2PDBA

Human aldose reductase mutant f121p complexed with zopolrestat.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
b'ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEPFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdbA00
4F40A 4NKCA 2P5NA 1ZGDA 2HDJA 3RX3A 2CLPA 4PRRA 4WDWA 3Q65A 3GHTA 2PEVA 4Q7BA 2FVLA 3CMFA 3M0IA 5JH2A 1PZ0A 3P2VA 3UZWA 2FGBA 3N2TA 4YU1A 4XZIA 4FZIA 3NTYA 4XK2A 5JH1A 3C3UA 1MRQA 3VXGA 3N6QA 3H7RA 4JIRA 4I5XA 4FAMA 2PZNA 2HEJA 2HE8A 3H4GA 2PDLA 3DN5A 3KRBA 1X96A 4YVPA 1RY8A 3MC5A 2PDWA 3UWEA 2IPJA 3V0UA 2IQ0A 1US0A 3UZXA 5DANA 3RX4A 1EXBA 1XGDA 4JIIX 3B3DA 3UGRA 4GACA 1PWLA 4JTQA 3WG6A 3GHUA 1ZSXA 2IQDA 2R24A 2R9RA 2PDGA 3V36A 2ACSA 3H7UA 4DZ5A 4LBRA 3S3GA 3LZ5A 2BP1A 3O3RA 3BCJA 2IS7A 4IJCA 4EXBA 2PDHA 3LD5A 1LQAA 3FX4A 1QWKA 2PDBA 1GVEA 3UP8A 4XZMX 2IKJA 2IKHA 1T40A 4JQ1A 1XJBA 3WBYA 4WRHA 5LIYX 2FZ8A 5LIXX 4RPQA 2ACRA 2BGSA 3WCZA 4GCAA 4GQ0A 1X98A 4YS1A 1PZ1A 3ONBA 3M64A 1A80A 1J96A 2HE5A 3R43A 1AFSA 3QKZA 4MHBA 2C91A 3ERPA 2ACQA 4YVVA 4GA8A 3BURA 4XVEA 2PDIA 5KETA 1C9WA 1HW6A 2PD5A 3UYIA 3LN3A 1Z89A 4GABA 3R94A 2ALRA 4G5DA 4DBUA 4PUWA 5LIKX 4ICCX 1QRQA 4XZHA 3G1RA 1S2CA 1UR3M 3WBXA 3V0SA 3GHSA 3U2CA 4JTCA 3V35A 1OG6A 3CAVA 2QXWA 3LENA 3MB9A 3O0KA 4WEVX 1JEZA 3LZ3A 2IKGA 3RX2A 2INEA 3LQLA 2INZA 5C7HA 2PDJA 3LNMA 2NVDA 1AH0A 3DOPA 2HVOA 4GIEA 3M4HA 4LB3A 3CASA 1T41A 4XO7A 3LQGA 3BUVA 1YE6A 4JIHA 1S2AA 4QBXA 3WBWA 2FZBA 1ZUAX 4IGSA 1RY0A 2PDMA 2PDUA 1YE4A 4H7CA 4JTAA 4H8NA 5LIUX 4JQ4A 4LB4A 1FRBA 4HMNA 3F7JA 4GQGA 3R7MA 4QXIA 2BGQA 3UG8A 1ADSA 2IPGA 2F38A 1ZQ5A 3GHRA 1Q13A 3R6IA 3G5EA 2A79A 2I16A 2PDCA 2FZ9A 1K8CA 2DUXA 2IKIA 4JTRA 1AZ1A 1M9HA 2WZTA 3COTA 4FA3A 3D3FA 3UZZA 1IEIA 3ONCA 2PFHA 4LBSA 5M2FX 1Z3NA 4IJRA 1EL3A 4PUUA 1HQTA 4JQ3A 3LUTA 4PRTA 3R58A 4WDXA 1PWMA 1XF0A 2DV0A 4JQ2A 4Q3MA 4XAPA 2F2KA 1X97A 1AZ2A 2HV5A 2DUZA 4HBKA 3R8GA 3UFYA 2J8TA 1YNPA 1EF3A 1PYFA 2FZDA 4FALA 4DBWA 2PDPA 1VP5A 3R8HA 1Q5MA 1Z8AA 3T42A 2PDQA 3LEPA 1S1RA 2PF8A 1EKOA 2I17A 2IPFA 3Q67A 4R9OA 2PDNA 1SM9A 4QR6A 1S1PA 3EB3A 2ISFA 2HVNA 4EXAA 4L1WA 1R38A 2PDYA 4OTKA 3CV7A 3BV7A 4WDUA 4DBSA 4XO6A 1YNQA 4WDTA 4XZNX 1MZRA 2ACUA 4PMJA 4JQAA 4AUBA 5HNUA 4YVXA 1LWIA 2PD9A 4XZLX 1RALA 4L1XA 4QX4A 1IHIA 1AH3A 4WGHA 4XVDA 2IPWA 2NVCA 2WZMA 3CV6A 1AH4A 2PDXA 3CAQA 4ASTA 4PR4A 3V0TA 3LBOA 2VDGA 5HNTA 1VBJA 4JTDA 5AZ0A 3GUGA 5HA7A 4ZFCA 5LIWX 2AGTA 4LAZA 3EB4A 2PDFA 4LAUA 3UZYA 1Z9AA 1MI3A 2PDKA 3EAUA 3FJNA 5AZ1A
chains in the Genus database with same CATH superfamily
3TAOA 3LHYA 1ZGDA 3PTQA 3HB9A 1XIGA 3M6DA 3DCPA 2VR5A 1KB3A 3I7QA 4L80A 1HL9A 2F6XA 1OHLA 4OOUA 2HNEA 6REQA 3KCJA 3BAIA 1EP2A 2EPOA 4I9MA 5FF2A 3V75A 1HX0A 4BCEA 3N2TA 4KWVA 3PG9A 5F2LA 1RJQA 4D6EA 2REQB 2V5KA 3VFLA 1OFBA 2QLYA 4NJGA 3DECA 3JVAA 4G7EA 4WQ6A 4DN1A 1EJSC 3EA2A 4FIQA 3CUFA 3H4GA 4B5UA 4N0RA 3UGVA 2OEJA 4I9TA 3W53A 2HROA 3CV1A 3QJAA 4R9XA 3VOCA 3VNKA 4DNHA 1B0IA 2WV8A 1OC5A 3H70A 5B7YA 1UD2A 4KBXA 4HNNA 3SUSA 3IJ6A 2YYTA 3DU0A 4IXHA 4FX7A 5HMDA 3E2VA 1KRMA 1IXPA 5IHSA 1W3NA 2IQDA 3ZJ6A 1QI4A 1IIHA 4JTSA 1YTEA 1XSKA 3VFCA 3PZVA 2P8CA 2UZ9A 1BG4A 5DY3A 2VO5A 5BWFA 3ITGA 4O8RA 5DN1A 4RR4A 3N73A 5GJNA 1MXDA 2J75A 4KFNA 3QFEA 7TIMA 1EPVA 4V28A 4AD3A 2AMGA 2Y89A 4JQ1A 5FJRA 3K13A 1SSGA 1PKYA 1XI3A 1VEMA 3GYCA 2V9DA 3G24A 3RILA 1UIOA 4O8AA 2XYLA 4M7SA 3KRSA 1XQKA 4RZBA 2V68A 2TRSA 3H2MA 3O63A 5LNWA 3VM7A 2E0PA 3JRKA 3TTSA 3CH0A 3UVIA 3M0XA 1K03A 2ODOA 3DUGA 4EANA 4MSSA 2R14A 4MUPA 4LYPA 1CXHA 2BV9A 3MP3A 3QTPA 4HNCA 3GNOA 3ARSA 4RLIA 4I9AA 2FTWA 5C9UA 1LRNA 1Z89A 3MW7A 4CNTA 3ZVIA 3R94A 3WL0A 1W1B1 3GDRA 2OELA 3U4AA 4ERGA 4JTTA 3QGAC 3G1RA 3UCDA 5K3VA 4PL1A 3EDJA 2EG7A 2QPSA 4XZBA 3OG3A 3UWYA 4EP8C 2VRQA 2PLJA 2QDDA 2PMQA 1OADA 5JVLA 5REQB 3O9NA 4YWSA 1DJQA 5C7HA 3GU1A 4CD7A 4HJWA 1A5MC 5CBJA 1NDVA 4M24A 4LXFA 4WHBA 4GIEA 4TXEA 3CYJA 3VNDA 4MJ4A 2BB0A 1G69A 5CH9A 3QY8A 1ITXA 2A7NA 2BZNA 4IT1A 3ZOAA 6CGTA 3A4AA 4JTAA 1AL8A 1FWTA 4H19A 4RNFA 4JQ4A 4P7LA 1DIKA 1D8CA 3MKCA 4IFOA 3L2LA 1LQ0A 4XIMA 2D0HA 3CHCA 3PAJA 2XGIA 3PPGA 3QW3A 1L6WA 1R30A 2QMKA 3CHEA 1M04A 2X41A 3VI2A 1H41A 3AS0A 4U2YA 5DX7A 3QC0A 2F9RA 2ZC1A 5CZTA 1XRFA 1TV5A 4RDWA 1QBBA 2WZTA 2DZAA 2QQ6A 3PZNA 4JIPA 5HJLA 1XYBA 1RCXB 4ZOCA 4MVAA 2QVHA 5IDIA 3PWAA 2P3EA 1NF0A 2C79A 4D6JA 4AG0A 4IMGA 2GQAA 3FNDA 4D9PA 3L2MA 3IUIA 3A21A 3EB2A 4DJFA 4GY0A 4TU1A 1DJIA 1R6WA 1XRTA 3AYSA 1XDMA 1MO0A 3HPZA 1RXOB 2VEPA 5SWUA 1IT7A 1K9FA 3JU2A 5H91A 5CC3A 4Q7NA 4MKVA 4KRUA 1VEPA 4F0RA 3IACA 2BOFX 3SCUA 1YBQB 1S1RA 3W2NA 1QPKA 4TTGA 2Q8ZA 1EKOA 3Q67A 1JCYA 1RQBA 2BFGA 4AISA 5EBAA 1W5OA 4FNUA 1GTEA 1QI2A 3O06A 4LVDA 1DJYA 4PMDA 4I9JA 4L1WA 3TEVA 1V3KA 1VJZA 4FOJA 2PDYA 3S2LA 1Q6EA 2PE4A 4QTGA 4Z1AA 3STFA 1DWJM 1H11A 3HFYA 3T78A 4MWAD 5I6SA 1GHRA 4AUBA 4HB7A 5HNUA 3C0QA 4HQVA 1PUDA 4K3ZA 3GXIA 2ZBTA 3NL5A 3WK3A 1ADOA 1LYXA 2BSLA 3OJGA 2PDXA 1EEPA 4PTWA 3MQTA 3RGTA 3HV8A 4RJEA 3RCMA 1NM9A 4RDZA 1E5JA 1J5TA 4IXXA 2SFPA 4MZYA 4ECLA 1EO5A 1JYVA 5K2ZA 3GNRA 3MKVA 5GPRA 3REQB 4W87A 3V16A 3IK2A 4Q4RA 1I60A 4B5NA 3SFKA 2WHMA 5EB8A 5AC7A 5XIAA 4NKCA 2YYUA 2GK1B 1QAPA 5AFDA 2BOEX 4DJED 3NO1A 1X7IA 5I3GA 1OZQA 3W4RA 4CVUA 3UBPC 1WCGA 2PWGA 3QSTA 5JIWA 3M0IA 2E5CA 1HIZA 3K4DA 4ATLA 4UQDA 1PX4A 4B4HA 4MIMA 4PBFA 4XZWA 3EX6A 4DYJA 3WZ0E 4HN4A 3BZJA 2YL6A 4MTVA 1TJ2A 1E6ZA 4HK6A 1MRQA 1XBXA 3MWAA 1NQ6A 2HEJA 3ZVHA 1F7BA 4J27A 3VILA 3S9IA 1H7XA 2VWSA 6ENLA 3KBWA 4AY1A 2E4TA 1SU5A 4Q22A 3NR0A 1RJPA 5DANA 2J7GA 3Q4DA 3HGRA 1ZFJA 2OKOA 4B5XA 1BVNP 2HQAA 2B7PA 3QXBA 2PTZA 5A2BA 3PB0A 3QV9A 1GQIA 2Y63A 1A5BA 4HGXA 1I4NA 3KM8A 3LI1A 3WX7A 2J8FA 3T09A 1OGBA 2QNEA 2WJDA 1DE6A 4O0QA 2QDEA 4EVZA 1ZL1A 3LB0A 3VZYA 3MBFA 3GSMA 4AC7C 1US3A 1LQ2A 4WXZA 1N82A 4UTWA 4UOJA 4PMOA 2XIQA 1JL8A 3C86A 2C0AA 3FX4A 2QW5A 3RM8A 3E0VA 1W9PA 3SW6A 3KBVA 3K4WA 4DZIA 4NILA 1ESWA 1W37A 3LCFA 5DELA 3I6RA 4Q4PA 3B8WA 4Q4SA 1LP6A 3W38A 2FZ8A 4FSAA 1YMYA 2ACRA 4REQA 2DZPA 1PKMA 4B5SA 2BGSA 3UWZA 3N2MA 4LTSA 5LGZA 4YTQA 2YBUA 3CQ0A 3TSDA 2DPEA 3PWIA 1C9DA 1A4LA 2R91A 4IIHA 1SFSA 3W7HA 1TTPA 3IJQA 3CIXA 4O15A 2OG9A 5BRBA 3SADA 4YVVA 1NARA 3TUUA 1DBTA 1GOOA 1TE1A 3IIZA 4HU8A 1B1YA 5EY5A 2VWTA 4M8UA 4FF7A 4H01A 1HJWA 3QKEA 2H3BA 4UB9A 1XYMA 2PCEA 1XLJA 2VFHA 1O1HA 2GGEA 4YTSA 3SUUA 1KLYA 2NXIA 4MJZA 4US5D 4HPXA 3GHSA 2AAMA 3FHQA 4HTBA 4AYGA 2PBGA 4WOQA 4HNOA 5E0FA 1CXFA 1GZ1A 4AH7A 4IX2A 3W86A 2FPTA 2ZICA 4AZHA 3N9RA 1VD6A 2C14A 2KAUC 4YHGA 1JYWA 1WKDA 1TVLA 4OBRA 2Y1HA 4U3CA 4ZR8A 3POHA 1V6YA 1OFOA 1XGZA 2PTXA 1IR1A 3H6OA 2CNCA 4IGSA 3V18A 1YE4A 1DVJA 1ZJHA 1KFKA 1XLEA 3TYUA 3W22A 1F4AA 3P0WA 1Y65A 2WMKA 3W7EA 4ERAA 2QS8A 3P5ZA 3A4XA 2RGMA 3G0XA 3CT2A 1JNEA 1XBVA 4BI7A 5T9BG 4Z17A 1JFHA 1JCXA 4C6IA 4TV5A 2ZWZA 3QV8A 4UR8A 3RIKA 3K1GA 3R0UA 3QM3A 1JZ3A 4GIRA 1AZ1A 2VFIA 2ZUVA 1FOBA 4PUEA 3LPFA 3W1UA 4UMCA 1V6XA 4QLLA 3HN3A 3WQPA 1ZCOA 1E1FA 4Q33A 3EWYA 5M2FX 3QR1A 1P6WA 2O0TA 3WDPP 2E6FA 4S3EA 2ZZ5A 4UZUA 3SY1A 2OCZA 1X97A 2QUVA 1EOMA 1ZJBA 3QV7A 3E12A 4KF1A 2DUZA 3ZXWA 1E9ZB 3LGDA 3W87A 1EF3A 3AHXA 4B16A 1ZNNA 5DBTA 1ECEA 1I0BA 2FFCA 3NL6A 4QLJA 5A8PA 1QU4A 5D4YA 4DF1A 5I3JA 1QBAA 1BRLB 3TQPA 2G3FA 2BTMA 4FMVA 1K4GA 2D22A 5JUVA 3S1WA 5HK4A 3L0NA 4R9OA 1O5QA 1TPB1 2WSPA 1AW2A 2DT0A 1HKMA 2HVNA 1CPUA 1XLHA 2HS6A 2VUYA 3VGFA 1XKJA 2P0OA 4H3DA 2FMOA 2X0SA 2D23A 1I8JA 3O1NA 3LLFA 3ARRA 3N12A 3A24A 2XWEA 3WJWA 3RN6A 4M6UA 2C7FA 2QF8A 1NOFA 3OVPA 4N9DA 3WEOA 3ZJKA 1OINA 1P0DA 4MJMA 2DIKA 2WZMA 4B5WA 4RL3A 2NV2A 4JTGA 4WKFA 5AZ0A 3WQDA 3VKAA 1OX5A 1TUFA 3LXBA 3LM7A 1SPQA 3MA8A 1TZZA 2DIJA 5AYXA 1QXLA 4FEZA 3WF0A 2F84A 3OVQA 1GZJA 1Z41A 3KTSA 4JKLA 2B7QA 2VP8A 3TSBA 3UY8A 1K8YA 1EDGA 4B4FA 3MU7A 4AF0B 4XAFA 1JVNA 2P50A 5A6BD 2HWGA 2C6QA 3TOYA 4PL2A 1TZ7A 3U5YA 2CLPA 3DKLA 2HCVA 1FQ0A 2XG9A 5U7SA 2WMFA 5HPOA 3HA1A 4JFVA 4NAEB 4ZO7A 2E8YA 2ZC8A 4HHHA 4M19A 3UZWA 1S2VA 1VC4A 1EC9A 1HZYA 1SYTA 4AD5A 3NTYA 3AMKA 3AIWA 4EK7A 3ALGA 4GZ7A 2PF0A 4X60A 3FY1A 2XN0A 4IJBA 4WVXA 2UY3A 3N29A 4IPNB 2Z00A 1M68A 5TNVA 5BXTA 3CEPA 1Z7AA 3FHAA 4YVPA 3QRHA 3R1ZA 3VDAA 1QNOA 1VBUA 3STGA 1FX6A 4R53A 3E2RA 3N2OA 3CEUA 3W81A 1XGDA 3B9AA 3FW6A 1PKNA 3EKGA 3WQ6A 4R3UA 2ZUTA 3T05A 3E0LA 4CD6A 4GACA 3TXVA 3ARPA 4JTQA 3WG6A 1YYAA 1ZSXA 3TTEA 1XKYA 3STCA 2PDGA 4BFAA 5EBUA 3M5YA 1W2VA 4V15A 1S5VA 3ZSSA 2QHAA 1JDDA 1LTDA 3G1AA 4DZ5A 1OABA 5I78A 4U2ZA 3CZ8A 3ARTA 3WF3A 4AW7A 2OOFA 4IJCA 3UF9A 3ANUA 1AJZA 3RCNA 1VPYA 3BTNA 2AGKA 3N17A 1S2TA 5D37A 4N42A 1GVEA 1HGWA 1JUEA 1IEQA 4D1IA 1A47A 2IKHA 2F8QA 2CERA 3XINA 3ZQ9A 3N6JA 1WZLA 1IEVA 2QVNA 4GVFA 4R5EA 1DKWA 1F2JA 5FESA 2J7EA 1V03A 2J79A 1E55A 2J4GA 1ALDA 3N9SA 1K7EA 4IL0A 5AYYA 5L6UA 4BQ2A 4GH3A 4H7VA 1WBHA 2J24A 4JEQA 1OFQA 4NZFA 3NZRA 4C5YA 1X6UA 1C8QA 5D9NA 2GVJA 1TX2A 2A6NA 2PGFA 2DGAA 3R12A 3EOLA 1JRCA 3AIBA 4FNPA 1DEDA 4XISA 1J0YA 2VNCA 4HKPA 1QW7A 4L65A 1VFHA 4DJEC 3T2OA 2FHCA 2WJFA 4DWDA 1FP9A 1I2NA 5CAKA 2VD9A 4J2MA 4Q4MA 1OVDA 3CQJA 3B9DA 1SO6A 4B3LA 3D46A 5CG7A 1DYSA 2J77A 1DIDA 4WEVX 4GD0A 1ISVA 2V3FA 4FX8A 2WLYA 3LZ3A 2INEA 4J3VA 1F76A 1QK2A 1YQ2A 4HHLA 2VQUA 5I7GA 1DJWA 2YZ5A 3EWXA 1E0VA 4ATWA 3RMEA 4AEOA 2Y62A 1OD0A 1GW1A 3LGGA 5CPNA 1R3YA 3CH9A 4O1CA 1YE6A 3HG5A 5I77A 1M5WA 2WANA 3WBWA 1CTNA 3AZRA 3P0XA 4X0NA 4AMCA 3LK6A 3PZ9A 3WNKA 3OVRA 1KRAC 4QCEA 3QVQA 2FTPA 3TYZA 4L56A 4RNIA 3W9ZA 3GTHA 3UPBA 4B5TA 2DEPA 3QLLA 1XHGA 2TMDA 3Q2DA 2J25A 1XD1A 4LY8A 1CBGA 1X1NA 4DELA 4Q7IA 3ITVA 1UR9A 3ZZ1A 2IKIA 2Z2UA 3QEZA 4HNVA 1K1DA 5DT5A 8CGTA 3COTA 4HMDA 5CPLA 5I23A 2O9PA 2TSYA 2P76A 1IWBA 5AC8A 1TA3B 3W3OA 3DBPA 2D20A 5HMSA 3OGVA 2OO6A 1IT8A 2DZTA 5CJMA 1Z3NA 3BAWA 1AL7A 3M16A 1ZY9A 3H4XA 3OU8A 2OGYA 3WFAA 3KVJA 5TQLA 1JQXA 2TPSA 1NWRA 5FSDC 3P74A 2F6KA 1KGUA 4QSFA 4DUXA 4Z42C 4Q8VA 2QEZA 1H7OA 2E67A 1H51A 4Q4KA 3TMLA 4JAWA 3TFCA 3E96A 4EXQA 1F8IA 1H62A 2EKGA 4AU0A 2D0FA 3UJRA 1SZEA 3TWBA 5FJIA 4YPJA 4UCFA 3FN9A 4QS5A 4JY9A 4K36A 2E5BA 1X38A 2QJGA 4IPJA 2HMCA 3NQAA 2X42A 1MEIA 5E0CA 1TIWA 4UFIA 5IRPA 2FFIA 2YA2A 2ZX9A 1VZWA 2VZUA 5D04C 1QOPA 2XGBA 4GBUA 3FCPA 4C60A 1TYGA 4Z1BA 2NQ5A 1RK6A 4JQAA 1VF8A 3AS2A 4YVXA 4DX3A 1TRIA 1JR1A 2VXNA 5C5YA 5BYWA 4IFRA 4RXFA 1KV8A 1T96A 4MG4A 5BXRA 1S5WA 3M0YA 4ZOAA 4Y7EA 2FGZA 1MXGA 3NO5A 5D9PA 2NT0A 3OGSA 3VYLA 4Y8EA 5BOEA 5HUOA 2D3NA 2V2HA 3G2GA 2QPXA 2YZRA 2ZUWA 3O6DA 1EJTC 3MHFA 4XKYB 3BLKA 4PTXA 3UG3A 3W7RA 4QJ1A 4U33A 5MKGA 3E74A 2VKZG 3W7IA 4GUJA 1FH8A 1WP6A 3WL1A 4AZGA 1UWSA 1Y5VA 3C56A 4PCTA 3KBSA 1HKIA 2OU4A 4PRRA 3ID7A 5I03A 2Z2AA 3IIOA 5D03A 1CGYA 1A3WA 4H4IA 3PFRA 2X05A 1KLZA 1R8LA 1NTHA 1UPMB 1FY6A 4IF2A 3H7RA 3LHTA 3MUAA 4FXJA 2W66A 1GZGA 3MZ2A 1QHPA 4ZQCA 3ZLGA 2HS8A 3WQCA 1X96A 2E77A 4ES4A 2ZRZA 1XX1A 4JTUA 1PHQA 3BJFA 2OYKA 3V0UA 3CHDA 2Z1XA 3LBMA 2ISVA 2DW7A 2BY2A 1E70M 3WMBA 5BOOA 4K2SA 3I6EA 1A4MA 3OQEA 2HTMA 4QCFA 4IIDA 1JPMA 3BQ5A 3ES7A 1WUEA 3KFTA 4L9XA 5T91A 4DQWA 3NWRA 2PZ0A 2VQTA 5AHEA 4NSBA 6PTDA 3WNOA 3IARA 4HMEA 5CC7A 2GL5A 4KETA 3HGSA 3MJMA 2WCSA 1ICQA 3QSRA 2BY3A 1POJA 3S5SA 4WSJA 3CZGA 2CZVA 3AXIA 4IUOA 1W3LA 4MMWA 4XZMX 3ARUA 4C6KA 3BAYA 1T5AA 4PODA 3VE9A 3BMWA 2Q3RA 2AL2B 4XAGA 3CL8A 3B8UA 4AMAA 1GJUA 4HZ6A 3G1DA 3HG4A 4ZGYA 5GNXA 4ZOBA 3N13A 3WCZA 3QPEA 3KXQA 4K7YA 3OP2A 1ZAHA 3ONBA 2JQXA 3ZJ8A 4LUTA 2J7BA 3AZSA 4HYRA 2GDQA 4V1YA 4X0VA 2GVLA 2ADAA 1AA1B 3AWNA 2GGIA 2FDMA 1BTCA 5E6YA 3ZLFA 1PZ3A 3SY8A 3FGCA 5E93A 1UG6A 2C1HA 2G95A 1R9ZA 5FEXA 4A3HA 1XLBA 2G37A 3VKJA 3A64A 3GW0A 2QDGA 4YJ5A 3OIHA 5E9AA 3ZMRA 2C0HA 1G4EA 3SECA 3WIJA 1S2CA 3KX6A 3MCOA 3WBXA 1PVNA 2E25A 3SSJA 3S5ZA 1SJAA 2DDXA 3ITCA 4O10A 4DUWA 1G4TA 1QW9A 4ZQMA 3L4ZA 3G3DA 2NSXA 1JUBA 4UOZA 1VIWA 2EG6A 3BAJA 4IL2A 1B90A 4NZJA 3VZXA 4HPJA 2A3HA 2VFFA 3LY0A 3FYPA 1JG9A 3TA9A 1ISYA 1QTWA 1CECA 4BI5A 1CEOA 2NVDA 4H8VA 3RPTA 4ACZB 1K02A 3T08A 4W86A 4HPNA 2WC7A 4C1LA 1XUUA 2VOTA 4QE1A 4UTMA 4O11A 3EEGA 4JIHA 4P7QA 1NELA 1JD7A 3T9PA 4LGXA 4GLEA 1M01A 4O4VA 1NAL1 1RAKA 4H9YA 3TC6A 3VIHA 5G1YA 3ANVA 1A50A 1XIJA 2BGQA 3TAKA 1U5HA 2QDHA 2WZIA 4OE7A 5G2WA 1Q13A 4DM1A 2J13A 4JX5A 1W9VA 1R46A 1UQYA 3OO2A 2CXEA 1J9YA 4NASA 4JFWA 1PKLA 3WJXA 5J5RA 1REQA 2QZRA 3E6EA 3GBDA 4AYSA 3LXAA 2CBUA 3ZWSA 3GXFA 3WLTA 2XFYA 3QY6A 3P84A 4S3BA 5CPTA 3QV6A 2YXGA 4P7RA 2DQWA 2VEFA 3H26A 2CPUA 3C3NA 1YHTA 1XF0A 3KL0A 1OT2A 4OKDA 1VFOA 3KRZA 2OXNA 1KFEA 4EF8A 2CWXA 3ZWTA 2V5BA 5G4EA 3RJYA 3UFYA 1XRSA 3FAXA 1QCWA 3H53A 4N4QA 3A4JA 4L6DA 3T42A 5HAOA 3C52A 4GG9A 4HPHA 1EO7A 9XIMA 1FBAA 2BG5A 4QDPA 4JX4A 5HULA 3NZ1A 2P10A 3UCQA 3SR7A 2E9LA 3P67A 2Z1WA 3OBKA 1ZJAA 3GH4A 3CV7A 4TX8A 4FNTA 3M07A 3FA5A 5J5DA 1A0CA 2FHFA 4RXGA 2VM8A 1MZRA 3CC1A 4MF4A 1BLIA 1TO3A 4HA1A 2QUMA 4PFMA 2Y8UA 3PZIA 3ZFHA 5CJNA 4MNJA 3UNTA 2DSUA 2EG8A 3SQLA 4ZL1A 2ZOXA 3BAXA 4DWSB 3VNZA 2WBKA 1VCGA 1J8VA 7ENLA 3CZEA 4QS6A 1MNZA 1F3WA 4GPNA 2O7QA 3UXDA 3ARWA 3PZOA 4TV6A 3UEQA 4E0CA 3M1ZA 1B2YA 3HPSA 4FXSA 4LUSB 4CU8A 1JXKA 2ZQ0A 1WBJA 3ENLA 4W4QA 3CUGA 3R0DA 3VD5A 2OO0A 4LVGA 3W26A 3LSCA 5AC6A 1BPLB 3FJNA 1C91A 5FJUA 3DEQA 4PZVA 1E71M 5H1WA 1VFTA 1Q4NX 1MUWA 2NV1A 2QKFA 4AEFA 3BOFA 3G77A 4Q7BA 4M1BA 3LHWA 5LNSA 4IQLA 1PZ0A 1UZDA 3H2OA 4DJDD 1H61A 2Z6JA 4Z0JA 4BEQA 2GUYA 2H90A 4GVGA 5EFDA 2D73A 2EO7A 4ZZ9A 2HE8A 4NNAA 1PCKA 1AQHA 1UZ1A 3B06A 2ZCGA 4PEKA 2WCAA 3UCCA 3N18A 3CQKA 4LC6A 2I1OA 3QBUA 1I2QA 1KFJA 4V1XA 4D72A 5FCZA 1XG4A 3QZ6A 1TB3A 3GW3A 5EMKA 3K2GA 3V5OA 1OD8A 4F9DA 1YADA 2YFNA 3USZA 3PZUA 2G97A 2XVNA 2AL1A 2POZA 4CCDA 5HBFA 3RU6A 4TMCA 4WOZA 1HO4A 2XH4A 2BVTA 1VR6A 3LXCA 1V02E 2ZUSA 1EJRC 1ZCCA 3DKJA 3AS1A 4XG1A 1SR0A 1RSCA 2DSZA 3W72A 4ORMA 4OFCA 2L5HA 3FJLA 4DZHA 4AY7A 5I07A 3ABZA 3C5QA 3MO7A 3GQYA 4GI9A 3LZ5A 3OYXA 3O3RA 5AHIA 2DH3A 1FHDA 1KXTA 2FJUB 1KKOA 2J7CA 5RUBA 2LLEA 2PRMA 2WOQA 3W7KA 3TW9A 5C8BB 3UP8A 3OYZA 4ROPA 4C1NB 2Q8LA 1G4PA 5I3FA 4LU0A 3WQOA 5LIYX 3TQ0A 1TPH1 2V6AA 2FYMA 2JALA 3GKAA 2QCEA 1IZKA 4JTFA 3MP4A 1WDWA 3GXPA 2PP0A 4BZYA 1J12A 4ZBCA 3RM4A 2NQ9A 4IMFA 3GAKA 1OF8A 3U2ZA 3WUGA 3FEMA 2OYLA 1FDYA 3GC2A 4FX6M 1JPKA 2WMIA 4G9PA 4LVBA 2XH0A 5TD4A 3O8AA 4AWUA 4MLRA 1DXEA 3VD4A 3KRUA 2IMRA 1D3GA 1A53A 4PGLA 3BARA 4MJ2A 4LS2A 5EYWA 1U1UA 4IICA 1V8EA 3VDHA 4BR1A 1G7VA 5EGRA 3UPWA 2YXXA 4DAFA 2JEPA 1NWTA 3FXYA 2OZ8A 4C1KA 3Q94A 3NL3A 3TQKA 1M3UA 2X1TA 3W6YA 4H83A 1QK0A 3HURA 3F5LA 5D2VA 3F4WA 3SCRA 2FGLA 3W82A 1CXLA 3MB9A 3S2CA 5EU9A 4M6PA 4J4KA 3VDBA 3MANA 3RLHA 5FF0A 3UJFA 1WKEA 5IFTA 4JTJA 1AH0A 1NOUA 2CLOA 1OM0A 2J6VA 2EPMX 3L4XA 3TN3A 1DTNA 3NQFA 1LLWA 1Q6OA 4ZXOA 1DJGA 1CGXA 3U7VA 3B4UA 3QZEA 2D2OA 4PB5A 3BUVA 3O2LA 1IZCA 1AMYA 2OQHA 3GXTA 4B5VA 3TYCA 1J0HA 3KL5A 1GEQA 2HK0A 4AY8A 4GUFA 3WSUA 4PMYA 4AWSA 3UJEA 1R2SA 4A3RA 4GNJA 2RDWA 1U5VA 3P8IA 3DG6A 3PM6A 3N6HA 3W24A 3GNDA 2ZE0A 5HJXA 1P0EA 3H2EA 1I1WA 5KZEA 1UIPA 1ZQ5A 1BWVA 1VIZA 3IVUA 1GT8A 1FDJA 1B57A 1FWCC 5AVNA 8A3HA 1AQ0A 2ATSA 2CKRA 1P7TA 2P88A 3VO0A 3O0FA 2QT3A 4GI6A 3GAYA 4FF5A 1Q2RA 4ZVJA 1M53A 5D8WA 4DLMA 1AVAA 2X7WA 2J7HA 4DF0A 2XSAA 1F6YA 4AAJA 4H8UA 4ZB0A 1OFDA 3LMZA 2VI0A 3KVMA 2V0TA 1IEWA 4DJEA 2BXZA 4I3GA 2VFEA 3DFSA 3R58A 2YCLB 3TV8A 3SJ3A 3G0UA 2ZTJA 1UH3A 1FWNA 4RCXA 4IPLA 1TTQA 3AAMA 2DT1A 1DJZA 1MWOA 4L9ZA 3QHMA 3BZGA 3W1MA 1ICPA 6XIMA 1VP5A 4OECA 5G4HC 3MMTA 1UOZA 4IMEA 3PR2A 4WX2A 1KTBA 3VGGA 1UKOA 1LM1A 4KWWA 1XW8A 1UQZA 1CI1A 3JS3A 1TJ0A 3WUFA 1F4HA 1NP2A 3N3MA 1V6VA 3LSBA 4YYFA 4CNUA 2OMAA 4DBDA 1QO5A 4H2CA 3C61A 1YW1A 1FKWA 3CZJA 5FI8A 3DFQA 4W8BA 3SCVA 4CNNA 4WGXA 1J01A 2QV4A 1E6SM 2REQA 1F6PA 4Z2KA 5DMNA 5C54A 3W84A 3V1PA 5CXPA 3DERA 4UWMA 4CEXC 3N2BA 4AX6A 5A8OA 1UA3A 3APYA 5E09A 1EGZA 3GDLA 3F2BA 4W7UA 1RPXA 1GVFA 3LBOA 1W3TA 3FFSA 3NFUA 4C6MA 3KLLA 4BS0A 2BASA 4C6DA 1EZWA 4N02A 1E51A 5CC6A 4K8EA 1E4NA 1SQ7A 1XD0A 4E2VA 1KWGA 4M51A 3EAUA 3DC8A 4BQ5A 2ZXBA 1GOQA 4F48A 1QVBA 1KBLA 4LNYA 3MYOA 3SURA 2R6OA 4POCA 5CSSA 4KRTA 5IHRA 3LCIA 2ZRWA 2WK2A 1NWSA 3TW7A 4UQCA 3ZR5A 1HUVA 4DWSD 4NF7A 1WV2A 1DQWA 4Q8NA 2VZOA 3ITOA 4OBTA 2OEMA 5D2YA 4E38A 3OW1A 3DH7A 3VINA 3QYSA 4V27A 4CQCA 4U28A 8TIMA 4RPPA 2CKSA 2YB4A 2PDLA 3K8KA 3A3XA 3KRBA 1IGWA 4EIVA 4ACYA 4CN6A 3W7NA 5D05A 4PTDA 3B97A 4US5A 3S83A 1P4CA 3QOMA 3SN1A 3FA4A 5JMUA 1YX1A 1W3IA 2WSKA 5CSUA 2ZTKA 4JOMA 2ZZ7A 3TTOA 1DHPA 2Q71A 1FWHC 4JICA 4MNLA 4E8DA 4XAYA 3TIMA 5CPOA 3GBEA 4QIUA 3T1GA 2FH6A 5HINA 4GNVA 3VUPA 3APTA 4UQBA 1E9YB 4KGLA 5CZKA 1O7AA 3V36A 4HNLA 3W88A 4DY1A 4AIBA 2EPLX 3RO8A 4Y6GA 3F03K 2ZUNA 3DFYA 3S3GA 3CTLA 3W01A 3WNLA 3UD6A 4KMQA 1JCJA 2AQOA 4EXBA 2O7SA 4GZIA 1SSDA 5CG0A 3N15A 3ZR4A 2PDHA 3WLRA 2CZ5A 3WDHA 5M3WA 2W61A 3CUIA 3WF2A 1XS2A 1W1ZA 1ME9A 3ZS4A 2QGYA 2R1PA 3GDMA 4HZ8A 3RMJA 1OWQA 2QUTA 5C9RA 3SM0A 1CB2A 1MQQA 3LG3A 3LRKA 1U30A 5CZSA 3KOFA 4AVOA 2VD8A 5REQA 3WYZA 6TAAA 4YCPA 1BGAA 4GQ0A 1JZ4A 1X98A 1GQJA 2OZTA 3SUVA 5C2XA 3CHVA 1TPDA 4C7FA 4FIRA 4H7ZA 4MZ1A 2OSYA 4BF5A 3NDZA 2XZ9A 3LU2A 3QKZA 5HWMA 2J9ZA 3WD2A 4EF9A 1F3XA 4Z2HA 1E56A 2CCRA 1Q3NA 2CBJA 4XVEA 4YL2A 1BFNA 1R9XA 1J0ZA 3VCRA 4Z1YA 5BNKA 4LYQA 3FYYA 3KE0A 3GVVA 4R7OA 2WQDA 4Z2LA 2ASHA 4O50A 3T4WA 1LL7A 4ICCX 2UY5A 4E3VA 3GIPA 4LX4A 4UIOA 4C65A 2QUNA 3BW4A 4H04A 4GI8A 3T8LA 3ZYZA 3FVDA 4JTIA 3UWQA 1H7NA 4Q6XA 3GZAA 2FIQA 2WJZA 4K38A 2QJNA 3QMSA 4X22A 2IKGA 1NDWA 2Z1BA 1VYSX 2A4AA 1HL8A 1KA9F 4HZ7A 3JR2A 4GI4A 3TNBA 1I75A 4Y9NA 1E6RA 1JCTA 5AHNA 3ELFA 4KIEA 1T41A 4HIBA 1MZHA 1LT7A 1Q6RA 2Z2BA 2DIEA 3VNJA 3O16A 1LL6A 5LHEA 2XUCA 3RITA 1NFPA 4K1GA 4L64A 2XZ7A 3H55A 5I3DA 4DYKA 3VIMA 4QROA 4MUZA 3W7JA 1V6UA 5BCAA 3XIMA 2Y85A 3M5ZA 1YBQA 4LANA 1Q7ZA 1Q63A 1X8CA 1YRRA 3M46A 2YR1A 1R9YA 3SEPA 3VM5A 4BA0A 5I24A 3AIEA 4O14A 4HPGA 4ORIA 2E6DA 2DUXA 3CS2A 5HMEA 3THUA 1R7AA 2QF7A 1DWAM 5TIMA 5A6BA 5BU9A 4DM2A 2O9RA 4A6GA 4A2RA 4HOXA 1TVPA 1T8QA 4J3XA 4PUDA 3NIYA 4HA3A 2ON3A 3PBGA 3GTIA 1N55A 2GVGA 1GOIA 5C9WA 1V7AA 3C2VA 1H09A 1YXYA 4WK9A 1WOAA 4HP5A 2RH9A 1B9BA 2PBOA 2WZEA 1OFEA 1DWFM 2GSEA 4HMCA 2W4XA 3N9KA 1Z8AA 2FQIA 2PURA 2BY0A 3REQA 4WCJA 4M6QA 3PC0A 1QW8A 1J4EA 4JIEA 3WH7A 1B4EA 1UWIA 1S1PA 2ZYFA 4L7ZA 4NI8A 3KBNA 1LF1A 3BWWA 4EXAA 4LT9A 4O19A 1ONWA 5JXQA 1K6WA 3NPUA 3QGVA 1JZ6A 4C6FA 2NX1A 4DBSA 3VX0A 2CU0A 4XBSA 4NVTA 4ZTYA 3G8EA 1E6PA 4QE5A 1VBRA 3NZPA 3AALA 2WMJA 4TMBA 5I2UA 3D47A 1ZAJA 1GOKA 4JBRA 2Y8KA 4N4PA 2ZADA 5CAHA 2GJPA 1YLVA 1RALA 4L1XA 1KM0A 4QX4A 3WN6A 1KBBA 1QNSA 4Q8WA 2ZZ1A 1AH4A 1V3MA 2HK1A 1XLKA 3CAQA 3LTPA 2NX9A 4J5NA 5A8GA 3M0VA 3H2NA 4PR4A 2IXUA 5AHFA 1JIBA 4JTDA 4S23A 4KH2A 4KESA 1KM3A 3TNOA 2WVTA 4Q8MA 4AZ5A 2J6XA 3IJ8A 4ZFCA 5LIWX 3A22A 5HQMA 4HVXA 4PUMA 1ZZMA 3U57A 3OHMB 4PYSA 3GNXA 3CUHA 3GZ3A 5AZ1A 3BG3A 1W1PA 4GC4A 2YA1A 2ZXQA 3NQBA 4P8WA 1CLVA 1W5MA 2ZXAA 3TYEA 4WDWA 4LF1A 1FVPA 3PN8A 2B0MA 1ITQA 4UOQA 4I8YA 2CESA 1CLKA 3T4CA 4U5IA 3THAA 3LTSA 1C29A 1B3VA 3CTTA 4QHRA 3WLIA 1JDFA 1XQLA 3BJTA 3PJTA 2X0HA 1BTMA 2DH2A 4XD5A 5DT7A 1NOWA 4ZFMA 2P1FA 2CXGA 2JKAA 3BQ6A 3MUIA 2FJKA 2Y88A 1XIMA 3H4WA 4GFSA 4MZ8A 2IQ0A 1FH7A 1EXBA 4UTKA 3EX4A 2NX3A 2C8NA 2JFEX 3KWSA 2J7FA 4WY0F 3BG5A 2EF9A 2WWDA 4B3KA 4X9YA 2R9RA 3P14A 3LI0A 3T7VA 3HFTA 3T40A 3NGFA 1S3HA 4JTEA 3MY9A 1F3TA 4P2VA 3ARYA 2A3AA 4LBRA 1EYEA 4E5TA 4FOKA 1TR9A 1GVOA 2NLIA 2WB5A 4J3SA 4TVDA 3CMGA 2IS7A 2Y61A 2I5IA 4UFMA 2QCDB 3MVIA 4Q8OA 5A3HA 2E1WA 2DT3A 1HKJA 2JBMA 3VNIA 5FF4A 3I10A 3KAOA 2OGJA 3E02A 1VCVA 3NJ3A 2RDXA 1AJ2A 4EAMA 3W29A 2W3ZA 2H3DA 5KINA 4FR6A 4J3WA 5A1AA 3H2FA 1IE7C 4GYFA 4RNHA 2GZXA 3AS3A 1PZ1A 1S3TC 4NT0A 3HMCA 2EPHA 3H22A 2PODA 4L4LA 2ISDA 1QPOA 4LUIA 5BWAA 3F4NA 4KFOA 5AKQA 1XICA 1US2A 1YPFA 1WKYA 3HJZA 4MHBA 3C6CA 3ERPA 3DIPA 1WXYA 5D32A 3VIPA 3Q58A 4EX4A 5F4SA 3EWWA 2OR2A 2PDIA 1E4IA 3I65A 3SN4A 2X8RA 3GXDA 2NXGA 2DORA 3UR8A 4YCOA 1DE5A 1FWRA 1EIBA 4MWAB 3QZAA 3V4BA 1R3QA 1TUXA 3LN3A 3AXHA 1OC7A 1W5PA 3B8DA 4OZOA 3FEQA 2NUYA 4PUWA 1VB9A 4CGTA 3VGBA 6TIMA 3W7CA 1QNPA 4E3TA 4LVAA 4DWSC 3CAVA 2CEQA 1JFXA 2CIPA 3N1AA 3DESA 3MO4A 5ABTA 2X2YA 2QCLA 4PMZA 5I06A 1H63A 3O15A 4KEVA 4M81A 3PUOA 1MW3A 1TJPA 3KOXA 1H49A 2BXVA 3B9NA 3HGJA 4PFHA 1JCNA 5BU6A 5DXXA 3M47A 4U5KA 4ZXLA 1J2BA 1ZLPA 3QYQA 2WKGA 3GYEA 1W91A 1H4PA 1NVMA 4QBXA 2PC8A 3EOSA 4X61A 3OZOA 4DI8A 2OZ0A 2V5DA 1FRBA 3VOGA 3F7JA 1KRCC 2WBGA 4RZ6A 1LLZA 3V3WA 2PGRA 1EGMA 3PZTA 1BRLA 4JD4A 3GG7A 3WLOA 4X9SA 2HNHA 2HPIA 4G2DA 1S38A 3RPDA 1THFD 3PB2A 2HBVA 4AWEA 1K9DA 1K70A 4F8XA 1MRAA 1F73A 5ABHA 1H1NA 1SFTA 1SMAA 2HRWA 1Q4WA 4LQ1A 4QITA 3UZZA 3LLDA 3NXFA 2W63A 2V38A 2YL8A 1SW3A 4GYKA 1XISA 1D8WA 1IYXA 3EOUA 4K6AA 3TU9A 2C1IA 4C6OA 3NCOA 3W23A 3WMSA 3WLHA 4RV8A 2DFAA 2CLIA 5E0KA 3R25A 2GJXB 2C15A 1H50A 1OCBA 3MP5A 1UR2A 4PSPA 2D69A 5KMYA 3S46A 1YDOA 3QPYA 2Z25A 4PB4A 1MVYA 1P0KA 3RR4A 3IJ7A 3GWQA 3L4UA 4HSNA 4JHOA 2NSOA 2Y6ZA 3DBNA 2PA6A 2VMFA 1W9BM 3W7GA 1Q5MA 2Y8VA 4LAMA 3B03A 1E1EA 3MPGA 3EX1A 1ZU8A 2BGNE 1B9ZA 1CX9A 4QR6A 1TREA 1JPDX 2VUNA 4AF0A 1CXEA 1U5JA 2W0UA 4WJXA 2GGGA 3BV7A 1R3RA 4I7UA 3UG4A 1V0LA 2I5QA 3EDDA 3VPLA 4JGDA 3GR8A 5FF7A 1CW2A 1JNDA 2E3ZA 4NAEA 4QNWA 3CQHA 3W1LA 3F4DA 3RRXA 2H9AB 2NZLA 3WH8A 4YYCA 1X39A 1EX1A 2E6YA 4AIEA 2CLLA 2OQLA 4R33A 1C90A 3A47A 4UTLA 3G6LA 4KPLA 1K8XA 1LWIA 3OA5A 4XV0A 3ABRA 4XKMA 1TMLA 3AIRA 1GOWA 2JIWA 1PO9A 1K9EA 4O4WA 2GSJA 1U1HA 4F0HA 1JRBA 5FL0A 1C8XA 3PTKA 4JFUA 2VC9A 4O52A 3OBAA 1QMLA 4PSRA 4LEQA 4DIAA 1QOXA 3M0LA 4XQ6A 4DBEA 4LAZA 5A6KA 5ABFB 1BF6A 4LH8A 4LAUA 4ZO8A 1XLGA 5CGQA 3W37A 1VYRA 2XIMA 4W8AA 1SVDA 2ISSA 3QR3A 2QV5A 4CLMA 2WYSA 3P8JA 3OEXA 3MWCA 3W75A 1JAKA 3KS5A 4MDPA 4MM1A 2PEVA 1EF2A 2PAJA 1YTDA 4XBJA 4A8NA 3W70A 2UWFA 1UROA 4DUOA 3L12A 1XSJA 3TA6A 4GH1A 4GBDA 2HBXA 2Z7KA 1UUQA 1YPIA 2Z1VA 4XZIA 1O66A 2V3GA 4HU3A 4RX0A 9XIAA 3SGGA 2JF6A 3L5MA 3PPHA 4JIRA 2WMHA 2FVKA 1XLMA 3P5YA 4AHPA 3S9ZA 3DN5A 1L6SA 1VLWA 1LJYA 1QI5A 5IBXC 3MHUA 4E2DA 1O1ZA 1IZJA 3BG9A 1RY8A 3S6OA 3T2PA 1OK4A 1VFFA 1PIGA 1KR0A 1FWWA 4FR1A 1QT1A 4R85A 3ISIX 4TUFA 4QISA 4HSOA 1HGYA 1MDRA 1KGXA 3ABQA 2WM0A 1A3XA 4B2DA 5FACA 1QJWA 3ZLHA 2ZDRA 1B3WA 3L2IA 4S3DA 2O9OA 3AMCA 1YXCA 3F1QA 5KTLA 4Q6JA 2HPMA 2YJQA 3TK7A 3FK4A 2D1ZA 4UFKA 1CT5A 2V2DA 3QMTA 3W1AA 3AIVA 3T0BA 4UQ9A 3GD6A 4CEUC 3W07A 1ZB5A 1K77A 2PDBA 1J2WA 3TFXA 1R3SA 2NQHA 2YA0A 3NQDA 4IQEA 1A3HA 4GGHA 2J47A 4I8DA 1XJBA 1PEZA 1GEHA 4P7OA 2JIEA 5HPCA 3W1XA 1KD0A 4V2XA 4W5ZA 1F3EA 4A8LA 3ATZA 5F2IA 1J6PA 4N9BA 5LNVA 1KGWA 1G94A 4ML4A 1CWYA 2V5LA 5C9ZA 3GDBA 1ZBVA 2AKZA 2YCKX 5H8MA 3NL2A 1JZ2A 4ZB5A 4Z2JA 1LT8A 4AB4A 3ARZA 4ZEPA 1JULA 1HVXA 3CZKA 1ZENA 1UHVA 1HKWA 4LAOA 1WQ5A 3LDVA 4IPIA 2D3LA 3GS6A 1VGAA 3INPA 4GKLA 1SJDA 4NX5A 4HTYA 5IM51 2ZE3A 2WAGA 4U31A 5HR7A 5A2CA 4QQ3A 4GMEA 4CQBA 3WQEA 3QQ1A 5EMMA 4K1WA 5DXYA 3M0JA 3VDGA 4G5DA 3BLDA 1NWUA 3S2MA 3VTRA 2QAPA 2QCMA 3MHGA 4OBSA 1UD5A 3SAZA 3MCNA 1FXQA 3TQVA 5G4WA 2QXWA 3CNYA 3CZLA 5LGXA 1J5SA 1JEZA 1AW5A 3TROA 2X1UA 3RX2A 1TA3A 4XZ9A 1M6JA 4KT2A 3K1DA 4LAKA 2GSHA 3SCQA 1GWJA 4FNQA 1S46A 1B4KA 5DRIA 4HHPA 5M03A 3HQNA 2GQ8A 4RE2A 4O17A 2GWGA 4GVIA 1O6IA 1S2AA 5CSYA 3S1GA 4Z0SA 1N2VA 4H8NA 3TCEA 2A85A 3A23A 2J9YA 2DUAA 3WMCA 2PWFA 3C2RA 2J7DA 2J78A 4NP7A 5IXEA 3L7RA 3NUKA 4GQGA 2WXDM 3N19B 1FUYA 4XD4A 3IV3A 5G2HA 2VTFA 4GHRA 2ABAA 3MMUA 5A6MA 1VH7A 1V3IA 4DXVA 3UWWA 3Q37A 1W5QA 4O57A 3LMYA 4S2BA 5D2TA 2PWUA 4IOTA 3VE7A 1Q7MA 2YSWA 3WJZA 4RE3A 1SW0A 3SIMA 3T6CA 4NQ1A 3ZO9A 3H7VA 1K7FA 1UOKA 1Q6LA 2G8ZA 4W84A 2OSWA 4C6LA 1KCLA 3P80A 1XLCA 1ONXA 1RR2A 5HNNA 2NUXA 1UR1A 4CNSA 2J66A 1EL3A 3KHDA 4PA8A 4MADA 5FJTA 1NQKA 4ZSUA 4DF2A 3RO6A 1UP3A 1GG1A 1A5CA 4HBKA 1GJPA 4RW3A 4XUGA 4K7VA 4L4PA 4DLFA 4R7JA 3G1FA 3AHYA 1ZBWA 1PYFA 1QPQA 4XKYA 1Q2SA 1KTNA 3N4AA 3TYDA 1RD6A 3TYAA 1JZ7A 3V7PA 3ECQA 2E9BA 1TWWA 2VDIA 3AWOA 3NDOA 3OBEA 4MFDA 1OFPA 3EB3A 2WC4A 4KQNA 3EPNA 3FXGA 1JI1A 2G4JA 3HPFA 3UW6A 1WO2A 3NQEA 1RBAA 3GFYA 5FEPA 3PY2A 3QLDA 4XZNX 1OX4B 3WUEA 1BVZA 3LERA 4HOWA 2WNZA 1Y5XA 3CB8A 4GQQA 3WH5A 5E9XA 3GDTA 4UFHA 3RK8A 2IUZA 4ZQNA 3WEMA 4FI4A 2OODA 4C6EA 3VD7A 2XHYA 4GO9A 3AO0A 4GJJA 3WNPA 3VMOA 1N8IA 2PI6A 4OU1A 3OQ8A 2EJAA 3R4IA 4CD8A 1JDEA 3L5AA 1JZ5A 4EWND 4JL2A 1RVGA 4W8LA 4NX0A 1UC5A 2ABBA 2FLIA 1TWSA 2EAWA 2Z0IA 4GXPA 3W7DA 2X16A 3CO8A 1TRDA 4S1FA 3MV11 3MSGA 4LVFA 2W9MA 3RJXA 1PHWA 5LXEA 1WDQA 1TQJA 4F40A 2ZZ3A 3S42A 1MNSA 1DWGM 4J28A 3EXTA 4YIWA 3U5UA 1S5NA 4INFA 4MYAA 2QAFA 1GGOA 2VFDA 3U48A 2R94A 3VNMA 3Q65A 1PBGA 3MUCA 3SCTA 3TXZA 5JH2A 2PU0A 2FGBA 4B9YA 2WVUA 2G5WA 1Q6CA 2WPBA 3WMLA 1PZ2A 1P43A 1UWAA 2WNNA 3H2AA 1GW9A 5JH1A 3C3UA 3L0GA 3ZT6A 1JCMP 2DW6A 2PZNA 2WVSA 1POKA 1TIMA 3PP7A 1KFLA 2ZX8A 3VCCA 2VRKA 3O05A 1TJRA 3LS9A 3MKKA 3CIWA 4DZAA 2AL2A 3KOYA 2ZRYA 4N7QA 4GISA 3KL3A 1TV4A 4C6BA 4PCSA 4NJKA 4HCHA 3S8HA 1D2KA 1FWDC 1N8WA 3D6NA 3UGRA 3W83A 2Z1SA 3DFPA 1D7KA 2YBVA 3BGAA 3KP1A 1RLCL 4W5UA 2CHRA 4IM4A 3UPMA 3CU2A 3W74A 3VD3A 4Z1CA 4G1KA 1BYAA 4MB4A 1Q6DA 3ALFA 1L2QA 4D6IA 1TX0A 4YMZA 3QOKA 2FTYA 1W1IE 1T6MA 4HJFA 3O6YX 1VJSA 1XYZA 3BCJA 3OGRA 4AZCB 3M0HA 3DYMA 3TJIA 4LNCA 4LPCA 2YXOA 4UBPC 3LNPA 4Y9PA 3MSDA 3SCOA 1CGTA 2VC5A 1V7YA 1ISZA 2UY4A 3CMJA 5AHMA 4AC1X 5CJ5A 1E4LA 2OT0A 4PCNA 2AQVA 1HVQA 1P0BA 5EPDA 3W1QA 3OA3A 3PNZA 3A9IA 4ACZA 2E5DA 3R43A 1JCLA 1NEYA 3L68A 5LA2A 3P7YA 5DCBA 3SFWA 2VEGA 4DAIA 1M1BA 5EKYA 4QDWA 1QNQA 2VZTA 2OTDA 3FSUA 1RVKA 2Z6IA 3WKZA 3NO3A 2J9XA 3LV5A 4F66A 5KETA 4IG2B 5CC5A 1I2PA 1PTAA 3FVMA 2FVMA 3G1SA 1D9EA 1IWAA 3VKDA 3GTXA 1W8SA 3U3HA 3BXWA 1EBGA 2WCGA 3F4CA 1GKQA 4MYXA 4IIFA 1EJXC 3PBMA 4NRRA 4J3TA 5IOBA 5AYIA 3IJLA 3T44A 4CVWA 1WA3A 1CGUA 1FWSA 2PWDA 3L66A 4C6QA 3LNMA 1KNWA 1KM6A 3DOPA 5A8QA 4ERIA 1B30A 3EGJA 1AD4A 1TR1A 5CLTA 3VKCA 1G67A 3LQGA 3NA8A 1EFZA 3S9YA 5F2GA 2XU2A 2WO5A 4DVOA 4P8XA 1UR4A 4WIWA 3NZGA 3TTYA 2C16A 2VEKA 4RW5A 4ONVA 3G1YA 2I9EA 1E6QM 4MPKA 1FH9A 2OZ3A 1ADSA 1PB0A 5A6LA 3PANA 4IP7A 3RDKA 3S1VA 4DUVA 3BJSA 3HQOA 3R6IA 5AOUA 5A6TC 1LWJA 3AXMA 3G5EA 4OUIA 2A79A 2UY2A 5JBFA 3K5XA 1K8CA 4JKMA 2YW4A 1YTKA 4F2BA 1S5TA 3W25A 2YCIX 4G7FA 1RP8A 2GJRA 4FPSA 2VURA 4JEJA 5HQLA 3CK5A 4W93A 1WXJA 3DI0A 1GK8A 3OB8A 1FCUA 1S2WA 3L67A 4BF7A 1LG2A 2XJ7A 1HQTA 2DU2A 5BROA 3LUTA 2Z1KA 1V6WA 1DHKA 1XC4A 4DWSA 3HIJA 3DFHA 1G0CA 1EPXA 2CC0A 4QEHA 2JE8A 1TV3A 1WUFA 3B8TA 1B54A 1EJUC 1KQYA 2PRHA 3TE9A 3GNNA 3RNDA 1C92A 2EPNA 2JF7A 1C93A 1RHCA 3VC6A 3ZR6A 3KDOA 4LUSA 4DYEA 3VNYA 2XISA 2O55A 3EPOA 3NYZA 3G1XA 4PN2A 3CWHA 1ONRA 3LBCA 1FWGC 3I3DA 2C18A 3UU0A 5LZLA 3PUGA 1RPKA 1OBAA 2NT1A 3GVWA 1EIXA 3L4VA 4HZMA 3ZT5A 1WDDA 3PZMA 3N2XA 1UUMA 3PJUA 5GNYA 1QOQA 4FB7A 2DT2A 2W5FA 3GNPA 4E8GA 3H21A 2NWSA 2VL4A 1E9LA 4J1OA 3I4KA 4XO6A 1KM2A 4FLRA 4F9JA 4WDTA 2PS2A 1XDLA 2CHNA 3OHIA 4O13A 3RLUA 1F9CA 1OEPA 5JIPA 5F2MA 1DTUA 3SZ8A 1E0TA 1E0UA 1V4YA 1EEXA 4PE8A 4U4MA 1EGVA 3UZ5A 2GOKA 2DVXA 3ABXA 5GQBA 1IHIA 4QJ5B 1AH3A 2IPWA 3PS7A 4J3UA 1PS9A 3A3HA 3IV8A 3M41A 3DXIA 4ASTA 3UR2A 4GRSA 5CGTA 3WK0A 1FHVA 1Z32X 3HM7A 4ADUA 1XCXA 7ODCA 1PV8A 1QNRA 3AYTA 3F5JA 4KS0A 3VOFA 1DJHA 3RYSA 1G6CA 1PCWA 4FLSA 4H6RA 2HVMA 1ZP3A 5GJPA 4MWAC 4FP1A 5ABEA 1L8PA 1UKQA 4QJ4B 5DFAA 5DCEA 1SO5A 1W9DM 2PLMA 4EWJA 4GUGA 4QJ3B 1UP2A 4NIRA 3HPAA 3GXMA 3L9CA 3CB3A 5C9XA 3W7LA 3B40A 2YPIA 3ZIZA 3CMFA 4NUWA 2O4QA 2I14A 2BHZA 1F6KA 1KM5A 4Y2WA 4YU1A 3VMPA 5A6SA 3WLKX 4NU7A 5F4XA 4FZIA 4P8VA 2E7FA 2BHUA 1PSCA 3P82A 3CO4A 3AYVA 1JPHA 4GIYA 2VGIA 2E1DA 4C1NA 3CT7A 1UKTA 4M6VA 4GYJA 1AJ0A 3HV9A 4Y8FA 1LBMA 1WZKA 3L4WA 1M7PA 5CKSA 3K30A 1GORA 5HR6A 5G5IA 3DZ1A 1KXHA 7CGTA 3EBVA 3LPGA 4HD5A 5HATA 3B3DA 2C13A 4GVHA 2OJPA 3NQMA 5K7JA 3QN3A 4Y9MA 4KCWA 4J2PA 4B3ZA 1J10A 3VUSA 3WD3A 1R2RA 1V79A 3QHNA 3BPWA 1W54A 4W88A 4O16A 2VC6A 2RGLA 5XIMA 1UZHA 1B3XA 1OJXA 2QUUA 4HNTA 2YCJA 2CETA 2DSVA 3KBMA 4MWAE 3UYCA 1SZRA 1ODZA 1TCMA 3S5NA 2JGYA 4J3ZA 3LD5A 5EFFA 2A0NA 2PRLA 4UNKA 3U7BA 1IF2A 4PUJA 3J7HA 3O6AA 1W1A1 1P6BA 4MY8A 3SQSA 4IFKB 3KOZA 2CW6A 1VYPX 2R8WA 3TWAA 2BLEA 3OLDA 5CPMA 4HNUA 5FD0A 5I0DA 1RJRA 4YS1A 3T55A 3IGSA 3ITXA 4L1GA 2HJPA 4A3QA 1FFQA 1IQ8A 1UZ4A 2VZSA 2WVVB 3T0TA 2G4FA 3WF4A 3NZQA 3BC9A 2GJLA 5IBXA 3R13A 1E1CB 2YW3A 1PDZA 3WNMA 4MKSA 5ENLA 4XAZA 3MT1A 1SJBA 4XD6A 4RZ4A 5FA5A 3W0KA 2ALDA 4GABA 1ZPTA 4WUIA 3RLVA 1F61A 1UMYA 2FZMA 1K4HA 2PCQA 3AICA 1HP5A 3BLLA 2VR2A 2ZX7A 4MB3A 3MCMA 1TWDA 2GQ9A 4L61A 4D2JA 1TPC1 2CZDA 1PIFA 3QW4B 4UR9A 2PDJA 1ZRQA 2DVTA 3W7MA 3OODA 3P81A 1PE1A 5DCDA 3TCSA 1SO4A 1L2UA 3PTDA 1TG7A 2A3EA 3CASA 4C7GA 1WX0A 2YCLA 3PULA 2VVSA 3H24A 2XM1A 3LLXA 3V5FA 2ZIDA 2A3BA 1HNYA 3G8RA 3IRDA 5LIUX 3RCYA 3DI1A 1KBJA 1WAWA 3MI3A 3SCPA 1QHZA 1IXOA 2QMJA 1TQXA 1BG9A 1RP9A 5LNRA 1F05A 3HQ1A 1W56A 5HJYA 5AHLA 2XVPA 3RXZA 1NFBA 1OQFA 2OYMA 3SDOA 1HP4A 4CCEA 2ZZ2A 3HO8A 1SZGA 2DZWA 4E2BA 2I16A 1LDCA 1MYRA 1TTIA 2ZKMX 4B92A 3SRFA 1SMDA 4GY1A 1VRXA 3EMZA 4NZ3A 3YPIA 2XTKA 1E3XA 3B9EA 4IQJA 1XLIA 1PAMA 4FA3A 3D3FA 2ISWA 2ZRXA 4NY2A 1KO0A 1EA0A 1TMHA 1FWJC 2WHKA 4RUBA 4IWWA 3D3AA 4WY0B 1V0KA 1OC6A 5FEWA 4DNMA 5EL1A 3IJIA 5A69A 2V8ZA 4BKNA 3R11A 3BSMA 1A5OC 3OPSA 4LSBA 1ZP4A 4D6HA 1DQXA 5KEZA 1WDPA 4MB1A 5JU6A 4MKNA 2YX0A 4DXXA 3EOOA 4WSKA 4TR9A 3LHZA 2PP3A 1YNPA 4IGMA 2I9UA 1TPWA 3K4AA 3W76A 2I5GA 3C4UA 3TLQA 3ITTA 3TW6A 1O95A 2D0GA 4UTTC 3LCWA 4TX6A 1HL2A 4WXYA 3AMLA 1VBGA 3PUEA 2WMGA 4UC5A 1UD3A 4QDMA 4HYWA 2WHLA 5D02A 3EZ4A 3AUJA 3C8NA 1NIUA 3ITYA 2X1SA 2QCGA 3OLIA 3N2CA 1LRTA 2F61A 2ZZ6A 4NZ1A 1E43A 1M7OA 1WE5A 2XVLA 2YLLA 2E28A 1XCWA 4EE9A 5C7VA 2NQJA 3WQWA 2PD9A 3HZ3A 3EDKA 1X1ZA 4PMXA 3OLGA 4X2RA 4PC8A 5FIPA 9CGTA 4NAFB 3E5PA 3QH2A 4GX8A 1S2UA 3SCNA 1R87A 1EQPA 2C3ZA 5HA7A 4ZQRA 3WENA 1GTHA 3NNTA 5CEWA 5DQPA 2F2HA 4Q8PA 4X2PA 1FWIC 1SUXA 1YDYA 4MY1A 3EDEA 3AIUA 5G1MA 4DHGA 1MI3A 1IXNA 1I2OA 1S39A 3STPA 3FYOA 2WLZA 5I09A 5M5DA 1GKRA 2HDJA 1Q66A 4H2HA 2V81A 3BLEA 5PTDA 4OUEA 3DFOA 3GUWA 1FWFC 1VFUA 3EWUA 3EX2A 5CPQA 3HU7A 4BK9A 4S3KA 1VLIA 1SR9A 2Z29A 4WKAA 3AMDA 4GCXA 3NPXA 3BV4A 8RUCA 3CAKA 1QR7A 4MNKA 1KCKA 1MXSA 3ABSA 3UA4A 2VEMA 2CITA 3HBLA 1V5XA 2JK2A 3CM4A 1UWQA 1LUCB 3A9BA 2VT0A 4PTMA 1NP0A 3LCLA 3PZQA 4O0ZA 2CLFA 4WKHA 2PU1A 3WQ8A 3GRIA 1T0OA 2PDWA 1AW1A 4F79A 2ESCA 4RE0A 5GNZA 4FLQA 4AHOA 3DGRA 5C0QA 4J35A 4O1AA 1LLOA 3PSWA 1DL3A 1XPYA 3DYPA 4HCDA 1UBPC 4FXRA 3DDMA 4JIIX 4H9XA 3SRHA 2RDTA 2XIOA 3KS6A 2A5HA 1QI0A 1UWUA 1ISWA 4BI6A 1X6LA 1PX8A 4F3HA 3UXLA 1Y5WA 4O28A 2VR4A 4MB5A 3BO9A 2BY1A 4NZ5A 4IQDA 5LXXA 4EPEC 5IDZA 1JZ8A 3T0DA 4ALDA 2QCHA 3CV2A 1KCXA 4JKKA 3A4WA 3F5KA 3MI2A 4NNBA 2BX7A 4H9VA 5DMLA 3C0SA 3HPXA 4OV9A 1LQAA 4ZENA 4EAYA 4RKAA 3VABA 1SZFA 3VU2A 1QWKA 1TWIA 4LY4A 5HNRA 3ZM8A 1UYQA 1VFLA 1UPPA 1XSIA 3U6WA 1GG0A 2NUWA 1OGGA 1OG0A 1Y0EA 3EMCA 3NPWA 1M41A 3S2NA 1L6FA 3S4TA 4CQDA 3TJ4A 3GY1A 4GYPC 2DZUA 1VCFA 1UH4A 3EWBX 2CLHA 4ZO9A 4B91A 1CDGA 1FCQA 3NVTA 3BVJA 3I68A 4FS9A 3HTWA 4AXNA 4NI3A 2Z27A 2VELA 4URIA 4IX0A 1XPGA 2XGZA 5EMLA 3GB6A 2CFFA 1KBKA 1RK5A 3VNLA 1QATA 2DQXA 5DLCA 3MDWA 4M5PA 4GO8A 1GNXA 4IHCA 4R7WA 3NQ6A 5C70A 4H6QA 2YOCA 4N9CA 1CCWB 4AZ6A 2ZRVA 1W5NA 1TE6A 1QRQA 3QC3A 4TX9A 1HKKA 1XYLA 4IISA 3UJ2A 4IP5A 3EXRA 2VC7A 2Y24A 4OT7A 3UXAA 3PJWA 3QTGA 4ZMGA 4CN1A 5K4XA 3LQLA 1XDJA 4F0MA 3F4VA 1EH9A 3E9AA 4HSHA 1BVWA 2HVOA 3ZJ7A 1DV7A 1OX6A 2CWNA 4XO7A 1Y7VA 4C91A 3OZPA 2D2GA 3R10A 4L4OA 2FZBA 1ZUAX 2VHLA 4OWGA 1W9XA 2TYSA 3AFBA 1KV5A 2EEXA 1EC8A 3R7MA 1JGMA 5KZ6A 1OCJA 2V30A 3RF9A 2PC4A 3WH6A 4Y96A 1YXDA 4KERA 3NEHA 4WD0A 3I7RA 1O4UA 1BWKA 2F38A 4CQ8A 1L8NA 1LG1A 3HF3A 4KWSA 2FDSA 1XYFA 2ANUA 1GCYA 3CUXA 3IRSA 1ISXA 3VOJA 3VGDA 7TAAA 3W7OA 2I56A 3GH7A 3URNA 3FV9A 2XIIA 3E3HA 5FEZA 4CU6A 3L5LA 1EP1A 3C0JA 1W3HA 4LBSA 3GC4A 4JNZA 4A4AA 1ZAIA 4IJRA 5U4NA 3WLSA 4EACA 1EX5A 3T0CA 3QY7A 2BVYA 4N6EA 2YGYA 2X30A 3B4YA 3M7WA 4PCPA 1AZ2A 2ZZ4A 1WXZA 1VEOA 4BEUA 3VKBA 4LJ3A 5D9MA 3N25A 3VAVA 1OYCA 1A5LC 4UTJA 1RA0A 2D24A 1O5KA 4UNIA 2PF8A 4IH3A 5T9CE 5KITA 4GUHA 3RHGA 3UXKA 4LCSA 1SM9A 2ISFA 3AHZA 1FXPA 3PPFA 1R3TA 3CHFA 1XYCA 5BXPA 4LALA 8XIAA 1BHGA 3Q45A 2WNWA 4MAZA 2TAAA 3BMXA 1KBIA 4ADTA 1UWTA 1XV8A 2CYGA 2IQTA 1J11A 2JEQA 3VIIA 2V82A 3SBFA 2NW0A 3PWGA 4JY8A 3NSMA 3TLLA 5FKYA 4HYVA 4XZLX 4UCGA 5DMMA 3V1HA 3S47A 1DIEA 4NG3A 1CYGA 1HF6A 2RHGA 1EJ7L 2G96A 2OX4A 2E40A 4XB3A 2GJNA 2XPKA 1RBLA 1U22A 3DFNA 4M80A 1C3FA 3NQGA 3NYDA 3H54A 3I3BA 4JZ5A 5B80A 4L4MA 4W85A 2PDKA 3CQIA 2QJMA 1QHOA 1Z44A 4MY9A 1HO1A 3K46A 4PBEA 5XINA 2DSWA 3DFTA 1Q7QA 4G56A 2PB1A 1HJXA 6XIAA 2X09A 1FCBA 2BXYA 3TDFA 1O60A 4C6NA 1E9IA 4CNPA 4F0KA 3G1VA 4UUIA 1P5BA 3THCA 1GPFA 3WD1A 3QFWA 4XD3A 3C2FA 1OYAA 3ABOA 4Z08A 4JCMA 4L6HA 4XK2A 3NG3A 3T0AA 1GVRA 4W9TA 2QCDA 3VXGA 1TPEA 3TZFA 4I5XA 3UXIA 3IVSA 4UQAA 2A3LA 3W2LA 1I6NA 1G1YA 3QMRA 1YPXA 2W27A 3RUBL 2DJLA 1EC7A 3SSZA 4JX6A 3ARXA 1X7FA 4NJJA 3GFZA 1QO2A 1OFAA 3A13A 2QPUA 4GQBA 1US0A 1PJ9A 1M7XA 2W67A 5I3KA 4LYRA 2QR6A 2E8ZA 1GYLA 1CGWA 2VX5A 3MSYA 1BQGA 1L6YA 4N6FA 1XIEA 2W6RA 3ATYA 4D8ZA 3A6OA 3U9IA 3VZZA 4QP0A 2VYOA 4WF7A 1F5ZA 3S5OA 4ICNA 2R24A 1S5MA 3RRAA 1NDYA 1ICSA 2ACSA 3LM3A 3AHTA 5EMUA 3OG2A 2FPYA 6REQB 5KZDA 3SUTA 3ARQA 3FOKA 3H8AA 2GWNA 8XIMA 5BXSA 1H5YA 1I0DA 4XX6A 4MWAA 1DXFA 4EPDC 2JKPA 3QGKC 3BLPX 4I5UA 3RLGA 2FMNA 1A0DA 2B4GA 2BWGA 4GUIA 1YNYA 1LOLA 1ZBKA 4G7EB 1ZJIA 4CU7A 4XBKA 3GR7A 3GM8A 1GVIA 2A21A 3FSTA 3KUMA 3G1HA 1MFVA 3TR9A 3EWCA 1GVYA 2QCNA 1HFBA 1AQFA 5LIXX 1E4MM 3CXOA 4RPQA 3RG6A 3VCNA 4BY3A 2Q3OA 4ZO6A 2QGHA 5CCZA 1F8MA 2R1LA 1U1JA 1R7OA 4CCCA 4P7NA 3P61A 3IS4A 5C71A 3PBYA 3M0KA 5C55A 4H00A 1V77A 1ELSA 1KW1A 3MUXA 1MUMA 1TPVA 3KZSA 3RPMA 4IP4A 3UR7A 1UP0A 3B0YA 4RDVA 4D71A 3MUY1 3GTFA 1GVSA 2GPTA 4O1EA 4FO4A 2G50A 3CGTA 5FAJA 3MI6A 2YDRA 4QG9A 2JGQA 2Z28A 2BBFA 1NF7A 3W7QA 3OOQA 4GY7A 1UJPA 3LENA 1HKVA 2GVYA 2MNRA 3O0KA 4ICMA 3USBA 3DYOA 1TV7A 2C19A 2WSQA 4DPPA 4UFLA 1SO3A 3UJSA 2D2HA 4MGGA 3L4YA 2CLEA 3SCWA 2DJXA 1OT1A 2GOUA 4FLOA 3EKZA 3SN0A 2WW5A 1QASA 2GJXA 2BVWA 4XIAA 3W6MA 3TN4A 1H7RA 1LCOA 5BZAA 3PSVA 3SGUA 1PTDA 3AU6A 4NXKA 2NWRA 4HMNA 5K4ZA 1IXQA 2A2IA 2GGJA 4D6DA 4LV4A 3V5CA 1KR1A 4UMAA 2ZVRA 4A3YA 4C5ZA 2X2GA 2XM2A 2B81A 4H41A 5LKYA 4GZEA 2B7NA 3TONA 2VX6A 2G3JA 4LCRA 1RLDA 1L6GA 4K8HA 2RKXA 4JYFA 1VENA 3KLKA 3ONCA 4QNEA 3W2JA 3A5VA 4C6PA 1VHNA 3M44A 2UV8G 2PFHA 1BAGA 2H9AA 1OB0A 3NEVA 3WNNA 4J7RA 5M1TA 3AJ7A 3WF1A 1FFRA 2EGZA 2WKJA 4L6OA 1V3JA 3WLNA 4XSMA 3TJXA 1KWKA 2F7FA 4OQVA 1XC6A 4Q3MA 1K7XA 3LCGA 1X6NA 4KEMA 3L23A 1IEXA 3NXLA 3WDIA 3R8GA 4JXCA 3II1A 4RE4A 4PEEA 4OGZA 3R89A 4CNOA 4MDOA 4UXDA 1XP3A 5ABFA 4FNSA 5F4WA 2PDQA 3MMDA 1RV8A 1VJIA 3NURA 1X1OA 4KW2A 2R1KA 1E6NA 2NLYA 4KCUA 3UA3A 4DO4A 1EZ2A 1W6TA 2VGFA 1A5SA 5CZ0A 4OVXA 3WDQA 2BMBA 3B0PA 4E4PA 1G7UA 1A5NC 3G6MA 3FJ6A 2XH2A 3DG3A 3QR0A 4HU0A 3UY7A 3IAPA 4ZTXA 3W28A 1JXJA 2ACUA 1BF2A 3W1RA 3GX9A 3WLMA 5BMWA 3MUZ1 4CUCA 3IEBA 1FCVA 3TC3A 2HISA 1E3ZA 2TODA 2YB1A 3JW7A 3IUDA 1VAHA 2OPJA 4XVDA 2FB3A 2NQZA 3CV6A 3GG1A 1TFVA 3TR2A 4QEEA 5LSMA 5FOOA 4CQ9A 5FL1A 4M1RA 2BNJA 1DJXA 2H8XA 3EB4A 3IWPA 3HG3A 2OLAA 4JYEA 4D6GA 3AHVA 3AIQA 1KFBA 3IAQA 2DP3A 2EJ1A 4HU4A 3RX3A 4O18A 1XXXA 1LWHA 5FJPA 4AVFA 2HXUA 1WYIA 3GHTA 1Q6GA 4X63A 2I7GA 4H9TA 1PXGA 4RNJA 1V08A 2BHYA 1UKSA 1EP3A 3BCFA 5ECVA 4QLKA 1R3VA 3JZEA 4UTTA 3F2DA 4TQTA 4TTUA 1AODA 3RR1A 4GE8A 3L4TA 5ECUA 4S3AA 1FHUA 5HANA 1RQHA 4YHEA 2FKPA 5HUPA 4GX9A 4OHQA 1C8YA 3WD0A 1JD9A 3FIGA 5D8ZA 1NDZA 3NAVA 4F2UA 3N04A 3MC5A 1MW1A 3N4EA 3S1UA 3UWEA 3PTMA 3VIKA 4ZQPA 4G1NA 2GQ3A 3UZXA 3NM1A 4BWLC 2OKTA 2VX7A 4ZSTA 1MQPA 2V63A 2R82A 5H8PA 3QHOA 5AYZA 4DJDC 2O56A 1CNVA 2OT1A 1UBSA 3W71A 5C6MA 3B0UX 4G6CA 4H8HA 1PYMA 2PGEA 4A8IA 1AUSL 4NRSA 4U10A 3WK2A 3WFZA 3KCOA 4S3JA 3E2QA 3IUHA 5A94A 4AVNA 4QRNA 3GE7A 1HTIA 4W7VA 1TWZA 1XWYA 1O12A 1PL9A 2GGHA 3GR4A 2V67A 3ORWA 2ZRUA 2QIWA 2ZUMA 2P53A 4PUNA 3ZVHB 2IKJA 2X40A 4J40A 4GZJA 1AD1A 4I5RA 2OWWA 1TJ1A 1E6XM 1UJQA 1QWGA 1RCQA 1V6TA 2VVNA 4JHZA 5E5CA 1XIBA 4GCAA 2G3MA 1LORA 3POCA 3NQ8A 4BQ3A 2B7OA 2V3DA 4PTNA 5KZMA 4FXFA 5FAGA 3WJYA 1CLXA 2WM1A 3DHPA 4IIBA 4ZB2A 4H6KA 3N14A 3FAWA 1J6OA 3AQUA 1OSEA 2V3EA 5D30A 1OK6A 1O5RA 4S3FA 4GA8A 2J27A 3ZSTA 3BURA 3TZNA 1G9HA 2XFRA 5M17A 2VEIA 3TX9A 1HW6A 4UTHA 3CPGA 3UYIA 3GVGA 2VCBA 2JKEA 2ALRA 3OZYA 4YWIA 4JNYA 3WQ4A 1L0PA 3SB0A 1QDSA 3DHFA 3V0SA 4UTFA 1ODUA 2I57A 4LEFA 3TMQA 3CWNA 1XCFA 4JTCA 1JDAA 4IMAA 3HG2A 4XTDA 3WQVA 3BW3A 4REQB 1GPWA 1N8FA 3AUOA 3PK7A 3KVKA 2V69A 1CGVA 3E5BA 4JCLA 2IXVA 2FPVA 1H60A 2UBPC 3PBUA 3I4EA 3HOJA 5BOFA 3WQGA 1WPCA 3GFXA 4RZ5A 4HK5A 5I5RA 3VC5A 3R5EA 2HZGA 4ZE5A 3OVGA 2FH8A 3IANA 1RY0A 4HK7A 2PDUA 2ZXDA 4K37A 3W2KA 2WNQA 2QULA 2XIJA 4CD4A 5A6AA 4JHMA 4LB4A 2BOGX 1XRVA 3T2QA 1R5YA 4GXMA 3SI9A 3E0WA 1TSIA 5DY2A 4H9ZA 5ABGA 5JBDA 2GFTA 2RFGA 4GYPA 3K8LA 3CWOX 4ZOEA 1SZNA 5C2GA 5I3IA 2W79A 1KRBC 4XTIA 3PG8A 4NHVA 3GHRA 4A21A 3VIOA 1HXJA 2ZUUA 4B9ZA 2PLKA 2G0WA 2J62A 4C90A 5LNUA 2FZ9A 1GYMA 2VX4A 1KKRA 2INFA 4NZCA 1L9WA 2Z24A 4H9UA 4Q8QA 5IFPA 2Y0FA 3IJDA 2VCAA 1I9CB 4KGJA 4YLWA 1OX4A 5D9OA 3GU9A 2QJIA 2Y70A 3GC5A 4O53A 2OFJA 1FDZA 2WZHA 1W17A 5TBOA 4PRTA 1JPIA 4WDXA 1UASA 2ICSA 4UMBA 4QGCA 3GVQA 1BKHA 4JQ2A 4JN8A 1V0NA 3VGEA 3UR5A 2F2KA 3LA4A 1RA5A 3I3EA 1P6CA 2E68A 2O92A 3PHAA 3CL7A 3D5HA 3H23A 4PBGA 2HV5A 4XWUA 1T8XA 4HOZA 1P48A 1HJQA 3URAA 4Z2GA 5FF3A 3UETA 3UG5A 1KM4A 4FALA 4DBWA 2A1YA 4LRTA 3R8HA 3U8GA 4AD0A 3BLIA 2D2JA 2YDQA 1E5NA 3JZUA 5CZJA 2IPFA 3CLWA 4B2DD 4LC8A 2Y5JA 3MTWA 3S6TA 3GG8A 1NSJA 3PAOA 6A3HA 2Y5EA 1RCOB 1EA9C 2VRJA 4ML9A 1P0NA 1IV8A 1XIDA 3AYRA 3HMJG 4WDUA 3W00A 1VBHA 1YNQA 3GIQA 1UWRA 1OIMA 2DZXA 2DY3A 4HT3A 2YFOA 4J9JA 1KTCA 2H8ZA 3AXKA 3TSMA 1MFUA 3WH9A 3NM3A 4WR3A 5BRPA 5J8LA 3GDKA 2Y5SA 2OVLA 1DJNA 3KOWA 5CLWA 3P93A 4U3AA 1Z6KA 3CBWA 3DENA 1VPXA 1PPIA 1JGIA 1F07A 1VBJA 2Y7FA 1FP8A 3OLEA 4BJHA 3EA1A 1D3CA 3GUGA 4A29A 3VGHA 1W32A 1KXQA 2MUCA 3TN6A 3LPPA 3WBEA 4PUKA 3UWVA 3U4FA 2VFGA 1DQUA 1Z42A 4OJYA 3IIXA 4E4UA 1H3GA 1EDQA 2RAGA 2DZSA 3WQ5A 2GUBA 3S6DA 1Y8BA 2OQYA 2ZFAA 4A05A 3NOYA 5A95A 1UC4A 3O6CA 1RBOB 1GHSA 4UR7A 1GOXA 4IMDA 2VZVA 3WQFA 4JS3A 2PWVA 1LBFA 4GXWA 4AX7A 3P2VA 1V51A 4DJFD 4R88A 4LCQA 4AZCA 1A49A 3C2EA 4S3GA 4JFTA 5D38A 1G01A 2XH7A 1SFLA 2DSKA 1WDSA 4IPPA 4PULA 1GQNA 4FAMA 1OCNA 1W0MA 4GINA 5E6ZA 3WFLA 3VK5A 1KC7A 1TELA 1OCQA 3CAWA 4N2YA 3DAQA 1B3ZA 1RUSA 4LS1A 2ZA3A 3EPMA 1OY0A 2Q02A 4JL1A 1WAUA 3BH4A 1VQTA 3RX4A 4E2OA 2CZEA 3JUGA 5CSRA 1NJJA 3LGEA 1HJUA 4OV4A 3URBA 3SRKA 5AN7A 1MUCA 4AEEA 3UWUA 1R0MA 1PWLA 3G3MA 3KBJA 2G3IA 1FKXA 1U83A 3NSNA 1UCWA 5HWNA 3IJ9A 4NYYA 1XH0A 2AQWA 1Q6QA 3H12A 1C8VA 3H7UA 2GUUA 2W62A 4GQRA 1RZMA 5B7ZA 2ATMA 1N7KA 2FZNA 3FKRA 4IG2A 3S5YA 1EOKA 1MW2A 1ITCA 1U33A 2QJJA 4Z2IA 1BXBA 2Y4SA 3TP4A 1H1YA 4ADSA 4JFSA 4D1JA 2ZDSA 3PZGA 4LYKA 1XH2A 1EXPA 1HT6A 1WB0A 2A6LA 1NFGA 3WO8A 4Z1DA 1BWLA 2HSAA 5LA0A 2ONEA 3MZNA 2NXHA 1JYNA 4DXKA 2C1GA 3E0FA 3FS2A 2AKMA 1O5XA 3PPCA 7REQA 3W7PA 1A80A 1UW9A 1RH9A 3GO2A 4HCLA 2X0YA 3WD4A 4Q8TA 1WDRA 4KCVA 3BL3A 1JDCA 2FHBA 3LHVA 3C8FA 2IW0A 4WZHA 4D8AA 1ZBCA 3R79A 3STEA 3VD9A 1WNOA 1W31A 3DX5A 3LX9A 1C9WA 4IUGA 3GIYA 3W1NA 4PMNA 4GC3A 3A3WA 4MFEA 3BDKA 4DBUA 2O4MA 4V33A 1M65A 4HA4A 3IGXA 4XZHA 1J93A 1ZALA 4EKJA 5AECA 4F2TA 1UR3M 1CXIA 5H8UA 1B3OA 1IWPA 3B8IA 4TOQA 9RUBA 4O1BA 3V35A 2VDHA 2X7VA 3GK0A 1BSLA 1J18A 3TYBA 2INZA 3AROA 4W89A 4GFIA 1UA7A 3CUJA 2VOMA 3B8SA 4RDYA 3W27A 1QFEA 3VVGA 4AFYA 4KRZA 4X3ZA 2H6RA 4AD4A 4LB3A 1VKFA 1ADDA 3IPWA 1M03A 1OF6A 3M5XA 3DGBA 2QYGA 2PDMA 1ECQA 1OIFA 1W8GA 3PJXA 2R1NA 3WLJA 4MOZA 2PWHA 1V93A 1EDTA 4GIAA 4FNRA 4QQUA 5BW6A 2WC3A 1H7PA 4QXIA 5K9DA 3PBWA 1GVQA 1AK5A 4W7WA 3EXSA 4GJIA 1BYCA 2B31A 4HHMA 2X1IA 3EX3A 4IIGA 1E15A 4AZIA 4LUYA 5AC4A 3GTNA 4JTRA 4YN5A 3AC0A 3QQ0A 2Z4GA 2OX1A 3EEZA 1IEIA 1J0IA 1KFCA 2WWCA 3TN5A 4ZQOA 1XINA 4K39A 3OTRA 4KKXA 4AXKA 5I00A 1XGEA 1XUZA 4O1DA 5JQ9A 3TVAA 1VHCA 5GJMA 4QSHA 1PWMA 1K8ZA 4HN8A 4AD1A 1JAEA 4LF2A 1D7FA 1KM1A 3PBVA 7A3HA 1JUKA 5D2XA 1PTGA 3S2JA 2NVAA 1E40A 3ARVA 3R8RA 4R34A 4DO6A 4UQEA 3NQ7A 2E6AA 4PMUA 4F0SA 5LA1A 4JDYA 1J0JA 3PF3A 2GVEA 2AOSA 5FJOA 3PNUA 4Y9OA 1DWIM 3P60A 3LEPA 3K8MA 3H2CA 3KTCA 5BMXA 3RU8X 3IGHX 1H5VA 5F1VA 1OYBA 3AMGA 5TAOA 3NPVA 1BYDA 1XG3A 4FHAA 5LHFA 3MJYA 4YTUA 5DO8A 3M7SA 2Y7EA 4JR5A 3N11A 2V5CA 1B3YA 4DRSA 1XR2A 1TPFA 3T07A 2OWXA 2RUSA 5BRQA 3F2CA 2PTDA 3WJSA 3LCXA 3T81A 5G2IA 1DWHM 3IVTA 2W91A 3OIXA 4WGHA 4WLCA 3VDCA 4TVCA 2A7PA 1QI3A 4ZODA 1EUNA 5AY7A 3M5VA 2EPKX 2P3ZA 1MDLA 1B31A 3QPZA 5G1TA 4CN4A 2CHOA 2PPGA 5FSEC 3LPOA 3BAKA 2P8BA 1ME8A 1E0XA 3M6YA 4A22A 2CLKA 4LWWA 2PDFA 1BD0A 1GONA 3UERA 3UESA 3UT0A 5AVHA 3C0LA 1GKPA 3B9OA 4QE4A 4K68A 3ANYA 4BHYA 2ZA1A 4NXSA 3TJLA 3KTXA 5T26A 4PH6A 2XSBA 3BK0A 2XSXA 4OOZA 2NQLA 3BW2A 2P5NA 1BKSA 3WLQA