4JTSA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with 072
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 136
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtsA00
4IMCA 4WXYA 4MVAA 5K3VA 3NGJA 4UC5A 3LTSA 2CW6A 4MYAA 4GUIA 3M9YA 4UTWC 2OCZA 4OV4A 3QC3A 2FFCA 3W1TA 5LNVA 1KTNA 2A2IA 3MO7A 1U83A 1OK4A 1FBAA 3NM1A 3TR2A 3S9YA 1C8VA 5CKSA 3AJXA 1G7VA 1YYAA 1YADA 3W07A 3ATYA 1G4PA 1GVSA 2ZTJA 3IVUA 2YSWA 2VFIA 2DZTA 4Q33A 3GDKA 4LVDA 2BTMA 4JTIA 3BG3A 2RDUA 4EIVA 2ZZ7A 3DKLA 1SR9A 3NVTA 3DGRA 5K9XA 3W86A 3UZ5A 1KM0A 3PSVA 4Z08A 5G2IA 3MWAA 5LKYA 5F1VA 1J5TA 1G4TA 4QSHA 1T8XA 4M6VA 1YTDA 3UQNA 2X30A 3G3MA 4ML9A 4WY0F 3SJ3A 1WXJA 1OFBA 1OVDA 1TV5A 1B57A 2A6NA 1IF2A 3SFKA 1DHPA 3O06A 1EX5A 2BWGA 2QF7A 3L0NA 2GUUA 1GVRA 3IIVA 3RF9A 3TJLA 2BLEA 1WQ5A 4AVFA 2C13A 1VHCA 3GXTA 3GVGA 1ZHAA 3QMSA 1WA3A 2VFDA 1NF0A 1TTJA 4UTJA 3TKFA 3DU0A 2YDAA 4DO5A 4XQ6A 4GBUA 3E49A 1A50A 3EXRA 4JTSA 3NQ2A 4P2VA 2X1TA 2O7QA 5AB3A 2V8ZA 3LV5A 3N2XA 3OBKA 1NFBA 2V2CA 3BG9A 1H62A 4JX6A 1DBTA 3MI2A 1YXCA 4R53A 1GT8A 1O4UA 5HWNA 1VC4A 1Q6LA 1F74A 2Q8LA 1H63A 3KHJA 6TIMA 5IM51 3G0UA 5CSSA 3P80A 2PCQA 1I2OA 3TSDA 4OV9A 1VYPX 1NVMA 5A8GA 3HQ1A 3DH7A 3GNDA 2Y7GA 4S1FA 4MYXA 4JY9A 3C2VA 3C56A 4OBTA 3W1UA 3MP3A 3WJSA 4PC8A 1SUXA 1FCBA 1KFJA 1PHQA 3HOJA 3LCFA 3A23A 1KBIA 3NQCA 3SGZA 4YLWA 5DXXA 1J4EA 1LRNA 1OFDA 5AC6A 3O6DA 2W79A 3GIYA 1D9EA 1TPC1 4Y6GA 4UFLA 1TPEA 2Z1BA 5F2LA 5F4WA 3NL5A 4O57A 3L0GA 1DKWA 1FWRA 2ZQ0A 4O50A 1VYRA 3GR7A 1TPVA 3MP5A 4CCDA 1QDSA 1UASA 2V30A 5EYWA 2C3ZA 4OU1A 3TW6A 3LHVA 1HFBA 1L6SA 1KM5A 5DXYA 3O15A 4WOQA 4MZ1A 3HG4A 4UNLA 3W74A 1PVNA 5D32A 3EWZA 4JTTA 1LLZA 5L9FA 1L2UA 4RR4A 3MYOA 1L6YA 5MHBA 3F03K 3HGSA 1Z48A 1F76A 5DN1A 1BTMA 4A2SA 3TV8A 4HT3A 3GLCA 1N55A 2FJKA 2P1FA 2QUVA 3FFSA 2R8WA 4JX4A 2DZPA 1GTEA 4KKXA 3W9ZA 4O1BA 1VCVA 2ISVA 3T44A 1DQXA 4ZQNA 2VFHA 1MEIA 3TSMA 1M7PA 2E5DA 4JS3A 2VEKA 1QPOA 1WBHA 4K37A 4CQAA 3G1VA 3NL3A 3W7MA 1ICQA 4LW7A 1SZFA 2G5WA 5G4EA 4EF9A 3L65A 5LZLA 1G6CA 3GNNA 3VI2A 2RH9A 4QITA 3N3MA 1NAL1 2P10A 4MPQA 4AWTA 3W1QA 1V7YA 4FNPA 4Y90A 1OX6A 3M5YA 3GAYA 3JS3A 1RD5A 4DELA 3NQFA 4H6KA 1H7RA 3M16A 2Y6ZA 3N73A 1LBLA 3TXVA 2G97A 5CGQA 1EUNA 3NPXA 2AQWA 4JTEA 2NUXA 4MY8A 4Q4KA 3ZWTA 2C1HA 1BEUA 1ZALA 3C2EA 2W6RA 1W31A 4H3DA 4O18A 3P60A 2X1SA 4NXKA 3B03A 1Q6OA 3W7QA 1JQVA 3IVTA 3N2MA 1QPQA 3TMLA 3GXNA 3S1WA 2NV2A 1LTDA 2I1OA 1XUZA 1JCJA 4AWSA 3STCA 2VFEA 1JR1A 4QNEA 3V1PA 1SW0A 2VOMA 1QCWA 2WNQA 1A5SA 2V82A 5I3KA 3LXAA 2ZCGA 5FEPA 3G1YA 1FCVA 4LC6A 3GAKA 3ATZA 2YW3A 1VRDA 3KRZA 3NDOA 4FEZA 1AW5A 2E77A 4N4QA 4O0ZA 1QO2A 3NQDA 1XL9A 1KBJA 2Y89A 1W0MA 1G4EA 2E6DA 4LV4A 5DCEA 4O1CA 1OYCA 4S2CA 4DF2A 3T4CA 1WX0A 3BARA 1SO4A 1TPFA 4RX0A 4BFAA 4N6FA 2NX9A 3NQ8A 3O1NA 3R89A 1N7KA 3DHFA 3F1QA 4ONVA 3WJXA 4PEKA 3BO9A 1K3UA 5K9CA 2V2DA 3N14A 1HTIA 4DXVA 3GXPA 3QW3A 2A5HA 1QPRA 4AF0A 4NNAA 4KWWA 3GKFA 1SPQA 1K8XA 3EXSA 4IXHA 4Z0JA 2OT1A 4E2BA 1Q45A 3O8AA 4IMFA 1EA0A 5J5DA 3EXTA 4GUJA 1ADOA 2WSQA 5C55A 4XWUA 2QUUA 1OFOA 2RKXA 4M5PA 4CNNA 3D0CA 3E96A 4A2RA 1B3OA 3S8HA 1RQHA 1JQXA 5FEZA 1G67A 3PB0A 4JTGA 3FOKA 3NL2A 2WSRA 5J5RA 4MZ8A 3EKLA 3MW7A 3QSRA 4M7TA 3OHIA 2HSAA 1I8JA 3W23A 2RHGA 1KM3A 3B04A 3JR2A 4LVFA 5FEXA 5CZ0A 1EWDA 3I6RA 2FIQA 4UTWA 5AN7A 3UWQA 2C19A 3T40A 1F2JA 3FJLA 5G5IA 1X7FA 4O28A 3FKRA 3TW7A 4CQ9A 5E93A 1LBFA 1VH7A 5CG7A 4PA8A 1B4EA 3BV4A 5TBOA 1ME7A 4KFOA 1Z41A 3CWNA 1KM1A 1W3NA 4IX2A 3WK2A 2GOUA 2W0UA 3CWOX 5HMSA 4IMDA 1ME8A 1KM2A 3B06A 3R2GA 1M7OA 4EWND 3OVPA 1I4NA 5KSWA 3BG5A 4DO6A 3UNDA 2C18A 3PM6A 3VNDA 1UJPA 3P62A 4UTKA 3DFOA 3Q94A 1QOQA 1K7EA 3EWWA 3I7QA 3IGSA 1S5WA 2H6RA 5G1YA 3UWYA 3IGUA 3W71A 2V5LA 1ICPA 4WY0A 3KXQA 4PH6A 2ZA1A 5CSRA 1FUYA 1TO3A 3N19B 2ZRVA 5F2IA 3LXCA 3QQ0A 2OT0A 1PV8A 1OF8A 3W7GA 4CNOA 3P7YA 4MY9A 3CQ0A 1KLZA 1OFEA 3IIPA 5LNUA 3L21A 5DCDA 2ZZ1A 1H1YA 4MJZA 1QFEA 3BGJA 4X22A 4GXMA 4BF9A 4JYFA 4O52A 1YTEA 3A22A 3PBWA 3M5XA 4O8RA 2C14A 3UPWA 5LSMA 1H7NA 4WUIA 3W3OA 1KW1A 2YYUA 1H51A 1OX4B 4O16A 5AFDA 5BNKA 4GRSA 1G7UA 3W6YA 2QJHA 5K9DA 5LNWA 1E51A 4PCFA 4JTJA 4BWLC 1G69A 2VFFA 3YPIA 1EB3A 2B0MA 3W2NA 1GOXA 1Q3NA 3IIZA 1MXSA 3LHZA 2GQ8A 1TPWA 1TIMA 3HGRA 1DL3A 3INPA 5ABTA 4LVBA 1IXPA 3TAOA 2NXHA 5FESA 1K02A 1VCGA 3E12A 1OABA 3S5ZA 3HGJA 1GVFA 5DELA 2V9DA 2X1UA 1W37A 4ZMGA 1KA9F 2YX0A 3G1XA 4LC8A 1EUAA 1YDOA 4B5NA 2EPHA 3WJWA 3E9AA 3NYZA 4JTUA 3CM4A 4QQ3A 5C5YA 3BLIA 2XN2A 4MFDA 3O6CA 4I7WA 3B8DA 1YLVA 2C16A 5BMXA 5K4ZA 4CCCA 2JK2A 4ZVJA 4TX9A 2E6AA 3HBLA 3DFTA 3TQVA 5D04C 2TMDA 5E1QA 1WAUA 2V5BA 2HS6A 5EBUA 3KVMA 4L4LA 3LTPA 1BWLA 3ABRA 3LRLA 2HMCA 2QKFA 5FEWA 1MEHA 2FLIA 2JGQA 1FDYA 2QCCA 1TPUA 5K7JA 3B0PA 2E09A 3LCIA 2JKEA 3VKJA 3QMTA 3OVQA 4NJIA 4A3UA 2TRSA 1MZHA 4UFIA 5IBXC 3PC0A 4RKAA 1K8YA 1YXDA 2GVJA 5EA9A 3F4NA 1FX6A 5CZTA 3TXZA 3SW6A 3MI3A 4J9JA 1TRIA 3PAJA 3S42A 3W70A 3DBPA 2H3BA 3NEVA 4ZL1A 1R2SA 1ML1A 1Z44A 3GDRA 5AYYA 1VQTA 4A21A 4LTSA 3LBMA 3CIWA 1FDZA 3TDFA 4LWWA 2A21A 2PRHA 3HG5A 5AYZA 5G1TA 2BSLA 3RNDA 4JGDA 2NX1A 1AW2A 2OZ0A 1GG1A 4RZ4A 1FWTA 3UWWA 4FNQA 2ZZ2A 4K8EA 4JYDA 4N6EA 4PFMA 4DQWA 3HG3A 3S1UA 3PR2A 3NZRA 4CQ8A 4UUIA 2Q8ZA 3GX9A 4N9BA 5U4NA 3S6DA 3W7JA 3LHUA 2QCNA 3PUDA 1GPWA 2BX7A 4RJEA 3N34A 3VFLA 3P82A 4WZHA 3I7SA 4AEOA 2ISWA 4JR5A 4UFHA 2WO5A 3DKJA 4AB4A 3PULA 3OG3A 1UUOA 5H2ZA 4NQ1A 4TO8A 4ZZ9A 2QDGA 4TIMA 2C6QA 4OE7A 3RLUA 3P74A 1H7WA 1VZWA 4XTDA 1JCLA 4UXDA 3H54A 4U28A 3MYPA 5DY3A 4ORIA 2ZRZA 5TQLA 4MY1A 1XI3A 3THQA 1JCYA 4NUWA 4RXFA 2H8XA 2A1YA 1RPXA 3FYOA 1P0NA 1OFRA 1I2QA 5C2XA 2GQAA 4R33A 4WQ6A 3LCGA 2VC6A 3STFA 1OHLA 3PY2A 3IGXA 3A9IA 2NZLA 3W7KA 1KTBA 3EWUA 1TCDA 1T96A 2DP3A 2X16A 2ZRWA 1LYXA 3GDTA 3W2LA 3CPRA 5FF0A 1TPH1 2NWSA 3MP4A 2TPSA 3A24A 4ZQCA 2GQ9A 3TH6A 1RR2A 2G96A 2ZYFA 4MFEA 1ZNNA 5LGXA 1W5MA 3TMQA 4NJGA 2R94A 4OWGA 3U2OA 5HULA 2E5BA 4LS1A 2JBMA 3GDLA 5U7SA 2YR1A 1VLIA 2YGYA 3FJ6A 1RQBA 1YPIA 2FQIA 2AAMA 4LV9A 3ABQA 2A7NA 3O63A 1M6JA 4GWEA 4XKYB 2A85A 1ALDA 1IXQA 3L67A 1S3HA 2ATMA 4YWIA 4JEQA 4NJHA 2ZZ3A 3PS7A 3L9CA 4Q32A 3CHVA 4FNSA 4KFNA 3C52A 3W1NA 2HTMA 4HNNA 3L5MA 1AG1O 3PBUA 1DJNA 2RFGA 2VKZG 3HPZA 4RZ6A 2R14A 3W22A 2V81A 1F7BA 3DAQA 2Y61A 4BWLA 1HO4A 2C15A 3FYPA 1OK6A 1YDNA 5CPMA 3LI1A 4DF0A 2AGKA 4ZQPA 2DJXA 3B4UA 2Q3OA 1GTHA 1W3TA 1QMLA 4E38A 4PL1A 4N2YA 1KV5A 1XKYA 3M44A 1PCKA 4N4PA 1UUMA 3HB9A 4M6PA 3DI0A 2E1DA 4XTIA 1F73A 3TROA 4Y9AA 5SWUA 5AHLA 4I7VA 2CLLA 3TAKA 2TYSA 2NXIA 5F4XA 3EX4A 2YXGA 1V5XA 4FNUA 2QCFA 2CLIA 1DV7A 3W7OA 1EPXA 2CZEA 2NXGA 1TTIA 3W1LA 4DPQA 3TFXA 3TFCA 3DHDA 2GVGA 4WJEA 2QJGA 4O14A 3NOEA 5H91A 2ABAA 3W1XA 4LVGA 2DZSA 1W5OA 1MO0A 3G8EA 3W73A 5E0KA 3O6YX 2GJLA 2WPBA 3IRDA 1L9WA 4HPXA 1JJKA 1J2WA 3QYQA 4IUOA 4MIMA 3LTYA 4RXGA 1H1ZA 1VPXA 1XBYA 1VS1A 2J9XA 4DPPA 1SSDA 3O05A 1QAPA 4IXXA 3K30A 3VCRA 4QJ1A 4GUFA 4X9SA 3VE7A 3NQEA 4IMEA 3MHUA 3E0IA 4LUJA 1KM6A 3QEZA 4DO4A 2R91A 1KFCA 3GDMA 2ISSA 2E5CA 3QQ1A 2GJNA 4JICA 4L4MA 3PF3A 3C8FA 4O19A 3TA6A 3NPVA 1OYAA 4QM1A 2FB3A 2YW4A 4FX7A 5FF7A 2ALDA 3ZFHA 3DENA 2RDWA 5EY5A 2XFWA 4IWWA 3P8IA 1TB3A 4N9EA 3NG3A 1R30A 1TMHA 4C1LA 1OFAA 4FXRA 4TU1A 2VFGA 4E0CA 5D05A 1S5TA 4AHOA 2QUTA 4GFSA 3W7RA 1OFQA 5CZJA 4O17A 1LDCA 4LT9A 5BOOA 2HS8A 4MLJA 2WKJA 2B7PA 2QDHA 2ZZ6A 4ADSA 1XM3A 3NL6A 2Y63A 4X2RA 4ZQRA 3NNTA 3PUEA 4JIPA 3W88A 5FF4A 3ZWSA 1S5VA 1A5AA 5AHNA 3W2KA 4Z1AA 3HG2A 2DZWA 4HIBA 4GUGA 4XKYA 4FX8A 1Q6RA 1LRTA 2QEZA 4HKPA 5HWMA 3P5ZA 1K8ZA 4K7VA 2YFNA 3HJZA 4JYEA 3TQ0A 3W2UA 1CX9A 3E02A 1VR6A 4HNTA 5AHMA 2OJPA 4A29A 3M0ZA 4ICNA 1EWEA 4O12A 3TE9A 4O11A 3OIXA 3UWVA 2J9ZA 2DZUA 4RV8A 1SZEA 1U5JA 5TIMA 1Z42A 1RV8A 3G8RA 3A5VA 4IPIA 1GYLA 3UWUA 2QCEA 2QCGA 2V2HA 4AF0B 3UXDA 5F1UA 5AHIA 4TR9A 1QWGA 4Z1CA 2J6XA 1OYBA 2CLEA 2EKCA 1UCWA 1KFKA 2QR6A 3RLVA 1LOQA 4OHQA 3KOFA 3P61A 1WOBA 4IMGA 4NU7A 3WJYA 4UMBA 1W56A 2CLFA 3NPUA 4JTHA 1JUEA 4MLRA 1TPDA 3NA8A 2ZZ5A 1G4SA 5D37A 1W5QA 3PSWA 2CFFA 1X8FA 3CT7A 4ORMA 1GVQA 3LLFA 1WBJA 3UPBA 1LP6A 3WK0A 3HMJG 4R7JA 1H7XA 1FCQA 2J27A 5EKYA 3GB6A 4LS0A 3SY5A 4JTKA 1FDJA 1KM4A 5CZSA 4CLMA 5CPNA 1LLWA 3G1SA 1DVJA 2UV8G 4YL2A 2ZDRA 5LHFA 2A6LA 4Y96A 5HNRA 4LUIA 4FNRA 3EWBX 4JDYA 2OX1A 3P84A 1XBZA 3G1FA 5G4WA 4Z1DA 1H7PA 4LOCA 3QW4B 1XCFA 1GYNA 1Q6QA 1F05A 2QCDA 4RK8A 3CIXA 1F6PA 3BW2A 4JIQA 1JCMP 4N9CA 4GJ1A 5K4XA 2CZ5A 1JUKA 5K2ZA 2DORA 3TK7A 2ZRUA 3LDVA 2CU0A 4JNMA 2QAFA 3PG8A 1UBSA 3W87A 1F5ZA 2VEIA 3EEGA 2WNNA 1JCXA 4JY8A 3CTLA 3W7LA 1TREA 4C1KA 4QAIA 1R46A 2WJZA 4OT7A 5A5WA 5D03A 4UMCA 1WV2A 4PTNA 1SZNA 3M43A 1HUVA 1LCOA 1W5PA 3UY7A 4PL2A 4M6QA 4KWVA 2WSYA 1L6WA 2G95A 1GG0A 5KMYA 4U4MA 3I7RA 3C3NA 3I68A 4UMAA 4LY8A 1KV8A 3VE9A 1H50A 3QF0A 1VGAA 4IQLA 4UIOA 3S5OA 4UFMA 3W1PA 3C61A 1O95A 1EP3A 3NZ1A 1VJIA 3WFAA 2X1RA 1H60A 3NQ7A 7TIMA 2FPYA 4MUZA 2E6FA 4K36A 4O53A 1SFLA 3TSBA 1SW7A 3O16A 5HINA 2NX3A 4I7UA 1PS9A 5I3JA 5KZMA 3IIXA 4UTMA 1C9DA 1WYIA 4XBKA 3QPYA 1P1XA 5GVJA 3C6CA 1JULA 2X2GA 1CW2A 4FF7A 3UXAA 3GYEA 5G2HA 3M5VA 1JRCA 3NQMA 3DZ1A 2Y62A 4AHPA 4AH7A 1O60A 2CZDA 4K38A 2H90A 1TYGA 1XDMA 3ABOA 3W85A 3W75A 4POCA 5EMUA 3BW3A 3MJYA 3OVRA 5EL1A 4UTTC 4UTUA 3W72A 3TUUA 2EAWA 1TQJA 3B05A 3EKZA 3GR8A 4FXSA 1OJXA 2Z6JA 2D73A 3SGUA 3R12A 1QPNA 1K7XA 3W84A 3DFSA 1SFJA 1AL7A 1O5XA 3C2RA 4O1DA 4YCOA 4LS2A 3W83A 4DEFA 3MUXA 4UTLA 4FIRA 2H3DA 1RQEA 4XUGA 1M5WA 3L66A 1KTCA 3HF3A 1JUBA 5FF2A 1PE1A 3LRMA 2YPIA 3S1XA 4Z0SA 3GK0A 4O54A 5AOUA 1LOSA 3WK3A 3T7VA 1IXNA 3W7CA 3BLFA 3Q37A 4LU0A 3G22A 1MEWA 4YXGA 3RFAA 3CC1A 4HN4A 3QPZA 1KFLA 3KFTA 3GZ3A 3QZEA 1JRBA 2QCDB 3IIOA 4JTLA 5D2XA 5AYXA 3U6WA 1DJQA 2DZVA 1TJRA 4A22A 3B0VC 5D30A 4UR8A 4O0KA 4EF8A 2FB2A 3KVLA 3LRKA 3W7NA 3MBDA 5DY2A 3FEMA 2PURA 2QCMA 2CLKA 3FA5A 1P5BA 3M1ZA 2VENA 4TMCA 4ZQMA 5AC7A 2DZXA 1TV7A 4YCPA 4TMBA 3S5NA 1NSJA 1YTKA 4UTHA 3TU9A 1LM1A 5BRBA 4MJMA 3TC6A 4EOUA 1D3GA 2B7OA 2CWNA 2KZHA 4OGZA 1ZCOA 2YYTA 1AW1A 3NPWA 2I14A 2CLHA 2ZRXA 2J9YA 3M41A 2O7SA 3S1VA 4JXCA 1C29A 3NQAA 3R8RA 3UD6A 3UYCA 3IVSA 3PB2A 3FIGA 4MOZA 1D3HA 3HIJA 5DBUA 4AXKA 4JD4A 3O07A 4MKNA 3STEA 3S0CA 1GVOA 2ZA3A 4AAJA 2PRMA 1OG0A 2CLOA 1DOSA 2TSYA 1GQNA 4K7YA 3B0UX 2VEMA 3FKKA 4W9TA 2QCLA 1NF7A 5C6MA 3CLMA 2QAPA 3PG9A 1ZAJA 1OFPA 3QMRA 1SO6A 1LOLA 3DFNA 1LORA 1IIHA 1TRDA 3W2JA 3L68A 5F4SA 4ALDA 3QFEA 1SU5A 3SSJA 3UWZA 3SECA 2FTPA 3KRUA 5HQEA 5AHEA 5EPDA 4OQVA 3DI1A 4O10A 3MBFA 1JVNA 3LLDA 1A53A 3W7PA 4LRSA 1K03A 2ZTKA 3W7HA 1T0OA 1XFBA 3G0SA 4ADUA 1PIIA 4FX6M 4FIQA 3GKAA 3G18A 1W5NA 3TQKA 3L5LA 1SSGA 5HUOA 1B9BA 1WDWA 1X1OA 3IV3A 4GC4A 1AK5A 5KZEA 2EHHA 3NQ6A 4XZ9A 4NT0A 3LHWA 3QM3A 1OX4A 4R34A 5D2WA 1H7OA 1FWNA 4AWUA 3TIMA 1YPFA 3N9SA 4UNKA 3STGA 6ALDA 2XN0A 2P0OA 1WOAA 1P4CA 1O94A 5C54A 4YMZA 2Y7FA 4UFJA 2Y88A 1VHNA 1R47A 1TSIA 3H55A 1QNVA 1XUUA 5T26A 3C4UA 4JX5A 4M7SA 2ATSA 3NM3A 4BK9A 2YZRA 5HR6A 1FXQA 5D33A 3LCHA 3LM7A 3NAVA 1XBVA 3ANYA 1R2RA 3I65A 4NZJA 3G1DA 3PVFA 4HNVA 5D2VA 5HWJA 2Y7EA 4RLIA 4K6AA 1OF6A 3MHFA 3CU2A 2IQTA 1K7FA 5F2GA 4O1AA 3W7DA 1YDVA 1SQ7A 3MI6A 1KFBA 4X3ZA 4CCEA 2A4AA 4PODA 3ZR4A 2VELA 3HPSA 1TQXA 1W3IA 1FXPA 3LI0A 2NUWA 3W76A 8TIMA 1CI1A 4LRTA 1TV8A 3EX2A 4M19A 5DLCA 3M6YA 4Z1BA 4UTTA 4WY0B 2LLEA 4HSOA 2H8ZA 3USBA 2F84A 4BI7A 3RMJA 4GNJA 1KFEA 4HPJA 2ZBTA 1FY6A 4XBSA 2NUYA 1JCNA 4FHAA 1GWJA 5I3IA 4RZ5A 1PHWA 3QJAA 4S2BA 2F7FA 1RZMA 2CLMA 2WQPA 3KRSA 1HO1A 1AL8A 3MHGA 4O4VA 1EP1A 3JRKA 3LXBA 3T55A 4ZQOA 3BVJA 3LOTA 1F6KA 1THFD 4NVTA 4HSNA 3TC7A 1VLWA 1ZY9A 2A7PA 3TCEA 3MMTA 2YCEA 4N9DA 5I3HA 4BI6A 2B7QA 3LHTA 3G3DA 3L0KA 3DXIA 4NX0A 1W1ZA 5KITA 1ONRA 1HL2A 3PWAA 5BW6A 1TTQA 3W7IA 2BZNA 4DBEA 3HPXA 3W7EA 4MZYA 2EF9A 3M7WA 5AC8A 3UZJA 1ME9A 2Y85A 2GPTA 2E6YA 4IX0A 3C2OA 3OA3A 4IJBA 5BMWA 4UCGA 3CB8A 1SO3A 3W1RA 4FB7A 1W8SA 5AHFA 4UTIA 5D2YA 2QCHA 4ADTA 4GUHA 3ZS4A 1UB3A 1P0KA 3DFPA 3HO8A 1LROA 1LBMA 3F4WA 3BGGA 1ICSA 2ZA2A 1QR7A 4O15A 3V75A 3TJXA 1ZFJA 2A0NA 3BLEA 4NJKA 2Q3RA 3Q58A 1FWWA 4NNBA 5DBTA 2FDSA 4WOZA 2CZFA 3NQVA 2EGZA 5D09A 2FPTA 4WD0A 4HHPA 4FNTA 3G1AA 1LZOA 1BKSA 1B4KA 3S5YA 3NQGA 1XDLA 1VCFA 4WXZA 4DBDA 1HG3A 1LRQA 3SI9A 2A7RA 1PL9A 1EP2A 3R5EA 5FF3A 4N02A 2VEPA 2YFOA 4K39A 3W1AA 2PE4A 2RDTA 4GE8A 3U8GA 4QISA 2ZZ4A 2J88A 3BPWA 1TJPA 1XC4A 1KLYA 2C0AA 3EB2A 1EEPA 2BXVA 4K8HA 3A21A 3TNOA 1X1ZA 3UY8A 3QRHA 3LX9A 5LNSA 3EWYA 3RK8A 4HNUA 1RVGA 5LHEA 3IEBA 1IXOA 2NLIA 2PC4A 1ZAIA 4P61A 5KTLA 3SZ8A 3WK1A 4DF1A 1TTPA 4O4WA 3W1MA 3PBVA 2WV8A 4IOTA 3KVKA 1BWKA 1PCWA 3LCLA 1A5CA 2JKPA 1FCUA 1I45A 1Y0EA 3BK0A 3DFQA 4IGHA 5D38A 3LBCA 2Z2UA 4NNCA 2JGYA 5L6UA 3A5FA 2NV1A 1FWSA 1XBXA 5LNRA 2DJLA 1I2NA 5IBXA 2DU2A 1QO5A 2Y70A 2JKAA 5KINA 4WX2A 1FQ0A 3AO0A 1DORA 3BW4A 4NJJA 4QIUA 4O13A 3RU6A 1W54A 5I3GA 2E68A 3P67A 1I2RA 2PRLA 2OMAA 4JDBA 1MSSA 4H4IA 4Y8FA 4BR1A 4G1KA 3SIZA 1I2PA 3L2IA 2B7NA 3L5AA 4QNWA 5HJLA 5LGZA 1IIGA 3FS2A 5F2MA 3THAA 4JN6A 3T78A 1NEYA 3LERA 5I3FA 4NXSA 4I9AA 3H53A 5KZDA 1T99A 3LB0A 5G2WA 2Z0IA 4EVZA 3CEUA 2ABBA 3PUOA 4UFKA 5HR7A 4KFPA 1SO5A 2QJIA 3PBYA 4IPJA 3SR7A 4AMAA 1H5YA 4AHQA 1QOPA 3QH2A 3LCXA 3NO5A 3N9RA 3C2FA 1A5BA 2VXNA 1X6UA 1OX5A 4CNPA 2ZRYA 1GEQA 3R13A 1ZENA 1EIXA 2GVLA 1ZJIA 4RCXA 3NR0A 2ZFAA 1XXXA 3P5YA 4LNYA 3HGOA 4BI5A 4UR7A 1DQWA 3C0JA 3W2MA 1N8FA 2WNZA 5D02A 4NX5A 1GZGA 2Y7DA 3LGEA 4D2JA 5CPLA 4FO4A 2I9EA 2WOQA 1R2TA 3Q2DA 3TX9A 3KVJA 3P8JA 5HUPA 3LCWA 3WJZA 1GJPA 1ZAHA 3KX6A 1AMKA 4E2DA 3LHYA 2J24A 1SZGA 3EX3A 3G0XA 3EX1A 3P81A 1SW3A 5FI8A 3M47A 3LV6A 1H61A 2FPVA 2XN1A 3NXFA 2B4GA 3G24A 3FLUA 3EX6A 5D2TA 5DCBA 3G1HA 1IGSA 4JTFA 4NZFA 5CPOA 3OEXA 2NWRA 3M5ZA 3EWXA 2V0TA 4LVAA 3CEPA 2Z6IA 3ELFA 1YXYA 3QSTA 3ABSA 1O5KA 1TPB1 3KAOA 1VYSX
chains in the Genus database with same CATH superfamily
4MVAA 5K3VA 3LTSA 3W1TA 5LNVA 4JKMA 3MO7A 1OK4A 3R8GA 3DYOA 3VGEA 4C1NB 4GC3A 1FBAA 4AQLA 2ESCA 1C8VA 5CKSA 1GVSA 4ATDA 2ZTJA 5CC7A 4S3GA 4LVDA 3LSBA 5A6TC 2RDUA 4EIVA 2ZZ7A 3DKLA 3ZLHA 3MVIA 3DGRA 5K9XA 3VD7A 3KUMA 3QQWA 3B9OA 5G2IA 3SAZA 3MWAA 1J5TA 1T8XA 4GZEA 3PZ9A 1WNOA 2X30A 3WH8A 1WXJA 1TWIA 1OFBA 3TN5A 4C65A 2A6NA 4WIWA 1IF2A 1DHPA 1BWVA 1LL6A 1PIGA 5J04A 4IPPA 2GUUA 2O0TA 2O92A 2V68A 2POTA 4DIAA 3ABXA 3SCRA 4AVFA 5AY7A 1VFLA 1CGVA 3QMSA 1WA3A 1NF0A 3DU0A 4DO5A 1V02E 2EPKX 3EXRA 3PZMA 5A6BA 2X1TA 3VZYA 3D6NA 1ZBWA 4YU1A 3VZZA 4AD4A 1DBTA 1TG7A 3HQOA 4HZ7A 1LQ0A 1Z7AA 4Y9PA 1H63A 1VFMA 6TIMA 4LAMA 5IM51 4N0RA 1I2OA 1XDJA 4DZ5A 1DWGM 1LWJA 1YEYA 3XIMA 1MUCA 5A8GA 1JFHA 4S1FA 1P0EA 4QG9A 3WJSA 5IXEA 4B91A 1PHQA 3S3GA 3WQ6A 3SM0A 2E8YA 2C0HA 1BYDA 4F66A 1EOMA 1GOIA 3M0KA 2BGSA 3TTQA 1JDEA 4Y6GA 1TPEA 1QBBA 5F4WA 2MUCA 1WAWA 1DKWA 4WSKA 1EYEA 3KBVA 3QV7A 1H2JA 4CCDA 1JZ6A 1ZBVA 1UASA 3DFHA 3BJSA 2PDHA 3TW6A 3LHVA 4C6OA 4EKJA 2R24A 3IARA 1L6SA 1KM5A 4MZ1A 3HG4A 3E5PA 1UP2A 4WDUA 1PVNA 1LLZA 5L9FA 2ZUVA 1Q2RA 3HGSA 1A5MC 1F76A 3V5CA 4NAEB 3UEQA 3TV8A 4HT3A 4NZ4A 2ZKMX 1N55A 3LY0A 2P1FA 4OBRA 1FOBA 4XD6A 4C6EA 4S23A 2MNRA 3T44A 1MEIA 1KWGA 5A3HA 3H26A 3ITCA 1IQ8A 4JFVA 3QGVA 3I6EA 3NL3A 2OQLA 3VI2A 4QITA 4NIRA 1MRAA 4MPQA 4IUGA 3W1QA 1KRAC 1V7YA 1W91A 3JS3A 3DN5A 3TLQA 3NQFA 1F9CA 1XICA 1H7RA 3M16A 5JBDA 1EJ7L 1RSCA 1B3XA 1ZBKA 2G97A 4WSHA 2GDUA 3NPXA 3M46A 4CNUA 3HQNA 3V35A 1R87A 4PTMA 4D6DA 3P0XA 1W31A 1UYQA 4GY0A 3B03A 1BF2A 1HVXA 4L4OA 1JQVA 2Y8KA 3TYCA 2HPMA 3TMLA 3F2BA 3S1WA 1NQKA 1LTDA 4GVGA 3GFXA 3C0SA 3STCA 1JR1A 1QJWA 4QNEA 1BTCA 4A6GA 3O0KA 2PD9A 3VIMA 4PMNA 1KKOA 2HK1A 5FEPA 1REQA 3S2JA 4RE0A 1VRDA 3NOYA 4O0ZA 1QO2A 3NQDA 3FXGA 2QUMA 1SGJA 4Q4OA 1KBJA 1W0MA 1G4EA 4IJCA 2E6DA 4LV4A 5DCEA 3VNJA 1OYCA 3L12A 2Z7KA 5E09A 4IGSA 3GC4A 3O1NA 3MANA 1N7KA 3DHFA 3TWBA 1K3UA 4JN8A 4Q4SA 1ZB5A 3N14A 3JW7A 4GGBA 4DXVA 5CQ1A 3GXPA 4IQDA 3S2NA 4W85A 1SPQA 1K8XA 3BH4A 1NM9A 3WD4A 2PSNA 1JNDA 3O8AA 4GISA 4KEMA 5CBBA 5J5DA 3E2SA 3VCNA 3BOFA 2WSQA 3B8UA 3N15A 2JQXA 3QV6A 2QUUA 3F5LA 1DJZA 1I1XA 4M5PA 1FFQA 3GHUA 5FJRA 4MF4A 3SQMA 1RQHA 3S8HA 1IE7C 3NJ3A 1G67A 3K8MA 5AVHA 4GCAA 4W5UA 1OGSA 5E9AA 1YPXA 4B5SA 2HSAA 1CWYA 1KM3A 5D8ZA 3WNKA 1J11A 2FIQA 1KKRA 5AN7A 3UWQA 3WDQA 3FJLA 5G5IA 4O28A 3FKRA 4KW2A 3TW7A 1PWLA 4G5DA 1CGUA 4ECLA 1CXLA 1LT7A 2FGZA 5CG7A 3BV4A 1Q2SA 3DGBA 4IX2A 3WK2A 3E2VA 5HMSA 3UR5A 4IMDA 3B06A 3OVPA 1I4NA 5IDIA 5KSWA 2NW0A 3BG5A 2FZDA 4HYWA 2PDYA 4IP7A 3APYA 3P3BA 1UJPA 1EKOA 3EWWA 1F4AA 2PDIA 5LIKX 2OU4A 1CGTA 1HW6A 1UKPA 2FHFA 1W9PA 7TAAA 2X7VA 1TO3A 4NYYA 4RW5A 1JZ7A 1JYNA 5DANA 5FOOA 3THDA 5E70A 1FHDA 4AFYA 3PJUA 4TX8A 3WLQA 3OHMB 2CERA 3PBWA 3TWAA 3RJXA 3ZLGA 2C14A 4BZYA 2WHMA 8A3HA 2YYUA 4KMQA 1H51A 3S5SA 2ASHA 2BHYA 3ORWA 1G7UA 3WD0A 3EB3A 5LNWA 3UVIA 1E51A 1UR0A 4Q4MA 4QROA 3PN8A 1DJGA 2B0MA 3W2NA 3M0XA 1MXSA 4GGHA 3TJ4A 1TPWA 3V18A 1TIMA 3HGRA 3INPA 2HEJA 2OLAA 3COTA 3REQB 4DWSC 4ES4A 1K02A 1XD1A 3BMWA 1BRLA 2X8RA 1OABA 3KL0A 1VFFA 3C0LA 3BMXA 2X1UA 4H04A 4AX7A 1UH3A 2NVCA 4B5NA 1YDOA 5H8MA 3SCNA 3E9AA 3NGFA 4JTUA 5C5YA 3ITTA 3F4CA 1VFHA 1A0CA 4GY7A 2C16A 5BMXA 2HK0A 3WQDA 4DUOA 4UB9A 2E6AA 3TQVA 3TVAA 2WHLA 5A6AA 5EBUA 4L4LA 1BWLA 3LENA 2O55A 1TZ7A 3GY1A 1MEHA 2FVLA 1FDYA 2QCCA 4ZO8A 4CNTA 3VK5A 4FLSA 5K7JA 1HX0A 2J25A 2FKPA 2JKEA 2OOGA 2TAAA 4A3UA 4HNLA 5IBXC 1DWHM 1EJWC 5AVNA 2QMKA 3ZVIA 5EA9A 1NOUA 3S42A 3W70A 3U5YA 3DBPA 1E0VA 1OZMA 2BOGX 3R7MA 1AD1A 3THUA 3TW9A 2WCGA 5AYYA 1V08A 4HU3A 1FDZA 3VIFA 4LWWA 5AYZA 1A5KC 3BXWA 2Z25A 3HG5A 4IH3A 3I6TA 2BSLA 2C8NA 1E9YB 4JGDA 2NX1A 3RCMA 2OZ0A 1GG1A 3PBMA 1EH9A 2Z24A 2PBOA 4K8EA 1ONEA 4ICMA 4DJFD 3ARQA 1KD0A 1RBLA 4C6JA 3S1UA 3NZRA 4CQ8A 1J79A 3L2LA 2OG9A 3G6MA 4NZ1A 2QGHA 3S6DA 3LHUA 1GPWA 4GMEA 2D20A 3P82A 4QAWA 4AEOA 1H0GA 3WSUA 2WO5A 3DKJA 4PSPA 3PULA 3FEQA 1NTHA 5H2ZA 3M0LA 4NQ1A 4V1XA 2HNHA 4NRSA 4KCUA 4TIMA 2C6QA 3TC3A 1UR4A 3R1ZA 3UBPC 1JCLA 4UXDA 2IXUA 2J6VA 4C6IA 4Z17A 2ZRZA 5DMLA 1NWTA 3V5FA 2E28A 1KR1A 7REQB 1CYGA 2PWGA 1W2PA 3H24A 1EA9C 4MGGA 1CXEA 1MDRA 1P48A 2CIPA 1E6NA 4J5NA 2GQAA 4WQ6A 3MUCA 1OHLA 1A3HA 1UMLA 5FL0A 1ZBCA 4NL1A 1VB9A 3SN4A 1Z69A 1C7TA 2Y4SA 1FWIC 1TVPA 1E71M 2ZRWA 2POZA 1LYXA 1M68A 1YE4A 2PDXA 4HGXA 3GDTA 1M04A 3W2LA 4IL2A 2NWSA 2TPSA 3SCWA 1BXCA 1UA3A 4MFEA 1ZNNA 3T8QA 2GUYA 2Q02A 2VGBA 1G01A 4HPNA 3KTXA 3K2GA 2GQ3A 3A4WA 3ITXA 3AIVA 1NOFA 5HULA 3GDLA 3APGA 4GI4A 2ZVRA 3ABQA 1VEPA 4GWEA 3T05A 3C0QA 2DGAA 4ATWA 2VX5A 4A8RA 1IXQA 3L67A 4YWIA 3TNBA 1UKSA 1VBGA 1OSEA 3GVQA 3R79A 4TXEA 4ZB2A 4LFYA 4AMCA 1J9YA 1XR2A 3IUIA 3BJFA 1RCXB 2VKZG 3EMCA 4RZ6A 3HPZA 2R14A 2V81A 3N12A 3TA9A 4D8LA 4HYVA 4MWAE 3UJRA 4BWLA 2C15A 4S3CA 3PWIA 5CPMA 4J3ZA 4BEUA 2A79A 4AUBA 4R5EA 5BU9A 1V8EA 1UD3A 2UWFA 3VO0A 4LCRA 4HN8A 1T5AA 1Y5XA 3DI0A 2E1DA 2XVPA 2O56A 2WMGA 4PCNA 2VQTA 4GH3A 5F4XA 2ISDA 1HQTA 1PKYA 3S83A 4D72A 1MXGA 5BXSA 1JZ8A 3UJFA 4B5WA 1YKWA 3ARRA 3KCOA 5CJNA 4UQBA 1E4LA 2CZEA 3HURA 4D6GA 3DHDA 2GVGA 3F4DA 1Q13A 3CYJA 3WD2A 2ABAA 4LVGA 1W5OA 2REQA 4KH2A 3G8EA 3WNLA 5E0KA 3O6YX 1XLMA 2GJLA 3DUGA 2PB1A 1J2WA 3QYQA 4IUOA 5LIXX 2J7EA 1KWKA 3ONBA 4KGLA 3AUOA 2J9XA 4YVPA 1SSDA 3N9KA 4FF5A 3VXGA 4DWSD 3AYSA 4GUFA 2VZTA 4X9SA 3NQEA 3HV8A 3EDFA 4B3ZA 3MHUA 3E0IA 1Q8JA 4LUJA 3GDMA 3SDOA 3GHTA 1C8YA 3DEQA 3L4WA 1HVQA 3C8FA 2QPXA 4HPGA 3OTRA 2PUZA 4CN6A 4W4QA 2YLAA 3P8IA 4B90A 4UOQA 1XIHA 5ABGA 2W92A 1S2AA 3PTDA 4OTKA 4H6RA 4JNZA 4S3EA 9RUBA 4PRTA 4QCEA 3W7RA 4DM1A 1AZ2A 3E2QA 2F6UA 2HS8A 2DUZA 2GGJA 4MLJA 2WKJA 4ADSA 1RK5A 2REQB 5FL1A 4ZQRA 2WMIA 3UESA 2VQUA 1XH1A 1UKOA 3EKGA 5IDZA 1S5VA 5AHNA 3ITVA 3FN9A 4PUWA 3K4DA 1K8ZA 1E72M 2PBGA 2PWHA 4PMVA 4K7VA 1BRLB 1J01A 1VR6A 4EAYA 4O12A 4H7VA 3ARYA 4JKLA 4H1ZA 2DZUA 3F5KA 3MZNA 1JFXA 5TIMA 3EOSA 1R38A 2PDJA 4CQDA 3KBSA 3BLOA 1YX1A 4AF0B 4XB3A 2J7FA 5CJMA 2CLEA 1BYBA 5HA7A 1E55A 1NWSA 1JPKA 2EKCA 3FJNA 2YOCA 2DIKA 3FVDA 4WGHA 4GYFA 3P61A 3VKKA 4NZCA 1JZ3A 1SM9A 1TPDA 1B30A 2ZZ5A 1G4SA 5D37A 3AHTA 1W5QA 3EAUA 1KXHA 3CHDA 3PAOA 2CFFA 3I3BA 1L0PA 3LLFA 1E1CA 3UPBA 3WK0A 2WC3A 1H7XA 5FJJA 4LS0A 1KM4A 4HD5A 5CZSA 5CPNA 2XGBA 2ZDRA 2R9RA 1A4LA 3NDYA 1E6QM 4C90A 1UHVA 1EXBA 3EWBX 4AVNA 3VGFA 4JDYA 3ZLFA 4GIRA 1H1NA 3AC0A 3CUGA 1AMYA 4LXFA 3WFLA 1PAMA 2QCDA 3BW2A 4JIQA 1JCMP 4N9CA 2WM0A 5K4XA 3B9NA 5K2ZA 6A3HA 2ZRUA 1TR1A 4JNMA 3BURA 1RCQA 1UBSA 2ZXBA 1KBLA 3EEGA 3GBDA 4JY8A 1TREA 3PTKA 1HJSA 2WJZA 5A5WA 3WLMA 3S9ZA 3T9PA 2VDIA 3FY1A 1WV2A 4PTNA 3LZ3A 2DH3A 3ALGA 1ZJHA 4KWVA 2RJHA 1GG0A 4M51A 4U4MA 3I7RA 3OIHA 1V02A 3GNXA 3LSCA 4EPKA 4RE2A 6REQB 3VNKA 2NV9A 4EWJA 4UIOA 1MYRA 1O95A 4ZODA 3NZ1A 1VJIA 2X1RA 1H60A 1PYFA 4A35A 1J12A 4GVIA 1HJQA 3TSBA 1V0KA 1IEVA 1Q6EA 2OSXA 5ABHA 1JNEA 5KZMA 3IIXA 4N7QA 3ES7A 4UTMA 2G4JA 4FS9A 1H49A 3CZ8A 4B5XA 3V1HA 4NILA 1CW2A 2PDNA 4FF7A 3UXAA 3GYEA 3M5VA 4ZBCA 1JGIA 1TWWA 3PP7A 4JIRA 3P2VA 3PK7A 4C6LA 1ZPTA 4POCA 1BSIA 5EMUA 4ACZA 2HDJA 2OVLA 4GYJA 3W72A 4EANA 3TUUA 2Z29A 4MM1A 3CV1A 4TV6A 3WEZA 2Z6JA 1Q5MA 2OLSA 1QPNA 1K7XA 2WM1A 5DRCA 1SFJA 1W9UA 4O1DA 1FWFC 4DEFA 4LBSA 4FIRA 3VNMA 2H3DA 4PB5A 1HJUA 1KTCA 3N13A 3JUGA 4C60A 3WNMA 3QYSA 3TYBA 1KRBC 3AZRA 3CMFA 4O54A 1LOSA 1W1IE 3BZJA 3WK3A 5I3DA 1IXNA 5GNXA 4KWUA 1UD6A 4YXGA 1XV8A 1EJSC 4PULA 3RFAA 3VUSA 1QNPA 3EWDA 3GTFA 3N2BA 3GZ3A 4KEVA 1GQKA 1JRBA 3AIUA 2IW0A 1DJQA 1TJRA 1CDGA 4GX9A 3UZZA 4RL3A 3CHFA 3KVLA 2J8GA 1UWTA 2CLKA 3WLIA 3I4KA 1ADSA 5A6LA 1H5VA 4W8BA 3MZ2A 3S5NA 1NSJA 1MZRA 3SJNA 4DUXA 4GO8A 2OO6A 3TC6A 1ZCOA 2YYTA 5D9MA 1AW1A 2IS7A 4QJ4B 1PXGA 3NQAA 2OXNA 1OIMA 2OPJA 3UD6A 2P8CA 3SRDA 1AVAA 3H23A 4AXNA 4G7EB 3B0XA 3GUGA 3HIJA 5C2GA 3AISA 4MKNA 1XYFA 3AJ7A 2ZA3A 5HNTA 1OG0A 1PB0A 3B0UX 3UCQA 1UZ1A 2VEMA 3FKKA 4J3XA 3U9IA 3CLMA 4Y9MA 3DFNA 1LORA 1P7TA 4ILSA 1C93A 1GONA 3LA4A 1YE6A 1IIHA 5F4SA 3QFEA 1SU5A 2Z1XA 4S3JA 3SSJA 1IR2A 1Q6DA 1DIOA 2FTPA 3KRUA 2CC0A 5EPDA 5FJIA 3NDZA 3LLDA 1A53A 4KWOA 3AS3A 4DZAA 2R1PA 1QHPA 1US0A 3UXKA 1SZRA 3AMCA 3W7HA 1FH7A 2GJXB 4ZR8A 1XFBA 5H8UA 3W28A 1K9DA 2E67A 4ADUA 2XFRA 4FX6M 4MADA 4MNJA 2DY3A 1W5NA 4MSSA 1M53A 4DHGA 1SSGA 2D1ZA 4PTWA 4Z42C 3OZYA 4WCJA 4GC4A 3HN3A 1AK5A 5KZEA 2VC7A 5HANA 3L4YA 3NQ6A 4H8UA 1DWAM 3N2TA 4W84A 4XZ9A 1B1YA 3AS1A 2BBFA 4R34A 3LYEA 4AIUA 4AWUA 3H2OA 5FSEC 3STGA 5DEZA 2XN0A 4HSHA 3NURA 3CK5A 4JQ2A 1CCWB 5ABEA 1BSLA 4PMOA 1TSIA 1XX1A 3GQYA 1XUUA 5T26A 2ZX8A 4LQ1A 3MSDA 1CGXA 2YZRA 4D71A 2FZ8A 1ZJBA 3NAVA 4L6OA 3AOFA 2O9RA 3ANVA 3ANYA 3I65A 1C8QA 3PVFA 3QY8A 5D2VA 5HWJA 2MANA 4H41A 2BV9A 5CG0A 1AH0A 3MHFA 4J3SA 2IQTA 1K7FA 3W7DA 4DWSB 3T08A 2I56A 4PODA 3HPSA 1E6SM 3GG7A 1DWFM 1W3IA 4I6VA 3L4UA 5HPCA 4L4PA 2NUWA 1F4HA 4C7DA 2NSOA 4FP1A 2XIIA 2LLEA 4L64A 2ZBTA 4PR4A 5ECVA 1GWJA 1PTDA 1XYCA 4H2CA 4CNSA 5HK4A 4S2BA 2F7FA 1RZMA 2WQPA 3KRSA 2XIBA 4ZE4A 1EP1A 3JRKA 3N6QA 2E0PA 1RA5A 2XM2A 1O6IA 5E5CA 1PX4A 4PUKA 4J3UA 2OWWA 4XZWA 3WLSA 1AQMA 3PWAA 3UXLA 1YNYA 4QE4A 3TEVA 1ZQ5A 4DBEA 2AQVA 4GHRA 3DFYA 3HPXA 1J6OA 5XIAA 3EZ4A 1D2KA 3UZJA 3CLWA 2E6YA 5JXQA 2XUCA 3OPSA 3O2LA 1W1B1 1J8VA 3CB8A 1DP0A 1R3TA 1DEDA 3HFTA 3AWNA 4MNMA 1SJBA 3V0SA 3HQPA 5AZ1A 3CH0A 4O15A 1VBUA 3OGRA 1ZFJA 2A0NA 3CL8A 3BLEA 3ZXWA 3BLLA 1UA7A 4NNBA 2IQ0A 2FDSA 4Q8TA 4QLJA 2YDSA 1EJRC 4I5UA 2YL9A 3RLHA 2EXOA 4AY1A 3CYVA 1RD6A 1BKSA 3N4EA 3NQGA 1XDLA 4TVDA 4LYQA 1GHSA 4P8XA 4WXZA 1QT1A 2AOSA 1HG3A 1LRQA 4HB7A 1F61A 1M1BA 1EP2A 3R5EA 2VEPA 3W1AA 2QIWA 4GIAA 3U8GA 2ZZ4A 3QKEA 4HZ8A 2ACRA 1TJPA 1XC4A 5I6SA 1EC9A 1KLYA 4U31A 1EEPA 2BGNE 1J0ZA 2AMGA 4K8HA 3TNOA 1J0JA 1RLDA 3A21A 1ONXA 3QRHA 4JCMA 4HNUA 3IEBA 1L8PA 1WXYA 4GQ0A 1XSIA 4IPNB 2PC4A 1GZJA 4P61A 1NJJA 8XIAA 4A3HA 4NY2A 1EC7A 1EJXC 1TTPA 1N2VA 3UCDA 7PTDA 3P6LA 1A5CA 1VEMA 2JKPA 1I45A 1BVZA 3DFQA 2VUYA 3A9BA 1WZAA 1QO5A 3IPWA 2JKAA 5KINA 3UWEA 5DMYA 4PMQA 4QE5A 1VPYA 1YBQA 3FW6A 3BGAA 1A0EA 4NJJA 4QIUA 3RU6A 4DLMA 1W54A 4JQAA 1D3CA 2YBTA 3SB0A 4BR1A 4G1KA 3L5AA 4J3VA 2FZMA 3FS2A 4FOJA 4PUUA 3N6JA 1HN1A 2BY1A 4HZMA 3THAA 3S1GA 3VCCA 1NEYA 5I3FA 4NSBA 1TE6A 1UBPC 3H53A 5EBAA 3MCOA 3AUJA 2Y2WA 2PWEA 4EVZA 1OB0A 4WDXA 3PBGA 5HR7A 4DY1A 2QJIA 1GKQA 8XIMA 3OBAA 4S3AA 4AMAA 1EEXA 3R58A 3RO6A 1QOPA 2VVSA 3CQHA 4B3LA 3NO5A 3DERA 3KDNA 4NRRA 4AY7A 4AD1A 5EGRA 1OX5A 2ZRYA 1GEQA 3DX5A 4RCXA 3U7BA 4GNKB 2FTWA 2QV4A 2O9TA 3NR0A 2PGRA 2ZFAA 2G3MA 3P5YA 2PAJA 3O3RA 2DIJA 3QKZA 4UR7A 3IJLA 3C0JA 3T0TA 4NX5A 3ZJ7A 2Y7DA 3LGEA 1YNPA 4D2JA 5CPLA 5FJUA 2D0HA 1DIKA 4S39A 4MWAD 3UJ2A 4Y7EA 3P8JA 3PZQA 3WJZA 3LCWA 1A5UA 3LHYA 1VENA 3LEPA 1SZGA 3DHUA 4GPNA 5A95A 2O9PA 3G0XA 5ECUA 5T9BG 5FCZA 5FI8A 2G41A 3CUZA 1XRVA 2VI0A 4GOAA 1JG9A 1H61A 2FPVA 2XN1A 3NXFA 3G24A 4FALA 5A2BA 2NQHA 5D2TA 5DCBA 4F79A 4NZFA 1JPHA 2JEPA 3IACA 2NWRA 3W4RA 4F40A 2F38A 3B8SA 4LVAA 4F0MA 1TV2A 2IKHA 1UROA 1TPB1 1R9ZA 3CS2A 3NGJA 2VWTA 2OCZA 3NZGA 3SGGA 3NM1A 3S9YA 1KFWA 3SEPA 1DXIA 2NQ5A 1YADA 4JIEA 1ZUAX 4DJEC 3KBMA 3IVUA 1R3VA 4Q33A 3GDKA 4NI3A 2C1IA 3T2QA 3ERPA 4JTIA 1DIEA 1V6VA 1KBKA 3H2AA 3WBYA 1SR9A 3S2CA 3UZ5A 2FVKA 3PSVA 4Z08A 2PLKA 4QSHA 1S3TC 3DYMA 4ZOBA 2VVNA 4HMEA 1XYBA 1B57A 4F2BA 4LSBA 1KR0A 1Z89A 4Q8PA 3SFKA 4DBSA 2DQWA 5JBEA 2BWGA 2QF7A 2VEGA 3L0NA 3M0YA 3TZNA 1P0DA 1M65A 3MQTA 1XF0A 1VJSA 3IIVA 3TJLA 2XH7A 4UQEA 2C13A 1GZ1A 5C9UA 2QGYA 2HBVA 1NDWA 4Y9OA 1WKEA 2VFDA 2DT1A 3KOYA 4GBUA 2G3JA 3E49A 2CHOA 3MC5A 3NQ2A 4C6FA 3LV5A 2AAAA 3T2OA 2V2CA 3ARUA 3BG9A 4ACYA 1VC4A 2D69A 1Q6LA 1F74A 3IJ9A 3WLPA 2QLYA 1ISXA 3PFRA 3UA4A 4HJWA 3KHJA 5CSSA 5HNUA 5CPTA 5BXRA 3TSDA 4GIYA 1NVMA 5ABFA 1XQLA 3HQ1A 3VD9A 3GNDA 2Y7GA 2HBXA 2XGIA 3MP3A 1M41A 1GKRA 2HWGA 3OGSA 3NQCA 3SGZA 1AH4A 4W7UA 4GK8A 3ENLA 1LRNA 1BHGA 5EMLA 4R88A 3GIYA 1TPC1 3MTWA 5DMNA 1QU4A 2Z1BA 3NL5A 2P3ZA 1VFOA 4IJRA 4W88A 2VURA 3GYCA 3MP5A 1TPVA 4HZ6A 1QDSA 5CAKA 1HFBA 4MWAC 3O15A 2IPWA 4P7NA 1JPDX 3FGCA 4UNLA 2A3HA 3W74A 5CC6A 5M2FX 3L4TA 1CB2A 4PB3A 4JAWA 5MHBA 2Z7GA 4A2SA 4OZOA 3GLCA 3POHA 1UWQA 2FJKA 1GNXA 1N8IA 3FFSA 2OWCA 2DZPA 1QW9A 1GTEA 3RCNA 3T0DA 5EMYA 1ZP4A 1M7PA 4ENLA 4D6JA 2E5DA 4JS3A 4GACA 3NZPA 1RY0A 3M64A 4W87A 4CQAA 1AFSA 4NP7A 1ICQA 1E0TA 3AROA 4LW7A 5G4EA 3GNNA 5I24A 1NAL1 2ZWYA 3QGKC 3AU6A 2D0GA 4FNPA 3Q67A 3H70A 3BUVA 3OYXA 3EGJA 4DBWA 1LBLA 1EUNA 2AQWA 4GG9A 4Q4KA 4QEEA 1DTNA 1IV8A 3CZKA 3QHOA 3RX2A 3ZWTA 2C1HA 4FZIA 2W6RA 3G2GA 4ROQA 1JF6A 2X1SA 2I7GA 2PS2A 5KEZA 3N2MA 1QPQA 1ZTVA 2NV2A 2NT1A 2I1OA 1XUZA 3H2MA 2PEVA 1GKPA 2VFEA 2R6OA 3V1PA 3KHDA 1SW0A 2ZE0A 2VOMA 1Q7QA 3LXAA 2ZCGA 5MKGB 3G1YA 1FCVA 2I5IA 3DIPA 4IIHA 2YW3A 1IT8A 3EA1A 4GZIA 2FH8A 4I90A 3NDOA 4N4QA 3L4XA 3W24A 3L2MA 4GJIA 4H6EA 4RDWA 3PANA 1ITXA 5BU6A 3T4CA 1WX0A 4JHOA 3VABA 1QNRA 2BHZA 4BFAA 3NQ8A 4D1JA 3R89A 3P14A 3WJXA 5K9CA 3WD3A 2VDHA 3V3WA 4CCZA 3VMPA 3PJXA 4YIWA 3QW3A 4S38A 4AF0A 3CZLA 1XLFA 2XG9A 4L56A 3EXSA 3C3UA 2OT1A 2XIQA 3CJPA 3R6IA 4IMFA 1EA0A 1UW9A 3OYZA 3ZYZA 1E73M 3GBEA 3PZIA 3Q65A 3PJTA 1ADOA 1EO7A 2XIOA 3S2LA 4AZ5A 4CNNA 3R0KA 5I79A 3E96A 4A2RA 4B2DD 4URIA 1AH3A 2QHAA 4I9JA 2G50A 4JTGA 1A49A 3UGRA 5J5RA 4H9VA 4DJED 3QSRA 3OZOA 1OQFA 3OHIA 4MAZA 4RDVA 2EEXA 2QVHA 1LUCA 3IGHX 1F07A 3JR2A 1Q6GA 1UG6A 3H21A 3QN3A 3I6RA 1W8GA 3R11A 3VAVA 1X7FA 4YTRA 1UR3M 1X7IA 3DDMA 1W3LA 5E93A 3N6HA 4WSJA 1Z41A 3CWNA 4YVVA 1W3NA 4IT1A 1HXJA 4Q6JA 4WDTA 3R4IA 1FP8A 1NWRA 3R2GA 1M7OA 3CWHA 4EWND 2D24A 3VKCA 2VR5A 4DO6A 3UNDA 3EDEA 4J35A 3QOMA 3VNDA 3GZAA 1QNOA 2NQLA 2XVNA 3PZOA 3I7QA 2VNCA 5A8OA 1M01A 1JEZA 1S5WA 5G1YA 3VKBA 3W71A 3WF1A 4XAPA 4L9YA 4WY0A 3BLDA 3CQKA 4UBPC 3N19B 2ZRVA 2D2HA 2IKIA 3ARXA 3QQ0A 3RMEA 1PV8A 1OF8A 3OG2A 4M56A 3P7YA 1BVWA 1KLZA 3GXIA 4LGXA 3WBEA 4MHBA 5LNUA 1H1YA 3MS8A 1QFEA 1R6WA 4GXMA 4JYFA 4HCLA 3WENA 2G8ZA 4O8RA 2IKGA 3UPWA 4WUIA 2C91A 4LX4A 3W3OA 1FWCC 1KW1A 3E0WA 4QDPA 3IK2A 3VINA 1OX4B 5BNKA 4GBDA 4M1BA 3KEHA 3W6YA 3VIGA 4AVOA 1CGWA 1UUQA 4RPQA 1JPMA 4GVHA 1NELA 1IXPA 3QR3A 2NXHA 1XCXA 3E12A 3PPHA 4C6PA 3B8WA 2F61A 1IT0A 2J13A 1PDZA 2F6XA 4P8WA 3ZSTA 3M0JA 1V79A 2V9DA 3D3FA 5A8PA 4ZMGA 2F9RA 4ML4A 3U2EA 2EPHA 5CC3A 3WJWA 1S39A 5C8BB 3CM4A 4PTXA 4QQ3A 3UZXA 3WUGA 3BLIA 1HJWA 2XN2A 2YL5A 4Q3MA 4HK6A 3WUBA 4I7WA 1YLVA 2PLMA 3OVGA 1Z32X 3L4ZA 4D9PA 4KCTA 3E3HA 1JYWA 2W62A 3UW6A 2EG8A 4DXKA 1MNZA 1X8CA 3LRLA 1XIEA 1UJQA 2EPOA 1BQGA 1XLIA 5FEWA 3VA8A 3J7HA 5ABFB 5H8PA 1AQ0A 5D4YA 4WEVX 1F3XA 1TPUA 4XV0A 3B0PA 5D8WA 1RCOB 3QMTA 4NJIA 2TRSA 1HKJA 1MZHA 1TZ9A 3VX0A 2DEPA 3LUTA 2PLCA 2ZX9A 2X0YA 4OFCA 1YXDA 2GVJA 4HTYA 1EJVC 4J9JA 2NSXA 1TX2A 2G3IA 1TUFA 3IAQA 1UIPA 2D22A 3LBMA 1MW0A 4IFKB 2PRHA 2YXXA 1C92A 2GFTA 4Q6XA 1XIIA 4XZNX 3OODA 4E8CA 4DUVA 3WQEA 3GU9A 3UWWA 3CAWA 2XH4A 3EOEA 2Q71A 1VBJA 2CPUA 4JYDA 1W1TA 4AZCA 4GKTA 3PR2A 3S2MA 1XWYA 1QVBA 4P7RA 1UWIA 4KRZA 4RJEA 3BTNA 4PMJA 4QDMA 2HVNA 4Z2KA 3RR1A 1IEQA 3H2FA 4J2PA 1LWIA 4JEJA 5GPRA 4AZ6A 4CQBA 5FD0A 1QATA 2QDGA 4OE7A 4BQ5A 5C71A 4JOMA 2X2YA 4HOWA 3IJQA 3UETA 3P74A 1CT5A 1H7WA 4XD4A 4JHZA 4IZGA 4QP0A 1RA0A 2P5NA 2GZXA 3KL3A 3H54A 4U28A 2GJPA 2R1KA 3MYPA 3U7VA 2YCIX 2HNEA 4KBXA 2OKTA 5TQLA 1GEHA 3IWPA 4RXFA 1Q63A 1I2QA 3TN6A 3QR0A 2BY0A 1P7TB 4R33A 5FJOA 3FCPA 3OP2A 2VC6A 1G9HA 3IGXA 4E3VA 5A8NA 3MMUA 1LT8A 1JYVA 2PGWA 1KTBA 2YKKA 1HIZA 1TCDA 2G37A 1T96A 2X16A 3GG8A 3B40A 2VCBA 3CL7A 4HNCA 4HVXA 4IP4A 4UQCA 4D6EA 1C9WA 5LA1A 4LUTA 3CO4A 1W5MA 3RX4A 2R94A 4OWGA 3U2OA 1RBAA 5LYRA 3GDBA 2YGYA 1RQBA 3EOUA 1YPIA 2FQIA 2AAMA 3UT0A 1T6MA 1RALA 3A4XA 3O63A 1QNSA 1T41A 4XKYB 2A85A 5E9XA 1ALDA 4GI8A 2DT3A 3KLKA 4DN1A 1NDYA 5A94A 1DXEA 1LQ2A 2OYKA 4DZHA 1IWPA 2UBPC 1U1JA 1DWIM 1W9DM 2W61A 1V4YA 3C52A 3WG6A 2HTMA 3OQ8A 3L5MA 4YWSA 3PBUA 3W22A 3WMCA 4AU0A 3DAQA 2Y61A 4XIMA 1LUCB 1P6CA 3GO2A 1O12A 1HO4A 4ZA0A 1OK6A 1ADDA 1YDNA 1XCWA 3F7JA 4RDZA 3LI1A 2RGMA 2G3NA 4ZOEA 1W3TA 1QMLA 4MKSA 2VDGA 4ZENA 1SJAA 4PE8A 4E38A 1UP0A 4I8YA 4PL1A 4N2YA 1XKYA 2JF6A 2XIJA 3MT1A 3M44A 1CLXA 1KXTA 1CXFA 2QNEA 4XTIA 4QR6A 1UQYA 1F73A 3M0VA 2X05A 2DFAA 3GHSA 1FWAC 4OUEA 2CLLA 3W25A 4U33A 2WSKA 3H8AA 1V5XA 1UH4A 3LBOA 4IIBA 2HXTA 4B9YA 2CLIA 3RG6A 2X7WA 4ZO7A 4MUPA 5B80A 3TFXA 4ZO9A 1E1CB 1KO0A 5FSDC 1E4MM 4O14A 5H91A 3UXIA 1R3WA 3W1XA 1XIDA 1YNQA 3W73A 3WX7A 1E0XA 3IRDA 2VGIA 1ITUA 4M0XA 1XLDA 1RJRA 3RLGA 1E9IA 1VPXA 1XBYA 3VYLA 3D5HA 4DPPA 4JPGA 4MMWA 1QAPA 4QJ1A 4CKQA 4CVWA 1SFTA 5KZ6A 3KZSA 4IMEA 5BROA 2ALRA 2FGLA 4GZ7A 2GUBA 4RDYA 5T8GA 3DBNA 3A6OA 4A8LA 4Q7IA 2WBGA 1OYAA 4QTGA 5E0FA 2ALDA 3DENA 1LJYA 2WVVB 4IWWA 1VFTA 4C5YA 1UD4A 4QGCA 1KCLA 4PMYA 1TB3A 4F0HA 3N3TA 4FXRA 1EDGA 5HMEA 4JFWA 4AHOA 4ZFCA 3S46A 3FK4A 2DSVA 5CZJA 1IZCA 3M0IA 5BOOA 2ZC1A 2BG5A 3IJ8A 2B7PA 2QDHA 3BJTA 2Y5SA 2Y63A 4EAMA 4X2RA 1I9CB 3EOOA 3U2ZA 3T0BA 3LS9A 4JIPA 3W88A 4P5UA 4GD0A 1A5AA 3W2KA 2C71A 4REQB 4FX8A 1CENA 7ODCA 3EPMA 1O1ZA 1JD9A 1MVYA 3T2PA 4AD5A 3WLRA 3P5ZA 1KNWA 1JIBA 5FAGA 2JE8A 2YFNA 9CGTA 2XGZA 4H9MA 1CX9A 2W63A 4HNTA 4A29A 3GU2A 2WC4A 4MB5A 1GOMA 1EWEA 1VFSA 3GC2A 4O11A 3TE9A 3UWVA 3VDBA 2J9ZA 4RV8A 3A3WA 1U5JA 5CC5A 1OBAA 4KQNA 4M80A 1RV8A 3Q45A 4IPIA 4QFUA 3UWUA 2VCAA 3USZA 2QCGA 4TR9A 1QWGA 2J6XA 3WDJA 2QT3A 3WFZA 3ZOAA 4JL2A 4ZTXA 2W27A 1UCWA 1C3FA 3RLVA 2PPGA 1LOQA 5IFTA 4UOZA 3UU0A 4OHQA 4V2XA 3VZXA 3RR4A 1X38A 2GVEA 4JTHA 4I8DA 4REQA 4UR9A 4B4HA 1OY0A 1XG4A 2CKRA 1VBHA 3H4GA 3NQBA 4G9PA 5M03A 1QI3A 1X8FA 3CT7A 4ORMA 5C9RA 3GSMA 2FFIA 7REQA 4BY3A 4FK9A 3HMJG 1AUSL 4HPHA 3BDKA 4R7JA 1OCQA 1WO2A 4JTKA 3AXKA 3OLGA 4XD3A 5JIWA 2UV8G 4Z1YA 2YL6A 4ZO6A 2QYGA 4G2DA 2BVDA 4X61A 4NYUA 4XZMX 1XBZA 4Z2HA 2PP1A 4XZBA 4Z1DA 3LPOA 3QW4B 1F3EA 5BXTA 1GYNA 1Q6QA 1F05A 3CIXA 2XWDA 4NHVA 1F6PA 4L65A 2PC8A 1XH2A 4L6DA 1JUKA 4LBUA 4BQ2A 4IF2A 5C9WA 1RP9A 3LDVA 2PGFA 3PG8A 3KCJA 1F5ZA 2WNNA 2GYIA 2HVMA 4GFIA 4QAIA 1R46A 4OT7A 3TCSA 3A4JA 3NUKA 7ENLA 2WVUA 2YDRA 4QJ3B 5CZKA 2WZHA 1FRBA 4UMCA 1HJVA 3UY7A 2BOFX 1ELSA 2X42A 3UF9A 2ZIDA 3RXZA 4G7FA 4YHEA 1R3RA 2QV5A 2ZX6A 4LY8A 4B2DA 5EFFA 1F3WA 4IQLA 3W27A 1Y5WA 3GTNA 4UFMA 3W1PA 3PNZA 6CGTA 3WFAA 5CLTA 1YW1A 1XLBA 4K36A 4N42A 5DMMA 3AHXA 2OYLA 2PDQA 2Q6ZA 4AZIA 2WJFA 4D6FA 5H6HA 1C90A 3W53A 3OGVA 4LY4A 3LGGA 1MUMA 5G2HA 2QULA 1U1HA 2CZDA 3ABOA 1TYGA 3VIIA 1XSJA 3PHAA 3W85A 2L5HA 3W75A 3BW3A 3MJYA 4UTUA 2BGQA 1PBGA 1H41A 2UY2A 1TQJA 3EKZA 3LK6A 4FXSA 1FHUA 4KETA 5IHRA 1GPFA 2E9MA 3HZ3A 2GSJA 3SCTA 3R12A 3TTSA 3W84A 3LG3A 1HF6A 4M24A 4CU7A 5C9ZA 5B7YA 1O5XA 4LS2A 5A69A 3KLLA 5LA2A 3UR8A 5A2AA 4G8TA 1UWAA 1PE1A 3W6MA 1UIOA 4Z0SA 2GDVA 4W86A 3FSUA 2OEKA 3VIKA 1JAEA 3T7VA 4NAFB 2VCCA 1R0MA 1MEWA 3GG1A 4OOUA 2O9OA 3QY7A 1UR1A 3KFTA 8RUCA 3VX1A 5CPQA 4YJ5A 3EDKA 2DZVA 3LPGA 1E9LA 4E2OA 3CMGA 4O0KA 3W7NA 3RIKA 1B31A 2J77A 2PURA 4YHGA 4UQAA 4I6KA 2VENA 3ANUA 5AC7A 1WZMA 4YCPA 4TMBA 4PMRA 2EPLX 1YTKA 4UTHA 4MJ4A 1W3KA 3TU9A 4TTGA 5BRBA 4X60A 1D3GA 1POKA 2CWNA 4RNJA 2KZHA 4OGZA 2D0FA 4PBGA 2EJ1A 2OR2A 3NPWA 3G1RA 4I5XA 2J9YA 3M41A 2O7SA 4LF1A 1ZLPA 4JXCA 1XLGA 5AYIA 1B3VA 1JDCA 3BSHA 3QGAC 3IVSA 2PI6A 1D3HA 1ITCA 3ARSA 4AXKA 2V5JA 1A3XA 1X39A 4U2ZA 3STEA 3DC0A 2IPGA 4QRNA 4ZCWA 1GQNA 1HGWA 3GXMA 1J0IA 1EZ2A 4Z2IA 2ACUA 1YDYA 4A3QA 1RBOB 4ALDA 3UWZA 2ZE3A 4CQCA 2XVKA 1KGXA 1BFNA 1QWKA 2PDWA 2WYSA 3GR4A 2KAUC 1RY8A 3W7PA 2ZTKA 3SQSA 3G0SA 4FIQA 4S3KA 1R3YA 3CGTA 3L5LA 2V3EA 4QHRA 1P6BA 4F3HA 4CEUC 1NQ6A 1A5NC 4NT0A 3LHWA 3QM3A 2PDPA 5D2WA 3SCSA 1HJXA 3TIMA 4UNKA 1UMYA 4AEFA 4DJDA 4GH1A 2P0OA 3VC6A 1O94A 1BKHA 1ZSXA 3GD6A 3H55A 1W32A 4QS6A 2ATSA 2VZSA 4MB1A 5HR6A 4I9MA 1U1UA 3LM7A 1S1RA 4QG8A 1XBVA 1R2RA 4NZJA 4HNVA 1GVEA 1MFVA 3LD5A 4GYPC 2A3AA 4RLIA 3CU2A 2O4MA 4JFTA 5F2GA 4EXQA 1YDVA 1KFBA 2QUNA 4R9XA 2P50A 1JDAA 3WH7A 4HTBA 1TQXA 1L6GA 4YVXA 2WAGA 4HQVA 1N82A 3W76A 4GABA 5A8QA 4M19A 4J3WA 2H8ZA 2F84A 5FJPA 3MY9A 4BI7A 3RMJA 4GNJA 1KFEA 4L1GA 1NY1A 3EYPA 3MMWA 4CD5A 1XRFA 4DYEA 4L1XA 1D7KA 4H8VA 4AC1X 3LQLA 1LG2A 4IPLA 3WQWA 4DBUA 2A3LA 4ZQOA 1RJQA 1WKFA 3URAA 1XISA 4H9XA 3TC7A 3EPOA 1VLWA 2A7PA 3MMTA 2YCEA 5I3HA 4GYKA 2B7QA 3LHTA 4BI6A 4DB7A 1UD8A 2WHJA 3L0KA 3DXIA 1IWBA 3VGBA 5KITA 1ONRA 5BW6A 4H7ZA 1CECA 1AQFA 3W7IA 2BZNA 3C86A 3L4VA 5LIYX 3W7EA 2EF9A 3VKDA 4GA8A 1J5SA 2VM8A 3FA3A 1PDYA 2WC7A 3W82A 4IJBA 2WWCA 5BMWA 4HOXA 5LXXA 1SO3A 3ITLA 3W1RA 4UTIA 5D2YA 3VNLA 1P0KA 3P0WA 1VJZA 3HO8A 1LBMA 3F4WA 4C5ZA 1VKFA 1QR7A 3BOXA 3V75A 3TJXA 1TELA 3H7UA 4NJKA 4ZGYA 2Q3RA 1FWWA 1V3IA 3WQ8A 3NQVA 1AA1B 3IJIA 3MKKA 2EGZA 4WD0A 3EEZA 1JDFA 3NO1A 3G1AA 1L2QA 4IG2B 1GOQA 5AZ0A 1DJIA 2OWXA 3E5BA 2GSHA 4N02A 2YFOA 2PE4A 2RDTA 2WJDA 4Z2GA 4GE8A 2WZTA 5LIUX 3BPWA 4YYCA 2WMHA 4C6DA 2C0AA 4Z2JA 3IAPA 4US5D 3ZJKA 3WELA 2BXVA 3AS0A 1X1ZA 3GVRA 4DJDC 1B3WA 1RVGA 3PTMA 4FA3A 5I23A 1ZAIA 3WK1A 3WD1A 3W1MA 3NZQA 2WV8A 2BMBA 4IOTA 3KVKA 1BWKA 3K13A 5CBJA 3BK0A 2YA0A 5D38A 3LBCA 2Z2UA 1C91A 1FWSA 1XBXA 4UTFA 4DJFC 1I2NA 3SN1A 1EIBA 2CBUA 3FDKA 4WX2A 2ZOXA 4C7FA 2NQJA 1XH0A 5I3GA 3P67A 1I2RA 2OMAA 5J8LA 4LJ3A 1GCYA 4Y8FA 5H1WA 1SYTA 2B7NA 4QNWA 1BGGA 1TWDA 1IIGA 5LGZA 4XX6A 4ERIA 2IKJA 1PZ1A 1T99A 5C7VA 5G2WA 1RK6A 2PDGA 3KL5A 3CEUA 3PUOA 4UFKA 3MU7A 1TCMA 4H8NA 4IPJA 3KE0A 2NQ9A 5I7GA 1H5YA 4AHQA 1IEXA 3M0HA 1VEOA 1OC7A 2SFPA 3AXIA 3U0HA 4IIGA 1PX8A 2F2KA 3CHCA 3HA1A 3LCXA 2YBVA 3BCJA 1EYWA 2OB3A 3CV7A 3ZT5A 4CNPA 3ABZA 3BCDA 1GOOA 4WJXA 3TLLA 1EIXA 4ZFMA 5D9PA 1MMFA 3FJ4A 1CLKA 1QPKA 1W17A 2WNZA 4W8AA 3QVQA 2ZXQA 2WW5A 4DUWA 2I9EA 3CZJA 3Q2DA 1R2TA 3TX9A 4XISA 4IM4A 2PLJA 1ODZA 3KX6A 3AMGA 3LMYA 4GXPA 2DV0A 4DM2A 4L9XA 3TTYA 2WSPA 4IIDA 1MW1A 3M47A 2XH2A 3L23A 4ZE5A 2DVXA 2YXOA 2UY4A 3FLUA 5CPOA 4ICCX 3G1HA 3NVDA 1E1FA 1GJUA 2E25A 3WMBA 1SMAA 3B9DA 1UWSA 4H9UA 1TV3A 4FLRA 2O4QA 3VIJA 4PUMA 2Z6IA 2GGIA 3A3HA 1DJXA 3ELFA 3POCA 3RAOA 1JI1A 4XSMA 3RM4A 3SRKA 4UC5A 2CW6A 4MYAA 3M9YA 4CU6A 2FFCA 3WLJA 1KTNA 2A2IA 1O68A 4AISA 4LBRA 4B5VA 4LEQA 3H2EA 1EGVA 3AALA 2CXEA 1S2TA 3AJXA 4WGXA 3ZSSA 3LM3A 3W07A 2XH0A 2GLKA 3KS5A 3ATYA 2YSWA 4TUFA 2ZUNA 3V0TA 1W1VA 3BG3A 4XO7A 5MKGA 3H6OA 2QDDA 2FMOA 2PGEA 3W86A 1K6AA 2CHNA 1RPKA 2WMFA 3AAMA 1G4TA 4M6VA 1YTDA 4WY0F 1ZJAA 4IL0A 2OQHA 1OVDA 3ARVA 4C7GA 4LB4A 3O06A 7CGTA 4X9YA 4DNMA 1EX5A 1MQQA 2ADAA 3B0YA 2FYMA 1GVRA 4XAZA 3RF9A 3AU2A 5I07A 2BLEA 4D1IA 4OVXA 1VHCA 4AZ7A 3GFYA 5IOBA 1IZJA 1H3GA 2V5DA 4IISA 2VUNA 2YDAA 4XQ6A 1TWSA 3LU2A 1A50A 3DG3A 4GQGA 2XFFA 4XAGA 3GNPA 5AB3A 2V8ZA 3AXHA 4JX6A 1H62A 1YXCA 5HWNA 3RO8A 4W7VA 4QXIA 2PD5A 4OV9A 3DH7A 3KCLA 1R8LA 2YB4A 4MYXA 3VIHA 3A47A 3C2VA 3C56A 4OBTA 3SUWA 1H11A 3HOJA 3JVAA 3LCFA 2I5QA 3MCMA 1IZKA 4YLWA 2DSWA 2R1LA 1J4EA 1EJTC 4H01A 3OLEA 4XO6A 2EBNA 3M7SA 3O6DA 1D8WA 2W79A 1D9EA 4UFLA 2OZTA 5M1TA 2ZQ0A 4O50A 4BHYA 9XIAA 1VYRA 2J74A 2V30A 3OOQA 4OU1A 2A3CA 2I5GA 1ECQA 1EPVA 5HATA 3W38A 4A8IA 5DXYA 4JL1A 3VGGA 4JTTA 5FA5A 1L2UA 2PDFA 3F03K 2WJEA 1BTMA 2J62A 4RZBA 4L9ZA 2QUVA 2R8WA 3C5QA 4JX4A 4M8UA 2HPIA 4KKXA 3W9ZA 4O1BA 2ISVA 2FVMA 4CUCA 4U10A 2CETA 2X0HA 3TSMA 1U5VA 2VD8A 2BODX 2V6AA 1QPOA 1WBHA 4LF2A 1EFZA 4K37A 3G1VA 2DT2A 1BAGA 2OLHA 3W7MA 1XGZA 3UJEA 2G5WA 4EF9A 3L65A 5LZLA 4QLKA 1V6TA 4G6CA 2RH9A 5FJTA 3N3MA 3EPNA 2PDBA 2VEFA 4Y90A 3M5YA 5HJYA 3GAYA 4AYSA 1RD5A 4DELA 4Q8WA 4H6KA 1T8QA 3ISIX 3N73A 2X40A 3TXVA 5EMJA 3QPEA 4OECA 3GXDA 2VX7A 2PFHA 3BQ6A 4JTEA 3NIYA 3WQCA 2D23A 3C2EA 5BXPA 4H3DA 4O18A 4NXKA 1TWZA 1FWGC 3OJGA 2DW7A 3BAIA 3IUDA 1GHRA 3GXNA 3K8LA 1QNQA 4WK9A 1JCJA 4AWSA 3CB3A 3QLLA 4LYPA 1QBAA 1NARA 3WDPP 2WNQA 4W8LA 4OJYA 4DXXA 3UG3A 4LC6A 5CGMA 3GAKA 1R9XA 1UH2A 3E74A 3UG8A 3AXXA 3VMNA 3VOGA 1AW5A 3CQJA 3NSNA 1XL9A 5D9OA 1XSKA 3ARPA 3MWCA 4J2MA 4O1CA 4S2CA 4DF2A 1SO4A 2VGFA 1RVKA 3TP4A 1DPMA 2PWFA 4FOKA 5A6MA 3F1QA 4ONVA 3ZJ6A 3VFCA 4PEKA 3BO9A 2V2DA 3FYYA 3KTCA 1P0BA 3MO4A 4OOZA 1HTIA 1K9TA 1QPRA 4NNAA 3GKFA 1H4PA 3PPCA 3K4WA 3MKVA 4R27A 2V38A 1JDDA 4Z0JA 2E4TA 1PZ2A 4E2BA 1XYMA 1G0CA 3F2DA 3EXTA 1T7LA 3WQOA 3UR7A 1DE5A 4XWUA 1OFOA 3D0CA 1B3OA 1Q85A 4AD2A 3PB0A 3ZQ9A 2WSRA 3S6TA 3VKAA 1XQKA 3MW7A 4PCTA 2HXUA 1E70M 3AMKA 2PODA 1IEWA 2G0WA 1FKXA 4H9YA 3BSGA 1A4MA 4F8XA 1I8JA 2QPSA 2E8ZA 3RYSA 5FEXA 5LXEA 1OADA 1EWDA 4UTWA 4LAZA 1MQRA 2C19A 4C6KA 4AYGA 3U4AA 4CQ9A 1HKMA 4WLCA 1LBFA 1VH7A 1K6WA 4H19A 5TBOA 4KFOA 3GFZA 1TA3A 3QV8A 2GOUA 5I77A 1EL3A 1R86A 1T40A 2W0UA 3CWOX 2YCLB 3V4BA 1ME8A 4XSLA 5DT7A 4JFUA 5BWAA 4JHMA 5IRPA 1HP5A 3DG6A 4E6MA 4K68A 3EDDA 1K7EA 5BWFA 2CWXA 3MSGA 1QASA 3IGUA 4AD0A 1ICPA 2BXZA 2X41A 3CUFA 1SR0A 3MB9A 3SCVA 5EFDA 2W5FA 2Y0FA 4EPBC 2NLYA 2OZ8A 2ZA1A 4H7CA 1FUYA 3KW3A 4XAFA 5F2IA 4PH6A 3E0FA 1ONWA 3W7GA 3SY1A 3WUFA 4CNOA 4MY9A 3CQ0A 5DCDA 1POJA 3BLKA 3F2CA 4HCDA 2A3EA 3CAVA 4BF9A 1UR8A 4O52A 4XZIA 3A22A 3NTYA 5LSMA 1H7NA 4IQJA 3KWSA 2CESA 1Q4NX 4O16A 3GM8A 3CL6A 4UWMA 5K9DA 4PCFA 2VFFA 3YPIA 1EB3A 4AEEA 1GOXA 1E3XA 1G94A 1Q3NA 3IIZA 1F3TA 1ITQA 1E5JA 3EMZA 1KBBA 1I75A 4LVBA 3TAOA 2Q8XA 5FESA 1VCGA 5BOFA 3S5ZA 4R3UA 1J18A 3VTRA 1KA9F 4LUTB 2VOTA 4F0RA 3NYZA 1VAHA 1KGWA 2DT0A 4MFDA 1AZ1A 5K4ZA 4ZVJA 3HBLA 4ZB5A 3KP0A 4PBEA 3RHGA 4WRHA 3KVMA 4FMVA 2FHBA 3ABRA 2HMCA 2QKFA 3MV01 4DZIA 2W9MA 1V6UA 3SUSA 2HE5A 4HHHA 5JBFA 4UFIA 3PC0A 1YHTA 3I3EA 3MSYA 3F4NA 1FX6A 5CZTA 3SW6A 3MI3A 1TRIA 3PAJA 4QCFA 2OO0A 3NEVA 4ZL1A 1R2SA 1ML1A 3T8LA 4KCWA 4O1EA 5A8MA 4LTSA 3BC9A 2DSKA 2DPEA 3T0AA 2A21A 4JQ3A 2RJGA 3VMOA 3W00A 1AW2A 3EOLA 3TYDA 3JU2A 4HHMA 4MDPA 4FNQA 3W01A 2VGGA 2ZUSA 1MFUA 4YS1A 3SCPA 2VRJA 1OG6A 1US2A 4DQWA 1DE6A 1O7AA 5U4NA 4LUSB 4IQEA 2E40A 2PDLA 1Q7ZA 1Q8AA 2QCNA 2BX7A 2EQDA 2WMIB 2PTWA 4WZHA 2IMRA 1W9XA 3R0UA 5C9XA 4JR5A 4UFHA 4OBSA 3PPGA 1UUOA 3FA4A 3G77A 3T1GA 4ZZ9A 2PDCA 5A6SA 7XIMA 2CBVA 1VZWA 3GW0A 2HQAA 4JZ5A 4RW3A 5DY3A 3CQIA 2OODA 4ORIA 3A12A 1QUMA 4J27A 1BLIA 4MY1A 1KB3A 3THQA 1JCYA 4NUWA 3UZYA 2H8XA 3ID7A 1RPXA 3FYOA 3WQPA 2DVUA 3WNOA 5TNVA 3N04A 1PEZA 3AXMA 3LCGA 5GNYA 4PCSA 3STFA 2W91A 1UZHA 2XZ9A 1RAKA 4ATLA 3URBA 2NZLA 3BOLA 2NQZA 1JXKA 1PSCA 3STPA 4U3CA 1BXNA 2DP3A 4QG6A 5JQ9A 5FF0A 3MP4A 3CXOA 3FGCB 5EMMA 2IUZA 4DI8A 2GQ9A 3TH6A 2G96A 5EMKA 2P8BA 1ZCCA 3TMQA 2Y1HA 4NJGA 1VFUA 4ZXOA 4J3TA 6PTDA 1LF1A 2D2JA 2V5CA 1GOWA 4LAOA 5U7SA 1VLIA 1CTNA 1NP2A 2D2GA 3UG4A 2WZEA 1V6WA 2R82A 3CBWA 1KCKA 5FIPA 1S3HA 2ATMA 4NJHA 3PS7A 1OCJA 3MJMA 3WUEA 2RGLA 3TONA 3W1NA 1R5YA 1JPIA 1AG1O 1DJNA 4MAVA 1F7BA 3EMQA 4ROPA 2ZC8A 3BLPX 3WL0A 3ZM8A 2Y5EA 2AGKA 4ZQPA 2CLPA 2DJXA 2FGBA 2Q3OA 1GTHA 4C6MA 3AFBA 3UJSA 1HGYA 3GHRA 1KV5A 4Q7BA 4HA0A 4C6CA 1UUMA 2UY3A 2Z2BA 4JTRA 1MW2A 4OIFA 5SWUA 1M7XA 3TAKA 3AHZA 3URQA 3PJWA 3AHVA 2Z4GA 3QZ6A 2YXGA 3AZSA 3B8IA 2QCFA 3TTOA 4D6IA 1DV7A 4AC7C 1EPXA 2NXGA 1TTIA 5XINA 3W1LA 4DPQA 3DC8A 4WJEA 4ZEPA 4KIEA 2X1IA 3GIQA 3KOWA 2XM1A 1Q6FA 4RUBA 2DZSA 4AY8A 1KXQA 5HQMA 1DYSA 4QLLA 4HPXA 2IPFA 2CNCA 1JJKA 3N1AA 4O0QA 4MIMA 4IGMA 3FHQA 4RXGA 4AZGA 1H1ZA 1HNYA 3WLNA 4TV5A 5CH9A 1F6YA 2EJAA 3W26A 3ONCA 5HPOA 3O05A 1J6PA