2PDBA

Human aldose reductase mutant f121p complexed with zopolrestat.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEPFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdbA00
1US0A 3S3GA 2IQ0A 2IQDA 2PDKA 4OTKA 2IS7A 1XJBA 4MHBA 3LZ3A 1LQAA 3LEPA 3CASA 2NVCA 4FALA 2HE5A 5LIKX 4DZ5A 4WDTA 4PUUA 3LUTA 2PDLA 1PWLA 3R43A 3F7JA 2PDMA 3H7UA 3LENA 1PWMA 3LQGA 4JQ1A 4Q3MA 2INEA 3UZZA 1RALA 4L1WA 3ERPA 1MZRA 1K8CA 3NTYA 3GHRA 5HNTA 2FZ8A 4YS1A 4JIRA 4NKCA 3WBYA 1GVEA 1XF0A 2FZDA 2FGBA 4DBWA 1HQTA 4JTQA 4JIHA 1QRQA 4JQ2A 4YVPA 4F40A 2J8TA 4R9OA 1M9HA 4IJRA 4XZLX 1R38A 1ZUAX 4ASTA 2IKJA 2I17A 4GIEA 4WDXA 1S2CA 4JIIX 4LAUA 4ZFCA 4XVDA 2IPFA 4XZIA 1HW6A 3VXGA 1Q5MA 2C91A 3V0SA 4L1XA 2PDNA 3GUGA 3CAVA 1AH0A 1PZ1A 1X97A 2ACQA 2ALRA 4QXIA 3R7MA 3WBWA 1C9WA 4LB3A 3G5EA 3LZ5A 1ZQ5A 4I5XA 2P5NA 1OG6A 3V0TA 4EXBA 2ACRA 4Q7BA 4QBXA 2INZA 1EF3A 4XZHA 3UYIA 2DUZA 2PDPA 3M0IA 2PDGA 3O0KA 3O3RA 1J96A 1YNQA 4AUBA 4XZMX 1Z9AA 3COTA 3MC5A 1Q13A 1EXBA 3R58A 2HEJA 3CV7A 5DANA 3BUVA 3N2TA 3KRBA 3GHUA 4PUWA 3WG6A 4GACA 3WBXA 2PD5A 3DN5A 4LAZA 4PRTA 4LBSA 1YNPA 3LD5A 4FZIA 3Q67A 1EL3A 4PR4A 4GQ0A 3H4GA 1S2AA 4HMNA 4H8NA 4JQ4A 2PF8A 3UZXA 5LIYX 5M2FX 2BGSA 3LBOA 3EB4A 4JTRA 5LIWX 4GQGA 3ONCA 4RPQA 1X98A 3CAQA 4GCAA 2BP1A 1PYFA 1RY8A 4IGSA 1AH4A 3UZYA 2PDIA 3UZWA 3M4HA 3BURA 3N6QA 1FRBA 4JTAA 4GABA 3CV6A 1JEZA 2R9RA 4JTDA 2IPGA 4XK2A 1PZ0A 1AZ1A 3LQLA 4H7CA 4PRRA 1AH3A 3U2CA 2PDUA 2PDCA 1IHIA 1EKOA 2I16A 2PEVA 2PDQA 3UWEA 1MI3A 4QR6A 2AGTA 2A79A 2CLPA 2HE8A 2BGQA 1RY0A 3R8GA 3ONBA 3Q65A 4YU1A 2F2KA 2HDJA 1S1RA 4QX4A 4G5DA 5JH1A 2IKGA 3DOPA 2PZNA 1SM9A 2DV0A 3MB9A 4EXAA 2IKIA 1UR3M 3EAUA 5LIUX 4JQ3A 1Z89A 3D3FA 3FJNA 4XZNX 3P2VA 3BV7A 1YE4A 3UG8A 3V36A 3WCZA 3GHSA 4WEVX 2F38A 3UP8A 4YVVA 2IKHA 4DBSA 1IEIA 1LWIA 4XVEA 1S1PA 2FVLA 3T42A 3CMFA 5HNUA 3V35A 1T41A 1QWKA 4DBUA 3R94A 2FZBA 4IJCA 4FAMA 1Z8AA 2WZMA 4LBRA 1XGDA 3FX4A 2PDFA 2PDBA 3LNMA 1VP5A 2HV5A 4XO7A 2NVDA 2PDHA 1AFSA 4WRHA 3RX4A 2PD9A 3QKZA 2PFHA 1A80A 2HVOA 2PDWA 3RX2A 1X96A 2DUXA 3B3DA 2HVNA 1MRQA 5JH2A 3GHTA 3M64A 3V0UA 5LIXX 4FA3A 4XO6A 3BCJA 1T40A 4WDWA 5C7HA 1VBJA 4PMJA 2PDYA 3RX3A 3H7RA 2FZ9A 5KETA 3UFYA 4WDUA 5AZ1A 4GA8A 3R6IA 3C3UA 1ADSA 3G1RA 4LB4A 3LN3A 2ISFA 1YE6A 3R8HA 2IPWA 2QXWA 3EB3A 2ACSA 2PDJA 2ACUA 2IPJA 2WZTA 1ZGDA 1AZ2A 4HBKA 1Z3NA 4YVXA 2PDXA 4WGHA 2VDGA 1ZSXA 4JQAA 2R24A 4ICCX 5HA7A 3UGRA 5AZ0A 4XAPA 4JTCA
chains in the Genus database with same CATH superfamily
1CBGA 3PG8A 3S5OA 2OODA 3WF4A 3WQOA 4ZTXA 1TWZA 3OZOA 4MHBA 4C7FA 1VFHA 3FOKA 3UXDA 3TMQA 4XKYB 4E8CA 3CASA 2PA6A 5G5IA 2HE5A 1PB0A 3NO3A 2F6UA 4DNMA 1CENA 3RCNA 1QNOA 3EYPA 4MB4A 1F3EA 3WELA 1XRTA 4LAOA 1JFXA 4WF7A 2VO5A 4KEZA 1B9ZA 3GDLA 4ERIA 1VHNA 4RV3A 3HF3A 5CBIA 4QDMA 2QV4A 4YL2A 2IUZA 1ZAIA 2HBVA 3W7PA 4MWAE 1IT7A 4QEEA 4DQWA 4F3HA 3CQIA 1C7SA 4Y7EA 3VOCA 2FZ8A 3WBYA 2VX4A 4JKLA 5EMJA 4A05A 5E09A 3CUGA 1Y0EA 3A4WA 2ABAA 4IX0A 5JUVA 3CS2A 2HK1A 3PFMA 3TK7A 2OTDA 4UWMA 3G8EA 1EJXC 4WDXA 4KRTA 3PAOA 4NSBA 5FEZA 3R5EA 1YBQA 3G1AA 1H4PA 3EX1A 4XVDA 1XLGA 4EACA 2NXGA 2C91A 1E1FA 5H6HA 1LORA 3RCYA 3S9ZA 2WHLA 1EA0A 4B92A 1MRAA 2BBFA 2QVNA 2GSEA 1VPYA 1L2UA 3ZS4A 2W0UA 4AXKA 5HQEA 2ZUWA 3ID7A 1YRRA 4C6NA 3WNLA 2YW4A 3TX9A 2YXXA 2PS2A 2C79A 3S1VA 1HJQA 1NQKA 5I24A 1EF3A 4HMDA 4NHVA 2QAPA 5DMMA 4GY0A 4FOJA 5H8UA 3TEVA 1YPFA 4MWAC 3VNLA 2G0WA 3O3RA 2YA0A 3ITCA 3LOTA 4M56A 3S1GA 1O1HA 4M82A 3TNOA 2DH3A 2E6YA 1EUNA 1MW3A 3CM4A 4AIBA 2JQXA 3K8KA 2YB1A 2QGHA 1V3HA 1EUAA 2C0AA 2FYMA 1VB9A 3HO8A 1GJWA 4PFHA 2OVLA 3TC3A 2OSWA 3DC8A 3DFPA 1S2AA 4O1AA 4IIDA 3CZEA 1TTIA 1QPQA 4J7RA 4HIBA 1PJ9A 1QI5A 4MLJA 5CJ5A 1B0IA 1DWJM 1D3CA 4JTUA 1VEMA 1SJAA 2OSXA 3MP4A 4O8AA 4RE3A 5K4XA 3ARUA 3A9IA 3CAQA 3MA8A 4INFA 3GX9A 2WQDA 3MKVA 2IXVA 5HDRA 1EP1A 3WDIA 8A3HA 2XH0A 3CU2A 1ICPA 2FZNA 3TAOA 4CQCA 2CBVA 1WDSA 2OR2A 1K7FA 3A5VA 3KE0A 1AODA 1MFUA 3AALA 2XFFA 1IWBA 3N6QA 4AH7A 2EO7A 4JTAA 1GW1A 4E4PA 7CGTA 5FL1A 2J13A 3RF9A 2QZRA 3CQKA 5C9XA 3B8TA 1W3TA 3BICA 1W3KA 3PPFA 3HPAA 3O63A 4GY7A 5HR7A 3WD2A 4AF0B 4NXKA 3NO5A 3LS9A 4PTXA 2PP0A 4FIRA 3W1UA 2E3ZA 5BCAA 5HNNA 2GGHA 2VEIA 3PNZA 2V5DA 1JPMA 2YGYA 4ZO9A 2CLPA 3UXIA 3WH8A 1XRFA 3MSGA 4GKTA 2PWVA 3PZOA 4D1JA 1LWHA 4H9TA 1EC7A 3KS5A 3BH4A 3GFXA 1PIIA 4BKNA 3CXOA 3WK1A 1QCWA 3PFRA 4AEOA 1DTUA 3WUGA 1JDEA 3CPRA 5LA0A 1DL3A 1VJSA 4FHAA 3R8RA 1B3YA 3P2VA 4A3QA 1F3XA 1NOUA 3G1DA 4AWTA 1QI2A 1BGGA 1ZCCA 4WEVX 3DYOA 1KNWA 4RNIA 4DBSA 1AJ2A 3PSWA 2FVLA 3FSUA 3L2MA 4UTJA 4HOZA 2G4FA 4FO4A 5HNUA 4DWSB 2GWNA 4MAZA 3F4NA 1GOKA 1YNYA 4YPJA 5HWMA 4GGBA 2XVNA 5KSWA 3MJMA 1QPOA 4KIRA 3GNRA 3RK8A 1K9FA 1Q85A 1CB7B 1E43A 3MSYA 5KMYA 3TIMA 4LNYA 2PFHA 2EEXA 1VAHA 3MANA 1LROA 3ARXA 1VIWA 1UH2A 1ONXA 4HU4A 3WLKX 4O14A 3T4CA 4CCDA 1KFEA 1RZMA 3WD4A 4JN7A 1BG9A 2ATMA 1RD5A 3TSMA 2D1ZA 2QQ6A 3OVQA 4G7EB 3PZ9A 3MV01 1VBJA 4PMJA 5CGTA 4GH1A 2H9AB 3UFYA 5AYZA 4F2BA 3DU0A 3R6IA 1HL2A 4NI3A 4ZO7A 1TJPA 4LB4A 4GUGA 4XAFA 3THAA 1TCMA 3AUJA 4Z2LA 1CZ1A 3H21A 1OFQA 4XX6A 4BA0A 3VC6A 1Q6CA 1R3TA 2TSYA 3T6CA 3UGVA 2GK1A 1SFJA 3UJEA 3PTQA 1B3VA 1PHQA 4OUIA 2VTFA 4S23A 3KTSA 1ZSXA 4OOUA 1YDOA 2NXHA 1B3ZA 2QCGA 4A3YA 2WNQA 3MYOA 1XINA 3DFNA 5A6BA 1TWWA 4H6RA 1G4PA 2ASHA 2ZA2A 1UHVA 2ZUMA 3LGDA 1QTWA 4PMDA 3K1GA 2HS8A 2DT1A 3E0LA 3VGFA 1GONA 3R43A 1CECA 1A5UA 2ZCGA 2F8QA 3NSXA 1TX2A 4AZGA 5MKGB 3VX1A 1HZYA 2Z2AA 2C1IA 2CPUA 1VFOA 5C8BB 2W79A 4TX8A 3VNYA 4R5EA 1O5XA 3HJZA 4WQ6A 3R1ZA 1L6GA 4CVUA 3KS6A 2Q3RA 1KXTA 1MUMA 4MJZA 4J28A 5HMEA 4S3BA 2PPGA 4C6BA 4N9EA 1VGAA 5CQ1A 1VLIA 2ZXAA 2R14A 4R9OA 2G95A 2DT3A 3LCIA 3CH0A 2UY2A 1M9HA 4OFCA 3W2JA 1JRCA 1GVIA 2DZSA 4ASTA 5HUPA 4HT3A 4HJFA 2JKPA 5CPQA 1Y5XA 3TV8A 2OZ0A 2E68A 2OLAA 4A8RA 3SURA 4MWAA 1XLCA 4G2DA 5U7SA 2P1FA 2Q71A 2EGZA 5CLWA 1KBIA 1Q4WA 2ACQA 4FLSA 3LTYA 3YPIA 3EB2A 1J01A 2BHYA 2VZVA 2GVJA 1M6JA 1UWTA 1GOWA 4PODA 4IFKB 4OHQA 3TA9A 3E6EA 3Q4DA 4NJKA 1MDLA 4HPGA 1KTNA 4PB4A 2QUMA 2CNCA 4Y9MA 4DRSA 2FGZA 2PGFA 3AHYA 3Q94A 5RUBA 1GJPA 4ZOAA 1UZDA 2PDPA 4FX7A 4IQLA 4N02A 2CHOA 3I4EA 3UPMA 1J96A 4US5A 1R6WA 1BKHA 5CSSA 1UJPA 4CU8A 1MQQA 2G3FA 3G3DA 2JKEA 1XC6A 3GVRA 2HEJA 2L5HA 4JX5A 3H2AA 3H22A 3GNPA 1QPRA 4XAGA 2EPKX 3LPPA 3B0UX 3G1XA 4GACA 3SQLA 3RLHA 3MUIA 3VKBA 4D1IA 2WWDA 3NDYA 4BI6A 5F4XA 3NL6A 1TTPA 4S3FA 1YNPA 5D32A 4QAIA 2A21A 1JRBA 3N6HA 4PR4A 4A35A 2D3NA 1GQKA 3ZR5A 1YDYA 4NZ5A 1YYAA 1K4HA 3GH5A 3QEZA 1OGSA 2O9PA 1G69A 1GOQA 3SCOA 2YL9A 3NWRA 1XP3A 3BANA 2GDVA 5LZLA 1X98A 1Z48A 4Y9OA 2QUUA 2YSWA 3FIGA 5CXPA 2Y7DA 5ABFB 2I14A 4PTWA 3GD6A 1BKSA 4UCGA 1POKA 3MHGA 4Q4KA 2Q6ZA 1WKYA 3FVDA 3T81A 2CZFA 3KOWA 3BURA 3BLIA 1C8XA 3TC6A 2IPGA 4XUYA 3W75A 2DPEA 3BG5A 2PBGA 5T9BG 3UWUA 3W22A 1PPIA 1HIZA 2WM1A 4PRRA 3WF0A 3UT0A 1S2TA 4H9MA 5AC6A 2PTWA 4PMYA 4MY9A 5D2VA 1O60A 3WDJA 1KC7A 2FTYA 3L21A 1OABA 2WSRA 4HSOA 1A5BA 2HE8A 1WE5A 4F0HA 3UERA 3NJ3A 2WVVB 1MWOA 2O92A 4PUEA 2PTYA 3NEHA 2CETA 4GWEA 3Q65A 2PZ0A 4FNQA 4G5DA 1W1IE 2V63A 2E67A 1EXPA 3UY7A 1P6CA 1Q7MA 3FYPA 4M8UA 3P93A 2DV0A 2XZ9A 1EJSC 3GW0A 4WK9A 4B9ZA 4FR6A 4XKYA 1J6PA 1LQ0A 1QMLA 1R9ZA 1WPCA 4B3ZA 3UP8A 3IGXA 3N13A 2PCEA 3GDBA 1ZS2A 1IEIA 1GTHA 3VINA 4OU1A 3L2IA 1ZBCA 4IIFA 3FGCA 1TV8A 2POTA 3B9OA 5I6SA 1QWKA 4DBUA 3ISIX 5FL0A 2GPTA 4LU0A 4RZ5A 1A4LA 2Z28A 3ZO9A 2DZPA 4UTIA 3DBNA 4F2UA 5BU9A 2D2JA 2ZZ6A 1ZRQA 2HV5A 4XO7A 4P5UA 3W2LA 3O6CA 4E2DA 3BK0A 1A0CA 3UXAA 1PDYA 3W9ZA 2DORA 5M03A 2CESA 4KERA 4LEQA 1DQWA 4KQNA 2AKZA 1Q6OA 2QCDA 2D23A 1IZCA 2FDSA 5IHSA 3DKJA 9CGTA 5FJPA 4W7UA 2JALA 1TMQA 4OKDA 3TJIA 2WQPA 1S5MA 1O4UA 1XDJA 3VIHA 3MSRA 4AVNA 4I3GA 5BW6A 1FHVA 4XO6A 3BCJA 4H9ZA 4QE1A 5C7HA 2CU0A 1BXCA 1NEYA 3GY1A 3ZWTA 1XIGA 1HN1A 4O1FA 4C7DA 3K2GA 3IAQA 3UWVA 4LUSB 2ACSA 3TDFA 3OBAA 2EQDA 1M7OA 3H55A 3OG2A 6XIAA 1YDVA 1J12A 3BOXA 2IPJA 1BYCA 4A2RA 4ZL1A 2F84A 1DIOA 2PP3A 3HFTA 3VPLA 5HA7A 4LVAA 4K1GA 3SCQA 4B5WA 1UA3A 3M5ZA 3DHUA 1E70M 1Q66A 3WF1A 2FGLA 3A3WA 1MXSA 4JNZA 2BHUA 3OA3A 2DSKA 4LJ3A 1PHWA 2RDUA 1A0DA 1F07A 3GB6A 4AVOA 4PB3A 2JBMA 2HXUA 3UF9A 4E4UA 3WLJA 5I00A 1MNSA 5F4WA 3HOJA 3O8AA 3S5NA 1XIIA 4DM1A 4UFJA 3PWGA 1R9XA 2QMJA 2PI6A 3P14A 1Q8JA 5T8GA 4QITA 4C6EA 3DKLA 3B0PA 1DE5A 3NTYA 3IUDA 2O55A 1JGIA 1A47A 1U1UA 2O9RA 4UNLA 2V3DA 3EPNA 4PN2A 4YN5A 5ABEA 3H2MA 5K9DA 1GVEA 4OBSA 2FZDA 3KZPA 1S2VA 1XD0A 5B80A 4D6IA 3WJYA 4RE2A 2NUYA 1FA2A 1RPXA 2GDQA 4GYKA 2OQLA 2WJZA 2XVKA 4O10A 3GC2A 3TR2A 1GTEA 3M6YA 3QJAA 4WHBA 3CYJA 2F2HA 2PRHA 1DJNA 1GZ1A 3FLUA 3WMSA 1VRXA 3RMJA 4LS2A 4J1OA 5KINA 4K37A 4WJXA 2OXNA 2FTWA 3LDVA 4UOQA 2PAJA 3IJ6A 4XZIA 3WO8A 4F9JA 4GH3A 4O28A 4K2SA 1V79A 3U4FA 1HUVA 2Z4GA 4DJFC 3B4UA 2PC4A 4O53A 1M41A 3DCPA 2YCIX 4L6HA 4CNPA 1AJ0A 3BLOA 4UNKA 4M5PA 4A4AA 1AUSL 1QI3A 1EQCA 1TMLA 2X1TA 5I78A 1F4HA 2VZTA 2V8ZA 2ZXDA 2Z0IA 2W5FA 1TYGA 1J6OA 4HK5A 2WMIB 1TWSA 2J8FA 4Q8PA 3TTQA 1ZBVA 3SRFA 1ISZA 3UR8A 3LI1A 1V0KA 1H1ZA 4EPDC 4KT2A 4J3TA 2XVLA 4ATDA 2D69A 1YNQA 2FH8A 2VQTA 4O0KA 4RV8A 3OU8A 3VM7A 2PLCA 2AL2B 1E3ZA 1JPDX 1O5KA 5HANA 5E1QA 4DO7A 2ZDRA 1UIOA 3R58A 3N2OA 3S8HA 3STGA 4W9TA 3ANVA 2ZVRA 4IGNA 1CNVA 1NWTA 2FMOA 4U2YA 1KM4A 3Q37A 4GE8A 2HNEA 4BQ3A 5FKYA 3LHYA 3DN5A 5AC4A 2VGIA 4DWSA 3O07A 4LBSA 3Q45A 3LD5A 4O57A 1BHGA 3NOYA 1EC8A 3WF2A 4REQB 4EF9A 1JPIA 4ZQPA 5D9NA 3RN6A 3WJSA 5H8MA 2EKGA 3O2LA 2CKRA 3TJLA 1WYIA 4C1NB 3PBYA 3WL1A 5FSEC 3LRKA 3MO7A 4GI9A 3QR3A 5F7UA 1OCBA 5KZDA 4AZIA 1PEZA 1W5MA 1S3TC 1XCWA 5D8ZA 2PDIA 3DBPA 3GK0A 1XH1A 3T2OA 1SO4A 3T2QA 3CV6A 4XD3A 3ZFHA 1TUFA 5C5YA 1JI1A 5LNWA 1Q6EA 1FWRA 2YX0A 3B0XA 2WLZA 1HNYA 2UY3A 2ICSA 3E38A 1IXQA 5I3HA 3M16A 3WLHA 1FP8A 3V5CA 3VK5A 5A6MA 2PTDA 3AHVA 1DXIA 3FW6A 4N9DA 2PDQA 5DELA 3PUGA 1GPWA 1SMAA 2WMHA 2BXZA 4S3DA 3M6DA 3QF0A 4XSLA 1QXLA 5I3DA 4JEQA 2CC0A 1IZKA 5IDIA 4HA1A 4FLRA 2W61A 1NQ6A 2E6DA 2Z7GA 2ZVIA 5EMYA 4UTUA 3BLLA 2GZXA 1A3WA 4ROQA 4MLRA 1OC5A 2QJHA 1R46A 3ITOA 3PF3A 3L4XA 2VM8A 4DJEC 3SZ8A 4QNEA 1JZ7A 1H7WA 1OYAA 1UMLA 4JQ3A 3RIKA 3WNMA 2VELA 3DC0A 2OX4A 3P7YA 1VRDA 3WCZA 4GFSA 2IXUA 3FYOA 3M7SA 3R79A 5CGMA 1CEOA 4H2CA 1OF6A 4KFPA 3AXHA 4IMAA 1FWDC 1R2SA 3EA3A 3CMFA 1V6VA 1W6TA 1C90A 1FWNA 4O50A 5MKGA 5D9MA 2R1MA 4YWSA 3UY8A 4LVFA 3BJTA 1SFLA 3KWXA 3C2FA 3UBPC 3PULA 5DXYA 1FWJC 4PL2A 4O18A 3W25A 3N11A 2BY3A 3F4CA 2D0FA 2J7GA 2B7OA 3T0BA 3N18A 4WX2A 1I2RA 2I9EA 2J62A 4HHLA 1JJKA 4LC6A 4R7OA 3L12A 2PC8A 1R8LA 2C1GA 4J3WA 5A1AA 5I3KA 1K8XA 3NQ8A 2YA2A 1P0EA 3BW3A 3URNA 2CZDA 3CO4A 3WQWA 3I3DA 1N8WA 3WQ4A 5LYRA 1YTDA 1MQPA 2R1PA 4H7ZA 5I3GA 3U5YA 3SGGA 4PSPA 1A4MA 3C4UA 1HP5A 3MBFA 1TCDA 4AMCA 1E4NA 1ME8A 4Q8MA 3AO0A 2IPWA 1VPXA 2GGIA 1EEXA 2ZZ7A 1OZMA 4MFEA 1C3FA 4R9XA 1XV8A 1GW9A 3FY1A 3HIJA 4HPJA 1JF5A 1Q63A 3MMTA 1UYQA 3P81A 3NQ2A 2V2DA 2GOUA 3VFLA 1VCGA 1DIEA 3G8RA 4QG8A 5FAJA 2RGLA 1PUDA 4BEUA 3RM8A 5F2LA 2PDKA 3M47A 2IS7A 3FEQA 2F6XA 1XJBA 3VKCA 2AQVA 2V30A 4JYFA 3SJNA 3TUUA 1E6ZA 2YR1A 3NR0A 3ES8A 1UR8A 3ZT6A 3WMLA 1KA9F 4Y8FA 1DJQA 2PDMA 3NPWA 3WFZA 1XCXA 1AW5A 2X05A 1QFEA 4LAMA 4K6AA 2ZC8A 1RALA 1EZWA 4HPNA 3F5KA 1XSJA 5TBOA 3MKCA 3HG3A 2TAAA 1CXHA 2XIMA 6XIMA 4AYSA 3H53A 1E6RA 4UC5A 2J75A 3RM4A 4X60A 2J25A 4W84A 1W5QA 3WH9A 5C2CA 1KFCA 5TD4A 3ITXA 1EFZA 4DJFA 1K70A 4CD6A 1R87A 1PKMA 3V3WA 3PG9A 5G4HC 3NFUA 4TUFA 3GR7A 1RJQA 2VFHA 4K7VA 4N0RA 4F40A 4XB3A 4Z0JA 2XM2A 4R53A 4XZLX 3W7EA 4LW7A 1ZUAX 1OC6A 4CN6A 3SDOA 1VS1A 2Z2BA 4KRUA 2YYTA 3E5BA 1HXJA 1LT8A 4NRSA 1NDZA 2X09A 3QV7A 1JZ8A 3VXGA 4NL1A 2QAFA 2Q3OA 4UQ9A 3D5HA 4GQBA 1EA9C 1KTCA 1KBBA 3LV6A 1CT5A 4H3DA 3QGKC 4U5KA 1W32A 3GG0A 3QPEA 5FESA 3GRIA 1B5TA 1XBXA 2YXGA 4IIBA 1JD7A 3SCTA 4NZ4A 3V75A 5K4ZA 1XH0A 4W5ZA 2P5NA 1DWIM 1Q7ZA 2C13A 4CQAA 4Q4OA 4EXBA 1R9YA 1NDWA 4D8ZA 4XG1A 3S2LA 4L1GA 1GWJA 4YTRA 4HGXA 4GK8A 3WLSA 4DBDA 3B9NA 3LBMA 4W7VA 1RCQA 2WYSA 1QVBA 4I7VA 3KWSA 3MC5A 4R88A 1VJZA 1UBPC 2J9XA 1Z42A 3FJ6A 3CIWA 2QPUA 5DFAA 1G4EA 1X1NA 3AHXA 1AW2A 1HGWA 5CGQA 3U48A 3KRBA 3KM8A 3OG3A 3AXIA 2JKAA 2MNRA 4D6DA 3IK2A 2ZWYA 3DG3A 4GXMA 1CGTA 2VRQA 4PRTA 2PUZA 3B0YA 3SBFA 2RJGA 4GQ0A 2HK0A 4J2MA 3P61A 4Q8UA 4E38A 5LIYX 4WIWA 4Y9NA 1EJVC 3IIVA 4JTRA 1MZHA 1C8QA 1GYMA 5LNRA 1SFTA 4B3KA 1WZMA 2JK2A 4FNRA 5DRIA 3WJZA 4FOKA 3FAWA 4XSMA 3N04A 4HK6A 4ECLA 3GU9A 2FIQA 2X1RA 4TTUA 3UZYA 1EWEA 4PTNA 1HG3A 2QJIA 2RDXA 4AMAA 4XIAA 2VZUA 3QR1A 4QLLA 1W3NA 4ICNA 3APGA 3AYSA 3FK4A 4XK2A 4H7CA 1KD0A 3BXWA 1I0DA 1BLIA 4TIMA 4L65A 3VU2A 3ZR4A 1WX0A 4M7TA 2E6FA 1MEHA 2A2IA 2UY4A 1HVXA 4RNJA 3HQOA 1RUSA 4LUSA 4HYVA 4NJIA 2P0IA 1J0JA 2OELA 3SSJA 3BCFA 3PS7A 4WY0B 3B97A 1OX4A 2EG8A 4YMZA 1MSSA 2WC4A 1NAL1 4GNKB 1FWSA 1HKMA 2BVYA 3PY2A 3C2VA 5A2BA 3RO8A 3EMCA 3DYMA 2BOFX 3TR9A 3B9DA 2QIIA 1ITUA 3GFZA 3VNIA 2A3CA 5I03A 3INPA 1QNRA 3HGRA 3AU2A 3AMKA 3HURA 4E3VA 2P3EA 4UNIA 4I9MA 5JQ9A 4G1KA 1LRTA 1IXPA 2FB2A 2F38A 2ZTKA 3VA8A 2DFAA 1ZBKA 2CWNA 4D6CA 1FTXA 4JS3A 1L6WA 2X1IA 4IMEA 9RUBA 3OZMA 3EKZA 1AL8A 5BXTA 4NNCA 3STFA 2AKMA 1JYXA 1KCZA 5FD0A 3MI6A 3RILA 1DJZA 7REQB 2OT0A 5CLTA 3UVAA 1HKVA 1X1OA 1H0IA 1QOQA 3QSTA 4LY8A 3VUSA 3B04A 1V5XA 3UVIA 4FXSA 1B1YA 3GZAA 1DXEA 2PDHA 4R27A 4NZJA 3IAPA 3IVUA 3V4BA 4MB5A 3EWXA 4KWSA 3RX2A 1ZBWA 3N4AA 5FF3A 2V5JA 2DUXA 3B3DA 1VQTA 2HVNA 2JEPA 1F76A 1AD4A 1N7KA 2NW0A 4O13A 4GJ1A 4BQ5A 3VKDA 1JQVA 1V3IA 3VABA 2HBXA 3RHGA 3KVMA 4RJEA 3TAKA 3WH7A 2E9MA 1VIZA 4LF2A 4MKSA 2ZUTA 3BLKA 3W2KA 3WH6A 4HJWA 5LKYA 4KETA 3ARTA 5ENLA 1AA1B 3R8HA 4C90A 2HWGA 4CEUC 1E4IA 1M65A 1SFSA 2OOFA 1NF7A 4A3RA 1QATA 4Q8VA 3EX2A 5LXEA 1ZGDA 1AZ2A 3PHAA 1JXJA 4TOQA 3L68A 5ABGA 3W7GA 4QM1A 1Y65A 1YHTA 3M07A 1WDDA 3F5JA 3FHAA 3QSRA 3FAXA 2WMIA 1YPIA 3EX4A 3E1F1 2V5LA 3AXKA 3MUZ1 2I5GA 1U2YA 1TIWA 2DZAA 1IGWA 4NASA 3HU7A 2NVCA 2CXGA 3SUSA 3FEMA 5LIKX 4KGLA 3W7MA 2WJDA 3KUMA 2D0GA 3BZGA 1XQLA 2VVSA 4Q3MA 1E71M 2UWFA 3SRHA 3GIQA 4WGXA 2AQOA 5M17A 4GPNA 3IACA 3VUPA 1WUFA 3SUVA 3THDA 1CXEA 2QIWA 3PWAA 4MYAA 3ZMRA 2W91A 1ZJIA 3ITYA 2BHZA 5DT7A 3GFYA 1FOBA 1TZ7A 4P7OA 2NUXA 4JQ2A 4ADTA 1QUMA 2WNNA 3NEVA 3DX5A 3NNTA 3L0NA 4CUCA 3N29A 1LL6A 5HMFA 3GDKA 4C6CA 1N8FA 3DFTA 1F61A 1OEPA 3AS3A 4FMVA 1WDQA 1K4GA 2A3LA 4GIEA 2A6NA 5B7YA 4JIIX 2YJQA 3AICA 3I6EA 5D09A 1XIHA 3VMOA 1S38A 3QMTA 4JHZA 1RAKA 3H2CA 3V0SA 5HJLA 1YKWA 5I09A 3CZKA 1XL9A 4JN6A 3KXQA 2CWXA 3NQMA 1M7PA 3KDOA 1NELA 1EOKA 1GNXA 1ZQ5A 4I5XA 3GH4A 3WUEA 1B4EA 3IVSA 1UWQA 4O12A 3WDRA 2ABBA 2FHBA 3V0TA 4YTQA 4IHCA 5KZMA 3I6TA 5DRCA 4A22A 1B2YA 1OK6A 4HYRA 3A4AA 1EGMA 1I9CB 3UYIA 3CBWA 4JAWA 4DJDC 1UJQA 3QQWA 3C52A 4LCRA 4UOZA 5CPNA 2EPOA 3PK7A 1E72M 3JVAA 1FCUA 3E2VA 2VCBA 4DHGA 3P80A 2NZLA 2FFIA 1EXBA 3QFEA 4QFUA 3WSUA 3E2RA 2VFEA 1QW9A 3OVPA 3IJ7A 5FIPA 1UIPA 4S38A 3FXYA 3OHMB 2QJMA 2XDFA 3I4KA 3A21A 2Y7GA 4YLWA 2HTMA 1XLBA 3QHNA 4JD4A 3WLIA 3WLPA 3VZXA 1TVNA 1EL3A 4HNVA 3B8VA 1RV8A 4O54A 3NQFA 3UZXA 1FCVA 3DUGA 4MPQA 2WZHA 2R8WA 2GWGA 2Y63A 5LIWX 2PGWA 3M0LA 4MIMA 1F2JA 5MHBA 1JZ4A 1TUXA 1LP6A 3OA5A 4B5VA 3CHCA 4YIWA 2Z26A 1FDJA 1M68A 1AH4A 3M9YA 3M0ZA 2HS6A 4S3GA 2NWRA 4XZBA 4LWWA 4UTHA 4AEEA 4EAMA 4FOUA 4PUKA 1SJBA 1IGSA 2F6KA 3GIYA 3C3NA 1KXVA 3FYYA 2VD8A 3NUKA 1AH3A 1VFFA 4B3LA 3TN4A 4I7UA 2OFJA 2FH6A 2FMNA 4HU0A 1US3A 3UNDA 5G1YA 2PU0A 1KM2A 6TAAA 4UFIA 2QDGA 3CGTA 3N25A 5BRPA 3W1RA 2BWGA 3UJSA 5CSRA 1KLYA 2QJNA 2V5CA 1TPEA 4C1KA 1XUUA 3VKAA 1RQHA 4BCEA 4LUTB 1HO4A 4UTWC 2O4QA 4LC8A 2IKGA 1J0ZA 1B3XA 4FNTA 2AQWA 3MB9A 2ISSA 1GUVA 4RL3A 3SCNA 1LCOA 3RCMA 3QTPA 2NLIA 3QN3A 4O8RA 3F5LA 1KBJA 1OY0A 3O6DA 3GDMA 1CGWA 1LWIA 1WO2A 3NDOA 1UKQA 3ALFA 3ATZA 1L8PA 4QE5A 4UTFA 5HMDA 3SAZA 5IXEA 4IXHA 3WQFA 1U5JA 5AYXA 4IMFA 2Q02A 3GH7A 3ZJ7A 1Z8AA 3FX4A 5CC6A 3LNMA 5HBFA 3CZJA 4MFDA 1VP5A 1V0LA 3WQ6A 3AIVA 5CCZA 3WFLA 3B8WA 4MAVA 3SSZA 4WRHA 5I7GA 1NP0A 2WSYA 1UH4A 1X96A 2WO5A 5G2WA 4DXKA 4Q8QA 1G0CA 5KTLA 2QF7A 4QJ3B 4R85A 4MJ4A 2EKCA 4AISA 5DQPA 1F74A 3UCQA 4FA3A 2H90A 3K46A 1ZNNA 4IFRA 1EJUC 3BL3A 3TC7A 3UWYA 4WDWA 3ABRA 3IS4A 1IXNA 5FJTA 4BQ4A 2YLLA 5BRBA 4NP7A 3NYZA 1OD0A 3G1RA 1UPMB 2CZ5A 2W9MA 1ONRA 1ZHAA 3EDJA 2ISFA 1LZOA 4G9PA 4B5XA 3W7DA 3T1GA 3KBJA 2Z7KA 4HPHA 3SN1A 2ISDA 1UW9A 3VTRA 2HQAA 1GK8A 2WW5A 2PDXA 4KEVA 5DBTA 4PMXA 4HSHA 2BY1A 4IG2A 2E1WA 2H3DA 4FPSA 2QCLA 1B3WA 1NP2A 4BZYA 4ICCX 1TA3A 5CBJA 1EJRC 5BNKA 3RPTA 3T08A 3AZSA 4V28A 1SJDA 1VC4A 1TR9A 3TW9A 2AMXA 2GJNA 3LZ3A 7XIMA 4L6DA 4EPEC 4JDBA 3PUEA 4JTTA 4IPIA 5D38A 1EDTA 3S6OA 2DZBA 3L4WA 3N14A 3TCSA 3IUHA 4GNVA 4K8GA 1CXLA 3CQHA 3LENA 1PWMA 3AU6A 2C6QA 3PZNA 3NAVA 1D8CA 1Z32X 4LSBA 4Z0SA 3LCGA 1I2PA 3C0JA 3R2GA 1O95A 2PSNA 1VH7A 2XJ7A 3NQ6A 3ZVHA 3ARSA 1Y8BA 4M0XA 1IEQA 3OVRA 3M41A 1WZAA 3TOPA 3DFQA 4HNLA 2ANUA 4MKNA 2EPNA 3POHA 2WKJA 4K3ZA 2C7FA 2I56A 3I3EA 1P48A 1G1YA 2J8TA 1UB3A 1VZWA 2AOSA 1RBLA 3TLLA 3OIXA 2REQA 4PUDA 4ZFMA 4AW7A 4IM4A 4D71A 1A5SA 1UD3A 4L4PA 1R7OA 1R30A 5SWUA 3DHPA 1QI0A 1H7XA 2FPVA 3O7UA 3G0UA 4DO4A 2OWWA 1X6NA 5A6LA 3HGOA 4LCSA 3WBWA 5I5RA 4WY0A 3L5LA 5JXQA 2BTMA 5HWJA 3DG6A 2D2HA 1JCXA 3W73A 3GW3A 3L23A 4HB7A 3VNJA 3EEGA 3B8IA 4PSRA 5LGXA 1VD6A 2G3MA 4TU1A 3FA4A 3QLLA 4A29A 2X2YA 1RLCL 2CYGA 1ICQA 3RJXA 5FF2A 3F4WA 4KWVA 2A3HA 1SW3A 2BG5A 4FR1A 1ZJHA 4AUBA 4A2SA 3ATYA 2GGJA 1VJIA 3O0FA 3PBUA 4PULA 4YCPA 4HNOA 5EA9A 3R89A 3VZYA 4AZCB 2UZ9A 1VLWA 1W31A 3CEUA 4J5NA 3PC0A 5A8NA 3SQMA 3G6LA 1JYWA 3NSNA 1VF8A 1NDYA 1ZB5A 1TG7A 4MNMA 3MWAA 2WJFA 3N2BA 3CNYA 1EO7A 1REQB 3UCDA 2D0HA 3W7IA 2LLEA 1ECEA 5D8WA 2ISWA 3CUXA 3W1LA 2VKZG 1V0NA 3C0SA 3EB4A 4M7SA 3NQ7A 3W1QA 3PB2A 4P7QA 3SADA 3QV6A 4KKXA 3IIPA 4GXWA 1UC5A 4KCUA 1BRLB 2OWCA 1RY8A 3CO8A 4GBDA 4NYYA 5A95A 1X1ZA 5IBXA 2XWEA 1NVMA 2A3BA 4DLMA 5I07A 2GVEA 4AYGA 1UP3A 4W8LA 2ZKMX 5LA2A 5A6TC 3VNDA 3WLOA 4A6GA 4UTWA 3RR1A 5AC8A 4LALA 3VKJA 2GYIA 2PDUA 5DN1A 2Y62A 3N4EA 3TN6A 3ECQA 3KCJA 4QG6A 2YDAA 5AYYA 1EKOA 1UWSA 7ENLA 1KCLA 1UZ1A 5FSDC 1LL7A 1XBVA 3A22A 4GHRA 5GVJA 4MB1A 2CFFA 2OO0A 2DU2A 3JU2A 1TJ2A 4LQ1A 1VYPX 1IZJA 4H2HA 2ZRXA 3FVMA 1YMYA 4CD4A 4YU1A 4US6A 2OKTA 1FXQA 1W5PA 3SFWA 3N6JA 3IJ9A 3AOFA 2JF6A 2WZIA 4O0ZA 1F7BA 1UR3M 3PTMA 2DEPA 5C9ZA 3SCUA 1WA3A 1Z89A 2ESCA 1WKFA 4ICMA 4IQEA 2CW6A 2C3ZA 3EX6A 1UKOA 3STPA 2Y7EA 3PUDA 5LNSA 2D2OA 2BX7A 3UESA 3MQTA 3BJFA 1J0KA 2DVTA 1SZGA 1UD5A 2XM1A 1ZL1A 3GC5A 1QT1A 5HPOA 4QTGA 3W1TA 4PCSA 4PMQA 1EWDA 5DX7A 4IJCA 2G8ZA 4IISA 3VNMA 4JY8A 3RMEA 1SO3A 2PDBA 1TPVA 1EDGA 3PZUA 3SFKA 1RSCA 3LCWA 2GVLA 3BO9A 2ZUVA 1MDRA 5HXMA 2W4XA 1DYSA 4GJIA 4AZ6A 2QUTA 3OLIA 1CLXA 1OYCA 1PDZA 4HTYA 4ZR8A 1XYBA 2YCLA 1PTAA 1D7FA 4GLEA 3SUWA 1JDFA 4PTVA 4XD4A 2J7FA 3H24A 3KCOA 1FX6A 3LCHA 2ZICA 4ZB0A 1TO3A 5BYWA 4C6FA 1GQNA 5EL1A 1ITCA 5L6UA 3CV1A 3AMGA 1NARA 4EKJA 5H91A 2PDYA 4O0QA 2G4JA 7PTDA 1CDGA 1PIGA 1PL9A 2SFPA 3WYZA 1UPPA 3GTIA 4E5TA 1UD2A 3LN3A 3O06A 4C5YA 3SRDA 2WZTA 3G1FA 2OKOA 3OTRA 2GGEA 1XDMA 4CQ9A 4L4OA 2WWCA 3L5MA 5IRPA 1O5QA 1TREA 1SJCA 4Z1CA 1P4CA 4IPJA 2XIOA 4D8LA 1US0A 1JUKA 3UW6A 2IQ0A 1QU4A 5G1TA 2IQDA 1XQKA 3AHZA 3GXFA 2ZQ0A 2DSWA 3KDNA 3SGUA 1QO5A 2GJXB 4FX6M 1XLKA 5MF5A 3AXXA 3MZNA 5DCDA 5T9CE 4ORIA 4FALA 4LV4A 4XQ6A 4AVFA 4FLQA 1R47A 4IP5A 2YFOA 3IRDA 4AEFA 3QY7A 3GTHA 4S3AA 1H0GA 3TWAA 2X40A 4AG0A 3IJDA 4R7WA 3TP4A 1C8VA 4U33A 1XIEA 2GUUA 3T40A 2MUCA 5BXSA 3HPFA 2JEQA 4JIRA 4Z42C 1H1NA 3WEOA 1ISYA 2Y61A 3S5SA 2TODA 4KCTA 1GQLA 4PBEA 2Q8LA 1G7UA 4ZO8A 4P8WA 4ZSTA 3K1DA 1K9DA 4O1CA 3SJ3A 1P0DA 3W28A 4ZE5A 2R82A 3WQPA 1XBZA 4UBPC 1T96A 4N9BA 3UD6A 1PXGA 3GKFA 3TROA 1GHSA 1HW6A 1CWYA 1UR2A 3TW6A 3S1WA 5DCBA 2CLLA 2GJLA 2Y5SA 1PZ1A 5AHMA 5GJPA 4IMDA 4C6LA 3W71A 2VX5A 3EOLA 1J93A 4MNJA 3UZJA 1P1MA 1PCKA 3LZ5A 3WKZA 3PM6A 1I2OA 1KRAC 4QIUA 1B4KA 2ZZ1A 1AK5A 1OG6A 2ACRA 4NNBA 2Y8VA 3KVKA 4ZSUA 3KBNA 4EAYA 1V51A 5CZ0A 3EXRA 1T5AA 2ZZ5A 3ZJ6A 3C6CA 2I5QA 3UG5A 3U7VA 1WV2A 1NM9A 3N12A 3SIZA 3XISA 4HNNA 1JI2A 4CN1A 3ARQA 4OJYA 1QPNA 3ABOA 4I90A 2JIWA 3MS8A 1FHDA 1X7FA 2BY2A 1UR1A 3LMYA 3LG3A 2CBJA 5TNVA 4JTSA 4HNUA 4HZ6A 1JNDA 4E8DA 3JRKA 1EDQA 1M04A 1VEPA 2BOEX 3BLDA 1YTEA 1FWBC 2XSBA 1A49A 2OQHA 4FXRA 2Z1VA 4AZBA 2Q01A 4X3ZA 3FV9A 3ONCA 4GX8A 3APTA 5A6KA 4HKPA 5K9CA 4KWUA 1TPH1 3GO2A 4KEMA 4F66A 4ADSA 3AAMA 1ZPTA 3PZVA 1SU5A 3M0HA 4P8UA 4QG9A 5FA5A 3NZQA 3ZOAA 1RXOB 3CUZA 3W72A 4W93A 4Z2IA 4HMCA 4MG4A 3LBCA 1PCWA 5E0KA 4N6EA 2XINA 1TIMA 3TW7A 2E7FA 5AHNA 4GABA 5A8GA 1J8VA 2E28A 2DW7A 5LHEA 1OGBA 4GQRA 3IV8A 2EG6A 2OCZA 2BSLA 2J4GA 3QXBA 3ZT5A 3QW4B 3P84A 2PWUA 1G4SA 5CC3A 4DYKA 4JEJA 4NU7A 3MVTA 5GNZA 3NQEA 4WJEA 4DZAA 3TSDA 3A12A 3MUXA 4GJJA 3VGHA 1D7KA 2V3GA 3PBMA 2BGQA 2GSHA 4IZGA 3BTNA 1QBBA 1XPYA 1QOXA 1GEQA 2G96A 3BGJA 3CTLA 4EPKA 3WUFA 1UP2A 4RZ4A 2A3AA 4XWUA 2VC6A 5LSMA 3AZRA 1J9YA 5A69A 3GE7A 4JGDA 3WLQA 1EX5A 3OW1A 4XZNX 1RP8A 5IFPA 3LNPA 1C29A 2WMGA 3VE9A 1H7NA 3V36A 1EEPA 3K4AA 1JVNA 1QJWA 1KGUA 2VL4A 1XYLA 4BEQA 3W7LA 3GWQA 3T7VA 5D02A 4JKMA 3LY0A 1A5CA 3I10A 3E96A 3LCXA 4HHPA 4GYJA 3A3HA 1K9EA 1IEVA 4Z2KA 1H7RA 3KOZA 3AC0A 2VENA 3DFSA 3EOSA 1IEWA 2IW0A 2XUCA 3P0WA 2G5WA 1B31A 3QR0A 1XYCA 4A8IA 1OIMA 4W85A 4J4KA 5E70A 3JW7A 3M0JA 2HMCA 5AYIA 2PGRA 1KR0A 1MRQA 4HMEA 3UJRA 3N1AA 1CGYA 3ZWSA 2ONEA 1B57A 2G97A 2WC7A 2Y88A 2YBVA 1E4MM 2YBTA 3L4VA 2W63A 3CH9A 2O4MA 4K8EA 4ROPA 1H5YA 1W56A 1F6YA 3LM7A 4JHMA 4QRNA 4DY1A 1Q4NX 3WDHA 2VUNA 3CC1A 2GQ8A 3G1YA 4H6QA 3TZFA 2DT0A 2EF9A 2WNWA 3DDMA 3LHTA 4M1BA 4OECA 5J04A 2C8NA 2V5BA 3BCDA 3EWUA 1KWKA 4FSAA 2J47A 1TFVA 2QHAA 2DVXA 1JGMA 3W7KA 4CNNA 2A5HA 1UZ4A 3FDKA 4JTCA 2PWGA 1JXKA 1CI1A 1BWVA 4Z1DA 3T09A 1IT8A 1BVWA 4JPGA 3GSMA 2ZX8A 5LNUA 3OODA 4NZ1A 3SEPA 3VD9A 5BOEA 1OB0A 3LPGA 1ENUA 2WHKA 3W7NA 5HINA 4FF5A 3UJ2A 2VRKA 3GNDA 4Q8WA 3THQA 2ISVA 4UFKA 1ODZA 5DMLA 5HULA 3KAOA 3MU7A 3UWWA 4D9PA 3LHWA 1LT7A 1E0WA 4GVFA 3UZZA 3VKKA 2NT1A 2NLYA 4W86A 4C6MA 3PB0A 3A47A 3QRHA 1X7IA 4WUIA 4IIGA 1UASA 4ONVA 4AIEA 5I3FA 3KL3A 1US2A 1G67A 4BJHA 6TIMA 4NT0A 3C2EA 3GNXA 1MEWA 3SECA 1CPUA 4UUIA 1R2TA 2CXEA 3C8NA 2WHJA 3BG3A 3PPCA 4DBWA 1JCMP 2VXNA 3GG8A 2XFWA 1OSEA 1BRLA 4K68A 3M43A 4YVPA 3A4JA 1RJRA 2BVDA 4ZZ9A 1JPHA 1LUCB 1SMDA 3G1VA 1DE6A 1NFGA 1Q65A 3T0DA 4NJJA 2D22A 3CJPA 5FEPA 5GJMA 4PTMA 1ZCOA 2WZEA 4FF7A 3CPGA 4QJ4B 2IPFA 1BXNA 5EKYA 4W7WA 3GYEA 1IE7C 2C1HA 3NQAA 3VIIA 4RR4A 1JAKA 2GQAA 3GUGA 4JFWA 4XAYA 4B5TA 2VOMA 3AIWA 3WQGA 2Z6IA 3WEMA 4RW3A 1IIGA 1UZHA 1WUEA 4KMQA 3S2NA 1AJZA 3CQJA 4Q6XA 2OJPA 3E2QA 2O0TA 2INZA 5CSYA 2VQUA 3ZQ9A 4C7GA 1D9EA 2B31A 3G22A 3CAWA 3CB3A 1MXDA 2ALDA 1OFRA 4Q8NA 1XLJA 2FPTA 4DJED 5D05A 1Q6FA 2WPBA 4KWOA 2XWDA 1DWAM 4KFNA 4V27A 4UQEA 1D2KA 4Y9PA 1E73M 3LM3A 2Y5JA 3BUVA 1KQZA 4AXNA 2QW5A 4BWLC 2HNHA 4IF2A 5EMLA 3MCOA 1SSGA 5FJJA 2E40A 2VGFA 4O17A 5EMMA 3Q67A 4ML9A 4JQ4A 3CHEA 1KM5A 1XX1A 1W2PA 4OV9A 2YIHA 2HPIA 3T0AA 2VEGA 4B5UA 1A5MC 2FVKA 3P0XA 3EA2A 1XLLA 3WNNA 4I5RA 4MZ8A 1GQIA 3GR4A 3VNZA 1OC7A 1X8FA 3REQB 2X1SA 1FDYA 3WLMA 1WXZA 2A4AA 1RVKA 3A3XA 3O15A 1CGUA 1ME9A 1EGZA 4JL2A 1PV8A 3TTSA 4MTVA 5BRQA 1G6CA 3W53A 1OZQA 4OV4A 1PZ0A 3DYPA 1XLEA 2VEFA 3MT1A 2WAGA 3NZPA 5BMWA 3CT7A 3WK2A 3MHUA 3F03K 1OFOA 1IHIA 3IIXA 1VBGA 1MI3A 1QBAA 3VDHA 2VYOA 3MUAA 4RLIA 4DNHA 2QS8A 5G2IA 3RPMA 3ARWA 3VIJA 2PRLA 4IMCA 3VDBA 3W1AA 3ONBA 3FN9A 4C6KA 1Q6QA 2DH2A 5JH1A 2YB4A 4H01A 4NAFA 1PVNA 1E9YB 4DEFA 4X9YA 4B2DD 2IKIA 5REQB 4RE0A 4EVZA 4PUNA 2Y89A 3FJNA 3UJFA 2GJXA 3N34A 2V68A 4U4MA 3UG8A 3PJWA 2PBOA 2YLAA 1C7TA 3LHZA 3W01A 1LWJA 3VE7A 2F7FA 2NX1A 2OOGA 3KOXA 3UR2A 3LLXA 3PVFA 4WLCA 3UQNA 3HFYA 1ZAJA 1FUYA 2F61A 1QNSA 3ARVA 3T05A 2WMFA 2VR5A 3GVWA 2Y70A 5FJRA 4RK8A 5I3IA 4ORMA 5G4WA 5C70A 3XIMA 4MMWA 2NVDA 4WSHA 3QQ1A 2PWHA 1NFBA 4H9XA 1H49A 5K7JA 3KW3A 3Q58A 3DHFA 4V2XA 5TIMA 4Q6JA 3M0MA 1HFBA 1Y5WA 4AHPA 4EX4A 3GTNA 2B7NA 3DAQA 4GUHA 2QYGA 1VFTA 1E6SM 1WP6A 2J7HA 3E49A 4UMCA 2WHMA 3UXKA 4QHRA 4OBRA 2ZUSA 2O7SA 3LXAA 2Y0FA 1XICA 2R6OA 5D2YA 1VBUA 4R3UA 1RBAA 4JFUA 2NSOA 1S39A 5FAGA 1L0PA 2QXWA 1KKRA 1R0MA 2RKXA 1FWCC 2PLJA 4WKFA 2VC7A 5A5WA 3WENA 3FA3A 4GX9A 1XKYA 4AQLA 3PUOA 3W4RA 2R24A 4S39A 5F4SA 4D6EA 1QPKA 4JNMA 3PANA 1BAGA 3GG7A 4MB3A 4L64A 3S1XA 4OTKA 2V3EA 4C60A 3LA4A 4EXQA 4U5IA 3OLDA 4JTGA 4WD0A 3IRSA 2NV2A 2YL8A 2A0NA 1O7AA 4H41A 1FWEC 4LOCA 4UTLA 1PWLA 4HA3A 2YKKA 2XVPA 3GVVA 3N3TA 4U3CA 2QDDA 3TTYA 1QWGA 1TPB1 1VCVA 1VPQA 4OZOA 2PWEA 2WCAA 1H50A 2I57A 1XLFA 2P0OA 3VIMA 4Q8OA 3TLQA 3IUIA 3UPWA 5FJOA 3I6RA 5FF0A 1LJYA 4AX7A 1FXPA 4KCWA 4PUMA 1HJXA 4OE7A 4Y6GA 3HTWA 2GUYA 3H54A 1OGGA 2OLHA 1XI3A 4GUFA 2FGBA 4AIUA 3S1UA 1WDPA 3H4WA 5D2XA 5KZ6A 3TQVA 1HL9A 4QCEA 4O1DA 3W70A 1X8CA 5A3HA 1QRQA 3E5PA 1P7TA 2Q09A 5E5CA 4MDOA 3EA1A 3F4DA 1TELA 2B0MA 2GL5A 3LI0A 5T26A 5M1TA 4RXGA 3FNDA 6A3HA 4DWSC 4IWWA 1O12A 3RU6A 2FPYA 4XBKA 3SN0A 2VT0A 3VIPA 4ZFCA 2OU4A 3R11A 1GG0A 4Q4MA 1ZP3A 3L7RA 1P0BA 4CNUA 3ZLHA 2Z00A 4UFLA 4W87A 3W07A 3CWHA 1WDRA 3W1XA 1VFMA 1FFRA 3UG3A 1C9WA 3N2MA 1PKLA 2J27A 1E0TA 7TIMA 1G4TA 4RNFA 5D33A 5AKQA 4CCEA 4Q4QA 1S5NA 4BWLA 1JCYA 4RXFA 4C91A 4HN8A 3JS3A 1DWGM 1P6BA 3USBA 4N4QA 5EFDA 5J5RA 4RX0A 4RCXA 1W9PA 1M5WA 5AC7A 5I02A 3BARA 6REQA 3QTGA 3KBWA 1GVSA 3AUOA 2VP8A 4ZMGA 1RA5A 2PRMA 1GVRA 4AY8A 5E93A 3CV7A 5M3WA 3O1NA 1U30A 3B4YA 1BYDA 4H1ZA 3PJUA 2RHGA 2ZUUA 2I7GA 4DAIA 3CAKA 3P74A 1UCWA 4GYFA 2HCVA 3A24A 2YDQA 4PMVA 4GIYA 3W2NA 4V1XA 4HVXA 4DI8A 1ECQA 3KP0A 4IICA 2JGYA 1S2UA 2BXYA 3T2PA 4HP5A 1U5HA 3E02A 4H9VA 4S2CA 4CQ8A 5I77A 1VKFA 5M5DA 2XVGA 4GQGA 3BSMA 3WQVA 5GNXA 4RDZA 2BV9A 4I8DA 3VOJA 1XLHA 1W1A1 4QLJA 2BP1A 1XIDA 2VFGA 4CCCA 1B90A 1QNQA 3KOYA 4DF0A 1W1YA 3WN6A 2BVWA 3LXCA 2B81A 4PMNA 3QZAA 4JTDA 1LYXA 1GG1A 4B91A 3OBKA 3VD4A 1HP4A 5J8LA 3T55A 2Z24A 1KM6A 2PDCA 5BOOA 4OBTA 3W81A 3B9EA 1MW1A 4HCLA 3BGAA 2NT0A 3GG1A 2AAAA 4F0LA 4Z1YA 3OLGA 3UWZA 4S3JA 2Z1SA 4JNYA 4KW2A 3H6OA 1JIBA 1ZU8A 3NURA 3UZ5A 1WNOA 2QCMA 2NV1A 5IOBA 4IP7A 2RDWA 1W9UA 2Z1BA 5C54A 1F6PA 3LGEA 3BAKA 3TH6A 3LYEA 4Z08A 3TN3A 1CLVA 3N9KA 4FXJA 1HJVA 3R0KA 1VCFA 3S2JA 1WXJA 3DFHA 3VMPA 2VFDA 1QW8A 3L4ZA 1XWYA 1QOPA 5F1UA 1W17A 3LERA 2V81A 3SCPA 4IT1A 5C0QA 1E1CB 4Q7NA 2ZX7A 5F2IA 3TFCA 4ADUA 1QK2A 5KITA 3W02A 3CZGA 4JFSA 1H09A 3R94A 4PL1A 3QY8A 2GSJA 2D24A 4LXFA 3CLMA 4GI8A 4BFAA 1CXFA 1F73A 3SR7A 1EBHA 1RHCA 3VGBA 3GIPA 4BHYA 2W27A 4PH6A 1BD0A 4F0RA 3ANYA 5JIPA 3VCRA 3WD1A 3GLCA 1PYMA 4BK9A 1GKPA 4MKVA 1KRMA 6ALDA 2BVTA 2VDHA 1WKEA 1LUCA 2AGKA 4M81A 4QQ3A 4HA0A 1XYAA 3V0UA 4O52A 3WQ5A 2AMGA 1DJXA 3B9AA 4MWAB 3HPZA 3NYDA 4RNHA 3E0FA 3N4FA 1J0YA 1FWWA 1KKOA 4LH8A 4S1FA 4WDUA 4QLKA 4GA8A 5CAKA 5I06A 1CB2A 1PO9A 4TX9A 4NVTA 4XUGA 2VC9A 4AF0A 5LHFA 5DEZA 2J88A 1R86A 3HZ3A 1RQEA 1YX1A 5AC5A 1K6WA 2PWDA 5K2ZA 2QDHA 2WLYA 4YVXA 5AYBA 2DJLA 1FCQA 2DUAA 2VFFA 4I9JA 4NXSA 1DV7A 3C0LA 4RW5A 1JL8A 4P8VA 2OPJA 1TSIA 2ZZ2A 4UQCA 1IV8A 5JU6A 2W66A 4CVWA 1PKYA 3R12A 3CHDA 3EX3A 1BQCA 4DJDD 4M80A 4CLMA 1UROA 2B7PA 1H7OA 3LEPA 5BZAA 4JXCA 1TTJA 4JHOA 1LRNA 3EOUA 4RKAA 3NVDA 4B15A 4PUUA 1IR1A 2QUVA 4HHMA 5DY2A 5K3VA 4L7ZA 1P0NA 1NWRA 4K36A 2VRJA 4UXDA 4EP8C 4WKAA 3APYA 1JULA 1MUCA 5DMNA 5AFDA 4J35A 1V4YA 1BTMA 3CIXA 3ERPA 4IQJA 2QVHA 1K8CA 3TZNA 3EPMA 2H8XA 4V1YA 1OX6A 2I9UA 2VWTA 3VOHA 1XISA 2FHCA 1SR0A 3GBEA 4HU3A 2OZTA 1XF0A 3W23A 3M5XA 1IXOA 4QROA 4HOWA 1XYFA 3REQA 5HQMA 2PURA 1HKIA 2HSAA 4XKMA 1DBTA 1RQBA 3TXZA 2ZDSA 1ITQA 4G8TA 2NSXA 1WBJA 3CYVA 2O9OA 3V5OA 4OT7A 3PBVA 4B4FA 3ZM8A 5HMSA 3W6YA 4AIOA 2XSAA 3WQDA 3E0VA 2YA1A 3DHDA 2V69A 2NWSA 2PMQA 4TTGA 3WMCA 4H6KA 1UOKA 4FI4A 4L4MA 1GOOA 4G7EA 3GQYA 2A85A 3NQDA 3N2XA 5I2UA 2DZTA 2H9AA 3CAVA 3S46A 1V93A 4QS6A 2GQ3A 1W9XA 3RXZA 3RM9A 1VHCA 5EB8A 3KBMA 1NJJA 4KBXA 1BVNP 1A53A 2PCQA 5DXXA 4UMBA 3TXVA 3FS2A 4G6CA 2GOKA 5BWFA 2E0PA 2P8CA 3GDRA 1B30A 3AWNA 2MANA 4IFOA 4WCJA 3H26A 1TV2A 2E8ZA 1HKJA 4FIQA 1BF2A 1ITXA 3DEQA 4MYXA 4NJGA 3P60A 3E0IA 2VD9A 2VR2A 3BAXA 4XZMX 3FDGA 3TN5A 4F2TA 1JCLA 1Q8AA 5REQA 1ZTVA 1EJTC 4FNPA 2HRWA 5E9AA 4IMGA 3GKAA 3GTFA 4LYRA 5HR6A 1FH8A 3FGCB 5A6JA 4BF9A 4PUWA 1H5VA 3OP2A 2OGYA 4E8GA 2EPHA 3MUCA 4M51A 2YBUA 3PNUA 2CEQA 4LAZA 1K9TA 1KV8A 3NZGA 1C92A 4NZCA 4YHEA 3WLLA 3PTKA 3RRXA 1PX4A 1V7AA 1MNZA 1TKKA 4LUIA 1R3WA 1E0VA 2BGSA 4M19A 2OGJA 4FNUA 3IVTA 2QCDB 4RPQA 1E0UA 8RUCA 1GVQA 2G37A 1VFLA 3FSTA 4U3AA 4A3HA 1J5SA 3QH2A 1C91A 3PZIA 4E2OA 3CUFA 1DIDA 5A6AA 4C6QA 3ITTA 4NRRA 4ZVJA 3C56A 2CHRA 3BMVA 4KF1A 2Y4SA 4KGJA 3W85A 5CBBA 3NOEA 1BYAA 3U2CA 4G1NA 1CCWB 3L4YA 3MP3A 1TPC1 2GJRA 3S9YA 4B5NA 1J4EA 3SI9A 1HJWA 4WJ8A 2PEVA 3SCSA 3A4XA 3M0XA 2AGTA 5AHEA 1R7AA 3UA4A 3RAOA 4PBGA 3A64A 3C2RA 4Z2JA 2NX9A 4IFKA 4ZO6A 3D46A 2YYUA 3MV11 1Q45A 2GVGA 2HDJA 4U10A 2FLIA 2OB3A 2VC5A 5HNRA 3BGGA 1Q6RA 1RK6A 1XCFA 5E0FA 4HSNA 2I1OA 2EG7A 1JZ2A 2FJUB 3KL5A 3K4DA 3OQ8A 1U1HA 1C93A 2AAMA 5BXPA 2VR4A 4ATWA 3ITGA 1EQPA 1PX3A 3D6NA 3E0WA 4HCDA 3QHOA 5J5DA 2QR6A 4XVEA 2OMAA 4H04A 2CLFA 3KHJA 3V35A 5D04C 4HA4A 1YXCA 2DT2A 1H60A 4O1EA 1N2VA 4ZENA 1DOSA 4DM2A 2WZMA 1PX8A 1TWIA 3M0VA 4PRWA 1FCBA 3L2LA 2XGBA 3B8SA 3MO4A 1VYRA 4N2YA 5BMXA 1W5NA 2QT3A 3VMNA 2V2CA 1KBKA 2PD9A 2XGZA 2D20A 3QKZA 5HUOA 3WDQA 5BOFA 1NSJA 1UWRA 4AFYA 3UCCA 5ABTA 3NL5A 4U28A 5ABFA 3NVTA 5HK4A 1TVLA 1KCXA 1OBAA 3KBSA 3WX7A 4P7NA 1E55A 2RUSA 4EWJA 1D8WA 1W1TA 4CU6A 1I6NA 1XC4A 4D2JA 2DSZA 4IGHA 4J3SA 4I6VA 3MTWA 4HU8A 2YZ5A 2WK2A 4Q33A 3VM5A 1PTDA 2DVUA 4LUJA 3ALGA 4JX6A 4GFIA 1QHOA 5G1MA 4HZ8A 2D73A 1HJSA 4Q4RA 5CZJA 3TONA 5D2TA 3WBEA 1A50A 4HPXA 4HD5A 4DXXA 3EWYA 5I3JA 1F4AA 4MM1A 3N3MA 2E9LA 4JTEA 2VMFA 1SPQA 2WVVA 5AZ0A 1FWTA 3SUTA 5E6YA 3S6DA 3FKKA 2VCCA 2Z1WA 2VEPA 1JYNA 2V2HA 4IUOA 1UWIA 1ME7A 2G3NA 3CHFA 4A21A 3LLFA 2A7RA 3DFYA 3S5YA 1S2WA 2QCEA 3EEZA 5CEWA 4NX5A 1TV3A 2YFNA 1CTNA 1WZKA 1H7PA 2Y24A 1DHPA 3BAWA 4I6KA 2DSUA 2VX6A 4GUIA 3SUUA 3LUTA 3NXLA 1GOMA 4K38A 1FHUA 1P0KA 4E6MA 3EOOA 1KFWA 1SZRA 5H1WA 2INEA 3P67A 3O16A 2X16A 3ARPA 3BMXA 1BTCA 3ZXWA 2E8YA 1MQRA 1PTGA 3HQPA 2ATSA 2X8RA 3LU2A 4FS9A 1OFAA 1H61A 3H2FA 4MF4A 3NSMA 1RP9A 2J74A 4MPKA 1PS9A 1FDZA 3IIOA 4AHQA 4DF1A 4GC4A 2ZTJA 2WVTA 1WB0A 2ZZ3A 3OJGA 4GZIA 4PMOA 1MW0A 3GR8A 4ZTYA 4TVDA 1XH2A 1F6KA 1C9DA 3CUJA 6CGTA 4GI4A 2OYKA 2H6RA 3ES7A 1G5AA 1JYVA 2HZGA 4P7LA 1J5TA 1V6UA 2XFRA 4UFMA 5CPTA 4AU0A 4XAZA 1H1YA 1YADA 1BSLA 3VGEA 4ERGA 1W9BM 1SUXA 3M0YA 2JF7A 4L1XA 1V8EA 4GRSA 1HO1A 3UR7A 5B7ZA 3GXTA 1PZ2A 4QXIA 3WQCA 1XSIA 3W7HA 2FTPA 4LB3A 1GT8A 4QS5A 1I0BA 3AFBA 3EDKA 5C2XA 4NJHA 3Q2DA 1EIXA 3AIBA 1J2BA 3EWBX 2PTXA 4X63A 2D2GA 3SN4A 4YNGA 1TPWA 2DUZA 2EXOA 3UR5A 2YCKX 4JFTA 4XTIA 1UWAA 4AD1A 5HQLA 3C2OA 1I1WA 2GVYA 4J27A 1QHZA 3C86A 2WJEA 5ECVA 5TF0A 3VIOA 3W24A 3UXLA 3VILA 4QDPA 3WG6A 4PCFA 2YXOA 3P82A 4JIQA 4DN1A 4AD3A 1E1CA 1SR9A 2BODX 3T78A 1KXHA 1K8ZA 4PTDA 4FZIA 5E0CA 5EFFA 3T44A 1TV7A 4CQBA 3OOQA 2W6RA 2DZXA 3QY6A 3K30A 4AWUA 4V15A 1VBRA 1VEOA 2E77A 1NOFA 3KFTA 2QGYA 3TKFA 1BGAA 4JTLA 3VCNA 1YXDA 1QR7A 1XKJA 1HVQA 1CIUA 4IGSA 4AWEA 4NG3A 4DO5A 3GTXA 5CPSA 1VYSX 4J3VA 5EPDA 3CL8A 3EPOA 4DB7A 1VFUA 4R7JA 3M4HA 4F8XA 4DELA 4YHGA 2WOQA 2QCNA 1NH6A 2E6AA 4ZB5A 2P50A 4RUBA 2NV9A 3NM3A 1SGJA 4QCFA 1JR1A 3C8FA 3NQBA 3BLEA 1YW1A 1YXYA 4RDYA 1EYEA 3M1ZA 1LBMA 4D6FA 3H23A 1E0XA 3SO7A 1R3QA 3P3BA 4JTKA 3CQ0A 1E3XA 2HISA 1XIFA 1EHNA 3QQ0A 2P88A 4MSSA 5D9PA 3R8GA 4J3UA 3HGJA 1HTIA 1E40A 4M6VA 2DJXA 3N2CA 4WSKA 1JG9A 3QVQA 1UKTA 4S2BA 1XS2A 3W76A 9XIAA 2W67A 1SM9A 3G0SA 3V18A 1IQ8A 2OSYA 4UIOA 1CGVA 3MBDA 1KWGA 1DQUA 3CUIA 3VNKA 1KRCC 2AL2A 3OPSA 4ZBCA 1QW7A 2J6VA 1ADDA 2Z27A 4GINA 1ZZMA 1YIXA 4GGHA 2XSXA 5EU9A 3NGJA 2IKHA 3BG9A 2QF8A 1S1PA 2YDSA 4PFMA 3KOFA 4UQDA 3HG2A 1SW0A 1DIKA 2F9RA 3AIUA 5AN7A 3ZT7A 5EY5A 1W54A 3EMZA 4FAMA 1X6UA 3MCNA 1MUWA 4REQA 4GQQA 4W4QA 1Z7AA 5I23A 1QK0A 4R33A 1OFPA 3BPWA 2DIJA 1M53A 3I3BA 5A6SA 3HMCA 4OQVA 1FWAC 4C1NA 3S4TA 4QEHA 2XH7A 5CZKA 4L56A 3KRZA 2Z29A 1GHRA 3GYCA 4KFOA 2P76A 3OZYA 2QCHA 4FK9A 2DGAA 1E15A 3H8AA 1XFCA 1JUBA 3B06A 3QOKA 4AY7A 5LGZA 1SW7A 2A7PA 3A23A 2DIEA 4FXFA 3I7RA 4FEZA 3H4XA 3RX3A 1RPKA 5DT5A 3KP1A 4B16A 4AD0A 3FHQA 3AYRA 1W1B1 4Y96A 4PEKA 1TV5A 3GXMA 1XGEA 1T7LA 1OWQA 3BLPX 4GI6A 3M0KA 3DIPA 3WQEA 1GQJA 1TRIA 3HQ1A 1FH7A 3VIKA 1EPVA 1G7VA 1RK5A 1W3HA 1Z3NA 2QKFA 3VIGA 4AY1A 1HKWA 2VURA 2WANA 2VDGA 4ML4A 1EHAA 2X1UA 2NX3A 3U8GA 3IGUA 1JZ6A 2DDXA 3JZUA 4FLOA 5FOOA 1T8QA 2G41A 1XUZA 4GCXA 2ZX6A 5CSUA 3KX6A 3AS2A 1SZNA 7ODCA 4A3UA 4MY8A 4XISA 4F0SA 3RYSA 4C5ZA 4JX4A 3QMSA 3RPDA 3SY8A 5JBFA 1IEXA 2XPKA 3WNOA 3AYTA 1EIBA 3OGSA 1E4LA 2EJAA 4LFYA 3MWCA 2OO6A 1RR2A 5CZTA 4H9YA 3E74A 2J78A 4HZ7A 1LDCA 2OEMA 3VOFA 3AQUA 2ZA1A 3ZJKA 4IOTA 1DP0A 1PIFA 5U4NA 1EJWC 3N9SA 4TV5A 3A13A 1N82A 1F8IA 4PCTA 3W3OA 1QDSA 2WMJA 4ACYA 2XIQA 4KPLA 1T99A 4F4RA 1HQTA 4F0MA 2Y8UA 4ZE4A 3THUA 1O66A 2P3ZA 2WSKA 4MJ2A 4RDVA 4JIHA 1V6TA 1IIHA 2C16A 4UCFA 3TJXA 5CPLA 4IL0A 4LVGA 3ZIZA 1W3IA 3BSHA 3RUBL 3RLUA 2OYMA 1W3JA 1XLDA 4ZOBA 4QSFA 1WOAA 1BQGA 1W1ZA 3RLVA 1V02E 3MSDA 4LAUA 5A8PA 3L66A 3LHUA 1Q5MA 5EMKA 1MXGA 4TQTA 3RO6A 3II1A 1H2JA 1AH0A 1IT0A 2NQ9A 1JCNA 1FWHC 1OX4B 1OT1A 1X38A 4CN4A 4HTBA 1LG1A 1YLVA 4JTJA 2VI0A 1E5NA 5IBXC 2ZFAA 4CNOA 3LCLA 5GQBA 1GORA 1V3KA 3VD3A 4A8NA 5AHIA 3NZ1A 1EYWA 1EO5A 1KV5A 4YWIA 4S3KA 4I9TA 4GY1A 4UQBA 4DUXA 3M0IA 1XRSA 3L65A 3U57A 4ZOEA 2DQXA 4QAWA 3TCEA 5FCZA 8TIMA 2DP3A 3BJSA 1Q13A 2HVMA 4UQAA 1A3XA 2OZ3A 3LLDA 4HNCA 4KESA 4UTKA 1I4NA 3N2TA 1ZAHA 4O4VA 2J9YA 3VGGA 4ZQMA 4O19A 4LY4A 4QJ5B 4IPLA 4LTSA 4CD7A 5C6MA 2ADAA 2CLMA 3H4GA 1ML1A 4NUWA 1TJ0A 2XHYA 2PF8A 3CWNA 1GCYA 1S3HA 4QP0A 2QUNA 3LX9A 1JUEA 2FVMA 1QHPA 1WQ5A 4QNWA 1TPUA 5A6BD 3IIZA 4H4IA 3LPOA 3EOEA 3WBAA 3LSBA 4CKQA 4Y2WA 1V3LA 4MOZA 3UZWA 4OVXA 2E4TA 3ABXA 1LM1A 1JFHA 1R3VA 1XIBA 2WXDM 2YOCA 4PCNA 3XINA 3LB0A 2CBIA 2W92A 1IF2A 4HHHA 1ESWA 3U4AA 2Y7FA 3URBA 4H19A 4DXVA 5GJNA 1TPFA 1V77A 3ZZ1A 1Q6GA 1GVFA 2J79A 3OGVA 3P8IA 4QR6A 2J66A 3V1HA 1ZY9A 2A79A 2YPIA 1UR0A 3BE7A 4H9UA 3H12A 2BGNE 2XFYA 5A8QA 3AROA 5A8MA 3B8DA 5HWNA 7TAAA 4WY0F 1WDWA 3WK0A 3ITLA 4HCHA 1GPFA 2F2KA 2ZOXA 1IR2A 1XRVA 3ABQA 3VIFA 2CHNA 3QOMA 1K77A 4I8YA 3PZGA 3T4WA 1X39A 3MUY1 3G6MA 3CHVA 1UBSA 4YTUA 1L6YA 4MWAD 1XLAA 1DWHM 4DPQA 2OZ8A 4KH2A 4C6IA 3GHSA 1E6QM 2QV5A 4LYKA 4DIAA 4U2ZA 5HPCA 2J7EA 5AHLA 3TQPA 4LBUA 1LOQA 3SQSA 1BEUA 4Z2GA 4W88A 5CG7A 3LRMA 4M3PA 3URAA 4O16A 1I75A 3H7VA 3EXSA 3WEZA 2FZBA 1OVDA 3WJWA 4BY3A 1K7EA 5EYWA 4LBRA 2Q8ZA 2A7NA 3EZ4A 4IPPA 5HOSA 3DZ1A 5BXRA 3L5AA 4US5D 4OGZA 4ZQCA 4PB5A 2WSPA 1HJUA 3NDZA 1OG0A 4ZXOA 3RFAA 2PDWA 1NU5A 3ZVIA 1TE1A 1M7XA 2WVUA 1ZJAA 1A5OC 3W7JA 3HPSA 3ZLFA 4IUGA 2I5IA 1GYNA 4M6PA 3V7PA 5GNYA 3HA1A 4XD6A 1GEHA 4X61A 1GGOA 3EWZA 5AZ1A 3NA8A 3QYSA 3PWIA 4GZJA 3UWQA 4KCVA 2ZIDA 3PR2A 1KM1A 3OLEA 1BWLA 1GZGA 1YE6A 2Q8XA 1GOXA 2WBKA 1ZALA 4XZ9A 2EBNA 2V38A 3W38A 1F8MA 3N19B 4F9DA 5D03A 4U31A 4HBKA 4IJBA 5D30A 4WGHA 2XZ7A 2A3EA 3GXIA 3AJXA 3H2OA 5IM51 3S5ZA 3MPGA 1D3HA 2J8GA 4JQAA 4LVBA 3F4VA 1YEYA 2OT1A 3ZR6A 4W8AA 4H6EA 4CGTA 4P8XA 2CCRA 5C71A 1KFBA 2XU2A 1VFSA 5AY7A 4UMAA 1FWGC 3ABZA 2G3IA 4H83A 9XIMA 3H70A 1DPMA 3W7OA 2X7WA 3KRSA 4LGXA 1KCKA 4AWSA 2XN1A 1RVGA 3SY5A 2FZMA 2W3ZA 1ODUA 5C9RA 1AG1O 4E4FA 3NGFA 2PODA 3KCLA 3ORWA 2BXVA 3VDAA 4GBUA 3F7JA 1MEIA 2NQLA 3EDEA 1BF6A 3OGRA 2ZBTA 4L1WA 2C15A 2J7DA 3IGSA 1W0MA 1HKKA 1IWAA 1TPDA 2EJ1A 3GZ3A 3VFCA 3MHFA 4O15A 4M6QA 1W37A 2E09A 3KVLA 1UD8A 3MCMA 1UG6A 1UD4A 2PGEA 4YS1A 7REQA 1NY1A 2J7CA 5TAOA 4JTQA 4LS1A 1NFPA 4IX2A 3TQKA 2BNJA 1O68A 1M7JA 1HT6A 5EMUA 4YYCA 5EGRA 1NIUA 3CEPA 3BVJA 4IJRA 4NY2A 4UZUA 4C1LA 2E5CA 2QCCA 1UQZA 3LHVA 4F79A 3FJLA 3SW6A 4EF8A 1AMKA 3G77A 4DZIA 3LMZA 6PTDA 4YTSA 2VGGA 3S83A 1P43A 5PTDA 3ZYZA 2IQTA 3U2EA 1G01A 2FDMA 1L8NA 3QZEA 4YCOA 5C9UA 4ACZB 1X97A 3A5FA 4DX3A 2FHFA 1J10A 2ALRA 5BU6A 4GIAA 3R7MA 3U9IA 2VVNA 4QDWA 1KGWA 3HG5A 3UEQA 4ZCWA 3MY9A 4B4HA 4JCLA 1DJGA 3W83A 3W87A 1VBHA 3BDKA 4N42A 3KTXA 3BW2A 4J2PA 4JY9A 4J9JA 3R25A 4LYQA 1V02A 4NNAA 3O0KA 4P2VA 1V0MA 2G50A 4B9YA 4GVGA 1DXFA 4Z1BA 1W9DM 1M3UA 3WIJA 1ONEA 4RZBA 3BAIA 1NDVA 4HYWA 3W86A 5FJIA 5JVLA 2UBPC 3AHTA 3NIYA 4NZFA 5XINA 4JDYA 2JE8A 4P7RA 3WZ0E 1O6IA 5HATA 5DY3A 2PD5A 3OVGA 3GXNA 5FF4A 3AI0A 4AB4A 5KEZA 4E3TA 4H8UA 3TSBA 3S42A 1UOZA 1LG2A 3VI2A 5FEWA 1SSDA 1U1JA 2WVSA 1KLZA 4AZHA 4H8NA 2KAUC 3GAYA 4UR9A 1IYXA 5JBDA 1E6NA 2WM0A 2WCSA 2NUWA 4X22A 3LK6A 4C6OA 1CGXA 1XYZA 4TO8A 1UH3A 3CZLA 3W6MA 3S6TA 1PYFA 1WXYA 1NF0A 1BYBA 3I7SA 3F2BA 3WJXA 2W62A 1ISWA 3KRUA 2R1LA 3KZSA 3OO2A 3GUWA 4Z17A 2C71A 3T0CA 1GZJA 1XXXA 1L2QA 2X42A 5CJMA 1UD6A 1UUMA 8XIMA 1M03A 3GXPA 1YTKA 3IWPA 4CQDA 4L80A 4X0NA 3GVGA 1SO6A 1WAUA 4DF2A 2XIJA 3C2YA 3HPXA 4W5UA 4W8BA 4IG2B 3TVAA 2DZUA 4KRZA 4KIEA 2OLSA 1TA3B 2HJPA 3K13A 5H8PA 4HNTA 3AMLA 3N15A 1YQ2A 3HB9A 4AD4A 2XN2A 2RH9A 1UKSA 2A6LA 3IJ8A 4QX4A 4DBEA 2VNCA 4B5SA 1LRQA 3ANUA 3OB8A 2V82A 4PE8A 2PZNA 2ZRYA 1BVZA 1I60A 2QMKA 1OINA 3D3FA 3BSGA 3VDCA 1T8XA 2X0YA 3BV7A 4AD5A 1QASA 3OQEA 2OG9A 4NYUA 2UY5A 1K03A 2V0TA 4GIRA 2CLKA 2X30A 3ARRA 3AISA 4PCPA 2DIKA 3ZVHB 2QCFA 4UFHA 1LL4A 1E6XM 4UZSA 4LT9A 1VR6A 3NXFA 1H41A 1KXQA 1AQHA 7A3HA 1OD8A 1KM0A 1E9LA 3GS6A 3M5VA 4IXXA 3B0VC 3LXBA 1AFSA 4WOZA 1E6PA 2RFGA 4ES4A 3TQ0A 3LSCA 1PSCA 3AS0A 3OZPA 3NPVA 3GNNA 2CLEA 1WCGA 1FQ0A 1LOLA 1GJUA 2NQ5A 5JH2A 2CLHA 1B54A 1X6LA 3M64A 4DZHA 2REQB 2R91A 1UUQA 1L9WA 2PWFA 1JD9A 3CLWA 1YPXA 3DGBA 4URIA 5BWAA 3LCFA 1NWSA 1H62A 4X9SA 1H11A 2ZX5A 4DWSD 4DJEA 1OT2A 3WF3A 2FZ9A 5XIMA 4G7FA 1SO5A 3MYPA 1ELSA 3EKLA 4Q7IA 3R0UA 4LAKA 4L5ZA 4JIPA 4RPPA 1MO0A 3USZA 1JNEA 2ZE0A 4MDPA 4TX6A 3EB3A 1P6WA 2ACUA 3ELFA 1XM3A 2R1NA 3RITA 3L0GA 1OCNA 2XISA 2KX9A 1KR1A 1D3GA 3IK4A 1OFBA 3IJLA 1V3JA 3MMUA 2YCJA 4IP4A 4S3CA 4LUTA 3S3GA 4WR3A 1WBHA 2P10A 1TZZA 4CD8A 2EAWA 3SIMA 2CLIA 1DQXA 2QNEA 3CMJA 1DHKA 5I79A 2DSVA 2XN0A 3UG4A 3LTSA 1OFDA 3W27A 2CITA 4WDTA 1OIFA 1NOWA 2PDLA 2CKSA 3D0CA 3SB0A 2OWXA 5LA1A 1R3SA 3MKKA 4Z2HA 3BWWA 3LQGA 3W1NA 3EMQA 2E1DA 3VX0A 1VENA 4LANA 5CZSA 1EH9A 4LS0A 1CXKA 4PC8A 4F48A 4WZHA 1I8JA 5HNTA 4IH3A 4K39A 2VDIA 1KFKA 4NKCA 1FWFC 5K9XA 1E9ZB 2E25A 3CPUA 3C0QA 3CB8A 1MFVA 1U33A 3IJIA 4WXZA 3C61A 3CWOX 3KTCA 1B3OA 4BR1A 1O94A 3POCA 2PF0A 1UC4A 3T8LA 1OF8A 3GU2A 2R1KA 1XGZA 3LRLA 3A6OA 3QKEA 3QYQA 4UR7A 3AIRA 1EOMA 4JOMA 1XW8A 1F5ZA 4B2DA 4GO9A 5CG0A 2QPSA 3OHIA 4ZGYA 4LRTA 1LLOA 1V7YA 4AZ5A 5XIAA 3BQ5A 4Q8TA 3E2SA 3BV4A 4L6OA 3AWOA 2GJPA 4EANA 1RD6A 1ZENA 2DQWA 3NQGA 3IEBA 3CUHA 4D72A 3G5EA 5E9XA 4FB7A 4XZWA 1UWUA 4CCZA 1RBOB 1PBGA 4GOAA 2WKLA 1G9HA 3VOGA 3R4IA 1JCJA 2TPSA 1KRBC 3B8UA 4GVHA 4PMZA 4XBJA 4IQDA 4AC1X 3L4TA 1EC9A 3IANA 1GVYA 3QGAC 1BSIA 3SGZA 2BFGA 3KVJA 3NL3A 1FY6A 1QNPA 1TQXA 4POCA 4MZ1A 3MMDA 4QQUA 3HN3A 1DJHA 3P5ZA 2D3LA 5FJUA 4NAEB 3MVIA 4GO8A 1GOIA 1I2QA 3LTPA 5L9FA 1ZP4A 2CZVA 3OEXA 1ZLPA 1BPLB 3KLKA 3WBXA 3W1MA 2X0SA 3AS1A 4AX6A 3T8QA 3WD3A 3QZ6A 1TZ9A 4TVCA 4X0VA 4JR5A 3TYUA 1SVDA 4ZXLA 4HMNA 1V3MA 1W3LA 1JQXA 5JIWA 2IMRA 3U3HA 1DKWA 1MW2A 3KL0A 3BAYA 2YCLB 2TMDA 3WFAA 3M7WA 4KS0A 3KBVA 3SCVA 2XYLA 4DO6A 4GCAA 3PBWA 3CL6A 1LBLA 4JYDA 4LPCA 3OYZA 3ZLGA 1A5AA 3GVQA 4AZ7A 5DCEA 4WKHA 3R13A 1EP3A 3PAJA 1R3YA 4PYSA 2H8ZA 4BQ2A 3W0KA 1CX9A 2NVAA 3AYVA 2R9RA 4PUJA 3D3AA 4LNCA 3LQLA 4DPPA 4HQVA 4IIHA 2QJGA 2ZXQA 1JZ3A 3PPGA 3DERA 1DTNA 4R34A 4PGLA 3JUGA 3ZSTA 5CH9A 3VVGA 2EPMX 1V6XA 1GKQA 1QAPA 2ZYFA 3L67A 5D4YA 4J3XA 1S46A 1POJA 2BOGX 3O6AA 5D37A 1W91A 3K5XA 4DJFD 1TJ1A 5D2WA 3RU8X 3BC9A 2Z25A 3NO1A 3VC5A 1ICSA 1I45A 2NXIA 3VYLA 3N9RA 1KBLA 5E6ZA 3WY1A 2OEJA 1PKNA 3PTDA 5IHRA 4OIFA 4JKKA 1GKRA 2JFEX 4HN4A 2AL1A 5C55A 5T91A 3DOPA 2VFIA 3QV8A 3NM1A 4EXAA 1DWFM 4XIMA 1LF1A 2FFCA 3S9IA 1IWPA 2H3BA 2P8BA 1XR2A 3NG3A 3UA3A 4AZCA 1WKDA 2PE4A 3TFXA 3B40A 3BAJA 4LVDA 4YVVA 3BOLA 3W74A 2BMBA 4C6DA 3QM3A 6ENLA 3NCOA 2GUBA 3TYAA 4NIRA 4ZOCA 4DWDA 2Y6ZA 1BG4A 1E51A 3L4UA 3H2NA 1XG3A 1FH9A 2J6XA 4WSJA 1XGDA 2ZA3A 1REQA 4BF7A 4GNJA 1A5NC 3U5UA 3QC0A 2V3FA 4D6HA 2HVOA 3I65A 3G0XA 1XFBA 2FB3A 4JCMA 4X2RA 1F3WA 3QV9A 5IFTA 1EPXA 1EX1A 1AQ0A 1S5VA 1R2RA 3V1PA 1QNVA 5CC5A 1KM3A 3CIVA 4PMUA 1CXIA 1XHGA 5LNVA 2J7BA 3W00A 2ZWZA 3TYZA 2E5BA 1XPGA 2XTKA 2XIBA 4NILA 4PZVA 3PSVA 3C3UA 5A8OA 4A8LA 3CZ8A 4UTTC 1OCJA 2XG9A 4JL1A 1TE6A 4ACZA 2BDQA 3TYEA 4E2VA 3W84A 3TOYA 5DF0A 1ZJBA 3FXGA 1J0HA 4UB9A 4JN8A 3NPXA 3EWCA 3T9PA 3WLRA 3WUBA 1FKWA 3HQNA 3U2ZA 2INFA 3M5YA 3RLGA 2PLKA 5FF7A 3WH5A 3KHDA 4ZA0A 4NI8A 1XDLA 1W8SA 1LBFA 4GYPC 4AD2A 2VUYA 1XBYA 3DG7A 4ILSA 3ME3A 1O1ZA 4MVAA 4W89A 1SZFA 2UV8G 2V67A 4UOJA 4D8AA 3TE9A 3G2GA 3GAKA 4DZ5A 2B7QA 4YJ5A 4GISA 3CV2A 4PA8A 3W88A 1FFQA 5CPMA 1J11A 1Z44A 4NQ1A 3HGSA 3HG4A 4QGCA 4JQ1A 2VWSA 4TMBA 2Y1HA 1AL7A 3IGHX 2Z6JA 4Y90A 2ZADA 4IL2A 3V5FA