2ZZ3A

Covalent complex of orotidine monophosphate decarboxylase d70a mutant from m. thermoautotrophicus with 6-cyano-ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAAFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 85
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zz3A00
1VHNA 4I7WA 2C16A 3RMJA 4ZMGA 1EEPA 7TIMA 4A22A 4HN4A 1K8XA 3M5ZA 1G4TA 4IX2A 5FESA 1F05A 3QC3A 2RFGA 1YDOA 3LOTA 5I3IA 2DZPA 1QPOA 2TSYA 1G7VA 3EEGA 2NWRA 1BTMA 4MFDA 3T78A 3EX4A 3DENA 3O16A 3LDVA 3W7NA 3BG3A 1KTCA 4G1KA 3OVRA 4WY0F 3MHGA 1QCWA 3M5VA 3P82A 1IIHA 1KM3A 4IQLA 1FWWA 1PL9A 4UTTA 1SZFA 2QF7A 2ZZ1A 4WOQA 1FCUA 3TQVA 3U6WA 1VCGA 3NVTA 3HBLA 3K30A 3NR0A 3L21A 3VE9A 3E12A 3LHYA 1XKYA 3W85A 3S8HA 2HTMA 5SWUA 3BARA 3QZEA 2ATSA 4O12A 2B4GA 2BSLA 2P1FA 4O19A 3ATYA 3GX9A 1FWSA 2NZLA 3N2XA 2ZDRA 4JTTA 5CG7A 4RXGA 3RF9A 2J27A 4UFMA 4S1FA 2ZYFA 3BW2A 3TC7A 3F4WA 3L5MA 4K7VA 3C56A 1OF6A 1S5WA 4HPXA 4ZQCA 1B57A 4M7SA 4X3ZA 3DFOA 3S1XA 1Z41A 3KFTA 1HTIA 3RLUA 3P5YA 3SSJA 3NQCA 3JRKA 4WZHA 3KAOA 3PB0A 5FF3A 3M5YA 4MY8A 3OIXA 3DGRA 5K2ZA 3BW3A 4MJZA 1X8FA 3HPZA 3DI1A 1F7BA 3W72A 1SQ7A 2NUXA 3QF0A 2OMAA 5F1VA 3QSRA 3THAA 3TA6A 1H7RA 1R47A 1U83A 3EX6A 3KVKA 1JRBA 1KFJA 5G4WA 4FB7A 5DCDA 4N6FA 2YFOA 4JEQA 1I2OA 1R30A 2PRLA 1QR7A 2R14A 3JS3A 1GVRA 3STEA 3C2RA 4Z1BA 2YX0A 3MBDA 1I8JA 1JUBA 3EB2A 1WA3A 3W6YA 1W3TA 4E38A 3EX3A 5D09A 3NQVA 5HUOA 2JGYA 3O6YX 3O1NA 4AWSA 1WV2A 4ADSA 4NXSA 2ZBTA 1W8SA 4ORMA 3BG5A 4K38A 4R53A 3STFA 4QITA 1ZAJA 1XC4A 1W31A 3W76A 2RKXA 3GB6A 4UNKA 3OHIA 4NJKA 5LGZA 5EL1A 2CZEA 3NPVA 4KFPA 2C15A 3L0KA 3F1QA 1KLZA 5D32A 2I14A 2NXHA 1DKWA 3PSWA 1LCOA 5HJLA 6TIMA 3DU0A 3MJYA 1V7YA 4U4MA 2XN2A 3DFPA 3TW7A 4Q33A 3STCA 4NJJA 4XBSA 5C6MA 3GKAA 2RH9A 5CZJA 3PY2A 1FWRA 3GLCA 3TUUA 1RD5A 1GYNA 3BO9A 3P8IA 1JJKA 3GDMA 5D04C 1GTEA 3GDKA 3GR7A 3W7JA 1OVDA 2DZUA 5LNSA 2RDWA 1FY6A 5CPLA 3O15A 3INPA 3W7QA 3HG3A 5BNKA 5AHNA 2WPBA 3E9AA 5GVJA 1WDWA 3LI1A 4TR9A 3WK0A 1YPIA 5D2VA 4RCXA 5BMWA 3DBPA 4O0ZA 4E2BA 3IVUA 2ZRXA 4IJBA 4B5NA 1W0MA 3HMJG 1GVSA 3H54A 1LRNA 5KSWA 3QJAA 3CEUA 2NLIA 3L68A 2G95A 5K4XA 3GKFA 2TRSA 1OYCA 1I2RA 1EUAA 3V1PA 1TJRA 3I7SA 5FEXA 3B8DA 4DF0A 4DBEA 3GAYA 3S1WA 8TIMA 4K36A 3W1NA 2NUWA 1EUNA 2ZA2A 3N9SA 1OFQA 3W83A 1W3NA 3BLIA 3GIYA 1ZALA 2A2IA 3L9CA 5D03A 3R13A 1JVNA 4WOZA 4UUIA 3PSVA 3KRZA 4BFAA 2V5BA 1FXQA 3LHWA 4S2BA 3UD6A 1H61A 3GDTA 3ANYA 3FYPA 5HR7A 1EP3A 1R2TA 3NDOA 3LTPA 1KTNA 3W7HA 4MOZA 2BTMA 2ZRUA 5CZSA 3G0XA 3S5YA 3NGJA 1LYXA 2WNZA 4NJIA 3WFAA 2YDAA 2AQWA 4FNPA 2QCDA 3EX2A 3DH7A 1Q6QA 3HGJA 3O05A 4CQAA 1IF2A 1VCVA 3M1ZA 3FFSA 5AHMA 4MY1A 3I6RA 3M47A 2EF9A 1G4EA 4BWLA 2YR1A 3IRDA 1L6SA 2FPTA 4RXFA 2JKPA 1EPXA 1GOXA 1RQBA 1QNVA 1UUOA 2VEPA 1AW5A 3CHVA 5EY5A 1UASA 4NJHA 4WUIA 2NX1A 5I3FA 2Z6IA 2ZFAA 1G7UA 2ZRZA 3W84A 5AOUA 3UY8A 4JY8A 4WQ6A 1UUMA 2A4AA 2E6DA 2PRHA 1H5YA 4JX6A 3RK8A 1MXSA 4WXYA 1CI1A 3BGGA 1SW0A 2NUYA 4FNQA 4MZ8A 1JCYA 1OYAA 3QPZA 4JYDA 3UXDA 2TYSA 3KOFA 4NVTA 3NNTA 2DZWA 2OX1A 3BVJA 4TMBA 4GNJA 2Y6ZA 1YXDA 1LRTA 3B0UX 3O63A 2J6XA 5G2IA 3QM3A 1EP2A 3G24A 1G6CA 2OJPA 5CPOA 3NL5A 4QM1A 2R94A 2CLMA 3T4CA 4XKYB 2ZCGA 5DLCA 1ONRA 2ZZ7A 1TV8A 3A22A 3MO7A 1C8VA 4IUOA 4IXXA 4HKPA 1DVJA 3OA3A 3SI9A 1FWNA 1ICPA 2BLEA 3EKZA 4A29A 5BMXA 3W88A 3U2OA 5A5WA 3RFAA 4H3DA 3G3DA 3PF3A 4XKYA 3TAOA 3MYOA 5EMUA 3FYOA 1PHWA 2VFIA 1PV8A 1ZJIA 3EWXA 3PG8A 1KM6A 4NNBA 3P80A 2C6QA 4O15A 2F7FA 4W9TA 4P2VA 3UZ5A 4XZ9A 3G0SA 1KTBA 3GXPA 3PG9A 5D05A 4Q4KA 2E6FA 1LROA 2FIQA 1F76A 4XUGA 3LBCA 3OVQA 4MPQA 2PCQA 3L0GA 2XN0A 4KFOA 4CCDA 3M0ZA 2R8WA 1X7FA 1I45A 4TX9A 5AYXA 4N02A 4OV9A 5G2WA 1NSJA 3SFKA 3W7PA 3KRSA 5AYZA 1WOAA 3NPXA 2CWNA 3O6CA 4OHQA 4ML9A 4MJMA 3WK2A 1TRDA 4FXSA 3NQ7A 4LVFA 2VFGA 2GJLA 1AL8A 3TSDA 1XDMA 4RK8A 3W1MA 2PURA 1CW2A 2QCLA 1M5WA 4LV9A 3EWYA 4CNPA 3UWQA 2V81A 5A8GA 2HSAA 2CLFA 5CPNA 1GYLA 4O13A 4MLJA 2WNQA 3VI2A 2C13A 5U7SA 1RZMA 1LP6A 4DXVA 2CLKA 2QJGA 1TPC1 4JIPA 4AHOA 3LRLA 2Y62A 4PTNA 4ORIA 3W7MA 4MKNA 3NL2A 1NEYA 1MSSA 2QCFA 4UIOA 4O0KA 2G5WA 1DBTA 1ME9A 3C2FA 2BZNA 3FA5A 1ZY9A 5G5IA 3UWVA 3W07A 2ZA3A 5AC6A 3S5ZA 4LT9A 5D30A 3GXNA 4PEKA 3PR2A 1W5QA 1FX6A 4TU1A 4WY0A 3UWZA 4L4LA 2DZTA 2ZZ6A 2H8ZA 3LTSA 2BX7A 3LCFA 3LRMA 3TJXA 1F6PA 1HFBA 5LSMA 5C55A 4EWND 1AMKA 3PBUA 4RX0A 5KZMA 4IOTA 4DPPA 3C52A 4HT3A 3LGEA 3IIPA 3TR2A 3W75A 2V82A 4UFHA 2JK2A 4ZZ9A 1FXPA 3TXVA 2Y7EA 2Y7DA 3PUEA 4QQ3A 2WJZA 1HO1A 2JBMA 1ZAHA 4UTHA 1QPNA 1SSGA 1DQWA 3R89A 1XDLA 1EX5A 1KM2A 4FNRA 3S9YA 3LB0A 4NT0A 5EBUA 4IMFA 3G1YA 1X1ZA 1B4KA 3TV8A 4DO4A 2A7NA 3WK1A 4AMAA 4GUGA 3MHFA 1AW2A 2NXGA 5K9DA 2WSQA 1Q6RA 2A1YA 1SUXA 1NVMA 3CM4A 1E51A 4RZ6A 5AHIA 3LCWA 4X22A 4R33A 1XL9A 1TYGA 1XUUA 3EXSA 3W7GA 3ELFA 4DBDA 5CPMA 3LX9A 3NQDA 1GZGA 1L6WA 3BV4A 2JGQA 4QIUA 3CWOX 1W3IA 4O14A 3PUDA 1VC4A 1KFLA 4K37A 2C3ZA 3HIJA 3N73A 3NPUA 2VFHA 3MP3A 2QJHA 1J5TA 4IPJA 3W86A 3LLDA 2NXIA 3USBA 1VQTA 1O4UA 1ALDA 3M16A 2VKZG 1VCFA 4FNSA 3RU6A 1F73A 1JULA 4UTIA 1JQXA 2B7NA 3IGSA 2QUUA 3GZ3A 1KM5A 1KV5A 1M7OA 4YXGA 1FDZA 4GUFA 1TPFA 4JTEA 3LLFA 3UZJA 3FS2A 1OFEA 1H60A 3LXAA 3S1UA 2E77A 4PCFA 3TXZA 1GJPA 3QH2A 1NF7A 5LNRA 3TMLA 5I3JA 2PE4A 1Z42A 3QPYA 3WK3A 1SW7A 2GQ9A 3G3MA 1G67A 1KW1A 1MZHA 2GVLA 3LERA 3P5ZA 2X1UA 3PS7A 5K4ZA 2A6NA 4O17A 5FEZA 1L9WA 1SO5A 5F2GA 3B05A 1TO3A 4NX5A 1EWDA 3C2VA 1OX4B 2B7PA 1H62A 3LCIA 3QW3A 3ZFHA 3G8RA 2X30A 2QKFA 2ABAA 5TIMA 2CZ5A 1BKSA 3ZWTA 3OVPA 1OX6A 3GDRA 2V8ZA 1WBHA 3HGRA 3EKLA 1XBXA 4HSNA 1W5PA 4GJ1A 1TRIA 2Y61A 3LXCA 1XXXA 4HHPA 3S5NA 1YTDA 2YW3A 3E0IA 1UJPA 4WD0A 1S3HA 4QAIA 4UTMA 3W2MA 4EOUA 2YCEA 2DZXA 3WJZA 1FWTA 5AC7A 1LBLA 4X9SA 1GVOA 3W7CA 1YPFA 4OV4A 1TREA 2BXVA 3I68A 3IEBA 2CLIA 4JTGA 1T8XA 3W2KA 3ZS4A 1L6YA 3NQ6A 5E1QA 4O50A 3UWWA 2V0TA 1AK5A 1JUEA 1W5MA 4UMAA 3RLVA 5EKYA 5F4WA 4LNYA 1D3HA 3HOJA 3ABRA 3Q2DA 2YSWA 4Y6GA 2B0MA 4BI7A 3L2IA 1K7EA 4ICNA 4ZQPA 3GK0A 4O52A 2QCEA 4M5PA 1KM1A 4O18A 5D02A 4RR4A 4N4QA 3TQKA 4HNTA 1FQ0A 3B04A 3HGSA 3M6YA 3UY7A 1NFBA 3CLMA 5BRBA 2VENA 1PE1A 1G4SA 3B4UA 3P84A 2E1DA 1H7XA 4N4PA 2ATMA 2Y70A 1MEWA 3B06A 1XBYA 2PC4A 3CB8A 4DQWA 2FQIA 2GVGA 1KFCA 3W7DA 5DN1A 1LBMA 4S2CA 2VFEA 1SO3A 1JCMP 3MWAA 3N9RA 2QAFA 4RZ4A 3WJWA 2HMCA 1WBJA 2VXNA 4GC4A 4ADUA 5IBXC 2W6RA 1SFJA 4M6PA 3LCGA 1SO4A 1HL2A 2V2HA 5KZEA 1O60A 3CIXA 4R7JA 1RQEA 3TNOA 3MUXA 3R5EA 3I7RA 2CLHA 3B0PA 1LLWA 2ISVA 5F2IA 4AWUA 3HPXA 4NUWA 1JR1A 3C8FA 1YDNA 5HWMA 4CQ8A 1OF8A 3T55A 2QCNA 2WOQA 2DORA 4JIQA 3P81A 5KMYA 2E5CA 2EGZA 2E6YA 3TX9A 3F03K 2FDSA 3ZWSA 2GPTA 1PHQA 3M5XA 2A5HA 3NQAA 3W2LA 1VJIA 2J9ZA 5HUPA 4DEFA 4NX0A 4CCCA 3GDLA 3UQNA 3O06A 4UTKA 2Y85A 4HPJA 5AC8A 3EXTA 4WXZA 3FLUA 2ZA1A 3VCRA 1O5KA 2ZZ4A 3GVGA 1SPQA 2GQAA 3LV6A 3SECA 3W7KA 3L0NA 1IXQA 3H53A 4AHPA 1WQ5A 3NM3A 1I2PA 1VPXA 3L5LA 4Y9AA 1K8YA 3DHDA 4O4WA 1BWKA 5K7JA 4XTIA 4AWTA 4JYEA 3YPIA 4HNUA 1ZENA 3IIOA 3O8AA 1O5XA 1P1XA 2YGYA 4LRTA 1XCFA 3W23A 2NV1A 2FJKA 3DZ1A 5FF4A 3CQ0A 3A23A 3HJZA 4GUIA 4UFIA 3A21A 2VEMA 3CC1A 5DCEA 3W2UA 1A5AA 1H7PA 1A53A 3W87A 4MVAA 3N19B 3B03A 5FF7A 3SZ8A 3CPRA 3G1AA 3STGA 2DJXA 1KFEA 2ISSA 2FLIA 4MLRA 1EWEA 4IMGA 4NQ1A 1OFBA 1SO6A 3SIZA 2CU0A 4JTSA 3GNNA 4AAJA 4IGHA 3DKLA 2B7OA 3G1FA 4FHAA 2CFFA 3EWWA 5D2TA 3MI6A 1VLIA 1S5VA 1TPDA 3N14A 4Z08A 1K3UA 1QO5A 4KWWA 4IWWA 4JDYA 1K03A 1L2UA 5H2ZA 1O95A 1ADOA 1LLZA 3W1XA 3GR8A 2RDTA 1RV8A 3PBVA 1W37A 4O54A 2C1HA 2LLEA 3MI2A 3CTLA 4K8HA 2CW6A 3A5FA 2IQTA 2OZ0A 2H6RA 3BLEA 2OT0A 1VLWA 3NQ2A 5FF2A 1DJNA 5HINA 4LV4A 3TMQA 2C14A 4GE8A 3W3OA 4KKXA 3DXIA 4NNCA 1GG1A 4YMZA 2Z6JA 3S1VA 2WNNA 2O7QA 4ZL1A 1VYPX 3PBWA 3B0VC 1TTIA 3G1HA 4TIMA 3C0JA 2Y7GA 1UCWA 5LZLA 1G69A 4CLMA 2VEIA 1VS1A 5F2MA 1KBIA 1SW3A 1GVQA 4AF0B 2NV2A 3UPWA 1D9EA 2FFCA 1H1YA 1VYRA 1IIGA 3QMSA 1FDJA 4HNNA 3W2NA 5BW6A 2I1OA 4GUJA 4PA8A 4K7YA 3Q37A 4JTLA 1M6JA 1VYSX 3G1DA 4ZQMA 1LZOA 3QFEA 1BWLA 3NG3A 4FNTA 4JGDA 4BF9A 2X1RA 5AFDA 2H3BA 5HMSA 4DO6A 1PCWA 1J2WA 3KXQA 1KBJA 4OBTA 2DP3A 3G18A 1IGSA 4RV8A 5D37A 4HIBA 5DBUA 1ICQA 1C29A 3MYPA 2FTPA 3W1RA 4UTWA 1MO0A 2GUUA 1TMHA 1MEIA 1TV5A 3LHVA 3NO5A 3G1VA 4NZFA 4UNLA 4K6AA 5K9CA 5C5YA 2ZTJA 3BK0A 3Q94A 1OFRA 4Z1CA 2TPSA 4AVFA 1K7XA 4K39A 4UTTC 1W1ZA 3DKJA 3NPWA 5EPDA 4ALDA 1TJPA 4O1DA 1TQJA 3TCEA 5DCBA 3NL3A 4PL1A 4JTJA 1F5ZA 5H91A 2QEZA 4QSHA 4JY9A 4HNVA 2FB3A 4XQ6A 3MP4A 1FDYA 5DY2A 4JTHA 1OK4A 1YDVA 1ML1A 1GPWA 1WXJA 4LC6A 2YZRA 4N9CA 3R12A 1H7OA 4J9JA 1QFEA 1SZGA 1LOLA 1RPXA 4FXRA 3N2MA 1F74A 4LS0A 5CKSA 3EX1A 2CZDA 5LNUA 5LHEA 1VRDA 4M7TA 1TPB1 1H7NA 5ABTA 4Z0SA 4BI6A 5BOOA 1KFKA 2V9DA 3I7QA 3NXFA 1U5JA 2C19A 4DPQA 4GUHA 3T44A 1YLVA 2WSRA 1XBZA 3TDFA 4FEZA 1HO4A 1F6KA 1K8ZA 1OABA 4PH6A 1R2RA 5AN7A 1GTHA 2FPYA 1QPQA 4LTSA 3T7VA 1W5NA 1OJXA 4UMBA 4XBKA 3PWAA 1H51A 2J9XA 2QJIA 1NAL1 1QAPA 5LNVA 1KM4A 1SZNA 5KITA 1TTQA 1LORA 2NWSA 3M43A 4CNNA 2QUTA 4BI5A 3W74A 1K02A 3NEVA 2AGKA 3W2JA 1OFDA 3DI0A 5FI8A 5KZDA 3PULA 2A7PA 1KV8A 5E93A 6ALDA 2Q8ZA 4FIQA 1FCVA 3IIVA 3C2EA 3HGOA 4UTUA 3EWZA 1FCBA 2ALDA 4LU0A 2ZQ0A 2Y89A 1EB3A 3TKFA 5AHLA 1TPH1 2Z0IA 3WJSA 2GJNA 1A5SA 2RDUA 3TE9A 3L65A 2C0AA 1OFPA 5D2WA 3ABQA 3HB9A 3HPSA 1OX5A 4O28A 4UTJA 3NQ8A 1HUVA 3GYEA 3QMTA 4NU7A 3W7RA 1ZFJA 4EVZA 3NQEA 3G1SA 2E5BA 4N9EA 5FEWA 3TQ0A 5L9FA 3P62A 3DFTA 1IXNA 2Y63A 4N9BA 5D2XA 1LBFA 3P67A 1YXYA 3P60A 2J9YA 2FPVA 5LKYA 1HG3A 4RZ5A 3P61A 4UCGA 5DXYA 3VNDA 1Q45A 1LM1A 3A5VA 3W1LA 2OCZA 3T40A 3OBKA 4LWWA 4UC5A 1ME7A 4CQ9A 1DJQA 1YXCA 1S5TA 4DF1A 2ZRVA 4A21A 2Q3RA 3FIGA 4JDBA 4LRSA 1CX9A 4H4IA 2EPHA 3W7LA 3LHZA 4JN6A 5AYYA 1P0KA 3CU2A 1F2JA 3UYCA 3PAJA 4UFKA 4XWUA 3THQA 2R91A 1N55A 1PIIA 4LVGA 4PL2A 2QCCA 4ZQNA 4IMCA 4LVBA 2VFDA 2TMDA 4EF8A 5KTLA 5F4XA 1OFOA 1TTJA 4N6EA 3PC0A 3LTYA 3A24A 3TSMA 1H50A 4YCPA 3LCHA 1DV7A 2X1TA 3WJYA 3LBMA 3TJLA 3G0UA 3M41A 5EA9A 3BGJA 5LHFA 4MYXA 2CLLA 3WJXA 1Y0EA 2NX9A 1LRQA 1W5OA 4GBUA 3W7EA 3V75A 1WOBA 4U28A 3L66A 1R2SA 1OX4A 2YXGA 3W71A 1MEHA 3S0CA 1EIXA 4M19A 2V2CA 2GVJA 4IPIA 1FBAA 2FB2A 4FO4A 2EKCA 1JQVA 3E96A 4UFJA 2H8XA 1TPWA 2XN1A 1P0NA 3SR7A 1ZAIA 3HG4A 3GXTA 3G22A 4DO5A 4JX4A 1M7PA 2H90A 1N8FA 3W1UA 4LC8A 4JTKA 1OFAA 3OEXA 1ZNNA 3TSBA 3ZR4A 4Q32A 1JCXA 5D38A 4BR1A 1QDSA 2C18A 4UTLA 4ADTA 1P4CA 1A50A 3P74A 4O16A 2X1SA 4POCA 3KVMA 4YCOA 5DXXA 3CT7A 2E6AA 3C4UA 2W0UA 1IXOA 4JR5A 4M6VA 4O53A 3TW6A 4ONVA 2HS6A 4IX0A 5HWJA 4LS1A 2Z2UA 2DZSA 3BW4A 1EA0A 4N2YA 3NQFA 2A0NA 4CCEA 5J5DA 2ZTKA 4E2DA 4BWLC 4NXKA 4R34A 3SY5A 4OT7A 1Q6LA 4JYFA 5D33A 4BK9A 4I7UA 3IVTA 1WAUA 3L5AA 3W1QA 4E0CA 3MHUA 5J5RA 1QWGA 1SFLA 3TK7A 1EP1A 3IIZA 3JR2A 1I2NA 3I65A 1UBSA 1ZCOA 5HWNA 3QQ0A 3NZ1A 4MY9A 1B9BA 5CZTA 2CLEA 1D3GA 5I3KA 4IMEA 4LOCA 3EWBX 3L67A 3QSTA 3CWNA 5FEPA 4QISA 5E0KA 1TCDA 3PB2A 4RLIA 4Y96A 5I3HA 1GEQA 3UWYA 4XTDA 3Q58A 3F4NA 1XM3A 3VFLA 3N34A 4NZJA 1QOPA 4JNMA 3BLFA 3FJLA 3KRUA 5C2XA 1X6UA 4FIRA 3UPBA 3QMRA 4CNOA 2Z1BA 3MI3A 3QEZA 1KLYA 2J24A 1JUKA 4FX8A 2QDHA 1YTKA 3EXRA 1C9DA 4AXKA 3DFQA 4A2RA 1NF0A 1DORA 4I7VA 3NM1A 4P61A 4HSOA 2F84A 5HULA 2YYUA 5AB3A 2OT1A 1YTEA 1TSIA 4MYAA 1KM0A 1QOQA 4K8EA 3LI0A 5CZ0A 3SGUA 4WX2A 4FX6M 1GQNA 3NYZA 2VOMA 3LHTA 3P8JA 3IGXA 3G8EA 4LUIA 2ZRWA 1Z48A 1ME8A 4O1CA 3HO8A 2WQPA 4UR7A 2RHGA 3ABSA 1OG0A 3TFXA 4AH7A 4JXCA 2XFWA 4O11A 1WX0A 1Z44A 1JCLA 1TPEA 1OHLA 4Z1DA 3TAKA 3HG5A 3LXBA 4X2RA 4PC8A 3P7YA 1VH7A 5DY3A 2QUVA 1T96A 1GT8A 1LOSA 4MIMA 3DFNA 3C3NA 1DQXA 1GG0A 1VR6A 4C1KA 2WV8A 4YL2A 4MFEA 4OE7A 1W54A 5DBTA 2QCDB 4RKAA 2WO5A 3CEPA 4GFSA 4O8RA 5TBOA 1T0OA 4JICA 3ATZA 4EF9A 1TPUA 4MZYA 4YLWA 1WYIA 2DZVA 4UTWC 5F4SA 4N9DA 3QYQA 1TV7A 3QQ1A 4QNEA 3D0CA 1Q3NA 2VFFA 5LGXA 4GRSA 2QCMA 4TO8A 1ICSA 3TFCA 2UV8G 1TPVA 1X1OA 3PUOA 5CSSA 4WJEA 1A5CA 1YADA 1SSDA 5AHEA 3NZRA 3O07A 3MBFA 3NL6A 3OG3A 4FX7A 5T26A 1H63A 3S5OA 4O1BA 4NNAA 3PVFA 2ZZ5A 4ZVJA 2WKJA 3NQGA 4AEOA 4Y8FA 3FOKA 2QR6A 1XBVA 1J4EA 4JD4A 1DL3A 1LOQA 4TMCA 4OGZA 5G1YA 3TH6A 4RJEA 3M7WA 5FF0A 1O94A 1TB3A 3SJ3A 3KHJA 3W22A 4LUJA 3H55A 4KFNA 5IBXA 4FNUA 1OK6A 5C54A 3KVLA 4Y90A 5AHFA 3UWUA 5HNRA 2DU2A 3LCLA 1VHCA 3W7IA 3ABOA 4LY8A 3MP5A 4IXHA 4PODA 1LTDA 3W1AA 2VC6A 2ZRYA 2J88A 3TC6A 1Q6OA 1KA9F 4A3UA 2X2GA 2VELA 3A9IA 3FJ6A 3PM6A 3TROA 1YYAA 2ISWA 4NJGA 2E68A 2V5LA 3FKRA 4UXDA 1A5BA 1FCQA 1JRCA 3NOEA 2PRMA 3MW7A 5TQLA 1B3OA 3NA8A 4O1AA 2ZZ3A 2V2DA 4JX5A 1W56A 1UB3A 2Y7FA 2A85A 5IM51 4QJ1A 3KVJA 1V5XA 3DHFA 5U4NA 1AG1O 3VE7A 4LVDA 4LVAA 5F2LA 3QRHA 1I4NA 5HR6A 2DJLA 4AF0A 3R2GA 3W70A 3LCXA 3SW6A 3LHUA 1GWJA 5G4EA 3RNDA 2VEKA 2W79A 1RR2A 4O10A 1I2QA 3E49A 2YPIA 5F1UA 5CGQA 1FUYA 1QMLA 4Z0JA 2G96A 3PBYA 4YWIA 3IVSA 1OYBA 4DELA 4KWVA 4GXMA 4I9AA 1H1ZA 2P10A 3C2OA 1PCKA 3M44A 1PVNA 1XUZA 2A21A 2AAMA 5D2YA 1IXPA 3C6CA 5K3VA 3UXAA 1XFBA 2QAPA 2YYTA 2B7QA 4O4VA 1SU5A 1TIMA 4GWEA 3LRKA 3CIWA 3FEMA 3IIXA 2Y88A 3NQMA 3W1PA 4JS3A 4OQVA 5G2HA 1RQHA 2ABBA 2CZFA 4UMCA 1PS9A 3U8GA 3M9YA 3S42A 3DFSA 2D73A 2A6LA 4ZQRA 4D2JA 1LDCA 2NX3A 2H3DA 2Q8LA 3BG9A 1DOSA 3HQ1A 4AHQA 4WY0B 3R8RA 3SGZA 3EWUA 4JTFA 4O57A 2X16A 1TTPA 4UFLA 1R46A 2V30A 3AJXA 2I9EA 2BWGA 1KFBA 3W9ZA 1VZWA 3IV3A 5LNWA 2P0OA 1QPRA 4M6QA 3C61A 4LS2A 4DF2A 4LW7A 1H7WA 1XI3A 3HF3A 3W73A 2CLOA 3O6DA 3NAVA 1G4PA 2JKAA 3W1TA 1K7FA 2EAWA 2QCHA 5KINA 3MMTA 2GOUA 3BPWA 4PFMA 4ZQOA 1BEUA 1P5BA 4MUZA 3UNDA 3LM7A 4QNWA 2GQ8A 3LV5A 4UR8A 5CSRA 1JCNA 3QW4B 3HG2A 2WSYA 4Z1AA 2ZZ2A 3IGUA 4FF7A 1QO2A 2KZHA 4MZ1A 3FKKA 1N7KA 1T99A 4A2SA 2QDGA 4OWGA 1VGAA 1AW1A 5DELA 5HQEA 3E02A 3TIMA 4AB4A 4IMDA 4H6KA 1TQXA 5EYWA 5K9XA 4JTUA 1RVGA 2O7SA 1DHPA 3N3MA 4EIVA 1SR9A 1AL7A 4L4MA 3KX6A 5MHBA 3DAQA 2YFNA 5I3GA 5L6UA 2YW4A 3GNDA 2E09A 3S6DA 1GVFA 2G97A 2JKEA 4C1LA 5G1TA 2E5DA 4OU1A 1B4EA 2A7RA 4JTIA 1JCJA 2HS8A 3GAKA 1THFD 1ZHAA 2QCGA 3G1XA 2EHHA 3TU9A 3AO0A 1SZEA 2Q3OA 3W7OA 3VKJA
chains in the Genus database with same CATH superfamily
1VHNA 4HYVA 4I7WA 1DIKA 1PXGA 3TLLA 1XH0A 5CGMA 3AUOA 1UA3A 4QE4A 2OFJA 1G4TA 3G6MA 1JF5A 1W9DM 5FESA 4BCEA 3QTPA 2DH2A 3DG3A 2Y2WA 2I7GA 1YDOA 1UWQA 2DZPA 2REQB 3EEGA 3EX4A 4B3LA 2WANA 4MNLA 1QCWA 3M5VA 3P82A 4YTRA 1KM3A 4IQLA 3NYDA 3T9PA 3AIQA 1NARA 3PPGA 2BODX 3TWBA 3FEQA 4ZGYA 3HMCA 1EO5A 1GYMA 4ZO9A 3K30A 3KP1A 4PMVA 4MDOA 3VE9A 1GQKA 3E12A 2VP8A 1Q7MA 3S8HA 2HTMA 2UY3A 5C2CA 4V1YA 3GHUA 2W91A 2B4GA 3SRFA 3USZA 4P7NA 3ATYA 3O9NA 3MMUA 5CG7A 1BQGA 3V36A 3WEOA 3BW2A 2VCBA 3TC7A 4LYKA 3L5MA 4E5TA 7PTDA 3C56A 1OF6A 4BKNA 4HPXA 1B57A 3DFOA 3KFTA 1HTIA 1C93A 3RLUA 2WMHA 2PP3A 3NQCA 3A47A 2OSWA 3AISA 3LMYA 2W27A 4WZHA 3KAOA 3PP7A 3RILA 1YNPA 3ZVIA 3KBSA 1XLBA 2IKIA 2FVKA 3BWWA 3BW3A 4GLEA 1QK0A 1SQ7A 2NUXA 2OMAA 1QW8A 1LF1A 3MUY1 2D3LA 1JRBA 1KFJA 5G4WA 3O0KA 2J7EA 1L2QA 4HNLA 3TYAA 3TA9A 4EACA 4IHCA 1MNZA 2Z26A 2JFEX 1RCQA 1IEIA 4I5UA 1I8JA 3OBEA 1JUBA 3EB2A 4YTTA 3AICA 3MUZ1 1XHGA 4HOWA 5FJJA 3EX3A 4OJYA 1DIDA 4JZ5A 1DJYA 4DM1A 4DNMA 4D1JA 2VMFA 3UR5A 4RUBA 4WDTA 1YIXA 3BG5A 5TD4A 2PC8A 2W9MA 2MANA 3WH5A 1KXHA 1LG2A 2RKXA 3ZM8A 3GB6A 4NJKA 2CZEA 3NPVA 2BY0A 4KFPA 2C15A 3SADA 5EGRA 2I14A 2NXHA 2PP1A 1KWGA 4D8AA 1DKWA 3O6AA 4LBRA 3N4EA 3TW7A 3E3HA 1LQ0A 2ZUMA 2NLYA 4WR3A 1FWRA 3TUUA 7REQA 4GVGA 5KZ6A 3BO9A 1LL4A 2P88A 1CLKA 3H26A 3R8HA 2PGWA 4XVEA 4GINA 1IZCA 1OVDA 1P7TA 5CLWA 2GK1B 1BFNA 2RDWA 3L7RA 5CPLA 2W61A 5C9ZA 5BNKA 2WPBA 2DZAA 4PYSA 4B4FA 4R9XA 4XZHA 3LI1A 5XINA 2WZIA 5C2GA 1Q8JA 5G1MA 5HNNA 4B5NA 4JFWA 3HMJG 1XSJA 5KSWA 4BQ5A 4WLCA 3QJAA 3CEUA 3O7UA 5A8MA 2G95A 2ZUTA 3EOSA 4J3UA 3QKZA 3R0UA 3WCZA 3S1WA 4HPHA 4L7ZA 2BY2A 5M2FX 1OFQA 2X09A 4NY2A 3ANUA 3L9CA 2O9RA 1VEPA 3JVAA 4M1RA 1QW9A 2QDEA 1VFMA 2V5BA 3LHWA 2XIOA 3ANYA 1EP3A 3LTPA 2PTWA 3W7HA 5LIXX 3VXGA 1RSCA 4Y9OA 3VNMA 2FHCA 1BYBA 3ITOA 2ANUA 4FNPA 4Q8NA 4LAKA 3DH7A 1YBQB 2QVHA 1VCVA 5FJUA 2GGGA 4RE2A 2WSKA 5AHMA 2YR1A 4TVUA 3IRDA 3CPGA 4L1GA 1XDJA 2CHNA 1BG9A 1UYQA 4AYSA 1AW5A 4IIFA 3CHVA 5EY5A 4NJHA 4PMRA 1BF6A 4V33A 2Z6IA 1A4MA 3WO8A 1TUXA 1G7UA 3W84A 5AOUA 4JY8A 5FA5A 1DJXA 2AQVA 1V79A 2PRHA 3DN5A 3DYMA 2QQ6A 3RK8A 2TODA 2XZ9A 4CQBA 3NSMA 3QPZA 5IRPA 3CAKA 3KOFA 4NVTA 1XQKA 5ENLA 3LM3A 3CV6A 4A3YA 4GNJA 1YXDA 5FL0A 1DTUA 3O63A 3AYRA 5G2IA 2YCLB 5C70A 1G6CA 1YMYA 4Q7NA 3NL5A 4DWSC 3BJTA 1R0MA 1ZQ5A 1SYTA 1B30A 4F0HA 1ONRA 2ZZ7A 1TV8A 4WKHA 1GOOA 3A3XA 4MJ2A 5DANA 2J8TA 1DVJA 1NIUA 3RM9A 4F2UA 4Z2KA 4UQAA 3U2OA 1VFTA 3K46A 3N12A 3PF3A 4NP7A 3UF9A 3MYOA 4D6GA 1W1IE 1PV8A 4AZIA 2E67A 3PG8A 2QPXA 2WKGA 3GFZA 2C6QA 2F7FA 4W9TA 1Q4NX 4QSFA 2P0IA 1J11A 2JF6A 3OLGA 3PG9A 4B5WA 4JHMA 1KBKA 4Q4KA 4NI3A 1F76A 3CK5A 4HHLA 4B5TA 3AU6A 3PANA 3LBCA 2XN0A 4K1WA 2R8WA 1X7FA 4TX9A 4N02A 3V1HA 4OV9A 3SFKA 3NPXA 4NRRA 3KW3A 5T91A 2CWNA 3ZT7A 4FXSA 3NQ7A 1T41A 4Q4PA 4PMZA 3TSDA 3VKDA 2OOFA 4Q4OA 1BHGA 3EWYA 4GYJA 3CQKA 2W3ZA 4ACZA 5A8GA 4MAZA 2CLFA 3B8IA 4H9TA 4O13A 1V93A 1CXEA 5U7SA 1RZMA 5D4YA 4U3CA 2QJGA 2CERA 1Y5XA 1PZ2A 1A0DA 3KCOA 3AIBA 3WUGA 2POTA 3W7MA 3S2CA 1BYCA 1MSSA 1CIUA 1RA5A 2BVTA 2BZNA 1Y8BA 1EPVA 2NSOA 2D0HA 4CEXC 3TLQA 2A3AA 2IPWA 1FX6A 4TU1A 2DZTA 2ZZ6A 2BX7A 4B3ZA 3LRMA 3WBAA 1BRLA 2DY3A 4J3ZA 5LSMA 4EWND 4RX0A 2AL2A 2CEQA 5KZMA 1EGVA 3A4XA 4PBGA 2O56A 1CXHA 3PWIA 3LGEA 1EL3A 3IIPA 5A2CA 3TR2A 2V82A 4GQQA 1EYEA 2Y7EA 4IIHA 4QQ3A 2WJZA 3D3FA 5AYIA 4J27A 1DYSA 4J4KA 5A2AA 3ZO9A 5HJYA 3NOYA 4UTHA 1CCWB 3RRAA 2PZ0A 3WEMA 4RNIA 1QOXA 8XIAA 1XDLA 3GZAA 4FNRA 4AZCA 2Y1HA 5IHSA 1IEVA 3K1DA 5H6HA 4IMFA 4XKMA 4AY7A 4DO4A 4YN5A 3WK1A 4AEFA 3WD4A 1TWDA 1AW2A 5K9DA 4S23A 3CM4A 5EMJA 1SM9A 4RZ6A 5AHIA 1MQRA 1VIZA 2ZWZA 1UWSA 3EXSA 3I4KA 3LX9A 3R7MA 3LK6A 1W3IA 3VKAA 3E2RA 4Q8TA 1KFLA 2C3ZA 3BZJA 3UXIA 4TQTA 1XD0A 4HZMA 3MP3A 1I75A 1JYVA 4IPJA 2NXIA 3AOFA 2IS7A 4ICMA 1LQAA 1HGWA 3K2GA 2VKZG 1VCFA 3F5JA 5BU9A 4PB3A 2X1IA 3AUJA 1JULA 3SN4A 2QUUA 1KM5A 4DIAA 4JTEA 3CUFA 2XSBA 2REQA 5M17A 3T42A 2E77A 4PCFA 3TXZA 3AALA 4DWDA 4TOQA 1Q2SA 3T08A 4MB4A 2VWSA 1KCKA 4QDPA 5LNRA 3TMLA 3THCA 5I3JA 1Z42A 3WK3A 1SW7A 4MKSA 3L4WA 3G3MA 1KW1A 4QX4A 1MZHA 1JZ8A 4OVXA 4KESA 2OYMA 1MRAA 5K4ZA 3FAWA 3N1AA 4L4PA 1NQKA 5F2GA 1TO3A 4JTCA 3EKGA 3TONA 3C2VA 1OX4B 2B7PA 1H62A 3NTYA 3LCIA 1UD8A 3QW3A 3H4WA 5E5CA 2ABAA 3PTDA 1E9YB 1QHZA 5TIMA 4DRSA 5TF0A 1YE6A 1V3HA 1BKSA 5CCZA 3OVPA 3MUAA 3AS0A 1T40A 3GDRA 3HGRA 2ZDSA 3PZUA 1JZ5A 1RK6A 1TRIA 3POCA 4HHPA 1XXXA 2XU2A 5CZKA 1MUCA 3E0IA 4NG3A 1UJPA 2HQAA 4Q3MA 2GJRA 1RK5A 3MCNA 3GVVA 2YCEA 1JXJA 2HPMA 4PMYA 3LYEA 5AC7A 4ZA0A 2Y8KA 2NSXA 3W7CA 1YPFA 1P0BA 4GABA 4NSBA 3H22A 4EKJA 1R6WA 3ZS4A 3DGBA 3NQ6A 3QZAA 4AY1A 3QN3A 1HJXA 3VKBA 3HOJA 3Q2DA 3APGA 3ITCA 5E9AA 2UBPC 4HZ6A 4ZQPA 1XJBA 3AXIA 3M0VA 4C6NA 4S3CA 4HGXA 3TQKA 1VB9A 2F8QA 1TV3A 2PWGA 1HKKA 1X6NA 3HGSA 2WWCA 2O92A 3NCOA 3B4UA 3P84A 1AH0A 5BWFA 1H7XA 1HKWA 1W9VA 4EANA 3TTYA 3KBNA 1EJVC 2Y24A 2GVGA 1LLOA 2WHMA 2YL8A 1SO3A 1E15A 1U30A 4ADUA 2JQXA 5IBXC 2W6RA 4XVDA 4TTGA 3AC0A 3LCGA 1SO4A 1GQJA 2PDYA 3H21A 2X0SA 4N42A 4J2MA 1RQEA 3TNOA 3WD0A 1L8NA 3W27A 1JZ3A 1E43A 4NUWA 1U1UA 1JR1A 3C8FA 2A79A 4B91A 4CQ8A 5JVLA 1OF8A 3LZ3A 4C6DA 2WQDA 4JQ2A 4F3HA 4JIQA 3KRBA 2XPKA 4ZFMA 5AZ1A 3VIMA 3GW0A 3ZWSA 2GPTA 4AD5A 1XSIA 1VJIA 1GEHA 4DJDA 4D6CA 1UR1A 3UQNA 1Y5VA 1C92A 5FAGA 2DIKA 1MUMA 1E6QM 3FV9A 3PK7A 3WQCA 3ITTA 3FLUA 3VCRA 2DSUA 3VZYA 2HBVA 3W7KA 4AHPA 1A3WA 1VPXA 2VC5A 1K8YA 4JFVA 4O4WA 1Q6GA 4XTIA 4GGHA 1O5XA 2YGYA 4LRTA 3W23A 2VEFA 5FF4A 3CQ0A 3HJZA 4MTVA 4UFIA 4PSPA 3VNYA 4FLRA 2FH6A 2QGHA 2PF8A 3RLGA 4GO9A 3COTA 3N19B 4AYGA 5FD0A 1Q85A 1LQ2A 1QJWA 1Q4WA 3G1AA 4IL2A 3C3UA 4PB4A 2PDUA 4MM1A 4AC1X 1GJWA 1UD3A 4JTSA 4OOZA 3DKLA 4OZOA 2CFFA 2FGBA 1FOBA 5A2BA 1VLIA 1RY8A 1TPDA 2YIHA 1YBQA 1ZJAA 3L2MA 4XAGA 5JH2A 1FFRA 3IAPA 1KRAC 3A12A 1XPGA 4LUSB 3SDOA 3BMXA 5BCAA 1JGIA 1VD6A 4GACA 1RV8A 3I6EA 2LLEA 1Z89A 2ZKMX 3MI2A 4R88A 4K8HA 2UWFA 2CW6A 2D2JA 1UA7A 2VX6A 2QUNA 3SJNA 5HINA 1KR1A 2C14A 1XINA 3DXIA 2ZX5A 5I78A 1LL7A 3TNBA 2EG6A 3LMZA 4U3AA 3B0VC 1TTIA 4YPJA 3UGRA 1UR9A 4KCTA 2Y7GA 4IF2A 2GWGA 1SW3A 1GVQA 2YCLA 3EDJA 4TUFA 4PCTA 3CZLA 5DT7A 4FA3A 3VZXA 1M6JA 1L6FA 4XK2A 1WB0A 4ZO7A 1RLCL 5H8UA 3OQ8A 4LUYA 4XIMA 3QFEA 1A3HA 4JGDA 3RRXA 3N2TA 2X1RA 3L2LA 5AFDA 2CCRA 4DBSA 4UWMA 1CGXA 3LU2A 3UCDA 2X05A 1J2WA 2OG9A 2VGFA 5T8GA 4KEZA 3TN3A 1IGSA 5EFDA 4C6KA 3VPLA 1ICQA 4HN8A 4X61A 3U2EA 9CGTA 5I6SA 1VBGA 3T2QA 1UBPC 1TMHA 1HN1A 3N2CA 1MEIA 1MXGA 4E8CA 4UNLA 4K6AA 4RL3A 3AHVA 5JBEA 4MJ4A 2ZTJA 2VDHA 2O0TA 1UC5A 2OU4A 1OFRA 1F8MA 3NO3A 3B40A 3GU2A 4MSSA 4Z1CA 4GI4A 4DYEA 1CGUA 4AVFA 4K39A 1W1ZA 4WEVX 2ZXQA 4DB7A 2QJMA 4O1DA 3TCEA 5DCBA 1XH2A 4Q6XA 3BAJA 4PL1A 4JTJA 4BQ3A 1F5ZA 1EOMA 4RDWA 1F3TA 2QEZA 4QSHA 4G6CA 1A49A 4H6RA 4S3BA 5GNXA 1FDYA 1YDVA 1FWFC 4LC6A 2YZRA 2KX9A 3AIVA 3EMCA 4UOJA 1RPXA 3N2MA 1V6XA 3GC2A 3UFYA 3K5XA 3DYOA 3BAWA 3EB4A 2QMKA 2CPUA 2DUAA 1U5JA 4DPQA 3T44A 4YVXA 3BTNA 4PCSA 3QBUA 1P48A 1K8ZA 1QBBA 1RXOB 1R2RA 5AN7A 1GTHA 3T7VA 1DEDA 1NAL1 1QAPA 5LNVA 1FP9A 1SZNA 1TWIA 1KC7A 1LORA 4IFRA 3W25A 3DBNA 2QUTA 1OFDA 3QQWA 3K4WA 4GC3A 3STPA 5E93A 1XYMA 2DSWA 2ON3A 1J0KA 1FCVA 3C2EA 4FR6A 1K9TA 1EJTC 3U57A 1B3VA 1D3CA 3TKFA 2J74A 2GJNA 2RDUA 3GQYA 3TE9A 2YOCA 1OFPA 5D2WA 1S2CA 2DVTA 2WAGA 4W93A 1UKPA 3APYA 3KE0A 3FVDA 3N13A 3IRSA 2PAJA 4NI8A 3NQ8A 2DV0A 3UA3A 3QMTA 1BGGA 1W1PA 1ZBCA 5BOEA 3SM0A 2E5BA 3UERA 3MMWA 2Y63A 1XX1A 3DHUA 4N9BA 2V3GA 1UZ1A 5D2XA 1NOFA 2D24A 1XQLA 3GD6A 3P60A 2FPVA 2QT3A 5LKYA 3ORWA 4D72A 5DXYA 1DWGM 1Q45A 4ZXOA 3WDRA 2YL5A 4L4OA 4AFYA 4EPEC 3RIKA 3T40A 1REQB 4B3KA 4LWWA 4K68A 3ZJ8A 4TTUA 2FJUB 1YXCA 1S5TA 1JDCA 1AQHA 1RVKA 2OEJA 2ZC1A 4Q8UA 5IDIA 3LHZA 1P0KA 1F2JA 2RUSA 1XGEA 4FS9A 1W9XA 3PAJA 2VX7A 4WGXA 5AY7A 1PIIA 4PL2A 2ZUNA 4ZQNA 2DT2A 3KS6A 2PODA 5MF5A 1TTJA 4N6EA 3PC0A 1Z3NA 1VENA 4JKLA 1DV7A 2X1TA 3WJYA 5FIPA 3VUPA 3WJXA 3U0HA 2NVCA 3SSZA 3FYYA 1LRQA 2WNWA 4XD6A 3LPGA 1TJ2A 1L8PA 4P8VA 1A5MC 1OX4A 3W71A 1FBAA 4MWAB 4ZB2A 3D47A 4UFJA 1TPWA 2X40A 3HG4A 3G22A 2DGAA 3BL3A 2H90A 3TOYA 3W1UA 1E70M 1ZNNA 3ZR4A 3QLDA 3CZKA 1P4CA 2VL4A 1K4GA 2X1SA 5D9MA 1PZ1A 3KVMA 3VOGA 1BGAA 1S1RA 5DEZA 5FOOA 4HSHA 4Q8PA 5HWJA 4LS1A 4YHGA 2DZSA 4CCEA 5J5DA 2ZTKA 1XG4A 1I1WA 1J5SA 4Q8QA 1M9HA 4JYFA 4PMJA 2YBTA 5CLTA 4OFCA 7ODCA 3IVTA 1WAUA 3TN5A 2B81A 3W1QA 4E0CA 1NFGA 2WCAA 3I65A 2F6UA 3GG7A 5HWNA 5LXEA 4F4RA 3CGTA 3P0WA 4LOCA 3CAWA 1U5HA 1ZGDA 3QSTA 1HP4A 1GOMA 1QK2A 3CWNA 5FEPA 2G50A 4TX8A 1I1XA 3T81A 3B8TA 2OKTA 5ABHA 4RLIA 1AH3A 5EMMA 4LH8A 4C1NB 1JFHA 3RCNA 3UWYA 2H9AA 2PEVA 2ZE3A 3B9EA 3FJLA 3KRUA 3V0UA 4IISA 4ATLA 1NDVA 2E4TA 1RP8A 1KLYA 5HJXA 1JUKA 1XYBA 3S6OA 2WVSA 1YTKA 4HZ7A 3EXRA 3DFQA 4LB4A 4A2RA 3S2NA 1DORA 3GS6A 3N15A 3NM1A 2DT0A 2F84A 1CXIA 2YYUA 4FOKA 4HA3A 1PDYA 1F07A 2IQDA 1QOQA 4K8EA 4HMEA 4D6JA 1JPDX 4GHRA 3P8JA 3ZLGA 4QG6A 2XH2A 3VMNA 4LUIA 2ZRWA 1HIZA 3VGFA 4H8HA 5MKGB 4LY4A 1OG0A 3BQ6A 4JXCA 2WMJA 1Z44A 3FJ4A 1JCLA 3LLXA 2VRKA 2V3DA 4Z1DA 2QPSA 1JPKA 4PC8A 5DY3A 4B2DA 2C8NA 1LOSA 4C5YA 4H9MA 4AVNA 4F9DA 1XH1A 3A4AA 3VD5A 1VR6A 3OODA 4QLLA 1R3WA 2G41A 5DBTA 1B90A 3OBAA 3TP4A 1T0OA 5ECVA 4HJFA 3S47A 2I17A 3ATZA 4MZYA 4YLWA 4B5XA 3PWGA 5F4SA 4LPCA 4LYQA 3A4JA 3PNUA 4TO8A 1UOKA 4H8NA 1GUVA 3OVGA 1TPVA 1XLEA 3AS2A 3JU2A 4DBUA 4C91A 1V3MA 5AHEA 1SSDA 3NZRA 3MBFA 2XM1A 1M1BA 2J78A 4IH3A 2WKJA 4ERAA 4YS1A 1WZAA 2V5JA 1BLIA 2OOGA 4L6DA 4U2YA 1EGMA 1J4EA 1DL3A 1Y5WA 4TMCA 5H8MA 1X98A 3ZSSA 4OGZA 4E4UA 2QLYA 3OO2A 4HTYA 4WRHA 1TB3A 4DUOA 3KHJA 4KT2A 3TR9A 2WBGA 3WQWA 5C54A 3MZNA 5AHFA 3UWUA 3QXBA 3O2LA 4LUSA 3H7RA 2DU2A 1VHCA 2UY2A 3QY8A 2GQ3A 4PODA 5FJOA 3W1AA 2J47A 2ZRYA 2J88A 3SCTA 1KA9F 3I10A 4E8DA 4KS0A 1UD2A 2X2GA 2YKKA 4M6UA 2E68A 1W9BM 3B8WA 1GQLA 4UXDA 4TV6A 3MW7A 5EB8A 1F6YA 3NA8A 3D5HA 1UB3A 2Y7FA 5LIWX 1C7TA 2CBUA 2ZWYA 3GUWA 3UGVA 3ZT5A 2DH3A 5U4NA 4WK9A 3B8VA 4FK9A 1AG1O 4LALA 4LVDA 3QRHA 3GFXA 2DJLA 1E3ZA 1A5LC 3W70A 4HOZA 3SW6A 2NVAA 3RNDA 3VGGA 1RR2A 3ARUA 4O10A 1I2QA 8RUCA 1BYAA 2PPGA 5F1UA 1Q6DA 4KCUA 1FUYA 2G96A 2PDBA 3IVSA 1OYBA 4LUTB 4GXMA 4D6DA 3QY6A 1EC8A 2FZ8A 2JIEA 4GWEA 1M65A 3LRKA 5C9XA 3CIWA 1HJUA 3VIFA 2Y88A 4JS3A 3OTRA 4A05A 2ABBA 2CZFA 1S46A 3U8GA 3APTA 3GE7A 4IUGA 4XSLA 1W1B1 3IWPA 3S42A 1BVWA 2I5GA 3T2PA 3CL8A 3H6OA 3SIMA 3LD5A 1EF2A 3R79A 4MG4A 3T0TA 3HQ1A 3VD4A 1DJIA 4GZ7A 1UWAA 3AIWA 1LWJA 1ELSA 1R46A 2OYLA 2I9EA 1TZ9A 3B0YA 5EMLA 2EPKX 1CB7B 2P0OA 2RJHA 4G8TA 3CO4A 4H8UA 2WW5A 3IARA 4LW7A 3N4FA 3W73A 3O6DA 1CDGA 2V5CA 3T2OA 1K7FA 3ALFA 2QCHA 5LYRA 3EB3A 4HK7A 1P5BA 4MUZA 3IJ6A 3LM7A 3SCOA 2F2KA 4UR8A 4B9YA 5CSRA 3QW4B 3SUSA 3WX7A 3CZGA 1QO2A 4MZ1A 2QDGA 1EZ2A 3OJGA 2BNJA 3OZPA 1NWSA 3GXDA 4CD7A 4EIVA 1AL7A 4G7EA 5HPCA 3DAQA 3II1A 4HD5A 4J28A 2OR2A 5I3GA 5L6UA 2YW4A 2GJPA 4HU0A 2DFAA 3WLIA 1GVEA 1HVQA 3MB9A 3I3DA 1P6WA 1WKDA 2JKEA 5LXXA 4O8AA 2ZOXA 5G1TA 5DMYA 1GONA 1VAHA 1V02E 2W62A 4DZHA 3TU9A 3AO0A 1SZEA 1MFUA 3CMFA 1EBHA 3W7OA 3VKJA 4IPPA 3RMJA 4J5NA 4ZMGA 7TIMA 4A22A 4HN4A 1ENUA 1K8XA 4MNJA 4IX2A 5GNYA 3PPCA 1NELA 2RFGA 4IICA 1KO0A 1WNOA 5I3IA 3NFUA 2TSYA 3N25A 1CGWA 1TVPA 3T78A 5KEZA 4QROA 3W7NA 3WDIA 2W63A 4G1KA 1XWYA 4O1FA 1O68A 3CIVA 3CT2A 2FFIA 3ANVA 2E40A 4FMVA 1FWWA 4UTTA 2W5FA 3OIHA 1LG1A 1US3A 2Q01A 3VO0A 3TQVA 1J6PA 4IP5A 1EDTA 3D6NA 2X7VA 4B15A 3VFCA 2DT3A 1PZ3A 1REQA 3BARA 5BWAA 4QJ4B 3ARVA 2P1FA 3N2XA 2OELA 4RXGA 4UFMA 4S1FA 2FKPA 8XIMA 2XIQA 4K7VA 3UA4A 4ZQCA 4M7SA 5HMFA 3S1XA 2DDXA 1Z41A 2OWCA 1R3RA 3PB0A 2W67A 1UWUA 3DGRA 3W53A 3AHTA 2ACQA 3EYPA 2IPJA 1E4LA 1F7BA 1SMAA 3VCCA 3BC9A 2IPGA 3QV8A 4PRRA 3ZMRA 1EGZA 3CHDA 3QR1A 3GBEA 4N6FA 4MWAA 1OD8A 2PDFA 3IJLA 1I2OA 4RDZA 2X8RA 3EA2A 4XISA 3OYXA 4YWSA 3S46A 3EA3A 1T8QA 1UHVA 4E3VA 3VD9A 4Z1BA 1RUSA 2YX0A 1B3YA 3MBDA 5J04A 4HJWA 1WA3A 2HJPA 5D09A 2J8GA 5HUOA 3O6YX 2OTDA 3O1NA 4AWSA 1ZP4A 3CLWA 1WV2A 4ADSA 2ZBTA 1HP5A 3AMKA 4K38A 1AD1A 3STFA 2NQ9A 1ZAJA 2QZRA 1VFUA 1S2VA 2GUBA 2O9OA 2I56A 5CC7A 4UNKA 2OVLA 4M80A 1QVBA 3HU7A 2WHLA 2CLPA 4WVXA 4P7OA 3HN3A 2VWTA 4JKKA 1AODA 2VEGA 3PSWA 4M51A 3MJYA 2BVYA 4Z17A 3DFPA 4Q33A 1HJSA 4MNKA 5IFPA 1EA9C 5CZJA 1SJBA 3WBXA 3PY2A 3GLCA 1GYNA 3P8IA 1JJKA 6CGTA 1G01A 5HANA 3KOZA 2PU1A 1F3WA 1FHLA 3Q65A 3WLLA 3M0XA 1JYWA 2OX4A 1FY6A 3WLJA 4RNHA 2A3CA 3TYUA 4EXBA 3EMQA 3IJ7A 4M56A 1NOUA 3CUGA 1RD6A 4W4QA 6REQB 1XYZA 5HMDA 4NIRA 2HNEA 3U4AA 4CD4A 2FGZA 3H7VA 3LPOA 4CVWA 1M3UA 5FJIA 1YPIA 3WK0A 5BMWA 4J3SA 4JL1A 1YNYA 2YLAA 4MB1A 2ZRXA 3ECQA 1GVSA 1QI3A 3GYCA 3H54A 3M46A 3L68A 4OIFA 2TRSA 1TMQA 3AIRA 5FEXA 4DBEA 3GAYA 4A3RA 8TIMA 4AY8A 3W1NA 2V5DA 2ZA2A 3W83A 1X7IA 4PFHA 1ZALA 2PDQA 3CQHA 3R13A 1JVNA 4WOZA 2ADAA 4BFAA 4DBWA 2PWEA 3T0CA 2D22A 3URNA 3UD6A 3GDTA 1C90A 1XC6A 1R2TA 3NDOA 4W7UA 4L5ZA 3CQIA 5CZSA 3S5YA 3R25A 1HF6A 3NGJA 3CQJA 2YDAA 2R1PA 4BEQA 3LSCA 4KH2A 1Q6QA 3HGJA 4CQAA 4ZENA 3M1ZA 3FFSA 1GVYA 1R3YA 3I6RA 4BWLA 4H9VA 3TCSA 1BWVA 4RXFA 2JKPA 1UUOA 3NO1A 2Z1XA 1I0BA 2VEPA 5A69A 5I7GA 1UASA 2XDFA 4WUIA 3VGBA 3VK5A 4GI6A 5I3FA 3GC5A 1FWCC 3T09A 1KQYA 3FCPA 1UUMA 3UR8A 4N0RA 1OADA 1KXVA 4FZIA 4TVCA 4WXYA 3EPMA 1X97A 1WCGA 3P2VA 3BGGA 1H3GA 1JCYA 1Q7QA 1M7JA 3UXDA 1GW9A 4CU7A 2DZWA 4GBDA 1SFTA 3B0UX 1C7SA 3G24A 2CLMA 3EZ4A 3A22A 1UKTA 4CU6A 1AJ2A 4C7FA 3E0VA 2NT1A 1MNSA 3L12A 3D46A 3ENLA 3EKZA 4A29A 2IKJA 2VDGA 3KL3A 3FSTA 4IPLA 4XKYA 2X0HA 5EMUA 3FYOA 1PHWA 2WMKA 3EWXA 1E6NA 3SB0A 1OZQA 3P80A 5FJPA 3H24A 2ACRA 3LS9A 1EF3A 3DESA 1KTBA 3WMLA 2PLCA 3M4HA 2E6FA 2FIQA 3AWOA 3E0LA 1OD0A 2PCQA 1JCTA 3C5QA 3M0ZA 4H19A 4AZBA 2B31A 4PUJA 3ID7A 5AYZA 3GH7A 4PR4A 4DM2A 4ML9A 4MJMA 4ZO8A 3KDOA 2FVLA 1WZLA 3VU2A 1UG6A 1XLHA 1QNPA 4CNPA 3A13A 3UWQA 3VM7A 4U5IA 2WNQA 4V28A 4DI9A 3DOPA 1F9CA 3B9AA 1W3HA 1U1JA 5JQ9A 1E1EA 1SJAA 5CC5A 2Z00A 4PULA 1TPC1 4XZNX 4AHOA 3LRLA 2Y62A 5BXPA 4MKNA 4GMEA 3ES7A 1BAGA 1NEYA 1Q5MA 1NQ6A 3GG8A 1Z7AA 2G5WA 3C2FA 1ME9A 2IMRA 5I3DA 2ZA3A 4Z2IA 3RXZA 2BOFX 2XG9A 3CHFA 5M5DA 1HQTA 3GXNA 3PR2A 3AROA 1W1TA 2C1GA 2H8ZA 3VNZA 3LTSA 3LCFA 3SRDA 3T8LA 3GTHA 4AX6A 2BP1A 2GJXA 3C52A 2E8ZA 3W29A 2OEMA 4C7DA 4PB5A 3DCPA 3W75A 3GHTA 2C79A 3VM5A 1ZJHA 2JK2A 2Y7DA 2PU0A 3PUEA 3EBVA 4H9ZA 2OO6A 4WDXA 4WKFA 1DQWA 1ZSXA 4LAMA 1EX5A 1P6CA 4JHZA 3F5LA 3UXLA 4AIEA 1AVAA 1C8YA 1X1ZA 1F8IA 4LCRA 2NQLA 4JN8A 2YZ5A 4GUGA 3MHFA 3MDUA 4DO7A 1HW6A 2XWDA 4DJFA 4KMQA 2A3LA 2VHLA 2AMXA 3WKZA 4X22A 3Q4DA 1TYGA 3W7GA 2Z27A 5BU6A 1GZGA 3CWOX 4QS5A 1PUDA 1VC4A 5I02A 3WH6A 2PS2A 4K37A 2YB1A 4CD6A 4IP4A 3NPUA 3PN8A 1J5TA 3W86A 3LLDA 1D8WA 1O4UA 4LBUA 3M16A 4A6GA 4GJIA 4FNSA 4BHYA 4KEMA 1LJYA 2QJNA 4X63A 5HNUA 3WUEA 4HZ8A 4V27A 4UTIA 3MA8A 2B7NA 3I6TA 1KV5A 1M7OA 2HK1A 1FDZA 2VT0A 4MPKA 1OFEA 3L4VA 5CPTA 4ZCWA 1L6GA 1Q7ZA 3CL7A 3A3HA 4M24A 1W9UA 2CC0A 4ZSTA 4W7VA 3SCUA 3GM8A 2PE4A 3W4RA 1JEZA 2GQ9A 4KRZA 1HKJA 5A6AA 3UJEA 2FDMA 4F48A 2GVLA 3LERA 4BJHA 4HYRA 3P5ZA 1KRMA 3PS7A 2BG5A 2Q71A 4O17A 5FEZA 1L9WA 2PBOA 5I07A 1AQFA 3DERA 5ABFA 3S2MA 4UOQA 1PKNA 2GSEA 3ZFHA 4HA0A 4W84A 4CVUA 3U2CA 1VBRA 2V8ZA 4S39A 3VIJA 1OCBA 4D6IA 4DYJA 4GJ1A 2Y61A 3VYLA 4DJDD 3BAXA 4W88A 3RR4A 1E4MM 4AX7A 3ZXWA 3W2MA 4JNZA 3VABA 1ODZA 3BGAA 4AW7A 4IMAA 3PHAA 4X9SA 1GHRA 2VQTA 4WIWA 4OV4A 4KCVA 1E5JA 2YCIX 3AMGA 3NURA 3IEBA 1XCXA 4JTGA 3CV7A 4GCAA 1L6YA 3VIGA 5IOBA 1AK5A 1O1HA 2XFYA 4LNYA 4EPKA 2OSXA 2VCCA 3ABRA 3SCVA 2YSWA 2VC7A 1V6VA 1WO2A 3KOXA 4Y6GA 3CUZA 2B0MA 3L2IA 2DT1A 3GK0A 4ZBCA 1EQPA 2XZ7A 4M5PA 4FAMA 5D02A 2HCVA 4HNTA 4ILSA 4US6A 3UY7A 3CLMA 3KTCA 1T7LA 2VENA 1OWQA 1PE1A 3RPTA 4D8ZA 2VUNA 3B06A 1MEWA 2PC4A 3H2AA 1EDQA 3AZRA 4DQWA 3VGEA 2FQIA 5I24A 4GY1A 3DHPA 4GVFA 2CIPA 3MWAA 3VX0A 2HMCA 1O1ZA 5REQB 3IS4A 5HDRA 4AG0A 4M6PA 3VNLA 4AZ7A 4R5EA 4WGHA 3CIXA 4R7JA 4IIEA 3JZUA 6XIAA 2GGIA 3VZZA 3KHDA 2EG8A 2ISVA 4F79A 1YDNA 3T55A 1V3IA 2QCNA 1O7AA 3MANA 3P81A 5BRPA 4NRSA 2E5CA 2E6YA 2VM8A 3ICJA 3WBEA 1FWEC 2FDSA 3NQAA 3W2LA 3OLDA 3LN3A 4NX0A 4DEFA 4CCCA 3GDLA 2R6OA 3CWHA 4MUPA 4Y9PA 3S2JA 3TN4A 5CG0A 3VGDA 4HPJA 5AC8A 3EXTA 1RBAA 2IW0A 3NVDA 3MCOA 1O5KA 3MSGA 6REQA 2DPEA 2DUXA 1I2PA 1CBGA 1IT8A 4REQB 3V5FA 3DHDA 1WZMA 1BWKA 1E3XA 1SZRA 4IT1A 3ZLFA 3LPFA 1ZL1A 3WLPA 3O8AA 1IEWA 1XCFA 2NV1A 1E9IA 3A23A 1J9YA 1EJSC 2VEMA 3FW6A 3W2UA 1A5AA 3IPWA 1XLJA 1H7PA 3KP0A 3HFYA 2HISA 2QV5A 1H41A 3GXIA 1FTXA 1R9ZA 1FHDA 2AKZA 1OC7A 2VR2A 2DJXA 1XICA 3LZ5A 4L65A 1XIIA 3GNNA 1PKLA 4AAJA 3VC5A 1UKSA 1VJSA 4FHAA 3DEQA 1R9YA 4NAFA 4J3TA 1ZRQA 5DMLA 1S5VA 3N14A 3P6LA 3R0DA 4F2TA 4KWWA 1XG3A 3WL0A 4IWWA 4JDYA 1HZYA 3OW1A 2P76A 3W1XA 3GR8A 2DSKA 1R7OA 3PBVA 2DW7A 3V5OA 2WC4A 4KERA 1JZ6A 1W37A 2C1HA 2EPNA 3GNXA 2IQTA 3BLEA 3QGKC 3KLLA 1PB0A 2ISDA 1V3LA 4QDWA 1DJNA 2INEA 3W37A 3NXLA 3F4CA 3GIQA 4GPNA 3KUMA 3W3OA 4NNCA 3WQ4A 3EWDA 3S1VA 1TX0A 2XFFA 4ZL1A 4GKTA 2CXEA 3PAOA 4TIMA 1X39A 4JFSA 2P50A 3PJWA 1EC7A 5F2MA 4JTRA 4AF0B 3MCMA 3F2CA 4GYPC 3UPWA 5A6KA 1D9EA 3OA5A 3MKVA 1IIGA 1JPMA 4PMDA 3GNRA 1TG7A 1WDDA 5BW6A 4K7YA 2VZUA 1VYSX 4XUYA 1ODUA 2P8CA 3G5EA 4QGCA 3GIPA 4DLFA 3HURA 4FNTA 2OB3A 1DIEA 3URAA 1EHAA 1TX2A 1WDRA 3NWRA 4E4FA 2BASA 4XAPA 5HMSA 1PCWA 3U7VA 4EWJA 3KXQA 1A5NC 5B7ZA 3MPGA 4OBTA 2A3HA 4RV8A 5RUBA 2PTDA 3QGVA 3P14A 4HIBA 4K8GA 1JL8A 2AGTA 5DBUA 3KBVA 2FTPA 3W1RA 1V51A 3LHVA 3NO5A 4IM4A 4KIRA 3WDPP 5K9CA 3PNZA 3Q94A 2PWUA 2HPIA 1EYWA 1RALA 1UH4A 1K9EA 3NSXA 3REQA 4H9UA 5FKYA 4E4PA 2POZA 3R58A 3DKJA 1Z8AA 2I5IA 5A6LA 2WLYA 4Q7IA 3P93A 4HU4A 4H2CA 2GL5A 5H91A 4OUIA 1EIBA 1PKYA 1ZTVA 1C91A 4JY9A 3P0XA 2FB3A 2F61A 3W81A 4UZUA 2V5KA 3R11A 1OK4A 2YCKX 2G4JA 4KBXA 1GPWA 1WXJA 1MQQA 4I3GA 3R12A 3ARSA 1QFEA 1SZGA 1LOLA 5TNVA 1E6PA 4H9XA 3EX1A 2CZDA 3BMWA 4CCZA 4Z0SA 4BI6A 5BOOA 1KFKA 3I7QA 1JDAA 4GUHA 1YLVA 2WSRA 3URQA 4FEZA 1JDDA 2PTXA 1F6KA 2J7HA 1EEXA 1QPQA 4ICCX 1DWFM 3PWAA 3K13A 1BXCA 1RP9A 1KM4A 3E0FA 1A5OC 2PGFA 3WQ5A 1K02A 3NEVA 1GQIA 3BURA 1SR0A 5FI8A 1JAEA 5KZDA 6ALDA 2Z1WA 3L4TA 4FIQA 2ACSA 3NGFA 3HGOA 4P7QA 2WZEA 3CUJA 1FCBA 2ALDA 4LU0A 4LYPA 1EB3A 1XP3A 1HL8A 3WJSA 4Y9MA 4QQUA 1A5SA 4DNHA 1CXLA 1VFOA 1V4YA 3AYVA 1XLKA 3HPSA 4O28A 2VC9A 3UZXA 4UQBA 1QTWA 3KZPA 1C3FA 5LA0A 3GYEA 3WD2A 2CBIA 1IR1A 1ONEA 3NQEA 2GGJA 2BXYA 4AXNA 2DEPA 3TQ0A 1OCJA 1EOKA 7A3HA 3GTXA 1YXYA 2PLMA 4QR6A 4FF5A 1J12A 2E8YA 5XIAA 2PDXA 1E72M 1LM1A 1B9ZA 3KWSA 3B3DA 4V15A 3W1LA 1S5NA 2J77A 3UVIA 1GOIA 2XIIA 5E0FA 3VX1A 3PZOA 3UCQA 3SURA 2YLLA 4CQ9A 1DJQA 2ZRVA 3FIGA 4JDBA 4OTKA 3VIKA 1CX9A 2QIIA 2EPHA 4JN6A 3QLLA 4QLJA 4AD1A 3OHMB 2R91A 4V2XA 2QCCA 5LA1A 1ONXA 2G37A 4EF8A 5KTLA 4LAOA 5F4XA 1OFOA 4S38A 3DYPA 3A24A 3TSMA 1KNWA 1KCXA 4NF7A 2WKLA 3LBMA 4GIEA 3TJLA 4C6EA 5EA9A 5LHFA 4C60A 1GKQA 1IR2A 4AUBA 1PTDA 1WOBA 3EDEA 3WELA 4U28A 3L66A 1KRBC 1R2SA 4NILA 2YXGA 1MEHA 3S0CA 2OPJA 4QFUA 4FO4A 4X60A 2EKCA 3E38A 3V18A 2VTFA 3IUDA 3GXMA 2Z1KA 3GXTA 1UKOA 4JX4A 1W8GA 4CKQA 1FRBA 4LC8A 4GO8A 1EDGA 2OXNA 3TSBA 1M53A 3ZJKA 4UTLA 1A50A 2PFHA 3P74A 4O16A 4PTVA 1UR8A 1MVYA 2QNEA 4YCOA 5DXXA 4B2DD 2E6AA 2PLJA 1IXOA 2ASHA 4F0RA 1E0UA 4O53A 4ONVA 1QBAA 3AWNA 1HGYA 4BEUA 3CB3A 4NYYA 2D0FA 1JNEA 2Z2UA 1EA0A 3NQFA 1ECQA 2A0NA 4E2DA 4R34A 1J0YA 3SY5A 4OT7A 3N3TA 1XRSA 4INFA 4BK9A 4I7UA 3WIJA 4FPSA 1TELA 3L5AA 2FMNA 1QT1A 1LL6A 3QTGA 5J5RA 3J7HA 1PYFA 3JR2A 4GVIA 3SO7A 1I2NA 3E1F1 1UBSA 2HROA 4DUVA 4MY9A 1B9BA 3BLLA 1C8QA 2CLEA 1D3GA 1XF0A 5I3KA 4FLOA 2VVNA 4IPNB 3M0MA 1TV2A 5E0KA 4JCLA 1BKHA 4XV0A 3OU8A 3W26A 4AVOA 3PUGA 4XTDA 3OOQA 3BLFA 2JE8A 4GQ0A 2OQYA 2Z1BA 3VDCA 3MI3A 3QEZA 5DRCA 1RH9A 1AA1B 1K9DA 1C9DA 2ZE0A 1OZMA 4I7VA 2MUCA 4HSOA 5HULA 1DWIM 2OT1A 4GZEA 4MYAA 1KM0A 1V77A 3SGUA 4A8LA 4UQ9A 4FX6M 1GQNA 2J7BA 4FSAA 4RE3A 2VOMA 3LHTA 2QW5A 4PGLA 5A1AA 5CBIA 2XWEA 2GDUA 2OZTA 2WQPA 1A0CA 1FWDC 3N2BA 4AH7A 2XFWA 1WX0A 1UIOA 2ZUUA 4HVXA 1BSLA 3IK4A 3QVQA 2QUVA 3W28A 1T96A 1GT8A 3JW7A 3PPHA 2CITA 1DQXA 1Z69A 4MFEA 3F2DA 1D2KA 2WJEA 2PDWA 4JEJA 3CEPA 1DTNA 4DHGA 4O8RA 1ISWA 4JICA 4PMUA 4EF9A 1V02A 1OY0A 5HMEA 2DZVA 4GQBA 3RJYA 1OINA 3OG2A 1TV7A 1OT2A 1Q3NA 2E0PA 4GRSA 1KBLA 4M81A 4GNVA 1PBGA 2YDSA 2UV8G 4CD5A 5CSSA 2OLHA 4WJEA 1A5CA 1YADA 3O07A 3NL6A 5C0QA 3OG3A 4FX7A 2RJGA 2WHJA 1R8LA 2VD8A 1RBLA 4NNAA 3PVFA 5JUVA 4LQ1A 4ZVJA 3NQGA 3WSUA 5G1YA 4ZB5A 3QV6A 2WVTA 3LGGA 4RJEA 4MF4A 3M7WA 5FF0A 2VZTA 1XRFA 5EU9A 1O94A 3VOHA 4IFOA 1J8VA 3KVLA 4Y90A 5HNRA 1KKRA 3W7IA 3ABOA 4XSMA 3MP5A 2PWFA 2W66A 3TTEA 4F66A 4QG9A 4A3UA 4ZTYA 1PX8A 1CLVA 3CHEA 3IK2A 3ONCA 4ECLA 2ISWA 3BV7A 4KW2A 6TAAA 1FWIC 1FCQA 3OZMA 2PRMA 1B3OA 3HV8A 4O1AA 4I5XA 1WUEA 2ZZ3A 1CGTA 4DN1A 4Y8EA 5FSEC 1W56A 3MT1A 2A85A 5T9CE 1VF8A 5IM51 2BY3A 1ADSA 3KVJA 3NJ3A 3JUGA 1X6LA 4LVAA 5F2LA 3SQLA 4AF0A 3BSMA 1O12A 3WLRA 3LCXA 1E6XM 1GWJA 1FH8A 3FGCB 1PPIA 5CH9A 4KWUA 3R8GA 4XAZA 1DWJM 3E49A 2YPIA 4AIBA 1EQCA 1NM9A 5A6BA 5CQ1A 1XYAA 4MWAE 1QMLA 3AAMA 4KWVA 2P10A 3CASA 3M44A 2AMGA 2A21A 3RGTA 4I5RA 2IUZA 5D2YA 5K3VA 4NYUA 3UXAA 3W24A 7ENLA 1BTCA 1IYXA 1H5VA 2YYTA 2B7QA 1TIMA 1XLLA 4NZCA 3UJFA 4XZLX 2I16A 1ITUA 3IIXA 4KETA 3CUXA 4OQVA 2VURA 2D2GA 4FP1A 1E40A 4UMCA 4I6VA 3S5SA 3CXOA 3RLHA 2A6LA 4ZQRA 4D2JA 2PBGA 3MVTA 3B9OA 1TV4A 2R82A 2ACUA 1W1A1 2WC7A 4JL2A 3K1GA 1AJZA 4J3WA 2EPLX 4ATDA 4WY0B 3R8RA 3EWUA 4JTFA 1VIWA 1TZZA 2XH0A 3F4DA 1TTPA 4E2VA 1WE5A 1V3JA 3N6HA 1CPUA 3LEPA 2FZNA 2IKHA 3W9ZA 5CXPA 3AIEA 2D1ZA 2E9MA 3C61A 4LS2A 4QTGA 1H7WA 3FDGA 2CLOA 4GYKA 2JKAA 3W1TA 1V6WA 4YTSA 5E0CA 4Q4SA 3CTTA 3TYCA 2GQ8A 1X38A 2G8ZA 3HG2A 3A3WA 2ZZ2A 1V0LA 4FF7A 1FHVA 1ITCA 1QXLA 5DELA 1JYNA 4KGJA 3E02A 4B92A 4XG1A 1NWUA 5EYWA 5K9XA 4JTUA 4UR9A 2O7SA 3N3MA 1WP6A 1SR9A 2INFA 3AMCA 4BY3A 2YFNA 2Z25A 4BF7A 3S6DA 3LENA 3R4IA 4HK5A 4C1LA 4OU1A 3NQBA 2IQ0A 3LSBA 1OB0A 3GAKA 1THFD 4JTQA 1ZHAA 3QMSA 2Q3OA 2ZX8A 4X0VA 2C16A 3IV8A 2Y8VA 4DY1A 3GBDA 2YJQA 1EEPA 2AOSA 3M5ZA 3KL5A 1R3SA 2WZTA 4IIDA 3TYBA 1JI2A 4GVHA 1U5VA 4I9JA 3BG3A 3AMLA 1KTCA 4WY0F 1CLXA 3MHGA 1YRRA 1GZJA 3SCQA 3BJFA 1NH6A 3JZEA 1PL9A 4CQDA 1SZFA 1BF2A 2QF7A 4RW3A 1FCUA 4WOQA 3U6WA 5I00A 1UPPA 1J0IA 1QU4A 3HBLA 4JCMA 3NR0A 4AWEA 3L21A 1VFFA 3ZOAA 3RM8A 3PZNA 3W6LA 4W86A 1FFQA 3QZEA 1B3XA 1UD6A 1DQUA 1IHIA 1JPHA 4KRUA 1NP2A 1H49A 1QRQA 1XLMA 4ZO6A 4O19A 2GDVA 3U2ZA 2ZDRA 4JTTA 4DJDC 2J27A 4HCHA 3F4WA 2WCSA 5IDZA 3WF2A 3QPEA 1GGOA 5JIWA 4P8WA 4DZAA 1Y65A 2CBVA 3P5YA 3MO4A 3JRKA 2FTYA 3RUBL 1JFXA 5FF3A 4X2PA 4MY8A 3EPNA 3LGDA 5K2ZA 2Z2AA 2HVOA 4PUWA 4PUKA 5HQMA 1PTAA 1NDYA 3HPZA 4GG9A 4L9YA 3QF0A 5F1VA 3QSRA 3THAA 2OWXA 4W89A 2E3ZA 2XHYA 3KZSA 4HTBA 4PCNA 4JEQA 4LCSA 3SRKA 1R30A 4JIIX 1QR7A 3JS3A 4JIHA 1GVRA 5C9WA 2WM0A 1RCXB 3ALGA 3E2QA 3PJTA 3VILA 3F5KA 2PA6A 4ATWA 2BOGX 3W6YA 1W3TA 4E38A 2Y5EA 3NQVA 4NXSA 1E1CB 4ORMA 3HPFA 2YXOA 4R53A 1XC4A 2VRQA 3CYVA 3WQFA 3W76A 3VIPA 2Y8UA 3BSHA 3LUTA 5EL1A 3CHCA 1QI4A 4PE8A 2YA0A 3L0KA 1KLZA 2FVMA 3OLIA 2XYLA 3KTSA 1LCOA 3IJ9A 3GC4A 2DVUA 4DZ5A 2ZX7A 3N04A 1V7YA 4U4MA 5HPOA 4NJJA 3W38A 1JGMA 4QAWA 1AD4A 1E6SM 1RD5A 1DE5A 2HE5A 3GDMA 5D04C 5CBJA 1KFWA 1GTEA 3GR7A 2V68A 1D7KA 1IT0A 3GG0A 1V6TA 5LNSA 1XCWA 2VCAA 1DJGA 1OCNA 3O15A 2QDDA 1UWRA 2VNCA 3E9AA 2WHKA 5I77A 1WDWA 2G4FA 5A8QA 3G1RA 3TJ4A 1HL9A 2IXUA 4TR9A 4RCXA 4ZODA 3WL1A 4RE0A 5CJMA 2GK1A 1U33A 4JTAA 3W82A 3IVUA 1XIJA 4IJBA 1LRNA 3WENA 2XFRA 2NLIA 5K4XA 3GKFA 2FZBA 1OYCA 1EUAA 3V1PA 5EBAA 1TJRA 4DF0A 1PWLA 3AYSA 2W92A 3BAYA 2NUWA 1TWZA 1S3TC 1QNRA 2ZUSA 3IGHX 1RAKA 3BLIA 3RN6A 2A2IA 5D03A 1ZBWA 4UUIA 1A3XA 3PSVA 4K2SA 3GNPA 2XTKA 1FXQA 4S2BA 1H61A 5HR7A 3CMGA 4KIEA 3CH9A 4MOZA 2BTMA 3VDAA 2ZRUA 1JIBA 1HJQA 4WSKA 1N2VA 2AQWA 2CHRA 3THDA 4JTDA 4GQRA 4OBRA 2QJJA 3BCDA 5GJMA 1GHSA 4MY1A 3M47A 4XD3A 2EF9A 1L6SA 2FPTA 1EPXA 1GOXA 1RQBA 3BUVA 1QNVA 2FHBA 1TA3B 5M1TA 4PUDA 4H41A 2NX1A 4ML4A 3OGVA 2HBXA 1GORA 2FZMA 3PTQA 1Q66A 4HMCA 4PTMA 2PCEA 5B7YA 3UY8A 1U2YA 2PDPA 4WQ6A 2A4AA 2E6DA 1H5YA 2GDQA 1MXSA 1SW0A 2NUYA 4XD4A 2EQDA 3C0SA 2E9BA 3RO6A 3NNTA 4B5VA 4ASTA 4TMBA 2VX5A 1JF6A 3PBMA 3KL0A 1EJUC 2J6XA 2VRJA 2WMFA 3QYSA 1UD5A 3UR7A 1B31A 4HA4A 2OJPA 5CPOA 4L64A 2R94A 3U5UA 3T4CA 4R3UA 3UPMA 2ZCGA 5DLCA 1ZPTA 3OLEA 1JZ7A 1MDLA 2HNHA 4YVVA 4C6BA 1CXFA 1UZ4A 4IUOA 5AC4A 4JQ4A 4HKPA 3SI9A 3WLNA 4GX9A 1FWNA 4A35A 2BLEA 5CAHA 5BMXA 1MW0A 4LB3A 5E70A 1B3ZA 3BCJA 1M68A 3W88A 3RFAA 4DZIA 4H3DA 5CAKA 3H8AA 1GKPA 1W32A 1KM6A 2DVXA 2G3JA 5GJNA 4YTQA 3UZ5A 1CZ1A 4XZ9A 3G0SA 4J40A 1VPQA 2GOKA 3GXPA 5D05A 4DLMA 1A4LA 2XGBA 2XVKA 4KFOA 1Q8AA 3FGCA 2ALRA 1BXBA 3H2NA 3ZQ9A 1I45A 2HRWA 5AYXA 1OT1A 1MQPA 1NSJA 3W7PA 1KGXA 1G94A 4OHQA 3NSNA 3WF0A 1TRDA 1S38A 4LVFA 1AL8A 1XDMA 4RK8A 1ZLPA 4LCQA 2PURA 1K6WA 1DXFA 2EEXA 1M5WA 1US0A 4LV9A 3KEHA 3TEVA 1N8WA 3ARZA 2FMOA 4DAIA 2V81A 2FHFA 3BAIA 2HSAA 1OIFA 3W02A 4Q22A 3SQSA 3MQTA 2C13A 2OEKA 3VI2A 4DXVA 4PMOA 4C6FA 1B2YA 2V3EA 4E3TA 1H4PA 4JPGA 4B9ZA 3CZEA 3EA1A 4ORIA 1FWGC 1BRLB 5LIUX 3NL2A 3DECA 1RA0A 2QCFA 3PJXA 3SCNA 4O0KA 1IQ8A 4UBPC 4ACYA 3HQNA 1DBTA 1ITXA 1ZY9A 3UWVA 3KDNA 3VGHA 2YDQA 2OYKA 3O3RA 5AC6A 3WNKA 3S5ZA 3H4XA 5D30A 5CC6A 1E73M 1AMYA 1W5QA 4B16A 5LIYX 4WY0A 1TZ7A 4AQLA 3UWZA 4DWSB 3PZMA 3G2GA 4F0SA 2OODA 3TJXA 1F6PA 1HFBA 4LJ3A 5DQPA 3ZR5A 4M0XA 3PBUA 3UESA 3FX4A 3B9DA 4LX4A 1Q6FA 4IOTA 3SUTA 1CWYA 4HT3A 2VX4A 4AZCB 4F0MA 4PBFA 3IUHA 1DHKA 4F0LA 3CYJA 4I8YA 4UFHA 2EPOA 1NP0A 3TXVA 4X9YA 5A95A 3E0WA 2FYMA 3N18A 2I57A 4N7QA 4D8LA 1NOWA 2OLAA 1HO1A 2JBMA 5LIKX 1ZAHA 4Q8WA 1QPNA 4HP5A 1SSGA 3CJPA 1UR2A 3WD3A 1CYGA 3S9YA 3WNLA 3U48A 4XZIA 5EBUA 3G1YA 4IP7A 1B4KA 2A7NA 5CJNA 2XIMA 3KBJA 4EAYA 2NXGA 2WSQA 4GISA 1Q6RA 3SY1A 1MFVA 1SUXA 2GVYA 1NVMA 3I4EA 4GJJA 4HQVA 2R24A 4PUNA 3LCWA 3VNKA 1XL9A 3RCYA 4HNOA 5CPMA 3NQDA 1L6WA 2PB1A 3BV4A 2JGQA 1W1YA 2C71A 2ZX9A 4O14A 2F2HA 5EMKA 2ZICA 5ECUA 1RHCA 3BAKA 1OC5A 3HIJA 3H7UA 2VFHA 5D8WA 1XIBA 4M1BA 1VFHA 2QJHA 3EWCA 3USBA 3WNNA 3BOFA 2WPGA 3RU6A 3R94A 1VJZA 3KWXA 3WNMA 3MMDA 3MSDA 3IGSA 2PDMA 2UY5A 3GZ3A 4YU1A 4QE5A 1RCOB 4YXGA 3VA8A 4GUFA 1TPFA 1GW1A 2E25A 8CGTA 3FS2A 4AMCA 3GH5A 4PTDA 3S1UA 1EH9A 1NWTA 3VNIA 2HK0A 3QH2A 5A6JA 1UZHA 1NF7A 3GHSA 1PSCA 2XGIA 3QPYA 4C6JA 4CNTA 3EOLA 4J1OA 6ENLA 1XYLA 3DIPA 5H1WA 1WXYA 1S2WA 4AD0A 4OKDA 3LNMA 4MADA 4NX5A 1IE7C 2FZDA 1JXKA 1YQ2A 3PFRA 3G8RA 1F4AA 2YBVA 2Z24A 3ZT6A 3ZWTA 4O0QA 5E6YA 1OX6A 1KBBA 1LT7A 3EKLA 3KCJA 1OG6A 1W5PA 3LXCA 3GUGA 4XZBA 2BVDA 3S5NA 3ARQA 5CSUA 2WZHA 4WD0A 1S3HA 1UQYA 3KOWA 4EOUA 4IG2B 2DZXA 3WF4A 3ITGA 2Y5SA 1GOWA 1GVOA 1V0MA 4PEEA 1TREA 2CLIA 1GZ1A 3BE7A 3RMEA 5A6SA 3GG1A 3UWWA 6PTDA 4LAUA 4AZ5A 4DJEA 1PX4A 1TVNA 3VCNA 3DX5A 5EKYA 5F4WA 1VBUA 4PUUA 4BI7A 1K7EA 2P3ZA 1PDZA 2QXWA 4ICNA 2Z7KA 4O52A 5IHRA 4HMNA 2QCEA 4JKMA 1KM1A 4O18A 4RR4A 1Q6EA 5D9PA 1FQ0A 1FWAC 3T8QA 3M6YA 1NFBA 3RX2A 3K4DA 2ZVRA 1SFSA 2QHAA 2ATMA 1XBYA 3E2VA 4L1WA 5DN1A 1LBMA 4H6QA 4S2CA 1DWHM 3DFYA 4MB3A 2VFEA 1JCMP 5AECA 2QAFA 3B8SA 1E1CA 3QY7A 3UZYA 4M8UA 1EHNA 1KQZA