2PDBA

Human aldose reductase mutant f121p complexed with zopolrestat.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEPFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdbA00
1JEZA 2PF8A 3EB4A 2PDHA 2PDUA 2ISFA 5C7HA 4DBSA 5LIYX 2NVDA 4GQ0A 4GIEA 1XF0A 1PYFA 4XK2A 4IJRA 2NVCA 2IPGA 3UZZA 4YVVA 1X96A 3WBXA 1YNPA 3R8GA 4PRTA 5AZ0A 3RX2A 1GVEA 3DOPA 3RX3A 1X98A 4JQ2A 2F2KA 2R9RA 4GCAA 3UZYA 4JQ4A 3GHUA 2J8TA 3M4HA 2ALRA 2HEJA 4PUUA 3UZXA 3ONCA 3EB3A 2F38A 1YNQA 4RPQA 2PD9A 2IQDA 3BUVA 2PDBA 2IKJA 2PDFA 3B3DA 3EAUA 1Z3NA 2ACQA 1PZ1A 1FRBA 2HVOA 4EXAA 3UG8A 1S2AA 2FZ8A 2HDJA 3LN3A 1UR3M 1XGDA 4YVPA 2INZA 4FZIA 4XAPA 2PFHA 3Q67A 1J96A 2PZNA 4AUBA 3ONBA 3R6IA 4FAMA 3KRBA 4YU1A 3CV6A 4YS1A 1ZGDA 1QWKA 4JQAA 4JTRA 2FZ9A 1PWMA 4NKCA 3CV7A 4JQ3A 2PDCA 3RX4A 4JQ1A 1PZ0A 5HNTA 2FVLA 3GUGA 3S3GA 3LBOA 3BCJA 3LZ3A 3D3FA 1K8CA 4LAUA 3VXGA 1LWIA 3UFYA 1PWLA 5JH1A 4XO7A 4XO6A 3V0TA 1M9HA 2BP1A 2WZMA 1YE6A 2ACSA 4QX4A 5HA7A 3GHSA 1QRQA 3R43A 1OG6A 3WG6A 3UGRA 2HV5A 2AGTA 4G5DA 3R58A 2PDLA 1MI3A 2C91A 3LQGA 2PDMA 1EL3A 1EXBA 4JTQA 4GABA 2IKGA 5KETA 2HE8A 3V35A 2PDGA 3LUTA 1T41A 1R38A 4WDXA 3V0SA 5LIWX 4FALA 2PDYA 3M64A 3BURA 4HMNA 1HQTA 1S1RA 4OTKA 2I16A 2IQ0A 2PDJA 3G5EA 3H7RA 4XVDA 2QXWA 2IKHA 2PDWA 4EXBA 4XZNX 3R8HA 1IHIA 1T40A 3LNMA 2WZTA 3LEPA 1EKOA 3F7JA 4Q3MA 3U2CA 1MZRA 1LQAA 2PDQA 3MB9A 2HVNA 3Q65A 2FGBA 3CAVA 4WEVX 4GQGA 1EF3A 3WCZA 1MRQA 2CLPA 2I17A 2PDPA 3BV7A 3LQLA 3NTYA 1ZSXA 2P5NA 4WGHA 4XZMX 4QBXA 2A79A 1AH3A 3G1RA 4XZHA 4ICCX 2R24A 1VP5A 3UYIA 3WBWA 4JIRA 1RALA 2PDXA 4PRRA 3P2VA 5LIXX 2FZBA 4XZLX 3ERPA 1SM9A 3R7MA 3N6QA 3DN5A 5M2FX 5HNUA 2VDGA 1S1PA 4FA3A 3V0UA 3H7UA 3CMFA 4PUWA 2INEA 2FZDA 3LD5A 4LB4A 4LBRA 4MHBA 4GACA 1ZQ5A 3H4GA 3UP8A 5JH2A 4L1WA 4JTCA 4WDWA 4ZFCA 4PR4A 5LIKX 5AZ1A 2PEVA 4JTAA 2DUXA 2IS7A 3FJNA 3CASA 2IPJA 4LAZA 2BGQA 1US0A 4LB3A 3CAQA 1ZUAX 2DV0A 1XJBA 3O3RA 4DBUA 5DANA 3C3UA 3WBYA 1ADSA 4JIIX 1C9WA 2PD5A 1AZ1A 3LENA 1AH0A 1Z89A 3MC5A 4ASTA 4WRHA 1HW6A 4WDUA 1AH4A 3UZWA 3N2TA 1A80A 4HBKA 3GHRA 2PDNA 3M0IA 4I5XA 1RY8A 1Z8AA 4XVEA 1AFSA 4JTDA 3R94A 3FX4A 4IJCA 1AZ2A 2PDKA 4DZ5A 4IGSA 2IPFA 4F40A 3GHTA 4JIHA 4L1XA 4YVXA 2HE5A 2IKIA 3UWEA 4H7CA 4XZIA 4PMJA 1YE4A 3QKZA 2ACRA 3T42A 1Q5MA 3V36A 1X97A 2BGSA 1IEIA 4H8NA 1VBJA 3O0KA 2DUZA 4LBSA 4DBWA 1Z9AA 3COTA 1S2CA 2PDIA 4QXIA 5LIUX 4WDTA 2ACUA 3LZ5A 4Q7BA 2IPWA 4QR6A 4R9OA 1Q13A 4GA8A 1RY0A
chains in the Genus database with same CATH superfamily
3HO8A 4GGBA 1NOUA 4IPLA 4EVZA 3BSHA 1GYNA 2PP1A 3E0FA 2ZTJA 4HP5A 3TN6A 4J3TA 1GCYA 4S3GA 2WNZA 1GG0A 3C2FA 4MIMA 4QHRA 3W1TA 2Z24A 3UZZA 2VCAA 3PTMA 4WIWA 3T09A 2OEMA 1P0EA 2WW5A 4Z42C 4KRZA 2QDHA 2AMXA 4ZL1A 1SPQA 4X3ZA 1UBSA 3B8VA 5HOSA 3UZYA 2EG7A 3SRHA 2ZWYA 3POCA 1G6CA 1ZHAA 4NNBA 4ZCWA 4H83A 1UIPA 4E8GA 1EA9C 1KBBA 2VD8A 3ZVHA 4KMQA 1BKSA 2BV9A 1V6XA 1VLWA 1MW0A 1X8CA 3C61A 1UZ4A 3NXLA 4ICMA 1E5NA 1JAKA 4YMZA 5CZTA 1XLIA 2RDUA 2PWFA 4ZE4A 2AAAA 3UVAA 4Z2KA 1M7XA 3N2BA 1AL7A 2QJIA 4UTJA 4H6KA 4J3XA 4HN4A 2OG9A 5TNVA 3TYCA 5KEZA 3PPGA 3GC5A 3I10A 1PHWA 3FK4A 1GVOA 3Q67A 5F4WA 1BAGA 1L2QA 2GVEA 3AWOA 1LUCA 1TRDA 1OF8A 4PH6A 3DYMA 3L4XA 2ZX6A 1BVZA 2OKTA 2E8ZA 1W5OA 4A05A 1TA3A 1P6CA 4O50A 2V2DA 4JHMA 3P82A 3W7HA 4GIAA 3S3GA 3UR2A 3NL6A 1REQA 1A5CA 3NQAA 1OADA 3V18A 1VGAA 3AU2A 3O2LA 2ZVRA 2DT1A 3KLKA 3W26A 1R3YA 1JYNA 4XIAA 1YE6A 5E1QA 2ZBTA 3RRAA 3PWGA 3FAXA 1H7OA 4ZO8A 3S5NA 3BG5A 4MUPA 3MYPA 1BHGA 4H01A 3GNDA 3BOFA 1EGVA 3A64A 5REQB 1EP2A 3BG3A 1RJQA 2TRSA 4FO4A 1DV7A 2F6KA 4NASA 2DIKA 4BF7A 1ZPTA 3H2AA 3W2JA 2RDTA 2VX5A 4ZSUA 1IGWA 2W27A 4HK6A 1ECQA 3PNZA 1GG1A 2DT0A 3GVGA 5A2AA 3I6RA 4DBEA 1L6GA 2OGYA 3ANYA 4ZQPA 5CPOA 4RXFA 4Y6GA 2ZUUA 4WDXA 2CU0A 2Z2AA 3GIPA 3M0YA 4PCFA 3H7RA 3BH4A 1H11A 5J5RA 2QXWA 3NSXA 3AS3A 1TJ0A 3NZ1A 4PEEA 3A4WA 4AF0B 4EXBA 1QO5A 1P43A 2YDAA 1RPXA 1PIFA 3W86A 3HJEA 1EH9A 3USBA 1QPOA 4KEMA 4X2RA 1T5AA 4Q8QA 1LG1A 1CXKA 2H90A 4M24A 1ITXA 3WLPA 4L4LA 4WEVX 4H2CA 1MRQA 3W87A 2PDPA 3W6LA 4LNYA 4AQLA 4DZHA 3WDJA 4M56A 3W1AA 4GO8A 5FCZA 3BL3A 3T78A 4BY3A 5LHEA 3LPPA 1HJUA 3ZLHA 1E40A 1EBHA 1DIDA 1E1CB 3ARSA 1EIXA 1TV7A 4R7WA 3VI2A 1W54A 1SM9A 3DBPA 4GKLA 1YRRA 1KCZA 4IP5A 4Y8EA 4MNLA 3NDOA 3PTQA 3A3HA 4AWTA 4NYYA 1QBBA 4HSNA 3TMLA 1IT0A 4UCGA 1E0VA 1TA3B 4Z08A 3M9YA 4JEJA 4IQJA 4HNUA 2VFEA 4N4PA 3P67A 3P61A 4JTCA 2XH0A 5A8GA 5BOOA 3STCA 3GAYA 4TU1A 1QUMA 1L8PA 1RP9A 2VHLA 3URBA 3U9IA 5CGQA 4N0RA 4A3YA 1KW1A 3T07A 4B4FA 4B9YA 3FAWA 3TZNA 4CKQA 3VGHA 3MP4A 4YYCA 4Z1DA 4D1IA 4NAEB 4YTQA 3NQ2A 4HZ6A 4MNJA 4WF7A 4GYFA 1H41A 3TYDA 2Z0IA 5MHBA 1YQ2A 3GYEA 1HNYA 1FBAA 3WH7A 1Z89A 1LOLA 2PU1A 3WNLA 2B7PA 3W7NA 3LB0A 1KV5A 2EPLX 3UZWA 4PE8A 1RQBA 2A2IA 1SFSA 3HPAA 4EPEC 1UYQA 4PTXA 1XH1A 1EPXA 1SO3A 3WFLA 2P3ZA 4MNMA 4I5XA 3E2QA 4G7FA 1XR2A 1NWUA 1GOQA 1ESWA 4PA8A 3VD7A 3BCDA 3LLXA 3N14A 4NIRA 3U2ZA 2FFIA 1MSSA 2P53A 3UG3A 3NVDA 3PB2A 2IPFA 1XLHA 1EF2A 1WBHA 5GPRA 3OBAA 4FXRA 1IXOA 1HJVA 4ADSA 2E6YA 1DJGA 2J77A 4RL3A 2WMHA 5ECUA 5LNRA 4Q8VA 3GY1A 2QJHA 3CUGA 3W6MA 4Q32A 3VOJA 2CLLA 1Y65A 2G8ZA 4L4PA 2EPHA 4WDTA 4P8WA 1AQ0A 5G2IA 3FS2A 1XIJA 4QR6A 3WL0A 4DAIA 1G69A 1RVKA 3H12A 3SQLA 2V5CA 3W71A 3W0KA 4FNPA 5LIYX 2G95A 4E0CA 4H6QA 4XSMA 3U3HA 1B3OA 1XLKA 4GQ0A 1V6UA 3IJ6A 4U4MA 3CUIA 3H53A 3OYZA 3WO8A 4JTEA 1YPIA 2J6VA 1GKRA 1EX1A 1R46A 3KZSA 1DL3A 2YL6A 1K9TA 4QLJA 1NJJA 2CXEA 3B0VC 4FX6M 4B2DA 3AZTA 3KUMA 2XYLA 1TJ1A 2X40A 2YGYA 1EYWA 1YNQA 4UR9A 2IQDA 1KM2A 2YXGA 3IGHX 1OCBA 1BG9A 4R85A 3FDKA 4LUJA 1MQRA 2GGGA 4GFIA 4Q8OA 1K7XA 2J9ZA 4AHQA 1XDJA 1EPVA 7REQB 2OQYA 4MJ2A 1VFHA 4FZIA 3OIXA 3II1A 4YTRA 3W37A 4RZ4A 2WM1A 3PR2A 2Q8LA 4DJED 3G6LA 3ATZA 4M1BA 4O1BA 4LCSA 3B9EA 4YU1A 1J0HA 4GISA 3U0HA 1FDJA 1QAPA 3N4AA 4RE2A 4B5XA 1XSJA 2E09A 1XDMA 3WD4A 4M6QA 3VGFA 2A0NA 3QW4B 4LX4A 4H9MA 1IZJA 1F2JA 2CHRA 3OA5A 3ITGA 1U2YA 4LYRA 4QGCA 3R79A 4WHBA 3W1RA 4DJDD 5JH1A 3VX0A 4IG2A 1DXEA 5HA7A 2H6RA 3BV4A 4BWLC 1LLWA 2NUXA 3FXGA 3AUOA 1WDPA 5LHFA 4OZOA 2DZUA 1U22A 2HISA 4TTUA 1IYXA 2QCCA 4HYVA 2ABAA 4QDWA 4CQDA 4LAMA 3EWUA 3P0WA 3TC3A 4QE1A 3OB8A 5HMSA 2FDMA 6A3HA 1KM6A 5XINA 4NZFA 1UA7A 3NCOA 2Y7FA 2AMGA 3TQKA 2OT0A 1X7FA 4IM4A 2WANA 1B9ZA 4AZ5A 3IGXA 1H0GA 3LTSA 2POZA 3NIYA 4JIQA 4I9JA 1IXQA 1EOKA 3LGGA 1H4PA 2J7DA 1JI1A 1H7XA 2B0MA 2WVUA 3NUKA 2RKXA 3LX9A 4S3CA 4O11A 2I16A 4AMAA 3EX6A 4XVDA 4XTDA 4DJFC 1BGGA 4B4HA 4ZQNA 4PTDA 1XYMA 2EEXA 1M53A 3W1MA 3FJ6A 2QKFA 1BWLA 5AHNA 3SI9A 4BQ2A 2MNRA 3TTSA 2J7FA 4GVFA 1WBJA 3SW6A 3K8MA 4QJ1A 1YXCA 4GE8A 2J79A 5KSWA 1BTMA 1WQ5A 2PBOA 2E5BA 5G4HC 3KOZA 4OGZA 1M68A 2C16A 3CPRA 3BV7A 1IZKA 1XGZA 3OLEA 1YADA 4W87A 2ZA1A 3OGSA 4NJGA 1SR0A 3V5OA 4D6CA 5I3DA 1P7TB 4X9YA 4O15A 1TMHA 3RR4A 3FYPA 3KXQA 1W3LA 1LJYA 2GQ9A 3ALFA 3HURA 4HA0A 1ZB5A 5AYIA 4PRRA 2VRKA 1NAL1 8CGTA 4K8GA 2D2GA 4K7VA 3DG6A 3NO5A 1XIDA 3GSMA 4DRSA 5B80A 2VURA 4HIBA 5LA2A 2TODA 4ZMGA 1UMLA 1SJDA 4B2DD 3HG2A 1N55A 4QG9A 3FKRA 3CWHA 4HGXA 5BROA 2PGWA 4Q7IA 4W88A 1CTNA 3DHPA 2BVTA 2EXOA 3FYYA 3VKJA 4P7NA 3OZPA 4MKSA 2J24A 1GOKA 3UXLA 2CZEA 1CIUA 1E6QM 4GOAA 1T96A 4AHPA 2DUXA 4DNMA 3MDWA 1IWPA 3IIPA 4QNWA 4Z0SA 1KGWA 4N6FA 5GQBA 2VQTA 5EL1A 2G37A 5EU9A 2ZRVA 2XDFA 4LF1A 2PA6A 3MSDA 4K1WA 1H09A 3N25A 4QE5A 2AQVA 2AOSA 3QW3A 2J62A 1ZALA 3STGA 2WJDA 1VHCA 4GYPA 2VCCA 4OE7A 4FIQA 4AZHA 5HPOA 1IWAA 1CI1A 5HDRA 2XH7A 2WNWA 2Z29A 3N17A 4REQB 3EXSA 5I77A 3NQEA 2A7RA 3L4YA 3P6LA 4BHYA 1I2RA 3CUZA 4PMQA 1FP8A 1D9EA 1KFLA 2X16A 4CN1A 3MZ2A 3ABOA 2GSJA 4F79A 4IISA 1G4TA 3UCQA 3BGAA 3SDOA 4RNFA 7ENLA 3GE7A 3TTQA 4MDPA 4M8UA 3W7LA 1V6YA 4C6DA 3CUXA 3F5LA 3T42A 2PGFA 3WZ0E 5D2VA 1EA0A 4F3HA 5E0FA 1VFLA 4KCUA 1O1HA 2OYLA 3WK3A 4CN6A 1AQHA 3KL0A 4P7RA 4C6JA 3WQFA 1TZ7A 1RJRA 3V7PA 1ZAIA 1UD8A 3XIMA 4EX4A 1ISXA 1HXJA 2BDQA 1EUNA 3QVQA 3HQNA 1YDVA 4LAKA 4A2SA 1KWKA 4S3FA 3RM4A 4DPPA 1JXKA 1UB3A 3AYRA 3CZJA 3CIWA 5FF0A 2V5BA 1VEOA 1BPLB 4PRTA 1ISYA 5HUPA 3R25A 4C90A 4IFKB 1XBXA 2H3DA 2D24A 3KOXA 3RLUA 4GCAA 1JCYA 3RRXA 3SCUA 3MV01 1ISVA 2Z1WA 3ZO9A 4MWAB 5CJMA 4REQA 1B3YA 1A53A 2BOEX 1A5AA 5DX7A 1QDSA 2PD9A 1MXDA 2ZICA 5EMLA 2JEQA 2PDFA 1H1YA 4D71A 3CNYA 2YCKX 1Z3NA 1DJZA 3MKCA 2I57A 3ZR6A 2XH2A 3EKLA 3MMWA 5CGMA 2BX7A 3DFQA 1A5BA 1CEOA 2YLLA 3GXDA 5T9BG 4AIEA 2WZIA 4O10A 3GXMA 3W7QA 1XGDA 2GLKA 3B4YA 2RHGA 4IL0A 5CSRA 3SCNA 3M0VA 4X2PA 3KVJA 4JOMA 4FIRA 2Y5EA 1P6WA 3LV5A 2PF0A 4WUIA 2JKEA 4N9EA 2ZA3A 1C29A 2CFFA 3L0GA 1CB7B 1JDEA 1FUYA 3IIVA 5D8ZA 4BR1A 5C55A 1F6KA 2GPTA 1Q85A 1Q2SA 3L5MA 2XGBA 4JFWA 1XYFA 4XSLA 4CU8A 4UTTC 3KL3A 3S5YA 3LBOA 1T8QA 4ZQRA 4AIBA 5TAOA 3KRZA 3QY6A 3PWAA 1FWBC 3W22A 4JN6A 2OGJA 4S3KA 4UFJA 2E1DA 2YA0A 2Y2WA 3MCNA 2NUYA 1XIIA 4ZXLA 1GJUA 3N3TA 4HHHA 3V1PA 1DXFA 4J9JA 3GVRA 1VS1A 3G1AA 2E0PA 3UGRA 3CHDA 1ALDA 2FGZA 1MW2A 4F0LA 3LQGA 3UYCA 2PDMA 3GAKA 4KRTA 1IEXA 1U33A 3GU1A 3MBDA 1EWEA 2HE8A 2CKRA 4JD4A 3VUPA 1KGXA 3UY8A 1UWUA 2QF7A 1O5QA 4J2MA 3W82A 1NM9A 4M3PA 4W7VA 5DCDA 4DX3A 3JR2A 3SAZA 1JQVA 3MANA 1L6WA 4XAZA 2Q01A 2VENA 5HJXA 4OIFA 1R3QA 3ZR5A 3W00A 3S1XA 2HNHA 8XIAA 2QV5A 4C6MA 4EF9A 3THQA 1JZ2A 1VJSA 3B0XA 1W31A 3S1WA 3KW3A 3DIPA 3UNTA 4OJYA 3G8RA 2ISVA 4GY0A 4Q4OA 5LZLA 3MB9A 4Y9AA 2ZDSA 3NQGA 2QIWA 5BU9A 3CAVA 2G41A 1JPDX 3EOSA 1M5WA 1YIXA 4D2JA 2ONEA 4XZMX 3RNDA 1N8WA 2A79A 3TXVA 3W3OA 4C6NA 1Z41A 3O07A 3KAOA 5GVJA 4CNNA 3CT7A 4I9TA 4AVFA 1CLKA 3VDGA 4RK8A 3NYZA 3S1GA 4J3ZA 4GWEA 2I5QA 3MVTA 1R3RA 4DI9A 3LSBA 4BS0A 4GVHA 4RCXA 3D6NA 4B3ZA 3EGJA 3QGAC 1S5VA 3GIQA 2WSQA 8RUCA 3RAOA 3USZA 1IR1A 2OVLA 4PTVA 2CZDA 1EEPA 2FPTA 3W07A 1LROA 3LD5A 3TZFA 1W3NA 1NFBA 3N6JA 1VPQA 4MHBA 3ANUA 1US3A 5D09A 1HL8A 2Q8XA 3N6HA 4H04A 4KGJA 1I6NA 4BF5A 2FJKA 2ZTKA 3WQVA 3H4WA 3JRKA 1BVWA 2J66A 3BXWA 5E5CA 1JZ3A 3PP7A 4KH2A 3VKDA 4E2BA 1F76A 1QO2A 1US0A 4Z2LA 3T44A 1XXXA 3H7VA 1XC4A 3ZT5A 3TH6A 4JYEA 1DEDA 1UR0A 1X1OA 3GX9A 4F0HA 3GH4A 1TVLA 1BVNP 3W75A 3ZS4A 1N7KA 2WSYA 3MUZ1 3UJ2A 1DJIA 3BLKA 4UMCA 4XAYA 3TIMA 3Q2DA 1QBAA 1UH4A 4OUEA 4HB7A 3HOJA 4WRHA 2REQA 4UFHA 1A80A 2SFPA 4JKMA 4ACZB 4D6IA 2O9TA 3AXKA 2YCEA 3H2CA 2BHYA 3KP1A 1RY8A 2F61A 3KCLA 3SUSA 1QVBA 2WMKA 1E0UA 4J35A 1CLXA 4WSHA 3GTHA 1M04A 3PSWA 3WJWA 4E8DA 5A69A 3BK0A 2I9UA 2XFFA 1Z7AA 4IIDA 5A6TC 3KM8A 2AGKA 1QW8A 4UOZA 4Y9NA 2GYIA 3RCYA 1MUWA 3VZZA 1S3HA 1FWCC 3WQ4A 3CEPA 2A3CA 1Q5MA 1EB3A 4K68A 5BXRA 1GOMA 3BJTA 5ENLA 3QKEA 1VBJA 5BMWA 1KFBA 1V3HA 4YN5A 4EAMA 4CLMA 3E9AA 1OGBA 2ZXBA 5A6MA 4NJKA 1GW1A 2W92A 3KBJA 2I56A 4DYEA 4PCNA 3A22A 4IPNB 3ITVA 3PUDA 5AY7A 1FTXA 4HTBA 1QFEA 1REQB 5DY3A 3BO9A 4GXMA 1C8YA 1E1EA 2EKCA 3KOYA 1NIUA 4PTMA 3HGOA 5AC8A 3SCSA 1PYFA 4LGXA 3W84A 2VWTA 3M5YA 4J4KA 3EDEA 2ZDRA 2ADAA 4FXSA 3EDDA 3AYSA 1JYWA 4AZCB 3MWAA 2Y7GA 2WMIA 1XX1A 1FWJC 2QPSA 4M6PA 1SW7A 1XLBA 4J3UA 1BRLB 3T08A 3L67A 3M4HA 2Q3OA 4JNZA 3I3EA 3WK2A 2HEJA 4UQBA 3N11A 1H1NA 3N18A 3FA5A 4QLKA 4J5NA 2ZX8A 1KM1A 4JFTA 2PLMA 1DOSA 1OB0A 4U28A 1AJ2A 2NSXA 2IQTA 2JF7A 3H55A 2J78A 2RUSA 4R27A 4UB9A 1VFUA 1TWWA 3VO0A 1Q3NA 5M03A 2I5GA 4W84A 3N73A 2UBPC 3M0LA 4RDZA 3E02A 1VYRA 5EGRA 4LSBA 3H8AA 3OU8A 4K2SA 4O19A 1J96A 4E2DA 1XG3A 3EOOA 3ATYA 3SY1A 4LY4A 1K6AA 1OVDA 3WMLA 3Q37A 2G3JA 1RHCA 5KINA 2Y61A 1GVQA 6REQA 2Y8KA 3CV7A 2ZFAA 3L23A 1YEYA 2FVLA 3TTYA 2CLHA 4H6RA 4I6VA 5IDIA 9CGTA 3BPWA 1Q2RA 1EDTA 2PTWA 3NXFA 2FIQA 4LAUA 1W3JA 3W2MA 1FWEC 2ZRZA 1J2WA 2OQHA 4TOQA 1OYAA 2VC7A 1KRAC 4J7RA 1MEWA 2Y7DA 2PBGA 2PTZA 4MB5A 4JN8A 2WAGA 3DI1A 1GW9A 1K7FA 1V0LA 1V02A 5AHIA 2ODOA 3A13A 2NSOA 4F2UA 2VM8A 5LNUA 2VUNA 3P60A 2HBVA 3TR9A 1O6IA 3CQJA 4JYDA 2OB3A 1SJCA 1OHLA 3I7RA 2Y8UA 4GYJA 2WMJA 1DQWA 1RH9A 4E2OA 3D46A 3VKCA 3VU2A 3N2XA 2WNNA 3HGRA 3KTXA 4US5A 2DQXA 3V0SA 1XISA 2PDYA 4Q6XA 4K6AA 4DWSD 3BURA 1S1RA 4H41A 4CCDA 2IQ0A 1PUDA 6REQB 4RV3A 1XW8A 3VGEA 4U10A 3LK6A 1RA5A 1XYLA 2DIEA 2GUBA 5C9ZA 1EHNA 3C0LA 5C9WA 1UKTA 3PZMA 4ICNA 4DO5A 1XDLA 1EGZA 3L2IA 2ZOXA 1A5OC 2GUYA 3KBNA 4WX2A 5TQLA 3DFNA 2FGBA 3LHZA 2XWEA 4R88A 3M6YA 4UQAA 2B7NA 2VRJA 5T91A 3A6OA 3THDA 5U4NA 1AW2A 2J7EA 4QBXA 5E9XA 4DF2A 3AQUA 3PVFA 3TU9A 2GK1A 3LU2A 1JULA 1OIMA 4HPHA 2R24A 4FOUA 1VH7A 3MQTA 1MVYA 4KEZA 4D6JA 1QK0A 5M5DA 5BMXA 4DJDC 5G1MA 5CC3A 2TSYA 3H2EA 4G1KA 4LUTA 1VJIA 3P2VA 4PN2A 2WCGA 2G3FA 4DVOA 3STFA 4M19A 3QPZA 3V0UA 1UD2A 4MLRA 4A3QA 3W7IA 1QI5A 3LHYA 3QV7A 1AW1A 1B3WA 4LB4A 2ZRWA 4IPJA 3KCOA 1H5YA 4IXHA 1EO7A 1BFNA 1XFBA 1E4NA 3H4GA 3GYCA 5IRPA 5I3FA 5B7YA 4L9ZA 5JH2A 3N12A 2WB5A 4GO9A 4QJ4B 1DQXA 1ZNNA 4PR4A 4M80A 4BI7A 1E0WA 4RE4A 3SIZA 1JF6A 2DSZA 4RE3A 5CJ5A 3EPMA 1XPYA 3O15A 5HATA 4LAZA 5CBBA 3RFAA 3SN0A 4AG0A 3GNXA 1TR1A 1BWVA 1A3XA 3R11A 2VEIA 3UW6A 5CZKA 4I6KA 3MWCA 3S5ZA 2PRHA 4DO6A 1K70A 3AC0A 4IP7A 3LENA 4EP8C 2JK2A 2E1WA 4HJFA 1DHPA 1O60A 1BF2A 5KZMA 2QJGA 4ZB0A 5A8QA 2BVYA 2YDRA 1IEQA 3VDHA 5BYWA 1UBPC 3CAKA 2P3EA 4O57A 3UPMA 3RITA 3L5LA 2EBNA 1W3KA 3CT2A 3ITOA 2H9AB 3C2RA 2QCGA 5AECA 4QNEA 4RNHA 3QC3A 5A95A 1F3XA 1UIOA 3ICJA 4FLSA 1H63A 4XKMA 3AICA 4DUOA 2JEPA 4L6DA 2DW7A 3O7UA 5CKSA 3G1VA 2X09A 4TV6A 2G96A 5LSMA 2HE5A 3BQ6A 5EMKA 1E1FA 3NAVA 1AJZA 4TXEA 4RNIA 2ZC1A 3OPSA 3FOKA 7CGTA 1TMQA 1X1NA 1KCLA 4B3KA 3CZ8A 5MKGA 3COTA 5EFFA 1GT8A 5HINA 3DC8A 1OFAA 3PM6A 1KRMA 1LF1A 3GG8A 3LZ5A 1KC7A 4JZ5A 4DM1A 3ABQA 1VEMA 1SYTA 4WJ8A 3KRUA 4ORMA 3RCNA 3OIHA 1G94A 1OF6A 2Q3RA 5FAJA 3VTRA 3TAKA 1OX5A 3W7DA 4HCLA 5DBTA 3AISA 3VC5A 4MYAA 1KLZA 3VNZA 3IVUA 5A2BA 3PULA 3JVAA 1PB0A 1SR9A 1UD6A 2WWCA 3RF9A 2VL4A 3EKZA 4ZOBA 3GUWA 2PODA 1L6FA 3RUBL 3WBXA 3LRLA 2WZHA 3SURA 4JL2A 3R0KA 4ZO6A 3UXDA 1H5VA 3NWRA 5M17A 2WKGA 2EF9A 3GNRA 3HMJG 5IFTA 1GVRA 3ARUA 4JQ4A 3G1FA 4NT0A 1H2JA 1FWHC 5F7UA 1ZENA 2V38A 1A4LA 1TE1A 2NLIA 1DXIA 3GLCA 3P84A 4IF2A 2XWDA 2NXGA 1BD0A 1ISWA 4PMNA 4XKYB 1CYGA 2FDSA 3QH2A 3VPLA 3QM3A 3K2GA 3EAUA 1VCGA 5EKYA 3TQVA 1P7TA 3FCPA 3W1LA 2Q02A 1F5ZA 3VCCA 1WZMA 4NL1A 3VC6A 4KFNA 3LS9A 5BNKA 1XYCA 1BYCA 3DC0A 4NXSA 3I6TA 2PP0A 1SO6A 2YXOA 1DJWA 3N13A 2KZHA 2VGBA 1FA2A 3CUJA 3M7SA 3RPTA 4PFMA 1EP1A 1VYPX 1Q4NX 3FJLA 5C9XA 3WLJA 3ONBA 1LG2A 2JALA 1JUKA 2HNEA 3WN6A 3N1AA 3T4WA 3WFAA 2YL9A 3EX4A 4JQAA 4JS3A 4LEFA 4P8UA 1EC7A 3BZGA 2ZUVA 4UTHA 2C1IA 1D3HA 1WA3A 3IV8A 2ZZ5A 1KM4A 1LWIA 1GKQA 5AC4A 1KTBA 2XVNA 3VGBA 4AYGA 3FDGA 3I3BA 1HF6A 3AFBA 3WQ8A 3UWWA 2XH4A 1QR7A 4HHLA 5K3VA 3V4BA 5CZSA 4EK7A 2WV8A 4JX6A 1KFWA 1A0DA 3L2LA 3E1F1 2HV5A 1T6MA 1TKKA 1M6JA 3G1HA 3AZRA 2D3NA 3CGTA 1W1IE 1MFVA 2QW5A 4DZIA 2ON3A 1EXBA 5HJYA 1WNOA 1LL4A 4IWWA 4UFLA 3WJZA 3FHQA 1F8MA 1G7VA 3MMDA 1S39A 1XLFA 5I03A 3LHVA 2YZRA 1KBJA 4HOWA 2VZSA 4HCHA 3W2KA 3LLFA 3PJTA 4MWAC 1HN1A 2A7PA 5CBJA 1JIBA 4YJ5A 1PXGA 4HMNA 1HQTA 1H50A 1V0MA 3BAKA 4WD0A 1ZY9A 2KAUC 1UWRA 3NDYA 4NAFB 1B5TA 4ZO9A 2DZBA 3VUSA 3AI0A 1JNEA 2R1LA 5C9RA 1QOQA 3ITYA 4QFUA 2G3MA 5EA9A 4E8CA 4M0XA 1Q6RA 1TELA 4KWVA 1NOWA 3IEBA 2O9PA 1WXZA 4HYRA 3TCEA 4IT1A 4Z1YA 2P88A 3KLLA 1TPDA 1BKHA 1EZ2A 2Q71A 1VFFA 1CW2A 2HMCA 4CD4A 5JBDA 3M6DA 3SSJA 3WF3A 3SBFA 2YPIA 1SVDA 1K8XA 4ZXOA 3B9OA 3ZSSA 3WDQA 1V7YA 1TUXA 3BG9A 1VJZA 1HVQA 1FQ0A 1LCOA 3H21A 2F7FA 1IIHA 4QJ3B 2O9OA 1I9CB 4RXGA 1EQCA 3QRHA 4GC3A 4ZVJA 3FN9A 3A3WA 3OW1A 1U30A 4XZLX 3B06A 1HT6A 2VC5A 1KXHA 3TKFA 4FK9A 4W85A 2AQWA 4FA3A 2DVUA 3W83A 1NP0A 2PP3A 3OO2A 2PMQA 4Q33A 2VRQA 1TREA 1ZQ5A 1BXCA 2C3ZA 1FWRA 1LDCA 1OK6A 3E74A 3AWNA 2V81A 3GNOA 3JW7A 1CGTA 6ALDA 5CG7A 1XSKA 5AYZA 2ASHA 4DY1A 1YNYA 4QDPA 1FX6A 4L64A 1TCDA 4E4UA 1C92A 4JTAA 3S9ZA 3ARWA 1JGMA 4B92A 1VLIA 3CASA 3S6TA 3VM7A 4DUVA 2CIPA 5I0DA 3O0FA 4G7EA 3CAQA 3ARZA 4DO7A 3KS6A 3QQ1A 2V69A 1WDRA 1QNSA 2HQAA 3C3UA 4O1FA 2J4GA 4DWSC 4FB7A 4JEQA 1ADSA 1P5BA 3PSVA 1UR4A 2NQLA 3CZGA 3VD4A 3UR5A 2TYSA 3GRIA 4MWAA 4JIEA 3TNOA 2YDQA 3T0DA 4V33A 3GHRA 1XD0A 4DHGA 1CXLA 4CD7A 5L6UA 4BFAA 5CC6A 2Z7KA 3A24A 3OOQA 4AC1X 5D9NA 3R10A 3W29A 4Z2HA 3NR0A 3BJSA 3SRFA 1BSLA 4F0RA 1GZ1A 2CPUA 3W72A 1J2BA 3N9KA 4N7QA 2JGQA 1UC5A 2OCZA 1UWSA 3L0KA 1UH2A 5H2ZA 4AX7A 3KL5A 3V1HA 1GQIA 3D5HA 1VKFA 4ACZA 3MO7A 1MQPA 1F9CA 3UY7A 4Q8NA 4D8AA 1R47A 2VDHA 3DBNA 1OY0A 1FWGC 3BAYA 1ZFJA 3RO8A 1HJSA 5PTDA 4IHCA 3TTEA 3WNNA 2WHMA 4PBGA 3VMNA 1LQ0A 4OV4A 3CZKA 1QI2A 3EB4A 4U2YA 1SMDA 4PFHA 4ZOCA 3UJRA 5GNYA 4MTVA 4UR8A 2RDWA 4N42A 1QWGA 1WX0A 4D8LA 1XRSA 1OX4B 1D2KA 2A6NA 4GUGA 3G0UA 3RGTA 1TTJA 2ZRUA 4HZ8A 4NSBA 1OFPA 2FPYA 4IJRA 1E43A 3G2GA 1NFPA 2NVCA 3FVMA 1KM5A 3IJ8A 2XIMA 2F6UA 1I8JA 1CPUA 6XIAA 3SSZA 1Q4WA 2X1IA 2ZXDA 3NPWA 4JQ2A 3FSTA 2UY2A 4O52A 4CQAA 1HX0A 1CBGA 3HFYA 3N04A 4AXKA 4PMXA 3EWBX 1JF5A 3ZOAA 3TVAA 1QJWA 3EB3A 3H26A 3N4FA 4CEXC 3P74A 3WEZA 4C6CA 2DP3A 1UP0A 1XCXA 6PTDA 1TPVA 5E6ZA 3DFYA 2PC4A 2PWHA 4GZIA 2XVGA 2HVOA 5HXMA 2Z1XA 1H0IA 1AA1B 1S2AA 1TQJA 4Z2IA 4AFYA 1W6TA 1KGUA 5CXPA 2PWGA 1PKMA 5EYWA 4MJZA 1QNQA 3C4UA 5D03A 1EXPA 4URIA 2RGMA 5BWFA 3BLIA 3PZTA 4KIEA 5H1WA 4QAWA 4MY9A 3S2CA 5AHEA 2EQDA 4QCFA 1G4PA 2OSYA 3TFXA 1D3GA 3MSGA 3IJLA 4P8VA 1QNVA 3LCGA 2VP8A 4UXDA 4NKCA 3VD9A 1K77A 2PDCA 1H7PA 1UUMA 3UR8A 4LEQA 4AEEA 2YR1A 1EYEA 3VXGA 2BVWA 3QR3A 4YWSA 3W70A 3V0TA 3T0BA 2FMOA 4KETA 4P7QA 2CESA 3GHSA 3WLQA 1J5SA 4HMCA 3RO6A 3PHAA 1VFOA 1GOWA 5LNWA 4MWAD 1E73M 3R89A 5ABEA 2V3DA 1LRNA 3SR7A 3M07A 3QZEA 1KBLA 1SZFA 3E5PA 3EZ4A 3SRKA 3TCSA 2C91A 1V4YA 3H70A 3WEOA 1K8YA 3IRSA 4JTQA 2VX7A 7REQA 4JYFA 5H6HA 1TX2A 1H3GA 1VBRA 2WCAA 3WSUA 2VVNA 3MCMA 3C52A 3OTRA 1CLVA 4HPGA 5A1AA 1DE6A 2D69A 2XFRA 4KWOA 3GFYA 3W74A 1HP4A 3PB0A 1IT8A 4A3HA 3CQIA 1HO1A 4Y9OA 4N9CA 2PDWA 3S46A 3DGRA 1H61A 1WCGA 1JUEA 2ANUA 4FNQA 5FKYA 4E3TA 2CW6A 1QK2A 2X7VA 3P5YA 4YXGA 3CL8A 4JTJA 5JXQA 4HPJA 1GEHA 2UZ9A 3HPZA 3AS0A 4IMFA 4DM2A 1HL2A 1VFMA 1C8VA 4TVUA 1BEUA 1CDGA 1MW1A 4WGHA 2ZQ0A 2D22A 1BWKA 4GYKA 4ICCX 3CU2A 3FGCB 3H6OA 3KDOA 1WDSA 3VD5A 1UKSA 3S2LA 3RU8X 4DJEC 1QNOA 1F74A 1ENUA 1PPIA 3T0CA 3C0QA 2VEGA 1PTGA 3KBSA 4NRSA 3NG3A 2I1OA 2QEZA 3FSUA 3BMXA 3BW4A 3BLDA 1Q8JA 3T2PA 1T0OA 1OC6A 1OQFA 1YTDA 2OWCA 1Q66A 1DWHM 1EC9A 1JR1A 4M5PA 2X7WA 3EOLA 1PCKA 4AD4A 1U1JA 1M41A 3B0UX 4LW7A 4WKFA 2JFEX 2BY0A 2ATMA 2WJEA 3ZSTA 2J6XA 2VJXA 3RLHA 2VFIA 3GWQA 3CO4A 3GTXA 4ADUA 3M5XA 2WVSA 2XIQA 1JL8A 4TX8A 1UOKA 4HNNA 3ARXA 4MM1A 5FJJA 1XIBA 3VNDA 2GL5A 1GUVA 1AH0A 2NX3A 1BF6A 5J5DA 3FFSA 1PV8A 4JL1A 3QQ0A 3O16A 1HW6A 3CV1A 3T0TA 4HPNA 1GK8A 3O8AA 5CZJA 1DQUA 2CITA 5A8MA 4AYSA 1NP2A 2G3NA 2OU4A 1VD6A 1TZ9A 3TW9A 3Q45A 3KFTA 4UCFA 4AH7A 5FEPA 4JTDA 3W7KA 4BQ5A 1OG0A 3QTGA 1AZ2A 4CVUA 3CHEA 5D9PA 2IXUA 3DCPA 4Y8FA 2PURA 3P80A 2IKIA 2QS8A 2ACRA 5FJUA 2W91A 3CLMA 4HHPA 3IV3A 4RDWA 4FNRA 1M7OA 2AL2A 1XI3A 1V77A 3U48A 4DBWA 3S8HA 1LOSA 2CLMA 3T81A 3PBUA 1SO5A 4QG8A 3PZQA 1YHTA 5AN7A 3VOCA 4AZIA 5MKGB 4MDOA 5SWUA 2O92A 1TO3A 2OOGA 3T55A 4H6EA 2AL2B 4EF8A 1J79A 3WH9A 4LOCA 3T2QA 4O8RA 2OMAA 4FHAA 2XJ7A 3W24A 1SJBA 3WQEA 4MY1A 2NVDA 1FWNA 1RUSA 1UUQA 1JD9A 3IPWA 5BW6A 1HKMA 2XIJA 5ABGA 1BLIA 4Z2GA 3BOLA 5CPTA 4PBFA 4CNSA 4QJ5B 1E72M 5E09A 1EOMA 3WJXA 3U2EA 4S2BA 3HMCA 4NZ1A 1JXJA 1XINA 3UEQA 3VZXA 4HMDA 4KF1A 1OJXA 3CUHA 1Q7MA 4D6FA 3O63A 4UMAA 4HCDA 2PRMA 1DJYA 4PUUA 1SGJA 4QAIA 4Y9MA 3UZXA 4PB3A 5EB8A 4LRTA 1OGSA 1H7WA 2GGJA 3DAQA 2JKPA 2IKJA 1XH0A 3IIZA 3QFEA 3S2MA 4X9SA 2CHOA 4A8RA 3B0YA 1B4KA 3P3BA 1GHSA 2DSVA 3S42A 1DTNA 2HDJA 1Q6OA 3SIMA 3AJXA 4LPCA 4W89A 3CPUA 4K1GA 4FOJA 1WZKA 1K6WA 4LYQA 1RPKA 4A22A 2PFHA 1P1MA 2PZNA 4O54A 4E6MA 1IEWA 3WDIA 2ZRXA 4GVGA 3LMZA 4AUBA 5D9OA 2QCNA 3R6IA 1Q6GA 2VFFA 1ZBKA 3CV6A 4UQ9A 3UZJA 3ZFHA 1FH7A 3P8JA 3PG9A 1OSEA 4JQ3A 2QVHA 1PZ0A 2WHKA 3GU2A 1PEZA 5HNTA 8XIMA 1W1VA 3VOHA 1DWGM 3RCMA 2WMIB 3C0JA 3TTOA 2C79A 2BTMA 1ICPA 1W3TA 4JBRA 1JD7A 5BZAA 2OPJA 3ZYZA 3DFTA 4N6EA 1AJ0A 2PGRA 4JX5A 1M9HA 3K1DA 1FWFC 4D6HA 1J12A 4GUFA 3ITCA 4F9JA 4W9TA 3ARQA 4LVDA 2WLYA 1S2WA 1Y5XA 4R33A 2XM1A 1P1XA 1S5TA 1CWYA 4D9PA 3TSDA 4QS6A 1TFVA 2VOMA 4S38A 3ALGA 4O1CA 3AIWA 2TMDA 2E9BA 4JPGA 3GZAA 5I02A 4ORIA 1EQPA 1B90A 3PAOA 3ZT6A 1UJQA 4BCEA 1N2VA 2PDGA 5DF0A 1RLCL 1HVXA 3UXAA 2C0AA 4XD6A 1HGYA 4AEOA 1XG4A 3WKZA 2V6AA 1LORA 3DKLA 3NQBA 2VGFA 1LLZA 1UZ1A 4IIFA 2HVMA 4XZNX 3IACA 3VKKA 2OOFA 2V63A 2VZVA 3GU9A 2B7QA 1V3JA 3CPGA 3AYTA 4Q8MA 4CQCA 3NQMA 1E6XM 4BA0A 2QNEA 2VEFA 1E9LA 3TN3A 4A21A 5F2MA 2GFTA 4GQGA 1G01A 2QAFA 4KWSA 2CBUA 5I3HA 1HFBA 4L56A 3PZNA 3L0NA 1LRQA 1FCVA 4IZGA 4PCTA 5I3IA 3BZJA 2Y8VA 1XLCA 3UF9A 1JCLA 1NWRA 3LRKA 3ZJKA 3QMSA 4ML9A 3CQ0A 1V0NA 3IUDA 4OHQA 3QSRA 1ME7A 3OG3A 4UFMA 4I7VA 4LVBA 2J25A 1ITUA 2O9RA 2VEPA 2C14A 3JU2A 2DZPA 1KLYA 2C18A 2W0UA 3AHYA 1GQNA 3I4KA 5HNUA 1JCMP 3CHCA 3XISA 2PWVA 1TWZA 1W8GA 5D05A 3UWUA 2FZDA 3ID7A 3SGGA 2QDDA 3G1DA 4TR9A 3Q94A 2W3ZA 4OKDA 2XGIA 1PX4A 5AC6A 2NXIA 2AAMA 1JCJA 5I00A 4JHZA 2PEVA 2VX6A 2FZMA 1RK6A 3KHDA 1ITCA 4IFRA 2ZYFA 3QR1A 4HNCA 5ABHA 2PS2A 1Z32X 3UJFA 3GB6A 3S0CA 7PTDA 2KX9A 3E5BA 3WBYA 2VFDA 4IFOA 4O18A 3NZPA 3S47A 2XN1A 4JIIX 4WJXA 3NA8A 2A3BA 1ZP3A 3W27A 1DIOA 4ZEPA 3F4CA 4ASTA 1XKYA 1QNRA 3N2TA 1J93A 1E0XA 4DBDA 3E49A 3RN6A 1Z8AA 4XVEA 3WUBA 3R94A 1KBKA 3QOKA 3CYJA 4P8XA 1GOIA 4DJEA 4WVXA 3NZGA 4C7GA 3WX7A 3BC9A 2WQDA 3GHTA 1K03A 4L1XA 4YVXA 4GZJA 1G5AA 5LYRA 1POJA 1J5TA 1Q8AA 5DY2A 3A5FA 3QKZA 4KBXA 4IGHA 1TV4A 3DFOA 4DELA 3RDKA 3VINA 5ABFA 4J2PA 2OO0A 4W8AA 2FMNA 4H8NA 2X2YA 2JE8A 4DYJA 2DUZA 3TUUA 2WC3A 1P4CA 2GZXA 3LLDA 4XZ9A 2PDIA 4DJDA 2VD9A 4X63A 3TA9A 2YZ5A 1CGUA 2J8GA 4B5WA 1FWDC 4LTSA 3GK0A 4ZZ9A 3WEMA 3PS7A 1HZYA 4FX8A 4UQEA 3NPUA 5C6MA 5EMMA 2ZX7A 4ZODA 1JZ8A 3W7JA 3ECQA 2BG5A 4H8HA 2TAAA 3KOWA 2L5HA 4AZBA 3QY7A 2Z1KA 5BRQA 2EJ1A 2GVJA 1DYSA 3EEZA 4N9DA 4GNVA 3PC0A 4ERAA 3H2FA 4BKNA 3LY0A 1A0CA 2CLEA 4JFUA 2A5HA 4PMDA 3KS5A 5DMNA 4XZBA 1W9VA 3ISIX 2EGZA 3OJGA 4QLLA 2ZZ3A 4ATWA 1XBVA 5A8OA 5CCZA 4IMEA 3F4DA 4ZTXA 1QASA 3R8RA 3UG4A 3C8NA 4CD5A 4JIPA 2VFGA 3DYPA 3ONCA 4DN1A 3VKBA 3VIPA 3MSYA 2BHUA 3VIGA 4J3SA 1OBAA 1WPCA 3N34A 1FDYA 3PK7A 3OA3A 1YBQB 2WOQA 1QMLA 3D3AA 1HKVA 1FRBA 3R12A 1KRCC 5AHLA 1LBFA 5DELA 3UG8A 4IGNA 1CX9A 1QW7A 4XD5A 4Q6JA 3MTWA 3CS2A 2A4AA 2NQ5A 3GR4A 4MAVA 1NEYA 5I09A 2ZZ1A 5DMMA 1F3TA 4DWDA 4MADA 4I9AA 3IGUA 2WK2A 2QCFA 3UCDA 3TJLA 3RPMA 2PUZA 4PTWA 3W7PA 3IJ7A 4QCEA 3VIJA 3ME3A 3E96A 4TVDA 1KFJA 1POKA 4GNKB 3ES8A 2Z2BA 2ZIDA 5FIPA 2VUYA 4Y7EA 3FW6A 2C7FA 1R86A 3VABA 3UERA 2IMRA 3NGJA 3RYSA 4G1NA 3G22A 1T7LA 5I3JA 3O1NA 5C54A 1CGYA 1K9DA 2RAGA 1NH6A 3W02A 2OODA 3SFWA 2YA1A 1C93A 3CC1A 3UWQA 1FCBA 4CNOA 1DKWA 1XLDA 3GTFA 5HMDA 5T8GA 4M7SA 4QITA 4MF4A 2AGTA 3BAIA 4RR4A 3KBMA 5CJNA 3U4FA 4HMEA 3SO7A 1SZRA 1W5QA 4H00A 1YTEA 1KRBC 2EPOA 2IKGA 1HGWA 2V5DA 3QXBA 2Z00A 4GPNA 4DEFA 4U33A 3WQ6A 4C5YA 1L6SA 1OIFA 4TTGA 1YDYA 5LIWX 2E28A 5AVHA 2A3HA 4LUYA 2YFNA 3BJFA 5C2GA 1CGVA 3SUUA 1TVNA 3QYQA 2CLKA 3A4JA 1F4HA 5FEZA 3B03A 1J18A 4FLRA 1V0KA 2R94A 1I60A 1TCMA 2D2JA 1WKEA 2GSHA 4CU6A 1IHIA 2W6RA 3VDAA 1RCQA 3PTKA 1G1YA 3LEPA 4DYKA 1ZBCA 1EDQA 3DX5A 3OZMA 4OQVA 4PL1A 3SCWA 3EX1A 2X8RA 5FJPA 3L21A 3K46A 1SSDA 2FHFA 2GJNA 2CLPA 1PE1A 2GVYA 4WJEA 1VRDA 3DYOA 4NI3A 1SU5A 3W6YA 3FEQA 1BXBA 1OC7A 1VP5A 3QLDA 3LPFA 3UYIA 3WBWA 1X7IA 4CGTA 4R9XA 3E6EA 4DWSA 3IRDA 1MFUA 1UD5A 2E6FA 1B2YA 2DU2A 2TPSA 3R7MA 4B91A 1ITQA 4PUEA 3CEUA 3Q58A 3GTIA 4HU3A 1U1UA 2J13A 1AG1O 5BOEA 1FKXA 2D0GA 2PGEA 2PPGA 2RJGA 3NNTA 1S5WA 5IBXC 5K9XA 4EXQA 1V3KA 5I6SA 2BFGA 2QYGA 3WJYA 3DFSA 1R85A 4WY0F 3U7VA 4WSKA 1V5XA 2O0TA 3WYZA 3IANA 4CU7A 2VWSA 1MDLA 3PPHA 4WSJA 4XTIA 3QYSA 4DI8A 1U5VA 3VZYA 2WNQA 1GVFA 1X8FA 3BLEA 3VIMA 1XJBA 2AKMA 3ZJ6A 4DBUA 1BRLA 4XV0A 3QSTA 1Y5WA 3VD3A 3W23A 1IR2A 3HPSA 1AZ1A 1CECA 2OZ3A 5CPLA 3ARTA 1FFQA 2P10A 3U5YA 4DJFA 5HQEA 2CLFA 2VGGA 2E67A 5F1UA 4PRWA 4GIYA 3N4EA 3QQWA 4ATDA 2RJHA 2XVPA 5L9FA 1BQGA 3VMOA 4Q22A 1V51A 2WLZA 1N82A 1Y8BA 4HSOA 3F1QA 4TIMA 1EWDA 3HN3A 3R0DA 5D33A 1TTIA 1UKOA 2CZ5A 2PDKA 4DZ5A 2FQIA 1O1ZA 2BXYA 2ABBA 2HRWA 1J0KA 9XIMA 5CC7A 2UWFA 2Y7EA 3LOTA 3HV9A 1I45A 3MCOA 2C0HA 5LIUX 4FNTA 3VIHA 4FSAA 2ZADA 4Q4KA 2WJZA 1Y5VA 1JNDA 1UWTA 3WF2A 2E6AA 1Q13A 2EPKX 1NOFA 5DCBA 3AS2A 2JIWA 3MJYA 1RY0A 3M7WA 4IMGA 5CLTA 2PDHA 4QDMA 1JFHA 4F4RA 2EKGA 4FP1A 1LLOA 5FF7A 1F07A 4QISA 1XS2A 4DXKA 3KVMA 4E4PA 3SADA 2R91A 1P48A 4JTHA 5A6BA 1W37A 3SRDA 2XU2A 3FJ4A 2QUUA 1G4SA 4FX7A 3NL2A 4DUWA 4K39A 3E2RA 3B40A 2D2HA 3NPVA 2NUWA 1OX4A 5BWAA 2WHLA 5IFPA 2VOTA 4Z1AA 2P0IA 3M0MA 4IIBA 4IOTA 3P7YA 1UZDA 5CLWA 4ERIA 1XPGA 1OFBA 3UGVA 1UWAA 1FOBA 1W9UA 1S2UA 2WJFA 3S1UA 3SN1A 3W1UA 1HKKA 3MA8A 4NQ1A 2HK1A 2PDBA 4KKXA 5KTLA 3PZ9A 4ZFMA 2ACQA 3WFZA 3BMVA 1NVMA 1IE7C 1PTAA 3UNDA 1EP3A 2ZUTA 1VF8A 3LN3A 4PCPA 4DO4A 2X42A 5RUBA 1GKPA 2V2HA 2J75A 4R53A 3KEHA 2XVLA 2CC0A 1GGOA 1V93A 5T9CE 1Z42A 5FJTA 1PHQA 4J1OA 7ODCA 1VB9A 2VZOA 3AMGA 3LCIA 2I9EA 4N02A 2BNJA 1PAMA 4GRSA 4PMZA 2O4MA 3UU0A 1ME9A 4PL2A 2PTYA 4RPPA 4AISA 3EKGA 4GCXA 3VGGA 3D3FA 3HG4A 9XIAA 4UOQA 3EA3A 4NY2A 3C0SA 2MANA 5HMFA 3H4XA 4DJFD 1XQLA 3DUGA 3OYXA 1MXGA 1SQ7A 4X60A 7A3HA 1EDGA 4O16A 3MHGA 4JKLA 1W1B1 3VOIA 3UA4A 1K9FA 2AL1A 3NQFA 2A3LA 4GYPC 1EJUC 1LBMA 4IUOA 1R3TA 2YX0A 3VIKA 3SFKA 4EPKA 1FY6A 5DEZA 4K8HA 4LU0A 2R1KA 1JYVA 4G6CA 1XRTA 2OJPA 4RDVA 1GONA 4D1JA 2ZUSA 5F2LA 3WNOA 1G0CA 1MQQA 3HQ1A 4O0ZA 3HV8A 4RLIA 3AALA 4EWJA 3DESA 4A6GA 1GOOA 4HU4A 3EOUA 2ZX5A 4N9BA 4H8UA 1RAKA 4OVXA 3LCLA 4IIHA 2E8YA 5BRPA 4HZ7A 1OYBA 4R3UA 2W62A 1JYXA 3LNMA 2D0HA 4AXNA 1F3WA 5C2CA 2YBUA 4C6KA 3VKAA 1W0MA 3M43A 2DSUA 3G3DA 1JPHA 4RUBA 6XIMA 2O4QA 1CENA 5DCEA 2D23A 3WQCA 3CWNA 3R5EA 4FXJA 4Z1BA 4KCTA 1WDDA 2NX1A 2CZFA 2J9XA 5K4ZA 4P61A 2D1ZA 1NF7A 4EKJA 2JBMA 2E5CA 2JF6A 5CPSA 2DDXA 1MW3A 4YPJA 5DBUA 4XBJA 4ZB5A 1UR1A 3CBWA 3B4UA 4C6IA 2C1GA 3E0IA 5I79A 1AK5A 1K02A 1YMYA 3CO8A 4JNYA 4H3DA 1S1PA 2OO6A 1QHOA 2JQXA 3PZVA 3HTWA 2C8NA 1PL9A 3M0KA 3KVLA 3LMYA 1VQTA 3S2JA 4NZ3A 1TYGA 3N9RA 2O55A 3AZSA 1S38A 1DJNA 3UA3A 4MKVA 1TVPA 3C56A 3FXYA 3L12A 2XVKA 1IEVA 2Y4SA 1BYDA 3FKKA 2O7QA 1SW3A 4HK7A 3KDNA 3PANA 2HTMA 4AB4A 1BTCA 3A12A 4PMVA 2DVXA 4UQDA 3JS3A 4LBUA 4PSRA 3PAJA 2WM0A 1OFEA 3TV8A 5C8BB 1MMFA 1AVAA 1TPB1 4QRNA 1R7AA 1FFRA 1C9WA 3LPOA 1TPH1 5LXXA 3WLNA 3J7HA 1W9XA 2UV8G 1SUXA 4K8EA 3VAVA 4AF0A 5A6KA 2XIIA 4HD5A 4DNHA 3TE9A 1GYMA 1JJKA 4LF2A 3TFCA 2CWXA 1FWIC 3G1SA 4KCVA 4Q8PA 2DZAA 1RQEA 1QCWA 5XIAA 4UTIA 1YW1A 2Y62A 1O5KA 2XISA 1W9DM 4V15A 5DT7A 3QR0A 3VA8A 3MMTA 4AIUA 4PULA 4G8TA 3S4TA 1X39A 3OZOA 1QW9A 4AAJA 1JPIA 1ZJAA 2YYUA 2NQHA 1ONRA 3ZVHB 4AZGA 1EO5A 3QBUA 4TV5A 1IEIA 2Q6ZA 3ZIZA 3O0KA 4ZTYA 3LYEA 2XSXA 1Z9AA 1R9YA 3PZUA 1VIZA 1S2CA 4QXIA 3GC2A 2ALDA 3CK5A 4JCMA 4C6OA 5FEXA 2Y88A 3W1NA 3HF3A 2IPWA 4XQ6A 1R7OA 3LPGA 3RU6A 4GA8A 5A3HA 1K8ZA 3TX9A 3SY8A 3AIQA 3N29A 5FA5A 3ZVIA 5LKYA 4G9PA 3EWYA 1I0DA 1PKNA 2BASA 5BU6A 1FWSA 3NOYA 4WCJA 4JICA 4OBSA 4PSPA 1B3XA 4EACA 3U6WA 1DJXA 2H3BA 4QG6A 1X96A 4OECA 3RX2A 3ZWSA 1N8FA 1O95A 3LNPA 1GVIA 4YTUA 1KFCA 1G67A 3M16A 3MT1A 2GJLA 3CM4A 3W53A 1OK4A 1E56A 2YB4A 3EB2A 2YKKA 3L68A 1FCQA 2FTYA 3E3HA 1ICQA 3B8TA 2OLSA 2F38A 1O5RA 2NV9A 3BUVA 2QMJA 1FVPA 4B90A 3GBEA 3UWYA 3B3DA 2ESCA 3MKKA 3VYLA 5AOUA 4J28A 4JTGA 3RILA 1U5JA 1EJRC 4UR7A 4ZENA 4MJMA 4KRUA 4YCPA 3EEGA 1UD3A 3PBGA 1A4MA 5FD0A 4O4WA 5GJPA 1QTWA 4C1NA 4C1LA 4GNJA 1XSIA 4CN4A 2OLAA 3WNPA 3EPOA 3MHUA 2VKZG 2ZXQA 1EFZA 4AMCA 5DXYA 1TTQA 1Z69A 1YDNA 4M6UA 2GVGA 2WVVA 2ZKMX 1FWAC 1MO0A 3F5KA 4MZ8A 3IVSA 2GDUA 3W38A 2CWNA 3K13A 2YJQA 3VX1A 2FVMA 1TUFA 4FLOA 3S83A 4JDYA 3SM0A 3ABRA 3HGJA 5JU6A 1K3UA 3H23A 4EANA 4ROQA 3BCJA 2XPKA 3HJZA 4UFIA 1K8CA 3THAA 3NYDA 2PLJA 4IX2A 3SJNA 2XFWA 2IUZA 1H7RA 1UMYA 3DXIA 1GVSA 4H19A 5AHMA 3UXKA 3W9ZA 1GZJA 4J27A 1W9BM 1OG6A 2OLHA 2NT0A 4O13A 4E5TA 1Q6QA 3GXNA 3DEQA 1D7FA 3MO4A 3V3WA 4JTIA 5GNZA 2BHZA 3W2NA 5A8NA 2ISDA 5A6JA 2HXUA 1A5LC 3HG3A 4UNIA 5G1YA 4RX0A 3TA6A 5JBEA 2FB2A 3ITTA 1WB0A 4E3VA 1Q63A 2W61A 2NWSA 4HVXA 2QGHA 3M5ZA 4UQCA 1I1WA 2O56A 3OZYA 3MI6A 1K9EA 3WLRA 4B5SA 3W1QA 4C6BA 4PMUA 3TQ0A 6TAAA 4MG4A 3G5EA 5FSEC 3DHUA 2W79A 3PF3A 3FHAA 4UTWC 3I7QA 4C7FA 5I24A 3WH5A 5LA0A 3EMCA 2E40A 3HB9A 1V6TA 1OM0A 5DMLA 1LQ2A 3NFUA 3WF1A 5HANA 3EMQA 3SCQA 2HPIA 2WBKA 2PDQA 2Z25A 2HSAA 1XL9A 2E68A 5KZDA 2HVNA 2I7GA 1V3MA 5G5IA 1C7SA 1TIWA 4H8VA 3PJXA 2Y85A 3R0UA 5JVLA 5DXXA 3GTNA 1JZ5A 3MUCA 4Z17A 2WC7A 3FV9A 1XLMA 4CCEA 2YIHA 1Y7VA 4JX4A 3VCNA 4XZHA 1W5NA 3GG7A 3EX3A 1B54A 4K36A 4JIRA 2FJUB 4GH3A 5EMJA 3PPFA 1XV8A 4NI8A 4O4VA 3RLVA 1MUMA 4RV8A 3THUA 4QE4A 4QQUA 1OCNA 3WMSA 3CMFA 1XYZA 2HXTA 4WXZA 4I5RA 4ALDA 1I4NA 1E6NA 1I2OA 2F9RA 3L2MA 5C2XA 7TIMA 4KT2A 1NQ6A 1XM3A 2G4FA 2GDQA 3TYAA 1QPRA 5CEWA 3INPA 4ZFCA 1I2PA 5GNXA 3TW6A 3S2NA 4NAEA 1AD1A 1ZCCA 2WYSA 3ZWTA 3ABSA 3N19B 3WUGA 2EPNA 5HULA 3WIJA 1P0KA 5CPNA 1YX1A 5I06A 3HPFA 4HPXA 3FIGA 1QATA 4FNSA 3SGZA 2XIOA 4LVAA 1UOZA 3SY5A 1DIKA 2P76A 4AD1A 1AD4A 3VGDA 4AX6A 3AU6A 1E9YB 2OKOA 2B7OA 1WV2A 5K7JA 2OX4A 3EWDA 3AMKA 5HR7A 1C90A 2XSBA 4HA4A 4YTSA 4OWGA 4R7JA 3CIXA 4PUMA 4D8ZA 4GLEA 2QQ6A 3MHFA 4L9YA 1AMKA 4LJ3A 3TEVA 1KR1A 1RBOB 3QF0A 2PDNA 1ZBWA 2DSWA 2QJNA 1QU4A 5F4SA 1YTKA 2GWNA 3SCRA 4GXWA 2NW0A 2YSWA 4S2CA 5EPDA 3IARA 3PBYA 2DY3A 4JY9A 2EHHA 3QZAA 1KXTA 3Q4DA 1WXJA 3K4WA 3STPA 4WKAA 3F4NA 2VNCA 4GC4A 2RDXA 3SEPA 1WUEA 3N9SA 2D3LA 2DIJA 2NQZA 4U2ZA 5KZ6A 2BGSA 1UQZA 2J7BA 4C6PA 4MPKA 2BLEA 2XIBA 2QVNA 6CGTA 2BSLA 1L2UA 4GUJA 1LM1A 1HL9A 4IPPA 4UTWA 2XSAA 4CEUC 5E0KA 1LZOA 1Q6EA 4XX6A 3W7EA 3VDBA 4H7VA 1KQYA 2V3EA 1JG9A 3IIOA 4EAYA 2PF8A 1ONWA 4XG1A 2C1HA 2PDUA 2ISFA 2BY2A 3PZOA 5C7HA 1SZNA 1NTHA 4M82A 2B81A 3CV2A 3NSMA 5FJOA 1JCTA 4JTFA 3A23A 1G7UA 3R13A 3RMJA 4QM1A 1XF0A 3OQEA 1O4UA 1TE6A 3LTYA 4U5IA 5FESA 1J0JA 1YNPA 1VYSX 1JQXA 1M7JA 2F2KA 4AVOA 4XD3A 2F2HA 2NLYA 1GWJA 3KZPA 3QTPA 1IV8A 3K30A 3QJAA 3GD6A 1EEXA 3ARYA 1TG7A 4A35A 4JTUA 4AD3A 4YL2A 1QPNA 1GORA 5KITA 3WLIA 4RDYA 3S5OA 3RIKA 3KWXA 3NQDA 1S3TC 1EJSC 2REQB 4FF7A 1BG4A 3TJXA 3NJ3A 2QUMA 1WDQA 2FZ8A 5JUVA 5BCAA 3BAWA 4DF1A 1F3EA 1QXLA 4CUCA 4ES4A 3E0WA 2P0OA 3BANA 3E0VA 3UJEA 3OVQA 2CXGA 3EYPA 1SFJA 1E1CA 1XIGA 3L9CA 2FZ9A 2DZXA 3U5UA 3UJSA 3V5CA 3RX4A 2VGIA 2FVKA 1JCNA 2H8XA 3VOGA 1H51A 2C13A 1F73A 1TQXA 1X6NA 1UA3A 5TBOA 1TZZA 1A5SA 3N2CA 5HMEA 4P2VA 2ATSA 4XO6A 3BGJA 1WAWA 1C8XA 2WZMA 2ACSA 2YCIX 3OBKA 4X0NA 4S3JA 3O6YX 3W1PA 2G4JA 3APGA 3HFTA 1TV8A 4PODA 5FJIA 3NOEA 1PCWA 3REQB 3EPNA 4JTKA 1YPXA 1DP0A 5AC7A 3AIEA 1OFOA 4NU7A 4GZEA 2Z1VA 5F4XA 5IOBA 5HQLA 4S3AA 4ECLA 5LA1A 1TRIA 4LH8A 3PN8A 3V75A 3WELA 1WXYA 3VK5A 5ABTA 3BSMA 4NHVA 1IF2A 2DZSA 3UPBA 2Y24A 3W25A 7XIMA 1Z44A 1R2TA 2V3GA 1QOPA 4A3RA 4OUIA 3L4WA 1R6WA 3MUXA 3T0AA 3C6CA 4AY8A 1R9XA 1MRAA 2NQ9A 2BGNE 5FAGA 4GX8A 3BDKA 3P62A 1V08A 4DAFA 4AW7A 3UQNA 4R5EA 2D2OA 1EKOA 4FI4A 1Q6CA 4AD5A 2D73A 3LHWA 4XAGA 1X6LA 3ZM8A 3AXHA 2QULA 3GM8A 2C6QA 2F8QA 1GYLA 3Q65A 3LCFA 4W93A 3DG3A 4P7OA 1U1HA 4O1DA 3GDTA 1VFTA 4ZBCA 3RJYA 1NQKA 1VBUA 1ZLPA 2QJMA 4GD0A 2A21A 5DRIA 5H8MA 3BGGA 4F9DA 2GOUA 3TYZA 1ZJBA 3G1RA 3UBPC 1GZGA 1UR2A 4PCSA 3SCOA 1QNPA 1JZ7A 1LTDA 3UCCA 4X22A 4LANA 2WVTA 5FJRA 2PTDA 1FH9A 5CSUA 2DT2A 2VR4A 3PZGA 5GJMA 3EDJA 3TYUA 1FXPA 1K1DA 4C7DA 4O53A 1FHUA 2R1PA 4ZB2A 3YPIA 3C2YA 5AHFA 2ZXAA 4H9XA 3NO3A 4HYWA 4K7YA 4N2YA 4LQ1A 2GJXB 4IL2A 2Y1HA 1OT1A 3QMRA 4OBRA 3KP0A 3WLSA 2QT3A 4LCRA 2PWUA 5FI8A 4ZOEA 5F2GA 4W86A 3UXIA 1MEHA 1TMLA 3ABXA 3G1YA 3JZEA 2IS7A 3WL1A 1UWIA 2IPJA 1EX5A 4Q4SA 1F8IA 1NF0A 3FVDA 2ZA2A 4PYSA 4HA1A 2A3EA 4HJWA 4U5KA 1WZLA 4MWAE 2E4TA 1HO4A 4NX5A 3WH8A 2GQ3A 1OFQA 2G50A 1T8XA 3WK0A 3TYBA 4A3UA 3V16A 4S3BA 3NEVA 2QCDA 4QP0A 3G77A 3OVPA 1FHVA 2QCEA 2WC4A 3ZLGA 2PC8A 1US2A 2ZUWA 4LUSB 4W7UA 1OT2A 1UG6A 1U5HA 3NZRA 1WKYA 3HZ3A 3GR8A 1OINA 2DFAA 2BS9A 1B9BA 4F2TA 1OCQA 4M6VA 4HQVA 1UUOA 1XCWA 4YYFA 1Q6FA 4IGSA 3AJ7A 3GXIA 4YCOA 2JIEA 2E9MA 1TPEA 2XHYA 1R2RA 1QHZA 1X97A 1V03A 4WGXA 2XINA 4PB5A 3DENA 1UP2A 2Z2UA 5D2WA 4BK9A 4KERA 4BQ4A 1OYCA 5D04C 4WQ6A 3ABZA 3MDUA 2R82A 3DI0A 2NZLA 1Z6KA 2FPVA 3GH7A 4ADTA 1V8EA 5JIWA 3TOYA 4WY0A 2Z6JA 4I8YA 2FFCA 1OC5A 3NQ7A 4O0QA 2C15A 3QV9A 4PBEA 3WENA 3PUGA 3EDKA 4F66A 1VBHA 5HJLA 2QAPA 1YKWA 3E38A 4US6A 3P93A 5HNNA 4GINA 5AYBA 4Y96A 4D6GA 1G4EA 1V3LA 1ZP4A 4A29A 4H4IA 1GOXA 1W1PA 2AKZA 1NWSA 4JNMA 2INFA 3TSMA 3ZQ9A 3GVQA 4JFVA 4PUNA 1TWSA 3QV8A 2WO5A 4WR3A 1V6WA 1GTHA 3BLOA 4OT7A 5LNSA 5IXEA 4XKYA 5BXTA 2D0FA 5G2WA 4ZGYA 3CHVA 3WNKA 2ISWA 4WOZA 3WMCA 4GBUA 3TLLA 5D2YA 4L6OA 1RD6A 2A85A 1F4AA 3A4XA 3L5AA 1ONXA 5D38A 2X1UA 1PZ1A 1GPWA 1IQ8A 2PRLA 1DBTA 1LT8A 3HBLA 2WKLA 4LVFA 2AQOA 3CTTA 2DGAA 4MJ4A 2CBJA 3TJ4A 3CTLA 3RMEA 2ZVIA 3BVJA 4C1NB 3I4EA 1OWQA 2V5KA 5FL0A 4XAPA 1SZGA 3SN4A 3RLGA 3SJ3A 1CB2A 4PMRA 1XYBA 1KNWA 3D0CA 1V7AA 4HOZA 3ARPA 1UR8A 2Z6IA 4PEKA 3M1ZA 1PWMA 3WUFA 4JQ1A 4LC6A 3O9NA 4Q4MA 1EC8A 4WY0B 3GUGA 4KFOA 3LA4A 3UT0A 3GO2A 4V1YA 4H1ZA 3A3XA 4GH1A 2VR5A 3WD2A 4NF7A 3W81A 1F7BA 2WCSA 4EPDC 5D2TA 3URQA 5IBXA 2ZX9A 3EWCA 3WQ5A 4LRSA 1C7TA 2BP1A 4D72A 1W1TA 3WH6A 4AHOA 1L6YA 1BSIA 4KW2A 1QRQA 3FNDA 2QUVA 1EUAA 1PZ2A 2QHAA 4B5NA 4O1AA 2ZZ7A 3BW2A 4G5DA 2HROA 4DQWA 2PDLA 1IT7A 1NFGA 1XKJA 1B4EA 4E2VA 3KBVA 2VMFA 5BXSA 1GEQA 4ZQCA 4GABA 4E4FA 3PFMA 4B5TA 3ES7A 3WY1A 1NARA 4F8XA 3ZT7A 1RSCA 4W4QA 4RW3A 3ZJ7A 3B8SA 2OX1A 3A4AA 1XUZA 3VFCA 4HK5A 3LCWA 3M64A 4RKAA 3M47A 1XH2A 5A6AA 3ENLA 4MLJA 4MB1A 5CAKA 2PLCA 1XICA 3QHOA 4IPIA 4XWUA 3B05A 3TN4A 1OCJA 2EO7A 3ZR4A 3TAOA 3IK2A 4IP4A 1T40A 2VC9A 3TWBA 1LP6A 5IHSA 2RH9A 2W63A 4FOKA 3FEMA 3B8DA 2BY1A 1J0YA 1FH8A 2CLOA 5A2CA 2VDIA 3PNUA 1WAUA 4CNUA 3CL7A 3AXXA 2I17A 4LYPA 1XHGA 2I14A 2YB1A 1DHKA 1L8NA 3QV6A 4PTNA 4L1GA 2DSKA 3F2CA 4TQTA 4LALA 4CNPA 5C71A 1KQZA 4DLMA 1HG3A 1R3SA 3TXZA 5KMYA 5DLCA 4C1KA 5G1TA 5LIXX 1PDYA 1R8LA 3WNMA 2DZTA 4C6FA 3G1XA 4IQEA 1CXEA 4XUYA 4PUWA 3EWZA 1AUSL 4GI9A 2INEA 1ADOA 1XWYA 1GQJA 1XC6A 3H22A 5E0CA 1VAHA 1X1ZA 4IMDA 1WYIA 2V9DA 4B3LA 4GACA 3K4AA 2DJXA 2Y89A 2POTA 2QCMA 3ZZ1A 1TV5A 4C6LA 2WSKA 4KEVA 4B16A 3KBWA 3WLLA 3DHFA 4HOXA 4H9YA 1CXIA 2QUNA 2ZZ4A 1A47A 2A6LA 4MB3A 1LRTA 1KA9F 2BGQA 2YCLB 4MYXA 2WQPA 1QPQA 3NO1A 2LLEA 5DANA 4LCQA 2MUCA 1WDWA 1G9HA 1I0BA 3BE7A 1NU5A 4RZBA 3WQPA 4AY7A 5KZEA 1Q65A 1XRVA 3U2OA 1IZCA 5DQPA 4QTGA 1ADDA 1O7AA 2Z1SA 3W2LA 3URAA 1GTEA 3TQPA 4LV9A 1FXQA 2WHJA 4ACYA 2X1RA 2E3ZA 1OZMA 3TDFA 2XG9A 4NJHA 3F5JA 3LBCA 4AWSA 1WO2A 3PBWA 4HBKA 5AYYA 1P6BA 4NILA 4R34A 5CPMA 3STEA 1KTCA 1ZAJA 1A0EA 5CSYA 3QMTA 5DFAA 1I2NA 1M01A 4F48A 5CZ0A 1ZRQA 1UJPA 4JGDA 5D9MA 1B30A 4JIHA 4DXVA 6ENLA 4I7UA 4GI8A 2DT3A 2VEKA 4DZAA 2Z28A 1YE4A 1PO9A 3ARVA 1AODA 5I2UA 2XGZA 1KCKA 2YBTA 4WOQA 1HP5A 3GS6A 3M46A 3SUVA 1ZAHA 2XZ9A 4L7ZA 3RJXA 3A5VA 2ACUA 2J47A 2ZZ2A 5K2ZA 4Q7BA 1W91A 1JGIA 5FACA 4ATLA 1H49A 1GHRA 2A1YA 4W7WA 4H2HA 1MDRA 3U7BA 1JEZA 2Y5SA 3CMGA 3UWZA 1C9DA 3IIXA 2PI6A 2HZGA 1OGGA 3S9IA 4QEHA 2Q09A 4DWSB 2DW6A 2B31A 4Q7NA 1E70M 4HNLA 3OP2A 2D20A 5HUOA 5AYXA 3IVTA 3QLLA 3L66A 4LWWA 4MKNA 1TPFA 3JUGA 3PWIA 4XK2A 3QN3A 4PC8A 4UC5A 4YVVA 3L4ZA 2Z27A 2V82A 1R30A 3R8GA 1GVEA 3DOPA 4FLQA 1XUUA 4K38A 2CLIA 4H9UA 1S2TA 2GDVA 3IK4A 3TC7A 3SCPA 3T4CA 1R2SA 1CXHA 2DJLA 1LT7A 1SZEA 2QUTA 1J11A 2NT1A 2OZTA 2WBGA 1JUBA 2G3IA 2ZE3A 1UH3A 3UESA 4J3WA 3W7MA 1OFRA 4HKPA 2R6OA 3QGKC 3H24A 5I3GA 1XQKA 1EJXC 1P0BA 1E4IA 3NEHA 1LWHA 1DWFM 4POCA 4EOUA 2YBVA 3T9PA 4IICA 1W17A 1EJTC 4MY8A 3AXMA 5AVNA 3I6EA 3WQWA 2DEPA 3OHMB 4XZWA 1LBLA 3AS1A 1JPKA 1L9WA 1YXDA 1RBLA 1W5PA 3UPWA 4C6QA 4ZR8A 4DUXA 4IGMA 3BMWA 1UZHA 2OYMA 2CEQA 1I2QA 2CYGA 3K4DA 4GBDA 4GQQA 1ZGDA 4IMCA 1X6UA 1QI3A 5JBFA 4LUSA 4ZOAA 1VFSA 2PAJA 2ZZ6A 3W2UA 2NWRA 3IUIA 3HGSA 1RQHA 3DKJA 3TP4A 1PSCA 2VI0A 3EXRA 4CNTA 1JRCA 3M0ZA 1V6VA 3QHNA 5REQA 3T8LA 1E55A 3MZNA 3MUAA 1ZCOA 1DWIM 3OEXA 5JIPA 1TJPA 4LC8A 2OFJA 3WLHA 1I1XA 3QGVA 5A5WA 1FDZA 3K5XA 3T40A 4DLFA 3OHIA 1D8CA 4F0SA 3R43A 4YNGA 2NQJA 4I5UA 5E9AA 2XUCA 2YXXA 3CAWA 1OABA 4L4OA 2JKAA 4MUZA 4HU8A 3E2VA 3VIIA 3VFLA 1AQMA 4JKKA 2EJAA 3E0LA 3LHUA 3CIVA 2NV2A 3C2EA 4G7EB 3LUTA 1GPFA 3IAQA 3WDPP 5FSDC 3PZIA 4IH3A 5E70A 3LRMA 4ILSA 2BY3A 4HZMA 2DH3A 3WF4A 3D47A 3VIOA 5A6LA 3GW0A 4LY8A 3CH0A 3TOPA 4FEZA 4F2BA 3CLWA 1UD4A 3NSNA 3AUJA 4YWIA 1K4GA 1J6OA 2F6XA 3TONA 1E15A 4PZVA 1UP3A 1FHDA 4Q3MA 4S3EA 3AMDA 8TIMA 1C3FA 2XZ7A 1B31A 3WCZA 4L61A 2P50A 1O94A 3KVKA 1BYAA 1R5YA 4RNJA 1ZJIA 1N8IA 1VZWA 1Z48A 3I3DA 1FP9A 4JHOA 3CMJA 3OG2A 3W7GA 5D8WA 2ICSA 3SUWA 4I90A 4G56A 2FZNA 2OZ8A 2YCJA 3LXAA 1B1YA 5LGZA 3EOEA 5H91A 3U4AA 4O17A 4G2DA 4LS0A 2C19A 1M3UA 1TSIA 2FZBA 2G5WA 5FOOA 2BWGA 4BEQA 2OSXA 2XM2A 4JTTA 4GQRA 4UFKA 1TIMA 3BQ5A 4UZSA 3VVGA 4ZQOA 1T99A 4YHEA 3H7UA 1S5NA 5CBIA 4DPQA 3QFWA 5AKQA 4LBRA 4K37A 3A21A 3B97A 3I65A 5HWNA 4NZJA 2FHBA 3VM5A 3DECA 1D7KA 5I3KA 4IQDA 4FXFA 2E9LA 5HPCA 3W7OA 4MPQA 4JTSA 1J9YA 2HJPA 1PTDA 4GZ7A 4GGHA 3G0SA 2R1NA 5TD4A 4WLCA 3KX6A 4GMEA 4ZO7A 5D4YA 4KS0A 2J9YA 2XN0A 1E9IA 1TR9A 2J7CA 3PBMA 4NZ5A 1ODUA 1ZUAX 3MPGA 2PE4A 3VMPA 1B3ZA 3DFHA 1QI4A 2PB1A 3NM1A 3LHTA 1JDAA 2CBIA 1QHPA 1NSJA 1CXFA 4GIRA 1MUCA 3LCXA 3R2GA 3GG1A 3HQOA 3OVRA 4NAFA 3OLIA 4GY7A 2OEKA 4MSSA 3VILA 5C7VA 3AIUA 3OGRA 3PTDA 3CUFA 4N4QA 3M5VA 1PKYA 3I68A 4XUGA 4Z1CA 2V30A 1UHVA 3QOMA 4EE9A 3OVGA 1VENA 4LS1A 3L4TA 1J0IA 3UD6A 3FY1A 4IJCA 2B4GA 1KBIA 4HNTA 2YL5A 4UWMA 4WKHA 3MVIA 1B0IA 3EWWA 3GDLA 2VZUA 3GFXA 4XZIA 1A5NC 1MYRA 4PMJA 4TVCA 1CZ1A 1DVJA 3V36A 1RR2A 4RW5A 1C91A 4Z0JA 1OD0A 4NXKA 2ZCGA 3O05A 4LBSA 5CQ1A 3H2MA 4XAFA 1ECEA 4QS5A 1D8WA 3K1GA 4A4AA 3GIYA 5XIMA 1CGWA 3RXZA 1ZS2A 3ORWA 1ELSA 1DE5A 3M0JA 2QIIA 3WF0A 1A49A 1DORA 4P5UA 5D32A 3BSGA 1RK5A 3GDBA 4CD6A 4J3VA 3THCA 2GJXA 3NM3A 1ME8A 5IHRA 4GIEA 5K4XA 3E12A 2X0SA 4BI5A 2VZTA 3BICA 2QLYA 1R3WA 1E71M 2GVLA 2VQUA 2YL8A 2PTXA 2QPUA 3TR2A 2GSEA 3GDKA 3B9NA 3LBMA 4B5UA 1RVGA 1FHLA 5LXEA 3MBFA 2CHNA 1MWOA 4XBKA 2UY4A 2E6DA 1F61A 4L80A 5HNRA 3GHUA 1IIGA 2X2GA 3ARRA 3LTPA 4GUHA 4IJBA 4AWEA 4GXPA 3M44A 4IQLA 1W2VA 4PMOA 1V3IA 1A5KC 3TK7A 2ISSA 3LGEA 1BQCA 1E3ZA 3KTCA 2OELA 1MZHA 4L9XA 1EIBA 4C6EA 1DWJM 4EXAA 3RM9A 2X1TA 4I9MA 1JPMA 4QSHA 5D37A 5FF2A 1W3HA 3QPYA 4LNCA 3OLDA 4ZE5A 1KV8A 4Q4QA 3QPEA 3KRBA 1V02E 4GJJA 4LUTB 5CSSA 5FEWA 5C70A 1S5MA 4C65A 1QWKA 4JTRA 3RR1A 3N15A 3ZLFA 4IG2B 1RA0A 2WSPA 1LL6A 1F6PA 4WZHA 5CGTA 1ONEA 2WPBA 1TV3A 1GVYA 3B9DA 1E6SM 2Z1BA 3UFYA 3B8UA 1QPKA 2DORA 3M0XA 4XO7A 4CCCA 1E4LA 3IAPA 4RE0A 3SB0A 1W2PA 5FF4A 5I5RA 2PLKA 4ZA0A 2QZRA 3NQ6A 2WZEA 1SFTA 4LUIA 4GVIA 1RLDA 4D6EA 1UCWA 3S6OA 1MXSA 3DH7A 3AMLA 5J8LA 3R58A 4RJEA 3VNYA 5IM51 2OT1A 3B04A 2QJJA 4KFPA 1DPMA 3WQDA 2WWDA 3HA1A 1W5MA 3VNKA 3B8WA 1XIFA 5C0QA 1HKWA 1W8SA 5KETA 3V5FA 3E2SA 3REQA 4PB4A 4WK9A 1QI0A 2BVDA 4FR1A 3URNA 3M0HA 4M51A 3BAXA 2V0TA 4FALA 5FL1A 1UPMB 4EPBC 4OTKA 2VT0A 3W76A 2PDJA 3MJMA 3UWVA 1TJ2A 2CNCA 3CYVA 1GQKA 2FTWA 2RGLA 5IDZA 3BLPX 4BEUA 4V2XA 4FNUA 3KOFA 3MV11 4GHRA 1IWBA 3VDCA 4BI6A 3DU0A 3ZJ8A 1UKPA 1RCOB 3U2CA 1PYMA 3MYOA 1KR0A 4LS2A 2OXNA 1BXNA 2HS8A 3B8IA 1ICSA 1YBQA 1HJXA 3GVWA 4W5ZA 2Z7GA 3VNIA 2EPMX 1VHNA 1AW5A 1VIWA 3WMBA 3CXOA 3NTYA 2FTPA 2I5IA 4GUIA 2NVAA 3SECA 4LXFA 2P5NA 4J40A 3RM8A 1W3IA 2WSRA 5J04A 1AH3A 5BRBA 3MU7A 3P81A 1DIEA 3BWWA 4JDBA 1KWGA 4HNOA 3WLOA 1NDVA 4KPLA 2GUUA 4UTKA 2YW3A 4HNVA 3MI3A 4AD0A 2V3FA 4LFYA 1FWWA 4OFCA 5CG0A 3WK1A 1HJWA 1MNSA 3OGVA 3DN5A 2YCLA 5M2FX 4IXXA 1EBGA 3VOFA 1LUCB 4UOJA 1FCUA 1H60A 5ABFB 3JZUA 2PCQA 3HQPA 2W4XA 2X0HA 3MW7A 3AROA 2UY5A 1A5MC 4AEFA 2H8ZA 3AIVA 1CGXA 3IJ9A 1PKLA 3L65A 3W4RA 5A6BD 4NJIA 3CB8A 5BXPA 1S2VA 5AZ1A 4DIAA 1DJHA 1J6PA 2V5JA 4KQNA 1XBYA 3VNMA 1A3WA 2VO5A 4A8LA 3PBVA 1JI2A 2CCRA 1VRXA 3PJWA 1WZAA 1KD0A 3W01A 3T05A 3QC0A 2EAWA 1PIGA 5JMUA 4UUIA 1HKJA 3PFRA 3P14A 1XRFA 5AC5A 4PUJA 2ZRYA 4F0KA 4US5D 3LERA 4YHGA 4MMWA 1UC4A 1H62A 1NWTA 2J74A 4HA3A 2Y5JA 4X0VA 1OEPA 3OLGA 1RD5A 4M81A 3TROA 1XYAA 5CH9A 3BW3A 1UROA 2GGHA 5EFDA 1ZBVA 1AH4A 3O6CA 2EG6A 1WOAA 2HWGA 1UQYA 3PUEA 4H9VA 3M0IA 4Y2WA 4BWLA 1DJQA 2X30A 1SMAA 2OQLA 3SCTA 3TMQA 5HBFA 1OX6A 1AFSA 4HHMA 2A3AA 4JN7A 2J88A 1XP3A 1XIEA 4GY1A 3W88A 1WP6A 4Y9PA 2G97A 4S39A 2YW4A 1B3VA 1U83A 3UG5A 3GG0A 3IJIA 2WMFA 3FGCA 1XIHA 4H7CA 1E5JA 1PS9A 3TNBA 4IMAA 2CBVA 1TTPA 2Z26A 5A8PA 4MFEA 2PZ0A 2YYTA 3C86A 4R7OA 4XIMA 2OWWA 3LGDA 4LT9A 2W66A 1RCXB 2QDGA 5HK4A 2P8BA 1V79A 5A6SA 1ZJHA 4L5ZA 2DQWA 2QCLA 4R9OA 1TWIA 5DT5A 1D3CA 4V28A 5AB3A 3S5SA 4KEUA 1OD8A 2CETA 4KCWA 2HBXA 4DBSA 4NZ4A 4A8NA 2V2CA 2VXNA 2QCDB 4TMCA 3W73A 4M1RA 1LL7A 3H54A 1J0ZA 4MNKA 1E6PA 5HQMA 1CCWB 4NRRA 1LOQA 5EMYA 4I8DA 4BF9A 2OTDA 5AZ0A 5HWJA 2VEMA 3GC4A 1KB3A 4UTLA 3WDHA 1SO4A 1X98A 2FB3A 2WXDM 4M29A 5HAOA 1THFD 1HIZA 4E38A 2J8TA 1WKDA 3LG3A 2YDSA 3MMUA 4YIWA 4XBSA 2FH8A 1XLLA 4O28A 3T6CA 1NDWA