4JTSA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with 072
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
365
structure length
365
Chain Sequence
b'TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 136
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtsA00
1XBYA 5A5WA 4WJEA 3W6YA 4MY9A 1EIXA 2FPVA 2NWRA 4RKAA 3PBUA 1TTJA 1Z48A 5CZSA 1L6YA 2I1OA 3OVQA 4LNYA 3LBMA 2BX7A 2Y6ZA 2DZWA 5E1QA 2ISWA 4UTWA 3UQNA 5AC6A 3LRMA 1IXPA 2H8ZA 1H7OA 1KTCA 2GVLA 2FQIA 2GVGA 3QH2A 2H3DA 4O28A 5F4XA 1PHQA 2ZDRA 3BLEA 2J9YA 5K4XA 1IIGA 3VFLA 1XBXA 3PVFA 4Z0JA 3TNOA 1GTHA 4AHPA 1H62A 3TK7A 3PAJA 5DCEA 1B57A 1ZALA 3C4UA 4XWUA 5BRBA 2FB3A 5LZLA 1PV8A 1TRDA 3IIXA 2Y85A 1F74A 1FCUA 3KVKA 3MWAA 3L5MA 1O4UA 4IMGA 3W9ZA 1LBLA 4Y90A 4NZFA 2CZ5A 2V5LA 3RFAA 4HNUA 1TB3A 3HG5A 4WD0A 4KFPA 3KVMA 1AW2A 2E77A 3U2OA 5K2ZA 1VR6A 1H51A 4LOCA 4LVFA 3ZS4A 3W2MA 3G1VA 3HPZA 1VH7A 3NPXA 3RLVA 1EUAA 1OFAA 3WK0A 1MEHA 2G5WA 1H7PA 4S1FA 5EY5A 1KW1A 4RLIA 1ZAIA 2ZZ7A 4JS3A 1FDJA 2Q8ZA 1VPXA 2Y88A 4QISA 3CLMA 4JTHA 2PC4A 2HMCA 5D2WA 5K9XA 3A22A 5D37A 4D2JA 4S2BA 3NQAA 4XUGA 2YZRA 3C3NA 1Q6RA 3W7IA 5HUPA 1DOSA 5KITA 3TMQA 4LS0A 3NAVA 5D2YA 4LV9A 4UMCA 3S5NA 3FS2A 2GQAA 3EX6A 3QZEA 1C8VA 1GQNA 2GOUA 3EX4A 4JYEA 4KFOA 1SZFA 4DO4A 2E6FA 5IBXA 3O6YX 3OG3A 3UZ5A 4R7JA 5LNRA 3NG3A 4K6AA 4UIOA 4WXYA 3CWOX 3OVRA 1NSJA 4K8EA 2V2DA 4LUJA 5TBOA 1ICQA 3LB0A 3LDVA 4J9JA 4DELA 5KTLA 3NNTA 3DHDA 1GTEA 3QW3A 1JCLA 1XUUA 4O1BA 1QOQA 4FNSA 4Z1DA 3R8RA 3NGJA 3L5AA 4FIQA 4AF0A 1YXYA 3P61A 1TTIA 2WV8A 4A29A 4HKPA 4PTNA 5AYZA 2Z0IA 2C0AA 5DLCA 2C18A 4N9DA 1QDSA 5HJLA 4RR4A 4XKYA 2QCNA 3N3MA 1RR2A 2ISSA 3BPWA 3LOTA 3W7RA 4LC6A 1FWNA 2Y70A 1NVMA 3LM7A 1GJPA 1SFJA 2BSLA 4KWVA 2NUWA 3W75A 4JIPA 5DCBA 1Z42A 2FIQA 3W1TA 1H7WA 1UUOA 4N4PA 2C13A 2ZYFA 1SO4A 2H90A 1LP6A 1FY6A 4JIQA 4MY1A 4ZQCA 4GRSA 4CCDA 3SGZA 1TV7A 5FF7A 5BW6A 3LXAA 2X1TA 3PB0A 3O06A 2ZBTA 2R91A 3W07A 1ADOA 2CWNA 4ORIA 3TXZA 3S5ZA 3EWZA 1YLVA 1OK6A 3W71A 3CIXA 1ICPA 3CM4A 3HG3A 3FKKA 1K7EA 3W22A 3G0XA 1H60A 1F6KA 4WX2A 1J2WA 1BKSA 3Q2DA 5FF3A 3HG4A 3N9SA 2A85A 1WOAA 4Q32A 3HGJA 3UYCA 1YDVA 3M5ZA 5CGQA 1W5MA 2D73A 4MZYA 3I65A 4LC8A 1O95A 1YADA 2RDUA 2O7QA 3JR2A 3QEZA 5AHLA 2WNNA 3TH6A 1ZNNA 3KXQA 5K3VA 2Q3RA 2GJLA 5BOOA 3B05A 4JTGA 2R8WA 2FLIA 2RKXA 4DO5A 2ZA3A 1I2QA 4PCFA 4OE7A 5I3JA 2OT0A 1W5OA 5G4WA 3M44A 2YFOA 5CSSA 1VYRA 1E51A 3TJLA 4A3UA 3MI3A 3TDFA 1VZWA 3B0VC 4OWGA 4KFNA 1EWDA 3W1PA 1G4EA 3ATZA 2A21A 2X30A 5LNUA 4UNLA 1SPQA 2YW4A 3C56A 4BF9A 2A4AA 4JTSA 1VYSX 2Y7FA 4O19A 4QAIA 1WXJA 3ELFA 3F1QA 1IXNA 1F73A 5F1VA 3NA8A 4LY8A 3M5XA 3G1XA 3LLFA 1FWSA 3HGOA 2E5DA 3EWUA 5EMUA 1VQTA 1LZOA 3E02A 1VLWA 3TFXA 3NQ6A 4K38A 3H54A 1KM3A 3QQ0A 3O6DA 1LCOA 2HTMA 2E09A 3W73A 1JCMP 2NV2A 3M47A 3QJAA 4LT9A 1OFOA 3ATYA 2AQWA 4JN6A 2QCEA 1OVDA 4HPJA 1JQXA 4RZ6A 4JGDA 5DY3A 4K7YA 1UJPA 4FNTA 5FEPA 1KM6A 3GXTA 4FEZA 3BK0A 3PR2A 5BMXA 1GVOA 1OFPA 3W84A 2PRHA 1TPVA 2FDSA 1MEIA 3LXCA 4N9EA 3W88A 4GUGA 3FYPA 5BMWA 2HSAA 3CEUA 5G1TA 4U28A 3THAA 1QPOA 2WSQA 2BZNA 1TTPA 1YYAA 3S5YA 3EEGA 4RXFA 2V2CA 4UTJA 2EKCA 3L65A 3W7QA 5F2MA 3VNDA 2V30A 3IEBA 3UWUA 5F2LA 4I7UA 3IVTA 5CPNA 3V75A 1QMLA 1BWKA 5LGZA 1TQXA 1W3NA 2QCLA 4WY0F 5C54A 3C2FA 3IVSA 1K3UA 3NM3A 1LOLA 1LROA 1OX5A 3N2XA 1N55A 2YPIA 3W1NA 1XBVA 2VEPA 3B8DA 4JNMA 2R14A 2VEKA 3TC6A 1SR9A 4N9CA 3I6RA 3QSRA 1OF8A 1WBHA 5CPOA 3VE9A 1WOBA 3NVTA 5C5YA 1FX6A 3BLFA 3A5FA 4UXDA 3SFKA 4DBDA 3IIVA 2J9ZA 1FCQA 3EX1A 3W3OA 3LXBA 2H3BA 3DBPA 2Z6IA 3RU6A 1D3GA 3GK0A 2F7FA 4TMCA 3R5EA 4ZVJA 4EF9A 2JGQA 2QAFA 4L4LA 4JDBA 3LRKA 1ICSA 3NOEA 1LDCA 2YW3A 1H1YA 1ZY9A 3KVLA 3ZWTA 4FF7A 7TIMA 4MJZA 1O94A 2Y62A 4UNKA 3QSTA 1P1XA 2V82A 3E49A 4MPQA 3GLCA 1TPC1 5TQLA 4A21A 4DEFA 1TPUA 1S5VA 3MYOA 2VFIA 4MYAA 4PA8A 2QJGA 5D2TA 2VC6A 4EIVA 4DPQA 4LW7A 2QDHA 3DI1A 2C3ZA 1XKYA 3DKJA 3PB2A 1ME7A 1IXOA 2DZPA 4YWIA 3TW6A 3NQEA 3USBA 2CLEA 3O8AA 2WJZA 1BEUA 3DXIA 3IGUA 5EKYA 4MUZA 1SO5A 3KX6A 4X2RA 3WJYA 3ZFHA 3W7CA 1VCVA 1VCFA 3LCIA 5I3KA 3PSWA 4M5PA 2NX9A 3HIJA 3C2VA 4WXZA 3MP5A 2P10A 4FHAA 5C6MA 5L6UA 1W31A 3NPUA 1TSIA 2VELA 1HL2A 1YPIA 1NAL1 4O57A 3SZ8A 2EPHA 5FF2A 4E0CA 1K8ZA 2CZFA 3DU0A 1OYBA 3HGRA 3MI6A 3PG9A 4JX4A 3NM1A 3NQ2A 3W2LA 1HO4A 4PC8A 4Z1BA 4Z0SA 1C9DA 3MP4A 3MJYA 5CSRA 3W86A 2RDTA 4TU1A 1W56A 1TPH1 5U7SA 1P4CA 5G4EA 3O1NA 3P8IA 3LGEA 1AK5A 1VYPX 1KM4A 3LCLA 4N2YA 4WQ6A 1OFDA 4CNPA 5AHFA 4PFMA 4IUOA 3I68A 5K7JA 5D38A 2JBMA 1W37A 3W74A 1X1ZA 5AHEA 4UFKA 5K9CA 2XN2A 3H53A 4A2SA 3PBVA 4HIBA 1WX0A 5AN7A 1GVRA 1ZJIA 3QMRA 5DELA 1LBMA 1RV8A 2ABBA 2RHGA 4ZZ9A 1D3HA 3KRUA 4EOUA 1RQBA 4BWLC 3P82A 4PL1A 3QMTA 1FCVA 1OX4B 3TC7A 1VCGA 4K37A 1P0KA 1F2JA 1X7FA 2VFHA 3FFSA 2R94A 3P62A 3M7WA 5D2XA 2J27A 2ZZ3A 1TPEA 2V0TA 4RZ5A 3LRLA 2A6NA 3M16A 3PC0A 4OT7A 2VEIA 2Y7GA 2VEMA 4IJBA 2G97A 1FWWA 2AAMA 1VC4A 2TMDA 4ADTA 3RF9A 3P60A 5MHBA 5IM51 3CEPA 1C29A 3C8FA 1KBIA 4JTEA 4FXRA 2OZ0A 3WJSA 3TCEA 3NL3A 3B4UA 3LTSA 1KM1A 3GXPA 4NJJA 3R2GA 1H7RA 2ZRXA 4HN4A 3VE7A 3MHGA 3L0KA 3TUUA 2C15A 2A6LA 3MHUA 3KOFA 1UBSA 2BTMA 4NNCA 1EX5A 2P1FA 5HWMA 4KWWA 1R46A 4C1LA 3CTLA 4O1AA 5EPDA 1LLWA 2E6YA 1YXDA 3DFOA 4NJGA 4WOQA 1T99A 4NXKA 2ZTKA 1EP2A 3WK3A 4GUIA 3B03A 3NR0A 1H1ZA 2E6DA 1AL8A 1HTIA 4NT0A 2QCFA 3TSDA 3CT7A 2ZFAA 2J88A 2Q8LA 1EUNA 2E1DA 3GYEA 3PUDA 4NJHA 1ME8A 3EX3A 1KM2A 2G95A 1AL7A 4MKNA 5FEXA 4LRTA 4LVGA 4QITA 3UWYA 4AWSA 4JTTA 3ABRA 4MLRA 3M5YA 3W85A 4YCOA 4R33A 2TYSA 1IF2A 1AW1A 2C16A 4PL2A 1QPQA 4GWEA 6TIMA 3L5LA 5TIMA 2GPTA 2V5BA 1QR7A 3BW3A 4NNAA 5HR7A 1SZGA 4LVDA 2NWSA 4N9BA 1L2UA 5D09A 3Q58A 1QPRA 3TX9A 3GKFA 4UC5A 2NLIA 3TQKA 3WJZA 1GG1A 1KLYA 1PL9A 1H63A 2ZRZA 4JTIA 4I7VA 1EA0A 2DJLA 4AWUA 1KFJA 2PRMA 4UFIA 4M6PA 4YL2A 3BW4A 4GUFA 5G5IA 1K7FA 3M6YA 4UMBA 1JCJA 2Y61A 1RZMA 2W6RA 4O4VA 2X16A 3M9YA 2VKZG 5K9DA 5CKSA 2ZZ1A 3W1RA 3LX9A 3CWNA 3PWAA 3H55A 3T78A 3P5ZA 3STFA 2FPTA 5KZEA 3O16A 1J5TA 4AMAA 3LTYA 3IIPA 3QYQA 4AAJA 2WKJA 1OYAA 4OU1A 3GNDA 3LV5A 3BG5A 1H7XA 1X8FA 3HBLA 4YMZA 2VFGA 1AMKA 3TW7A 2HS6A 1YTDA 2VENA 5A8GA 2QCDB 4QNEA 2QCHA 4MIMA 1D9EA 5KSWA 5LGXA 3EWWA 3THQA 3P8JA 2OMAA 1R47A 2E5CA 3L0NA 5D30A 2PURA 4CLMA 3TAKA 3ANYA 1M7PA 2QUTA 2ZRVA 3IRDA 4NQ1A 5AHNA 3PG8A 4KKXA 1JRCA 3TXVA 4ICNA 4IXXA 2WO5A 3TSMA 1LRTA 2QCGA 3O63A 5HINA 3ABSA 4XBKA 2ZRUA 5I3IA 3TR2A 4HNTA 3G0SA 4A22A 3GAYA 4H6KA 3G8EA 3L21A 2WSRA 1FDYA 4MFEA 3N14A 3HPXA 1JQVA 2YXGA 4IGHA 4ZMGA 3L67A 2DZUA 3W7KA 2CLHA 3R89A 3MMTA 3NQVA 1KFBA 4FXSA 5SWUA 4UTTA 1OHLA 3KVJA 1G4SA 1TREA 4U4MA 1I2RA 2DJXA 3M0ZA 4CNNA 1MZHA 4S2CA 2VFFA 5FEWA 5KZDA 2RDWA 2KZHA 1FBAA 2OX1A 4B5NA 3NL2A 2W0UA 3PUEA 3W7DA 6ALDA 2NUYA 4FNQA 2J9XA 2DZVA 3BG3A 5HWNA 1ZCOA 1GZGA 5D03A 4LVBA 5AYYA 5CPMA 3W70A 1K8YA 2H8XA 1IXQA 3DFPA 4MLJA 4Y9AA 2CLOA 1EP3A 1ML1A 5HULA 4IMFA 3SGUA 1W8SA 3OBKA 3S8HA 2B7OA 4K8HA 3C0JA 2GJNA 4HSNA 2B0MA 1RVGA 1XC4A 2QEZA 3FEMA 3IGSA 1IIHA 1DVJA 5DN1A 4WY0A 4MVAA 3M5VA 1G7UA 3P74A 3D0CA 2CU0A 1SSDA 3LHVA 5I3HA 4IOTA 3O6CA 3QM3A 3NL6A 3DENA 3S1UA 4DF0A 3FJ6A 3P67A 1O5KA 2C6QA 1TJRA 4QIUA 4AWTA 3AO0A 3FOKA 1NF0A 2CLKA 1WBJA 4DBEA 3S0CA 5LNVA 3MW7A 3GR7A 3YPIA 4ML9A 1TMHA 3W7MA 5G1YA 3LCWA 4JX5A 3W2JA 4IX2A 2EHHA 3C2EA 2QJIA 1DBTA 3NQGA 4ADSA 5GVJA 3EXSA 1CW2A 2JKPA 3QFEA 3UPBA 1J4EA 3ABOA 1DV7A 3B04A 3GR8A 3PUOA 5C55A 2B7PA 2WSYA 2YSWA 2YYUA 5EA9A 4CCCA 5LHFA 3R13A 1B4EA 4GC4A 2ZA1A 3W2KA 4MZ8A 4IPJA 3PBYA 4HT3A 4WUIA 2WQPA 1MXSA 4OV4A 3FIGA 1HG3A 3B06A 3DFTA 4K39A 1A50A 2I9EA 4NX5A 1L6SA 1FXQA 2DZSA 4QSHA 4O0ZA 4UFMA 4BI6A 3KHJA 4O54A 1LRQA 3IV3A 3MP3A 2G96A 2WNZA 3MUXA 1Q3NA 2YDAA 3JS3A 1FCBA 2EAWA 1G69A 3OIXA 4LV4A 5G2WA 4IXHA 1VHNA 5KINA 4O4WA 2H6RA 3DI0A 2FFCA 1S3HA 1JULA 1G7VA 5EL1A 3NO5A 2VFDA 4O1CA 4O53A 3BO9A 4P61A 4ONVA 2Z6JA 5F4WA 4UTKA 4ZQOA 3NPWA 1HUVA 2FPYA 1QNVA 1KA9F 1PIIA 3W76A 3A24A 4X9SA 3G1FA 1PE1A 3GDLA 4AF0B 1LOQA 5CZTA 4ZQPA 1FWTA 1TO3A 3LHZA 4HNVA 1DKWA 1OFEA 3G22A 1QO2A 2QF7A 3E9AA 5F2IA 1EP1A 1TJPA 2RH9A 3N34A 3S1XA 3SECA 3KRSA 4XKYB 1OG0A 3F4NA 3TJXA 5T26A 3BGJA 4IMDA 4PODA 4FX6M 1Z41A 2E68A 1ONRA 1A5CA 5K4ZA 3I7SA 5E93A 1U5JA 3W1LA 2A1YA 2CZDA 1V5XA 3EWYA 1ZFJA 1I8JA 1VGAA 1I2NA 4XTIA 4JD4A 4Y6GA 4DO6A 3A5VA 4OBTA 2QUUA 1WV2A 1KV8A 3FJLA 4LVAA 5LNSA 2YGYA 1TPFA 2QDGA 5E0KA 1ZHAA 4CQ8A 3FA5A 1UB3A 1Q6LA 2YR1A 3UWQA 2VFEA 2Z1BA 1FUYA 4EVZA 5FF0A 1SW3A 3NQMA 1NFBA 3LHYA 5HQEA 3SW6A 3TU9A 2BWGA 5HUOA 3PS7A 1R30A 4FNRA 4YLWA 1R2TA 4Y96A 4JTJA 2ZRYA 3P7YA 3VI2A 2NV1A 1TQJA 1LTDA 2RFGA 2X1RA 5FESA 3I7RA 4ALDA 4O1DA 1VRDA 4RV8A 1FDZA 3UZJA 4HHPA 5ABTA 4I7WA 5U4NA 3WJWA 3HPSA 3W1AA 3P84A 1W5PA 4GE8A 4R34A 4YCPA 4NVTA 4XTDA 3LTPA 3LLDA 3SY5A 2E5BA 3GDMA 5J5DA 3TROA 1JJKA 3GKAA 3C2OA 4Q33A 3ZR4A 2A7NA 5G2IA 4AVFA 1EPXA 1KLZA 3GZ3A 3FKRA 4R53A 3W1XA 1GVFA 4JDYA 1FWRA 2E6AA 4IMEA 4JICA 3W7HA 1Y0EA 1PCWA 1KM5A 1O60A 4EF8A 2QKFA 4O13A 1BTMA 4NNBA 4W9TA 3M43A 3TAOA 4JYDA 2A2IA 4BFAA 1F76A 1EEPA 5KMYA 3NZRA 1MO0A 3G1YA 3NQ8A 5DXYA 4O16A 4TIMA 3RLUA 3V1PA 4O18A 1GOXA 2AGKA 2X1SA 2ZZ4A 1F7BA 4AEOA 4PH6A 1W5NA 3LBCA 3S5OA 1KFKA 1MSSA 4LRSA 4WOZA 1GVQA 1GYLA 2FB2A 2WPBA 3DHFA 4AH7A 2C1HA 4LTSA 1TTQA 4UTMA 4JX6A 5I3GA 3G18A 1GYNA 4JXCA 1LLZA 3W72A 4I9AA 1A5AA 3EKZA 4POCA 3BLIA 3GVGA 1Z44A 4X3ZA 1TV8A 3GNNA 1KFLA 3L0GA 4TMBA 3UWVA 3OHIA 3FYOA 5AHMA 3QRHA 5FF4A 3LHWA 3L68A 1HFBA 4TR9A 1F5ZA 3LCFA 4JY8A 3TKFA 3NQ7A 3LCXA 3DAQA 3UNDA 2BXVA 1SW0A 4IQLA 1UASA 3W7PA 5DXXA 2ZA2A 3RK8A 5J5RA 4UTHA 1W5QA 3HF3A 1YDNA 2PE4A 2CLIA 3N9RA 4XBSA 1Q6QA 2CLMA 2XN0A 3A23A 3G1HA 3MBDA 2QCMA 1L6WA 1R2RA 4MJMA 4BI5A 3QF0A 3NQCA 3BW2A 3E12A 4Z08A 3OEXA 3EB2A 4Z1CA 1F6PA 1LM1A 3R12A 3BV4A 4RJEA 1SZNA 4MFDA 3PF3A 1TV5A 2CZEA 2NZLA 4BI7A 4LS2A 1P5BA 2Q3OA 1FXPA 4DQWA 2CLFA 3C61A 1EWEA 1YPFA 3T4CA 1H7NA 1SZEA 3QQ1A 4NXSA 5CPLA 3BARA 3UXDA 3PBWA 3GDKA 5LHEA 3VCRA 4RXGA 2YX0A 1JCXA 1Q45A 1PCKA 3T55A 3O07A 5EYWA 4M6VA 3QPYA 4O17A 3ZWSA 3TA6A 5AFDA 4O10A 5I3FA 1TPDA 1MEWA 1QAPA 1T0OA 2X1UA 3QMSA 2B7NA 1OX6A 3GDRA 5D02A 1WYIA 3F03K 5AOUA 3MI2A 3SJ3A 4UFLA 3EXTA 5CG7A 3LV6A 2V9DA 1YXCA 3BG9A 2FTPA 1NF7A 5D33A 1TRIA 1JCNA 1KTBA 4E2BA 1GEQA 4LU0A 1KM0A 3TV8A 3TIMA 1JVNA 5CZJA 3EXRA 2NX3A 2DP3A 1PS9A 5HNRA 1GT8A 2ALDA 1CX9A 2TSYA 1JUEA 3TFCA 4K36A 3STGA 1ZAJA 3IGXA 2XFWA 1LBFA 3QC3A 1B3OA 1S5TA 1OABA 1QO5A 4IWWA 1CI1A 1W3TA 1H50A 1IGSA 1JUBA 4MYXA 4N02A 4GFSA 5HMSA 4O52A 4M7TA 5AB3A 1VHCA 5HWJA 1JR1A 3WK1A 1W1ZA 3A9IA 2QUVA 3W2UA 3SI9A 4O11A 1N8FA 1SW7A 3MYPA 1OF6A 3QW4B 2DZXA 1JRBA 1VJIA 5D32A 2JKEA 3U8GA 3MO7A 1KFCA 1A5SA 3IVUA 2ZQ0A 5H91A 4RZ4A 2JKAA 4LS1A 1K02A 3EWBX 2OCZA 3HQ1A 1G4TA 4LWWA 4HSOA 1TCDA 4AHQA 4E2DA 2ZRWA 5DCDA 1SUXA 1XUZA 3N73A 4MZ1A 2C19A 3STEA 1DJNA 4UUIA 3T40A 1G67A 1F05A 4CQAA 1LYXA 3LCGA 2DZTA 5AHIA 3TQ0A 1QCWA 2ZCGA 1LORA 4NZJA 1WQ5A 3W7OA 4QNWA 1KBJA 4FNPA 2J24A 2Z2UA 3SR7A 4N6EA 5F4SA 3GAKA 4GXMA 3BVJA 3W7GA 3RMJA 3G24A 2EF9A 1TPWA 3NEVA 3NQDA 4O0KA 1SFLA 5H2ZA 4TX9A 4JEQA 2QJHA 1PVNA 3S9YA 4A2RA 3B0PA 2WOQA 1W0MA 3OA3A 1RD5A 3M1ZA 2NUXA 3W1MA 4WZHA 5AC8A 4O8RA 2ISVA 3NZ1A 2A5HA 3G3DA 1XXXA 1KV5A 2CFFA 4ZQNA 3UWWA 1SO6A 5G2HA 5DY2A 2ZZ6A 2W79A 4CQ9A 2B4GA 4NUWA 3CPRA 3RNDA 2WNQA 1K8XA 3C6CA 1XCFA 1LRNA 4P2VA 3CB8A 3T7VA 5D2VA 2J6XA 3QPZA 3IIZA 5F2GA 2QAPA 2ZZ5A 4G1KA 4UTIA 2PRLA 3T44A 1V7YA 4ZQMA 4UCGA 1JCYA 1PHWA 4CNOA 2V81A 1L9WA 3G1DA 4BWLA 2YCEA 2F84A 2DU2A 3NPVA 4UMAA 1KTNA 2A0NA 4GUJA 4QM1A 1GPWA 3U6WA 1OFBA 1XDLA 1A53A 2JK2A 3CQ0A 3L9CA 2Y7EA 4PEKA 1OFQA 1K7XA 1KFEA 1X1OA 5EBUA 2GUUA 1RQHA 2OT1A 4UTWC 3ABQA 3L66A 5LSMA 5AYXA 1YTKA 4BK9A 3S1VA 3CU2A 5AC7A 3CHVA 1S5WA 4ZL1A 1VS1A 4ADUA 3DH7A 4X22A 1TYGA 4FX7A 3DFNA 2ATSA 4JTUA 4NU7A 4Z1AA 3W7EA 4UTLA 1LOSA 1BWLA 2A7RA 3JRKA 3KAOA 4IMCA 2I14A 4JTFA 3W87A 2GQ9A 1U83A 4MOZA 1ALDA 1P0NA 1NEYA 1X6UA 1OX4A 1QFEA 2DORA 4E38A 4UFJA 4M6QA 4O50A 4GBUA 3DFQA 3NQFA 3WJXA 1A5BA 1B9BA 4NX0A 3W7NA 3S6DA 3DFSA 1DL3A 3TMLA 2YFNA 4NJIA 1DQWA 1AG1O 1ZENA 4AXKA 2Y7DA 3DGRA 3PY2A 3HJZA 3HGSA 2YYTA 4H4IA 3N2MA 3GXNA 3I7QA 1T96A 1Q6OA 1UCWA 4BR1A 3WK2A 3S1WA 1WA3A 3FLUA 1ME9A 2NXGA 1SQ7A 2HS8A 4OV9A 1DORA 2A7PA 4RX0A 1JUKA 1QPNA 1OK4A 5FI8A 1DQXA 3K30A 1XL9A 3W23A 2XN1A 1OYCA 2V2HA 1DJQA 1HO1A 4M7SA 1WAUA 5IBXC 4O12A 4H3DA 1YTEA 5HR6A 5L9FA 2QCCA 5C2XA 1XM3A 3GDTA 4N6FA 4HNNA 2BLEA 4Q4KA 3LI1A 3INPA 2UV8G 2EGZA 4ZQRA 4OQVA 5DBTA 5KZMA 3G1AA 1I2OA 4RCXA 3N19B 1OJXA 1ZAHA 1W3IA 1XDMA 3AJXA 3UY8A 3DKLA 3LCHA 2Y63A 1K03A 1T8XA 1GWJA 2ATMA 4K7VA 3VKJA 3TSBA 2NXHA 2Y89A 4IPIA 1I4NA 3HB9A 1OFRA 2TRSA 5FEZA 1B4KA 1DHPA 4DF2A 3IIOA 1R2SA 3L2IA 2P0OA 3P80A 2JGYA 4GNJA 2C14A 4JR5A 3EKLA 2O7SA 2ZTJA 3UY7A 3G8RA 1M6JA 3Q94A 3A21A 1QWGA 1M7OA 4N4QA 3W7LA 2NX1A 4OGZA 4O14A 4LUIA 4UFHA 2VXNA 2FJKA 3KFTA 3MHFA 4L4MA 4UTTC 1G6CA 1I45A 4AB4A 3WFAA 1EB3A 1THFD 4WY0B 1I2PA 4UTUA 4UR8A 3GX9A 4GUHA 3W1QA 3E0IA 4Y8FA 2CLLA 1M5WA 4XZ9A 1GVSA 3STCA 2TPSA 3GB6A 4JTLA 1SO3A 4NJKA 1TPB1 4AHOA 3NXFA 2LLEA 3SIZA 2VOMA 5BNKA 3GIYA 3HG2A 5CZ0A 4DXVA 3UWZA 4FX8A 1SU5A 3TE9A 3P81A 1XBZA 3W1UA 3UXAA 1VLIA 1H5YA 1G4PA 2QCDA 3C52A 5D04C 3CC1A 4IX0A 4JYFA 4DPPA 4C1KA 1GG0A 2IQTA 3OVPA 3BGGA 1RPXA 3DZ1A 3F4WA 3TQVA 1O5XA 4YXGA 1TIMA 2CW6A 3NYZA 4O15A 3M41A 4OHQA 4RK8A 2QR6A 4EWND 4JTKA 5DBUA 4HPXA 1WDWA 4MY8A 3KRZA 4FIRA 3HOJA 3B0UX 1FQ0A 2ZZ2A 1RQEA 2GQ8A 3EX2A 3MBFA 3O05A 4TO8A 4ORMA 3PSVA 3Q37A 3W83A 3UPWA 3HMJG 2B7QA 3SSJA 3PULA 5D05A 3LHUA 4QQ3A 2OJPA 1W54A 5LNWA 4GJ1A 4UR7A 4FO4A 1N7KA 3LERA 8TIMA 2NXIA 4M19A 3PM6A 4FNUA 3HO8A 3NL5A 4DF1A 1XI3A 1QOPA 1YDOA 5F1UA 3P5YA 3UD6A 2ABAA 3CIWA 3E96A 1AW5A 3G0UA 1SSGA 3O15A 3C2RA 1UUMA 3W7JA 4CCEA 2V8ZA 2X2GA 3G1SA 3NDOA 3S42A 4FB7A 4JY9A 2GVJA 1H61A 5LKYA 4QJ1A 4XQ6A 2PCQA 3G3MA 3LI0A 3W2NA 3EWXA 1XFBA 3LHTA
chains in the Genus database with same CATH superfamily
4HJWA 1XBYA 1RPKA 1U1JA 2NWRA 3PBUA 3W02A 1Z48A 1SYTA 2I1OA 1E6NA 2BVTA 3K8KA 1FWEC 2Y6ZA 5DRIA 4FOJA 1P7TA 4JTAA 1CENA 2ISWA 4FLQA 3UQNA 1WXYA 3WBEA 3TJ4A 1KCXA 1XFCA 2H3DA 1Y8BA 2O9PA 4BJHA 1NDZA 2ZDRA 4QLLA 3VFLA 3PJTA 4ZGYA 3OLGA 3N04A 1TA3B 4AHPA 3RPTA 2JF6A 1B57A 2PTWA 4W8BA 1TWDA 2UWFA 1GOWA 1S2VA 3KVKA 5E0CA 1O4UA 2G41A 4IMGA 3W9ZA 4M1BA 5DMLA 4Y90A 1EYEA 2CZ5A 2V5LA 2IS7A 4HNUA 4C90A 5GJMA 3U2OA 1QBBA 5K2ZA 1H51A 3OOQA 1NIUA 4LVFA 2QGYA 1C8YA 1KR0A 3WBAA 2G5WA 1KW1A 4RLIA 4JKKA 1ZAIA 4LQ1A 4JS3A 2Q8ZA 1VPXA 4AZBA 4QISA 1VFSA 2ZUMA 2E4TA 3A3HA 4Q8TA 2BGSA 4A8LA 4ECLA 3W7IA 2OFJA 2QT3A 5TNVA 2AL2B 1DOSA 5KITA 5D2YA 4LV9A 3S5NA 3MMUA 2MUCA 1SJCA 3QZEA 2CZVA 1P1MA 4HVXA 1GQNA 5FAJA 1UWSA 3M0IA 4JYEA 5HNNA 3EDKA 3BLOA 3CO8A 4XK2A 4UIOA 3OVRA 4PCPA 3T42A 4BEUA 2V2DA 5TBOA 4DELA 5KTLA 5E6ZA 1GTEA 3XISA 4NF7A 1LT8A 1WDSA 1QOQA 3KBSA 5XINA 2JIEA 4DLMA 1YW1A 3NGJA 3RX4A 4FIQA 4AF0A 3P61A 1TTIA 4BQ4A 1H09A 4HKPA 4GK8A 1EGVA 4US5D 2Z0IA 5CBJA 4IIFA 2XSAA 1QDSA 1KFWA 2BHZA 1Q66A 3ISIX 2QCNA 2PD9A 3KBVA 1XYCA 1E9ZB 3LOTA 4AYGA 2VZSA 2EEXA 4GH3A 4DJDC 3LM7A 2A79A 1GJPA 1W1YA 3QBUA 5A2CA 2WNWA 1D2KA 3HJEA 1UUOA 1E0TA 4GINA 1LP6A 1BRLA 3MUCA 3GBEA 1E5JA 2VZVA 2NQHA 3R11A 3GG8A 5CC6A 1ADOA 2CWNA 3S5ZA 1K9EA 3HG3A 1K7EA 3NZGA 3PWGA 4Z1YA 4PEEA 1BKSA 3Q2DA 5FF3A 4QG9A 2A85A 4Q32A 4QDWA 1YDVA 1PDZA 5BWAA 2D73A 4PUUA 1O95A 1HGWA 3S47A 2D69A 1V02A 4I5RA 1U5HA 3GTIA 5ABFB 2JE8A 3TH6A 3KXQA 4WKFA 4UOQA 2Q3RA 4QR6A 2PDCA 2BOGX 3RU8X 4DAFA 1HP4A 4L9YA 4PCFA 2OT0A 1W5OA 3R4IA 3M44A 5CSSA 3VK5A 4UQCA 1G4EA 3ATZA 4K8GA 5KETA 4GHRA 1KGWA 5HNUA 2YW4A 5HA7A 2A4AA 3AMGA 5LA2A 2Y7FA 1CXHA 3BOXA 3F1QA 1YNPA 4C6QA 3NA8A 1WO2A 2DFAA 3G1XA 1B54A 3V0TA 2E5DA 3BMVA 3TFXA 3NQ6A 3T09A 1KM3A 3WLTA 3REQB 4AZCA 4NG3A 4S38A 3W73A 3M47A 3QJAA 1CXKA 2FH6A 3ATYA 5BRPA 1OVDA 2NQ9A 3CHDA 5HOSA 4AXNA 4IG2A 1LQ2A 1UJPA 5FEPA 1EIBA 8RUCA 4I5XA 4B5VA 2HDJA 2VDHA 4LAMA 1BGAA 1H49A 3L4WA 4F0KA 5G1TA 4G8TA 4HZ6A 4H83A 3HPAA 1DIKA 2WSQA 3SGGA 3CZ8A 2BZNA 2Y5JA 3GTXA 4RXFA 4YHEA 2V2CA 2EKCA 5BU9A 3BMXA 2QVNA 3IRSA 2V30A 3S2NA 3IEBA 5F2LA 3V75A 4FALA 1BWKA 1K3UA 1SMAA 4PMXA 4DAIA 1NQKA 1QWKA 2VEPA 2X09A 2R14A 4X9YA 1SR9A 3PPFA 1WBHA 2IXVA 3VE9A 3CS2A 5C5YA 1EJVC 6XIAA 4AQLA 4DBDA 3IIVA 2W62A 1FCQA 3W3OA 3EPMA 2C1IA 1GOIA 3AXMA 3RU6A 1KR1A 3GK0A 3R5EA 4EF9A 2PCEA 3UWEA 4L4LA 2F6XA 3SN1A 3NOEA 1CYGA 2I5IA 1QHPA 2WHMA 4R7OA 2QW5A 4FF7A 2DY3A 4AIUA 1VFUA 3QSTA 3CWHA 3E49A 4MPQA 3GLCA 2FZBA 1TPC1 2W9MA 5TQLA 4DEFA 3KTSA 1Z8AA 1JDAA 1TPUA 2X2YA 1VFOA 4W89A 1M03A 4MYAA 1JPHA 5JUVA 4DPQA 4LW7A 3DI1A 4YWIA 2MNRA 5LXXA 4AFYA 3NQEA 2CLEA 3O8AA 4MUZA 2YIHA 2PC8A 4P7RA 5FAGA 4HOZA 4TV5A 1VCVA 1V6YA 3OQ8A 3QZAA 4H01A 3VM7A 4S39A 3BMWA 3HU7A 3PSWA 4MADA 8XIMA 2FJUB 4G7FA 5L6UA 3NPUA 1HL2A 2BVYA 5IRPA 2QDEA 1W9DM 1NAL1 4G1NA 3E74A 5FF2A 4E0CA 3RLGA 4XD4A 3NZQA 3EMCA 3NOYA 1BXBA 3OG2A 1TUXA 3GXFA 1BYCA 4ZO8A 5T9CE 3EOOA 3NQ2A 3W2LA 3VGGA 4P8VA 5XIMA 2QV5A 4Z1BA 4Z0SA 4LUSA 2DH3A 1M3UA 4XZLX 5LXEA 2HQAA 2PGRA 3I6EA 1P4CA 3BWWA 1ONWA 4CNPA 5AHFA 4IUOA 3I68A 2IUZA 3PTQA 1V6XA 2VOTA 4EWJA 1GVIA 2XN2A 3N2BA 1WX0A 4UNIA 1G01A 3QMRA 2NQ5A 5DELA 1LBMA 1RV8A 3WF4A 3U4FA 4BWLC 3P82A 3A3XA 3F5LA 3MV01 2PWVA 2G3IA 1PBGA 2ACRA 2WK2A 2VFHA 1P6CA 3FDKA 1FKWA 3P62A 3M7WA 2J27A 3SM0A 1TPEA 7ENLA 3RM4A 1E3XA 5DMNA 4PUEA 4C5YA 2XPKA 1S38A 1ZJHA 3NURA 2TMDA 3QLDA 4TVCA 3RF9A 2PODA 3QKZA 4Q4PA 3O3RA 3P14A 2OZ0A 3TCEA 1Q2RA 3E2RA 2Y2WA 3LTSA 1HP5A 3DGBA 1OC5A 1Z9AA 4MF4A 5A6SA 2WHLA 1EX5A 2BOFX 2E6YA 1YXDA 3DFOA 4H9MA 2WMJA 4GUIA 3W0KA 3NR0A 1BVWA 4NT0A 2Y5SA 4AC7C 1C7SA 1ELSA 1ZJBA 4JIIX 2QCFA 1P43A 2ZFAA 2VRQA 1NWSA 2Q8LA 1FRBA 2R1NA 4IICA 1X97A 2Z00A 2Z28A 3POHA 5HNTA 4Z2KA 1KM2A 5LYRA 3IJLA 5FEXA 2J74A 3ANUA 4MKNA 3SY1A 3MO4A 3EWCA 1IWAA 4LRTA 1XSKA 2XUCA 4LVGA 4AWSA 2O9TA 3KZSA 1P0DA 3E0LA 1FOBA 1REQB 2ZX5A 2YA2A 1N8IA 2V5BA 3VIMA 3VABA 3WKZA 2NWSA 5IHRA 4N9BA 1L2UA 5D09A 3Q58A 1W9VA 3VDAA 2C79A 4UC5A 1QK0A 3TQKA 2X42A 1KLYA 2ZRZA 3ZLGA 2PRMA 1Q8JA 2QLYA 4M6PA 3PFRA 1E6RA 1WZAA 4M24A 4UMBA 3UVIA 1IEVA 4S23A 5BOEA 2W6RA 3DG3A 4Y8EA 4Y9MA 1KRBC 1US3A 4L9XA 2VKZG 5GNZA 3R79A 5CXPA 3N6JA 1IGWA 3LPOA 1ZU8A 2EPNA 4F0LA 3NWRA 6ENLA 5CC3A 2PP3A 4IIEA 4EANA 1LQ0A 3TLLA 3LTYA 4LBSA 4Q6XA 3IIPA 1OYAA 1QOXA 3LV5A 1TWSA 1H7XA 1PYFA 1X8FA 3MDWA 4B5WA 5EFDA 3R8HA 3THUA 3PJWA 2HS6A 5A8GA 4QNEA 4US5A 4G6CA 1KQYA 4JCLA 2CLPA 3SRFA 2E5CA 4KEVA 3VKKA 2RAGA 5FJUA 3CYJA 1M7PA 2I7GA 1C8XA 2WKGA 5JBDA 3GS6A 1ZP4A 3BC9A 1K1DA 4WK9A 1JZ2A 4ICNA 1M68A 1GKQA 1B3VA 2JEQA 3HV8A 4LUYA 2Z27A 2ZRUA 3G0SA 4H6KA 4GNKB 4CD7A 3UG8A 4A8RA 4JAWA 3S2CA 5CLWA 1XSIA 4IGHA 1CGTA 4AMCA 4JFSA 4ZFCA 3W7KA 2CLHA 3R89A 3NQVA 1JNEA 3KVJA 5D9OA 2ALRA 1G4SA 3AJ7A 1TREA 2GSEA 3M0ZA 1G0CA 4CNNA 1FP8A 2VFFA 1ISVA 2OX1A 4B5NA 3CZJA 2F38A 4GACA 4JCMA 3S46A 4ZOAA 9RUBA 6ALDA 2CITA 2DZVA 3BG3A 3TN4A 1BTCA 2FZMA 4CD6A 1XIMA 2X41A 2ZVIA 3WMLA 3N2OA 4MLJA 2CLOA 1TV3A 2GSJA 5HULA 4HYRA 1W8SA 2XVGA 3S8HA 3UCQA 3IUDA 3C0JA 2GGJA 2J7HA 2IQDA 3FEMA 1H3GA 3IGSA 2P76A 3F2DA 1DVJA 2VEFA 2IXUA 4PUJA 5DN1A 4WY0A 3M5VA 3CQHA 1G7UA 2C8NA 2EPMX 1SSDA 2VTFA 3O6CA 4ENLA 3DENA 2DGAA 3ARPA 4F8XA 1O5KA 3TWBA 5T9BG 1QASA 4ZBCA 2QUNA 1OGBA 1JGMA 1NF0A 2INFA 2WC4A 4C6KA 3S0CA 3FJNA 3GR7A 2PWUA 4ML9A 4IIBA 4IX2A 4PUWA 3C2EA 1DBTA 1U30A 1V3IA 3EDJA 1E1EA 4DUVA 4UBPC 1DV7A 3CHFA 3GR8A 1F6YA 3UZWA 4HU4A 3V0UA 5LIYX 1T41A 2ZA1A 3KE0A 3QVQA 3PBYA 4JIEA 1JI1A 1L6SA 1FXQA 1TV4A 4UFMA 4BI6A 1ZZMA 5DQPA 4GI6A 4NRSA 3MP3A 4I6KA 1TE6A 2Y4SA 5KEZA 1OC6A 3JS3A 1PKYA 2EAWA 3FHQA 4IMAA 3OIXA 5IFTA 3ANVA 4C6DA 3EAUA 1L6GA 2WM0A 1KQZA 3BO9A 4P61A 4ONVA 1OT2A 1XISA 3NQBA 5F4WA 3NPWA 2FPYA 4B4FA 1YMYA 3GTHA 1KA9F 4XZNX 4P7NA 1LT7A 3W28A 3WD2A 4AF0B 3LN3A 5CZTA 4ZQPA 4DUXA 3T08A 3PZVA 1V08A 3GW3A 4S3EA 2RH9A 3UJEA 3KRSA 4QCEA 2ACSA 1X98A 4X61A 3TJXA 1PWLA 3WNLA 1DWAM 4FX6M 1Z41A 2E68A 2D0HA 4PBEA 3BUVA 4EPKA 3I7SA 3W1LA 3M4HA 2HE8A 1GZ1A 1VBJA 1V5XA 3WDIA 3GXMA 3IK2A 3ALFA 4KWOA 1L8PA 4JN8A 1I2NA 4FXFA 2WJEA 1HXJA 3A5VA 1BRLB 2QUUA 3FJLA 3PBMA 1TPFA 5E0KA 4S3AA 4H9XA 2DIJA 3FA5A 3PAOA 3MC5A 5FF0A 1E43A 1SW3A 3NQMA 1A0DA 4IQEA 3L4TA 5HQEA 3IJ7A 4CUCA 1UR2A 4FNRA 3L4XA 3KEHA 4Y96A 2ZRYA 1TQJA 2RFGA 4PUMA 2X1RA 4GKLA 2OEKA 1VRDA 4UQ9A 4AD4A 1FWCC 2GSHA 4HHPA 5ABTA 5U4NA 2E25A 2XVKA 4XVDA 3H2CA 4RUBA 2WC3A 1EJTC 4GE8A 3D47A 4H9UA 4YCPA 4D6CA 2JALA 2X1IA 4E4UA 4I9TA 3LLDA 3SY5A 5D9NA 2E5BA 3NFUA 1S2AA 1P0BA 3OGSA 3UF9A 4MNKA 3TROA 1QRQA 4U31A 2OZTA 3ZR4A 2A7NA 5G2IA 3CK5A 3FKRA 3KOZA 1GVFA 3KWSA 4Z2IA 3ZVIA 4D8ZA 3B40A 2YL6A 4MJ4A 2E8YA 1O60A 2BDQA 4EF8A 4XD6A 1XLBA 2G3NA 3WLPA 4GMEA 1XRTA 1LWIA 1EEPA 3WBXA 2POTA 3G1YA 4AZCB 4P7OA 5I03A 1KCZA 1FH8A 1JI2A 1GOXA 5LA1A 4IG2B 2X8RA 4PH6A 1NARA 3VFCA 4MAVA 3ARTA 3VKCA 3G1RA 4TVUA 2ICSA 1GYLA 3TOPA 5BXPA 3T6CA 2C1HA 4LTSA 4JX6A 4X63A 5I3GA 2XVNA 2CKRA 3EKZA 3GVGA 4DZAA 1BVNP 2HZGA 4HD5A 3GNNA 1S46A 3OHIA 3LSBA 3QRHA 1J0JA 1OSEA 3T2OA 2WVVA 3ERPA 2OWCA 2RGLA 5EB8A 5CBIA 1EO7A 2VX6A 2J7DA 3W7PA 3BLKA 2ZA2A 1I60A 3KBJA 4UTHA 5B7ZA 2CLIA 2XN0A 3MBDA 1O7AA 4Z2JA 1UQYA 4GVFA 2F61A 3W24A 4MWAD 1FH9A 4DJEA 2MANA 3PHAA 1F6PA 4LH8A 4QS6A 1BHGA 4AD1A 3R12A 3BV4A 1H4PA 4RJEA 4HGXA 4WRHA 2WVUA 3PF3A 1A0CA 2I56A 2NZLA 3CYVA 3SSZA 3V7PA 1KRAC 1FXPA 1SZEA 3TEVA 5ABGA 5LHEA 1VBRA 4JTRA 2OYKA 3O07A 5EYWA 2XVPA 3BOLA 1E1FA 3QPYA 4F40A 1UR3M 3RX2A 8A3HA 4FPSA 5I7GA 4LEQA 1F3XA 5I3FA 2J77A 2VGFA 4UR9A 3M0MA 1GONA 5CBBA 3QMSA 3H7UA 5D02A 1XYBA 3F03K 3SJ3A 5FJOA 5F7UA 2YB1A 3VNZA 2PDBA 4M82A 4A3HA 1XGEA 1EKOA 2FTPA 1GQKA 1JCNA 3UR7A 1KTBA 1R85A 1V03A 3TIMA 3BGAA 3UEQA 4HU8A 2CIPA 1K4GA 1W6TA 2NX3A 3EA3A 3W81A 2DP3A 1PS9A 3HA1A 4HA1A 3UU0A 2ALDA 1CX9A 4BF5A 3M46A 5E5CA 4LUSB 1WDQA 3IGXA 2ZWYA 3BCJA 3CV1A 4PFHA 2XFWA 3GVQA 1JD7A 3QC3A 1AA1B 2FVMA 1JFXA 3V3WA 3FA4A 1EF3A 1VHCA 1JR1A 3WK1A 1W1ZA 1NP2A 1C91A 4Q8MA 1NDVA 4O11A 1N8FA 2E3ZA 1JD9A 4HZ7A 3QW4B 2JQXA 5A6TC 3H8AA 3U8GA 3WUBA 1L2QA 2Y8UA 2BMBA 4IHCA 2WZHA 3WDHA 3THDA 1K02A 3WLLA 4LWWA 1SUXA 5DMMA 1XUZA 1UOZA 1QVBA 1ADDA 4GQBA 4AWEA 4UUIA 5AZ0A 5I06A 1TVPA 3LCGA 2DZTA 3RR4A 1HKVA 1G94A 2ZCGA 1LORA 4NZCA 1IT8A 4I3GA 1R87A 1QNPA 4FNPA 2AKMA 1S39A 1XYMA 2Z2BA 2Z2UA 3VIPA 4U2ZA 1V51A 4N6EA 2XIQA 5F4SA 4DJFD 2GJPA 3GAKA 3BVJA 3SUTA 3VDCA 3W7GA 3WQVA 1EH9A 3CQIA 2EF9A 1TPWA 4IFOA 1BAGA 3EDEA 3VVGA 2XM2A 3OW1A 3TCSA 2PWEA 2BVWA 4FK9A 2GL5A 3WQPA 3VDGA 4DRSA 2WHKA 1W0MA 2VC9A 2NUXA 3DYPA 3EZ4A 3L4YA 1H41A 2ISVA 2A5HA 2HK1A 3G3DA 1A3HA 1X6NA 1SO6A 5G2HA 3SRKA 2ZZ6A 2W79A 1Q6DA 3OGRA 2VVSA 3R58A 3CPRA 4NUWA 3C6CA 3NJ3A 3WF1A 1LRNA 1I1WA 3RJXA 1XLFA 1RBLA 5D2VA 3N3TA 3CO4A 1ZUAX 4Q8UA 1QJWA 4C6IA 4UCGA 1PHWA 4CNOA 2QPSA 5EBAA 2HRWA 1RJRA 2DU2A 2WZMA 3CXOA 1XINA 1XDLA 3CQ0A 1C90A 4GQ0A 4MWAE 2AQVA 4CCZA 1KFEA 2QUMA 3ARZA 2R1KA 1ZRQA 2PWDA 2VI0A 3CTTA 1YHTA 3L66A 2NVDA 1GKRA 2ASHA 3QV8A 5AYXA 3D3FA 3LZ3A 5C9ZA 1A4MA 3CHVA 5AC7A 3ZJKA 4Q8NA 1VPYA 2XVLA 1E9YB 2A3LA 4X22A 2P3ZA 2QNEA 4GI9A 1JXKA 3W37A 2YDSA 1SGJA 4UTLA 1HJQA 4FA3A 3UGRA 4ZSTA 3T9PA 1RXOB 4IMCA 2WVTA 4JTFA 1RLDA 1TE1A 1U83A 4H2HA 1IZJA 4GIEA 1P0NA 5ECVA 1J5SA 4O8AA 3PANA 4O50A 1DJWA 4GBUA 1GOQA 3DFQA 2W91A 4QE4A 4ZR8A 2ZUTA 4DXXA 4A6GA 5CSUA 4MB4A 2YFNA 4HA4A 3D5HA 3H7RA 1AG1O 2XH0A 2Y7DA 4F79A 4H4IA 3N2MA 4P8WA 2VZUA 3KBMA 4D9PA 1TX2A 1UROA 4AX7A 4L61A 3S1WA 1YBQA 2GDQA 3USZA 3K8MA 1WA3A 2XH2A 4ZSUA 1JPMA 3VIIA 3HPFA 2QHAA 4RX0A 1SJBA 1OK4A 2ZUNA 5FI8A 1B30A 1DQXA 1XL9A 2AQOA 3W23A 2XN1A 3GY1A 1OYCA 3WLIA 4OUEA 1DJQA 1HO1A 5IBXC 4O12A 5HR6A 1XM3A 4N6FA 3FXYA 5EMYA 1ZP3A 4HNNA 1ADSA 2EGZA 3F4VA 5KZMA 3G1AA 3N12A 3QTPA 4WDXA 1OJXA 4JL2A 3WQ8A 1XDMA 4PTDA 3DKLA 1HJXA 1L8NA 4GCAA 2Y63A 3RAOA 1EPVA 1V3KA 2WQDA 3TSBA 2VCBA 2PSNA 1M65A 3C8NA 1OFRA 5FEZA 3GXDA 1B4KA 4GD0A 3AALA 3L2IA 3SQLA 2PDFA 3POCA 1UD2A 4B5TA 1TR9A 3BICA 1XLMA 3EKLA 1SJDA 1BQCA 3IS4A 5C70A 3G8RA 3Q94A 4N4QA 1M7OA 3MUIA 1YPXA 3W7LA 2NX1A 3AQUA 4O14A 1UP0A 2CCRA 4LUIA 2VXNA 2FJKA 2VX4A 4L4MA 3MHFA 3TW9A 1EB3A 4WY0B 4KIRA 2NLYA 3I10A 3GBDA 4UR8A 2DPEA 3GX9A 4GUHA 1LF1A 2WLYA 5FD0A 4BS0A 4XZ9A 2FZDA 5MF5A 3GB6A 3EEZA 3BJTA 4NJKA 1TPB1 3MV11 2IKJA 3WQDA 4NIRA 3WLKX 2OEMA 3UWZA 1RY0A 1XBZA 2A3CA 3ITCA 4J2MA 3TTQA 5HPOA 2QCDA 5D04C 2WZIA 3CC1A 2POZA 4DPPA 2IQTA 3TQPA 1DJIA 3F4WA 4AVNA 1UWTA 3OO2A 3B9AA 2Z1XA 4C6EA 4H8NA 3SURA 3CB3A 3FA3A 4RK8A 4JTKA 3NZPA 4HPXA 4HTYA 4MY8A 5ABEA 1FQ0A 1SJAA 3EX2A 4TO8A 4F2TA 1E6SM 4QQ3A 4GQRA 3TLQA 1VAHA 2OQLA 1OQFA 4M19A 4IT1A 8XIAA 1VFLA 5AKQA 1J0ZA 1XI3A 2AMXA 9XIMA 1S1RA 4L9ZA 3DYMA 3FW6A 4S3JA 2GGGA 1UUMA 3EYPA 3AYTA 5HDRA 3CZKA 2GVJA 3OODA 1US0A 4QJ1A 3CPUA 2PCQA 1EDTA 3G3MA 3IJ6A 1YE6A 3N9KA 7A3HA 5REQA 1JZ5A 4HN8A 1O12A 5BCAA 1X96A 2GLKA 4MY9A 5CZSA 1XX1A 4LNYA 1TJ2A 3HM7A 2BX7A 3I6TA 1ZGDA 4PUDA 1TWWA 5AC6A 3MQTA 1H7OA 4JPGA 2G0WA 3APTA 3OLEA 4LBRA 3BE7A 4O28A 2YDRA 3WD3A 4GY7A 1XR2A 3UA3A 2J9YA 1IIGA 3PVFA 7REQA 1X39A 1GTHA 3B3DA 1H62A 3TK7A 3PAJA 3C4UA 4XUYA 5I5RA 1C7TA 3PBGA 2GOKA 4JFVA 1TRDA 3WH5A 3TR9A 2GGIA 3TYUA 1F74A 1FCUA 3MWAA 5AC4A 3L5MA 1VFMA 1LBLA 4DZHA 4PB5A 3RFAA 3L4VA 1TB3A 1Q65A 3L4UA 3HG5A 2CHOA 4GIYA 1K4HA 1VR6A 4NP7A 1VJSA 3HPZA 2ZUUA 4H6QA 1TG7A 2WSPA 3RLVA 4XISA 3WY1A 1TMQA 1EHNA 2UY5A 3H26A 1JXJA 3VD5A 5EY5A 2D0FA 5I3DA 1AH4A 3AHVA 3DG7A 2YA1A 1FDJA 4EXAA 4WDWA 4DYEA 2V3FA 4JTHA 4JIHA 5D2WA 5K9XA 5D37A 4YHGA 4S2BA 1XYFA 1FWJC 2YZRA 1Q6RA 3K5XA 2CESA 1V77A 5HUPA 3TMQA 3HFYA 2I9UA 3CUGA 3T0CA 4P7LA 3FS2A 3BL3A 3WH9A 3EX6A 4IQJA 1WCGA 1CLXA 2GOUA 3GQYA 2E6FA 3TYBA 4MB3A 4R7JA 1ZBVA 3PWIA 4K6AA 4G7EA 1A5KC 1IEXA 1P6WA 4K8EA 2WYSA 4LUJA 3LB0A 3GE7A 3SN0A 4DVOA 4O1BA 2DSKA 2ZX9A 4FNSA 1Q2SA 3DESA 3QR3A 1XLDA 3L5AA 1YXYA 3RJYA 2WV8A 4A29A 4PTNA 5AYZA 1JF6A 3UPMA 3WIJA 3TVAA 4RR4A 2QGHA 4DJFA 3BAIA 1EDGA 4XKYA 3C0QA 4JQ2A 1GCYA 1RR2A 4MB5A 3W7RA 1NVMA 1K6WA 5C71A 1X8CA 4B92A 4O1FA 1FKXA 5DX7A 4JIPA 5DCBA 1ZJAA 4RW3A 3R0UA 1HNYA 2FIQA 3W1TA 1PX8A 1H7WA 4BF7A 4ZQCA 2Y0FA 4GRSA 4CCDA 3SGZA 2X1TA 4KH2A 1B5TA 3MJMA 2WVVB 2ZBTA 4ORIA 4B91A 4IFRA 3WDPP 5DFAA 3GHUA 3W22A 1ENUA 3OZPA 1UD4A 1H60A 2DVTA 4WX2A 3GH7A 2QMKA 2EJAA 3N9SA 3VMOA 1WOAA 3HGJA 4YTUA 1CDGA 1UH2A 1W5MA 3UR5A 5HMEA 4LC8A 1EOKA 3BSGA 1SFTA 3S6OA 3QEZA 1FWDC 1H11A 2WNNA 4CN4A 3PZOA 1ZNNA 1UD8A 5K3VA 2RJHA 3LMYA 5BOOA 4TQTA 4JTGA 2FLIA 1IEQA 2ZA3A 4O1EA 1E0VA 2XFFA 4KETA 4DNHA 2DEPA 1UYQA 1D3CA 5I3JA 3OTRA 3HQPA 1E51A 4QG6A 3TJLA 4DUOA 2R24A 3B0VC 3VOCA 3WH8A 4MM1A 1EWDA 2X0HA 2A21A 1EOMA 3DECA 5LNUA 4XKMA 5LIWX 4NRRA 3LGGA 1SPQA 4C7GA 2PLJA 3BOFA 1AH3A 4HU3A 4L56A 4BF9A 1AD4A 1VYSX 4EX4A 4A8IA 1F73A 4LY8A 3DERA 4H9ZA 3EWUA 1LZOA 3E02A 3KBWA 3MB9A 3H54A 4GY1A 1BSIA 4HA3A 1S2UA 3TYEA 3O6DA 3SADA 4QX4A 3GHRA 2XIMA 1JCMP 2NV2A 2FH8A 1XYLA 2V3GA 2VHLA 2AQWA 1RJPA 2QCEA 4HPJA 3SEPA 4RZ6A 3BDKA 1TVNA 5RUBA 3NEHA 3COTA 3KL3A 1KM6A 4LF1A 3RO6A 1VJZA 3BK0A 5A8PA 5EFFA 1OFPA 2PRHA 1TPVA 4IPNB 3W88A 4HHHA 3DBNA 3QR1A 3ECQA 3L23A 4U28A 2QIWA 3CUJA 3UXKA 4WGHA 4YTRA 2RUSA 4ZTYA 3A12A 3L65A 5F2MA 1RVKA 4HMEA 3SCQA 4FAMA 1W3NA 2QCLA 2Y1HA 3C2FA 2E8ZA 3IVSA 3NM3A 1TCMA 1LROA 1OX5A 3L12A 4RDWA 4F3HA 3KP0A 3BSHA 3U2EA 5AYBA 3W1NA 3B8DA 4L5ZA 2PLMA 2BGQA 2QULA 4N9CA 1U5VA 3NDZA 3WEZA 5M5DA 1CGVA 3TTYA 3EA2A 5D9MA 1DXFA 4MG4A 1WOBA 3NVTA 3BLFA 3A5FA 1UKQA 2I16A 2AL1A 4HBKA 2PAJA 3O9NA 3H23A 3LXBA 2H3BA 1UR4A 2DUZA 3DBPA 3VIKA 2Z6IA 1D3GA 3AS2A 2F7FA 3GFZA 4ZVJA 4JDBA 5A69A 3PZGA 1LDCA 2FVLA 2D24A 3ZWTA 3ARQA 4TTGA 7TIMA 1ECQA 1O94A 2Y62A 4MJZA 5HAOA 2OYLA 3TYDA 4LEFA 4M81A 3MCOA 3MYOA 4PA8A 2QJGA 5D2TA 4EIVA 3LEPA 4A3RA 4LAZA 2C3ZA 4RPQA 1ME7A 2OOGA 3USBA 2VDIA 4OBRA 1AFSA 3DXIA 4V1XA 3T1GA 2GJRA 2J62A 1SO5A 4DN1A 4XAFA 4NYUA 4PMRA 3ZFHA 5BZAA 3LCIA 5I3KA 4M5PA 4WXZA 4J4KA 4FHAA 1W3KA 2GJXB 1W31A 5C6MA 1TSIA 5CG0A 4J3WA 2WKLA 5HATA 4D1JA 4UCFA 4D71A 3B0YA 3BAJA 1CB2A 1OYBA 3PG9A 3E2VA 4JFWA 4OVXA 1HO4A 4PC8A 4HPNA 3ARUA 3WQWA 3AZRA 2YCLA 1JZ8A 2PF8A 3A4AA 3MP4A 3MJYA 4YVPA 1UWUA 4TU1A 3UA4A 1TPH1 2WZEA 1J18A 4KESA 5G4EA 2VC5A 3JZUA 3LGEA 1AK5A 4KS0A 1VYPX 4N2YA 3LCLA 4WQ6A 1OFDA 5D38A 4Z42C 1X1ZA 1TVLA 4EXQA 3H53A 3U7BA 1QK2A 1ZJIA 1X38A 5HBFA 2RHGA 4ZZ9A 1O5RA 3KRUA 2Z2AA 1JYWA 3NXLA 3MSYA 1J6OA 4GQQA 2JFEX 3FFSA 3G6LA 3URBA 1R3SA 3N2TA 3PPGA 5A6KA 2V0TA 3ZLHA 3LRLA 3VKBA 4RV3A 1JDEA 2VEMA 2ZOXA 2WMKA 2ZXBA 3G77A 2ZX8A 4ADTA 2OGYA 5MHBA 5IM51 3CEPA 1C29A 1ITCA 4FXRA 4LYQA 4AEFA 2YZ5A 4Q4MA 5M3WA 1KM1A 3GXPA 2ZE0A 2ZRXA 4QBXA 3WLHA 2V68A 3TUUA 5EMMA 2A6LA 4HJFA 3T8LA 4DZ5A 1XG3A 2BTMA 1W32A 4NNCA 1XIDA 1R46A 4C1LA 1RY8A 4LYPA 4O1AA 4NAEA 4TX6A 1T99A 3IUHA 4NXKA 1VBUA 3I3EA 2E6DA 4GVIA 1AL8A 1QI3A 3DX5A 4PBFA 4AIOA 2DZBA 3WQ5A 3K4WA 3RITA 4HA0A 3N6HA 6CGTA 2HWGA 1ME8A 3VMNA 2G95A 1RH9A 2CWXA 4QITA 4ASTA 4JTTA 3M5YA 3GU1A 4XZHA 3VUSA 4IPPA 2V6AA 2VP8A 1BGGA 5HXMA 2WPGA 2VGGA 1G5AA 2GPTA 1QR7A 4IJRA 4GVGA 3BANA 4AY8A 1UKPA 4LAKA 4Q4RA 2P5NA 1QPRA 3D6NA 2OLAA 5A2BA 4C6JA 1PL9A 4XO6A 1EA0A 4YL2A 4GUFA 3NTYA 4B3ZA 1LJYA 3IPWA 2OSWA 4FMVA 1SZRA 3VGFA 1GHSA 3GG0A 1JCJA 2Y61A 2BG5A 1EJXC 1GUVA 3QGKC 4RNFA 2OLHA 2X16A 3M9YA 5K9DA 4S3FA 1X6LA 4FZIA 4PTMA 4U3AA 3H55A 3T78A 3O16A 4EAYA 1B3WA 3VD4A 1J5TA 2O9OA 3AFBA 4J3XA 3NGFA 4AAJA 1F3TA 1GYMA 3EB3A 2OXNA 3HBLA 3NIYA 4YMZA 1K77A 1AMKA 2WCGA 4MTVA 1DJGA 3TW7A 1GQJA 1YTDA 2VENA 4PTVA 2QCDB 2ISFA 4KW2A 1D9EA 5KSWA 4Q4QA 1EBGA 3QV6A 1YX1A 1V79A 1FWGC 3SCPA 4AD2A 3APYA 2OKTA 2EO7A 5BWFA 1IR1A 1D7KA 4GXWA 4KKXA 1BFNA 2PI6A 3CASA 3MS8A 4HNOA 2WO5A 2QCGA 1K6AA 5HINA 3OGVA 2ZC8A 4UQBA 3M0JA 3L21A 1UZ4A 4ERGA 1FDYA 5J8LA 2E7FA 3UETA 1B90A 3N14A 3WBWA 1Q85A 4ZMGA 3L67A 5FL0A 4PTWA 1NTHA 2QDDA 3W26A 3MMTA 1KFBA 1OHLA 3UGVA 1DTNA 4B90A 1I2RA 2GYIA 4Y9OA 4S2CA 3IARA 4LNCA 3OBAA 5FEWA 5KZDA 2RDWA 2KZHA 4WCJA 5REQB 2V69A 2G4JA 3PUEA 4H9TA 1XKJA 3KBNA 2NUYA 1XIEA 3RO8A 3EPNA 5D03A 4LVBA 1WUFA 3W70A 2Z29A 1ONXA 2H8XA 3DFPA 4HTBA 4Y9AA 4KWUA 4IMFA 3SGUA 4ICMA 3R25A 2B7OA 2GJNA 3WF2A 4HSNA 1T40A 3GNXA 4JQAA 4XG1A 1MXDA 1F4HA 2PDKA 5GNXA 1UKOA 4X60A 1UH4A 2PA6A 2CU0A 7REQB 4WR3A 4IOTA 4AIEA 3QM3A 3NL6A 3E3HA 1GHRA 3S1UA 1DQUA 2BNJA 3N11A 4MWAC 3N29A 2XFYA 3LMZA 3P67A 5IXEA 2C6QA 5I00A 4CVUA 4AWTA 3WMSA 4W7WA 4MB1A 5FA5A 4M29A 3RCYA 2HPIA 1WBJA 1YEYA 1J12A 1D8CA 4W85A 3LCWA 4JX5A 3W2JA 1DE5A 3GYCA 1MQQA 2DQWA 3GUWA 1KKOA 2JKPA 3QFEA 3WH7A 1J4EA 3SQMA 1OY0A 3ABOA 4IGNA 3FCPA 3B04A 1Q7ZA 4UQEA 3WZ0E 4PE8A 1PTDA 2WSYA 4GNVA 4CCCA 5LHFA 3R13A 4CNUA 2SFPA 3K46A 5JH2A 1MXSA 4OV4A 1HG3A 2XM1A 4K39A 4WLCA 4WKAA 2I9EA 4QSHA 4O0ZA 3M64A 5IFPA 4O54A 4KBXA 1LRQA 1XQLA 3IV3A 2G96A 1F9CA 3H70A 4L1WA 3H4GA 4AD5A 1LG2A 2YBUA 1W1TA 4LV4A 1VHNA 5EMLA 3R8GA 2BB0A 2XZ7A 2H6RA 4O4WA 1S3HA 4GX9A 3H7VA 4G7EB 4LYRA 2O92A 1O1ZA 1PEZA 1V4YA 2KAUC 4FR1A 4ZQOA 1ZBKA 3W76A 3G1FA 1PE1A 1EJSC 3C0SA 3RX3A 1DKWA 1NELA 1QO2A 1Q7QA 2NQZA 3M0YA 3SRHA 1EP1A 3GC2A 1KO0A 4H7CA 1QT1A 1TJPA 3UNTA 3S1XA 4XKYB 4I5UA 1OG0A 1E5NA 2J7FA 2EPKX 5T26A 3PTDA 1A5CA 3QY6A 3V4BA 2A1YA 2GWGA 1GQIA 4MSSA 1ZFJA 1Z7AA 1VGAA 5JBEA 4XTIA 4JD4A 1J6PA 4Y6GA 1IQ8A 1KV8A 3IV8A 4LVAA 5LNSA 2ZE3A 2J79A 2HBVA 2QDGA 2EG6A 1UB3A 1OG6A 2PDXA 3SRDA 2YR1A 4IUGA 3UWQA 4EVZA 1FUYA 4G9PA 3BH4A 4C6CA 4GVHA 5HUOA 2G4FA 2EQDA 1OZMA 4FLSA 1ISYA 1LTDA 2ZXDA 1HJVA 4DBWA 4DJFC 1UPMB 1XPGA 4JQ3A 2PBGA 3W4RA 3GM8A 2YKKA 1R9XA 2WMFA 3I7RA 1S2WA 4RV8A 1FDZA 3UZJA 1MUMA 5E0FA 2VCCA 2DDXA 1YIXA 4KWSA 4PRWA 5FJTA 4ZXLA 4XIMA 4F0HA 1MMFA 1A5NC 4W8AA 4H8UA 3SCSA 4D6IA 4NVTA 4XTDA 2WB5A 1UA3A 1HKWA 3WENA 3STPA 1KWGA 3DCPA 5J5DA 4BA0A 3GKAA 4YU1A 4Q33A 2GWNA 2VZTA 4L6DA 4AVFA 1EPXA 1KGUA 3UBPC 3WQ4A 1DYSA 2OQYA 4W4QA 1WUEA 3FVDA 2V3EA 4JDYA 3VD9A 2E6AA 4IMEA 3ITVA 2WSKA 4JICA 1JPKA 1PCWA 6REQA 1GK8A 1KM5A 3HURA 2QKFA 3N4FA 3UG3A 4W87A 1BTMA 4E4PA 1HZYA 4NNBA 3C0LA 5BOFA 4JYDA 2A2IA 1I6NA 1YE4A 2AOSA 1MO0A 5CGTA 3IJQA 1XD0A 2Q6ZA 5AECA 5DXYA 3CUZA 3WFLA 1R7OA 3WO8A 4YIWA 2PGFA 4G2DA 3VZXA 4OOUA 4LRSA 4WOZA 3EWDA 1MQPA 1NOUA 1TMLA 3DHFA 2DT0A 3G18A 1GYNA 4JXCA 2A3HA 1LLZA 3SUSA 3IGHX 1O66A 4POCA 4HCLA 1Z44A 3CPGA 3AXHA 1KFLA 3L0GA 3WLNA 4Y9PA 4CD5A 1XRFA 5AHMA 4FS9A 4AW7A 4A05A 1F5ZA 1CEOA 4JY8A 3WFZA 3VM5A 4TX8A 2BASA 3NQ7A 1ZSXA 3MMDA 2WJFA 3LCXA 4AVOA 3PZUA 3UT0A 5DXXA 1UD5A 2HE5A 4W86A 5J5RA 1KB3A 3P0WA 1W5QA 3N18A 1YDNA 4E8DA 2GDVA 4KRZA 5BROA 3G1HA 2QCMA 2OO6A 2DSZA 4GO8A 3QF0A 4HYWA 3BW2A 4Z08A 3OEXA 1ZQ5A 3H2EA 3EB2A 1ONEA 1WAWA 1SZNA 4MFDA 2D2OA 6PTDA 5FSEC 4WSHA 4BI7A 4WKHA 4LS2A 1P5BA 1MDLA 2CLFA 4IIGA 1YPFA 5CPLA 3BARA 3UXDA 3PBWA 2BV9A 1WDRA 5HJXA 1XGZA 1PCKA 1Z3NA 3EPOA 4DUWA 4BQ5A 4E6MA 1Z6KA 2C91A 3IWPA 4H6EA 3RCMA 5CGMA 5D4YA 3FXGA 1QW9A 4O10A 4J28A 1JZ4A 1DHKA 2FTYA 3P0XA 1TPDA 5C9WA 1T0OA 1KBLA 2B7NA 1OX6A 3VNMA 5AOUA 1LUCA 3CV2A 3EXTA 2WMGA 2V9DA 1YXCA 1ZB5A 4FSAA 3HQNA 5D33A 4E2BA 4WDUA 3SBFA 4S3BA 1NWRA 4YVVA 3EXRA 2E28A 2VR5A 2ZADA 4O0QA 3WNNA 5HNRA 3SCVA 3VD7A 2TSYA 2OVLA 3VX1A 1U22A 2YCLB 1ITXA 3O0KA 2O0TA 3ORWA 3WQEA 4KCUA 2V5DA 4X2PA 1IV8A 3UJRA 3ITOA 4IWWA 3TZFA 1W3TA 1DE6A 2OQHA 1IGSA 1JUBA 4MYXA 4N02A 3VOJA 3BSMA 4KEZA 4M7TA 3BZGA 5DT5A 3CAWA 3MCNA 4PGLA 3MYPA 3U2CA 5IOBA 5D32A 3BZJA 4D8LA 2XGIA 3UXLA 1A5SA 4OTKA 4C6FA 1ODUA 3N2CA 3A47A 4CD8A 3GIPA 1G4TA 2W61A 1XP3A 1J8VA 3AMLA 2G8ZA 5AVHA 3N73A 2C19A 2VRKA 4CQBA 4ZO9A 3CUFA 1LYXA 5AHIA 1BPLB 5M2FX 2D23A 2DVXA 3ZMRA 1WQ5A 4QNWA 1SFSA 4FLRA 2BXYA 1I1XA 3CMFA 1KBJA 2ZUWA 1EJ7L 2ON3A 2Z1WA 4GXMA 2DVUA 3RMJA 4ICCX 2GVYA 3ICJA 3I3BA 2PGWA 1XCXA 2XDFA 2OOFA 3WD0A 2X7WA 3NEVA 1C92A 3VZYA 2DH2A 7TAAA 4TX9A 4BZYA 4D6HA 2AGTA 5C7HA 4JEQA 3RR1A 2J47A 5I78A 3N13A 2PLKA 3AXKA 4NAEB 3B0PA 3OA3A 4C6BA 1ZCCA 4WZHA 4H6RA 5I09A 2PMQA 1V3HA 4ZQNA 3U48A 3SCNA 1HQTA 3UWWA 5DY2A 1OB0A 3A9BA 1XV8A 1XLIA 2PDWA 3FDGA 2J4GA 1UOKA 3W38A 1JYNA 4IPLA 1DJHA 3RNDA 5HJYA 5I02A 1ZS2A 2D1ZA 1GPFA 3DDMA 4PMVA 2QAPA 2ZZ5A 4G1KA 4B3LA 2XWDA 1V7YA 1Y5VA 4FLOA 3QOMA 1A5OC 2PS2A 3G1DA 4L65A 2DSVA 1QHZA 3NPVA 1KTNA 2ACUA 4C7FA 1HW6A 4FI4A 4DLFA 1GPWA 3TA9A 3S83A 2JK2A 2Y5EA 1NDYA 1IHIA 1X1OA 2DUXA 1RQHA 4PUNA 2DSWA 4UTWC 2R82A 1MNSA 3SCTA 4QLJA 4BHYA 4BK9A 3S1VA 3MMWA 1S5WA 4Q7BA 4ZL1A 3FJ4A 2EKGA 4U2YA 2CHRA 3DFNA 4PMZA 2Z25A 2UY3A 3FK4A 4Z1AA 1AODA 5DMYA 1BWLA 1F4AA 2A7RA 3JRKA 2PFHA 2I14A 1EC9A 3W87A 2GQ9A 3ZR6A 2IW0A 3KOYA 4MOZA 1A80A 1OWQA 1W9BM 2BHUA 2V5KA 3V0SA 3MSGA 1EC8A 3NQFA 3CL6A 3PZMA 3QGAC 1LL6A 1SR0A 3DFSA 1DL3A 1DPMA 1NFPA 1ZENA 3RMEA 3PY2A 1YNYA 5HPCA 3HJZA 4OUIA 3T81A 2YYTA 2HROA 3M6DA 5JU6A 5CQ1A 1OCNA 3GXNA 3AYSA 2PGEA 3WK2A 3U2ZA 2OTDA 4LB3A 4JTCA 5A8OA 2P88A 3CH9A 4ZODA 7ODCA 3M0HA 2UY2A 4IF2A 1ME9A 1A3XA 4DIAA 1CT5A 3T2PA 1GORA 3NVDA 2D2HA 3E38A 1XYAA 2A7PA 3MVTA 4DYJA 3VIFA 4K3ZA 2OPJA 4QFUA 3S6TA 1XIHA 3PZQA 4PMYA 1BG4A 4M7SA 1WAUA 4H3DA 2D22A 1TJ1A 3BAXA 2QCCA 1UBPC 4YN5A 3GDTA 4PCNA 4HPHA 2BLEA 3S9IA 4JZ5A 4L4OA 4ZQRA 4OQVA 4U3CA 4B15A 2INZA 1C3FA 5H8UA 1EC7A 3N19B 3SCRA 3H2NA 3LCHA 4M51A 1K03A 4KGLA 3EOEA 1R3VA 1EF2A 4I8YA 3B9NA 2ATMA 2YOCA 1AMYA 4K7VA 1XDJA 2JEPA 1B3ZA 2VQUA 1BG9A 3HB9A 3WL0A 1DHPA 2WVSA 2QJMA 4DF2A 1FWHC 2P8CA 1XIFA 1PIFA 2P0OA 4AZHA 2VR4A 2C14A 3MY9A 1V0KA 2O7SA 4PB3A 1V6UA 2DZAA 1XRSA 1M6JA 4H7VA 1QWGA 3UG5A 3FAWA 4UFHA 1Z69A 4W93A 3T8QA 4EXBA 1I2PA 4P8XA 3UZYA 1N82A 3IANA 4ZEPA 1UWRA 3E0IA 1MRQA 2CLLA 3CUHA 5AYIA 1M5WA 3GNPA 3STCA 4JTLA 5A95A 1M04A 4JQ1A 4AHOA 1OINA 3ARWA 2VOMA 4KT2A 4ERAA 1A4LA 5BNKA 3GIYA 4LF2A 5CZ0A 4H00A 4GG9A 2XIJA 3K2GA 5I0DA 3LZ5A 4ZXOA 3W53A 1DWHM 2C1GA 1KXQA 1H5YA 4IX0A 4L6OA 5G4HC 4YXGA 3B9EA 1TIMA 3VIJA 4OHQA 4EWND 4AUBA 2A3EA 3RG6A 4LB4A 4FIRA 1W1IE 3FVMA 3O05A 3TYAA 2WWDA 3Q37A 4MKVA 2B7QA 1BYDA 3WLSA 4F9JA 3PULA 4CEUC 4ZE5A 1XWYA 1UW9A 2OJPA 1ECEA 2NXIA 3LS9A 1JGIA 3HO8A 3TYZA 4DF1A 4PRTA 4TXEA 5FSDC 1O6IA 3WDJA 3E96A 3G5EA 1RLCL 5FCZA 3G0UA 1JYXA 1SSGA 4CCEA 1KXHA 1WDPA 2V8ZA 4QXIA 3G1SA 2DQXA 3VILA 5LKYA 2HBXA 4XQ6A 3LI0A 3UJFA 1XC6A 3EWXA 4A8NA 3LHTA 4WJEA 4FOKA 4S3KA 3W6YA 3O2LA 1VIWA 5I77A 2FPVA 1TTJA 4F4RA 4PN2A 5A1AA 2D3LA 3NO3A 2DZWA 3HFTA 4W88A 3SJNA 3KRBA 1IXPA 2H8ZA 1KTCA 2FQIA 3QH2A 1UMLA 2CHNA 2Y8KA 1I0BA 4AEEA 1PHQA 5CJ5A 5K4XA 2WMIA 2QPUA 4Z0JA 1XYZA 4PULA 4JN7A 5DCEA 1ZALA 4GO9A 3ITXA 3MU7A 3CT2A 3VXGA 4AX6A 3IIXA 3VAVA 2YL5A 2CC0A 4R27A 4ES4A 4HMNA 4WD0A 2E77A 4RL3A 3SIMA 4R3UA 3ZS4A 3W2MA 1UR0A 1PUDA 1VH7A 1XIJA 3NPXA 1EUAA 1JDCA 3EOLA 2XIIA 3VDBA 2ZZ7A 4XD3A 2G3MA 2Y88A 3A13A 1VRXA 2PC4A 2HMCA 2J13A 2C0HA 1XIIA 2DW7A 4D2JA 3NQAA 3C3NA 4LS0A 2BBFA 3NAVA 4UMCA 2VCAA 5JIWA 2GQAA 3DC0A 5CSYA 4J40A 3ONCA 1C8VA 2E40A 2PDMA 4Q22A 4KFOA 6REQB 4DO4A 4S3GA 1E4LA 5IBXA 3O6YX 1XLKA 3EOSA 2WC7A 3R7MA 2WM1A 3OG3A 2H9AA 4WIWA 3WF3A 1GEHA 5LNRA 3NG3A 4WXYA 3ZJ8A 1EJWC 1Q13A 4DBUA 1ICQA 3LDVA 4J9JA 1HVQA 4ILSA 3NNTA 1JCLA 2VYOA 2FHBA 2OSXA 3R8RA 1QPKA 1SVDA 3MZ2A 1TELA 4KRTA 2ZDSA 4LSBA 4N9DA 5HJLA 4GQGA 1BF2A 2FZ8A 3N3MA 2ISSA 4H1ZA 3VNLA 3BPWA 1NJJA 3T0TA 2X0SA 6TAAA 3QY7A 1B1YA 4LANA 3RPDA 1FWNA 3VMPA 4LXFA 2NUWA 3O7UA 1Z42A 1UMYA 3BXWA 4M80A 3VKAA 2H90A 4TTUA 4MY1A 1R7AA 1NM9A 1O68A 1J11A 1TV7A 1V7AA 5FF7A 5BW6A 5BYWA 3LXAA 3PB0A 1MVYA 2IMRA 4CU8A 2R91A 4HOXA 3LGDA 2BGNE 5C7VA 3EWZA 1YLVA 2XINA 1OK6A 2XH4A 5HQMA 3G0XA 1IZCA 1J2WA 5FACA 3S1GA 4E3VA 1DTUA 3HG4A 4QQUA 5H8PA 1XLEA 4DO7A 3UYCA 3M5ZA 2NT1A 4RNHA 3OU8A 4W7UA 4MZYA 1WP6A 1XHGA 4NL1A 1EJUC 3VDHA 1YADA 2O7QA 3JR2A 5AHLA 1EBHA 2P53A 1FP9A 5E70A 2GJLA 4J35A 1V8EA 3B05A 3ZR5A 2R8WA 3OA5A 4DO5A 2ISDA 3QFWA 3UZXA 1UH3A 2PDNA 3AHXA 5G4WA 2YFOA 4PSPA 4V27A 3WYZA 3MI3A 3TDFA 2VZOA 2WXDM 5T8GA 3GC4A 2X30A 3KP1A 1HKMA 2HVOA 5FJPA 3C56A 1B31A 2YCIX 4JTSA 3K8LA 3CHCA 1WXJA 4MHBA 4QAIA 3ELFA 1EO5A 4QDMA 1S1PA 3M5XA 1FWSA 1I0DA 3CV7A 1TUFA 5EMUA 1VQTA 1VLWA 4K38A 3BLDA 1LUCB 2PDUA 5HMFA 1LWJA 2XIBA 2HTMA 2VR2A 2E09A 4AY1A 4LT9A 1MUWA 4XZIA 1JG9A 1OFOA 4U5KA 3ZXWA 4JN6A 3DG6A 4GBDA 1JQXA 4JGDA 5DY3A 4K7YA 4FNTA 5HANA 4FEZA 1F8MA 3PR2A 4U10A 3VOGA 3W84A 3L4ZA 1P6BA 2HSAA 3THAA 1QPOA 1JL8A 3AZSA 1KWKA 1AUSL 1VBHA 1TTPA 1YYAA 3EEGA 2NSXA 1PZ0A 4UTJA 2G3FA 3VNDA 3SUVA 3PUGA 3UWUA 3AIBA 4I7UA 5GJPA 3IVTA 4WJ8A 2PDJA 3PP7A 1V3MA 1TQXA 2HJPA 4F66A 3ARVA 4ATWA 3QYSA 2I57A 1Q6GA 1CPUA 2YPIA 1S5MA 4JNMA 1WDDA 2VEKA 5I24A 3OPSA 3TC6A 3QZ6A 3I6RA 2IPJA 3QSRA 1UA7A 2J7GA 5CPOA 2YXXA 4F2UA 4JHOA 4PMOA 1DP0A 4J3SA 1K8CA 5FKYA 3B8IA 2VUYA 4TMCA 4HMDA 4UQAA 2QAFA 1ICSA 1IWPA 2YW3A 1GVEA 4BCEA 1E6ZA 3U7VA 3S2LA 4UNKA 5A6BD 1P1XA 4LAOA 1QI0A 3QHMA 1BF6A 3WH6A 3PFMA 4A21A 3V5OA 1PXGA 3WLJA 4TUFA 4KQNA 1S5VA 4H19A 1QBAA 4YTSA 5A6JA 2VC6A 2F2HA 4D6DA 1PO9A 3DKJA 3PB2A 1QI2A 1IXOA 3O6AA 3ABXA 3KTCA 1FHUA 3IGUA 2UY4A 5EKYA 4X2RA 3WJYA 3W7CA 1VCFA 1OCQA 3C2VA 1NU5A 4YTQA 3MP5A 2P10A 2VELA 1UWQA 5AVNA 3CZLA 1MRAA 4O57A 1I9CB 2EPHA 3H22A 2R1LA 1K8ZA 3DU0A 2DIEA 1S5NA 1XPYA 3HGRA 3MI6A 4LGXA 4BEQA 4L7ZA 3M07A 4RDYA 5TF0A 1DEDA 2YDQA 7PTDA 1Y7VA 2R1MA 7XIMA 2OZ8A 1DJZA 4OBSA 2RDTA 4PRRA 4K68A 4OOZA 2B31A 3O1NA 4PCSA 2J6VA 1KM4A 3ITYA 1UZHA 3KWXA 3CUXA 2JBMA 1MXGA 3MT1A 2UBPC 3W74A 1V02E 3GH5A 2Q09A 5AHEA 4J2PA 4UFKA 5K9CA 1RBOB 1JZ7A 2VM8A 3MKVA 3T05A 1GJUA 1J10A 4KERA 1R3TA 1GVRA 2ABBA 1D3HA 1RQBA 3PN8A 1GQLA 4PL1A 5EGRA 1FCVA 3TC7A 4Z2LA 4OFCA 1P0KA 1F2JA 3N4EA 2PP1A 1RK5A 1LLOA 1UD3A 3Q65A 4YWSA 3MTWA 2ZZ3A 5BXSA 4RZ5A 4NZ3A 3WLMA 4QRNA 4OT7A 2W92A 2VEIA 3FSTA 3AIRA 4IJBA 1FWWA 2V38A 1WKYA 2NT0A 2YA0A 4XZWA 1VD6A 4NASA 3C8FA 1KBIA 3HMCA 2J66A 2OB3A 3WJSA 3C3UA 2XU2A 3B4UA 1H7RA 3MHGA 3L0KA 3TN6A 2FVKA 3R0DA 3KOFA 1Z89A 1UBSA 1GGOA 3WQGA 3RRXA 1BYBA 3T0BA 4E8CA 3KCOA 4CN6A 3CTLA 4E5TA 5EPDA 4HSHA 4QS5A 2ZTKA 2GFTA 3WK3A 3B03A 5PTDA 5KZ6A 2VGIA 3CT7A 2J88A 1W9PA 1VFFA 1EHAA 3GHSA 3EX3A 3FAXA 4NY2A 1AL7A 3AHYA 4R7WA 3UWYA 1A5MC 2VURA 3W85A 4R33A 4XZMX 1IF2A 3QV7A 4KPLA 1UR8A 2G37A 4QJ3B 4CU6A 2E1WA 1QPQA 3VO0A 4GWEA 3WDQA 3R0KA 4HMCA 1A49A 1E4IA 1V0NA 4NNAA 5HR7A 1SZGA 4LVDA 2EPLX 3AYRA 2PB1A 3D46A 3GKFA 3SO7A 2NLIA 2YLLA 4DI9A 1H63A 1QI4A 4JTIA 4AWUA 4DI8A 1HL8A 1U1HA 4AD0A 5CJNA 4KEMA 3BW4A 1NP0A 5G5IA 1K7FA 4ZB5A 4NYYA 1RZMA 4LJ3A 4EP8C 4O4VA 2ZZ1A 1NDWA 3LX9A 3W1RA 3TOYA 1CWYA 3FGCA 3CZEA 3P5ZA 2FPTA 2WCSA 2CXEA 1FWAC 2QVHA 3AIQA 3U0HA 4AMAA 1FFQA 4QE5A 4PUKA 3QYQA 4D6GA 4OU1A 3GNDA 1RALA 3LPGA 3D3AA 4DXKA 2VFGA 1VIZA 5JQ9A 1QTWA 3H4WA 2PTXA 3AIVA 4H9YA 3UESA 4JQ4A 5E9XA 2VD9A 5LGXA 1M7XA 3EWWA 3THQA 3QGVA 4AG0A 2OMAA 1PPIA 1R47A 3WDRA 1IE7C 4P8UA 1QHOA 2GDUA 4KGJA 1CB7B 4AZIA 4CLMA 1DWJM 2D2JA 3TAKA 4QE1A 2J7BA 2WCAA 2ZRVA 3IRDA 3CV6A 1AQFA 4NQ1A 3TWAA 3S4TA 4L6HA 5AHNA 2VD8A 3PG8A 1JRCA 3U4AA 3TXVA 4S3CA 3MA8A 4IXXA 2FZNA 1LRTA 3O63A 3OLIA 3ABSA 4P7QA 5I3IA 4HNTA 4A22A 3GAYA 3MANA 3ZIZA 3P6LA 3HPXA 1O5QA 2YXGA 4WGXA 2J7CA 2I5GA 1JZ3A 3Q4DA 1OC7A 2PEVA 5SWUA 2RDXA 3E2QA 3GTNA 2OYMA 2DJXA 1E15A 3CQJA 4EKJA 5CPTA 4MNJA 1A3WA 3VKDA