2YSWA

Crystal structure of the 3-dehydroquinate dehydratase from aquifex aeolicus vf5
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
219
structure length
219
Chain Sequence
b'MLIAVPLDDTNFSENLKKAKEKGADIVELRVDQFSDTSLNYVKEKLEEVHSQGLKTILTIRSPEEGGREVKNREELFEELSPLSDYTDIELSSRGLLVKLYNITKEAGKKLIISYHNFELTPPNWIIREVLREGYRYGGIPKIAVKANSYEDVARLLCISRQVEGEKILISMGDYGKISRLAGYVFGSVITYCSLEKAFAPGQIPLEEMVELRKKFYRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal Structure of the 3-dehydroquinate dehydratase from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
total genus 86
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yswA00
4LOCA 4LUJA 3TU9A 1A5CA 3P81A 4JICA 4RLIA 3G8RA 1JRCA 1EEPA 1SU5A 5DY3A 5LNSA 3W1LA 1G4TA 4WQ6A 1FDJA 3W84A 1OHLA 1OX6A 4MY1A 1T96A 5TQLA 3NOEA 5KINA 3V75A 1AL7A 1RQBA 5G5IA 2A6NA 1VGAA 1SZGA 3O16A 4H6KA 5EA9A 4PH6A 2ZRUA 2XN0A 1GJPA 2DU2A 2QCHA 3QPZA 4DELA 2ZZ6A 3UWWA 4UR7A 3H54A 4RCXA 5MHBA 3ANYA 1KBJA 1KM4A 3PSVA 3E02A 3C2RA 1BWKA 1SQ7A 1KBIA 1JJKA 1W3IA 1RQEA 3LXCA 1TTPA 1AW2A 3T78A 3NZ1A 1PL9A 1QO5A 2QDGA 2WNZA 1W54A 3W7PA 1GVOA 1JR1A 1TPEA 2AAMA 4BI5A 3C52A 4GNJA 4GWEA 4P2VA 3R89A 4A21A 1WDWA 4MIMA 2YDAA 3ABSA 3KVKA 1QNVA 1YXDA 3W2JA 1YXYA 3LLFA 4TMBA 4ZQCA 1UBSA 1M7OA 4UTWA 3HB9A 2V2HA 1OX4A 4NJJA 1OYCA 4UFLA 5D09A 1XC4A 1LM1A 1A5SA 3QQ0A 2R94A 4ADUA 2PE4A 5AHEA 2G97A 4HPJA 3PUEA 5HR7A 1HFBA 2X30A 3W83A 1V7YA 1P1XA 3AO0A 1KTBA 3P82A 3VNDA 1SZNA 1R2TA 5LSMA 4O8RA 2JBMA 5HINA 1GTEA 4EF9A 4LY8A 3VE7A 3W87A 3NM1A 3OG3A 3O6CA 4ADSA 1TB3A 1F2JA 3OA3A 5AFDA 4UUIA 1O94A 3QSRA 4FNSA 5IBXC 3PG9A 1SO3A 3GNDA 3DFSA 2H90A 4JTFA 3U6WA 4ALDA 2UV8G 3FA5A 5CZJA 4GE8A 3MBDA 4DF1A 3RF9A 4IMGA 2YW3A 4JTKA 1LZOA 1X1OA 1VYPX 3UZ5A 3UPBA 4G1KA 3V1PA 2YZRA 4NNAA 1SZFA 4N9DA 1J4EA 4ZQMA 1S5WA 1G69A 4N02A 4C1LA 5LHFA 5G1TA 3BGGA 4BWLC 1NEYA 3LCLA 3DFOA 2ZZ3A 1LLWA 3NQ7A 4POCA 4B5NA 1N8FA 3W6YA 4LS0A 2C16A 2JK2A 1DBTA 3TAKA 3GIYA 5LNRA 3PM6A 1MSSA 1JCMP 3GR8A 5AYYA 5I3GA 2EF9A 3WFAA 3NQMA 2B7OA 1KA9F 3C56A 3KVJA 4IGHA 3P8IA 5HR6A 1LRNA 2C15A 3NO5A 4FHAA 3MJYA 1FY6A 3W76A 1RVGA 2W0UA 3B0UX 3KHJA 5EL1A 1XUUA 1FCQA 4YXGA 4RZ6A 3LCHA 4BFAA 1UCWA 2BX7A 1VHNA 1H7XA 5A8GA 3NQ6A 2ZZ2A 3EWWA 4JEQA 4ML9A 4CNPA 3LTYA 1TPWA 2EGZA 4IQLA 3W7GA 4GXMA 1MO0A 4NZFA 2CLMA 2ZZ7A 4DPPA 2CZEA 1ALDA 2B4GA 5AHIA 1R46A 5BRBA 1I45A 2VEMA 3NG3A 5DELA 1T8XA 3A22A 3P80A 4CCDA 1TQXA 3S5YA 3LHZA 3NL3A 1LOQA 3NQ8A 2PCQA 3IIXA 4XKYB 3HOJA 1YDOA 5A5WA 3DFPA 2VFEA 3WK1A 1I2QA 4NX0A 4XBSA 5CZ0A 1WYIA 3CQ0A 3DFQA 3S0CA 4O0ZA 5ABTA 1H1ZA 3BGJA 4UTTC 4KFPA 2DZWA 2WKJA 4O1AA 3NQVA 3PSWA 5FEZA 3W2KA 3WJWA 3W1MA 4Y96A 2Y88A 3CM4A 2QCGA 4O28A 1W31A 3T55A 3NPUA 4Y6GA 2ZBTA 3E12A 1D9EA 4JTSA 4QM1A 2DJXA 3NR0A 1ZAIA 3G3DA 3PF3A 2DORA 1R2SA 4A2SA 3MWAA 2OT0A 4WX2A 3TQVA 4XTDA 4YLWA 1EWDA 1OFEA 4N6FA 3ATYA 1B57A 1R47A 4JIPA 5I3KA 5G4WA 1ME9A 4D2JA 1YPFA 1NVMA 5DN1A 1EP1A 1THFD 1LROA 4O12A 3R12A 5D2VA 4PL2A 2X1RA 2FJKA 1VC4A 2D73A 3L68A 1H63A 1XBYA 1LBMA 1YXCA 4WD0A 3G1YA 3LCWA 2J9YA 1SUXA 4NJIA 3HGSA 2FTPA 3STCA 4M6PA 3I7SA 1YADA 1N7KA 5K4XA 3WJXA 3PS7A 2J88A 3S5NA 1HG3A 4FX6M 4A29A 3CC1A 4M6QA 4GJ1A 2QF7A 4TU1A 3K30A 4JXCA 4I9AA 2GQAA 4K6AA 3EKZA 4AF0A 3LTPA 3EKLA 1TCDA 4AWTA 3LX9A 1W1ZA 1TPB1 2E6YA 3PR2A 3H53A 2J6XA 1XXXA 4ORMA 3C3NA 3QH2A 5G1YA 3O63A 1XBXA 1KFCA 4RZ5A 3WK0A 2O7QA 3IIVA 3QW4B 1GTHA 4MZ8A 1SW3A 4N4PA 4FXRA 4FNPA 4E0CA 5HMSA 1I2PA 2GVGA 3L67A 2A21A 2OJPA 1WX0A 3W7JA 3C2EA 1VRDA 4X22A 2DZPA 5FI8A 1KTCA 3M16A 3GXPA 2YXGA 1FWWA 4TO8A 1ZFJA 2P0OA 2ATMA 3LCXA 4JD4A 3MO7A 5LNWA 1OYBA 2X1SA 4JTJA 5F4XA 3P84A 5F4WA 3W7MA 2ZRXA 3Q58A 3TSBA 2EPHA 3EX1A 2G96A 5F1UA 2C18A 2X16A 1TIMA 1L6YA 4JTGA 3IGUA 1TRIA 2W79A 5K9XA 5C2XA 2ISWA 3LV5A 2WV8A 4GUIA 1F74A 2YFOA 3G22A 2GJNA 4O13A 3W2UA 2BLEA 3WJZA 1MEHA 4JX4A 2YSWA 1P0NA 1OYAA 2NX3A 3DKLA 4R53A 3NQGA 3GX9A 1TREA 4MYAA 4ZQOA 4FXSA 3L65A 1OFBA 3EX2A 2QJIA 3PUOA 3BW2A 1WA3A 3DU0A 3EX3A 5KSWA 1I2RA 1OK6A 4X3ZA 3O8AA 1W8SA 3BLIA 2E5DA 1LBLA 3I68A 1H50A 2CLIA 5J5DA 1TTQA 4O1DA 2BZNA 2BSLA 2V0TA 1TJPA 5BMXA 4WY0F 1A50A 2DZUA 1VCFA 2FPVA 4LVDA 2BXVA 3N2XA 3MP3A 4LUIA 2Y6ZA 4P61A 3DFTA 4WUIA 2JKAA 1QR7A 4Z1DA 3VKJA 1F05A 3FYOA 3U2OA 1W56A 1UB3A 3ABOA 3LHYA 4NUWA 4OV4A 1L2UA 5C54A 1NF7A 1G7VA 3SI9A 1KFEA 5D32A 5EMUA 2A7NA 1JCYA 4FIRA 1H7OA 5CPOA 3DGRA 4HNVA 2OCZA 3TSDA 1F5ZA 4C1KA 2E68A 4MFEA 3BG9A 5F4SA 4O17A 2VEIA 4IPIA 1ZHAA 4JY9A 3TE9A 2Y70A 3M6YA 4LVBA 3GAYA 2P1FA 3BVJA 3DHDA 3GDLA 3QRHA 4ZL1A 3TJXA 2BWGA 1R30A 4IX2A 3PVFA 2NZLA 4H4IA 4LVFA 1OFQA 2Y61A 4AVFA 3LXAA 1VR6A 1PHQA 3NL5A 5AC6A 1LRTA 3JRKA 3RNDA 4NT0A 3L5MA 1CI1A 2QR6A 4O0KA 4QNWA 1NAL1 2ZRVA 3NM3A 4TMCA 1SFLA 5BOOA 3W88A 3JR2A 4AH7A 3CB8A 3QZEA 2C13A 1FXPA 3HPZA 2RDTA 3B4UA 1HO4A 2A1YA 2Y63A 2ZCGA 1XBZA 3M9YA 2CZ5A 3NGJA 2A7RA 4CNOA 1K8XA 5K7JA 4AAJA 4O11A 2FB2A 3HG2A 1ZJIA 3CIWA 3KVLA 3FYPA 4M19A 4DBDA 4Q4KA 3LERA 5AHLA 1ML1A 4L4MA 4UTKA 4WXYA 1P5BA 3UQNA 2VELA 3RLVA 1GOXA 2PRMA 5DCBA 3EB2A 3DHFA 2CFFA 3E49A 3BG5A 2I1OA 1UUOA 4GUJA 2XN2A 3BPWA 4MZ1A 2FDSA 1LCOA 3FJLA 3GK0A 4PTNA 5U7SA 1RQHA 4UNKA 5K2ZA 4WOQA 5EY5A 5KTLA 2NUWA 5IM51 4LC8A 3TAOA 2BTMA 2Q3OA 3PY2A 3SJ3A 2ZZ1A 2FPYA 1W5NA 4IMDA 3TQ0A 1TPUA 2B7QA 4O18A 4AWUA 2OMAA 4LRSA 1K7EA 4Z1AA 1OFPA 3W7EA 1KFLA 3W86A 4RR4A 3DH7A 2XFWA 1TPC1 1IXNA 3MMTA 4Q33A 5AHFA 4LV4A 1W3TA 1IIHA 2ABBA 3CLMA 3Q2DA 4Z08A 3W74A 3W7LA 3CWNA 5FF7A 1VLIA 2PURA 4CQ8A 2A4AA 5LNUA 4BR1A 4JY8A 1IXOA 5D03A 3DBPA 3MUXA 5BW6A 1G67A 2E77A 1RPXA 2JGQA 4S2CA 3G0SA 4DXVA 3LCFA 1G4PA 1W3NA 4GUGA 5D2YA 2JGYA 2VFHA 4DQWA 3B8DA 2VFFA 3P60A 5KZMA 3HIJA 3FKKA 1X6UA 3MI3A 2EAWA 5LGXA 3UNDA 2RDUA 2W6RA 1AK5A 2QCFA 3AJXA 3P62A 4QNEA 5FF3A 4EIVA 4HN4A 1PV8A 3P8JA 2Y7FA 1JUEA 2C0AA 3QQ1A 3VFLA 4YMZA 1DJQA 2NXIA 2EKCA 5LNVA 1SO5A 1PCWA 4UC5A 2HTMA 4UTWC 4UR8A 2ALDA 2NWSA 1D3HA 4GC4A 3CWOX 5GVJA 2DP3A 5F2GA 3PC0A 4UTHA 1KFJA 3F03K 3Q37A 2E6FA 1F73A 3C8FA 5CSRA 3W7CA 1ZAHA 3BLEA 3P5YA 2GQ8A 1TV5A 4AEOA 4JX6A 1YTEA 4JX5A 4KWVA 3SECA 3NDOA 1U83A 1Q6RA 4WZHA 1I2NA 1J2WA 2V8ZA 3GXTA 4OT7A 5K3VA 3TJLA 4RXFA 3L2IA 4MJMA 1QDSA 2ZTJA 3G1HA 3G0UA 5IBXA 2ZQ0A 1W5QA 2E5CA 2ZYFA 4N6EA 2E09A 3GDKA 2IQTA 5CGQA 4O50A 1KW1A 3TSMA 3LHUA 1PE1A 3BG3A 4TIMA 5LHEA 5AYXA 3TROA 1EIXA 3C61A 4FB7A 2YW4A 1J5TA 4LS1A 1S5VA 5HJLA 3W3OA 4AHPA 1DHPA 4WJEA 4JDYA 3STEA 2DZVA 1H7NA 2OX1A 1TYGA 3STFA 1VS1A 1SSDA 8TIMA 4IUOA 3NQAA 1PHWA 1H51A 1L6WA 3TFXA 5I3FA 4MLJA 3I65A 3PAJA 3I7QA 4MY9A 4A3UA 3NYZA 3IIOA 4O53A 3NQCA 1TO3A 4E2DA 3A21A 5DCEA 3TW7A 3EWUA 1XCFA 3RK8A 3T40A 1KFBA 1YLVA 2GJLA 3DI0A 1FWTA 3SW6A 3LBCA 2Z0IA 4MOZA 3TIMA 4O14A 4PFMA 4JS3A 1LBFA 4CCEA 4WY0B 2ZTKA 3UYCA 3W2LA 3N14A 4CLMA 2GUUA 4R7JA 4Z0SA 1KFKA 2QCDB 3W1QA 5D2WA 2E5BA 1FUYA 3P74A 3W7RA 1H5YA 3USBA 2WPBA 1ZENA 4K37A 3GB6A 2WQPA 3M41A 3NQ2A 4IWWA 5K4ZA 3L66A 3THQA 3HG3A 2J27A 2QAFA 1VZWA 2Z6IA 3BARA 3GVGA 1H61A 1C9DA 2B7PA 1N55A 4EVZA 4ZZ9A 1FBAA 3S8HA 4RX0A 3MI6A 3KFTA 3LI1A 3S1VA 3BW4A 1VPXA 4NNBA 3W1UA 2Y7GA 2Q8ZA 1VYSX 4M6VA 1Z41A 1P0KA 2ZZ4A 1SO4A 4OWGA 4EF8A 1G6CA 1FCVA 1MEWA 1GWJA 1XI3A 4FIQA 1IGSA 1XM3A 1O5XA 4WOZA 3W7IA 5G2WA 4UTTA 4GUFA 3LOTA 1FWSA 3ZS4A 4UMBA 2ZRYA 1WAUA 2R91A 3T4CA 3W75A 1LOSA 4FO4A 1O60A 1QPOA 2TSYA 2F7FA 2ZFAA 3R8RA 2C19A 2CZDA 3FLUA 1EWEA 3GDTA 3W7QA 2TMDA 4XQ6A 2DZSA 4LTSA 2WNQA 4UXDA 4HIBA 4Y8FA 3TA6A 3FKRA 1G4EA 1M6JA 3F1QA 4O57A 1TV8A 2QUUA 3GYEA 3LBMA 3QMRA 4YCOA 1IXQA 2WNNA 1X7FA 1E51A 3M43A 2V30A 3M1ZA 5HQEA 2HS6A 3G8EA 4O4VA 5HUOA 3LXBA 2YPIA 3D0CA 1KM1A 1YDVA 2H6RA 2NV1A 5FF0A 1BKSA 4JNMA 4O54A 1EUAA 3S5OA 2VOMA 3P61A 3DI1A 1B9BA 4UFJA 1H1YA 4HT3A 4ZMGA 1AW5A 3A23A 1I4NA 1LYXA 4LVAA 1EX5A 5C5YA 2FIQA 4UTLA 2WJZA 5I3HA 3W71A 3G0XA 2HS8A 5AC8A 4HHPA 4K39A 4FF7A 3BW3A 1A5BA 4BI6A 2QCMA 5DLCA 1TMHA 3NPVA 3PBUA 4UTUA 3VI2A 1UASA 4JGDA 3B03A 2A2IA 3HBLA 3W72A 4TX9A 3WJSA 4XUGA 3RMJA 2C14A 4FNQA 3TFCA 2V9DA 1I8JA 2KZHA 1KV8A 3TXVA 3HGJA 1GVRA 3N19B 2X1UA 2WSYA 1K03A 4RK8A 5DXYA 5I3JA 3G1DA 1ZNNA 2ISVA 3S1WA 1GPWA 2NWRA 4YCPA 1MEIA 7TIMA 4ICNA 1GG0A 2CWNA 4JYEA 4AHQA 5FEWA 1W37A 3LHVA 1DVJA 1YPIA 2C3ZA 2VFDA 3CTLA 4LU0A 2E6DA 1B3OA 5CSSA 5FEPA 3OVRA 3DKJA 3PG8A 1W5PA 5EBUA 3FOKA 5FEXA 2QKFA 3PBWA 4PC8A 5F2MA 1JQVA 1VQTA 2ZA1A 4M7SA 1S3HA 3SR7A 1VLWA 5AOUA 4M5PA 3C4UA 1T99A 1DKWA 3W85A 1KLZA 4DEFA 4JR5A 1RD5A 5CZTA 5AYZA 3HGOA 3SGUA 3I7RA 3NQDA 3ZR4A 4UNLA 1GEQA 3EXTA 2RFGA 3G1FA 1RZMA 3N3MA 3IV3A 3MBFA 3W7DA 5G2IA 1XDMA 2WSRA 2H8XA 5K9DA 3W07A 1Q6QA 3W1NA 3W1AA 3UD6A 3LCIA 1PIIA 2Z2UA 4JTIA 3GLCA 1B4KA 2B0MA 4I7UA 4XZ9A 3UY8A 2QCCA 2J9ZA 2Q8LA 1TTJA 1DJNA 3QMTA 2JKPA 2R14A 1NFBA 3C6CA 3S42A 4OHQA 1JCNA 4Q32A 3WJYA 4UTIA 3INPA 3F4NA 3IVTA 4QJ1A 5AN7A 4UIOA 3N2MA 1HUVA 1DQWA 1Q3NA 2RDWA 1EPXA 5J5RA 3NQFA 3S9YA 2E1DA 3QEZA 3QF0A 4S2BA 5KMYA 3UXDA 1AG1O 3TMLA 2FQIA 2C6QA 4QSHA 4E38A 3VCRA 1YTKA 3W7OA 2AQWA 3L0NA 4OGZA 3TV8A 4Z1CA 1QWGA 1GZGA 2TRSA 5D04C 2EHHA 5U4NA 3CU2A 2QUVA 4MFDA 4W9TA 1HTIA 2FLIA 3PUDA 1KM5A 3QMSA 1GVSA 3GAKA 3EX6A 4IMEA 2NLIA 4X9SA 3N9SA 1UUMA 1Y0EA 3LM7A 3E96A 4J9JA 5KZDA 2CLEA 1GYLA 1XUZA 1TPDA 3UWZA 4GBUA 1KM6A 1LP6A 5D38A 4N9BA 1H7WA 2B7NA 4QISA 4BK9A 1K3UA 4ADTA 3HG4A 1OX4B 4NZJA 3NEVA 5T26A 2GVJA 1VH7A 2TYSA 4HNTA 1LOLA 1ME7A 3BO9A 3LHTA 3RU6A 3W22A 4LVGA 5D37A 2ZDRA 4FNTA 1VCGA 2GVLA 1OFAA 2VFIA 4OV9A 5FESA 4XTIA 5LGZA 3TR2A 2RHGA 2CW6A 4UTMA 3HPSA 3DAQA 4JIQA 2ZA3A 1TRDA 3N34A 1GYNA 1YDNA 2A7PA 2QUTA 1Z44A 4S1FA 5EYWA 2VKZG 3CEUA 1QOPA 3BV4A 4JYDA 4K7YA 4FEZA 3KRSA 1HL2A 3IIPA 2QJHA 3R13A 3TC6A 3LI0A 5E93A 3PULA 5CPLA 1XBVA 3S1XA 3MHFA 3DXIA 3L21A 3TH6A 1OX5A 3F4WA 4PA8A 3OBKA 3A24A 3IGSA 5L6UA 3MP4A 2V5BA 1EUNA 2VFGA 2X2GA 3P67A 4CNNA 2Y85A 1LLZA 4YWIA 5HUPA 3A9IA 3NPXA 1SW0A 5AC7A 3R5EA 1RV8A 3GKAA 4O1CA 4BI7A 2CLLA 4Z1BA 4UMAA 1G7UA 3G1AA 1LDCA 1JQXA 4NNCA 4MZYA 4R34A 1QO2A 3KXQA 2ZZ5A 1EP3A 1UJPA 3HG5A 3C2VA 3MW7A 1LORA 4U28A 2WSQA 3B05A 2V82A 4IPJA 5LZLA 2A0NA 3M5VA 2VXNA 2HSAA 2NX1A 5AB3A 3NXFA 2YX0A 4UCGA 3TC7A 4DO5A 3W2MA 4NJKA 1JVNA 2CLOA 1ZCOA 1VCVA 4N9EA 1KLYA 4MLRA 5HULA 4Y90A 3UWYA 3SSJA 4PCFA 1C29A 3MHGA 3L0KA 3LRMA 2VEKA 2OT1A 3M5ZA 4O10A 3I6RA 4MYXA 3C0JA 3O6YX 1IXPA 4GRSA 5D2TA 4HNUA 4MJZA 3TUUA 4ZQPA 3ZFHA 2AGKA 4XWUA 4DF0A 1CW2A 1BEUA 4UFMA 3H55A 4ZQRA 1GVFA 3C2FA 1KV5A 4M7TA 3EWBX 4DF2A 2H3BA 1TPFA 4DO6A 3S5ZA 1H62A 4NVTA 1FWRA 1JUBA 1H7PA 3MP5A 4JYFA 1GT8A 4RJEA 4K8EA 4LRTA 5AHMA 3TW6A 2NXHA 5EKYA 4R33A 2PC4A 1OF6A 3P5ZA 3HF3A 1V5XA 1SZEA 4NXKA 3M5YA 5CPNA 3STGA 2VC6A 1NF0A 2QCNA 1DOSA 4O4WA 3B04A 4KKXA 5K9CA 3UWQA 4ZVJA 2C1HA 1AMKA 2CLHA 3LRLA 1D3GA 3TCEA 3SY5A 4KFOA 3KRUA 1M5WA 2G5WA 1FCBA 2A6LA 3MI2A 4N4QA 4HKPA 4QIUA 1AW1A 1IIGA 1OFOA 3G24A 3NA8A 1TQJA 4ZQNA 3W70A 1OG0A 1L9WA 3LTSA 1A53A 4AB4A 1O4UA 3O15A 5CG7A 4LT9A 2DJLA 2RKXA 1XL9A 3W1XA 1CX9A 3W2NA 3B06A 4FNUA 4JTTA 4E2BA 3JS3A 3LHWA 1JULA 3KVMA 4AWSA 3N9RA 3G3MA 4BWLA 5F1VA 5KZEA 3NAVA 3EXRA 4RZ4A 2FB3A 1Z42A 3OHIA 4K7VA 1W5MA 2NXGA 2ABAA 4NQ1A 1KTNA 1Q6OA 3LGEA 5D33A 3LB0A 3LV6A 1KM0A 5D30A 3GR7A 4OBTA 5DBUA 6TIMA 3L5AA 5H2ZA 3IEBA 4OQVA 2NUYA 1QOQA 3NZRA 4LV9A 1PS9A 3DENA 1OVDA 1FX6A 4A2RA 4AF0B 1TJRA 2P10A 5HWNA 1R2RA 3W7NA 3CHVA 4CCCA 4NJGA 2G95A 1JCLA 1T0OA 4LNYA 5E0KA 4X2RA 3HMJG 4CQ9A 1YTDA 3ZWSA 1IF2A 3SZ8A 6ALDA 3TQKA 3PB0A 3BK0A 4IX0A 3TK7A 3IGXA 1KM3A 2OZ0A 3RFAA 4WXZA 1PCKA 1ADOA 1TPH1 4HSOA 3PWAA 3L5LA 4RXGA 3G1SA 1L6SA 1WOBA 4DBEA 1F6KA 1GVQA 3IIZA 3L9CA 4YL2A 2X1TA 1C8VA 1FQ0A 3RLUA 3CEPA 1TV7A 1DL3A 1TSIA 2DZXA 5HNRA 2Z6JA 4AHOA 2YYTA 4A22A 4ONVA 4CQAA 1QPNA 2QCEA 3CIXA 3FJ6A 3O1NA 4XBKA 1PVNA 1OF8A 2VEPA 3QM3A 3NL2A 3W73A 4FNRA 1EA0A 2LLEA 1GQNA 3W1PA 1QCWA 3M47A 3E9AA 1QMLA 2GOUA 1XFBA 4LC6A 3B0VC 3UXAA 3MHUA 4JTUA 1OJXA 3A5FA 3W1RA 3PB2A 4PL1A 1ME8A 3KAOA 3NQEA 3HJZA 3T7VA 1RR2A 2J9XA 2O7SA 1FXQA 3FFSA 3O05A 3OIXA 5E1QA 3OVQA 1B4EA 2QEZA 1ONRA 1JCJA 2V81A 1SPQA 5SWUA 1WV2A 4MKNA 2H8ZA 1GG1A 3ATZA 1MXSA 1K8YA 4IJBA 4JTLA 4Z0JA 4EWND 4I7WA 4DPQA 2V5LA 2TPSA 1OFDA 1K02A 4FX8A 4TR9A 5CPMA 2YYUA 3GZ3A 4BF9A 4MY8A 3ABQA 1TTIA 1M7PA 4PEKA 3GDMA 4IXXA 1EP2A 3HO8A 3TKFA 3WK2A 1JUKA 3B0PA 1ZAJA 4NXSA 4O16A 1P4CA 4K36A 5TIMA 4PODA 1W0MA 4KWWA 3LLDA 5DY2A 4AMAA 1X1ZA 1FCUA 2CLFA 2V2CA 4K38A 4HNNA 1G4SA 2Y62A 1VYRA 3VE9A 2XN1A 4UFKA 4WY0A 4QQ3A 4IMCA 3CT7A 1WXJA 2F84A 1SSGA 3M0ZA 5KITA 2GPTA 2JKEA 2QCDA 4MUZA 5FF4A 3A5VA 3IRDA 2J24A 3EX4A 3M7WA 4IOTA 3UPWA 2QAPA 1OABA 3FEMA 2WO5A 4JDBA 4H3DA 2I14A 3NVTA 3CPRA 3IVUA 3SFKA 3LDVA 5CKSA 5EPDA 3ELFA 1Q6LA 5F2IA 1OFRA 3EEGA 1NSJA 4UFHA 3S1UA 2QDHA 3DZ1A 1WQ5A 4KFNA 1TPVA 5HWJA 1BTMA 3EWZA 3ABRA 4XKYA 1QFEA 3U8GA 1ICPA 2Y7EA 3S6DA 5HWMA 2ZRZA 4LW7A 1VHCA 3TXZA 1QAPA 1Z48A 2CU0A 2NV2A 1O95A 4NX5A 1SW7A 2Q3RA 3O6DA 2Z1BA 5TBOA 3Q94A 4OE7A 3EWYA 4LWWA 3NPWA 1HO1A 4NU7A 2I9EA 2YFNA 1FDYA 2NUXA 3SIZA 1EB3A 3TX9A 4NJHA 3OEXA 2A5HA 3MYOA 4QITA 1K8ZA 1DV7A 1H60A 4QAIA 3TDFA 3YPIA 1YYAA 1XKYA 3QSTA 3EXSA 3G18A 5L9FA 5DXXA 1I2OA 3R2GA 4O1BA 2H3DA 4IMFA 3HGRA 4UTJA 4UFIA 4I7VA 4JTEA 1AL8A 3C2OA 1ICSA 1U5JA 1F76A 1JRBA 3M5XA 3PBVA 4N9CA 1ZY9A 1S5TA 3EWXA 4RV8A 3THAA 4ORIA 5BNKA 4O19A 3M44A 1BWLA 2CZFA 1O5KA 4MPQA 2QCLA 4JTHA 3W9ZA 1QPQA 1F6PA 2YCEA 4O15A 3OVPA 4HPXA 4UMCA 2ISSA 2FPTA 1LRQA 4L4LA 1WBHA 1DQXA 2VENA 3QYQA 2YR1A 2A85A 4AXKA 2WOQA 3UWVA 3PBYA 1X8FA 3QJAA 2ATSA 4U4MA 4GFSA 1K7FA 2ZRWA 3W7KA 1SR9A 3P7YA 5LKYA 1W5OA 4GUHA 3UWUA 5DBTA 3QW3A 4FX7A 2V2DA 3ZWTA 2NX9A 5D02A 3GDRA 2PRLA 3HPXA 5CZSA 3HQ1A 4MVAA 1A5AA 1FWNA 3NL6A 3UY7A 2FFCA 1ZALA 3O06A 5D05A 3BLFA 3KRZA 3W7HA 5C55A 5D2XA 1XDLA 2E6AA 3QC3A 4OU1A 1JCXA 3W1TA 3O07A 4O52A 5DCDA 4Y9AA 1WOAA 3L0GA 3NNTA 2HMCA 5G4EA 4N2YA 4EOUA 3G1XA 4RKAA 1QPRA 3WK3A 3LCGA 5F2LA 3FS2A 3GNNA 4K8HA 1VJIA 4IXHA 5AHNA 5H91A 2RH9A 3T44A 3SGZA 3E0IA 3GXNA 5C6MA 2GQ9A 1MZHA 3GKFA 1LTDA 3KX6A 1WBJA 2YGYA 2R8WA 3TNOA 3LRKA 1F7BA 1FDZA 3G1VA 2PRHA 1ICQA 5G2HA 1OK4A 1SFJA 3QFEA 5BMWA 3KOFA 1K7XA 2QJGA 3TMQA 5I3IA 1H7RA 4LS2A 3QPYA 3W23A 4DO4A 2CLKA 3FIGA 3IVSA 5FF2A 2DZTA 1Q45A 1KM2A 4HSNA 1SO6A 2ZA2A 2Y7DA 1DORA 3MYPA 2Y89A 4JN6A 3UZJA 3DFNA 3N73A
chains in the Genus database with same CATH superfamily
4LOCA 1A5OC 1ONEA 4XZLX 2RGLA 3TJIA 4P7RA 1A5CA 3P81A 4RLIA 1JRCA 3MUY1 3S3GA 5DY3A 1KNWA 3W84A 7TAAA 2VQUA 3BANA 5ECVA 1AL7A 2CHOA 1EC9A 2GDQA 2DEPA 2NSXA 5EA9A 4PH6A 1TUXA 3QPZA 2OFJA 3WZ0E 3WQ5A 7A3HA 3H2OA 4QLLA 2D2OA 4A3RA 1UKOA 3PSVA 4WDTA 3LYEA 1KBIA 3KOYA 2I5IA 1RQEA 2GWNA 3LXCA 3QGKC 3DYOA 1GQLA 3NZ1A 3KTSA 4GYFA 3R94A 1YNQA 2X0HA 1GVOA 3H4XA 2FYMA 3SCQA 1JEZA 1TPEA 1SMAA 2OO6A 2AAMA 4Q4MA 1DIEA 3CZEA 4ZOCA 3C52A 2PTDA 4GNJA 4GWEA 4XSLA 1J0YA 3MDUA 4P2VA 4A21A 5FJPA 2YDAA 1QNVA 2VO5A 2VUYA 1MMFA 5HMDA 4TMBA 4IPLA 4GQ0A 5I07A 4UTWA 3T07A 1OX4A 4CUCA 4HK5A 4PTDA 4EACA 3BSHA 4UFLA 2OWCA 4B92A 3ARZA 3QQ0A 2R94A 1XRSA 3R0DA 4ADUA 1UROA 2OPJA 5AHEA 5HR7A 2EJ1A 2PDCA 3TJ4A 1JG9A 3K1GA 1KTBA 3VNDA 1SZNA 1U1JA 2PWUA 4O8RA 2JBMA 4EF9A 4LY8A 3W87A 4RDWA 3H23A 3OG3A 4DWSB 2DY3A 1C91A 4YHGA 1TB3A 3R10A 4ACZB 4DY1A 4XZBA 3QSRA 3SCRA 2PWDA 5CH9A 3UA3A 3NCOA 3PG9A 1R3SA 3U6WA 4ALDA 3A3WA 1VB9A 4GE8A 3MBDA 2QV5A 4YTRA 1WO2A 3UZ5A 3UPBA 2CBIA 2GLKA 2YZRA 1VF8A 3GS6A 4C1LA 5LHFA 1CXHA 1QI2A 3DFHA 1TELA 3R8HA 3IJ7A 4Q8OA 4B5XA 1XPGA 1KO0A 3UF9A 2XGZA 1N8FA 5HNTA 1HKIA 2C16A 2ZC8A 3VC5A 2G3FA 2TAAA 4C6KA 3RX2A 1MSSA 1JCMP 1AJZA 3GR8A 5AYYA 4WRHA 2B7OA 3KCOA 1TZZA 3KVJA 3NQMA 3QPEA 4IGHA 5HR6A 4LUSA 3ZVHA 2YXXA 1HP4A 1FY6A 4ZB5A 3BLOA 3KHJA 5EL1A 1AJ2A 4DIAA 1WZKA 3SUUA 4RZ6A 4UNIA 3BSGA 4P8UA 2JALA 2J7HA 1UCWA 4XO7A 3T42A 4AU0A 2BX7A 4LY4A 4A8RA 1C8XA 2PLMA 2WJEA 1E1CA 4QGCA 4V1YA 4XV0A 4MGGA 3T8LA 4NZFA 3TLLA 4DPPA 3RR4A 3N2BA 1E71M 1AJ0A 1H11A 1JFXA 4CN6A 4ZE4A 4LGXA 3NL3A 4Y8EA 1V3HA 5FL1A 3BCJA 3IIXA 3F5KA 3VA8A 4FOKA 4XKYB 4QG9A 1W1B1 1YHTA 2VFEA 3V7PA 4NX0A 1MXDA 3CQ0A 3AWOA 3GXMA 2P53A 1REQA 2WKJA 1M01A 1A3XA 5KZ6A 3BV7A 5FEZA 3ZSSA 5DMNA 2QCGA 4QHRA 4L1XA 2QGHA 3UU0A 1W31A 4Y6GA 2EXOA 4HPHA 1K9FA 3AIWA 1D9EA 3KP0A 1ZAIA 4KW2A 3PF3A 5DMYA 3WEZA 1DJXA 2OT0A 5BXRA 4XBJA 4XTDA 1YIXA 1OIFA 4E8GA 3UEQA 3BDKA 1B57A 1R47A 3PJXA 4JIPA 5G4WA 4PMOA 4D2JA 1W1VA 4GCXA 1AZ2A 3U2ZA 1O1ZA 1QNOA 3W24A 3R12A 2X1RA 2FVKA 4DJFA 2BVDA 1R9ZA 3L68A 4OOZA 3LMZA 1A3WA 1XBYA 1LBMA 1OSEA 1YXCA 2Z2BA 4WD0A 1SUXA 2FTPA 4E3VA 1YADA 1N7KA 4V2XA 4BCEA 3S5NA 1HG3A 4AY8A 1XD1A 4A29A 4GJ1A 1EJRC 3EKZA 4AF0A 2BXYA 4US5D 1IT7A 3B9AA 1ISXA 1CLVA 2E6YA 1MUWA 3PR2A 5CSYA 1AODA 1BGAA 1ZBWA 2J6XA 2OGYA 1KFCA 3WK0A 1BXBA 1KGUA 4DYEA 3EMCA 3QW4B 4WJ8A 5LXXA 1GTHA 3GW0A 3VNJA 1SW3A 4N4PA 4W8LA 4FNPA 5CGMA 1TZ7A 3BAKA 5HK4A 2OJPA 3MCNA 3UZXA 3C2EA 1AH3A 1XJBA 2Q01A 2DZPA 5FI8A 3VZXA 4QCEA 1V02E 3VNMA 2C91A 2P0OA 4Q7NA 3EPMA 3LCXA 4JD4A 1HL9A 5CLWA 1OYBA 3ALGA 2X1SA 2YA0A 2QMJA 2AOSA 2VL4A 4PMYA 3GD6A 4S38A 5F4XA 2BGQA 1PYFA 5F4WA 1UQZA 2ZRXA 4NAFB 3W6MA 1S2UA 3TSBA 2EPHA 3WLTA 1I6NA 3EX1A 2VD9A 4L9ZA 3IGUA 1P6CA 3K2GA 3WDIA 4C5YA 1P0EA 1TJ1A 5C2XA 1RK6A 4GUIA 1Y7VA 3VDHA 1MEHA 3CH9A 1UR2A 2YSWA 3OGRA 3SCTA 2V5KA 2W5FA 3DYMA 4WHBA 4PCSA 4FXSA 3L65A 3ZMRA 4QJ5B 1FRBA 2OG9A 3M0LA 4F0LA 4A8NA 2QJIA 3I3BA 3LPGA 1I2RA 3QTPA 4W86A 4DAFA 4XZMX 3N04A 3USZA 2E5DA 3FGCA 4IIGA 3CL7A 2QMKA 1TTQA 1XQKA 1HN1A 2BSLA 2V0TA 2DH2A 1UD3A 1Q66A 2POZA 4GVHA 1V6UA 1ZJHA 3BSMA 2W66A 4LVDA 2AKZA 4LUIA 3ES7A 4Z17A 1XX1A 1GUVA 1UB3A 4Y9PA 2HK0A 1ECEA 2ZOXA 3AYSA 5C54A 1NF7A 1G7VA 1BTCA 4FIRA 1JCYA 1RCOB 4H19A 3V5CA 3E6EA 4QS5A 4C6BA 1UHVA 3AIQA 3VYLA 1MW1A 4MFEA 5F4SA 4LYRA 4L9YA 4FOJA 3VGBA 3M6YA 4LVBA 2HDJA 3GDLA 3ZLHA 3V36A 3AYTA 4H4IA 3LXAA 1E0XA 3L5MA 2QR6A 3ABXA 4QNWA 1XIGA 4QAWA 5GNYA 4TMCA 1SFLA 3ITVA 2D0HA 1UW9A 1JIBA 4QEHA 3IJ9A 3L4VA 3B4UA 3HJEA 3WLRA 1OGGA 4NRSA 4JCLA 3NGJA 2A7RA 1K8XA 5K7JA 2VC7A 7ODCA 4O11A 2GGHA 4H6QA 2Y8VA 1FH8A 2FB2A 1HW6A 1ZJIA 3AFBA 4M19A 3THUA 2YBUA 1ML1A 2PGEA 4UTKA 3RLVA 1GOXA 3AMDA 1VFHA 3VDCA 3DHFA 1ZGDA 1PTGA 3E49A 4W85A 5A95A 3K4WA 1UUOA 1KB3A 2VX6A 2OGJA 4MZ1A 2GJRA 3FJLA 5A6JA 1RCQA 5IM51 1A5MC 4XVDA 1F3EA 1NIUA 3T6CA 3PY2A 3SJ3A 1OC6A 1QI5A 4XSMA 2ZZ1A 1BVWA 3KL0A 1W5NA 2ZWYA 5EU9A 4F79A 4LRSA 1K7EA 4DI8A 4Z1AA 3W7EA 3FHAA 1KFLA 2XISA 3W86A 3DH7A 2XFWA 2PDIA 1IXNA 4Q33A 4LV4A 3Q2DA 1EGVA 3M0HA 4DNHA 2PURA 1BRLA 2A4AA 5LNUA 3LZ3A 3APTA 1AQFA 3OLGA 3PZGA 1G67A 2Z1SA 1CYGA 3H8AA 2FGLA 2GGIA 4XK2A 3LCFA 4YVPA 1V03A 2Z26A 1W3NA 4GUGA 5D2YA 2AMGA 2JGYA 4INFA 2VFHA 2IKGA 2PI6A 3GZAA 4DQWA 2ODOA 5FSDC 3P60A 3KS5A 5CXPA 1A5KC 3MI3A 4RNIA 2W61A 3L4TA 1G5AA 3UNDA 4C6DA 1M65A 3AJXA 3P62A 1JDCA 1LT8A 3VOIA 1UR9A 1UOZA 2EQDA 4PMUA 1MUCA 2D23A 4YMZA 1W2PA 2ZXQA 5LNVA 2J8TA 1SO5A 1NY1A 3GG0A 2GGJA 4UTWC 3PZOA 1E6RA 3CWOX 2WWDA 2DP3A 3WLOA 1H2JA 3Q37A 4NAEA 3NURA 4KWSA 5CSUA 3C8FA 2XU2A 1TV5A 1F4AA 3S2LA 4JX6A 4AEOA 3SECA 3C2YA 3SN4A 4EPKA 4WZHA 3GXTA 4OT7A 1BSIA 3KRBA 3L2IA 4IT1A 3KCLA 3G1HA 5IBXA 1W5QA 2RUSA 2GDVA 4M6UA 2E09A 1PKMA 3TA9A 1T5AA 1S2AA 3VNIA 3BMXA 4KMQA 1XYBA 2EEXA 4Q4PA 2CYGA 2YW4A 2NT1A 2Q6ZA 4TTUA 1DJGA 3STEA 1XR2A 2DZVA 4AZCB 1TYGA 1OADA 5JIWA 3GDBA 1VS1A 1SSDA 2R1NA 4J27A 1PHWA 1H51A 4LYPA 4MADA 4H9UA 4MLJA 4GQGA 4MY9A 3ME3A 1L6GA 4A3UA 3NYZA 1QPKA 1UKSA 4NP7A 5DCEA 3EWUA 4PUJA 3VKBA 3VD9A 2PDLA 1FWTA 4J4KA 4GC3A 1EA9C 2Z0IA 3V5FA 1U1UA 4PFMA 4CCEA 3UYCA 2EG7A 4NZCA 5HATA 3N14A 3WH6A 4R7JA 3BLLA 3WF4A 4BEUA 3DG3A 1H5YA 1V6YA 4IWWA 2GQ3A 1HF6A 3THQA 1JPDX 3HG3A 2QAFA 3GO2A 1H61A 2B7PA 5FSEC 1XQLA 3BE7A 5FL0A 1AQHA 3IS4A 3W6LA 3S2JA 1FBAA 3OZPA 1JI1A 1LWIA 3S1VA 4CNSA 1UD4A 3BW4A 3MTWA 4DVOA 3TYZA 3W1UA 5FA5A 3KDNA 3C0LA 4MWAD 2Y7GA 2PTWA 3DC8A 2WZHA 3UVIA 2ZZ4A 1WDSA 2ZUTA 1JZ5A 1JZ3A 1Q4WA 1XM3A 4LEFA 1IEXA 1SR0A 3ZS4A 4UMBA 3WF3A 3W75A 1QPOA 4IFKB 2BY3A 2TSYA 4EPBC 2F7FA 2C19A 2GFTA 3GDTA 3W7QA 2TMDA 2AMXA 4LTSA 3E0LA 1G4EA 4O57A 1U30A 3LBMA 4QG8A 2WNNA 4A8IA 4GI9A 1S39A 1MFVA 3M43A 3VMNA 3NYDA 4K3ZA 4D6CA 1HKKA 4HHLA 4O1EA 3WL1A 1S5MA 1W3HA 2Y5SA 4O54A 3S5OA 2VOMA 4DJFC 3DI1A 1B9BA 1GZ1A 2C0HA 3URNA 1BQCA 2ZICA 1EO5A 1RJRA 3ITYA 3QVQA 3VOCA 5I3HA 1SYTA 3G0XA 1BXNA 5AC8A 4HHPA 4K39A 4BI6A 1OT1A 3VD3A 1UP0A 3KS6A 4WDXA 3E2RA 1UIOA 3T2OA 1MXGA 3UNTA 4TX9A 4Q6JA 1E0UA 5I02A 3VD5A 4F9JA 1E5JA 4XO6A 4Z2IA 2O92A 3S1WA 2NWRA 3WKZA 1K9TA 7TIMA 3CHCA 5FEWA 1YPIA 3AMLA 4TUFA 5M1TA 4YYFA 1JDFA 4B5UA 1NWTA 3FOKA 1GW1A 5FEXA 4P7LA 1TG7A 1Z7AA 1JQVA 1VQTA 1S3HA 3SR7A 1VLWA 5AOUA 3N2TA 3A3XA 3URQA 3H2NA 1OB0A 4DEFA 3AIUA 3N15A 1US2A 2I7GA 3VOFA 1FWIC 2QYGA 3D3FA 3HGOA 1ZP3A 2D3LA 3NQDA 3ZR4A 1KRAC 3MCOA 4UNLA 2BS9A 3MWCA 3EXTA 3R6IA 2RFGA 3G1FA 2ONEA 4MAZA 3IV3A 3UT0A 1CT5A 3MU7A 2G41A 5G2IA 7CGTA 2WSRA 2H8XA 5K9DA 3H4GA 3W1AA 5I6SA 5IFTA 3N29A 3U57A 2B0MA 4I7UA 3O0FA 4Z2GA 2ZE3A 3IACA 2Q8LA 3U2EA 1B9ZA 4C6CA 2JKPA 1G9HA 2VT0A 2R14A 2BOEX 3L2MA 1XIEA 3REQB 1TWZA 4YNGA 4S3BA 3INPA 3WQ4A 1X6LA 5AN7A 4UIOA 1WB0A 3N2MA 1YDYA 1VEOA 1A0DA 2HVNA 3KHDA 1DQWA 3SCSA 4CNUA 5J5RA 4E6MA 1UWQA 2E1DA 3QY7A 4S2BA 4M8UA 2O4QA 3UXDA 5FD0A 4E38A 2B31A 4KRTA 3CJPA 3L0NA 3TV8A 4Z1CA 3WDRA 2TRSA 5HXMA 5DFAA 4DXXA 5U4NA 4V28A 4E8DA 3M46A 4W9TA 2FLIA 2NQ5A 4IMEA 2WVSA 2WJFA 4L6DA 4F0SA 2VGFA 5DT5A 3LM7A 2BODX 1GYLA 3BL3A 4DI9A 7ENLA 3SSZA 2QZRA 2NQHA 1H7WA 4N9BA 1FWAC 5FACA 1DQUA 4GO9A 1M3UA 4AD1A 5D9NA 4NZJA 4ZA0A 2GVJA 3UXIA 4HNTA 1LOLA 1ME7A 4R27A 4ZO9A 3FHQA 3W22A 3BAWA 1UBPC 1XLAA 3WQ6A 5LGZA 4JL1A 1XP3A 2SFPA 3HMCA 4GISA 2F2KA 4F4RA 1AMYA 4JIQA 3CXOA 1TRDA 3N34A 1GYNA 4PE8A 3RCYA 2VKZG 2J66A 2POTA 2XYLA 3CEUA 4H01A 3ZT5A 1S1RA 4W8AA 4CNTA 5CC7A 4AX7A 4Q4RA 5E93A 4XKMA 1KR0A 1C7TA 3ZOAA 3F4WA 4PA8A 3A24A 5L6UA 3GUGA 3TOPA 2VFGA 1HKMA 4ERAA 3TZFA 4X0VA 4J28A 1SW0A 4WSHA 3GKAA 2XVLA 4O1CA 3NIYA 2JEPA 1XISA 3HURA 1LDCA 5AYBA 1Y5VA 3KXQA 1EP3A 3MW7A 3B05A 5LZLA 2E28A 2OYMA 3T0CA 3W2MA 2YB1A 1TV2A 1KLYA 4MLRA 3SSJA 2IW0A 4JIEA 2PLKA 1J0KA 2YL8A 3PTQA 3LRMA 2VEKA 3VGFA 2CPUA 4O10A 3M5ZA 2GUYA 4RW3A 2W27A 3VMOA 1RA5A 3HN3A 4G2DA 5D2TA 2HBXA 2XSAA 4MJZA 8RUCA 3TUUA 1XV8A 2PDXA 2AGKA 3H55A 1EF2A 2ZVRA 4M7TA 1TPFA 3QR3A 2FZMA 3BOLA 3S5ZA 4JFWA 2YZ5A 4M24A 3THCA 4WGXA 3MP5A 1YE4A 4LRTA 3TW6A 2PDQA 3P5ZA 3HF3A 1SZEA 3WEMA 2EPMX 3M5YA 3CZGA 4HU3A 1V3IA 1NF0A 1KCKA 3VIGA 2QCNA 2R24A 1DOSA 3QR0A 3T9PA 1VFLA 4C7GA 1Q2RA 3TCEA 4CD4A 3SY5A 3AHVA 4KFOA 4FXJA 3KRUA 3U4AA 1M5WA 2Y5JA 4HCHA 1MI3A 4M29A 1Q8AA 1GCYA 2QUMA 1WDRA 4QIUA 4AZ7A 2Q09A 4U2ZA 3BC9A 3MZNA 3NA8A 3PTDA 4CU7A 2WZEA 4OECA 5C7HA 4MWAB 3H2AA 5CG7A 1EBHA 1DP0A 1XL9A 3U5UA 3W1XA 2XTKA 3W2NA 2G3JA 1H5VA 2QHAA 2A3CA 6XIMA 1QBAA 2YJQA 3JS3A 3PNZA 1JULA 3R0UA 4HMEA 1VBUA 3E5BA 1V4YA 6A3HA 1Z42A 2NXGA 1DHKA 1NQ6A 1Q6OA 3LGEA 3LV6A 6TAAA 4LB3A 4GABA 1GEHA 2J7CA 3G6MA 4HOZA 2OYKA 4RDZA 2NUYA 4JFSA 3QYSA 4ES4A 2HRWA 2OEMA 3WUBA 1TJRA 2P10A 1ZBVA 2G95A 1IT8A 2WKGA 2J13A 5J8LA 4LNYA 2XIJA 3C5QA 1KXVA 1MQQA 1BFNA 1JZ4A 1KM3A 4XD4A 2VP8A 1SFSA 9XIMA 1T41A 4LFYA 3AQUA 3PWAA 2CXGA 3SCWA 2A3AA 3ITXA 3HTWA 1C8VA 4AIEA 5JBEA 1TV7A 2V68A 4XD6A 4UB9A 7REQA 4AHOA 4A22A 3S9IA 4ONVA 3GNXA 1YE6A 1DEDA 3O1NA 2X40A 1OF8A 1NFGA 4C6PA 4TQTA 1MW3A 2LLEA 1RAKA 3GXIA 1EHAA 3E9AA 1NM9A 1SJCA 5FJIA 3B0VC 4Q8PA 3A5FA 4JAWA 1MW0A 2XM1A 1ME8A 4ZXOA 4CVUA 3HJZA 4RW5A 4QBXA 1XH0A 3KE0A 1RR2A 4MB4A 5HBFA 3QXBA 3OIXA 5B80A 2V81A 1SPQA 5SWUA 2H8ZA 3KBSA 3ATZA 1MXSA 4Z0JA 4EWND 2XUCA 4DPQA 3KOZA 3PTMA 3URBA 1OFDA 3EDKA 1K02A 3GZ3A 2OO0A 2QPSA 2HVMA 6REQA 4D72A 3ABQA 3GDMA 3AICA 4IXXA 1XCXA 4IICA 2P0IA 5IHRA 2DDXA 3E5PA 1P4CA 4K36A 3OP2A 4GQRA 1WXYA 3N18A 1O68A 4RE0A 2V2CA 4RZBA 4DJED 3HU7A 3AUJA 4R85A 3QV8A 4KETA 4WY0A 5M2FX 1WXJA 3ZXWA 3MQTA 5KITA 2IXUA 2JKEA 1E15A 3BGAA 2Y1HA 2Y4SA 3UPWA 3NQBA 3QOMA 4LBSA 3QY6A 3FEMA 2WO5A 4K1GA 4H3DA 4J35A 3SY1A 1KKRA 1CXEA 3IVUA 1E72M 2DUXA 5CKSA 3IK2A 4S3EA 2HVOA 4HN8A 2DSZA 1ENUA 2V3FA 4KFNA 4LUTB 3VUPA 1F8MA 4IIFA 4XKYA 1ICPA 2ZRZA 1VHCA 3WUEA 2NV2A 1O95A 5TBOA 1W17A 4GZIA 1MUMA 4LWWA 4NU7A 3TR9A 2I9EA 3TCSA 2YFNA 4NI3A 1FDYA 4PBEA 4EK7A 1A47A 3RJYA 1EB3A 2ISDA 3SQMA 4Q7IA 1NH6A 3MYOA 4DBUA 3GTNA 1YYAA 4MAVA 4F0KA 2J7GA 1XKYA 3ARVA 2VZOA 4KEMA 4EPDC 1E73M 4AZ5A 4JTEA 1AL8A 2W63A 3E38A 4Q4OA 3M5XA 3H2FA 5I06A 3OLIA 4RV8A 4XVEA 2ZX9A 4DZAA 5BNKA 4S3KA 4XUYA 4MPQA 2QCLA 3W9ZA 3OO2A 1WBHA 1J18A 2VENA 4F2BA 2FH8A 4GX8A 1TWIA 3QJAA 2ATSA 4U4MA 5DBTA 4FX7A 2V2DA 4FPSA 3N6JA 1A0EA 3HPXA 5CZSA 3HQ1A 2HNEA 1A5AA 1QNQA 4GX9A 4LSBA 4V27A 1FWDC 2FFCA 4YJ5A 1ZALA 2YCLB 3O06A 3ZT7A 1E0VA 2PGWA 1XF0A 5C55A 4ACYA 1M04A 1XGEA 3N12A 5C71A 2D24A 1Z9AA 3ARWA 4JNZA 3WBAA 2REQB 3NNTA 2PD5A 5G4EA 1R85A 4UOQA 4N2YA 5EMKA 2VURA 4RKAA 3LCGA 3FS2A 5AHNA 2C8NA 4B3KA 2V3GA 1I75A 1CECA 4NAFA 1MZHA 3GKFA 3KX6A 2YGYA 1FHUA 3WYZA 2Z27A 1ITCA 2PRHA 2BOGX 3BMVA 1SFJA 3V0TA 3ZR6A 2C7FA 2QJGA 4WVXA 1JAKA 1EOMA 4LS2A 1VEMA 1OEPA 3QPYA 2FZ8A 3NDZA 2CLKA 2GDUA 3H22A 9XIAA 1SO6A 3QKEA 3P0XA 2Y89A 4JN6A 3UZJA 2EPOA 4LB4A 2VOTA 1W9PA 4LUJA 2DFAA 2HK1A 3TU9A 4IHCA 3NZQA 2CBJA 3G8RA 5AECA 1SU5A 4DX3A 3LSBA 4GKTA 3T4WA 5LNSA 1S38A 1TKKA 1OHLA 4C6FA 3TYAA 1OX6A 5TQLA 1GOOA 3I6TA 2BY0A 2A6NA 1SZGA 4DHGA 2XN0A 2V6AA 4MJ2A 4V1XA 5A6LA 4Z2LA 2QDDA 3GE7A 4UR7A 2V5CA 4RCXA 3ANYA 4F48A 3UG4A 1KBJA 1BD0A 1RA0A 1W3IA 4XAFA 4QDWA 2PWGA 5HOSA 1AW2A 3T78A 1GONA 1AQ0A 4E4UA 3JVAA 4S23A 3W7PA 5GJMA 4GYPA 3GBDA 1BAGA 2PB1A 1DIKA 5LYRA 3ZT6A 4N0RA 3OG2A 3FDKA 3PK7A 1OCNA 1S5NA 1WDWA 3ABSA 4GXWA 4JHMA 4H9VA 1RHCA 3GTHA 2PTXA 2J25A 1M7OA 4AXNA 4YWSA 4PB4A 2V2HA 1B0IA 1OYCA 4DUOA 5D09A 1XC4A 3EOOA 1LM1A 4NRRA 4XZHA 3CYVA 1QATA 1IWPA 3R1ZA 4B90A 2PE4A 5E9AA 2WVUA 3PUEA 3MV01 1HFBA 2X30A 2V5JA 4OBSA 2ACSA 3MDWA 1R2TA 3DN5A 5HINA 2XM2A 1PZ3A 1JYXA 4PULA 1MDLA 3WMSA 1F2JA 1YRRA 3GSMA 2RDXA 4QEEA 1O94A 4GY7A 2O9PA 2VZVA 4RNHA 2XVKA 3VDGA 1SO3A 3GNDA 4H8UA 3ZQ9A 1XRVA 3II1A 1Q2SA 1LWJA 1ISVA 4JTFA 4Q8VA 2UV8G 1UR1A 4JFTA 1K9EA 3FA5A 3RJXA 4DF1A 5CJNA 3RHGA 3OHMB 5ABFB 3LA4A 1W9XA 1FOBA 1X1OA 4N7QA 2VGGA 1E6PA 3V1PA 1SZFA 4ZQMA 1S5WA 4N02A 1W9DM 3M0KA 3SUWA 1LT7A 3RLGA 5DRCA 4MG4A 3BMWA 3LCLA 1LLWA 4TVUA 4POCA 1N2VA 4LS0A 3ZLGA 2CHNA 2KAUC 3U5YA 3N3TA 3GIYA 5LNRA 3GC5A 2C15A 3E0FA 2VCAA 4P7NA 1W1A1 1E3ZA 3W76A 4CQCA 5CBIA 1XUUA 4YIWA 3CQJA 3UZYA 1YNYA 5BU6A 1MQPA 3O3RA 1RCXB 1GNXA 1XRFA 3AMCA 2QLYA 1H7XA 3RITA 1W1IE 3E2QA 4R7OA 4ML9A 4IQLA 3W7GA 1MO0A 3WENA 3AXXA 1CCWB 1J12A 1DPMA 1US3A 3MUZ1 1HJXA 2CLMA 2JQXA 2ZZ7A 2CZEA 3MY9A 5BRBA 1V02A 2VEMA 3NG3A 3S2CA 4CCDA 1IYXA 3U7VA 3S5YA 1LOQA 3VNKA 4NZ4A 4V15A 4ROPA 1I2QA 4BHYA 5CZ0A 1WYIA 4M0XA 2X8RA 2DSUA 1UH2A 4PTVA 3CPGA 4DWSC 4O1AA 3CS2A 3NQVA 3DHPA 3W2KA 4ZBCA 1M7XA 4YU1A 2IUZA 1NU5A 4UQCA 3THDA 3OB8A 3CT2A 3E12A 3H21A 5AYIA 2BVYA 2DJXA 2DORA 1UZHA 3S6TA 3BCDA 4YLWA 1UIPA 1OFEA 4N6FA 3ATYA 1MRQA 1PSCA 4JIIX 1ME9A 3OYZA 2VX5A 3KZSA 1NVMA 4HP5A 5B7YA 1THFD 1SGJA 5D9OA 1DTNA 5D2VA 2CCRA 1VC4A 1FWHC 4EAMA 2DT2A 3M0VA 3CBWA 1WXZA 2A3BA 2J9YA 4NJIA 3HGSA 3W28A 1WDPA 3I7SA 2ZWZA 5K4XA 1V3LA 2PBGA 4PUEA 4TU1A 4QE4A 1OBAA 3LTPA 3CUGA 1TCDA 1UKQA 3LX9A 3C0SA 2PBOA 3MKVA 4ZO8A 1GVEA 3EZ4A 3L7RA 1E40A 1MW2A 2VZUA 2GK1A 4G7EB 3CL8A 1DWIM 2FJUB 4LCSA 3VZZA 4PR4A 4QROA 4ZCWA 4UQDA 4IIEA 2DZBA 3UW6A 3RPDA 2WZTA 5HMSA 2OX4A 4ROQA 2NT0A 1ZQ5A 2GVGA 3L67A 3L12A 3CV1A 1VRDA 3N2OA 4RE3A 2DPEA 5E6YA 3TN5A 1ZFJA 1FWGC 3KP1A 3MO7A 2WXDM 5LNWA 1LG1A 2Z7KA 1XLMA 2B81A 3TYBA 4RDVA 3W7MA 2GSJA 3OGVA 3TZNA 3PZTA 3Q58A 3F2CA 2V3DA 2X16A 4JTGA 3UBPC 7PTDA 3PP7A 5K9XA 4D8LA 5CG0A 2XZ7A 4WF7A 1EDQA 2WV8A 3AHTA 1FP9A 3SCUA 4BA0A 2DT0A 1TWSA 3G22A 3LZ5A 4IISA 3SY8A 4X0NA 2BASA 3WJZA 3WIJA 2BMBA 3DKLA 3MA8A 3WH8A 4PMJA 4MYAA 4JL2A 5H8MA 3DG6A 1HT6A 3TYCA 3DU0A 5KSWA 1XH1A 1OK6A 1B3XA 2WLZA 1IV8A 3O8AA 1LBLA 4H9MA 9RUBA 1L8PA 4HHMA 2CLIA 4GIYA 1LJYA 1GOMA 4LUYA 2FHBA 1A50A 5C9XA 4WUIA 2JKAA 5CJ5A 2QT3A 3AHYA 3FYOA 3B4YA 2WYSA 3LHYA 5JBDA 3HPFA 1H3GA 4F2UA 1IZJA 2WBGA 1I0DA 2OR2A 3UETA 5CPOA 1H7OA 4HZ6A 3DGRA 4HNVA 2OCZA 5JUVA 3WQFA 3GQYA 2VEIA 4IPIA 4JY9A 3TE9A 2Y70A 1XYAA 2J8GA 2P1FA 3BVJA 3QRHA 4ZL1A 4IX2A 1JZ6A 1OFQA 2CESA 2Y61A 4AVFA 3WLLA 1VR6A 3RX4A 5AC6A 3JRKA 1QK0A 3UERA 1CI1A 1K9DA 4GO8A 1NAL1 1T6MA 3G2GA 3NM3A 4QCFA 2C13A 2F61A 2WSPA 4G8TA 1FXPA 4OUIA 1HO4A 2Y63A 4ZFCA 1DXEA 3M9YA 2CZ5A 4L56A 4W89A 4YPJA 3VU2A 5HQLA 4ZFMA 4C65A 3CIWA 3KVLA 4L61A 1WDQA 4Q4KA 4QJ3B 3PZIA 5AHLA 1P5BA 3MSDA 1X39A 3M0MA 2PU1A 5I79A 2CFFA 3BG5A 1D8WA 3EAUA 4AD0A 3VX1A 4GLEA 4Q22A 1VFSA 1WUEA 5EY5A 4HNLA 4GY1A 2OLHA 1GK8A 1E4MM 2NUWA 4OOUA 3PFRA 4LC8A 4YTQA 3TAOA 3MS8A 4Q4QA 2GGGA 5HPOA 4MDOA 3DDMA 4AWUA 1E4LA 1EEXA 3MUIA 4P8VA 1XICA 3MMTA 5AHFA 1W3TA 2OKOA 4R88A 3W7LA 2WNWA 1XLGA 2PDBA 1ZCCA 1IXOA 3DBPA 3CV6A 3AOFA 4QR6A 4CD6A 3WQDA 1RPXA 3T2QA 2INFA 2OELA 4DXVA 1FWEC 4UZUA 3U7BA 4DXKA 3HZ3A 4D6JA 2VFFA 3GNOA 4I90A 2CHRA 3ZO9A 4BY3A 3CUHA 4IQJA 1JXKA 2DUAA 4QNEA 5FF3A 4W84A 4IGSA 4LCQA 2Y7FA 1JUEA 2C0AA 1Y8BA 2W91A 2WBKA 4CEXC 3AIVA 2NXIA 2P88A 1PCWA 1DWHM 2PDKA 2HTMA 4UR8A 3KLKA 3PZ9A 2NWSA 3CASA 1XYLA 3WDHA 3UR2A 1YQ2A 1B3WA 2FZDA 1V3JA 3CWHA 3NDYA 1ZAHA 1DXFA 3BLEA 4LALA 2DH3A 3V35A 5T8GA 4JX5A 2MANA 4W87A 1U83A 1Q6RA 2C79A 2PP0A 4MJMA 1EBGA 2R9RA 4LPCA 2FTYA 4WGHA 1BG9A 1RVKA 3I4KA 5CGQA 3TSMA 3URAA 1PE1A 3PBMA 3VNLA 5LHEA 1FWCC 4B3ZA 3TROA 3C61A 1RD6A 1J5TA 1U33A 5CBBA 4WJEA 3TYUA 1H7NA 3STFA 3NQAA 3WX7A 1NWRA 3QV6A 1IZKA 1VP5A 2Q8XA 3N6HA 2VDIA 4WIWA 1E0WA 1L6WA 2R6OA 3F2DA 1PTAA 5I3FA 4L4OA 3PAJA 3I7QA 1PZ2A 1XG3A 3VO0A 2DW7A 4E2DA 1HKVA 1ITQA 3BJSA 4YN5A 1XCFA 3RK8A 8XIMA 2WLYA 2GJLA 1EX1A 3SW6A 2CC0A 1Z8AA 4MTVA 1O12A 4O14A 1VENA 3H7RA 1RLDA 2UZ9A 3MPGA 2HJPA 3ZJ7A 2GUUA 1KFKA 3W1QA 2WHLA 3OU8A 4KCWA 2WPBA 1RP8A 1IGWA 3GB6A 1ZJBA 2C71A 2RJHA 3GVGA 1JPKA 3RPTA 5REQA 5JH1A 4JEJA 4H2HA 1P7TB 1C9DA 1N55A 1CLKA 4EVZA 1QOXA 3GHUA 4RX0A 3KFTA 3LI1A 3QQWA 1VPXA 1M9HA 4NNBA 3SAZA 3RMEA 1IWAA 3AROA 4M6VA 3O9NA 4H2CA 1KR1A 4BF5A 1W9VA 1MEWA 1FCVA 1GWJA 4O1FA 1RLCL 1O5XA 4S3JA 4GUFA 3LOTA 6XIAA 1FWSA 3T4CA 4DWDA 1SVDA 4B15A 1Z32X 4H04A 2H9AB 3N2CA 4PUMA 1OZMA 3FLUA 1VJZA 4XQ6A 2DZSA 1UD2A 4WEVX 4UXDA 3FKRA 1M6JA 3CAQA 4ATLA 4BQ4A 3GYEA 3QMRA 1X7FA 3K8KA 2DQXA 2V30A 3GFXA 5HQEA 3ZLFA 3G8EA 4O4VA 3LXBA 2YPIA 3ARUA 4IMAA 1YDVA 3EDJA 2VTFA 1BKSA 1EL3A 1EC8A 2XIQA 3P61A 4FR6A 4C5ZA 4AW7A 4CU8A 1AW5A 3A23A 3A3HA 4LVAA 3Q67A 3RCMA 2FIQA 4ZTYA 3W71A 2L5HA 4AX6A 2HV5A 5H6HA 3BW3A 3SO7A 5FOOA 2BY2A 3PBUA 3WUGA 1RBOB 4UTUA 3WLIA 3HBLA 2EPNA 3AXKA 1JZ2A 4GI8A 5BWAA 3MVTA 2KX9A 3TXVA 3W26A 1QK2A 4M1RA 3VUSA 4AY1A 5CBJA 3A4XA 3N19B 4FS9A 3IJ8A 4L1GA 1UH3A 1C93A 3HQPA 5I3JA 5A6TC 4QG6A 4U31A 3NZPA 4NYUA 3WFZA 2PDFA 5ENLA 1GG0A 3B0YA 4JYEA 5C9RA 5IFPA 3STPA 4TV5A 1PTDA 2VFDA 4R7WA 1YBQA 2E6DA 2A3HA 3N9KA 5CSSA 4ZB2A 5EBUA 4MHBA 2D1ZA 2QKFA 4B91A 4FMVA 4PC8A 3W4RA 4Z2KA 3H26A 1K70A 4FF5A 2ZA1A 4PSPA 2VHLA 3KBVA 4H8HA 1CXKA 1GQKA 4DBSA 3C4UA 1VEPA 1HJUA 1KLZA 1RD5A 3VKDA 1JPMA 3Q65A 1XLJA 1RZMA 2I17A 2VGIA 4IJCA 1IR2A 5GNZA 5ECUA 3W1NA 1Q6QA 4W8BA 3WF1A 3UD6A 3LCIA 1PIIA 3GLCA 1B4KA 4MNMA 1R38A 3UY8A 2J9ZA 3CUXA 1DJNA 4I9JA 5I77A 1OGBA 4AYSA 1NQKA 1NFBA 2FTWA 4I8DA 1JCNA 1BLIA 1R3YA 4Q32A 2ZVIA 1NJJA 4ZOBA 2YLLA 1FWBC 4C1NA 4Q4SA 5D8WA 3NOYA 3N4AA 1EPXA 5A94A 2VZTA 3S9YA 3C86A 3WUFA 3QEZA 2VQTA 5KMYA 2VRQA 3DG7A 1R6WA 1YTKA 2AQWA 4PGLA 1QWGA 3RO8A 1GZGA 1S3TC 3EOUA 4I5RA 3TNBA 2BB0A 3UJEA 4C6IA 2QUVA 4MFDA 1XFCA 3T08A 1GVSA 1NTHA 2W67A 4LF2A 3GAKA 3EX6A 1B30A 1Y5XA 4GI4A 2IQDA 4FK9A 1CGVA 1Y0EA 2CLEA 3PPFA 1HZYA 1MVYA 5H8PA 1LP6A 1JDDA 1EPVA 3M0XA 3RPMA 4IF2A 3D5HA 1PX8A 1PAMA 1P6BA 4ADTA 1OX4B 1Y5WA 3NEVA 4L6HA 5FJRA 3E74A 1VH7A 5I09A 4PRRA 3BO9A 4JN8A 1PWLA 1RBAA 3RU6A 4FXFA 3NO3A 2F6UA 2J62A 3B8WA 4YVXA 2W92A 4OV9A 2VFIA 2CW6A 4UTMA 4RE2A 1BYAA 2PP1A 2YBVA 3DAQA 1GOKA 2X05A 2ZA3A 1NDYA 4H8NA 1Z44A 3IJ6A 4S1FA 5EYWA 2ACUA 1W3LA 2E9LA 4JYDA 4FEZA 3ONCA 2PDWA 3LLXA 2QJHA 3CAKA 2WKLA 3TC6A 6PTDA 5E9XA 1WNOA 4S3GA 3PULA 1XGDA 4J5NA 5CPLA 2CWXA 3MHFA 3BUVA 3L21A 1XLBA 4LX4A 1OX5A 3OBKA 2DZAA 3MP4A 2V5BA 1S2WA 3GHSA 3IGHX 5A2BA 2Y5EA 2X2GA 2Y85A 2HXTA 1R3VA 4NG3A 3FXYA 2OTDA 3UR5A 4Z1BA 4UMAA 5DANA 3FN9A 3G1AA 4R34A 1JQXA 4DJDD 2ZZ5A 3IPWA 4G56A 3N13A 1J0HA 1TA3A 5JU6A 2V82A 3JZEA 2PMQA 5JMUA 2VXNA 3D47A 5AB3A 3NXFA 3UJ2A 3KDOA 4LUSB 4NJKA 3SFWA 5EBAA 2FKPA 4Y90A 3WDQA 1C29A 3L0KA 1XYZA 3SCNA 1FA2A 3EWCA 2OT1A 1QUMA 4S39A 1C8QA 4A8LA 2BVWA 3ZFHA 2Z29A 4XWUA 1CW2A 4ZQRA 1E1CB 4XZWA 1TWDA 2IKHA 1WZAA 3EWBX 2QNEA 4DO6A 1XYCA 3GUWA 1H7PA 4JTQA 3HPAA 3SQSA 5E0FA 3CYJA 3VGGA 4DLFA 4R33A 2PC4A 1VFTA 3STGA 2VRJA 5K9CA 1BKHA 3SB0A 1D3GA 1V6VA 1TJ2A 1XW8A 1REQB 2PS2A 3MI2A 4N4QA 4KEZA 3S2NA 4ZB0A 1GGOA 3QLLA 4HKPA 1TCMA 1IR1A 4CEUC 5FJJA 1IIGA 3ZVIA 5BROA 5FJOA 3W70A 4DM2A 3UCDA 4J3WA 1NELA 4AB4A 1O4UA 1IQ8A 5LIWX 2Q02A 5CC6A 1KQYA 3QOKA 4XG1A 1QHOA 3S2MA 1UWRA 3WNLA 2RKXA 3GH7A 4EXAA 1CX9A 4JTTA 4E2BA 3T81A 3B8IA 3LHWA 2GOKA 4BWLA 2XSBA 1Q13A 3EXRA 4GYKA 1ADSA 3CAWA 4HMNA 4HVXA 3OHIA 1W5MA 4YS1A 4D71A 3IAQA 1TE6A 1KM0A 2VWTA 1CLXA 3GR7A 1IT0A 4PMDA 1CPUA 1F3WA 5H2ZA 4UZSA 1QOQA 3NZRA 3TN6A 2FMNA 3I6EA 4AF0B 5HWNA 2CERA 2J78A 3CQIA 4GHRA 4AD5A 3LQLA 4X2RA 1KBBA 1YTDA 3ZWSA 3SZ8A 4B3LA 6ALDA 2X2YA 1PX4A 3BK0A 4IX0A 3TK7A 5E5CA 4E8CA 3EA1A 4WXZA 3DX5A 4H83A 1TPH1 2TODA 2G3MA 1R7AA 1TZ9A 2Z1VA 3NFUA 1UWIA 4RXGA 4DBEA 3L9CA 1W1YA 2ZC1A 5DX7A 2WMHA 5E70A 4B9YA 3FV9A 1EXBA 3R58A 3WLKX 3PJTA 2Y2WA 1HGYA 1TSIA 3OBAA 1EKOA 4R3UA 4GGHA 2DZXA 2E67A 2YYTA 3WELA 4S3FA 1QPNA 5JXQA 1WZLA 5KETA 2QCEA 4XBKA 1PVNA 4FOUA 1Q7QA 3NL2A 1F3TA 1GQNA 3MKKA 3CHFA 5FCZA 2PWEA 4E2OA 5FJUA 3T1GA 4NHVA 1CZ1A 1V0LA 1OJXA 3PB2A 4B5TA 4PL1A 3KAOA 3H24A 1Q65A 4CQBA 4MWAC 3JW7A 3T7VA 3TQPA 3UWEA 4U33A 2QEZA 3M6DA 4LAMA 1UR4A 3FA3A 1K8YA 4IJBA 4PCTA 2V5LA 1NDVA 3MJMA 4FX8A 4TR9A 5CPMA 1MWOA 4BF9A 2CBVA 1ZP4A 2UY3A 2PU0A 3BICA 5EMYA 3HO8A 1UP3A 2AQVA 3FGCB 3WK2A 1D8CA 4PCNA 2F8QA 1B5TA 3AI0A 1R9XA 1Q6FA 1FHLA 3FEQA 1XLFA 3BAIA 1X1ZA 2FZBA 1ISWA 2PPGA 4K38A 4EXBA 3SADA 2Y62A 3WNNA 5CAKA 1VYRA 1RY8A 4UFKA 2Z24A 1ODZA 3OZYA 3CHEA 4XB3A 2YL9A 3E0WA 1SSGA 3M0ZA 2QCDA 4S3DA 4MUZA 4PSRA 3A5VA 5TAOA 3W38A 4NILA 1OABA 5H1WA 4JDBA 3RO6A 2I14A 3LQGA 3NVTA 3CPRA 1XIFA 4C6QA 4DJEA 5EPDA 3FSTA 5F2IA 1V51A 4Q7BA 1LG2A 1TPVA 3EB3A 5HWJA 1BTMA 3EWZA 3PBGA 1OC7A 1O5QA 2Y7EA 4MMWA 5HWMA 4GI6A 3DIPA 4IG2A 2CU0A 4HPNA 2Z1BA 5DMMA 1LL6A 3Q94A 3KWSA 3VNZA 3SIMA 3S1GA 2ZIDA 3GXDA 4CGTA 3SN0A 4KEUA 5AKQA 2PDUA 4AC1X 3QZAA 3SIZA 2BFGA 3SUSA 2PF8A 2DSVA 1OD0A 3OEXA 5C7VA 2OZ8A 1OD8A 4A3QA 3W00A 3YPIA 2VEFA 2X0YA 4QDPA 3S4TA 2J8FA 5L9FA 2VX7A 5DXXA 3A64A 3IUIA 1I2OA 3R2GA 2H3DA 1LWHA 2PDYA 1OCBA 3HGRA 4G5DA 2GVYA 4UOZA 1BGGA 1J01A 1ICSA 1U5JA 3QHMA 1PKNA 3EKGA 4B5SA 2E1WA 2YBTA 3QZ6A 3PBVA 2PDPA 3FW6A 3THAA 1EJWC 3WH5A 4I8YA 4O19A 3B8TA 2YDSA 1BWLA 4H6RA 1O5KA 3O6AA 1V93A 3OLDA 5I7GA 3XISA 1QPQA 3VK5A 2YCEA 4O15A 1BRLB 4A3YA 4IGNA 2YR1A 1XH2A 5MKGA 3CMFA 2GJXA 2YA1A 3UWVA 3RUBL 1X8FA 2XZ9A 1I60A 3PPCA 4GFSA 4W5UA 1SR9A 5LKYA 1W5OA 2OWXA 3DHUA 3QW3A 2OKTA 3ZWTA 4CU6A 3GDRA 2RAGA 4X60A 1XDJA 1D7KA 4QLKA 2XG9A 1FHDA 1CWYA 2QJJA 3WEOA 3GWQA 1BF6A 4PTXA 4HHHA 1OY0A 1DWGM 3GXFA 4DYJA 3BLFA 3DUGA 2X0SA 3EA2A 2E6AA 3B3DA 2WWCA 3W1TA 2PP3A 3O07A 3RXZA 4Y9AA 3L0GA 2ZUVA 4OTKA 4GBDA 5F2LA 1XLEA 1XWYA 4UOJA 1VJIA 4IXHA 4ICMA 5H91A 2O4MA 4M51A 3T44A 3CV7A 3RG6A 4NAEB 1E1FA 1UWTA 3E0IA 3RU8X 5C6MA 1IEIA 2GQ9A 2WK2A 1LTDA 1QW9A 3TN4A 4B2DD 3G1VA 3S6OA 3GVVA 1K7XA 5H8UA 5I3IA 3HFYA 2O55A 4DO4A 1Q45A 1KM2A 4CN1A 3D6NA 1GVYA 1KCZA 3N73A 2YXOA 4YVVA 3P3BA 1RXOB 1EDTA 1NFPA 2X7VA 4JICA 2AGTA 1EEPA 4IFOA 1XS2A 1G4TA 1FDJA 1T96A 3NOEA 3R25A 5KINA 1E6QM 3V75A 5G5IA 4FP1A 3CZJA 1VGAA 2CITA 4H6KA 3PZMA 2EG8A 4QE1A 2ZRUA 4UR9A 3W29A 4NY2A 2DU2A 5XIMA 3EOSA 2ZZ6A 3VD7A 4FLSA 1POJA 2FZ9A 3TP4A 1HNYA 1KM4A 3E02A 2CEQA 4XIMA 3C2RA 1JJKA 3GU9A 3VDBA 1JNDA 3B8VA 3VC6A 1PL9A 1QO5A 3RX3A 1PUDA 3K4DA 1V3KA 3W81A 5TNVA 2CBUA 1W54A 3DYPA 5GNXA 3VIJA 4GG9A 1EJSC 1JF6A 4BI5A 4JIRA 2BXZA 3UG8A 3UGRA 5HMFA 1R3WA 1T8QA 3W2JA 1YXYA 4AD2A 3OW1A 1UBSA 1BG4A 3HB9A 4Z42C 4NJJA 1E9ZB 4W93A 1A5SA 1AA1B 4IPNB 3KBNA 2BHYA 1V0KA 4JFVA 1WKEA 2G97A 3WMCA 4HPJA 1XKJA 5DQPA 1P1XA 4PUWA 3P82A 3ZJKA 4DUWA 5LSMA 2PEVA 2VEGA 4J3UA 3NM1A 4X61A 4KWOA 5BOFA 2CZVA 1S1PA 3O7UA 3DCPA 3WLMA 1BYBA 4ICCX 1B31A 4FNSA 3CAVA 2VR4A 3GFZA 2GSEA 3DFSA 3KUMA 4GQQA 1ZL1A 1UKPA 3A9BA 3RM9A 1IEVA 3ITOA 2YW3A 3TTSA 5CJMA 4JTKA 1LZOA 1XSJA 3V18A 3VGEA 3N17A 4NNAA 4A35A 4N9DA 1J4EA 3MZ2A 4TV6A 3EMZA 4J40A 1R0MA 1A4LA 3CQKA 7XIMA 3G1RA 1UUQA 4GIEA 1KFWA 4FALA 3BGGA 4BWLC 1NEYA 1ZU8A 3DFOA 2ZZ3A 2XDFA 3NQ7A 3SRDA 1UP2A 1NP0A 3W6YA 5A8PA 1N8IA 3EYPA 4RPPA 3TN3A 3VIPA 3AXIA 1DBTA 1VD6A 3WH9A 5I3GA 4Z2JA 1KA9F 1EC7A 3UR8A 4C60A 4FHAA 1VPQA 3MJYA 4PFHA 3GG1A 5EMLA 4M1BA 3MKCA 2QUNA 4YXGA 4BFAA 2O56A 3GR4A 4GACA 4IQEA 1ELSA 5A8GA 3NQ6A 4KIEA 4KH2A 2ZZ2A 4CNPA 1TPWA 3VM5A 4GXMA 1VBJA 3N6QA 2ICSA 3FVMA 3SUTA 2VC5A 4DO7A 2D22A 4WDWA 3PN8A 1ALDA 3EEZA 1R46A 1TR1A 3CUJA 2F38A 3OJGA 2YLAA 3HV9A 3P80A 4I6VA 1A0CA 4F66A 1EJ7L 1TQXA 3LHZA 3NSXA 3FAWA 3NQ8A 2BOFX 1YDOA 4F2TA 5A5WA 4J7RA 4XBSA 3DFQA 3S0CA 2G0WA 5ABTA 1H1ZA 1M7JA 4BKNA 3AYRA 4UTTC 4KFPA 2HE5A 1JAEA 4AIOA 1ONXA 4JOMA 3WJWA 1O7AA 5FKYA 4AVOA 2DV0A 1P1MA 3T0DA 3T55A 3NPUA 1U5HA 3ALFA 1EH9A 1MNZA 3AIRA 4WX2A 4JZ5A 1E0TA 1EWDA 1G0CA 4AZIA 4OZOA 5I3KA 2QS8A 1YPFA 5DN1A 2PDGA 1EP1A 3UG5A 3ARTA 1WKDA 1LROA 3GG8A 2GJPA 2A79A 3VZYA 4AZ6A 2CLPA 3WBWA 3CH0A 3T2PA 2WW5A 3QV7A 3VPLA 1QW7A 3ZIZA 1JYNA 4NYYA 4GZEA 2XIOA 4M6PA 3WBXA 2F2HA 3WJXA 3PS7A 2J88A 4X63A 3KZPA 4FX6M 4IH3A 4IGMA 4M6QA 3APGA 1UR0A 2QF7A 4RUBA 3IJIA 4JXCA 1T7LA 4I9AA 2GQAA 5I78A 4ATDA 2VX4A 5LA1A 2WMIA 1TPB1 4B4FA 1UG6A 1P48A 4UBPC 1P6WA 3LU2A 2WMGA 3ARPA 1XXXA 4ORMA 3B9EA 3QH2A 3QHNA 5G1YA 3O63A 4RZ5A 5D9MA 2Z1XA 1ZJAA 3KTXA 4ZENA 3QC0A 4JKLA 3W0KA 3EDFA 1W1PA 2DGAA 3OQEA 4PMXA 1K6WA 3WQCA 4DJEC 1H0IA 2XPKA 3MANA 1EJTC 2AL2B 3K4AA 1WAWA 4XAGA 1WX0A 3W7JA 5I23A 5HNUA 2FHFA 4X22A 4XZIA 1QT1A 4K8GA 1KTCA 4J3TA 3M16A 3PJUA 4BS0A 4TO8A 2ACQA 2ATMA 4PBFA 3VIFA 2WB5A 1A80A 4QFUA 5LIXX 4JTJA 5B7ZA 3GW3A 3R8GA 3VIKA 5F1UA 1WUFA 5AZ1A 1J10A 1TRIA 5JQ9A 4RPQA 2AAAA 2W79A 2ISWA 3NXLA 3LV5A 1F74A 1IEWA 3GIQA 2YFOA 2GJNA 3S47A 4O13A 3UJFA 1TJ0A 3DERA 4RV3A 3W2UA 2BLEA 4JX4A 1CTNA 4MDPA 1V0NA 2NX3A 1PPIA 3ZJ8A 4R53A 3GX9A 1ISYA 4ZQOA 4GXPA 1M53A 1TUFA 1US0A 5DMLA 3TONA 4MWAE 4D1JA 3NUKA 3PUOA 4LBRA 1WA3A 1RUSA 5A8QA 2OXNA 4M80A 1XG4A 4X3ZA 3GC2A 4KT2A 2GYIA 1IEQA 4AD4A 3I68A 1H50A 1DE6A 3L2LA 3MVIA 4O1DA 2BZNA 5BMXA 4EKJA 1E70M 4TX6A 3CUIA 2FPVA 1VCFA 1ZUAX 4L1WA 3KBWA 1YEYA 2BXVA 2IXVA 3N2XA 4P61A 1SJAA 1LUCA 1GJUA 4Z1DA 3VKJA 1F05A 3GTIA 3SUVA 3ABOA 4NUWA 3RR1A 4OV4A 1L2UA 5TD4A 3MMDA 4G7FA 3SI9A 2A7NA 3CMJA 3RM4A 1F5ZA 4GIRA 4C1KA 2E68A 1YNPA 1PXGA 4GVIA 4JTCA 3BG9A 4Y7EA 3OODA 1UOKA 1ZHAA 2WHJA 2Y0FA 5I24A 3OTRA 3GAYA 3DHDA 2ZKMX 4RNFA 1B3YA 1R30A 3PVFA 3ABZA 4LVFA 1EXPA 3LS9A 3NL5A 4HMDA 3ZR5A 1LRTA 1GQIA 4QE5A 3AS3A 1Q85A 1GKPA 1TV4A 4O0KA 2OZTA 1J6PA 2ZRVA 3ZJ6A 3W88A 2P50A 3JR2A 3FY1A 2BG5A 3AHXA 3MUAA 3HPZA 2XINA 4D6FA 2A1YA 2IPFA 3EMQA 1XBZA 2P3ZA 1E4IA 3AUOA 4CNOA 1UMLA 4N42A 3FVDA 5IRPA 1CIUA 3HG2A 2J4GA 3LD5A 4I5XA 3LERA 4TXEA 2OU4A 4WKAA 4L4MA 4LH8A 1ZLPA 3UQNA 4P8WA 2VELA 2PRMA 3C8NA 5DCBA 3EB2A 1UD8A 2I1OA 4GUJA 2XN2A 3BPWA 2FDSA 1LCOA 3GK0A 4PTNA 5U7SA 1RQHA 4UNKA 1E9YB 2PGRA 4U5KA 1OCQA 3KWXA 4JQ3A 1TVNA 2J7BA 3LPOA 3AZSA 1NDWA 3C3UA 1RY0A 2FPYA 5T91A 1V6XA 2O0TA 1U2YA 4IMDA 1TPUA 2B7QA 2Z2AA 4O18A 2WVVA 3W37A 2WPGA 1BWVA 4RR4A 1TPC1 4UQEA 3RYSA 2XIBA 2PSNA 3W74A 5FF7A 1VLIA 2MNRA 4JTAA 1R9YA 3KCJA 4JY8A 2WC7A 4XD3A 2VUNA 5D03A 3MUXA 5BW6A 2E77A 1H09A 3HV8A 5DO8A 2X1IA 3G0SA 5PTDA 1G4PA 2QVNA 3NZGA 2E0PA 1OC5A 4H9ZA 3XIMA 4HTYA 3B8DA 1E6NA 5G4HC 2R1KA 5KZMA 2BHUA 3HIJA 2OEJA 1X97A 1KWGA 3R79A 4DAIA 2W6RA 4CD7A 1AK5A 2QCFA 1NWUA 1JDAA 3CMGA 5DF0A 1QNPA 3M0JA 2GVEA 1WKFA 4EIVA 4HN4A 1PV8A 1TV3A 1CDGA 3KBMA 3U2CA 2G50A 3P8JA 2J7EA 3QQ1A 2ZXAA 3VFLA 2VI0A 1DJQA 3BZGA 4YYCA 4D6GA 2XVPA 4UC5A 1KWKA 1D3HA 1Q6EA 1KRCC 1MYRA 5GVJA 2E3ZA 1SMDA 4G6CA 4LYKA 1MFUA 1KFJA 7REQB 2P8CA 2E6FA 1QNSA 3GRIA 3VGDA 3LPPA 2VR2A 1ZSXA 2IS7A 4HQVA 3NDOA 2V67A 1J2WA 2V8ZA 3OPSA 4RXFA 2FFIA 3G0UA 2EBNA 3VOGA 2ZQ0A 3DECA 4CD5A 4N6EA 1X1NA 3WLSA 3GDKA 1GKQA 3DGBA 4H9XA 3SEPA 1KQZA 3WH7A 1IZCA 4MNJA 2ZX5A 3ONBA 4HJFA 3W3OA 4HU0A 4AHPA 4JDYA 2FVMA 3BCFA 2OX1A 3I3EA 4JTDA 1SJDA 4IFRA 6REQB 5A1AA 1LQ2A 4YTSA 3CLWA 4H7ZA 1UZ4A 3VIIA 1CGUA 1V3MA 4U2YA 1NARA 3E0VA 2GUBA 3IIOA 2HROA 3NQCA 1TO3A 3OA5A 3A21A 3TW7A 3M64A 3CK5A 3AIEA 3T40A 3NEHA 1JPIA 1Q7ZA 3LBCA 1HQTA 3TIMA 3MV11 5D4YA 3WG6A 2GSHA 4WY0B 2ZTKA 3E2SA 3MUCA 1EFZA 4CLMA 3VILA 3FX4A 3CQHA 2QDEA 4FAMA 2FZNA 1FUYA 2XH4A 5BOEA 1ZENA 4K37A 3M41A 5K4ZA 4PRWA 3UZZA 2J27A 2Z6IA 1VZWA 3BARA 4TVDA 1R86A 3ARYA 1L8NA 2QPXA 4ZZ9A 1S2VA 1EF3A 1OZQA 2GWGA 1E56A 4DRSA 1SFTA 3T0BA 2Q8ZA 1VYSX 3EA3A 1Z41A 1KBKA 4ZEPA 1SO4A 3SCOA 4OWGA 1G6CA 2F6XA 1IGSA 4WOZA 2CNCA 4DWSA 2ZRYA 1WAUA 4HK6A 4ACZA 4CD8A 4R9OA 4LXFA 1LOSA 4FO4A