2PDBA

Human aldose reductase mutant f121p complexed with zopolrestat.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEPFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdbA00
2DV0A 4PUUA 4JTRA 1XGDA 5HA7A 3FX4A 2PDNA 4FAMA 3O0KA 1ZUAX 3GHUA 4XO7A 2WZTA 4XZMX 4WGHA 4L1WA 1AH4A 3LZ3A 3T42A 4ZFCA 2NVDA 2PF8A 3M64A 3G1RA 3UYIA 2PDBA 3CAQA 3GHSA 3V35A 2FZBA 2HDJA 1LQAA 4LB3A 2ALRA 3UP8A 4YVXA 3V0SA 1J96A 2PDMA 2BGSA 2BP1A 3FJNA 1S2CA 1Z89A 3LQLA 1YNPA 4IJRA 3Q65A 1VP5A 2IQ0A 1X98A 1GVEA 1PZ0A 4DBWA 4DBUA 4GACA 1PYFA 4GQ0A 3O3RA 3LN3A 4YVPA 4DBSA 3UFYA 4ICCX 4DZ5A 4IGSA 3CV7A 1UR3M 2PDPA 5LIYX 1IHIA 4FALA 4HMNA 2IQDA 2HE8A 4QR6A 4F40A 1AZ1A 5JH1A 1ZGDA 4EXBA 1X97A 5M2FX 4YU1A 2IPFA 3MB9A 3C3UA 3P2VA 3V0UA 4JQ1A 2IKHA 3VXGA 2ACQA 2IPGA 3ONCA 4XZNX 3U2CA 3ONBA 4YVVA 3QKZA 5LIXX 3V0TA 2A79A 3D3FA 5AZ0A 3F7JA 5KETA 3LD5A 4XAPA 4QXIA 3R94A 2FVLA 2PDIA 3R7MA 2DUXA 2NVCA 3M4HA 2IPWA 3UZXA 3R58A 4JIRA 2F2KA 1AFSA 4GIEA 3LQGA 4Q7BA 2PZNA 1HW6A 1RY0A 3UZWA 4FZIA 1K8CA 2PFHA 4GABA 1QWKA 1T41A 2INEA 4OTKA 2BGQA 4IJCA 3GHTA 2C91A 1Z8AA 3M0IA 2IS7A 2PDJA 3R43A 4GCAA 3UZYA 3BUVA 3WCZA 2AGTA 1IEIA 2PEVA 2PD9A 3R8HA 3UGRA 1Q13A 3S3GA 4JIHA 2PDWA 5C7HA 1ZQ5A 1ZSXA 2PDKA 2ACUA 1Z3NA 2DUZA 3KRBA 3LZ5A 2R24A 3CMFA 4H8NA 3WBYA 4LAUA 2FGBA 1Q5MA 3NTYA 2I16A 1R38A 3CAVA 4XZHA 4MHBA 3BCJA 4NKCA 2IPJA 3CASA 4LB4A 1PZ1A 4JTDA 2PD5A 4PUWA 2PDHA 3BV7A 1T40A 2QXWA 3H7UA 4Q3MA 1LWIA 4PR4A 1FRBA 4GA8A 4L1XA 4XZLX 1PWMA 4PRTA 2PDXA 3EB3A 4QX4A 1JEZA 3Q67A 2I17A 4HBKA 1AH0A 4XZIA 1YNQA 3EAUA 1X96A 3LBOA 3COTA 4XK2A 2HEJA 3RX2A 2R9RA 4JQ4A 4XVEA 2IKJA 3ERPA 1YE4A 2PDLA 3B3DA 1EXBA 3H7RA 1S1PA 4JQAA 3CV6A 4QBXA 1RALA 2PDFA 2VDGA 3UWEA 2PDYA 1EF3A 3LENA 3DOPA 1C9WA 3H4GA 2HVNA 1ADSA 2ISFA 4PMJA 5DANA 2WZMA 4LBSA 2P5NA 1VBJA 1PWLA 2PDGA 3WBXA 3GUGA 4PRRA 3UG8A 5HNTA 2ACRA 1US0A 3R8GA 2HVOA 1MI3A 2INZA 2HE5A 1QRQA 2FZDA 4WDTA 1SM9A 4EXAA 4JQ3A 4JIIX 4WRHA 4XO6A 2J8TA 5LIKX 3EB4A 4JTAA 2IKGA 4WDXA 4WDUA 3WG6A 3RX3A 1XF0A 1AH3A 4ASTA 1MZRA 4WEVX 4LAZA 4AUBA 2PDUA 1OG6A 3R6IA 2F38A 4FA3A 1Z9AA 1HQTA 1EL3A 1M9HA 3LNMA 5JH2A 3LEPA 2IKIA 4WDWA 2ACSA 3WBWA 3DN5A 4XVDA 4G5DA 2PDCA 4YS1A 2FZ9A 4I5XA 1S1RA 3UZZA 5AZ1A 1YE6A 1S2AA 1EKOA 1XJBA 3MC5A 1MRQA 4R9OA 4JTQA 1RY8A 5LIUX 3G5EA 4JTCA 2FZ8A 3BURA 3RX4A 4RPQA 4JQ2A 1AZ2A 3N6QA 1A80A 2CLPA 3LUTA 4LBRA 2HV5A 5LIWX 5HNUA 3N2TA 4H7CA 4GQGA 3V36A 2PDQA 3GHRA
chains in the Genus database with same CATH superfamily
3EPOA 1EPVA 1UA7A 1CCWB 1O95A 3ES8A 2RHGA 4NZ3A 5AC6A 4PMNA 1TIMA 3PNUA 1GYMA 3HA1A 4H9XA 1SR0A 3W85A 1J2BA 4J27A 1B3WA 3PUGA 1DVJA 3IIVA 3UT0A 4LB3A 4B2DA 3LGGA 1XSJA 2XDFA 4YVXA 4X60A 1ODZA 3FIGA 1BRLB 4ZB5A 3F4WA 3KXQA 2RDWA 1D3GA 1FDJA 3BAXA 3FDGA 1W3HA 5I77A 5CSUA 2TAAA 3D6NA 3UBPC 3ITCA 4GZEA 4LT9A 3TQKA 1V3JA 5LA0A 1DHPA 2WM0A 3NM1A 1R87A 1JVNA 1TA3B 3ANUA 1V6XA 1J18A 4IP4A 1E4NA 5C0QA 2FDMA 2PDPA 5DBTA 1NM9A 3CWOX 2XYLA 3WH8A 2PCEA 4BEQA 1X6LA 1YW1A 2YDSA 1BD0A 1AZ1A 1G94A 3AS1A 3LHTA 4XIAA 4E5TA 4WJXA 1VIWA 1KRAC 3TJXA 1S2TA 3EPNA 3RGTA 2ACQA 2ANUA 2FZMA 1OT1A 3MMTA 4N9CA 2VR2A 3VMPA 4ZTXA 4ZMGA 3GXPA 6XIMA 3R25A 5TNVA 3DC8A 3D3FA 1C92A 4J3TA 4C7FA 1US2A 5E93A 3T9PA 3HGJA 3S1WA 3QR0A 1WDPA 2CZDA 3ZR6A 1XC6A 4J3UA 3UPMA 2OQLA 1BFNA 3GDTA 1LL6A 4HK6A 4AIOA 2WAGA 1R3WA 3FXGA 4TXEA 3ZJ7A 2XFWA 3WLTA 1OK6A 4P7NA 1PHWA 3W6YA 5F2GA 2F7FA 4RPPA 4NI3A 2BFGA 4ATLA 4GABA 1KGXA 3AYSA 4WHBA 1XYMA 5SWUA 1AUSL 4DLMA 2G3JA 1XLCA 3IUIA 3HF3A 1KCKA 2XPKA 3MT1A 4OOUA 1F73A 2FZNA 3W7LA 3QOKA 3UZYA 3OYZA 1MDRA 1JDFA 3A4XA 3G8EA 4QDPA 2JKAA 4L9YA 3GY1A 3G3DA 1CB7B 4FIQA 3FA4A 2F2HA 3S3GA 4D6EA 3H8AA 2Q3OA 3QLLA 5C7HA 1J5SA 3W24A 4NT0A 3E2RA 1E0TA 4X0VA 1OYBA 3BLLA 2PTYA 1LBLA 3OIHA 5AHIA 1W1YA 1DJNA 3ELFA 3MJMA 4G56A 5B7YA 2QJHA 3IK4A 4XX6A 1HFBA 1ISYA 3M1ZA 4LGXA 4JY9A 1FHUA 4TVDA 1T40A 4XZBA 3NO3A 1TR9A 4JTKA 3G1FA 4HQVA 1TPC1 3SCPA 2AOSA 2X42A 1NVMA 1XLGA 1XG4A 4Y2WA 3HGRA 4ZSTA 2VGIA 2ZZ5A 4ZXLA 3WJZA 3EOSA 5JMUA 1OX5A 1OX4A 4IOTA 3O6YX 4R9XA 1IQ8A 1PHQA 3ZZ1A 1XYCA 4H00A 4AWTA 3ZVHA 4ZQNA 2EKGA 3GTHA 1ADOA 5ABFB 3A4AA 3ZXWA 2PC8A 3W2KA 5CLTA 4M82A 4RDWA 3A4JA 3OBKA 1GVFA 4ENLA 3LY0A 3S1GA 1H7RA 4S1FA 1J9YA 3E5BA 4PULA 3UA3A 4YHGA 4M81A 4LOCA 3W28A 3GUGA 5LNSA 1US0A 1UD6A 4JFTA 3ZT5A 5CPTA 1YEYA 3O6CA 4PMOA 3VKJA 2VC6A 1D7FA 1YQ2A 3M6YA 3UXLA 4O1AA 2GJXB 1H7XA 1T6MA 5CLWA 3LMZA 4Z1CA 4MZ8A 4DUWA 3IEBA 4FSAA 3VNZA 1M01A 3IJDA 1AL8A 3WSUA 4DJFA 3ITOA 1EJSC 2AQVA 1KB3A 3B0VC 3UNTA 4JIEA 3L4UA 3QQWA 1TWZA 3W75A 3B9EA 1JDEA 3EOEA 3RMEA 1P1XA 3S47A 4A3RA 1KM1A 1O5XA 1OG6A 3BSHA 3NO5A 1FH8A 1POKA 3BLKA 4LRTA 3OQ8A 1ICQA 3NQ2A 2PC4A 4U3AA 2E6AA 4UMBA 4JX6A 4NJGA 1J4EA 3ZLFA 3UERA 4YS1A 4O0ZA 3UXDA 1L2QA 7ENLA 1WZKA 4JTSA 3ARPA 3QYSA 1I9CB 1V7AA 3BQ5A 3W7QA 1VBRA 3E3HA 3G1XA 1XQKA 4XB3A 3W83A 4L9ZA 5DT5A 1QOPA 1G5AA 4IFRA 1QATA 3TROA 2GDVA 1R3QA 2W5FA 3UJSA 3VKAA 5AECA 3MCMA 4CD6A 1JNDA 4LW7A 1M65A 4C6NA 1BXNA 3V5OA 3DEQA 1XFCA 1ZAJA 4O1EA 3M7SA 3VCRA 3GU2A 1I2NA 5HNUA 3HU7A 3GW3A 4J2MA 1CGXA 1RLCL 3HG2A 4GQGA 1QO2A 3ABQA 4WJ8A 1MEWA 4O18A 4OZOA 5TAOA 5BZAA 5FACA 1EUNA 1AMKA 2TRSA 4KBXA 4QCFA 2PRHA 4AMAA 4AD5A 4R7OA 3WLIA 3QZ6A 5KSWA 1DJGA 1R30A 3WX7A 4U31A 3GHUA 3P3BA 2OFJA 4O28A 5BWFA 1TV3A 2G3NA 1E6SM 4WGHA 2LLEA 4C1NB 2HXTA 1YMYA 3C5QA 3G0SA 4MFDA 4LC8A 4JD4A 4R53A 3THCA 4Y8FA 1LT7A 5HJYA 3ZYZA 4AHPA 4H9MA 3CV2A 3ARVA 3RITA 1CGYA 4I3GA 2HS6A 5A8PA 1EDTA 1GQLA 4IJRA 4FX7A 4NUWA 4E6MA 3TYEA 1KCZA 2D2GA 2WSYA 1CGTA 5A3HA 4ZFMA 1UA3A 3O2LA 1GKRA 1XLKA 2W66A 3K5XA 1CGUA 4K2SA 2Z1WA 1GVEA 2ZZ6A 3O9NA 1RH9A 1A5CA 2YYTA 3BW3A 2BY1A 1K4GA 2FH8A 5BRBA 4GZJA 2YA1A 3Q58A 3KUMA 5IBXA 3GFZA 3SJNA 3CM4A 2QHAA 1CX9A 3UWWA 3WY1A 1HKMA 1AVAA 4CNOA 1FVPA 5D33A 3S5OA 2VR4A 4FF7A 4HU8A 2IQDA 4KMQA 3UJFA 4ACZA 3PPHA 4IG2B 1N2VA 1FY6A 2QPUA 4HMEA 1ZL1A 3ENLA 3TN3A 4XKYA 3LG3A 1JXKA 2V6AA 3AIUA 4BFAA 3T7VA 3N04A 1EDQA 4QAWA 2NT1A 2Z24A 3PP7A 1DJXA 3GU9A 2YCEA 1A5UA 3VUPA 2OZ0A 1E4MM 4OECA 4QSHA 1J6OA 3URBA 4UCGA 2DUXA 1OYCA 1UWIA 6A3HA 3OYXA 4PB5A 1H3GA 3I68A 1PZ3A 5G2HA 3BZJA 3WLKX 1GVSA 2TSYA 1A0DA 4B5UA 2R82A 2WOQA 4HB7A 1PIIA 1DJZA 2P10A 4Q7BA 5CJMA 3CO8A 4FZIA 2X05A 2GJLA 4Q4MA 3P8JA 4IXXA 3A47A 4Y8EA 5HDRA 1B90A 2QUTA 4NG3A 1GOXA 3CL6A 1XV8A 3RG6A 3E9AA 1NU5A 3V18A 4WSKA 1JPIA 1DPMA 1SUXA 3GC4A 4QCEA 1A3XA 2WSRA 1A53A 2VD9A 5BOFA 3CEPA 3WF2A 5AYXA 4JTUA 4AY1A 4O16A 4PSPA 1PTAA 4HNLA 2V68A 5M17A 2BOGX 3TMLA 2IMRA 3A13A 3U6WA 1EOKA 1XDLA 1ZS2A 4NVTA 3WQ5A 2ACUA 3B03A 1Z69A 1Q2SA 3B8DA 3N4AA 1A0CA 2ATMA 2VDIA 1AQMA 2GQAA 3WLSA 2CBUA 4IF2A 4D1JA 2CCRA 3SDOA 2IXVA 4NQ1A 3WBYA 4IH3A 3CZ8A 4C6IA 3KW3A 4NKCA 2IPJA 2W0UA 1VFUA 1NFBA 4R33A 3UG4A 1ECQA 4ORMA 3MWCA 2R8WA 3ZLHA 2EF9A 3VNJA 1EIBA 4DO4A 1EJUC 1V02A 1AJZA 3P61A 3LYEA 1WAUA 4NL1A 2Y7GA 1UPPA 1JPMA 3MI3A 1L6YA 2Y88A 4HSOA 4B5SA 5D2XA 2YFOA 4GFIA 4L1GA 3UD6A 2E68A 3OZYA 4BI6A 3OEXA 1L6FA 1YNQA 4B16A 3LDVA 3EWYA 3L4ZA 3TR2A 4Q6JA 3F5JA 2ZUMA 3AIRA 1IZJA 4HZ7A 3TKFA 3ERPA 1ZJIA 4BR1A 2OQYA 1W2PA 1KTBA 1R8LA 4QGCA 4UTFA 3S9IA 4EF8A 2G41A 2AL2A 3ZS4A 2I5IA 3B8SA 4GI8A 2ZE3A 2OLAA 3TAOA 1Q4NX 4DO7A 2FJKA 2OO0A 2V81A 1VS1A 1MW3A 4TMBA 1QAPA 1PWLA 3WF4A 3W88A 5GJPA 2C13A 3BDKA 3SEPA 1WCGA 1XQLA 3N13A 4P7RA 3PF3A 3GVWA 3OU8A 1TV4A 2WWCA 1MUCA 1P7TA 4MF4A 5LA1A 1LTDA 3IJLA 4IQEA 2QUVA 5CBIA 2E1DA 3R89A 4O1BA 2JF7A 4TTGA 4LANA 1S38A 3ANYA 1KV8A 5HK4A 3P93A 1P43A 4UQCA 3UCDA 3ES7A 3AHVA 4Y9PA 2V3GA 1F6KA 3TN4A 4BQ5A 1A47A 1JD9A 4PTNA 3S42A 2IKIA 2NUXA 5JIWA 4AIEA 4FI4A 2ISWA 2E9MA 4IMFA 3TW7A 3HPAA 3F4VA 3GH5A 1X1NA 2O7QA 4DPQA 4GUFA 3DYPA 4AY8A 3UJ2A 2OOFA 3CB8A 4LUTA 3N34A 1GJWA 3G5EA 3C56A 3PZOA 4S38A 1CXKA 1QWGA 4MM1A 1HP5A 4G8TA 2PB1A 3M7WA 3PG8A 1OZMA 3C61A 2QPSA 2HTMA 2WLZA 4DPPA 2GWNA 3NL2A 1PX4A 2QDHA 4ZOBA 1N8FA 1ELSA 4Q8PA 3V4BA 2GDUA 2P53A 3NGFA 3Q45A 1BVNP 1OK4A 3AHYA 4O54A 1JZ6A 5HJXA 1GCYA 3VNKA 1MEIA 3W7IA 5EGRA 2MNRA 4J5NA 1NQKA 1TREA 3M0XA 4CCCA 3UJEA 2JKPA 3MDUA 4H6QA 1J2WA 3M0LA 3O0KA 1Q63A 3MYOA 1FWSA 1F6PA 2VZOA 3C6CA 1TIWA 2P8CA 2WZTA 4OU1A 4EK7A 3VD5A 3S1XA 4AD3A 4JYEA 2QPXA 5HNRA 1FWRA 1M03A 2WJEA 1VEMA 4JOMA 1YNYA 2B7NA 2B7QA 3TQ0A 4DIAA 3BMVA 1LJYA 5DCBA 2G4JA 4YXGA 4M8UA 1R46A 4GNVA 2ZUSA 1WDRA 3W71A 4IT1A 2TYSA 4PMZA 3ARQA 1PS9A 1UIOA 4DYEA 2C3ZA 2INFA 2DZPA 4M19A 4DX3A 1W2VA 3LS9A 1SZNA 3BVJA 1NWUA 2PODA 5G4WA 3LV6A 1LWHA 3VVGA 2GGGA 5AHNA 3OLEA 4IHCA 1GVQA 4QISA 3PTKA 1CDGA 3W1LA 4XTDA 3CO4A 1JDCA 1DHKA 1N7KA 2BMBA 4GO8A 3VKDA 3PBMA 4DBSA 5C71A 2YW4A 2CLOA 3CV7A 3EMZA 4KT2A 1XIEA 1DIEA 1OYAA 2BY0A 4WF7A 1XXXA 2QV4A 1EDGA 3I7SA 3B40A 4EXBA 2J9ZA 3MO7A 3C4UA 3H22A 3HQNA 4Q33A 2C0HA 2IKHA 8CGTA 2PBGA 3GBDA 4CVWA 2VNCA 1LL4A 3CT2A 4B5XA 1T8XA 3ATYA 4QE5A 3VC6A 1J0JA 1B2YA 5LKYA 3VAVA 5LIXX 4QSFA 3W22A 2OODA 3F7JA 3EGJA 4NX5A 5CC7A 5HPCA 3T0BA 4YYFA 3GKFA 5GNZA 2P3ZA 1WDWA 2ZZ4A 2X1RA 2XISA 2OYLA 1HJSA 3USZA 1OY0A 1B57A 1RJPA 1A4MA 3SCRA 4RNHA 3L4WA 5EFDA 1Z48A 1IZCA 3CMJA 1K7XA 1YXCA 3NEVA 3QH2A 7XIMA 3T8LA 4K36A 1E3ZA 4QJ3B 1HGWA 4HHPA 4IISA 4PBGA 1J11A 2QT3A 3H55A 5EMUA 1RVGA 4Q8MA 4IMCA 4PMUA 4O12A 3UPWA 4F2BA 1KBKA 5EPDA 1LRTA 2ISDA 3CQJA 3APGA 3PB2A 4MY9A 4ZO7A 1VB9A 3AZRA 1IWBA 4A2RA 1TE6A 2XVKA 3W4RA 3WNMA 2PDJA 1E4IA 4ZTYA 1RPKA 4W86A 5HR7A 4IMAA 1SGJA 4DWSC 3L66A 4QJ1A 3PUDA 2QW5A 3E0FA 3QV8A 2PGRA 4FHAA 3KL5A 5D2VA 4NZ1A 3JZEA 3V7PA 3U57A 3EKLA 2QDEA 3G1VA 3IS4A 4DWSD 4J7RA 4V27A 1JCXA 4IQLA 3VNIA 3THAA 2HRWA 4LX4A 4GKLA 2HCVA 3F03K 3CHEA 4GJJA 1V3MA 4ZO6A 1KCLA 4EPDC 2HPMA 3SR7A 3KZPA 2ZOXA 3M5VA 2OZ8A 1WDDA 2FVMA 4FNUA 1XIHA 2CHRA 1GHSA 3AXXA 4GUGA 1J0KA 2E5CA 3L9CA 1FRBA 2VEPA 1BG9A 1HL2A 4WXZA 3GVRA 4QX4A 1EZ2A 4B9YA 4JNYA 4AC1X 2EEXA 2ZVRA 1AH0A 2IW0A 5E9AA 3W1TA 3YPIA 1R2RA 3GFXA 1V0MA 2VXNA 4NZFA 1SO6A 4GPNA 2PWEA 3W38A 4QQ3A 4EVZA 3AIEA 4WGXA 1W17A 4PTMA 2I7GA 1NJJA 2A3CA 4LUSB 1YE4A 1RPXA 2XG9A 1FWIC 2FFIA 2QNEA 2ZDRA 4UQAA 2RFGA 5E6YA 2G8ZA 5D9PA 4W8LA 2PDFA 3VYLA 3H21A 1RJRA 3FAXA 3JR2A 3LM7A 4PUJA 4J3SA 4OOZA 4P8UA 1X1OA 2G3FA 2P5NA 2JALA 1VBJA 3TW9A 2AAAA 4W5UA 3WBXA 4IFKB 4MWAE 3ZT7A 3SQLA 4CVUA 2GOUA 3TN5A 4RK8A 2HE5A 3NQMA 1JDDA 1B9ZA 3BAIA 1UUQA 3W76A 4HVXA 2QCLA 2Z29A 5CSRA 3LRLA 2J8TA 5XINA 3JU2A 2OX1A 3EKZA 5IHSA 1EIXA 3RX3A 1XF0A 4K1GA 1ZJBA 3WK1A 1MZRA 2G5WA 3DBNA 4ZODA 3U0HA 1R9ZA 5G2IA 2J7EA 2YBVA 3SCVA 4D2JA 2ACSA 3WBWA 3MCNA 1UP3A 2X1SA 2YDRA 2AMXA 1VBHA 2OYMA 3PBYA 3TIMA 1FFRA 4KIEA 2PTWA 4A3HA 2W63A 2XIOA 2I5GA 1GJPA 1EKOA 1H1ZA 3NQFA 2D2OA 3MZNA 4C6BA 4PTWA 1XBYA 5CG0A 3RN6A 3R13A 3UGVA 3SCNA 3BURA 4LYQA 3TOPA 1RD6A 1H09A 3Q4DA 2QAFA 3WFLA 1FUYA 3EX1A 2DJLA 4RZ4A 2WMIA 3SUUA 4S2BA 1UWUA 3W7HA 1R0MA 2PGFA 4QNWA 3PANA 2FPYA 1CIUA 3MUXA 1WA3A 2VMFA 2WNNA 1UH4A 3PBUA 4OWGA 4UTTC 3TTOA 3RCNA 4DNHA 3SRFA 2XIJA 4LU0A 1MWOA 1YHTA 2GQ3A 1V3LA 1A49A 3WNPA 3RJYA 2ZIDA 3E5PA 2YJQA 4E38A 1JJKA 3M0MA 3TDFA 3NCOA 3SIZA 3VGGA 1LQAA 2Y7EA 2CERA 5FL0A 5AHEA 4E8GA 1XWYA 4HA3A 1FCVA 3NA8A 3OG2A 4PYSA 5EMKA 2G95A 1WNOA 3H6OA 4GD0A 2HWGA 3UR2A 4F4RA 3WLHA 2WMHA 3F2BA 1B31A 4G7FA 4IUGA 1QBBA 2XVGA 4JHOA 4C6DA 3QC0A 1LRNA 2QCGA 1XPGA 4HCDA 4BEUA 4GQRA 3VINA 1F9CA 4AU0A 3LB0A 4DBUA 3GZAA 1J12A 4GACA 5LXXA 4ROPA 3W25A 4QRNA 3TONA 2DVXA 3NL3A 1H51A 2Y5SA 3OZOA 3GH7A 4WX2A 3QR1A 1EGZA 1PB0A 3W1QA 2ZRYA 3WMLA 1W9PA 1IHIA 3A9IA 4GJIA 1SSGA 1NY1A 1TELA 1RJQA 3LXAA 2WM1A 1ISZA 3BE7A 4UTKA 1ZPTA 1DIDA 4XV0A 4RXFA 4R27A 3TTYA 4XZNX 1XIMA 1ZP4A 1SFLA 3O7UA 4MJMA 1RA5A 4Y96A 3NZGA 3JVAA 3L12A 4DJDC 3PUEA 4PCNA 1WPCA 4PUEA 4XAPA 3CQHA 3M44A 3DBPA 3CIVA 4DELA 1A5MC 2QCFA 3NEHA 1T8QA 1KM5A 1Q85A 4DJDD 1IEQA 2IPWA 4CCDA 2Z2AA 4Q7NA 4DM1A 3R58A 3BOXA 3VFLA 2G3MA 3KS6A 1XIDA 4FPSA 2BXVA 3T78A 1RP8A 5C2CA 3P67A 4NJIA 3TCSA 3V5CA 1K8CA 3C52A 1RQHA 3ITTA 5XIAA 1EYWA 1XIIA 1T41A 4N2YA 4JIPA 4L4MA 3N12A 2I9EA 1XW8A 1H1YA 1JAKA 4Q22A 1DWIM 2DT2A 2FHFA 3EOOA 4MJ2A 2G0WA 4A3YA 2ZICA 4BZYA 2VFIA 1PVNA 3ZOAA 1CXHA 1KBBA 2D0FA 2WMJA 1LUCB 5EBAA 3SCOA 4MUPA 4NAEA 1EPXA 4GXPA 4E2DA 1DXIA 2XU2A 1ZFJA 5REQA 4J3VA 4ZOCA 3NTYA 3TYBA 3VZXA 2UY5A 1Z32X 4QS6A 4JTDA 3AQUA 2QULA 4AF0B 3LCGA 4JFVA 3C2VA 1QHZA 1QFEA 2BOEX 1OJXA 1O6IA 2WSPA 4TIMA 4LS0A 1CPUA 2W62A 3BK0A 1UKSA 2X40A 3W72A 4HA0A 4XZIA 4M6QA 3C0SA 4TQTA 2Z4GA 4NJJA 3F1QA 3TFCA 3PR2A 1CLVA 3QTGA 2FYMA 1G9HA 3L0GA 2DW7A 1H5YA 4JQ4A 4DXXA 2WZEA 2R1PA 1M7OA 3VPLA 1SZRA 4B5NA 4XUYA 1OD0A 3FVDA 1KKOA 2PZ0A 4CQBA 5E0KA 4HJWA 3S9YA 1FH7A 1E1CA 2NXHA 3ZJ8A 3WQ4A 4Q4SA 1AQHA 5DEZA 2ZA3A 3QVQA 4B4FA 2VRJA 4GZIA 5DANA 2J74A 4CQ9A 5DXXA 2WZMA 5LNUA 2F84A 2DVUA 3G24A 4FOJA 1WP6A 5LNVA 1LP6A 3R8GA 3CC1A 2HVOA 5A8GA 3W07A 2H3DA 3TUUA 2JK2A 4QNEA 3NZRA 1ZAIA 1SM9A 4I9MA 4JQ3A 1FWAC 2PS2A 4XO6A 2GVJA 4D9PA 3A12A 3QV7A 1YDVA 1GVYA 1OF6A 3WQCA 5FL1A 3NXLA 5G1YA 3KBWA 3CYJA 2YLAA 1X1ZA 3LA4A 4PCTA 3BLFA 1GZGA 4HZ6A 4CQCA 3S2JA 3CL7A 2O9PA 2J8GA 5I3JA 1TV7A 2QV5A 4L6HA 3VE9A 4D6IA 2ZCGA 3HFTA 1KLYA 4Q32A 3VIGA 4XUGA 4RKAA 1E5NA 3GH4A 4Q4OA 4Y9MA 2OZ3A 2YR1A 3EWWA 3APYA 3ID7A 3L23A 3NM3A 1XLDA 4MWAC 3W7CA 4GISA 1SFTA 4HNUA 1J0IA 4RR4A 1M3UA 1F6YA 4H83A 3EBVA 2BB0A 4MWAD 4PTDA 3PJWA 1W5NA 3VNMA 2HV5A 5HWJA 4LEQA 1FOBA 1UR8A 4JZ5A 2DSWA 2NQJA 3TNBA 4JNZA 4L65A 3KVMA 1GOOA 2CNCA 2QUUA 2XVLA 2DV0A 4Z0JA 4FOKA 4PUUA 1K8XA 3WELA 5I02A 2ONEA 4G9PA 2XH2A 4WQ6A 5A2AA 1RBLA 2VCBA 2WMFA 3KRZA 3CZGA 4ZQPA 1HG3A 1NFPA 4LNCA 1V03A 2PDBA 3DG3A 3GHSA 2FZBA 2ZC8A 2HDJA 4J1OA 1DIKA 1E73M 4NAFB 4L80A 4BF7A 4GNKB 2FHCA 2Z2UA 3MSGA 1IE7C 4C6CA 1CB2A 3VM5A 3B8IA 4BWLC 3V0SA 4F2TA 1HKJA 4K38A 4E2BA 3VIJA 1L0PA 3Q65A 1Y5XA 3HPFA 4EANA 4MVAA 2WCGA 4HOZA 1UASA 1LYXA 2OR2A 4CCEA 4K37A 1PX3A 3WEMA 1MZHA 4P61A 1REQA 1VP5A 2IQ0A 1PO9A 1HT6A 1GGOA 3GFYA 4HNVA 4GJ1A 2VEFA 3RPDA 3MBFA 4B90A 2YZRA 3ZJKA 2P8BA 3UF9A 1UR3M 3GDBA 2WB5A 2GVYA 2ZE0A 4HN4A 2VRKA 2YCLB 4ZBCA 3TC6A 1BWVA 1M1BA 4ZR8A 2ZXAA 3MWAA 3CWNA 3CTTA 3IJIA 4LAKA 3BJFA 2GGIA 1GZJA 2R94A 3TTSA 2VVSA 1FFQA 1ITXA 4X2RA 3IJ8A 2A1YA 3RU8X 4DJEC 3NJ3A 1VFFA 2VKZG 2CYGA 1WXJA 3L21A 1CZ1A 3V0TA 2R1LA 4NYUA 1XIGA 3OVRA 5AZ0A 1J79A 3NQBA 1NWRA 5C5YA 3IGHX 5A8MA 2DSZA 1DJWA 4HNOA 4C65A 1PBGA 2GFTA 2KAUC 2DIJA 1LWJA 2W9MA 4FB7A 3R94A 3A3XA 4PEKA 5H6HA 1W5OA 4DUXA 1W9UA 2ZXBA 4S3EA 3RILA 5F7UA 3M4HA 1BLIA 5D9OA 4IPIA 4NJKA 2WZHA 1KLZA 2XWDA 3SRHA 1W3LA 2PZNA 3OODA 2XFRA 5CZKA 1GYNA 2VI0A 3N2OA 1NDVA 3RAOA 3GR7A 1E6RA 4D6CA 2E28A 4AZCB 2OWXA 4EPKA 4PUKA 2INEA 3WQ8A 4FNTA 3EDDA 5FESA 3AHTA 2NQZA 5A6LA 3TU9A 5U7SA 2OLSA 2POTA 2G37A 4WK9A 3TYDA 1W5PA 4HOXA 2AGTA 3VC5A 2VEMA 4QDMA 3UGRA 4XBKA 5E09A 1J93A 3TA6A 1E6QM 1AW5A 2GK1A 3QEZA 3WJXA 3IIOA 2DUZA 2YCJA 1FWDC 2D0GA 3B0XA 4JTEA 1FWFC 4DJEA 2CLLA 7A3HA 1QPRA 5D03A 1W6TA 3CHDA 3KVKA 1V3IA 3ZM8A 4XZHA 1MMFA 1S2VA 2BVDA 3A9BA 2QAPA 4LB4A 4Z2KA 4GO9A 4QFUA 2FIQA 3S5NA 4X9YA 3C2RA 4A4AA 3GIYA 2QXWA 2QGYA 4DVOA 1DBTA 4HNCA 3SUTA 4U10A 2EPHA 1PWMA 4E8CA 3BAYA 1K3UA 2XN2A 4WLCA 1A5BA 1JF6A 3UXKA 2BS9A 1WDSA 4C7DA 3QFEA 2UBPC 2XVNA 4F0MA 3RMJA 2DH2A 2BY3A 1OFOA 4PBEA 3N29A 4FXJA 2IKJA 3K46A 4GLEA 4Q7IA 1ME8A 1J0HA 5G1MA 1XLEA 3WQEA 4UMCA 1VFSA 3CQKA 1OZQA 1SMDA 1KQYA 3T4WA 4ILSA 2ESCA 3PPGA 1ZTVA 1JGMA 1FCQA 1IIGA 3F5LA 1OM0A 4O1FA 3QHNA 4DQWA 4UR7A 3TQPA 1RUSA 5EMMA 2Y4SA 3FA3A 4MB4A 4AX6A 4QAIA 4U28A 1XRTA 2X0YA 1WO2A 3N9SA 2H3BA 4LVFA 1G67A 4PTVA 4GI9A 1R85A 5BWAA 2A85A 1C3FA 3ZSSA 2WHKA 1OIFA 2ZUVA 3VX0A 3GS6A 4O0KA 5TQLA 4OFCA 1E40A 4JHMA 2GJNA 3HURA 4B3LA 1P5BA 4WRHA 5K4ZA 5KMYA 4DUVA 1FHDA 3DKJA 2IKGA 2OTDA 5I3GA 3K4AA 3NG3A 4YWSA 1PCKA 1BEUA 1TSIA 4LAZA 1F5ZA 3WLRA 4AUBA 4ZQRA 2XVPA 2DZXA 1M9HA 4AEEA 3AUJA 4KESA 5C6MA 3PJTA 4JEQA 2VUNA 4Z2IA 1FHVA 1M5WA 5C9WA 3GXDA 5C2GA 4L9XA 9RUBA 3HPXA 3ANVA 4LY4A 1UZ1A 4OKDA 4CQ8A 3RR1A 3E12A 4Q4PA 4X63A 1VGAA 2BTMA 3E0LA 3WEZA 2WHMA 4G7EB 3MP5A 1QI4A 4LXFA 3GLCA 1M7XA 3VIMA 4OBSA 5D09A 1SO4A 1S5WA 4GH1A 2EG6A 1UZ4A 1TTPA 1J8VA 3S2CA 3FN9A 5MHBA 1A80A 1WZMA 2CLPA 3LUTA 3GVQA 1QNVA 5AHLA 2B7OA 4IIGA 4AZGA 1BRLA 8TIMA 3TR9A 3GW0A 3V36A 1SMAA 3D46A 4J3XA 3KVLA 1U33A 3WUFA 3DFNA 3LV5A 2WPGA 3PPFA 2NQHA 4S3DA 1TTQA 3MW7A 3CGTA 4L4PA 4US5A 1SW3A 3N17A 2R1MA 3GVVA 5A94A 1RXOB 2EO7A 1K7EA 4NZ5A 4AB4A 1XYLA 4UWMA 1TA3A 1CBGA 1UR4A 3DZ1A 1JUKA 4S3BA 6REQB 4XG1A 4TMCA 1LQ0A 3EWZA 4N02A 3HQ1A 3LOTA 1TUFA 4PCFA 3QXBA 1XIJA 1G0CA 1Q6CA 1TPEA 3LNPA 1GVOA 4UFIA 2AGKA 3H7VA 1QR7A 1F3EA 4Y9AA 3QFWA 3LGEA 1TPB1 2WNZA 3B04A 1JYWA 2ZTKA 1XDJA 4CN6A 3LMYA 4A22A 5U4NA 3E96A 4ZXOA 1X39A 5D2WA 5ECVA 4DF1A 4GVFA 1TUXA 1UJQA 4Y9OA 1P0NA 1EJXC 3SQSA 4MGGA 1O68A 1X98A 3S4TA 3EX3A 3KCOA 2Q8LA 1V6VA 2BZNA 1X7IA 3LN3A 1VJIA 3T0CA 2CZFA 4L61A 1JZ8A 1JCLA 3LGDA 3WD2A 3E2QA 2WJFA 4D6HA 3G1DA 1H1NA 2HNHA 4GX8A 3W7JA 2W27A 3N1AA 3N6HA 1UD3A 1WYIA 3EX6A 2IPFA 4LH8A 3INPA 1AG1O 3C3UA 1UPMB 5C2XA 3HFYA 4N6EA 2Y7FA 5F4XA 5G2WA 1UZHA 4K3ZA 3SSZA 3VKKA 4YL2A 1TVPA 5KZMA 2Y89A 2C0AA 1EEXA 5DY3A 4KCWA 3B9OA 2WC4A 1AQFA 1MUMA 3AWNA 3GXTA 4IIDA 2O9TA 1GOKA 1YPFA 3UYCA 2DORA 5E0FA 5FAGA 1B5TA 2HQAA 4WOZA 1HP4A 1AA1B 4NIRA 4LBUA 3STGA 3ABSA 4HSNA 4F9JA 2F2KA 4NNAA 1AFSA 2EJ1A 3SUWA 4F8XA 1H0IA 1EYEA 5HPOA 4KWWA 1IXQA 3WJWA 1A5OC 1BG4A 1ICPA 1RCXB 1MRAA 1GEQA 1EP3A 3BANA 1L2UA 3C2FA 5CSYA 5A6SA 2E8ZA 4LQ1A 5HQMA 3IV3A 3A23A 2XN0A 4WKAA 4EP8C 3BJSA 3IPWA 3WF1A 4CNUA 1ISXA 1PTDA 2C1HA 5JBFA 3IV8A 3ZR4A 1IEIA 4UTWC 2H8ZA 3C8NA 2NX3A 3WMCA 5E9XA 1VLWA 3GTXA 3WIJA 1O66A 5I24A 3FGCB 1S3TC 3E2SA 3Q37A 4U4MA 1EX5A 4PGLA 1UBPC 3M0YA 1AW2A 5I3KA 3H2FA 3H4XA 4H19A 3TW6A 5ABFA 2FGBA 1PAMA 1L6GA 1GW9A 2I16A 2UV8G 1JZ4A 3EA1A 4MHBA 4LALA 4DXKA 3G1YA 4CD7A 3J7HA 4WY0F 5T91A 1D7KA 2CC0A 3DFOA 2YA0A 2J75A 2QCNA 3PZ9A 2XJ7A 3DYOA 3EB3A 3CPRA 3NOEA 1ZCCA 7CGTA 2XM1A 2W3ZA 3OVPA 3SCWA 3NSNA 5ABEA 3B4YA 2GJXA 2C19A 3H26A 3M5YA 4AD1A 3CU2A 2VCCA 3DHDA 4LVAA 5EFFA 5LA2A 1FWCC 4HK5A 4NRSA 1BF2A 3W7KA 1JD7A 3TWAA 2QS8A 4UFLA 2NZLA 5BRQA 1GONA 4RNIA 1M6JA 3IWPA 3U5UA 4EXQA 2Y85A 1RALA 4UUIA 2I5QA 1H11A 1AW1A 3GTFA 5GNYA 1CGWA 4QJ5B 1OCQA 2D20A 1CXIA 2FVKA 3G3MA 4K6AA 4XZWA 3DOPA 4UNKA 4ZZ9A 1C9WA 2WK2A 1D3CA 4NZ4A 4BK9A 2DH3A 4Q8UA 4LBSA 4JFUA 2B0MA 4PRRA 5HNTA 3H2AA 4H2CA 1Q6FA 4UCFA 4UTMA 1HN1A 2ZYFA 3NQGA 4CD8A 4RNFA 1B30A 4CQAA 3N18A 2XSAA 4UFMA 5J5RA 1FWGC 1QRQA 1I2OA 2D23A 3G18A 4JN7A 4ZEPA 2OPJA 3W6LA 2XIIA 1LDCA 1K8YA 1OX6A 3GDRA 3HQOA 3WBEA 1PKYA 4PMRA 3EB4A 3NQ8A 2Y8VA 3WD0A 3W2NA 3E02A 2GGEA 1Y7VA 3WN6A 2O9OA 3QV6A 4HNNA 4WIWA 1A5LC 2V2CA 5F1UA 4FXSA 1PV8A 4ZQMA 2WQPA 4FLQA 2QCDB 1IV8A 1TPFA 3BGGA 4FNRA 1OVDA 1WUFA 1OC7A 2OYKA 3BV4A 4FLOA 4PTXA 1YE6A 2VFDA 3MC5A 1MRQA 1EWDA 4BI5A 1X8CA 1HIZA 3JRKA 3UA4A 1RQEA 2ALDA 2J77A 4LYKA 4JBRA 4YNGA 1JZ7A 1YTDA 2FZ8A 1UG6A 4GINA 4C1NA 3P62A 3DFHA 1J0ZA 3P14A 3MY9A 3L0KA 4ATDA 2Y5EA 1GOWA 2Q8ZA 4L5ZA 3PNZA 1EHNA 3T40A 3ARRA 1KBIA 1UD8A 2BXZA 3P82A 5BXSA 1B4EA 4U2ZA 2UZ9A 4C5ZA 2QF7A 3LHUA 3BMWA 5L6UA 4LYRA 1DE5A 2P76A 2YL6A 2VWSA 4MFEA 4JTRA 2PBOA 2FHBA 1YXDA 1GUVA 2GSJA 7ODCA 1R3VA 1XYZA 2YGYA 4JX4A 2V5JA 2ZRVA 3WD1A 5DMMA 3M64A 1LT8A 2YIHA 4HZMA 2C79A 3GG1A 4I7VA 3S6TA 5A6BD 2GQ8A 5CGTA 1KNWA 3TYZA 3SAZA 4P8WA 1UCWA 3ARZA 5BROA 4GE8A 1JF5A 1W9BM 3DU0A 2GGHA 1KXTA 3MP4A 4Z1DA 3T8QA 3WQWA 1OFPA 4DLFA 4IG2A 4W85A 1K70A 3S0CA 2PDMA 2BGSA 4W5ZA 5CZ0A 1Z89A 4C1LA 3WNKA 1KGWA 3TQVA 3F2DA 4ES4A 4TVUA 2X7WA 4LUYA 4FR1A 4A8NA 1QNQA 2PP0A 2X1UA 5L9FA 3BLDA 2PTDA 1PYFA 1K02A 3BAKA 2GQ9A 3RLGA 1KXHA 1TR1A 5ABGA 4Y7EA 1JCTA 1FXQA 1VFLA 3LTYA 1P7TB 1WOAA 3DKLA 4HHMA 1TB3A 3OZMA 5AYBA 1FP8A 1A5KC 5KITA 4UR8A 2YB1A 5JH1A 5A6MA 3U3HA 1X97A 3GNXA 2H9AB 2BHZA 3B9NA 3FS2A 1GOIA 3HG5A 3V75A 3UWUA 1RK5A 2QR6A 1LOSA 4JFWA 2X09A 2VVNA 3TLQA 3GNDA 2O4MA 1W5MA 2GSEA 1KFCA 3N2MA 4DYKA 2VEGA 3NQAA 1I2QA 3O05A 1UOZA 1BXCA 4QXIA 5I7GA 2BBFA 3K8LA 3N4EA 4WSHA 3LPFA 3CZLA 4Q8OA 4L6OA 1HF6A 3TWBA 3O8AA 2NXGA 2GJRA 2NVCA 3UZXA 3GVGA 3FKRA 3LK6A 3ZMRA 1BQCA 1FKWA 1VRDA 4LFYA 3W01A 5CKSA 3WQ6A 1K4HA 5D32A 4AG0A 1MQRA 1RQBA 1GKPA 4OVXA 4GGHA 3AMGA 4GRSA 3IGXA 4CN1A 3VIIA 4DBDA 1CGVA 2GJPA 3PZQA 3R43A 4GHRA 4UTHA 3GXMA 3HV8A 1OD8A 3LSCA 1TCDA 2B4GA 3TSBA 1W32A 4IWWA 1POJA 2B31A 2NQLA 3AMCA 3FK4A 2PD9A 1V4YA 4IQJA 3M46A 2X2GA 1O5RA 1OIMA 1QPNA 2CBJA 1JDAA 1VCFA 1Q45A 2Z27A 4N0RA 3LZ5A 4H8NA 1NH6A 1LBMA 1NDWA 1TMQA 1ITUA 3TYAA 1EWEA 3THQA 3FYYA 1ZBCA 4UTJA 1PSCA 2PD5A 4B2DD 4K8GA 1EP2A 3QPZA 2D1ZA 5MF5A 5FSDC 1ONRA 1BTCA 4CLMA 4H9UA 3WDPP 2HMCA 4N9DA 4DO5A 3KM8A 3Q67A 3NOYA 4HMCA 1QDSA 4DM2A 1QI3A 4AWUA 3UXAA 3VNLA 5IFPA 1DJHA 2JKEA 4YTQA 4GH3A 3T4CA 3WQDA 4XK2A 2HEJA 1YX1A 2REQB 2A5HA 4NYYA 1ZAHA 1OGGA 7REQB 3V16A 1EC9A 2OG9A 3VD7A 4TX8A 1K03A 4MKNA 3ZQ9A 3VDGA 4IJBA 5D2YA 1W1B1 4HPGA 3ZFHA 2CLMA 4M3PA 2YBUA 2QJNA 2Q3RA 4GY0A 4PMJA 3VD9A 1F3WA 1ZALA 2NUWA 4W7UA 4ZA0A 4F79A 3II1A 9CGTA 1C8YA 1YKWA 4CCZA 4A29A 3H2MA 5JQ9A 1JL8A 4FX6M 1UR1A 2DZTA 2Z26A 4JHZA 3VIFA 1S39A 1W3KA 1K6AA 4GYPA 1EO5A 1WKEA 1F7BA 1TVNA 5FJJA 4NILA 4WDXA 1F74A 2ISSA 1G69A 3WG6A 4GGBA 4MDPA 4ASTA 3T09A 5BYWA 4GVHA 3WFZA 4AQLA 1ZENA 4K7VA 4KGJA 2Z28A 1OFQA 1EJTC 4FOUA 4ZVJA 4ZL1A 1ZP3A 4UQBA 1YRRA 1ZZMA 3H4WA 2VX7A 1U1JA 1VQTA 4CKQA 3NAVA 3L68A 3H24A 4PMYA 4Q4RA 5LIUX 5LGZA 1QNRA 1Z42A 1Q7ZA 2EPOA 4RPQA 1VAHA 2RDUA 1BHGA 2YXOA 3N6QA 2BVWA 4RDYA 1RP9A 1HKIA 2J7DA 2VEKA 3RLUA 5IFTA 4DY1A 3KTCA 2PTZA 4H7CA 2EQDA 1H0GA 1MEHA 2WNWA 2VFFA 1UW9A 1ADDA 4YTSA 4PZVA 4GG9A 2PLMA 4Z42C 4QTGA 2ZRWA 4UFKA 3VIPA 3P0XA 3LBCA 3CUFA 1LZOA 4NI8A 4GC4A 5A6AA 4FIRA 1T5AA 4GC3A 1TKKA 5GQBA 5A2BA 3AU6A 1WX0A 3B8VA 2NVDA 3AIWA 1GG0A 3V35A 1TJ2A 1MQQA 4XD6A 5CEWA 1M68A 2NWRA 4US6A 1UQYA 1DEDA 3LPOA 3KX6A 1V7YA 1FWHC 3FEQA 1SJAA 1HJVA 2C8NA 2VOMA 4UQDA 2O7SA 2J24A 3JW7A 3LQLA 2P88A 3MO4A 3CB3A 1I1XA 3G1HA 1W1A1 4WCJA 2ZRXA 4B15A 2J78A 3P60A 1I8JA 3DI0A 3B0UX 2OSWA 3PG9A 2VO5A 2CKSA 2Q09A 3M43A 3OBEA 4TTUA 4DWSB 3KL0A 1HZYA 3NQEA 3W1UA 2FPTA 3IGUA 1HNYA 4R5EA 1UR9A 4DBWA 3DECA 3CHVA 4LTSA 3AMDA 3W2JA 5DMLA 4CD5A 4CU8A 3U4FA 2BV9A 3WZ0E 4IGSA 1QVBA 1K8ZA 3A3HA 4GMEA 1NOUA 4DJFC 4WUIA 4CEXC 1XLHA 3AMKA 3BOFA 2KZHA 3QLDA 4KWOA 2X0HA 3GYCA 2VWTA 5DELA 3MSRA 2ZRUA 4H9YA 1KA9F 4DZIA 4DJFD 5FJPA 3T0TA 3VKCA 3M0VA 3STPA 1L6WA 3QQ0A 3QY7A 1RV8A 1V93A 3WQFA 3SIMA 4EAYA 4LSBA 4J35A 5C9RA 1CEOA 5E70A 3WLPA 2E4TA 2PGWA 2NSOA 2CEQA 1UD2A 4M7TA 1DTNA 2OJPA 3S5SA 3UCCA 1GEHA 2JF6A 3R7MA 4LC6A 5I3DA 7TIMA 4C5YA 1JFXA 4OUIA 4D71A 2DP3A 5DXYA 1YPIA 1S2UA 3CLWA 4DYJA 1TZ7A 3L5MA 3BH4A 2V82A 2Z1XA 1XGEA 3PTDA 1ESWA 1YBQB 4X22A 4GIEA 3TC7A 1LOLA 4MNLA 2E8YA 3ZWSA 3IAQA 1R2TA 3W2MA 2ABBA 1QPOA 3LXCA 5JBDA 3R5EA 4YIWA 1UIPA 3DAQA 5DRIA 1Z7AA 5EKYA 2DZUA 4BQ3A 3G6MA 1MXGA 2Y6ZA 4I9JA 2R91A 2C91A 3MP3A 3M0IA 1YLVA 4RJEA 4RE0A 1XISA 1C90A 4F2UA 1XIFA 1N82A 4AWSA 1F76A 1G4TA 1CXEA 1P0BA 2V5BA 1UKTA 4OJYA 1Y65A 1KM2A 3TH6A 2C16A 3PZNA 4IX0A 1SU5A 1TVLA 3ABXA 4PA8A 2DUAA 4IGHA 4XAFA 2EJAA 3GU1A 2R24A 5FF4A 5I5RA 1EQPA 4BA0A 2CZEA 5AYYA 3W73A 2GPTA 1F8IA 1ECEA 2VENA 3G8RA 3SADA 3HGOA 4MDOA 3ABZA 3ATZA 3W00A 1Q6LA 3THDA 5G4HC 1W31A 1DQWA 4AISA 4BF9A 1BYDA 2A6NA 2WKLA 2V30A 4AVNA 4W9TA 4JX5A 3AROA 2I9UA 4F0RA 2PDXA 3PAOA 2Z1KA 4IFKA 3BQ6A 4EPBC 3NQCA 5F4SA 2FTYA 5LSMA 3PZVA 5HJLA 4OGZA 1TV5A 1W0MA 5IBXC 1OC5A 4HPXA 4BF5A 1UC5A 1NDZA 4LV4A 4ADTA 1RBAA 3H70A 5CPOA 3W7PA 3AU2A 3RIKA 3T2QA 1BPLB 3O6DA 2E40A 4WY0B 1EXBA 2YL9A 1TFVA 4BHYA 1JXJA 4QBXA 3LI0A 1QI2A 3CUXA 3QMTA 5I00A 2PDYA 3RXZA 4O17A 3LENA 4EAMA 3CQIA 5M3WA 3IACA 5C70A 3CZJA 1W1TA 3NDZA 3N25A 3OB8A 3HO8A 1RCOB 1M7JA 2FJUB 2D3LA 2VC7A 4P7OA 1IGSA 1W1VA 4RE2A 3I3EA 2ATSA 3G6LA 4WDTA 4F9DA 5CG7A 3MUIA 3HJEA 1XBVA 1ZBKA 3O1NA 1VD6A 3KOFA 4JXCA 2BY2A 5LIKX 3GRIA 5C8BB 3NPWA 1RK6A 4JKMA 4G1KA 1MW0A 5TF0A 2ZUWA 1C8XA 2F38A 1EL3A 1OFRA 4JN6A 3HV9A 4CNTA 3TOYA 3LEPA 2RJHA 4WDWA 1E6XM 5AY7A 1FTXA 4UFJA 3IANA 5A5WA 2VGBA 1I2RA 3KRUA 2R1NA 3VNDA 1UQZA 1KV5A 4JEJA 4KEMA 4R88A 4IPLA 2PLCA 1XDMA 2ASHA 5DMYA 4RW3A 1FP9A 1OFDA 5AZ1A 2VOTA 1QNPA 4ZE5A 1XJBA 4KFNA 1S5MA 2YXGA 5EL1A 1NAL1 4JTQA 3UWQA 1ODUA 1GHRA 3NDOA 5JVLA 4MKSA 3C0JA 3SSJA 1LBFA 1IXNA 4V15A 1TPWA 3AIQA 1IR2A 2J66A 1TWSA 4KFOA 2Y1HA 4LBRA 2MUCA 1XKYA 5REQB 3SURA 1PDZA 1PKMA 4POCA 4ZB0A 4XAYA 3UETA 3FAWA 1HKVA 1FCBA 3OQEA 3LU2A 3FYOA 1L8PA 3B0YA 4J2PA 3W1MA 3KBSA 4LPCA 3EDEA 1CXFA 1GOQA 4HPHA 4O10A 3PZUA 3ZLGA 3GXIA 2XHYA 2WLYA 2E25A 1OHLA 4L1WA 4AC7C 1AH4A 3KBVA 3T1GA 5HATA 2WSKA 1NWSA 3OP2A 2E6DA 4KERA 1NARA 3ARWA 4IMEA 3T08A 1KFJA 3HG4A 5CAKA 2RUSA 1LCOA 1UHVA 3SW6A 1S5TA 4NZCA 2OQHA 1UWSA 3OLIA 4JGDA 3AIBA 3I7QA 4K7YA 2AL1A 4MJZA 5LNRA 3VKBA 1E6PA 1R5YA 4UTIA 3K4WA 5I0DA 3BGAA 2D22A 3BG9A 4M6UA 4IGMA 3MHGA 3BXWA 4ZSUA 4TX6A 4QHRA 3DUGA 4XZ9A 1B3ZA 1G4EA 1KR1A 4HYWA 3OGSA 4N4PA 4F0HA 5EMJA 3WH5A 3BTNA 2WVUA 4DZ5A 4LS2A 5BXTA 3JS3A 1I75A 4AYSA 4IX2A 5LIYX 1V0LA 1KWKA 3H2CA 1EC8A 4V1XA 1XUZA 4YU1A 3MB9A 2ZUUA 3BJTA 2RGMA 1VKFA 2CESA 3KVJA 5K3VA 5I3IA 1PDYA 4ERIA 3P81A 2XFFA 5DBUA 4E8DA 1TJRA 4KCTA 4M7SA 5HWNA 1XLLA 2DZAA 2DFAA 3S6OA 7TAAA 2FVLA 2PDIA 2Q71A 3W7MA 1TQJA 4IMGA 1GW1A 2FKPA 2V3DA 3ZVIA 1H2JA 2V63A 1LUCA 2J6VA 3L4YA 2OELA 1UD5A 3U9IA 3WK2A 3CAKA 4YWIA 1UWQA 4PC8A 1FKXA 3TV8A 4DAIA 4JIRA 5DY2A 1DQXA 1YADA 8A3HA 1JRBA 3PM6A 2DT3A 4N9EA 3P80A 3WH7A 1VEPA 1LQ2A 1ZB5A 3IRDA 3P84A 4AHQA 2ZXQA 2WVSA 4IUOA 3USBA 4R3UA 1MNSA 3MYPA 5G5IA 1JQVA 4GOAA 3GHTA 4AF0A 1IF2A 1D9EA 3AXIA 3UVAA 3FY1A 4GCAA 2Y8KA 1J01A 2NV2A 4E3TA 1EGVA 2Y63A 3BLPX 1E0VA 2H90A 2XH0A 3IJ9A 1GPFA 1SPQA 3G22A 2HK1A 3SRDA 4P7QA 4ERGA 4I5UA 2BG5A 2EPMX 4CU7A 1PE1A 1Q13A 3UQNA 1CT5A 4LVBA 1FWEC 3KDOA 4KQNA 3H53A 5DF0A 1OABA 8XIMA 2J4GA 4KRZA 3M6DA 2FPVA 4REQB 3CAWA 4LCSA 3CNYA 3KRBA 1NTHA 1R9YA 3SUSA 2CKRA 4R34A 4RX0A 3SY5A 3T05A 1Q5MA 3NDYA 3EWDA 1F3XA 5I03A 2Y5JA 4PUMA 1PX8A 4YTUA 3CASA 1PZ1A 5DRCA 2CXGA 4O0QA 3R2GA 3KL3A 3QW4B 1LLZA 1TV2A 4OUEA 2F6UA 2PRMA 4H9ZA 1HL8A 2Q6ZA 4ZO8A 1Z6KA 1JZ2A 2HXUA 4MWAB 4CGTA 3IVTA 3M0HA 4HNTA 3BGJA 3F4DA 1MSSA 1CWYA 4F0LA 4M1RA 1JPDX 2CLIA 1B3YA 2C1GA 3QZAA 1V3HA 3A4WA 4H1ZA 3BARA 1ZBVA 3V5FA 4K68A 3BG5A 2X30A 5BXPA 2PDLA 3UPBA 3PFRA 3VIOA 3BO9A 1XCWA 3FV9A 3H7RA 1S1PA 2XZ7A 3H23A 3KOZA 1WE5A 5D2TA 1C9DA 4PE8A 3W37A 4WJEA 3OHIA 3TZFA 2QQ6A 2FFCA 2OKOA 3MBDA 2HJPA 2FGLA 3VIKA 5T8GA 1R3TA 3T6CA 4BY3A 4YTTA 1MI3A 2PU0A 3UZ5A 3RCMA 3RLVA 1KTCA 4N9BA 4MB3A 4NP7A 3S8HA 3GXNA 3MTWA 3WNOA 3LLXA 1S5NA 1RR2A 3I6RA 2ZVIA 2P50A 3BSMA 3CUZA 4JTJA 4Y9NA 3BWWA 2V5DA 4QS5A 3TAKA 4XAGA 3R8RA 4INFA 4EWND 1AH3A 4HU3A 3OTRA 2VEIA 2ZQ0A 2Q01A 3R6IA 4XD3A 2VC5A 4A3UA 3HZ3A 3CLMA 1XBXA 4UOJA 2G3IA 1Q3NA 4B3ZA 1NDYA 1AJ0A 1VYSX 3REQB 3T2OA 1U1UA 3M41A 5FEWA 3U48A 5D9MA 2AQOA 2OEKA 3F5KA 1EOMA 1XLJA 4LVDA 5AC8A 4LCRA 4MG4A 1R3YA 4UZUA 3DX5A 2W67A 1BQGA 1FHLA 3VILA 1M41A 4GUIA 3XIMA 1IZKA 1F8MA 3M0JA 1HO1A 4JTCA 2QVHA 1IWPA 4RLIA 1QASA 4U2YA 4MNKA 1UR2A 1ZJHA 4NAFA 1KFKA 1P48A 3UY8A 1L6SA 3SFKA 1IXOA 3UZJA 3NL5A 3V3WA 3ITGA 2XTKA 3GHRA 4Y90A 1C93A 1W1IE 4OHQA 3TSMA 1LG1A 2VL4A 2VZUA 2OSXA 1KD0A 3SY8A 1P0KA 5K9CA 3TTQA 2WMGA 3SI9A 2V3FA 4KEVA 1IT8A 3BAJA 2WO5A 5K2ZA 3CQ0A 1JGIA 3BSGA 3BOLA 3IIXA 1BYAA 5IDZA 3N73A 3AXKA 4NXKA 3KLLA 3EMCA 4FNPA 3CUIA 1XP3A 4EOUA 4KETA 2WCAA 3SCQA 4MB5A 2PAJA 1R7OA 2YCLA 1WXZA 3CUJA 3VOIA 1FH9A 1VENA 1WZAA 4OE7A 3P0WA 1IIHA 3AICA 3ARXA 3FJNA 4JY8A 1MVYA 3QZEA 5HINA 3N3MA 4QP0A 1JG9A 2I56A 2FGZA 3BW4A 3QGAC 3BAWA 4HKPA 3SFWA 1O4UA 1TPUA 2GUBA 1G6CA 1I6NA 1QTWA 1V5XA 3RO6A 4A8RA 2EBNA 2JEQA 3O07A 5I6SA 5FKYA 1KQZA 3FFSA 4M6VA 2VC9A 3FVMA 2TMDA 4S3JA 5AVHA 5EBUA 5DO8A 3EDJA 3B97A 2E67A 1VCVA 3U4AA 5C9XA 3UWZA 4QG6A 4ICCX 1LM1A 2Z1BA 1JYVA 4EX4A 5CPSA 4WD0A 1Q7MA 5T26A 3TX9A 2PMQA 2J7FA 4Z2HA 4YMZA 2C1IA 4MMWA 3EEGA 3ONCA 3W27A 4GIYA 1QUMA 1TMHA 4YVVA 4HU0A 3ZR5A 4AZCA 3WUGA 1DL3A 2E09A 2VQTA 3CHFA 3DDMA 5C7VA 4ORIA 5AB3A 5CPMA 1V08A 1IT7A 1W1ZA 4FR6A 1QBAA 4JKLA 3KZSA 1VPQA 3ISIX 4GI6A 3W1XA 5DQPA 3VX1A 4GXWA 3VABA 3VGDA 1EH9A 1W91A 1FWBC 2WQDA 1NOWA 1MQPA 1VF8A 1HW6A 2NV1A 2YLLA 2DY3A 4I6KA 1IXPA 5HMFA 1JNEA 2NWSA 4MB1A 3RDKA 1QWKA 4IJCA 1JCNA 2WVVB 1Y0EA 2YZ5A 5AC4A 3PB0A 5DN1A 1KGUA 2VM8A 3PBVA 1W3JA 2WHJA 2CETA 5ABTA 2PEVA 1GWJA 3AC0A 4B9ZA 4J9JA 5FCZA 1OADA 2W92A 2QF8A 2A3BA 3I4KA 1W3TA 3L5AA 3A5FA 3W53A 4M29A 2E3ZA 2OEMA 2A3LA 4LCQA 4NNBA 4OBTA 1F05A 1XM3A 3H7UA 1RHCA 5IDIA 4HHLA 3NUKA 1LWIA 4PR4A 4DI8A 3VGBA 3MUAA 4PRTA 3NWRA 1O5QA 1CECA 1WV2A 2W61A 2WVTA 3DYMA 3PJXA 1X7FA 4ROQA 3DIPA 1CENA 1J6PA 1X6UA 3PSWA 5F4WA 3EB2A 1OGSA 1DKWA 2DSVA 1PXGA 3COTA 2XM2A 3SGZA 1CTNA 3PN8A 5HUPA 3TE9A 4AX7A 3WBAA 2X1TA 4DHGA 4E4UA 3RYSA 3QW3A 2NX1A 4F0SA 4O8AA 5I78A 1VH7A 1F4AA 3SCSA 3UXIA 3B06A 4S39A 4CNSA 2DSUA 4O1CA 3FA5A 5AFDA 1DIOA 5IXEA 5EU9A 1Q7QA 3AFBA 1NWTA 1NFGA 1ITQA 1GJUA 2A3EA 5D05A 1U5HA 3UG8A 4HA4A 2D73A 1DP0A 2IXUA 4G7EA 3TJIA 3AJ7A 3CV1A 1FDZA 2FTWA 1V0KA 1E43A 2J79A 1GQJA 4ZGYA 1VHCA 3NQ6A 1GTHA 3EXTA 4HYRA 4UOZA 1UP0A 3FYPA 3FOKA 2CBVA 1H7WA 3TMQA 1SSDA 5I09A 4O4WA 4B5WA 4W93A 1KO0A 3KE0A 4HTYA 3AI0A 2YX0A 1GKQA 1XI3A 2CLKA 2YDQA 3O16A 5CZTA 1Q66A 3VNYA 4YN5A 2EHHA 5CPLA 1OFAA 3CPGA 1V6YA 3NURA 2Z6IA 4Z2JA 4ZE4A 4H3DA 4LJ3A 4C6LA 3QF0A 4JS3A 5AOUA 1WBHA 3MKVA 4KRTA 1UC4A 1YTEA 3N6JA 4G6CA 4I7WA 4HIBA 2ZZ1A 3AZSA 3IIZA 1GNXA 4E3VA 1WKFA 4DZAA 3KBNA 2W6RA 6REQA 4UNIA 4QM1A 1TTIA 3N9RA 4I9TA 1XLIA 2GSHA 5TD4A 4IPPA 2EGZA 3QM3A 4J40A 5EB8A 1E9ZB 1H50A 4DN1A 1EFZA 1W54A 3VGHA 5BOOA 1F61A 3SQMA 3VGEA 1JUEA 3K1GA 3WL0A 4IIHA 2CW6A 4F48A 3K30A 3WK3A 1B9BA 3OGVA 2VZSA 1Q6RA 3A6OA 3DGBA 1XG3A 2NVAA 4XO7A 1KRMA 4E0CA 2QEZA 3C2YA 3HPZA 4XZMX 4DO6A 1X8FA 3LZ3A 3T42A 3CJPA 2ZUTA 5HR6A 1BKHA 3PSVA 1NSJA 5CSSA 3U7BA 2ZZ7A 2CXEA 2PA6A 4AZ6A 3TEVA 4IIFA 4LUJA 2E9LA 1KFEA 3WQGA 3HMJG 2X16A 1SYTA 2VJXA 1S2CA 2YB4A 3AO0A 4PMVA 2V2DA 5JIPA 4FF5A 3VD3A 4JPGA 3VD4A 3H2NA 1J10A 3A5VA 1BYBA 3L5LA 3TTEA 1FXPA 3LLDA 3VU2A 1GOMA 4LY8A 1GYLA 3S5YA 1OBAA 5B80A 3TYUA 2XZ9A 3MQTA 4GQ0A 3O3RA 2VX5A 2HBXA 3G0XA 2JBMA 2VHLA 2GL5A 1XYFA 1XH1A 4FP1A 2QJMA 4ZQOA 1MW2A 4FALA 4OT7A 3TNOA 2HE8A 1KM6A 4F40A 1ZGDA 4BQ2A 1E0WA 1HJXA 1JAEA 3C2EA 1MFVA 1KM0A 3P2VA 3KWSA 2IPGA 4WZHA 2Z00A 1BWKA 3D0CA 3S2NA 3U2CA 4NX0A 3HBLA 4YHEA 3EMQA 5I23A 3U7VA 4Z2LA 2WMKA 3V1PA 4C6JA 1EX1A 2OU4A 2NXIA 3NXFA 1KFBA 1JYXA 5ABHA 2F61A 1V3KA 3CH9A 2DJXA 4JDYA 3W1AA 5H1WA 2ZDSA 4RV3A 2IUZA 2YW3A 1XH2A 1OFEA 1W5QA 4XAZA 1QI0A 2X7VA 5F2MA 2VD8A 3FGCA 5FJOA 2PWFA 3M5XA 1I1WA 1EQCA 2UY2A 3TLLA 2OMAA 2PE4A 3NQ7A 3UZWA 2QIIA 4YTRA 1VEOA 1Y8BA 4NF7A 4RE4A 4QLJA 5AN7A 3BL3A 4K1WA 2ZFAA 3W82A 5B7ZA 1C7TA 5AYZA 3N11A 1HKKA 3W86A 4ZO9A 2E0PA 3PVFA 3KBMA 2FH6A 5K9XA 3B4UA 3QSTA 2JEPA 3FJ4A 4JIHA 3TP4A 3ZT6A 2V5KA 3OLGA 1DOSA 3GDKA 4I90A 1ZSXA 2PDKA 2V0TA 4DF0A 3QGVA 4M56A 4AD4A 2UY3A 3CMFA 4BCEA 3GIPA 3QYQA 1I2PA 1G1YA 3URAA 1H7OA 4IICA 3E49A 3SUVA 5CJNA 3BCJA 4S3KA 1AL7A 5FJUA 4QJ4B 4URIA 3EPMA 1X38A 1RLDA 3B0PA 2QZRA 4L1XA 3W2LA 3QRHA 2EPNA 1VJZA 3OJGA 1LG2A 4JTTA 3BPWA 5CQ1A 2YL5A 4H8UA 2Y62A 3LCFA 4KWSA 4DAFA 1FX6A 1O5KA 3EAUA 2ISVA 1CI1A 1XYAA 1TZ9A 5MKGB 1P0EA 1JQXA 1E1EA 4J28A 3WO8A 3URNA 3OOQA 3NIYA 5HOSA 4ZQCA 3GNRA 2WSQA 4UBPC 2Z0IA 1G7UA 4JCMA 4EIVA 5GPRA 1MW1A 3W74A 1S3HA 3C2OA 1R86A 2Q8XA 4MKVA 4FNSA 2QCDA 4M24A 3UU0A 1HJUA 3CWHA 4HSHA 3W70A 2J9YA 1XUUA 4ZOEA 1C91A 2NX9A 2VELA 3WNNA 4UC5A 2INZA 4DEFA 2G50A 2JGYA 4MPQA 5A2CA 4Q8VA 5CGQA 3T0AA 2HS8A 2VDHA 1QJWA 4JIIX 1CLKA 2PWDA 3D5HA 1BKSA 1Y5WA 4V33A 1W9DM 2W79A 5I3HA 4KH2A 2EAWA 4JTAA 3WLMA 3LCLA 5H8PA 1EJWC 5H8MA 4WDUA 4QQUA 4BS0A 2PDUA 1RD5A 4FA3A 1KR0A 4UQ9A 4ATWA 4ML4A 1HQTA 3UY7A 1OFBA 2CPUA 3OA3A 3QHMA 5TBOA 4MNMA 3DN5A 5HBFA 4XVDA 4G5DA 3AALA 3AOFA 3VZZA 2VTFA 3P74A 4PFMA 3MUY1 4W8AA 2V5LA 4I5XA 2EG7A 4UXDA 3QMRA 2A6LA 5A8NA 1PL9A 1EA9C 4XD5A 4RW5A 2Y70A 3TVAA 4O50A 5D38A 2CZ5A 5HMDA 3STFA 1XHGA 4W4QA 4B5VA 4GX9A 3RM4A 3EYPA 1HJQA 3ALFA 3MVTA 3PWAA 3RX4A 1ZU8A 3QY8A 1TWIA 4H6RA 3LCIA 1FWTA 2HPIA 3T07A 3RPTA 2WC7A 4AIUA 1ZLPA 4MIMA 5ECUA 2E7FA 3SCUA 1G4PA 4P8VA 4RXGA 3ITXA 1UWRA 4DJED 5BRPA 4Z0SA 3QSRA 3BCDA 2YFNA 1QXLA 2DDXA 1UH3A 4FXRA 5EY5A 1XGDA 4S23A 3FX4A 2Z6JA 1HTIA 4FAMA 3QQ1A 3DFYA 5LZLA 3MSDA 2QGHA 3M07A 4LUIA 1SFJA 1YPXA 4ZFCA 1UR0A 3AZTA 3G1RA 3VOHA 3JUGA 3RRAA 3CAQA 1ZNNA 2GWGA 5D04C 1DJYA 1U30A 2Y61A 1VYPX 3NSMA 3U8GA 3DFPA 3W81A 1L8NA 3O06A 3UR8A 3UP8A 1E15A 2D69A 4W88A 1EHAA 3PWGA 5E1QA 4C6EA 1TYGA 2H9AA 1W8GA 2BP1A 1JPHA 4O4VA 2WHLA 3HPSA 2CHNA 5CXPA 2L5HA 5JU6A 3I6EA 1PUDA 2PF0A 2VFGA 4D8ZA 3N2XA 1E70M 3MI6A 2WW5A 4IP5A 2EXOA 3T81A 5D37A 3B8WA 4M51A 1PZ0A 3KOYA 5I2UA 1FBAA 4A8LA 5TIMA 1M53A 3ZWTA 2GVLA 1MXDA 4FS9A 3PUOA 4ADUA 3NFUA 2C18A 4QITA 1ONXA 1KFWA 2ZUNA 4HT3A 1UOKA 1FWWA 1GTEA 2CIPA 2Y7DA 3IAPA 2NV9A 3TA9A 4QR6A 2OX4A 5M2FX 3L4XA 4V28A 3WK0A 4V1YA 3RM8A 4JQ1A 4D8AA 3T2PA 4DB7A 5IM51 1XKJA 1XRVA 1KWGA 2NSXA 9XIAA 3QKZA 4KWUA 1WKYA 4JIQA 2O4QA 1WXYA 4H8VA 3W6MA 4U33A 3LHYA 2ICSA 2D24A 5KETA 2ODOA 4KRUA 1O94A 5CPNA 1XBZA 5AVNA 3D3AA 1XLFA 2XIQA 4IIBA 4XTIA 3URQA 3PBGA 3AYRA 4OV9A 4AXKA 1WBJA 3M16A 4BI7A 4PEEA 3PWIA 1SJCA 2GVGA 5C9UA 2WJDA 3DESA 4PH6A 4EF9A 4W7VA 4D6FA 4M5PA 4MNJA 4PRWA 4XKMA 2JGQA 4QLKA 3UCQA 4Y6GA 5BMXA 6PTDA 4E2VA 1KBLA 3VDBA 2V69A 5A69A 3GTIA 3HMCA 3CHCA 4C6QA 4LAOA 2X8RA 5HNNA 4BQ4A 3GDLA 2CU0A 4S2CA 5A1AA 5AHMA 1PPIA 1JRCA 1XCXA 2X0SA 1Z8AA 4XSLA 1W3IA 2G4FA 4WVXA 3W7EA 3VCCA 3V1HA 2YXXA 3AS2A 3ABOA 4GUHA 3PZMA 1NP0A 1ENUA 4US5D 2J25A 4NXSA 4Q8TA 4PBFA 3EWXA 3FHQA 3AAMA 1H41A 3AXMA 4GYJA 3SBFA 1JI1A 2QDDA 2H6RA 2REQA 4XSMA 4AY7A 3VO0A 7REQA 1Q2RA 4O57A 4GVIA 4HU4A 3UWYA 2J88A 3S9ZA 2E6FA 4AIBA 2JIWA 1NELA 3IRSA 5FEPA 1BF6A 2EG8A 2DU2A 4L7ZA 1BGGA 2GZXA 3AWOA 2OSYA 3LHZA 4LF1A 5LHEA 5AHFA 4JCLA 3W0KA 2OVLA 1UD4A 3R4IA 4PB3A 3WENA 1K9DA 5A8OA 4CQDA 3NPUA 2FB2A 3CK5A 4GK8A 2J27A 3W29A 3PAJA 2DSKA 2G96A 4P5UA 5DT7A 3LBOA 3ARUA 1VLIA 1UP2A 3CZEA 5LXEA 1PEZA 3O15A 1AD1A 4XVEA 5FJRA 8XIAA 2BODX 4JR5A 1Z44A 5M1TA 3B3DA 1DWHM 4C60A 3WFAA 2V3EA 4H9VA 3ARYA 3MJYA 3FSUA 1J5TA 3E0WA 3PJUA 1TE1A 4JQAA 3I6TA 2BDQA 3CL8A 4ALDA 1DE6A 2HVNA 5HUOA 4FXFA 4XIMA 4FK9A 2PWVA 5FD0A 4ZENA 4X2PA 2DIKA 2Y2WA 3LLFA 3NYZA 2V2HA 3SCTA 1OX4B 2CBIA 2YBTA 1NEYA 2ZBTA 3TN6A 4Z1YA 5BU6A 3BLEA 2VX6A 4TO8A 1WQ5A 2PUZA 2C71A 3R0KA 3ZVHB 4D1IA 3ITYA 1XD0A 1BXBA 3KEHA 1KXVA 4EXAA 1MDLA 3IJ6A 2J7BA 4GY7A 2JQXA 1BVWA 1F3TA 3L65A 1QK2A 1K9TA 1Q8JA 4U3CA 3H2EA 2P0OA 1DTUA 1CW2A 2B81A 2C6QA 3NR0A 4WEVX 3WJSA 3RUBL 3LTPA 2ZA1A 5CCZA 5KZEA 3B8UA 4X61A 4ECLA 2W4XA 4XQ6A 1G7VA 3W26A 2XUCA 4O15A 2HISA 5FF7A 3UG3A 2PDCA 2QJIA 1W37A 4PMDA 3K8MA 1OGBA 2O0TA 4MUZA 1VC4A 4KCVA 4C91A 3WNLA 3RU6A 2FQIA 3M0KA 1TZZA 1TPVA 2YDAA 4LV9A 3GR8A 1KFLA 4LNYA 4NY2A 4RNJA 3DFSA 5LNWA 4TOQA 4YYCA 1QCWA 1OCJA 2EPKX 2WWDA 1AZ2A 1XLAA 2D2HA 3M0ZA 1LLWA 1E6NA 3A64A 2VR5A 5LIWX 2KX9A 1HXJA 2BVYA 3L67A 3MHUA 5D8WA 3U5YA 4QIUA 2XH4A 4RL3A 4DWDA 5FOOA 3ARTA 3QPEA 2OT1A 5BU9A 2ABAA 1R9XA 3ABRA 3HG3A 2E6YA 5T9CE 3O6AA 5LHFA 3UW6A 3KP1A 3EXRA 4A2SA 3EDFA 2PDNA 3GNOA 4DWSA 3VOJA 2GUUA 1ZUAX 1UROA 3VA8A 2DQXA 3W7RA 1VPYA 3GX9A 5CH9A 3GUWA 6XIAA 1E55A 1GVIA 2BHYA 3CYVA 3SY1A 5CC3A 3MI2A 2PF8A 5D30A 1GPWA 5AYIA 3EWBX 1E51A 1KKRA 1U5JA 3N19B 1UBSA 3L2IA 3CUHA 4KPLA 5FI8A 1GQIA 3W3OA 2XIMA 4QE4A 3F2CA 3RCYA 6ALDA 3EXSA 5DLCA 4ACYA 1I0DA 1OT2A 3A3WA 2I14A 3WLLA 4HPJA 2HBVA 3FJLA 3WH9A 3W1RA 2FDSA 4Z1BA 3ZJ6A 2A7NA 4MYAA 1R47A 5FIPA 4O13A 1U83A 1VYRA 3NZ1A 1WUEA 2OZTA 7PTDA 3IIPA 4OIFA 3GB6A 5IHRA 4ZB2A 1LRQA 3IARA 2XGBA 1XSIA 3UFYA 3EA2A 2FMOA 2POZA 4JTIA 3KCJA 3CIXA 4WSJA 3GTNA 4OV4A 1VZWA 2ADAA 4FLSA 2WCSA 1YBQA 2VGGA 4JTFA 2PWUA 2CLHA 3WLQA 3VXGA 1R3SA 3RFAA 2F6XA 1RAKA 3H12A 1EC7A 2A0NA 1CNVA 3KCLA 2XH7A 2QCMA 2BX7A 4H8HA 3RK8A 3ZSTA 3Q94A 2J7GA 3LD5A 3SECA 4BKNA 1XX1A 4IL2A 3I65A 3FEMA 3PS7A 1VR6A 4WXYA 2BLEA 2Y24A 4C6PA 1XLMA 1V77A 3VDAA 2GVEA 2A7PA 3UESA 3DHFA 2OCZA 3SM0A 4LAMA 4ACZB 1QO5A 1SFSA 4TX9A 2E5BA 5DCEA 1DYSA 4E4FA 2NUYA 1SQ7A 3W23A 3NPXA 4EKJA 8RUCA 2J9XA 4O8RA 2VFHA 4GCXA 4XKYB 3RRXA 3D47A 2PFHA 5D02A 2RKXA 3VOFA 1AODA 4FNQA 2ZX5A 3AYVA 3GNNA 3R79A 3MV11 4E2OA 2Z1SA 1SO5A 2XWEA 3GDMA 2DIEA 1Q6QA 3PZIA 2CITA 2QYGA 3BUVA 4J3WA 3AMLA 3QKEA 4PCPA 1M7PA 1RVKA 2X41A 4PCSA 2A4AA 3A22A 4F3HA 1GT8A 1WKDA 3B9DA 1XC4A 1EJ7L 2PU1A 1L9WA 3DH7A 4O53A 5D9NA 3N2BA 3OVGA 3APTA 3FSTA 5D8ZA 2YL8A 1YTKA 2YCIX 1ICSA 4WY0A 3MUZ1 2QJJA 1OEPA 2CLFA 1KM3A 5HWMA 3SN0A 4UTTA 5FF2A 4MLRA 1Q6GA 4PUWA 3VOCA 4JDBA 4UTLA 1XSKA 3QC3A 2OT0A 4FX8A 3BV7A 4ADSA 1Q6EA 5FJIA 1QT1A 4NJHA 3WQOA 3ARSA 2ZX8A 2DQWA 4GVGA 2Y0FA 1KXQA 3KTSA 5AC7A 4GBUA 3L0NA 1EJVC 4F0KA 3GC2A 1SJDA 4O1DA 4NSBA 3WMBA 2I17A 4HBKA 1K1DA 2I57A 2DZVA 2ZZ3A 3DFQA 3WDHA 3U2ZA 3B8TA 2HK0A 3TFXA 1WZLA 5PTDA 3F4CA 4WKHA 3G1AA 1UZDA 2C7FA 3NGJA 5HULA 3RX2A 3C0LA 2ZWZA 1DJIA 9XIMA 1HL9A 3JZUA 5BMWA 3IJQA 2V9DA 4L64A 4QLLA 4ERAA 3EOUA 4IXHA 4JAWA 4DNMA 3G1SA 3H2OA 1IEXA 1FDYA 2BNJA 1QOXA 4GIAA 3GM8A 1V6TA 3MHFA 3O0FA 5F1VA 1JUBA 4M1BA 1TRIA 2QMKA 3VM7A 4P7LA 5J5DA 4U5IA 4I6VA 2ACRA 4A3QA 3PZTA 4B5TA 4QG8A 5K9DA 2AAMA 5JUVA 3WLOA 1VFHA 3HB9A 3M5ZA 4L56A 1RA0A 5BNKA 5F2LA 2FZDA 4LS1A 1V6UA 3UEQA 4QEEA 2G97A 2XINA 4A21A 2RDTA 2F9RA 3PFMA 1C8VA 5HMSA 4HA1A 3AISA 3W7NA 2XSBA 3RF9A 1YDNA 5M5DA 1RCQA 4H9TA 3SO7A 2AL2B 1BVZA 2QDGA 4KFPA 1O7AA 1T96A 3W1PA 2XIBA 1AQ0A 1CXLA 1EUAA 3N3TA 4GZ7A 5BXRA 2PTXA 3UVIA 2ZA2A 3IUDA 3QGKC 1GG1A 3VE7A 2DZBA 3MMWA 3PK7A 4J3ZA 3MKKA 2X2YA 4JYDA 5HAOA 3KWXA 4DJDA 1K6WA 1Z41A 2H8XA 4KF1A 3RLHA 1B1YA 1T0OA 1TCMA 1T99A 1S2AA 4MY8A 1O1ZA 2OOGA 1IT0A 5FEXA 4FO4A 1D8CA 1VCGA 3SGUA 3ME3A 1S46A 4GYFA 4JQ2A 3NVDA 4JFSA 5J04A 3NZQA 1XS2A 1HVQA 2JE8A 4HYVA 4A6GA 4YCOA 1TQXA 4KCUA 1OC6A 1JYNA 2RDXA 5I3FA 1PTGA 2DGAA 2AKMA 1TTJA 5GJMA 5JXQA 1K9EA 1PIGA 4GBDA 3T0DA 1N8IA 2QCCA 3NQDA 3K4DA 4ONVA 4B92A 3SZ8A 4GFSA 1TG7A 3MS8A 3WLJA 1IEWA 1VJSA 3EWUA 4LUTB 2AQWA 1OQFA 3P5ZA 4WOQA 5E6ZA 3RO8A 2ZTJA 5CGMA 3KS5A 2WPBA 2C14A 3FNDA 3QHOA 3DCPA 4QDWA 1C29A 1E56A 4LYPA 2CWNA 5CZSA 2QIWA 4HMDA 6TAAA 1UKOA 3K2GA 2VZVA 3KRSA 2WANA 4J4KA 3FLUA 3TC3A 3UWVA 6ENLA 3VFCA 1UYQA 1J96A 1W8SA 4RE3A 4HCHA 4YJ5A 2OXNA 4E4PA 1YNPA 4ICNA 5H2ZA 5I07A 3GG7A 4DBEA 1JZ3A 4AZ7A 2QCHA 4HN8A 1O12A 3SN4A 1P0DA 3LRKA 4Z1AA 4C6KA 4GQBA 4AZHA 1SZFA 5I06A 4MLJA 1JULA 4JICA 3TJ4A 4AFYA 3ALGA 1Q6DA 1EBHA 2DZWA 4GYPC 1E72M 5G1TA 3FDKA 1PKLA 3VDCA 3HN3A 3NYDA 3PBWA 4NZJA 4Q8QA 2BSLA 4ZCWA 3QV9A 3V0UA 4DUOA 1B0IA 5IOBA 3AS3A 3OLDA 5CAHA 1H7NA 3ONBA 1UWAA 2HVMA 2X1IA 1ALDA 3BMXA 1ZRQA 2YPIA 4DZHA 2A79A 5DCDA 1QMLA 4IFOA 3R0UA 3XINA 1QW9A 4UIOA 1DQUA 1VRXA 2A3HA 2VQUA 1JCYA 3WF0A 1YXYA 4X3ZA 4QE1A 1RSCA 3O63A 3DC0A 4HGXA 4GWEA 2NLIA 4L4OA 2YYUA 1SW7A 3W7DA 3TYCA 2BGNE 4W89A 2RAGA 5C9ZA 1THFD 2J6XA 4PL1A 1DORA 1UMLA 3I4EA 4GY1A 1E71M 1V0NA 4N7QA 4AD0A 4REQA 1DWGM 4Z08A 1FCUA 3QY6A 1QW7A 3PTMA 1RY0A 2P1FA 5DFAA 1H61A 4AEFA 3CUGA 2PP3A 4UNLA 2WYSA 3S6DA 4WKFA 3DHUA 2VURA 5CBJA 3MUCA 1Q8AA 4H4IA 2OWCA 1R2SA 4HPNA 5C54A 4GQQA 4MOZA 3LRMA 2ZRZA 1U2YA 1N55A 2ZX9A 4XISA 1BYCA 2A7RA 1AMYA 2CLEA 2W91A 4RV8A 3WCZA 3DFTA 3CMGA 3KP0A 3PULA 1G01A 1H4PA 4MWAA 1LL7A 1XPYA 2PDWA 1DXEA 4MAVA 4KGLA 4PMXA 1B3VA 2PSNA 2ZX7A 4PMQA 5T9BG 1Z3NA 2ZADA 1GK8A 1V02E 5A8QA 2DZSA 1R38A 2XSXA 3B9AA 4JYFA 3CAVA 3SN1A 2ON3A 3HTWA 1OF8A 2FB3A 1YYAA 1H62A 2WNQA 5EMYA 2O9RA 5FEZA 4DF2A 2OO6A 4IGNA 3W84A 4MAZA 4IP7A 1VFTA 1A5AA 2PWHA 4Q3MA 4W84A 3TCEA 3GQYA 2QMJA 1DWJM 4IM4A 3DG6A 1SZGA 1GQKA 2JIEA 3AJXA 3PZGA 3L4VA 4MADA 3SRKA 2QLYA 4N4QA 2UY4A 3Q2DA 1JCMP 5EMLA 3MMDA 3R1ZA 3N4FA 3CT7A 2A2IA 3KAOA 2V38A 1W56A 5EYWA 3K1DA 3B05A 3HQPA 4JTLA 1ME9A 1TWDA 4L6DA 1XRSA 4BWLA 4IMDA 3S2MA 3AS0A 5H8UA 4RZ6A 3FXYA 1N8WA 1QHOA 2PP1A 3W02A 2VDGA 2QKFA 4EE9A 2UWFA 5BCAA 4R85A 3H4GA 3VMNA 5BW6A 5HQLA 3C3NA 3BCFA 1ADSA 3WEOA 2PDGA 1ONWA 3R10A 3SB0A 3REQA 1H49A 4OBRA 2E77A 1HO4A 3PPCA 5HANA 3VOGA 1DXFA 4K39A 1P6WA 3M9YA 2ZX6A 3GZ3A 1IGWA 2OGYA 2BXYA 4MY1A 3GD6A 3GK0A 2OB3A 4LRSA 3WD3A 4IPJA 5J8LA 2HROA 4XWUA 4FLRA 1TX0A 3NSXA 3LPGA 3OIXA 3UNDA 2GGJA 3MZ2A 4AZBA 3NNTA 1T7LA 3LX9A 2RJGA 3QBUA 3HM7A 2FZ9A 1C7SA 1HUVA 3HJZA 3QOMA 4C7GA 3N9KA 1B3OA 3RNDA 1SR9A 1V6WA 2A21A 1E3XA 3EKGA 1PKNA 4R9OA 1KTNA 2O55A 5E0CA 1BSLA 4LVGA 1FWJC 1DWFM 1Q65A 4GNJA 1S2WA 3A24A 3ITVA 4IZGA 4LWWA 1EXPA 4HHHA 4UMAA 1VFMA 2CWXA 3QTPA 3LBMA 4S3AA 2XGZA 1H60A 4H41A 1QK0A 3E6EA 1KBJA 1CYGA 4TU1A 5FA5A 3T44A 1AK5A 4XBSA 4CN4A 1VBUA 5A6TC 4HTBA 2RH9A 3DG7A 1HGYA 2YKKA 2BWGA 3VDHA 1TO3A 5D4YA 3GAYA 1B54A 3TJLA 4QEHA 4HOWA 4P2VA 5CZJA 3WDQA 3N15A 4N6FA 5M03A 2ZKMX 3MANA 2QCEA 1KRCC 2GYIA 3GSMA 1F4HA 1EA0A 2DT0A 4A35A 1HKWA 1ZBWA 3E0IA