2ZZ3A

Covalent complex of orotidine monophosphate decarboxylase d70a mutant from m. thermoautotrophicus with 6-cyano-ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAAFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 85
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz3A00
3VI2A 3N14A 4DF2A 4BWLA 4IJBA 3Q94A 1OFBA 1XXXA 4JX4A 4TU1A 3LCLA 2A0NA 3W7QA 2B7OA 2BZNA 4LUIA 3MBFA 4OQVA 2OJPA 2QUUA 5G2WA 4JTEA 1G4SA 2B0MA 3DBPA 2Y7FA 3AO0A 3SR7A 4GNJA 2FIQA 1RQBA 3N19B 4IMFA 5BMXA 3GNNA 1FX6A 5F2GA 1KFKA 1F6PA 2ATSA 2ATMA 3GR7A 3BLIA 1VC4A 3LXAA 3C56A 3KVMA 2X2GA 5KMYA 4UTTA 1YDNA 5LGXA 1T0OA 1K3UA 4DO5A 3LCIA 3PG9A 1ME9A 1EIXA 1QR7A 1RPXA 3PM6A 1VLWA 2NZLA 3MW7A 3LCHA 3LRMA 3MWAA 2X30A 3O63A 4ZMGA 3LM7A 4WY0A 1S3HA 1M5WA 3LI0A 2OT1A 1W56A 1ZENA 3C2RA 4MY1A 4ZQCA 2VXNA 3NQCA 1V5XA 3GXTA 2W6RA 3EEGA 4N6EA 2C13A 3C2OA 5CZ0A 1JCJA 3S1UA 2H90A 3UPBA 1KBJA 4O17A 1GVQA 1BEUA 1SZFA 3WJYA 1YTEA 4HNUA 2R14A 4FNQA 2QDGA 1KTCA 2I9EA 2CWNA 3LRKA 1RQEA 4UTKA 1JR1A 1QO5A 2JK2A 4MVAA 4HPJA 4ADTA 3DHFA 5C6MA 1KM1A 3EXSA 2X1UA 1LLZA 5DCBA 1VS1A 4QISA 5G1TA 1FCUA 4QM1A 3W23A 1OYCA 2KZHA 2Y85A 2Z6JA 3N9RA 4MKNA 5DBUA 2XN1A 2C18A 3G24A 3PSVA 3O1NA 2QCNA 1EA0A 1OFRA 4KFOA 5U7SA 1CW2A 3FIGA 4MOZA 3FS2A 4JXCA 3MP5A 4YCOA 3GDMA 4JX6A 3UD6A 5EL1A 4WY0F 2RH9A 4HIBA 3NR0A 1OVDA 2YW4A 3WJZA 4LNYA 3TJLA 3UWZA 4O4WA 2CLMA 4O52A 1YDOA 4R7JA 3T40A 1T99A 1YXYA 3SZ8A 1S5WA 5I3FA 5G5IA 4JTHA 1LCOA 1HUVA 4C1LA 2YCEA 4AHQA 4FNUA 1GVFA 1F6KA 3C8FA 4O1DA 3W1TA 3LGEA 4WJEA 3S1XA 1GOXA 5AHMA 1H7XA 2RDTA 5FEXA 2YX0A 1B57A 2NXHA 2NXIA 2A4AA 3L0GA 3BV4A 3TUUA 2ZRWA 3HPSA 1H7PA 1WOBA 3A24A 4LVGA 3ZWTA 3FEMA 5C55A 1TV8A 2A85A 4FNRA 2Z1BA 5AC6A 4Y8FA 3W2NA 3OIXA 4LVFA 4BFAA 2ABAA 3W87A 2V81A 1I2QA 1U83A 1E51A 4UTHA 1KLYA 3TCEA 1LRTA 1AW1A 4I7UA 4WQ6A 1OABA 4DF0A 4O8RA 4M6QA 1O4UA 5J5DA 4S1FA 5K4ZA 2ZZ5A 1LOSA 3R89A 1W31A 3JRKA 1FWNA 1KFBA 4GUGA 3KVLA 3UNDA 3F4WA 3NQVA 3S1VA 4DBEA 2CZDA 4DELA 2C19A 4PC8A 4UFJA 3GX9A 5KZEA 5D04C 3TW6A 5D32A 1YLVA 4M6PA 3LBCA 4NT0A 3W70A 3O6DA 3PG8A 4RZ5A 3I65A 3THAA 1NFBA 3EX6A 3CTLA 1GVOA 2V2HA 1WA3A 3QC3A 1OFEA 3PVFA 2NUWA 1XDLA 1XBXA 3L2IA 3S42A 1JVNA 4Y6GA 1HG3A 4KFPA 3W7MA 1VCGA 3B0PA 4JTFA 2ZFAA 4M5PA 3TAKA 1TTPA 1GG1A 4R34A 4RZ6A 4A22A 4AWSA 2ZZ1A 3O8AA 1P5BA 2GJNA 2X16A 2J88A 2QJGA 3QJAA 5FI8A 5FEWA 1MEHA 1QPOA 1VHNA 3SECA 4GFSA 1TREA 4ADSA 3PB2A 1T96A 1PCWA 3E0IA 1R30A 2YDAA 4HSOA 4Z1AA 5LSMA 3ZFHA 1H61A 1I2RA 8TIMA 1OFDA 3W1PA 1QO2A 2P10A 4A3UA 3DAQA 3QSRA 5A5WA 3KVJA 1GWJA 2TSYA 4XBSA 2NX3A 1R2SA 3RU6A 2VFIA 1W8SA 1ALDA 1Z48A 3R12A 2DZPA 2PE4A 2Y70A 2ZQ0A 3UWQA 4IMCA 2P1FA 1IXOA 3IV3A 4UTWC 2DZVA 1IIHA 3L0KA 1NSJA 1TB3A 4K37A 2NV1A 2A2IA 1TV5A 1D3HA 5AHLA 4NJIA 2E09A 4O10A 4IWWA 3PUDA 4O1BA 3GKFA 3LV6A 4FIRA 4GUIA 1TPB1 5CPLA 3TE9A 3FFSA 3OBKA 4KFNA 3LTPA 3WJXA 4O19A 1EX5A 4GXMA 4UXDA 4X2RA 4RK8A 5HJLA 3MO7A 2QCCA 3N73A 3G8EA 3L5MA 3STGA 4N9CA 3FKKA 4NX5A 4JTTA 3E12A 4WOZA 1SW3A 2QCDB 5K7JA 2H8ZA 2CLLA 4MIMA 3W7KA 3PSWA 1JULA 4WUIA 4UFMA 4HT3A 1SZNA 5FEPA 3IIVA 3UYCA 4AHOA 1K02A 3UWYA 4EVZA 4UTWA 4JY9A 4O1CA 5D30A 5I3IA 4JTSA 3DHDA 1SSDA 4UR7A 4FXSA 3TQKA 1OK6A 2EAWA 1DORA 2A21A 3CPRA 1TCDA 1F2JA 1GT8A 1OG0A 3NQ2A 1JRBA 4LW7A 4BI7A 2A6LA 4ORMA 1TQJA 2GQ8A 5KZMA 4J9JA 2WOQA 1YADA 3QF0A 3TMQA 3UWVA 4QJ1A 3C0JA 4XKYB 3R8RA 3NEVA 2E68A 2W79A 4E2DA 4AXKA 3TH6A 1QAPA 3MBDA 1NF0A 1JJKA 1KFCA 1ICSA 1XUZA 1UCWA 2ZZ4A 3HIJA 5D2TA 3LTYA 5FF3A 3QPYA 1FXPA 3L0NA 3M7WA 1JUEA 4XQ6A 1KV8A 3BW3A 3WK0A 2VENA 3LHZA 4MUZA 4O54A 1LYXA 6ALDA 2JKPA 2WQPA 2FDSA 1I2OA 2FFCA 3MYOA 3IVUA 2AQWA 2Y88A 1TSIA 2ZRUA 4XUGA 3QMRA 1QPNA 4OE7A 4XBKA 5G4EA 1KM0A 1VHCA 3GR8A 2NV2A 3MYPA 4UFHA 3G1FA 4DEFA 3W7NA 2RHGA 2H3DA 3W07A 4LVAA 4JD4A 2B7PA 4JEQA 4CLMA 3TXVA 5IBXC 2HS8A 4LS1A 1G7VA 4LWWA 1O94A 1TTQA 4K36A 2JGYA 3UWUA 1LBMA 3NZRA 3INPA 1LROA 4IUOA 3W86A 5CZJA 4RX0A 1G4EA 2ZZ7A 1TPFA 3TC7A 2H3BA 1RZMA 3L9CA 4O13A 3RK8A 1GYNA 3T78A 5DXYA 2PRHA 3A21A 3PBYA 1FDJA 1NF7A 4PEKA 4MZ8A 4HHPA 4UTIA 1D9EA 1J2WA 2JGQA 3B8DA 2CFFA 3EB2A 3S5YA 4CCDA 4UMBA 3TV8A 3HQ1A 4RXGA 4PH6A 4NVTA 3ZR4A 3GB6A 4ALDA 3HJZA 3C4UA 4IXHA 4ONVA 3G18A 3N34A 2Y89A 2ZA1A 1S5VA 4TMCA 1OYBA 2ZZ2A 1ZAJA 1JRCA 3C2EA 2QEZA 3LCFA 4HN4A 4AF0B 3EWYA 4MPQA 4JY8A 3M1ZA 4O0KA 5IBXA 4R33A 5CKSA 5DXXA 1SUXA 5EA9A 2QAPA 3AJXA 3LCWA 4K6AA 2C14A 5F4WA 3SGZA 4K39A 1VYSX 3NO5A 5CSRA 2X1RA 3OEXA 1TMHA 3N2MA 2TPSA 2GPTA 3TROA 1QWGA 4RJEA 2EF9A 3CIXA 1UUOA 1L6WA 4MFDA 3K30A 5F1UA 4CNNA 1IXQA 3TJXA 4P61A 2NWRA 3PY2A 4N9DA 1Z41A 3O6CA 3W7OA 1XBZA 4RCXA 1SZEA 3TA6A 1X1ZA 3W2KA 1H1YA 3NQDA 5DCDA 2E6YA 3M9YA 1G7UA 1Q3NA 4UTJA 1F76A 2CU0A 1MXSA 1RVGA 3B06A 3MI2A 2ZRZA 3TNOA 4EF9A 2BSLA 3WJWA 2FPYA 1LP6A 4L4MA 4JYEA 3OHIA 1EEPA 1KLZA 1XFBA 3HOJA 5AC8A 2O7SA 3T4CA 4KKXA 3IRDA 5L9FA 3GYEA 3M5XA 3HPZA 3QQ0A 1ICQA 1FWWA 3P84A 5LNWA 3IGXA 2ISVA 2I14A 2BTMA 3S8HA 4PL1A 3KVKA 3NPXA 3W2MA 3TR2A 1TYGA 1LORA 2NWSA 3W7CA 1TPUA 3KAOA 2R94A 4O57A 3QW3A 4FHAA 4N02A 2CW6A 4LS2A 2J9YA 5L6UA 3YPIA 1BWKA 2WV8A 4HNTA 1YXCA 3TX9A 2DU2A 1I2PA 2YW3A 3HG5A 4K8EA 3SSJA 3VE7A 1TPC1 3GVGA 4NJGA 2TYSA 2PURA 4IMEA 2PC4A 2ABBA 1FCBA 4RKAA 1H1ZA 2ZZ6A 3IEBA 5LNUA 4JS3A 2J9XA 4B5NA 1P4CA 1XM3A 1A53A 5AHEA 3G1AA 2DJLA 3UY7A 2ZTKA 3ABSA 5A8GA 4O50A 3ABOA 1WBHA 1G69A 4A29A 1W0MA 5EPDA 5DY3A 1TRIA 4IQLA 3W1NA 3SJ3A 1TJPA 4PCFA 2E5BA 1WBJA 2XN0A 3EXRA 3E96A 3QYQA 1NVMA 4O28A 3EWXA 2CLEA 1EUNA 4AEOA 1K8XA 5DY2A 1K7EA 3M5VA 5HWNA 4L4LA 3GKAA 2QJHA 1Q45A 4FX6M 1OK4A 3W9ZA 4TO8A 2GJLA 2QCLA 3F03K 3R2GA 3LBMA 3PC0A 1BKSA 3NM3A 3RFAA 3M6YA 4FB7A 2V9DA 1X8FA 4Q33A 3CC1A 1LZOA 3QEZA 2YR1A 3NYZA 4MYAA 3G0UA 3USBA 2GOUA 1ML1A 1KFEA 5LNSA 2Y7DA 5D09A 1XDMA 3NPUA 4CQAA 3HBLA 4D2JA 1ME8A 3W2JA 1XC4A 2AAMA 1FBAA 2Z6IA 3MP4A 5ABTA 4Q4KA 3GDRA 3W1LA 1J5TA 4CQ8A 4QSHA 3I6RA 3W71A 1KA9F 4NZJA 3NQ7A 1LRNA 5AFDA 1P1XA 4PA8A 3KOFA 4WZHA 4Z1CA 5D02A 3ANYA 3MUXA 2HMCA 2V5BA 1WX0A 1H62A 1H51A 1MEWA 5KSWA 3HGOA 3KHJA 2FTPA 5BNKA 3M16A 4HNVA 2DZSA 1PHQA 2QAFA 1L2UA 3HG3A 2GQAA 1IGSA 1QNVA 3LB0A 5EBUA 4CCEA 2QDHA 3L65A 3W83A 1TPEA 3DFQA 2P0OA 3TC6A 3WJSA 1TQXA 3UY8A 1DKWA 3MHFA 3BGJA 1EWEA 3NOEA 3NQ8A 2HS6A 5C54A 3G1XA 2AGKA 2VFFA 2Y61A 3W6YA 3KRSA 3TMLA 5FF7A 1KTNA 4JNMA 4IX2A 2ZYFA 1YXDA 4GBUA 1ZFJA 3PAJA 1SU5A 1LRQA 2B7NA 5HUOA 1OFQA 2YZRA 4LY8A 3SIZA 4LC6A 3IIOA 4ZQPA 4X9SA 3FA5A 3BW4A 4NNCA 1Q6QA 4JIPA 5HMSA 3S1WA 2VEIA 4Z1BA 1KBIA 4ZQOA 4M6VA 2WNNA 3W1UA 4I7VA 1OFPA 3CT7A 3GK0A 3RLUA 1TTIA 5AHNA 2QJIA 4Z1DA 4S2CA 4YCPA 4EIVA 1K7FA 4CCCA 1S5TA 3MMTA 2GUUA 4LV4A 3DZ1A 2A7PA 2DJXA 4N9EA 1VZWA 3W7LA 1FCQA 3NL2A 4UTMA 2X1TA 1JUKA 2YSWA 2NLIA 5EMUA 1L9WA 2VEMA 4FNPA 3IVTA 3NDOA 1SO5A 5F2LA 3RNDA 4MLJA 3FOKA 2XFWA 3EX2A 2Q3OA 2V82A 3BG5A 3WFAA 2VKZG 2R8WA 5E1QA 4G1KA 3DH7A 4EOUA 1VJIA 4NJJA 1VR6A 3G1YA 3PS7A 3P5ZA 5LZLA 3EWBX 3EX3A 2E5DA 2G97A 5D2XA 1N8FA 3IGSA 3OVPA 1GG0A 3KRUA 1JCMP 3KXQA 4LU0A 2H8XA 3CEUA 3MP3A 4LVBA 1H7WA 2BWGA 3R13A 4TMBA 3BGGA 4NJHA 2J9ZA 5DN1A 2QR6A 5F2MA 4WXZA 1ZY9A 3MI3A 3C3NA 3CEPA 3R5EA 2G95A 1WDWA 4UFKA 1ME7A 4UMAA 2Y63A 5FESA 3W88A 3Q58A 3KX6A 4IOTA 4YL2A 1VGAA 3TXZA 4AWTA 4BR1A 2A5HA 2LLEA 1YPFA 2G96A 1IXNA 4LTSA 7TIMA 3FLUA 1K03A 1ONRA 4S2BA 2Q8ZA 3W7EA 3NG3A 5HULA 2QF7A 4N4QA 3EXTA 1PHWA 2ZA3A 3NAVA 2I1OA 2ISSA 3GDLA 1EP3A 1X6UA 2D73A 1AL7A 1TTJA 4PODA 5U4NA 3W1XA 2G5WA 2QUVA 1W1ZA 1LBFA 3A5VA 4NXKA 2DORA 4WOQA 3L21A 1HTIA 4RZ4A 1GQNA 1H50A 1TO3A 3OVQA 3GAYA 2WSQA 4JTKA 3OA3A 1VCFA 4UNKA 3C52A 2NUYA 1LTDA 4KWVA 3W7PA 4DF1A 3W85A 3O6YX 2DZWA 4A2SA 1ZALA 1TPDA 4AHPA 3W2LA 3BW2A 1QDSA 3P8IA 2OZ0A 3V1PA 1FWSA 2C0AA 4UFLA 5K3VA 2OCZA 2UV8G 1PVNA 1TIMA 1N7KA 2CZEA 1GTEA 1F73A 2WKJA 3G1SA 1MZHA 4BI6A 4O11A 1A5AA 4BF9A 3NQ6A 1EPXA 1KFJA 4JTJA 5LHEA 3M0ZA 4IMDA 3EWWA 3N2XA 4JTIA 3I7RA 3FYPA 4RR4A 3SGUA 1FXQA 3BK0A 1VH7A 2C16A 1A5CA 3BARA 4OU1A 3NQMA 1Q6OA 3HF3A 2ZRVA 1R46A 4RXFA 3A23A 4Y9AA 3H55A 1OX5A 4ML9A 3MHUA 4UIOA 4W9TA 4WD0A 1OJXA 3P8JA 3MJYA 4N4PA 4LS0A 3FJLA 2TRSA 3GZ3A 4O53A 1GEQA 1SW0A 3M41A 2BLEA 1GVSA 2QCDA 3DGRA 3W76A 1SFJA 5LHFA 4O15A 3B03A 1JCXA 3DFPA 3STFA 1T8XA 1EP1A 4CNOA 3UWWA 3DKJA 2VFEA 3NPVA 4H6KA 3GDTA 1F5ZA 2Y7EA 3F1QA 1JCYA 5K9DA 2Z2UA 3HG2A 1Q6RA 1AK5A 6TIMA 3B05A 2GVJA 4QITA 3LHUA 3RF9A 3UZJA 2ALDA 1G4PA 1QOQA 5SWUA 3LHVA 3C61A 2YFNA 5G2IA 3TSMA 3W7JA 1YTKA 2E6AA 1SSGA 3DENA 3QPZA 3BG3A 4O12A 4QQ3A 5CSSA 5D03A 3DFOA 4LRTA 2RKXA 1DQXA 2CLKA 3G1HA 4POCA 4XKYA 3S0CA 3LDVA 3I7QA 3P62A 5D2YA 1QPQA 4LUJA 4O4VA 4Q32A 4JYDA 3W7DA 1H7OA 3NVTA 4BI5A 1C8VA 4GUHA 4N2YA 4HPXA 2X1SA 3O16A 3VKJA 3CHVA 3LHYA 4NX0A 4PL2A 3BLFA 1EP2A 2BXVA 1A50A 2C6QA 3IIXA 5AOUA 2YGYA 1HO1A 3W7RA 3LHWA 5I3GA 4LRSA 3EKZA 5I3HA 4O16A 1KM4A 2EHHA 5FF2A 2GVGA 3PBWA 1I2NA 4TIMA 1VCVA 2QCMA 2FPTA 2FB3A 1JQVA 3G0SA 2YYUA 3OVRA 1OF8A 4ORIA 3QMSA 4K7YA 4Y96A 4FNTA 1VYPX 4OGZA 1H7RA 1L6SA 3TFXA 3LLFA 1SR9A 3W7HA 4JGDA 5CGQA 1SO3A 1OFAA 3CM4A 1A5BA 4KWWA 3M43A 4RLIA 4OBTA 1DOSA 2EKCA 4FIQA 4MFEA 1FWTA 3L5AA 4FEZA 3FKRA 1SW7A 3QMTA 1XKYA 3WK3A 1XI3A 5KZDA 5HQEA 4P2VA 5LGZA 5K9XA 3A9IA 4LC8A 1YPIA 4DO4A 5AHIA 5K4XA 1W3NA 3P80A 1RD5A 1QCWA 3TSBA 4JTGA 3B04A 4GUJA 2ZTJA 5H2ZA 2VC6A 1BTMA 3HPXA 5HNRA 3CB8A 1JCNA 4JN6A 4NU7A 1GJPA 1HL2A 2PCQA 2EGZA 3DU0A 4GC4A 4E2BA 1HO4A 1KFLA 4FO4A 1JQXA 4AF0A 3O15A 3LHTA 4QNWA 4WY0B 4JDBA 4GWEA 1TPH1 3W1RA 4DBDA 1LOQA 1CI1A 2IQTA 3EX4A 3ATYA 4HNNA 1PE1A 4UTUA 4M19A 1KV5A 3A5FA 5KITA 1EB3A 1TJRA 2B4GA 2B7QA 3LTSA 4FX7A 4AVFA 3IIZA 1VYRA 3W84A 1DL3A 3IIPA 3LCGA 4NUWA 3QSTA 1W5QA 4IPIA 2QCHA 1AW5A 5KINA 5CPMA 2CZ5A 5E0KA 1XL9A 3PF3A 1IXPA 3O06A 2R91A 4EF8A 1B4KA 4MY9A 4OWGA 3UXAA 2C3ZA 5K9CA 4K7VA 5G4WA 2FQIA 3G0XA 2NUXA 3P81A 4I7WA 1DBTA 4HKPA 4GUFA 1PS9A 1O5KA 2E77A 2V5LA 2V30A 5AHFA 2WSRA 2FJKA 3CWOX 5H91A 1B4EA 3TIMA 4JR5A 3CLMA 4DPQA 2YXGA 2FPVA 3B4UA 3W75A 1AG1O 3S5OA 1WOAA 1WAUA 1M7PA 2CLIA 3QM3A 5FEZA 4ZQMA 1I4NA 2DP3A 3DFSA 3GXNA 3TKFA 2FLIA 3DKLA 3CQ0A 1LOLA 2YYTA 3BO9A 5LKYA 4HSNA 1LDCA 1VRDA 2A7NA 4O1AA 4NQ1A 1KM5A 3PB0A 3GLCA 4UFIA 5LNVA 1GTHA 3SI9A 3GDKA 1K7XA 3T7VA 3PBUA 4ZQNA 1WV2A 3W22A 3B0UX 1SPQA 1ADOA 2CZFA 3S9YA 3FYOA 1M7OA 1H5YA 4R53A 2JKAA 1ZCOA 3M47A 2WNQA 3UZ5A 4H3DA 3QFEA 1D3GA 4UTLA 1F7BA 2Q8LA 3QRHA 5HWMA 3HMJG 2A1YA 4NXSA 4BK9A 4LV9A 1YDVA 2CLHA 1SZGA 1KM3A 1Z42A 3LXBA 1QMLA 1WQ5A 5CZTA 2J6XA 4DO6A 4OT7A 3NQFA 1QOPA 3A22A 3TFCA 1LM1A 1OX4B 3IGUA 2C1HA 3QQ1A 5G2HA 1ZAIA 3W3OA 1O60A 1FY6A 4PTNA 1DJQA 3M44A 3W7IA 4YLWA 2Y62A 4X22A 2VEKA 3E49A 5EY5A 1G4TA 1FDYA 3M5YA 4Z0SA 3EKLA 4MJZA 3UPWA 4A2RA 2ZRYA 3EWZA 1PIIA 1UB3A 4UUIA 5K2ZA 3DFTA 1DQWA 3ABRA 3GIYA 5CZSA 4JX5A 3I68A 1U5JA 3NL3A 1TPWA 3GXPA 4FNSA 4JTUA 3TDFA 3KFTA 3EX1A 1Q6LA 3E02A 1GPWA 2QCFA 4ZL1A 3TK7A 2GQ9A 3P82A 2V2CA 4ZZ9A 3T44A 1PV8A 3CWNA 1THFD 3THQA 5AYZA 2DZUA 4H4IA 3MHGA 1TRDA 3GNDA 3W1QA 1KM2A 4M7TA 3JS3A 4QNEA 3G8RA 1MO0A 1OX4A 1XBVA 4O0ZA 5TIMA 5BOOA 5D2WA 1AMKA 1CX9A 3HB9A 3C6CA 3NGJA 4UC5A 1W5OA 2C15A 4AWUA 3UXDA 1MSSA 5I3JA 2Y7GA 4E0CA 1R2RA 5EKYA 5DBTA 3VCRA 1AL8A 3C2FA 5C2XA 1B3OA 5E93A 3S5ZA 1SO6A 2J24A 3H54A 1FUYA 2RFGA 4IPJA 3W74A 2XN2A 4U4MA 3W73A 3LRLA 1L6YA 1QPRA 1W37A 3ZS4A 3TW7A 1GZGA 5CPNA 1IF2A 2RDUA 5I3KA 4AMAA 2DZXA 1KM6A 4C1KA 1JCLA 2VELA 1A5SA 2E6FA 3W72A 1R47A 4Z08A 4UNLA 2NX1A 3TSDA 1RV8A 4TX9A 2VFHA 3BPWA 3U6WA 4DPPA 4NNBA 4LVDA 5DLCA 4AB4A 2QKFA 1VQTA 1UBSA 2YFOA 4K8HA 4CNPA 1BWLA 1W54A 2Q3RA 5T26A 4TR9A 3FJ6A 3QZEA 3TQVA 4GJ1A 3NQEA 3BG9A 1VPXA 3NZ1A 4NZFA 3VE9A 2Y6ZA 2E1DA 2DZTA 3LX9A 3TQ0A 3LLDA 1C9DA 1FCVA 3PWAA 5GVJA 3PULA 2A7RA 1LBLA 2RDWA 4Z0JA 3VNDA 1ZNNA 3W2UA 2OMAA 2OX1A 5HUPA 3O07A 3CIWA 3P67A 1LLWA 3E9AA 4WXYA 3W1AA 2WJZA 3DXIA 4IMGA 3SY5A 1FQ0A 1M6JA 5HR6A 2JKEA 1DJNA 3G22A 3L68A 5KTLA 2WO5A 4MZ1A 1C29A 1W5PA 3NQAA 3M5ZA 5HWJA 1AW2A 1OF6A 3U2OA 1W3IA 1N55A 3H53A 1RR2A 1O5XA 4IXXA 1XCFA 3ATZA 5CPOA 5F4XA 4NJKA 4DQWA 2FB2A 2PRLA 3PUEA 3HGJA 1KTBA 3RLVA 5BW6A 1TV7A 4JDYA 1GYLA 3G3MA 5CG7A 4ZVJA 5C5YA 3SW6A 1MEIA 1H7NA 2PRMA 4M7SA 5AC7A 1I8JA 1HFBA 3ABQA 4Y90A 5D05A 3L66A 4O18A 2NX9A 3ELFA 2CLFA 4XWUA 2J27A 3NL6A 5EYWA 2O7QA 3NM1A 1P0NA 1WXJA 3JR2A 1PCKA 1ZJIA 4QIUA 4OV9A 5LNRA 2VFDA 2CLOA 1ICPA 3WK1A 5TQLA 2OT0A 1G6CA 1H60A 5F1VA 2QCGA 5FF0A 3HG4A 2V2DA 4YWIA 3NXFA 4FX8A 4JTLA 2A6NA 3DI0A 4GE8A 1XBYA 3G3DA 4EWND 4AAJA 3STEA 5DCEA 5AB3A 3P61A 2VEPA 1NEYA 1EWDA 1K8ZA 1NAL1 3S6DA 1K8YA 2QCEA 3LXCA 4GRSA 2ZZ3A 4N9BA 5G1YA 3Q2DA 2ZCGA 4UCGA 3IVSA 4MJMA 1V7YA 1DHPA 4I9AA 3STCA 3L67A 3BVJA 3N9SA 4MYXA 4DXVA 2NXGA 2ZBTA 3U8GA 3S5NA 1KW1A 3W1MA 3GAKA 3NL5A 2Z0IA 1W5NA 4N6FA 3TU9A 2ZRXA 5D38A 5AYYA 2E6DA 5BRBA 1I45A 2ZA2A 3NNTA 3P60A 1PL9A 2HTMA 3DI1A 3P5YA 4K38A 4RV8A 4YXGA 5HR7A 3LI1A 5D37A 4UR8A 1UUMA 5AYXA 2HSAA 1WYIA 4ADUA 5D33A 4FXRA 1TPVA 3PR2A 3G1VA 4O14A 4FF7A 4X3ZA 2V8ZA 4U28A 4LT9A 1OX6A 1YTDA 1F74A 2WNZA 1SQ7A 1J4EA 2YPIA 3CU2A 3LV5A 1DV7A 3HGRA 3KRZA 5J5RA 1UASA 2WSYA 3G1DA 1OHLA 1P0KA 4AH7A 1EUAA 3BLEA 4ZQRA 1B9BA 1FDZA 4CQ9A 1IIGA 2BX7A 3P7YA 5BMWA 1Y0EA 3HGSA 3DFNA 1F05A 4MY8A 5MHBA 4JYFA 2V0TA 2H6RA 1SFLA 3T55A 4PFMA 3HO8A 1OYAA 1XUUA 3WK2A 2W0UA 4JIQA 3F4NA 4MLRA 2ZDRA 3NQGA 3B0VC 1ZHAA 4XZ9A 5F2IA 1GVRA 4QAIA 4MZYA 3LOTA 1OFOA 4XTIA 4YMZA 2F7FA 3Q37A 5D2VA 3L5LA 4BWLC 1X7FA 3C2VA 5DELA 4UMCA 4WX2A 2QUTA 3UQNA 1Z44A 2E5CA 2ISWA 1G67A 4IGHA 2GVLA 5AN7A 2F84A 3W7GA 3PUOA 1SO4A 1O95A 5IM51 3N3MA 3V75A 1W3TA 3NA8A 1JUBA 3NPWA 1W5MA 3VFLA 2WPBA 4NNAA 2JBMA 3I7SA 3MI6A 4A21A 1H63A 1YYAA 4LOCA 1VLIA 4OHQA 1UJPA 2VFGA 3EWUA 3QW4B 1FWRA 3TAOA 5FF4A 5TBOA 3PBVA 4E38A 2EPHA 1ZAHA 3P74A 3QH2A 3O05A 4OV4A 4UTTC 3RMJA 4XTDA 5F4SA 3LCXA 4ICNA 2VOMA 3LERA 4JICA 3OG3A 3SFKA 1DVJA 1X1OA 4IX0A 3D0CA 3ZWSA 2TMDA 5HINA 1QFEA 1RQHA 1R2TA
chains in the Genus database with same CATH superfamily
1YE6A 3N14A 1OCQA 1HX0A 1CB7B 3WNLA 5A95A 3WEOA 2BVWA 2Z2AA 2B7OA 2BZNA 3NUKA 4LUIA 3MBFA 4NF7A 1TG7A 3UPMA 3NVDA 2V3DA 5G2WA 1TZ9A 3PZIA 4HMCA 3UGRA 2QHAA 4G2DA 2QGYA 3WKZA 4L5ZA 4XAFA 1KB3A 1MUWA 2WJDA 3CV1A 5H1WA 1JIBA 2R24A 3BWWA 2ATMA 1KBLA 1V8EA 1J10A 1Q7MA 3POHA 3C56A 3CHEA 3DERA 5KMYA 2I17A 5M1TA 9XIAA 1POKA 4TTUA 4AG0A 2JEQA 3KP1A 3PG9A 4HMDA 1KGWA 1GVYA 3P93A 2NZLA 3MW7A 5ECUA 3LCHA 3MWAA 2GDQA 3EMZA 2X30A 1JDDA 1S3HA 1M5WA 3LU2A 1W56A 4DUXA 4ZQCA 5M2FX 2Y8KA 2Z29A 3EEGA 2C13A 4GIEA 2QF8A 2H90A 2IUZA 1TJ0A 3PJUA 1YTEA 3ANVA 5EGRA 2QDGA 3SQLA 3CJPA 3QR1A 5FSEC 3LRKA 1RQEA 3V18A 2FVLA 3BLKA 4RE3A 2D0FA 1KM1A 2V69A 3EXSA 4I5XA 1LLZA 2F61A 1UJQA 5G1TA 4QM1A 3QHMA 5EMKA 4G7EB 4AY7A 2C18A 4IL2A 2XM2A 5E09A 3FIGA 3STPA 3WG6A 4I8DA 3RGTA 5I02A 1J0YA 3KTXA 3MP5A 2OO0A 4J4KA 1VPYA 1D2KA 3UCCA 3SCSA 3IJ7A 4R7JA 3T40A 1YXYA 3ZOAA 3TWAA 4JTHA 4NASA 3RCNA 4KF1A 4C1LA 2VT0A 3LBOA 1F6KA 5ABFB 4B9ZA 4WJEA 3S1XA 3VZYA 4B15A 1H7XA 3VKKA 4AYSA 1QUMA 2RDTA 4CD6A 1B57A 4JPGA 4ATLA 3L0GA 2P5NA 2ZRWA 3TUUA 1LWIA 4TQTA 4PMXA 3VZXA 4HOXA 4LVGA 3WQDA 1RCOB 1F07A 4Y8FA 3CAVA 3W2NA 3OIXA 4LVFA 3W87A 2V81A 1J18A 2DH2A 1KLYA 1LRTA 1AW1A 3MO4A 4MB4A 1OABA 4DF0A 3R79A 3OVGA 4H9YA 2QXWA 4NAEB 3AUOA 2HDJA 1XP3A 1GQLA 4ATDA 2RJHA 4AZ5A 4H9XA 2Q8XA 3ZT6A 3KVLA 3WBWA 3MB9A 4OKDA 3E2SA 3T42A 3K8MA 3F7JA 1D8WA 3FJNA 3FN9A 2FHFA 3H21A 3LZ5A 1J6PA 3LBCA 3WD2A 3KWSA 1QNSA 4RZ5A 3I65A 3T2PA 1W17A 3CHFA 4NL1A 1NFBA 4JTRA 1PKLA 4IQEA 1WA3A 3I6TA 3KLLA 3PVFA 2NUWA 1XDLA 1WO2A 4R9XA 2IPFA 4KEVA 1J5SA 5AECA 1VCGA 1TR1A 2HE8A 2J7CA 3MV11 3TAKA 4A22A 3RR1A 4AWSA 1HJVA 1P5BA 2VC5A 2Y1HA 2YL8A 3DYPA 2X16A 5LXXA 5FEWA 2Y24A 4IP7A 1FWJC 1GOKA 3EWCA 4QLLA 1NU5A 1A4MA 3PB2A 3WFZA 3E0IA 1R30A 5LSMA 4Z1AA 4IFKB 1H61A 2E28A 1IE7C 1I2RA 3TLQA 3UWEA 2ZUTA 3W1PA 1RALA 2P10A 3DAQA 2P53A 3NZQA 3QSRA 3GY1A 1OY0A 4HP5A 3VKCA 4DX3A 1GWJA 4E2OA 2TSYA 4XBSA 2NX3A 4JCMA 4BF5A 4DYEA 3RMEA 3VD5A 4HNOA 1Z48A 3B0YA 1E0VA 2WKGA 2Y70A 1GQIA 2VWSA 3WNOA 1ZBWA 1IXOA 4UTWC 1IIHA 2VZSA 3L0KA 3QV9A 4W84A 4E6MA 4K37A 3UJEA 2NV1A 3APTA 3ID7A 2QVNA 5E6ZA 4AQLA 3PUDA 2YCLB 3RG6A 3EA1A 5I5RA 1ISWA 5CPLA 4KFNA 4DVOA 3AHZA 2QCCA 1HJXA 3N73A 1J96A 3GIPA 3STGA 4NX5A 3WNMA 1S2WA 3E12A 2Z7GA 1A49A 1V3IA 1SW3A 3IUIA 1E1EA 1G1YA 4GH1A 4DRSA 2ZICA 3W7KA 1GQKA 4GXWA 4HT3A 4JAWA 3AWNA 3S4TA 4AHOA 3UWYA 4GXPA 4UTWA 4JY9A 4O1CA 5D30A 1YRRA 2BVYA 3DHDA 2OQYA 4AX6A 4CVUA 1WXZA 5BOEA 1OK6A 2EAWA 1WPCA 2CNCA 2PA6A 2CERA 2FTWA 1W1B1 1OG0A 3T0BA 1U1JA 4ORMA 3RX3A 2GQ8A 4LGXA 2VYOA 2WOQA 4LCSA 3S2LA 5FKYA 4W7VA 5BWAA 1B3ZA 3QF0A 3TMQA 1HL9A 2FYMA 4QJ1A 3C0JA 4XKYB 3R8RA 2E68A 2W79A 1CENA 1Z69A 1UR9A 1QAPA 3TH6A 3RYSA 1JJKA 3QY8A 3QR0A 4DUOA 1Q66A 1Q8JA 3C3UA 1A0CA 4OJYA 1QHOA 4UQCA 3HIJA 1QNOA 1EC8A 1E9LA 4LEFA 3VMNA 4ZBCA 3CUXA 3WK0A 2VENA 3BLDA 4O54A 1LYXA 2JKPA 1B9ZA 3DC8A 3E1F1 2PDNA 3CAWA 2R1NA 3N4FA 2G50A 2W67A 3GW0A 4V28A 3K4DA 3ZJKA 1JL8A 1GONA 1K9EA 3GR8A 3CPUA 3PNZA 1M65A 5CC3A 4KRZA 2RHGA 2E1WA 5I7GA 1HJUA 3L12A 2HS8A 2HISA 1H0GA 4K36A 3V3WA 4LUTB 5C9WA 4QE1A 5CZJA 2ZZ7A 1TPFA 2J79A 3URAA 3GC2A 1R3SA 2HRWA 1MQRA 5DXYA 1IEIA 5B7ZA 1R85A 1XSKA 4IHCA 4HHPA 5M5DA 3BANA 2JGQA 1S3TC 3ITTA 4PH6A 2ON3A 3PZTA 2Y89A 4D6CA 4YTRA 4UWMA 2GOKA 2FVKA 2RGLA 4H7VA 4YNGA 4R5EA 1UA3A 1GYMA 4AF0B 1BVWA 3EWYA 3UT0A 1E3ZA 4O0KA 5CKSA 2OGYA 1HIZA 5FJJA 4YJ5A 3OLGA 4X63A 2WC4A 1A0EA 3CT2A 1Y5VA 2C7FA 5JH1A 3M0JA 4K39A 4A4AA 4LBSA 3FDGA 5GJPA 1PX4A 3ISIX 2VX5A 1M03A 5IHRA 2PLMA 2WZMA 1QWGA 3CIXA 2PB1A 4MFDA 4Q6JA 4IT1A 2XSBA 5CQ1A 5C9RA 1DWIM 3TJXA 3GIQA 2NWRA 3PY2A 3M0VA 5I03A 1SGJA 1TX2A 3VMOA 4RCXA 1PPIA 7CGTA 1H1YA 1PDZA 2V5JA 3M9YA 1Q3NA 1MXSA 3KCOA 2BBFA 3MV01 1ZLPA 2VEFA 2FPYA 4JYEA 4B91A 2EG6A 1HKIA 5E6YA 2WYSA 3N6JA 5CLWA 2YDRA 3M5XA 3QQ0A 1E9ZB 4ROQA 4ZXLA 3P84A 3IGXA 4MWAB 2A3AA 3S8HA 4PL1A 3NPXA 2XGBA 4GGHA 2FMOA 1C91A 3O6AA 4Q4MA 1VBJA 1CZ1A 1RCXB 4N02A 5L6UA 3YPIA 1BWKA 1R3QA 2WV8A 4HNTA 5XIAA 1TWWA 1O7AA 1TPC1 1DWGM 4I9MA 4QBXA 1S5NA 4NJGA 4TTGA 4IMEA 2F2KA 2PC4A 2DW6A 2HWGA 3WH6A 1MW0A 3IEBA 5LNUA 4HJWA 3G1AA 2DJLA 3UY7A 4V1XA 1RK6A 3ABSA 5A8GA 1WBHA 5B80A 2FHCA 4A29A 1W0MA 2EEXA 3CQJA 1CLVA 3W1NA 1MW1A 1TJPA 4PCFA 3MSYA 2E40A 3KL3A 2GVEA 3AXXA 5LYRA 3E96A 4GIRA 3EWXA 4PCNA 1EUNA 4YWSA 5HPCA 2BHYA 3C0SA 4L4LA 3GKAA 5EFFA 5XINA 1E4LA 5IFTA 3W9ZA 2PI6A 3OP2A 1EQPA 3F03K 1U2YA 2PTYA 2JFEX 1NOUA 3F5JA 3GXMA 1X8FA 4S3DA 3QEZA 4J3UA 4JIHA 3USBA 3G0UA 3DFHA 1SMDA 4JIRA 1ME8A 3W27A 3MP4A 2Z6IA 4D71A 1UR1A 3A12A 2V3FA 1UH3A 3W71A 1L6GA 1B30A 3O9NA 4NZJA 5AFDA 1P1XA 3BH4A 3FGCB 5D02A 4CUCA 3V0SA 3IJ6A 3Q45A 1MEWA 3U48A 3WD3A 4ML4A 4HNVA 1PHQA 1PKMA 1QNVA 3LB0A 3RHGA 2QDHA 3DIPA 3L65A 1UG6A 1TPEA 3HURA 1CLXA 4S39A 4AZ6A 5A6AA 3EYPA 3N18A 2CPUA 5FF7A 5BU9A 4L7ZA 2HK0A 1XIBA 4AZ7A 3WDQA 1FOBA 1GOMA 3PAJA 3T08A 2OGJA 3WF0A 2DSWA 4G7EA 2YZRA 4ZOCA 3GS6A 4ZQPA 4CN4A 2W27A 2WW5A 4JIPA 2VEIA 2BMBA 1MNZA 4M6VA 4S3BA 1C9WA 1TTIA 4GKLA 1BG4A 4YIWA 4IJCA 4NKCA 1BF6A 1K7FA 4B3KA 2DT0A 2DJXA 2V6AA 2PDFA 2G8ZA 4N9EA 1KKOA 1FCQA 4UTMA 1OGGA 2YSWA 3FAWA 5EMUA 1L9WA 3NDOA 1J12A 3XIMA 1LUCA 3RNDA 2XFWA 4JIIX 4WCJA 3CAKA 1NP0A 3WFAA 3WDPP 3BV7A 2R8WA 3W53A 3WNNA 4J40A 4NZ4A 5IHSA 3DH7A 4JL1A 3U2EA 1F3EA 1J2BA 5LZLA 3EWBX 4PUWA 1XLJA 2E5DA 1E4IA 1P0EA 1E0XA 1GW9A 2VRQA 1DYSA 1BD0A 2G97A 3IGSA 1GG0A 2ZC8A 3VOFA 1JF6A 2X7VA 4AVOA 3N11A 4K3ZA 1JEZA 3GVVA 4TMBA 4NAEA 5A8NA 1ZY9A 1JYWA 5CSUA 1BQGA 4B16A 1OSEA 2Y63A 2UWFA 2VP8A 3Q58A 3KX6A 3HQNA 1GHSA 3TLLA 3TXZA 1VGAA 1YPFA 2X0YA 1Z9AA 3QLDA 1R8LA 4S2BA 4O1EA 4ECLA 2Z26A 1FP9A 1E0WA 2QF7A 2BOEX 3S2CA 4JN7A 5REQB 1EP3A 5JBEA 2WVTA 1AL7A 4WDXA 4XD3A 3SUUA 5U4NA 3W1XA 1LBFA 4WOQA 2ZE0A 2YA0A 1GQNA 1TO3A 2QGHA 3OA3A 3C52A 3W7PA 4DF1A 3W85A 4AIOA 5FJUA 5LIXX 5BCAA 3O6YX 1VAHA 2BOGX 2OLHA 1ZALA 2VGGA 3RLGA 1TPDA 3TTYA 4PBGA 4RPQA 2Q71A 3BW2A 4IFKA 1QDSA 2OZ0A 4RL3A 1W2VA 4IF2A 3CZKA 1FWSA 1US0A 4KEZA 1Q6EA 3MVIA 2DIKA 1TIMA 3UZWA 3H12A 4J3TA 3VOGA 1X97A 2YOCA 3RCMA 1F73A 2WKJA 2GK1B 1CXHA 5BRPA 5DMNA 4JNYA 3V4BA 3EWWA 4JTIA 5DX7A 1QI0A 1VH7A 1R46A 3VNZA 2ZUMA 1DJYA 4HA1A 4J3XA 4Y9AA 3U0HA 3PPCA 4KGJA 5CCZA 4H8HA 3WEMA 4W9TA 4WD0A 4QTGA 1FWEC 3P8JA 3MJYA 4FXFA 3SUTA 1UA7A 4O53A 1EA9C 3KWXA 5JH2A 3AHXA 4XISA 3W76A 5CSYA 3SEPA 1CXIA 2YXOA 3B03A 1JCXA 3OIHA 3STFA 1T8XA 3VUSA 1TWIA 1XH2A 2MANA 2VFEA 4XBJA 1Q6GA 2NVAA 3GDTA 2XG9A 2Y7EA 4NILA 2IKGA 1Q6RA 4H6QA 2F6XA 1AK5A 3BAIA 3K46A 2CYGA 1AQMA 1XRFA 4ZOEA 1Z7AA 2A79A 3LHUA 3TOPA 2ALDA 1G4PA 2OLAA 4IQDA 3C61A 3TN4A 1SSGA 1M3UA 4ERGA 3UJRA 1BYCA 1N82A 4QG8A 1DQXA 4XKYA 3WQGA 3LDVA 4I9TA 5D2YA 1QPQA 3B8TA 1BQCA 4QQUA 3NVTA 4GH3A 4J35A 1P6WA 4PULA 3AHVA 4HPXA 2X1SA 1OG6A 5C70A 3VKJA 3CHVA 3BLFA 4JKKA 3PTMA 1AH0A 3BGAA 1CT5A 2C6QA 3VU2A 1XGEA 2YGYA 1QT1A 3PFMA 3LHWA 5XIMA 5I3HA 4O16A 1KM4A 5FF2A 3N4EA 4TIMA 3LSBA 2FPTA 1HGYA 1PBGA 2EJAA 1ITQA 3OVRA 1OF8A 3EOEA 3QMSA 2BDQA 2VTFA 3SQMA 3RJYA 1H7RA 6TAAA 1L6SA 4R88A 4UQBA 2BODX 3W7HA 1EYWA 5CGQA 2QNEA 4KWWA 3M43A 4FIQA 3VIKA 1XPYA 3L5AA 3ZQ9A 1XKYA 4I3GA 3WK3A 2OEMA 2W91A 3FX4A 4P7OA 3A9IA 4DO4A 5AHIA 1W3NA 3DC0A 1QCWA 4LANA 3TSBA 7A3HA 4GUJA 1Q13A 3CH9A 1CWYA 5HNRA 3H2NA 1HL2A 4GYFA 1Q5MA 4GC4A 4E2BA 1ECEA 1D8CA 2BGNE 1IWBA 1JQXA 4AF0A 4Z42C 4WY0B 2WHMA 4JDBA 3WH7A 1R3VA 3W1RA 3CZGA 3GG0A 1CI1A 3FXGA 3EX4A 3O0KA 1Z6KA 5EU9A 1N8IA 1KCKA 4MWAC 4Q6XA 4WEVX 1JNEA 2B7QA 2J8GA 1LF1A 3K8LA 4AVFA 1BLIA 2J62A 3IIZA 4XSLA 1Q2RA 1Y5WA 4JHZA 3W84A 4C6IA 2VC9A 3RCYA 1W9XA 2ZXBA 1W5QA 3R58A 2OQHA 3UG8A 3WLJA 1IXPA 1WKEA 3FW6A 2DQWA 2R91A 3GH4A 2XVLA 3QPEA 1SJAA 2XWEA 4YTTA 3A47A 3SN4A 2PUZA 5I06A 1R9ZA 3VNKA 4R3UA 3VVGA 1BGGA 1C92A 4H9UA 2E77A 1DXEA 2V30A 3SRHA 2FDMA 2NT1A 4K1WA 3VOCA 4DPQA 4J3WA 1BTCA 2VQTA 1AG1O 3S5OA 3OZMA 1B3XA 4GLEA 4MWAA 3FK4A 4GX8A 3CPGA 4ZQMA 1I4NA 2DP3A 3PTQA 3DFSA 1UKSA 4NIRA 3DKLA 1LOLA 3M0KA 1EIBA 4HSNA 5HA7A 7XIMA 4O1AA 3WQCA 2ANUA 4UFIA 5LNVA 5EMYA 3PBUA 3B8WA 4GI4A 2E67A 4GHRA 3KS6A 5LIYX 5H8UA 2PWVA 4X61A 1AD1A 3PWGA 3UZ5A 4PSPA 4XO7A 4FAMA 4XD5A 5HWMA 3HMJG 3QLLA 3VD3A 4BK9A 1U1HA 4ZTYA 4QE5A 2RJGA 1V0MA 4GYJA 1A5OC 1QATA 4DO6A 3ZM8A 1PDYA 1LT8A 3WH5A 5CLTA 2PCEA 1EOKA 1LM1A 4PRRA 3QQ1A 2IXVA 5G2HA 2PTDA 3P0WA 1UD5A 1X6LA 3I6EA 3ARPA 4L80A 4PSRA 4BQ2A 3VIIA 4IMAA 3VNJA 3ZR6A 1G4TA 1FDYA 3M5YA 2OQLA 4Z0SA 3EKLA 3UPWA 4A2RA 4W93A 4Z2LA 2MUCA 1GJWA 4UUIA 2QMJA 3WDIA 3DFTA 1TZZA 3R7MA 2J4GA 2HNHA 1U5JA 1TPWA 4F0MA 4JTUA 3D3FA 3KFTA 4C6BA 3NO3A 3QHOA 1GPWA 4ZL1A 1SVDA 2OU4A 2QQ6A 1SMAA 3LZ3A 5AYZA 5DANA 3FGCA 2J7BA 4H4IA 3MKVA 4Y7EA 3U7VA 3VKAA 3PBGA 3MHGA 3OYZA 4FI4A 4DN1A 4CD7A 3JS3A 3G8RA 3IUHA 4XD6A 1RK5A 1OX4A 1A5NC 4O0ZA 1AMKA 3R4IA 4JHMA 1CX9A 5LA0A 3NGJA 2C15A 5D4YA 3N2BA 4OOUA 2PP3A 3WQOA 1FFQA 1PX8A 4B3LA 5EKYA 2R9RA 2WPGA 2WJEA 3C2FA 1B3OA 2QPXA 4F2BA 1YHTA 3ITYA 4ZO7A 4MB3A 4LF1A 3U4FA 3LRLA 1W9UA 3MSDA 1XGZA 2HVMA 1EJRC 1DWAM 2XZ9A 2VELA 3KRBA 3W72A 4ICCX 2G3JA 4LPCA 1C8YA 1I9CB 4F0LA 3I3DA 4RNIA 1E72M 4LVDA 5C8BB 4W88A 2QJMA 1UBSA 2UY2A 4WIWA 4AZBA 1ADSA 4CVWA 4CNPA 3CMFA 3QOMA 1A3XA 3C0QA 2Q3RA 3M0HA 3TYAA 8RUCA 4TR9A 2G4FA 5A2AA 3NQEA 3BG9A 1VPXA 3VE9A 1Z32X 3ARTA 3LLDA 3AMKA 1EHNA 2Q09A 3H2CA 3LENA 4XAZA 4R9OA 2RDWA 3VNDA 2POZA 2Z24A 4GO8A 4X60A 2Q02A 5HUPA 1I0BA 3CIWA 3P67A 1VEMA 1LLWA 1UWRA 4WXYA 3W1AA 3SY5A 3VIFA 2JKEA 3G22A 4YVPA 1E40A 5KTLA 1KXQA 1W5PA 1OF6A 3U2OA 3GTFA 3H53A 1E1CB 4IXXA 2EQDA 4D6JA 1QU4A 1YIXA 4LYQA 4DQWA 1V0NA 3F2CA 4S3AA 3HGJA 5CG0A 2OTDA 2RUSA 5BW6A 3UP8A 3CQKA 5CG7A 5C5YA 3AXKA 1W8GA 2V68A 4GC3A 4CD5A 5G1MA 3QFWA 4M7SA 1ZGDA 1I8JA 1HFBA 5REQA 5D05A 3L66A 4XWUA 3NL6A 4WJ8A 3CUHA 3NM1A 1WXJA 4J7RA 2CWXA 1UBPC 2WKLA 4OV9A 2VFDA 5HDRA 3WK1A 4E4UA 1H60A 2QCGA 3HG4A 2V2DA 4YWIA 4FX8A 1XBYA 4PUNA 1TWSA 1XV8A 1DTNA 1XCXA 2VEPA 1K8ZA 3PWIA 1ESWA 3CS2A 1K8YA 1E15A 5I07A 1W6TA 4N9BA 5G1YA 1DIEA 3L4VA 4DJDA 5A6BA 2ZCGA 4BKNA 3WLNA 3WLTA 4C6KA 1RY8A 3WY1A 3B97A 4MYXA 1FWBC 2GK1A 4JFVA 5HMDA 2D24A 3AFBA 1Q4WA 4PB4A 1KW1A 3W1MA 4D6EA 3GAKA 5E0CA 6XIAA 1W5NA 4N6FA 1FKXA 4UQDA 1ODUA 4C7GA 3CZJA 4J2MA 2HXTA 3EOSA 4IFOA 3NNTA 3P60A 4RV8A 2HTMA 5HR7A 4YXGA 4KIRA 2ZC1A 3KBWA 1EOMA 4PMOA 1VFOA 4Y9MA 4S3JA 3PR2A 3TN6A 4PCPA 2DV0A 6PTDA 1V93A 4LT9A 3CU2A 4DUVA 3KEHA 1XD1A 1IV8A 1P0KA 1EUAA 3WDHA 2XTKA 4NG3A 4D6IA 1B9BA 4S3GA 1IIGA 4Z2JA 2BX7A 3P7YA 3IJDA 3VAVA 3JUGA 4HGXA 4BA0A 5HJYA 1R9XA 2W0UA 4GI6A 4JIQA 3NQGA 5CJ5A 5F2IA 4PRWA 4Q8NA 4BWLC 3C2VA 5E70A 3UBPC 1Z44A 2XFYA 3VGFA 3OLDA 3UU0A 2ISWA 3W4RA 4IGHA 2PGWA 3PUOA 3NA8A 3NGFA 3NPWA 1W5MA 1B2YA 4AD1A 2WPBA 2AKZA 4NNAA 5CEWA 1A4LA 2YL9A 4A21A 1A5UA 1C7SA 2DSZA 5CBIA 1CLKA 3EWUA 3TAOA 5TBOA 3PBVA 3H7VA 1V02E 2ISFA 3RJXA 3N3TA 4HPHA 3AXIA 4UTTC 1R87A 3LCXA 2VOMA 4LFYA 4JICA 3GW3A 1ZS2A 2DT2A 1XIMA 4DJFC 1ONWA 3D0CA 4A8RA 1SJBA 2VEGA 3A4AA 4CEXC 4BWLA 1B3YA 3Q94A 1OFBA 1XXXA 4JX4A 3LCLA 2A0NA 2NQ5A 3W7QA 3Q65A 4OQVA 2XYLA 5ECVA 2YDSA 2L5HA 3VX1A 5FAGA 4JTEA 1G4SA 4GJIA 3ITOA 4JL2A 3EA2A 1DJHA 1J0JA 3DBPA 1LLOA 3SR7A 3OTRA 1JPDX 5BMXA 4Z2IA 1NDZA 5AVHA 5F2GA 1F6PA 1X8CA 3ZLHA 3BLIA 4IIFA 2EJ1A 3EZ4A 2OVLA 2F6KA 3KVMA 2X2GA 3WBYA 4UTTA 1YDNA 1MZRA 4L61A 4LX4A 1K3UA 2BY1A 2VRJA 1JPIA 3LCIA 4DJFA 3CQIA 1VJSA 1EIXA 3PM6A 1RPXA 1VLWA 1XLCA 4IGMA 1T8QA 3LRMA 1Q63A 4ZMGA 4WY0A 1IR2A 4IP5A 2OT1A 3BC9A 3C2RA 3BCFA 3EOOA 4BEUA 1EGMA 2VXNA 3NQCA 1XYZA 1POJA 4B90A 3THUA 4EACA 2QS8A 2JIWA 4MAVA 4MHBA 1M7JA 1JCJA 3S1UA 3UPBA 1OZQA 1KBJA 4O17A 1VF8A 3A4WA 4S3CA 1BEUA 1E5JA 4HHMA 2R14A 1NWTA 1W1VA 4FP1A 1V3HA 1P7TA 1WUFA 4RDWA 2I9EA 1YNQA 3BJFA 4UTKA 2PDWA 1JR1A 1PWMA 4ADTA 3DHFA 5C6MA 2DVTA 2X1UA 1VS1A 2WZEA 3CAQA 4XG1A 2ADAA 3HMCA 3BTNA 4MGGA 4H9TA 3ZJ7A 4R7WA 1DXIA 4HBKA 3G24A 1HW6A 4QG9A 2GSHA 5EMMA 5HQMA 1EA0A 1OFRA 4MDPA 2PU0A 1LQ0A 1WXYA 4HYVA 1HJWA 4AISA 1W3KA 4LQ1A 4JX6A 3QC0A 2W92A 1XKJA 4ILSA 4WY0F 2PP1A 2IMRA 2YW4A 3NR0A 3WJZA 4LNYA 3TJLA 4O52A 4XZMX 1T99A 3SZ8A 5I3FA 1D7FA 1DEDA 2DVXA 2VGFA 3ZLFA 5IRPA 4L9YA 3CZ8A 4KERA 3IK2A 1BHGA 4AIUA 2X41A 5FEXA 2YX0A 3CHCA 1HNYA 2A4AA 1RJQA 3E0FA 2I9UA 3PN8A 3CBWA 3GR4A 2OLSA 1WOBA 1EJVC 2HXUA 3OZOA 1EO5A 1SJCA 3AS0A 3RX4A 3QBUA 3MSRA 5A3HA 2ABAA 1E51A 3CV7A 4I7UA 2O55A 4L1XA 4XKMA 1CYGA 3SSZA 2VX4A 1O4UA 2ZZ5A 1LOSA 1EPVA 2YB1A 3ALFA 4GUGA 1T40A 2XU2A 3S1VA 5AY7A 2XH4A 2C19A 4PC8A 4UFJA 3GX9A 5D32A 4C60A 1YLVA 4A05A 1GOOA 4NT0A 3PG8A 4WF7A 1GHRA 4AUBA 3U3HA 2IKHA 1RBOB 5MF5A 3QC3A 3CYVA 1Q7QA 1XBXA 4WVXA 1V6TA 2VNCA 4KFPA 3R0UA 4TVUA 1BVNP 2AL2B 4JTFA 2ZFAA 1UR8A 3BOXA 2G3IA 3HZ3A 2O9OA 3QY6A 4AD2A 3TTOA 3U5UA 1WZMA 1RUSA 3QV6A 3KBNA 1QPOA 2WANA 1JYNA 4D1IA 2AMGA 1TR9A 3C2YA 2UY5A 5AZ0A 4B5UA 5BXRA 1T96A 1PCWA 4ERIA 2GL5A 4GIAA 2PWDA 3GXDA 1QO2A 4QGCA 2XDFA 1LWJA 3KVJA 5HMEA 3BLPX 1R2SA 1XRTA 3RU6A 3B9AA 3VM5A 1ALDA 2BGSA 1PWLA 1V6UA 2PE4A 3UWQA 4IMCA 1PO9A 4KCUA 1EF3A 4RE2A 3IV3A 2E9MA 3GNRA 3WF3A 5KZ6A 3UCDA 2A2IA 1V4YA 4Q8MA 4P7NA 1R0MA 1H41A 4IWWA 4KESA 1XG4A 3GKFA 3LV6A 1O5QA 2ZXQA 1RBAA 2YLAA 4PMUA 7TAAA 3LTPA 4WR3A 2X0HA 1RA5A 2EKGA 3WJXA 1ZL1A 4GXMA 6XIMA 2F2HA 3UZYA 4X2RA 4L6HA 5HJLA 3F5KA 3T07A 4FXJA 4HU4A 1B1YA 4GYKA 3G8EA 3L5MA 2OG9A 2DFAA 3FKKA 4JTTA 2NQLA 4HB7A 4WGXA 1UKPA 3FA3A 1FP8A 3DUGA 3RUBL 4DJDD 5A6BD 3VNYA 2PDPA 4WUIA 1R9YA 4IL0A 4K2SA 4M1BA 1FWCC 4QAWA 2XJ7A 4HYWA 2A21A 2ZX7A 1F2JA 4GYPA 1SFTA 5KZMA 5A6LA 4F79A 1B3WA 4KT2A 4ZSTA 1PTAA 4U5KA 4PUMA 3UWVA 2Z28A 3MBDA 4AX7A 3ECQA 3EPMA 1KFCA 3MUIA 1HN1A 1ICSA 1XUZA 3VABA 2ZZ4A 3QKEA 5CJNA 3LTYA 4H6RA 3QPYA 3L0NA 1E1CA 1JUEA 4X0NA 1KCXA 4JQ2A 4MUZA 1VB9A 2FZNA 2FDSA 2ZUNA 5TF0A 3IVUA 2AQWA 4NZ1A 1TSIA 3WDRA 3QMRA 1QPNA 3WD1A 5I0DA 3W07A 4LVAA 2B7PA 1W1PA 3TXVA 3T0TA 4L1GA 1O94A 3BE7A 1LBMA 1LROA 4IUOA 3W86A 1UPPA 1G4EA 4PRTA 4RX0A 3E0VA 3FVDA 1QJWA 4CQDA 3LPOA 3LQLA 2HVOA 1GYNA 2VVNA 1UMLA 3AYSA 2E8YA 2J7DA 1FDJA 4H2HA 3RPTA 4MZ8A 4IUGA 4UTIA 1D9EA 2CCRA 2VDGA 3EB2A 4CCDA 1JZ3A 2WLZA 2TODA 3HQ1A 3TYEA 1RHCA 4MNMA 1V3MA 2XH0A 3ZR4A 3GB6A 1JZ8A 4ALDA 1XIJA 3HJZA 5CGMA 1MNSA 4TMCA 4HNCA 3V0UA 7REQB 2GSJA 3HA1A 3F4CA 2QEZA 2BFGA 3NFUA 5C9XA 3U7BA 5DT5A 2D22A 1NY1A 3AJXA 1L0PA 3LCWA 3S6TA 1EJ7L 2IQ0A 2PDMA 3WENA 4EAMA 3T8LA 3UG5A 4H2CA 2BXZA 1M04A 2OOGA 5JVLA 3MUY1 3XINA 1F61A 1UUOA 4XVEA 3QZ6A 2H9AA 1KGXA 1BF2A 3K30A 4RDYA 5F1UA 4CNNA 1SJDA 5D9MA 1JD9A 1Z41A 1XBZA 1FH7A 2TAAA 5DCDA 4WJXA 3VOIA 1G7UA 1F76A 2CU0A 1REQB 1UWTA 4HTYA 2GUBA 4ZB5A 4EF9A 2BSLA 4L4MA 4E8CA 4DJFD 1P43A 5C9UA 5AC8A 3T4CA 3H2FA 3IRDA 4E3TA 5L9FA 1OD8A 4GY0A 3KLKA 4PYSA 1HZYA 1ICQA 3NSNA 1UH2A 3W28A 5LNWA 3KVKA 4GVHA 4I6KA 4NY2A 4JZ5A 2CHOA 1L8PA 1I75A 4C6FA 3KAOA 3LQGA 4YHGA 3GG1A 1B0IA 1QNRA 2ISDA 1PKYA 4M81A 2EXOA 4TXEA 3BLLA 3FHAA 3S2JA 4P8XA 2DU2A 1ZBKA 4QEHA 2J7FA 3GVGA 2IQDA 4MPKA 2WMHA 1CGUA 4RKAA 1E0TA 5AC4A 3VCNA 1ONEA 5DRIA 3DG7A 5AHEA 1VRXA 2QMKA 4Q7IA 2ZTKA 4ZO6A 5M03A 1E1FA 4ROPA 4UZSA 4C65A 1KWGA 3OG2A 5DY3A 3ALGA 2R1LA 4IQLA 1KR1A 2C1GA 1JG9A 4C5YA 2E5BA 1J0IA 3DG6A 3EXRA 3T2QA 3W24A 4C6MA 2VX6A 3KOXA 1K8XA 1K7EA 3GHRA 4ACYA 4FZIA 3U5YA 1Q45A 1OK4A 5FOOA 3R2GA 3LBMA 4FSAA 4GABA 3ARRA 4HPNA 5I78A 1KXVA 3PZGA 4Q33A 2GGJA 1WZAA 2YR1A 3NYZA 2GOUA 1ML1A 1KFEA 1MDLA 4ATWA 5D09A 2ZXDA 3LK6A 3S1GA 4M80A 5TNVA 5T8GA 3W2JA 2AAMA 1FBAA 5ABTA 1AQ0A 2QVHA 1J5TA 3TCSA 4QSHA 3S83A 1KA9F 4TX8A 3EDKA 4U10A 2UZ9A 1LRNA 2IPGA 1LL7A 1KRBC 1PX3A 2HMCA 3P14A 4B2DA 5KSWA 4JTQA 3ARQA 3HGOA 3KHJA 1BYBA 3N2TA 2EBNA 4AZCA 2V38A 3AXMA 2QAFA 5BYWA 1IGSA 1IHIA 1RLCL 4CCEA 3NQBA 2RAGA 4F2UA 2CHRA 1TMLA 4F2TA 1JPMA 3DFQA 2P0OA 1TQXA 3UY8A 4DBWA 3BGJA 3H7RA 3NQ8A 2HS6A 2AGKA 3P2VA 1KFWA 4GO9A 5C71A 2PS2A 4EXQA 4F0KA 2IKIA 4IX2A 1HGWA 2OSXA 1YXDA 1JDAA 1JDEA 3CZLA 1TA3B 3SIZA 4LC6A 1XIIA 3EA3A 1PTGA 1NDYA 5T9CE 1Q6QA 4GVIA 5HMSA 4ZQOA 2W62A 2WNNA 3W1UA 3CT7A 3GFXA 3V0TA 4K68A 1P0DA 3HJEA 4GQRA 4Z1DA 2PDLA 4GI8A 1ITUA 4S2CA 3T2OA 3M0MA 3MMTA 2VZUA 1QBBA 3H2MA 1TWZA 4MB1A 1VZWA 1TCMA 3W7LA 3NL2A 1TE6A 2XZ7A 1JUKA 2D0HA 3FHQA 3E6EA 4S38A 3IVTA 3M7SA 1XFCA 3MMWA 3EX2A 1CTNA 2V82A 4WKFA 2C1IA 2XFFA 2YKKA 2PDHA 3CLWA 4HZ8A 2XIIA 4EOUA 2Y5SA 3N6HA 1VR6A 2ZVIA 3CHDA 3PS7A 4N42A 3P5ZA 3EX3A 3PTKA 4GJJA 3LMYA 3UEQA 4C6EA 5KEZA 1GEHA 1FH9A 5D2XA 5C9ZA 1A3WA 5DT7A 3IANA 2MNRA 3WH8A 3KRUA 1OINA 4LU0A 2VM8A 3OOQA 3MP3A 4LVBA 3FYYA 4EXBA 1U5VA 4NJHA 4LY4A 5DN1A 2G3FA 3MI3A 4AC1X 3R5EA 2G95A 1IGWA 4UMAA 3B3DA 2VOTA 3W88A 5CAKA 3W26A 1KRCC 1EJWC 5LA2A 4BR1A 4AWTA 2G96A 7TIMA 3FLUA 4Q8UA 1DJZA 1K03A 3B9EA 1W9BM 3W7EA 4W4QA 2BHZA 2I7GA 3GDLA 3T6CA 1E3XA 2D73A 1TTJA 2AL2A 4KS0A 3SJNA 2O92A 3C0LA 3N29A 3GFYA 4XO6A 1X1NA 2PGFA 3RXZA 1S46A 2DSUA 4UNKA 2PDXA 4H01A 4Y9NA 1XLIA 3CXOA 1RSCA 4CNTA 2DZWA 1C7TA 4A2SA 4PMQA 1XIFA 4JNZA 4AHPA 1XW8A 2YBVA 1HVQA 3GTNA 4HCDA 3V1PA 4UFLA 2OCZA 1H0IA 2C79A 2YCKX 2Z1XA 3GSMA 1N7KA 3DX5A 4BEQA 1LL6A 3T4WA 1Y8BA 2V67A 1Q6CA 1KFJA 4JTJA 3M0ZA 4FLRA 4US6A 3N2XA 1UMYA 4CNUA 4REQB 3BARA 3CIVA 3NQMA 1Q6OA 2ZRVA 4U5IA 3CO8A 1EJXC 2REQB 1OADA 4LAUA 3GHTA 2QZRA 4EK7A 1RJPA 3H55A 4RZBA 5GPRA 4Q8OA 4ML9A 2XSAA 3OGSA 1OJXA 4N4PA 3FJLA 2TRSA 3GZ3A 9CGTA 5CH9A 1SW0A 3M41A 1CXLA 4INFA 2BLEA 1SFJA 4TOQA 2PDIA 3GDBA 3AIVA 4W5ZA 2PWEA 4MB5A 1XYFA 3WQWA 3TP4A 4N0RA 1F5ZA 5FAJA 1NDWA 1IT8A 2Z2UA 4C91A 1PJ9A 4M29A 3I3BA 4QITA 5HAOA 3RF9A 4C6PA 3IJ8A 5G2IA 3F5LA 5FD0A 3BG3A 4O12A 4QQ3A 5CSSA 1MI3A 4LRTA 2CLKA 1EC9A 3NWRA 4WRHA 3TW9A 3S0CA 2F9RA 3W7DA 1US3A 4L9XA 1XIHA 5A1AA 3PZOA 4QHRA 1C8VA 3T0CA 2B31A 3LHYA 4NX0A 4G9PA 2P8BA 2BXVA 1A50A 4M8UA 3IIXA 5AOUA 3EEZA 2E4TA 5I09A 3FV9A 1S2VA 1KBKA 4ORIA 2WVVB 4FNTA 1K9FA 1VYPX 2W3ZA 1EDTA 4OGZA 3LLFA 5EMLA 1SR9A 3W29A 3N04A 3HU7A 1HKKA 1A5BA 4ZENA 2XIMA 3GM8A 1OGBA 1MFUA 4BJHA 3GTHA 1V03A 2X8RA 4ASTA 1V6VA 3QMTA 3EPOA 2A3BA 5I23A 5KZDA 3N1AA 4MAZA 4IZGA 1WZLA 4P2VA 5LGZA 4LC8A 3BZGA 5K4XA 3P80A 1YKWA 1U33A 3GE7A 4JTGA 1OIFA 3UXLA 1T6MA 2X2YA 1IZKA 5TAOA 1BTMA 3HPXA 4FOUA 4DHGA 3QGAC 2YCIX 1JCNA 1U22A 3M0IA 1CXFA 2XISA 4H8UA 3BL3A 3DU0A 3RPDA 1OC7A 7REQA 2JIEA 1UPMB 1J93A 2AOSA 1TPH1 4QLKA 3V36A 3ATYA 3I4KA 1AJ0A 3A5FA 1EB3A 2YBUA 2B81A 3GNPA 3AICA 4MTVA 2VCAA 4PUEA 4ZA0A 4G7FA 1G9HA 1UKOA 3WSUA 1E55A 1JGIA 4NUWA 4DUWA 1V08A 4IPIA 1AW5A 1E6RA 3BICA 5CPMA 1XL9A 5KETA 4D6HA 5BXTA 2GZXA 5A6JA 1UP3A 3AMCA 3O06A 4IISA 3F4DA 3VIPA 2OELA 4OWGA 3TYDA 2C3ZA 4GQQA 4DI8A 5K9CA 4K7VA 3OO2A 2FQIA 3G0XA 3LPGA 4KIEA 2OX4A 1HT6A 1KRMA 3MUZ1 1UZ4A 4HKPA 3N25A 4XZBA 4GUFA 1PS9A 2V5LA 5LIUX 1JAKA 2WSRA 4Q22A 4XVDA 5H91A 3TIMA 4JQ3A 3CLMA 4W87A 4O8AA 3LD5A 1WOAA 2CHNA 3APGA 3V35A 2CLIA 3NZPA 3QM3A 3WCZA 4Y2WA 4ZTXA 2SFPA 1H2JA 4B2DD 3OA5A 3GXNA 2VZTA 3TKFA 2FLIA 3CQ0A 4LXFA 2J6VA 1FA2A 5LKYA 3KE0A 3ARSA 2A7NA 3DOPA 1RY0A 5GJNA 1K7XA 3T7VA 1WV2A 3S9YA 1E6PA 1M7OA 1QNQA 2JEPA 2WNQA 3MCOA 3CH0A 1W1A1 3QRHA 4JFUA 5DMMA 5JBDA 1SZRA 2P3EA 4ICMA 4LV9A 4DXXA 2QLYA 1KM3A 3LXBA 1QMLA 3TNBA 1EX1A 4KCTA 4IG2B 1WQ5A 2QDDA 1FRBA 5CZTA 1CGXA 4OT7A 3NQFA 4A8NA 1QOPA 3A22A 3TFCA 4Q8WA 3W3OA 1FY6A 4PTNA 3H26A 3GC5A 1IT0A 3VIJA 2OOFA 3B8IA 4F9JA 2WSKA 4MJZA 3CK5A 5AYIA 1PIIA 3ARXA 1UB3A 5K2ZA 2IS7A 1GCYA 3GIYA 5CZSA 3SM0A 2ZOXA 3UF9A 1EF2A 3GRIA 3HTWA 3I3EA 5H6HA 3HPFA 2PAJA 1UC5A 3OGVA 3MZNA 1IZJA 3EX1A 1E6ZA 3WX7A 2I5QA 1Q6LA 3E02A 1A80A 3NDYA 3T81A 2CETA 3TK7A 3P82A 2EPLX 1J0KA 1FVPA 5A8QA 2QT3A 1R3WA 3D3AA 1TRDA 3CL8A 2E25A 4P7LA 1KM2A 4M7TA 4QNEA 5LIKX 1MO0A 5C2CA 3VD7A 2GGEA 1XBVA 4MG4A 1OEPA 5D2WA 3EWDA 2NVDA 1CXKA 4C6CA 4AZGA 2QV5A 3PFRA 3C6CA 4IPPA 5I3JA 2Y7GA 4E0CA 1XINA 3GBEA 5D9OA 2DT3A 2Z25A 4F9DA 1ZU8A 4IIDA 1RP9A 2ACUA 3S9IA 3VDBA 3ES8A 2ODOA 2J24A 1VPQA 1UWUA 4W8BA 4Z2HA 3W74A 4U4MA 3ZS4A 4F40A 4AMAA 1VFLA 4ZCWA 2XHYA 4F3HA 2CZVA 1VFTA 4LNCA 1R47A 4C6DA 4Z08A 4S3KA 4TX9A 2PDGA 3BPWA 4RNFA 3ZVHB 5DLCA 4XAYA 4HZMA 3OYXA 4FLQA 3WNKA 3AHYA 5A8OA 2WBGA 2YFOA 4K8HA 3TOYA 3VIMA 5DEZA 1W54A 4QP0A 4TVDA 4GJ1A 4U3AA 4UQEA 1XYCA 3NZ1A 2XH2A 2Y6ZA 3TQ0A 1XLKA 3FDKA 2OYLA 4L1WA 2GQ3A 1X6NA 3E38A 1QPKA 4FR6A 2CLPA 4A6GA 4MUPA 3PULA 4YPJA 2OMAA 1DQUA 3TONA 3E9AA 3PJWA 1XHGA 4ZFCA 4IMGA 1TWDA 1FQ0A 1LJYA 1ZBVA 2E0PA 3ZO9A 4IIHA 1ZJAA 3HM7A 3M5ZA 2WHKA 1FWIC 3QQWA 1N55A 4D1JA 1V51A 3GUGA 1Z8AA 3ATZA 3UG3A 1R38A 4Q4SA 4LAMA 5F4XA 2FB2A 4XV0A 4ZO8A 3QYSA 3BDKA 3G3MA 4Q8VA 4DYJA 1CGTA 1K77A 4ZVJA 1RH9A 2P0IA 3TQPA 4ERAA 1F8IA 1DE5A 3W01A 5AC7A 1DJXA 1G94A 1IYXA 1FWDC 3ELFA 3REQB 2AQVA 1ZJIA 7PTDA 1BYDA 1TX0A 2XIOA 5JBFA 2W61A 4TX6A 3NXFA 3DI0A 1HJSA 2J13A 4GE8A 1V6YA 3G3DA 4AAJA 3QY7A 1Q65A 3STEA 4KWUA 4RUBA 4NYUA 1CCWB 2OZTA 2QCEA 2VD9A 3Q2DA 1ELSA 5C0QA 4UCGA 3IVSA 2GJRA 1V0LA 3EMCA 3TWBA 3U8GA 4PMZA 2VURA 3TU9A 3R25A 5AYYA 5JUVA 3GFZA 3N12A 1ZQ5A 2E6DA 5BRBA 1I45A 3P5YA 3RDKA 4UR8A 1UUMA 2E3ZA 3R10A 5AYXA 5CZKA 5D33A 4FXRA 1O6IA 3G1VA 4TV6A 2WMJA 3RLHA 1JZ5A 1OX6A 5FL0A 1W1YA 3LV5A 2YPIA 1XR2A 3QXBA 1V3KA 3HGRA 3PP7A 1UASA 2WSYA 1NELA 4S23A 4P5UA 1OHLA 1HJQA 1CECA 4AH7A 3SDOA 4ZQRA 2O9TA 4QDWA 3DFNA 1F05A 4JYFA 2V0TA 1RBLA 2H6RA 1V0KA 1VFMA 4L9ZA 2PLJA 1BRLB 1DJWA 4PFMA 3CTTA 3HO8A 4V27A 1XUUA 4PUJA 3IS4A 5CAHA 4H1ZA 2V3GA 3OQ8A 1Q8AA 4GOAA 3B0VC 4FLSA 4XZ9A 3NXLA 5E9XA 4MZYA 1WUEA 1OFOA 4RNJA 1HKMA 4YMZA 1XIGA 3WBXA 5AC5A 2ZDSA 4DWDA 4WX2A 2QUTA 4OBSA 1BWVA 1KXTA 2E5CA 2XSXA 4WDUA 4A35A 1G67A 2CITA 3W7GA 4LUSB 1QI2A 5IM51 3AS2A 1JUBA 2ZIDA 1NQKA 3EOLA 4JQAA 2JBMA 3I7SA 4U2YA 1CGYA 3UW6A 4IPNB 1YE4A 1FWRA 3QW4B 3VMPA 5FF4A 3B0XA 4CD8A 3L7RA 2VR5A 3O05A 4XTDA 2E9BA 3OG3A 3SFKA 1DVJA 4IX0A 3D46A 3UA3A 3ZWSA 4D9PA 5HINA 4B5VA 2WVVA 4RDZA 1VP5A 4PFHA 4ZXOA 1UKQA 3RILA 8CGTA 4DF2A 4IJBA 3KP0A 2A3EA 4MJ2A 3ARYA 4IIEA 2QUUA 4IICA 5C2GA 1O1HA 4URIA 1UUQA 2I5IA 2D20A 3AO0A 3S2MA 3SFWA 3N19B 1KFKA 3TTSA 2VCBA 4NHVA 2VZVA 2XUCA 5HNNA 3LXAA 3GH5A 3VGBA 4LALA 1YPXA 4GQ0A 1JPHA 3WH9A 5HK4A 3HPAA 1E0UA 2VGIA 1PKNA 1XX1A 2UBPC 2FMNA 1EDQA 3O63A 3A4XA 3LI0A 1R3TA 2AL1A 4B5WA 1RLDA 1SM9A 4MY1A 4GG9A 1AFSA 1V5XA 1YNPA 1E43A 1IEVA 4N6EA 5CZ0A 1PZ1A 1OB0A 4W5UA 1KWKA 2CIPA 4HNUA 3WN6A 4NI3A 1V77A 3C8NA 5T9BG 3AWOA 5I77A 3SRFA 1KTCA 4DZAA 1TVNA 2DSKA 5HNUA 4HCLA 1QO5A 4MVAA 4HPJA 3FJ4A 2GGHA 4DNMA 5DCBA 1FCUA 3W23A 1OYCA 3THCA 3V5FA 2Y85A 5DBUA 1EHAA 3PSVA 2QCNA 3JU2A 2BOFX 4MOZA 3FS2A 5C7VA 4YCOA 3GDMA 1W1IE 5E9AA 3UD6A 1OVDA 1BG9A 3UWZA 4O4WA 2BASA 1YDOA 4A3YA 2BVDA 3II1A 1S5WA 3TTEA 4GNVA 4R85A 1HUVA 3LS9A 4GCXA 2IPWA 4HK5A 4AHQA 3VDCA 4HPGA 3C8FA 4O1DA 3AIRA 4A8IA 4MNJA 3KM8A 1GOXA 1Y7VA 2FH6A 2QJNA 4G5DA 4AD4A 1LL4A 2OZ3A 2NXHA 2HV5A 2NXIA 5MKGB 2Z1VA 2DVUA 3WO8A 3PJXA 3HPSA 1H7PA 1V6XA 3L4UA 4AD3A 3KZSA 3A24A 2CBIA 1TV8A 5C55A 2HJPA 2Z1BA 4D72A 3PTDA 4L6OA 5AC6A 3FNDA 4OBRA 2V5CA 2W9MA 1TELA 1I2QA 1U83A 3SCRA 2BY2A 4UTHA 3Q4DA 3PZ9A 4ZR8A 4OFCA 4IG2A 3P0XA 1F6YA 1J79A 4RDVA 3R43A 4S1FA 4XIMA 1DE6A 1S5MA 4F4RA 1W31A 2F8QA 2O9PA 3UNDA 4DBEA 2CZDA 4DELA 3VGHA 5KZEA 5D04C 3CZEA 4M6PA 4PMNA 3GNXA 2QIWA 4JEJA 1E9YB 3EX6A 3CTLA 1GVOA 4GY1A 5M3WA 2V2HA 1FHUA 5ABFA 1OFEA 1W9DM 4U31A 2YBTA 3L2IA 5LXEA 3S42A 1UHVA 3W7MA 1EBHA 2FZMA 3MCMA 4OTKA 1LWHA 1E9IA 5A8MA 2CKRA 1TTPA 1GG1A 4R34A 4RZ6A 2FZ8A 1DWFM 3HQPA 3O8AA 4C1NB 4JOMA 3NZGA 1FHVA 2QJGA 3QJAA 3ICJA 1V6WA 1MEHA 1VHNA 4HJFA 2DIJA 4GFSA 1TREA 1VIWA 4FALA 2C8NA 2I5GA 3MANA 2YDAA 1W9VA 4MWAE 3ZFHA 2DPEA 8TIMA 1OFDA 4A3UA 1OIMA 2KAUC 3ZXWA 1DIKA 1EQCA 4AVNA 1UP2A 5JMUA 2PDKA 2VFIA 4H9VA 4J3VA 3R12A 3RO6A 2ZQ0A 3MVTA 4DIAA 3FCPA 3IWPA 2ACSA 1S39A 1E6SM 2NVCA 2DZVA 1HVXA 4ZSUA 3SAZA 4PMDA 1TB3A 3V16A 1NDVA 3TYBA 1D3HA 2D3LA 5AHLA 2E09A 4DM2A 3VIHA 1GOWA 2NLYA 1QXLA 4PB3A 3FA4A 1WKYA 2WC3A 4FIRA 1UZDA 4O0QA 3VDGA 1UOKA 4JBRA 1XPGA 3FFSA 5AYBA 5ABGA 3OBKA 4LB4A 1QOXA 4NZCA 1BPLB 5GJMA 1QK0A 3ITCA 4YS1A 1EX5A 4UXDA 4YN5A 4XZNX 3MO7A 2NQZA 1D7KA 1ODZA 4LEQA 4WOZA 2INEA 3KCJA 3TR9A 1VD6A 4DXKA 5K7JA 2H8ZA 3OBEA 3A13A 4UFMA 3E74A 2YA2A 2FKPA 4GMEA 3UYCA 1K02A 2ZVRA 4JTSA 1SSDA 2DQXA 3TQKA 3W38A 1RP8A 2BNJA 1A5KC 3CPRA 5T91A 1SR0A 2J8FA 3COTA 3AC0A 5ABHA 1Y65A 1K4HA 3CL6A 3ANUA 1YADA 2NQJA 5I24A 2YCLA 5GQBA 2FGBA 1MW3A 2IPJA 1PSCA 1WDDA 3NEVA 3KZPA 4NYYA 4FPSA 4E2DA 4AXKA 4Y9PA 2OEJA 1YW1A 1CGWA 3WF4A 2PDJA 3ZMRA 4HU8A 3L4XA 1NTHA 1UCWA 5D2TA 3VNMA 1G5AA 1FXPA 3KL5A 3M07A 3BW3A 1GOIA 2X40A 6ALDA 3GNOA 1AUSL 2FFCA 3MYOA 3WDJA 2HROA 1W91A 1X39A 2Y88A 3KBSA 3UGVA 2ZRUA 4HA3A 1NWRA 1XLHA 4E4PA 4OE7A 4GQBA 3KOYA 5G4EA 3MPGA 4B3ZA 2NV2A 3MYPA 4UFHA 3UCQA 3W7NA 2WZTA 3OZPA 5JIWA 4LS1A 1G7VA 4LWWA 3REQA 1Q6FA 3UWUA 4GD0A 4WKAA 1KO0A 1O66A 2VWTA 3ZT5A 3CGTA 3WIJA 3L9CA 1OCBA 2NW0A 3T78A 2PRHA 3N2CA 3PBYA 3CL7A 4DWSB 1JXKA 1NF7A 1NOFA 4OVXA 4PEKA 1TMQA 1JXJA 4MKSA 5IXEA 4MNKA 4IFRA 1J2WA 2CFFA 2ZUVA 4UMBA 3TV8A 1P48A 4RXGA 4NVTA 2W63A 3U2CA 2DDXA 2YIHA 1K8CA 4ONVA 3G18A 3FEQA 4ZGYA 4B9YA 2XH7A 4I6VA 3MS8A 2ZZ2A 3C2EA 4Q8TA 3LCFA 4UOZA 4HN4A 4PUKA 4MPQA 3B9OA 1P0BA 4L56A 3M1ZA 3SB0A 4M24A 4R33A 2FZBA 3WLLA 1SUXA 5EA9A 2QAPA 3WQ4A 4K6AA 3AS1A 3SGZA 3KDOA 3NO5A 3GWQA 4LUTA 3OEXA 3N2MA 1XDJA 4DI9A 4RJEA 2EF9A 2J66A 1NFPA 5D8ZA 1CXEA 4EWJA 2EPMX 4N9DA 2PP0A 4CN6A 5D9PA 1SZEA 1YMYA 2E6YA 2GJXB 1W2PA 1WAWA 2WM0A 4UTJA 2J74A 3B06A 3SIMA 2ZRZA 3H22A 1BRLA 3PPFA 3JZUA 4J2PA 3C86A 1EEPA 1XFBA 2Y4SA 3HOJA 1YX1A 4KKXA 4ZODA 3ZJ6A 3WF1A 3FXYA 4PN2A 2VL4A 3S47A 4G8TA 1QW9A 1UIOA 3UR5A 2ISVA 3VK5A 2I14A 2BTMA 3PBMA 3U9IA 1JDFA 3AU6A 3TR2A 1P1MA 1TYGA 1LORA 2NWSA 1BAGA 3GUWA 2R94A 4LUSA 3QW3A 4FHAA 2CW6A 5IDIA 1VJZA 2D23A 2J9YA 1U1UA 2J25A 2HZGA 4PEEA 3WEZA 1XIEA 1YXCA 2PBOA 1I2PA 4HQVA 4E8GA 2YW3A 3BZJA 1FWGC 2RGMA 3SSJA 1E73M 3VE7A 1XRSA 4QS6A 2TYSA 1X38A 2J7EA 3EGJA 4GINA 1ZZMA 2RDXA 2ABBA 1FCBA 4EKJA 2ZZ6A 4H19A 4JS3A 2J9XA 4QX4A 1CIUA 1LG1A 5BXPA 1KGUA 3L4WA 4CU8A 1A53A 1ISXA 5EFDA 4Y8EA 2J8TA 2JQXA 3GH7A 3OBAA 2CESA 3WLHA 1G69A 3HQOA 3LY0A 3D47A 4IPLA 5EPDA 4GK8A 1I6NA 6REQB 4PTVA 1IWAA 3VOHA 3NURA 2PDCA 3BLOA 3SJ3A 4JKLA 3OB8A 2X09A 1WBJA 1PB0A 2WNWA 3H6OA 3QYQA 3AIEA 1GK8A 2CLEA 1XLEA 4AEOA 5DY2A 3AMDA 4U2ZA 3M5VA 4QSFA 1AH4A 4H8VA 3RM9A 3WUBA 2I57A 3PC0A 4F0RA 1BKSA 3NM3A 3M6YA 4DNHA 2V9DA 2XVPA 3K4AA 1FFRA 3SADA 3EOUA 1LZOA 3BCJA 3Q67A 1M68A 3DYMA 1GW1A 4MYAA 5LNSA 4IGSA 3PZUA 4FF5A 2Y7DA 2OWXA 3BJSA 4LH8A 4D2JA 1QASA 2PDBA 4LYPA 4NI8A 2J78A 2QPUA 4FS9A 4RV3A 1D3CA 4GIYA 3UJFA 4PMRA 3HV8A 3ME3A 4PA8A 2PD9A 3KOFA 4WZHA 4G1NA 2V5BA 2WCSA 5BNKA 2PU1A 3M16A 3K1GA 2DZSA 3HG3A 2GQAA 1LUCB 5EBUA 3OU8A 4CGTA 4W7UA 4E3VA 3WJSA 3AQUA 1DKWA 6CGTA 1NH6A 3NOEA 5C54A 2VFFA 3VA8A 3TMLA 1KTNA 5AKQA 2ZYFA 1ZFJA 1W3LA 1LRQA 2B7NA 1GGOA 1OFQA 1F8MA 3GVWA 3IIOA 1E70M 3UFYA 4NNCA 3ABXA 2GLKA 3K8KA 3VIOA 4C90A 1KBIA 4I7VA 1QBAA 2FZDA 2ZWZA 1OFPA 9RUBA 4AEFA 1XSJA 2R1KA 4YCPA 4GGBA 3J7HA 4CCCA 3V5CA 4LV4A 1QI4A 1WDQA 2A7PA 4XK2A 3VGGA 3RN6A 8XIAA 1UOZA 2VCCA 3PUGA 1UR3M 3ITXA 4XD4A 5F2LA 3UZXA 1BVZA 1NIUA 3N15A 4M82A 3FOKA 2Q3OA 1HL8A