4JTSA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with 072
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 136
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtsA00
5F4WA 3L0NA 3KXQA 2CLEA 4WUIA 1MZHA 2PRHA 1SW3A 1B3OA 4FNPA 4E2BA 3F03K 1FX6A 3R12A 4BFAA 3GKAA 3CQ0A 1S3HA 1XBVA 2QAFA 5G2WA 4DF2A 1NVMA 4LOCA 1JCJA 4Y9AA 2A0NA 2C19A 3LLFA 3SGZA 4EIVA 4S2CA 4BWLC 5KINA 2CU0A 3W1TA 4MY9A 1GYLA 1TPFA 1H7WA 3IV3A 1S5WA 3UWWA 1SZGA 1CI1A 3LCXA 5HR7A 2NXHA 3UWUA 4XQ6A 2VENA 1WV2A 4XKYA 1THFD 1WXJA 3BVJA 3G0XA 3LM7A 4IMEA 4Y90A 2WSQA 1SU5A 3PS7A 3OIXA 1HTIA 1TPUA 3NQ2A 5TIMA 3UNDA 4RJEA 2I14A 4X3ZA 1PE1A 3S9YA 2QCEA 2Y6ZA 4XZ9A 5C6MA 4WX2A 4LW7A 4JYFA 4UCGA 4CNOA 5HULA 1M7OA 1O5KA 2NWSA 4MY8A 2OT1A 1XM3A 3GNDA 3LCIA 1XUUA 3M43A 3UYCA 3BG5A 1UBSA 3GDKA 2WV8A 4N9EA 2P1FA 1OX5A 1G4SA 3FYPA 1LYXA 1EB3A 5AHMA 1I8JA 3M7WA 1M7PA 1VHCA 5CPMA 3R89A 4LT9A 3QMTA 4NX0A 4HNNA 6TIMA 1OX6A 3GNNA 3TE9A 1GVOA 3E0IA 3T40A 4MY1A 5BMWA 4GBUA 1FCBA 4O16A 3FKKA 2X16A 3O15A 4E0CA 3ANYA 1VPXA 4ICNA 1LLZA 3HIJA 1FWSA 1MEIA 4M19A 3NL2A 4ORIA 2GVLA 1PVNA 1LDCA 2ATMA 2HMCA 3DFTA 3HB9A 5LNSA 2B4GA 4MKNA 1B4EA 4YCPA 5U4NA 5FESA 4IX2A 1YDVA 1TMHA 4B5NA 2BTMA 5IBXC 2C3ZA 1H61A 1RVGA 2QCMA 4YCOA 4Z1DA 3S42A 4UR7A 4WOQA 4RKAA 2OX1A 4A29A 2NX1A 1YTDA 1PCKA 3NR0A 2NWRA 3EX4A 4AF0A 1SFLA 1BEUA 1QO5A 1HG3A 3C52A 2PCQA 3QSRA 4GUHA 4AVFA 3MJYA 1FDYA 1VLIA 4O53A 1DKWA 4NJJA 4AAJA 1G4EA 2P10A 4O15A 4JNMA 1AK5A 3TNOA 4IGHA 3IIVA 2A7NA 3TUUA 1ZAIA 3S5ZA 3KX6A 2BZNA 3YPIA 3PG9A 1K03A 1YDOA 5D2WA 1GG1A 1VS1A 1WOAA 4AWUA 4FEZA 4FXRA 1MO0A 4PL1A 5BW6A 4NXKA 2OMAA 3L5LA 4FHAA 2VELA 2AAMA 4LUJA 1XFBA 2Z6JA 3BW2A 5T26A 1H62A 4CCEA 3WJZA 4O11A 5DN1A 2YFNA 5F2LA 3L5AA 4O4WA 1JRCA 3LCGA 4K8EA 3LBMA 3T78A 1FUYA 5K9DA 2Y62A 4K37A 3W2JA 3NZ1A 4FNUA 1EIXA 4XTIA 2FB2A 3LXCA 2YDAA 2ZA1A 4YXGA 1Z42A 1NSJA 1QCWA 3K30A 4WXYA 3DFOA 1B9BA 1K7FA 2VFDA 5D33A 4X22A 1P0NA 3P81A 3BW3A 5I3FA 1W37A 1TPVA 4D2JA 3QC3A 3AO0A 3W84A 4BI6A 5AB3A 4FNQA 3TA6A 1RQEA 3QW4B 3A22A 3G1HA 3UPBA 4AHOA 4C1KA 1IGSA 2XN0A 2A4AA 4O54A 3QEZA 1W31A 2A21A 4UTWA 3FKRA 3CU2A 1ML1A 4ONVA 2YFOA 4N9DA 1XL9A 1ME9A 3TH6A 2WO5A 3P8JA 3LCHA 2DZSA 3P5ZA 5MHBA 1FDZA 3P62A 4O4VA 1SFJA 1VC4A 3MMTA 3O07A 4S1FA 1GVSA 1YADA 1XUZA 5BRBA 5EY5A 3R5EA 1ME8A 4WJEA 3DHFA 1B4KA 1WBJA 3QMRA 1RQHA 2A7RA 4KFPA 5G4EA 4P61A 2RDUA 2V2CA 3KVLA 4UTUA 2FPYA 3W7CA 1ZAHA 3MHUA 1GQNA 3RLVA 1P1XA 3NQ7A 1IIGA 4DO5A 3QYQA 3W70A 2OZ0A 4O18A 4N6FA 1CW2A 3G3DA 2ISWA 7TIMA 3T44A 3EXSA 4PFMA 4NJHA 3GXNA 4JEQA 2NUXA 4IXXA 4DEFA 4O14A 2GJLA 3W7KA 5HJLA 3EXRA 4YWIA 3SSJA 1KM0A 2EKCA 3OG3A 1H1YA 3R8RA 3NQFA 4JY9A 3V1PA 2YYTA 1KM4A 3LB0A 3KOFA 1JCLA 3M5VA 2R8WA 3O6CA 1WBHA 4HPJA 4FO4A 2WSYA 5I3JA 2CLFA 4PTNA 1DORA 4QJ1A 4WY0B 2Z2UA 3EX6A 3PWAA 1ZFJA 4JTEA 5D09A 5H91A 3W7GA 1JCMP 4IQLA 1NFBA 4K6AA 3NYZA 4N4PA 2Z6IA 2DZXA 4WZHA 3V75A 2HTMA 3U2OA 3G0UA 3PBVA 5IBXA 5LNUA 1LRTA 4I7VA 5D02A 5SWUA 4MJMA 5CZ0A 3KHJA 1VCGA 2XN2A 2ZRXA 4FNRA 4NQ1A 1N55A 4GUIA 1OFAA 4M7TA 4LWWA 1TJRA 4FX6M 2W79A 3W9ZA 1TTJA 3L0GA 3B0VC 3LERA 5BMXA 5CZJA 4A3UA 3BW4A 1K02A 3W22A 2AGKA 5LNRA 2CLHA 5E1QA 1KFKA 1TV5A 1W5PA 3EX1A 3C2RA 3TCEA 5K9CA 1YPFA 3TU9A 1DV7A 4DBEA 3UD6A 3FJLA 3IVUA 3HO8A 1G7VA 1OFEA 3E49A 4UTMA 3STEA 4NZJA 5HUPA 2QAPA 3KVMA 3G22A 1H7NA 3TXZA 1FCVA 3TMLA 4OE7A 2XN1A 3LCFA 2YZRA 1VYRA 4LS2A 4MVAA 3THQA 2Z0IA 2RHGA 2GUUA 1W3NA 2G96A 3P74A 1RR2A 1W3TA 2NX3A 4CQ8A 1GOXA 4QNEA 3KVKA 3KRUA 1OK6A 2VC6A 2E6AA 2ZYFA 1YYAA 2QCLA 4UTKA 3NQDA 5G4WA 3M5XA 3MYOA 3S5YA 3TFXA 2V82A 1KV5A 3TX9A 5AFDA 2ZZ2A 4O0KA 3Q2DA 3CLMA 3N9SA 2YW3A 5C2XA 1MSSA 3C6CA 4FX7A 2DZUA 4OQVA 1LZOA 3ABOA 3MHGA 2NUWA 2VFGA 1VH7A 3TW6A 2YYUA 3TQKA 3TW7A 1OVDA 1LROA 3NQVA 2X1TA 3M0ZA 4UIOA 3B03A 1VCFA 1TPEA 1C8VA 1QPQA 5KMYA 2J88A 2CLLA 1X1ZA 1N7KA 3HPXA 2HS6A 4JN6A 1JR1A 1TQJA 3PF3A 4DQWA 1P0KA 4HNTA 3GDLA 4NJKA 3DU0A 5CPOA 1SO4A 5HNRA 2E5BA 4HT3A 4IMFA 4GFSA 4H6KA 2BWGA 1KFEA 1A5BA 4I9AA 3T4CA 5F2MA 1F6KA 3PUDA 4JTHA 4AWTA 1A53A 4AEOA 3W7QA 1YPIA 1EUAA 4PC8A 5HQEA 4PEKA 5TBOA 1G6CA 4JTKA 1L9WA 4N4QA 4O10A 2BLEA 5KITA 3EWZA 4UR8A 4QAIA 4OBTA 1EPXA 3W7LA 1QPRA 1KLYA 4MIMA 4JXCA 4KFNA 4XBSA 4UFIA 3A21A 3CM4A 4UTHA 4CNPA 2VEPA 5LNWA 1TTPA 4XTDA 3MWAA 1FWTA 2VEKA 1S5TA 4GUJA 2J27A 2Y7EA 4KKXA 1JQXA 3H54A 3WK0A 1I2PA 5AHNA 1QPOA 2FLIA 1DOSA 2C0AA 4O17A 3W75A 1XDMA 1BTMA 2V0TA 3MI3A 3DZ1A 2I9EA 3TAOA 1TRIA 1FQ0A 3W7MA 3PSVA 5G5IA 1EWDA 2I1OA 4O57A 5K7JA 3TK7A 3HG3A 4CNNA 3WJXA 2TPSA 3HGOA 3GXTA 1FWRA 1EX5A 1P4CA 1QFEA 1R46A 1R47A 1KFJA 1JQVA 3NA8A 3GAKA 2PRMA 3MUXA 1F73A 4UNLA 3EB2A 3LOTA 4H3DA 5EKYA 4ORMA 3S1XA 4UFKA 1ZHAA 2ZZ4A 1QAPA 5FEZA 3A5FA 4Y8FA 4I7UA 4UTJA 5LHFA 3I65A 1RQBA 1O60A 4JICA 4BI7A 1LM1A 2TMDA 2V2HA 3NQGA 3VE7A 1KFLA 1WX0A 3CWNA 5CZTA 1SZNA 3H53A 3QFEA 1JCNA 1B57A 5FEXA 1H7RA 1JJKA 1DJQA 3RMJA 4I7WA 2VEIA 1ADOA 4C1LA 2QKFA 1G67A 3B04A 5G2HA 4WY0A 1TCDA 4BK9A 1JUKA 2C6QA 4LU0A 4DO4A 4IOTA 4JX6A 2TRSA 3OBKA 3DH7A 3O16A 4RZ4A 3CWOX 1W3IA 1D3GA 3TDFA 2YR1A 4RK8A 2CZEA 3RLUA 1Q6LA 5GVJA 3TQVA 4ZQMA 2UV8G 4J9JA 4TO8A 3B0PA 3MW7A 3BGGA 3VCRA 5I3KA 4LNYA 2CLMA 4JTLA 2ZZ5A 3SI9A 2WJZA 1XI3A 2ZZ1A 3QQ0A 5CPNA 1QOQA 3NPVA 1KV8A 3W7NA 3P60A 3NQMA 1VGAA 1LTDA 3L67A 2CZFA 1A5SA 3LXAA 1RPXA 2DZPA 4ML9A 2GQ9A 5CZSA 1OJXA 3KRZA 2E6FA 1KTNA 1EP2A 2V8ZA 1IXNA 4YL2A 1OF6A 3NQ6A 3GR8A 4HPXA 4A2RA 1SO3A 5HWNA 4AWSA 4Y96A 3BV4A 2WNQA 3QZEA 3ATZA 1WAUA 2JKAA 2QCNA 2DJXA 1NAL1 3TIMA 4TMCA 5HMSA 4UFHA 3PUEA 4JTFA 3LTPA 3GYEA 1SO6A 3UWVA 2B7PA 5EL1A 1JVNA 4O1AA 1Z44A 2J9ZA 4TU1A 3HGJA 4W9TA 1HO1A 1ZAJA 3O1NA 3QM3A 1TPDA 1PV8A 2QCGA 3DFPA 3W76A 5F1VA 1QMLA 5HUOA 3N2XA 4TX9A 2FPTA 3W1PA 3S8HA 4Q33A 4HN4A 4UTTC 2VFFA 2E77A 5HINA 1H50A 2X1SA 4GC4A 1RV8A 1IXPA 3N73A 4LVDA 3B06A 3I7RA 3BO9A 1VHNA 3ZS4A 1IIHA 1K3UA 3NPXA 1L6WA 3TQ0A 1YXDA 5G2IA 1QR7A 4LY8A 5BOOA 2E5CA 1H7XA 2CZDA 3GDRA 3WK2A 3UQNA 2DP3A 4TR9A 3VI2A 1A5AA 1W8SA 1I2QA 5I3GA 3CB8A 3OEXA 2QR6A 5KZDA 2ZA2A 1NF7A 1GTHA 1GT8A 5DCEA 4RZ5A 1KTCA 3C2EA 3W2LA 3GZ3A 3G8EA 3LHUA 2PURA 3S5NA 3IIXA 1V7YA 1DQWA 5DCDA 3BGJA 4IJBA 3JRKA 3E96A 3PSWA 3BG3A 2O7QA 4NT0A 1AW2A 3W87A 1FY6A 3UY7A 3CEPA 1PL9A 3JS3A 3LHYA 4DPPA 3F4WA 3W7OA 2ZTKA 3QH2A 4A22A 1OFPA 4EF9A 3GB6A 5DXYA 5KZEA 4UMCA 1VQTA 4EVZA 4JTJA 1ME7A 1UUOA 4N02A 2G97A 3OHIA 1GVQA 4JYEA 3USBA 3O8AA 2Y70A 5U7SA 4JX5A 3F1QA 4BWLA 3EKLA 3MHFA 1MEHA 1QO2A 3GR7A 2FIQA 3STCA 1QNVA 4ZQCA 3W1MA 1R2RA 1UB3A 1GWJA 2GOUA 1YTKA 2J9YA 5C5YA 3CPRA 4Z1BA 3PUOA 5DELA 1TYGA 1TQXA 3SIZA 3C2FA 4OHQA 3NL6A 4KWWA 1LOLA 3G1XA 3TJLA 4LVGA 1DQXA 3OVRA 5E0KA 1YXCA 3U8GA 3W85A 1FBAA 4QISA 4JYDA 4O19A 4PH6A 3AJXA 2YGYA 1VYPX 1H51A 2ZBTA 1I4NA 5DBUA 3HPSA 1LORA 3W1QA 1KM5A 3CIWA 3M5ZA 3HF3A 1EP3A 4GWEA 3EWYA 3PM6A 3N19B 4TIMA 4MYXA 3M1ZA 1O95A 4UC5A 3I7SA 1OF8A 5L9FA 3SFKA 3IVTA 2BSLA 4MPQA 3M5YA 4WY0F 4K36A 5C55A 1TB3A 1ZY9A 2G5WA 1JUBA 3QPZA 2VEMA 3QPYA 4Y6GA 3SR7A 2C14A 3W83A 4G1KA 1JRBA 3DBPA 4OT7A 4R7JA 2XFWA 2E68A 3T55A 3W7EA 1W5QA 5F1UA 1X6UA 2ABBA 3RK8A 1PIIA 3NGJA 3UPWA 3O06A 3LX9A 4ADSA 1Q3NA 5J5DA 1JCYA 2CLKA 4K7YA 1FCQA 3IGSA 3MI2A 2NZLA 5AYZA 4WXZA 1LP6A 5AYXA 2V9DA 1JULA 2Y88A 2QEZA 1QOPA 2R14A 2DZTA 1L2UA 1TPB1 3KRSA 5DLCA 1ZJIA 2H3DA 1KBIA 3MP3A 4Q4KA 4LVFA 4O1CA 1KM1A 3S1VA 4OV9A 4Z0SA 2FPVA 1HUVA 4UFJA 4DELA 1WQ5A 4Z0JA 1LRNA 3M9YA 3MYPA 3MP5A 5D2YA 2Q3OA 5FF2A 6ALDA 3N34A 4E38A 3CC1A 1H5YA 2OCZA 2PE4A 2ZDRA 4PA8A 2C13A 4U28A 2YSWA 1J5TA 2W0UA 2GPTA 2FB3A 3QQ1A 4K7VA 4AB4A 4NNCA 4JTIA 1OYBA 2QDGA 3IGUA 1OFBA 4E2DA 3TAKA 3TV8A 5FF3A 2E6DA 3QSTA 4O1DA 2GQAA 2NV1A 3EWBX 4Q32A 2O7SA 3CIXA 3LTSA 2V30A 4K38A 1M5WA 1SR9A 5A8GA 1ICPA 3D0CA 1I2RA 3C2OA 1VYSX 3R2GA 2QCHA 3CHVA 4MLRA 3GKFA 1TPWA 5DY2A 5DXXA 3N9RA 1E51A 3ELFA 3DENA 4BI5A 1W54A 5AHLA 2WNZA 2ZRUA 3I6RA 5DY3A 3NM1A 3C3NA 1Y0EA 4HIBA 3WFAA 1LBMA 4IPIA 1Q6RA 3GXPA 4RX0A 5LHEA 3W73A 1OHLA 3G1AA 1KFCA 3NQCA 5ABTA 2NXIA 3UZJA 1IF2A 4P2VA 3M47A 3PY2A 1GTEA 4GRSA 1OFOA 3P5YA 3BARA 5LGXA 4UTIA 4JS3A 3LLDA 3LI0A 1TV8A 3ZR4A 1DHPA 1LBLA 4IWWA 5G1YA 2QUUA 1XBXA 4FB7A 4NJIA 1X8FA 3C61A 1XXXA 1J4EA 4K8HA 4PCFA 2OT0A 3EWUA 3MI6A 1D9EA 3TC6A 2EF9A 2FTPA 1SW7A 4UXDA 5AN7A 2ATSA 5HWJA 2CLIA 5CKSA 1OX4B 1TTQA 2X30A 1FDJA 1WYIA 3G3MA 3QF0A 5D2TA 4QSHA 4MYAA 4UMAA 4IXHA 2ZA3A 2QCFA 4CQ9A 2H8ZA 2FQIA 5K2ZA 3SY5A 4EWND 2Y89A 4MFEA 5AHIA 1R2TA 2YPIA 3HQ1A 2DORA 3FYOA 2YW4A 4XWUA 4M7SA 1OYAA 4MUZA 2NLIA 4LRSA 1L6YA 1WOBA 3N3MA 3BLEA 3PR2A 2ZRYA 5EYWA 5CSRA 1HO4A 3DFQA 3W1NA 1RZMA 3NOEA 2Y61A 3B05A 3PAJA 4ADTA 5A5WA 3VNDA 4YMZA 4JTGA 5L6UA 3ZFHA 2Q3RA 4CCCA 5EA9A 1I45A 4FIRA 3O6DA 3NVTA 3G24A 3W2MA 3LBCA 4RZ6A 2A6LA 5EMUA 1M6JA 3S5OA 3A9IA 5CPLA 3RFAA 1TTIA 3W7HA 2QUTA 5AC6A 4LVAA 1TPC1 3O6YX 4NJGA 3TFCA 1K8XA 3LRMA 3DAQA 2ZCGA 2QF7A 4O0ZA 1KA9F 8TIMA 3NEVA 3EKZA 2E6YA 4UUIA 2RKXA 3A23A 3LGEA 3S1UA 4XBKA 3OVPA 4WQ6A 3BLIA 1Q6OA 2WNNA 1SSDA 3FEMA 3DXIA 3IGXA 3O63A 5EBUA 4IMDA 4ZL1A 1A50A 1GEQA 1Q6QA 2ISVA 3WJSA 3NL5A 3CTLA 2CWNA 3BK0A 4DF0A 2EAWA 2E1DA 4A21A 3HPZA 4FX8A 1GZGA 3L5MA 3DKLA 3ZWSA 1ONRA 1XBYA 3G8RA 3NDOA 3IIOA 4ZQNA 2VOMA 2NUYA 2VFIA 3G1VA 5J5RA 2LLEA 3DKJA 5LGZA 1JCXA 3FFSA 2RDTA 4R53A 2Y7DA 2VXNA 3MP4A 3HG2A 3DI1A 2RDWA 3NAVA 1OABA 2WSRA 2QUVA 1GG0A 3UY8A 3W7DA 3P84A 1K7XA 1JUEA 4GUFA 1A5CA 4HHPA 1G4TA 1C29A 1VCVA 3L9CA 2TSYA 3IEBA 4UTWC 2ALDA 1HFBA 1BWKA 2P0OA 4JIQA 3W23A 1SPQA 4JR5A 3MO7A 2V5LA 4UFMA 1TO3A 1XC4A 3VE9A 1PCWA 4RLIA 3UWQA 2YCEA 4X2RA 1QWGA 3S0CA 3PBWA 4LC8A 2NX9A 2Q8ZA 3WK3A 5KSWA 3TJXA 1AG1O 3UWYA 5HWMA 5HR6A 4L4MA 1BWLA 4QITA 3G1YA 2ZQ0A 5I3IA 3SECA 3P61A 3EX3A 3W1AA 4O28A 2DU2A 3GX9A 1NEYA 1S5VA 2DJLA 2V5BA 1XDLA 4LV4A 4MZYA 5K4XA 3E9AA 3NPWA 5G1TA 5LSMA 2ZRVA 1BKSA 5CSSA 4IMCA 3W1UA 2TYSA 4EOUA 1K7EA 1TIMA 1YDNA 5D2VA 2GJNA 1CX9A 1G7UA 3GLCA 1O94A 2X1RA 4JDBA 4WD0A 2CFFA 4ADUA 4U4MA 5D32A 4ZVJA 1V5XA 3NQEA 5F4XA 1KLZA 5LNVA 1O5XA 2C15A 3C4UA 4PODA 3HOJA 3KAOA 5DBTA 4QM1A 2Y85A 3SGUA 2FJKA 3HJZA 3LRKA 4IUOA 4ALDA 3ZWTA 1GPWA 1OFDA 5DCBA 3W71A 3WJWA 4CLMA 3S6DA 4MZ1A 3W07A 3GDMA 1O4UA 4LVBA 3L21A 4X9SA 5LZLA 2OJPA 3LHVA 4JTUA 3G0SA 2ZZ3A 1LOSA 4DXVA 4MFDA 1X1OA 2HSAA 3L0KA 1QPNA 1TV7A 2QDHA 1L6SA 1ICQA 4M6QA 4LC6A 1G4PA 3HG4A 4AHPA 1OFRA 3LCLA 2H6RA 5TQLA 5D03A 3LDVA 1TRDA 2A6NA 3W2KA 3EEGA 1Q45A 1J2WA 1GVRA 3THAA 3B4UA 3IIZA 2JBMA 2Y7FA 2QJIA 3EXTA 3MBDA 4TMBA 2NXGA 5LKYA 3RU6A 1VR6A 1W1ZA 1OX4A 4FNSA 2E09A 3IVSA 4UNKA 3NG3A 1F7BA 1AL8A 4POCA 5K9XA 1F6PA 3STGA 2IQTA 3UXDA 2R91A 2A2IA 3TSDA 4LV9A 4MZ8A 3R13A 3H55A 4M6PA 4S2BA 2AQWA 3LV5A 1ALDA 3L65A 3M44A 3PBYA 1VRDA 2HS8A 3BLFA 2WKJA 3W74A 3W1LA 1EUNA 4FXSA 1SO5A 5D38A 3NQ8A 3LCWA 3KVJA 3NQAA 5FEWA 2VFHA 3NL3A 1T0OA 1ZNNA 3IRDA 4L4LA 1N8FA 4ZZ9A 3S1WA 5C54A 3LHWA 1OG0A 3ABRA 1GVFA 3PB0A 3HGRA 1KFBA 3PVFA 3B0UX 5CG7A 2X1UA 1EWEA 1R30A 4KFOA 3TXVA 4NVTA 4HNUA 2DZVA 1EP1A 1T99A 2QJHA 3L2IA 3GIYA 5FF4A 3RNDA 4NNBA 4MOZA 1FWNA 4RV8A 1OFQA 3LHZA 2GQ8A 1OK4A 2A5HA 2W6RA 3O05A 3DGRA 4O1BA 3A24A 4NU7A 2QCDB 1KM6A 4ZQPA 1PHQA 4DBDA 1TREA 1F76A 3DI0A 2WOQA 4Z1CA 1LRQA 3NNTA 4OV4A 2V81A 5D37A 5E93A 3W1RA 3NPUA 3UWZA 4JTTA 1Z48A 3GVGA 3MBFA 3IIPA 4LS0A 4JGDA 2A7PA 4NX5A 3RF9A 3C0JA 1H1ZA 3F4NA 4GUGA 3G1SA 4NUWA 1TJPA 4DO6A 3JR2A 3DFNA 1IXOA 2F84A 3ABSA 3P80A 3TMQA 5D2XA 5K3VA 3FIGA 2EPHA 3U6WA 4LS1A 2Z1BA 2CLOA 2H90A 3LI1A 3W7IA 3G1FA 3N14A 3W7PA 1IXQA 3L66A 1YTEA 4JTSA 1F5ZA 2ZTJA 2J6XA 3TKFA 4JY8A 3UZ5A 1W5OA 3ATYA 5F4SA 3TR2A 3A5VA 1AW5A 3E02A 3P7YA 1UCWA 4XUGA 4CCDA 3M16A 3FOKA 3VKJA 3ABQA 4QQ3A 1ZCOA 4BF9A 1C9DA 1T96A 2ABAA 3L68A 4IMGA 3INPA 1UUMA 5AHFA 2V2DA 3SZ8A 4M6VA 3STFA 2BXVA 4GXMA 5AC8A 1SW0A 3LTYA 4XKYB 1SQ7A 4OGZA 1G69A 2FFCA 4JD4A 2JKEA 3M6YA 5IM51 3VFLA 1LLWA 4O13A 3I7QA 2C18A 2X2GA 3FS2A 4IPJA 3PBUA 4UTTA 4HSNA 3OVQA 2KZHA 3P67A 4Z08A 3WK1A 1KBJA 4HKPA 4RXFA 3EWWA 1K8ZA 4GJ1A 3W7RA 3C8FA 4QIUA 3NO5A 4NXSA 5FI8A 1W0MA 3EWXA 4FIQA 3LV6A 4NNAA 4RXGA 3QRHA 1DJNA 5F2GA 3OA3A 5F2IA 3DHDA 3P8IA 3W72A 2JGQA 4RR4A 4HNVA 5BNKA 4HSOA 1TSIA 4AXKA 3FA5A 5D05A 4UFLA 4EF8A 2CW6A 1U5JA 1W56A 3LHTA 2RH9A 1OYCA 3HBLA 3EX2A 2WPBA 4O12A 2RFGA 2EGZA 3B8DA 2B7NA 2GVJA 3C2VA 4FNTA 1H7OA 2J24A 3GK0A 5D04C 4ZMGA 2DZWA 1ZENA 2F7FA 1LOQA 3QJAA 2ZFAA 4Z1AA 4KWVA 1MEWA 4DPQA 2ZRZA 3TSBA 2G95A 3LXBA 1U83A 3I68A 4JDYA 5KTLA 2B7QA 1D3HA 2WQPA 2YXGA 1TPH1 3SW6A 4RCXA 3LRLA 1FXQA 1PHWA 3TROA 4NZFA 1W5MA 1WDWA 3GAYA 4DF1A 3GDTA 2H3BA 4R33A 2CZ5A 4AF0B 3NZRA 2JKPA 4UTLA 4BR1A 3PULA 1SUXA 2A85A 4O50A 4ZQRA 3QMSA 1VLWA 3TSMA 3C56A 5KZMA 3FLUA 4AH7A 2Y7GA 2QCCA 1F74A 3M41A 4GNJA 3CEUA 2ISSA 2NV2A 2C16A 4AMAA 1UASA 3PG8A 3W86A 2QJGA 5AHEA 2D73A 4N9BA 3HG5A 2VFEA 2H8XA 1AL7A 4K39A 4QNWA 2ZZ6A 3G1DA 3SJ3A 1VJIA 3W6YA 1HL2A 1LBFA 1XBZA 2PC4A 4JIPA 2R94A 4UMBA 2A1YA 2J9XA 1KM2A 1R2SA 5H2ZA 4H4IA 5CGQA 3E12A 1DVJA 3WJYA 1AMKA 1H63A 2B0MA 1FWWA 5D30A 2B7OA 3P82A 4FF7A 5EPDA 2JK2A 4LRTA 3BPWA 5K4ZA 1H7PA 3Q58A 2BX7A 1DL3A 1EA0A 1RD5A 1KTBA 1AW1A 3G18A 1FCUA 4AHQA 1DBTA 4OU1A 3NXFA 1NF0A 1YLVA 5I3HA 4OWGA 1KW1A 1KM3A 4N2YA 2GVGA 3N2MA 2FDSA 1T8XA 1SSGA 4LUIA 2ZRWA 1F2JA 5FF0A 1SZEA 1EEPA 1ICSA 2EHHA 1QDSA 4M5PA 1F05A 3TC7A 4LTSA 1PS9A 4JX4A 1P5BA 1I2OA 2JGYA 3W1XA 2Q8LA 1ZALA 1Z41A 3CT7A 3W88A 4ZQOA 1W5NA 3Q94A 4MJZA 3NM3A 1LCOA 1SZFA 1K8YA 2QCDA 4N9CA 4O52A 2VKZG 3PC0A 4MLJA 4A2SA 2YX0A 2C1HA 5AC7A 3HGSA 1H60A 3BG9A 1FXPA 2PRLA 4CQAA 3DFSA 3W7JA 3UXAA 1WA3A 3KFTA 2Y63A 4IX0A 2E5DA 4O8RA 1MXSA 3Q37A 1UJPA 5FEPA 1XKYA 2ZZ7A 3W2UA 3FJ6A 1YXYA 4N6EA 3T7VA 5AOUA 1VZWA 4YLWA 3HMJG 1X7FA 5AYYA 4PL2A 4R34A 4WOZA 5FF7A 1XCFA 1GJPA 4GE8A 3PB2A 3W3OA 3W2NA 1GYNA 3QW3A 1I2NA
chains in the Genus database with same CATH superfamily
1IZCA 4HMCA 4C6NA 4L6DA 2CLEA 4CN6A 2DT3A 2E8ZA 1V79A 1XHGA 3RPTA 4C6CA 4RE2A 2QAFA 3AHYA 1NVMA 2J8TA 3OLDA 1JCJA 4M1BA 4Y9AA 3LLFA 3SGZA 3W1TA 4R88A 1TPFA 3UWWA 1J11A 1SZGA 5HR7A 3RPMA 4GIEA 3O0KA 4EACA 3BZGA 4EAMA 4GOAA 4H9TA 4H8HA 3BVJA 4IMEA 1UZ1A 3REQA 1XX1A 1HKKA 1DXIA 3ZXWA 1HQTA 2OB3A 2Y6ZA 1VFOA 4AYSA 3L4YA 4U5KA 4WX2A 4UCGA 3ARPA 5LIYX 1JZ6A 4NI3A 3PUGA 3WH5A 1ISYA 2Y8VA 2ACSA 1XM3A 1XUUA 3UYCA 3BG5A 1IGWA 4GQBA 3H22A 4N9EA 3F5KA 3K8MA 2XH7A 1UWSA 1EB3A 1GHSA 1Q2RA 4GIRA 1N8IA 4Z17A 3EEZA 3WH8A 2W62A 1E4LA 1FA2A 1PZ0A 4HNNA 3MQTA 2Y5SA 3RG6A 4WKFA 3T40A 4I90A 1TJ1A 1YE6A 4EK7A 3O15A 4E0CA 3ANYA 3VX0A 3VIPA 4ICNA 1LLZA 4W8LA 1UH2A 4AD1A 3AXHA 4ORIA 5IOBA 1Y5VA 4DB7A 2E3ZA 2QXWA 4YCPA 5U4NA 1TMHA 4B5NA 1RUSA 1J0YA 1H61A 4DBUA 4Z1DA 1XH1A 4D6HA 2AQVA 4A29A 1PCKA 1M3UA 3CLWA 5CH9A 3KDOA 2ZC8A 3VNIA 1L6GA 3TNBA 5BXTA 4QR6A 1AH3A 1N8WA 3PBGA 1QO5A 3QSRA 4AVFA 2YA0A 3GY1A 2AGTA 1FDYA 4YVPA 4O53A 4NJJA 1R3RA 2Z25A 4JNMA 2PBGA 4IGHA 4FLOA 4YS1A 1ZAIA 4L9XA 1EF2A 1AQ0A 1CNVA 1BYAA 5D2WA 2PLCA 3OU8A 4JFWA 1WOAA 1E40A 4PL1A 1RP9A 8CGTA 2OMAA 4L1GA 1HXJA 1M7XA 4V28A 5DN1A 4O4WA 1CEOA 3LCGA 4K8EA 1US2A 2VR4A 5K9DA 1DJWA 1EIXA 3USZA 2FB2A 1TCMA 4RUBA 3DFYA 1QCWA 2QYGA 3K30A 4WXYA 5ABFA 4UQAA 3GM8A 4HPGA 4ENLA 4Z2KA 5I3FA 1G5AA 4DYKA 1ZL1A 4C7GA 3QC3A 1E6RA 3W84A 4BI6A 4FNQA 3A22A 4IMAA 3GU1A 1GCYA 4AHOA 2HE5A 4O54A 2A21A 5D8WA 4R7OA 4AIUA 4ZSUA 4WGHA 1IHIA 2XWEA 4ONVA 1ME9A 5A2AA 1TE1A 1KGXA 1FDZA 3P62A 4O4VA 3CZKA 1QBAA 1VC4A 3MMTA 2Z29A 5DMYA 3O07A 3K4WA 4LAZA 3UXLA 1QWKA 3R5EA 1ME8A 3DHFA 1B4KA 3QMRA 1RQHA 1XJBA 4JTCA 3V5FA 2V2CA 1JPMA 2ZICA 2FPYA 3ZJ8A 1KFWA 1JDCA 3NQ7A 1U33A 2OZ0A 4O18A 3VIGA 2HBXA 2FGLA 3UT0A 2QGHA 2FHBA 5TF0A 1VBHA 1CW2A 7TIMA 3EXSA 4CEUC 3W0KA 2NUXA 4JIIX 2WBGA 1MMFA 1H1YA 3NQFA 4JY9A 1KM4A 4KH2A 4D8LA 2XZ9A 1HF6A 1WBHA 1NOFA 5I3JA 3CASA 4WY0B 4S3KA 4DBWA 1PYFA 3N2BA 4AEFA 1NFBA 3VYLA 3NYZA 4N4PA 4D71A 4WZHA 2HTMA 3PBVA 1LRTA 4I7VA 5D02A 5KEZA 4MJMA 3AIUA 1LQ2A 2IPWA 2ZRXA 5IDIA 4FNRA 1N55A 2OFJA 4GUIA 1TA3B 6A3HA 1PDZA 3WBXA 1XLBA 4FX6M 2EG6A 4B92A 1CXFA 1W17A 3LERA 2EJAA 4OZOA 1ZBWA 5CZJA 4D6CA 1SVDA 4C6OA 1XLHA 5HAOA 1ISZA 1TV5A 1B2YA 4HA3A 3VOFA 4DUOA 1YPFA 3TU9A 4TX8A 2NQJA 3GNRA 1DV7A 4XUYA 3FJLA 3IVUA 3MMUA 3HO8A 3EOLA 1OFEA 1EXPA 1GOIA 1E15A 2EG8A 4UQ9A 3BSHA 2XN1A 3LCFA 2O55A 3I3DA 3A4XA 1BRLA 1VYRA 3VNLA 2G96A 1W3TA 4XB3A 1GOXA 5CCZA 1CGUA 3TR9A 2VC6A 2ZYFA 1GVYA 3RXZA 4YN5A 1TZZA 3SRDA 3WDRA 1E6NA 3NQDA 1VBJA 3M5XA 3FAWA 1HJSA 3TFXA 2V82A 5AFDA 2ZZ2A 3VGDA 4Q8TA 4E2OA 1EOMA 1V08A 3N1AA 4E2VA 1YPXA 1E1FA 3WL1A 1VP5A 2HCVA 4RDZA 3TQKA 1SMDA 2SFPA 1XYLA 4S39A 2X1TA 1JD9A 3H21A 1VFTA 4UIOA 3B03A 1LL7A 2CLLA 3HPXA 2HS6A 1JR1A 1TQJA 4DQWA 1BVWA 3GDLA 4NJKA 3VIOA 1E0TA 3K5XA 5JQ9A 3F2DA 1P43A 1BXCA 1QW7A 1D7KA 1V6XA 2BWGA 1EJ7L 2IW0A 2PI6A 4LXFA 5F2MA 1Y5WA 2Z27A 1H5VA 4JTHA 2WMHA 4XKMA 1A53A 4AWTA 4ACYA 1T8QA 5ABFB 1RJPA 3FCPA 1YPIA 3VABA 2G3JA 2PD5A 5TBOA 3DECA 2PDIA 3M0LA 2X41A 3EWZA 3WLKX 2H9AB 1QHOA 4OBTA 3WG6A 1EPXA 1TWSA 1EJSC 4JXCA 3CL6A 5REQB 3L7RA 2DSWA 3K8LA 2GL5A 4KETA 2BV9A 3A21A 5CJMA 4UTHA 4CNPA 2VEPA 5LNWA 1POJA 1LQ0A 3P0WA 4GUJA 1JQXA 1M68A 1BG9A 2VI0A 3MKVA 4NZCA 5JMUA 2C0AA 4AG0A 1XDMA 3TAOA 1TUFA 3PSVA 4GVIA 2I1OA 1EX1A 3R8HA 2J7BA 4O0QA 2TPSA 1A0CA 2VM8A 2XGIA 3WNNA 1FVPA 1EX5A 4NRSA 1R46A 3POCA 1FWAC 3EB2A 3LOTA 4K8GA 1PBGA 1GW9A 1V8EA 4HCDA 4QJ4B 5FEZA 3A5FA 2DSKA 1H09A 3U2ZA 4AZCB 1WUEA 3BQ6A 1RQBA 1O60A 4C6BA 3CK5A 3LYEA 1FP9A 1QATA 1QW8A 5E5CA 4LANA 3WEZA 5RUBA 1YNPA 3Q45A 4B5XA 3U7VA 4FLSA 1YHTA 4C1LA 2WW5A 3GHUA 1G67A 1JDFA 1NDZA 3JW7A 1JUKA 9XIAA 3LD5A 6ENLA 4N42A 3UJFA 2CZEA 5GVJA 4TVCA 3PZVA 2VRKA 3BMWA 2OWXA 3BGGA 3VCRA 5AZ1A 2CLMA 4F2TA 4GIAA 2ZVIA 2ZZ1A 3QQ0A 3F7JA 3TZFA 4GYKA 2J47A 3MB9A 3LPPA 1J79A 3KOWA 1W8GA 1LTDA 3L67A 1RPXA 4L65A 3HN3A 2XWDA 5CZSA 3KRZA 4LAKA 2E6FA 1BWVA 2V8ZA 2OZ3A 1IXNA 1R3YA 4BY3A 4FOKA 1KXTA 4HPXA 1SO3A 5HWNA 3UXIA 4Y96A 3VD9A 1XIGA 4WVXA 1BYCA 2JKAA 2QCNA 2DJXA 1DWAM 1VBUA 1UIPA 3TIMA 2PTDA 1U1JA 4EXQA 4UFHA 5H8UA 4GKLA 3UWVA 1K4GA 3QZ6A 1JVNA 2V5DA 1HJXA 1Z44A 2J9ZA 3HGJA 4W9TA 1HO1A 2EKGA 1PV8A 1PTAA 1WZKA 3N2XA 3T0CA 4TX9A 2BP1A 1EJXC 1ITQA 3S8HA 5GPRA 5M3WA 4UTTC 2VFFA 3HFTA 5HINA 2X1SA 4LBSA 1WXZA 1RV8A 1IXPA 4GI9A 1IIHA 3NPXA 1QR7A 1ECQA 1J18A 1XRSA 4KPLA 3WMLA 4ACZB 3VU2A 2CZDA 3UQNA 4TR9A 3VI2A 4PCTA 5I3GA 1VJSA 4UWMA 1IT8A 2VCBA 3OEXA 5KZDA 2V3GA 4U2YA 4TXEA 5DCEA 2EO7A 2FTWA 3W2LA 1ONEA 1DQWA 3S4TA 3CV1A 4IJBA 3PSWA 3MVTA 4XD3A 2RUSA 3MV11 1XYFA 3VFCA 3TYAA 4C7DA 3CEPA 3DCPA 3JS3A 4IIBA 2ZTKA 1TV2A 4EF9A 4M6UA 3QYSA 5DXYA 2BY3A 4YNGA 1VQTA 2JALA 1ME7A 1U1UA 1V93A 1UUOA 3WLIA 5GNZA 3OHIA 1GVQA 1B31A 3HM7A 4XZIA 3PPFA 2Y70A 4BWLA 1E6SM 4E3VA 1R87A 2G3IA 2DFAA 1EJVC 1MEHA 2WMJA 4HTYA 1QNVA 3W1MA 2J9YA 1GQLA 2PODA 3OA5A 1GOWA 4L1XA 3VMNA 3ONBA 1JPKA 5DELA 4W93A 2V3DA 1K6AA 4F48A 4Y7EA 3TJLA 4DZ5A 1DQXA 3L4TA 1FBAA 4Q8PA 1CB2A 1VYPX 2ZBTA 2D23A 2DQXA 4F0MA 1ZJAA 3RM4A 3M5ZA 1EP3A 4A8LA 3CL7A 4I8DA 3N19B 4MSSA 4TIMA 3T0BA 2Y0FA 1TUXA 1O95A 4I5RA 3GTXA 1UKTA 1Q63A 3VKBA 2HNEA 1X97A 3SFKA 1Q4NX 3E2QA 3H26A 4MPQA 1UC5A 2DH3A 2GLKA 5C55A 3AS0A 1JUBA 1TJ2A 4WSKA 3WNKA 4Q7NA 4H9VA 4KWSA 1UD4A 3GS6A 3QPYA 5JU6A 2C14A 1C91A 3SO7A 3GHTA 3DYMA 4R7JA 5E0CA 4QS5A 2E68A 3T55A 3UZWA 3NGJA 3UPWA 3LEPA 1QNSA 4YTQA 5J5DA 3MSYA 4K7YA 2G3NA 1AQFA 1CTNA 2RJHA 2NZLA 3MUAA 3T6CA 5AYZA 2TODA 3LQLA 1O12A 2QIIA 3PN8A 1QU4A 2PDGA 5AYXA 2V9DA 1ESWA 4P8WA 1ECEA 1R5YA 4L4OA 5DO8A 1TPB1 2IXVA 5DLCA 1ZJIA 1FKXA 4KRTA 4O1CA 2PGFA 3GVWA 1KM1A 5GJMA 3M0JA 3KUMA 4OV9A 3XISA 3RLGA 3M9YA 3G1RA 1U30A 2OO6A 2KX9A 3MP5A 5FF2A 5LIKX 3U2CA 4PYSA 1OD8A 3VTRA 1H5YA 1YW1A 2OCZA 2PE4A 2WMIA 2C13A 4U28A 1M1BA 1EGMA 3QQ1A 4A05A 4NNCA 4MJ2A 4DJDD 1OYBA 3WDIA 3NIYA 1OFBA 4C60A 5IFPA 2E6DA 4V27A 4ZENA 3K4AA 4GX8A 4OVXA 3EWBX 2FZ8A 2OODA 3AICA 3GWQA 3LTSA 4K38A 1M5WA 1KWGA 1JYNA 4YIWA 4LAOA 3B0YA 2VZOA 3MU7A 1AJ2A 4CUCA 1OBAA 3GKFA 1EZ2A 2BVWA 3N9RA 3WLNA 3ELFA 3A12A 2VCAA 4JTRA 2ON3A 1W54A 4ZOCA 1ZRQA 1TKKA 4GY7A 3VM5A 1A3XA 5I07A 2WQDA 5AYIA 3C3NA 5CJNA 4LUYA 2Y1HA 1Z32X 4RX0A 5LHEA 4A3QA 1RCQA 2V68A 4AZ5A 2BY2A 3G1AA 3VD7A 4IISA 4P2VA 3PWGA 1Z89A 4J7RA 3P5YA 3BARA 2R24A 4AXNA 1EDTA 4JS3A 4BS0A 3ZR4A 3KE0A 3B40A 1DHPA 3SUWA 5G1YA 2QUUA 1X8FA 4CU6A 1QHPA 1SJBA 3C86A 1HVXA 3F4CA 3TC6A 4DJDC 2EF9A 1UZHA 1WZMA 4RDYA 3MTWA 3PZIA 3ARVA 1SW7A 4UXDA 3BOLA 4DJED 3DX5A 3DUGA 3QTPA 5BZAA 5CKSA 3BICA 3SCPA 1L0PA 2VT0A 4YU1A 3QF0A 5D2TA 4IXHA 2ZA3A 3QHOA 2J13A 3HV9A 1BSLA 3LMZA 4QSFA 5K2ZA 4GK8A 5GJPA 2YW4A 3E6EA 4XWUA 3G6MA 2P0IA 1A3HA 1OCJA 4JHMA 3PR2A 2OGYA 3KOZA 4ERIA 4ERGA 4UQBA 3ARUA 3W1NA 1C9WA 1RZMA 3B05A 4Q4MA 3AU6A 1ADDA 4YMZA 2WZMA 1HZYA 4JTGA 1XPYA 1PZ3A 1UMYA 3VIIA 3W2MA 4C6KA 3TTQA 1HGWA 3OHMB 1LG2A 1M6JA 4MJ4A 3SCVA 1O5QA 2FZ9A 2EEXA 4LVAA 1V3HA 3TA9A 4Q6JA 5JH2A 1KA9F 4LSBA 4PMVA 5FSDC 1SYTA 3N6HA 1TX0A 2P76A 4XVDA 3S1UA 4ATWA 4B4HA 1Q6OA 2VOTA 4Q7IA 4US5A 4I6KA 1SSDA 3EMQA 8A3HA 3AIEA 4ZL1A 4GY0A 1Q6QA 3NL5A 1WO2A 4X63A 2XSAA 1GZGA 3L5MA 4HPHA 4HU8A 1XBYA 3IIOA 1B3VA 4F3HA 1UR8A 2QW5A 2NUYA 3G1VA 3QV7A 4Q8MA 1JCXA 2RDTA 3D5HA 3MP4A 3VD4A 5H8MA 1OABA 3QR1A 1GG0A 1K7XA 1JUEA 1A5CA 3SBFA 1C29A 3WLQA 2TSYA 3IEBA 2ALDA 3V0SA 2NQLA 1HFBA 4WDWA 1TMQA 3S2NA 2QMJA 4JIQA 3AIQA 5H1WA 4JR5A 1PCWA 4X2RA 3PBWA 4LC8A 3KZSA 2NX9A 4PB5A 1CXLA 3VOCA 2A3AA 3H2FA 5HR6A 1SFSA 3G1YA 2GSHA 2ZQ0A 3BLPX 5I3IA 1JZ3A 3SECA 3W1AA 2A3HA 2GJRA 3CGTA 4O28A 2DU2A 3UJRA 4PULA 4GHRA 1W3LA 3GX9A 2V5BA 4GKTA 2PDYA 4BA0A 3E9AA 1J12A 4HK6A 2J78A 3V16A 3H23A 1TIMA 5D2VA 5D9MA 1CX9A 1MRQA 1G7UA 1W9PA 3TWAA 2UY3A 1MFVA 2X1RA 2FYMA 3AQUA 3AYVA 4KIRA 1V5XA 1K77A 5F4XA 1M04A 5LNVA 4C91A 3ARSA 2C15A 3CWHA 2PTZA 2PDLA 1QK2A 3U5YA 5DBTA 3W6LA 1XH0A 4IUOA 3RIKA 3BQ5A 2BMBA 1OFDA 3C5QA 3AMGA 3S6DA 1QI4A 1X96A 3GDMA 4ICMA 4J3UA 2OOGA 3WQ5A 4JAWA 5FJIA 1WDSA 2IKIA 2OLHA 3G0SA 2ZZ3A 3W27A 3GXMA 1EO7A 1IEXA 3OQ8A 2BHZA 3AC0A 3OZPA 5CPSA 1H1NA 4HSHA 1YQ2A 3CMFA 1TRDA 3VKCA 3VNKA 3N25A 5I2UA 1W9XA 1ZS2A 2QJIA 4DJEA 3EXTA 4TMBA 2EPLX 2NXGA 1R6WA 5LKYA 3WLLA 1W1ZA 3BLKA 1OT1A 3IVSA 4UNKA 4AY8A 4LFYA 3WF4A 3UXDA 1E6ZA 2R91A 3TSDA 4XD5A 3FSTA 4QG9A 3H55A 1RVKA 3GTNA 3T1GA 1ALDA 4CQDA 1VRDA 1XGZA 4NZ4A 2X42A 3QR3A 3W1LA 4KERA 4JHOA 3UA3A 3NQ8A 4PCNA 3WF2A 4EPDC 2VFHA 2VTFA 5AVNA 1T0OA 3IRDA 4YWSA 1J2BA 3N11A 1OG0A 3CS2A 3PVFA 3B0UX 5M5DA 4F79A 3QTGA 5A1AA 3TXVA 4Z2GA 4FMVA 2DZVA 4XAYA 1EP1A 1Q7ZA 2QJHA 1UWUA 5FF4A 2QS8A 4MDPA 1OC5A 3ANVA 4NNBA 3WLHA 1OK4A 2W6RA 3FDKA 1TE6A 3DGRA 3O05A 4B9YA 4DUWA 3A24A 4BF5A 4DBDA 4Y9MA 5T9CE 3A3XA 2VGGA 1F76A 1XSJA 3M7SA 3FGCA 4OV4A 3NNTA 4REQA 4NG3A 5D37A 1ITCA 3NPUA 1J96A 1W9VA 4JTTA 4XZWA 3MBFA 1UKPA 4LS0A 4NX5A 1GQJA 3MSDA 4GYPC 3NZGA 2YL9A 1TJPA 3JR2A 1J6OA 1PKYA 1NWTA 4J40A 2OZ8A 1B3WA 1P0EA 4L6OA 1EYWA 2H90A 3EKGA 3N14A 2L5HA 1W1YA 2ZTJA 2O9RA 4ZR8A 1NM9A 3TKFA 1PPIA 1BKHA 3B97A 1HJQA 1I60A 4HJWA 4TX6A 3E02A 1XQLA 2XTKA 1IYXA 1T5AA 5FAJA 3WQPA 4CCDA 1UD6A 1EL3A 3T0TA 4QHRA 1TIWA 1P0BA 3MPGA 1ZCOA 4BF9A 3L68A 7TAAA 3INPA 4MADA 1UUMA 1HN1A 2POZA 4PTDA 5D9OA 1YE4A 4PUMA 3SZ8A 3KHDA 5AC8A 1FRBA 1G69A 4MGGA 3M6YA 5IM51 1UP3A 3PZQA 4O13A 3I7QA 2W3ZA 1Y5XA 2D3NA 4IPJA 4LX4A 3C0SA 3WK1A 1WDPA 2DSZA 3CHCA 4M8UA 1IR1A 3NO5A 4NXSA 2AMXA 3CQIA 1IR2A 1R38A 3EWXA 1VIWA 4FIQA 1RK5A 1KRAC 1B9ZA 1T40A 5FIPA 1X38A 1PYMA 4RXGA 1M65A 1DJNA 1H49A 1R3WA 1I1XA 1UR9A 2D2OA 3W72A 1V6VA 2OVLA 3BANA 1PKNA 1W56A 2GFTA 3IRSA 4IH3A 3MKKA 1OYCA 3AOFA 3HBLA 6XIAA 2XM2A 3UJSA 2B7NA 2GSJA 4MG4A 1PZ1A 2BVDA 2G3FA 5D04C 2Z1KA 1QVBA 4DO7A 2VYOA 2VNCA 3STPA 2WVUA 3DHUA 3EGJA 4WCJA 3BLLA 1Q6EA 4PB4A 1UZDA 4JDYA 3VA8A 5KTLA 4B16A 3EOUA 2YXGA 3WNPA 4ZO6A 3OGVA 1E9YB 4PTVA 4QS6A 1BQCA 4XK2A 4GGBA 4LYKA 5LIXX 4NZFA 2ZC1A 3UEQA 1A5LC 1WDWA 4DF1A 4Z2LA 3ITOA 3MS8A 4K1WA 2J8FA 3U0HA 5A2CA 2IKHA 5EMKA 1FWCC 4O50A 1BXBA 4NZ1A 4LF2A 4AH7A 4H01A 2YDSA 3RGTA 1DWHM 2HK0A 3M41A 2NV2A 2C16A 2VX6A 2QJGA 4JKLA 2D73A 4CN4A 2DT1A 1NP0A 2PDJA 3AWNA 1QK0A 1F07A 1XBZA 2PC4A 2YCLA 4JIPA 2XIIA 2R94A 4UMBA 4H4IA 5CGQA 1RD6A 1AMKA 3AROA 3TYDA 4FF7A 2OEMA 1QNQA 2PWEA 1AW1A 1ENUA 3GG7A 2VMFA 1KBKA 1FCUA 3GFYA 3DGBA 4DM1A 3LUTA 4OWGA 1KM3A 4N2YA 3WLMA 2QVNA 4HOZA 5DMMA 2O0TA 3EMZA 2Q09A 4NP7A 3DESA 3MZNA 2A3CA 1MFUA 4JX4A 1A5MC 2JGYA 1ZALA 3UZZA 4K68A 4PBGA 3CT7A 1US0A 3ARRA 3NM3A 2X1IA 4U3AA 1K8YA 4JKKA 2IS7A 4R5EA 4REQB 1H60A 2OWWA 3WUEA 3M0IA 3W7JA 1TVLA 1BG4A 3BE7A 3KFTA 2Y63A 2GGGA 1MXSA 3Q37A 1UJPA 3KEHA 1UWTA 3DC0A 1XCWA 1S5NA 5AYYA 4R34A 4WOZA 4JPGA 1XCFA 3I4KA 1E56A 4W7WA 1K1DA 3ITTA 4JQ2A 4RNJA 3W3OA 2WZHA 9CGTA 3IK2A 1GYNA 3N04A 1MW3A 1I2NA 5AVHA 1UD2A 4A3HA 3KXQA 5HJYA 1RCOB 2UY5A 4DJFC 1T41A 4MWAE 1B3OA 1QHZA 1V7AA 4FNPA 4E2BA 3F03K 3R12A 4BFAA 1NTHA 1G9HA 2FHCA 2YA1A 2WSKA 1S3HA 1XBVA 4DF2A 2HV5A 4JNZA 4LOCA 3WUGA 2A0NA 2C19A 4XBJA 4S2CA 2VWTA 2CU0A 3ISIX 3UWEA 4MY9A 3IV3A 4C6LA 1S5WA 3UWUA 5I78A 3NJ3A 3LM3A 1WV2A 1WXJA 4Y90A 2ESCA 2WSQA 4AX6A 2V5KA 4I9TA 3WBAA 2I14A 1NFGA 1PE1A 3DYPA 2WLYA 4XZ9A 3TC3A 4JZ5A 4LW7A 1IEQA 4JYFA 1UD8A 2GGHA 1FWJC 4CNOA 3U5UA 4HCLA 5HULA 2PU1A 3EOOA 4Q7BA 4M1RA 1MYRA 3RCNA 2WV8A 4FR1A 4LPCA 3FYPA 1LYXA 4UQDA 1M7PA 1VHCA 2WMGA 1MRAA 3R89A 3W24A 4LT9A 3VNZA 1AA1B 1V3LA 3QMTA 4ASTA 3GG0A 6TIMA 2J25A 3DOPA 2PA6A 1QTWA 2V5JA 1NY1A 3ES8A 2E9BA 3E0IA 1B5TA 1SJCA 3BGAA 4GBUA 1JI1A 1FCBA 4YVXA 3FKKA 1PKLA 4DYEA 3APYA 1S2VA 1VPXA 5ECUA 5T91A 1FWSA 3QGKC 1U2YA 5IRPA 1VJZA 3TCSA 4K1GA 3SSZA 1LDCA 2ATMA 3DFTA 3HB9A 3LPFA 4TQTA 1SGJA 4MKNA 3LPGA 4M80A 1B4EA 5FESA 1UR0A 1RA0A 2VDHA 1DHKA 1XSIA 5IBXC 2C3ZA 1RVGA 2QCMA 4XSLA 3B0XA 1PXGA 4WOQA 3SUSA 1NJJA 3GZAA 2NWRA 4UZUA 2HROA 4KGJA 1CB7B 1T7LA 1G01A 3VDBA 1HG3A 3C52A 2PCQA 1RY0A 1E1CB 2P10A 3I6TA 3TNOA 3IIVA 1DWFM 3KBWA 4EXAA 1TMLA 4Q8NA 3S5ZA 3KX6A 4GH3A 2BZNA 3FSUA 1ISWA 3EB3A 2CERA 1ZZMA 3L4UA 3PTKA 1LWHA 4AWUA 2WCAA 1UKQA 1KQZA 4C5YA 3UCCA 2CKSA 2VELA 1LL4A 1XV8A 1X98A 2Z6JA 1XIMA 1H62A 2YFNA 3L5AA 3CUZA 4TV6A 1JRCA 2VCCA 3GBDA 4GI6A 1FUYA 2Y62A 4K37A 3W2JA 3MUY1 4HMNA 4XTIA 1KKRA 2YDAA 3R8GA 4HU3A 4YXGA 1Z42A 3L4XA 4LUTA 1EJWC 2X09A 2RAGA 4DUXA 2JIWA 2EPNA 4F9DA 2OSWA 1L6FA 3AO0A 4XG1A 4H83A 3QW4B 1CLKA 3G1HA 4MMWA 5CSUA 4W84A 4AIOA 4C1KA 1IGSA 4S3FA 1O7AA 2G8ZA 4DHGA 3FKRA 1WB0A 2PTYA 2YFOA 4ERAA 2PGEA 3TH6A 3VNYA 3P8JA 3P5ZA 2V3EA 2VZUA 5MHBA 1PX3A 1SFJA 5C7HA 5HXMA 4JCMA 3ZZ1A 1LJYA 3K46A 4OJYA 3BV7A 1GUVA 3T42A 1A0DA 1GVSA 8XIMA 3VIMA 2GK1B 4G1NA 4I5XA 5EY5A 2JIEA 3WLPA 3RHGA 4R9OA 3DFHA 2A7RA 3QQWA 4P61A 4LEFA 4UTUA 3KVLA 1GZJA 1ZAHA 3PJTA 3NO3A 1TR1A 2GDQA 3VGFA 3RLVA 1P1XA 1IIGA 3QYQA 3W70A 4HCHA 2ZOXA 4IIDA 1J0HA 2XVLA 3HQNA 3WEOA 5T9BG 1IWPA 2RJGA 4WSHA 4OOZA 3GXNA 4HA1A 3RCMA 3GSMA 4DEFA 4O14A 3QKEA 3EXRA 1XYCA 3K1DA 2EKCA 3OG3A 4OUIA 3R8RA 2WCGA 1RALA 2AKZA 2ZE3A 2D3LA 2I5GA 3RX4A 2R8WA 4FO4A 2OGJA 3EYPA 4JHZA 5C9WA 3R11A 3R0DA 1NQKA 2CLFA 4PTNA 2DIJA 1ZFJA 4R27A 5D09A 3W7GA 1JCMP 1JYVA 1W1IE 1WXYA 3EA3A 2DZXA 4QXIA 3R7MA 4DNMA 1HVQA 5IBXA 4OKDA 5LNUA 1DJYA 3KHJA 4MWAA 2XN2A 3CQKA 3F2CA 3I3EA 4M7TA 6XIMA 4HZ7A 3W9ZA 1TTJA 3N15A 3B0VC 4QBXA 4GI8A 1K02A 4HOXA 3QGVA 2CLHA 1DWJM 1KFKA 4IG2A 3TCEA 5K9CA 3T81A 2ZDSA 4DBEA 4CGTA 3UD6A 3STEA 2Y24A 4NZJA 5A8MA 3KVMA 3G22A 1H7NA 3KL3A 1XGDA 1FCVA 4IPNB 2FZNA 3CYVA 3RJYA 2YZRA 4MVAA 2RHGA 2WVTA 1W3NA 2HXUA 3P74A 5HPOA 4CQ8A 3KRUA 1MUMA 3RU8X 2XSXA 5FJUA 2QCLA 4UTKA 2XFRA 1H0IA 3MYOA 4H9UA 3QFWA 1RCXB 2Z1WA 4O0KA 4J3WA 3CLMA 3KM8A 3AHZA 3N9SA 4A4AA 4QAWA 1MSSA 3OGSA 4L9YA 2C71A 1PIFA 4FX7A 2DZUA 2X0SA 2J7HA 2W66A 3TW7A 4EPEC 1OVDA 4PMQA 4ZSTA 1MNSA 1ZSXA 2ZUNA 5JBDA 1QPQA 4UTFA 1X1ZA 4RDVA 2CXEA 2D20A 3PF3A 1C92A 1P0KA 5CPOA 1SO4A 4Q4PA 4FPSA 1S2TA 4HT3A 4RL3A 1FKWA 3ZVHB 1XG4A 3VCNA 4PBFA 4I9AA 3T4CA 2XUCA 2O9TA 1F6KA 1F6YA 6REQA 4LUTB 3IJDA 4EE9A 3BMXA 4F66A 4PEKA 2DEPA 1F8IA 2C91A 4O10A 3A3WA 2BLEA 2ADAA 2O9OA 5KITA 3CXOA 5MKGB 5FJRA 3QLDA 2PWFA 2PWVA 4GZJA 2YLLA 1KLYA 3T2QA 4DM2A 4PTWA 1XSKA 4XBSA 3AS2A 4UFIA 4AX7A 3MJMA 2XM1A 3MWAA 1O1HA 1FWTA 1VKFA 2J27A 1XLCA 3POHA 4H6RA 5AHNA 4H6EA 5AY7A 1BTMA 2V0TA 3OW1A 3P2VA 2NVCA 4KGLA 2DIKA 3H4GA 1P7TA 4A3YA 1E0VA 3H2OA 3GXTA 3BJTA 1JZ7A 1KFJA 1SR0A 4I6VA 3UCDA 3PNUA 4H3DA 1C3FA 2ZZ4A 1MW1A 3VOJA 2AOSA 1T6MA 4UTJA 3B8TA 4BI7A 1A4MA 3WMCA 3VE7A 1KFLA 5CZTA 1DE5A 1JCNA 4P7OA 2CEQA 2FHFA 1ADOA 4PFHA 4G2DA 3B04A 2ZADA 2C6QA 2I5QA 4DO4A 3NVDA 2P50A 1ZBKA 3OBKA 4PMOA 3O16A 3CWOX 1TJ0A 3RPDA 1D3GA 1HKJA 3VOGA 3TDFA 3TONA 1B54A 2ZUSA 3M0MA 4AD5A 1CXIA 4ZQMA 4J9JA 1FHLA 4TO8A 5I24A 2QVHA 1M01A 4LNYA 4JTLA 1J8VA 1RPKA 2ZZ5A 3SI9A 2DQWA 1XI3A 5CPNA 1QOQA 2OU4A 4YTTA 3NPVA 4J28A 2GJXA 1O6IA 3P60A 4AMCA 3WYZA 1LUCA 4WDXA 4BEUA 1C8YA 4JBRA 1A5SA 3CQHA 3CV6A 4CCZA 1JDDA 3T9PA 3MVIA 3H70A 1EP2A 4C7FA 4GQ0A 3NQ6A 1XLDA 5C2GA 3ATZA 1K9DA 3WD4A 3IK4A 4US6A 3TYCA 4PBEA 3PBMA 4P7RA 4JTFA 1XC6A 3A3HA 3ZSTA 1SO6A 1VEOA 2D2HA 4O1AA 4MNMA 1XYBA 3B4YA 3GFXA 1ZAJA 4J27A 1LQAA 3QM3A 1TPDA 2QCGA 3DFPA 4X2PA 3W76A 2XDFA 4AD3A 1QMLA 4KCWA 2OOFA 3W1PA 4F40A 2BGQA 3KBVA 2E77A 1H50A 4GY1A 4RPPA 3B06A 1CIUA 3XINA 4H9MA 1VHNA 4NRRA 3WEMA 4JIRA 1R3TA 3U9IA 2D24A 1YXDA 3FK4A 5G2IA 3AMCA 3R0KA 9XIMA 4LY8A 4PE8A 2XIQA 2F6XA 1RBLA 3U3HA 2WVSA 3CB8A 2QR6A 1GTHA 1GZ1A 1GT8A 1KTCA 3QN3A 3SIMA 3S5NA 1V7YA 2UY2A 2PLKA 3WF0A 4Q4SA 5LXXA 1MNZA 3JRKA 3E96A 2OKOA 2F2HA 4ZB0A 1NDYA 3IUIA 1GW1A 3LNPA 3WMBA 2YBTA 3EOSA 5KZEA 4JTJA 2G97A 4JYEA 1W1VA 3Q65A 2CETA 4JX5A 2OPJA 3MHFA 4Z2HA 1E5JA 1JDAA 4ZQCA 2XFFA 5AZ0A 2GOUA 2WVVA 4GJJA 1GK8A 5C5YA 2PS2A 4C1NB 3ZIZA 3PWIA 1TYGA 5EFFA 3BCJA 3QPEA 3C2FA 4HNOA 4PRRA 1MUWA 2P53A 1NDVA 4A6GA 2KAUC 3W29A 4JYDA 4O19A 3ZSSA 3H7VA 2I56A 3AJXA 2BVYA 2REQA 3NXLA 5AYBA 1H51A 1IWAA 2R9RA 1XIFA 5DBUA 1LORA 1F3XA 1KM5A 3CIWA 3HF3A 3ZT5A 4C6MA 3S47A 2O92A 4GG9A 4RNIA 4OBSA 3CJPA 2VC9A 3LQGA 2JEQA 3TWBA 4QGCA 3AYRA 3QPZA 3DIPA 2VEMA 4NYYA 4Q8OA 4QCFA 3SURA 1K70A 5CGMA 1JNDA 4HNLA 2PPGA 3DBPA 1PO9A 7A3HA 4AZ6A 1BF6A 2HJPA 3MUZ1 4DWDA 2WZIA 4IPLA 3RK8A 1I1WA 3WUBA 4BQ4A 4F9JA 1PIIA 4F0RA 4TTGA 2UWFA 1CPUA 1FCQA 2QJNA 3IGSA 2HQAA 1BXNA 1Q66A 4U3CA 5A69A 3OG2A 5FOOA 1X6NA 3V5OA 4WXZA 2PZ0A 2Y88A 3E0FA 2ZUMA 1E9LA 2R14A 4QLKA 2NSXA 1L2UA 3KRSA 1CWYA 4P7QA 4WDTA 2Z24A 2XYLA 3MP3A 2WNWA 3MWCA 4I9MA 1AD1A 1CGVA 2R82A 2Z2BA 4J3ZA 2FPVA 3VZZA 4DELA 4Z0JA 1LRNA 3ZLHA 4QRNA 4WHBA 5D2YA 3N34A 4E38A 3CC1A 2F2KA 4PA8A 2YSWA 1J5TA 4CD6A 4GNVA 1XLAA 1JEZA 2OQYA 3LS9A 4ZB5A 3WDPP 2YXOA 2CIPA 3IGUA 1H41A 5A6TC 3DERA 3TV8A 3PP7A 4O1DA 1GVEA 4NZ3A 2NV1A 1YBQA 1KC7A 3R58A 3SAZA 2O7SA 3ITLA 3N2TA 1S1PA 4QG6A 2PF8A 1SR9A 1V3KA 2RGLA 3D0CA 2DGAA 3C2OA 1VYSX 3URNA 3AI0A 3SB0A 3SFWA 4C6EA 1AZ2A 4DZHA 4MLRA 3IJ6A 5A2BA 4H8UA 3IAPA 1GNXA 2PLMA 4PMNA 2CXGA 3QV8A 5HOSA 2ZRUA 1GPFA 3MMDA 3E74A 1OINA 1JL8A 5FKYA 2HK1A 1Y0EA 3ICJA 5FL1A 1LBMA 1Q7QA 1Q6RA 3GUWA 3GXPA 2XVKA 1OHLA 3QGAC 3NQCA 3PY2A 3RO6A 4UTIA 2WANA 3LLDA 1TV8A 3R1ZA 2FZMA 4IWWA 1XBXA 4FB7A 4NJIA 3TJIA 3C61A 4B90A 3RDKA 4WJXA 1NH6A 3MI6A 1CXHA 3ALFA 3M07A 4PRWA 4PUUA 2ATSA 2VR2A 4GLEA 3KWXA 3GNOA 5EMLA 4PMUA 4QLJA 1TTQA 3WQ4A 4E6MA 4JQAA 1FDJA 1WYIA 4E4UA 4QSHA 2QCFA 1E0XA 2H8ZA 5I00A 4J2MA 1FOBA 4K3ZA 4GXWA 5AHIA 4MPKA 2DORA 1FTXA 4JQ4A 1H0GA 4MUZA 1ONXA 4LRSA 3H6OA 4KCVA 3WQWA 1E43A 1F9CA 3BLEA 2ZRYA 3MANA 5EYWA 1FFRA 5CSRA 1HO4A 3DFQA 3VIKA 3NOEA 3BL3A 5A5WA 3TYEA 3GH7A 3PANA 3FX4A 1XIEA 2GVEA 1REQA 4Y9OA 3O6DA 1XH2A 1G0CA 1HJUA 3LBCA 4ATDA 3S5OA 3H4XA 3PTMA 4FR6A 1PKMA 3RFAA 2GWNA 4H6QA 4D6IA 3ITGA 3TFCA 3DYOA 1P6WA 2QF7A 3AYTA 4RDWA 5BCAA 8TIMA 3NEVA 1R8LA 3EKZA 4UUIA 2RKXA 3AYSA 4XBKA 2XVNA 4S3DA 1RAKA 4B4FA 4HZ6A 4GINA 2R1MA 3F2BA 2WNNA 4KS0A 2YDRA 3DXIA 3O63A 1R0MA 5A6BD 5CGTA 2ISVA 3BK0A 4DF0A 2EAWA 2E1DA 2F38A 3KLLA 4FX8A 1OQFA 3DKLA 3G8RA 1HJWA 3NDOA 2DT0A 3E1F1 2VOMA 4WSJA 3QY6A 3WLJA 4I3GA 4AISA 3DKJA 5LGZA 3QHMA 3FFSA 1XLKA 2Y7DA 5C9RA 2AL2A 3EZ4A 2CHRA 2OQHA 3DI1A 2RDWA 3NAVA 3XIMA 2QUVA 2BOFX 3W7DA 3P84A 4HMEA 4DWSA 4QTGA 3D3AA 1I0DA 1HKMA 3EA2A 2PP3A 4CU7A 1AMYA 2CPUA 3AALA 1EBGA 4PMYA 4IP5A 4D6JA 2Y8KA 1PAMA 1TO3A 1DP0A 3VE9A 3UWQA 4W89A 1P0DA 4DX3A 2ZIDA 4ZTYA 4AU0A 4JKMA 3WK3A 3TJXA 1AG1O 3WH9A 3UGRA 2HVOA 5HWMA 3CO4A 5E6YA 4URIA 1K9FA 1VRXA 1A3WA 3EX3A 4H41A 4LYPA 5E09A 4W5ZA 3IGHX 1XQKA 3CMGA 2EPKX 3M0HA 3W26A 2XIOA 3WCZA 3WMSA 5LSMA 4J5NA 2PCEA 4XO6A 4IMCA 4CVWA 2TYSA 4EOUA 1K7EA 2GJNA 4IFKA 4JDBA 4WD0A 4BQ2A 1RP8A 1ZGDA 4HN8A 1KCLA 4ADUA 4U4MA 4ZVJA 2IQ0A 3FXYA 1ODZA 3K8KA 1ZBVA 2XGBA 1Z69A 2WC4A 4B15A 3S6TA 4NKCA 3SGUA 2ASHA 3LRKA 4ALDA 2X7WA 1GPWA 3ZWTA 2I17A 4IICA 2CHNA 1JGMA 4X9SA 3NZQA 5LZLA 3BAXA 4KBXA 3LHVA 4XZNX 2EJ1A 4DXVA 1X1OA 2HSAA 1E9IA 1QPNA 2HPIA 3V35A 3FJNA 4V1XA 1L6SA 4LJ3A 3CAWA 2GGJA 1G4PA 3THDA 2O56A 3GRIA 4AHPA 2JF7A 4C6IA 3L12A 5D03A 3LDVA 3RM9A 3LZ5A 3ZJ6A 1C7TA 1DJXA 3EEGA 4YYFA 1J2WA 1S3TC 3HU7A 3B4UA 4C6PA 2Y7FA 5C8BB 5H8PA 3ERPA 2W61A 8RUCA 3K13A 1OX4A 3NG3A 1FFQA 4NHVA 1MXGA 4QFUA 1F6PA 3OOQA 3STGA 2IQTA 3S3GA 1L2QA 5HK4A 3WBWA 2DVUA 1W9UA 3QV6A 1VFFA 2HRWA 4MZ8A 4S2BA 3HTWA 3L65A 3M44A 1Q6DA 1KR0A 4IGSA 3WY1A 2HEJA 1LLOA 5FEWA 2IXUA 5A3HA 2YB4A 3LG3A 4ES4A 3NL3A 5BRQA 3RO8A 3W81A 1PTDA 4BKNA 4H1ZA 4L4LA 3LU2A 1JPIA 2HE8A 3WD2A 5CC3A 3HGRA 1WKFA 2X1UA 1R30A 4KFOA 4HNUA 2P5NA 2MANA 1EC8A 3RNDA 3GW3A 3PNZA 1J0ZA 5DT5A 4G7EB 4Q4RA 3LHZA 2A5HA 1U1HA 2CBIA 3SN0A 4HP5A 4HYVA 4YJ5A 2OKTA 1TREA 3DI0A 4Z1CA 4QDMA 2Z7KA 4PMDA 3V1HA 1Z48A 3GVGA 2W27A 5KZ6A 3IIPA 4F0LA 2IPGA 3GU2A 4NUWA 3UA4A 4XV0A 3IWPA 1X8CA 3DFNA 2OO0A 4IJRA 3ABSA 3P80A 1D2KA 2F9RA 1E3XA 1QI0A 5A6BA 2EPHA 4LS1A 2CLOA 3LI1A 3SN1A 1V77A 4BCEA 3WNOA 3L66A 2VUYA 1I75A 2ACUA 3WNLA 3UZ5A 5GJNA 2EG7A 5C9XA 2ZX6A 3TR2A 2AL2B 4U5IA 1JF5A 3ME3A 2ZX5A 4P7NA 5JBFA 2NT1A 5LA2A 1C9DA 1T96A 5AECA 1JCTA 2V2DA 1UWQA 2W5FA 2BXVA 4GXMA 1SW0A 1GKRA 1HGYA 2FFCA 3L2LA 3REQB 3VFLA 3N2OA 1LLWA 1IQ8A 2C18A 5IXEA 1EA9C 3APGA 2CWXA 4KEVA 4AIEA 2XISA 4PCSA 1ADSA 1E5NA 1X6LA 4D1IA 4RXFA 1K8ZA 4GJ1A 3C8FA 3O6AA 4IZGA 1KBBA 5FI8A 2DZBA 3A13A 4PUWA 4YTRA 1VFUA 4D8ZA 1QPKA 3ZR5A 3E2SA 3DHDA 1H2JA 3H2NA 5EBAA 3AXKA 3UNTA 3UU0A 3ZJKA 3GFZA 4HSOA 4AXKA 3CH0A 5D05A 4UFLA 4EF8A 3PPHA 4KWUA 1NIUA 2RH9A 3FVMA 1TWDA 3BUVA 2WPGA 4IFKB 3EX2A 2WPBA 4ZOBA 1RH9A 2ZX7A 3VDHA 3U4FA 2J7CA 3EOEA 1H7OA 2J24A 3N13A 1ZENA 1LOQA 4UCFA 2ZFAA 2IPJA 3S5SA 3AIWA 4Z1AA 4ZTXA 2ZRZA 4IGMA 4QEEA 2ZUUA 2PU0A 2G95A 2D69A 3CZGA 4HTBA 5AC5A 3GG8A 1ZJHA 3AHXA 4LCSA 2BXZA 2WQPA 2C79A 1JPHA 5HANA 1HJVA 4RCXA 3SW6A 3NGFA 4JL2A 8XIAA 4GQQA 1PHWA 3TROA 3SCWA 2XH4A 4WEVX 1W5MA 3GAYA 2ZXAA 3GDTA 1E1EA 2HXTA 2CZ5A 1YDYA 3ALGA 3NZRA 4UTLA 5XIMA 4BR1A 3TOYA 2A85A 1UUQA 1N2VA 1VLWA 3PJWA 2Y7GA 4M24A 2D0GA 3PZNA 1HIZA 1C8QA 2QCCA 1UWRA 4GNJA 1Z3NA 2X0HA 3QV9A 2C1GA 3P93A 5A6SA 5AHEA 4PTMA 4GMEA 3L4VA 4N9BA 3OZMA 1XISA 3HG5A 3R4IA 1GVIA 3IACA 2H8XA 4WGXA 4L4PA 3G1DA 1VJIA 1V0KA 4GA8A 3W6YA 1QASA 2J9XA 1R2SA 5H2ZA 3WJYA 4LEQA 1H63A 2B0MA 3M6DA 2WM0A 4FLQA 4EX4A 4TVUA 5EPDA 3GC5A 3P82A 4LRTA 3BPWA 2DVXA 3DHPA 4FAMA 1MI3A 1H7PA 1DL3A 2J66A 1EA0A 1RD5A 3CUGA 4AVOA 1E6QM 1OZQA 4IQEA 4AHQA 3A47A 3IANA 1K9TA 3U4AA 5A6MA 5I3HA 4J3VA 4H2CA 5ENLA 1SSGA 3CAVA 1QNOA 1E55A 2XH0A 1SZEA 1EEPA 2EHHA 4V15A 3TC7A 1MDRA 1CGWA 4B9ZA 4Q22A 2G50A 1HNYA 5EMMA 1PS9A 3KBSA 4AD0A 1K8CA 4MJZA 3GIQA 4O52A 2QCDA 4N9CA 1J0IA 1UQYA 3CBWA 3NCOA 2Q8XA 5AC7A 1EO5A 2QMKA 4D6EA 1XYZA 1FXPA 3BZJA 4CQAA 3DFSA 3UXAA 4ZBCA 1WA3A 1DIEA 2Z7GA 2ANUA 4IX0A 1KCXA 2E5DA 3SUTA 2P88A 3W2UA 2NSOA 3FJ6A 1YXYA 4A8IA 3T7VA 4CQBA 2DZAA 5CSYA 4PL2A 5FF7A 4C6DA 1V02E 2W67A 3H8AA 3KCLA 1UOKA 3W2NA 1UKSA 2OG9A 3W01A 3E0LA 4KT2A 4U2ZA 1BYDA 4WUIA 1OSEA 1SW3A 1BAGA 4M0XA 1FX6A 2WAGA 3WELA 5G2WA 3NO1A 2VZSA 4EIVA 4BWLC 3D3FA 2GSEA 1GYLA 4L7ZA 1EDQA 3LCXA 4KWOA 4HHHA 2NXHA 5LA0A 4S3GA 3SCOA 5GQBA 4X0VA 1OGSA 4XKYA 3G0XA 1QT1A 3UFYA 3SQLA 3PS7A 3OIXA 2NLYA 1HTIA 1TPUA 5B7YA 3C0LA 5TIMA 3UNDA 1DXEA 4KRUA 4RJEA 2CYGA 3TN4A 1VFLA 1O5RA 5I77A 1O5KA 2NWSA 4MY8A 4W7VA 2OEKA 3WFZA 3EDKA 3VDCA 1UBSA 2Z1XA 2P1FA 3MDWA 3CAKA 5ABGA 3FA3A 5CEWA 5AHMA 3TTSA 2WJDA 2PAJA 5CPMA 1JAEA 1R3SA 5HDRA 4B5VA 5CBIA 4NX0A 3CUFA 2YL5A 1HKVA 2BHUA 1OX6A 1Q7MA 3GNNA 4PRTA 1GVOA 1ZCCA 5BMWA 2XFYA 4O16A 5M2FX 2X16A 1BRLB 3W37A 2G41A 4PMRA 1UC4A 2Z4GA 4IGNA 3NL2A 2OSYA 2GVLA 2HMCA 5HMDA 1PZ2A 2B4GA 3BMVA 4TV5A 5LNSA 4LALA 1KB3A 3MSGA 2PDHA 4J3TA 3S42A 3DN5A 3GYCA 4J3SA 4G5DA 3SCRA 4MAVA 3EX4A 1DJGA 4AF0A 3B9NA 3ZO9A 1BEUA 1GOQA 1UPPA 3MJYA 4H7VA 3B9OA 1TELA 1DKWA 1IZJA 1F3WA 4O15A 4KEZA 3WDJA 1AK5A 4KCUA 4ICCX 2CNCA 2A7NA 5HBFA 5CG0A 3SQMA 3CB3A 1GG1A 1GHRA 3M4HA 1RY8A 1RLCL 3KP1A 4FEZA 5FAGA 1MO0A 2OYKA 2QGYA 1MWOA 1RK6A 1DYSA 3IJ8A 3BW2A 5T26A 2DW6A 4QEHA 4CCEA 3NDZA 4ZGYA 2NW0A 1P6BA 2VDGA 5F2LA 5A94A 4RPQA 3OBEA 3LBMA 3D47A 2UBPC 1Q6GA 4B5UA 1NSJA 2B81A 1UD3A 3DFOA 4Z1YA 3DG7A 2OYLA 4X22A 3BW3A 1W37A 1TPVA 3B8WA 4D2JA 4IIHA 1S38A 3F5LA 2IKGA 4DIAA 1RQEA 2E8YA 4KEUA 5M1TA 2XN0A 2GGEA 3QEZA 1W31A 2PEVA 4UTWA 5I06A 4GACA 3CU2A 1ML1A 3UZYA 3IPWA 5C9UA 2WO5A 1OGBA 2DZSA 3LCHA 3CTTA 1HP5A 1MXDA 3UR5A 3M0VA 1SJDA 1NWUA 3KDNA 1XUZA 5BRBA 2MNRA 4L1WA 3GO2A 1RXOB 1WBJA 2WC7A 4KFPA 2PWGA 2RDUA 3W7CA 1GQNA 4V33A 4DO5A 3UG8A 4US5D 5CC6A 4N6FA 3RYSA 3OP2A 3WL0A 3P3BA 3IJIA 5I02A 1HL8A 1BQGA 4NJHA 4JEQA 3O3RA 5IHRA 4IXXA 2GJLA 3ARXA 5HJLA 4I8YA 4YWIA 3UR2A 1KM0A 4BQ5A 3TN3A 3V1PA 2YYTA 3WD0A 4F0HA 2VJXA 3ZJ7A 3KTXA 3GG1A 3LB0A 1ITXA 4GC3A 1JCLA 1WKYA 3O6CA 4HPJA 1GEHA 2WSYA 3W38A 1JXKA 3FHAA 1DORA 4QJ1A 4AZGA 2DW7A 2Z2UA 3EX6A 1V02A 1KRCC 2WC3A 2WMFA 4IQLA 4K6AA 2ODOA 2E9LA 3M0YA 4ZFMA 3V75A 2CC0A 4F2BA 4ZOAA 3H2CA 4AZHA 1AJZA 4H8NA 1J10A 4L6HA 3TYUA 4XD6A 1OC6A 3SN4A 1DIOA 5HMEA 1AUSL 2NV9A 3L4ZA 3L0GA 1VEPA 4DYJA 5BMXA 3BW4A 3S2LA 5E1QA 1W5PA 3P6LA 3UG4A 2WKLA 1NP2A 4P5UA 3KOYA 1G7VA 3E49A 3UERA 1ODUA 3CPGA 2JE8A 3FY1A 4PMZA 3GUGA 3WBYA 5A6KA 3TXZA 3URQA 4CD5A 3UETA 3T05A 2QQ6A 1XIIA 3DBNA 4LS2A 3THQA 2Z0IA 3IJLA 3M46A 2ACQA 2ZXQA 2NX3A 5FL0A 3QY8A 1HW6A 3KWSA 3VMPA 2E6AA 3A6OA 5FACA 1YYAA 2HWGA 3EA1A 5G4WA 3FAXA 1V0LA 4FF5A 1KV5A 1KRBC 3EDJA 1EXBA 1EC7A 4ILSA 3Q2DA 3KS6A 4OIFA 1NFPA 2BOGX 2YW3A 3KL0A 4IPPA 4OQVA 1JYXA 3HMCA 1LZOA 3GTIA 1XIJA 5H6HA 3TW6A 1CDGA 1LT8A 3B3DA 2YYUA 4JCLA 3THUA 4DI9A 2GOKA 1LROA 3NQVA 4V2XA 1X39A 1VCFA 4F0SA 4OOUA 4EPBC 1N7KA 3MCMA 4JN6A 4HNTA 1JGIA 3DU0A 5HNRA 5D9PA 4EP8C 2E5BA 2DSVA 5CBBA 4GFSA 4H6KA 5CLTA 1EZWA 1A5BA 3BH4A 4AZIA 4GIYA 2WZEA 4F8XA 4KW2A 3FHQA 2X7VA 3FV9A 4W4QA 1G6CA 3E2VA 4JTKA 1FHUA 1L9WA 4N4QA 4B5TA 5C71A 3EWDA 1AFSA 4B5WA 2XIJA 4MKVA 1UR4A 4MNLA 3ITVA 1MQPA 2P3ZA 3RN6A 2NQ5A 4XAPA 1QPRA 3BSGA 2JFEX 3GD6A 1CLXA 1TTPA 4XTDA 4Z2IA 3BAKA 4WIWA 3GXIA 1OGGA 3OGRA 3H54A 4S23A 5FA5A 3UBPC 1I2PA 3VC6A 2D2JA 3CPUA 2ICSA 1FWIC 1QPOA 1DOSA 4LBUA 3W75A 5DX7A 3VNJA 1W2VA 3VKKA 4NILA 2I9EA 3O9NA 1XICA 4QROA 5G5IA 1EWDA 4QP0A 2FDMA 4UOQA 1P48A 1WAWA 4RZBA 3HG3A 4CNNA 4DJEC 3WJXA 1C93A 3GVRA 1OD0A 1FWRA 1P4CA 1QFEA 5FJJA 4QE4A 1TVPA 4I5UA 4HD5A 3NA8A 2PDBA 4QJ3B 6PTDA 3GAKA 2PRMA 4UNLA 1F73A 5CJ5A 4GYJA 1UD5A 1TV4A 4ORMA 4UFKA 3GNXA 1ZHAA 4Y8FA 5CPQA 3WKZA 4LCQA 1VEMA 3MV01 4JICA 2BY1A 2TMDA 3NQGA 1WX0A 5E9AA 3IUHA 5C9ZA 2YCKX 3OODA 1JJKA 4JOMA 3RMJA 1PUDA 1FWGC 2W63A 5G2HA 4WY0A 1TCDA 4XX6A 4BK9A 4IOTA 3VGBA 4PR4A 2ZKMX 4JX6A 4GQRA 1FWHC 4LF1A 1E6PA 1W3IA 3EAUA 3GW0A 4V1YA 3RLUA 4JNYA 1Q6LA 4IL2A 1GQKA 2YOCA 2UV8G 4MDOA 3I6EA 4HB7A 5TD4A 3B0PA 3MW7A 3QR0A 5I3KA 3VC5A 1TA3A 4IM4A 2Z1VA 3HV8A 3T2OA 2WJZA 3FNDA 1YKWA 2WMIB 4OFCA 1V3JA 4XISA 4JQ3A 3NQMA 2GUBA 1VGAA 4H7ZA 3CHEA 5C7VA 4FI4A 3SUVA 4HA4A 3TOPA 1RBAA 2GQ9A 1OJXA 1EDGA 4HA0A 1KTNA 3DG3A 4HU0A 3WUFA 3FVDA 2VQUA 3GR8A 3AXXA 1UBPC 4R7WA 1OCQA 3BV4A 4J2PA 3CMJA 4JFSA 3QZEA 3VD3A 1Q4WA 1WAUA 1NAL1 1KWKA 1H11A 1DPMA 5HMSA 4I9JA 4AY1A 3PUEA 3GYEA 3KS5A 1O68A 1RJQA 3WX7A 1WKEA 4TU1A 3CUHA 1DIKA 3GC2A 5F1VA 5HUOA 3T8LA 2PC8A 1R7OA 3A9BA 3CV7A 3ZYZA 4HN4A 3ZLGA 1CECA 1MVYA 4BEQA 1R85A 4GC4A 1BD0A 2QUMA 3I7RA 3ZS4A 4U10A 4GVGA 2NQ9A 2FKPA 3S2MA 5DMNA 5HNUA 1H7XA 3ONCA 3JVAA 4PCPA 2ZVRA 2FVKA 2D0HA 1IEIA 4YPJA 1W3JA 3ITYA 1EYEA 3VVGA 4H04A 3AUOA 1OM0A 3GZ3A 3G8EA 1UWIA 2PURA 1XLIA 2WB5A 2WMKA 4CNUA 5DCDA 3W82A 1WZAA 1CGYA 2F6KA 3D6NA 3A4WA 3BG3A 4NT0A 2WWDA 3UY7A 2J74A 4C90A 1PL9A 3LHYA 3F4WA 3W7OA 1UR3M 3IJ9A 3QH2A 1OFPA 4A22A 3LMYA 3O0FA 2WJEA 3GB6A 4UMCA 4X61A 4EVZA 3U2EA 5DANA 3USBA 3WQ8A 1ZP4A 5T8GA 1B3XA 2H9AA 3EMCA 3F1QA 3EKLA 4AD2A 3AS3A 3GR7A 2FIQA 1NELA 1R2RA 1YTKA 3EDFA 5REQA 3CPRA 3HURA 1XLMA 3OBAA 2BG5A 5LIWX 1TQXA 4OHQA 3NL6A 4KWWA 1LOLA 5BOEA 9RUBA 4LVGA 2EQDA 2VD8A 1YXCA 5E0KA 1S39A 3U8GA 1JZ2A 3W85A 4F4RA 1GOKA 4QISA 4PH6A 3H7UA 2YGYA 3N2CA 4GFIA 1QJWA 4WR3A 3N17A 3W1QA 1G1YA 1OC7A 3RRAA 2OLAA 3EWYA 3HZ3A 3PM6A