2YSWA

Crystal structure of the 3-dehydroquinate dehydratase from aquifex aeolicus vf5
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
219
structure length
219
Chain Sequence
MLIAVPLDDTNFSENLKKAKEKGADIVELRVDQFSDTSLNYVKEKLEEVHSQGLKTILTIRSPEEGGREVKNREELFEELSPLSDYTDIELSSRGLLVKLYNITKEAGKKLIISYHNFELTPPNWIIREVLREGYRYGGIPKIAVKANSYEDVARLLCISRQVEGEKILISMGDYGKISRLAGYVFGSVITYCSLEKAFAPGQIPLEEMVELRKKFYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal Structure of the 3-dehydroquinate dehydratase from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
total genus 86
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2007-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yswA00
5KZDA 3TXZA 4OE7A 3UWVA 3S1VA 4HNUA 3GX9A 2V8ZA 1U5JA 4HN4A 4UFHA 3H54A 4IMDA 3BK0A 3NPXA 2PRHA 4K8HA 4HNVA 4HKPA 2P10A 5LNRA 1H60A 1ZCOA 2Y62A 3MBDA 4XKYB 1VZWA 4JTKA 1H62A 1ZFJA 3DAQA 3FA5A 1VLIA 1UUMA 4EF9A 2O7QA 3RLUA 1Z44A 3MP3A 4O11A 3GR8A 1JQVA 3HIJA 3C2VA 3TNOA 1YYAA 4JTHA 2ZRXA 1TPH1 4UR7A 5BRBA 1JCYA 1JUKA 2ATMA 3N3MA 4MFDA 1H7OA 5F2IA 1B3OA 1QOQA 5HMSA 5K4XA 3BV4A 3QQ0A 5FESA 3S1UA 3L9CA 2ISVA 3LHYA 1J5TA 1ICQA 3GDMA 1C29A 2Q8LA 3TIMA 4FB7A 5CPOA 4DQWA 2BSLA 3W87A 1KM2A 5DLCA 2DZVA 2AGKA 2R94A 7TIMA 4ADTA 4H6KA 4KFOA 4QNWA 4MJZA 5D04C 1FDYA 4N6EA 5TQLA 1UCWA 1JRBA 3M16A 2AQWA 2RKXA 1HFBA 1GT8A 5E93A 5MHBA 2QF7A 1VHNA 2W79A 3WJWA 3PBVA 3NL2A 3M5XA 4MY1A 3V1PA 1Q6OA 3OBKA 3TW7A 1TPFA 5EA9A 1JCJA 2WV8A 3SIZA 2A7NA 4AMAA 3WK3A 5I3IA 1W8SA 3N19B 4KFPA 2NX9A 3UQNA 1IIGA 4QSHA 3FLUA 1JCXA 4PCFA 4UFIA 2CLEA 5D30A 1XM3A 5FF2A 1I2RA 3HPSA 4UMCA 2VFFA 1TO3A 2QCDA 3GXPA 2GQ9A 4LY8A 5HUOA 1VYSX 1PS9A 3W22A 4M19A 1QPRA 3W1MA 3HGSA 1G6CA 2WJZA 4X22A 1RD5A 4DF1A 1DJNA 2CLKA 3SSJA 5J5DA 3LRLA 1O95A 3TCEA 3CHVA 5FF7A 2Z2UA 1MEWA 2ZZ2A 3L68A 2OMAA 1S5TA 2QCCA 2QCNA 5G1TA 1ZY9A 4M7SA 5K9DA 4M6QA 4JR5A 4K36A 4LV9A 3HG2A 3JR2A 1FCBA 1VYRA 1I2QA 4O53A 4BR1A 4UXDA 1QPNA 3LXCA 3SZ8A 3HJZA 2PE4A 2IQTA 2DZPA 4AEOA 2OT0A 2YR1A 2CFFA 1AG1O 3TJLA 2DZWA 3T44A 4JIQA 2OJPA 3TSDA 5H2ZA 1MXSA 3VE9A 1KFCA 1D3GA 3GKAA 3UWYA 4GUGA 1TRIA 4CQ9A 3LERA 4FXRA 1SZFA 2VELA 2V5LA 3GDLA 3LX9A 2DJLA 3NDOA 5LGXA 1LYXA 2B4GA 3LI0A 2QCEA 5DBUA 4O18A 3T78A 1B4KA 1VH7A 1NEYA 1W5PA 3G24A 4FXSA 2E6YA 5AYXA 3DBPA 5D2XA 1G67A 3UD6A 3HG3A 1GVOA 4RXGA 5DCEA 2E1DA 3KOFA 4O13A 4UTTC 1X1OA 2EF9A 4O16A 4ORIA 3NQ2A 3I7QA 1IF2A 1K7FA 2HS6A 1GQNA 3BPWA 1NVMA 3FKRA 5AHMA 2Y7FA 1B4EA 4HNTA 3MO7A 5FEWA 3C2FA 3C8FA 5U4NA 1K8XA 3N2XA 1SUXA 2YPIA 1I45A 1QWGA 5LSMA 2B7PA 4IPIA 4RCXA 5K4ZA 2V82A 2TMDA 1DQXA 3FYOA 1OK6A 1OJXA 3P67A 4O1AA 5DY2A 1Z42A 4LS0A 5EY5A 4UTHA 1G69A 2WNZA 1A5BA 1RR2A 5CZSA 2ZZ5A 2E6FA 5AC6A 1SZNA 4IWWA 4A22A 1Q3NA 4WX2A 4S1FA 1I2OA 3SY5A 1T99A 3G1YA 1LBLA 1OF8A 3TH6A 1VQTA 3W23A 1PVNA 2VFHA 3HF3A 1KFKA 2ZTKA 1SQ7A 1VCGA 2E6AA 2C13A 3G1FA 3ZWSA 1TTIA 3EWYA 4UCGA 1F6PA 4WQ6A 3ATZA 3EWXA 4LU0A 4LUJA 4OBTA 1XL9A 3RFAA 4QIUA 3P74A 3W83A 1TJRA 3S0CA 1OF6A 3TC6A 4LWWA 4EF8A 4O10A 3A9IA 4UNKA 1FWWA 3VE7A 5LNSA 5BOOA 2WQPA 3UPBA 3S5NA 3BG5A 1EWDA 4LC6A 1L6WA 1ME7A 4O57A 4NJIA 2CLLA 1RV8A 2NV1A 4RX0A 1W5MA 1KTCA 5LZLA 2HTMA 2PURA 3LCXA 4Z08A 4NZFA 3C3NA 2V9DA 3DFPA 4UMBA 3W2JA 1ZENA 2WO5A 1XFBA 4XWUA 4UNLA 3PY2A 2XFWA 5HWMA 3K30A 4GJ1A 1WXJA 5LNVA 2GQ8A 2QUUA 4EOUA 3L5AA 3DH7A 3IIOA 4UFKA 5DXYA 3C61A 1WBJA 3ABQA 4TX9A 4LOCA 2H3BA 3EX1A 3RNDA 1QMLA 3NL5A 1V7YA 1TRDA 1ML1A 1EIXA 1TPVA 3TSMA 3OHIA 5D37A 2GPTA 1JUEA 1G4PA 4CQAA 1JUBA 2X1SA 2VFDA 4GXMA 1T8XA 3W1LA 1WX0A 5SWUA 3NQAA 2ZRYA 3HG4A 3LHTA 1HTIA 4IMCA 3IVUA 3KRUA 4CCDA 3NA8A 4RR4A 1F74A 2V5BA 3L5MA 5DXXA 4IXXA 3ZR4A 2ZZ6A 5K7JA 1W5QA 3B05A 1LORA 4K7YA 5D2VA 1KM1A 3BW3A 3TFCA 4JD4A 1LCOA 2VEMA 5A8GA 2H8ZA 4KWVA 4WXYA 2Q3RA 4O50A 4JICA 1XBXA 4JS3A 4JTSA 2XN2A 4HSNA 4RLIA 1PE1A 4MYXA 3EX2A 3OVQA 1RQEA 1OFPA 1W3TA 2JKPA 1OFDA 1ZNNA 1H7PA 1ADOA 2DP3A 4RK8A 4ORMA 1IXQA 3DFSA 4DPQA 1RZMA 5KTLA 4FNTA 3NQVA 3T55A 4YXGA 1EP2A 3ZFHA 1D9EA 3KVMA 3ATYA 3SGUA 1KLZA 2WNNA 1C9DA 4GC4A 2BX7A 2WSQA 1XUUA 1OK4A 5EPDA 1H61A 5CPLA 4HPXA 1FWTA 1HG3A 1R30A 1CW2A 2X1RA 2Y7DA 1L2UA 4BF9A 4DO4A 3A24A 4AAJA 2NXGA 3USBA 2RDUA 3JRKA 1FCVA 1SFLA 5D03A 1TMHA 1KTNA 4I7WA 4R53A 2QAFA 3IIZA 4I7VA 3M44A 2YFOA 5HWNA 1EPXA 5IBXA 4E2BA 3CLMA 3G0UA 3TA6A 5U7SA 1WYIA 3GLCA 3PR2A 1B57A 4C1KA 1XI3A 2OCZA 3GIYA 3I68A 3W7IA 2ZRUA 2TSYA 2I14A 5E1QA 2DZUA 3LTPA 3PM6A 3EXSA 3W86A 3C6CA 4IXHA 3P8JA 3WFAA 1FXQA 5C54A 3PG9A 5ABTA 4PL2A 3D0CA 1VS1A 3G8EA 3M1ZA 3N9SA 4GWEA 4JTFA 3TK7A 1OX6A 1O5XA 1F73A 1PHWA 1TCDA 2B7NA 1Z41A 4O14A 4N9DA 3AO0A 3CB8A 1AK5A 1OFRA 3LGEA 1VLWA 1U83A 1EEPA 2WPBA 1S5WA 4MY8A 3S9YA 3IV3A 4O0ZA 1KM3A 1UBSA 3HG5A 4TU1A 3NVTA 2FPVA 4Y8FA 3BLEA 4TMCA 5EL1A 1G4EA 3LRKA 4QM1A 3W9ZA 3AJXA 1LOSA 1H1YA 4JGDA 4AHQA 5K9CA 3W73A 2YXGA 3P62A 2YW3A 1DHPA 2VC6A 3O8AA 2BLEA 1JVNA 1VHCA 3CTLA 4NX0A 2CW6A 4LVAA 3BLFA 2QDGA 2YYUA 3P82A 5I3KA 1GEQA 4Y9AA 4BI5A 1LDCA 3MHGA 1LZOA 3NQGA 4NVTA 4JY9A 5HUPA 1EWEA 3M7WA 3UXAA 1FX6A 4JYFA 2XN1A 1KBJA 5G4EA 4DO5A 5KZEA 3TAOA 3LRMA 5KMYA 4XKYA 3RF9A 1YDOA 2E09A 2QUTA 3STCA 3P61A 1G7VA 1OX5A 3Q37A 1T96A 4NNAA 3IGSA 2R8WA 5LNUA 5D2TA 3QMSA 5AC8A 1XBVA 2J24A 2J9ZA 3HOJA 3FS2A 3QPZA 1UJPA 4GUFA 1P0KA 4X9SA 2OT1A 1LOLA 4GUIA 4PTNA 3FKKA 3LB0A 4K6AA 1SO6A 3TJXA 2ZZ3A 1ZAHA 3KFTA 2Y6ZA 4ADSA 1D3HA 1EUNA 1KA9F 2VEIA 3STGA 6TIMA 2X30A 4AF0B 4WY0B 3B03A 1SW0A 3PULA 3TKFA 1Q6QA 1KV8A 3G3MA 3PC0A 1LRTA 2E68A 1FDJA 3KVJA 1SZGA 3STEA 4OV4A 3IIVA 3VFLA 1GVFA 3BLIA 2J88A 1VC4A 3PAJA 1K8YA 1KBIA 1XBYA 1UB3A 1MEHA 2W0UA 3KXQA 4FNUA 1ZAIA 4S2BA 3B04A 1V5XA 3G18A 5C5YA 4O4WA 2Y85A 1JCMP 1TQJA 3STFA 1YTKA 3CWOX 3I65A 1SPQA 3F03K 4MYAA 3VKJA 2QUVA 4UTWA 3F1QA 2YSWA 4FF7A 2CZEA 1YXDA 4AXKA 3M47A 3IEBA 3NGJA 3GVGA 3MMTA 5H91A 4LT9A 4JTTA 1EX5A 3O6CA 4Q32A 1JCLA 1G4TA 4W9TA 4B5NA 4QQ3A 4OHQA 3LHZA 3CWNA 3SI9A 4HHPA 4MLRA 2R14A 3HGOA 1GPWA 4NQ1A 3W1AA 4HT3A 1B9BA 4LRTA 5F2GA 2YW4A 3H53A 1VCFA 3BW2A 3G1XA 2BTMA 2Z0IA 3C2OA 3G0SA 5DN1A 2HSAA 3DFNA 4JDBA 3BO9A 3CU2A 5CSSA 3W7MA 3WJSA 4WOQA 1BTMA 5BNKA 1TPUA 5AHFA 4Z1DA 3TROA 1TTPA 5C55A 1YDNA 3CC1A 4OV9A 2QJHA 3IVTA 4UTIA 1C8VA 3C56A 1LRNA 5KINA 2C15A 2G97A 3R8RA 5HR7A 2O7SA 1PHQA 5KSWA 4UTKA 4Z0SA 3C0JA 3R2GA 3WK1A 2VFIA 1OHLA 5BMWA 1VCVA 3F4NA 3W2UA 1LLWA 3GK0A 2KZHA 2NXIA 2Y63A 5CPNA 2JKEA 3DGRA 4IMEA 4GBUA 3O6DA 4RV8A 3VI2A 1YTDA 2YZRA 3G8RA 1TPDA 5G4WA 3W7CA 5LHFA 5CG7A 3O06A 4BWLC 3EX6A 1KFJA 3W1NA 1XC4A 5AHEA 3W1UA 3W7OA 4ADUA 1K8ZA 1E51A 1QOPA 1MSSA 2VFEA 3M5VA 3C2RA 3LV5A 3NEVA 4P61A 1TREA 5AYZA 4N4PA 4AWUA 4MZ8A 1H7XA 4E38A 3CT7A 3LCGA 1QO5A 8TIMA 2GVGA 2B7OA 4WUIA 1A53A 2E6DA 2WKJA 5I3HA 2RH9A 3UY8A 3GDRA 1VR6A 2P0OA 5DCDA 1T0OA 4MY9A 1DKWA 3H55A 1TJPA 1TV8A 3QW4B 1OYAA 4NXSA 3ABRA 3UZJA 3LHWA 5D05A 3THAA 4LVBA 2G96A 5CZTA 5J5RA 3HPZA 2ZFAA 3E0IA 3R5EA 4YMZA 3NG3A 3L65A 4DPPA 3O1NA 4HNNA 3HGJA 4IPJA 3GKFA 4IMFA 4M6PA 4PODA 2DORA 1IGSA 3LV6A 3NNTA 4AHOA 1G4SA 3O15A 2ZZ1A 1EA0A 4RJEA 3MW7A 4NXKA 3N9RA 5AHIA 4UTJA 1TQXA 3GNNA 3W2MA 5FF0A 5HJLA 2JKAA 2OX1A 3L21A 3UNDA 2CZ5A 2GVLA 2TRSA 3W1XA 3Q94A 3HO8A 3MHFA 1MEIA 1SZEA 1SSGA 2JGQA 2VOMA 4AB4A 3W7GA 1LTDA 2EAWA 1RVGA 3FJLA 2NV2A 3DXIA 4IOTA 3QMTA 4J9JA 3PUEA 3A5VA 1TSIA 4WOZA 1L9WA 1G7UA 3B8DA 1R47A 3SECA 4CCCA 3NZRA 4GE8A 1BKSA 1I2PA 2C6QA 4K7VA 2ZRWA 3E49A 2ZA2A 4Q4KA 1XKYA 3M9YA 3WK2A 1H5YA 5I3GA 3INPA 3I7SA 2GVJA 3BG3A 3GB6A 4TMBA 4RKAA 1H63A 3DKLA 1KM0A 4XBKA 3GAYA 1XBZA 1M7PA 4ZQOA 3UWUA 2JK2A 3W7EA 1GJPA 4JXCA 3W74A 3DFTA 1GVQA 5HWJA 2YFNA 1GTEA 5D2WA 4O12A 1OFEA 1QCWA 4JX5A 5D38A 2E77A 1I2NA 3OG3A 4JNMA 3TMQA 1WA3A 4JTEA 3T7VA 1X6UA 3W88A 4O19A 3TC7A 5TIMA 3F4WA 1K03A 5DBTA 2DZTA 2C18A 3LDVA 4I9AA 2RFGA 5AYYA 3A22A 1RQBA 2BXVA 3PVFA 3R12A 3NQDA 4M7TA 3MYOA 4BI7A 3WJZA 4QNEA 4WXZA 1W31A 3I7RA 1KM4A 1OABA 3KX6A 1Q6LA 3ABOA 3IIPA 1R2RA 4G1KA 5LNWA 4NJGA 3UXDA 3THQA 4N02A 1NAL1 3G1DA 1F5ZA 1FWSA 2A7RA 2R91A 1A50A 2H90A 4FX7A 4PH6A 1LBMA 4LRSA 4Z1BA 1W5OA 1LM1A 4OT7A 3PBWA 1A5CA 1AMKA 4A2RA 3R13A 3PUDA 2NWSA 2RDWA 4IQLA 1NSJA 3GR7A 3NQ7A 3E9AA 3P7YA 1XDMA 1YDVA 2EHHA 1DVJA 3DKJA 1LLZA 1F7BA 2X1UA 3QM3A 4NU7A 1YLVA 1Z48A 1LP6A 4DXVA 3TAKA 3GZ3A 2ZTJA 3MI6A 3G22A 3JS3A 3R89A 1QR7A 3S5OA 2ZQ0A 1GTHA 3W1TA 2GJNA 3PUOA 4O17A 2D73A 1FWRA 4R33A 1P1XA 3OVPA 5F2MA 3S5YA 4JYEA 4YWIA 4MKNA 5D02A 3CEUA 3KVKA 2NXHA 3QMRA 4PEKA 2VEKA 1VYPX 4E2DA 1R2SA 4IUOA 3L0NA 4XQ6A 4UC5A 5F2LA 2X2GA 4IGHA 4GUHA 1FCQA 3BGGA 3B0PA 3NPWA 4O15A 1ICPA 3W70A 3M6YA 5F1VA 1DOSA 5G5IA 1WOBA 3PB2A 2H6RA 1QO2A 1GYNA 4PL1A 1QFEA 2DZSA 2Z1BA 3LCHA 1J2WA 3TXVA 4AWTA 2A6NA 1K7XA 3OA3A 4ZL1A 3SJ3A 3W3OA 2A1YA 3GDKA 1FDZA 1GVSA 2Z6JA 5D2YA 1SFJA 2HMCA 2E5BA 4ICNA 1MO0A 4BFAA 2ALDA 4ZVJA 3B4UA 1QAPA 4XUGA 2ABAA 1FXPA 3BARA 4OWGA 2QJIA 2C19A 2CZDA 4CNOA 4DF2A 3G1VA 3EWBX 3MBFA 1CI1A 1IXOA 1M6JA 4TR9A 4JDYA 5KZMA 2W6RA 4AVFA 3W7HA 4EWND 5L9FA 4MZYA 1TPB1 1L6SA 1W1ZA 2TPSA 1AW5A 2QR6A 2NLIA 2VXNA 3LCWA 4CNPA 2OZ0A 5CKSA 5A5WA 1M7OA 3HQ1A 1PCKA 1QDSA 3QF0A 4LVGA 1ALDA 1TPWA 1OFQA 4N2YA 5K9XA 4GRSA 1KFLA 2LLEA 3HGRA 5F4SA 3CEPA 4UFJA 3L0GA 3SW6A 3DFOA 4LUIA 4ZQPA 1KM6A 5HR6A 3GXTA 3QH2A 4N6FA 1KFEA 5AN7A 3W2NA 4LC8A 3E12A 1F76A 2E5DA 1FY6A 1ONRA 4KWWA 1JJKA 3TSBA 3MWAA 3O63A 3S8HA 4Q33A 2C1HA 1GVRA 3W76A 3TQKA 3YPIA 2CLHA 3W7DA 4NJJA 5AFDA 1SSDA 4I7UA 4FX8A 1ICSA 2ZRZA 4NJHA 3W7QA 3WJYA 2FLIA 2RDTA 5BMXA 3N34A 5D33A 4Y90A 2X16A 3FJ6A 3S1XA 1HUVA 5F4XA 1DL3A 2JGYA 4ZMGA 3OIXA 1ZHAA 3V75A 4E0CA 2ZYFA 3QPYA 1IIHA 5EBUA 3W72A 4AF0A 4K39A 1PIIA 4BK9A 3LI1A 2EGZA 3W71A 4LV4A 3W07A 1Q45A 4JTGA 3PS7A 3NYZA 1A5SA 4MLJA 1WDWA 2NUYA 4O28A 4PFMA 3W75A 2CWNA 1GOXA 2FQIA 3P5ZA 2FIQA 3W6YA 5AHNA 1EP3A 3NQEA 4MVAA 4O1DA 1PV8A 4HSOA 4ZQNA 1O60A 1TTQA 2ISWA 4UR8A 1DJQA 2PC4A 1WAUA 4GNJA 3B0UX 2DZXA 4X3ZA 5HQEA 4O54A 1W3IA 1W56A 3TW6A 1VGAA 3SGZA 2YYTA 1N8FA 1IXNA 4JEQA 3GDTA 5FF3A 3I6RA 4KFNA 4NUWA 1NF0A 4D2JA 3NQ6A 3E96A 3LM7A 4YL2A 5AHLA 1TIMA 4UTTA 1XCFA 3RK8A 4Z1AA 2XN0A 4HIBA 1KTBA 1OFBA 2RHGA 4YCOA 3S1WA 4K8EA 4ZQCA 1AL8A 3L66A 5AB3A 4XBSA 1ZAJA 1OX4B 3S5ZA 4UFMA 1JQXA 3NZ1A 2FPTA 3NR0A 1A5AA 1LRQA 1BWKA 1R2TA 4FNQA 2I9EA 4UUIA 2QJGA 4DBDA 1LBFA 2CU0A 4FX6M 4JTLA 1F2JA 3B06A 2VFGA 1SO3A 1TV7A 3NO5A 4JTUA 3RMJA 5FEXA 4JYDA 1N55A 1P4CA 2G95A 1SO4A 2EKCA 4FNPA 2CLFA 3LTSA 3C52A 3QEZA 3S6DA 4RZ6A 1BEUA 1VPXA 3DHDA 3N73A 3LBCA 3O05A 3UWQA 3LHVA 3NPUA 3ZWTA 2V2CA 4A3UA 1WBHA 1O5KA 3ABSA 4N4QA 3TR2A 3EWWA 4ONVA 1XUZA 3UPWA 4PC8A 5BW6A 1ZALA 1KFBA 4A21A 3OVRA 3P8IA 2CLMA 3U8GA 3G1HA 3KHJA 3QSRA 3M5YA 2H8XA 3O6YX 5IBXC 4EVZA 1HO1A 4WJEA 1H50A 1SR9A 1EP1A 2ZZ7A 4FO4A 4MIMA 4R34A 2FDSA 1AL7A 4MPQA 5G2HA 4JX4A 2PRLA 4A29A 4OQVA 1FBAA 2NUWA 1K3UA 1UASA 2ZA1A 3W84A 3ZS4A 4DEFA 2ZBTA 4LNYA 2ZRVA 6ALDA 4JTJA 3RLVA 4BI6A 1H1ZA 2A2IA 3PSWA 4ZZ9A 3CIWA 1I4NA 1KM5A 3O07A 4XZ9A 4OGZA 5KITA 1LROA 3PBYA 3IIXA 5GVJA 3NM3A 4AH7A 3M0ZA 3O16A 4QAIA 1KW1A 2V2DA 1OFAA 3LXBA 3FFSA 3LCLA 5G2WA 5LKYA 2A4AA 1K7EA 2A0NA 2C3ZA 3MP5A 1DORA 4MJMA 2V2HA 4JTIA 4U4MA 4Z0JA 3FYPA 4NX5A 1S5VA 3MJYA 1SW3A 3NPVA 3G3DA 3NXFA 4AWSA 2BWGA 4NJKA 4FHAA 2DJXA 2FTPA 3KRSA 4LS1A 2QCGA 1VRDA 1FUYA 3QYQA 1QPQA 4A2SA 5LHEA 4N9BA 3L67A 1JRCA 5CZ0A 4ZQMA 5TBOA 3A21A 3BW4A 1WOAA 1HL2A 5T26A 3QJAA 2E5CA 2J9XA 1X7FA 2QCDB 3NL6A 2Q3OA 3RU6A 3W2KA 1N7KA 2YDAA 3W1QA 5EMUA 2FB3A 3QRHA 3UWWA 1QPOA 1P0NA 3BVJA 4LTSA 2QKFA 5K3VA 3WK0A 3M41A 4NZJA 2GOUA 3TV8A 4Y96A 1FWNA 4RZ4A 2C14A 4ML9A 1JR1A 4MOZA 2VKZG 1VJIA 4LW7A 4L4MA 4XTDA 3IVSA 4NNCA 5IM51 1H7WA 3L0KA 3C4UA 1XDLA 3FOKA 5HINA 2WSYA 3LCIA 1THFD 4FIRA 3L5LA 2QCLA 3P81A 2YGYA 3NQMA 4O0KA 2J9YA 1IXPA 1TV5A 3IGXA 4FIQA 2J27A 3W7JA 3WJXA 4P2VA 2C0AA 3VCRA 4JN6A 3LOTA 4UTLA 1M5WA 1H7NA 1P5BA 5G2IA 1R46A 4WY0F 4N9EA 4C1LA 4GFSA 4R7JA 1SW7A 2QCFA 2QEZA 4RXFA 3DHFA 4LS2A 1LOQA 3BG9A 4H3DA 4K38A 4O4VA 2QCMA 1NFBA 1O4UA 3GNDA 4UTWC 1OG0A 5EKYA 4IMGA 3TUUA 1YPFA 3P80A 5F1UA 1DV7A 3U6WA 4WZHA 2VENA 3GYEA 4LVDA 3VNDA 2A85A 1SO5A 5I3FA 3NQCA 2A7PA 2FFCA 3G0XA 2V0TA 4OU1A 3EEGA 1TPEA 2A21A 3EB2A 3Q58A 3TU9A 2QDHA 2EPHA 4YCPA 2NZLA 3MYPA 2PCQA 1F6KA 1W54A 2PRMA 2B0MA 4UIOA 3L2IA 2Q8ZA 4O1CA 2Y70A 1ME9A 2Y88A 3IRDA 3SFKA 3DFQA 2H3DA 3KVLA 2Y7GA 5FF4A 2QAPA 3W7RA 4JX6A 1TB3A 3HMJG 5CZJA 4TO8A 1EB3A 4XTIA 3EX3A 1NF7A 2CLIA 3PF3A 4N9CA 1J4EA 4CNNA 4LVFA 4FEZA 1SU5A 1W5NA 4ALDA 3P60A 2G5WA 4KKXA 3HPXA 4HPJA 3W1RA 1OYBA 5EYWA 2ISSA 5I3JA 4O52A 2A5HA 1H7RA 1YTEA 3W7LA 5G1YA 4FNRA 4PA8A 3PSVA 5CGQA 4YLWA 3LTYA 1F05A 1DQWA 1RQHA 2YX0A 4EIVA 3W2LA 4L4LA 1YPIA 5CPMA 3G1SA 3CQ0A 3Q2DA 1WV2A 2ZZ4A 3NQFA 1S3HA 3SR7A 3TQVA 1QNVA 4JIPA 3FEMA 3A23A 2CLOA 4RZ5A 3W7PA 1JCNA 1ZJIA 1W0MA 3QFEA 3EKZA 4Y6GA 3DU0A 4GUJA 3DZ1A 4O8RA 2TYSA 2F84A 4MZ1A 5C2XA 5LGZA 3G1AA 4UFLA 2WNQA 4QJ1A 2ZA3A 5DCBA 3ANYA 3PB0A 1TYGA 2ATSA 1I8JA 1Y0EA 2FB2A 4JY8A 5L6UA 1GG0A 2NX1A 3E02A 4CQ8A 2WSRA 3LLDA 1HO4A 3B0VC 1W37A 5K2ZA 3QZEA 4CLMA 2P1FA 1YADA 3CIXA 1W3NA 3NQ8A 1KV5A 4MUZA 1PL9A 2DU2A 1O94A 2YCEA 1X8FA 3MUXA 4O1BA 3N14A 1BWLA 1OVDA 1RPXA 3W1PA 2GJLA 1WQ5A 1PCWA 3GXNA 3ELFA 4DELA 2X1TA 3EXRA 5FEPA 1H51A 1XXXA 1JULA 2VEPA 3DI0A 1GWJA 5C6MA 2V30A 2C16A 4M6VA 1AW2A 1MZHA 4UMAA 3OEXA 3M5ZA 3TMLA 1EUAA 5D32A 4QISA 1Q6RA 5FI8A 4TIMA 4AHPA 1YXYA 3LHUA 3UZ5A 3UYCA 1OYCA 1FCUA 1FQ0A 4ZQRA 2NWRA 5D09A 3N2MA 5HULA 5DELA 4X2RA 4K37A 4Z1CA 3EWZA 1GZGA 4UTUA 1L6YA 3EKLA 4BWLA 1GG1A 1ME8A 3P84A 2J6XA 3LXAA 3T4CA 2ZCGA 4NT0A 5DY3A 3EX4A 3QSTA 2V81A 4POCA 2I1OA 3FIGA 3NM1A 2HS8A 3KAOA 4U28A 5E0KA 2UV8G 4FNSA 3PWAA 1GYLA 1X1ZA 4DF0A 3GAKA 3IGUA 3HBLA 1TTJA 2ABBA 3TX9A 4UTMA 4NNBA 3EWUA 3MI2A 2CZFA 2NUXA 2BZNA 2Z6IA 3MP4A 4WY0A 3KRZA 2Y7EA 3QC3A 4WD0A 4DO6A 3DENA 4CCEA 4DBEA 4IX0A 5F4WA 2FPYA 3P5YA 4QITA 3EXTA 1KLYA 2Y61A 2FJKA 3PBUA 1TPC1 2A6LA 5HNRA 2GUUA 4MFEA 2WOQA 1OX4A 5CSRA 3PG8A 3LBMA 2ZDRA 1UUOA 3W7NA 3TFXA 2JBMA 3UY7A 3W85A 3LLFA 3MI3A 2AAMA 3S42A 2QCHA 2F7FA 3MHUA 3NOEA 3M43A 2GQAA 5FEZA 3QQ1A 4H4IA 1AW1A 1YXCA 3C2EA 3NL3A 3TQ0A 5AC7A 4S2CA 2B7QA 5AOUA 3CM4A 3QW3A 1OFOA 4M5PA 3UWZA 3U2OA 2Y89A 3BGJA 3TDFA 3A5FA 3W7KA 3NAVA 1DBTA 4IJBA 1CX9A 3T40A 3TE9A 1K02A 3DI1A 2NX3A 3LCFA 3CPRA 4IX2A 3HB9A
chains in the Genus database with same CATH superfamily
4OE7A 3VDGA 2D24A 1XPYA 1WE5A 4H7ZA 5EB8A 4IPPA 1KCKA 3GX9A 4RPPA 1BRLB 3KP1A 4U2ZA 1R0MA 5DEZA 4HKPA 3IUDA 1G0CA 1MQQA 3GRIA 3MBDA 3DAQA 1VLIA 4AD5A 4EF9A 3OGSA 2Z29A 3MP3A 4O11A 1JQVA 3HIJA 3RDKA 4JTHA 4IIDA 1ZP4A 2TAAA 3N3MA 5A8NA 1ZB5A 5F7UA 5F2IA 1X6LA 2EJ1A 2XTKA 3BV4A 5K4XA 3QQ0A 5FESA 3QQWA 3LHYA 2ISVA 3S1UA 1J5TA 2Y0FA 5EFDA 2BSLA 1KM2A 4XVEA 1KFWA 2DZVA 3AIEA 4ZXLA 4ADTA 1GOKA 1SFTA 4H6KA 2PWHA 4KFOA 1QNOA 4QNWA 4MMWA 3HM7A 3E6EA 3ARSA 4CU8A 2DUZA 3GS6A 4AD0A 1Q4WA 3M16A 2RKXA 1GT8A 3H2MA 3AUOA 3BZJA 2W79A 3PBVA 3M5XA 1J9YA 2VX6A 3TW7A 4ASTA 1JCJA 4GX8A 1BAGA 4L1GA 1H0GA 3DBNA 3C2YA 1JI1A 3FLUA 4PCFA 2CLEA 2WMGA 2F2HA 1EJXC 4J3WA 3HPSA 1UP0A 3E3HA 3BAWA 1PSCA 2ZKMX 2IKIA 1GVIA 2VGIA 2GQ9A 1VYSX 4PMNA 3AFBA 8RUCA 1QPRA 3W1MA 2Y24A 4OJYA 3UP8A 1BD0A 1DJNA 2CLKA 3SSJA 3UZXA 1UD5A 3QOMA 2CXGA 1WXYA 3WFZA 2D2OA 2OMAA 4TV5A 4EWJA 1ZY9A 3HG2A 3JR2A 5CSYA 1R5YA 4G2DA 3WDRA 1VYRA 1I2QA 4O53A 4BR1A 2GSJA 2E3ZA 1XRVA 1QPNA 3LXCA 1CYGA 4QEEA 2OT0A 1SYTA 3TJLA 4C5YA 2BDQA 3A47A 4JIQA 3TSDA 1MXSA 3VE9A 3WUBA 4D6DA 1PDZA 1LWIA 4GUGA 2ZOXA 1YBQB 3QGVA 3ICJA 2V5LA 3GDLA 5REQB 5M3WA 1F6YA 3NDOA 1QNRA 3V0TA 2QCEA 5DBUA 3SN1A 3GM8A 1Q63A 3U48A 3K2GA 1TR9A 4FXJA 4FXSA 3ZT7A 3A3WA 2I17A 2E1DA 4LCQA 3THCA 4O13A 3WDJA 1X1OA 1RCXB 4Q8PA 3M0HA 1K7FA 3BPWA 3FKRA 2Y7FA 4HNTA 1JDCA 1UHVA 1IT7A 5FEWA 1K8XA 1SUXA 2DUXA 2YPIA 2B7PA 4FOUA 1UMYA 1NU5A 5K4ZA 2V82A 3BMVA 1WUEA 2TMDA 4FOKA 4IIBA 5E0CA 3FYOA 3H7UA 4UQ9A 3P67A 4CN1A 1Z42A 5ABGA 4B5XA 3QTPA 4A22A 4WX2A 4HYRA 4S1FA 1I2OA 1PTGA 3OW1A 3SY5A 1O66A 5A6LA 3R8GA 1VQTA 4DNHA 3HF3A 2XFRA 2ZTKA 1VCGA 2E6AA 1SFSA 3KOXA 3LZ5A 4LU0A 4OBTA 1Z7AA 3RFAA 3BJTA 3S0CA 1OF6A 4LWWA 4EF8A 4O10A 1QI4A 4UNKA 3VE7A 3ARXA 4LC6A 4ZXOA 1L6WA 2CLLA 1I9CB 2NV1A 1KTCA 2AMXA 1ISXA 4HNCA 2PURA 3QV9A 4Z08A 4Q8QA 1IT8A 1CDGA 3BCJA 3GBEA 3DFPA 4DN1A 4UMBA 3FX4A 1TV4A 3EBVA 1CCWB 1XG4A 3PY2A 3CL6A 4G9PA 5HWMA 1WXJA 1UC5A 2GQ8A 2GWGA 4EOUA 3L5AA 4HPGA 3C61A 1WBJA 4HB7A 3B4YA 2WSKA 4JTDA 4AFYA 3L4XA 1QT1A 3NL5A 1EIXA 5LIUX 5H6HA 1BXCA 3WUEA 2FVMA 2GPTA 1G4PA 3GNPA 4I9MA 1JUBA 2INZA 2X1SA 5M03A 2ZWYA 3IJLA 2P3ZA 5C9WA 3ES7A 3O7UA 3HG4A 1HTIA 4IMCA 2J8GA 2ZXQA 1DXEA 3L4WA 3G2GA 6XIAA 1XFCA 2O9PA 2QXWA 2ZZ6A 4JHOA 7TAAA 4K7YA 3A6OA 3BW3A 5A8GA 2H8ZA 4WXYA 4MWAB 4J5NA 1E55A 4JICA 2DT0A 4I5XA 4HSNA 1PE1A 4OUIA 3WQ4A 3OVQA 4ZOBA 1NFPA 1SGJA 2O55A 4P8VA 1AVAA 1OFDA 2OEMA 2DP3A 4JKKA 2DQWA 1IXQA 4LAOA 1L2QA 2ZUMA 4R85A 2FZBA 5CGTA 1E4NA 3GC5A 3CT2A 4YXGA 3TYBA 1D9EA 3KVMA 4Y9NA 2WNNA 1XLJA 1C9DA 1XUUA 1FWTA 2GGGA 3O9NA 1UQYA 2X1RA 1NP2A 2R6OA 4BF9A 4IFOA 1MZRA 3E2SA 4DO4A 5I7GA 1WDPA 1SJBA 4D8ZA 1SFLA 2AKMA 1KTNA 1W9DM 2QAFA 4I7VA 3M44A 3OGVA 2DGAA 5FOOA 3BDKA 5I2UA 3G0UA 3KM8A 3EMCA 1WYIA 2BHUA 4RDWA 3XISA 2ZRUA 1R6WA 4DWSC 2V67A 4IXHA 3AU6A 1FH9A 4D6EA 3P8JA 1B54A 1FXQA 5C54A 3QV6A 4L9YA 5ABTA 3DUGA 3D0CA 3E2VA 3NVDA 3G8EA 3N9SA 1E9YB 1OX6A 2GSHA 4J35A 1O5XA 3VDBA 4AIEA 1F73A 4UZUA 2Y8KA 1TCDA 2B7NA 3IJQA 1XIIA 3S2NA 4N9DA 3SCUA 3UU0A 3CB8A 1XYAA 1OFRA 4Z2IA 2UY4A 3PN8A 4NG3A 3ZM8A 5HPCA 3BICA 1S5WA 2UY2A 3S9YA 2J6VA 4B92A 1KM3A 2OO6A 1E6NA 4TU1A 4TMCA 3GXMA 2NQHA 4Q8MA 1Q66A 4NZ3A 4Z2JA 1V79A 3L4ZA 2VC7A 3ANVA 4PE8A 2YXGA 3P62A 1DHPA 3O8AA 2ZE3A 4LVAA 3G5EA 3P82A 4MF4A 1JYWA 4BI5A 3MHGA 2G3NA 3RHGA 3M7WA 2ACUA 4LY4A 1WDRA 3VPLA 1OD0A 4U5IA 3WBEA 3P61A 1OX5A 1ODUA 3WNPA 1IWPA 2CHOA 3N11A 1KRCC 5D2TA 2JIWA 4CN6A 1P1MA 5AC8A 1M04A 3QBUA 2YCLB 3HOJA 4TTGA 4GUFA 1OQFA 3WBYA 4MJ2A 1CGWA 4RNJA 2W5FA 5CGMA 4RE0A 2VEIA 4LQ1A 6TIMA 3PPGA 1JFXA 3V4BA 3STEA 1GVFA 3VNMA 3BLIA 4ZE4A 3WH6A 2VCAA 2PP3A 1R3VA 2PDGA 1KBIA 3A4WA 1MEHA 2W0UA 2AOSA 4S2BA 3F4CA 1SMDA 1WZLA 5JBFA 4HA1A 3PANA 2X05A 2D0GA 3CWOX 2F6XA 4EAYA 5DO8A 1J2BA 2OQLA 1PDYA 4MYAA 1PYMA 4UTWA 3N17A 2MANA 3LQLA 3NGJA 3MMTA 5H91A 1NY1A 3O6CA 1G4TA 4W9TA 3TYCA 4B5NA 3SI9A 1XIEA 3VD5A 5F2GA 5A1AA 1E1FA 3B9DA 3FXGA 3DFNA 2EQDA 3BO9A 3S46A 3W7MA 3ERPA 5AHFA 3TROA 3CC1A 3ZSTA 1C8VA 3C56A 2G97A 2WKGA 1PHQA 2V3EA 1C91A 4PGLA 1Y5VA 1ZBKA 3R2GA 2J47A 1H0IA 1EO5A 3H23A 1VCVA 3KTCA 2OB3A 1LLWA 2DV0A 2HISA 2KZHA 1NQ6A 3D3FA 3CO4A 5I07A 2D2HA 4INFA 3KL5A 1BTCA 1ZCCA 1C90A 3PZIA 3QKEA 1EDQA 4XAGA 3CPGA 2Z7GA 4ILSA 3O06A 4IP7A 4BWLC 3ORWA 3W1UA 2ZDSA 1MUWA 4F0LA 1C93A 1E51A 1W2PA 4L6OA 2CZVA 3LGGA 2VYOA 4IM4A 1K9EA 2VFEA 1A5LC 3C2RA 3LV5A 3NEVA 1TREA 1TUFA 5AYZA 3SN4A 1DJWA 4MZ8A 1H7XA 2ZE0A 1LL7A 4A8IA 4E38A 1NH6A 2IPWA 3LCGA 5AC5A 1AH4A 1NDWA 4MG4A 2B7OA 1E15A 1NTHA 2RH9A 2G3JA 1VR6A 2P0OA 5DCDA 1VEMA 4UOQA 3H2AA 4JTQA 1HGWA 4CN4A 1TV8A 1TJPA 4NYYA 3T2OA 2NQ5A 4NXSA 3UZJA 2HBVA 4JIIX 2H9AB 2XGIA 1ISYA 3HPZA 4CD6A 1F3XA 2QLYA 1U30A 1NDVA 2A3LA 3KS5A 4MSSA 3UR8A 2HVOA 3GKFA 3MS8A 3V36A 2DORA 4HYVA 2ZZ1A 3SRHA 1EA0A 1KNWA 1ZBWA 1LT8A 3TYDA 4IGMA 3CAQA 1TQXA 1Z69A 3HURA 1N8IA 5HJLA 2GVLA 2TRSA 3UG4A 4DAIA 4GXPA 2J4GA 2VOMA 2AL1A 1LTDA 1RVGA 5HDRA 4IOTA 1H2JA 3QMTA 3WEZA 2VR4A 2DSKA 3W81A 3PUEA 3NSNA 4WOZA 4W84A 2PDIA 2PD9A 1DWFM 2XU2A 1XIDA 4PMRA 3DYOA 2RDXA 1XKYA 3WK2A 3QKZA 4F9DA 3IJ7A 3WH9A 3F4DA 4RNFA 3INPA 2ACSA 4FPSA 3OHMB 4M0XA 5D9MA 1OWQA 1KM0A 1VFTA 1E5NA 2X09A 1JPHA 3TJ4A 2D23A 3FDGA 4R9XA 5HWJA 8XIAA 2YFNA 4H9TA 1U1HA 1H11A 2D0FA 5D2WA 1OIMA 1R9XA 5JVLA 1JNDA 3GQYA 2E77A 3GG8A 1FWGC 3OG3A 4JNMA 3EDFA 4ZBCA 2XVGA 1WCGA 3W88A 4PMXA 3RCMA 2ASHA 4NZCA 2EBNA 3F4WA 2A3CA 4AWEA 3WNOA 3KOWA 2J7FA 4I9AA 2OYKA 5AYYA 3GU1A 5H1WA 6REQB 2BXVA 3TYAA 3AYSA 3AWNA 2J8FA 4UR9A 4WXZA 3PBMA 2ADAA 3I7RA 1Q6LA 4CU6A 1AH0A 4NJGA 5DMMA 1EJVC 1NAL1 3F2BA 1Q6FA 2A7RA 3MSYA 2H90A 4UWMA 4LRSA 4E3TA 4Z1BA 3OLGA 3PJWA 4A2RA 4IICA 3PUDA 2NWSA 4F2UA 4LNCA 1XDMA 1DVJA 3GY1A 4AX6A 3QM3A 4LGXA 4JQAA 4NAFB 1LP6A 1ITUA 4IQEA 4J1OA 2ZTJA 3TAKA 3G22A 3R89A 2FKPA 1QR7A 3S5OA 3AS0A 2ZQ0A 2J13A 2BY3A 3LZ3A 1AZ2A 3H2EA 2D73A 1VFUA 1V0NA 3S5YA 1K8CA 4MGGA 5D02A 2PWDA 2A79A 5EBAA 2WC3A 3SRFA 3BOFA 1VYPX 4Q6XA 1ZJAA 1R2SA 2R82A 2AKZA 4CD5A 4EPDC 4XQ6A 3RIKA 3M46A 4IGHA 4HMDA 1YE6A 4GUHA 3PTMA 4DJFC 4I5UA 4O15A 3A4JA 3OODA 1DIDA 3HTWA 2G4FA 1WOBA 4KPLA 3MZNA 5A3HA 3FGCB 2DZSA 2A6NA 1A0CA 1DJGA 3COTA 3VYLA 1U5VA 3SJ3A 4AX7A 2A1YA 2QIWA 1SFJA 4AZCB 1PJ9A 1TE1A 2HMCA 4FLQA 5I77A 2E5BA 1EX1A 1YEYA 3B4UA 4YHGA 2XSBA 4BEQA 1UWUA 3BARA 4AYSA 2JF6A 1UD3A 4PB3A 3GH4A 2CZDA 2A3EA 2A3HA 3EWBX 3WF2A 4LBUA 3MBFA 4QE5A 1IXOA 4C1NA 4JDYA 2Y4SA 1FWFC 2W6RA 2OWCA 3QYSA 4AVFA 3H4WA 4BQ4A 1L6SA 4LB4A 1W1ZA 1AW5A 2P88A 2NLIA 3LCWA 4CNPA 1F4HA 2HROA 1PCKA 3DYMA 1XLCA 2Z25A 2PCEA 2EG7A 4N2YA 5K9XA 4GRSA 1KFLA 3L0GA 3SW6A 4NF7A 1KM6A 3IWPA 3OB8A 5I0DA 3OZPA 3HPFA 4JFUA 3E12A 1XLDA 2R1MA 3H12A 2EXOA 1R3WA 4BJHA 1JJKA 2Z2BA 3MWAA 4CEUC 4ERIA 1JNEA 3S8HA 2C1HA 4NI8A 4GD0A 1W17A 1YQ2A 3KDNA 4KCVA 1UR0A 4NJJA 4I7UA 3CZLA 4F66A 2ZRZA 1XRSA 3CNYA 4IFRA 1OBAA 3WJYA 2RDTA 3CO8A 5AKQA 3RR4A 4GNVA 4ES4A 2J66A 3N34A 5HNTA 1JDFA 3QC0A 4Y90A 3FJ6A 3LPGA 5F4XA 4ATWA 4JNZA 1ZHAA 1XPGA 3WF3A 3DN5A 4DM1A 1EYEA 1K9DA 3ZZ1A 3IAPA 4EXBA 4K39A 4AEEA 4BK9A 3GTNA 2EGZA 3W07A 2WVUA 4JTGA 4HTBA 1ADDA 2PDNA 3VIFA 4GMEA 5E6ZA 3DG6A 1DTNA 3NOYA 1C92A 3GVRA 3BLDA 2FQIA 2FIQA 2I9UA 4QE1A 5T8GA 3W6YA 4HU4A 2CKRA 1PV8A 3MCOA 4G7EB 4ZQNA 3WDHA 4J3ZA 1TTQA 3VA8A 2PC4A 4IT1A 1BYAA 1NWSA 3AMDA 3LPOA 4XX6A 4H9MA 2DZXA 4MNMA 5HNUA 4X3ZA 4L5ZA 5HQEA 1ONEA 1W3IA 1Q65A 1S5MA 1YMYA 1J6PA 3FA4A 3U7BA 2PLJA 4C60A 1QASA 4KFNA 1AH3A 5FKYA 4B5WA 4D2JA 1QNQA 3NQ6A 3VNLA 2YCIX 5BRPA 7REQB 2RHGA 1F9CA 1OFBA 4ZQCA 1CXHA 3CHEA 3EDDA 3TTQA 1JXKA 4XD3A 3UZZA 1JQXA 3UW6A 3WQWA 4R9OA 2E7FA 3ARRA 2JEPA 3WLHA 1LRQA 1EA9C 5E09A 3R4IA 4FNQA 2O4QA 4HPHA 2I9EA 3KDOA 1DWIM 2CU0A 4FX6M 4JTLA 4FAMA 3B06A 2VFGA 5BYWA 1TV7A 3NO5A 1KC7A 4JTUA 2ZC1A 4Q8UA 1H5VA 5BU6A 3CASA 2EKCA 2HNEA 4FNPA 3LTSA 2GJPA 3QEZA 3S6DA 1M68A 3W27A 4RZ6A 1DJHA 1VPXA 1S2CA 5DT5A 4LYKA 2QV5A 3TR9A 1CTNA 2Q02A 3UWQA 4C6FA 3ZWTA 3NCOA 3ABSA 3MB9A 3EWWA 1JPIA 2GFTA 3GIPA 4ZOCA 1ZALA 5M5DA 4A21A 3P8IA 1MFUA 3G1HA 2W91A 1Q6EA 3C8NA 5HBFA 4EVZA 1HJVA 4WJEA 1OY0A 1YPXA 3PPCA 4MIMA 4QEHA 5IXEA 1AD4A 4FOJA 3QV8A 1TA3A 2PRLA 5C2CA 3CUIA 4PCNA 3AXHA 3TWAA 2PP1A 1CBGA 1WKFA 3W84A 3ZS4A 4DEFA 1L8PA 2IW0A 5E6YA 1J6OA 2YJQA 3PZQA 4PULA 4JIHA 4GK8A 6ALDA 4JTJA 3R0UA 2A2IA 4S3AA 4ZZ9A 4XO7A 4XZ9A 1LROA 4DI8A 3ZLHA 3IIXA 1TJ1A 4AH7A 4LAMA 5CG0A 3ARZA 2V2DA 1CGYA 3T6CA 4C6PA 4XKMA 1Q8AA 4K68A 3LXBA 5LKYA 2A4AA 4MJMA 1RBLA 4JTIA 4JCLA 5AYIA 2DW6A 1O1HA 4J2MA 4JNYA 3UZYA 4LB3A 4LYRA 5DT7A 5I78A 1PWLA 2DJXA 3KRSA 2DT3A 1TMQA 1YW1A 2J62A 1VPQA 1FUYA 3QYQA 9XIAA 3L67A 2YLLA 5TBOA 2EPMX 1B2YA 1UJQA 3BW4A 3IJ8A 4IG2A 3NL6A 1MYRA 3RU6A 1EYWA 4H9ZA 3UWWA 2Y8UA 4NZJA 1NM9A 3MU7A 3FN9A 1J0JA 2VKZG 4L4MA 4XTDA 3IVSA 2C8NA 3B9OA 1E6RA 3ZLGA 5IM51 3H7RA 1TE6A 3GH5A 5IOBA 1XQKA 4TVUA 3L0KA 1BQGA 1THFD 4AU0A 2QCLA 3P81A 1JDAA 3KL3A 1UR3M 4H6RA 3L2LA 4LEFA 2J9YA 1IXPA 3UJRA 3IGXA 4IHCA 1TVPA 3EA2A 5FIPA 1UR4A 2C0AA 2W67A 4DWSA 3WMSA 1IHIA 4M80A 3ABZA 1H7NA 3WLMA 1Q7MA 3AIBA 3SCOA 5ECUA 4AZIA 2QCFA 2P5NA 3DHFA 4W8BA 1LOQA 4Y9PA 4H3DA 4K38A 1UPPA 5BU9A 3VXGA 2FGLA 1O4UA 3MCNA 1OG0A 3NSXA 2WHJA 3M7SA 2VTFA 3P80A 4B4FA 2NSXA 5I3FA 1D7FA 2A7PA 3E5PA 2V0TA 3VX0A 1FWEC 3UESA 5I02A 4OU1A 3FHQA 3B97A 2XH0A 3BLOA 3Q58A 1TMLA 1FFQA 4A3YA 3EWCA 1LWHA 3M07A 4YCPA 4HA3A 4PZVA 3CHDA 1W54A 3C86A 4BA0A 4PUWA 2Y88A 2GVYA 1RALA 2H3DA 3SAZA 5FF4A 1LL4A 3CWHA 3UG3A 3W7RA 2OGJA 1G01A 1MUCA 4WDTA 3I3EA 4TO8A 1XLBA 4FZIA 1OT1A 3CH9A 1NF7A 2UY3A 2DY3A 4FA3A 4FEZA 2GOKA 2XM2A 1W5NA 1EJWC 1EDTA 4HPJA 1OYBA 3E1F1 3N12A 5I3JA 1EO7A 1H7RA 1U5HA 4G5DA 4PA8A 1GPFA 5CGQA 1OCBA 4YLWA 2YLAA 3WBAA 3M6DA 1E56A 3W2LA 4CUCA 1UOKA 1PEZA 3AI0A 5CPMA 3MUAA 1XJBA 1WV2A 3NQFA 3ISIX 2ESCA 3QY8A 3BSMA 4D6FA 4B5UA 1E0WA 4PB4A 4RW5A 2L5HA 1A3XA 2VO5A 3NZQA 4EKJA 3DZ1A 2TYSA 2D3LA 1A5NC 3DFHA 4MZ1A 1CXIA 1T8QA 3T09A 1E0XA 4JAWA 1E70M 4DZHA 1RSCA 2Z4GA 1JZ6A 3PNUA 3E02A 4CQ8A 2WSRA 3CUJA 3B0VC 1XIHA 1W37A 4CLMA 5A2AA 3R7MA 3U5YA 3HA1A 2ZC8A 5A6SA 4AZ5A 3LQGA 3HFTA 1BYDA 4DVOA 3AXMA 5TAOA 2WC4A 1KGUA 2X2YA 4O1BA 1OSEA 2FTWA 4E4UA 1DEDA 1OVDA 1XD0A 4DLFA 3V35A 3W1PA 2GJLA 1W3JA 1MUMA 3GBDA 3N6QA 5FJJA 4WJ8A 1OG6A 3DI0A 1Z6KA 1Y65A 3BV7A 1AW2A 3TMLA 3M5ZA 4C6BA 5D32A 1BF6A 1Q6RA 4PMVA 4BQ2A 1YXYA 2HK0A 3UYCA 3FJ4A 4L9ZA 1OYCA 2NW0A 4ZSUA 4C7DA 3N2MA 5HULA 2O9RA 4HK6A 4Z1CA 1GZGA 4UTUA 5IFTA 1L6YA 2JE8A 4BWLA 2O0TA 1XR2A 1RCOB 2CLPA 4QGCA 4KH2A 4AIBA 5A6KA 4PMOA 3EX4A 3HMCA 2PGFA 3VTRA 4POCA 2TODA 3NM1A 4E8CA 5CXPA 2VDIA 5E0KA 2UV8G 2VJXA 3C0QA 4JZ5A 1PKNA 1VRXA 1DHKA 3FA3A 2CZFA 2BZNA 2X7VA 3KRZA 2Y7EA 4FF5A 5A6BD 2VRJA 1V0MA 5CBJA 2PF0A 5TF0A 2E28A 4ATLA 4CCEA 4IX0A 3VDAA 1PZ0A 3BSGA 3VGFA 1B3WA 4W7UA 1UWQA 1TPC1 5HNRA 3WLRA 2WOQA 1OX4A 4H6QA 3LBMA 1UUOA 1ZQ5A 2JBMA 2R9RA 1HQTA 1BVNP 3UY7A 3W85A 4JQ3A 4EXQA 5LIYX 4NKCA 3S42A 4JHZA 4DZIA 2QCHA 2F7FA 1AA1B 3AZRA 3M43A 1MXDA 3WF4A 1E71M 3QQ1A 3C2EA 3GC2A 3NL3A 3VMPA 2VD9A 2XIIA 3RUBL 4KBXA 2F9RA 2Y89A 2D1ZA 5DRIA 1E6PA 4N0RA 3NTYA 1ZJHA 3TE9A 3ITCA 5IFPA 3DI1A 2WJDA 3GSMA 5KZ6A 1FA2A 3UWVA 1CEOA 3S1VA 4HNUA 3LK6A 1JF6A 4EE9A 2Q09A 4HN4A 3GVVA 2ZICA 2VI0A 3BK0A 1TWSA 3KCLA 1OZQA 2P10A 4DUXA 1FWAC 3IK4A 3ALGA 2NV9A 5LNRA 1H60A 2Y62A 4J3TA 1VZWA 3S2MA 1XGDA 3FA5A 4Z2KA 3Q65A 4EAMA 5T91A 4PBGA 3P2VA 3TNOA 1YYAA 2WAGA 3UR2A 3WNMA 3W6LA 1TPH1 1JCYA 3L2MA 4G56A 1JYNA 4XB3A 1JUKA 3DHUA 3CS2A 3PZGA 2X0SA 3F5LA 3RM4A 2OKOA 5HMSA 1S2WA 4ZGYA 1F8IA 3L9CA 3GDMA 3ZJ8A 2Q8LA 1GW1A 4KT2A 5FACA 3IGHX 4DQWA 3VOHA 4KMQA 4GPNA 2IKJA 2AGKA 2R94A 7TIMA 1KWKA 4GI4A 1UR9A 3GUWA 3E2QA 4Q7NA 2BHZA 4GGBA 1UCWA 4L6DA 4RZBA 5KETA 1H4PA 1JRBA 2AQWA 5E93A 1VHNA 4OIFA 1RAKA 2Y5SA 3CLWA 1WZAA 4MY1A 3NL2A 3GR4A 1TPFA 5EA9A 3JZUA 1S1RA 2CCRA 2A7NA 4GGHA 4AMAA 4XIAA 2QPSA 3LPFA 4KFPA 1CIUA 3GTXA 3MC5A 4MWAE 4UFIA 3AXIA 3MO4A 1GQJA 3TLQA 5D30A 2VGBA 3EB4A 3RGTA 5FF2A 2CETA 3AYVA 4UMCA 3UVAA 1FH7A 2VFFA 1TO3A 4F0KA 4LY8A 1XH0A 2POZA 2VRQA 3W22A 1G6CA 2Z1VA 3FEQA 3QHOA 2OKTA 5J5DA 3CQKA 5DMNA 3IJIA 3N6HA 4FSAA 4DX3A 3WLQA 1PZ1A 3L68A 5G1TA 4M6QA 4JR5A 1R3QA 4IQDA 4Z42C 4AC7C 5I3DA 4DJFA 2NQLA 4S39A 3K8MA 3W24A 1MFVA 1QWKA 3WLLA 3SB0A 5CQ1A 4PUEA 3R0KA 1R3YA 5JU6A 3PZNA 2VWSA 2YR1A 2CFFA 1AG1O 3T44A 1LQ2A 3MANA 2XGBA 5H2ZA 1XIBA 1E43A 1D3GA 3VIIA 4AC1X 2QJMA 4CQ9A 1SZFA 4O8AA 4ZTXA 2V68A 2DJLA 4W93A 3A4AA 4NZ1A 3O0KA 5LGXA 1RP9A 3BCDA 4HN8A 2B4GA 3LI0A 3T2PA 1B4KA 1HGYA 1NEYA 1W5PA 3ZVHA 2CWXA 2E6YA 5AYXA 3DX5A 1OT2A 4MKVA 5DCEA 1X1NA 3D6NA 3BANA 5FCZA 1V0KA 1WAWA 5C9XA 3GVQA 3I7QA 4QFUA 2O92A 3VIPA 2WANA 1GQNA 2ZADA 5AHMA 1B4EA 3OQ8A 2NVAA 4L56A 3MO7A 2YXXA 3C2FA 5U4NA 3N2XA 3WH8A 5LSMA 3OZOA 3OGRA 4LSBA 1EC8A 4IPIA 4FK9A 3BURA 1DQXA 1HKKA 2UBPC 4HJWA 1OJXA 3GXDA 3OBAA 4M29A 4LS0A 5JQ9A 4A3RA 4IP4A 4UTHA 1HX0A 4WK9A 1XIJA 3M0VA 1OF8A 3HQNA 3AMLA 3ITGA 4AD1A 1KFKA 1TELA 1RJQA 4CD8A 2C13A 4WQ6A 1F6PA 1MQRA 2W4XA 3CIVA 1XL9A 1X96A 4LUJA 1BPLB 4QIUA 1DIOA 3P74A 3RM8A 2OO0A 2QZRA 3A9IA 3I6EA 2WQPA 2BFGA 3ITTA 1EWDA 4A8LA 2BOEX 4ZO7A 2V3DA 2ODOA 1S2TA 3EPOA 4H8HA 1NOUA 3LCXA 4NZFA 3WNLA 2OSXA 4LAUA 1XFBA 4UNLA 3SBFA 4L61A 3K30A 5C70A 2X1IA 2QUUA 1XKJA 3EX1A 1L6GA 4C65A 1TRDA 3MDUA 1ML1A 3WDQA 1SM9A 4PMYA 2BVWA 3TSMA 3VILA 3OHIA 3RXZA 4B2DD 5D37A 4HHLA 4D6GA 1NOFA 2ZUVA 3QXBA 1JI2A 1XGEA 1WX0A 3QGAC 2FTYA 1BG9A 1PYFA 3KRUA 1JGIA 4PUJA 4RR4A 1VPYA 5JH1A 5DXXA 4IXXA 3ZR4A 5DMLA 4XVDA 4GKLA 1YHTA 2HVNA 3TFCA 2VEMA 3DFYA 4KWVA 3FVMA 3BTNA 3W0KA 1XBXA 5CJNA 4RLIA 4K3ZA 1FHUA 4GZJA 3MT1A 4AEFA 2QGYA 3V7PA 1R3SA 4FR1A 4GG9A 1OFPA 3GD6A 2JALA 2XIQA 3LG3A 1ZNNA 4UQCA 4MNLA 3WKZA 1IE7C 3URNA 3E2RA 2IPJA 1TFVA 1RZMA 1H3GA 5KTLA 4FNTA 4YTSA 4MNJA 4JIRA 4PRWA 3ZFHA 3ATYA 1UQZA 3SGUA 3GC4A 4R88A 2D22A 1KLZA 4ZOEA 4DIAA 4PR4A 1HL9A 1PAMA 2AAAA 1OK4A 2WJFA 1H61A 2CKSA 5EPDA 4HPXA 1R30A 2W3ZA 2Y7DA 3USBA 1JAKA 2RDUA 3JRKA 1TMHA 5LIKX 3TOYA 4GI6A 4REQB 1EPXA 1IR2A 3WEOA 1RJPA 2PLMA 3OBEA 4QDPA 3I68A 2QIIA 3W7IA 2TSYA 2I14A 3W26A 2DZUA 3EXSA 4XISA 3W86A 4B16A 3C6CA 2VD8A 4KWUA 4MDPA 3Q45A 4LANA 2CESA 2VCCA 1WNOA 1ITCA 4O14A 3GW3A 1BVWA 2EJAA 1H49A 1V03A 1R3RA 3DEQA 1QBAA 3LGEA 1CGVA 3UXLA 3H6OA 5I6SA 2WPBA 1I1WA 4DYEA 3I3BA 3EOUA 3IV3A 4EX4A 4HTYA 1SMAA 4O0ZA 2OU4A 4B9ZA 2XIOA 3HG5A 3OZYA 4DLMA 1H1NA 2FPVA 3CV6A 5EL1A 2VZSA 2FMNA 3W9ZA 3K8KA 1DXFA 1LOSA 3TTYA 4E8GA 2PA6A 2GYIA 4AHQA 5AYBA 3W73A 1D3CA 2YW3A 2Z1WA 3N3TA 4EANA 2BLEA 5BXTA 1VHCA 3CTLA 4NX0A 2QDGA 4HZMA 5I3KA 3CZJA 3N4EA 1NIUA 4GZIA 1LZOA 4JY9A 5A8OA 4H2HA 2XN1A 1KBJA 4DO5A 2Q8XA 2QW5A 4XKYA 3RF9A 1UIOA 2VZVA 2E09A 2QUTA 1G7VA 3P0XA 3Q37A 1T96A 4X60A 1XBVA 3AJ7A 2J9ZA 3T2QA 1MDRA 1EIBA 2OLHA 5A2BA 4X9SA 1P0KA 3AIWA 1LOLA 1U1UA 4PTNA 3TJXA 4K6AA 2XVNA 1SO6A 4GACA 1ZAHA 5LXXA 4ADSA 2PP0A 2V69A 3P3BA 4WY0B 2V5CA 4F2TA 3TKFA 1JFHA 4Y9OA 4GIYA 1LRTA 2E68A 1U33A 1FDJA 3IIVA 3VFLA 4GINA 4QJ5B 4DXKA 2GJXA 1Y7VA 3RO8A 4FNUA 1F8MA 2Z1SA 2XGZA 1TJ2A 2Y85A 3STFA 4X63A 1YTKA 3I65A 3TW9A 3ZT5A 1I60A 3GDBA 4DZ5A 1VFLA 7A3HA 3F1QA 2YSWA 4FF7A 3M47A 3KBVA 3SRDA 4JTTA 4Q32A 1ZUAX 1FWIC 3CWNA 2Q01A 1W3KA 2R14A 3N13A 1O68A 2ISDA 2YW4A 4DJED 1H09A 3VOFA 1HVQA 5DN1A 4IPNB 2HSAA 2OSWA 4JDBA 1EBGA 5CSSA 2BXZA 5C55A 4ZTYA 2QJHA 3IVTA 3T81A 2BS9A 2QQ6A 2PDQA 3C0JA 3WK1A 3LYEA 2VFIA 2OZTA 5BMWA 1C7TA 2NVDA 1WZKA 2UZ9A 1V77A 1ZRQA 5CSUA 5CPNA 3DGRA 1VEOA 3SDOA 4U3CA 3BSHA 1AQHA 4GBUA 3VI2A 4Q3MA 1HN1A 1FP9A 5LHFA 4GVGA 1HT6A 1EF3A 1NWTA 1KFJA 5AHEA 2F8QA 4K1WA 3ZR6A 4MPKA 1QOPA 1EQCA 1MSSA 1NJJA 2FMOA 4FXFA 2W9MA 4YWSA 3ENLA 4QCEA 4N4PA 4AWUA 3KBWA 5I09A 1QO5A 2EPNA 1J0YA 3U3HA 2Y5JA 1RK5A 3MY9A 4DUVA 1LG1A 1VJSA 5ABFA 3EA1A 2PAJA 4PEEA 2DEPA 2VZUA 4V1YA 5LYRA 1OYAA 4OECA 3RG6A 4LUYA 4IL0A 3GFYA 3LHWA 5D05A 2E9MA 4G6CA 5CZTA 3WLTA 4YMZA 4KRUA 4DPPA 4C6OA 3O1NA 4HNNA 4UQAA 4IPJA 1HP5A 3A13A 5DANA 1W1B1 4PODA 2YXOA 4D71A 3NWRA 4YTTA 3NNTA 4AHOA 4YVPA 1D7KA 1D2KA 3O15A 5E9XA 1MXGA 5AHIA 4UTJA 2OGYA 2QF8A 3IS4A 5HMDA 1YE4A 4Q8WA 3H2CA 4GFIA 4JFVA 3BQ6A 3BJSA 3Q94A 3BL3A 1MEIA 1SZEA 4QQUA 3W7GA 3FJLA 3DXIA 1MI3A 3CJPA 3A5VA 3VKBA 3TNBA 3VGEA 2ZXBA 1G7UA 3B8DA 1R47A 1UH3A 3OJGA 1I2PA 4K7VA 3E49A 2XZ7A 4H8VA 4Q4KA 3M9YA 3FVDA 1JZ2A 5LIXX 1FHVA 3UJEA 5GNYA 3MTWA 3U0HA 4PCSA 4TMBA 3N4FA 1MW1A 1H63A 3FNDA 2IKHA 6CGTA 3GAYA 3QOKA 1M7PA 4ZQOA 2XSAA 3L7RA 3GO2A 3W7EA 1GJPA 4JXCA 3W74A 2CBVA 4IJRA 1PBGA 5JXQA 1AJ2A 1U22A 4IZGA 2JEQA 2BB0A 2VURA 4JX5A 4K8GA 3PWGA 1WA3A 4JTEA 3W4RA 3B9AA 3GFXA 2PB1A 1V4YA 5DRCA 2VQUA 4EPBC 5HQLA 5AC4A 3VZXA 8CGTA 4H7CA 4M7TA 2OWWA 2VUNA 3WJZA 4QNEA 4E4FA 4LBSA 3QPEA 1A5UA 1W31A 3KTXA 1OABA 3ABOA 1BYBA 4G1KA 2YL8A 4AZBA 3O3RA 4N02A 2PLCA 2FVKA 4FX7A 4UBPC 1J11A 5A94A 1IEQA 1W5OA 1LM1A 1AMKA 1DJXA 1IZJA 3AOFA 3KBNA 4TTUA 3GR7A 7CGTA 1DE6A 3VKAA 3NQ7A 3E9AA 1PKMA 1LLZA 1F7BA 2X1UA 4C7FA 1BLIA 3CBWA 3MI6A 3JS3A 1IGWA 2C7FA 5MF5A 1V3JA 3W1TA 1CB2A 2GJNA 4O17A 3T8LA 3AS1A 4S3CA 3OVPA 5F2MA 4QG9A 2PODA 3BH4A 4MKNA 1QRQA 1ZZMA 3KVKA 2W63A 2W27A 4Q4MA 4S3DA 2VEKA 5G4HC 2VZTA 1GHSA 3L0NA 4F0SA 5F2LA 1PUDA 1SZRA 2X2GA 2R1LA 2QMJA 2BGSA 2UWFA 4OOUA 3KEHA 1ELSA 4XSLA 2ZVRA 1ESWA 5G5IA 2Z1BA 3OZMA 1MW3A 1K7XA 3W3OA 4D8AA 1ISVA 2VX5A 1CXEA 2ALDA 2VC5A 4NSBA 1F3EA 1K1DA 1GKPA 5C7HA 1QAPA 3EAUA 3VDCA 1FXPA 4OWGA 1W3HA 2D20A 4DF2A 3RPDA 3HN3A 1V6YA 5RUBA 4B5SA 2XIMA 1CI1A 3CZGA 4V2XA 4H01A 5KZMA 2X0YA 1B3XA 4EK7A 3W7HA 3LU2A 1TPB1 3WY1A 4LH8A 3QHMA 1FWCC 3TZNA 5A5WA 1E1EA 4YU1A 3SO7A 2CNCA 4LALA 4WVXA 2XVKA 3MVIA 4G8TA 4AD3A 1BHGA 4ZFMA 4ZQPA 4TOQA 2GQ3A 3BLKA 4JN7A 1J79A 3LPPA 1AJ0A 1K70A 2EG6A 2CC0A 3GU2A 3N2OA 3W6MA 4GISA 2VEGA 1K9FA 2AL2B 2CHNA 3AZSA 1QW9A 4YS1A 4KW2A 5AFDA 1SSDA 1ICSA 2NSOA 2PDBA 1TG7A 1O7AA 3M0JA 3VUSA 5HNNA 3UETA 2JGYA 4Y2WA 5D9PA 3V75A 4E0CA 5D8ZA 3OVGA 1V6XA 3QPYA 4J4KA 3W72A 3PNZA 4L4OA 3EA3A 1FWDC 2QPUA 3OG2A 3NYZA 4MLJA 4FLOA 2NUYA 2OWXA 3MMWA 4PFMA 4PSRA 1J0KA 2YA0A 1M7XA 1GOXA 1UYQA 4GO8A 4H9XA 4A3HA 5JMUA 2NLYA 2DZBA 3WIJA 3SCPA 1EP3A 2VCBA 4OVXA 1BYCA 2ISWA 4UR8A 2ICSA 1TZ7A 3RJXA 4GNJA 3W00A 4E2OA 3VIHA 1W56A 4GJIA 1VGAA 3VOGA 2WZIA 8A3HA 2YYTA 1S38A 4LX4A 3NUKA 1ISZA 4NUWA 3TVAA 3BAKA 1NF0A 3LN3A 3SY8A 5C0QA 1XCFA 3MV11 3URBA 3TYUA 1EDGA 4AY7A 2WPGA 1CECA 4K8EA 1LLOA 2DPEA 1UROA 1XYLA 1AL8A 3L66A 4NAEA 1ZAJA 1OX4B 4GQRA 4UFMA 5A69A 4IIEA 1Z32X 3T0DA 3II1A 1KGWA 3NR0A 1L8NA 1A5AA 4BKNA 1RA0A 3GG0A 4DBDA 1GOOA 3KP0A 1GQKA 5H8PA 1F2JA 4DBSA 3GZAA 3WBXA 4JYDA 4KESA 1WDSA 1N55A 4MB1A 4BS0A 1PZ2A 4H9YA 3LEPA 4Y8EA 3F2DA 1V6TA 2G37A 3DHDA 3FXYA 3N73A 3O05A 2V5KA 3LHVA 3CZEA 1WBHA 1O5KA 3NDZA 4N4QA 3WDIA 4JQ4A 3TR2A 2J79A 1RY8A 1J8VA 2PUZA 3KE0A 3U2EA 2QJNA 4PC8A 5BW6A 1EXPA 3QSRA 1ONWA 2H8XA 5IBXC 4P7NA 1HJSA 3WQOA 3RRAA 2ZZ7A 4E6MA 3W82A 4NI3A 3H21A 4V33A 2GGEA 4R34A 2FDSA 5C8BB 1AL7A 4IISA 4E5TA 3WEMA 4HU3A 1RLDA 1YDYA 4OQVA 2J75A 1T41A 3NFUA 1FBAA 2OLAA 2VX7A 1XCWA 3QY6A 4LNYA 1A5MC 4GZ7A 4R7OA 1W9XA 4BI6A 4CVUA 1KM5A 4OGZA 3KZPA 4QAIA 3GYCA 1W1A1 4NRSA 4B2DA 1K7EA 2C3ZA 3MP5A 1R7OA 2RGLA 3ZLFA 4WJXA 1A80A 4XD6A 4ZEPA 3FYPA 3UCQA 1S5VA 1SW3A 4JKMA 4HYWA 3NXFA 1N2VA 2YBUA 1P6CA 2BWGA 5FJRA 1S2VA 3WQCA 2QCGA 2P8CA 3QLLA 4HU0A 4A2SA 3ZVIA 1JRCA 4CNUA 4BQ5A 4ECLA 1HL2A 3V16A 1J10A 2J9XA 1L6FA 3WCZA 2DSUA 3RU8X 4W88A 1X7FA 4AY8A 2Q3OA 1N7KA 2YDAA 2FB3A 1JEZA 3RAOA 3QRHA 1PKLA 2OELA 4LTSA 5ABEA 3VKCA 4P7QA 3N6JA 3SM0A 1A3WA 4ZCWA 1M53A 3N2TA 4RZ4A 4GYKA 4MOZA 1VJIA 4LW7A 2WMFA 4NNCA 1H7WA 4RDZA 1P6BA 1E1CA 3SUUA 4AISA 1B90A 1E40A 3L5LA 4B3ZA 4YTQA 3VOJA 3DOPA 2J27A 2PSNA 3FDKA 1CPUA 4JN6A 1M5WA 3AU2A 1P5BA 3VD3A 4US6A 3VDHA 3A3HA 4JIEA 4N9EA 2PDMA 4R7JA 2QGHA 1GZJA 4RXFA 4JOMA 4LS2A 3UA3A 3WD2A 4O4VA 2QULA 2QCMA 3THDA 3PJTA 4RNIA 1UKTA 5ABHA 5F1UA 2GDUA 1DV7A 3U6WA 3GTIA 4WZHA 2VENA 3GYEA 3WQFA 3ZVHB 4LVDA 4Q4QA 1HKMA 2A85A 1A3HA 4JTRA 3KWXA 4QLJA 3H70A 2WHKA 4D1JA 3W53A 2PMQA 5B7YA 3EEGA 1TPEA 3TU9A 2NQ9A 2E67A 3OPSA 4RPQA 1YNQA 2B0MA 4AZ6A 1C8YA 4U5KA 2HK1A 2OODA 4QDMA 2Y70A 1P6WA 5CLWA 3IACA 2ZUNA 4YJ5A 4BZYA 2JFEX 3KVLA 1ZPTA 2YDRA 4DRSA 4V28A 3WNNA 4HCDA 4KEMA 2DZAA 1A5KC 5CZJA 4KIEA 1EB3A 1UZDA 2HPIA 2WZHA 1B31A 2Z28A 1J4EA 5DMYA 5IDIA 1SU5A 3ZO9A 2WZTA 4A4AA 1QOXA 2G5WA 1B3YA 3W1RA 4R27A 5G1YA 1VIWA 2C91A 3LTYA 4UNIA 1RQHA 2DSWA 3WH7A 4JL2A 4J7RA 3N4AA 3M0IA 3G1SA 2CYGA 2GUYA 2YDQA 3ALFA 4DHGA 1W1VA 3MSGA 1HJUA 1QNVA 1VFHA 2V3FA 2CPUA 2WMHA 3FEMA 2EPKX 1LT7A 1UUQA 4GYJA 1W0MA 3WL0A 3W37A 2V63A 7ODCA 3DU0A 3LS9A 5E5CA 3SCQA 3U9IA 3MKCA 1A4LA 3HV9A 3HZ3A 4KRZA 2WNQA 3SCWA 2PDJA 3ANYA 1E9IA 1SVDA 1TYGA 1I8JA 4YVXA 4GJJA 3N15A 1UWRA 2NX1A 1XP3A 3NURA 3BOXA 3SUSA 4DB7A 3QZEA 3S2CA 4H7VA 3LSCA 2P1FA 1HKIA 4TUFA 3CIXA 1J93A 3NQ8A 1TUXA 1ISWA 4QS5A 1DPMA 2YCEA 1OC6A 3VCNA 4M24A 9XIMA 2W92A 3MUXA 4M8UA 1BWLA 3W38A 4ZR8A 4QP0A 4Q8OA 5XINA 2VVNA 4DELA 2X1TA 4DJEA 3EEZA 1XISA 1XXXA 1PTDA 3REQA 2V30A 2XIJA 1MZHA 5BWFA 1PO9A 1RCQA 4DWSD 1C7SA 5FI8A 3AHVA 1VIZA 4AHPA 3LHUA 1KR0A 3CMJA 3EWDA 2PI6A 3UT0A 2NWRA 5DELA 4X2RA 4K37A 4YYFA 3EWZA 1FWHC 2WBKA 1UD2A 3EKLA 4G1NA 1DWAM 4JBRA 2ZIDA 2YDSA 4KERA 1RJRA 3T4CA 2ZCGA 5DY3A 2VOTA 3PTQA 7PTDA 4PRTA 3QV7A 3DCPA 2JIEA 4U28A 4FNSA 1F3WA 1GYLA 1X1ZA 3PJXA 4DF0A 1HF6A 1XICA 4KEZA 1TTJA 5AECA 4UTMA 3EWUA 4H6EA 1TV2A 4AZGA 3FAWA 4MB4A 2YKKA 4WD0A 4KEUA 1X7IA 4RDVA 5EMKA 3DENA 4RE3A 5F4WA 2FPYA 2HBXA 4JPGA 4QITA 1PX3A 1KLYA 2Y61A 2FJKA 2A6LA 4KWOA 2GUUA 4IPLA 4MFEA 2RJHA 4QRNA 4GKTA 3TFXA 3F2CA 2VWTA 3WQ8A 4X0VA 3S6TA 1NWRA 4HHMA 4Q8NA 2AAMA 1XRFA 4HD5A 1WKDA 3B8IA 1EEXA 1V02A 2VM8A 4GC3A 2V5JA 1UH2A 4H4IA 4NIRA 3TQ0A 1VFFA 3M0KA 4S2CA 1KBLA 3CM4A 5B7ZA 2X0HA 5HANA 2PDXA 2VEFA 4GY0A 1LJYA 2PEVA 3NAVA 1JZ4A 1IEVA 3RR1A 1D8CA 1LUCB 3T40A 2R1NA 2CIPA 3WQPA 3CPRA 5KZDA 4C6DA 3TXZA 4Q4OA 4W87A 1Q2RA 2V8ZA 2WHMA 2CITA 3H54A 1JZ5A 3OQEA 4Q4SA 3OLDA 2PRHA 4K8HA 4DYKA 4HNVA 3P14A 1GYMA 1QI5A 4XKYB 4JTKA 1XS2A 1H62A 2QNEA 1ZFJA 5TNVA 3VMNA 2FVLA 2O9TA 2WMJA 4WKAA 2O7QA 1E72M 3EDKA 3GR8A 2HCVA 3C2VA 1OCQA 1W1YA 2ZRXA 3MUIA 1KWGA 4MJ4A 5BRBA 3VM7A 3H2OA 1EJUC 1JD7A 2ATMA 4KCTA 3TC3A 1H7OA 4MUPA 1B3OA 3C0LA 1PXGA 1NDYA 3ZJ6A 1KRMA 1C29A 1XSKA 3TIMA 3V5CA 5CEWA 5PTDA 3DC0A 3QLDA 4WSKA 3U4AA 1WZMA 5DLCA 1IYXA 1PIGA 2PTYA 3IARA 1Z89A 2BY1A 4PMQA 4FMVA 2IPGA 3UXIA 4N6EA 1XH2A 1HFBA 2GJXB 5MHBA 3MMDA 4WKHA 3WJWA 3V1PA 2BVDA 3OBKA 1XINA 2WV8A 1CXLA 5C71A 2GGIA 3RPMA 5I3IA 1W8SA 2NX9A 1ONXA 4QSHA 1JG9A 1DQUA 1QNSA 1I2RA 1X8CA 2WJEA 4O1FA 2DT2A 3UERA 4A6GA 4AG0A 3E0VA 4E8DA 3GXPA 5HUOA 1Z3NA 1XYBA 2G50A 2IMRA 1UMLA 4M19A 4PRRA 4Z2GA 2E4TA 3HGSA 1EGMA 2WJZA 4X22A 1RD5A 4C6LA 4DF1A 2DQXA 2X41A 2HXUA 1TJ0A 1EOKA 4FS9A 5FF7A 2Z2UA 2ZZ2A 4AD2A 2QCNA 1ODZA 4YVVA 4PTXA 3N18A 1B9ZA 1C8XA 4ZENA 5FL1A 2C1IA 3VZYA 4XAYA 2NQJA 5DQPA 4JEJA 5FA5A 3HJZA 2PE4A 5AZ1A 3IAQA 4W89A 3EPMA 2FZDA 3UZWA 4ZO9A 2OJPA 2Y5EA 3WFLA 2J77A 1KKRA 1TRIA 5JUVA 3SSZA 3ARQA 2OOGA 2WMKA 4MHBA 4LFYA 4ENLA 4ZSTA 4O18A 3T78A 2YB1A 1VH7A 4YN5A 3UD6A 3HG3A 1WPCA 1A47A 3K1GA 5ABFB 3PFRA 3KOFA 4UTTC 4HOXA 2EF9A 4O16A 3TN6A 4ORIA 3CYVA 4DXXA 3NQ2A 2FHCA 1CLXA 3W25A 1NVMA 1QU4A 1BXBA 3MKVA 3TZFA 3QY7A 4DBUA 3C8FA 4HNLA 1I45A 5BROA 4S3BA 4RCXA 3ITVA 3B8SA 4I9JA 1K4HA 1VP5A 5DY2A 2BY0A 2WNZA 1RR2A 4WDXA 5E70A 2ZZ5A 2E6FA 5AC6A 1SZNA 2DFAA 2OXNA 1Q3NA 4IWWA 4KGJA 1T99A 3M0LA 4Q6JA 3G1YA 5EU9A 5HA7A 4WF7A 1NDZA 3TH6A 3B40A 3W23A 1PVNA 4ICCX 3ID7A 1SQ7A 1FTXA 1L0PA 1SR0A 1MMFA 3ZWSA 3G1FA 1GOWA 1TTIA 3EWYA 4UCGA 3EWXA 1MQPA 2IS7A 3W83A 1TJRA 2Z1XA 4PFHA 3KOYA 1Q6CA 4JTAA 1FWWA 5LNSA 5BOOA 3BG5A 1CB7B 3BAYA 3VABA 1NWUA 4NJIA 3ECQA 1RV8A 3UVIA 3RX3A 1W5MA 4RW3A 2WMIA 5LZLA 2HTMA 4IGSA 1HZYA 1XC6A 3W2JA 2WO5A 2FYMA 2XH2A 3KRBA 4QHRA 2BNJA 2XFWA 3BXWA 3FGCA 1UKPA 5LNVA 4C91A 3DH7A 2WCSA 2GVEA 3OLIA 2J7EA 1E0TA 5DXYA 3ZSSA 3ABQA 3EPNA 4AIOA 3AIRA 3WLIA 4LOCA 2P3EA 4GIAA 2XZ9A 1X97A 1S39A 1MW2A 1HNYA 1FWJC 4NHVA 4DJDC 1JUEA 2PF8A 5CLTA 3TN4A 2WLYA 4IH3A 1HL8A 5A8MA 2VFDA 3D5HA 1T8XA 4GXMA 2ZUUA 3AISA 3NQAA 3IVUA 4AZHA 3NA8A 1QW7A 5LA0A 5FJUA 3VC6A 2WVVA 1QTWA 4B4HA 1W5QA 3B05A 3EMQA 5D2VA 4JD4A 1LCOA 1RD6A 1YIXA 4H8UA 4DJFD 1WP6A 1V7AA 4LAKA 6ENLA 5CCZA 4MYXA 1IEXA 3EX2A 3A64A 4JFWA 4ATDA 4TQTA 4LEQA 1RQEA 3TWBA 1W3TA 2JKPA 1XIMA 4RK8A 4ORMA 9RUBA 1TKKA 1TVLA 4PYSA 1J12A 2E9LA 3DFSA 4DPQA 3VCCA 3MSRA 3NQVA 4IIGA 5CC5A 1DWJM 3T55A 4IGNA 1EP2A 3EMZA 4I5RA 4B15A 4UTFA 3ONBA 5JH2A 4GC4A 3SJNA 5CPLA 1HG3A 3AIUA 1OC7A 1W3LA 1CW2A 1L2UA 3GXIA 4D6IA 1HXJA 3A24A 4AAJA 2OG9A 2NXGA 1NOWA 2RAGA 4ROPA 1JIBA 5CPQA 1FCVA 2O9OA 5CJ5A 3IIZA 2YFOA 4U3AA 5FSEC 1TCMA 4OKDA 5IBXA 1J0IA 1PIFA 2ANUA 4NZ5A 2CHRA 4HCHA 1EGZA 5U7SA 3GLCA 5FJIA 3AS2A 3FHAA 5E1QA 3NXLA 3LTPA 4F4RA 3NO3A 2F38A 3PM6A 3BGAA 1XLFA 4LF2A 2WXDM 1Q7QA 3WFAA 3APTA 3PG9A 1TZZA 1K77A 2WBGA 3T4WA 3TK7A 1R8LA 2WVSA 3CUGA 2X42A 1Z9AA 1M41A 1Z41A 3WG6A 1AK5A 1RA5A 1VLWA 5GNXA 1U83A 2WCGA 4M81A 4HVXA 4XBJA 1PX4A 3MMUA 1XH1A 3AHZA 1UBSA 4QJ4B 4BHYA 4Y8FA 3BLEA 1POJA 4QM1A 3LRKA 3AJXA 3OTRA 1H1YA 5C7VA 3MA8A 1EQPA 3UXKA 4JGDA 5K9CA 4DAFA 3CV7A 2CBUA 1Q5MA 5AY7A 2NT0A 1DXIA 2CW6A 2WYSA 2YYUA 4PBEA 1GEQA 1LDCA 1BFNA 3NQGA 2GK1A 1HVXA 1OC5A 4LF1A 1RHCA 5G4EA 1TIWA 5KMYA 4US5A 4X0NA 3WUGA 4WIWA 2XFYA 3TQPA 2YZ5A 3IGSA 2R8WA 3Q67A 1N82A 5LNUA 3QMSA 1RXOB 2J24A 4FLSA 4D9PA 3WLKX 3QPZA 2F6UA 2QT3A 1DIEA 4X61A 4GBDA 2ZZ3A 1P0BA 4ICMA 2Y6ZA 1KA9F 3STGA 2X30A 1ZBVA 5BZAA 3B03A 2XWEA 1Q6QA 3J7HA 1ZBCA 3G3MA 3PC0A 4L65A 3SCRA 1SZGA 3KWSA 3TYEA 4C6EA 2J88A 2GL5A 4OBSA 1VC4A 3PAJA 1BWVA 4C6CA 1K8YA 3FSUA 1UB3A 3KXQA 1ZAIA 3B04A 2FHFA 3S47A 5C5YA 5TD4A 4O4WA 1TQJA 3EZ4A 1SPQA 2QYGA 2VC9A 3JU2A 2Z27A 3CGTA 3WYZA 2E0PA 1X98A 1OM0A 3WMBA 5BOFA 3KBMA 3GVGA 4ZOAA 1AQ0A 1GW9A 1JCLA 4QQ3A 3LHZA 1GONA 4HHPA 1EZWA 3HGOA 4PTDA 1GPWA 3W1AA 2YCJA 4XD5A 4HT3A 4LRTA 3R8HA 1ZS2A 2PZNA 4IJCA 4IQJA 4OOZA 1VCFA 3BW2A 3T05A 1FVPA 2OVLA 2Z0IA 3CL7A 1HKWA 3QGKC 3A9BA 1WDQA 3CU2A 3UR7A 5MKGA 1Q6GA 5BNKA 1TPUA 4Z1DA 2I57A 1JPDX 1T6MA 4OV9A 5FJPA 5KINA 2C15A 4NAEB 1Q85A 3R8RA 5AVNA 2RUSA 5HR7A 5FAGA 4I8DA 5KSWA 5BXRA 1VAHA 4UTKA 4Z0SA 4W5ZA 4XG1A 1KGXA 2J7BA 3CQHA 2PTDA 3T0TA 1JZ7A 3WLNA 4W4QA 2Y63A 2JKEA 4MB5A 1OCNA 5BOEA 4WDUA 4NL1A 1EHAA 3O6DA 4RV8A 1MDLA 3CHFA 2JF7A 5G4WA 5CG7A 3EX6A 2HE5A 1CGTA 3W7OA 4H9UA 5HK4A 1K8ZA 3DESA 4YTRA 4DWDA 2E9BA 5GNZA 3OIHA 1EF2A 5LIWX 3T08A 4NP7A 1US2A 3CT7A 3A4XA 4D6CA 4WUIA 3ARWA 1A53A 5BXPA 5T9CE 3CZKA 3UY8A 1T0OA 4MY9A 1LQAA 2CXEA 1Q2SA 3E38A 3DERA 4HZ8A 2Y2WA 1GCYA 3QHNA 1UWAA 2IXVA 4IIHA 4YYCA 2YIHA 4WEVX 2R1KA 2G96A 4LVBA 2OYMA 4OBRA 3WD4A 2I5QA 2VDGA 1OGGA 2ZFAA 4X9YA 4UCFA 3E0IA 3W28A 4A3QA 3R5EA 3IUIA 4P7LA 1V6VA 3VIJA 3NG3A 3FW6A 3K8LA 4LPCA 3EYPA 4IMFA 4M6PA 1P7TA 1TZ9A 3AIVA 4GQQA 3H4XA 1EL3A 2I5GA 1G4SA 4H2CA 3MW7A 3U4FA 2FZ8A 1HJXA 3GNNA 2A3BA 5FF0A 2OX1A 1W9BM 3UNDA 2CZ5A 3WQDA 5CJMA 4JKLA 3SCTA 2QHAA 3MHFA 2PGRA 1B5TA 2JGQA 2E8YA 2NV2A