2ZZ3A

Covalent complex of orotidine monophosphate decarboxylase d70a mutant from m. thermoautotrophicus with 6-cyano-ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
215
structure length
215
Chain Sequence
b'VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAAFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 85
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz3A00
3I7RA 2WOQA 3I6RA 1JQVA 3NQVA 2VKZG 1TRDA 3W73A 4K39A 3NDOA 3HO8A 2GQ9A 3QPZA 1UBSA 4FHAA 3LXCA 1LRQA 3PG8A 1FWWA 3R2GA 3PY2A 2DZUA 3CIWA 1L6SA 2QUUA 4HHPA 4K7YA 3W7DA 1Q3NA 1HO1A 4GBUA 5E93A 4XZ9A 4TMBA 4UFKA 2VEKA 2V2HA 1W3IA 4CLMA 5D2WA 2A7RA 1I4NA 1ML1A 3QMSA 5F1VA 4LV9A 4KFOA 3GKAA 2CLIA 4I7VA 2WPBA 4FO4A 3PVFA 4AHPA 4AB4A 2OCZA 4AWSA 4IOTA 4GUFA 4GUHA 5DY2A 2ALDA 2JKEA 2R14A 1H1YA 1FXQA 4N6FA 3B05A 4L4LA 1VLWA 2CU0A 4C1KA 1I2QA 1PCWA 1HUVA 2HMCA 1MEHA 4GE8A 3IIZA 3KHJA 3MP3A 3CIXA 1BWLA 2JK2A 5CSRA 1TV8A 3S1UA 1LRTA 4TMCA 1ICSA 3NQMA 1OX4A 2XFWA 4JGDA 4ADUA 1OF8A 1XUUA 3NYZA 1O5XA 3BG3A 2E5DA 4A2SA 1XL9A 4ORMA 5L6UA 2C0AA 2NX9A 1H60A 3W1XA 1V5XA 5TQLA 4UNKA 3L68A 2JBMA 3M41A 4Z1BA 1P4CA 3MI3A 4WOZA 4M5PA 4O1DA 1LOLA 3P74A 5EYWA 1H7OA 4O8RA 5SWUA 2Z6IA 1XM3A 2FPTA 3EX3A 4HPJA 1EP1A 4OV9A 2LLEA 3KRUA 4G1KA 3KRZA 3QSTA 3KVKA 3IGXA 3MHUA 2VEPA 3G1FA 3TSBA 1C9DA 4EF9A 5AYXA 3P5ZA 1K03A 1SO3A 1LM1A 3PBWA 4JDBA 4PH6A 4O52A 1JCJA 1Z41A 3BO9A 4IMEA 4JR5A 3FKKA 4JNMA 1TTPA 1S5VA 2VELA 3P82A 3Q37A 1LDCA 4MLJA 3GVGA 4BI7A 2HS6A 3HGOA 4UMAA 3W2NA 4O53A 1QOPA 3LCFA 3S42A 1ZAJA 3EX6A 4CNNA 3L5MA 4FXRA 4UTWA 1RQBA 5K3VA 4JEQA 2IQTA 3GYEA 3S5ZA 3TXVA 2VEIA 1YDNA 5DELA 3QYQA 3DZ1A 4AWTA 1QWGA 1XDMA 2QCLA 4RK8A 1XFBA 5K9CA 3B0PA 1I2OA 1KM4A 1SZFA 4O11A 4LVDA 1T96A 2GPTA 3USBA 3CTLA 1OHLA 1LTDA 4RZ5A 3DI0A 1FDYA 2Y85A 1N7KA 2WNZA 1EA0A 1AW5A 1FWSA 1SSDA 2Y7EA 1D9EA 4JYFA 3NA8A 4JTUA 4R33A 3KX6A 4K6AA 4IJBA 3GNNA 4O57A 1THFD 1W1ZA 3HPZA 3W7PA 3PC0A 1TJRA 3BLIA 3PSWA 3MW7A 3T4CA 2DZVA 2AAMA 3M5YA 1TYGA 3W72A 5LGZA 5HR6A 1OFPA 3F03K 2ZQ0A 1F7BA 2NXHA 3QM3A 2A4AA 4UTKA 1MSSA 3DI1A 4X9SA 1WBJA 3S5NA 4Q33A 1IF2A 4XTDA 2NUXA 2V30A 2O7SA 3HGRA 3W2JA 4ORIA 5CZSA 3N34A 3TNOA 1VRDA 4YL2A 2Y7FA 3LBMA 2TYSA 3PF3A 2ZTJA 5KTLA 3BW2A 4GNJA 3S6DA 1ME7A 3ZFHA 3P60A 1MXSA 4JY8A 3UXDA 3M5ZA 1TQXA 1SSGA 1GT8A 1PHQA 1YLVA 3GK0A 4FIQA 1QR7A 4Y6GA 3UWYA 1LROA 1A53A 3O05A 4QJ1A 4FNQA 4XBKA 4BR1A 4O54A 1VLIA 3LM7A 1QNVA 1Y0EA 4ML9A 2QUTA 3T78A 1SU5A 3WK3A 3A22A 3I7SA 2BX7A 3IVSA 3L67A 3A5VA 1W8SA 1TV7A 2I14A 4O4VA 1PL9A 2ZRWA 3KFTA 2VC6A 3BG5A 4Y96A 3IRDA 2C6QA 5K9XA 1I8JA 1PCKA 1H1ZA 1TB3A 1S5WA 2RKXA 4NJGA 2B4GA 3WK0A 3E12A 3WK1A 1HO4A 3GNDA 4K38A 1FWNA 2E68A 3W7GA 4OU1A 1QCWA 5DCEA 3LTYA 2V0TA 1KFCA 1EPXA 1M7OA 1KBIA 1W5MA 4UFIA 5J5RA 4IXXA 3B0VC 2BSLA 4UFHA 1Q6OA 1JJKA 5G1YA 2ZRYA 4ADTA 3DFPA 1SZGA 1TMHA 1TPWA 4S2CA 4XWUA 3UWWA 4RJEA 4IXHA 4YLWA 4MYAA 4HNTA 4RZ6A 3W76A 3C2RA 5D03A 5FF3A 1KA9F 4NJIA 4PA8A 4ZQOA 3G1SA 3LHVA 3W7LA 4QISA 3LLFA 5HUOA 3O15A 3PB0A 1VQTA 3LTPA 4TO8A 2O7QA 3DKJA 4AHQA 5FI8A 1UUMA 4UTJA 3DHDA 3CHVA 1RQHA 3EXTA 3OEXA 5HR7A 3QSRA 3RU6A 1H7NA 2J88A 1CI1A 4MZYA 8TIMA 5J5DA 2E6FA 1GVQA 3LRMA 4I7WA 4Q4KA 2B7NA 1X7FA 1N55A 2ABBA 4AH7A 1TRIA 4OWGA 3U8GA 2CLHA 1XC4A 1W31A 4FNUA 4N9BA 2A7PA 1FCVA 1FQ0A 1P0NA 5A5WA 4O19A 1KM0A 3G1VA 3B8DA 3M0ZA 2YPIA 1FBAA 3INPA 2FPYA 1H61A 4GC4A 3TA6A 2PRLA 4C1LA 3LRKA 1OK4A 3W07A 2TMDA 1WX0A 2FIQA 3C3NA 3IEBA 4CCEA 3NQ2A 5AHMA 2ZCGA 1OFRA 1TPDA 1SO6A 4M6VA 3CQ0A 1AL8A 4LNYA 1GVRA 1KM2A 3RLUA 3W70A 4DF2A 1ZENA 4ZQCA 4KKXA 1IGSA 4NJHA 5K7JA 3TKFA 3G8EA 4O50A 1SO4A 5FF7A 5G2HA 2ZYFA 3W23A 2C19A 3N2MA 4EVZA 5C54A 4CNPA 1JR1A 5HWMA 2XN0A 5EY5A 4YCOA 1UUOA 1W54A 2GVGA 3HPXA 3BGJA 1LZOA 5TIMA 3UWZA 5G5IA 1NAL1 2J6XA 3CM4A 3S1XA 5F2GA 5H2ZA 5EL1A 1GG0A 2CZEA 1KFKA 3E0IA 1K3UA 1JVNA 3ATYA 2A1YA 2FB3A 1IXQA 4HSNA 2QCHA 2Y61A 4KWVA 5D2TA 1XXXA 3C6CA 4NZJA 3JR2A 2OT1A 1OF6A 3PUDA 5AN7A 1A5AA 1LBLA 3W1RA 4MPQA 3G1XA 3G1AA 4Z1CA 1TPVA 3NQ8A 2YFNA 1G7UA 1H7WA 3DENA 1WXJA 2QCMA 2YXGA 1R2SA 3TV8A 4ZQPA 1CX9A 1B4KA 1TPB1 2E5CA 3MP5A 3CU2A 3W7KA 1LYXA 5HWJA 1GG1A 3ABRA 1GVOA 1KW1A 4LUIA 3WK2A 4UFMA 5D2VA 1JCXA 1LOSA 1OYCA 3W1LA 4Z0JA 3DFTA 2FB2A 1A50A 1ZY9A 1VS1A 4AF0B 1W37A 4S2BA 5BMXA 5DLCA 1JUKA 2TSYA 3PAJA 2PRMA 4WUIA 2YR1A 5I3JA 2ZZ5A 2PRHA 4HPXA 4N9CA 3NQGA 3P81A 1AW1A 2QCGA 5C2XA 1W5NA 3L0KA 2YX0A 4JICA 3LCLA 3NPWA 3DFNA 3LV5A 5DBUA 4DO6A 4MLRA 3TW6A 1A5BA 3NL5A 3W1TA 1ZCOA 1G6CA 3OG3A 4XQ6A 1W5OA 1GYNA 5C6MA 4FEZA 3S8HA 2EF9A 4UTIA 1EB3A 3C8FA 2QR6A 3HPSA 1JUBA 4BFAA 4D2JA 4IPIA 5HUPA 3BG9A 4ZQRA 3W86A 2A2IA 2QF7A 3NO5A 3RLVA 3L5LA 3G1HA 4GFSA 3W74A 2W6RA 4HN4A 4MVAA 2BZNA 1VGAA 2QUVA 3BK0A 3IIXA 1RR2A 5BOOA 4KFNA 3SI9A 1TV5A 2X1RA 1OFDA 1OK6A 2EPHA 2VOMA 2ZZ2A 4O17A 3M1ZA 1YADA 3MMTA 1VHCA 4Y9AA 6ALDA 5FEPA 1SW3A 4K37A 1FCQA 3CC1A 1YTEA 3P84A 3UYCA 1TSIA 4NXSA 4ZQNA 1GEQA 1VCFA 2RDTA 4UC5A 3LXAA 1LBMA 3AJXA 4GUIA 1D3HA 1JUEA 2DZWA 1OG0A 2CFFA 5D30A 3PS7A 4AAJA 4FNRA 4Q32A 5CPNA 1GVSA 1MEIA 4JTEA 4DBEA 4MZ8A 5LNVA 2FTPA 1PS9A 4NT0A 1KLZA 4PEKA 2Z0IA 2NV2A 2ISVA 2Q8LA 4O1BA 4UTWC 3EKZA 2FLIA 1QO5A 1WAUA 2ZFAA 3NQAA 4ICNA 4CNOA 3TK7A 3OIXA 4DPQA 1S5TA 3PUOA 3M9YA 4JX4A 3W3OA 4DBDA 2JGYA 4RXGA 1ALDA 1WA3A 3L2IA 1JRCA 3UPBA 5LSMA 4N4PA 1ADOA 4M6PA 1TJPA 2Y7DA 4KWWA 2G95A 1N8FA 3GR7A 3PBVA 1Z42A 2CLFA 3SGUA 1OJXA 4UTTA 3L5AA 2ZTKA 3HG4A 2EKCA 3IVUA 4DF0A 4BK9A 3F4NA 2FQIA 3MBDA 2Z1BA 3QPYA 4XBSA 4Y90A 1PE1A 2W0UA 1H5YA 2QJGA 4NJKA 5LNRA 4UCGA 3W7EA 3N2XA 3M44A 4LVBA 5DXYA 1RZMA 1HG3A 4A29A 1O95A 4UMBA 3KRSA 3W85A 3TXZA 5E1QA 1GTEA 5KINA 3DHFA 1PV8A 4JTLA 3NPXA 2VFFA 1T0OA 3TU9A 3P8IA 4JX5A 1GVFA 4LY8A 3L65A 3UD6A 1I45A 4MY9A 3W7OA 2EAWA 3M43A 5LGXA 3UPWA 1A5SA 4FF7A 4GRSA 1A5CA 4H3DA 2QCNA 3V75A 2BXVA 5AHFA 3PULA 2ZZ1A 2I1OA 1TREA 3QW4B 5K4ZA 1QOQA 2QAPA 3W1AA 1QMLA 4UR7A 3DH7A 4YWIA 2WNNA 3PM6A 1B4EA 1TO3A 2NLIA 1YDOA 4QNEA 4TU1A 1OFQA 3E49A 3GR8A 2JKPA 5U7SA 3QRHA 3SFKA 3MP4A 3S5YA 3UNDA 4Y8FA 2A21A 2V2CA 3H53A 3O1NA 4O1CA 3R5EA 1KTNA 3S9YA 4UNLA 4A3UA 4GUJA 4ONVA 4UMCA 3TW7A 3Q94A 2JGQA 4L4MA 4YCPA 1XBXA 3O16A 3ANYA 1PIIA 3IGSA 1GJPA 3PBYA 3JRKA 2GJLA 3OVPA 5F2LA 1ZALA 1QPRA 5DN1A 3HIJA 3GDTA 4QIUA 1QFEA 2YSWA 2NWRA 4MFEA 3HB9A 4RLIA 5BRBA 2YYUA 5I3KA 2C15A 5CG7A 1YPFA 1B9BA 1AL7A 4GUGA 2AQWA 4JIQA 5KZEA 5D2XA 2DZTA 5D04C 2GVLA 1IIGA 2QDGA 1ICQA 5LNWA 3L0NA 3H55A 4Z08A 1QAPA 5BMWA 2YZRA 3E02A 4IMGA 1WYIA 3EWUA 1LBFA 1FY6A 3M5VA 2XN2A 3G3DA 2VEMA 1XUZA 2QDHA 4UIOA 2RFGA 3U6WA 3GXTA 4IWWA 1WDWA 3MYOA 1M7PA 3GLCA 1OYBA 2UV8G 4M19A 3TQ0A 3W22A 1Q6QA 1ZNNA 4H6KA 2X1SA 1KM3A 4IX2A 2ATMA 2VFHA 3BV4A 4QQ3A 4MFDA 2H8ZA 4WZHA 1BEUA 3B0UX 3W87A 1MO0A 1ZFJA 4JD4A 3KVMA 3EB2A 1CW2A 4OGZA 4BWLA 3E9AA 3N9RA 5G4WA 1J4EA 1X1OA 3QEZA 3TAKA 3UZJA 4QM1A 1NF0A 1YTDA 3HGSA 5MHBA 4NZFA 2OT0A 1B3OA 3NL6A 3TDFA 1SUXA 4LRSA 2BTMA 3PWAA 4JTTA 5CPOA 1IXOA 3U2OA 4O16A 4WXYA 3G0XA 3T44A 3QFEA 4XKYB 3Q58A 4CCCA 4OE7A 3KVLA 1G7VA 1O5KA 5AFDA 2H8XA 4DEFA 4FX7A 5DCBA 3ELFA 1I2RA 2Y88A 3MYPA 1BWKA 4P61A 4OQVA 3SR7A 1AW2A 3EWYA 4GXMA 4O0KA 5HINA 3TCEA 2OZ0A 3Q2DA 5D37A 1FDZA 3DBPA 2V9DA 3GXNA 5AC6A 3QQ0A 1VJIA 2A6LA 3A5FA 1PHWA 4JTIA 4UFJA 2ZBTA 4LVGA 1NEYA 3SY5A 3T55A 4JTGA 2GVJA 3HG3A 3CPRA 2NXIA 1JCMP 2JKAA 2C1HA 2GQ8A 3NEVA 1F6PA 5I3FA 5K4XA 3QQ1A 3HMJG 3E96A 1FX6A 2C16A 2RH9A 4UR8A 2Y70A 3GB6A 2OMAA 3EX2A 3LOTA 4EIVA 3L66A 3BVJA 4NNAA 2ZZ3A 2WJZA 3FOKA 2ZRUA 4X22A 2DJLA 3P7YA 3TC7A 6TIMA 2CW6A 2YFOA 3H54A 1QDSA 2G97A 3VE9A 3QJAA 2ZRXA 3ZWSA 3P61A 3QH2A 2NX1A 1XBYA 2RHGA 3W1NA 4M7TA 3LI1A 3G0UA 5KMYA 4PTNA 3RNDA 2RDWA 3A23A 4NXKA 1VPXA 5F2IA 1D3GA 3PSVA 1H7RA 3B4UA 3C52A 3DGRA 3S5OA 1HTIA 1OX6A 5DCDA 1L6WA 2P0OA 4IGHA 1UB3A 1YYAA 3WJYA 3O6YX 3W2KA 3BLEA 4FX8A 2R8WA 3S1WA 5AC7A 3ZS4A 2V82A 2B7QA 4IUOA 2DZPA 2GJNA 3NPVA 1QO2A 3MUXA 4PCFA 4OT7A 1M5WA 4PFMA 1TQJA 2CLEA 1UASA 3BPWA 4AF0A 4CQAA 4CCDA 3QF0A 3B04A 3NQEA 2E6YA 1DHPA 4LS2A 4YMZA 4FNSA 1OFEA 3VI2A 3SECA 3R89A 1KFEA 4QAIA 1ZJIA 1JQXA 3UWVA 2Y62A 1VH7A 1KV8A 3P62A 1RQEA 4N9DA 3OVQA 3IIVA 3A24A 3EX4A 1W0MA 3TFCA 1FCUA 3LLDA 5KITA 2QCDB 2G96A 1JULA 1K8YA 5DY3A 4N6EA 5DBTA 4JTFA 4ZVJA 3BW3A 1SQ7A 2V2DA 3DFSA 3HG2A 1OFAA 4JDYA 2GQAA 1MEWA 2WQPA 5T26A 2QCCA 4NQ1A 3YPIA 1O94A 3SW6A 4CQ9A 3ABQA 2NZLA 2NUWA 1R30A 3PG9A 3TE9A 2P1FA 3P67A 1J2WA 5A8GA 3SIZA 1EWEA 3D0CA 4WOQA 2WKJA 1F6KA 1DKWA 3MHGA 1XKYA 4R7JA 5H91A 2WSRA 3LBCA 3UY8A 1F05A 3W7HA 3MI6A 2YW4A 2Y6ZA 3NQFA 1H7PA 1HL2A 1KV5A 3IIPA 1I2NA 2PC4A 4UTLA 1P1XA 3LHZA 4IMDA 3DFQA 3EX1A 1OX5A 4OHQA 3THQA 1KBJA 2VFDA 3HBLA 5HJLA 4QITA 1DVJA 1IIHA 4LVFA 3I65A 2DZXA 1TCDA 2ISWA 5C5YA 2I9EA 2EGZA 4NNBA 3GIYA 3QMRA 1H62A 2QCEA 3G0SA 5FEZA 5I3IA 3HG5A 4ALDA 3O06A 4HNUA 4H4IA 3VKJA 1BTMA 1DQWA 5AHEA 1TPH1 4M7SA 2ATSA 7TIMA 3T40A 1AK5A 4O15A 1FCBA 1SW0A 2XN1A 3RFAA 1W3TA 3LTSA 4Z1DA 4Z0SA 1YPIA 3UQNA 3STFA 3C4UA 2A85A 4UTHA 3W6YA 4FIRA 3SZ8A 3KVJA 1L9WA 3N3MA 1OABA 2Z2UA 3R12A 3TJXA 4PC8A 5FF4A 1WOAA 4E2DA 1JRBA 2J9XA 4MZ1A 3NM3A 3GDLA 1SFLA 2HSAA 3ABOA 1ME8A 5CKSA 3CB8A 2G5WA 5AHNA 3W75A 4GWEA 2Y63A 5AB3A 3MI2A 5I3HA 1VCVA 4UTTC 3W9ZA 3C2OA 3EXRA 4WY0B 2J9YA 3C2FA 3L21A 1X6UA 2J27A 2B7OA 4LS0A 4WY0F 5HMSA 4E0CA 4R53A 4CQ8A 3LV6A 3GXPA 3NG3A 2TPSA 4DQWA 2D73A 3R13A 3GDRA 2B0MA 4X3ZA 1EEPA 4DO5A 5F4XA 2DJXA 4IMCA 1FWTA 5DXXA 3LCWA 4JTJA 2A0NA 5BNKA 1R46A 3TFXA 5U4NA 3M16A 1KTBA 2H3BA 3STGA 5G2IA 2ZA2A 3LB0A 4LUJA 3HQ1A 4MUZA 2C3ZA 5KZDA 5D02A 2FPVA 3NM1A 2C14A 3EEGA 1LCOA 3L9CA 4RXFA 1YXYA 1JCLA 4NUWA 1QPNA 5D33A 3LERA 4ZL1A 2CLKA 1G67A 2X30A 3W7JA 4JYDA 1QPQA 3LXBA 1U5JA 3NVTA 4JY9A 4OBTA 3W88A 2YYTA 3PB2A 4LW7A 1GWJA 4N9EA 1AMKA 1EUAA 1BKSA 5AOUA 2RDUA 5EBUA 1VCGA 5HWNA 1OVDA 3MO7A 5EA9A 3FIGA 5EMUA 1K7FA 4O1AA 4I7UA 1TTQA 1XCFA 1KLYA 3FS2A 4WQ6A 4NU7A 1QPOA 1R2RA 1T99A 1JCYA 3MJYA 4POCA 3W1UA 5LZLA 5E0KA 5GVJA 1P5BA 5F1UA 3SJ3A 4X2RA 1OFOA 3AO0A 5F4SA 4RX0A 3M5XA 3VE7A 1Q45A 2GOUA 2NUYA 1GPWA 3NQ7A 5C55A 4A21A 5G4EA 5ABTA 4K36A 1KFBA 3TMQA 1GQNA 4MYXA 2V5LA 2H6RA 3MHFA 3IV3A 1EX5A 2FDSA 5G1TA 3CWNA 1U83A 4HNNA 2VFEA 4EWND 3S0CA 1YTKA 3W7NA 4NVTA 4LC8A 4O10A 1FUYA 3BGGA 1R2TA 4DO4A 4NNCA 3CLMA 5D38A 3GZ3A 1KM5A 5EPDA 2QKFA 2OJPA 1LOQA 3QMTA 1ICPA 2KZHA 5FESA 4A22A 3VCRA 4DXVA 3TROA 3HJZA 3O6DA 2FJKA 1NSJA 3GX9A 1YXDA 1XBZA 2YW3A 3R8RA 4RCXA 5TBOA 4JX6A 4MIMA 3G3MA 3LHYA 4TR9A 1EWDA 3FEMA 2ZRZA 2PE4A 3W7IA 4LTSA 3RMJA 5AYYA 5CGQA 2NXGA 3UZ5A 4WX2A 2E6DA 1VHNA 1KM1A 3ABSA 3TIMA 3N73A 2YDAA 3K30A 2R94A 3RF9A 3PUEA 2CWNA 3LX9A 3NR0A 4BWLC 3THAA 3GAKA 3L0GA 3S1VA 4IQLA 4B5NA 1JCNA 4HKPA 1P0KA 3G18A 1KFLA 3NZ1A 5G2WA 2CLLA 2BWGA 3C2VA 4EOUA 4ZQMA 3DFOA 3BW4A 2R91A 5LHEA 2PURA 5HULA 3VNDA 1RV8A 3IIOA 5CZTA 1XDLA 2C13A 5IBXC 1VYPX 4MKNA 2F84A 4BF9A 1DL3A 1OX4B 4LV4A 3HGJA 4O12A 4XKYA 2E5BA 3DAQA 5D09A 5CPLA 3TC6A 3PR2A 1PVNA 4AMAA 5D05A 4HIBA 3DXIA 3FYPA 3UY7A 4K8HA 1G4SA 1TPUA 2VXNA 1YDVA 3IGUA 4WJEA 3LCGA 4KFPA 4HNVA 3FA5A 4IX0A 1TPEA 1DBTA 2CLOA 3NGJA 4IPJA 3NQCA 1O4UA 3OHIA 1IXPA 2V8ZA 1DV7A 4EF8A 3OBKA 3W7RA 2X16A 5LNSA 4FNPA 1F73A 1WQ5A 2ZA1A 1GTHA 1SR9A 3BLFA 3F1QA 2ZA3A 3GDKA 4LOCA 3QZEA 3CEUA 3W1QA 1EUNA 3EWBX 5FEXA 2Q3OA 4Z1AA 4N2YA 2B7PA 1FWRA 4J9JA 3LDVA 4NJJA 1F74A 2DORA 2WSQA 2VFIA 4AHOA 3W2MA 1SZNA 4WD0A 2DP3A 3TX9A 1WBHA 1ZAIA 3O07A 2Q3RA 3GAYA 3OVRA 3C61A 4MJMA 4JXCA 3UWQA 3ZR4A 5HQEA 3ZWTA 3NAVA 3T7VA 3NNTA 3P8JA 5IBXA 3SGZA 4YXGA 1ZHAA 2HTMA 2E77A 3EWZA 5F4WA 1SPQA 4NX5A 1W5QA 3W84A 4JN6A 1HFBA 1EP2A 3LHTA 4P2VA 1TPC1 4ZMGA 2Y89A 3RK8A 2A5HA 2V81A 3F4WA 2P10A 2VFGA 1R47A 2QAFA 2ABAA 3W7QA 3FJLA 3N14A 3TH6A 3G8RA 4RR4A 1I2PA 2NWSA 2V5BA 3NZRA 3I7QA 1GOXA 2E6AA 5AYZA 3MBFA 3M7WA 3EKLA 1LP6A 5AC8A 3TR2A 5AHIA 1W5PA 2OX1A 3PBUA 3CEPA 5EKYA 1Z48A 5IM51 3QW3A 2H90A 2QJIA 2CZFA 1Z44A 2WNQA 3G1YA 2Q8ZA 4E2BA 2DU2A 1EP3A 1Q6RA 3CT7A 3VFLA 4FB7A 2J9ZA 2CLMA 2QCDA 5LKYA 5D32A 4MY8A 1E51A 1T8XA 2FFCA 3LI0A 2VENA 1TTJA 2X2GA 3FLUA 3HF3A 3LCIA 4FNTA 4LU0A 3W2UA 3V1PA 3W2LA 4K7VA 1VZWA 5K9DA 1SW7A 3TQVA 1RPXA 4FXSA 1RD5A 4UXDA 1G4PA 1H50A 4MJZA 2WV8A 3SSJA 3BARA 3UXAA 1NVMA 1VYRA 3B06A 1DOSA 1YXCA 2WSYA 3C56A 4MOZA 5AHLA 1KFJA 1VR6A 2ZZ4A 3G22A 4ZZ9A 3STEA 1WOBA 5K2ZA 4O0ZA 5CZJA 3TQKA 2E09A 1L6YA 3WJZA 1C29A 5I3GA 3NL2A 4UTMA 1C8VA 1J5TA 2C18A 3KAOA 3TAOA 4XTIA 1X8FA 2X1UA 5D2YA 1ME9A 3IVTA 1K7XA 1LLWA 3NPUA 2TRSA 1XI3A 4AWUA 1DJQA 4O4WA 4AXKA 3M6YA 3A21A 3LHWA 1UCWA 4PL2A 3N19B 5HNRA 3CWOX 3KOFA 2ZZ7A 4BI6A 2PCQA 2ZRVA 4S1FA 5BW6A 3WJSA 2W79A 1KTCA 3ATZA 3NL3A 2F7FA 1VYSX 4M6QA 3GDMA 4JS3A 4QSHA 3W1MA 4N4QA 1F5ZA 3W1PA 1ZAHA 3G1DA 3O6CA 4RV8A 3W71A 3MWAA 2QEZA 4JIPA 3NOEA 3NXFA 1X1ZA 4R34A 4E38A 4U28A 2X1TA 4AVFA 2AGKA 4I9AA 4JTHA 4TX9A 3G24A 5FEWA 4ADSA 4FX6M 3DKLA 1AG1O 1F2JA 2CZ5A 4JTKA 4TIMA 2Z6JA 4XUGA 4LWWA 2EHHA 1FDJA 3NQ6A 3TJLA 3JS3A 3EWWA 1WV2A 3A9IA 1TTIA 4DELA 3LCHA 1GYLA 5LHFA 3P80A 2QJHA 4HSOA 3UWUA 1TPFA 2J24A 2ZDRA 4WY0A 1MZHA 5FF2A 2BLEA 2A7NA 3TMLA 2YCEA 1W3NA 2NX3A 4WXZA 2YGYA 3NQDA 4DF1A 1IXNA 3LCXA 3W7MA 2NV1A 1VC4A 3QC3A 3FJ6A 3W83A 2DZSA 3LRLA 1H7XA 3STCA 3KXQA 5KZMA 3TSDA 4IMFA 1FXPA 4OV4A 4GJ1A 1SO5A 4NX0A 4LS1A 1M6JA 4QNWA 1F76A 4UUIA 3DU0A 5CZ0A 2GUUA 1DQXA 1TIMA 5KSWA 3B03A 3C2EA 4JTSA 3O63A 1NF7A 1XBVA 5L9FA 1B57A 3W7CA 3TUUA 3WFAA 4A2RA 3LGEA 4MY1A 3EWXA 3HOJA 3WJWA 1GZGA 1G4TA 1DORA 1K8XA 4LRTA 4PL1A 2HS8A 4K8EA 1G69A 4O13A 3C0JA 1K7EA 4AEOA 2E1DA 2WO5A 3OA3A 4JYEA 4HT3A 1ONRA 3P5YA 3I68A 3TSMA 4W9TA 1OYAA 1W56A 1SZEA 1OFBA 3FYOA 4O18A 4U4MA 5CSSA 5LNUA 3FKRA 4O14A 1H63A 1SFJA 5FF0A 1L2UA 5F2MA 2QCFA 4PODA 1UJPA 2ZZ6A 4UTUA 4LC6A 1KM6A 2H3DA 5CPMA 1V7YA 1LLZA 1Q6LA 1K02A 3LHUA 4BI5A 2Y7GA 1NFBA 1EIXA 2ISSA 4DPPA 1DJNA 4LT9A 2CZDA 4O28A 4RZ4A 1G4EA 4UFLA 4RKAA 1H51A 1LRNA 3EXSA 4LVAA 3M47A 1S3HA 3GKFA 1O60A 3N9SA 2A6NA 1RVGA 1K8ZA 3WJXA 3O8AA 1LORA 4N02A 3FFSA
chains in the Genus database with same CATH superfamily
3I7RA 3I6RA 2VKZG 4K39A 4NZ4A 3NDOA 2ZX5A 1Z89A 4QTGA 1XLEA 3UCDA 3CIWA 4LBUA 4DJFC 4J4KA 4AY1A 4HHPA 4K7YA 4DO7A 5HJYA 1I0DA 1E3XA 4GBUA 2OSXA 4PULA 1XYLA 3H2MA 2PLMA 4UFKA 4REQB 1MUWA 5CZKA 1WUFA 3F2BA 4G2DA 5GPRA 1W3IA 2GJRA 2R1LA 1XLGA 4LXFA 2A7RA 1I4NA 1W9DM 5A6BA 3QMSA 4W4QA 4LV9A 4KFOA 4B16A 5HATA 2FZDA 3BL3A 3S5SA 4AB4A 4GUFA 4GUHA 1KKOA 1Q6CA 2ZUWA 2HMCA 2ESCA 3ZLHA 3CIXA 2JK2A 5CSRA 2XZ9A 4K8GA 1OX4A 5HPCA 2XFWA 1OF8A 4AC1X 3WLOA 2E5DA 2WB5A 5CH9A 1MQQA 2W91A 3S83A 4C6FA 1PYFA 2C0AA 2BP1A 1H60A 3WBXA 1V5XA 3WH6A 5TQLA 4DBWA 4UNKA 4UB9A 4DNHA 3R1ZA 4Z1BA 1P4CA 2CCRA 2WHLA 3RX4A 1B3WA 4O1DA 3ZT5A 1GJWA 1LOLA 1A0CA 2HVMA 2OR2A 1XLJA 1Q8JA 1H7OA 4XBJA 3EDKA 5SWUA 1NY1A 1XM3A 4J2PA 2D1ZA 2IUZA 4PBFA 1V51A 4JTDA 1C9DA 1VPQA 4EF9A 3P5ZA 2CITA 3GM8A 4O52A 4O0QA 3BO9A 3WYZA 3JZUA 2CBVA 1TTPA 3P82A 4HYWA 3NO1A 2ICSA 3OGRA 4O53A 2PAJA 3UFYA 1OIFA 2IQTA 3GYEA 1FHLA 1KXQA 1YDNA 3CYVA 3QYQA 5DELA 3WH5A 3B40A 1XDMA 4JHMA 1XFBA 1QJWA 1KM4A 1LT8A 4O1EA 4LVDA 3REQA 1OHLA 1LTDA 3ARSA 4IH3A 3WLJA 5FJRA 2WVVA 3VOFA 2Y85A 4W5ZA 4RNFA 5AECA 1XCWA 2FGZA 4LB3A 2V3GA 1EL3A 4QE4A 2CNCA 5LXXA 4R33A 4GYJA 3F2CA 2G50A 3W7PA 1JPKA 2DZVA 1IZJA 2AAMA 5LGZA 1TE6A 3A9BA 5BXPA 2D2OA 4PB3A 3WELA 2OQHA 3QM3A 2A4AA 4ZFMA 3DI1A 1LWIA 1S5NA 3RMEA 1UKPA 3W4RA 4WK9A 2NUXA 3VCCA 3D46A 3Q67A 2PLCA 3W2JA 5CZSA 2YL5A 3N34A 1VRDA 4E3TA 4KS0A 3PF3A 2EKGA 1WDQA 4JL2A 3S6DA 4DN1A 2V38A 1BYCA 1I6NA 4ICMA 3ECQA 3UXDA 3M5ZA 1GT8A 4H01A 4Y6GA 1XLLA 3L4UA 3TWAA 1LROA 1XICA 1PEZA 2DSWA 3O05A 4FNQA 4BR1A 3LM7A 2PDGA 3T09A 1J9YA 3T78A 1SU5A 3WK3A 3A22A 3VM7A 3VYLA 3L67A 3APYA 3A5VA 3VZZA 2I14A 4O4VA 4HGXA 2ZRWA 2DSVA 1IZCA 1E15A 4GOAA 2DY3A 2C6QA 5K9XA 1UOZA 1I8JA 1FWEC 3E0VA 4D6CA 4W8LA 3OZPA 3SUSA 2YKKA 3O0FA 4XV0A 4PMRA 2IKGA 3WEMA 3QFWA 4G1NA 3B3DA 2QJNA 4GMEA 2O9TA 5H8PA 2VRKA 5DCEA 3LTYA 2FYMA 1XSJA 2V63A 3S9ZA 4LYPA 2IPJA 2BSLA 4R5EA 2BFGA 4YHGA 4ADTA 5CGMA 1TMHA 4S2CA 3UWWA 2XGBA 4RJEA 3T8LA 4IXHA 3BV7A 5HA7A 3L12A 5D03A 1WZKA 1S2AA 1KA9F 1ECEA 4ZQOA 1RALA 4QISA 2VUYA 1MW0A 1J10A 5J04A 1VQTA 5BWAA 3LTPA 2WVSA 5FI8A 1XC6A 2FMOA 1H7NA 4MZYA 2E6FA 1GVQA 2XZ7A 2I7GA 4OWGA 1HXJA 1XC4A 2ODOA 1W31A 1QK0A 4FNUA 1FCVA 5M17A 3SQLA 3B0YA 1KM0A 2FTWA 3B8DA 4QEHA 3QXBA 4HN8A 2FPYA 2J78A 6A3HA 4AZCB 1VFFA 4GY1A 3W07A 4R85A 2NT1A 2FIQA 3C3NA 2J75A 3MCMA 2YCIX 4MMWA 4US6A 4KGLA 1ZL1A 3HMCA 4C6EA 3L4XA 4LNYA 1GVRA 4DF2A 3TN3A 5EU9A 2PD5A 4ZE5A 4ZQCA 1ZBWA 4KKXA 2XSAA 1IGSA 3CYJA 5K7JA 1W1PA 4PB5A 4CU8A 5G2HA 4QFUA 1OADA 1XX1A 2OO6A 1JR1A 2PDBA 2XN0A 1JFHA 5EY5A 2GVGA 3A4WA 4IIDA 5TIMA 3PZNA 2UY5A 1NAL1 3S1XA 5H2ZA 2PLJA 5I0DA 2XVNA 1JVNA 1E71M 3L4TA 4HSNA 3WQFA 1XXXA 4BCEA 3TN5A 1W17A 3T2OA 2PBGA 4DXKA 3JR2A 2OT1A 5HNTA 3PUDA 1DJGA 5AN7A 2ISDA 4ATLA 4MPQA 3G1XA 4LUYA 3AWOA 5XINA 2YFNA 3GW3A 1V02A 4YYCA 1SGJA 2IMRA 3VIHA 1B4KA 3QGAC 3N04A 1LYXA 1Q6EA 3ABRA 4LUIA 1CNVA 3UG4A 4A6GA 3A47A 1PB0A 3NJ3A 3BCJA 1X1NA 3IJ7A 2AMXA 2EEXA 1ZY9A 3BQ6A 1VS1A 4JKKA 4DI9A 1JUKA 1UWAA 3PAJA 4WF7A 5BRPA 4WUIA 4ZO7A 1T41A 1UW9A 3KLLA 2WWDA 3IGHX 4N9CA 3NQGA 4PTMA 4YS1A 1DTNA 1W5NA 3LCLA 3N17A 3LV5A 4DO6A 3AS3A 1A5BA 4AD5A 2D2HA 4JFSA 3W1TA 3KM8A 1OIMA 1G6CA 3DFYA 1C3FA 1UZ1A 5C6MA 4FEZA 4NZ3A 4UTIA 1XLFA 2FDMA 3E3HA 2Z25A 2A3LA 3ITXA 3OOQA 3C8FA 4QLKA 2J7FA 3HPSA 4D2JA 5HUPA 4H7CA 3NO5A 3AXHA 1V3HA 3L5LA 5IDIA 3EDFA 2DIEA 2DIKA 4MVAA 1T8QA 1VGAA 1HJSA 3BK0A 4LYRA 4KFNA 4INFA 3L4YA 1XRVA 3WH9A 5ABFA 1C90A 1NELA 2EPHA 4GISA 2VOMA 2ZZ2A 2ZUTA 4GA8A 4ZQNA 3QHMA 2VL4A 3ARUA 1GEQA 1VCFA 1AH3A 1JEZA 1LBMA 1I60A 2WHKA 4GUIA 2CFFA 4W88A 5D30A 3MKKA 4FNRA 1WCGA 5M03A 1B9ZA 2JQXA 3SEPA 5EFDA 3TN6A 2CLPA 5LNVA 1PS9A 1KLZA 2NV2A 2GK1B 1UWSA 3AALA 3ABZA 3HQPA 1AQHA 2Q8LA 2XFFA 1C8YA 3EKZA 5KZ6A 4U5KA 1WAUA 4C91A 5A95A 1S5TA 4GYPA 1JRCA 1PPIA 3ARXA 1ADOA 2F8QA 1BRLA 4MWAD 3UBPC 4HHHA 1Z42A 2CLFA 2DVXA 4R7OA 4UCFA 2VI0A 3T05A 3L5AA 3HG4A 3IVUA 3MUIA 4DF0A 3CK5A 2PP0A 2FQIA 3MBDA 2Z1BA 1QI3A 4XBSA 3ICJA 3OG2A 4PMYA 1H5YA 4A4AA 4LF2A 1J18A 2DIJA 4DYJA 1IHIA 4CQBA 1JPIA 3M44A 1XIFA 3KLKA 1O95A 3KRSA 3CUIA 5FOOA 2VRJA 5AC4A 2J7GA 4JTLA 3NPXA 4JZ5A 3TU9A 4LQ1A 5CPTA 1BKHA 1J8VA 3L65A 1I45A 4MY9A 2EAWA 4IFOA 3M43A 5LGXA 4GRSA 1EJUC 3GG0A 2OU4A 1ZU8A 3RPDA 2BXVA 1BWVA 2QAPA 3CTTA 1QMLA 4YWIA 5I3DA 3PM6A 1C8XA 3KWSA 1V0MA 3CHDA 2EQDA 2YCJA 4QNEA 4JN7A 1V93A 3QRHA 2GQ3A 1YPXA 4F2BA 3O1NA 4GBDA 4O1CA 1QHZA 3R5EA 2VR2A 1XD1A 4ONVA 4UMCA 4JNYA 3Q94A 4G7FA 2JGQA 4L4MA 4YCPA 3MUY1 5AZ1A 1PIIA 3JZEA 2PDPA 2C91A 4P7RA 2P76A 1FWAC 3HIJA 3GDTA 3XISA 4FI4A 2ZXDA 1QFEA 2XWEA 4DM1A 4MFEA 4HNCA 4JKMA 1H3GA 3ZSSA 3CHCA 3NSXA 3BOLA 4ATDA 4GUGA 2AQWA 4AD1A 4R7WA 1NJJA 3FVMA 1RLDA 3V35A 2GVLA 3H55A 1QAPA 3I4KA 4GIEA 2YZRA 5HNNA 3TYZA 1E4NA 3M5VA 2OSWA 2VEMA 1PZ2A 2CIPA 3ARPA 4IWWA 2IPFA 1OC6A 3MYOA 3LQLA 1AFSA 2ZE0A 2ATMA 3BV4A 4WKFA 4TX8A 3WH8A 2GSJA 4TOQA 4MG4A 3ZT7A 4ILSA 2FH6A 4YVVA 1EGVA 3KVMA 1PTDA 1HKKA 1OD0A 1CLXA 4XVDA 2Y4SA 4BWLA 5G4WA 4OBRA 3QEZA 2E9MA 1NF0A 2V67A 4AZBA 2VD8A 3SO7A 2BTMA 1X6LA 2CWXA 5CPOA 3AIQA 3CZ8A 2RAGA 4XKYB 4DBUA 4OE7A 3IUHA 2UWFA 4J27A 3WF3A 1O5KA 4DEFA 4FX7A 3EKGA 3ELFA 4WCJA 1V6YA 4JIEA 3MYPA 1BWKA 4P61A 4QG9A 4OQVA 3BXWA 1AD1A 4F4RA 3TCEA 2I9UA 1MW1A 3Q2DA 1FDZA 1ZS2A 5AC6A 2PGRA 3QQ0A 5DMMA 2QLYA 4JTIA 2FH8A 1OZQA 4S3AA 4CD6A 5H8UA 3SCVA 2I5GA 3K8MA 3RITA 2C1HA 3PTDA 1PZ1A 5I3FA 4F0HA 2J25A 2ZKMX 3LMZA 4RNHA 4CEXC 4YYFA 4D72A 2Y70A 4IL0A 2OMAA 1RSCA 3DUGA 1LL4A 3EX2A 3L66A 3SQMA 1CXKA 2FHFA 4PBGA 3F5JA 2QGYA 4WDUA 6TIMA 2ZX8A 3VOIA 3VE9A 1DXFA 4IIGA 2P88A 3MA8A 3ZWSA 1IZKA 5LYRA 1XBYA 4IIFA 3H23A 2W4XA 1WNOA 2RDWA 1VPXA 3BMVA 3OLIA 1D3GA 2NQZA 3GTIA 3B4UA 2DQWA 3VIIA 1QNRA 3C52A 3DGRA 1TVLA 4D6HA 4DAFA 2NQLA 4KCTA 1Z7AA 5DCDA 4IGHA 1UB3A 1YYAA 4WGHA 5AC7A 3ZS4A 5DFAA 2V82A 2B7QA 4KEMA 3N4AA 3EWDA 3MUXA 1GUVA 4PCFA 4UQ9A 1M5WA 2HCVA 4PFMA 3ZT6A 2CLEA 3OP2A 3NSMA 5A6SA 3B04A 4GH3A 1MDLA 3R89A 1JQXA 3UWVA 1KV8A 2PZ0A 4MNMA 3GXDA 3BAJA 3IIVA 2VZTA 2GSEA 4MNKA 3A24A 2X1IA 2PWGA 4EP8C 3L2MA 3WFLA 1W0MA 4HZ6A 1FCUA 3AFBA 4N6EA 5DBTA 2BY3A 3WD0A 4JDYA 3NDYA 4KRZA 3YPIA 2FZ8A 3AU6A 3QV9A 4JQ3A 3DYMA 2ZOXA 2P1FA 3P67A 3O0KA 1N82A 2WMIB 2BVDA 2PDYA 2QPUA 2F9RA 2GOKA 3VMOA 3WQWA 3MHGA 4HYRA 4R7JA 1XISA 5H91A 2OFJA 3UY8A 4P8WA 3EEZA 3MI6A 5C9UA 2YW4A 3PP7A 4HPNA 3NQFA 1HL2A 1KV5A 1MRQA 2PD9A 4G5DA 4IMDA 3DFQA 4BQ4A 3EX1A 3GS6A 4TV6A 3THQA 2PDQA 1KBJA 1HKJA 4QITA 1E5NA 3ARRA 4NNBA 4MNJA 4Q8TA 1MZRA 1DJWA 2HBXA 4GKLA 3VKJA 1TPH1 1AQMA 2OZTA 3N2TA 3VDBA 1AK5A 4GY7A 3FDKA 3RFAA 1W3TA 3O3RA 5CBBA 2OLSA 4B92A 3GU9A 2H9AA 3AXXA 4V1XA 4WRHA 1R7AA 3SZ8A 4I9TA 3KVJA 3N3MA 4LGXA 4V15A 3OQ8A 1WOAA 3GFZA 2J9XA 4MZ1A 1BGAA 4F0KA 2HSAA 1SR0A 4US5D 2PTDA 1WKDA 4KQNA 3CB8A 1C92A 1D3CA 2G5WA 3L21A 2V5DA 4R53A 1H5VA 2HE8A 2VX5A 2TPSA 1XYBA 2ONEA 4PZVA 3GDRA 3WNKA 4M51A 3RLGA 3S2JA 1B5TA 4X3ZA 1EEPA 4IGMA 5F4XA 4GVHA 1SZRA 3IJIA 3UJ2A 1K6WA 3V5FA 1W1YA 1V0NA 3KL0A 3VGDA 5RUBA 3B9EA 5U4NA 4RE2A 3FNDA 3CV7A 1GCYA 2C3ZA 4MKSA 5KZDA 5D02A 3AC0A 4W84A 2CXEA 5D33A 2J79A 1JGMA 1A47A 3AIUA 1QPQA 4PUNA 5T9BG 2YYTA 3S3GA 4FF5A 2BASA 1AMKA 2RDUA 4WDWA 3ZVHA 2YBTA 1JNDA 4HMDA 3UXKA 4TXEA 4WQ6A 4WEVX 4KF1A 1I1XA 5GVJA 2PDUA 1P5BA 5F1UA 3UPMA 1XLDA 3W02A 1UKTA 1NH6A 1P0EA 4PMQA 2BXYA 3VE7A 1Q45A 2GOUA 3VXGA 4K68A 3KCJA 4A21A 1UZDA 2WCAA 4K36A 3M0IA 4W7UA 4IF2A 2J7BA 4HNNA 4IT1A 2VFEA 1V8EA 5LIUX 5FSEC 1LL7A 3H4WA 2DGAA 2CHOA 3UGVA 4NNCA 3CLMA 2P3EA 1VIWA 4Y9OA 4QE5A 4GVIA 2FZNA 3WQ5A 3QMTA 3LSBA 1ICPA 2KZHA 2Q8XA 3R43A 3HJZA 1BFNA 2V3FA 3EMCA 1S1RA 3CIVA 4NYUA 1KQYA 3CO8A 3R8RA 2WNWA 2NLYA 4RCXA 3NEHA 4PMXA 4TR9A 3FEMA 2PE4A 4AUBA 3PZ9A 1PUDA 3B9OA 1R9YA 3UZ5A 2E6DA 1KM1A 3ABSA 4AY7A 4J3XA 1ZJHA 2IKIA 2YDAA 3W24A 1UYQA 3PUEA 2CWNA 5E9XA 3LX9A 3NR0A 3V0TA 1GNXA 1NOWA 3DEQA 1QOXA 4IGSA 2WMKA 5G2WA 4WSHA 2F38A 1SVDA 3DFOA 3PANA 5HULA 2DVTA 4EXBA 1KD0A 4TVCA 1FWJC 3CHEA 5IBXC 1VYPX 5HAOA 1OX4B 3BJFA 1TA3A 1EJ7L 3SRFA 4Q22A 5FJJA 3DAQA 5AVHA 3AMDA 3TC6A 1PVNA 3DECA 5D05A 3DXIA 3UY7A 4K8HA 1IE7C 1US3A 3WBEA 4PMNA 1KKRA 2G3MA 2NVCA 3CZLA 4Q8NA 4XAGA 3VKCA 4IX0A 1TPEA 4CN4A 4U3CA 4IPJA 3NQCA 1O4UA 2YJQA 4EF8A 3KBNA 3W7RA 5LNSA 2G3JA 3HPFA 2VR4A 3CUFA 4ACYA 3WQOA 3UA3A 3F1QA 4IICA 1XLCA 4F3HA 3DFHA 3EWBX 3DIPA 1JFXA 5FEXA 2OB3A 1Y8BA 2B7PA 4J9JA 4TV5A 3WQGA 2WSQA 1EQPA 3AJ7A 1R3YA 3O07A 3WQPA 3OVRA 1POJA 3VIOA 4LX4A 4M24A 3BLPX 3QHNA 4JXCA 4MUPA 3KTCA 2PCEA 2JIEA 5HQEA 3N2OA 4UZSA 5D9MA 3ZWTA 4GK8A 5FIPA 2BY2A 3FAXA 3G5EA 4C7FA 3REQB 3OPSA 2WVVB 2E77A 4GINA 2F6UA 1NWUA 5F4WA 1SPQA 4A3YA 3LHTA 2PWHA 2Y89A 3RK8A 3SN4A 3V18A 2EO7A 3ALGA 2HROA 4JBRA 2ABAA 1TR9A 2VT0A 3N14A 3TH6A 1XLMA 4LCQA 1I2PA 5CBJA 2V5BA 5I77A 3MBFA 5EMMA 1EQCA 1EX1A 3AYVA 1Z48A 5A8PA 5A6JA 4X60A 2QJIA 4DM2A 2CZFA 3VMNA 1Z44A 3OZYA 3TLLA 3W29A 4YVPA 2X8RA 1P6BA 3CB3A 3VFLA 4D8LA 2J9ZA 1JF6A 4CQCA 1QVBA 4PCPA 1WZLA 4L6OA 2WJFA 3LZ3A 4KEZA 4ECLA 4BF5A 3UG5A 2IPGA 4O1FA 1YIXA 2YBUA 4EXQA 4NL1A 1SJCA 4JHOA 3FLUA 4HK7A 3W2LA 1GKRA 4EPEC 2IXVA 1SW7A 3TQVA 2X7VA 1RPXA 3OYZA 1DWJM 1RD5A 2W3ZA 1VYRA 3B06A 1JZ2A 2PWFA 2DSKA 2WSYA 2EPLX 3C56A 1KFJA 1WOBA 5K2ZA 1VFSA 5JU6A 3OO2A 4MWAA 5JIWA 1C29A 1ONWA 3LNMA 3RRAA 1CCWB 4J3WA 3EOLA 3MSGA 1ME9A 1XI3A 2BDQA 4V1YA 1HP5A 2ZIDA 2G4JA 4PL2A 1CPUA 3UYIA 1UUQA 4BI6A 2QIWA 3FHQA 3NDZA 3R8HA 3WJSA 4DAIA 4JS3A 4C6QA 1V6XA 4ACZA 1GORA 3W1MA 5LIWX 1H49A 3N6JA 2ACUA 3NXFA 4LBRA 2DUZA 4AVFA 1AH4A 4I9AA 4HMNA 1V02E 1J0JA 5LXEA 1ZJAA 2D0GA 4FX6M 2ZE3A 5M3WA 4RNJA 5M2FX 4TIMA 1EXPA 2OGJA 1NU5A 3PN8A 3EWWA 3A9IA 3LCHA 2OOGA 5LHFA 3P80A 4WJ8A 5HNUA 1LG1A 2D3NA 2HZGA 5CGTA 2WVTA 2AQOA 1TPFA 2ZDRA 1MZHA 2BGQA 2YCEA 5REQA 1UKSA 4DF1A 1C8QA 4L1GA 2NV1A 1OG6A 3W83A 1QNQA 1RBLA 1GONA 2DZSA 2PDHA 3LRLA 3IANA 3TSDA 3MV01 4OV4A 4GJ1A 1C9WA 4LS1A 2I17A 3GG8A 3P93A 3DU0A 3K1DA 3OZMA 5CZ0A 3E2RA 1TIMA 3O63A 3BAKA 5FAJA 2POZA 3EPMA 1B57A 3W7CA 3M6DA 3WFAA 4AX6A 1SJDA 1UIPA 3TTYA 3WJWA 1G4TA 1K8XA 4LRTA 1BXNA 4PL1A 4QXIA 4K8EA 4DNMA 1O1HA 2VVNA 1ONRA 3P5YA 2OLHA 3ENLA 4W9TA 1OYAA 1W56A 1OFBA 4U4MA 1HKIA 1JNEA 5CSSA 1R9XA 5LNUA 3BDKA 3IUIA 3KS5A 1XYFA 1SFJA 4B4HA 4PODA 1V79A 4LC6A 3HQNA 1BYBA 5CPMA 1V7YA 2VCAA 1LLZA 1Q6LA 4YTTA 3LHUA 4K1GA 3QQWA 1NFBA 2PSNA 3MSRA 2EG7A 4CNUA 1WXZA 2ISSA 4AZGA 4LT9A 2CZDA 4O28A 4HOWA 5GNZA 1NQ6A 3E5BA 1H51A 1LRNA 2PTWA 5JH2A 3M47A 4M80A 4Y2WA 1ZLPA 3N9SA 3PJUA 2DFAA 5I02A 4GCXA 5JUVA 1Q85A 3NQVA 2WC7A 4ERAA 1SFTA 3LXCA 1LRQA 3PG8A 1FWWA 3R2GA 3EDDA 3PY2A 5T8GA 2GJXA 1KBLA 4TMBA 2AQVA 3GHUA 2VEKA 5FJIA 3T07A 3S9IA 2V2HA 3G6LA 2D69A 3D3AA 6TAAA 5D2WA 3ZXWA 1IGWA 3TR9A 4H9UA 4HPHA 2HK0A 1K9FA 1CXIA 2CLIA 5AY7A 4AHPA 1AMYA 2YL9A 1RJRA 2ALDA 2D0FA 2JKEA 2R14A 1FXQA 3B05A 4L4LA 1VLWA 4C1KA 1I2QA 4IPNB 3UJEA 1HUVA 4GE8A 2HE5A 3IIZA 4UQEA 1EJTC 3MP3A 4QLJA 3T0AA 1J0ZA 2OX4A 1TV8A 1LRTA 4XISA 3VZYA 3NQMA 1QU4A 4M82A 3PWIA 4ZO8A 1XUUA 3WENA 2Y8VA 3BG3A 2Z7GA 3B9DA 4YJ5A 2NX9A 3GSMA 4AIBA 2CPUA 2QUNA 5ABFB 3S6TA 1B30A 1B31A 3MI3A 4YTQA 4M5PA 4KGJA 2X7WA 1KQZA 1Z6KA 2Z6IA 4HPJA 1WE5A 1W9PA 2LLEA 3KRUA 3QSTA 1E5JA 4A8NA 3BAYA 1FP8A 1HL8A 4QG6A 3H70A 2BV9A 1LF1A 1JCJA 3FKKA 3RHGA 3Q37A 3K4DA 3GVGA 5BZAA 3DC8A 3W2NA 1S2VA 3GBDA 4MPKA 4CNNA 2ZADA 2PWEA 4FXRA 4C6JA 1RQBA 4YU1A 3S4TA 3S5ZA 5KEZA 4RE4A 3UXIA 4C90A 3RILA 2PBOA 4KMQA 1AQFA 5HXMA 4RL3A 2V69A 4C6NA 3T6CA 5K9CA 1BRLB 4O11A 5DMLA 1FH8A 3NYDA 1T96A 5CAHA 3S1GA 4RZ5A 3DI0A 3GXMA 3BAXA 1RJPA 1N7KA 1AW5A 2F2KA 2Y7EA 3GTXA 4B5WA 1D9EA 1VP5A 3NA8A 4ZB2A 3TW9A 1GVIA 3KX6A 4K6AA 1P6CA 1AZ1A 1W1ZA 3PC0A 3BLIA 4D1IA 3PSWA 3T4CA 5A8MA 4FR1A 5HR6A 1TFVA 1OFPA 2PGWA 2C8NA 1YKWA 1Q7ZA 1P48A 4UTKA 1MSSA 4L9XA 4LB4A 4ZE4A 4I6KA 4LSBA 4XAYA 2O7SA 4DZHA 4A3QA 4DIAA 2WMGA 5HDRA 3SUVA 3GUWA 4YL2A 3WLPA 2TYSA 3PFRA 3NGFA 3BW2A 1F61A 1MXSA 1FKWA 2ALRA 4JY8A 2RJHA 3KBSA 1JI1A 3FA3A 1TQXA 3N11A 2DT1A 1REQA 1SSGA 1V6VA 1WP6A 3GNRA 5T9CE 4ZXLA 3URNA 4QJ1A 4XBKA 3LM3A 4GJJA 4H04A 3UF9A 1H1NA 3DHUA 2YDRA 3VC6A 3C0SA 3I7SA 1W8SA 1QHOA 1TV7A 3BOFA 1IR1A 2ACQA 3HFYA 4PCNA 3KFTA 4NYYA 3WF0A 1MW2A 2VC6A 3PZQA 4Y96A 1PCKA 3FK4A 2XTKA 1PKLA 1H1ZA 3VIPA 3AMLA 3VU2A 5KETA 3MUZ1 2FMNA 5A6AA 1S5WA 2RKXA 4Y9NA 2B4GA 1S1PA 3SY8A 1BQCA 1EEXA 1FWNA 2A79A 4OU1A 1QCWA 4U5IA 3K13A 5AVNA 2V0TA 1UKQA 5GQBA 2FZ9A 1KFCA 5I79A 1W5MA 5J5RA 1QI4A 1Q66A 4CKQA 5A6BD 3B0VC 5MKGA 4UFHA 2FTYA 4HHLA 1JJKA 2GGGA 3DFPA 1TPWA 2PDKA 3N18A 2WMHA 2E67A 3S2NA 4C7GA 4FPSA 4AZ5A 3GXIA 4PA8A 3G1SA 2HJPA 4NZCA 2O92A 1BVZA 3BZGA 1EPVA 3O15A 3QOKA 5FAGA 3IS4A 1UUMA 5CLTA 4PUKA 4UTJA 3CHVA 1RQHA 5EMYA 1GW9A 3RU6A 1CI1A 3O2LA 3GG1A 3QZAA 2NQHA 4GPNA 1K6AA 1WAWA 1DE6A 3LRMA 3WQDA 1ZBCA 1N55A 3GVRA 2ABBA 4AH7A 1TRIA 1VD6A 5I06A 2CLHA 1VFUA 3GR4A 1V3LA 1A3HA 1OK4A 2Y24A 2TMDA 1WX0A 4DWSD 3LENA 4OJYA 3RR4A 3IEBA 5AHMA 2DH2A 5FJUA 1SO6A 2EPKX 2ADAA 3CQ0A 1TJ1A 4W86A 1J96A 1XSIA 3RLUA 3W70A 8RUCA 3N29A 3NCOA 1H0GA 2WC4A 4O50A 2PWDA 1SO4A 5FF7A 2ZYFA 3WLLA 5CQ1A 3N2MA 5HWMA 3ORWA 4DVOA 1W54A 3HPXA 4FK9A 1GVYA 4UOJA 3BGJA 4LPCA 1A5MC 2P5NA 5G5IA 4PTVA 3UWZA 4C1NA 2WSKA 5FCZA 3LUTA 3CM4A 3V0SA 3T2QA 2Q02A 5EL1A 1GG0A 2CZEA 1HP4A 1D7FA 1OB0A 3GRIA 1XLBA 1NARA 3RCMA 3ATYA 4KWVA 2ZC1A 3EZ4A 2EBNA 1LBLA 3W1RA 3VC5A 1HGWA 1G7UA 3GUGA 3DENA 1WXJA 2QCMA 3D3FA 2FZBA 2YXGA 3TV8A 1CX9A 2E5CA 3CXOA 3U5UA 4FLSA 3QYSA 2BHUA 2X0YA 1KW1A 4QROA 2PLKA 3AHXA 1QI0A 4H6EA 4HP5A 4UFMA 2R1MA 4C7DA 1CEOA 1LOSA 3CMGA 3W1LA 2PI6A 3PNZA 3B9NA 3DFTA 4Z0JA 2QQ6A 3WQ6A 3EA1A 1W37A 1V4YA 5BMXA 2YR1A 3LYEA 4PE8A 1US0A 3WQEA 2OPJA 3BC9A 3WH7A 2QCGA 1IEQA 1KO0A 3NPWA 3HPAA 4GD0A 5LIYX 1RK5A 3EWCA 4CD4A 1HGYA 4P8VA 3TW6A 3CL6A 3NL5A 4KETA 4HNLA 4XQ6A 4IIHA 2WZEA 1GYNA 1DJXA 4CD5A 4BQ3A 4R88A 3S8HA 3GW0A 4UWMA 5A8OA 1HN1A 1JUBA 1QW9A 4BFAA 4IPIA 1W2VA 1IEVA 3AS0A 1UQYA 1F3EA 4E6MA 4GFSA 4UBPC 3W74A 2W6RA 1Y7VA 2BZNA 3BAIA 1L8PA 2X1RA 4CNTA 5CSUA 1OK6A 4JKLA 3M1ZA 1VHCA 4K3ZA 3WLQA 1SW3A 3HN3A 1FCQA 2BBFA 3P84A 3W81A 4C6BA 4CUCA 1XQKA 4UC5A 3A3HA 3LXAA 1SMDA 3AJXA 3SY1A 2DZWA 5A8QA 3N1AA 1RP9A 3H2CA 1M7XA 2PU1A 1GVSA 4JTEA 2YCLA 3GNOA 2PP3A 2PU0A 2XPKA 4PEKA 4F79A 3CUGA 4LBSA 1OM0A 4TUFA 2H9AB 4IMAA 1UWQA 2P8BA 4GI6A 3OIXA 3FV9A 2XH2A 3GFXA 1J5SA 2JGYA 1ALDA 4U31A 3L2IA 1NDWA 2PTXA 3NUKA 4Q4MA 1TJPA 3U4FA 3UR7A 1DWFM 1XIGA 1XGZA 3OYXA 1ITQA 1ZZMA 2XVGA 3ZJ7A 2G95A 1N8FA 1ZRQA 4UTTA 1W8GA 1PZ0A 2ZTKA 3FJNA 2EKCA 4BK9A 5TF0A 2D2GA 3QPYA 2QV4A 3OLDA 4AVOA 1Y5VA 5E70A 4NJKA 3T0CA 1GJUA 5ECUA 3GDBA 3N2XA 1P1MA 3R58A 5ABHA 2J8FA 1RZMA 3BJSA 4UMBA 4HSHA 3W85A 7XIMA 1GTEA 3CAVA 1PV8A 4J7RA 4JNZA 3VGHA 4MHBA 2J7HA 3CUZA 1GVFA 3PZUA 4NAFA 1QXLA 2ZVRA 2QCNA 3MO4A 1CGVA 3C8NA 3MU7A 3V75A 5AHFA 3CL7A 3S2LA 1TREA 3QW4B 5K4ZA 1DTUA 4V2XA 1NQKA 1YNPA 4E4UA 1UOKA 4AD4A 3ZVHB 1B4EA 4HTYA 3F4DA 3F5LA 1YDOA 3PZOA 1OFQA 3E49A 2JKPA 5U7SA 4LYKA 3K5XA 2OKOA 4UZUA 4CU7A 1ZQ5A 1X7IA 4FLRA 5DT7A 3R8GA 4DJDD 1KTNA 2QW5A 4FOKA 1XBXA 4HA4A 3ANYA 3IGSA 3LEPA 3MS8A 1XKJA 1GJPA 3JRKA 2GJLA 3OVPA 3BSGA 3KOZA 4JTAA 1QPRA 3MSYA 3WD4A 4M81A 2AKZA 2R1PA 1KB3A 2J7EA 4YVXA 1XS2A 3HB9A 1UBPC 1E6PA 4PR4A 3ES7A 3H4GA 1YPFA 1B9BA 1TUXA 3CWHA 3H12A 2BVTA 1GZ1A 3MSDA 2DZTA 4J3VA 2WW5A 3L4ZA 1IIGA 4LANA 5GNXA 5LNWA 3HV9A 3ZYZA 1XF0A 4IMGA 1WYIA 1BVNP 3EWUA 1J6PA 4YTSA 4MM1A 2XN2A 2RFGA 4QJ3B 1V6UA 1WDWA 3V16A 1M7PA 4JEJA 3GLCA 6XIMA 1K1DA 3ZO9A 4MKVA 4H6KA 4LAOA 3ITVA 2YA0A 1EJVC 4MFDA 2GJPA 3U2CA 2XVLA 3CPUA 1Q6DA 3AHZA 1H41A 1ZFJA 2A3BA 4HA1A 4IIBA 3EB2A 4ZB0A 2INEA 1TE1A 3MUAA 1CW2A 4OGZA 5HQLA 2WCGA 4EPDC 5FJTA 3SDOA 4OECA 2X0HA 1B3OA 2IQ0A 3NL6A 1I1WA 3TDFA 1SUXA 3GZAA 1UZ4A 4JTTA 1IXOA 3U2OA 4O16A 1TA3B 2CBJA 4HA0A 3KVLA 2H8XA 4NZ5A 2J7CA 5DCBA 3VABA 2NV9A 1I2RA 3QV8A 2OVLA 4KRUA 5DMYA 4HJWA 4O0KA 2CESA 2F2HA 3OIHA 3UXLA 3ZZ1A 4D6IA 3NURA 5CJMA 1J0HA 3DBPA 1CIUA 4Q3MA 4DX3A 4F9JA 2AGTA 4E5TA 1DPMA 3SY5A 2WCSA 1B0IA 2XIMA 2PTYA 3CPRA 5CSYA 1XYMA 1GVEA 1OQFA 3TZNA 4AX7A 3NEVA 4ML4A 1J11A 2G41A 3E96A 5E6ZA 2I16A 2RH9A 3KBVA 2VGIA 3THCA 4KPLA 4RPPA 2Y2WA 3TCSA 4AIEA 4EIVA 3BVJA 2ZZ3A 2ACRA 1UH3A 3P7YA 1IWPA 2CW6A 3LPFA 3H54A 3FW6A 1QDSA 3RX2A 1OZMA 2W62A 3QJAA 2CXGA 3P61A 3QH2A 3UGRA 2RHGA 3WNPA 1YNYA 4M7TA 3LI1A 5KMYA 1K4HA 3WNOA 4FXFA 4Q4PA 2GWGA 3WJYA 4XG1A 5LIXX 1FOBA 2XFYA 4H7ZA 2FVLA 2R8WA 2PDXA 5BXTA 1E43A 1Q7MA 2ZX9A 3VDAA 3NPVA 3VUPA 1M9HA 1B3VA 1DE5A 3OA5A 3NZQA 3G1RA 1JZ6A 4CQAA 4MTVA 4CCDA 3QF0A 3VDHA 2E6YA 1DHPA 3PZIA 1KFEA 3UCCA 3ZR6A 5MF5A 4OUEA 4JTRA 1RY0A 1JD7A 2Y62A 1VH7A 3VA8A 1RQEA 1CXEA 5C9WA 3KWXA 3VNIA 3QTGA 2XFRA 3QLLA 3SM0A 1UD3A 3A4XA 2Y5SA 2UY3A 3BH4A 3LA4A 3LLDA 2G96A 1JULA 5CJ5A 1K8YA 2D0HA 3N2CA 4JTFA 4ZVJA 1SQ7A 1OFAA 3ARQA 1JZ8A 5T26A 1KRBC 2DT0A 4H8VA 1O94A 1DIDA 4CQ9A 3ABQA 3AIWA 2EG8A 1UR8A 1WXYA 1J2WA 3MY9A 4WOQA 2WKJA 2WC3A 2WSRA 3LBCA 4LAZA 1OCQA 1KCXA 3OB8A 4WSJA 2Y6ZA 2WZMA 2G3NA 3U4AA 1ZUAX 4MWAB 3IIPA 3LHZA 2VTFA 1QHPA 3QKEA 2BY0A 3H2NA 5IOBA 2DPEA 3IK4A 3CGTA 4L56A 4YPJA 1DVJA 4G8TA 3SN1A 2DZXA 1TCDA 3GH7A 4HMEA 4A35A 5I3IA 4ALDA 4HNUA 4H4IA 5HANA 1BTMA 1YRRA 4JQAA 3WLIA 4JOMA 1E1CA 5DANA 3WIJA 4QCFA 4M7SA 1MXDA 2ATSA 3LN3A 4ACZB 3R0KA 1SW0A 2XN1A 4J5NA 3AUOA 3OHMB 4Z1DA 4I5XA 2VVSA 1DYSA 3UQNA 3C4UA 5I78A 2R82A 5A6KA 4IP4A 4S3FA 3SRKA 3N2BA 2Z2UA 4GYPC 3R12A 1JGIA 5FF4A 3ZM8A 4E2DA 4ROQA 1Q4WA 1SJAA 5BYWA 1E0XA 1SFLA 1XIDA 5CKSA 5H6HA 4KW2A 3TVAA 3ANUA 1BHGA 1WDRA 1VCVA 3EXRA 1M7JA 1AA1B 3C2FA 3CL8A 1X6UA 1AJZA 1JXJA 5REQB 4PMVA 4MJ2A 3D47A 1PKMA 3R13A 4PFHA 3JVAA 4NASA 4RE3A 5IDZA 3MVTA 2DJXA 5GJPA 5DXXA 4S38A 3LCWA 4JTJA 2A0NA 1R46A 2G37A 3UVAA 1VBHA 3CZEA 1G01A 1KTBA 4MNLA 1E0VA 4XO6A 5G2IA 4G7EA 3KDOA 4LUJA 4AEEA 2R1NA 3SCUA 1FWHC 4H41A 4IPLA 3NM1A 3L2LA 4RXFA 1YXYA 1JCLA 3UG3A 1C91A 4GIYA 3LERA 3AIRA 2CLKA 2P53A 1U5JA 3NVTA 5HK4A 4QGCA 3PB2A 1GWJA 3TYBA 1EDQA 1QNPA 3AMGA 4XZHA 3CZJA 4ASTA 1BKSA 3GVVA 4F48A 3MUCA 5HWNA 1OVDA 3ITLA 5EA9A 4KBXA 5EMUA 4YTRA 1K7FA 4PUWA 1ELSA 1XCFA 1KLYA 3FS2A 4NU7A 1QPOA 1R2RA 1ITCA 3MJYA 4X63A 3W1UA 5E0KA 2YZ5A 4C5ZA 1VBRA 1D8WA 2QVHA 5F4SA 4RX0A 1S5MA 3AAMA 4I9MA 5C55A 2VP8A 1E0WA 3TMQA 1J79A 3M0JA 4QJ5B 3H7UA 1BGGA 2HRWA 2JEQA 2H6RA 5IHRA 1LUCA 3IACA 1EX5A 4ZTYA 1V77A 4FR6A 1TX0A 4D1JA 2RGLA 3AMCA 1CWYA 3WNNA 3S0CA 2DSUA 3W7NA 2YL6A 3DESA 2PP1A 5EMJA 3C3UA 2XUCA 1RHCA 1VAHA 4JQ1A 1M1BA 5FESA 4A22A 3TROA 2PB1A 1NSJA 3WD2A 1E56A 1ONXA 4HOZA 5BXSA 2GJXB 1EWDA 4AG0A 1KCLA 4DWSA 3PPCA 5AYYA 1AZ2A 1XRTA 5CGQA 4GQGA 3BCFA 1IV8A 2WYSA 3TIMA 2PDWA 4HU3A 3N73A 2R94A 3CUHA 3RF9A 1EYWA 2ACSA 4L61A 4BA0A 1A5KC 4H9XA 4V27A 4BWLC 4P7OA 4AISA 4B5NA 1E73M 4HKPA 1P0KA 1O5QA 4KCWA 2CLLA 4ZQMA 1DP0A 3M46A 1BVWA 3BW4A 2VX7A 2IQDA 2PURA 3TYEA 3OLEA 1RV8A 3VNDA 3K4WA 4AYSA 2EJAA 4H9MA 4OUIA 2F84A 2OELA 1TV4A 3HGJA 4O12A 2J66A 3CAQA 1MVYA 4GC3A 4BEUA 5CPLA 3NVDA 3KBMA 2WQDA 1G4SA 2VXNA 4WDTA 4XZBA 4JN8A 2PGEA 3QY8A 1U30A 3LCGA 2PFHA 2GVYA 1UZHA 1UG6A 4QQUA 1IXPA 3KUMA 1DV7A 4B90A 3OBKA 3DERA 3HA1A 2WJEA 1PIGA 1WQ5A 3GHSA 1YDYA 3BLFA 3GDKA 4LOCA 3CEUA 4XB3A 4Z1AA 1E9ZB 2DUAA 4GIAA 4XSLA 2P0IA 3SCPA 4NJJA 4Q6XA 2QIIA 1F74A 1S3TC 1V0LA 2XIJA 5DMNA 4AHOA 2ZXAA 3W82A 1ZBKA 2DV0A 1S46A 4B3LA 2XU2A 2BHYA 2O4QA 4WKHA 1O6IA 1XIJA 3UWQA 5CC6A 3VX1A 2G4FA 3T7VA 1JL8A 3P8JA 3I4EA 5IBXA 4Q8OA 2OYMA 4H9ZA 2HTMA 1E9IA 2V6AA 4QP0A 3VD7A 5A2BA 2VO5A 4NX5A 1W5QA 3H4XA 4JN6A 1HFBA 1EP2A 4WDXA 3BSHA 4AFYA 5ABEA 1XV8A 4P2VA 1Q13A 3LMYA 2A5HA 3EYPA 1GHRA 4DZ5A 4GVFA 3WLSA 3VKBA 3W7QA 4DJEA 3ZIZA 1DXEA 3G8RA 1U5VA 5BXRA 4RR4A 4DUOA 3WL1A 3MKVA 4ZO6A 2E6AA 3VOHA 3M7WA 1S2UA 3EKLA 2GUBA 3TR2A 5ECVA 1W5PA 1U5HA 3DDMA 1OCBA 4F0MA 4PMOA 2H90A 4LALA 4PRWA 1U1HA 4E2BA 1K9TA 2FVMA 3CT7A 3GTFA 4FOJA 4FZIA 4B9YA 2CLMA 3JUGA 5I2UA 3G77A 1T8XA 3VZXA 3ABXA 1R38A 3CASA 2DEPA 2XVPA 3OBAA 1REQB 4WHBA 4TTUA 3M0LA 1FKXA 2XGZA 3W2UA 3HF3A 2ZUMA 2I5QA 2E3ZA 1VZWA 5K9DA 1YQ2A 1C7SA 4FXSA 1FVPA 1G4PA 1M65A 2YDQA 1UPMB 1NVMA 4H6RA 1DOSA 1UWIA 1YX1A 1YXCA 2EPOA 4MOZA 1ISVA 5AHLA 3G22A 3STEA 3UT0A 4O0ZA 3TQKA 2E09A 3MT1A 3ZOAA 1L6YA 3WMBA 3I3DA 3ES8A 2PTZA 4KT2A 4UTMA 2Z1WA 1L0PA 1P0BA 4XTIA 1KRMA 5D2YA 1UR9A 5BRQA 1FWFC 1EF2A 3NPUA 2ZX7A 2PMQA 2E7FA 4AWUA 2Z4GA 3GFYA 5AYBA 1DWAM 3T0DA 3M6YA 1FFRA 3LHWA 3WUBA 3N19B 3FSUA 1VBGA 2D22A 4M0XA 2PCQA 1UR1A 2XJ7A 4ATWA 5D9OA 3NL3A 4Q7BA 3WLNA 4U2YA 5MKGB 1B90A 4IJCA 3WBWA 4N4QA 1F3XA 1XLHA 2EG6A 1F5ZA 3CT2A 3G1DA 1YE6A 1JCTA 3MWAA 2QYGA 4MAVA 1KR1A 1X1ZA 2X1TA 1OT1A 2AGKA 3R25A 3KZSA 4JTHA 3QR1A 4TX9A 5FEWA 1EGZA 4ADSA 1TMQA 1OY0A 3DKLA 4MDPA 1Y65A 3QTPA 2GGHA 4LWWA 2O56A 2NQJA 6CGTA 3ZSTA 3JS3A 2Y1HA 1TTIA 1XRFA 2Y5JA 1EO5A 3URAA 2ZC8A 5FF2A 4WXZA 4RNIA 3Q65A 3KBJA 4HVXA 4ZCWA 2P50A 3VD4A 3QC3A 3FJ6A 4DJDA 1UA7A 3GE7A 1H7XA 5B7YA 4X2PA 3KXQA 3CQHA 1MFVA 2HK1A 4WGXA 1SO5A 4NX0A 4H6QA 3WY1A 4OBSA 1FWIC 1M6JA 4UUIA 4ZEPA 2CETA 1I0BA 1DQXA 5KSWA 3B03A 3C2EA 2VZSA 2IKJA 3II1A 1MDRA 5L9FA 3LS9A 3TUUA 2BG5A 4A2RA 3LGEA 4S3JA 4DUWA 4F40A 3HOJA 2GGIA 4XZIA 4CN1A 1XGEA 3AS2A 1I9CB 1O5RA 1OINA 4CQDA 1SYTA 3MDWA 2WO5A 4H9TA 4N0RA 3AYSA 3OA3A 2DDXA 1X98A 4C6LA 3N6QA 1SZEA 3PHAA 4FS9A 4I9JA 3NFUA 3FYOA 2J74A 3ISIX 1EOKA 4KIRA 4C1NB 4UNIA 1BYDA 4BHYA 2FHBA 1UWUA 1Y5WA 4UTUA 4HQVA 5JIPA 2OSYA 2H3DA 3K8LA 4GO8A 1C93A 1HJVA 3SRDA 3G6MA 4J3TA 4MGGA 2O9PA 4BI5A 3URBA 4GABA 4XO7A 2OYLA 1EIXA 3MZNA 3AI0A 5CC3A 1DJNA 1DIKA 4DY1A 4RZ4A 1G4EA 4RKAA 3W37A 3EXSA 1EC9A 4LFYA 3OVGA 3T81A 3TN4A 1S3HA 3U7VA 4EAYA 3VCNA 1RVGA 1K8ZA 4NIRA 1LORA 4N02A 3FFSA 1ONEA 2GZXA 2WOQA 1JQVA 3W73A 4ZGYA 2WXDM 4IM4A 3HO8A 2E8ZA 2GQ9A 4H8HA 1UBSA 1W3HA 3R10A 4WSKA 1BTCA 1LL6A 3VIKA 3T08A 4MB3A 1L6SA 2JIWA 3IJ8A 1NWTA 2QUUA 3T1GA 3ARTA 1X97A 1E0TA 1Q3NA 1B3YA 5A6MA 1F3TA 4K1WA 5LA0A 9CGTA 4Q6JA 5IHSA 3E74A 2X2YA 2HPIA 3OODA 4WKAA 1JD9A 4I8DA 1HVQA 1XLIA 4JIRA 3QGVA 1Q2SA 2E1WA 2L5HA 3GKAA 4I7VA 5C2GA 2DW6A 3OGSA 4XIMA 5DY2A 2GSHA 5TNVA 4ES4A 3F4CA 5C7VA 1PCWA 1GOWA 3DCPA 4Q8WA 2ON3A 5HBFA 3GU2A 1E4LA 3KHJA 1JIBA 1BWLA 1WKFA 1GYMA 2XHYA 2WHMA 3ID7A 3VOGA 1ICSA 4TMCA 4HJFA 4ADUA 1O5XA 5HJXA 2X42A 4G9PA 2G3FA 1S2CA 4HA3A 3W1XA 4A8IA 2VGBA 4PRRA 3L68A 1XCXA 3M41A 1OGBA 1MUCA 2CEQA 2XISA 3WLKX 1LT7A 4O8RA 4LNCA 1F8IA 3FXGA 3EX3A 1XIBA 2J47A 3QC0A 4OV9A 3KRZA 4D6JA 4DXXA 7ODCA 1KBBA 1TWIA 3TYUA 3W38A 1ODUA 4L5ZA 5M1TA 3TSBA 2C0HA 2YCLB 1LWJA 6REQA 3VGFA 1R3TA 1SO3A 1JYWA 1TX2A 3PBWA 4JDBA 3BOXA 4PH6A 1Z41A 4IMEA 4JR5A 3RM8A 5CC7A 4JNMA 1S5VA 4BI7A 2HS6A 3UZXA 4UMAA 3LCFA 3S42A 1ZAJA 3ONBA 4UTWA 4JEQA 1VFTA 1R86A 3TXVA 1PDYA 2WMJA 3RXZA 3KTXA 1V6TA 1W1B1 3NO3A 3DZ1A 4AWTA 3QN3A 1ZP4A 1YW1A 1XIHA 2R6OA 1RXOB 2BODX 3MB9A 3B0PA 1SZFA 3WL0A 3WNLA 3USBA 4M6UA 4NY2A 1JDFA 3V1HA 1FDYA 1CXFA 1F07A 3ZLFA 1EA0A 3V3WA 4AY8A 3RCNA 1QT1A 1FWSA 1SSDA 2HXUA 1UD6A 1YHTA 4GIRA 2Z28A 4JTUA 4EAMA 1EJSC 1U2YA 3VNZA 3UWEA 1THFD 3HPZA 1TJRA 3V7PA 3MW7A 3VNJA 4HK5A 2VWTA 4GXPA 1TYGA 3L4WA 3W72A 4BZYA 3XINA 2ZICA 3RG6A 1M03A 2ZQ0A 1F7BA 2OZ8A 4GGHA 2NXHA 4NAFB 3VNMA 4X9SA 1LQ0A 3APTA 3S5NA 4EX4A 1IF2A 3VGBA 2OYKA 4XTDA 3FXYA 4WIWA 1AH0A 1LWHA 4ORIA 2XVKA 3TNOA 1UQZA 1X96A 4YN5A 2F6XA 3LBMA 3W01A 1TZZA 1H0IA 2ZTJA 1CGUA 1QI5A 4GNJA 1ZCCA 1V3KA 2I57A 3WKZA 2GUYA 3P60A 2E28A 2XH7A 4H2CA 4GX9A 3UJRA 1FHVA 5B7ZA 1PHQA 1YLVA 4FIQA 1QR7A 4GACA 4O54A 4B3ZA 1QNVA 1Y0EA 1ISYA 1NOFA 2XIOA 1BF2A 2BX7A 3IVSA 3U5YA 5HOSA 3CMFA 4C6IA 4DYKA 4MWAC 1PL9A 3WN6A 3BG5A 3IRDA 5BROA 3EA2A 5DT5A 4L9YA 1AODA 2YLAA 1TB3A 2GWNA 3E12A 4AW7A 3UZYA 3GNDA 5EMLA 1CYGA 3W7GA 2J8GA 2BGNE 1WDSA 3VTRA 1EPXA 3BJTA 4GKTA 1M7OA 1KBIA 4QDWA 2D24A 4IXXA 4RV3A 4N7QA 1A3XA 1BG4A 4W7WA 1EH9A 4KCUA 1Q6OA 2HVOA 5G1YA 1SZGA 4TX6A 3CQKA 5XIAA 4I90A 2QS8A 2ANUA 4MYAA 3RJXA 4PSRA 3C2RA 4KEVA 3W76A 2Y5EA 5FF3A 4NJIA 3W7LA 5HUOA 2IS7A 3PB0A 2OGYA 1KC7A 4XVEA 1GOOA 4TO8A 2O7QA 3DKJA 3FEQA 3VKKA 4XKMA 3DHDA 4PTDA 3TYDA 2YOCA 3OEXA 1EJWC 5HR7A 8TIMA 2J88A 2WJDA 1XD0A 2WZIA 1Q5MA 4H8NA 2VEGA 3AOFA 1SM9A 3U8GA 4P7QA 1VFOA 3PTQA 1BSIA 2RGMA 4B91A 4N9BA 2A7PA 1FQ0A 1P0NA 1H2JA 5A5WA 2A3EA 3H22A 3ARYA 3G1VA 3M0ZA 2D3LA 1EKOA 4DJFD 4GC4A 3TA6A 2PRLA 4C1LA 3RR1A 2ZUUA 4FMVA 3VPLA 1GQIA 4A3HA 2NVDA 1M04A 3NQ2A 3NXLA 3WMCA 2NQ9A 4HBKA 1EZ2A 1OT2A 4M6VA 3NWRA 1AL8A 3TJ4A 1KM2A 3ANVA 4JFWA 1GHSA 1MMFA 4E8GA 2C19A 3E6EA 4X61A 3WDHA 3CUXA 3KW3A 4Z2LA 1W3KA 1XIIA 3TTSA 1LZOA 3P0XA 2PDFA 3FY1A 2J6XA 1KFKA 3E0IA 3WDJA 4Z1YA 5D2TA 2QCHA 3C6CA 5JXQA 1IWBA 1MW3A 4ZR8A 3WEOA 4OOUA 3R0DA 3JW7A 1A5AA 3G1AA 1TPVA 1TV2A 1H7WA 4GQQA 1R2SA 4W8AA 4ZQPA 1W3JA 1TPB1 3MP5A 4ICCX 1C7TA 4S3GA 3RM9A 4OZOA 3EOOA 4JTCA 4GLEA 3HZ3A 3WK2A 3STPA 1WDDA 3VNLA 3BUVA 1R5YA 1JCXA 1VKFA 1OYCA 1JPMA 3VVGA 2FB2A 1A50A 5FACA 4KWSA 1HF6A 3WBAA 4S2BA 1FHUA 2UBPC 3OGVA 4GGBA 3P6LA 4Q8VA 1P6WA 4RDWA 1A5UA 4Q8MA 1AW1A 7A3HA 3P14A 3L0KA 2YX0A 1PTAA 2ZXQA 3WUGA 1ZCOA 3GY1A 4BQ5A 1UMYA 1WB0A 4S3EA 1W5OA 2Y0FA 1UD4A 3TONA 2WVUA 1GOMA 2O55A 1EB3A 1E4MM 2OEKA 2PS2A 4B2DD 4ZTXA 5DQPA 3AWNA 1GPFA 4XD5A 4ZQRA 2A2IA 2JEPA 4ENLA 3RDKA 3RLVA 3GO2A 3LZ5A 4CGTA 1TKKA 3UP8A 4F0RA 3GH4A 4HN4A 2BS9A 1DWHM 3SCRA 4PCTA 2QUVA 5BOOA 4W5UA 3SCWA 1IEWA 4MAZA 3SI9A 1TV5A 4GNKB 1W9UA 2YLLA 1T7LA 4O17A 1YADA 3MMTA 1Q65A 5D8ZA 2MUCA 1JAKA 4K37A 1AQ0A 3CC1A 1YTEA 1GQKA 2Q71A 4NAEA 1TSIA 3QY6A 4NXSA 4R9OA 4FALA 2RDTA 4FOUA 3A12A 1BXCA 3N6HA 4DZAA 1V3JA 3PS7A 3TA9A 1E1CB 3VGEA 3KL5A 4GHRA 2OLAA 4DBEA 3KBWA 3BLLA 1IT8A 3MKCA 2FTPA 4B3KA 2ISVA 4IZGA 3V5OA 2Z1KA 4O1BA 2FLIA 2ZFAA 1VBUA 2EXOA 4MADA 4HYVA 3TK7A 3BMXA 2G0WA 4JX4A 3W3OA 4DBDA 4JCMA 4RXGA 1WA3A 1J0YA 3UPBA 4Z42C 1RVKA 3ARWA 4KRTA 1ZBVA 1UWRA 4F66A 5GJMA 2Y7DA 4KWWA 3PBVA 4EWJA 1OJXA 1UR0A 3WQCA 5ABGA 4MB1A 4J3SA 2Y8UA 3F4NA 1S38A 4LUSA 1ITXA 4Y90A 1PE1A 5A2CA 3N9KA 5JBDA 4Z2KA 2QJGA 1E6ZA 5HMDA 3AXIA 3H2AA 4X0NA 5LNRA 3TTQA 4UCGA 5DF0A 3W7EA 4LH8A 3DYOA 4A29A 4G7EB 4C6CA 3TXZA 2E9LA 1XH1A 4S3KA 5KINA 1PTGA 1T0OA 4JX5A 4LY8A 3UD6A 2FFIA 3M0HA 2HISA 1A5SA 4QDMA 4DZIA 1A5CA 4H3DA 3AROA 3H21A 1W1IE 5A3HA 8XIAA 3PULA 2ZZ1A 2I1OA 2A3AA 2BVWA 1QOQA 5M5DA 3DH7A 5HPOA 1OBAA 4A3RA 1TO3A 1UWTA 1Q6FA 2NLIA 4TU1A 1VF8A 1UPPA 1XRSA 1ISWA 2FGLA 2OEMA 3SFKA 3MP4A 3S5YA 3UNDA 2A21A 2V2CA 3I6EA 3MQTA 1IT0A 3UJFA 1P43A 3S9YA 4UNLA 4A3UA 3O16A 2Z27A 2VZUA 3PBYA 1LUCB 1E55A 2V5JA 4QBXA 3V4BA 3CHFA 4JFVA 4QIUA 1UIOA 4PYSA 3PNUA 4LAUA 4RLIA 4Q4OA 4B5TA 1WUEA 1FP9A 2WMFA 5CG7A 4A8RA 2E0PA 4I8YA 4JIQA 3KOYA 3QY7A 5D2XA 5FSDC 1EYEA 3W26A 3KDNA 3UEQA 3QZ6A 2QDGA 1ICQA 1RPKA 3MVIA 4Z08A 4FP1A 4F2UA 3AU2A 4BEQA 3EMQA 1LBFA 1EFZA 3K46A 1R85A 4UIOA 3GXTA 4HMCA 1HJWA 1OYBA 2UV8G 4NF7A 4DWSB 1TR1A 4M19A 4NSBA 3W22A 5HQMA 1Q6QA 1ZNNA 1A5OC 2X1SA 2WZTA 3WX7A 1KM3A 4IX2A 1XQLA 3A6OA 2P3ZA 3QVQA 2CERA 2H8ZA 1BEUA 1RCOB 3NTYA 5CG0A 3B0UX 4ZA0A 3N4FA 4Z2GA 3L23A 1ZP3A 4H9YA 4DUVA 4GNVA 2DUXA 3N9RA 1F8MA 5LA2A 1X1OA 3UZJA 4QM1A 1TZ9A