3H2OA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
273
structure length
264
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 264
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2oA00
3H2AA 2VEGA 2VP8A 3TR9A 2H9AA 4O1EA 3TYAA 2E7FA 4DJDC 2YCIX 3H2FA 3TYEA 1Q85A 4C1NA 1AJ0A 1TX2A 4S3AA 2Y5SA 3V5OA 3TZFA 3K13A 4NHVA 4S39A 4S3CA 3MCOA 3NOYA 1Q7ZA 4DAIA 2DQWA 2H9AB 3TYUA 3H23A 1TWWA 3MCMA 1Q7QA 4PZVA 4DJDD 3H24A 4MWAA 3H21A 1AD1A 4MWAE 4NILA 4HB7A 3H2CA 3H2MA 4NIRA 4D8AA 1TWSA 1TWZA 4S23A 4DJFA 4G9PA 1AJZA 1Q8AA 2VEFA 4O0QA 3TZNA 1F6YA 4S3EA 4NL1A 3H2NA 2YCJA 4S3DA 4CCZA 4DJEA 4S3FA 2DZAA 4MWAB 3TYBA 2YCKX 5JQ9A 4C1NB 3MCNA 4D9PA 4DAFA 1Q7MA 3TYDA 2DZBA 4DB7A 2YCLA 3H2OA 3H2EA 2Y0FA 1AJ2A 3TYZA 1EYEA 1AD4A 4MWAD 1Q8JA 4DJEC 2Y5JA 3TYCA 3H26A 4MWAC 3BOLA 3H22A 2BMBA 4S3BA 3BOFA 1TX0A 4DJFD 4O1FA 4DJDA 2YCLB 4S38A 4DJFC 2OGYA 4D8ZA 4DJED
chains in the Genus database with same CATH superfamily
4W85A 1EA9C 1UZDA 1XISA 1JVNA 1KM4A 3CUXA 4JL2A 2CEQA 3DESA 1KQZA 3MMUA 3RIKA 3VCCA 2HBVA 2C13A 2WMJA 1Q45A 2BGNE 3TN4A 4JHOA 4PR4A 5XIMA 4FS9A 2WNWA 5KZ6A 5BROA 5MKGA 4JOMA 4DBEA 1VFMA 2IXVA 3WQGA 3IARA 4CQ9A 4H9UA 4EX4A 3KTSA 3CZKA 2BB0A 3A64A 2WMIA 4J28A 2ZRWA 4AIBA 1RUSA 1Z6KA 2R82A 1SO3A 2OKOA 3I65A 1R0MA 5IOBA 4NG3A 3O3RA 1FX6A 4LX4A 3GR8A 5AC8A 3PJWA 2YYTA 2V5BA 4RDZA 5CJNA 4YVXA 4GPNA 3JVAA 3IV3A 2QS8A 2DU2A 4M80A 2ZQ0A 2VDHA 3C2VA 2G4FA 2O56A 3PB2A 3FNDA 1FHUA 3BLKA 3WF3A 2J47A 3SGZA 1K70A 4H8NA 3TYCA 3LSCA 5HJLA 1JYWA 3B06A 4J3TA 4AWTA 3PM6A 3VCNA 3OQ8A 4KETA 2DT2A 4JL1A 1XRVA 5LIXX 1C8XA 1O66A 3B4UA 1N82A 4O1CA 3MSYA 2RJGA 1AZ1A 1DXEA 2VEGA 2R1PA 1E4MM 3W1NA 3L2MA 5IBXC 3NIYA 4LS1A 5J04A 1NOUA 1ZP3A 3FDGA 1FDZA 1W1IE 3QLDA 1VHCA 3I68A 2J9YA 2XDFA 4BFAA 1TYGA 3WH6A 3O15A 6TAAA 5BU9A 2V9DA 4PUJA 3P60A 3PNUA 4DUOA 2A3HA 3E5PA 4MB3A 3WL1A 1A3WA 2J79A 3HOJA 4NZJA 2Q8XA 3W1LA 4HNNA 3KRSA 4GCXA 5B80A 4ALDA 3AIRA 1KR1A 3GU9A 1T99A 4P8UA 3UP8A 1OGSA 2VOTA 3MW7A 1MFUA 2G97A 4UIOA 1PYMA 2INZA 4MWAB 1GONA 3TTOA 4OGZA 3RLHA 2NT0A 4NP7A 4EXAA 3FK4A 3CEPA 1V0NA 4E8DA 2X41A 1Y0EA 3MQTA 1F5ZA 1BQCA 3S1XA 1R9YA 4KESA 2FDSA 2BTMA 3FOKA 3DG3A 3LX9A 2ZUMA 4MYAA 3B9AA 1Q6LA 1WP6A 5M3WA 1GQJA 3WLJA 3K4AA 1YYAA 2EXOA 1FWRA 2EQDA 3KAOA 3U48A 2WYSA 3W6LA 4C6PA 3IWPA 2HE8A 4UR8A 5D30A 1RY0A 1RJRA 4GG9A 1CLXA 4CU6A 4MNKA 1D3HA 5AYZA 3E12A 4LY4A 2ABBA 2Q71A 1E0XA 4A35A 4JEJA 3C2YA 3P84A 2JGQA 3HPAA 1ZENA 4AUBA 1J0JA 4Q8MA 2ZC1A 4H6RA 1NF7A 1QNRA 3RJYA 1K6AA 4HZ6A 2NVDA 3VGEA 4ACYA 3TJ4A 1ZY9A 1IT0A 3W23A 4GD0A 1E6NA 3BLEA 3G8RA 2GQ8A 1ZU8A 5I6SA 2E9LA 1Q7QA 1E70M 2DSWA 1I2OA 2PDWA 1FY6A 1S2VA 3WNLA 1KRAC 2Z6IA 3ZJ8A 2Y63A 1UA3A 1ADSA 1WKEA 3H2CA 1M03A 3LQLA 4N9CA 4OHQA 3ZSSA 4QXIA 1UCWA 3M64A 3MI2A 1W91A 3WH9A 1OY0A 2PFHA 4H8UA 3E2SA 3LN3A 3PC0A 4FF7A 5JBEA 4BK9A 4BKNA 3DG6A 3QPYA 2G37A 3PTKA 2UY4A 3I4EA 3NDOA 4IFKA 3E0FA 3KXQA 4I9JA 3VTRA 3SDOA 4GJ1A 3VDAA 2X2YA 1J10A 4TO8A 3C0LA 3CS2A 3W2MA 4RXFA 5CBJA 1NOWA 2PTZA 2B81A 2XWDA 1MMFA 2NSOA 4CNPA 1PDYA 3OG2A 2XINA 3THDA 3P62A 4M7TA 1G94A 1RCQA 2PWHA 3T81A 4M0XA 1OYAA 2NUWA 1E0UA 2E40A 5CGQA 3SFKA 1RV8A 5JMUA 1KM2A 1FXQA 1XLBA 5HUOA 3A4AA 3TU9A 1UD2A 2RAGA 1WAWA 2XWEA 3KW3A 1XLMA 1QU4A 1KA9F 4KCTA 3JZEA 1WZAA 3URQA 7TIMA 1EC9A 3QV7A 3W7KA 3LBMA 5HULA 3JZUA 1PPIA 3P74A 1PTDA 2VRJA 1K7FA 5SWUA 1K8YA 1SSGA 1R3TA 4F4RA 3NQ7A 5A6JA 4EWND 2WSYA 3WUBA 5D09A 2VL4A 1W54A 3LI0A 3NQMA 4DWSC 3AU2A 3SN1A 5HK4A 5CKSA 1HZYA 1S2UA 4HKPA 4GA8A 1I0DA 3LUTA 3TUUA 1RY8A 4L6OA 4DB7A 2H90A 5AYIA 2X1TA 1HKWA 3H2EA 4PMVA 2X40A 1IF2A 1RD5A 5KSWA 4V2XA 4LV4A 4PUNA 3ANVA 4MWAC 4IQDA 2E28A 5D4YA 3WLTA 1EJXC 3EPMA 2FPTA 2VGGA 2QXWA 3G6MA 1GYMA 1B3WA 1OFOA 1XIEA 4AC1X 1P6CA 4JFVA 4XK2A 4CQDA 5I3KA 2H9AA 3H70A 4DNHA 1ADDA 2VCCA 1ISYA 4PB3A 2DFAA 3ARQA 1NELA 3H54A 3OG3A 2HRWA 4WCJA 4FNUA 3LLXA 1RBOB 1KB3A 2BG5A 2Y24A 1US2A 5FJTA 4XUGA 2GDUA 2J6XA 4DXXA 3D3FA 1W32A 3L2LA 5CLTA 2FZ8A 4YVPA 3KDNA 1DJIA 3MDWA 1JCJA 1DIOA 2W79A 3C0JA 4GLEA 5I23A 2YLAA 5REQA 1W3HA 2J88A 2CHNA 3UT0A 2J77A 1AJZA 1XIHA 3DFNA 4HZ8A 1JL8A 4BZYA 2HJPA 4LCSA 4Y9OA 1W9BM 1EEPA 3N19B 4N9DA 3EKLA 4PN2A 3AMGA 1K8CA 3U0HA 4A6GA 4QSHA 1K9TA 5CC6A 4AD0A 4UB9A 2FTPA 4DLFA 5D05A 2PDBA 3ONCA 1V6TA 3OZYA 2WQDA 2NVAA 1VBRA 1GORA 2V30A 2GWNA 3M16A 3WELA 3F4NA 4M81A 4AZ5A 2C14A 2VELA 4R5EA 4JEQA 4ATLA 1G01A 3ZM8A 2E6AA 4JQ4A 2VNCA 1QW8A 3SCQA 3DU0A 4M29A 4NX5A 1G9HA 2VX4A 4EIVA 2OWXA 2WKLA 3TR2A 2R1NA 4AMAA 5BXTA 1V7YA 1V3JA 1XLGA 4A8NA 5AY7A 3LBCA 1A0EA 4DJDC 3E2VA 3IV8A 3O7UA 2LLEA 4C7DA 2I1OA 3ATYA 3W1PA 1E5NA 1BVNP 1HP4A 3CK5A 3W6MA 3R4IA 4UOJA 4C6FA 1GVQA 2XM2A 4WDXA 3IVUA 3UEQA 4ECLA 2NQZA 1FWDC 2OX1A 3TC6A 4XO6A 2NUXA 4GFSA 1XIBA 3LHZA 4UNIA 3NSMA 4AY8A 4GACA 2RHGA 2A3EA 2W4XA 1SZRA 1Q2SA 3H4WA 2OYKA 4C7GA 3W00A 1DIDA 2PDHA 1ICSA 4HT3A 3SGUA 1A5MC 3THAA 3TXVA 1KQYA 1OBAA 3VOCA 1CCWB 4PH6A 4ORMA 4R7JA 2V82A 3WLLA 3S9YA 1QNQA 3BJSA 3CPUA 1UKTA 1DHKA 4OOUA 4OE7A 4QCEA 4CCEA 3M6DA 2O4QA 1UUOA 2GSJA 4HGXA 1ODZA 4DJEC 4H19A 1VENA 3IACA 4AMCA 3QR3A 3MZ2A 4Q8PA 5HMFA 4E0CA 2BMBA 2V6AA 1RA5A 4RLIA 1W31A 4G2DA 3UZWA 5ECVA 1OC7A 2PP1A 3B8WA 1OC6A 2P1FA 4C60A 4V1YA 1MXDA 3WO8A 4RV8A 3BANA 3U5UA 1W1TA 3UVAA 3PBVA 1X1OA 1KBIA 3DENA 2DIEA 1E9YB 2AQOA 3OLEA 1JRCA 2WBGA 3N14A 3MY9A 1EKOA 2YZ5A 1WXZA 5F4XA 1YTKA 1XX1A 3BW3A 1RZMA 1V7AA 4M19A 4W5UA 3SRFA 2ZZ6A 2VFEA 3BK0A 1WDRA 1M6JA 2H3BA 4DAIA 4W7VA 4A8LA 2FFCA 2A6LA 2A4AA 4AVNA 4L4LA 4S3JA 2Y5EA 1BYDA 4PUDA 3N6QA 4PCNA 3NQEA 3ARVA 5IFPA 3SCUA 2WZIA 2YDAA 1T0OA 4TVDA 4ZZ9A 3OYZA 3CBWA 4IPPA 4HCDA 4I7WA 3PPCA 1D8WA 1UWTA 4QFUA 2CZVA 1GQLA 2WVUA 3PUOA 2ISVA 3F1QA 1EH9A 3PJUA 1E0VA 1Z9AA 2Q8LA 3SN0A 4D6EA 1R3RA 1ZBKA 4NAEB 1TPUA 3RK8A 2QMKA 1EFZA 4L4PA 1UP2A 2Z26A 2HS8A 1L6YA 3EA3A 3PP7A 4JX4A 5EGRA 4WY0A 1PX8A 1A5UA 2O9OA 1ZBWA 4KFOA 4PRRA 3N04A 3ZFHA 4S38A 1GUVA 1IR2A 1N7KA 1F3TA 4RDWA 3UJFA 2D3NA 2PDKA 2OXNA 1BG9A 4GXWA 3VX0A 4GNKB 2QCCA 4B4FA 2QVNA 3NL3A 5XINA 2OEKA 4Q4MA 6XIAA 3M0ZA 1P43A 1PV8A 1ZP4A 3UJRA 4EPKA 1TWDA 3GDKA 2RDUA 3QF0A 1TMQA 5U7SA 4XKMA 3H7VA 1ZUAX 3MC5A 1YXCA 4XG1A 1KXHA 3VGBA 3G22A 4Q7NA 3QYQA 4R85A 1UMLA 4NX0A 3DFSA 4MSSA 4GFIA 4ZTYA 2ZZ7A 3JRKA 1BGGA 3OLGA 4LV9A 1V3HA 3TN6A 4H8HA 1K1DA 4DYJA 1SQ7A 3ARUA 3M44A 2ATMA 5E1QA 3KWSA 2DW7A 1OFQA 4OIFA 1ADOA 2FTWA 3VX1A 1GCYA 1QBAA 3HMJG 2YLLA 3CHEA 3LLFA 4GKTA 3SFWA 2JE8A 4Q6JA 4DF1A 1XYLA 1DJNA 1ONRA 3A3WA 5CZ0A 1E3XA 3FVDA 2J25A 4UQBA 3EOLA 3UCCA 4RZBA 1E6XM 2QCMA 2WOQA 2W91A 2XIBA 3CIVA 4BR1A 2OPJA 4MAZA 3LHYA 2NQ5A 2XGZA 1LUCA 3KOZA 2F84A 2G50A 5G1MA 2E7FA 4NZ5A 4O18A 3WLMA 1VYRA 1XM3A 1B3ZA 1ISVA 1UASA 1V6WA 4JIPA 3K2GA 4O15A 2IQ0A 3IGXA 2CZFA 2VZUA 4JN7A 5EPDA 3TXZA 1TV4A 1ZSXA 3WBAA 5PTDA 1L8PA 4JIQA 1V0LA 2J7CA 4R3UA 1H7PA 1BRLB 4ZQPA 2P0IA 2EPLX 5CZSA 4Z1DA 4Z2GA 1Q6GA 4ZQNA 4RE4A 1KCLA 1LBMA 1LJYA 4AXKA 3B04A 4NIRA 2HTMA 2ZX7A 3KDOA 4YJ5A 1ML1A 5GJNA 2C79A 3VKKA 1VZWA 4TMCA 5EMKA 2OZ0A 2R1KA 2QT3A 1QNPA 4NL1A 3C5QA 1I45A 4D1JA 3XINA 1OFPA 4UQ9A 1XH1A 5JQ9A 4QEEA 4K1GA 4BWLA 3TQ0A 2PDLA 3VD4A 4Z1BA 3TYDA 1SFSA 2CWNA 3TK7A 1RLDA 4HK5A 5FEPA 4WQ6A 1DXIA 2X1IA 4GUJA 2PCQA 8RUCA 3CUGA 3O6AA 3AIQA 1YBQB 1UKQA 3AS1A 4PTNA 2G96A 2VC6A 1P1MA 5FF3A 3KHDA 4TX6A 1PHQA 4DZHA 7ENLA 1Q5MA 5BOOA 4Y9MA 3QY6A 4QCFA 1SYTA 3GR4A 1JCXA 2Z28A 3TA6A 3QMTA 1I2QA 4MLJA 4H7CA 3Q4DA 4IPNB 2ZZ1A 1NTHA 4AZIA 5BWFA 3OHIA 4AH7A 3GXIA 1EGMA 3DDMA 4PEKA 4OTKA 1TV5A 4E2VA 3N11A 2Z7GA 2W3ZA 3T4WA 1UP3A 1XL9A 3BGJA 3W29A 2XHYA 2FHCA 3NZRA 4JTRA 2DSUA 1V5XA 2FFIA 3ALGA 2X42A 5KINA 4LB4A 3WLOA 2CLKA 4HN4A 3TTQA 3VOHA 3PBWA 3H53A 2HEJA 4OV4A 1XICA 4R33A 3SRHA 4DJFA 2YR1A 4LBRA 4LYPA 2V69A 4L6DA 4S3EA 1I1WA 1UC4A 2ZRYA 1WXYA 1KD0A 1EGVA 3LDVA 1DOSA 5AYYA 1L8NA 3APGA 3KOWA 3KBNA 3TJXA 2NQ9A 1EF3A 2AL2A 4JN6A 1BAGA 3KTXA 2OQLA 4XUYA 2HDJA 2FZBA 3V0UA 1BXBA 3IGHX 4DF0A 2OLSA 2V0TA 3R10A 2WSQA 4LCRA 3IEBA 1QPNA 4LJ3A 2Z2UA 1YNPA 1OFRA 2A7PA 2Y1HA 1FRBA 2ZA3A 3THCA 4HK6A 3PPHA 1I4NA 5E6YA 1UPMB 3CH9A 3KWXA 2E5BA 2HNEA 1REQA 5D02A 4L56A 1FVPA 2B7NA 4GWEA 3ZLGA 3F7JA 1HKVA 5CPLA 1SFTA 1VCFA 4S3AA 1H41A 1F8IA 4U31A 4UMAA 3LBOA 2J7DA 3TZFA 3FVMA 2Y7GA 3RX4A 3N4EA 4B9ZA 4ZOAA 3C2RA 4BEQA 3MUXA 1B9BA 3UZ5A 1KFCA 1LLOA 1BVZA 2NX1A 4M24A 3UWEA 3NOEA 1O5RA 4D6IA 1Z48A 3G1DA 2E3ZA 4G7EB 2ISDA 2NWRA 2Q09A 4IX0A 3UYCA 3LTPA 4GYFA 2WPBA 2XVPA 3H4GA 4ZOCA 3EGJA 4IJRA 3PBYA 1A5LC 3ITOA 3T8QA 1LBFA 3VCRA 4C1NB 3VK5A 5CPTA 3GHUA 4FLQA 3RR4A 5DX7A 3R25A 3DX5A 1E6RA 4G6CA 4DWDA 2WJDA 4DO5A 4RE2A 3CQ0A 2BY2A 3A21A 3W7NA 4JQ3A 2VZTA 3ZO9A 5DFAA 2HV5A 4ES4A 2WPGA 4GMEA 3TC3A 4CUCA 4KRUA 2WB5A 4F66A 3GXTA 1JI2A 3REQB 3MO4A 1OC5A 1QI5A 3CL7A 3U5YA 4X3ZA 3VMPA 3T0AA 3C4UA 3EOUA 1WCGA 4KWOA 3VKCA 1XC6A 4W4QA 2NXIA 4QROA 2IPFA 1Q13A 3A9BA 3DXIA 2QJJA 3O6CA 4NHVA 1GJPA 2TPSA 7A3HA 1YXYA 3UXKA 4JTJA 3GNOA 3NURA 2YXOA 4IPIA 2PTDA 1T8QA 5LNRA 1EHAA 2GUUA 3CAWA 3ES8A 3PULA 5A6SA 2VMFA 1FOBA 1R87A 1MXGA 4H9ZA 4HHLA 2CETA 3BAJA 4S1FA 2Q3RA 4UTJA 2C1IA 1QOQA 3OA5A 4AAJA 2DUXA 4BA0A 3LCXA 1WNOA 3NQAA 3VU2A 2FDMA 2ZUTA 4XB3A 4O8RA 4UTFA 2OO6A 1S3HA 4F2BA 1CXHA 1FHLA 4NVTA 2PDCA 3W07A 3WJSA 3AROA 2REQA 1EX1A 3AS2A 3OW1A 5EMUA 3VXGA 4XD6A 4PUWA 3RFAA 4U33A 3SZ8A 3QV8A 4WD0A 2Z1XA 3W7OA 5HOSA 1W5MA 1P4CA 4GX9A 4XQ6A 1J96A 2Y8VA 4LSBA 5I5RA 4QISA 3LG3A 1EO7A 2BP1A 1W3TA 1B2YA 1XGDA 1PEZA 1MRAA 1CIUA 1GW1A 2A3LA 4GVGA 3N9RA 2E1WA 2EKGA 2GDVA 1XLLA 2I5GA 4G5DA 1K3UA 5I3GA 3W28A 3BG3A 1FWBC 3A47A 5C5YA 5C0QA 2Q6ZA 2O9PA 4CD7A 3IPWA 2QUTA 4KGJA 2GJXB 1Q7ZA 2VRKA 4DHGA 4O28A 4UTTC 2GL5A 1WKYA 1OX4B 2C71A 3RDKA 3QHOA 4B3KA 2WKJA 4RNFA 4NILA 4TV6A 3PTQA 5JU6A 4KS0A 1W8SA 2BS9A 1LQ0A 1EJSC 2E5DA 1P0KA 5E0FA 1RXOB 1V3KA 3ZT7A 1W1VA 4Z08A 2O0TA 3P2VA 3LNMA 4AZ6A 5E0CA 2E6FA 1GYLA 4V33A 4P5UA 5CC3A 2F6KA 2DPEA 2VUNA 2WHJA 3TYBA 4LUSA 4Y9NA 2TODA 4YVVA 5G1TA 3PTMA 1OGBA 4HA3A 4HTYA 1UW9A 1TVLA 1W37A 3GH7A 1GKRA 1PIFA 4JIHA 3NQFA 5CJMA 3AZSA 3TFXA 2O9RA 4XVEA 4IG2A 1EGZA 4Y8FA 4MFEA 4B91A 2OZTA 1ICQA 2V2DA 4OT7A 4S3BA 2GFTA 2FZNA 4DPQA 4ZO7A 4KCVA 2A2IA 1DIEA 1NU5A 3IUHA 2VDGA 4HNTA 4HSNA 1HVXA 1K03A 3RM8A 3KVMA 2WMKA 5G4WA 1B3XA 3N34A 2O55A 3ZYZA 4ZCWA 3I7SA 4U5KA 3N2OA 1E1CB 5DF0A 4FALA 2I57A 3LXCA 5EMJA 4W8LA 3ECQA 5BNKA 4BEUA 1GZ1A 3LTSA 1VJSA 4GE8A 3DIPA 5BWAA 4H7VA 1SJDA 2A1YA 1LORA 2D23A 5ABFB 3WLQA 4I7VA 2RUSA 4AVFA 4E5TA 4AQLA 4FMVA 1LBLA 3AJXA 4CGTA 3T07A 4JTLA 2QAPA 4I5UA 4FA3A 2WXDM 1W1YA 3B8UA 1GWJA 3OYXA 4Z2HA 4GBDA 4QDWA 1FWSA 1KM6A 1VPQA 1ZL1A 3CHFA 5AHLA 4PB5A 4F9JA 1B90A 2V2CA 4FX7A 3TEVA 4K3ZA 4H9TA 9XIMA 3NZGA 1Z32X 2XN0A 2DZBA 5FJOA 1PX4A 1GJUA 4IICA 2P3EA 1MQPA 4BI6A 1US0A 4XBJA 3O06A 4OBRA 3L2IA 1SVDA 1DJHA 4DY1A 1E5JA 4CNOA 1B3VA 3V16A 3R43A 3WD2A 3B8VA 2G41A 1EBHA 4NJIA 1M65A 3W83A 4G8TA 3RXZA 2Z7KA 4KEVA 3GXDA 5C2GA 1QAPA 4PUMA 4L80A 5I77A 2CKSA 1KLZA 2YKKA 3EYPA 3M5ZA 2H8XA 3NSXA 3SBFA 4PE8A 3UWYA 1O94A 2PWEA 2ISFA 4LVAA 3GVGA 3UA3A 2GJRA 3NWRA 3EMZA 2I56A 3W2JA 3VOJA 3GG7A 1MZHA 4XIMA 2PDIA 3UF9A 1TG7A 4KRZA 1DWIM 2W62A 2R1MA 2YDSA 3OQEA 1H11A 3V5CA 3DH7A 1C8YA 2ZUWA 4UZSA 1J79A 4K1WA 4FSAA 3UJ2A 2OELA 4EF9A 4IT1A 4W8AA 1MDLA 2WJEA 4CD5A 2GGGA 4MYXA 4JNYA 3ZLHA 4PSPA 5I3JA 3HB9A 2X0SA 3F03K 2RFGA 4YNGA 2ZX9A 1JDDA 2FYMA 2PBOA 1RK5A 4CCDA 3NFUA 4QITA 1M41A 4Z42C 1AQMA 3R8RA 2VVNA 2ZRVA 1EUAA 2CKRA 2J7EA 1UH4A 1EWEA 2IKJA 3P7YA 2BZNA 1D3GA 3EXSA 2J7HA 5LXXA 1DXFA 3AXIA 4UQEA 4UFLA 4GVIA 4JIIX 1T96A 5CC5A 2WBKA 1WOAA 3ANYA 2ODOA 3G1AA 4JFWA 3WFAA 2ZRUA 1THFD 5LIYX 4IIFA 4FXRA 4A8RA 1B57A 1OWQA 1E6PA 1C9DA 3RU8X 5C9XA 4DWSA 1D7FA 3BPWA 2P10A 2PUZA 5L9FA 3UWQA 1KWKA 1N8FA 2YBUA 4XISA 1D2KA 2ZXBA 4HNOA 3ZVHB 1QO5A 4O1DA 4S3CA 4GQQA 4XSLA 2PD5A 2ZE3A 5TD4A 2Y2WA 4XZWA 2TRSA 3FSTA 3W26A 5M5DA 3WJZA 5I24A 2ZIDA 2EGZA 4MWAA 4IMGA 3NJ3A 1GTHA 4XAFA 3G5EA 3LEPA 1QPQA 1BTCA 3BZJA 3CUIA 3V1HA 4S23A 4BQ4A 3B9EA 4JCMA 2IPWA 5FESA 3IJQA 4ZODA 4K2SA 5HATA 1FWWA 1HKJA 1KO0A 4D72A 5CEWA 1SW7A 1KBBA 1OB0A 1R3WA 3IGUA 4C7FA 4DNMA 3GBDA 1TJRA 3W87A 5AVNA 5F2LA 4K7YA 4IQLA 4PCPA 1M7OA 2JBMA 1XLIA 2HISA 4QE5A 5AHFA 3I3EA 4Y9AA 3W1RA 2JKEA 4GC3A 1VEOA 8XIAA 4BS0A 1VGAA 3WD1A 4TR9A 2YCLB 2HQAA 3SEPA 3NXFA 1GOQA 3CH0A 4AZBA 4C6NA 2YFNA 3EWUA 5BRPA 4YWIA 3UW6A 3EB4A 4WSJA 4ASTA 5FKYA 4MB4A 4XD5A 3U2CA 2BX7A 1IEIA 1Q85A 3PG9A 3DKJA 1UZ1A 1WB0A 3G6LA 4W89A 1DBTA 3UWWA 1XHGA 4AEFA 4B2DA 4YTQA 3VM5A 4GXMA 1LDCA 1FP8A 2D69A 1WDDA 3LHTA 1GPWA 2XH7A 3TJIA 3CMJA 1RHCA 4CQCA 4NJJA 1C8QA 3NEVA 2Y85A 1TMHA 4B92A 3H2MA 3MKKA 1YHTA 2WW5A 1ZJBA 4I3GA 3RLUA 3ITVA 3HA1A 2PF8A 2GGEA 3LCFA 4LGXA 3TTYA 4EPEC 4ZVJA 3VIKA 1CLKA 3AFBA 1DJYA 2ACRA 1U2YA 2QCDB 1I6NA 2GGJA 4US5A 1SZEA 3H12A 3HJEA 5LHFA 2FTYA 1PZ2A 4RE0A 1GVOA 4GYPC 3UVIA 3BGGA 3A3HA 3VA8A 1HJQA 3OLIA 4FNTA 4GY1A 5FAGA 1UMYA 1V3MA 2ZXAA 3UZZA 6A3HA 4XSMA 2OODA 1DWAM 4REQB 1OZMA 4HA4A 1HP5A 3BLIA 3K8LA 3D47A 3TQKA 2CLLA 1R47A 2GUBA 5CC7A 1EEXA 1Q6QA 1XINA 3LD5A 2CBUA 4PYSA 3HFYA 2BY1A 7ODCA 1ECQA 2NT1A 4ZXOA 3T0CA 2FVMA 4R9XA 3OVGA 1S1PA 3AHYA 1JCYA 4K38A 1T41A 2J27A 3RNDA 2PLKA 1O5KA 2DT0A 5JH2A 3LM3A 5G4EA 3VVGA 1P5BA 5CPSA 1NWSA 2WAGA 4M8UA 1MW1A 3IIXA 3O63A 2A7NA 4Q4QA 1OVDA 3VNLA 2BGQA 1VEMA 3N9KA 1JZ2A 2C1HA 4HOWA 4DUXA 3GDRA 2WANA 4RL3A 2CNCA 5EL1A 1C7TA 5A8NA 4D9PA 5C54A 3L67A 2C0HA 2NW0A 3TVAA 2ZYFA 4M5PA 2VM8A 2QDEA 2XH0A 2V3GA 4IMAA 5I02A 5DT5A 1E4IA 3FY1A 1OK4A 2Y5JA 3W1AA 1G4SA 1B4EA 2H3DA 3GC2A 3IJIA 1OT2A 2I5IA 3NZ1A 2VZVA 3F5KA 4LEQA 1EJRC 3DYMA 1TTJA 2DSZA 1L6GA 4EXBA 5M2FX 1XUZA 3R8GA 5FL0A 3PB0A 5JBFA 2XFWA 3T2OA 1AH0A 1S5TA 3N2TA 1NM9A 4IL0A 3D46A 3TNBA 3U4AA 3T40A 4DO6A 1RLCL 4JTKA 3QY7A 2G3NA 4QS6A 1BWVA 5EFDA 3HQPA 2BXZA 1FQ0A 3AZTA 1JCTA 1BYAA 4MJ4A 1C9WA 1YNYA 4XX6A 2ZVRA 4CD8A 3NYZA 4IUGA 3A23A 2R6OA 1GK8A 4N9EA 1D9EA 4YN5A 3S2MA 4QJ4B 3VD5A 1QCWA 4RCXA 1LG2A 4TOQA 3QZAA 4KWVA 3S2NA 2C18A 5LZLA 1GGOA 2G3MA 2WNQA 4L64A 2VC9A 3W25A 3H7UA 3PNZA 4FAMA 2R8WA 5CAHA 2BOEX 3L4XA 2VCAA 3OVPA 1J93A 1WDPA 1GZJA 2D20A 1VIWA 1GQKA 1P0EA 1E6QM 2IMRA 3V75A 1SMAA 5HPOA 4RV3A 3PSWA 4I90A 4DWSD 2ZWZA 4PBEA 1WA3A 3W7IA 3C2OA 3EB2A 3NPUA 1CB2A 5CBIA 3Q37A 3TN5A 4GCAA 3I7RA 2P5NA 5BXPA 4LT9A 2F7FA 3DHFA 1XG4A 3AYSA 1JYNA 3WEMA 3Q94A 3G1VA 3UU0A 2XN1A 4ZQCA 3DG7A 1TPB1 4JBRA 1FTXA 3JU2A 2YCIX 1SZFA 1LOSA 1WKFA 4H3DA 2F6XA 2HROA 1YQ2A 1KTNA 4WKAA 2WJZA 3STGA 4GIYA 2VR4A 1TFVA 1POKA 5LA0A 2V3DA 4F8XA 2IKIA 1UPPA 2G3JA 1L0PA 1VBJA 2XN2A 4JKLA 3WQ4A 3OGRA 3QKZA 1XG3A 3EWXA 1P7TB 2AL1A 3I6RA 1FHDA 3LZ5A 2CPUA 1XBZA 3AWOA 3L0NA 1AODA 3WMCA 5T91A 4V27A 4KW2A 6XIMA 2DGAA 3WG6A 1ZFJA 2PGEA 3SRDA 5FCZA 3VDBA 1JZ3A 4JTCA 1UBSA 3DOPA 4Q8TA 4O10A 1PAMA 3E96A 5A8MA 3DC0A 3TH6A 4UQCA 5DMLA 3P67A 1I2PA 4QE1A 3GUGA 5JXQA 3W75A 1U5VA 3N9SA 2WC7A 3CC1A 3BQ6A 3VNZA 4MY8A 5JBDA 1AW1A 1G7VA 2VGBA 3BMVA 1UYQA 2BY0A 1W6TA 3GSMA 2A85A 1V03A 3NDZA 2PF0A 1Q66A 3W7CA 1AQFA 1Z69A 3QFEA 1R9ZA 2ZADA 2Z00A 2RDWA 4ZB2A 1X8FA 1M53A 1QBBA 3F2CA 2E67A 3WDIA 3NQDA 3SCNA 3GH5A 3SY5A 1IZJA 4JICA 3NOYA 4O57A 2ZZ5A 3AISA 4DJDD 2YSWA 5CSSA 3U2ZA 2QIWA 3SIMA 4F0MA 3AAMA 1PL9A 3AHTA 4MWAE 4LVFA 4YTUA 3P93A 5EYWA 2Z0IA 4W9TA 1IE7C 1L2QA 1XYCA 4NAEA 1UD6A 1XP3A 4ZO8A 4ONVA 4LCQA 3M0JA 2X1SA 3L9CA 3EWCA 4LRSA 1K9FA 1ZJHA 3FAXA 3HPFA 4GZ7A 2A21A 3ZR6A 3KRBA 3BXWA 3UGVA 1EOKA 3IVSA 3TW6A 2CLHA 3W1XA 1A5SA 3W27A 1B0IA 1PKLA 4IIBA 4AWEA 3SURA 1VHNA 3TCSA 2FB2A 4FIRA 3SW6A 1B3YA 1KBLA 3OO2A 5FEZA 3N3TA 3WENA 2DZPA 2JALA 3P5ZA 4PFMA 3AJ7A 5LA1A 3V0TA 3POCA 1EIBA 3AUJA 3KHJA 2DZTA 2QULA 4XAGA 4DJED 4D8LA 3BSHA 2ZCGA 2YL9A 1SPQA 4XWUA 2V5DA 2XISA 4WLCA 3LCIA 3APYA 3MUAA 1M9HA 1IQ8A 1LG1A 1TA3A 2PC8A 4INFA 3ITLA 1DPMA 2QR6A 4LTSA 3M0HA 2QAFA 3NCOA 2XSXA 1NAL1 1ICPA 4D6CA 1TPWA 3O1NA 3TYUA 4NI8A 4XD3A 3W7RA 3AIUA 4QS5A 3L21A 1TIMA 1GOXA 5T9CE 1KFJA 1VFHA 1XIIA 3IIVA 5TAOA 3GW3A 2QIIA 3AI0A 1GNXA 2DZXA 1FWAC 1VJZA 3QR1A 4B3LA 1TB3A 3SSJA 2Z1SA 3QY8A 3WKZA 2PDMA 1L9WA 3W7MA 4GUHA 2CZDA 1IXQA 5E9AA 3W24A 4QDMA 4J35A 4RNJA 4W84A 1XD1A 1OD8A 4FZIA 5GNZA 5BMXA 4NI3A 3VILA 1GHSA 1K77A 3A4WA 5FSEC 3ZR5A 3I10A 4XBSA 1WAUA 2I5QA 1J2WA 2PDNA 2PZ0A 4GO9A 5CSUA 3EX4A 2Y88A 2CLIA 3QYSA 1XW8A 1OCNA 3MUIA 1PO9A 9XIAA 1JEZA 3WNNA 1ISWA 3HPSA 1J12A 1BF6A 4QX4A 1WDSA 3TJLA 3EPOA 3GFZA 4A3YA 5ABEA 1OX5A 1JUKA 1W3JA 2AMXA 2D2JA 2QYGA 6CGTA 3MUY1 3UCDA 5HJYA 1MO0A 3CASA 4HZ7A 4MDPA 4D6GA 5C71A 5HNTA 1UA7A 3GXNA 1BXNA 3QV9A 2WSKA 5A6BA 3OLDA 1TELA 4C5ZA 1KRCC 1TWWA 3GVRA 4N6FA 2DJXA 3QHMA 1HIZA 3H24A 3STFA 1KFKA 3WBYA 3TONA 1POJA 3IJ6A 4GUIA 4PTVA 2OOGA 1YW1A 5KTLA 1XYBA 3BLLA 2P8CA 3GU1A 2GUYA 2XVNA 4ACZA 2YDQA 1KCXA 1YBQA 4OU1A 4AYGA 4LY8A 2GJNA 1HGYA 5F4SA 1KTBA 4O0ZA 4AD3A 1AK5A 4IMDA 1KM3A 3RRXA 2Z1BA 4GUGA 3PFMA 3PS7A 4E2OA 4MOZA 4JY8A 3RUBL 5M17A 1B3OA 4DIAA 1JRBA 2J8TA 4HCHA 3L4VA 3SUVA 3T7VA 4A2RA 3NUKA 3GTNA 2AMGA 2BHZA 4GH1A 5CZKA 4EP8C 3P82A 3DUGA 4UBPC 4PMQA 3OODA 1ZLPA 3T1GA 4GHRA 5HMSA 2UY3A 4ZB0A 2WCSA 5BZAA 3WLHA 1DYSA 4PODA 4U3CA 4GGHA 1OYBA 2CBIA 1P0BA 2X8RA 5A3HA 3S1UA 4RR4A 3BLPX 2GQ3A 2QGYA 4J3XA 1NQKA 3QW3A 1XLJA 4M51A 3ONBA 2W5FA 2NLIA 1TJPA 4DBDA 5G2HA 2PLJA 1WBHA 3P0WA 2PURA 3VGHA 3APTA 4N6EA 1G5AA 4ATDA 1YPIA 4Y90A 3BH4A 4H2CA 2PE4A 5AN7A 5LGXA 4RW5A 3VDGA 3CB3A 4GJJA 3O0KA 2OWCA 4UTWC 1XSJA 1SUXA 1ALDA 2FH6A 1QATA 3L5AA 1Z3NA 4HPXA 3EDFA 2O92A 4JTSA 3P8JA 5LSMA 2ZRZA 5DCEA 2PWUA 2QCGA 3ZT6A 3UWUA 2GQ9A 2YZRA 4GIRA 3EMCA 2CXEA 1MQRA 2ZZ3A 4UTTA 2Y4SA 3DECA 3H22A 4A3HA 4BWLC 3GNNA 2QCLA 5DO8A 5DMMA 4Z0JA 1S5NA 1L6SA 4H00A 2E8YA 2V5CA 1MNSA 2W63A 1OG6A 4WGXA 1H0IA 3H2AA 2VCBA 5C9WA 1EYWA 5CGTA 1Z8AA 1XLHA 5HPCA 2WM1A 2XH4A 3W7QA 3NG3A 2CWXA 4ICCX 3N12A 3BURA 3EDDA 3GX9A 3OPSA 3VKAA 3PZUA 4G7EA 5L6UA 4KRTA 1WOBA 3QR0A 4KWUA 3KBSA 4LVGA 4F79A 5FF7A 4Z1CA 3UFYA 3V1PA 4UR7A 1Y5VA 1QR7A 1JD7A 4J4KA 3W38A 2VC5A 3VM7A 2PTXA 4O11A 1Z44A 3KM8A 4IP4A 3RM9A 4NT0A 2NUYA 2YCJA 5I0DA 2D2OA 4DRSA 4L65A 4DZAA 1UD8A 1UWIA 3MUZ1 4ATWA 4E4UA 4P7LA 3W9ZA 2AGKA 4GNJA 4FLOA 5LA2A 3REQA 4MNJA 4Y9PA 2YOCA 4KPLA 2CLMA 4ZBCA 4XO7A 4DX3A 1XLCA 3URNA 3OHMB 3ISIX 1LQAA 2XFRA 4RZ4A 5AHMA 5I3IA 4S3KA 3BAWA 1CNVA 1VRDA 3WFZA 2PAJA 2VD8A 3W82A 3QGAC 4L9YA 5ECUA 3UGRA 1B30A 2O9TA 1M68A 3T78A 4WSHA 2OLHA 3TOYA 3WUEA 1ONXA 4ZMGA 2QUNA 2XIMA 1IGWA 3UJSA 3MANA 4I8DA 2ABAA 1G7UA 4FOUA 1HKIA 4E3VA 2AQVA 4W86A 5IHSA 3MBDA 5E93A 5G4HC 3EWWA 3BOXA 2ZUSA 3P0XA 4NZ4A 4WSKA 4YTTA 1IWPA 5HNNA 3USZA 4Z1AA 4HK7A 2ZUUA 3S47A 1BSIA 2DEPA 1GQIA 1W5PA 3MCNA 4QM1A 3GUWA 3OTRA 3CZ8A 4K6AA 2CFFA 3IRSA 2G0WA 3GH4A 4MVAA 2XZ7A 6PTDA 4Q4KA 4EANA 3OVQA 1KFWA 5BMWA 1EYEA 4WVXA 3VKBA 1DKWA 1E9ZB 3BJTA 1VPYA 4MY9A 3IUIA 4ORIA 4MPKA 1AMKA 1JDFA 1MNZA 1J9YA 5A6BD 2HXUA 3AXXA 2GVGA 2ZFAA 4LB3A 1CGYA 4WR3A 3AMLA 3M0MA 4AC7C 2R94A 3B4YA 3W7DA 4WK9A 5I07A 1SZGA 3VOIA 1EQCA 4HVXA 1K4HA 1OZQA 1OX4A 4GRSA 2Z1KA 3M0IA 1NFGA 1R8LA 1EC8A 1ZPTA 4UCFA 3VC6A 3K30A 4IFKB 1MSSA 1XIDA 2OZ8A 1C91A 1CYGA 3N29A 1X6UA 2VYOA 4L1WA 4UXDA 4AZHA 4PEEA 3U7VA 2ZX5A 3S83A 4UOQA 3E38A 4HZMA 3PJTA 2DZWA 3FFSA 2BV9A 2QVHA 3URBA 1HN1A 3U6WA 2XYLA 3TTSA 1TWSA 2OQHA 3QTGA 2Q02A 1NEYA 3L12A 3R7MA 3OU8A 1DWJM 4DBSA 3CZEA 5RUBA 3VE7A 5EY5A 2HNHA 2IKGA 1ZAHA 5LGZA 1RP9A 3S5OA 3WLSA 3LV6A 1XRFA 3T6CA 3MMWA 3B8IA 4NZFA 3M0YA 4WZHA 4AZGA 1VCGA 4EACA 3CL6A 1OYCA 1DE5A 3EX3A 1AH3A 3MI3A 1E1CA 5K3VA 5JVLA 3TAKA 4MUPA 1M3UA 1UH3A 4XAPA 1QI4A 3E1F1 2POTA 3TP4A 5CZTA 1GOWA 2EG8A 3G0UA 4DPPA 2VP8A 1TIWA 3D5HA 5A94A 3TNOA 3RR1A 3BQ5A 5I3DA 3R89A 1ZTVA 5ABFA 4MGGA 1ZAJA 6ENLA 4AHOA 2XTKA 3GVWA 2Y5SA 5CPMA 1NDWA 3CUJA 4HSOA 1LT7A 1OINA 5BU6A 1DIKA 3HGSA 3K46A 4JIRA 4K39A 3M7SA 1SFJA 2VZOA 2WK2A 3P80A 2AQWA 2QDDA 4LOCA 3G1SA 3NZPA 3DFHA 1O95A 4RNHA 5TBOA 1CPUA 1HJWA 2OYMA 5F7UA 4FO4A 3GIYA 3QXBA 1JNDA 3VNIA 4IUOA 4Z0SA 4W88A 1F4HA 5TQLA 3IAPA 1S38A 1AMYA 4D1IA 3TMQA 1A50A 2HZGA 1SSDA 4YLWA 2EPMX 4KIRA 4JTDA 3EOSA 3NPXA 1QNOA 4ZFCA 4CLMA 1QJWA 3PUGA 4UTIA 3ZMRA 4CQ8A 3O6YX 1DHPA 1DQXA 1RQEA 1LF1A 4L4MA 4ADUA 1Q8JA 4HPHA 4IM4A 4DXVA 1P6BA 3R58A 1I0BA 3KFTA 3B97A 2CZ5A 3P3BA 2X1RA 4M7SA 3WUFA 3FHAA 1H1ZA 1W5NA 2XGBA 5LIKX 3W85A 1UJPA 4ROPA 5G5IA 4QAIA 2FPYA 4BHYA 2D24A 2VDIA 3C0QA 4C6CA 3DEQA 3B3DA 3IJLA 4DLMA 1ZNNA 4Z2JA 1CWYA 4IJCA 1KW1A 4GYPA 1H7OA 4FXFA 1F6PA 3AHZA 5HNUA 3QQ1A 3GKAA 4MAVA 2Z1VA 2GLKA 3ABZA 4IFRA 3GWQA 5FSDC 1J4EA 3NM1A 4JTIA 4QLLA 3LRKA 2VFDA 4PMOA 4ROQA 2WLYA 4J2PA 3NQBA 4ZA0A 1F73A 4QG8A 3W72A 1EO5A 1U1HA 4MUZA 5BW6A 3MHFA 4LYQA 1HVQA 4MY1A 5E5CA 4UTKA 4JTEA 4NUWA 1IEWA 1XUUA 3CZGA 2BASA 1IXNA 4KIEA 1UH2A 3I3DA 3M5YA 1J0KA 3TC7A 4L9XA 1HF6A 1OADA 1Q63A 3BCJA 2VKZG 1PB0A 3QC3A 1I2NA 1DTUA 1SM9A 5H6HA 2XIOA 1XBVA 3TIMA 4LNCA 3R11A 1T40A 3AXKA 1VFFA 3M7WA 3TLLA 2PRHA 1KR0A 4M1RA 3VZZA 1OHLA 4Q7IA 2EHHA 1FWFC 2J13A 2OLAA 1DJXA 4ZGYA 2PC4A 1NDYA 2WHLA 1QUMA 4L6HA 5D9MA 3SUSA 1PZ3A 5AFDA 4PGLA 1U30A 3HIJA 4LAUA 4S2BA 2ZTKA 3MP4A 4LH8A 4A8IA 2PWDA 5IHRA 1EPXA 1UQYA 5KZMA 4Y8EA 1KXQA 1UKOA 4HNVA 3QQ0A 3K5XA 1BGAA 2DVTA 4IP5A 2R9RA 1ME8A 1AFSA 4GYKA 3UR5A 1VD6A 2ZTJA 4AIOA 2V63A 4ERIA 4AXNA 1W1B1 1ODUA 1SO6A 2V5JA 3T42A 4ZEPA 1KKOA 2FQIA 3V4BA 2QPUA 5D8ZA 4RPQA 2WWDA 1FFQA 1WZKA 4WDUA 3CAQA 3U7BA 3GQYA 4B5WA 3SR7A 3EX2A 5I78A 3AYVA 4D6DA 2GYIA 1R3QA 5KZEA 4Z2LA 2EPHA 4H9VA 2YCLA 5HWJA 4E2BA 1WZMA 3RO6A 3RMJA 4UNKA 1W3IA 3N2BA 2YBTA 1IXPA 5B7ZA 1CLVA 4PA8A 4NZ1A 2CLOA 1HL2A 1YDVA 1JPHA 3QMRA 1GKPA 3LPOA 3BGAA 1XWYA 1N2VA 1YXDA 1X6LA 4X9SA 4E4FA 3HGJA 3WDRA 5H8UA 3U2OA 1P6WA 2XM1A 3S1WA 3LGDA 2GSEA 1H3GA 3S2CA 5AYXA 4LS2A 3TSMA 2P3ZA 3WJXA 2WVVB 5AHNA 3HGRA 3V5OA 3M0KA 1XCFA 1IT7A 4KGLA 4OBSA 1T7LA 4H6QA 1EA0A 3THQA 1G6CA 3VOGA 2G95A 5K4ZA 5DMYA 4IIDA 1XLDA 4LUYA 5LNWA 5JH1A 1H7NA 1UR8A 2V68A 3MPGA 3LRLA 4PCSA 1TV3A 4CNSA 3M5VA 2G3IA 2XPKA 3FXGA 1MW0A 3OB8A 3WLRA 3ZR4A 1E1FA 2CLEA 3C86A 2WVSA 4REQA 2ZA1A 4V1XA 3WK3A 1BHGA 2WC3A 5AC4A 3CGTA 1O7AA 4O1BA 1TTQA 4BF9A 3UPWA 1UIPA 1HKKA 3MVTA 3IRDA 3GFYA 3C2EA 4RXGA 2H8ZA 4H04A 1TRDA 1LOQA 3C8NA 2HBXA 2QHAA 3S5YA 2ZUNA 2VENA 3DFPA 2FKPA 3WUGA 3ZSTA 4FX6M 3CM4A 3KRZA 5D03A 1OQFA 1G1YA 1XCXA 2YYUA 1Z7AA 1A5OC 2W6RA 4KERA 4IZGA 4LF1A 2X09A 2B0MA 1MW3A 4JHZA 4B5UA 1ISZA 4AG0A 1XI3A 1J0YA 4C90A 5F2GA 3UNDA 4BI7A 3R12A 3LENA 1TRIA 5D33A 3KCLA 1JXKA 4ADTA 2D73A 3WJYA 4DYEA 4PMRA 2FGZA 2J7FA 1C3FA 1VH7A 4H1ZA 3ARWA 3E0IA 4LUTA 3CIXA 4GZJA 1JI1A 5DBUA 4ZO9A 3TKFA 3NGJA 1FWHC 1LP6A 2WZEA 3TW7A 2QJMA 1S39A 4ZSUA 3S2JA 3SGGA 1UJQA 3FS2A 4FB7A 2PS2A 1X97A 3LS9A 5CXPA 5GPRA 4AIUA 2A0NA 4IISA 2Z29A 2OMAA 3ITTA 1J0IA 1M7JA 1SO4A 1ZJIA 3FJ4A 4WJEA 3WEZA 1UBPC 3LCHA 1ZCOA 1MYRA 4S3GA 2ZWYA 2ADAA 3VC5A 4IGHA 1T6MA 3FW6A 1XDJA 5AOUA 1F8MA 2VEPA 4K8HA 4KCWA 4JYEA 3LCLA 3LV5A 2Z2BA 2NV2A 1CGVA 3M46A 4GY7A 1A4LA 4JNZA 1S2TA 4XV0A 1E56A 2X1UA 1FWIC 3WLKX 3BO9A 4I5XA 1FDJA 4ERAA 4M6PA 3FEMA 1JPIA 3DKLA 3HMCA 4QTGA 1IEVA 1FFRA 2QDGA 4LYRA 3GKFA 2YW3A 3BTNA 3WMBA 4J9JA 1OF8A 3NA8A 3F4VA 1EOMA 4WF7A 2E68A 4HD5A 3VKJA 3LYEA 1GKQA 3PG8A 3ME3A 4QAWA 5LIWX 2PB1A 1X39A 4JTHA 3WJWA 5HNRA 1M1BA 2GJPA 4GI9A 3SY8A 3W7PA 3PJXA 4GC4A 1PWMA 1VAHA 3A4XA 1EP2A 3ES7A 3W1TA 1K02A 3H7RA 5HA7A 1IZCA 4PTDA 3G3DA 4GI8A 4J40A 3AOFA 1OX6A 2DVUA 4V15A 1S2CA 3CHCA 1R3YA 3AYRA 3DFYA 3LI1A 1TJ2A 2XUCA 3WY1A 1GOIA 5A6MA 2Y7DA 4HHMA 1D8CA 4TVCA 1GEQA 4F0KA 2DT3A 4AF0B 5AECA 1YPXA 1UP0A 2ALRA 4IQJA 3TN3A 3S2LA 2AOSA 3I3BA 4O52A 3T44A 1UD5A 2RH9A 1A5KC 1WX0A 4O54A 3EPNA 2D0HA 5I03A 1VFOA 1MXSA 4H2HA 3WH7A 4JX5A 3W02A 3GDMA 1PKNA 4WXZA 5HJXA 1HJUA 4CVWA 3CTLA 4R7OA 2Y8KA 3F5LA 3FSUA 2IS7A 2Z1WA 1FUYA 4OKDA 1XV8A 2AL2B 2VR2A 5J5RA 4ML9A 1FCVA 2G4JA 1PYFA 1AW5A 3AIWA 1EZWA 5F2IA 1BPLB 3N6HA 2X7VA 3NGFA 1Z89A 2PEVA 4XZBA 3MWAA 4LC6A 1D3CA 3E3HA 3R8HA 4X2RA 3RG6A 4RNIA 3S8HA 3GNXA 4EF8A 4AB4A 4OOZA 1VQTA 4G9PA 1VFTA 3CV6A 1QHOA 1RPXA 3QFWA 2PGRA 3PWGA 3WQWA 5FJPA 1C29A 1TZZA 5HMDA 1OFDA 2PP0A 4AZCA 4HU0A 3BLDA 4GISA 4O13A 2INFA 3M4HA 1LT8A 1QW9A 4LF2A 4MMWA 3ZJKA 3NTYA 1E55A 5C70A 2DJLA 4L5ZA 3WSUA 1G4EA 4AEEA 3PPFA 2Z25A 3LK6A 4Z17A 1G0CA 4PMNA 2BOGX 4P7NA 1GOKA 1V6XA 3NQ2A 3PZIA 2J75A 2PP3A 3KP0A 3GYCA 5CGMA 4J3ZA 3MSDA 2NV9A 4X0NA 2YGYA 2UBPC 2FZMA 3O16A 3VNJA 1EP3A 3WL0A 3V18A 2D0GA 2GDQA 3EWBX 1VS1A 2OZ3A 1HT6A 4LXFA 3SQMA 3DERA 5DMNA 1YTDA 4WY0F 4D2JA 5E6ZA 1RQHA 1UWUA 3W7JA 1SZNA 4FOKA 1GG0A 3LU2A 3QEZA 1VF8A 1E0TA 2DV0A 3S6OA 1M01A 4ZE5A 4F2UA 4XIAA 3WMLA 3VABA 1QO2A 4M1BA 3DN5A 4IGNA 4CQBA 4NXSA 4G56A 1GW9A 1VLWA 3GG8A 3M47A 1EC7A 3M41A 1CXFA 1W0MA 1QMLA 4GIAA 2X16A 2EO7A 1UZ4A 1VKFA 4HU4A 4HNLA 3FIGA 4F9DA 7TAAA 3GTIA 1FWEC 3CZLA 3KVLA 2E5CA 1ZCCA 1FH7A 5E0KA 1NH6A 1XLEA 7CGTA 2C15A 2PDJA 2WCGA 1CT5A 2OYLA 1X38A 2PODA 1L6WA 4JTQA 1J6OA 3G8EA 4FEZA 4J3UA 3NL2A 1F2JA 1XYMA 3LHWA 5IDZA 3TA9A 1LL4A 4HMEA 4UTWA 4CKQA 4DO4A 4NU7A 2E9BA 4H9XA 3BARA 3B9NA 3TSDA 4RW3A 1JF6A 4YCOA 3V0SA 4ERGA 2P76A 3N18A 1BXCA 1Q6OA 3WF0A 3HV9A 1JCMP 3MCMA 1OGGA 3KEHA 1RBAA 3FDKA 1XLAA 3U3HA 4WUIA 1JZ5A 3MMTA 4KH2A 1NY1A 4NJHA 4GO8A 3EKGA 4PBFA 2EPKX 5I7GA 3CT7A 3ABQA 4MDOA 3SJNA 3GS6A 2KZHA 5F2MA 2FMNA 5A2CA 2BWGA 3HU7A 4O17A 3WH8A 1WDQA 2X2GA 4NYUA 4MJ2A 3UCQA 1FXPA 5BOFA 5EBUA 1LTDA 3MHGA 4M6UA 4HYRA 4HMCA 4XTIA 2CITA 1G4TA 4FPSA 4X61A 2GK1B 3BOLA 3AZRA 1ITXA 1TPDA 4ENLA 3KZPA 2YL6A 5K9CA 3SCRA 3ABOA 1N55A 3UJEA 1PHWA 3ZJ7A 5AVHA 3CQHA 4C6JA 3F4CA 1AQ0A 3GHSA 2ZXDA 4XKYA 4O1EA 3ATZA 4L4OA 3SCPA 2JIEA 3RJXA 2CC0A 1PTAA 5IFTA 4LUSB 2PDFA 2GWGA 5HANA 3J7HA 2VFIA 5DRCA 5EMYA 1H51A 3W7GA 3WLNA 4IG2B 4DYKA 3K4WA 1E9IA 4NNBA 4DI8A 3XISA 1IYXA 4EPDC 4U28A 2CHRA 3T08A 2P88A 1JGIA 1SGJA 1IWAA 1A80A 2ZOXA 1BTMA 1XSKA 4I9TA 3KS5A 1NQ6A 4AZ7A 1XIJA 4GY0A 1GG1A 1C92A 2IKHA 5GNXA 1TR9A 5EKYA 2OU4A 2C19A 4PCFA 4E4PA 4H9YA 3BJFA 1O60A 1M5WA 3R94A 3AS0A 1SFLA 1F4AA 4QLJA 3QQWA 2QDHA 3ABSA 2CW6A 3C3NA 4N4QA 1J01A 3RHGA 5DLCA 1VYSX 3BZGA 1ZGDA 1QWKA 3VDHA 3GG1A 1A49A 1TQJA 4PBGA 2D2GA 4MNLA 1KXTA 2VX7A 5DANA 2F38A 3M43A 1A53A 3DCPA 4R7WA 3DBPA 4TV5A 2QUUA 4J3VA 3I7QA 2A3AA 2TSYA 3BDKA 2A7RA 5FIPA 1O5QA 1OFEA 2DUAA 1CXKA 3UQNA 1A0CA 1GOMA 3G18A 4M56A 3WCZA 4JQ2A 2YX0A 3W01A 1KM0A 1OSEA 2VRQA 3CLMA 1MRQA 3G3MA 2V81A 4GIEA 3WK0A 3NQCA 4QJ1A 4O4VA 5C9RA 4Q3MA 1F61A 5J8LA 4JTAA 4FNPA 3FA3A 4HNUA 5DN1A 1U1JA 4WKHA 1V6YA 5J5DA 1KKRA 5HQLA 1L6FA 1TPFA 5AC5A 3L68A 4JNMA 1TCDA 2BY3A 3CUZA 3W3OA 1CENA 5CCZA 1H7RA 2HS6A 3PWIA 4AY7A 3SCOA 4Q22A 3W81A 1O6IA 4GOAA 5EB8A 3QOKA 4BF7A 4Q8WA 1R6WA 4UUIA 2VT0A 3DGRA 4OVXA 4WIWA 4LYKA 5LXEA 3RX3A 1K4GA 2ZBTA 3TYZA 4UFIA 3GDBA 4FR1A 3AMCA 3GAKA 2D22A 3R5EA 3IAQA 3Q65A 4KFPA 3OP2A 3WLIA 3KP1A 2PDGA 3EXRA 3L5LA 4P8WA 4U4MA 4DELA 4IPLA 4P7OA 4L7ZA 3PUDA 2WSPA 3A4JA 4MKVA 1EXBA 2QMJA 4W87A 1B4KA 3PUEA 1KM1A 3DZ1A 1V79A 2I14A 4B5VA 1Z42A 2IUZA 3MA8A 1AZ2A 4ICMA 3RILA 1YEYA 1OT1A 4W5ZA 3OGVA 3WIJA 3VAVA 1X96A 4D6HA 4IMCA 1HQTA 1ZS2A 3E2QA 1TUFA 3P14A 4EK7A 1PIGA 3RM4A 2NQJA 3RO8A 1R2TA 5G2WA 5A95A 3F2DA 1WPCA 3PSVA 3IS4A 2VEMA 4QP0A 4J7RA 3VD3A 2C16A 4HPNA 4O14A 4DWSB 2WZMA 3GIPA 5D38A 4AEOA 4AU0A 5DT7A 5I79A 1WYIA 2F2KA 3NQVA 2NXGA 1U22A 4AD5A 3AYTA 2Y89A 3DAQA 1WE5A 4ZB5A 2C1GA 3A6OA 5CPQA 2PU1A 2I7GA 1S5VA 1FBAA 2GGIA 4PFHA 3MKCA 1MFVA 4QLKA 4GKLA 2XSAA 3DGBA 2YL5A 1E3ZA 1PZ1A 5KEZA 3UR8A 1H0GA 3SADA 1I75A 4YWSA 1W56A 3C61A 2W67A 3CV7A 2IQTA 4N7QA 1IZKA 2Z6JA 1FCBA 5LYRA 2XG9A 4IXXA 3R0KA 1VFSA 3Q2DA 3BAIA 3RX2A 1V6UA 1S5MA 1GZGA 4QIUA 5DY3A 3E0LA 1LOLA 2C8NA 1K7EA 3STEA 2IPGA 4AW7A 1YRRA 4LANA 4GK8A 1F7BA 3W7HA 4N0RA 1UC5A 2QQ6A 4OUIA 4C5YA 4JTGA 1J5SA 1RCXB 3LLDA 2XSBA 3RCYA 1LROA 1LWJA 1XLKA 2EF9A 4NQ1A 3LGGA 5FEWA 3KVJA 1BSLA 5TF0A 3WDHA 3SI9A 1SW3A 3MP3A 4WXYA 2YB4A 3L4ZA 4PMDA 1XF0A 1CB7B 3VKDA 4IF2A 3O8AA 4HQVA 4ZQRA 3FAWA 2XVKA 3WQPA 2H6RA 1PBGA 5I06A 4IFOA 2PTYA 1XXXA 3OJGA 5D9PA 4MM1A 3CLWA 3DHPA 1IHIA 3HV8A 2X7WA 3RN6A 1TCMA 4PMJA 1W3NA 3WQFA 3QGKC 1O1ZA 3GXMA 4ICNA 1PJ9A 2HXTA 1KGXA 4L1XA 1H49A 3NM3A 2BHYA 3TQPA 4DJFD 1UZHA 1VBUA 3PHAA 4L61A 4F48A 4AHPA 3GHTA 4GQRA 4LUIA 2J62A 3FYYA 7REQB 4UTHA 1RD6A 3CV2A 3TTEA 4PSRA 2DZSA 4E6MA 1ITUA 1HX0A 2DZUA 3T8LA 4XAZA 4A05A 2DIKA 1NWTA 3BG9A 1US3A 4NAFB 3PPGA 5D2WA 3UWVA 3TX9A 5TIMA 4R88A 3SCSA 1TZ9A 1S2AA 4QQUA 3S6DA 3TMLA 4A3QA 4WRHA 4I6KA 1P0DA 4OV9A 3A12A 1ZHAA 4I6VA 1X7IA 2G5WA 2J78A 1HJSA 1YX1A 1TV2A 2Z27A 1JD9A 5C55A 3NXLA 4JQ1A 4C65A 2FHFA 3A13A 5DCBA 2PWGA 1F05A 4Q8NA 3QSRA 3U4FA 3GRIA 5HINA 3WD3A 5CBBA 4O53A 3VMOA 2INEA 3DHUA 4R27A 2JKAA 2BODX 4DZ5A 4MKNA 3VPLA 4Q8QA 1VFUA 3LXAA 3W37A 2KX9A 4OWGA 1Z41A 1XGEA 3AU6A 4I5RA 1AD4A 1HTIA 3RRAA 4M3PA 1I2RA 2CHOA 3AS3A 4YYCA 2VEKA 2VVSA 3QZEA 4DUVA 1XKYA 4B5XA 5CAKA 1X1NA 2FPVA 1KCZA 8TIMA 5IRPA 3C3UA 3PY2A 2BLEA 3LNPA 1M7PA 3GIQA 3KL3A 2X0YA 2DSKA 3CO8A 2HVMA 3BL3A 1MUMA 2WNZA 3PBUA 1WXJA 3TWBA 2YA2A 2P0OA 2D3LA 3O07A 5HR7A 3CT2A 1RALA 1QPKA 2TYSA 4S39A 4H4IA 4UTLA 3PZOA 4CQAA 1JYXA 4CEUC 4YTSA 4GABA 1JDCA 1YTEA 2P50A 4EE9A 3PZ9A 1JYVA 4LFYA 3CAVA 4PMZA 4ZQOA 1C8VA 1TJ0A 2GZXA 3QW4B 1V93A 2ZC8A 4CNNA 1XDMA 1GVFA 3UESA 3VO0A 5HQEA 5C7VA 1QOXA 4LAKA 3WD4A 4E2DA 1X8CA 1EDTA 4G1KA 2X0HA 1UWQA 4F0SA 2AAMA 3MZNA 5HXMA 3WQVA 4AX6A 4DAFA 2HVNA 1BKHA 3FA5A 4TMBA 4A22A 4B5NA 1XH0A 3F4DA 3OVRA 4HPJA 5HWMA 3OIHA 4IIEA 2A6NA 4W7UA 3VYLA 4OUEA 1QNSA 3CHDA 6ALDA 1CI1A 3BMWA 1LL7A 1QNVA 1HXJA 1V77A 4GI4A 3RF9A 1R38A 1H62A 1SMDA 1GHRA 4JR5A 5JUVA 1E72M 2OSWA 1UR9A 5AC6A 1NF0A 4UFHA 3B0PA 1ONEA 3TYAA 4J5NA 4YU1A 4DM2A 2DIJA 4QBXA 3E02A 2E77A 2ZXQA 3EDKA 3WYZA 2Z24A 1OCJA 2E0PA 2BOFX 2DQWA 3IJ7A 2OQYA 5HAOA 4Q4SA 3TCEA 1GVSA 5K9DA 1R3SA 4IGSA 3H21A 3FN9A 5A6AA 5M03A 4W93A 3VIPA 3BMXA 5A2AA 1QI0A 1KGUA 2E4TA 1XD0A 1XSIA 1MQQA 3IIOA 2PMQA 1JGMA 4QJ3B 2JK2A 3VIGA 3A5FA 3TFCA 4F2TA 1KC7A 3KOFA 3W53A 1FWGC 2QF8A 4NF7A 2GVEA 3TE9A 4PMYA 5T9BG 4CNTA 5FF4A 4XAYA 3GK0A 3RGTA 3PFRA 4JDBA 2CIPA 3ITYA 1W3LA 2EG7A 3HG4A 2PD9A 1LRQA 3CMFA 3W71A 5ABGA 3WF1A 4Q8OA 1TPVA 5BRBA 1TWIA 1RK6A 3BV7A 3GE7A 4IIHA 3KCJA 1NDZA 4JS3A 3VIFA 3VNKA 1GYNA 4YHGA 3KBJA 1TX2A 3QRHA 3UPBA 4D6JA 2OSYA 3GR7A 3L66A 4H83A 4Y6GA 1KRMA 4C6KA 1KBJA 4PC8A 3RYSA 1W1ZA 4NKCA 4IPJA 3V36A 4TXEA 3ZJ6A 2E25A 3A22A 3C2FA 3E0VA 1UIOA 2C91A 3AIBA 5I3FA 2FVKA 2JEQA 1RVGA 4PTMA 2EPNA 1SJCA 1YE4A 3WQ8A 4LWWA 1QK2A 4FI4A 3UERA 2WM0A 3SJ3A 3QVQA 1OG0A 4Y96A 5LNVA 2A79A 6REQB 4DZIA 3UZJA 4QHRA 4FXSA 4Q4OA 3CPGA 1ZAIA 5F1VA 1FWNA 9CGTA 4Z2KA 3KLLA 2VURA 2RDXA 2Y61A 2YBVA 4C6BA 2F9RA 4CU7A 3ARSA 3MBFA 2A3CA 3Q67A 2NQHA 1OFBA 3BE7A 3OA3A 4UC5A 1UOKA 3KOXA 1DWHM 3LM7A 2WVVA 4JTFA 1V02A 2YPIA 1JIBA 1KTCA 2QJNA 5D2VA 2UWFA 4D6FA 1QPRA 4GYJA 2DP3A 2VWSA 1PXGA 2DDXA 4Z2IA 4FP1A 1NIUA 3HF3A 3VFLA 2UY2A 1O5XA 3GXFA 1EL3A 4POCA 4YTRA 1UWSA 4Q8VA 1DEDA 1DP0A 4JX6A 3VMNA 3IIPA 3NQ8A 1LYXA 3QV6A 2QUVA 1H7WA 2PGWA 3LHVA 4O4WA 1UD3A 4CD4A 4I8YA 2JFEX 3ARXA 2GVLA 1XKJA 3G2GA 4HB7A 1R7OA 4LVDA 2PDXA 1T8XA 4CN4A 4X2PA 3FYOA 3K8KA 3WQDA 2GOKA 4IMFA 2J7BA 3XIMA 3CUHA 2J6VA 3K8MA 4HMDA 1TKKA 3HTWA 4PUUA 3SCWA 2XGIA 3K4DA 1NWRA 1TA3B 2O7SA 3W1UA 3CWHA 1N8WA 3AQUA 4L1GA 3AHXA 4GZEA 3MSGA 1FH8A 3TDFA 1QHPA 3EX1A 3P61A 3KLKA 3HZ3A 4XZ9A 4FK9A 3T4CA 4E38A 3W1QA 4GH3A 4FHAA 2VWTA 1HUVA 2GJLA 1ZBCA 3FEQA 5EBAA 1VRXA 3CJPA 5KETA 2ZDRA 3WDJA 3G1RA 4YXGA 2QW5A 2BXVA 3SCVA 1VBHA 2JF6A 2VXNA 1Q6RA 4LQ1A 3CIWA 5T26A 3KBWA 5EU9A 5I09A 1DQWA 4RPPA 4HOXA 4UTUA 3USBA 3LY0A 2PU0A 3WF2A 2PRMA 4FXJA 3PF3A 2ONEA 6TIMA 3RU6A 3MDUA 7XIMA 1GT8A 1PCWA 4PZVA 1OEPA 1NARA 4AD2A 2QCNA 1RVKA 5D32A 5CSYA 4JY9A 3QLLA 1Y7VA 1IT8A 1QW7A 2WV8A 3NL6A 4AYSA 3N25A 4LAMA 4HHHA 4EPBC 4NNCA 1F3XA 1QT1A 3RITA 3PZQA 5A6KA 5A8OA 3O9NA 2OB3A 4PL2A 1FKXA 1F07A 4WHBA 1ITQA 1U83A 2PRLA 3BC9A 4JTTA 3SQSA 4A21A 2PBGA 2RGMA 3INPA 3RLVA 2ZX8A 4MWAD 3N4FA 3MV01 5K4XA 4HTBA 3MMDA 2GVYA 3TROA 3WQCA 4YPJA 3V7PA 5HBFA 2VOMA 3MB9A 3F4WA 1J5TA 4J1OA 1KV8A 2FVLA 4QG9A 2UY5A 1VYPX 3F5JA 3S5NA 4CEXC 4ACZB 3BLFA 3HN3A 2VFFA 2TAAA 4OQVA 4TX9A 2A3BA 2Q8ZA 3ENLA 2NSXA 3RPDA 1AQHA 5TNVA 1V0KA 1GVRA 5C6MA 3MTWA 1JCNA 3E74A 1F9CA 2OX4A 2PDQA 3O05A 1OD0A 1R5YA 2WJFA 4C91A 3Q58A 4CCCA 2WMFA 4JFSA 3U8GA 3WBEA 4C6MA 2AGTA 4D8AA 1O12A 4PL1A 2RGLA 5HMEA 3KRUA 2EPOA 2IQDA 3WK1A 1ECEA 3L4WA 2VJXA 5C2CA 4NY2A 4UR9A 3C0SA 3W2NA 3HQOA 4O50A 3WK2A 4AF0A 1PWLA 2DZAA 1K9DA 1IIGA 5GJPA 2I16A 4C6IA 4KMQA 4XVDA 3TOPA 4KBXA 1Q7MA 4B2DD 2BGSA 1MZRA 1FCQA 1HNYA 2QNEA 5HQMA 4UFMA 3EMQA 2VUYA 4ML4A 3STCA 3GD6A 3H26A 4YL2A 3W1MA 4C1KA 1O1HA 4BCEA 3LPFA 3W84A 3CU2A 3UD6A 2TMDA 3QN3A 2RDTA 4JD4A 1W1A1 3W2KA 1YADA 3L7RA 3CZJA 3FJ6A 1YLVA 5AYBA 4US5D 4O19A 1NOFA 4LBSA 1WZLA 4FNQA 2FHBA 3TR9A 4HPGA 2OEJA 4FLSA 1HL8A 4AD1A 4L9ZA 1RAKA 2R14A 1RBLA 3FV9A 2PGFA 1YMYA 4ZL1A 1JULA 3T0BA 2ZA2A 2PLCA 3SUTA 3SRKA 3V3WA 3M07A 2NQLA 2NZLA 2ASHA 4EAYA 3H6OA 1JAKA 3ORWA 3LMZA 2W0UA 2V3FA 2Q01A 2J66A 1JR1A 3SIZA 4AX7A 3B9DA 4Z1YA 3OBEA 2WC4A 1DV7A 1TPC1 4DQWA 5LNSA 3NSNA 4WDWA 4A3RA 1VC4A 1VB9A 3LXBA 3L0KA 5M1TA 4MIMA 3U9IA 2BVDA 4BF5A 4KT2A 4S3FA 5MHBA 1UHVA 4BQ3A 3BSMA 3TV8A 3VGDA 3RPTA 3CQKA 4Q7BA 1H7XA 1GVIA 4DO7A 3ZOAA 2G3FA 2I9EA 3UWZA 3FGCB 3A9IA 3CYVA 3WNMA 4FX8A 2XVLA 1TJ1A 2FGBA 5FOOA 1VEPA 2YA1A 1IGSA 4JQAA 1R7AA 1V4YA 3BG5A 2XJ7A 1DL3A 4RJEA 4PULA 4JTUA 2BVYA 3W76A 1PDZA 3AC0A 4PCTA 3UA4A 2VGFA 1FKWA 4XBKA 5KMYA 4R34A 2QV4A 4WOQA 1XH2A 4BJHA 4P8XA 4KEUA 3W86A 5DRIA 1O4UA 3MCOA 4AWUA 1A3HA 3ANUA 1XPYA 1Q2RA 3DFTA 3DI0A 1EUNA 5FJJA 3CWOX 1PZ0A 3GNRA 3QC0A 1E6ZA 2OJPA 3EB3A 3W7LA 1FDYA 1DE6A 5DXXA 2VEFA 2BHUA 4MPQA 1EP1A 1UUMA 4RDYA 3LA4A 2HE5A 4NRRA 2QCFA 4WGHA 1H5YA 5FEXA 2J4GA 1XPGA 3PZTA 5IM51 2J8FA 3WQ5A 1KNWA 4HMNA 2HPIA 1AH4A 3S5ZA 3K1GA 4E8CA 1BRLA 2YCEA 5ABHA 1FHVA 3V5FA 4EXQA 3ARPA 4FOJA 4PTWA 1G69A 1JPDX 1A5BA 4XD4A 1V02E 2OT1A 4IGMA 1LL6A 3LPPA 4CN6A 5A8QA 3CQJA 1OM0A 1MVYA 4FR6A 4LC8A 5CQ1A 5K9XA 3UPMA 1JPMA 1WUEA 3AICA 4ZOBA 4JCLA 3UXLA 3AMDA 1AJ0A 5A8PA 5I2UA 4PUKA 3NVDA 1MUCA 3NEHA 1XYFA 3TAOA 3P5YA 1TVPA 2OCZA 1H1YA 4H7ZA 1UQZA 5E70A 4F0LA 1DQUA 2B7QA 4WJXA 3OBAA 1S5WA 1G4PA 1AD1A 1JDAA 2FB3A 1DWGM 5A69A 3MJYA 2FZDA 1XBYA 1K9EA 3ALFA 3PZNA 1A3XA 1AW2A 4QDPA 4B90A 1JZ4A 1W2PA 2GK1A 2W61A 3WMSA 5F1UA 1CEOA 2PPGA 4IWWA 3QKEA 1E40A 1Q6DA 2BFGA 3B0VC 2XFFA 3WLPA 3AWNA 4RK8A 3KCOA 3IANA 2YXGA 4TQTA 3HJZA 5BXRA 3WDQA 3N17A 1ZRQA 2RKXA 3AIVA 3VINA 2ISSA 5IBXA 4Y2WA 2G8ZA 3LSBA 1BWKA 1QOPA 1UR2A 3KBVA 5H8MA 1PS9A 4YHEA 3S5SA 1ZZMA 4C6QA 3S1GA 3MHUA 4HJWA 4K8GA 5EA9A 1QFEA 1CZ1A 4M6QA 3VNDA 4QQ3A 1QVBA 2WVTA 3N3MA 1UUQA 2D0FA 4X60A 3URAA 1S2WA 1YE6A 2YDRA 3H55A 3VNMA 5FA5A 5U4NA 1XR2A 1K6WA 1SU5A 3CPRA 1BD0A 2E6YA 1WQ5A 1IV8A 4UFJA 1QK0A 3SUUA 3QHNA 3BCFA 3ITCA 3LHUA 4OFCA 2P8BA 2FJUB 4IMEA 1OIMA 3GVVA 4F0RA 1KFLA 2VI0A 3O0FA 2PLMA 2DW6A 3S1VA 2WZHA 4U10A 5MKGB 3L5MA 4J2MA 4MZ1A 3GAYA 1ZB5A 4Y7EA 1JUBA 3T2PA 2EG6A 1U33A 4O12A 4WJ8A 3SAZA 3ABRA 1D7KA 2WMIB 2DZVA 3WN6A 1SR0A 2V3EA 1QI3A 1R85A 3BW4A 1CTNA 3DHDA 5LIUX 4IX2A 1W3KA 2CBVA 4LU0A 3WEOA 5KITA 4C1LA 4B5SA 1S46A 1JFXA 4JKMA 4GVFA 4ZR8A 4XTDA 3RMEA 1H2JA 3EX6A 2X05A 1ESWA 1ZALA 2OTDA 1V3IA 1GEHA 1E4NA 1A47A 3IUDA 3IVTA 1V8EA 1TVNA 1X6NA 3NYDA 4MFDA 3PZVA 2ZX6A 5DY2A 2J9XA 2OWWA 2FMOA 4BQ2A 4MZ8A 3ZVIA 5FJUA 5AB3A 1WDWA 3ZQ9A 2GSHA 4C1NA 5CLWA 5FL1A 3KVKA 2XZ9A 5FAJA 1E15A 1IIHA 1UWRA 1XC4A 1M7XA 1OCBA 3BVJA 3E5BA 2HPMA 1VBGA 1W2VA 2WCAA 1R86A 4GZIA 2PWVA 2VQUA 3VIIA 3CTTA 1NFBA 5LNUA 3FJLA 4W7WA 5D2YA 4URIA 1UG6A 1XYZA 1F74A 4AFYA 1I1XA 3WDPP 3BSGA 3VOFA 1B31A 2QPXA 1F6YA 3GDLA 1OIFA 1AVAA 1A4MA 2DVXA 3DFQA 1TQXA 3HGOA 1LZOA 3GTXA 4Q8UA 1R3VA 5GJMA 3SUWA 1KBKA 4UMBA 4KQNA 3H2OA 1KV5A 1GPFA 1AJ2A 1J8VA 3O6DA 1ENUA 1QASA 3BUVA 4NXKA 1HFBA 5E09A 1FWJC 4AHQA 1T5AA 1SJAA 2VFGA 2F61A 4IXHA 3BWWA 3PZGA 3ZLFA 1KCKA 5A6TC 4HA1A 1EX5A 1V08A 3PBGA 2VD9A 4BI5A 1JDEA 1YDOA 4H41A 2ISWA 3CO4A 1GTEA 4NASA 1K8XA 2E8ZA 2E09A 4NZCA 5AZ0A 3MJMA 3Q45A 3GLCA 1TV8A 4C6LA 3AHVA 1J18A 3ZWSA 5T8GA 3E9AA 3JW7A 4H8VA 3GBEA 3UR2A 1PKYA 3BAYA 4B9YA 2FGLA 4LS0A 3UXIA 3COTA 3CEUA 5AZ1A 4DF2A 4J3SA 1NDVA 4I9AA 3L4TA 2ZICA 1TUXA 4WKFA 3GZ3A 1N8IA 3UZXA 3AUOA 2YB1A 2V8ZA 3SM0A 4UQDA 2D1ZA 3H2NA 3IK2A 3PK7A 3VIHA 5IDIA 5XIAA 2OFJA 5JIWA 5C2XA 1XJBA 3N2XA 2J7GA 1NWUA 2YW4A 2V38A 2Y0FA 4HNCA 1Q6EA 2GJXA 3MYOA 2B31A 3PR2A 3ARZA 1PTGA 3MT1A 2QKFA 4JFTA 2ACQA 3HG2A 5HR6A 4CN1A 1GVYA 1TX0A 5G2IA 3VGGA 1DJQA 1OK6A 3RLGA 3S9IA 3A3XA 1XLFA 5AHEA 4B16A 2DH2A 5GQBA 1KGWA 2DSVA 3IJ8A 2HWGA 4DN1A 4MADA 1FP9A 1FH9A 1YIXA 3RCMA 1E0WA 4X22A 3ZT5A 1SR9A 1W1PA 3GY1A 4GJIA 3HBLA 3R13A 4MHBA 4U2YA 2GQAA 1W9XA 1A5CA 1DJZA 4UQAA 2WNNA 3OOQA 4WOZA 1H60A 1M04A 2W9MA 3SSZA 3W4RA 1MW2A 3GXPA 2WWCA 4OBTA 1XBXA 2NX9A 2BSLA 1BKSA 3HM7A 4X63A 1E1EA 2WQPA 2WHMA 2NWSA 1DVJA 2OOFA 1EPVA 5BYWA 1RA0A 2PSNA 4P61A 4JHMA 1UR0A 4PRTA 1XRTA 2OO0A 3N4AA 1GOOA 3S9ZA 2ZKMX 1NJJA 3DC8A 2CESA 2W27A 3MP5A 4GQ0A 4OJYA 3MO7A 1X98A 1YDYA 3MU7A 4JAWA 4KEMA 1BWLA 1MI3A 1E43A 2J74A 1PE1A 2NXHA 2JQXA 3UNTA 4DI9A 2JKPA 1EXPA 1W5OA 3SECA 1XDLA 3NNTA 4AIEA 4E8GA 3NAVA 4IH3A 4XZNX 2C6QA 3EXTA 2HK0A 4MB5A 7REQA 4N4PA 5D2XA 4GQGA 1JJKA 1RP8A 1KLYA 3EOOA 3ZS4A 2ATSA 4KEZA 3T0TA 4NNAA 3HQ1A 1NVMA 2VZSA 4QNEA 5C9UA 4DJDA 3PWAA 1Y5WA 4NAFA 1KRBC 3NO5A 4I7UA 4H9MA 1XS2A 4JZ5A 3W70A 4B5TA 1K8ZA 3FX4A 1BYBA 4GNVA 3GNDA 1H1NA 1CXIA 1W9VA 5MF5A 5H1WA 3G1FA 1JNEA 1G67A 1NSJA 3WFLA 1ITCA 1RPKA 4XZIA 1GQNA 2H9AB 2Y62A 2EBNA 1RQBA 3UG8A 1F6KA 3ID7A 3BICA 2POZA 3M5XA 5FF2A 4JN8A 4X9YA 1RJQA 1HW6A 3E6EA 4RZ6A 3KOYA 2VFHA 4GX8A 2Y70A 1HJVA 1QTWA 1H09A 5CPNA 2F2HA 4PUEA 1R2SA 1DJGA 3QZ6A 1S1RA 1HG3A 3P8IA 4O0KA 4QRNA 5B7YA 2BNJA 4DJEA 3EAUA 2PDPA 1A5AA 5IXEA 5H91A 2GPTA 5REQB 4LAZA 1JXJA 2ZZ4A 2VHLA 4LW7A 1B9ZA 3LB0A 4HU8A 1Q65A 4JYDA 2R91A 1HO4A 2AKZA 1UKPA 3W6YA 2OKTA 4K37A 5DEZA 4HP5A 4ZXLA 1EDQA 1QRQA 3ERPA 2OT0A 4Q4RA 3GC4A 3VUSA 2XH2A 4R9OA 2CU0A 4YMZA 3DYPA 4GI6A 3RCNA 3LERA 1KWGA 3PAJA 3OZMA 5CG7A 3WBXA 2FZ9A 2Y6ZA 3TQVA 3D6NA 3PVFA 1PSCA 3H8AA 1FA2A 4LUTB 1E9LA 3GNPA 1E6SM 1EB3A 3JS3A 3TLQA 3NO3A 5HDRA 7PTDA 3WF4A 3VE9A 2Y7EA 3UXDA 1YNQA 3FHQA 1R30A 1LWIA 3GB6A 3OGSA 4IQEA 1CGTA 1TZ7A 3B8TA 4B15A 2YFOA 5H2ZA 1GVEA 2V5LA 2QUMA 2RJHA 1IXOA 1VFLA 4JFUA 1TR1A 1QHZA 1ZQ5A 3QOMA 5DCDA 1TE6A 4J3WA 4QSFA 1JZ6A 2OG9A 4LALA 1MEIA 3WBWA 2UZ9A 2AAAA 3GM8A 3K1DA 2NV1A 5I3HA 2QCEA 3HPXA 1OF6A 3AIEA 2E1DA 3NVTA 3I6EA 3RAOA 1ZBVA 4PMUA 1DTNA 2IXUA 5K7JA 2OR2A 2JGYA 3P6LA 1Y5XA 1WUFA 4HYVA 1EJVC 3ZVHA 4P7QA 1BLIA 2QGHA 5EMLA 4TTUA 3EA1A 3H4XA 1JZ7A 1FCUA 3EWDA 2EJ1A 4PB4A 4MG4A 3ELFA 4LNYA 2WLZA 1CDGA 3NO1A 3UR7A 3KL5A 2YL8A 2XU2A 5DXYA 3W2UA 4EVZA 1WO2A 1H4PA 3L4UA 3II1A 2VR5A 3TW9A 4MJZA 4TU1A 1ELSA 4XZHA 4TUFA 1UR3M 1RSCA 4E3TA 2X30A 2QLYA 5DQPA 1HL9A 4DEFA 2EAWA 1DORA 5CSRA 1LRTA 5FF0A 2PCEA 3VZXA 5CJ5A 1WV2A 5A8GA 3EDEA 1Q4WA 3N2CA 5KZDA 3NPVA 4MF4A 1WKDA 1KFBA 4CD6A 1BYCA 3AO0A 4HOZA 1X7FA 1MEHA 2XIIA 4LBUA 5AC7A 4ZSTA 3HFTA 3E49A 4IOTA 2EJAA 1TSIA 2DT1A 3AMKA 2F8QA 3NR0A 2VC7A 3GG0A 1RH9A 3NZQA 1AA1B 2QEZA 3B9OA 3KE0A 5A1AA 3HO8A 4RDVA 3NPWA 2NX3A 2ZUVA 2W92A 2YXXA 2F6UA 4S2CA 2HMCA 1AUSL 1XRSA 3ZWTA 3SB0A 4JXCA 3M1ZA 4P8VA 3N15A 3U2EA 3WD0A 1TMLA 3GHRA 4G1NA 3OEXA 3MI6A 4GVHA 1F76A 1JZ8A 3N6JA 2BVTA 4B4HA 1RR2A 1H50A 4QGCA 1EHNA 1IEQA 3CMGA 4O1FA 2HK1A 2HSAA 3VGFA 4CU8A 2QPSA 4D8ZA 3AXHA 1CGXA 4J27A 1J0HA 3WZ0E 1R9XA 2FH8A 4GGBA 2IPJA 1NP2A 4R53A 4YS1A 3B0UX 1CW2A 2QCDA 4WY0B 3BAKA 1NP0A 3P81A 1I8JA 4WEVX 2ON3A 2OSXA 3QGVA 3T05A 2JF7A 2PZNA 4AZCB 3LCGA 4M6VA 4TVUA 2NLYA 4AISA 2Y7FA 2P53A 2I17A 4MLRA 4YCPA 1J11A 2ZVIA 1ONWA 5C7HA 4MZYA 2CCRA 3KS6A 4IIGA 4RZ5A 1TPH1 4AWSA 4H01A 4IJBA 4KKXA 3VIJA 3AXMA 1SW0A 5CPOA 1VIZA 6REQA 4HCLA 1ZJAA 2E6DA 2ZDSA 3G0SA 3L23A 3QTPA 3EKZA 3WH5A 4DVOA 3PTDA 1JPKA 3KTCA 3L0GA 3QJAA 3TSBA 2JEPA 3WX7A 3RPMA 2DH3A 5JIPA 1TO3A 3DFOA 2V5KA 2XIQA 3ZIZA 3FA4A 4DBUA 3R79A 3SN4A 3DI1A 2VO5A 5HUPA 2YCKX 3M0XA 2BDQA 5DBTA 5D37A 1JQXA 3T2QA 2WO5A 1F3EA 4ZO6A 4YYFA 3QPZA 1TE1A 3UYIA 3SCTA 4U5IA 4RKAA 4C6EA 1H5VA 3EEZA 3LGEA 4A2SA 4Q32A 3HG3A 3MKVA 2CLPA 2BBFA 3GZAA 1BFNA 1CBGA 2A5HA 3CWNA 1E73M 3EBVA 4C6DA 3L65A 2ZE0A 3GTFA 1UB3A 1S3TC 1E71M 3CNYA 3B0XA 2CBJA 1JFHA 1OJXA 2JIWA 3IK4A 2QCHA 3CUFA 1L2UA 2DQXA 3CAKA 2OGJA 4ILSA 5FJIA 4Q33A 1LUCB 2V67A 3C8FA 5C9ZA 5C8BB 2Q3OA 1UOZA 1TPEA 1FWCC 1V3LA 1JQVA 3WQEA 1EJWC 4QG6A 3ICJA 2R1LA 2WKGA 1TWZA 5D8WA 4O16A 2XIJA 3R0DA 1EF2A 3LRMA 3BW2A 1J2BA 3W7EA 1CECA 1GJWA 1E4LA 4P7RA 4AY1A 5F4WA 4XZLX 2VTFA 4ZTXA 4IHCA 4FNRA 2B7OA 4IP7A 1KXVA 1O68A 3N13A 3UZYA 1HGWA 1U5HA 3SQLA 4LUJA 1IR1A 4K36A 3JR2A 1JAEA 1CGWA 1J6PA 4B3ZA 4G7FA 3B0YA 3O2LA 1IWBA 1IEXA 1J0ZA 2MNRA 2HVOA 4NJGA 5G1YA 1EIXA 4UFKA 3BOFA