2ZZ3A

Covalent complex of orotidine monophosphate decarboxylase d70a mutant from m. thermoautotrophicus with 6-cyano-ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAAFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 85
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz3A00
2R8WA 1QCWA 1KFJA 1PL9A 2C6QA 1MZHA 3R2GA 4MY8A 3LGEA 4ALDA 2E09A 2WO5A 2C1HA 1PE1A 4JTUA 3BPWA 3LBMA 2WNZA 4MPQA 3GDMA 4CNPA 4RV8A 1R2RA 2C18A 2WPBA 3TXZA 1W54A 1EP1A 1G4EA 1OG0A 1TYGA 2J6XA 3STFA 2DJXA 3W1TA 1PIIA 3KVMA 3LBCA 3PWAA 2WSQA 1WBJA 2DZPA 1V5XA 1TTJA 1M7PA 1TIMA 3W2KA 3TCEA 1NF7A 4LRSA 4XKYB 1I45A 3S1WA 3IGXA 3R89A 3CPRA 2ZFAA 1B57A 1SO5A 5D03A 5EY5A 1PVNA 4IPIA 1JVNA 2ZZ3A 4R33A 1U83A 2H90A 4R53A 4XWUA 5ABTA 2B0MA 4XKYA 3TIMA 1OX5A 4Q4KA 1SO3A 4RK8A 5K7JA 1YLVA 2V2HA 5HUPA 2AQWA 1A50A 3LX9A 1U5JA 4UMBA 5KZMA 1QNVA 4WJEA 1K3UA 3NQFA 5K4XA 2J9YA 1JCMP 4NXKA 3W7QA 1T8XA 4N4QA 3NXFA 3ATYA 1SUXA 1H51A 2IQTA 4RZ5A 3EEGA 1KM3A 3L0NA 3RK8A 1W5MA 4JR5A 2TPSA 1XBYA 5G1TA 3UXAA 2WV8A 3HGSA 5SWUA 3NPVA 3A21A 4UTMA 3L0KA 2Y70A 1W56A 1KM6A 3TDFA 1DKWA 1QR7A 1FWNA 4LVBA 1YXCA 3PG9A 3IEBA 4YL2A 4EIVA 2C0AA 2YDAA 1W5NA 1H7NA 4OU1A 3G1DA 2ZRVA 4P2VA 4HPJA 2WSRA 4A22A 4PL2A 4K7YA 2A1YA 5CSSA 4WOZA 4UTWC 3IRDA 3ATZA 1RQEA 4JIQA 1OFQA 5E93A 1DV7A 3DFTA 5K9DA 3EX3A 2Q8ZA 1KTNA 1R47A 5D30A 1OFOA 2ZZ4A 3VCRA 3QMTA 3MW7A 2FLIA 2GJNA 4RJEA 3E0IA 5AC8A 5K3VA 1QDSA 1Q45A 4Z1AA 1UUOA 2YW3A 3QW4B 1BKSA 2VFEA 5D38A 5HQEA 3TAOA 1SZFA 3TV8A 1O5XA 5FEPA 3MP5A 1MEIA 1VLIA 1QWGA 2DORA 3SECA 2NX3A 1DORA 2GQ8A 2EGZA 3EWYA 4QNEA 4MZYA 4BI5A 1QMLA 4POCA 2YFNA 2Y7DA 3M6YA 2CU0A 1TPVA 4HPXA 5KZEA 5G2WA 4QIUA 1A5BA 1SO6A 1K7EA 3NL6A 3TQ0A 2YCEA 5DY2A 5AYYA 2A5HA 2V82A 2CLOA 3OVQA 3STEA 3VFLA 1DQWA 1VLWA 3W71A 4UMAA 2HS6A 3M43A 3VNDA 2E77A 4GUHA 5K4ZA 3BW2A 1K7XA 2VFIA 3VI2A 3FFSA 1T99A 5G4WA 1SZNA 3LTPA 3G1YA 3NA8A 3GDLA 4IXXA 2RHGA 2PE4A 2CZ5A 5F1UA 1R2SA 4I9AA 3E12A 1O5KA 4LC8A 2A0NA 1X7FA 1K7FA 1VQTA 1LRNA 4H4IA 1OFEA 3FS2A 2YW4A 1QPNA 3S5ZA 1A5AA 4LC6A 2XN2A 2BWGA 3PULA 3BLIA 5CPMA 3FLUA 1BWLA 1RPXA 1LTDA 3KVJA 3M44A 5LHFA 3LI0A 3C4UA 1L6SA 3S42A 2YFOA 1JQXA 3P7YA 4AAJA 5E0KA 1WX0A 1O4UA 4Q33A 4UR7A 4HNTA 3HIJA 4CLMA 1H7RA 4MUZA 7TIMA 5LNUA 2EPHA 3NQGA 1SFJA 1O95A 3BO9A 3EXTA 3UWYA 2YYTA 2B7PA 4X22A 5I3GA 4O12A 3T7VA 3MHGA 1FXPA 2VFFA 3FA5A 4G1KA 1VPXA 3TFCA 1YXDA 3GNNA 3NQVA 3RF9A 3TSMA 3W70A 3W74A 2DJLA 4ZQNA 4IX2A 1YTEA 4NJGA 3I65A 4UTKA 2E1DA 1W5PA 3O15A 1UBSA 1AMKA 3UZ5A 1P4CA 4N9DA 2B7OA 3QFEA 1IXQA 1YTDA 4XZ9A 1ME8A 3FJ6A 1TPWA 1FCVA 2G5WA 1XDLA 2QDHA 3NM1A 4HNUA 3UWUA 5DN1A 1FWSA 5T26A 2QR6A 3MP3A 4I7WA 5AFDA 2D73A 3BG5A 3LXCA 4AWSA 1Q3NA 4JS3A 2VFHA 3ABOA 4FNSA 4UXDA 3W2MA 1AL8A 3G22A 3L21A 2XFWA 1CX9A 2ALDA 2EAWA 1SW3A 2RKXA 1TRDA 1GT8A 3MI3A 1TPC1 1VCFA 4RLIA 3CEPA 3NPWA 4NNCA 1GWJA 1DJNA 1P0NA 4OWGA 2VXNA 4D2JA 3S1UA 3HPSA 3DFQA 4HIBA 2NXHA 1ME9A 2RH9A 3G1FA 1FXQA 5D32A 4IQLA 1XI3A 3EXSA 4IMCA 1NF0A 5AHEA 3P67A 1OF6A 4Z08A 3TXVA 3WK1A 1W3NA 1Q6OA 4AF0A 4RKAA 3HPZA 3TR2A 1GEQA 4FIRA 3P84A 3F03K 4IMFA 3HJZA 4X3ZA 1QPRA 2J9XA 5LZLA 3BLEA 4NZFA 1R2TA 2V8ZA 1ZNNA 3AJXA 1KBIA 4DPPA 3BW3A 5TQLA 4IGHA 1JCLA 4IPJA 1NEYA 5EBUA 3W88A 1TSIA 5D2YA 1KM5A 3S5NA 1SO4A 3UY7A 3JR2A 3G8EA 2E6YA 3W7MA 1F05A 1GVFA 5FF2A 4OBTA 4WQ6A 5C2XA 2OJPA 4GWEA 3FOKA 1LRQA 2ZTKA 4NU7A 5FF7A 5F1VA 4GXMA 1LBFA 1C9DA 2FB3A 4IMGA 1I4NA 3KOFA 1FCUA 2CLHA 4HT3A 3U8GA 3W1NA 4BR1A 3CEUA 4IXHA 4MY1A 1ZHAA 3CHVA 3NL5A 5HWJA 1SU5A 2JBMA 3S0CA 1TPDA 3IIVA 5K9CA 1SZEA 3PUDA 2Z1BA 1J2WA 2G95A 3G0SA 4UMCA 5HINA 3B0VC 2NUXA 5FEZA 4O17A 4JY8A 1FDZA 4AWTA 1G4TA 2A6LA 1YYAA 1GOXA 2Y85A 5KITA 1B4KA 4O19A 3LXBA 5K2ZA 3WJSA 4JYFA 1LDCA 2JKPA 2ABAA 1H7XA 1H61A 3TNOA 4FIQA 5CGQA 3STGA 1XCFA 2QJIA 3QF0A 4LV4A 4ADSA 5G2IA 3LHVA 5U7SA 5MHBA 1H63A 4ZQMA 5F4SA 2Y61A 2W79A 1YDVA 2FTPA 1L9WA 2CZFA 5CKSA 3C61A 4AEOA 4DF2A 1JUEA 4OQVA 2CLLA 3TW7A 3TK7A 3LV5A 3B0PA 4UTJA 1AW5A 3EWBX 3NVTA 2X1RA 5CZSA 2H6RA 3PAJA 3TAKA 2ATSA 1AW1A 4NQ1A 4IOTA 4UR8A 5EPDA 4ICNA 4OHQA 5EL1A 3QZEA 3LCFA 4IX0A 5LHEA 4MLJA 3W72A 3QM3A 1ZAIA 1TJRA 1XC4A 1KV5A 5CZTA 3W2LA 4UFLA 2QCEA 4HNNA 3W1LA 5A8GA 3GDRA 4Y6GA 2DZXA 3E9AA 3C52A 1HO4A 2WNNA 4XTIA 4RCXA 3NQ8A 4M5PA 3ANYA 2O7SA 4JX6A 1E51A 3M1ZA 4XUGA 4FEZA 2JGQA 2RFGA 5D05A 3UY8A 4NJJA 3P82A 3NGJA 1FUYA 5K9XA 3IIOA 1SPQA 1PHQA 2Z6IA 3OVPA 1ML1A 2GVGA 1KM4A 3S6DA 4A2SA 2ZRXA 2PRLA 1TPFA 5I3FA 4JTTA 3UWZA 4N9EA 3W7LA 3SY5A 1GVRA 3L2IA 3P5YA 1ICPA 3KX6A 3Q37A 3LLDA 3B04A 2OMAA 1BTMA 1GQNA 3E02A 4FNTA 5AC7A 4S1FA 3LRMA 3DZ1A 4M6PA 4UC5A 3WJZA 3CTLA 3C6CA 3BW4A 3HF3A 3M47A 5CPLA 1N55A 3C3NA 4QNWA 3A24A 1OYAA 2Q3OA 5HJLA 4MZ8A 3MYOA 3W7OA 4A29A 1VZWA 3DHFA 3SZ8A 4PL1A 2NXGA 3TA6A 2BZNA 3L5LA 3MUXA 1IXOA 1JCJA 3DAQA 4YMZA 5LNRA 4O8RA 4UUIA 3W87A 3O63A 1TO3A 1PHWA 2CZDA 4ORIA 2BSLA 4GBUA 1VRDA 3W84A 1JQVA 3TSDA 1FWRA 2QDGA 2VC6A 3DFPA 1QFEA 1EB3A 2FDSA 3EX1A 5J5DA 2DZVA 3LHUA 3JS3A 4N9BA 1OX6A 3V1PA 1SW7A 5AHLA 4AHPA 3M5YA 1XL9A 2B7QA 1KTCA 1F74A 3PBWA 3MYPA 4IUOA 3QRHA 1Z48A 3W7HA 4UFJA 2ABBA 4TR9A 3NYZA 2TYSA 1TTQA 4NX0A 3FKRA 4TMCA 1SQ7A 3HG4A 2ATMA 1DVJA 8TIMA 3HB9A 3QH2A 5D33A 1AK5A 3LXAA 4O50A 3ABSA 4UCGA 5AYZA 1L2UA 5A5WA 3U6WA 4ADUA 1WOAA 3W2JA 1WQ5A 2NUYA 1J5TA 4E2BA 3WJWA 1ZAHA 1CW2A 2C16A 2ZZ1A 3NQMA 2AGKA 1FWTA 5DXYA 3STCA 1DHPA 3FIGA 4X2RA 3CC1A 4J9JA 2E6FA 3G18A 5CPOA 5AHNA 4A21A 2G97A 3E49A 1LYXA 3KFTA 1VJIA 1NAL1 4YXGA 2NXIA 3C2VA 1KFCA 1HG3A 4O4VA 1SW0A 4GRSA 1H7OA 4JTHA 3W1MA 5LNVA 4JEQA 4BF9A 4O1BA 1GG0A 1RZMA 2H3DA 3W1XA 3G3MA 4QAIA 2ZQ0A 3SW6A 3L5MA 4A3UA 3C8FA 3SJ3A 2VEKA 3S1XA 3W86A 2QCMA 1T0OA 3FEMA 3BLFA 3H55A 5C5YA 4EOUA 2EKCA 2FPTA 3C0JA 4FO4A 4Y9AA 3W73A 1B3OA 5J5RA 1KA9F 1SR9A 5I3KA 5AHIA 4TIMA 2ISVA 2H8ZA 3W76A 1TPB1 3GDTA 4BI6A 1LOLA 3HG2A 4ORMA 3MI2A 1TPUA 1WDWA 4RZ4A 5HUOA 2ZA2A 3DU0A 3QSRA 2E6DA 4FX8A 1X8FA 4PA8A 4GUGA 4UTHA 1EP3A 2NV1A 4AH7A 1KTBA 1KM0A 3LHZA 3NAVA 1EPXA 4DO4A 3GXTA 2GPTA 1Z44A 5CG7A 2I14A 4UFKA 3GR7A 4YWIA 2ZYFA 3M5XA 3TX9A 3OIXA 1X6UA 2V2DA 5AB3A 3EWUA 1Z41A 2YGYA 4OV9A 1P5BA 1TCDA 2QCLA 4XTDA 4NJKA 3DFNA 1W3IA 5BRBA 1M7OA 1OJXA 1W37A 2Y7GA 2CLFA 4ZZ9A 1K03A 3BG3A 4Y96A 3O8AA 2OX1A 1I2RA 3O1NA 4O28A 2E6AA 1JR1A 2J88A 1GVSA 5BMWA 2O7QA 4KKXA 4O10A 3THQA 1MO0A 1W0MA 3CIWA 3INPA 5DELA 4TO8A 1Q6LA 5AHMA 4P61A 4K39A 1JCYA 2BLEA 4KFNA 5TIMA 1RQHA 4I7UA 1TTIA 2A21A 2DP3A 3G24A 4JN6A 4EF8A 2V5BA 1K8YA 4JTKA 4UFMA 4GJ1A 2DZTA 3NDOA 1OK6A 5U4NA 2DZWA 1UASA 2VELA 3W23A 3NOEA 2P0OA 3N9RA 1L6YA 3FKKA 5D04C 3W22A 4FHAA 3W7KA 1D3GA 2J9ZA 1P0KA 1NSJA 5D37A 5KSWA 2XN0A 1EEPA 3FJLA 5D02A 3N3MA 4AMAA 4HHPA 4FX7A 4LW7A 3YPIA 1MEWA 1LCOA 4N6EA 2CLMA 3EX6A 4JDYA 4UTUA 2ZA1A 3KVKA 5IBXA 2ZZ2A 2I9EA 5GVJA 4FNPA 5BW6A 4B5NA 3O6YX 5CPNA 2OCZA 4FF7A 3NQ2A 3M5VA 1DJQA 2Y6ZA 3U2OA 3MO7A 3HGJA 1RD5A 1TTPA 3CB8A 4BWLA 1JULA 2VEMA 3N2XA 3GAYA 4MZ1A 3GXPA 3GAKA 1OFBA 3MI6A 1ALDA 5KMYA 3DGRA 2R14A 3SR7A 3M5ZA 3GIYA 4FNRA 4K6AA 2FQIA 1GTEA 4UIOA 2YYUA 3P60A 3LRLA 5D09A 2H8XA 4K7VA 3WJXA 2X16A 1WV2A 3UWVA 1WAUA 2X2GA 1OF8A 3TH6A 1VR6A 2WJZA 4LU0A 3IVUA 2P10A 2B4GA 1Z42A 4AHOA 1C8VA 2VEPA 4WY0F 3W9ZA 1W5OA 1T96A 3NQDA 1UB3A 1LBMA 3NR0A 3QMRA 3Q58A 2GUUA 3IIXA 3UNDA 5BOOA 3M41A 1W31A 1HTIA 4CNNA 3EKZA 4N2YA 4LS2A 4PCFA 3B0UX 4ADTA 3I7QA 2C19A 5LKYA 3TE9A 4AF0B 1H62A 3NZRA 5I3IA 2NLIA 3WK3A 1FQ0A 4O14A 4QJ1A 1JCXA 3EX2A 4OV4A 3L66A 4N9CA 3ABQA 1WBHA 5H91A 1H7PA 1LZOA 3LV6A 1ICSA 2QEZA 2C3ZA 4PH6A 3I7RA 2ISWA 3F4WA 3ZFHA 3PC0A 4OT7A 1O60A 3W75A 2B7NA 2TMDA 3TU9A 2A6NA 1GTHA 3CQ0A 3W1PA 2ZZ7A 3R13A 4QISA 1PS9A 3QEZA 4L4LA 4CNOA 3A9IA 5E1QA 3O16A 4XBSA 4PC8A 3O6DA 2Y89A 3OBKA 1H1ZA 4MVAA 3L67A 1GYNA 1EWEA 2WKJA 3W7NA 1SSDA 4L4MA 4MYAA 3W7JA 3W3OA 4OGZA 3IVTA 1RQBA 3GK0A 4NVTA 2NZLA 1ADOA 4JYEA 3VE9A 3ZWTA 2ZRZA 3GXNA 1EX5A 1MEHA 2FPYA 1ZALA 3KXQA 2QCCA 1WOBA 2YR1A 3QSTA 5DCEA 3KHJA 5DLCA 1VCGA 3QPYA 4IMDA 1DQXA 1D9EA 3H53A 1EA0A 3LHTA 5H2ZA 4R7JA 3JRKA 3PSWA 4LT9A 2YX0A 3LB0A 4JTIA 3CIXA 5BMXA 1GJPA 5G5IA 5D2XA 4UTTC 4W9TA 4JTLA 4K8EA 4Z1CA 3C56A 3SSJA 3G8RA 2QUTA 2BTMA 3KRUA 3HOJA 3MBDA 2KZHA 4WZHA 4JY9A 1B9BA 4MFEA 1K02A 1XBZA 2ZZ6A 3I6RA 3B03A 5AN7A 1W5QA 3PSVA 1KLYA 5F2GA 1HUVA 4M7SA 2RDWA 4ZMGA 4JTFA 4WXZA 5HNRA 3DENA 5CZJA 2GQAA 5DY3A 4O11A 5F2LA 5I3JA 3DKLA 4LVAA 1VS1A 1XBVA 2CFFA 3P61A 3L0GA 4NXSA 3CWNA 3QC3A 2PRMA 1KM2A 1G4PA 2A7NA 1K8XA 4O1DA 3A23A 3G0UA 1CI1A 1KFEA 1RVGA 2YZRA 3GX9A 1UJPA 4JDBA 3PBVA 2E68A 4LWWA 4PEKA 3TROA 3NEVA 4KFPA 4UNKA 3W7RA 4WX2A 1OFAA 3GKAA 1OFPA 1YDNA 3EXRA 5G4EA 1TPH1 1SSGA 1FX6A 3RMJA 2JGYA 4YCOA 4DPQA 3OHIA 4UTLA 3TJXA 3W1QA 4K38A 5EA9A 3UWQA 2QCHA 1OVDA 3PVFA 4LY8A 2BX7A 3UZJA 1OK4A 3PBYA 3W2NA 3C2OA 1FCQA 1QAPA 2RDTA 1Q6QA 4O15A 3MBFA 2Z2UA 4MFDA 3TW6A 3W2UA 1PV8A 4NNBA 3IGUA 4NNAA 1F2JA 1XFBA 1G69A 4Y90A 1IXNA 3GLCA 2GOUA 3HMJG 1QO2A 2TSYA 5HWNA 3LCWA 2QKFA 4BFAA 2ZCGA 3CU2A 3EKLA 1WA3A 3TJLA 3G1XA 2A85A 4GC4A 4FB7A 1IIHA 2DU2A 3G1AA 4CCEA 3O07A 1KFKA 4GUIA 4O16A 1O94A 4PODA 3NQ7A 5FI8A 4PTNA 1TV8A 3GYEA 5DBTA 5AC6A 4C1LA 3BGJA 3L65A 3M7WA 5FF0A 2FB2A 3LCLA 1I2QA 1YXYA 2QUVA 2E5BA 3GVGA 4DF0A 4WD0A 1DOSA 2EHHA 4JX4A 3UYCA 1JCNA 3P74A 1OHLA 3LOTA 4QITA 5HR6A 2ZRWA 2NX9A 3NQCA 1LBLA 1IIGA 1VCVA 1A5CA 3B06A 5C6MA 3RLUA 3HG3A 1TQJA 3T44A 2J24A 2VOMA 1S5VA 3NQEA 2OT0A 2CLEA 3MHUA 4E2DA 3MP4A 4HNVA 3PM6A 2LLEA 2W0UA 5HWMA 1HO1A 3P8JA 4MLRA 1AL7A 3L68A 5IBXC 1LLZA 4GUJA 4QQ3A 1LP6A 2W6RA 3TKFA 1TV5A 2QCDA 1KV8A 3DKJA 2ZZ5A 3N14A 4NUWA 2ZRUA 1H60A 3DH7A 5KTLA 3PB0A 1IF2A 1I2NA 3V75A 1F6KA 2GQ9A 4Z1BA 1G67A 4BWLC 1UUMA 3KRSA 4O13A 3BGGA 1FDYA 2QCFA 4RX0A 3USBA 3AO0A 1KLZA 1GG1A 4A2RA 1QOPA 1KM1A 3GKFA 3LERA 4MYXA 1L6WA 1TMHA 1VH7A 3P81A 1HL2A 2VENA 3F4NA 4BI7A 5C54A 4O54A 3RU6A 4NJHA 3OA3A 2QAPA 3TC7A 3LCGA 4UTTA 3TC6A 4X9SA 5EMUA 3NQAA 2GVLA 1FY6A 4UTIA 1TQXA 4Z0SA 2YSWA 1ZENA 3S5YA 1YADA 3D0CA 1EP2A 3C2FA 3R5EA 3O05A 4K36A 3UPBA 1F73A 1TB3A 1VYPX 1BEUA 1PCKA 3NZ1A 2JKEA 1X1OA 2UV8G 2QAFA 2R94A 2CLIA 3LHYA 3PR2A 5FF3A 1G4SA 3S8HA 1UCWA 4WY0B 3RFAA 4O52A 2VEIA 3HO8A 1GVQA 4O0KA 1H1YA 5LGZA 2XN1A 4O18A 2VFDA 3HGOA 2QCNA 4JYDA 3ZS4A 1B4EA 1M6JA 4O1AA 4WY0A 3MWAA 2F84A 4M6QA 4MY9A 3W7PA 1KW1A 1IGSA 4PFMA 3LTYA 3QYQA 4LV9A 1ONRA 1I2OA 1YPIA 3LRKA 1I8JA 3PUEA 4QM1A 4HKPA 3W7DA 3LCXA 3DI1A 3A22A 3W7CA 3N9SA 1F76A 3BARA 1ZCOA 1LOSA 2VFGA 4ML9A 2AAMA 4CQAA 1RV8A 2V9DA 3NPUA 3VE7A 5G2HA 4S2BA 1ZJIA 4CCDA 2V30A 1A5SA 2FFCA 2DZUA 4EWND 4HSOA 4JIPA 4K37A 5D2WA 3LCIA 1G7UA 4GE8A 3BK0A 3DHDA 2EF9A 2WSYA 5HULA 3N19B 3KRZA 3CLMA 1XM3A 3NPXA 1XBXA 3SFKA 3HPXA 4U28A 4LTSA 4M6VA 4DF1A 3T78A 3W1RA 1QPOA 3BV4A 1I2PA 2YXGA 1YTKA 4XQ6A 3HG5A 2NUWA 1YDOA 4ZVJA 4LOCA 4HN4A 2C14A 3QJAA 2WNQA 2CLKA 1LORA 3LI1A 1TPEA 2A7RA 4KWVA 1F6PA 5FESA 5L6UA 5F2MA 4IMEA 1VGAA 4Z0JA 3WK0A 3ABRA 5FF4A 1TJPA 1G6CA 3MJYA 3QQ0A 1IXPA 4DO6A 4TMBA 1RR2A 3M0ZA 4LUIA 3H54A 5I3HA 2CW6A 1QO5A 1QOQA 4DELA 3NQ6A 4H3DA 4LVGA 4JX5A 1FBAA 2PC4A 3GDKA 2Z6JA 3TQVA 4LUJA 4N6FA 4Y8FA 5DBUA 3EX4A 3W83A 3WK2A 3FYPA 1TREA 1LOQA 3ELFA 4WXYA 1VYRA 3C2RA 3KAOA 1AG1O 2A7PA 4MJMA 2Y62A 3N34A 2ISSA 3L9CA 1S5TA 3NO5A 2P1FA 1D3HA 3W7GA 3LLFA 1JUBA 2V81A 3TMLA 3HGRA 4O53A 2JK2A 3PUOA 4EVZA 3THAA 5DXXA 2E5CA 1W8SA 5C55A 5LGXA 3DFSA 2QJGA 5L9FA 3LHWA 5AHFA 3OG3A 1H7WA 4FXRA 4NZJA 3PY2A 1GPWA 2F7FA 1FWWA 1F5ZA 2PCQA 1JRCA 6TIMA 5F4XA 3TQKA 1ICQA 4JTJA 2V5LA 3A5VA 5G1YA 2NX1A 2E5DA 3W1AA 3HQ1A 1XUZA 4S2CA 1MSSA 3QW3A 4DBDA 3M9YA 1PCWA 3PBUA 2HTMA 4YLWA 2ZDRA 2FPVA 5EKYA 4EF9A 4GUFA 3SGUA 1TRIA 3TSBA 4GFSA 4LNYA 4Q32A 2C13A 1QPQA 2CZEA 1TV7A 3RLVA 2X1TA 4MOZA 2Q8LA 5CZ0A 3LM7A 4H6KA 5BNKA 1KBJA 3IIZA 3LTSA 3MHFA 3I7SA 3QMSA 4JTSA 1EWDA 1BWKA 3Q2DA 4HSNA 1OFDA 1Q6RA 3E96A 2QCGA 4LS0A 3G3DA 1S3HA 4I7VA 2GVJA 1OYCA 3G1VA 3UXDA 4R34A 3W6YA 2PURA 1JRBA 1N8FA 2NWSA 2NWRA 3SGZA 3DI0A 3OVRA 4WUIA 4ZQPA 3G1HA 3DXIA 4JGDA 4RZ6A 4LVDA 1EUNA 3IIPA 4DBEA 5D2TA 3S5OA 2H3BA 2GJLA 1XXXA 3CT7A 1M5WA 1HFBA 1JJKA 4FNUA 3MMTA 2OT1A 6ALDA 3PS7A 3P80A 5TBOA 4AXKA 4UTWA 2JKAA 2V0TA 3TUUA 1VYSX 4KWWA 4BK9A 2HMCA 1A53A 3WJYA 1VC4A 1DL3A 2X30A 4OE7A 3EWXA 3F1QA 1AW2A 4KFOA 3P5ZA 1MXSA 4M19A 4CQ9A 1FDJA 3DFOA 2CWNA 1SZGA 3PB2A 4NT0A 2DZSA 3N73A 3O6CA 3P62A 3Q94A 3CM4A 4K8HA 3M16A 4NX5A 3R12A 1OABA 5IM51 4E38A 2X1SA 3O06A 3CWOX 4MIMA 2R91A 3NL2A 1NVMA 4QSHA 1V7YA 5CSRA 4FX6M 2HSAA 4UNLA 2A4AA 1W1ZA 4NJIA 3B8DA 2WQPA 5DCBA 3QQ1A 3B4UA 4AHQA 5DCDA 3T4CA 1KFLA 3B05A 3BVJA 5HMSA 4YCPA 3HBLA 3NL3A 1YPFA 1W3TA 3W7EA 1R30A 4RR4A 5LNSA 3IGSA 3C2EA 1XUUA 1LROA 2PRHA 4JXCA 2V2CA 5F2IA 2I1OA 4WOQA 1H50A 2Y7FA 3W07A 4JD4A 3OEXA 2TRSA 1X1ZA 3KVLA 1KFBA 4UFHA 3GR8A 5FEWA 1LM1A 2X1UA 3FYOA 4ZQOA 1ZFJA 2Y7EA 4O1CA 4O57A 1H5YA 1Y0EA 2Y88A 1XKYA 3TMQA 2ZTJA 3W7IA 2Q3RA 5KINA 4C1KA 2YPIA 1OFRA 4LRTA 1NFBA 3T40A 1J4EA 3T55A 1ZAJA 5EYWA 3G1SA 4M7TA 4FXSA 4ZQCA 4DQWA 3A5FA 4ZQRA 4XBKA 3N2MA 4JTEA 2ZA3A 3EWWA 2NV2A 3W1UA 1EIXA 2HS8A 2Y63A 3LDVA 2ZBTA 4AB4A 3SIZA 3GNDA 5AYXA 3WFAA 4MJZA 4O0ZA 4AWUA 2J27A 3EWZA 4MKNA 3LCHA 4AVFA 5LSMA 1GZGA 2C15A 4O4WA 3R8RA 1DBTA 1ZY9A 3EB2A 3S9YA 1VHNA 1WXJA 5FEXA 5D2VA 2VKZG 3P8IA 1VHCA 2QF7A 2RDUA 3IV3A 1LRTA 4TU1A 3NG3A 1N7KA 3RNDA 2QUUA 2BXVA 3K30A 1EUAA 3BG9A 1S5WA 1G7VA 4U4MA 3PG8A 4JTGA 1JUKA 3S1VA 2FJKA 1THFD 4N4PA 3PF3A 4JICA 4TX9A 3ZR4A 3VKJA 5F4WA 1OYBA 2ZRYA 3W85A 4CCCA 3GZ3A 5KZDA 4GNJA 2FIQA 4Z1DA 5AOUA 1K8ZA 4IWWA 4FNQA 4LVFA 3TFXA 3UPWA 2WOQA 3IVSA 4DXVA 3UQNA 2A2IA 4CQ8A 4N02A 4DO5A 3UWWA 3L5AA 3I68A 4RXFA 2OZ0A 5LNWA 3G0XA 3SI9A 1WYIA 4JNMA 3NNTA 1R46A 4ZL1A 3UD6A 2G96A 3QPZA 3ZWSA 1OX4B 1GVOA 2Z0IA 4IJBA 3NM3A 1ME7A 4RXGA 2QJHA 4E0CA 1FCBA 1SFLA 3DBPA 3GB6A 1F7BA 1P1XA 1XDMA 4LS1A 5HR7A 1OX4A 4ONVA 1LLWA 4UFIA 1C29A 2QCDB 1GYLA 4DEFA
chains in the Genus database with same CATH superfamily
4KS0A 4P7QA 3EA1A 1KFJA 4GYFA 2PDNA 2C6QA 1MZHA 3S47A 2ZICA 3BSMA 3NDYA 3FDKA 2G3JA 1PE1A 4PUNA 4PB5A 3AZTA 3LBMA 3AXMA 2BP1A 1V79A 1H5VA 3OU8A 2WPBA 1W54A 1O68A 2J6XA 1MXDA 4MPKA 1EOKA 1UROA 2WSQA 5CC3A 4QHRA 3CNYA 4HMCA 1V5XA 4F3HA 4A3RA 1M7PA 2P76A 3HURA 2J25A 1QWKA 3S1WA 3CPRA 2PDMA 1SO5A 2DQWA 4R33A 1FKXA 5CJ5A 4XUYA 2B0MA 7A3HA 4Q4KA 3SEPA 1SO3A 3G2GA 1V0NA 2F6UA 2V2HA 5LA0A 2AQWA 3C5QA 3ZR5A 4GVHA 4AZ6A 1QNVA 3NQFA 1BYBA 2AKZA 3UZYA 1WKYA 3BAWA 4NXKA 1JNEA 3NXFA 2BFGA 1J0KA 1SUXA 1FHLA 1Z7AA 4RZ5A 3W24A 1U2YA 3EEGA 3L0NA 4V27A 3HGSA 4FALA 3WLMA 4UTMA 3L0KA 4XVEA 3OBEA 4LVBA 3PG9A 3IEBA 3MCOA 3KCOA 2W67A 4NI8A 2D24A 4A22A 3DUGA 2XIMA 2ASHA 5XIMA 1AH0A 3ATZA 1OY0A 1UKQA 4GGHA 4CNUA 5K9DA 4J40A 3VCRA 2XYLA 2OWWA 3ZJKA 1JD7A 3QBUA 2WYSA 1DEDA 4QDMA 4GQRA 1HP5A 5BXPA 4DI9A 2J7DA 1BKSA 2VFEA 3XISA 4E4UA 5HQEA 3B9OA 1O5RA 4IFKB 2HK0A 1VLIA 4M1RA 3HJEA 3WD3A 4NZ5A 2DORA 1S2CA 3EWYA 4QNEA 4BI5A 4K8GA 2EG8A 2JFEX 2YFNA 2Y7DA 4R88A 2CU0A 1TPVA 4HPXA 3B8SA 4IFKA 3CHDA 4P8XA 3NSXA 2ZUTA 3TQ0A 5AYYA 1X96A 1ZP3A 3VC6A 4YNGA 2FZDA 1DJYA 2E7FA 4INFA 4UMAA 2PBGA 2HS6A 3VNDA 4GUHA 3RO6A 1A5MC 1E6RA 3GSMA 1VFOA 4X61A 2VFIA 3OJGA 4KMQA 1UQZA 3MMWA 5G4WA 2QUNA 3NA8A 1S2VA 2PE4A 2CZ5A 3UP8A 3VABA 3WSUA 1TX2A 1CGYA 3LEPA 5I06A 3ARRA 2A0NA 2J62A 1K7FA 2PTXA 4QJ5B 1LRNA 1JPKA 4H4IA 2YW4A 4D6IA 1A5AA 2RAGA 1GOWA 2EKGA 3IRSA 3WN6A 4JFUA 5CPMA 3FLUA 1RPXA 1LTDA 3M44A 1VFLA 5LHFA 2J7EA 4R5EA 4PFHA 1TJ2A 3VKAA 1NTHA 5CC5A 2E8ZA 4MF4A 3ME3A 2BY3A 5TF0A 3NQGA 1SFJA 1E3ZA 4WDUA 3BO9A 3EXTA 3WKZA 2YYTA 2B7PA 3OZPA 4X22A 2TAAA 4O12A 2PAJA 3HPFA 1FXPA 3W53A 2VOTA 3CMFA 3FA5A 3RPMA 1AMYA 4TXEA 2J8FA 4MWAE 3W74A 1LLOA 2PWDA 2E40A 4EAYA 2WMIA 3I65A 1W5PA 3O15A 1A0DA 1H0IA 5G4HC 2X1IA 2OSXA 1T8QA 3S4TA 4XZ9A 1ME8A 3NM1A 2OTDA 2GFTA 3UWUA 3PPHA 5DN1A 5EFFA 3VIOA 4J2MA 4H6EA 3WF0A 2QS8A 1NOWA 4DJDA 4GI4A 3ABOA 4GH3A 4JTDA 4FNSA 2BHYA 2J7GA 2G3NA 3G22A 2XFWA 3L21A 3QOMA 1KXVA 1TRDA 3ECQA 1TPC1 3LU2A 5LA2A 3CEPA 3NPWA 1UQYA 3E6EA 1KXQA 4OWGA 3QGVA 3PAOA 4D2JA 1GGOA 4HIBA 2J47A 1XICA 1GEHA 3K8MA 2NXHA 3SRHA 3G1FA 3WD0A 3M0VA 1E6QM 4ZE4A 4IQLA 4J7RA 4HK7A 3T0AA 3TZFA 3AIQA 3EXSA 3SCQA 1IEQA 3T81A 3D47A 2P3EA 1OGSA 4RKAA 2EPKX 1GEQA 4RUBA 1G9HA 3HJZA 1VIZA 5DMLA 4NZFA 4DPPA 1RP8A 3ABZA 3MV01 4IGMA 2QZRA 3MV11 1PZ1A 4H7ZA 1LQ2A 5D2YA 1HKVA 1KM5A 3UY7A 4DAFA 2ZWZA 3GVRA 5FIPA 3ZYZA 4N42A 3RMEA 2GQ3A 3VFCA 4WQ6A 3UR5A 3R0KA 5C2XA 2QV4A 3L23A 2ZTKA 4NU7A 4GXMA 4W89A 3IJQA 3B9EA 1CXIA 4X60A 3U8GA 4BR1A 5REQB 3AHVA 2VUYA 1SU5A 3BOXA 3GY1A 4MG4A 4Q8OA 5EU9A 4IM4A 1J0IA 3CYJA 1MW2A 4UNIA 3SRDA 3S2CA 1ESWA 2G3IA 4JY8A 3POCA 2WC3A 4AWTA 3TTSA 1M65A 1KRBC 1HJSA 2Y85A 2PUZA 2FVLA 4NSBA 4XISA 5DT5A 1QT1A 1JF6A 3WQVA 1LG1A 1UR3M 3EWDA 2ABAA 3TNOA 3MKCA 3ID7A 4E3TA 3QF0A 4US5A 4PEEA 5DEZA 4ADSA 3VA8A 3LHVA 5MHBA 1H63A 4LBSA 1WE5A 4ZQMA 3TR9A 2OPJA 1HL8A 1Q13A 5CGTA 1WKFA 3RILA 1JUEA 3F4VA 4LYPA 3TW7A 3VK5A 4UTJA 1AW5A 2X1RA 5CZSA 3TAKA 1NDYA 3TTEA 4IOTA 4D1IA 1FTXA 3QZEA 4IX0A 3QM3A 4YJ5A 1KV5A 2QCEA 5A8GA 3PANA 4IP4A 3GDRA 5C0QA 4AMCA 3E9AA 4HZ6A 4XTIA 2J79A 4GBDA 1V3MA 2O7SA 1E51A 3M1ZA 3FAXA 3VUSA 2GJRA 4XUGA 3CZ8A 2JGQA 2R1NA 2JF7A 1M41A 2CLPA 4NJJA 4WKAA 4NL1A 2Z6IA 3LG3A 3EKGA 1TPFA 1EQPA 3OZMA 4N9EA 3TJIA 3W7LA 2PDGA 3KX6A 4LFYA 2WLYA 2BGQA 3OGSA 4QEHA 1LT7A 1GOMA 4UQCA 4MMWA 5JH2A 2OEMA 3VDCA 4S1FA 3LRMA 1O12A 4PMJA 3WJZA 5CPLA 1N55A 1PWLA 1H2JA 1W3JA 1IYXA 1X97A 4QXIA 1EXPA 3CL7A 3DHFA 1NP2A 4PL1A 1XGZA 5HQMA 1F3WA 1B31A 3MUXA 3N4EA 3DAQA 5LNRA 4UUIA 4FS9A 1TO3A 1XG4A 1PHWA 3CTTA 4MGGA 2BSLA 3W84A 4L6OA 2DUXA 4EPDC 1FWRA 5BROA 2HPMA 4NILA 2VC6A 1EB3A 4HQVA 4Y9PA 2DQXA 5CXPA 3LHUA 2MNRA 1XL9A 1WAWA 1YRRA 1DJZA 4FPSA 1KBKA 1Z48A 5A6KA 4C6CA 2ABBA 4TR9A 3EDEA 3NYZA 4NX0A 3V5CA 1SQ7A 4HN8A 3HB9A 1AK5A 1MMFA 1W17A 3JU2A 1XSIA 2VJXA 1GCYA 2VX4A 3WENA 1U1UA 5AYZA 5A5WA 5A6MA 1PKLA 4ADUA 1WOAA 4DJED 1WQ5A 3WJWA 1XLBA 2GJPA 4LCQA 3HFTA 3W0KA 3TWBA 1FWTA 5DXYA 3STCA 3DG7A 4GKLA 1MNSA 3FIGA 1B3ZA 2ONEA 1KGWA 3G18A 1FHDA 5AHNA 2G97A 1W1B1 3KFTA 1JFXA 2NXIA 1KFCA 1HG3A 4O4VA 4X0VA 4B2DD 2PP1A 5M03A 4A3YA 2CNCA 1MXGA 4DJDC 5HQLA 1E3XA 2WMHA 2XVNA 4QAIA 2ZQ0A 4FAMA 4GO9A 4A3UA 2VCBA 1Q63A 1HVXA 2VEKA 3E2QA 3W86A 1YMYA 4MDOA 4TUFA 3FEMA 3BLFA 1FOBA 3H55A 5C5YA 4Z1YA 4AW7A 1UWRA 4FO4A 1KA9F 5I3KA 5AHIA 4GI6A 2HBVA 3WQDA 4ZTYA 3BWWA 2F6KA 3MSDA 1W9PA 2VVNA 3MI2A 3N4AA 2J13A 3E0LA 1LL4A 2V63A 2VC7A 4FX8A 1WUEA 3WNKA 4UTHA 4Z2IA 1EP3A 4ES4A 1R0MA 2NV1A 1NH6A 3LA4A 4H01A 1KTBA 4A3HA 2ZUUA 3WFLA 3RCMA 3NAVA 1EPXA 1Z44A 5CG7A 3ARVA 4UFKA 1PPIA 2HQAA 1X6UA 3B3DA 3U57A 4UQEA 1Z41A 4IJRA 3WLSA 4NJKA 2XIBA 4IG2A 2CLFA 2VEGA 3I3BA 3V3WA 2WANA 3IJ8A 3VXGA 3CO8A 3BG3A 3KOXA 4Y96A 3O8AA 2OX1A 1I2RA 3O1NA 2ZC8A 2J88A 1UWTA 1AZ1A 3GFYA 3LQGA 4F0MA 1UA3A 1ADSA 2DEPA 1XIIA 1IWPA 4JN8A 3DHPA 5AHMA 1JCYA 4EWJA 2BLEA 2IXUA 5CCZA 4I7UA 2GSEA 2V5BA 4PMYA 4GIEA 1JPMA 4JZ5A 2V69A 2VELA 1UP2A 2ZIDA 4EXAA 1SJAA 3N9RA 5D04C 1WKDA 5CJNA 2BY2A 4DYKA 2J9ZA 5AZ0A 2W92A 4D6DA 1NSJA 3NDZA 1EEPA 5LA1A 2X40A 7CGTA 4FX7A 4ILSA 3V36A 1PTGA 3DYPA 8XIMA 4GISA 4JDYA 2VHLA 3KVKA 1EGZA 4FNPA 4S39A 3O6YX 2OCZA 3OHMB 5BWFA 4M8UA 5A2CA 5DMYA 3MO7A 5LIUX 1RD5A 4H04A 1TTPA 3N11A 4XZNX 3GAYA 4MZ1A 4LY4A 1W9DM 3MI6A 4OBSA 3WLTA 4PYSA 2CXGA 3S9IA 2GGEA 3QY6A 3ITCA 4NZCA 3XINA 1XFCA 3EA2A 2X2YA 1WUFA 1JYXA 3KBJA 2FZBA 3WJXA 3ARXA 1NWUA 1EYWA 4LU0A 3H2CA 2I16A 1X8CA 4B92A 3EPMA 3VNMA 3RG6A 4WY0F 3EOEA 3NQDA 1LBMA 4HMNA 4KBXA 2F8QA 4F0RA 4FZIA 3GUGA 4C6EA 1HL9A 2IUZA 3SURA 1HTIA 3EKZA 2QUMA 4PCSA 4WIWA 2PDCA 1AH3A 3UF9A 4L7ZA 4ADTA 1NU5A 3DEQA 4DY1A 3VGFA 2JEPA 3WK3A 1FQ0A 4QJ1A 4OV4A 1KCKA 1OIFA 5H91A 1RPKA 2C3ZA 4PH6A 3I7RA 3UYIA 2ISWA 2B31A 1O60A 1CLKA 4OZOA 3ZLHA 3TU9A 2A6NA 3CQ0A 5E6YA 3MY9A 4IGNA 2BV9A 3QEZA 1WPCA 5E1QA 1CXLA 2Y89A 3CQHA 1H1ZA 2XJ7A 3OBKA 3BOFA 3ZVIA 4MYAA 4YYFA 4OGZA 5D4YA 1DWHM 2QDEA 4EANA 3CZGA 1D8CA 1CLVA 2NZLA 3RX3A 1XLFA 3U2ZA 4JYEA 1XSKA 4MTVA 1EX5A 4ATDA 1ZALA 4HSHA 2QCCA 1WOBA 3QSTA 5CPSA 3AQUA 2QDDA 1DQXA 3H53A 3AFBA 4MNKA 1XLGA 2WVTA 3GG7A 4NAEB 1JZ3A 2YX0A 2FMOA 5G5IA 5D2XA 4UTTC 4W9TA 4HZ7A 1AQHA 3MQTA 4FK9A 3G8RA 1VEPA 1EJRC 2IKGA 2QUTA 1WO2A 3KRUA 4WZHA 4KCVA 1AJ2A 1B9BA 3ANVA 4MFEA 3IJ6A 2O92A 2OWCA 2XFYA 3I6RA 1W5QA 4W7WA 3AZSA 1Q6GA 1PTAA 1YNQA 4ZMGA 3SCUA 3KBMA 3DENA 3AOFA 2GQAA 2Z29A 1XIBA 4WCJA 1R3RA 1IV8A 3PPCA 2GWGA 4LVAA 4ASTA 2PDUA 1E0VA 4NXSA 2EEXA 1LWIA 1TR9A 3CPGA 2Y5SA 4ZFMA 3FV9A 3A23A 3W02A 1YX1A 1EXBA 2WW5A 4N7QA 1KWKA 2QVNA 3PBVA 2E68A 3PTMA 4PEKA 4KFPA 4W93A 3W7RA 1EDQA 2HVMA 4WX2A 3SUTA 1OFPA 4XO6A 4DJFD 1SSGA 4A05A 1UD4A 4XX6A 3RMJA 1NWRA 1TA3A 1TMLA 4YCOA 3LGDA 3MSRA 4AEFA 4K38A 1OINA 2PC8A 3DECA 3W2NA 3GXIA 5BU9A 6PTDA 3RX2A 2RDTA 2DFAA 2Z2UA 3W2UA 1E1FA 1KCLA 1XFBA 3WH9A 2ISDA 1IXNA 3U9IA 2GOUA 4Y8EA 3V18A 5HWNA 3AS1A 3LCWA 3QV7A 4BFAA 3R94A 4NYUA 3G1XA 1PUDA 5C70A 2WBGA 4FB7A 1IIHA 5I6SA 3RRXA 3DG3A 2V3DA 4D6JA 4PODA 1RY0A 3NQ7A 3MO4A 1TV8A 1UC4A 1ZU8A 2YL5A 1I2QA 1Q66A 4RDYA 3BH4A 1F4AA 2E5BA 2J75A 1QRQA 3V0UA 3B4YA 1OHLA 3PHAA 4QITA 2NX9A 2VMFA 3QHMA 3M0XA 1VCVA 1ZS2A 3EDJA 3RLUA 4GIAA 3WD1A 5IRPA 3QLLA 1IGWA 1ITCA 3VC5A 3SCNA 2PDHA 4DZAA 5E6ZA 2W0UA 5HWMA 1HO1A 1O7AA 1FA2A 1LLZA 4GUJA 2VZUA 3BJFA 1TV5A 4PCTA 2QCDA 5FAGA 4ERAA 3N14A 3WH6A 1E1CA 3DH7A 3PB0A 1IF2A 3MMDA 3V75A 2GQ9A 1B9ZA 3GNRA 1Q2SA 5CSYA 3BGGA 3WG6A 1FDYA 3USBA 1QOPA 4W84A 3VD7A 1TMHA 4WGXA 2VDHA 4O54A 3CYVA 1XIDA 4PSRA 4NJHA 2QAPA 2R82A 3LCGA 3TC7A 1FWEC 1JZ4A 3RM9A 4LBRA 1LL6A 3ZLFA 2PZNA 1FY6A 4UTIA 2OZ3A 3WY1A 1EP2A 3ITYA 3R5EA 1E6PA 3APTA 2VL4A 3AYTA 1VYPX 2VWSA 3AYVA 4WRHA 3WEOA 4ERIA 1XW8A 4FLOA 1X1OA 2UV8G 1OSEA 1W1IE 2R94A 3O3RA 3DDMA 3VCCA 2WPGA 1GVQA 1TELA 4O0KA 4AD2A 2XN1A 1ZLPA 2QCNA 2VUNA 3GHUA 3T42A 1IWAA 2ESCA 1XRVA 3BV7A 1JGMA 1HKKA 3WUFA 5T8GA 4MY9A 1BAGA 1KW1A 1IGSA 4PFMA 3LTYA 1OC5A 1JG9A 1ONRA 4LV9A 4CNSA 3LRKA 4S3DA 3N2BA 2PS2A 2R1MA 1V77A 3AS2A 5ENLA 3LCXA 3KWSA 4V1YA 3W7CA 4EX4A 3AXXA 2ZX6A 3W25A 2ZUWA 4G5DA 4B5WA 1RV8A 4HA4A 1X98A 2J7FA 2I5GA 4EWND 2J6VA 4B3KA 5D2WA 3QVQA 2E1WA 2ZUSA 1ZQ5A 1PX8A 3NPXA 1OADA 1XBXA 3SFKA 4U28A 2DW6A 4DF1A 4M6VA 3T78A 3W1RA 2G4JA 3EDKA 4Z42C 3POHA 2XISA 3VNJA 3RRAA 4YYCA 3BV4A 2YXGA 2VZSA 3HG5A 2C14A 1R8LA 4LYQA 2IW0A 1V3LA 4KCTA 4H7CA 3SCWA 1TPEA 3P0XA 1JZ5A 1M1BA 5L6UA 3KRBA 5F2MA 1UR4A 8RUCA 5FJJA 5FF4A 1RK5A 3BAJA 3QQ0A 3M6DA 2CHRA 4HD5A 1RR2A 3M0YA 2FH8A 4C7DA 3VGDA 3NIYA 4UR9A 1QOQA 4DELA 4HMEA 4H3DA 3A9BA 4ZODA 3VOGA 3GNXA 1PIFA 2O9TA 3G1RA 2HK1A 2BVDA 4Y8FA 4Y7EA 1TREA 3GYCA 1ZJHA 3PZGA 3WF4A 2YDRA 4MJMA 4BKNA 2VQUA 3L9CA 2P1FA 1D3HA 3W7GA 3LLFA 3EEZA 3TMLA 2JK2A 4W85A 5DXXA 2GSHA 3DFSA 4REQA 3LHWA 2XSBA 1H7WA 1A5KC 1TVLA 4EXQA 3PY2A 3W82A 9XIMA 4AZ7A 3HQNA 1F5ZA 1TUXA 2XH7A 4GFIA 1JRCA 4QCEA 3E2SA 1KR1A 4WSHA 2GGGA 3RR4A 4XIAA 1MSSA 1PCWA 4YLWA 8CGTA 3T0CA 3K4WA 1FH8A 2C13A 3KM8A 1EFZA 3RLVA 4F0LA 4MOZA 2Q8LA 4XBJA 5BNKA 1NQ6A 1KBJA 1N8IA 5LXEA 1R3VA 2EPLX 3QMSA 4JTSA 3NWRA 2C1GA 4HHMA 4CN1A 1OFDA 3T0BA 2QCGA 4ZOAA 4I7VA 3FVDA 1U30A 3T09A 4AYGA 3G1VA 6XIAA 4LSBA 3W6YA 3QZ6A 3GVWA 3OVRA 4WUIA 3DXIA 3TN3A 4D8ZA 4JGDA 5B7YA 2GVEA 2GK1B 4K1GA 2YB1A 1HFBA 3M0KA 4HA1A 5EMJA 3MMTA 3PS7A 1QHOA 1DXIA 2VGBA 1QNRA 3TUUA 1WB0A 4AZCA 2WWCA 3T2QA 4RNIA 4RDZA 3H2FA 3WJYA 5CAKA 1JF5A 3EWXA 1EX1A 5A2AA 1DIDA 4CQ9A 3ZVHB 4WR3A 2CWNA 3DC0A 3NSMA 3O9NA 4IPNB 3UG3A 5GNXA 5JH1A 3BLLA 3N73A 3P62A 3R12A 2BOFX 3ICJA 1KXHA 4E38A 1US2A 3O06A 1G5AA 5CSRA 3CZLA 4ZA0A 1JNDA 4UNLA 2A4AA 2BVTA 3B8DA 5DCBA 5MF5A 2YCJA 2XHYA 4HK5A 1BYDA 3USZA 3BVJA 5HMSA 4S23A 1I9CB 2A3BA 3BLPX 3PUGA 4WKFA 5FKYA 1CECA 2X0SA 2KAUC 2VDGA 1DXFA 1AA1B 4WOQA 2CEQA 1JDCA 1H50A 5C7VA 5FSDC 3WQ8A 1I6NA 4JD4A 2TRSA 1KFBA 4UFHA 1UH2A 4NASA 4DLFA 1QNOA 4O1CA 3QPEA 5I79A 4CN6A 1Y0EA 2Y88A 2ZTJA 3FJNA 1J9YA 4OUIA 3VTRA 4IH3A 1NFBA 3T55A 5LYRA 4M7TA 4HCHA 5GNZA 3P2VA 3KCJA 4JTEA 2ZA3A 1F07A 3W1UA 3EAUA 2ISFA 1EDTA 2ZBTA 4AB4A 3WFAA 4YVPA 4MJZA 3ZSSA 5IFTA 1Q6DA 4MKNA 3W27A 1DIEA 3EB2A 3TYCA 1WXJA 2VKZG 2BY0A 1BXBA 3TTOA 3FW6A 3GQYA 2DVUA 2CKSA 4PTDA 2X05A 1CIUA 3VZXA 3TONA 2XWDA 3BG9A 4Q7NA 3ZR4A 2NQHA 1REQA 1OYBA 2ZRYA 3W85A 1UKSA 1VPQA 4FNQA 1P6CA 4DXVA 1XLKA 2F9RA 3ALFA 1US3A 1MNZA 2VURA 3L5AA 3VIPA 2OGJA 3I68A 3S6TA 1JI2A 1FH7A 2V3FA 4F0SA 3G0XA 2PGEA 3UT0A 2CC0A 1T6MA 1ODUA 4IL0A 3EMQA 3WIJA 3EPNA 2PDPA 4IJBA 4N0RA 3OOQA 3GHSA 3IARA 2R9RA 4XZBA 1SFLA 2Z27A 1XDMA 3REQB 1D8WA 3O0FA 3UESA 2YBUA 1C29A 3GH5A 1TJ0A 2NT0A 4WGHA 1QCWA 1E0TA 1NOFA 1MFUA 3W29A 1YNPA 4K3ZA 3REQA 3QGAC 3VIGA 5E5CA 1PX3A 3CPUA 2E09A 4ALDA 1JI1A 3AXHA 3WQEA 4L80A 1J12A 3GDMA 5EB8A 3N4FA 1EP1A 3EYPA 1OG0A 3STFA 2PU1A 4BHYA 1PIIA 1CXEA 1FWCC 2G3MA 1WBJA 1JYNA 1R3SA 3VGHA 5D8ZA 3FDGA 4C1NA 1HJQA 1TIMA 3EMCA 3RCYA 1NF7A 3LK6A 4LRSA 3RU8X 3TCSA 1W91A 1F3EA 3IGXA 2Y24A 4CKQA 2ZFAA 1B57A 1XYFA 3U0HA 1QTWA 4IPIA 2ZZ3A 5A94A 1U83A 3TYEA 4NIRA 3AXIA 5ABTA 4D71A 1UZ4A 3UGRA 3PFRA 1C8YA 2R1LA 4PUUA 1P48A 3CQIA 5K7JA 3U48A 3LX9A 8XIAA 4A3QA 1G01A 4F2BA 5AC4A 4GVIA 3TW9A 4JQAA 2D2OA 2VT0A 2INZA 2J9YA 3P6LA 5ABFB 5K4XA 2XFFA 4PUJA 3SFWA 4ZCWA 4QX4A 2PSNA 3GS6A 4NAFA 2DY3A 1BKHA 1H51A 4ICCX 3VD9A 1KM3A 2HVNA 2V38A 2TPSA 1XGDA 3JVAA 1PWMA 2Z28A 3K4DA 1W56A 3TDFA 4BY3A 1DP0A 1YXCA 4EIVA 2C0AA 2YDAA 1W5NA 1H7NA 2EXOA 4FR6A 3G1DA 2VDIA 2ZRVA 4HPJA 2WSRA 3AALA 1V51A 4K7YA 5CSSA 2AMGA 3SCOA 3QZAA 3AYRA 1RQEA 4JIQA 4E5TA 1OFQA 1IEXA 1DV7A 1P6WA 3V0SA 3RCNA 2YKKA 1R47A 1H4PA 3N2TA 3QN3A 2A3CA 1HKWA 1IEIA 2V67A 5AC8A 5K3VA 4M0XA 1XX1A 3QW4B 3B8WA 1SZFA 1HJVA 3TV8A 1GVIA 2FHBA 1MEIA 3SJNA 2XDFA 4ZB5A 3SECA 1DORA 3AMLA 1I0BA 4LF1A 3M6YA 4QIUA 5DY2A 3NXLA 4UZUA 2A5HA 2V82A 5FD0A 2CLOA 3VFLA 1DQWA 3E2VA 1VLWA 3W71A 2WJFA 2QT3A 3M43A 2W9MA 4OVXA 1K7XA 1S1RA 4C6LA 4JNYA 2PTWA 1ECEA 2VR2A 4PMRA 2D2GA 3SCPA 4LH8A 4MADA 1QNPA 2WSKA 1XH1A 3LTPA 4IXXA 4D1JA 4FP1A 3R7MA 1AODA 1K4GA 4I9AA 3S46A 2C1IA 4CQBA 3CT2A 1ZGDA 4KEMA 2FKPA 4DVOA 4LC8A 2NQLA 9CGTA 1O1ZA 2O9PA 1QASA 4C65A 2XN2A 2BWGA 3IJ7A 3C4UA 4Q8NA 3AIWA 1LJYA 2YFOA 2Z2BA 1JQXA 4AAJA 5BOFA 1O4UA 4XG1A 1SJBA 4HNTA 1VFSA 2RGMA 3QTGA 1GOOA 3KS5A 3O0KA 1H7RA 2EPHA 2Q6ZA 3VOIA 4HBKA 3UWYA 3H8AA 2OQHA 3T7VA 3MHGA 4DM2A 4JAWA 4G1KA 4LF2A 3LENA 3NQVA 4H7VA 3FCPA 3RF9A 3TSMA 3U7VA 5BCAA 4MSSA 2YCLB 1YTEA 3ITLA 4UTKA 4JHZA 2E1DA 1UBSA 4HYWA 1AMKA 4TVCA 3UZ5A 5C2GA 3UJ2A 3UVIA 3T0TA 2WHLA 4K2SA 3FJ6A 1TPWA 4ZR8A 1FP8A 2WWDA 3L7RA 2WMKA 2OLAA 1A47A 1FWSA 3EMZA 4BS0A 1XPGA 5CC6A 3MP3A 4I7WA 4HOWA 2YLLA 4NF7A 4AWSA 4JS3A 3E5PA 2VFHA 1RJRA 3W2MA 3KP0A 1CX9A 3AIUA 3RX4A 4M29A 2RKXA 1XISA 1ONXA 1J6OA 4HMDA 4A8NA 3MI3A 1G0CA 4RLIA 4RDWA 5I23A 3VINA 3OYXA 1UKOA 4NNCA 1P0NA 1U5HA 4M24A 5LIYX 1CT5A 3S1UA 3A3WA 1U22A 5J04A 3EDDA 1R3TA 5C9WA 3AMDA 3MUIA 4PMQA 5D32A 2CXEA 2PMQA 3TXVA 4A35A 1W3NA 4AF0A 4UZSA 3TR2A 4FF5A 1NDWA 3P84A 3F03K 4HA3A 4IMFA 4X3ZA 1H3GA 5LZLA 2D0HA 2V8ZA 4MB5A 2VD8A 1RH9A 2DVTA 1TSIA 2XGBA 1TZ7A 1AVAA 2V5DA 4S3JA 3H2EA 3E0WA 4OBTA 4IHCA 2DH3A 3B9DA 4ATLA 4XD6A 1NWSA 2C79A 1ECQA 3FOKA 4XD4A 1NQKA 4DRSA 2V5JA 2PGWA 4JQ3A 5CLWA 3MSGA 2FB3A 3A3XA 3W1NA 2EJ1A 3HU7A 4IXHA 4IPPA 4M6UA 3CHVA 5A6LA 3NL5A 1V93A 5HWJA 1J0ZA 4HP5A 1E6SM 2JBMA 3UETA 1BG9A 4IZGA 4YU1A 2Y4SA 1J2WA 2G95A 1QHPA 3URBA 1R6WA 3WNNA 4O17A 2PF8A 1OT2A 3PZVA 3UG4A 1VBRA 1Y5VA 1N8WA 1GOXA 2FJUB 3IGHX 1A4MA 3GIQA 4C6QA 1SVDA 2MANA 4EXBA 3WJSA 1LDCA 1H61A 3STGA 1KR0A 1XCFA 2Y0FA 3SADA 4AC1X 5G2IA 3VNYA 4B5SA 2Y61A 2FTPA 1L9WA 4MWAD 3PZNA 4AEOA 4DF2A 3S5SA 1A80A 3TK7A 3B0PA 1XIHA 1NWTA 4AIEA 1PZ3A 4S3EA 4NQ1A 4DWSD 1CNVA 2R1KA 2GDUA 4GY0A 5MKGB 5EL1A 1PZ2A 3KCLA 4PMUA 7ENLA 1U5VA 3W72A 1XC4A 5CZTA 3W2LA 4GXWA 3W1LA 2PTZA 4FOUA 3S2LA 1WP6A 4DUVA 2DZXA 4BF7A 3C52A 4Q7IA 1HO4A 2WNNA 2EG6A 2ZX5A 3NQ8A 2I5QA 2WK2A 3ANYA 4JX6A 3DGBA 3CAQA 3UY8A 1HP4A 4Q4OA 2NT1A 1UR0A 3IIOA 4RDVA 3OVPA 1ML1A 1KM4A 1J01A 1GZ1A 3S6DA 3H7VA 4A2SA 2I17A 4XIMA 5I3FA 2ZUVA 4IISA 3L2IA 4PUKA 5A6AA 3GG8A 3LLDA 3B04A 2WAGA 3EA3A 1IR1A 4FMVA 2G8ZA 1E9IA 4J3ZA 1Q2RA 4FNTA 4LAMA 1QOXA 3IJLA 2D1ZA 2D3LA 3BW4A 3HF3A 4QNWA 2AAAA 3KP1A 1OYAA 2Q3OA 3VO0A 4MZ8A 4QDPA 1VZWA 3SZ8A 1EJTC 1GKRA 2NXGA 3H21A 3L5LA 4OOUA 1S5NA 4PMNA 2QVHA 1AJZA 1BQGA 3AC0A 4YMZA 1GQIA 3MCNA 1K9DA 4LUYA 1QJWA 2CZDA 4ORIA 1M7JA 1US0A 5DRIA 2QDGA 1QFEA 2FDSA 3EX1A 2DZVA 3V0TA 3THCA 4GO8A 2WZEA 1TMQA 4HVXA 3SUSA 3W01A 1QI5A 4WSKA 1SW7A 3K5XA 2B7QA 2VVSA 1S2TA 3CIVA 4UFJA 3VGEA 1TTQA 3JUGA 2G37A 3FKRA 1LQ0A 4TMCA 1V08A 1DVJA 3H2OA 2BOEX 4JKMA 8TIMA 2O0TA 4O50A 1EJSC 1RD6A 3DHUA 3TOPA 3U6WA 3IAQA 2NUYA 1J5TA 3QY8A 4E2BA 1EF2A 3S9ZA 5DF0A 1K70A 1ZAHA 6CGTA 4XZMX 4AD0A 2PDQA 4X2RA 3IUHA 4A21A 4IGSA 1EJ7L 1Y5WA 1FP9A 1VJIA 4GRSA 1T40A 3W1MA 2PDFA 3BAXA 5JBEA 1FFRA 3AZRA 3SW6A 4K1WA 4YVVA 4I5XA 3C8FA 3SJ3A 4MB1A 3S1XA 1TFVA 1CB2A 3UCQA 4F66A 4UOZA 4BF5A 4D6EA 2WQDA 3TYZA 2C8NA 1B3OA 5J5RA 1SR9A 3VOFA 2ISVA 2H8ZA 4LUSB 3W76A 1AD4A 1TPB1 2HDJA 3CAKA 3II1A 2PZ0A 1WDWA 4ZOEA 2IPGA 2ZA2A 2YB4A 5M3WA 2QF8A 2OO0A 5FJUA 5C2CA 2VTFA 3UZXA 1W9UA 4AH7A 5RUBA 5HJYA 2ZVRA 3RPDA 3ALGA 2W61A 4DO4A 3GXTA 3ARYA 4XZHA 4JFVA 4GD0A 4YWIA 3M5XA 2V2DA 4OV9A 1P5BA 1TCDA 3E0VA 2QCLA 2BBFA 4XTDA 3IJDA 1DYSA 1S46A 5M2FX 2HRWA 3TN6A 2OZTA 3H24A 2ANUA 5BRBA 1M7OA 1W37A 2Y7GA 3BC9A 3H4XA 1SJCA 2CWXA 1VBUA 1OGGA 4XSLA 2I9UA 4O28A 1JR1A 2IMRA 4BCEA 1W0MA 3CIWA 1HJUA 4QFUA 4TO8A 3RM4A 3UBPC 1Q6LA 3WLHA 1DWIM 1MQPA 2A21A 3G24A 2DP3A 1HF6A 4JTKA 1UD6A 4GJ1A 2DZTA 3QQWA 3NDOA 3UA4A 4U10A 1IEWA 5U4NA 3RITA 3CHCA 3QV8A 4L9ZA 1N2VA 1G94A 3W7KA 1B3VA 3DG6A 4PR4A 1P0KA 1ELSA 2YIHA 5D37A 3SRFA 3PZQA 5D02A 3N3MA 4AMAA 4H9YA 1BRLB 1VFFA 3YPIA 1XYBA 4DZIA 3S2MA 2R6OA 4U3AA 3EX6A 1RA0A 2ZX9A 3H22A 1XRTA 4UTUA 5EMYA 2I9EA 1BRLA 2OO6A 2GSJA 4B5NA 1EL3A 1W1VA 3WQ4A 4FSAA 2HE5A 3HGJA 3JW7A 5HNNA 4GI8A 4GIYA 1OGBA 3V7PA 3CB8A 4BWLA 1JULA 4YPJA 2PWVA 3GAKA 1OFBA 4G7EA 5I09A 4YWSA 1K6WA 3DGRA 2R14A 3SR7A 4FNRA 4K6AA 1GTEA 1Z9AA 2JF6A 3GM8A 4I9TA 2BXYA 3LRLA 4DBSA 2CBVA 4TV6A 5A1AA 2OLHA 2X16A 3VD4A 1WV2A 3UWVA 4QSFA 3AI0A 3K4AA 4F9DA 2WJZA 5CBIA 1XGEA 4MWAC 4W7VA 1RK6A 2AL1A 1Z42A 5IOBA 4A4AA 2BGSA 1HQTA 2VEPA 5A3HA 2E28A 3W9ZA 1W5OA 1T96A 1BSLA 3I6TA 2YOCA 3Q58A 2WNWA 3R58A 5BOOA 1GW1A 2Y5EA 1W31A 4IUGA 1ZTVA 4CNNA 1C91A 4N2YA 3GR4A 4YTRA 4LS2A 4TTUA 4GINA 3B0UX 4I8DA 3BTNA 2EJAA 3OODA 1BTCA 1W6TA 4HU8A 3NZRA 5I3IA 5I00A 3JZEA 1JCXA 3EX2A 3FSUA 3ABQA 4YTTA 1RLDA 1H7PA 1LZOA 1ICSA 4HA0A 2P50A 3ZFHA 3UCDA 3GXDA 3W75A 4PBGA 2B7NA 3GU9A 2TMDA 5H6HA 4MJ2A 5FA5A 2ZZ7A 3PK7A 4QISA 4PRTA 1KQYA 1PS9A 1E0XA 4L4LA 1Z6KA 2OX4A 3O16A 4PC8A 4CEUC 4KRTA 3L67A 1GYNA 1EWEA 1NM9A 1I1XA 2Z24A 3F7JA 2VZTA 3ZOAA 3W7JA 1E9ZB 3IVTA 1KQZA 3GK0A 1UR1A 1EDGA 3Q67A 3DFHA 4J28A 3VNLA 1YIXA 2ZRZA 4DUXA 4H9ZA 1QVBA 2FPYA 4JIHA 3VIMA 3KXQA 4G1NA 5B7ZA 1M03A 3OGRA 2YR1A 3KHJA 3QPYA 4YTQA 4H19A 5H2ZA 3PSWA 1IT8A 3MT1A 4JTIA 2XM2A 1PTDA 1GJPA 2J8TA 1AFSA 4JTLA 2PDJA 1V8EA 2I57A 4W8LA 4J2PA 3T1GA 5D9NA 4UCFA 4ZXOA 3OO2A 4QG8A 1V6YA 3B03A 2F2HA 1V02E 1KLYA 1HUVA 3HZ3A 2VRJA 4LAUA 4JTFA 1TWDA 4LB4A 5DY3A 5F2LA 1MVYA 4UWMA 3DKLA 1VS1A 3KBWA 3E0FA 1QXLA 4GVFA 3QC3A 1WZAA 1G4PA 1D2KA 4UQBA 2A7NA 4JCLA 4DIAA 4LAKA 4QTGA 1BG4A 3LNMA 1KFEA 3EOOA 3F2CA 4XV0A 3GX9A 1UJPA 3LPGA 5IHRA 5A69A 4LWWA 2YA1A 3TROA 3NEVA 1E40A 1PZ0A 4LB3A 3GKAA 3RXZA 1HW6A 3EXRA 3DFYA 3DYOA 4UOQA 3QKZA 3PZIA 4UBPC 2CZVA 4UTLA 2CHOA 3W1QA 3UWQA 1OVDA 3PVFA 2BX7A 1J8VA 3HTWA 1U1JA 3PBYA 1E5NA 4E8GA 4O15A 3TW6A 1PV8A 3CO4A 4NNBA 3IGUA 2EPMX 1ISWA 1EC7A 2PGRA 1G69A 2CITA 2SFPA 4GYKA 4ML4A 2O4MA 1V6VA 2QKFA 2H9AB 1J5SA 2ZCGA 3EKLA 1E0UA 2X41A 5HPCA 1WA3A 1GVYA 3CUXA 3TJLA 4GC4A 1JPHA 2DU2A 1UH3A 4AVOA 4ZGYA 1Z69A 4CCEA 4GUIA 4O16A 3GTHA 4HPGA 3GXFA 1S2WA 1CGTA 4GZIA 5A6TC 3GYEA 3L4TA 3FHQA 2NQ9A 3M7WA 5FF0A 2E67A 3SBFA 3LCLA 4M81A 3ZT5A 2FMNA 1ISVA 3GVGA 4DF0A 3PZMA 4JX4A 3UYCA 5JBDA 1JCNA 4LYRA 1X39A 4S3FA 3RGTA 1NJJA 3H70A 2AQOA 2ZRWA 4D6FA 3CXOA 1B90A 3KOZA 2WVSA 2YCKX 3V5FA 1P0BA 3BXWA 3C86A 3U4AA 4HNVA 1WDDA 3QHNA 4GJJA 4MLRA 1VB9A 1LP6A 1L8PA 3A6OA 3TKFA 3KDNA 3MZNA 1HGYA 3A4XA 3H7RA 1TR1A 2ZZ5A 3WFZA 1MW3A 4NUWA 1PAMA 1XV8A 2XGIA 2XSXA 4BWLC 3LUTA 4XAPA 4MKSA 4O13A 2WBKA 2NW0A 1FWDC 3GW0A 3N15A 2WVUA 3AO0A 1KLZA 1TV4A 1UMYA 1KM1A 3GKFA 1KCXA 2CESA 3LERA 4MYXA 1VH7A 1HL2A 5C54A 4GY7A 1DIKA 4DZ5A 5H1WA 1QBBA 4YS1A 3RU6A 3OA3A 4WLCA 4WVXA 3TC6A 4X9SA 2OKOA 2G50A 4JFTA 1TWZA 1NFGA 3MC5A 2YSWA 2AOSA 3D0CA 2OZ8A 3W00A 1RBAA 3UPBA 4BQ4A 1GORA 1TB3A 5IHSA 3WD2A 1BGGA 4YTUA 1W3LA 4F40A 2G0WA 2GLKA 4GQ0A 1JL8A 3RFAA 3DERA 4B5XA 7PTDA 3LLXA 5I5RA 2L5HA 5LGZA 3T2PA 2HVOA 3FNDA 4EP8C 1I60A 3HGOA 3R25A 4JYDA 3ZS4A 1B4EA 4EAMA 4WKHA 4TQTA 4KH2A 4O1AA 1SJDA 1DWGM 1DWAM 2DH2A 1Q6FA 3WLKX 3ZM8A 4IQEA 3CASA 3MWAA 4CU8A 4R85A 3WF2A 4H83A 1ZRQA 3W28A 2WJEA 2GUYA 4L4PA 1I8JA 3PUEA 4HKPA 1TWIA 2WVVB 4YIWA 3DI1A 3A22A 2POZA 2F38A 1R9XA 3N04A 3GHRA 1F76A 1ZCOA 2VFGA 4ML9A 1UWUA 2AAMA 1J0YA 2V9DA 3NPUA 2VZVA 4PUWA 2JIEA 2X7WA 2PWEA 4CCDA 2V30A 2P8CA 2DZUA 1JD9A 4PGLA 2WHMA 3APYA 1P43A 1HNYA 1G7UA 3OW1A 1SMDA 2EF9A 3N19B 1O66A 1PYFA 1XM3A 4F79A 3WLLA 4YTSA 3CV7A 1QPOA 3CK5A 4BA0A 2Z2AA 4XQ6A 2NUWA 2GL5A 4C90A 4ZO9A 3QJAA 2WNQA 4WDXA 1OIMA 1LORA 3UZZA 1XLEA 2OOGA 4KWVA 1F6PA 1MUCA 3TOYA 4HZMA 3MVTA 2ZWYA 4Z0JA 3GC5A 3WK0A 3ABRA 6A3HA 1G6CA 3GTFA 1M3UA 2E25A 4GZEA 1CB7B 1UC5A 4TMBA 3PJXA 5I0DA 1XH2A 3M0ZA 3UA3A 2XZ9A 2ON3A 2Q71A 1ONWA 2ZVIA 4HGXA 1QO5A 1K9EA 4HCLA 2WCAA 4LVGA 3WD4A 1ISYA 2Z6JA 3TQVA 3CV6A 4LUJA 3ERPA 5DBUA 3EX4A 1F9CA 1C93A 3FYPA 3RAOA 3AIVA 1GPFA 4OKDA 4WXYA 3PTDA 3FGCB 3WBAA 1BYCA 4I5RA 1VFUA 3B9AA 2ISSA 1POKA 1S5TA 3NO5A 3I6EA 1B1YA 4GCXA 4AC7C 3M0IA 3HGRA 4EVZA 2E5CA 1NFPA 1W8SA 5CJMA 5LGXA 5H8PA 1DJWA 2QJGA 2FFIA 3G5EA 3GFXA 5AHFA 2Q8XA 3HV8A 3OG3A 5DRCA 4DJDD 1GPWA 5ABHA 1FWWA 3DX5A 3WDIA 1C9WA 3AIBA 1QNSA 3E38A 3UJEA 2EQDA 3TQKA 3CHFA 2V5LA 5G1YA 3KDOA 4Z2LA 2E5DA 5T91A 3W1AA 2PWGA 3HN3A 1XUZA 4S2CA 1YPXA 1J96A 3QW3A 4DBDA 3M9YA 2HTMA 3TSBA 3B0YA 4Q32A 3VDGA 1QK0A 2QXWA 2CZEA 4AFYA 1OC6A 5CZ0A 3IIZA 3LTSA 4EK7A 3I7SA 1XYLA 3N3TA 5KEZA 4HSNA 5A8OA 1C92A 3UU0A 4KIEA 3PJUA 1YNYA 2ACUA 3SUUA 1WXYA 1XC6A 4U5KA 3ONBA 3MZ2A 2PURA 4B5TA 2NWSA 2NWRA 3SGZA 1FWIC 3VDHA 3H4GA 4ZQPA 4L9XA 4RZ6A 4GG9A 4U5IA 4GY1A 3NSNA 3IIPA 1DWJM 3GG0A 4Q8UA 3S5OA 2H3BA 2EBNA 1BD0A 5JXQA 2AQVA 1MDRA 1VFMA 1UJQA 1A4LA 2OT1A 6ALDA 2X0YA 3B8TA 3UGVA 2EG7A 1F8IA 3OB8A 3ITGA 5TBOA 5AY7A 4UTWA 4LYKA 3U7BA 4BK9A 4R9OA 1A53A 1O1HA 3RR1A 2X30A 4OE7A 1HGWA 3P5ZA 4JHMA 3LM3A 3Q45A 1FDJA 1SZGA 2W27A 3IACA 3ARPA 1F3TA 4J3TA 1Q8JA 2DZSA 1XRFA 3O6CA 4D9PA 4AVNA 1C3FA 3CWOX 4L6DA 4PZVA 4B91A 2HSAA 2XM1A 4A8IA 4CD8A 4NJIA 5JQ9A 3LSBA 3QQ1A 1IQ8A 1JIBA 4US5D 3B4UA 4DM1A 3FVMA 5DMNA 5JMUA 3HBLA 1W3TA 2WZHA 3QYSA 4RR4A 1XUUA 2PDLA 2NVCA 4KWOA 3UZWA 4JXCA 7REQB 1OC7A 2V2CA 5LIWX 1DJHA 1POJA 1JFHA 3WBEA 4AZGA 4E6MA 3BLKA 1IZKA 2YDSA 5REQA 4QG6A 1X1ZA 3KVLA 9XIAA 1TV2A 5FEWA 2X1UA 4QE1A 3FYOA 5JBFA 1CXFA 3FEQA 4O57A 1H5YA 2OR2A 4PB4A 3W7IA 2Q3RA 3LN3A 2W4XA 3T0DA 4MHBA 2YPIA 3SCVA 4MKVA 3N6QA 1J4EA 3U4FA 4H2HA 3A5FA 2VX5A 2PLKA 4KEUA 1ADDA 1EOMA 2NV2A 2YJQA 1JAKA 3LDVA 3SIZA 5AYXA 3HPAA 4O0ZA 2XVGA 4AWUA 1C7SA 3SIMA 4KCWA 2OFJA 1QBAA 3U3HA 3LCHA 4O4WA 3R8RA 1JGIA 4ICMA 1VHNA 3P8IA 2QF7A 3P14A 4IT1A 8A3HA 3IV3A 1LRTA 4TU1A 1CWYA 3NG3A 1N7KA 2XH4A 3RNDA 3BUVA 2BXVA 5ABGA 1G7VA 3WEMA 4CN4A 1LQAA 4DWSB 2Z7GA 2E8YA 3IUIA 1THFD 4N4PA 3PF3A 2YA2A 1X1NA 5LXXA 1QU4A 2G3FA 2IS7A 2UZ9A 3PFMA 5AOUA 4V15A 1XCXA 1K8ZA 4IWWA 4AD1A 1OM0A 4CQ8A 3S2JA 1BQCA 1SM9A 1BWVA 2VQTA 3CLWA 4W5UA 3NOYA 5LNWA 2INEA 2IKJA 4JNMA 3J7HA 3NNTA 1R46A 3UD6A 5GPRA 1OX4B 4HOZA 4U2ZA 2OU4A 1ME7A 5JUVA 2ODOA 2QJHA 1OCNA 4E0CA 4H41A 4G2DA 3WH8A 4C6PA 3DBPA 1F7BA 1TZ9A 3WH7A 1OX4A 1E56A 4UFIA 3BMVA 4DEFA 3U2EA 3VKKA 3NO3A 2DIJA 3TA9A 4MY8A 4H6RA 4TTGA 1KWGA 2C1HA 4JTUA 3BPWA 2WNZA 4IFOA 4MPQA 1OT1A 4CNPA 5CSUA 5T9CE 2C18A 1TVNA 3BLDA 1G4EA 1UIOA 2O55A 1EPVA 2A3LA 3A4AA 2BODX 1UD3A 2XUCA 2DZPA 3WMBA 1XLDA 2QW5A 5HBFA 2BOGX 3N6JA 5CZKA 1TTJA 3KW3A 3W2KA 3TCEA 4AYSA 1I45A 3R89A 2OG9A 2XGZA 3R8GA 5EY5A 1PVNA 1PIGA 1DTUA 5HA7A 2NVDA 4AZIA 4ATWA 1IT0A 2A3AA 4R53A 3TIMA 3M0LA 3N29A 4MJ4A 4GCAA 5DO8A 4PN2A 3LSCA 3KL5A 2UY5A 4NZ1A 5AYBA 1U5JA 5KZMA 2DT2A 4AY8A 2F6XA 3N18A 1K3UA 3WMSA 1D7FA 1Z32X 4PMOA 2EO7A 1A5LC 1E1EA 3TC3A 1T8XA 2GYIA 3BCJA 4OFCA 3WO8A 2IQTA 4P8VA 3WBXA 4C6MA 2F2KA 3RK8A 1IT7A 2OWXA 5JU6A 5FL0A 5SWUA 3UG8A 3EOUA 2DSUA 1KM6A 4DUWA 3WNMA 1QR7A 1FWNA 1XJBA 4F48A 3COTA 1E6NA 1XIJA 2VD9A 1EJWC 4AIOA 4RNHA 1PO9A 3LMZA 2W3ZA 4PL2A 5CH9A 5CPQA 1TCMA 3IJIA 4UTWC 1OD0A 3IRDA 4RV3A 4CD5A 4AQLA 1E15A 5E93A 3FN9A 4Q8WA 1XG3A 1OFOA 2ZZ4A 1T7LA 3MW7A 1JCTA 1GHRA 3BSHA 3KBNA 3VOJA 2XPKA 1GONA 5IFPA 1BF2A 3E0IA 1Q45A 1KO0A 1UUOA 3BMXA 1I75A 1RCOB 3MANA 5D38A 4PTMA 3VPLA 3M7SA 2DV0A 5FEPA 3MP5A 4LPCA 3VKBA 1XH0A 1SYTA 4RE4A 4BEUA 2NX3A 3FXYA 2EGZA 4MZYA 4JHOA 1QMLA 1L8NA 3GIPA 3THUA 4AY1A 5KZEA 4IIDA 5EMMA 3QC0A 2VGIA 2OEKA 1A5BA 1SO6A 3NL6A 2YCEA 4DWDA 1SMAA 1E9LA 2EPNA 3OVQA 3STEA 4C6BA 4P5UA 4KEZA 1KKRA 5EFDA 3BW2A 3ONCA 3CB3A 3NYDA 3CL6A 3VI2A 4DXXA 3SQLA 1S1PA 3S2NA 4AD3A 1L0PA 2GGHA 3GDLA 2VC9A 2XTKA 5F1UA 1NDZA 1R2SA 3E12A 3EGJA 3TYAA 1VEOA 3TTQA 1YEYA 4TX8A 5I2UA 3TEVA 1X7FA 3PZOA 3D3AA 1WKEA 1V6XA 3NFUA 4L65A 1HIZA 3S5ZA 4LC6A 3F4CA 5I7GA 3PULA 3BLIA 3HV9A 2HROA 2PP3A 3LI0A 1L6SA 1V6UA 3S42A 3ARWA 1BPLB 3P7YA 4GC3A 1WX0A 3A4WA 3HIJA 4ZOBA 2VGGA 5LNUA 3CAVA 1E70M 1TE1A 3UFYA 4QROA 5I3GA 4A6GA 1VPXA 4AZHA 1YXDA 4QEEA 1AH4A 2GDVA 3AMKA 3W70A 4QR6A 4UQ9A 1DWFM 5A6JA 4Q8TA 2DJLA 3MPGA 4ZQNA 4IX2A 4NJGA 1UBPC 2PLJA 4N9DA 5FJIA 2B7OA 3QFEA 5D9PA 2ZKMX 2Z7KA 3L4UA 1WXZA 4QCFA 1YTDA 4PBEA 1FCVA 1XDLA 2VP8A 3ARZA 2QDHA 1JYWA 4HNUA 3QXBA 4Q4RA 2QLYA 5T26A 4UQDA 4LAZA 1Q4WA 2CIPA 2D73A 3T08A 4IICA 3KLKA 4PRWA 3WQGA 1AL8A 1SW3A 1VCFA 2UY3A 4Q6XA 2OELA 1S5MA 3TYDA 1GWJA 4J5NA 1DJNA 1J10A 2VXNA 3HPSA 4CU7A 3DFQA 4IP5A 4GYPA 4I90A 1FVPA 1ME9A 2RH9A 1L2QA 4AD4A 1AQ0A 3ZO9A 4G6CA 4H9TA 4E8CA 4KESA 4IMCA 5AHEA 4QLLA 2W66A 1OF6A 3C2YA 3WK1A 3WDQA 4QS6A 1Q6OA 1V0LA 2OLSA 1PX4A 3VZZA 4F8XA 2A3HA 4FIRA 2OQLA 4EE9A 2J9XA 4H8NA 3G6MA 3P93A 1UD5A 3UPMA 4ZEPA 5TQLA 1C90A 2XFRA 5I24A 1JCLA 4KF1A 5EBUA 4E4PA 1UOZA 3S5NA 1XIEA 4PTWA 2D22A 2E6YA 2QPSA 2PI6A 1F05A 1GVFA 2RJGA 2JEQA 2DDXA 2OJPA 4GWEA 4UOJA 5CBBA 5FF7A 5F1VA 1C9DA 4IMGA 3AMGA 1EO7A 2CCRA 5FJTA 5GJPA 2R1PA 1FCUA 3VCNA 3CEUA 1XCWA 4MY1A 1ZHAA 3VKDA 3L4XA 4US6A 4JTCA 4Z17A 3S0CA 1J93A 3QGKC 3TYBA 3IIVA 5K9CA 1SZEA 3PUDA 2Z1BA 4HJFA 3GH4A 4CQCA 4O8AA 3GE7A 4NAEA 5JIPA 2YL6A 3IS4A 3EDFA 2A6LA 1XLCA 1B4KA 3MSYA 4KWSA 5C9UA 1UA7A 5CGMA 3ARQA 1XLAA 2JKPA 4HB7A 5CGQA 3ZR6A 1DJIA 4KT2A 2QJIA 4LV4A 3NCOA 2UY2A 1GOKA 3HQPA 5CEWA 4X0NA 1QI3A 3QR0A 3TZNA 2W79A 3PPFA 3C61A 1M53A 4JEJA 3WLJA 2ACSA 1E72M 3PP7A 2BMBA 3LV5A 2AKMA 3EWBX 2VZOA 2ATSA 5EPDA 1R86A 4UR8A 3VDAA 4OHQA 2REQB 3AS0A 4GQGA 1DE6A 4ACZB 3PBMA 2NV9A 1TJRA 4UFLA 3S1GA 4B3ZA 4HNNA 1H11A 4PULA 4EPEC 2MUCA 3O6AA 1RXOB 3V35A 4Y6GA 5HOSA 3CUFA 4H00A 4M5PA 4TV5A 5A6BA 3PZUA 4FEZA 1ITUA 3P82A 5K9XA 1JZ8A 3ENLA 3RHGA 2YXXA 1OZMA 1RBLA 4FLRA 5KETA 2WMJA 1QUMA 2FZ8A 1GVRA 2YCIX 3P5YA 4L1WA 1TUFA 4I3GA 3QV6A 2GGIA 3Q37A 3OZOA 3M0JA 1BTMA 1XPYA 3ABXA 3GTXA 3DZ1A 1J0HA 1Y7VA 3CTLA 4Z2HA 3C6CA 3M47A 3A24A 5HJLA 7ODCA 3MYOA 4DNHA 3WNOA 2HJPA 1D7KA 4XK2A 2HPIA 3TA6A 3C8NA 1UD8A 2BZNA 2OXNA 1IXOA 3OLEA 2UY4A 2FHFA 4O8RA 4MM1A 1GJWA 3O63A 1LF1A 4B15A 4BQ3A 3VIKA 1VRDA 2C7FA 1W9XA 4GGBA 3URNA 1R9YA 1C7TA 3VZYA 3WQFA 2D0GA 4N9BA 3OVGA 1NOUA 3RJYA 3AJ7A 3ZT6A 3V1PA 2D3NA 3M5YA 1KTCA 1F74A 1I1WA 3MYPA 4IUOA 2TYSA 1KB3A 1YKWA 4GI9A 1XR2A 2PP0A 3HG4A 2ATMA 4Y9NA 2ZX7A 4DYJA 5BOEA 4UCGA 4DLMA 2BVYA 1EA9C 1L2UA 2IKIA 6ENLA 4ENLA 1J6PA 4IIHA 3W2JA 4OIFA 3F4DA 2C16A 4L64A 4PUDA 2AGKA 1P7TB 2VCAA 3CUGA 3BJTA 3CC1A 2DT0A 4GOAA 1Q7ZA 2E6FA 5CPOA 5ABEA 3E49A 3BGAA 2PD9A 1FWJC 3LS9A 4E8DA 1SW0A 3F2BA 4JEQA 3PJWA 1P7TA 4BF9A 4NYYA 1GG0A 1RZMA 2H3DA 3G3MA 3SGGA 1O6IA 4I9MA 4LEQA 1YBQB 5E09A 3KZSA 1CGVA 1T0OA 3URQA 2PB1A 3DIPA 4EOUA 2EKCA 3K46A 2CBIA 3C0JA 4HCDA 4RZBA 1RCQA 1YBQA 3VILA 4HYRA 1E4LA 2DIEA 3CZKA 4D6GA 3PN8A 1MI3A 4GYPC 1IE7C 3ZJ7A 1LOLA 3U5UA 4RZ4A 5HUOA 3QSRA 2VO5A 4C6FA 2E6DA 3PWIA 3VIIA 2NQ5A 2DZAA 2ZE0A 4W8BA 2FZNA 3OLGA 1KM0A 4ZB2A 2GPTA 3HMCA 2BGNE 2I14A 1NDVA 1OB0A 3GR7A 3OIXA 4IIFA 3EWUA 1HKMA 2NSOA 4FI4A 3R6IA 1OJXA 1OCBA 1FHVA 2GUBA 2ZOXA 1R87A 1UD2A 3N13A 4CU6A 1GVSA 1JPIA 2O7QA 2FGZA 5BXTA 3THQA 1MO0A 4MB4A 3SCTA 3IWPA 4J35A 2WLZA 4QBXA 2WJDA 1EKOA 3ZT7A 4KFNA 5TIMA 1ZZMA 1KRCC 1QI0A 3VD5A 1TTIA 4JN6A 4EF8A 4R7OA 1K8YA 2J7HA 3XIMA 3R10A 4RE0A 4GIRA 4UFMA 3L4WA 1W32A 4MNMA 2WB5A 3GTNA 4O1FA 2XZ7A