3H2OA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
273
structure length
264
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 264
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2oA00
3K13A 2VEGA 3H2EA 4DB7A 4S23A 3TYUA 4DJDD 4O1EA 1Q8AA 4S3EA 3H23A 2Y5JA 1TWWA 1TWSA 1Q7MA 3TYAA 2BMBA 1AJ0A 1TX0A 4S3DA 2OGYA 1TX2A 4PZVA 4S3FA 1EYEA 4NILA 3H2OA 2Y0FA 3MCNA 4DJFC 4HB7A 4MWAC 4O0QA 3BOLA 4DJEA 4D9PA 4NL1A 4DJDC 2DZBA 3TZNA 1Q7ZA 2YCIX 4D8AA 5JQ9A 4C1NA 3TYZA 4D8ZA 4DAFA 2YCJA 4DJED 1F6YA 4MWAE 1AJ2A 2H9AA 1AD4A 3H2NA 2DQWA 4DJDA 2VP8A 3H21A 2YCLA 2Y5SA 3H22A 4G9PA 4NHVA 3TR9A 3V5OA 1TWZA 4C1NB 2DZAA 1AD1A 2VEFA 4CCZA 3H2AA 4S3AA 3TYBA 2H9AB 3H24A 4DJFA 3H2CA 3TYDA 2YCLB 3H26A 3TYCA 4MWAA 2YCKX 4S3CA 1AJZA 1Q85A 3MCOA 4NIRA 2E7FA 3H2FA 4S38A 4S39A 4DAIA 4DJFD 3BOFA 3MCMA 3H2MA 1Q7QA 3TYEA 3TZFA 3NOYA 4MWAB 4MWAD 4DJEC 1Q8JA 4S3BA 4O1FA
chains in the Genus database with same CATH superfamily
2VEGA 1E4NA 2EKGA 1Q2SA 1XGZA 2C8NA 1DP0A 1WV2A 2H8XA 2DVUA 4EOUA 3L4UA 2OZ0A 1TPDA 3VZZA 4KFPA 3L65A 4ORMA 1JPDX 4WY0B 4LAKA 4ZQRA 3GFZA 2Z2AA 2IQTA 3AUOA 1Q6FA 2IKJA 2C0AA 2VOTA 3H2OA 5DXXA 4G7EB 1GZJA 4DM1A 1OK6A 2PP1A 4YXGA 3QV9A 3L67A 4IOTA 4CLMA 3DX5A 4YCPA 1TJPA 2DT0A 3BDKA 1XIFA 4V1XA 2VR4A 2CHOA 3W25A 3UYCA 4NY2A 4DLFA 2OELA 4WEVX 1MFVA 3UWWA 5LHEA 4LUTA 5C9WA 1EDQA 5HNRA 2YCJA 1QVBA 1Z8AA 3H53A 3MUY1 4ZOEA 2EAWA 3WQEA 5MKGA 1Z9AA 4MDOA 3CXOA 1XIJA 4RJEA 3WF3A 2OT0A 1XLMA 1XDLA 2A3HA 4Q8TA 1S3TC 2YLLA 1AMYA 4IG2B 1W5PA 2V68A 3R0UA 4C1KA 3LBCA 3HQOA 3MCOA 5EMLA 4HJFA 4E4FA 4ZSUA 3TXZA 1U1UA 1OHLA 3KRZA 2XWEA 3OVPA 4NAFA 1Q8JA 1V0LA 2Y8KA 3GAKA 1DHKA 3GNDA 3N4AA 1V0MA 1DJXA 1KLZA 1VEMA 4PL2A 3B97A 2BVDA 1UA7A 4WUIA 2PD5A 4GIYA 2PCEA 1VJIA 2W67A 4D1IA 4HA3A 3S5YA 3HPZA 1W2PA 5GVJA 2X42A 1Q6CA 2GJLA 3UR8A 4WK9A 5BRPA 4M5PA 4ZB2A 1IHIA 1EJUC 3E0FA 2Z00A 1SJAA 3LDVA 5AYIA 6PTDA 4PFMA 4V27A 1PCWA 4IH3A 1QT1A 3PTMA 3CHFA 3LGEA 1FWDC 5AHIA 1H7NA 2WPBA 5A2BA 4HKPA 2C1HA 4GA8A 1TG7A 3QFEA 4ADSA 2Z1WA 4ATWA 1HT6A 2BNJA 1G67A 2GGHA 1S39A 1T99A 4O11A 4AMCA 3DHFA 1PKNA 3B8UA 3GTFA 3W2JA 3H22A 3CUFA 4B15A 5DBUA 3QMSA 1P6BA 4WF7A 2EPKX 2ZDSA 2VEKA 2V8ZA 4C6IA 1CGYA 5IDZA 5LXXA 4A3RA 3G1FA 2B7OA 4NASA 2HBXA 1NOFA 3VD5A 2ZX8A 1ZSXA 4LVGA 4J27A 4I9AA 1YNQA 5I79A 1E0WA 2ZX7A 3LRKA 1EXBA 3PBWA 4XAGA 1VFMA 4R7WA 3WG6A 2QMJA 4UTHA 3KCOA 3PFMA 3LTYA 3C2VA 2ZKMX 1SZEA 1TPEA 1OQFA 2WHJA 4DUVA 4GFSA 4FIQA 3GW0A 4D1JA 3S8HA 1CYGA 3LCGA 3TYAA 1DPMA 3QBUA 1DVJA 1FFRA 5JIWA 3DDMA 4XAPA 2WYSA 2BVTA 4LBSA 3CZLA 1IE7C 3FA5A 4HOZA 1XH0A 3W27A 1BYBA 3VOGA 1ZLPA 6A3HA 3CK5A 3CEPA 4U28A 4BKNA 1UKOA 1ODUA 5F7UA 4WJ8A 1GKQA 2AQVA 2CZEA 3HV9A 4QITA 1UJPA 3F5LA 1PZ2A 4WR3A 2GGIA 1UUOA 3W1MA 5EMUA 3KWXA 4L1WA 3QV7A 3QQWA 3MMDA 2GJPA 2EF9A 1KBJA 2XGIA 1SFJA 3LS9A 3UWYA 5FJJA 4AHPA 4M7SA 3BLLA 4IQJA 4JZ5A 3E2SA 3GDBA 3WLJA 2BHUA 4I6VA 3FCPA 4GQQA 5KINA 3P5ZA 1DWFM 3MUIA 3WNPA 2EPHA 5T9CE 3W7MA 5LHFA 4REQB 4JTFA 4D6HA 2AQWA 2ZA3A 3EOOA 3S9YA 4KRZA 3M1ZA 4O1EA 5HATA 5LNRA 3DGBA 2VM8A 4TR9A 2ALDA 5CGMA 4PC8A 3C56A 2Z6IA 4TTUA 3OJGA 3AS1A 3VCRA 5CSYA 1HX0A 3OTRA 4JKLA 1SGJA 3U57A 2ZE0A 1QRQA 5AVNA 4GNKB 3O07A 2P50A 1F76A 4PMDA 2JIEA 3R4IA 1QJWA 1MI3A 2X16A 3DFOA 3ITYA 4H2HA 5CPMA 3REQB 4L6DA 3VU2A 2REQB 2ACSA 4GJ1A 3DFTA 1PZ0A 1A47A 4UFIA 2Q71A 4Z2KA 3LPFA 4JIIX 4P8WA 5CBIA 1XFCA 3E2QA 5BRBA 1Z44A 3DC0A 3TQ0A 3MUCA 3T0BA 2QCGA 2JIWA 2J27A 3EB3A 4O12A 4BF7A 3LSBA 3K2GA 4B5WA 1LRTA 5F1VA 2G41A 4HMCA 1FP8A 4N02A 3IRDA 1E6SM 4FXJA 4IL2A 1XW8A 5GPRA 3NDOA 3W1TA 4K8GA 3WNOA 3GBDA 3GZ3A 3U8GA 3TOYA 5CPLA 4HK7A 4WXZA 4W8AA 4ZA0A 2EPNA 2GSEA 1VJZA 1D8WA 2WWCA 2EPOA 3PNZA 2ACRA 3PJUA 4KEVA 1R9YA 4CD7A 2QUMA 4TX8A 1VIWA 2YL6A 2GQ9A 4KFNA 1M03A 5K4XA 1H3GA 4ONVA 1KWKA 3R6IA 4W8LA 1JJKA 3R94A 2YL9A 4FO4A 1R3QA 4JIRA 5TAOA 2XIQA 2ISSA 4HZ6A 1GT8A 3O2LA 3L4VA 3DAQA 3GW3A 3RX2A 3VVGA 3AHTA 4CNSA 1OD0A 5LKYA 3ZR5A 3MCNA 2W27A 3FY1A 3KW3A 4OTKA 5D9NA 2CW6A 4J3TA 2PDHA 4O54A 5JU6A 3M6YA 3ABSA 4NL1A 5C6MA 1TMHA 4IIEA 2E6YA 3FHQA 3S6TA 5JQ9A 4UB9A 1EHAA 2DZPA 5H8PA 1P5BA 2NVAA 1OFEA 1UUQA 4XSMA 2ALRA 4UTLA 1CIUA 2PWUA 3PZQA 3LXCA 4NAEB 1EGVA 2DT3A 1V6WA 2Z1BA 4UFLA 2I57A 3T81A 5FF3A 3UJEA 3QPEA 4TIMA 3N04A 1KXVA 4N0RA 3OLGA 4EPKA 2XVLA 3WDQA 1BYAA 1T6MA 3W07A 4LUSA 3GDLA 2L5HA 2YYTA 3KE0A 5HNTA 3WJSA 3H12A 1E1CB 2B7PA 1M6JA 2CLIA 2NT0A 4J35A 2Z0IA 4XV0A 3WQ4A 4F2UA 3VNLA 2VC5A 5DX7A 3T2OA 3V35A 4QNEA 1R2RA 1L6YA 1NDWA 2DSZA 4MGGA 1WYIA 1JUKA 2C79A 1HXJA 2UV8G 4ML4A 2A85A 2V5KA 3LYEA 3N9SA 4PFHA 2VRQA 4F0SA 4ZOAA 4P7OA 4XZIA 3RMJA 3OZPA 1H62A 1JI1A 5A6KA 4B5UA 3OBEA 1H1ZA 4DO5A 2HEJA 4JR5A 4JTLA 1NDZA 3QW4B 4HSNA 3GH5A 3GKFA 1KXHA 1PB0A 3GFXA 4Y7EA 4GIRA 1ONEA 1VRDA 1PZ3A 2VDIA 1I2NA 2ZYFA 4H6EA 2YR1A 3NM3A 1J6PA 2UY4A 4NT0A 3GS6A 2J79A 1OBAA 4Q3MA 2ZZ4A 2HPMA 2D0HA 5CG0A 9CGTA 4CNUA 2HRWA 1ICQA 1PIIA 3VOHA 2NUXA 3IJ8A 5FA5A 4A4AA 1J10A 3ZLHA 3ITTA 5EA9A 4B91A 3ALFA 3CTLA 3EMCA 1VYSX 4U10A 2J7EA 2D69A 1K4GA 5D30A 3EBVA 2Y24A 4PCTA 4UR8A 4N6FA 5HPCA 2IXVA 3IIXA 1RZMA 4EVZA 1UR9A 4DJDD 2CFFA 2PS2A 3KUMA 1RLCL 1ZGDA 1S5TA 3TUUA 4O4VA 3VMNA 4LC6A 1SZFA 4OU1A 1EO7A 4OUIA 2DUXA 2V2DA 5FJTA 3UXDA 3VI2A 2Q3RA 5ABGA 2GYIA 1GOOA 1S38A 4QG8A 1FWGC 5DANA 4GINA 1HP4A 3N15A 5CSSA 4BI6A 1W3HA 2EPLX 3S1GA 3CL8A 4Q8PA 4UNIA 5DCEA 5HUOA 2QCMA 4I7WA 5A8OA 1OY0A 1QO5A 4DI9A 3PANA 3EWUA 1I6NA 1E40A 3NSNA 3ALGA 3LGDA 1DTNA 4BQ4A 1TPUA 1TA3A 1UR3M 4LYRA 2VGGA 3DUGA 3IJ6A 1YTKA 4B5XA 3CMGA 4AEEA 6ALDA 3WQFA 1SW7A 4FMVA 1E1CA 1NWRA 3M16A 1TE6A 3LHUA 3HM7A 3M46A 1J2BA 1EQCA 4QE5A 2VZTA 3SCVA 4HOWA 3AC0A 1FCBA 4HJWA 2YBTA 3A4XA 3W84A 1V6UA 3TWAA 1P1MA 3UA4A 8A3HA 4DWSB 2XISA 3DYOA 3NAVA 5I3JA 3CWHA 3PR2A 2CXEA 3EA2A 3N3TA 4ZO9A 2DZWA 1GKRA 4D2JA 3WD1A 3GD6A 3UXKA 1Q2RA 3WO8A 1OYAA 3ZSTA 1TSIA 4WJEA 4AD1A 1VAHA 3C0SA 3VIOA 1QI3A 4HTBA 2PBOA 4JPGA 2KAUC 4PBGA 3VDBA 3W7LA 2PZNA 1B3YA 1KTBA 2WKJA 4NZCA 3ME3A 3MTWA 1AL7A 4NJKA 4H83A 3H7RA 3GC4A 2C71A 2NT1A 4GYPA 4HHPA 2YJQA 3V5CA 2J6VA 2Z27A 3SEPA 4PZVA 3QSRA 3U9IA 2O9TA 1A5SA 3Q37A 2ZFAA 4IF2A 5AYXA 1NIUA 4JD4A 4JS3A 3LB0A 1K6AA 5CH9A 4QLLA 3EDKA 4LQ1A 5D4YA 2OQYA 3EX1A 3E96A 2ZZ7A 2FMOA 1OT1A 1GOXA 4MG4A 2WJDA 4JCLA 4XD4A 4CGTA 3DFPA 4JBRA 3I3BA 4FOUA 2NWSA 2EJAA 2UY5A 3SDOA 3PTKA 5KMYA 5C54A 4CQAA 2GVGA 4XSLA 5CZKA 3NYZA 4Z08A 3LHVA 4A3HA 1EA0A 3O15A 1E56A 3PWGA 4M8UA 3GLCA 4BI7A 4H7ZA 3P8JA 4L1GA 1XCWA 1A5LC 2E6AA 4IX0A 4O8RA 3W7EA 1GYMA 4J3WA 3O7UA 3G1XA 2IPGA 2BY2A 2PZ0A 3TCEA 4QLJA 4MPQA 1EUNA 3VCCA 5IBXA 3DKJA 1DJIA 3SGGA 3JVAA 2OOFA 4HK6A 3KVMA 1MFUA 4J40A 1ZP4A 4WIWA 1GG0A 4FNTA 2FDSA 2EG6A 2HV5A 1D7FA 2VR2A 3CUHA 1NDVA 5REQA 3W1RA 3ITGA 2PSNA 4AWEA 2CERA 4GX9A 3VOJA 3OQEA 2NSOA 2X1RA 5BZAA 2Z1SA 1DWHM 3FKKA 3GVVA 2PLMA 1W8GA 2ZBTA 3WDJA 4HA0A 1KXTA 1BEUA 1S1RA 4GO9A 4O1AA 3W86A 3C8NA 3EX4A 2DZTA 4CU6A 1YRRA 2HSAA 4W8BA 4Y9PA 1O6IA 2QCHA 3EWXA 3FJ4A 4HNLA 4M80A 4NJJA 7REQB 1CXFA 1P0NA 3BAYA 3L7RA 4RW5A 4U5KA 2PDWA 1H09A 4AD4A 3NZGA 4AMAA 1PEZA 5T9BG 3GC5A 1NF7A 1LL7A 5I6SA 3RM4A 4H8UA 2D73A 3NPXA 4KEMA 3SURA 1Q65A 1LBFA 2NX9A 4RE4A 4WSJA 2INZA 5G1YA 2HS6A 3R89A 1EHNA 4Y9AA 1PAMA 3SCOA 3QRHA 4OBSA 3L4WA 1PKYA 1YPFA 2WHMA 1OFBA 1I2QA 2NV2A 5I07A 5LNUA 4K39A 2D0GA 3ZT7A 1QW9A 5H6HA 5I3IA 1JZ8A 2GUBA 5FESA 3HPFA 4PMQA 1CXLA 3VD3A 5DEZA 2XIMA 3L5AA 3WLPA 1RA0A 5ECVA 2X0SA 1TYGA 1TX2A 4GNVA 3SFWA 4A21A 2PGFA 3LMYA 1PS9A 4H6KA 1K1DA 1V6XA 4JTHA 1X6UA 4PTMA 5CC6A 4XZMX 3U4FA 1EXPA 3CLWA 2EEXA 3T2QA 5BOFA 2HDJA 1O4UA 3BSGA 3TC7A 4DPQA 3HJEA 3WLIA 2WZMA 1B2YA 2YDRA 4LB3A 1FX6A 2R9RA 5FSEC 3WFLA 1OSEA 1W37A 1MUMA 2WC7A 5EKYA 4B16A 6TAAA 4FP1A 3CO8A 1MSSA 3EMQA 2XPKA 4LVDA 1A5CA 2C0HA 1FWFC 3QMRA 1IXQA 3STGA 4WGXA 5I78A 3W2UA 3ATYA 1UD5A 3A9IA 4WQ6A 2ZZ1A 4UTFA 3GVRA 4BJHA 3DIPA 4JKKA 2RDWA 2E7FA 2ZRVA 5LIXX 2MANA 3Q67A 2PTYA 2OGJA 2X2YA 1HJUA 3AIBA 2F6XA 1FWJC 1XLLA 1B9BA 3K4DA 4FLQA 2TPSA 4FSAA 1OYCA 5E0CA 3MSGA 3F4DA 3UZXA 2BOFX 3USBA 4IQLA 1X97A 3W4RA 3LEPA 4US5A 2AAMA 1EC9A 4GVIA 4PB4A 2FFIA 3IJLA 4R85A 3SY8A 3WJWA 1Q7MA 1V3KA 5FSDC 1RPXA 3WN6A 3I7QA 2TMDA 3QYSA 1JEZA 2DSWA 5CC3A 6XIAA 3AROA 2VYOA 4LNYA 2X05A 1H0GA 2PDKA 4YVVA 2WVVA 1A50A 1CDGA 3VX1A 4WKFA 2OQLA 1QOPA 1UR2A 4IFRA 1F05A 2YOCA 2XUCA 1ECQA 3PHAA 3VOCA 4KEZA 1KGUA 3GR4A 3BCFA 3IIZA 4O18A 4DZ5A 1UBSA 2NQLA 3LI0A 4ACZA 3AIQA 3EX6A 4TUFA 1DBTA 3L9CA 4IP7A 1GEQA 5HULA 3SY1A 4CN4A 4GYPC 1MEWA 1ISYA 1KNWA 1RCXB 3OG3A 1XM3A 3NTYA 1H7PA 2ABBA 4KH2A 2ZRUA 2ISDA 4XZNX 3VPLA 4P8VA 1A5BA 2D23A 2ISVA 4LALA 1XD1A 2O92A 2VFDA 3GVWA 4FLOA 3CM4A 1SSDA 2AL2A 2WMIA 1DQUA 3SAZA 1E0UA 1PTDA 4TX9A 5G2HA 1LF1A 5HPOA 4O53A 5LGXA 2VENA 4GY7A 1TRIA 1XG4A 4GK8A 1VFSA 5HOSA 2ACQA 2PCQA 4S3FA 4C7DA 4GXPA 3E74A 4QSFA 5HWJA 3I3EA 4H2CA 1KRMA 3WLRA 4IICA 4A22A 4MSSA 2ABAA 4EXBA 1GORA 1M41A 1G4TA 3AS2A 1H1NA 5JMUA 1HKJA 3E6EA 3QGKC 3PWAA 3SBFA 1UD2A 2G96A 5KSWA 5HINA 2PWDA 3W00A 3QTGA 2BSLA 1IZJA 1XBYA 5IBXC 3GHSA 4QJ4B 3CNYA 2OMAA 3MO4A 4KCWA 3EB2A 5D9OA 2VP8A 3VOIA 1EB3A 1X6LA 4UNLA 1K4HA 3UVIA 3BGJA 1ZTVA 2PFHA 1EP3A 4D72A 2E5CA 4HSOA 1GJPA 4UFHA 3S5NA 3E38A 1HIZA 2FHBA 1RBAA 4IFKA 2VFFA 1BRLB 3O0KA 4Q6XA 4YN5A 4GZJA 4DAIA 4GBDA 2FZDA 3RILA 2DGAA 3CL7A 3CYJA 3VIMA 2QLYA 3SECA 4MWAB 3WH8A 3WDPP 3WLTA 4QS6A 4RZBA 4D6JA 1T8XA 4HTYA 3LD5A 1GVRA 1QI5A 3QTPA 1G6CA 2J24A 1K9FA 1OCJA 2C14A 3CLMA 2DW7A 3CQJA 2W91A 3KL0A 4M3PA 3VIHA 1GW9A 2W66A 4IJBA 3A22A 4BA0A 4MTVA 3VE7A 5M1TA 1ITQA 2X0YA 3RYSA 2E09A 1PE1A 2V81A 3OW1A 3TIMA 4HBKA 1ZCCA 3WYZA 4JXCA 1RQHA 2DW6A 3L23A 4AD0A 3NQEA 2HVNA 5AECA 4C1NA 3K30A 4D8ZA 3I7SA 2E1WA 4C6NA 4KEUA 4QAIA 1JD9A 3WQPA 2PRLA 5AY7A 1YDOA 2CBIA 1DIDA 4AZCB 4QXIA 4J3SA 3CT7A 3IGUA 4OBTA 2WPGA 2VGFA 4XAFA 3WK1A 2OOGA 1QNQA 2VEMA 1C7SA 3L5LA 3WX7A 1RCQA 2QJIA 1UJQA 3WDRA 4OKDA 4XAYA 3BXWA 2PDBA 4WXYA 1JCMP 1GOWA 1FOBA 2ICSA 3QW3A 3LPPA 4S38A 1XINA 3NDZA 2F61A 4ZSTA 1OVDA 3QY7A 4JX6A 4RV3A 1E3XA 1QWKA 4JQAA 2WSYA 3UGVA 2EJ1A 2VD9A 3OYZA 1K6WA 4A8LA 4GZ7A 1JI2A 2OXNA 1AW5A 3NQDA 2GVYA 2CITA 4IUGA 2R14A 4E3TA 2FGZA 1MXSA 4IMGA 5FL1A 3N12A 1QFEA 4A8RA 3KVJA 4WX2A 3G1SA 3QPYA 2E6DA 2X1IA 3TJLA 2V5JA 1JZ4A 2WBGA 4OHQA 4E0CA 2YW4A 2ZRZA 1CLVA 4ERAA 4RZ4A 1M65A 4GVHA 1KRAC 1X8CA 3G1AA 5ABFA 2V5CA 2DZBA 3TONA 4KWUA 3DESA 3PBUA 1IXPA 2WSPA 3DEQA 3NZQA 1FXPA 1JZ2A 1B3OA 1VCVA 3BPWA 3A5VA 3B9EA 4UXDA 1E6XM 1ESWA 4JY8A 1UWQA 1GQIA 2VEFA 1W1ZA 3W1LA 3IJQA 1I2OA 5CPQA 4ILSA 3JS3A 1IEQA 5FJUA 4FI4A 3W88A 3AU2A 2D24A 4NJIA 5BRQA 3DFYA 3D46A 3U7VA 1IWPA 4X2RA 3PG9A 4Q4PA 5KZEA 2A6NA 1BQGA 4FLRA 4JN7A 3NVTA 4GQGA 2A4AA 3THQA 3BOFA 3NL2A 4AX7A 1F4HA 1HTIA 3LXAA 3BMWA 3L12A 3EKZA 2CLHA 5I0DA 3W53A 4RNHA 1EEXA 3GR8A 2X30A 1G4EA 3P80A 3T8LA 3WBYA 3WUGA 4U3CA 3S0CA 3GE7A 1WP6A 5TF0A 5JUVA 3NQFA 3PTDA 4KIRA 4F8XA 1JQVA 4UTWA 2E9MA 5AHMA 4WDUA 4JL2A 2XVNA 3GG7A 4W86A 1IEVA 1YDNA 1U22A 2Y62A 3LHTA 1LL6A 2ZZ2A 3B05A 3BLDA 3WD3A 4D71A 4PGLA 1LWHA 1E5JA 3SUSA 2DJLA 1BTCA 1HKKA 4XD5A 2FJUB 2D1ZA 2ZZ3A 2AMXA 3OA3A 3ZYZA 2FLIA 2VCBA 3E0LA 1X98A 3NQBA 5LYRA 4ASTA 5J5RA 4TVDA 1W3JA 1DKWA 4GJJA 3N1AA 4Q4OA 4KFOA 4QJ3B 5DO8A 5DN1A 1OD8A 4PTXA 2GK1B 3N19B 2O55A 1V93A 3C2OA 4X0NA 2GGEA 5U4NA 2J78A 4UR7A 1KGXA 4O4WA 2DIKA 2XFYA 2H8ZA 2NW0A 3VC6A 1LZOA 1SO5A 1KTNA 5IDIA 4HMNA 2ODOA 3OZOA 3WFZA 2OKOA 1EIXA 1RR2A 1Z6KA 1ZCOA 5D2VA 1W17A 3BAJA 2POTA 1Y7VA 3MHUA 1YBQB 2WJFA 4HHMA 4H9MA 1QI4A 1QNSA 2UY2A 2CHNA 4FX8A 3S1VA 1Z3NA 3SN4A 3LG3A 2GSHA 3LHWA 4Z2IA 3T07A 4D6FA 4V28A 3N3MA 3HG2A 1J79A 3BC9A 1TUXA 5D8ZA 1V8EA 2YX0A 3FA3A 2IS7A 2UZ9A 2PF8A 1HZYA 4J3ZA 3MP3A 4OWGA 1U83A 1E3ZA 2JF6A 1PHQA 1TQJA 3UETA 1T96A 3WUEA 3S42A 4V33A 3SCPA 4AQLA 1U30A 1GVEA 3QH2A 1ISWA 3Q94A 4RDVA 4YWIA 5G2IA 1SZGA 3CGTA 2J4GA 3NJ3A 1Q13A 2D2HA 1NFGA 2QZRA 3D47A 1NH6A 5F4WA 3KWSA 1W1IE 5D05A 3IJ9A 3CEUA 3A3HA 4ACYA 4WJXA 1KM6A 4Z1AA 4JEQA 1KO0A 4I7UA 5KITA 1B3WA 3FOKA 2W0UA 2VRKA 3MY9A 3CT2A 3T2PA 3TMLA 1FQ0A 3FJNA 1VP5A 3U4AA 5CJNA 6TIMA 3MC5A 3UERA 3M6DA 4ZODA 3BG9A 1PWLA 2EKCA 4H8VA 2B7QA 1EUAA 1UKPA 1IGSA 3ZVHB 5PTDA 4MPKA 2QJMA 2ZTJA 3U2OA 2WJEA 4K37A 2OSWA 3BAWA 5AZ0A 4A8IA 2OX1A 2BDQA 2HQAA 3MV01 1DQXA 3FSTA 3R58A 1AFSA 4AEFA 3Q2DA 2WB5A 5I00A 4O0ZA 4OGZA 4MB5A 4OT7A 2EXOA 2X1SA 2XGZA 1I60A 4YL2A 2WVSA 4WD0A 3M5XA 2VO5A 1F61A 3UPMA 4ICMA 3JW7A 4AAJA 1JCTA 5A8NA 5DBTA 1S2CA 1YIXA 1IEXA 3WH5A 4XZ9A 4B5VA 1REQB 1RHCA 3WF1A 2GZXA 5D32A 2QUUA 3UCQA 1XUZA 3BGGA 5A8PA 5C9RA 2YYUA 3W37A 1XS2A 3CIVA 3B0UX 1EEPA 3TTYA 1F6PA 5FI8A 4JTEA 1BXNA 4DXKA 4E4PA 4N7QA 2J6XA 4WSHA 3OA5A 4XBJA 1ZZMA 3MI2A 1JG9A 2E8ZA 1DE5A 3ARZA 1OGSA 1IWAA 4G1NA 2OSXA 1TV3A 4JIEA 2A21A 5FCZA 2PURA 1W5OA 4L6HA 3DFNA 1XBXA 3V7PA 3SR7A 4QCFA 3KTCA 3BJTA 5HXMA 4RNIA 1BWLA 4DBWA 5K9CA 3SCSA 3KAOA 1QI0A 2OSYA 5FJRA 1W32A 3PTQA 2ISFA 3VGDA 5IFPA 3LLDA 1SFTA 3BG5A 1AMKA 2OO0A 3UQNA 3IVTA 4UR9A 2CIPA 3RXZA 3WNKA 4HPNA 8XIAA 2HE8A 4HZMA 3IS4A 2VC6A 1ONXA 3CPRA 2X8RA 4CNOA 4KBXA 3MANA 4O28A 3N17A 4A8NA 4MAVA 1OCBA 1L6FA 3B0PA 1OC7A 3PAJA 5B7ZA 1UC5A 2Q02A 4H9XA 3FW6A 4IPIA 3COTA 4GX8A 3ZJ6A 2DQXA 4UTWC 1U5VA 2G3IA 3ICJA 1E9ZB 1PTAA 5IHSA 1D8CA 3L5MA 5M17A 4AW7A 3TWBA 3IANA 1C93A 1JCYA 4RE2A 2ZE3A 3DECA 1PL9A 4XO6A 4M56A 5KETA 4RLIA 2QW5A 2O9PA 1UZHA 3IVUA 3N73A 4HGXA 4QE4A 1BKSA 5FL0A 4AC7C 4U2YA 1LBMA 5ABEA 1CW2A 2NZLA 1U5JA 1HP5A 4O17A 4GG9A 1EC8A 2BTMA 4M0XA 4QDPA 5CLWA 2OZ8A 1DIEA 1LLWA 1I4NA 1Y65A 5GNZA 2ZWZA 3GTXA 1XRSA 3OBKA 2CBJA 4J9JA 1O5RA 4Y9OA 2YL8A 3R0DA 4KCVA 1UQYA 4BCEA 1VH7A 3PZ9A 3V1PA 1AQ0A 1BWKA 1CCWB 4OOZA 1WDQA 3B4YA 3F7JA 1ZU8A 5I3GA 4XD6A 4PUEA 3CH0A 1WOAA 1JGMA 1H7WA 5I03A 4OE7A 4L1XA 3F03K 4UQBA 2DQWA 3CB8A 4ECLA 4F0KA 3H21A 2DVXA 1KRBC 5I3DA 1GOMA 2XVKA 4PODA 3GUWA 4O15A 5AB3A 3EOEA 4GLEA 3B8DA 1QAPA 4MKNA 3C2EA 3KCLA 3V36A 1NJJA 2PLJA 3H2MA 3F2DA 1FWEC 1TPH1 3EEGA 5G4HC 1BVZA 3A3XA 4CCDA 2FGLA 1P48A 2AAAA 3GNRA 3W1PA 1T41A 2Y7DA 3CUIA 3DYPA 1UP2A 3DG3A 2YXOA 2XJ7A 4H9UA 1Q4WA 5K7JA 2YPIA 1TWWA 1V6YA 2AL1A 1MYRA 3TTOA 1XC6A 2ZUTA 1QBAA 2ANUA 1KCXA 5EPDA 3RX4A 3WMSA 2OFJA 4QCEA 5HANA 3BWWA 3G1RA 3AJ7A 1X6NA 2B0MA 3HGOA 1VFFA 1F6KA 5CG7A 5DMNA 2AKZA 3TSDA 3OU8A 1SO3A 3PZVA 4C6LA 3GC2A 6REQB 5IHRA 1EQPA 1GQKA 3VNYA 1PDZA 2PF0A 3VKCA 1V7YA 1ZENA 3OLDA 1DEDA 4DJDA 1HW6A 3L68A 3AWNA 3ERPA 1PWMA 3W0KA 5CPOA 3AAMA 1UHVA 1UH4A 1AQHA 5I5RA 3VGGA 3RIKA 1JZ7A 1S5VA 4ZBCA 1UP0A 1KM2A 4CNPA 3LPOA 4AF0A 1TV4A 3QV8A 3GK0A 3GQYA 1I1WA 1PX3A 1ZAIA 2JKPA 1XH2A 2FPVA 3C5QA 2DY3A 3QC0A 3S6OA 1UIOA 2QS8A 3TZFA 2GWGA 2HWGA 4M1RA 3LOTA 3MZNA 2X41A 3EZ4A 3BMVA 5C55A 3H2EA 4E4UA 4AWUA 3UJFA 1BYCA 1IGWA 3URNA 1PTGA 3DI0A 5ENLA 3S5ZA 3NPUA 1QPNA 3EYPA 2BZNA 3OP2A 2CZ5A 1H4PA 5DRCA 4I9JA 3ARRA 3GY1A 5JH2A 4MIMA 1MMFA 1XI3A 4WSKA 1ADSA 3GVGA 1BXBA 1DTUA 1FDJA 5F2GA 2WZTA 2VX4A 3WQGA 3M5YA 5HMFA 4CEUC 3LNMA 5L6UA 4LYPA 2PP0A 5AFDA 1AA1B 1UZ4A 4MY8A 3VMPA 4AISA 4GACA 1EGZA 2IW0A 3AWOA 1VR6A 3C0JA 3P14A 1F6YA 4UQ9A 5CSUA 5ABHA 4AY8A 2J7DA 4UTTC 3U2ZA 1AD4A 1OFQA 4NU7A 4J2MA 1P43A 1ISZA 2YCLA 1TE1A 3A9BA 1F9CA 4RW3A 4US6A 3LI1A 1JAEA 2PGRA 3W1XA 3HO8A 1SJCA 4PUWA 3VTRA 5GNYA 4I3GA 1MDRA 2VFHA 3Q4DA 1B57A 3AIUA 2BG5A 3RM8A 2W9MA 4G6CA 2HMCA 1TKKA 1F4AA 1T40A 1ZAHA 3GXTA 3UNTA 3SSJA 2WLYA 4BFAA 1IT0A 3NOYA 5H8UA 2NQ5A 2QDHA 3N2TA 1RJRA 4LUJA 2E28A 2O9RA 3VNKA 2GJXB 3SW6A 5JH1A 4O1DA 1MDLA 3AXXA 4LF2A 4XBKA 2JKAA 2PDMA 1YW1A 4JICA 4J7RA 4B9YA 3M64A 1RBOB 3GIYA 1J11A 1X39A 5JBDA 3N2OA 1FDZA 4JTQA 3M0XA 1XSIA 3PPCA 5D8WA 3SIZA 1K8CA 3CMJA 4GPNA 2TSYA 3EDDA 3KL5A 1CGWA 3IEBA 1XPYA 2X1UA 1KV8A 2WHLA 2OR2A 4F2TA 1L0PA 1RY8A 3LRMA 3H70A 3IVSA 4MADA 3O05A 3G1YA 5AC7A 4DLMA 1PKMA 5EL1A 1DWJM 3GHRA 3C2FA 1OC5A 2PWHA 5I3HA 1G0CA 5G2WA 1XSJA 2A3LA 3VZXA 4MY1A 1G94A 3BW4A 4ATLA 3VIJA 3W76A 4DXXA 4N42A 2VNCA 2PTWA 1W9VA 3JU2A 3KCJA 2CLFA 3NQ7A 3FVDA 3O3RA 1SVDA 4XIAA 2WBKA 5E0FA 2VXNA 3GNPA 1Q85A 5A5WA 5C2CA 3TLQA 4B5SA 1JFXA 3RPMA 5A2CA 2Z4GA 3THAA 1ZBKA 2EBNA 4WRHA 4JYDA 4EAYA 4L9XA 1OC6A 5CXPA 5HJLA 4K7YA 3TA9A 1NP0A 1TJ0A 1FDYA 2Y2WA 5EMYA 1IQ8A 4XTDA 3K1GA 2XFWA 3AHZA 3S83A 1E55A 1W0MA 3FSUA 1KXQA 4P7NA 2WKGA 2Z2UA 4E8CA 5EBUA 3M0JA 1EP2A 2OPJA 1KQYA 4PR4A 1U2YA 2G97A 3N2MA 2EGZA 3O6AA 4I5XA 2OG9A 4DN1A 1C8VA 2O0TA 2D22A 4DYJA 3BV7A 4IMDA 2BY0A 3TCSA 1FKXA 3WQCA 1UH2A 3R7MA 2O4QA 4HK5A 5CC5A 3TZNA 1I8JA 2C6QA 3AS0A 2RKXA 3DERA 4YTQA 3PFRA 1QUMA 1WXZA 4GUHA 3EWBX 3AYRA 1JYNA 1UD4A 1PDYA 4PMRA 2CXGA 2QGHA 5E70A 1VKFA 3Q58A 3NWRA 4EKJA 3N9KA 1E4IA 1Z7AA 2C1GA 1ZFJA 3T08A 4S3KA 1TPB1 2PC8A 1I2PA 4S3CA 2IPWA 3OZMA 4ZOCA 4Z1DA 2VMFA 3BLPX 2DP3A 3GSMA 3L2MA 1XKYA 1B31A 2YGYA 1EO5A 1LBLA 2G3FA 3E2RA 4MM1A 3TN6A 3WQ8A 3WH9A 2GLKA 3TU9A 2WKLA 3TEVA 3WSUA 1UA3A 3DKLA 3IGSA 2BVWA 3GUGA 4EPDC 3GDKA 1U1JA 5E9XA 4F3HA 5C71A 3P3BA 3PPFA 4PUDA 2V38A 4US5D 4LY8A 1GYNA 3TFCA 3KZSA 4JKMA 3A21A 1QW8A 3LERA 4UCGA 3ARWA 4W88A 1MXDA 4TOQA 2F38A 4LVBA 4JX5A 2J66A 3WLHA 4PCPA 1CTNA 3WK3A 4YHEA 3CUJA 1XBZA 3S2JA 4P7LA 3KL3A 2J7FA 4IPLA 3G3DA 3THUA 4FA3A 1A5AA 1JCLA 5T26A 1UR1A 4MZYA 4FX6M 5F4SA 3MYPA 1YEYA 3VM7A 2O7QA 4H8HA 4PMZA 4GYKA 3A3WA 2RDUA 2DZAA 5I24A 2PUZA 4DO6A 3BLOA 3MO7A 1LT7A 2D2OA 1QXLA 4H4IA 4NNBA 2P3EA 5IXEA 1ZBVA 4PCNA 3ARSA 1NP2A 2OCZA 3N6HA 3AICA 4ES4A 3IV8A 1L8PA 3UXLA 1BVNP 4PUKA 1VRXA 2Q8XA 5AVHA 1GNXA 3WL1A 5CBJA 1Q45A 2PD9A 3PF3A 1EKOA 2WCAA 3FFSA 2PWVA 2JALA 3WY1A 4HIBA 1XGEA 2Z26A 3WNMA 5FEWA 1PO9A 4OBRA 4IGHA 2IKHA 4B4HA 2A3AA 3LV6A 4ROQA 4C7GA 3RHGA 3MVTA 3D3FA 3VIGA 3N11A 1GOKA 2CESA 1HVQA 5XIMA 1JZ3A 2WW5A 2QKFA 4MJ2A 3KOYA 1W1A1 5H8MA 1HO1A 1E0TA 2TODA 1BKHA 1H7XA 1N8WA 1R30A 3KEHA 4UQDA 3RAOA 3IIOA 3A5FA 1ZPTA 3TE9A 3VM5A 3BK0A 4GC3A 2I1OA 4O52A 5D2XA 3OOQA 3RGTA 4EE9A 2CZFA 3NL3A 4JFWA 3CV6A 4I7VA 2PDPA 2OKTA 3QXBA 3NZRA 1I1XA 1NM9A 2WJZA 4N4QA 3AFBA 3H55A 2H9AA 5DMLA 2FHFA 2J25A 5TIMA 2NWRA 4EPEC 3LCLA 1MO0A 3WEZA 1OF8A 4ZQOA 3H7UA 4JTKA 1C8QA 4LXFA 1X7FA 1G01A 2HCVA 2QIIA 3H26A 1GVIA 2YDQA 2V9DA 4MJMA 3VNJA 3KVLA 3FDGA 1ME8A 4YLWA 2PB1A 1FCQA 1AL8A 3D5HA 1TELA 5DXYA 1C8XA 4S3BA 4O1FA 4CD5A 1F73A 2PI6A 3JRKA 3IJ7A 4QJ1A 2A3BA 1VYRA 5FF2A 4HNCA 2V5LA 3OEXA 5LA2A 4DRSA 1JUBA 3LNPA 4GISA 2F7FA 2QCLA 4NF7A 3GXIA 3W26A 3S4TA 3EOLA 3QR3A 1AZ1A 2A5HA 4K38A 3W2KA 2PU0A 2PMQA 2I5IA 1RVGA 1KB3A 3VGEA 2GWNA 2PDJA 3CC1A 4J1OA 1Z48A 4QLKA 4G2DA 1QPOA 1UQZA 4ML9A 1DXFA 2D3LA 4JTAA 2QDGA 2VZOA 1T5AA 1KFBA 1RA5A 4YPJA 1H11A 2ZA1A 1UD6A 5A6SA 3ARTA 3VK5A 3MWAA 3EX2A 4GJIA 4RL3A 2J8TA 4LV4A 1MZRA 1SFSA 1YXDA 4TV5A 2PWFA 2VX5A 5BXTA 2OO6A 1JR1A 3ARYA 3FEMA 3CASA 1QOQA 3VILA 3RPTA 5TBOA 4LUTB 1X96A 3JUGA 1J4EA 1N55A 1BSIA 5MKGB 4IISA 2PTZA 3HA1A 2JEQA 1JNDA 4XG1A 3TYCA 1HL8A 3FJ6A 1XDJA 4XZHA 1CX9A 5DMYA 2XN1A 3U0HA 3H2FA 4EX4A 3N14A 4KERA 5AYZA 4HMEA 3TSMA 4H01A 1W3KA 4NP7A 3TJXA 3LTPA 3LCIA 2PDIA 3GH4A 3JZEA 4MKSA 1VB9A 2QV4A 1TRDA 2XYLA 3G24A 4NAFB 3MZ2A 4YTUA 4ADTA 1WZAA 1F3XA 2O4MA 3FYYA 3S2NA 4O16A 4AYSA 1TVPA 3ZT5A 3TKFA 4O8AA 4L6OA 4C91A 3DCPA 3N13A 1V08A 4EF9A 5HMSA 4OFCA 1W5QA 2O7SA 3AISA 4YHGA 2V3GA 4QROA 1VPYA 5E5CA 4DJEA 4LVFA 3W1QA 4XKYA 1EH9A 3EDJA 3GHTA 4JNZA 3RITA 3SQLA 3B9NA 2ZXAA 4RX0A 3ZJ7A 4DX3A 3W75A 3U6WA 3STCA 1TB3A 2WSQA 3RNDA 1CB7B 1QPKA 3FYOA 3B3DA 4L80A 3USZA 1E73M 1VBGA 1NDYA 3BSHA 1S5NA 1VCGA 3SUVA 4S3AA 4F40A 5A6AA 2JFEX 4JTTA 1OX4A 4IHCA 3ENLA 3RO6A 2FH6A 3RX3A 2YSWA 2XINA 2Z2BA 3DC8A 9XIMA 2HXUA 2RGLA 1K7XA 3CIWA 3K1DA 2J7BA 4TU1A 1TTIA 3MHGA 3TYUA 5FOOA 3L4TA 5M2FX 3RFAA 4Q8NA 1F07A 4P5UA 3ES8A 3ELFA 1Q6DA 1VBRA 1AJ0A 3BGAA 2NX1A 3O6YX 3OGSA 1KTCA 5A6BA 2Y88A 3W7RA 1DV7A 3RMEA 5KZMA 2HISA 3O1NA 2Y0FA 3W7JA 3NEHA 3S1WA 1MUCA 3NSMA 2OTDA 3CZ8A 4AZ7A 2FKPA 3GTIA 4Z1BA 4AZIA 4CNTA 2J9ZA 2YB4A 3LY0A 1R3WA 3SI9A 4MOZA 5DCDA 1BXCA 2VDHA 4GKTA 2F84A 5BWAA 1B3XA 3UG4A 1A0EA 1S5WA 2WM1A 4E2BA 4ZR8A 4NZ3A 1GTEA 4UQCA 2V82A 3R5EA 4L4PA 2GDVA 1V51A 3BAKA 2E67A 2Z7KA 4DELA 8CGTA 5B80A 1WBJA 4GY1A 2V0TA 4EANA 1TREA 3B06A 5FIPA 3B40A 2PPGA 2XSAA 4QISA 3RR1A 4CEXC 2E6FA 1LP6A 5J8LA 4A35A 4OECA 4QEEA 4ORIA 2DSUA 3ISIX 4YTTA 3LBOA 4YYFA 3S6DA 3NDYA 3CHEA 3HZ3A 1E51A 4LCSA 1XUUA 3RJYA 1CI1A 2FFCA 5FJOA 3A4AA 2VL4A 5RUBA 2PGWA 3QV6A 3LSCA 2WC4A 2A3EA 4RDZA 3ANUA 1WZKA 2GVEA 3D0CA 5EBAA 1DYSA 3MUXA 5D33A 3OLEA 4B5NA 1ONWA 3E9AA 5JBFA 3NXLA 2JBMA 4IGSA 4NILA 1BFNA 2VQTA 4DHGA 3SGZA 3G1VA 1M3UA 3GYCA 2HE5A 4UOZA 3BJFA 4I8YA 3F5KA 3A64A 3PPHA 3G5EA 1QDSA 2AKMA 3KP1A 4QTGA 1YXYA 1O1HA 2CNCA 7TIMA 1XYBA 4O57A 2HNEA 4MNKA 2GDUA 4CQBA 2ZZ5A 2Q01A 2OEMA 3HQNA 3U5UA 2DSKA 1VHNA 1TPWA 1JRCA 3YPIA 2R1LA 1YPIA 4B92A 4LCQA 3WZ0E 1SYTA 1HG3A 1B3ZA 1G4SA 1UG6A 3M4HA 4QEHA 1V0NA 1XKJA 2WCGA 3HG5A 2OT1A 4HMDA 2V5DA 3UPWA 2V2CA 2VEIA 4H8NA 4ZQCA 1OZMA 2Z1VA 4FOJA 1P6WA 5A69A 2ZICA 4JFSA 1QK0A 3MSDA 2JK2A 3PZNA 1J93A 3GTHA 3GHUA 4TVUA 2QVHA 2XIIA 1NF0A 4JTIA 4S39A 4BY3A 5A1AA 4R9OA 2G37A 3UZYA 3ORWA 2PWEA 2Z29A 3E02A 3MYOA 1AUSL 4UZUA 2YFOA 4BEUA 4S23A 4UUIA 3LUTA 1JPIA 4YTSA 5I3KA 1WDWA 4L9YA 3LA4A 1DJGA 2NV9A 3F2CA 1JD7A 1QWGA 2OWWA 4PRTA 2CLPA 4LJ3A 3ABZA 4ZENA 4W7WA 1OIFA 2FB2A 1EOMA 5KZDA 1H7RA 3WLNA 1C7TA 2NQHA 1WB0A 3CU2A 1VFHA 4ZB5A 3DZ1A 3CZJA 1ADDA 4GUFA 3VGBA 1A3XA 4OJYA 3C86A 3P6LA 1VCFA 4ZMGA 1LUCA 3ZQ9A 5EFFA 4QQUA 1DHPA 1EPVA 4HHHA 1R8LA 4R33A 7CGTA 4DPPA 3AS3A 3QGAC 1ZUAX 2Q6ZA 2YDSA 3AI0A 4MF4A 4XUGA 2VWSA 4GFIA 4IPJA 3F4NA 1ZAJA 4J3UA 4KMQA 2QAFA 4N6EA 5KZ6A 1UD8A 4L4LA 1ZJIA 4FR6A 1UASA 1KLYA 2OYMA 1DJWA 1FCUA 3UESA 1ENUA 3KLKA 3MHFA 4GWEA 3M0IA 4M7TA 4JX4A 4XQ6A 3P0WA 3MCMA 4ZVJA 3CHDA 2YB1A 5B7YA 2ZDRA 4DJEC 4EWJA 4ICCX 3AMDA 3UJ2A 2F6UA 4A05A 3UYIA 5AOUA 4PEEA 4UOJA 1OM0A 1XLIA 3KTSA 4LUSB 1TWDA 3VXGA 1U1HA 4ALDA 2P76A 3A12A 3WF2A 4Q7BA 1UZ1A 3T05A 3FJLA 1R7AA 4UFJA 3M0KA 3P84A 1I45A 1XP3A 1V3IA 5LNVA 2QNEA 4F0MA 1C92A 1GQLA 1EJRC 3NEVA 1S5MA 2I7GA 3H4XA 2C91A 1EZ2A 1TPC1 2QJJA 4DF2A 3P62A 2YZRA 1KFCA 1P6CA 2ZXDA 4D9PA 1MQQA 4QSHA 2Q8ZA 3AOFA 3VA8A 1M68A 3L4YA 3OO2A 5CKSA 4DUOA 1J18A 4UTJA 4WGHA 4QG9A 3HN3A 3TW7A 3BARA 2ZOXA 3HQ1A 4N2YA 2CPUA 3UJSA 3C3NA 3IIVA 3NQ8A 4Z17A 2C15A 1V3HA 1TVNA 4RCXA 2BHYA 4ZB0A 1E72M 1I2RA 1W9DM 2X2GA 1UWIA 3SADA 5LNSA 2BV9A 2OWCA 3QJAA 1CXHA 1H7OA 3TSBA 2ACUA 1ICPA 3RG6A 2Q8LA 3JR2A 1XR2A 5HQEA 3MUAA 1OFRA 4D8LA 1LROA 5FEPA 1SMAA 1PIGA 1K70A 2QDDA 1MW1A 4S1FA 2G3JA 1E1FA 4EK7A 4K1GA 1AH0A 2H3BA 4PN2A 4OOUA 3FGCA 1XYCA 5I06A 5IM51 1SQ7A 3UCCA 1O1ZA 3UZJA 5A8MA 1ZALA 1FH8A 1FH7A 2GJRA 1RV8A 2Z1KA 1HFBA 4JHMA 4C6MA 3LX9A 3A13A 3VABA 3BG3A 3VFCA 1OJXA 2F8QA 1NQ6A 4NZ4A 4AXNA 3BOXA 2NV1A 4RNJA 1UKSA 4B3ZA 1B1YA 3INPA 5HMEA 4WCJA 3SN0A 3PZIA 3KZPA 3QY6A 4NKCA 3TYZA 4A6GA 2ZC1A 4FOKA 4L64A 2V3EA 4IJRA 1K7FA 1JYVA 5M5DA 1KBBA 2OLSA 5EMJA 4IP5A 3HF3A 1TA3B 1OK4A 3HPSA 4UFMA 2NLIA 1R2TA 1V02E 2DZVA 1SR0A 3L66A 1A0DA 2R91A 2WAGA 3EKGA 1KGWA 1QNPA 1YPXA 5E9AA 3TNBA 2VC7A 1ZY9A 4KPLA 4QIUA 2FMNA 3NZ1A 2XDFA 2BY1A 3K46A 4O14A 1TWIA 3I65A 3M0VA 3PZOA 1FVPA 1H5YA 1P0EA 4RR4A 4DZIA 3TH6A 5GNXA 1KWGA 3FN9A 3G1HA 1A3HA 4IPNB 2QULA 2QCEA 2OJPA 2HZGA 1FHDA 2JE8A 2Z25A 2GL5A 3H6OA 3M7WA 1AW2A 3EB4A 3N2XA 4A2RA 5AC6A 4PB3A 4C6QA 3ZS4A 1JDEA 4RV8A 5A6MA 4C60A 1WUEA 1P0DA 1Q6RA 2IPJA 4PB5A 1YQ2A 2VUNA 4AIBA 4PMYA 3V18A 1RJQA 8TIMA 2OYLA 2CKRA 1TTJA 1L9WA 4O0QA 1ZBWA 4P7RA 4Q4QA 3MSYA 1J0IA 1M01A 4HN8A 5A95A 4DEFA 2OYKA 4B90A 2NVDA 4XIMA 1OX5A 2YFNA 3I3DA 5A6TC 3G8RA 4TMCA 1WKFA 3NO3A 1V7AA 5A8GA 3QKZA 3QYQA 5D2WA 1FWBC 1C3FA 3MDUA 1J9YA 1QHZA 3DGRA 3I7RA 2KZHA 3VO0A 2AOSA 3GRIA 2RHGA 2RGMA 1LYXA 2E9BA 4AIUA 1ML1A 4YYCA 1M7PA 4NX5A 3H24A 4IXHA 2GUUA 2VFIA 1EDGA 1JXKA 2Z28A 3URBA 3ZR6A 3CAVA 4CCCA 3QZEA 2BFGA 4C6PA 3WEOA 3WDIA 1OB0A 4MFDA 3TMQA 4CQ9A 4C6DA 1OYBA 4M1BA 2C1IA 1QNVA 3UG3A 1J96A 4LY4A 2E5BA 1KBKA 4FAMA 3S3GA 2QF7A 1J0KA 3LM7A 4J3XA 2IKIA 3ZO9A 1QCWA 1RVKA 1W1B1 4MUZA 3APGA 3W6MA 1F8MA 4XX6A 4AVFA 5REQB 4M51A 1EFZA 1WZMA 4KW2A 4E8DA 3POHA 4MNLA 1H5VA 2QR6A 1OG0A 5ECUA 3OGRA 3PAOA 5DMMA 4ZXOA 2J8FA 4OQVA 3F5JA 4ZZ9A 2OLHA 4H1ZA 1JRBA 2W5FA 4HQVA 3MMWA 5C2XA 2GGJA 4H9TA 1MW3A 1E6ZA 1EZWA 1S1PA 4BHYA 1GEHA 1B5TA 2NXHA 2VURA 4CNNA 1Q6GA 2PC4A 4LYKA 1OZQA 3BW2A 4Q4KA 5EU9A 2GOUA 1VJSA 1TTPA 4I5UA 3I68A 1VS1A 3W2NA 1S2UA 3DBNA 5DQPA 1XYAA 3H4WA 2R1KA 4PA8A 3T44A 3ITXA 3SRKA 1ZJBA 3LRLA 3ABRA 3IJDA 2QCDA 3WUBA 1P1XA 3KXQA 1KM4A 1YHTA 3KM8A 4N9BA 3KLLA 3EOSA 3HGRA 3FX4A 2DSVA 3VINA 1UR0A 2XVGA 4HCLA 3UZZA 4JL1A 1KFWA 1GJUA 1AH3A 3VUSA 3MWCA 3R2GA 4IMCA 3GX9A 5CAHA 1L2UA 2H3DA 1F3TA 3P7YA 4BS0A 2ZCGA 1DJQA 3NQ6A 4LUIA 2DT1A 2X1TA 2PTXA 3ZWTA 3ID7A 2A7RA 3KRUA 3U7BA 3ZOAA 1J5SA 4IXXA 1XIDA 3IGXA 2PDLA 3A4JA 2I9UA 1FHVA 5LIWX 1NWSA 1YE4A 1P0KA 4K2SA 2IKGA 1R0MA 1MRAA 3WQ5A 4G9PA 1W9UA 1LLZA 5HJYA 4NQ1A 4GI9A 5HBFA 3LLXA 3EOUA 1PYFA 2QAPA 3WD0A 4M82A 3EX3A 4MMWA 3TW6A 2ZVIA 1QOXA 2WMGA 2DVTA 4JQ3A 7PTDA 4C6OA 3RUBL 1YE6A 3V75A 1XQKA 1KCLA 1JDDA 1NQKA 3OLIA 4KCUA 4ZL1A 3G1DA 2JKEA 3HG3A 4KWSA 3E3HA 4UMBA 2QJGA 1Z42A 3O8AA 3QMTA 1QU4A 5CJMA 1KCKA 1KCZA 5J04A 1V5XA 5M03A 1OF6A 3ZMRA 1KD0A 1FXQA 3L4XA 1GTHA 3IGHX 5XIAA 2CLKA 3T40A 1G7VA 2BGSA 1O12A 1JIBA 1IIGA 1QW7A 3NNTA 1XJBA 1XX1A 2O9OA 4D6EA 2VDGA 1H41A 3HB9A 5T91A 1B90A 3MJMA 5C7HA 1FWCC 2WVVB 1LTDA 2Z7GA 3GH7A 3VNIA 1UUMA 1I9CB 5I77A 1HO4A 3S47A 1HF6A 3N6QA 4K36A 3CZGA 3PS7A 4XK2A 3TR9A 2F9RA 5DFAA 2NUYA 3B8WA 4HCHA 5CZTA 3CBWA 3DOPA 4MDPA 2E1DA 4GD0A 4AFYA 1UC4A 1EJTC 1XGDA 4U3AA 4ACZB 1EC7A 1E6QM 4Q33A 3AYVA 3E0WA 2RJHA 4CUCA 1SZNA 3TYEA 1R85A 1P4CA 2J88A 5HWNA 3M0MA 3VNDA 1V0KA 4ZE4A 3AHYA 3SSZA 1RP8A 2F2HA 1VLWA 3RCNA 5D02A 5C5YA 4PMNA 3E12A 1K8YA 3LBMA 4JGDA 4QAWA 4X2PA 1VEOA 5HR6A 3F4CA 3SIMA 3QLLA 2PE4A 3L21A 3QKEA 3CS2A 4KS0A 2AL2B 2WMIB 1BF2A 2Y8UA 3LTSA 3IRSA 3CZEA 1D9EA 3WBAA 2PRMA 5BU6A 2PODA 4EWND 2INFA 2WCSA 3QQ0A 1WDSA 3GXMA 3AMCA 3GIPA 1H61A 3EEZA 1TIWA 1OFOA 1BSLA 3VDHA 5CJ5A 3BVJA 2E40A 4WHBA 1MQRA 2H6RA 5IOBA 2QXWA 3RPDA 4AZ6A 1VBUA 1DIKA 4UFKA 3GNOA 4LB4A 2FTPA 3KFTA 4UZSA 2WLZA 1RK5A 4LSBA 4OV9A 1EJXC 3KP0A 2Z6JA 3W1AA 1KKOA 2GUYA 3NO1A 1VQTA 4H9YA 1NTHA 2CZVA 4V15A 4J28A 2P8BA 2UBPC 4AIEA 2WM0A 3M0ZA 2Y7FA 2G95A 1C29A 3T4WA 3NPVA 1S2AA 1Q63A 3K13A 4LRSA 2D2GA 2XSBA 4KCTA 5BXPA 1GPWA 4IFKB 1HGYA 2FGBA 3AXKA 3DYMA 1PIFA 1EP1A 4IFOA 5LIYX 5K9DA 1XRTA 1XFBA 1YDYA 2BASA 4URIA 3RCMA 2GJNA 5C9ZA 3R0KA 4XISA 1FWWA 2ZX6A 1FCVA 3PNUA 1AG1O 1F5ZA 4CD8A 5DRIA 4BQ2A 4LX4A 1RK6A 3LCXA 3TFXA 8RUCA 1W3LA 3ONCA 4Y8EA 2VX7A 5CZ0A 4EACA 4LAZA 1QPQA 4LRTA 1CT5A 3E49A 1B30A 5E0KA 2QUNA 4RKAA 3HURA 4B4FA 1HL9A 1POKA 1PPIA 3SUWA 4F0RA 1WE5A 1QMLA 2A0NA 2J9YA 5FF0A 1ZB5A 4C1NB 5FD0A 1P7TA 2X0HA 3PG8A 4HZ8A 1XIBA 2J7GA 3HPXA 5AC4A 4DJFA 1ZJAA 1E6RA 1Q6QA 1M7XA 1X1OA 1IIHA 2Y70A 1SPQA 1TVLA 2YXGA 2EQDA 3GXPA 1J0ZA 1DL3A 4GGBA 5LA1A 1ZRQA 2VUYA 3VKAA 2YA0A 3MBDA 2BOGX 5LIKX 3W7GA 5C9XA 4RZ6A 1L6SA 3P0XA 5C70A 5E1QA 4W93A 3ZJ8A 2XSXA 1WDPA 3GXDA 3PP7A 3CAWA 5D09A 2XVPA 2QHAA 2QCFA 1LG1A 4UMAA 5J5DA 4PMVA 5HK4A 5FACA 4DVOA 3NOEA 2CEQA 4O10A 4MYXA 3HPAA 1GW1A 1UWSA 4L4MA 3OVQA 5AKQA 3OBAA 2VC9A 4G8TA 4F9JA 4WDWA 1VFTA 5GJPA 3W7PA 3CUZA 3LZ3A 1O5XA 4PUMA 4A3QA 1H0IA 4GI4A 3SJ3A 1RLDA 4W87A 2CHRA 3WF0A 1NY1A 4PULA 3TVAA 3ARUA 5DY3A 2Y1HA 3OIXA 3B9DA 2FJKA 2B31A 2V5BA 3IK4A 3W2MA 5C0QA 4S3JA 1H51A 3UP8A 4MB3A 1V03A 3W7OA 4KGJA 3UD6A 4ZTXA 2VCAA 1KA9F 3S9ZA 5ABFB 4O1BA 4O19A 4Y8FA 4LWWA 1TPFA 3BURA 2Q3OA 3V5OA 2WWDA 4AC1X 1Z89A 3N18A 2FIQA 5G4WA 3TNOA 4CCZA 1ALDA 5AYBA 2CBVA 1W3TA 1IYXA 2R6OA 1W5MA 4MNJA 1XICA 3PUDA 3CB3A 3VMOA 4EIVA 1SMDA 4PYSA 3WMLA 3S1UA 3S1XA 3WKZA 4RUBA 2EHHA 3URQA 1R3VA 2JGQA 3PVFA 1KR0A 1WOBA 3AZTA 1IXNA 3LCHA 3CWOX 3EPNA 4GGHA 2HJPA 3KBVA 3W7QA 2GFTA 4WY0A 4XZBA 3V0UA 1TIMA 1Q8AA 4GUGA 4S3EA 3L2IA 3NL5A 4DNMA 3MA8A 1GUVA 1NSJA 4G7EA 4NRRA 1MEIA 1DQWA 1EF2A 1XLJA 4Q4RA 1X38A 1UH3A 3WJYA 2R1MA 4Z2HA 3NQVA 4XBSA 3NIYA 3MJYA 3VGHA 4JNYA 3WF4A 2PLKA 3CV2A 4BWLA 4IIFA 3LMZA 2HVMA 2VZSA 1XYMA 2WMJA 4FNUA 2VELA 2F6KA 3OG2A 3NSXA 2QDEA 1VPQA 1JVNA 2CLLA 4DJED 2C18A 1SJBA 3PBMA 3LK6A 2QEZA 4LV9A 3DFHA 5G4EA 2P88A 1BPLB 1FWNA 2I17A 4O0KA 1DWAM 4FNPA 4G1KA 3B8VA 4IG2A 1XBVA 1FRBA 4Y96A 3PB0A 3C4UA 4X0VA 1JZ6A 2FVMA 4RE0A 2PWGA 3GWQA 3TR2A 3CV7A 5DELA 1O95A 3BH4A 2E0PA 3ZJKA 4IZGA 4UIOA 1LCOA 4F48A 3GFYA 3QC3A 1RD6A 2FZBA 3O63A 3PY2A 3Q65A 2VX6A 2ZZ6A 1YKWA 3C61A 1E9IA 1T7LA 4ZGYA 3S2MA 2RUSA 3FS2A 2EG8A 2W61A 2WZEA 2UY3A 2QMKA 4AG0A 2BXYA 3AALA 1R86A 4N9EA 3TA6A 1JCJA 3WFAA 1C90A 3LGGA 3W6LA 1E71M 3T0AA 3M07A 1UZDA 3KHDA 3PZMA 1QNOA 1V4YA 1J0YA 2QCNA 5D9MA 4DZAA 3QPZA 3LENA 3GNXA 3BOLA 1YTEA 4QGCA 1D2KA 1W5NA 1XIIA 5A6BD 1XV8A 1SO4A 1SW0A 2VWTA 1F2JA 3W81A 3QY8A 4IGNA 5TQLA 3UCDA 5BOOA 5MF5A 2FZ9A 3T0DA 4W9TA 1HQTA 2GOKA 1G9HA 3B4UA 4MWAE 2PRHA 3I10A 3F2BA 3AZRA 2D3NA 2OQHA 3RU8X 3VDAA 1OABA 3MI3A 4GYFA 1MW0A 4YJ5A 2J13A 4KRUA 3K8LA 5IRPA 2E77A 3E2VA 3VKKA 1AODA 3LHZA 1CWYA 4O1CA 3MDWA 3M0LA 5C9UA 2B81A 3CMFA 3DXIA 4RXGA 3UVAA 4O50A 1IEIA 1WXJA 4E38A 1RALA 2YLAA 5LSMA 1RH9A 3NQCA 2Y61A 2A79A 5I23A 5DLCA 3B9AA 2HK1A 2G3NA 3GIQA 3TK7A 2ON3A 4C6EA 4H9ZA 1R3RA 1YYAA 5ABTA 1JYWA 3TTEA 1XLKA 5CSRA 1O60A 3SQMA 4Z2JA 2I14A 3G0XA 4PUJA 3RU6A 4CN6A 1YLVA 4AZGA 4WZHA 1K8XA 1AZ2A 1TQXA 3PJTA 1W91A 2ZX9A 4E6MA 4A3UA 4F0HA 2WC3A 4K3ZA 4DJFC 4PMUA 1H60A 4DM2A 4OZOA 3ZVIA 1UKQA 4Z0SA 4GOAA 3GG0A 1M5WA 1UBPC 1RPKA 1M7OA 3I6TA 3AIVA 3SJNA 3WBEA 4JIPA 1S2WA 1CENA 2BHZA 2G3MA 1TV7A 4RXFA 5FEZA 4K6AA 3PUOA 2CLMA 4OV4A 4C6CA 4GBUA 4MJZA 3F4VA 4C6FA 4RK8A 2VGBA 4CD6A 5EY5A 2CZDA 4MZ8A 1XRVA 1DWIM 1PCKA 4PRRA 3ITLA 1R46A 2XH2A 4NUWA 4F2BA 1ITXA 3T1GA 1W9BM 1KM3A 1KC7A 4REQA 5A8QA 4CU8A 3WLSA 4AZHA 2J77A 2WZIA 3W01A 5EGRA 3OPSA 4MJ4A 1NFPA 3UU0A 1XWYA 3G0SA 2V30A 4ZO7A 3QN3A 1V02A 4FF5A 1YADA 1N8IA 3DFQA 4UTMA 4Z2LA 3N4EA 2RDTA 3TX9A 1DIOA 4BI5A 4YS1A 2Y5JA 2XG9A 4JY9A 3WD4A 1UKTA 3REQA 4HNOA 2REQA 1TR9A 4Q8UA 1UR4A 3STEA 3SQSA 1LDCA 3APTA 4HPJA 1Q6EA 3G22A 4RDWA 1KBIA 1UMYA 2W3ZA 3BUVA 1KFEA 2ZXQA 1C9WA 1GVQA 1W8SA 4X22A 4PL1A 2WZHA 3DG6A 3TN4A 3UWZA 2WVUA 2ZUVA 1W56A 3EWYA 4R88A 1UWAA 1Y5WA 5LNWA 1L6WA 1BWVA 5I3FA 3NVDA 3NCOA 3LN3A 1R7OA 4Z1CA 4LGXA 1MNSA 4R34A 2VGIA 2XIJA 2PEVA 1AVAA 4FS9A 1UIPA 4AUBA 2QVNA 1VIZA 2VQUA 1F7BA 4DO7A 3W72A 5CZJA 3KDNA 3TYDA 3SCRA 1VBHA 1JUEA 3M5VA 4AXKA 1VD6A 3GAYA 3SM0A 4KRTA 2BWGA 1GZGA 5U7SA 4AZ5A 3I6EA 4Q4MA 4JTSA 1CB2A 1CGXA 3P8IA 4BWLC 5A94A 4HYRA 3LM3A 1A5UA 1JDAA 3RJXA 5KEZA 1WAUA 5EMKA 3WENA 3PBGA 1FKWA 1A80A 4BQ3A 3FK4A 4WY0F 1VFUA 3SO7A 1I0DA 3U48A 2ONEA 5G5IA 2W63A 4BZYA 1XLDA 4GNJA 3NGFA 3W73A 2OODA 3ITVA 1W54A 3NGJA 2CBUA 1WKDA 2YKKA 3BE7A 1NELA 4H04A 1CBGA 3BANA 3VGFA 2R82A 1OCQA 3FIGA 1US3A 3L0GA 3KVKA 1RSCA 4QHRA 1J2WA 1SZRA 3CTTA 4NAEA 1WXYA 4RPPA 2W4XA 1PXGA 3SCUA 2QQ6A 3U2CA 4FX7A 4INFA 1VENA 2E3ZA 3ITCA 4JTJA 2XM1A 1E4MM 2HK0A 3E5PA 3DN5A 3LV5A 1THFD 3N4FA 4QE1A 4UTTA 1WZLA 4DBEA 3TN5A 2VZVA 3RRAA 1DJYA 3WDHA 1OT2A 2ZIDA 4YTRA 3EA1A 3NL6A 4QDWA 1CZ1A 1BG9A 2V67A 3W23A 3KBMA 2X09A 4KF1A 3NQAA 4I9MA 4TV6A 4QX4A 3HG4A 1XHGA 3R8RA 3MP5A 1DOSA 1XRFA 1PYMA 3IUIA 2DIEA 3TROA 3S5OA 5E6ZA 1TX0A 2XTKA 4H6RA 4PCFA 1QBBA 5CGTA 3W2LA 3PB2A 2QYGA 5CPNA 5H91A 3P61A 1ZJHA 4QS5A 2WVTA 2HS8A 1JYXA 1TPVA 1G7UA 2R8WA 2V6AA 4L7ZA 4DXVA 2OB3A 3B0VC 2DZUA 4HT3A 2YDAA 4BK9A 5TD4A 2ZRXA 3WH6A 3GVQA 1RQEA 3TTSA 3UEQA 5AZ1A 3R10A 4PMJA 4NI3A 2JQXA 1V77A 3MVIA 3SGUA 3O0FA 3MUZ1 1CLXA 2XH4A 1XIEA 1UPMB 1FHUA 2XIBA 1IR1A 3KOWA 3TXVA 1MWOA 4IQEA 5AYYA 6XIMA 4C6BA 2MUCA 2XU2A 1ELSA 1PX8A 3B04A 4IM4A 4CQDA 3FEQA 4YNGA 1LOQA 4QFUA 3FYPA 1JL8A 1VEPA 3A6OA 4AF0B 1LORA 1IZCA 3QFWA 4C1LA 4MY9A 1FH9A 1B54A 3ABXA 1FWHC 3APYA 4XO7A 3VD9A 4HYWA 5FKYA 1W1YA 3TOPA 4HVXA 1AK5A 4XWUA 2GGGA 1QI2A 2SFPA 4ZO6A 3B8IA 1Q6LA 3IUHA 3W7KA 3HGJA 2P5NA 4NG3A 4W4QA 2QT3A 1EWDA 2POZA 1US2A 1WDRA 2PDXA 1EX5A 1D3CA 4LS0A 4L61A 4B2DA 4TVCA 3IACA 4BQ5A 5AHEA 1CPUA 1GOIA 1WPCA 3VKDA 1LRQA 5IFTA 1GK8A 5GJNA 4AY1A 3O06A 5D37A 3T6CA 3GO2A 3IAQA 1N8FA 5LA0A 3FA4A 1SJDA 1PUDA 2WQDA 4XB3A 1EJVC 3W28A 4S2BA 2DZXA 3N2BA 1PKLA 3H2NA 1AH4A 3N25A 1SUXA 1HKIA 4DWSA 1Q6OA 1XCFA 1ZQ5A 5HA7A 3M9YA 2J8GA 1TJ2A 3VFLA 4Y90A 4IX2A 2YCLB 1WAWA 3UWUA 1HGWA 4XKMA 1FWAC 3MP4A 4NZ5A 1UOZA 4QR6A 3RCYA 3TN3A 4L4OA 4R7JA 1EF3A 4HP5A 2DT2A 4ZFCA 3UR5A 5DT5A 4JYFA 4Q8VA 4AHQA 4PUNA 4GH3A 4QM1A 3W24A 3OHIA 4AB4A 3KBWA 2ZUWA 3HQPA 4D6GA 1OG6A 1K02A 1F74A 3SRDA 3ZR4A 1RAKA 5LIUX 1ME9A 3T7VA 1XLBA 2VRJA 3T0TA 4ERIA 2AGKA 4AX6A 1ONRA 1SU5A 4JQ4A 4HPHA 3S2CA 1V3JA 4Y9NA 2EPMX 2G8ZA 3VAVA 4C7FA 3GYEA 3C52A 3P82A 4DI8A 4IIGA 4YWSA 2WSKA 4L65A 3MB9A 3TQPA 1TFVA 5F2LA 1FTXA 1GVOA 3TV8A 3HV8A 3WBXA 3JZUA 2WMHA 4KWWA 3PUGA 1IWBA 3QSTA 1GKPA 5K2ZA 4TX6A 1Q66A 3NM1A 3VX0A 1KW1A 2XZ9A 3BMXA 4HNTA 4CN1A 5A2AA 4CD4A 2QIWA 3TC3A 1QATA 2V2HA 3QHMA 1D7KA 3SN1A 4U33A 2ZVRA 2OX4A 1QASA 4IIDA 1QO2A 1SW3A 6CGTA 4PTNA 3NUKA 3W71A 3UPBA 4WDTA 2NXIA 3AXHA 3DFSA 4FR1A 1XLEA 5H2ZA 4LT9A 1M04A 1POJA 1R2SA 1LQAA 4HZ7A 1NWTA 3UZ5A 1IV8A 3KX6A 1E6NA 3GG1A 4D6DA 2QV5A 3CWNA 1J6OA 2PDGA 4WKHA 1A5MC 3BJSA 3AXIA 4Q4SA 2VKZG 3WMCA 4Q32A 4FK9A 1XISA 1BGGA 4AY7A 2G50A 2WNQA 7REQA 1H50A 2Y6ZA 3DHDA 4AD2A 1HJVA 4IIHA 3FV9A 1E5NA 4JYEA 4NJHA 4M24A 3RM9A 4NVTA 2P8CA 1XLCA 2WK2A 2RDXA 1WO2A 3EWZA 1NOUA 3VC5A 3NG3A 3VYLA 3G2GA 4MLRA 4X3ZA 4LNCA 4TO8A 3WELA 4H00A 3CPGA 2C13A 1IT8A 3CH9A 3HMCA 1K9EA 4D6IA 1BGAA 3LQGA 4RPQA 5CEWA 1PX4A 4EP8C 1YNPA 4YVPA 4FIRA 1VPXA 5BMXA 3ARVA 3WNNA 1QK2A 1DJZA 1H2JA 1S3HA 1BQCA 3LHYA 2PDQA 4ZQMA 4C6KA 1G5AA 4HA1A 3W02A 2WO5A 4JTRA 4K7VA 4PSPA 3CYVA 5AHFA 2JEPA 2MNRA 3PBYA 4Q8QA 5G1MA 5FF4A 1W1VA 2A2IA 3L4ZA 4JN6A 2P3ZA 4J5NA 2DV0A 1CEOA 5BCAA 4IMFA 2CU0A 1XPGA 5CC7A 7XIMA 3SUUA 3TQKA 2VFGA 4UQAA 3W7DA 1W9XA 4JOMA 1PHWA 3UNDA 2WNZA 4HHLA 3SCNA 1UROA 2W62A 4E3VA 3EWCA 4NXSA 3M0YA 4DZHA 4LH8A 3R25A 4FXRA 4PTVA 1UPPA 3R43A 2CYGA 4NYYA 4P2VA 3V1HA 3U2EA 4E2VA 2WMKA 3AMLA 4MKVA 3O9NA 3THCA 3KS5A 3WL0A 4FLSA 2WXDM 3T4CA 1J01A 3WJZA 4GKLA 3II1A 3IAPA 4F0LA 2BGNE 2XZ7A 4LS1A 2WQPA 4C65A 1MVYA 3MPGA 4RE3A 2Y63A 3M7SA 3GXNA 3N29A 1ISVA 4ZO8A 1HKMA 1OFDA 3GB6A 2Y85A 3MV11 2YCEA 3VDCA 2ZRWA 1C91A 4NYUA 4EF8A 4HNNA 4DY1A 1JZ5A 5CLTA 3ZZ1A 4IT1A 2Q09A 3C2YA 3PK7A 4AVOA 1Y5VA 3S46A 4Z42C 4AYGA 3HFTA 2BGQA 4R7OA 1PJ9A 3S5SA 1XCXA 2VTFA 3A4WA 3WD2A 1XDMA 3W7CA 4J2PA 4DWSC 1QHOA 2WSRA 1LJYA 4DBUA 2HBVA 4X9SA 3W22A 2XWDA 4FNRA 4J4KA 2UWFA 3I4EA 3TJ4A 4DYKA 2CWNA 4UOQA 3ZT6A 2PLCA 3V0SA 3QQ1A 3R79A 3STFA 2BODX 5I7GA 4NHVA 4N9CA 2WHKA 3VUPA 1WKYA 1B4KA 5MHBA 4XVEA 3D3AA 3FAWA 3H2AA 4AD5A 2DUZA 2H9AB 4W5ZA 4F66A 3MBFA 1Y0EA 3SRHA 1UD3A 1DJNA 3G18A 2NQJA 3QM3A 4H7VA 1K77A 3UFYA 4FNSA 3UW6A 2CCRA 2CLEA 3KRSA 3QZAA 4UC5A 5E6YA 1VGAA 3AZSA 3AQUA 3UG5A 3OYXA 1QNRA 2QJNA 5AC5A 1I75A 2Y5EA 4WOQA 3W1NA 4C90A 1EJSC 3ONBA 1TWSA 2VJXA 1OFPA 4CU7A 4S3DA 8XIMA 4BEQA 1ISXA 2X7VA 2Z24A 3SY5A 4UMCA 5E93A 4W85A 2DORA 3C0LA 3SRFA 4NJGA 1E9YB 2G5WA 2FZMA 3E0VA 4QNWA 4NX0A 3E0IA 4Y9MA 3E5BA 3EWWA 3I6RA 3OVGA 2QPXA 1JXJA 4GQ0A 1UMLA 1N82A 2P10A 4I90A 3EA3A 2FZ8A 2BXVA 2DPEA 3BTNA 3G6LA 1BAGA 1T8QA 4DQWA 3V5FA 3QVQA 1V6TA 2ZUNA 5CAKA 3QLDA 4LBUA 3PN8A 4GYJA 3WQOA 2PA6A 4ZTYA 4LAMA 2YBVA 3UXIA 1C8YA 1ITCA 1VFLA 4H7CA 2A7PA 1TMQA 4LANA 2D0FA 4W7UA 4C5YA 5AC8A 5BNKA 3KTXA 3CZKA 2FPTA 2INEA 1KM0A 3MKKA 4HSHA 1BRLA 3N9RA 2HROA 3KOFA 1VHCA 3G77A 5EFDA 3PSWA 4MWAA 1KM1A 3QZ6A 1J0HA 1UWTA 3B0YA 3BLIA 4NIRA 3DU0A 3AUJA 3AMGA 4DJFD 5HUPA 4EXAA 1O66A 1TCMA 4RNFA 9XIAA 2FH8A 1KFJA 3QHOA 1Q4NX 4GRSA 3ANYA 3RLUA 1WNOA 4GCXA 1MXGA 5DF0A 2OVLA 4F4RA 2XH0A 3O6DA 3AIRA 4PH6A 1V3LA 3UWQA 1WUFA 4Z0JA 2P0OA 3WMBA 3VDGA 1H1YA 1OWQA 3EMZA 5K4ZA 3T42A 2HXTA 2YIHA 1EJWC 1OGBA 4W5UA 3P93A 3WQDA 4I8DA 3CHVA 1DORA 2GVJA 5D2TA 5HR7A 3W29A 4H19A 5BMWA 3PC0A 2XN2A 3GDRA 1TV8A 1E15A 3RLHA 4AZCA 1FFQA 4KETA 4G7FA 1FWTA 3QEZA 1TJ1A 1RCOB 1KFLA 4WVXA 2V69A 4YMZA 4XKYB 3LCWA 1A49A 2IPFA 5D03A 1UCWA 1SSGA 4HU0A 1EBGA 4JFVA 4B9ZA 2YL5A 1A4LA 3IJIA 1XQLA 2OZTA 4GIEA 2I9EA 3UWVA 5E09A 2FB3A 3BO9A 1Y5XA 3A47A 2HVOA 4ZOBA 3WK2A 5JXQA 2YBUA 4BR1A 3M47A 5FJIA 1I0BA 3ES7A 4HA4A 4KWVA 1LLOA 1OX4B 1W6TA 3PPGA 5EB8A 4B3LA 2J74A 1S2TA 4NSBA 4AVNA 1VLIA 3GBEA 2ZUMA 1M7JA 4ATDA 3B8SA 3AHXA 4R3UA 5AHNA 4FPSA 3BAIA 5HQLA 2IMRA 1FWSA 5CPSA 3CQHA 3KBNA 3ATZA 1K9DA 3NR0A 4KESA 5KTLA 4LU0A 1OADA 1EA9C 2R24A 2ATSA 1R9XA 3PJWA 3BZJA 5G1TA 1YDVA 1KRCC 2AMGA 4JFUA 1W31A 5JBEA 1ZNNA 3W7IA 2B4GA 3WUFA 4EXQA 3P60A 2DEPA 4M6VA 3LCFA 3K8KA 3SCWA 1CLKA 5LZLA 1LG2A 1VZWA 3K8MA 3H8AA 3WLOA 3KBJA 7A3HA 4OIFA 1B0IA 3OGVA 1RJPA 4IP4A 4CKQA 2ZUSA 1X1NA 1ZS2A 4JCMA 3RO8A 3WLQA 1ADOA 2DDXA 5JIPA 1TZ7A 1W3NA 2OEKA 2AQOA 3C8FA 3GM8A 1R6WA 4XD3A 3U3HA 3DI1A 3TW9A 3W9ZA 2CLOA 5GJMA 4ROPA 3BZGA 4IJCA 1U5HA 1M53A 3QF0A 2R94A 3BLFA 4LCRA 2X7WA 3DHPA 4Y2WA 2DU2A 1O94A 1CXIA 4GXWA 4JHOA 3R11A 3TAOA 4E2DA 3P67A 3PBVA 2BP1A 4PMOA 2E8YA 3QHNA 3B03A 4DO4A 3ZIZA 3KBSA 1SO6A 4LS2A 2DZSA 1J5TA 2ZADA 4JEJA 4YVXA 5EMMA 4DBSA 5FEXA 3L0KA 3R1ZA 1ITUA 4QP0A 4GMEA 2NSXA 1OINA 3R8GA 4IMEA 4AZBA 4DIAA 4K8HA 2J62A 4TXEA 4F9DA 3EPOA 2BLEA 1GYLA 3PSVA 4AWSA 2GK1A 3QR0A 3EXRA 4GC4A 1GVYA 4RZ5A 2J75A 4D6CA 1V3MA 4MLJA 2Y4SA 4DF0A 4AEOA 3V3WA 3MKVA 4P8XA 3AXMA 2YCKX 1HKVA 1EOKA 2PP3A 4JQ1A 2YA2A 1DWGM 3TAKA 1JF5A 5LXEA 3VE9A 4JIQA 4KQNA 3UR2A 1XD0A 1Y8BA 1JCXA 2QJHA 1CGVA 1YBQA 4LAOA 2VEPA 4PBEA 1G69A 1D3HA 4JDBA 1O7AA 1V6VA 1PSCA 3XISA 4QBXA 3W74A 5HNNA 3G0UA 3N2CA 4G56A 4LBRA 4YIWA 3AYSA 1L8NA 5FAJA 3MKCA 1K7EA 4UTKA 1UR8A 1XLFA 3G3MA 2A3CA 5F1UA 1XH1A 1E0XA 4JTGA 3WK0A 4GUIA 2VOMA 1E6PA 4LYQA 5AHLA 2JGYA 4WLCA 4HB7A 1EX1A 1WX0A 4MWAC 3VZYA 1TZ9A 2PTDA 3EDFA 1IEWA 4Q8WA 3M44A 4AWTA 1C9DA 2V63A 3F1QA 4O13A 1UW9A 2YCIX 1X7IA 2EO7A 3BW3A 3EXTA 2IQDA 1MZHA 4ENLA 1LUCB 3WQVA 4S2CA 2HNHA 2ZQ0A 4MB1A 2ZTKA 4U5IA 1RBLA 2WNNA 3CQIA 2NX3A 2X40A 2YW3A 3H2CA 4GE8A 4PEKA 5BOEA 2TYSA 4QDMA 1TJRA 1AJZA 2TRSA 3UGRA 4L9ZA 3KOXA 1A5OC 1U33A 4G5DA 3NA8A 2PDNA 2ISWA 1US0A 3AJXA 1R3TA 3HMJG 1A3WA 1Z32X 5FJPA 3OQ8A 4M19A 4JQ2A 4NNAA 3VD4A 4Z1YA 2CKSA 2XFFA 1N7KA 3FVMA 3VKBA 1GQNA 2Y89A 3ZVHA 3WQ6A 4GUJA 4B5TA 4FB7A 1E1EA 3G6MA 1R87A 3K4WA 3AU6A 1EYWA 3MI6A 3NQ2A 2BOEX 3NXFA 3C6CA 3EPMA 3ABQA 1BLIA 3RR4A 5C2GA 3AIWA 4QJ5B 4H41A 4IUOA 4FZIA 2WANA 2OEJA 3M5ZA 1A53A 1HN1A 4LEQA 1W1PA 1KFKA 5BROA 5CGQA 2ADAA 3BAXA 4HCDA 1OX6A 3FLUA 1S2VA 1JAKA 4LAUA 3PWIA 1GWJA 1GGOA 2CWXA 3W7NA 3RN6A 2W92A 1X8FA 4R9XA 4FHAA 1Q7ZA 2F2KA 4IIBA 3RDKA 4HU4A 4PTWA 5K3VA 3QR1A 4HD5A 1REQA 1NEYA 2PDUA 4LW7A 5M3WA 4LUYA 1NU5A 3RF9A 3WBWA 1H63A 4CQCA 4HPGA 1ICSA 3BL3A 4LC8A 3CAKA 1LQ2A 3CQKA 1AD1A 1XYLA 4IPPA 1Z41A 1E9LA 2FVKA 1O5KA 3FAXA 2BX7A 3ARPA 4GH1A 4DNHA 3LPGA 3TDFA 4HOXA 1LT8A 2QF8A 3HBLA 2XIOA 1XSKA 4I9TA 1CGTA 3V0TA 1QHPA 3VNZA 1F8IA 3T9PA 4YCOA 1VYPX 4PE8A 3LQLA 1Q7QA 2ESCA 4GHRA 3CHCA 4C5ZA 1IR2A 2VD8A 2J7CA 4PRWA 2C3ZA 3H7VA 1MW2A 2V3DA 4I5RA 4MNMA 3T55A 4IWWA 3GNNA 3CUGA 2VCCA 4AH7A 4Q8MA 4NZ1A 3UF9A 2TAAA 3UJRA 1A5KC 2OGYA 3FGCB 4IL0A 1WA3A 3UG8A 1GHSA 3C2RA 1F3EA 4JDYA 3ZSSA 4ZEPA 3NURA 4TTGA 3NPWA 1XLGA 2DFAA 4E2OA 1M1BA 4IGMA 3O16A 4GIAA 2D2JA 4ZQPA 4MZ1A 2CC0A 4KWOA 2WNWA 3WCZA 1BTMA 3AMKA 1E43A 1O68A 4HNUA 1OCNA 3W82A 3OZYA 4XVDA 3KDOA 5HWMA 1WDDA 3VOFA 5H1WA 5HMDA 1QTWA 3PZGA 1HJXA 4I6KA 1CNVA 1CXKA 3W87A 4PBFA 2GSJA 2FZNA 4CQ8A 1TV5A 5BXRA 4XUYA 4X61A 3W7HA 1ECEA 2P0IA 3P81A 2ZWYA 3ECQA 2VR5A 1E70M 1KR1A 1XIMA 3XINA 3PJXA 1JPMA 4Z2GA 1BHGA 1GZ1A 1W1TA 2YXXA 3GR7A 3ARXA 3BSMA 1Q3NA 1G1YA 3LZ5A 4S3GA 1Z69A 2NXGA 3QOMA 1JPHA 3GDTA 1JGIA 4GQRA 4GZEA 4DB7A 2KX9A 1FBAA 3TQVA 1BVWA 3PM6A 1HJWA 1QPRA 1UB3A 4AD3A 2ZA2A 1M9HA 3LU2A 3IV3A 3OHMB 1LM1A 3MMUA 1UYQA 4J3VA 3UT0A 1K3UA 3NQMA 3HTWA 1RXOB 1R5YA 1WBHA 1EYEA 3GZAA 4XZWA 2BB0A 2WV8A 4NRSA 2XFRA 3UY7A 5TNVA 3POCA 3EKLA 2R1NA 3H4GA 4Y6GA 3R8HA 3BQ6A 6ENLA 3NYDA 1H49A 4ADUA 4HU3A 2GQ8A 5XINA 1KM5A 3GKAA 4KGLA 4CCEA 3NQGA 1OEPA 3DBPA 5HJXA 1A0CA 1W3IA 3T09A 1PVNA 3F4WA 3GXFA 3PZUA 1R3YA 2NQ9A 3DH7A 3L0NA 2Y5SA 2GDQA 1HJQA 1TWZA 2BVYA 4EAMA 4GQBA 2G4FA 4QG6A 3VIIA 2PDFA 3B8TA 4H9VA 4AIOA 2GPTA 1LWIA 1UWUA 1XF0A 2C7FA 2FTWA 2W6RA 2QUVA 5L9FA 2QPUA 3VIFA 1WCGA 4BF5A 4CVWA 3B9OA 3IK2A 3R12A 4LF1A 1DXIA 1PV8A 3ZLFA 2J9XA 3KRBA 5HDRA 4PCSA 1NVMA 3T0CA 2GQ3A 3IUDA 4M6PA 3OB8A 3W6YA 3STPA 1NFBA 3T78A 3AO0A 3TP4A 4MHBA 1GONA 1EL3A 3THDA 1A4MA 3FDKA 3C0QA 4U2ZA 5C7VA 1DE6A 5D2YA 4Q7NA 5I09A 3MS8A 2XM2A 4CVUA 3ZFHA 3W85A 3I4KA 2E9LA 1HUVA 3IARA 1P0BA 4MB4A 3WH7A 3XIMA 6REQA 3EWDA 1ZBCA 7ODCA 5FF7A 3V16A 3IIPA 4PSRA 3SFKA 4LVAA 4B2DD 1ODZA 3SUTA 2G4JA 3TLLA 4D8AA 2FVLA 3CUXA 4DAFA 3ZM8A 4FALA 4ZFMA 3VD7A 2PU1A 4POCA 3GG8A