3H2OA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
273
structure length
264
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 75
structure length 264
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2oA00
4D8ZA 3H2AA 4MWAD 4DAIA 3TYCA 4DJED 4DJDA 4G9PA 4S38A 2BMBA 1AJZA 3H21A 3TZFA 2YCIX 3TZNA 1TWSA 4S3CA 3K13A 4S3BA 4MWAA 1AJ0A 4NHVA 3H23A 1AD4A 3H22A 3H26A 3MCOA 2YCJA 4PZVA 2OGYA 4MWAB 3TYAA 4D8AA 3TYUA 5JQ9A 2H9AB 3V5OA 2VP8A 4O1FA 4NIRA 3BOFA 4C1NA 1Q7ZA 1Q8AA 4S39A 1Q7QA 1F6YA 4DJFD 4DJEA 4DJDC 3H2FA 2Y5SA 4NL1A 4D9PA 3TYZA 4C1NB 4NILA 2H9AA 4MWAE 1EYEA 2DQWA 4HB7A 2VEFA 2YCKX 1AD1A 4MWAC 1TX0A 4DJFA 4DJEC 2DZBA 3H2CA 4S23A 2YCLB 4DB7A 2Y0FA 4O0QA 4S3FA 4CCZA 4DAFA 3TYDA 1AJ2A 1TWWA 3TYBA 2DZAA 3MCNA 4DJFC 2VEGA 3TR9A 3H2NA 2YCLA 1Q7MA 2Y5JA 3H2OA 3H2EA 1Q8JA 1TWZA 3NOYA 4O1EA 4S3DA 3BOLA 3H2MA 2E7FA 4S3EA 4S3AA 4DJDD 1Q85A 3H24A 1TX2A 3TYEA 3MCMA
chains in the Genus database with same CATH superfamily
4AD2A 3OHIA 1M7OA 4DAIA 4W8AA 3PZUA 2CBJA 1Q3NA 3QR0A 3QGKC 3DAQA 1J0YA 1F74A 3FFSA 3TZFA 1JPIA 2IKGA 1UH4A 4U33A 3WQCA 1EXPA 1YNPA 4GI9A 1XFBA 4XZIA 4CD8A 1SUXA 1RALA 1NOFA 3TYAA 1VYSX 4CVUA 2ZX8A 2ZKMX 4KS0A 4CQAA 1MQPA 2NX3A 4PODA 3RJYA 3WFLA 1A80A 3OVPA 4JS3A 3OBEA 4F2TA 4MZYA 4C6KA 3R4IA 2X0YA 3QY7A 4U5IA 1OJXA 5I3JA 3ARQA 3PB0A 3CYVA 3FX4A 1JR1A 3WDIA 3EWBX 4KCUA 2B31A 3W2NA 1Y5XA 1S2WA 4GMEA 3EOOA 1JZ4A 4AEOA 4H7CA 2ZX9A 4FX6M 1GKRA 4DF2A 4P8WA 1ZP3A 4GYPC 1L8NA 2ZUWA 1K8YA 3OW1A 1O4UA 1WBJA 4U4MA 1AVAA 1YW1A 3CUHA 3T09A 2POZA 2WC4A 1KBIA 1GQKA 1WAWA 1ADOA 2OTDA 4HA4A 4LNCA 1ZNNA 4J28A 3W88A 1Z9AA 5EU9A 3ALFA 5AC5A 5A8GA 3TX9A 3OA5A 1XHGA 3R0DA 2GK1B 1Y7VA 3W01A 2P76A 1DIDA 1KB3A 1ME9A 4NUWA 1ML1A 1D8WA 4Z1YA 1BLIA 1ZBWA 4DYEA 2WNZA 3B8SA 2FTYA 2ZOXA 2QDEA 2V8ZA 3PC0A 1BF6A 4W85A 1UC4A 3TJXA 4GXWA 3FJNA 1EBGA 4JL2A 4BFAA 3GDKA 1EUAA 1WKYA 5AYIA 1TIWA 1QNOA 1ZL1A 3LHVA 3BZJA 2I17A 2P8BA 4RUBA 1ICSA 4H9ZA 4JDYA 4G6CA 4QLJA 3KW3A 4KEUA 1XPYA 2GUYA 3R6IA 1PHWA 1JUBA 3C0LA 4O1FA 2C6QA 4NIRA 1F8IA 1J2WA 1XLBA 2Y2WA 3WJYA 3GS6A 2FZMA 2FZBA 1GVEA 4HMEA 1Z32X 3M0YA 4WDTA 1G4SA 1MMFA 1KM1A 3QPEA 4DAFA 4CCEA 4N6FA 3DN5A 1V6UA 2J7EA 1JAEA 1MQQA 5EMYA 2WMIB 4DZHA 1EX1A 1KCZA 4RPPA 2RUSA 1KNWA 1RV8A 3MTWA 3SGUA 3DDMA 2WLZA 4B5NA 1G01A 5IFPA 2E6DA 2ZRXA 4QDWA 4PUDA 3IIXA 5HAOA 1J0HA 4Y2WA 3H2AA 2FVKA 1QI5A 4C6QA 3B0YA 1QCWA 2VFEA 4PUJA 4CN4A 3L12A 5FL0A 1OSEA 3MMUA 4U10A 4MLJA 4WGHA 1JYXA 3WBWA 3S5OA 4R9OA 4N4PA 3LN3A 2C1HA 1FWDC 4RR4A 2HRWA 3QHNA 1UD6A 3KXQA 3CQJA 5CPLA 2WZHA 1F8MA 1M03A 2PA6A 1SFJA 8A3HA 1PZ1A 2GQAA 4F8XA 4AXKA 3AS3A 4FNQA 1IIHA 2QDDA 3RK8A 2V5DA 5XIAA 4W5ZA 2Z25A 4QE1A 3STCA 3W82A 3QW4B 1UD3A 3RX3A 1VBHA 2FGBA 1CLVA 4KQNA 2Z2BA 1MO0A 3ERPA 1Q6QA 5PTDA 3LRKA 1HUVA 4F3HA 1E9LA 3XIMA 3IGHX 2VNCA 3DOPA 1JDAA 2QF8A 3SJNA 1C8QA 4LUTA 3IV3A 5BROA 4MNKA 4O8AA 2PGRA 3EDEA 1JD7A 3CQIA 3DBNA 3W27A 4HK5A 5AY7A 3HPAA 4LS2A 4C6OA 4DUVA 2X16A 2E8ZA 1DTUA 2PCQA 3EWCA 4O50A 2X1SA 4A3HA 1H60A 2ACSA 1DTNA 2OMAA 3BCFA 4DY1A 2P8CA 2PCEA 2XM2A 3PAJA 2VURA 1H50A 2V3FA 3WQ6A 3C6CA 1FWFC 2GL5A 1VYRA 3N15A 3URNA 1OFEA 1PWLA 4AY7A 5BRPA 3CZLA 3UR2A 1QPKA 2QJNA 1PDZA 2R1NA 3NZPA 1XS2A 2PGWA 2J74A 1HKJA 4UTWC 3FK4A 2D23A 3MHGA 3CAKA 1VB9A 3VD4A 1KGWA 3MZ2A 3VVGA 2VD9A 3WNNA 4FEZA 5DBUA 2FLIA 2GGIA 2Y5SA 3SCOA 4E3TA 2TMDA 1YLVA 3VDCA 1BTMA 1A50A 4ZE4A 5BRBA 3RLUA 1DPMA 3GHUA 2O9RA 1QXLA 4HNLA 5ABHA 3DGRA 3Q2DA 4D72A 4K38A 1JRBA 3ALGA 3OZYA 1WYIA 1SO5A 3BSHA 4JY9A 2IKJA 2PP3A 1PKLA 3T44A 4O10A 1VPQA 1ISVA 1EGMA 4CD6A 4EF8A 1YXDA 1AZ2A 2XHYA 3VOGA 5A8MA 5FF3A 4H8HA 1EEPA 4O1EA 1W32A 5C6MA 1NOUA 5DFAA 4JQ3A 3WD2A 4EXAA 1TX2A 3N4AA 4JTCA 5CSUA 3RPDA 2TRSA 1ZS2A 2HNEA 2NXIA 4Q4RA 3L4VA 4A3UA 3JR2A 2GWNA 1WXYA 4DXXA 3GVGA 3W2KA 5BWAA 3QV8A 4A8IA 1V0NA 1LG2A 5CJMA 3GNXA 4Q4SA 3OVRA 5CSYA 4GQGA 2D69A 4A35A 3DUGA 3E5BA 5F4XA 2QS8A 4AW7A 4JIQA 4B5XA 4WZHA 4D8LA 3G0UA 1KKRA 4D6DA 5M2FX 4AX7A 3CHCA 1W2VA 1UBPC 3OLDA 2ABBA 3C0JA 4F0MA 1GVRA 1LP6A 1V6VA 1DWJM 2BNJA 1HGWA 1CLKA 2J78A 1V6XA 1AQMA 1JFHA 2YZRA 3N2MA 1TX0A 4DJEC 5E9XA 5I3FA 4DHGA 2CLEA 5D32A 2Y5EA 5IRPA 4AISA 1EJTC 2OYLA 3M0JA 5DCDA 1SW7A 1F7BA 1RK5A 3NNTA 2QHAA 4CNOA 3QSRA 4YLWA 1EEXA 1H49A 4ZO6A 4GWEA 3WBEA 4LAZA 4GZIA 4JIIX 2ODOA 2DSVA 1K7EA 3FEMA 1LM1A 3GNOA 3GQYA 4CEUC 1TWZA 2Y61A 4H6QA 3O0FA 3AAMA 4JIEA 3F4CA 3WUFA 3H2MA 3MO4A 3USBA 2GOUA 4R7OA 3S2CA 2NVAA 4G8TA 1X96A 3W72A 2WLYA 1WA3A 3SDOA 3HFTA 2ALRA 4GJIA 3DFSA 3MMTA 3UYIA 3P81A 2OKOA 4AWSA 3RYSA 3TOYA 2CLKA 1TVPA 3G8RA 5EA9A 1Z44A 4AHQA 1N8WA 4PUUA 5CC5A 4ZR8A 3O6YX 3GXDA 1K6AA 3MCOA 1H4PA 3QFEA 2Y70A 2NXGA 3W7CA 5DX7A 1GKQA 1N2VA 1V0KA 1ZALA 3HIJA 4Y8FA 4EXQA 2QAFA 2HZGA 4FOKA 4AG0A 1SR9A 2MUCA 5D2XA 4PCNA 3SY8A 3SB0A 4DO4A 3VIPA 1Q2SA 2F9RA 3V4BA 1I1WA 5FKYA 4IGNA 4XZHA 3CPRA 3SBFA 3IS4A 4JTFA 4N9DA 3MSRA 3UPBA 4Z2LA 4AEEA 3NZRA 3O07A 5DO8A 5SWUA 4YU1A 3LSCA 3THUA 3QYSA 4AZCA 1XSKA 4ONVA 1V8EA 2IQDA 1D3HA 4QEEA 1M04A 5FJRA 2QUVA 4L4LA 1DIOA 3S83A 3BOLA 1EA9C 5I3KA 3CH9A 3G24A 1VJZA 3LCFA 3SIZA 4MWAD 3U9IA 1S1RA 4M7SA 4M5PA 1OC7A 2IXVA 4US5A 2QCDA 1BHGA 3UG4A 1WP6A 2VQUA 1RR2A 3EXSA 2BVDA 4PTNA 3IK2A 2OB3A 4YMZA 1FH9A 3GZAA 2YA1A 2J8GA 4ZQCA 3A3XA 2WKJA 3CQKA 4JCMA 4KRUA 5J5RA 2VP8A 2Q3OA 5JXQA 1TQXA 3IJ9A 3L5AA 1E9YB 2DVXA 2ZA1A 4C6JA 3H2FA 3ZJ7A 4AWEA 1JQXA 2WW5A 2DUAA 3IIOA 5E6YA 2QIWA 3KWSA 2C3ZA 1D8CA 1ISZA 1FWRA 1WZKA 2CZFA 5BU6A 4LCSA 3W74A 1ZJHA 3C3UA 3IIVA 3ZZ1A 3ECQA 5T8GA 4I8YA 3OZOA 3QGAC 3WNLA 3CZEA 1UWRA 4GK8A 2L5HA 4RW5A 3EBVA 2Z1BA 2YL9A 3CPUA 4OVXA 1ECEA 1TPC1 5GJNA 4NRRA 3UZJA 3T0DA 3W23A 3ZVIA 2J8TA 3W1QA 4HSHA 3N6QA 3NWRA 3S42A 3NO3A 4NVTA 3WNKA 1X38A 2OYKA 4JIPA 2Q8ZA 4MM1A 4X0VA 1RD6A 4DWSD 5I3HA 4ILSA 5G2WA 2CCRA 3WMBA 4HHLA 4PCSA 1G7UA 2PD5A 1JXJA 1WZLA 5AHEA 4HU4A 4UTTA 1BQGA 1ME8A 2PDPA 1S46A 1CZ1A 5M1TA 3PTDA 3ELFA 4GI4A 3QQ1A 4V1XA 2QJJA 1EJRC 4ZQMA 4LQ1A 5I23A 2H9AB 3NGFA 1LQ0A 4J3UA 4R88A 3H7UA 1JNEA 1HL2A 2PWEA 1XYMA 3LPFA 4AXNA 2YYUA 2WSKA 3IUHA 2R8WA 1WKFA 1KQYA 1SW0A 3GDBA 3IJDA 2OLHA 4MY1A 3WMLA 4WUIA 4RDYA 1GWJA 4E8CA 4ATDA 3TDFA 3A5VA 4B9ZA 3F2CA 1IIGA 3MS8A 5FCZA 3W86A 3WEZA 1V3LA 1P0NA 4W89A 5HJLA 4R7JA 5AZ0A 3OG3A 4IT1A 3S2JA 4KCTA 2BWGA 4O14A 1FUYA 3NL5A 5FJOA 3AYVA 3PBYA 3NEVA 3NSMA 5DRIA 1IGWA 1IYXA 3QEZA 3O63A 6A3HA 1KGUA 1K7FA 3MBFA 5C9RA 8TIMA 3ARTA 1YIXA 3AIEA 3ZO9A 2GFTA 3TN4A 3DHPA 1PZ2A 1VCGA 3OOQA 4L61A 4QBXA 4ZFMA 4AZ6A 4DIAA 1A0EA 1EX5A 3W85A 3S3GA 3WLHA 3LGEA 2W27A 1QW7A 2NQHA 1OCBA 4H8VA 3A3WA 5FAGA 4HZMA 3ITXA 5HNRA 4DZAA 1ZBVA 3WLTA 4B2DA 2VZVA 2V67A 1P43A 3I4EA 4MIMA 1KM5A 2QCHA 4KETA 3UNDA 4S1FA 2VMFA 1XCFA 3R8HA 5E93A 4JTHA 1GGOA 2VX7A 4MTVA 1HN1A 3L67A 3N14A 4AVOA 2HSAA 2FZNA 4OV9A 2O9OA 4KIRA 4CNSA 1SQ7A 5JU6A 1D7FA 3PWAA 4BWLA 3VCNA 4B5WA 3CQHA 2EPLX 2KZHA 1TJ2A 3W24A 3MW7A 3SUTA 1J4EA 3U7BA 3L4XA 1OT1A 2QJIA 5CBIA 4FXFA 1E0TA 3E2SA 3OQ8A 2HXUA 1KFBA 4MJ2A 2WHJA 4L1WA 2XFRA 4RDVA 4GKTA 3IJ8A 4JTEA 1TR1A 2GOKA 4EOUA 2KAUC 5B7ZA 4CCDA 1H63A 4HMDA 2IQ0A 1H1NA 3UXIA 1BRLA 3ANUA 2Z1XA 3BQ6A 1HO4A 2F8QA 3AIQA 3MANA 1W9DM 1HKWA 4LYRA 3B9AA 4JN6A 3K4DA 3M0VA 1EHAA 9XIMA 1Z48A 4Z42C 4H6KA 4D71A 3EOSA 3POCA 1I2QA 3WQEA 5BOEA 3AIWA 1FCUA 5CG7A 3WQPA 1J11A 1KO0A 3CIVA 3OODA 4MB1A 1TE1A 2XFWA 4MWAB 4B5SA 1ZJAA 5CGMA 5ABFB 4KF1A 2VX4A 3MPGA 4WR3A 4C6PA 2WM1A 5I6SA 3O2LA 2J66A 1RPXA 1OX4B 3KOZA 2FGLA 5G1YA 1KWKA 3WY1A 3BAKA 4MNJA 5DQPA 2CWXA 3E9AA 4GI6A 1O7AA 4YVXA 4O8RA 6TAAA 2PLJA 4GG9A 3R7MA 2VR4A 4I7VA 4LX4A 4ORMA 2OX4A 1IT0A 1MRQA 2Z1WA 1LG1A 4JKMA 3WLSA 2BHZA 3BICA 3UA3A 1MZHA 4GHRA 3RO6A 1B3WA 4XUGA 1IZKA 4PRWA 3UY8A 1KFLA 1WKEA 2E5CA 2BGQA 3KBSA 3N2XA 4B15A 8RUCA 3NOYA 1B3OA 4GZEA 2CZEA 2ZZ3A 2CLIA 2YLAA 1NP0A 5G4HC 3TUUA 3ABZA 3B8DA 1KKOA 3N73A 4AD0A 3A9BA 4EKJA 3DFTA 2NUWA 2HJPA 1UP0A 1S39A 4HOWA 3F1QA 3BJSA 3S9IA 5I3DA 3ZOAA 5MHBA 3BLDA 2NV9A 2I57A 2VVSA 3TNOA 5M5DA 4DWSB 2E67A 2GGHA 3DHFA 1YMYA 3E2VA 1PUDA 5GNZA 2R1PA 1B2YA 3UA4A 4WOZA 1O95A 4H9UA 3WO8A 4P7NA 2BBFA 1A5SA 2GVLA 4Y9OA 4XZMX 2W4XA 1PIFA 4QJ4B 3W75A 1EOMA 1IR1A 4HPXA 3ZLHA 4PL1A 4AC1X 2Z24A 5LHFA 3AFBA 4NJIA 4PTVA 4KW2A 4MMWA 3U8GA 2TYSA 1GQJA 2RJHA 3MDWA 5AYZA 2ZZ5A 4NJKA 1YBQB 4IOTA 3BAYA 3GU9A 3LLFA 1R85A 1TRIA 1AG1O 5A6AA 1QI0A 1NEYA 1W8SA 3W2JA 1FH7A 2NT1A 2FVMA 3K4WA 2QGYA 5FEZA 1PE1A 1G4EA 1B4EA 1D2KA 2A7NA 3RNDA 1DEDA 4W7VA 1E6NA 5AB3A 2CXGA 2B7OA 3N3MA 2PRMA 1KRCC 6TIMA 4B3KA 1X6NA 3IPWA 2D1ZA 2CWNA 3G1AA 4HMCA 3NQBA 4AVNA 3ZIZA 4RNJA 2ZUNA 1GOOA 1HT6A 3C2OA 4KWVA 4PMJA 2O56A 2B7NA 2X30A 2YR1A 4JFVA 5HNTA 3TLLA 4PMDA 3CIXA 2WCGA 4NX0A 3A12A 4MSSA 3ABRA 3AYSA 4QP0A 1V3KA 3FOKA 4C1KA 2QUUA 4XD3A 1W17A 2CNCA 3IJIA 1I0BA 1UCWA 3AOFA 4HPHA 4JDBA 3WJXA 4OECA 3VOCA 1E1FA 4XAPA 2VEIA 1XYCA 4AIEA 3CMFA 1TVNA 1N7KA 3REQB 1H7OA 4RLIA 1B4KA 4DLFA 5T26A 4S3FA 3PS7A 3UCQA 3AZSA 1A5MC 2WM0A 1B1YA 5BXSA 4UFKA 2CKSA 1JNDA 4FLQA 1H0GA 1SYTA 3CUJA 4DBDA 4WDWA 1T41A 5D02A 4M0XA 3BC9A 1V03A 3WEOA 1LRTA 2ZX7A 5IHRA 1X97A 1S5WA 2QJGA 5ENLA 3NXLA 5DELA 3LTPA 4NZCA 4V2XA 5K3VA 4TQTA 3CUIA 1I0DA 1VFLA 3COTA 3WNMA 2A79A 2JKPA 3FNDA 3AIVA 3BXWA 3FW6A 2Y88A 1JRCA 1XV8A 1ZBKA 4Q4PA 3H55A 3HG4A 4UTTC 3IVSA 3T0TA 3GC5A 3PTQA 3AHXA 1ZSXA 4Q22A 4G2DA 4FP1A 1PZ3A 4ECLA 3FV9A 3KX6A 3TE9A 1R3WA 4HNOA 4U2ZA 4LUSA 2BP1A 1UP3A 3V0TA 3BCDA 1KRAC 3I6TA 4HU3A 1QFEA 4DNHA 3W2MA 4ENLA 4G5DA 3W7GA 4E8GA 3KFTA 1JPHA 4OT7A 1JCXA 2UY3A 3AMDA 2FZDA 5C7HA 3GX9A 3NQ7A 4UTMA 3G3MA 4YS1A 4PTXA 2RKXA 3VFCA 3B4UA 1Q65A 1REQB 1S2UA 1SJCA 2Z1SA 4J3SA 3NDOA 3L4TA 2CYGA 2A7PA 4PMRA 1XQKA 3GY1A 4W93A 3L5MA 1H1ZA 3MUY1 1AQHA 3W7PA 1UG6A 3E38A 4UOJA 1A5CA 3QKZA 3U2CA 1CGXA 2WHKA 1UD8A 3WFZA 4N7QA 3VIJA 3V35A 1OWQA 5DXYA 1NDVA 4CUCA 4DZIA 4E4FA 2AAMA 4IUGA 2INFA 1U30A 3SADA 1VS1A 5EMUA 2HS6A 4TVDA 4PMYA 1RY8A 1XH2A 2Y7EA 2CITA 1UZDA 1KGXA 1TPVA 3POHA 3ARYA 3S5ZA 2A4AA 5CKSA 1S38A 4H3DA 3AYTA 4TIMA 1Q6OA 5MKGB 5HWJA 4QNWA 3UG5A 4GVGA 4X63A 2FPTA 2EEXA 2XH4A 3OA3A 1ZZMA 2A3LA 1CGVA 1TMLA 2XVKA 4KCVA 1EDTA 4YVPA 1VHNA 1NELA 4IIEA 4HNNA 2OWCA 3AMLA 1XBXA 1DJQA 2QUTA 5AVNA 2D0FA 3ARPA 1HVXA 1KW1A 2G3IA 4MUZA 1R3SA 4UTHA 1GOQA 1QNVA 3ARZA 1OY0A 3L4YA 3AYRA 1HG3A 1WO2A 5A8PA 4GQQA 2NUXA 3GR7A 4WY0A 4IIDA 3QGVA 4BWLC 3QH2A 9XIAA 1YKWA 3L2LA 1R0MA 3GU1A 4C5YA 4ZFCA 3H2NA 1RCOB 5HBFA 1CTNA 1YPXA 1UD2A 1EO7A 3EKGA 3N4EA 1W9BM 1GG0A 4F2UA 5EMJA 4HMNA 1IGSA 3RILA 5C71A 4GYKA 1E4IA 1W3JA 1HFBA 3ZT5A 2WWDA 4O0KA 1MDLA 4LRTA 2F61A 1VIZA 3RAOA 5HMSA 4AUBA 3TQKA 5I00A 4IICA 2WANA 2QW5A 1XLFA 5FJTA 1VIWA 1UIPA 3MBDA 1DWHM 1MZRA 1P0BA 4FI4A 1I9CB 1W3KA 1VHCA 3QMRA 5REQA 1P1XA 2J75A 3AXKA 1AL7A 4AQLA 2UV8G 4GH3A 3USZA 3AHTA 2FHCA 3UZYA 1EA0A 3LGGA 3FKRA 5D8WA 1QBAA 1RY0A 2NQ9A 2FDSA 1HKKA 2YA0A 5HQLA 4L9XA 1TTPA 4EVZA 3CYJA 1HX0A 1SU5A 2FGZA 3CASA 4IG2A 5D9OA 2VEFA 7ODCA 3AS0A 3MO7A 1GJPA 1OBAA 1UR8A 3M43A 1R2TA 3CBWA 2WJZA 2O9TA 2G3NA 4HHMA 1FP8A 1BYCA 1OFOA 1H7WA 4KWSA 4TOQA 4DYJA 4PMQA 2JK2A 3DXIA 4NAEB 5T9BG 4CU7A 1C9DA 1OG0A 2FPYA 2OSXA 2PUZA 7PTDA 5IBXA 4H83A 4A8RA 4Q8NA 1BXNA 4FIRA 3UU0A 3HG2A 1FP9A 4NNAA 4X3ZA 4F0KA 1UR0A 3SN1A 4MJMA 1MDRA 1L2UA 2YPIA 2CZDA 5KZDA 2ZX5A 1O5RA 5CXPA 2PDMA 1LROA 5IXEA 1LL7A 2YCEA 2OZ3A 1NY1A 3NUKA 3GXIA 2E5BA 1DBTA 2Y62A 1Q63A 5AYYA 3V36A 2O7QA 1HNYA 4KKXA 1M01A 1E4LA 4QRNA 3L0GA 1B3VA 3QJAA 3WLIA 3KVMA 3MYOA 3ES7A 3K1GA 1JULA 3G1HA 3QQ0A 2REQB 1WB0A 1IE7C 1X7IA 4XWUA 3I6EA 3L66A 2ACRA 3CMJA 1JUEA 1PEZA 4QX4A 4Q8UA 3KRSA 3MZNA 2PZ0A 3GIYA 2OEJA 4HCHA 3OO2A 2Y6ZA 4WSKA 1UQZA 3I68A 4WIWA 4WJ8A 3A4AA 2NQLA 5C9WA 4K8EA 1PX3A 5CLWA 4GVHA 2J7BA 5GPRA 1NDWA 4ZQOA 1NQKA 1ZAHA 3OIHA 3SAZA 1TPEA 1L6WA 3AMGA 3LPPA 4G7EB 3H6OA 4LS1A 5H8PA 3V75A 4MZ8A 3W84A 3WG6A 2BODX 4FS9A 4INFA 1VPYA 1J0KA 1TELA 3WH5A 1LL6A 4PMVA 3DECA 2I1OA 1XD1A 2IKIA 2OKTA 3B9EA 3U2ZA 3HGSA 3BTNA 1XIMA 1CYGA 5A6KA 4F40A 4P2VA 1DORA 1XLCA 3FHQA 1OK4A 5F2IA 1OF6A 2OWXA 2VGFA 1R86A 4J3ZA 3PTMA 3VC6A 1EJ7L 4YHGA 2WQDA 1Z8AA 4N4QA 3S9YA 2TODA 1XWYA 2IUZA 2V9DA 4EP8C 1DV7A 4ZSUA 2V38A 4OUEA 2HE8A 1TUFA 1NDYA 2A85A 3T4CA 3PZTA 3THDA 3G2GA 4W87A 1W1ZA 1A4LA 1QWGA 3ZLGA 4LEQA 4PMZA 4BF5A 5EL1A 4CNPA 1VAHA 3CO4A 1JCYA 3NIYA 4OV4A 3H4WA 3UXLA 4I9MA 2SFPA 3VINA 4IQEA 2PTYA 4Y9NA 2V5KA 2BGSA 3AI0A 4UNIA 3WLQA 2HPIA 2NVDA 2NV2A 3KWXA 2VFGA 4IF2A 4QAWA 3M6YA 1WX0A 3F4DA 2GJXA 4JHMA 3KVLA 4UFHA 3K8LA 4XKYB 4G9PA 2C1IA 4KFNA 2PDUA 3VD9A 1CCWB 1M5WA 2A7RA 1N8IA 3RR1A 4GRSA 2CHRA 4IQJA 4E2DA 1KC7A 5E70A 2Z1VA 3H23A 3LTSA 1K03A 3T08A 1RJPA 3JUGA 3FKKA 3QR1A 4IH3A 1LUCB 3DI0A 4ZOEA 4PA8A 1XYAA 2BDQA 1M7PA 1SGJA 2J24A 2AL2B 3VMPA 4C6FA 4JKLA 5BXTA 4OTKA 1ODZA 5A1AA 4FZIA 1P1MA 1J5TA 3P3BA 1IZCA 4WK9A 1A4MA 4MVAA 4LRSA 2ZZ2A 4MPQA 1XKJA 1T40A 3TTOA 3MUAA 3BH4A 4RE2A 3ZSTA 5FACA 3W7IA 4UOZA 3SQSA 1UUOA 1T8QA 3KS5A 4H9YA 4RNIA 1ITQA 1KXVA 4K39A 3RGTA 3AIRA 1YADA 3UVIA 4KEVA 3L4ZA 1G4TA 1G6CA 2GVEA 5CCZA 2DJXA 3G1SA 4NZ5A 3AXIA 1FFQA 1SPQA 1H5VA 3N9KA 4BY3A 1X8CA 4XIAA 1AH3A 2EG7A 1F5ZA 3P74A 1W5OA 2CPUA 2BZNA 3RM4A 2NXHA 4A3YA 3SCSA 2V3GA 3EWXA 1QW8A 2OCZA 4TX9A 3Q65A 3RHGA 2PTXA 3W7DA 2JEQA 1H0IA 4UNKA 3FXGA 4DI8A 3EB4A 5C9ZA 3S1XA 2RGLA 1A3XA 4UTFA 4QDPA 2UY2A 4PSPA 4DEFA 4DO6A 3CAVA 4BS0A 4YJ5A 3VKAA 4JN7A 3NTYA 5LYRA 4KWOA 3GYEA 2YIHA 2ISDA 2QV4A 4LT9A 4ZSTA 4BI7A 1TTIA 5GNYA 4WCJA 3HFYA 1AW2A 1J2BA 5HINA 1Q8AA 3QYQA 3NPUA 3TTEA 2WQPA 5IDZA 1JYWA 1RAKA 4DJDC 2Y63A 5CGTA 1XIIA 4M6QA 1TPDA 4QSFA 3TKFA 1N55A 3CPGA 5J5DA 3BLLA 4OZOA 2ZYFA 1YQ2A 2XG9A 4WLCA 3WLMA 3UJEA 1PYMA 1B90A 1SZEA 2W6RA 1A47A 3WLPA 3SCVA 1US2A 3QW3A 1LWJA 1BXCA 1EJUC 5HJXA 1QI4A 4GXMA 3NQFA 4HA3A 3SSZA 2Y5JA 1E0XA 2C15A 2PF0A 2OT1A 2C91A 3KRUA 2W62A 4S3DA 1W9VA 3PR2A 1PCWA 4IFKA 4IGSA 2IMRA 3IAQA 3GWQA 1I45A 3JU2A 3CT2A 5C70A 3WDPP 3W7JA 3S6OA 3W0KA 1FWAC 4CCCA 1JPDX 1ITUA 1F4AA 3NQMA 4X0NA 1Q6DA 4HA0A 3RCMA 2VUNA 4NY2A 1UKOA 4MB4A 2VR2A 3MSDA 2P1FA 3RX4A 1VBUA 3HGRA 1UZ4A 2OU4A 1EZ2A 4IP5A 2VUYA 1NWSA 1MVYA 3GO2A 2E40A 3WQWA 2PLCA 3UVAA 1F73A 1XSIA 3SY1A 2I16A 1YDYA 1US3A 2I5IA 4D6FA 5MF5A 1EJXC 1XIHA 2H6RA 1UD4A 4Q8VA 4HCDA 4REQB 4IM4A 1AA1B 4HB7A 3DG3A 4BI6A 1XC6A 2J6XA 2YCLB 4A2SA 5LNWA 4HA1A 1NF7A 2C79A 3ORWA 1U33A 4I6VA 3UEQA 2VC7A 1NDZA 2ZA2A 2PTZA 4M3PA 1Q6CA 4KRZA 1SFSA 2J7CA 4AIOA 2DZTA 3WD0A 1W1PA 3DCPA 3PFMA 1E4NA 4QLKA 4JN8A 4LAKA 1SZFA 3CHEA 1JEZA 3DG6A 1SZNA 3LM7A 5HQMA 2QZRA 1FHLA 4X61A 1UUMA 4X22A 4Q33A 1TIMA 5IBXC 2P53A 1HGYA 4IIFA 5G1TA 3SQLA 2WMGA 3O8AA 4BHYA 5K7JA 3BLPX 3VIMA 2VFFA 2GK1A 2VC9A 1ITCA 3MVIA 1AFSA 1XICA 3PZQA 5A2CA 2CHNA 2PRHA 3TFXA 5A94A 4JHZA 1Z7AA 3NSNA 2E8YA 3NYDA 3PP7A 1W37A 1S2AA 1M1BA 1M68A 4HNCA 1U1UA 2DH3A 3B0UX 2D3NA 3L23A 4ACZA 4TVCA 1KXHA 3PVFA 2OLAA 4J3XA 4MAZA 4WXYA 4I5XA 4J27A 2O0TA 3LI1A 3AU6A 3IRDA 4L5ZA 1S5VA 3KAOA 7REQA 4K37A 2JQXA 2UWFA 2PWFA 1BPLB 1XYFA 3IARA 3R12A 3LZ5A 2PF8A 1UPMB 4JYEA 2QR6A 1E70M 2WJFA 1A5OC 2DY3A 2XJ7A 4HN4A 1H61A 2FH6A 1QHPA 4C7FA 5CAKA 1B3YA 4XD4A 2FTPA 4JYDA 3EAUA 4HSOA 1XH1A 1H5YA 1FXQA 1SO3A 3WK1A 4F48A 4HNUA 1LZOA 1OCJA 4HU8A 4Z2JA 3WBYA 1FH8A 3ZMRA 2RDTA 3D3FA 2EPMX 3ZR5A 1ZFJA 2X0SA 3WBAA 1TZ7A 1JL8A 4TTGA 2P0IA 2R1KA 4HK7A 4ZZ9A 2WMIA 3IGUA 4US5D 2OZTA 3F4NA 5TNVA 2ZICA 4JQ1A 3LCHA 5BXPA 4LXFA 3RLGA 1FCQA 5I07A 2WB5A 3PPCA 4DM2A 1S2TA 5C54A 4F79A 3NPXA 2E09A 1HJQA 4NXKA 3AWOA 3EB2A 2HS8A 1UOKA 1ZLPA 1VCFA 4MB3A 3I3DA 1M9HA 2PZNA 3PULA 4A6GA 1M7XA 2GWGA 2R6OA 3CH0A 1JDCA 2IPFA 4RKAA 3A22A 2FKPA 1L6YA 4GH1A 1DVJA 2E6FA 5BWFA 4UMBA 4C6CA 4K8HA 1SSGA 3FSUA 3PSWA 1UMYA 2XTKA 2R94A 1I2PA 1LOLA 4PCFA 3KLKA 2EBNA 1DWIM 5DY2A 3TJLA 2QV5A 1XLAA 4HHHA 3LM3A 2WKLA 3UYCA 3P8JA 1S5TA 3RRAA 2X2GA 3P8IA 2INEA 1HJUA 1ONXA 1E43A 4EX4A 1WDWA 4P61A 1ISXA 3BGJA 2Z7KA 3FA4A 4EF9A 1QNRA 3VDBA 1CXLA 5HDRA 2AKZA 3UPMA 3PZIA 5F7UA 1QPRA 1E6QM 1NU5A 4PRTA 4L1GA 3IWPA 3ARVA 4IJCA 3AO0A 4FNTA 1PKYA 3GVWA 3AALA 5E0KA 1YTDA 1BSIA 1RA5A 4J7RA 4S2CA 5I0DA 2YDQA 2BX7A 4NHVA 3GG7A 3NO5A 4GYPA 5E09A 2YYTA 3EZ4A 2WMKA 3V0SA 2C16A 3M0HA 3VPLA 3SFKA 5IFTA 3MYPA 3VDGA 1WDSA 3M5VA 3W22A 1C9WA 1W6TA 2J77A 4C1NA 2JF6A 1LOSA 4BCEA 1JZ3A 3L21A 4RZ5A 1R3YA 2A3BA 3D5HA 2WHMA 1W5PA 2XVPA 2PDWA 2GZXA 4UC5A 4I7UA 3VD3A 4IXXA 3P62A 3N18A 1Q66A 4GZJA 4W86A 3CNYA 4Q8MA 3WNOA 1Z42A 3TFCA 1UR4A 3QZ6A 1UR9A 4HTBA 3AHZA 2CZVA 3GVRA 3IRSA 4AWTA 1MEIA 3CQ0A 8XIAA 4YTTA 3DESA 3S46A 5DY3A 3EOEA 2ZRUA 3RXZA 3MUZ1 1BKHA 5A95A 3GXNA 4OUIA 1FA2A 1GHRA 1BXBA 1QU4A 2Q71A 1XLGA 3MHFA 1DE6A 1O68A 4GABA 3KL3A 3OEXA 4OOUA 3MUXA 3NURA 4PMXA 4Q4OA 2ZZ6A 3S47A 4GC3A 3BLOA 4B2DD 4QITA 3MSYA 4UFJA 3WH9A 4E4PA 1I60A 3MWAA 4ERAA 4LWWA 4O1CA 4GBUA 5CC6A 3APYA 3G22A 5D03A 1TA3B 1Z6KA 3FVMA 4MFDA 1O12A 1J01A 4Z2IA 2OR2A 3STPA 1EC7A 1ZCOA 4B4HA 4UFIA 9CGTA 1XISA 2B0MA 3MVTA 5CPNA 1L0PA 2QQ6A 3KOYA 1H7NA 3UJSA 4MPKA 4PL2A 4TMBA 4JPGA 3BK0A 4M19A 3IJQA 5I79A 3LHTA 1GOWA 4CU8A 2G3JA 3OQEA 5AYBA 4GX8A 5CPTA 2OGJA 4WF7A 2J8FA 2VXNA 3VFLA 4DF1A 3OVQA 1W1B1 3AJ7A 5AYXA 4Q6JA 4UXDA 3LXAA 2EPNA 4B3LA 2D73A 1NF0A 3PBVA 4CQ9A 4TUFA 1FFRA 4B5TA 3Q58A 2PDKA 4IMEA 3NVDA 3E96A 2YBUA 3GD6A 2E6AA 1L6GA 4UZSA 3KOXA 3NDZA 8CGTA 4GQ0A 3GR4A 4E5TA 1KBJA 3DHDA 4W5UA 3VGEA 4AZCB 1C7SA 1I2OA 3GFYA 3QC0A 3GBEA 3H24A 1PB0A 2XGIA 3WD3A 1ONRA 2VFHA 1F6PA 3R58A 2QCMA 2O92A 1OT2A 3SURA 3OZPA 3EPMA 4JICA 4G56A 4A3RA 3LQLA 3B97A 3LOTA 4I5RA 3B8VA 1E51A 5EKYA 1HJXA 1YEYA 3WN6A 2FYMA 3BMXA 4ACYA 3LV6A 1XFCA 2A0NA 3AMKA 4HIBA 3S2NA 5DXXA 4A05A 4UMCA 3SN0A 1HJSA 5KZMA 3UWVA 5D9MA 2YL8A 2Y1HA 3C86A 4UFLA 2EKGA 3S2MA 3CC1A 2VI0A 3DFHA 3N13A 5LIWX 3MSGA 3P5YA 3E2QA 3WF1A 1KM6A 3BJTA 2FZ8A 2ONEA 3ZWSA 4R34A 1QNPA 4AVFA 3T0CA 5K2ZA 2GJLA 1V02A 3SUWA 2PEVA 3NL3A 4H7VA 1FBAA 1BGGA 3VCCA 3GH5A 3MT1A 3WKZA 3E2RA 2W63A 5LGXA 2CKRA 3PK7A 1EIBA 4FSAA 3TWBA 3KBJA 3A13A 1K6WA 3C8FA 4V15A 1TKKA 4US6A 6XIMA 2A3CA 3AZRA 4RE0A 1E40A 1K3UA 5KETA 1VLIA 2XFFA 4NZFA 5DMNA 3UXDA 3FXYA 3OB8A 4K3ZA 1ME7A 3RITA 3MKKA 5D37A 4AD5A 3QOKA 4IMDA 3WJSA 3S0CA 1ZENA 5KMYA 4Q6XA 5CZKA 3KUMA 4Z0JA 3N2BA 3NA8A 1F05A 4WHBA 4FF5A 2BY2A 4NG3A 4M29A 3HPSA 3SRDA 3SRKA 5E6ZA 4C6MA 5LNUA 3NZGA 2Z27A 4QCEA 4KERA 2Z28A 4D8AA 4M51A 4DN1A 1A5LC 1XYLA 3Q67A 4JTGA 3VIOA 2FTWA 4DWDA 4WKHA 4O13A 3VM7A 1OEPA 3W7HA 1UQYA 1CENA 3WNPA 1UH3A 4PEEA 2G3FA 1MYRA 1WQ5A 1CLXA 4NRSA 1JZ5A 1ODUA 2W91A 2ASHA 1QDSA 4HD5A 5I02A 5C9UA 5CBBA 1EB3A 2HBVA 3NOEA 1R47A 3E74A 2BOGX 2PSNA 4CNTA 4NF7A 1OB0A 2DVUA 1QTWA 1HP5A 2RHGA 2ISWA 3UGVA 4Z1DA 1QAPA 1YE4A 1E6RA 4PMOA 1LF1A 3STEA 3B8TA 4I90A 1JYVA 3HM7A 4JQAA 3QPYA 1V3HA 4PUWA 1AODA 2A3AA 5CPOA 3BVJA 3RMJA 5HNNA 2BS9A 1VJIA 5LXXA 4UR9A 3O1NA 5GNXA 4IWWA 2DW6A 5DT5A 5J04A 4F0HA 5KZEA 4Q4KA 2VZOA 5B7YA 2E6YA 4UOQA 2A6LA 3E0IA 4H8NA 2PDNA 3QVQA 7TAAA 2IKHA 3KRBA 5BOFA 2NT0A 3DFYA 2C18A 3KZSA 2BGNE 3TC6A 4GFSA 1G1YA 4GY7A 1W3NA 2V2CA 3TV8A 3KS6A 4D1JA 2CERA 1XUZA 1UR1A 4C91A 4Z17A 5I3IA 1XBZA 3CB3A 4MUPA 4P8XA 3S2LA 5I77A 4QJ3B 2G50A 3NXFA 3DFOA 1YXYA 5CLTA 2ZXQA 2ZXBA 2H9AA 3SCWA 4H00A 1KXQA 3W7RA 2QAPA 3CTLA 1W31A 3WLKX 3CO8A 3EMCA 1UR3M 3UNTA 1GPFA 4I9JA 2I5GA 3GXMA 2ZZ7A 1VLWA 1CGTA 3BLIA 2YBVA 4ADUA 5FAJA 4LANA 5KINA 3GU2A 3UZ5A 4NYYA 3RG6A 1VBRA 1EP2A 4XO7A 1YX1A 1LLZA 3KOWA 1IEQA 2Z6JA 4BF9A 4AYGA 1UKTA 2HVNA 5DCBA 4LF1A 4RZ6A 2QCGA 5FSDC 5JH2A 3M5YA 3RR4A 1X39A 4JX6A 2YSWA 3T9PA 3GFXA 4YTQA 3DERA 4U28A 1QI3A 2NX9A 3V3WA 4K8GA 3MI3A 1K9EA 2VELA 1E6PA 1W2PA 5GJPA 3UWEA 3H70A 4X9SA 2QCNA 3MKCA 1I1XA 4JEQA 1ZPTA 4Z2HA 5A8NA 3LCWA 3R25A 4K1GA 1POJA 1RH9A 1TUXA 5XINA 1OC5A 3KL5A 3G77A 2Z7GA 3BSGA 2DSZA 4I9TA 3ZQ9A 4O16A 4D2JA 1Q6EA 1JPMA 1RD5A 5IDIA 1WUEA 1WOAA 3NM3A 1DJHA 1WZMA 1BQCA 3EXRA 1BG9A 2FQIA 3VIFA 4MHBA 3VO0A 3U6WA 4GD0A 4LBSA 5GJMA 3E49A 3WK0A 2DZPA 1JZ8A 4J1OA 4WSHA 4ZODA 3QM3A 3EYPA 4H19A 3C0SA 4OKDA 4Y96A 2QCCA 1P48A 4M81A 4EPDC 1B5TA 3C2EA 4TXEA 2YDAA 5LGZA 3W2LA 4EACA 2Z6IA 3LRLA 2OELA 1J0IA 3WMSA 3W1NA 4BKNA 4IPLA 4ZB5A 1KQZA 5I5RA 3PHAA 3ONBA 2LLEA 3I10A 1VP5A 3IIZA 4FR1A 3VNDA 5FL1A 3CEUA 1UJQA 2IPWA 3GLCA 1T8XA 1F9CA 3WLNA 2HISA 1KCLA 4P7OA 4MZ1A 3R13A 1LRNA 2ZCGA 3VMOA 3MQTA 5ECUA 3GNNA 1OHLA 3PG8A 1TV7A 1M53A 4QSHA 1DJIA 1T99A 1XP3A 4AZ7A 3UGRA 3KBMA 3LX9A 3TNBA 4QE4A 4DPQA 4HN8A 5ABFA 2WSRA 2CLLA 2YBTA 1UROA 2WXDM 1AD1A 2VGGA 1HVQA 2FFCA 2WVVB 3B9DA 3WQ5A 1Y8BA 5C5YA 4ERGA 2Y0FA 3RMEA 4DBUA 1TPWA 2CBUA 3SFWA 3W37A 4YCPA 4GJ1A 4RXFA 1H3GA 2KX9A 1OX6A 5FJIA 5A2AA 4JTDA 3NZQA 1GYMA 1XIJA 2EJAA 4FLOA 3BV4A 1XR2A 1MW2A 1OZQA 1TJPA 3W7EA 2A3HA 2XDFA 1EDQA 1OD0A 5ABEA 3PZNA 2PC4A 4BQ4A 2R24A 3UP8A 3S6DA 1SJDA 4J2MA 1YYAA 2PDGA 4ATWA 4ZTXA 5E0CA 3LERA 2BMBA 3KDOA 3W4RA 3KDNA 2XGZA 3P0XA 3L2MA 5HULA 4LH8A 5CJNA 3TIMA 3BAIA 2OOFA 2V6AA 7ENLA 2WOQA 3VGGA 3W7KA 4BEUA 5A8QA 4H41A 3MI2A 5D2YA 4B92A 2I7GA 4FNUA 3G1XA 1VR6A 4BI5A 5I2UA 3SN4A 4NZ3A 1OFRA 4N0RA 4DWSA 4H9XA 2X7VA 1FDZA 4H6RA 2OJPA 3M7SA 4TX8A 5BW6A 1VEMA 2CXEA 4UZUA 1KTCA 2X41A 2G37A 4Q8PA 2VWTA 4DJFA 1IV8A 1Z69A 5G2IA 5A2BA 2NQ5A 2HEJA 3HOJA 4AZIA 1VJSA 5JIWA 1XLEA 5GVJA 1XG3A 1HTIA 1YBQA 4NASA 4KGJA 4MOZA 3N3TA 3V18A 4O1AA 5CZSA 1JCMP 2WC3A 3PPGA 1CIUA 3SCNA 4KMQA 3C56A 3LEPA 4IMFA 1JVNA 1GJUA 2VZSA 1J10A 2ADAA 2RDUA 1CNVA 3DYMA 4IJBA 5I78A 2XIIA 5G4WA 2E0PA 3SY5A 5HWMA 1XRSA 5FD0A 3VI2A 1K1DA 5EYWA 1DWFM 2YFOA 3CGTA 2RFGA 4AD4A 6REQA 1R3RA 3O15A 3O0KA 3U0HA 3OBKA 3UY7A 3GYCA 4Q3MA 4UR8A 1WPCA 1XDMA 3GIQA 1A5UA 3S5YA 5FEWA 3GXPA 4F0SA 5EB8A 3ZS4A 1Q13A 3FCPA 4JTUA 1P6CA 4DRSA 1FWTA 3MDUA 3QC3A 3XISA 2G3MA 1TMQA 1XGZA 1Q2RA 4UNLA 2WSPA 2PLMA 2PDBA 2ZRYA 4KRTA 3QZAA 5CAHA 1VGAA 4O0QA 1S2VA 4LW7A 5AOUA 3W81A 5GQBA 3MCNA 1X98A 2GVJA 3G18A 2DFAA 1RQHA 3LUTA 3REQA 3WIJA 4N9EA 1X1NA 2XN0A 1Q45A 1RJQA 3C2YA 1E5JA 3LLDA 1Q7MA 2J7FA 1CXIA 3UJRA 3RX2A 2V63A 2YZ5A 2Y7GA 4AZGA 5L9FA 2AAAA 2EGZA 4UBPC 1OABA 1C92A 4WDUA 5TF0A 3EWWA 2CLHA 2WPBA 1GTEA 4GC4A 3O6CA 2VR5A 2O9PA 3WELA 4LY4A 2VX6A 4TX6A 5AC4A 1SSDA 1R30A 4MY8A 1M41A 1FWCC 1HKVA 2DQXA 4ZQPA 3IVTA 1B30A 3G1FA 3NVTA 3N2OA 4IISA 4PRRA 3SECA 1T7LA 1IEIA 3VE9A 3H7VA 2Z2UA 3M07A 4AY8A 5EFFA 3LTYA 1W1TA 3STFA 2V3DA 2F38A 3WL1A 4XZLX 1BGAA 1SO6A 3CUGA 1OFPA 1NAL1 3OGRA 3IJ6A 4XO6A 3W1RA 2PDYA 1Z3NA 2JGQA 2CHOA 2UY5A 4D9PA 1JDEA 3DZ1A 2J4GA 5LNSA 3TW6A 2GSHA 2ZX6A 2JALA 5CH9A 3CIWA 3TXVA 2Y89A 5LIYX 1J6OA 3RM9A 2VDHA 1V4YA 3EWUA 3G5EA 1KBKA 4RNHA 2PWVA 3KM8A 1EHNA 3ZJ8A 1W5NA 3NJ3A 1CXKA 3VIKA 5LSMA 4RZBA 4TVUA 2PI6A 4LOCA 3AICA 4W4QA 3BG5A 3SGGA 3DFPA 1R8LA 5EY5A 2WVUA 1BD0A 1E0WA 3V5FA 3O06A 3GHSA 4GA8A 1YE6A 3UG3A 1RK6A 2A1YA 3M5XA 1P6WA 3CM4A 3DG7A 5CGQA 2WZIA 4LAOA 2NQZA 4R3UA 2YLLA 3NGJA 2D24A 4UCFA 2OODA 5D05A 3D46A 3PUOA 4S38A 5AFDA 2QCLA 1TPH1 4C6BA 1X1ZA 3UW6A 1ONEA 4XVDA 3W38A 1IT7A 3HV8A 1T0OA 3TQPA 4HJFA 1L6FA 3W70A 1ZGDA 2VKZG 1XIEA 5JQ9A 3W7NA 2DZUA 1DJYA 4XSMA 1QOPA 2B7PA 1U5HA 1PSCA 1CPUA 5HUPA 4S3JA 4IL2A 5FA5A 1VENA 1XRVA 4E8DA 2GDQA 5REQB 2ZE3A 4JEJA 4E2BA 4FLSA 3UJFA 4Q8TA 3LHYA 1W56A 1Y0EA 3QKEA 2WBKA 1RVGA 3K46A 4OE7A 4Y7EA 1YHTA 4JNYA 4FOUA 4B3ZA 2BOFX 1U22A 3H2CA 1IEXA 1IXNA 4IG2B 3S8HA 5J8LA 4O52A 4Z2KA 2ZE0A 3WH6A 3TYDA 2FB2A 1W1IE 3A4XA 1PPIA 3ABXA 2W3ZA 4DF0A 1XG4A 1YPIA 1S3TC 4O53A 1LORA 1VFFA 2GGGA 3GH4A 1MW3A 4AWUA 1B3ZA 3T05A 3WQ8A 3SR7A 1V51A 1TE6A 4UTLA 2JIEA 3JS3A 4LTSA 4MDPA 5HUOA 1NOWA 2VOTA 2YFNA 2WZTA 4O57A 4X2RA 3VD5A 5U4NA 2X1UA 4FLRA 4AD3A 1XH0A 5HMFA 3SRHA 4BR1A 1UP2A 4P8VA 1BWLA 4FF7A 4GUIA 2WCAA 4NXSA 4FALA 3VXGA 1QUMA 4AHPA 3W87A 2I9UA 3NL2A 4KESA 2GLKA 4M8UA 1EQCA 2DU2A 4YHEA 1BVNP 4HPJA 3UR8A 4EE9A 1KLYA 3RFAA 2HE5A 1RLDA 3GR8A 4DLMA 1X8FA 4NAFA 3F5KA 5E1QA 1C91A 5EMMA 4RXGA 7XIMA 4JTKA 3GAYA 3UG8A 4MWAC 4GIAA 2BASA 1KD0A 2JKEA 3SUSA 4YCOA 2ABAA 2DSUA 3WQOA 2QJMA 2PWGA 1LJYA 4QHRA 3CLWA 1KBLA 2NLYA 3KP1A 3HBLA 1VQTA 4LB4A 3ITLA 4HTYA 1MNZA 3URQA 1V3JA 2XVGA 3SRFA 1M3UA 4PSRA 1R46A 3T0AA 1GHSA 1RPKA 3LENA 3ZXWA 3FA3A 1EXBA 4UQBA 2QF7A 4YWSA 3U7VA 3NPVA 3FYPA 2YW4A 5K9XA 1XLIA 1EZWA 4Z1BA 3OLIA 4JZ5A 3LPOA 3UR5A 1DJWA 1ECQA 3CLMA 1ZQ5A 1C8XA 2GJRA 4W8LA 2CW6A 2J13A 1P4CA 4IP4A 2PDQA 1P5BA 3WQ4A 4JTRA 4JTSA 1Q6LA 3T55A 3UBPC 2EKCA 4PFMA 3THAA 4GFIA 4W88A 5D2WA 2WNWA 2WNQA 4Q32A 5ABGA 2ZDSA 1E9ZB 3WJZA 1A0DA 3GNPA 3E3HA 4B16A 1IT8A 3VMNA 1S5MA 3TEVA 1RXOB 1YTKA 2UZ9A 4Q7IA 2C13A 2ATMA 4QDMA 1OD8A 4OBRA 4EPBC 3GTIA 1ZB5A 4LBRA 3PFRA 1JCLA 4WSJA 1PYFA 4LVAA 3PNUA 4UQ9A 2IPGA 5CG0A 2W61A 2AQVA 4JNZA 4QR6A 1X1OA 3C4UA 1EPXA 4U5KA 3AS2A 2EG6A 3PUGA 4DWSC 1GTHA 4WVXA 1RLCL 4GISA 3TA6A 2ZRWA 1RQBA 2NX1A 4O1DA 4HSNA 3TA9A 1J5SA 1MI3A 1ICPA 3LD5A 5FJPA 1QOXA 2REQA 1WDPA 3ZLFA 4CVWA 5A3HA 4DJFC 4MY9A 4DUWA 5DLCA 5C0QA 4WGXA 4GYFA 1F3TA 3VUSA 3HTWA 3H2OA 4GUHA 4RDZA 3KE0A 4ZVJA 3W6LA 1ZU8A 2Z0IA 5AVHA 4UQEA 2WWCA 3WEMA 9RUBA 3UZWA 1BYAA 3TW7A 3HB9A 4GACA 1EUNA 3CZKA 4KGLA 3WLJA 2YX0A 3G3DA 2INZA 2W92A 4X60A 4WX2A 2WSYA 4H01A 3CHFA 4YPJA 3GNDA 4NI8A 3O6AA 4BQ5A 4H9VA 2WSQA 2BTMA 3KCJA 3GXTA 4IIBA 5T9CE 1I4NA 4B4FA 2W67A 1LT8A 4MLRA 3WF0A 1I2RA 3MMDA 1F61A 1UKQA 3H22A 4QISA 1ENUA 5G4EA 2ZVRA 4GQRA 1G0CA 4AHOA 3GG0A 3QV9A 1A5NC 4GO9A 4R7WA 4ICMA 4UTKA 3AISA 4LVDA 2X09A 2TPSA 1LOQA 3G0XA 3PJUA 1N82A 1QOQA 3N12A 3TP4A 2E9BA 1T6MA 3NO1A 3N19B 3P67A 3BE7A 3DFQA 4H1ZA 4IPPA 2C1GA 1TRDA 3W53A 1TSIA 4FMVA 3R11A 3ID7A 3W07A 1KM0A 3ANYA 1UD5A 3UZZA 4HBKA 3BL3A 1PV8A 2NV1A 3AHYA 4KT2A 4PBFA 4DM1A 6ALDA 4JR5A 4JD4A 1H7XA 3FAXA 2UY4A 1FDYA 2A2IA 4UCGA 3PZ9A 4XQ6A 3UXKA 5A6JA 4I9AA 3WD4A 1OYCA 3LCIA 1JD9A 2XSAA 4IPIA 3GRIA 4B91A 3FYOA 3TJIA 1PKMA 5JH1A 3ARWA 3MHUA 4QGCA 5CZTA 2BG5A 1I75A 3QV7A 2QPSA 4N6EA 3O6DA 4ORIA 1MXSA 4F9JA 4A3QA 1DIEA 3VGHA 1JGMA 4S3KA 1HW6A 1W8GA 3TH6A 2E1DA 2YW3A 5A6BA 2VZTA 3H4XA 3W76A 2HXTA 1D3CA 1XGEA 2OZ8A 5LHEA 4V28A 1DHKA 3UJ2A 1JF5A 2HK1A 3A23A 3EKLA 4XKYA 1E3XA 4AF0B 4MGGA 1D7KA 2ZUVA 2XSBA 3G6LA 3OZMA 4PFHA 4F0RA 4C6IA 3VZZA 3DIPA 4AEFA 3MUIA 4JTLA 1J0ZA 2HMCA 3R10A 3BURA 3GIPA 1XXXA 1CWYA 2H3DA 4OQVA 4XTDA 1EWEA 1LUCA 1GG1A 1PZ0A 1H2JA 4H4IA 3T1GA 1PS9A 1KRMA 1PDYA 2ISVA 4OGZA 5E9AA 2OXNA 2QIIA 3OLEA 2WZEA 4PR4A 3OYZA 2GVGA 3H53A 4LCRA 3G1VA 2RDXA 5IM51 3TONA 4L9YA 5C2XA 4NZ4A 3PWIA 3W2UA 4FB7A 4AFYA 4PH6A 1TV5A 4I7WA 4ZB0A 4FXSA 4M6PA 2VDIA 5TAOA 1FWGC 3C3NA 2DT0A 3H12A 3ZJ6A 3WDQA 7TIMA 2WMHA 4J3WA 4I8DA 1XRTA 1BYBA 4C6LA 1GZJA 2ISFA 1PWMA 1NM9A 3T6CA 1GVFA 2BY3A 1NQ6A 5U7SA 4L6OA 3T40A 1LWIA 2GPTA 1OZMA 2FMNA 2DT3A 2XVNA 4GGHA 3BMVA 4C60A 3E02A 2OGYA 3AU2A 3LV5A 4HPGA 3VNIA 2ON3A 1GVOA 1V08A 4K1WA 1C3FA 3TQ0A 1MFUA 2ZUSA 4M7TA 1E6SM 1PTGA 1QT1A 1A3HA 4FHAA 2CLMA 1FTXA 4GCXA 1WAUA 2QDHA 3DC0A 1HO1A 3G1RA 5JBEA 4QG6A 1IQ8A 2XN2A 4ES4A 2WKGA 1JCNA 3ITGA 3EDKA 3GG8A 4XVEA 2PRLA 3VKKA 1JPKA 1XLMA 3SW6A 2PURA 3C61A 1WE5A 3Q45A 4R33A 3TYBA 3DKLA 3HURA 3A47A 3TCSA 1HF6A 4L64A 5HATA 2YXXA 1UWSA 4OBSA 1EJVC 7A3HA 1OC6A 4GI8A 3N04A 3PBWA 3L9CA 3UETA 4W8BA 3LS9A 2ZQ0A 3VOFA 3P2VA 3GDLA 1EC9A 2GQ9A 3M0KA 3PBGA 1VFTA 3AXHA 3VKDA 1RZMA 4ML4A 3VZYA 4C6EA 2YB1A 3HO8A 3H21A 5JBFA 1PXGA 1HKIA 4ZMGA 2VDGA 3MI6A 4QROA 3VAVA 4RE4A 4NP7A 5FJJA 3W7QA 1J93A 1DIKA 2P50A 3VKJA 3LSBA 3OHMB 3R2GA 4FA3A 2V30A 4PCPA 5EMKA 2JGYA 3H7RA 3I3EA 5BNKA 1CI1A 1QR7A 3BOFA 4MKSA 3M7WA 1XKYA 4H7ZA 4AU0A 2J9XA 4BK9A 4ACZB 3E0WA 3RUBL 2MANA 2A5HA 1G5AA 4EIVA 4JTJA 4XKMA 3WQGA 2Z29A 4NT0A 3M46A 5HWNA 2NZLA 3M47A 5I3GA 1QPQA 7REQB 4R27A 1P7TA 3R1ZA 1AZ1A 2B81A 2FJUB 2VEKA 4ZTYA 1DYSA 3FIGA 1LRQA 2OT0A 4REQA 1ISWA 3FSTA 4MNMA 2XUCA 3SO7A 4DBWA 4IGMA 3RCYA 4JTTA 2YCLA 5BMWA 4M80A 4JFWA 2RGMA 4U3CA 1WCGA 3KRZA 2VT0A 1UH2A 1X7FA 1EGZA 4ZGYA 5BMXA 3A5FA 1R3TA 1C8VA 4GPNA 4F66A 4Z2GA 1UWQA 3W00A 1FWIC 3P5ZA 4UTIA 3MJMA 1OFBA 1JCTA 3V5CA 3U57A 1IXOA 3NQ8A 1G9HA 1LBMA 2PB1A 1E56A 3CZJA 4C7DA 2PLKA 3JW7A 3MY9A 3WDJA 2F2HA 2XSXA 3CWNA 3EX6A 1SM9A 2X42A 5M3WA 3HGOA 3S9ZA 3PNZA 1C90A 3HJZA 5FI8A 5C2CA 1OYBA 3QXBA 4J3VA 3FGCB 1DKWA 2QMJA 4PBEA 5CSSA 1AK5A 4ROQA 1U1JA 3SCQA 4UUIA 1P6BA 3HQ1A 4M6VA 3C52A 3B06A 2ICSA 4JNMA 4YNGA 3ZWTA 3F5JA 4V27A 1WV2A 2D2JA 3MV11 4DB7A 1ELSA 4GINA 4LUJA 3UT0A 1FWNA 3UWYA 1V3IA 2ACUA 4QFUA 4NJHA 4HKPA 3S1VA 2HK0A 5AKQA 3CEPA 4DBSA 2F6KA 1LBLA 4HZ6A 4E6MA 4GXPA 2PFHA 2QLYA 1J9YA 1JZ2A 4PTWA 1QPNA 1W1A1 2VX5A 3GTXA 5DT7A 1J79A 3NQ6A 5G2HA 3OLGA 4MADA 3EPOA 2DUXA 4Q4QA 3M4HA 4IHCA 1E9IA 3KBNA 4FNRA 2DORA 2Z26A 5DEZA 4XZNX 4PB4A 1JAKA 1HP4A 4JFUA 5XIMA 3C2VA 4CGTA 3E6EA 2QUMA 3PZVA 1TWDA 4DJDA 1K9FA 2Q6ZA 3B8UA 3GUGA 1SO4A 2GQ8A 1TWSA 3SZ8A 2OFJA 2PPGA 1PX8A 3LRMA 3E0FA 4GX9A 1U1HA 1XLLA 2I5QA 4XZWA 1BSLA 1QHOA 1HZYA 4ZXLA 1FWHC 2EO7A 3P7YA 2PDJA 5KTLA 1Q6FA 4Z08A 1TTJA 3KZPA 3ARUA 5IOBA 3QTGA 4WEVX 4NYUA 3N2CA 5LZLA 4W9TA 3ZT6A 3KHJA 4K36A 1O5KA 3VKCA 3TYZA 2XIMA 4C1NB 3K8MA 1V7YA 3CV1A 1C7TA 4JGDA 4KBXA 3KEHA 1F3EA 4PUEA 1V93A 1D3GA 4DI9A 2FZ9A 4LUIA 3ZJKA 3W1PA 3GZ3A 3BG9A 3HJEA 3WJWA 4C65A 3UESA 1VCVA 4YXGA 3VIHA 1PCKA 5LA2A 2E28A 3S5NA 4DBEA 3LXCA 3HG5A 2PU1A 4GUJA 5HMDA 3B03A 3NQEA 3MMWA 4GGBA 5B80A 3NZ1A 4U3AA 4DJED 3EKZA 1V6YA 1XPGA 2C0AA 1UA7A 2W0UA 3P0WA 2XINA 4HJWA 3O05A 2VGIA 3FA5A 5EMLA 4IJRA 3BOXA 1ZBCA 4WXZA 3FYYA 4JIRA 2F84A 2Y24A 3TSDA 4AH7A 3QLDA 1BVWA 3CK5A 4BQ2A 4LALA 3E0VA 4IQLA 4WKAA 5BZAA 4JFSA 3L5LA 1Q7ZA 2ZXAA 1GW9A 2ACQA 1WXZA 1T96A 2C71A 3EA1A 5K9CA 4JTIA 1IXQA 1EQPA 2NVCA 1PJ9A 3DC8A 3BW3A 1FQ0A 4I6KA 3TN5A 3KTCA 1RBAA 1WBHA 4CD7A 2P3ZA 2V0TA 3RLVA 2GSJA 2O4MA 1JG9A 1E1CA 4ICCX 1WOBA 4Y6GA 1S3HA 4LS0A 1XIGA 4NX5A 4XUYA 3UCCA 1FHDA 4GOAA 4K6AA 5DBTA 4BJHA 1Z41A 3N9RA 4IQDA 3L7RA 4IPNB 1JXKA 1NH6A 3OU8A 2WC7A 5D9NA 1Y65A 1Q85A 2Q09A 1XLJA 4LCQA 1EPVA 3TYEA 1E3ZA 3FJLA 2E5DA 2OWWA 5FEPA 2HVOA 1PIGA 3M44A 3VD7A 3TYCA 4TU1A 4UQCA 2IXUA 3QTPA 4NQ1A 2X40A 4K7YA 3U3HA 4RE3A 2OZ0A 1K70A 3DH7A 2PBOA 4HP5A 3FEQA 3EEGA 3EDJA 2DV0A 3WK2A 1W5QA 5H8MA 3PJWA 3PPFA 2VTFA 2QVNA 4PC8A 2BY0A 3NQVA 3IJ7A 4J2PA 2HV5A 1TA3A 3TN3A 2VOMA 2TSYA 1I2NA 1LQ2A 1DQUA 2ZZ4A 3URAA 1J96A 3QMSA 3ZYZA 4HCLA 4XB3A 3UERA 5CJ5A 1UJPA 4D6GA 5BRQA 5F2LA 2JBMA 1E6ZA 1JF6A 4DX3A 3PZMA 5D04C 1FXPA 4HZ7A 1A0CA 1UR2A 1UC5A 2I9EA 4CNNA 2DZAA 3BCJA 3P84A 3JZEA 3S1UA 3WUBA 2VJXA 2FHFA 4KFPA 4UWMA 1AQ0A 4XV0A 1Q6RA 1BTCA 4LC8A 5D38A 2VENA 4A22A 4E38A 5A8OA 3CV6A 4XAZA 3W1MA 1S1PA 3BG3A 1JDDA 3LLXA 1LYXA 2J7HA 1T5AA 1DJNA 3PB2A 3R79A 2OOGA 3U4AA 2VVNA 1MW1A 3F7JA 1ZJBA 4K2SA 5DMMA 3SI9A 1AUSL 4ZEPA 3WENA 1GVQA 1O1HA 1QWKA 3W6MA 1FOBA 1OFDA 4ZL1A 4LUYA 1TR9A 1DE5A 1KV8A 2DW7A 2XFYA 3GHRA 3MP3A 3B0PA 2HNHA 3BLEA 3SCUA 1BKSA 3HF3A 1SZRA 2IS7A 2W79A 2DT1A 3PBMA 3VIGA 3B8WA 3IANA 1H1YA 1PAMA 1TYGA 2YDSA 5DMYA 2DUZA 4RDWA 1MNSA 3DKJA 1DQWA 1MXDA 1YDVA 3TK7A 2V68A 4MB5A 3DU0A 4ZOCA 3ITTA 3Q37A 2H90A 4H6EA 1B3XA 4HOXA 4IFOA 3LBMA 3MWCA 4PBGA 4CN1A 1L8PA 3EX4A 3PTKA 3PPHA 2VEGA 5FESA 1A5BA 1S5NA 1IXPA 1GQIA 2B7QA 2V5LA 3UFYA 2G8ZA 3VIIA 1MUWA 2HCVA 1U5VA 3F2DA 4JXCA 4JOMA 4M6UA 1EOKA 4XK2A 3M41A 3DEQA 3W1AA 2A21A 3ZVHA 5KSWA 4H04A 4PMNA 3LZ3A 5FF2A 3WQVA 3LG3A 3W71A 2PTWA 2PDCA 3T81A 3P93A 3THQA 3GVQA 4LYPA 1TG7A 4AIUA 2OG9A 4C6NA 5D4YA 1MEWA 3JRKA 1CDGA 1GYLA 4G1NA 5D2VA 1W91A 5CQ1A 3C5QA 1JYNA 3A24A 3MUCA 3OPSA 4L9ZA 3VDAA 3W1LA 1TTQA 3PF3A 4HZ8A 1UIOA 1X6LA 5CPQA 4R85A 1IWBA 2DP3A 4L4PA 2W9MA 4DJFD 4LVBA 2BXYA 1AMKA 4PN2A 1EP1A 4LAUA 4H2HA 3BARA 4S3GA 4LFYA 3KVJA 1WKDA 1ZAIA 2R14A 3DFNA 3PANA 3S6TA 1MQRA 3PZOA 5DRCA 1PTAA 4XBJA 4HPNA 5D8ZA 4YTRA 3O7UA 3VC5A 4L56A 4XIMA 1GPWA 1B57A 3NR0A 3LU2A 1WXJA 3TCEA 5A6LA 3CL7A 4ZXOA 4GNKB 3GTNA 3WD1A 1OX5A 4NJGA 2VC5A 3VU2A 2D0GA 4Q8WA 1EF2A 1R5YA 4IPJA 1BFNA 3MU7A 4D6IA 3TOPA 4O54A 3DYOA 4HOZA 1VC4A 3LY0A 2HWGA 2DH2A 4ZO9A 4S3CA 3M9YA 1WUFA 4M1RA 3I7QA 4RK8A 4HK6A 1LQAA 3WYZA 1OIFA 4YIWA 1NWTA 4FO4A 3QFWA 4J5NA 1GVSA 3OVGA 3ITOA 3HPFA 1NFBA 3WLRA 3HQPA 4DUOA 3TAKA 1RSCA 1E0VA 1UUQA 4O11A 4G1KA 1RA0A 3HPXA 3GW3A 1JCJA 4RCXA 1R7OA 1GZ1A 2DIJA 3TC3A 1OVDA 4IX2A 1GOIA 4DO7A 2D20A 4EAMA 2JFEX 2VC6A 1YDNA 3NQGA 2WMFA 1LTDA 2WAGA 3R89A 2VRKA 3RN6A 2XM1A 5K4XA 1IF2A 2PS2A 2Y8UA 2DGAA 4GQBA 4YTSA 3TC7A 3WLLA 1NFPA 1HL9A 2E9LA 1TV2A 1UASA 4QEHA 3ZSSA 4S3AA 4UQDA 2WVTA 5AZ1A 3M0MA 1EYWA 2WYSA 3AIBA 2QT3A 4TTUA 3CL6A 4M24A 1WNOA 3LI0A 3ISIX 2CLPA 1FWWA 4YYCA 2PODA 3ZR6A 4O4VA 4PTMA 1LCOA 4U31A 1D9EA 2F6XA 2QYGA 1G69A 2CLOA 2CBVA 3UWWA 1AW5A 2FJKA 4ZBCA 1CXEA 1FRBA 2BY1A 5EFDA 4QS5A 3V16A 3QR3A 3E0LA 3UD6A 2EXOA 2MNRA 3QY6A 3WBXA 1K9TA 2BVWA 1U5JA 1LBFA 2QNEA 3TMQA 1FWJC 3B05A 2W5FA 2E77A 3C8NA 1XDJA 4JL1A 1K4GA 4LC6A 1BWVA 1TPB1 1CECA 1H62A 2QGHA 3EWYA 2A3EA 4IIHA 5LA1A 2V82A 3T2OA 2NWSA 5A6MA 4EXBA 1FWSA 2X2YA 3NFUA 3CWOX 2Q8LA 1AJ2A 3LHUA 4NZJA 1NWUA 3NYZA 4O0ZA 2WBGA 4GYJA 3CXOA 4CNUA 5AC6A 1RP8A 3TR9A 3UCDA 2XISA 3PY2A 5BYWA 2G95A 2HTMA 1HJVA 2CZ5A 3FDKA 5C2GA 5EBUA 4O18A 3VX1A 4D6EA 4RX0A 4WKFA 2ZTKA 2XU2A 3SSJA 5I06A 2VGBA 1QMLA 1UZ1A 2JIWA 3GG1A 3SIMA 1VFHA 3N1AA 4M1BA 2QCEA 1H7RA 3VNKA 3LMZA 2DVTA 1XIFA 4GBDA 4MJ4A 4Y9AA 4UB9A 5DMLA 2XPKA 2VRQA 4PB3A 2GDUA 3FAWA 2GJNA 2PE4A 1KWGA 4HYWA 5AC8A 6ENLA 1C29A 3GE7A 2CEQA 3IIPA 1RHCA 1VBGA 4XAFA 3IV8A 1RCQA 3R43A 3K30A 2G96A 3OYXA 3V5OA 1UBSA 3RRXA 1BEUA 5CC3A 5C7VA 1FCBA 2AMGA 2C7FA 1TFVA 1ZP4A 4QQUA 3LYEA 1YXCA 4TO8A 4GUFA 3ME3A 3MV01 5JMUA 4LUTB 3FS2A 1U83A 3W7OA 2OSYA 1US0A 4N02A 2G0WA 1UWAA 4WJEA 4H2CA 3TTSA 4IGHA 1SZGA 1E4MM 4WD0A 3GKFA 3GXFA 4I5UA 1WDQA 4AY1A 4K7VA 3DX5A 4OIFA 3RO8A 4H9MA 3MJYA 5BCAA 3QPZA 4JX5A 2ZVIA 4W84A 2EJ1A 1TMHA 2WVVA 3L68A 4FR6A 2FVLA 2XWEA 2IQTA 2R91A 2YDRA 3G8EA 1DOSA 3VGDA 4WQ6A 4NSBA 4QTGA 1EGVA 4D6CA 3IGXA 1X6UA 4N2YA 3VK5A 2PBGA 4F0LA 2YOCA 1JDFA 3EXTA 2XH2A 3P82A 3R5EA 3GDTA 1UHVA 4NKCA 2AMXA 1J18A 1MW0A 4YN5A 3N34A 1XYZA 1Z89A 3LQGA 6REQB 4PZVA 4IL0A 1ZRQA 3MP4A 4IX0A 3HMJG 4EANA 2X8RA 1Y5VA 2BHYA 3OGVA 4GNVA 1K8XA 1TPFA 2ZDRA 3WDHA 1YTEA 5AHMA 3WSUA 4LPCA 1CXFA 4ZO8A 4GLEA 3IUDA 3H4GA 1PVNA 3IK4A 2PP0A 4IZGA 4IFRA 2FFIA 2OQLA 3KBVA 3LDVA 3M16A 3PM6A 1W9UA 1OGBA 3N17A 3I6RA 3OIXA 5FEXA 4LBUA 1ALDA 2ALDA 3TR2A 5HPOA 4C1LA 1OCQA 1S2CA 2QMKA 3W1UA 4DNMA 1OIMA 4KIEA 4PYSA 1UA3A 2OQYA 5LXEA 3BJFA 2EPHA 1VF8A 2ZWYA 4I3GA 3UZXA 1F07A 1K4HA 1UZHA 4FNSA 4DXVA 4IMAA 1ZTVA 5FOOA 1EF3A 1GZGA 2GUBA 3STGA 5BU9A 1FCVA 1KM4A 1XJBA 4EK7A 1GEQA 1P0DA 2DPEA 2YXGA 3HZ3A 3U48A 3AUOA 1QJWA 1P0KA 1E72M 1F3XA 2WV8A 3DYPA 1V0LA 3FY1A 5HMEA 3V1HA 4ASTA 4S3BA 2R1LA 3QV6A 4Q7NA 3PZGA 3C0QA 4FXRA 1KR0A 5KZ6A 1RUSA 3A4WA 4AYSA 1ZUAX 1W9XA 4R5EA 3TROA 2J79A 3R0UA 2GDVA 3K2GA 5AHFA 3XINA 1LWHA 2WCSA 1TQJA 2Z2AA 3V0UA 1Q6GA 2G41A 4IUOA 3UWUA 1HQTA 3VCRA 1E15A 2YA2A 1JZ6A 4LGXA 1YPFA 2PC8A 3URBA 2HDJA 4JTAA 2DQWA 2PU0A 4ZCWA 4TMCA 3FJ4A 1DJZA 1A5AA 4XTIA 4AZBA 2Y4SA 1JQVA 5FF7A 1XBYA 3HN3A 3WCZA 2E1WA 1EL3A 1A5KC 1M65A 4ZB2A 2ZZ1A 4GJJA 2X1IA 4F2BA 1SFTA 2GYIA 3MA8A 3WFAA 5HOSA 2EPOA 1XIBA 2ZFAA 4EPEC 3LGDA 4GVFA 3TJ4A 1QNQA 3BLFA 3BGGA 3GHTA 4P7LA 4YTUA 5DF0A 5TQLA 3FHAA 2G97A 2ZC8A 1AW1A 3M0IA 1FX6A 2VCBA 3BAJA 3DI1A 1PTDA 3C2FA 3CT7A 4XZBA 4ML9A 1TO3A 3GTHA 5K4ZA 3W25A 1K8CA 4ALDA 2DT2A 1VKFA 1G4PA 4QJ1A 3ATZA 2XZ9A 1TJ1A 4GY1A 3VKBA 5FSEC 4LF2A 4DYKA 3LCLA 4QNEA 3S4TA 1QK0A 1J0JA 3LCXA 3R94A 3KCOA 2DZSA 5C9XA 1VEOA 3CAWA 4Y9PA 1IR2A 5EBAA 2EQDA 1QASA 2RDWA 1EDGA 1AQFA 2PTDA 2NWRA 1F6YA 2CETA 1CT5A 3NSXA 1O6IA 3W83A 2HROA 2PDIA 3BQ5A 1F6KA 3KOFA 3U5UA 5FIPA 3W3OA 4QS6A 1K9DA 1Q4NX 4QQ3A 4M56A 4V1YA 2AL1A 4NI3A 2C19A 2BXZA 4A2RA 1W3TA 3K8KA 1IHIA 1ITXA 1TV4A 3VM5A 2BOEX 3AQUA 1AMYA 2Y8KA 1L9WA 2JKAA 2GVYA 3LA4A 5HANA 1KFJA 3EA3A 3KCLA 2QCDB 3CUZA 2WNNA 4LSBA 4CQDA 2QCFA 3MCMA 2NQJA 1W3HA 3SQMA 5A6BD 3CWHA 4JBRA 5A6SA 4JQ2A 4GY0A 1R3VA 4W7WA 3TVAA 4CD5A 4WDXA 3AMCA 1XBVA 2VEMA 1FY6A 2DSKA 5HA7A 1R2RA 1DQXA 1XLHA 3HPZA 3TYUA 3B9NA 1TV3A 1SFLA 2ZA3A 3O3RA 2WK2A 1R3QA 1NARA 3T7VA 4AX6A 1YRRA 5AECA 3ZT7A 3NQ2A 4LB3A 2B4GA 3P14A 3L0NA 5LIKX 1A3WA 2OVLA 2Y7DA 4NAFB 3BLKA 1EO5A 3PAOA 3TAOA 3QHOA 4PCTA 1VRDA 4KEMA 3R0KA 4PTDA 1E5NA 1V02E 4N9BA 2PGEA 4ZQNA 1A49A 3JVAA 1GORA 4CQCA 1GQNA 3VNMA 2XGBA 1UOZA 2BB0A 3PUDA 5G5IA 1RP9A 1IEVA 4QE5A 4RV3A 1B9BA 1GOMA 3WF4A 1RJRA 3WQFA 2ANUA 4XBKA 5E5CA 3FLUA 2Q3RA 4K68A 1GT8A 3INPA 4MYAA 5C55A 2O7SA 1H41A 4UIOA 3OGSA 2J7GA 4GZ7A 3CTTA 3CHDA 3IVUA 3EMQA 4L6HA 1JIBA 4J4KA 3IAPA 2OEMA 2NSOA 1GW1A 3E12A 3BUVA 1JZ7A 1AJ0A 5TBOA 1XYBA 1W1YA 1MXGA 1W3LA 2XZ7A 5LIXX 3BMWA 4C7GA 1P0EA 2IPJA 3M64A 4OOZA 3TW9A 2ZUTA 1GKPA 1XDLA 2ZRZA 2Z1KA 2XIQA 4O19A 3RJXA 1BVZA 3BANA 1KCKA 1KM2A 4GE8A 4NILA 1BAGA 4Q8QA 3BDKA 1LLWA 1PX4A 5HQEA 2FMOA 1FHUA 1G67A 3GM8A 3T2QA 3CUFA 2UBPC 1IEWA 2V81A 4HVXA 1QATA 2DJLA 5LNRA 2GGEA 4PEKA 2V5JA 1YNQA 3BWWA 1UWUA 3CL8A 3T8LA 3GBDA 5AC7A 2XIJA 1EWDA 5AHIA 2ISSA 1KFCA 1XCXA 1EFZA 4ERIA 2JE8A 4LV9A 3NL6A 3EMZA 3ZM8A 3AZTA 3GAKA 4H8UA 3NM1A 1FWBC 3LNMA 1OQFA 1CX9A 1FDJA 4A4AA 2WPGA 5C8BB 3FDGA 3PN8A 2WMJA 3GW0A 3V7PA 2D22A 1UYQA 2X1TA 3L4WA 4QLLA 2Y7FA 5H1WA 2OPJA 4GUGA 4EPKA 5ABTA 3M5ZA 2VD8A 1ZAJA 3SEPA 2J88A 3WL0A 3N2TA 3AWNA 4C6DA 1RVKA 3FJ6A 2YXOA 3F4VA 5F2MA 2BLEA 1AD4A 1EJSC 2WVSA 3CV7A 3GUWA 4R9XA 4DPPA 1NSJA 3I65A 3WH7A 1HKMA 1DL3A 2PGFA 2WJEA 1V77A 2VL4A 3RM8A 3GFZA 3WLOA 1KCXA 3QZEA 4LVGA 4FX8A 1Q7QA 4B90A 1R38A 1EP3A 3WK3A 4KEZA 3B04A 2C14A 3A21A 2X05A 1K77A 1MUMA 2VO5A 3Q4DA 3GDMA 3N9SA 4UTUA 1VFUA 1GEHA 1XX1A 1WDDA 5F1VA 1CGYA 3EGJA 2ATSA 3EX1A 3HG3A 4AB4A 3VOHA 4JQ4A 1BRLB 1F76A 1TWIA 2JEPA 3NDYA 3SCRA 2Q02A 2ZUUA 2OX1A 1Q8JA 2OO0A 3EOLA 4UMAA 1TB3A 1KFWA 1GOXA 1K8ZA 2FHBA 3W6YA 1CGUA 2J47A 4JYFA 1E55A 2HVMA 4ZENA 1HJWA 2WJDA 1SJAA 1N8FA 4BQ3A 4ATLA 3AIUA 1J12A 1EJWC 3HMCA 2EPKX 2V2HA 3W29A 4LYQA 4DUXA 1DXIA 3VE7A 5A69A 4OFCA 1BYDA 3QY8A 1EH9A 1EC8A 3B4YA 1I6NA 3WQDA 3OG2A 3RPMA 1F3WA 2YCJA 2J25A 3SJ3A 3RU8X 1KBBA 1L2QA 2O4QA 1G94A 1C93A 1L6SA 3FN9A 5DN1A 3A3HA 1E73M 4OU1A 3HQNA 4NL1A 4XAYA 2P88A 3HGJA 1EYEA 2Q01A 2ZIDA 2CC0A 5CEWA 2I14A 3EDFA 1KFKA 3EA2A 6PTDA 2VRJA 4B5VA 3L2IA 2ZC1A 2W66A 5HJYA 3S5SA 3LBCA 3ENLA 3OTRA 2QPUA 3VNJA 3NG3A 5EPDA 3KL0A 1LL4A 2QEZA 1TZ9A 3H2EA 5TIMA 4JX4A 1R7AA 3PJTA 1XLKA 2QXWA 3NQDA 1FKXA 4DJDD 2F6UA 3ANVA 3MKVA 2WZMA 4GIYA 3GK0A 4MF4A 1RBOB 5HK4A 3WDRA 2PDXA 3NQAA 4KPLA 5JIPA 4RW3A 2E4TA 4PULA 3GC2A 1UW9A 4MFEA 2A6NA 3ONCA 4TR9A 1VYPX 3P80A 4GKLA 1W0MA 4MWAA 3GSMA 2AGTA 1V6WA 4JAWA 3D47A 5AHLA 3APGA 4E0CA 1SMDA 4JY8A 1KTNA 1OX4A 1DXFA 4RPQA 3L0KA 3EB3A 3B0VC 1TREA 3EWDA 4QJ5B 1G7VA 1QPOA 3LHWA 5H2ZA 4AF0A 5G1MA 3ITCA 1SW3A 5A6TC 3WMCA 3BO9A 1R9XA 3D6NA 3TWAA 1XIDA 2TAAA 5A5WA 4MWAE 1QVBA 5F2GA 1DXEA 2VM8A 1ISYA 1R2SA 2BFGA 3EOUA 1R9YA 3V1PA 3II1A 3THCA 1JFXA 4R53A 1JI2A 2QUNA 4FPSA 2NLIA 3W73A 3GTFA 4Q8OA 5EGRA 3M0XA 1VFSA 2X1RA 1OADA 1QHZA 3K1DA 4POCA 4EWJA 2J62A 3W9ZA 3CAQA 4O4WA 1SJBA 2D0HA 3B0XA 3BAXA 2CESA 1MSSA 3F4WA 3TSBA 1O60A 2BSLA 1CB7B 2CBIA 2F7FA 1IZJA 4FIQA 2PWDA 2YL6A 2PDFA 3BSMA 4ZQRA 3U2EA 3F5LA 2HQAA 1LDCA 4HGXA 1KV5A 2P10A 3DENA 3G0SA 3SCTA 4E2VA 2DZVA 4RJEA 2H3BA 3PUEA 3BV7A 4N9CA 3UF9A 1PBGA 4MNLA 4KFOA 3L4UA 3AS1A 2D2OA 3EWZA 1CXHA 4XZ9A 1OGGA 1MEHA 4LJ3A 1M7JA 1XQLA 4PUKA 4OBTA 1GNXA 1XLDA 2DIEA 2P0OA 3QF0A 3N6HA 5F4SA 2DDXA 4FXJA 2BXVA 1WDRA 4L1XA 4AD1A 4DO5A 4EWND 5T91A 3T8QA 4HNTA 3ABSA 3T07A 4BF7A 1EKOA 3TXZA 2FH8A 2BVYA 3UR7A 3UQNA 1P7TB 4ZOAA 3MC5A 1VEPA 4KCWA 3S1WA 3TQVA 1A53A 2V69A 1TCMA 3GC4A 5AHNA 2OSWA 1DHPA 3ES8A 2YB4A 3FVDA 1W9PA 4GCAA 1O1ZA 4YL2A 1DJXA 3EPNA 2CU0A 1C8YA 1XGDA 4Q4MA 3B3DA 5D30A 4L80A 2RAGA 4HQVA 1TV8A 1FVPA 3DBPA 1OFAA 2OEKA 5HPCA 4A8LA 4DXKA 5M17A 3DGBA 3ZR4A 2VZUA 4Z1AA 2PMQA 2V3EA 3CU2A 2GJPA 2VQTA 1H09A 5KEZA 3M6DA 1GCYA 1R9ZA 2VCCA 4P7RA 4QG8A 3KBWA 4A21A 1JGIA 4Q7BA 2PWUA 2P3EA 3H26A 4O15A 2ZADA 4FAMA 2EG8A 4LUSB 1W1VA 4L6DA 2AGKA 4B5UA 5CBJA 3VUPA 3T78A 4ZA0A 2V5BA 4H9TA 5CSRA 4PGLA 3T4WA 1BF2A 1OFQA 3SUUA 4GNJA 4YWIA 3SGZA 2DIKA 1PKNA 1SMAA 3ZFHA 3AHVA 1DWGM 3NCOA 1XRFA 3RIKA 4MJZA 4PUMA 1KXTA 5TD4A 2F2KA 4JIHA 4MDOA 2O55A 4NNCA 6XIAA 2QVHA 4FK9A 5K9DA 2ZWZA 4XSLA 4IMCA 1XW8A 1OM0A 4RZ4A 1FWEC 2GSEA 2D3LA 2G5WA 1QI2A 1CGWA 3LPGA 3W26A 4Y9MA 4J9JA 3VNYA 3VGFA 1ZY9A 1QO2A 3VTRA 4LNYA 5L6UA 1QNSA 1TPUA 1ADSA 3TLQA 1H11A 3O16A 2AQWA 3CMGA 5AN7A 2J9ZA 3RCNA 1V6TA 4MAVA 4UQAA 4J3TA 3VILA 4E4UA 4G7FA 2Z4GA 3LB0A 4FX7A 3BW2A 3AXMA 1V5XA 1M6JA 3QRHA 4P7QA 4AZHA 3DHUA 3I3BA 3TTQA 4O1BA 3BGAA 2NSXA 3D0CA 5D2TA 1AH4A 3HV9A 4P5UA 2YKKA 3U4FA 1ZJIA 2VYOA 1XINA 5H8UA 1BG4A 1VH7A 3E5PA 4Z1CA 4CQ8A 3IUIA 2ZRVA 1AH0A 5FJUA 1TJ0A 2ZUMA 3N6JA 2QDGA 4S39A 4LV4A 4CU6A 3RF9A 2QJHA 4WY0B 1HL8A 3TTYA 3A4JA 3T2PA 1B54A 3FGCA 2YCKX 1SR0A 1O66A 1KRBC 2QULA 3CV2A 2DZBA 2VHLA 5I03A 3T42A 1REQA 2X0HA 4XBSA 4ZOBA 4C90A 8XIMA 3A9IA 1ZCCA 4UTJA 4JHOA 1RCXB 1TWWA 2XH7A 4OJYA 3OBAA 1KA9F 2E9MA 4F9DA 5HR6A 3BW4A