4JTSA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with 072
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 057
rcsb
source organism Homo sapiens
total genus 136
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2013-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jtsA00
2QUTA 3IIOA 1VLIA 4UFKA 4AF0B 4MZ8A 1AW2A 3P74A 1A5CA 5G1YA 1TTPA 2QCLA 3T55A 1KBIA 4LW7A 1OFAA 3MP5A 2C14A 1TPDA 2UV8G 2RHGA 1P0NA 3JRKA 1ZCOA 3NQ8A 2FB2A 4M6PA 2YW3A 2NXHA 4IXHA 3VNDA 5KINA 3WK0A 1VCVA 2JKPA 2YR1A 2C3ZA 2YFOA 4N9EA 5AC8A 4DBDA 3ATYA 1R46A 4RZ6A 3EWWA 5F2MA 3NAVA 4J9JA 2E1DA 3CEPA 1OFOA 1KV5A 2ABBA 3O06A 2D73A 3G1SA 4TU1A 3WJZA 1XDMA 2H3BA 3RFAA 4GE8A 4LNYA 3L65A 3NZ1A 1J5TA 1GYNA 3LHTA 4A21A 1W5NA 3MYOA 2VKZG 1BTMA 5CPOA 1FWRA 2NXGA 7TIMA 3NQCA 3HPXA 4HT3A 3UWYA 2Y6ZA 1U5JA 1B57A 5AC6A 1TTQA 2J27A 2W6RA 1H63A 3E49A 5HWMA 3QSRA 4QITA 4ZQCA 1PVNA 2WO5A 1W5PA 1UUOA 3KOFA 3PY2A 4ZVJA 5F4WA 1YLVA 3D0CA 4N4PA 4YMZA 3TAKA 4OWGA 2RDTA 1HG3A 1IXPA 4MJZA 2AGKA 3M43A 1FXPA 1MEWA 2ZBTA 3NOEA 1DVJA 4AWTA 3NGJA 3LTPA 3W1XA 6ALDA 5K3VA 4Y9AA 4GUGA 1YTDA 2H90A 3N73A 3OVRA 5J5DA 1FX6A 3KRZA 3EWYA 4U28A 4UXDA 1LOQA 2DJLA 4O14A 2ISSA 3WK1A 4P61A 5EY5A 3NPVA 4JTIA 4GXMA 1P4CA 1RZMA 5K2ZA 1THFD 2C18A 3CC1A 3PBYA 3HG5A 4OGZA 4W9TA 1YPIA 1XBVA 3TC7A 2VFEA 2ZQ0A 1WA3A 4GUFA 2CW6A 3I68A 2QDGA 1WBHA 2R14A 4RXFA 5FI8A 3DFQA 1CW2A 3MUXA 1TO3A 5KZEA 5D04C 3G0XA 1DBTA 4A3UA 3DAQA 4CNPA 1W54A 1GQNA 4FX8A 2G97A 5EMUA 4XBSA 1E51A 2ZRZA 3MHFA 3T40A 5FESA 3HO8A 1HL2A 4K8EA 4RZ4A 5CPLA 5TQLA 3N34A 4LY8A 2W0UA 4WD0A 4K7YA 3O6DA 3QSTA 3SJ3A 2GOUA 1WV2A 4JEQA 5D38A 5G2WA 1JRBA 1UBSA 2PC4A 2V0TA 5LZLA 1ZALA 2GQ9A 4JD4A 1MEIA 4O12A 4NNBA 2WNZA 1LBLA 3W7KA 2ZA3A 1GJPA 4O1DA 1I2PA 3M1ZA 2X1SA 2V82A 1FUYA 2TRSA 1H7RA 1LROA 1O4UA 1KFEA 4TIMA 4Y90A 5HNRA 3M41A 1RD5A 3NO5A 3DGRA 5U7SA 3HBLA 4NNCA 2ZFAA 1ZY9A 3CIXA 3GZ3A 2GQ8A 3KRSA 3LRMA 3NDOA 1CI1A 1ICQA 5T26A 2E77A 1KLYA 3OA3A 5BNKA 2FJKA 3L68A 1FCBA 2ATMA 4MYXA 4UFLA 2TPSA 5LNUA 3W1TA 3UY7A 2QAPA 3L5AA 4BI5A 3TE9A 2BTMA 3H53A 3HJZA 3TX9A 1VHNA 1QPQA 2A6NA 1NF7A 1FWSA 3TSBA 1W1ZA 1FCUA 2Y62A 5CZSA 1KM2A 1FQ0A 3LCIA 4Z0SA 1RQEA 2FLIA 4LVGA 1OK6A 1OX6A 4UTLA 3TH6A 4RKAA 3W1RA 1KLZA 4KFOA 1C8VA 3FFSA 2RDUA 3BO9A 1NEYA 4N6EA 2VEPA 4RJEA 5I3GA 1VQTA 3VCRA 4GUHA 3S1VA 2LLEA 2NUWA 1VYRA 4AMAA 1F73A 2Y61A 5D05A 2OT1A 2B7NA 3NQMA 5HWJA 4LS1A 3NQAA 3LCWA 4O16A 1TMHA 1X1ZA 3F4WA 3W72A 4C1LA 2B7OA 4N9CA 2CZFA 4A2RA 1TV5A 3W70A 3RLVA 4XQ6A 1DJQA 3LHWA 3LHUA 2Y7FA 4BWLA 1FY6A 3NVTA 2ISWA 4MOZA 2BLEA 4QJ1A 1ICSA 4IQLA 3N19B 1VHCA 2ZYFA 4NVTA 2DZPA 3BARA 1LDCA 4P2VA 2Y85A 5D33A 2E5DA 4NNAA 3T4CA 1KTBA 1XBYA 3G3DA 1JUKA 5ABTA 3LTYA 1WYIA 3S1WA 1WQ5A 3EXRA 3TV8A 3S5ZA 1ALDA 4ICNA 1Q6RA 5IBXA 1YTKA 1TPFA 4RR4A 1JCXA 4U4MA 1AW1A 4NX5A 3TDFA 1W5QA 4JTJA 2EF9A 3ABSA 3TUUA 2ZTJA 3QW3A 2ZRUA 4Q4KA 5EL1A 2C6QA 2HSAA 2P10A 4OHQA 3PSVA 2E6FA 3G0UA 2C19A 4JXCA 2NV2A 1B4EA 1XUZA 3M44A 1AG1O 3CTLA 1K02A 4ADUA 1LBFA 4LC6A 5AHFA 1G4SA 3TA6A 2CZEA 2V81A 1HO4A 2DZWA 3LHVA 1V5XA 4HSNA 1Q3NA 3R5EA 2Q3RA 5F2LA 4FB7A 1WAUA 5BMWA 2V9DA 4TO8A 1PL9A 3B4UA 1OABA 2RFGA 4MYAA 4ZQOA 3MYPA 4A2SA 1DJNA 4O54A 1Q6QA 4FIRA 2E5CA 1UASA 1Z41A 1SZEA 1WOBA 4AVFA 2ZRVA 2VFDA 3W83A 1Z48A 3QC3A 2NWSA 1TV8A 2AAMA 1W31A 3NQ6A 3S1UA 3MBDA 1M7PA 1S5VA 2E68A 4AWUA 1TRDA 5D03A 3BGGA 1RPXA 1KW1A 4CCEA 2YCEA 1AW5A 1P1XA 2NV1A 3I7SA 4HPXA 1F76A 2G5WA 4DO6A 2YYTA 3OVPA 5HR7A 3TR2A 2QCDB 2VXNA 2VEMA 1FWNA 5LKYA 5IM51 3E0IA 2ZRWA 3OIXA 2CLIA 3LBMA 3QEZA 3GXNA 2V2CA 3PBUA 5G4EA 4QQ3A 4LVBA 5E1QA 5HMSA 4JR5A 3W1LA 4EF8A 1IXQA 5F1UA 3EWBX 3M9YA 4O28A 1FCVA 2BWGA 4JIPA 1XCFA 3TCEA 1DHPA 3HIJA 1VRDA 4S2BA 3TC6A 1O94A 3C2OA 3KVLA 3HGSA 1JCMP 2VOMA 3OHIA 1IIGA 5D32A 3GX9A 4PL2A 1UB3A 3B05A 1TREA 1BKSA 1TJPA 2DU2A 3QFEA 3FJLA 1SO6A 1BEUA 3BVJA 1XL9A 4Q33A 2J9ZA 3W7MA 3WJWA 3A24A 5L9FA 1ME8A 2C0AA 4PL1A 1EP1A 4Y8FA 1ME7A 3H55A 2BZNA 4ADTA 3TFXA 4BI7A 3TIMA 3HGOA 4O52A 2QAFA 3GR8A 2OJPA 5AHLA 4Z08A 1W37A 4O0KA 4BK9A 4FXSA 4UTWC 3PUOA 3STCA 3IGUA 3W2MA 1I2OA 3SZ8A 3IGXA 2Q3OA 1VYPX 3O8AA 5KSWA 4DEFA 3G1AA 4C1KA 1JCJA 1TRIA 1XBZA 2ZRXA 4K36A 3GXTA 2EHHA 1M6JA 5E93A 3LDVA 3NM3A 2X16A 1SO4A 1PE1A 3DHFA 4NJKA 1O95A 4IMEA 5DCBA 4NX0A 1LBMA 1G4PA 3CWOX 3WJYA 3IGSA 1DV7A 1F2JA 2WV8A 3C61A 1KFBA 4H4IA 4RX0A 3MHGA 3LXAA 3TMLA 3RU6A 3LCHA 1DKWA 4PEKA 4CCCA 1EP3A 1QCWA 1SR9A 5LHFA 3Q58A 4O1AA 1YXDA 4JNMA 5GVJA 3W84A 3CLMA 1EWDA 3DFPA 1ONRA 5I3HA 1KBJA 3NPUA 3W7LA 3C8FA 3MJYA 3W1AA 4O11A 5KITA 1GOXA 5TBOA 3BV4A 1WOAA 1QPNA 3ABRA 2A2IA 1SO5A 1O5KA 4UUIA 4XWUA 1KV8A 1P5BA 2A5HA 3SFKA 3ABOA 3QMRA 2A6LA 3W75A 1JJKA 1FDZA 2ALDA 4GBUA 4N4QA 1OVDA 3PS7A 1TV7A 4WY0B 2C13A 2Y63A 4CCDA 3UNDA 5C2XA 4FF7A 3A5FA 1C29A 1VCGA 1LP6A 2I14A 5K9XA 1O60A 3SI9A 4TMBA 1OX4B 2DZVA 2ZZ3A 3NL3A 5AYZA 4LVAA 3N9RA 1GTEA 2R91A 3CPRA 3G0SA 1TYGA 1G4TA 1S5WA 5BW6A 4KFPA 4DO5A 1GVSA 2O7SA 1JCNA 3LB0A 5KZMA 1QOPA 1DQXA 3F1QA 3KX6A 4MLRA 3EX1A 2X1UA 1YADA 4IUOA 4NJGA 5K9CA 2YGYA 1DOSA 3UXDA 3W2UA 2GJLA 4WOQA 5I3KA 4N6FA 1VC4A 3HGJA 1ZFJA 4S2CA 1EB3A 1JCLA 1L2UA 2QJHA 4AF0A 1X8FA 2R8WA 4HNUA 3CU2A 1OFPA 8TIMA 1KFCA 2RH9A 5HINA 3P60A 2EAWA 1H7WA 4Y6GA 2XN0A 2QCMA 3UPBA 3GAYA 4E2DA 3UWVA 3WJXA 2VFIA 2ISVA 4ONVA 1AL7A 2NX3A 3PB0A 4KFNA 5EBUA 4UFIA 3A21A 2XFWA 3HG2A 1YDOA 3EKLA 1RQBA 2E09A 5FF0A 3OEXA 1JULA 4O50A 3N14A 4EF9A 1LTDA 4KWVA 3UQNA 2E5BA 2JBMA 3MHUA 4PODA 3NNTA 1W5MA 2NWRA 3PG9A 2YZRA 4JIQA 3KAOA 4CQ9A 3ABQA 1H1ZA 5HUOA 1AK5A 3JR2A 5A8GA 3TAOA 1TPUA 1K8XA 3HF3A 4JX5A 1MSSA 4ALDA 2O7QA 4RCXA 3L9CA 3SGZA 5D37A 3W22A 3RF9A 2WKJA 5F2GA 1I2QA 2A7PA 4GJ1A 5DN1A 3GDTA 4M19A 4AHOA 3QMSA 3ANYA 1C9DA 5AB3A 4UFHA 3LXCA 1FCQA 5LSMA 4ZL1A 3NQDA 2ZZ7A 1ICPA 4BF9A 2VEIA 1SSGA 2FQIA 4XZ9A 3Q94A 1W8SA 2X1RA 5H2ZA 1ZENA 3IIXA 1A50A 3HG3A 4NQ1A 3PWAA 1SW3A 4I7VA 4DXVA 3UWUA 4BI6A 1W0MA 3MP3A 3LI0A 3IIZA 4N2YA 3TXZA 3DFSA 4JY9A 4ZQRA 1FDJA 1GVRA 2JGYA 1Q45A 3DH7A 3R8RA 3HMJG 3FA5A 3B06A 4JTUA 1D3HA 4OE7A 2YXGA 3TSDA 1NSJA 1J4EA 3R13A 4O4WA 1F74A 3EWZA 4WXYA 3MW7A 3PBVA 4X3ZA 5EPDA 1F7BA 1EEPA 3UWQA 3L5MA 3BLEA 3W7DA 3W7JA 1T0OA 4HNNA 1NAL1 3MI2A 3TK7A 3NA8A 3FEMA 3P80A 4JYFA 1EX5A 3W7OA 1IXNA 3I65A 4LRSA 2TYSA 3G3MA 1PV8A 4LV4A 1OHLA 4ORMA 5K4XA 2BX7A 2EPHA 1G7UA 3PSWA 3CWNA 5AFDA 1TTJA 1M7OA 3IVUA 3TU9A 2FPYA 4NJIA 1MXSA 2YSWA 5LNRA 4S1FA 3GDMA 3STFA 1YDVA 3W1NA 1H61A 1DL3A 1F05A 1K3UA 4WZHA 1TPEA 4MFDA 4MZ1A 2C1HA 2WQPA 3BW3A 3GYEA 4DF1A 5D09A 2B7PA 1Q6OA 5E0KA 4IPIA 5C55A 4Z1AA 4EOUA 5AN7A 3SECA 4JGDA 1YPFA 1OK4A 1R2RA 3TMQA 3GAKA 1K7FA 3R2GA 1QDSA 2EGZA 1H1YA 4A22A 1XI3A 3LV6A 3N2XA 3CIWA 4IMCA 3ZWTA 4QSHA 5K9DA 1B9BA 2VEKA 2CWNA 3UWWA 4ZQPA 3THAA 5EYWA 5L6UA 2VELA 2ZTKA 2C16A 2V2DA 5G5IA 1LRQA 4Y96A 3FYPA 3E9AA 4IOTA 3TROA 4O17A 1H51A 4UNLA 3I7QA 3G1VA 5D2TA 1LM1A 1TSIA 5AHEA 1W56A 2HMCA 2ABAA 5D2WA 2A7RA 2Y7GA 2A1YA 5KMYA 1PHWA 3C6CA 3DXIA 4JYEA 3RK8A 1XXXA 2QEZA 2A21A 1H7NA 4WX2A 1KFJA 3WFAA 2PCQA 3BGJA 3S6DA 3W3OA 1A5AA 2GPTA 4JTEA 2Z2UA 1I8JA 5CSSA 3IV3A 3T7VA 1QMLA 1GYLA 3W7QA 4L4LA 1O5XA 1U83A 4JTSA 2CLMA 3C3NA 1DORA 4WJEA 3NPWA 2QCGA 3S1XA 2GJNA 2FPTA 3LCGA 4MVAA 2VFHA 2ZZ6A 1JUEA 3LI1A 1FWWA 1K7EA 3QQ0A 2DJXA 3LHYA 2NXIA 3NQFA 3L67A 1A5BA 1F6PA 3M5ZA 1PIIA 5FEZA 1D9EA 1GG0A 1LYXA 3STGA 3IVTA 4QISA 1TIMA 1G67A 5AHNA 3EX2A 3P8JA 4UTTC 1XDLA 1JVNA 1OF6A 4DPQA 3W7CA 4NJJA 4WXZA 4XUGA 4YWIA 5CPMA 4LUJA 3LX9A 4XBKA 3HPSA 3FKKA 1ZAIA 3KVJA 3O16A 3GVGA 1WDWA 3I6RA 2OCZA 3F4NA 1VLWA 4D2JA 2CLLA 3W23A 1OX5A 2AQWA 2FIQA 3UPWA 3M0ZA 3QF0A 3FOKA 3SIZA 3NPXA 4NT0A 4AAJA 2PE4A 4O4VA 2I9EA 2CFFA 3E96A 4FEZA 1JQXA 3R89A 2YW4A 1L6WA 2Q8LA 4MUZA 1EIXA 1QPRA 2R94A 1QPOA 3EKZA 1JCYA 3VFLA 3HOJA 4AB4A 3UZ5A 1NVMA 3NL6A 1QO2A 3DKJA 2PRMA 4M5PA 5CKSA 1GZGA 4XKYA 4M6QA 2XN1A 3LRKA 3LCFA 4FX7A 4O15A 4UR8A 4FNTA 5FEXA 1KFKA 5FF7A 4JDBA 2Z6JA 4HHPA 1W3NA 3PG8A 4TX9A 1Z44A 2WPBA 1VPXA 4IPJA 3TNOA 1Y0EA 3U2OA 1W3IA 1R47A 3W7EA 3UD6A 4Z1DA 1OYAA 1P0KA 1OFQA 4YCPA 2QCDA 3W7NA 1EUNA 2ZDRA 2QR6A 1SUXA 1KM5A 4OU1A 1KM6A 3TJXA 4K6AA 2RDWA 3E02A 4XTDA 2ZA1A 2X2GA 1TPVA 1LLZA 3QM3A 1M5WA 4R33A 4IXXA 2YFNA 4O57A 1JRCA 5G4WA 2FFCA 2TSYA 5C54A 3HPZA 2WSRA 3O1NA 4HPJA 1UJPA 4JTGA 3AJXA 1K7XA 3EWXA 5LNSA 3B03A 1ZJIA 3O15A 4HNTA 2NLIA 4OBTA 2FTPA 3L21A 1K8ZA 4ADSA 2ATSA 3W9ZA 2PURA 3N3MA 5LNWA 4M7SA 4KKXA 1L9WA 3P5ZA 4NUWA 3W7IA 3G8EA 3P5YA 3MBFA 1FDYA 1SZGA 2P1FA 3DKLA 1GTHA 4ZZ9A 1G69A 1KM1A 3P82A 2X1TA 4I7WA 4YXGA 3G22A 4MKNA 5EA9A 1SO3A 5DY2A 3P67A 3T78A 3W76A 3GK0A 3LBCA 2DP3A 1PCKA 3WJSA 3UWZA 1NF0A 1VYSX 4JX6A 3LCLA 3SW6A 1V7YA 5LNVA 1IF2A 4IMGA 2I1OA 3R12A 3MO7A 2GQAA 1RQHA 3LLFA 5DBTA 3MI3A 4UTWA 2ZA2A 2Y7DA 2QCFA 2A0NA 2ZRYA 2YX0A 3HB9A 3PUEA 2WNNA 1TPH1 3MP4A 5TIMA 4HKPA 5BMXA 1VZWA 1CX9A 2E6YA 2J6XA 3PF3A 5HWNA 3LRLA 2Z1BA 4FNPA 4HIBA 2CU0A 1VCFA 2JKAA 4H3DA 3BG9A 3GDKA 3N2MA 4PFMA 3EWUA 1JR1A 5LHEA 5F1VA 5AYYA 1TPWA 3RMJA 1VJIA 4IX2A 4MZYA 3GLCA 1SFJA 3MMTA 1G7VA 1GEQA 1S5TA 4MJMA 4NU7A 1WX0A 3WK3A 2JKEA 5HULA 4LVFA 2G96A 3DU0A 2H6RA 4GNJA 2V5LA 3BW2A 3EEGA 3NXFA 3QJAA 1F6KA 4LS0A 4UTJA 1SSDA 2DZXA 4K8HA 4CNNA 3S9YA 2TMDA 3P7YA 3PC0A 4A29A 5C5YA 4WY0F 3L2IA 2YPIA 4K38A 5F4XA 1RV8A 2J9XA 1OG0A 1YXYA 4LC8A 5DELA 1VGAA 2GUUA 4X2RA 3TKFA 3EB2A 1SW7A 4DO4A 3GB6A 4O8RA 3M5YA 4O10A 4QIUA 4PCFA 2CLOA 4Q32A 2QCEA 1HUVA 1W5OA 1ZNNA 5BRBA 4GUJA 4MY1A 2NUXA 4Z1CA 4NZJA 1TPC1 3G1HA 1X6UA 1SQ7A 3SSJA 4FIQA 4E0CA 2GVLA 3W71A 2YDAA 3PAJA 4LUIA 4JY8A 4LWWA 2OT0A 1UUMA 2Z6IA 3P84A 4NXKA 3TFCA 4MLJA 3BLIA 3LERA 3O05A 5CGQA 4LS2A 4UNKA 1LRTA 1MZHA 4UR7A 1H60A 3QW4B 3LOTA 2QUUA 5CZTA 4NJHA 3S5YA 3W7GA 3B8DA 1EPXA 1XFBA 4Z0JA 4OV9A 4ORIA 1TPB1 3CB8A 2V5BA 4X9SA 2QCCA 4K7VA 3GKAA 3O6CA 5HJLA 4NXSA 3FYOA 3G24A 4FO4A 3A5VA 1I2NA 1WBJA 4OT7A 2P0OA 2VC6A 2G95A 5LGXA 3P81A 4GC4A 3S5NA 1HTIA 3M5VA 3KXQA 2VFGA 4AWSA 4LRTA 2QF7A 2X30A 3ZWSA 4RK8A 1S3HA 4JX4A 1T99A 3PB2A 1ZAJA 2HTMA 3KVMA 5DBUA 1AL8A 3NG3A 4ZQMA 4KWWA 1IGSA 1KA9F 3GKFA 1N8FA 4O13A 4O18A 2CLKA 1EA0A 4O1BA 4QM1A 4O0ZA 3V75A 1XM3A 5DLCA 2ZZ2A 1B3OA 4AHPA 2Y70A 3TQ0A 4JDYA 3CEUA 3LM7A 4RV8A 1F5ZA 4IMFA 1QO5A 3ATZA 4JICA 2NX9A 3NQ7A 3IVSA 1OYBA 4M6VA 2DORA 4TMCA 5HR6A 2V8ZA 1I4NA 1QWGA 1LCOA 4MY8A 2CLEA 1KM4A 2ZCGA 3S5OA 1TQXA 3C2FA 5AYXA 3OG3A 2CZDA 1VH7A 3DFOA 2QJGA 3CHVA 4AH7A 3C2VA 3KVKA 1BWLA 2RKXA 4K37A 1UCWA 1KFLA 4CQ8A 3ZFHA 3FLUA 4EIVA 1TQJA 5H91A 1H7XA 5AHMA 4DF0A 2NZLA 5G2IA 5FF3A 4IX0A 3W6YA 5D2XA 2F84A 1XBXA 3KHJA 2Y88A 1OYCA 3GR7A 3L0GA 1H7PA 3W7PA 1QOQA 3KFTA 3L5LA 4N02A 3ZR4A 1BWKA 3NYZA 5DY3A 4MFEA 2B4GA 4UIOA 5G1TA 3O07A 3K30A 3IRDA 3W2KA 1G4EA 3EX6A 2Y7EA 4XTIA 1H7OA 3P8IA 4I7UA 3SGUA 3WK2A 1KTNA 3DFTA 3M6YA 2OMAA 1AMKA 1OFEA 4HNVA 1N7KA 1PCWA 2V30A 1TTIA 4FNRA 4PC8A 3W2LA 4N9DA 3S8HA 1G6CA 2H8XA 1TB3A 5KTLA 4O19A 3LXBA 3CT7A 5FEPA 3LGEA 3BG5A 5DXYA 2OZ0A 4LV9A 3VI2A 3W1PA 4UTKA 2QCNA 1LOLA 1A53A 1PHQA 4PTNA 5HUPA 3QQ1A 3G1XA 3MWAA 2NX1A 3P61A 4JTFA 1FWTA 5A5WA 3QPZA 3S0CA 1J2WA 1XC4A 4YCOA 1SZFA 4CNOA 1X1OA 2F7FA 3PR2A 3ELFA 2Q8ZA 3QYQA 3U6WA 3THQA 5HQEA 2A4AA 1IIHA 5I3FA 5F4SA 4O53A 3SY5A 4LU0A 4QNEA 3BPWA 3LLDA 4BWLC 4RXGA 4R7JA 1T96A 4FXRA 5CSRA 4IJBA 3G8RA 1HFBA 3IIVA 4TR9A 4E2BA 4OQVA 1YYAA 1N55A 1EUAA 4JS3A 4LTSA 2QDHA 3W88A 4BFAA 3IEBA 1W3TA 3B0PA 3PBWA 4X22A 4FX6M 3HQ1A 3UYCA 3M5XA 4MPQA 4AEOA 4OV4A 3TQVA 3OVQA 2J24A 4ML9A 2B0MA 1I2RA 4RLIA 3DI0A 1TCDA 5IBXC 4IGHA 4JTLA 3Q2DA 2XN2A 2EKCA 5J5RA 4PH6A 1QFEA 3UXAA 1GVQA 3B04A 4EVZA 1EP2A 2J9YA 4PA8A 3PM6A 1EWEA 3TQKA 5MHBA 3DENA 3C2RA 2FPVA 3L66A 3NQGA 1H62A 3M47A 3G1DA 2E6DA 4FNQA 1SPQA 2HS8A 3GNNA 3GNDA 5DCDA 3TSMA 4YL2A 4CLMA 2CLFA 2JGQA 3VE9A 3W1MA 1SFLA 2W79A 4MIMA 4ZQNA 3YPIA 2FDSA 3ZS4A 4UTIA 3DBPA 1ADOA 3FIGA 2QJIA 1MO0A 3EXTA 3OBKA 3VE7A 4YLWA 3LHZA 4GRSA 3N9SA 4QAIA 1YXCA 4DELA 1VR6A 3E12A 1SW0A 3QMTA 3HG4A 3QRHA 3USBA 3QH2A 5G2HA 2Y89A 3W7HA 3G1YA 4POCA 2ZZ1A 4H6KA 5D2YA 2BXVA 4HN4A 2JK2A 4K39A 3A23A 3MI6A 3AO0A 3F03K 3NL2A 4G1KA 1D3GA 3C0JA 4AXKA 4B5NA 1GG1A 4JTKA 4UTTA 1H5YA 2Z0IA 3DZ1A 5AC7A 3RNDA 3HGRA 3NQEA 2J88A 5I3IA 1H50A 3TJLA 2B7QA 4GFSA 3RLUA 3M16A 5BOOA 1YDNA 3TXVA 1T8XA 4UTMA 1LORA 2H3DA 1IXOA 1FXQA 4WUIA 2QKFA 2VFFA 3FJ6A 1KTCA 4UFJA 3IIPA 3FKRA 1OF8A 3W7RA 3NL5A 5CZJA 4XKYB 3V1PA 4R34A 5KZDA 2WSQA 5AOUA 3DHDA 1GT8A 1TJRA 4WQ6A 5EKYA 3W87A 2KZHA 2QCHA 3W2NA 3W1UA 5DXXA 2WOQA 2WSYA 2BSLA 1A5SA 1ZAHA 3NZRA 1PS9A 2H8ZA 4M7TA 5D2VA 3W73A 3P62A 3INPA 4R53A 5D02A 4IMDA 5CG7A 3QPYA 4BR1A 2WNQA 1R2TA 4GUIA 1ME9A 5FEWA 2DZTA 4N9BA 3DFNA 1QAPA 2FB3A 3T44A 1OFBA 4JTTA 3A22A 1Z42A 3LCXA 4LOCA 4CQAA 1KM0A 3LTSA 1R30A 1GWJA 3W2JA 5K7JA 2GVJA 3CM4A 3PVFA 2ZZ5A 3NR0A 3TW6A 4HSOA 1GPWA 2CLHA 3KRUA 4MY9A 3QZEA 3GIYA 1K8YA 1LRNA 4FNUA 1MEHA 4UC5A 4ZMGA 2E6AA 5CPNA 2HS6A 1K03A 1GVFA 4NZFA 1Q6LA 3W74A 3BK0A 1DQWA 1LZOA 3C56A 2WJZA 4FNSA 3O63A 5C6MA 1FBAA 1XKYA 3U8GA 2A7NA 1GVOA 1KM3A 5F2IA 1SZNA 4O1CA 2YYUA 3G18A 3EX4A 5K4ZA 3DI1A 4EWND 6TIMA 1R2SA 4GWEA 2OX1A 4WOZA 2NUYA 1WXJA 2ZZ4A 5CZ0A 1L6SA 3EXSA 5AHIA 2PRLA 3L0NA 3CQ0A 1YTEA 3GDRA 4JN6A 4I9AA 4QNWA 3M7WA 4AHQA 3FS2A 3W1QA 2V2HA 4DF2A 3O6YX 4UCGA 4UTHA 1XUUA 1QR7A 2A85A 3C4UA 4L4MA 3GDLA 1QNVA 4JYDA 3W85A 3B0VC 3TW7A 3NQ2A 1HO1A 1RR2A 2CZ5A 5DCEA 1L6YA 1ZHAA 3W07A 4Z1BA 5SWUA 4LVDA 4E38A 4UTUA 2DZUA 2VENA 3S42A 4DBEA 3PUDA 1OFRA 1ML1A 3B0UX 3G1FA 4LT9A 2GVGA 4RZ5A 2C15A 5I3JA 3UZJA 5D30A 5FF4A 3NQVA 4UFMA 3UY8A 1LLWA 3LV5A 3Q37A 1I45A 4WY0A 3NEVA 4DPPA 2IQTA 4JTHA 3BG3A 2QUVA 1OFDA 1X7FA 5LGZA 1JUBA 1LOSA 1RVGA 4UMCA 3W86A 3NM1A 1B4KA 3BW4A 3GXPA 3JS3A 1OX4A 2PRHA 1JQVA 4UMAA 1SU5A 3C2EA 4DQWA 3STEA 3A9IA 4IWWA 3VKJA 3H54A 4FHAA 1NFBA 3EX3A 3SR7A 5FF2A 1VS1A 5U4NA 3BLFA 3L0KA 3C52A 3PULA 3I7RA 1OJXA 2DZSA 4UMBA
chains in the Genus database with same CATH superfamily
2QUTA 1LT8A 4Z1YA 1AW2A 2FHFA 3KOZA 2Y24A 4LW7A 3NSXA 4UQBA 1TPDA 1OZQA 5EU9A 3GSMA 1DE5A 3TN3A 3JRKA 4HZ8A 3SRKA 4IXHA 2D0FA 1R9XA 1ZBVA 1JPKA 4PMZA 1VCVA 2E3ZA 1FH8A 2OQYA 2YR1A 4N9EA 1CLXA 5AC8A 1MDRA 3VNKA 3ATYA 4L4OA 2QYGA 5F2MA 3TTSA 3V3WA 4J9JA 1GNXA 2E1DA 3CEPA 3G1SA 1NOWA 3DHPA 1ITXA 1W3KA 2XH4A 1F8IA 5EBAA 1SYTA 3L65A 4K1GA 1Q2RA 5AYBA 2WMHA 1BTMA 4PMQA 1KBLA 3VKCA 1FWRA 2QVHA 1IEVA 3MMDA 4HT3A 2VZOA 3FCPA 3T4WA 5CAHA 3V7PA 1ISYA 1JDCA 3OODA 1H63A 4FPSA 3E49A 5HWMA 1A47A 3QSRA 4ZQCA 1PVNA 1CEOA 1W32A 1E43A 6REQA 3OGVA 1WDDA 2HBXA 2WZEA 3VD3A 2GL5A 3UG8A 7ODCA 4PMUA 4PSPA 4MJZA 4B3LA 1YMYA 4MAVA 1MEWA 2ZBTA 4AWTA 3LTPA 5K3VA 4GUGA 1HJXA 3N73A 3QN3A 1AJ2A 4S3JA 2WVUA 3BJTA 1MFVA 2DJLA 3VGHA 1SJBA 4W87A 1ONEA 5EY5A 2DW7A 2Y5SA 3WD1A 3U57A 1F6YA 1RZMA 5K2ZA 3SQSA 1THFD 4JKLA 3CC1A 4GI8A 3QGKC 5CC5A 1S5NA 5BWAA 3TVAA 3EOUA 4W9TA 1YPIA 4MWAD 2ZQ0A 2DUAA 1WA3A 1UWAA 1I1XA 5HXMA 2HNHA 1WBHA 4RXFA 5FI8A 3B8UA 3I3EA 2NVCA 2BOEX 3KTXA 3AMCA 1OWQA 4C60A 4XBSA 1E51A 2REQA 3MHFA 5BOFA 1HL2A 5CBJA 1NWUA 4O0QA 4KESA 4WD0A 4JBRA 4A05A 1FWGC 3L4UA 1QXLA 5G2WA 4REQB 1FHDA 2GQ9A 3UXLA 4JD4A 4NNBA 3W7KA 1LBLA 1E56A 1GJPA 4O1DA 3NQBA 2V82A 1DE6A 1O4UA 4TIMA 1IR1A 5EGRA 3LSBA 5HNRA 3NO5A 1AA1B 3KRSA 4RNHA 4UQDA 1VIZA 3P3BA 1E5JA 5AC5A 3RU8X 1AJ0A 3BURA 1VFFA 4PCSA 2G37A 1J0IA 3WMLA 3R25A 3W38A 3MANA 3GUWA 2J78A 3UY7A 2DQXA 3QV6A 4AVNA 2PDCA 3TE9A 3HJZA 3E2VA 2A6NA 4AYSA 2J6VA 1W1ZA 2OU4A 1V0KA 4F79A 3N6JA 3RRXA 1FQ0A 4Z0SA 2EO7A 3BWWA 1RQEA 1KCXA 1OK6A 3RITA 4YVPA 4K2SA 3ALFA 2RDUA 4IUGA 1C8XA 4N6EA 1PTAA 4RJEA 3N04A 1WE5A 1F73A 2IKJA 5FKYA 3NQMA 5HWJA 4LS1A 4ICCX 3NQAA 2P5NA 6XIMA 4O16A 3SCOA 3F4WA 4GYPC 2B7OA 3I3BA 1B3YA 4GIEA 3VMPA 1GORA 1TELA 4BF5A 2BLEA 3GUGA 2BY3A 2IXVA 3CHFA 1BG9A 1LDCA 4P2VA 2E5DA 3AIQA 3T4CA 3BMXA 5D4YA 2C7FA 4ZENA 3G3DA 1LJYA 3TEVA 3WLIA 5ABFA 4G2DA 3WLRA 4WDWA 1WQ5A 1PZ1A 4W7UA 5HMDA 3H4WA 4F48A 2CHRA 4RR4A 5A8NA 1SGJA 4LCQA 4U4MA 4KRUA 5LA0A 1QBBA 3ABSA 3TUUA 2VR4A 2ZTJA 2ZRUA 2C6QA 3ARVA 1XGEA 3H4XA 3N18A 4OHQA 2V5JA 5FJPA 1UD5A 2PGEA 4HOZA 3M44A 2Q02A 3KLKA 3OB8A 4JQAA 2OGJA 3CTLA 1JYWA 3ES7A 2CZEA 4JIHA 3T9PA 4R7WA 2OSWA 4Q3MA 1VEMA 3M0IA 3T1GA 1ISXA 1AJZA 2RFGA 3AFBA 4ZTYA 4ZQOA 3PJUA 4A2SA 1KXQA 1DJNA 5I79A 2WXDM 2WKGA 4E3TA 1UASA 4PB3A 1QHPA 4R7OA 2BFGA 1JAKA 1WDRA 4BQ4A 4AVFA 3CH9A 2ZRVA 3PN8A 2VFDA 3SQLA 3IJLA 2NWSA 3I3DA 2AAMA 1PX4A 1W31A 3MUZ1 1CLKA 4DZ5A 1UH2A 4AWUA 5C9ZA 2D23A 3GHSA 2XIIA 2KX9A 2YCEA 3FN9A 2NV1A 4Q8QA 1EH9A 4PTMA 1QOXA 2G5WA 3TTYA 2YYTA 3OVPA 5A1AA 5HR7A 2QCDB 3OIXA 3SRHA 3GXNA 3M0JA 3WQ4A 5E1QA 4JR5A 2VVNA 3BMWA 1XRVA 3SO7A 1TV3A 2R1LA 2WZMA 3FDGA 3HIJA 3TC6A 3GBEA 3C2OA 3KVLA 1CT5A 3OHIA 3K4WA 1UB3A 3WNPA 1Q4WA 3B05A 1MVYA 1TJPA 1BEUA 1XL9A 3REQA 1SFSA 5BZAA 1V7AA 3WX7A 1QNPA 1ME8A 4PL1A 3CL6A 4NG3A 4GACA 3H55A 3PUGA 1V03A 4BI7A 2E4TA 1TIWA 1EOKA 3HGOA 2QAFA 4Z08A 3MY9A 2WPGA 2X0SA 4PMDA 3IGUA 1FWCC 4H6QA 3SZ8A 1UD3A 4LEFA 4HMCA 5BU6A 5KSWA 4HJFA 4ROPA 1SFTA 1E71M 3DHFA 4NJKA 4IMEA 4IJCA 5DCBA 3GYCA 4FAMA 1AODA 1LBMA 3CWOX 1HVQA 4QG6A 1A5LC 4QS5A 3WJYA 5A6JA 1DYSA 4RX0A 3VD4A 1DKWA 1QCWA 3Q58A 4O1AA 1GYMA 3CWHA 4DO7A 3ZT7A 3K4DA 3NPUA 3CZEA 4PMXA 3SUVA 4GMEA 5KITA 5CC6A 3BV4A 5JQ9A 3WL0A 2A2IA 3A12A 1BWVA 3PTDA 1AQ0A 1P5BA 3SFKA 2A6LA 3DFHA 4LH8A 1VB9A 4GBUA 4X9YA 1X96A 4N4QA 3ALGA 2Y63A 3UNDA 3O0KA 1SR0A 2QLYA 1GVYA 3AIRA 4JN7A 3LGDA 3SI9A 1B1YA 3ONCA 3CQHA 1RHCA 3UETA 5AYZA 2ZZ3A 3N9RA 1GTEA 4ACYA 3TYDA 1E9ZB 1B90A 1NWSA 3VOJA 1S5WA 3O7UA 4KFPA 1R3SA 4DO5A 2PTDA 4FOJA 1PYMA 5FAGA 2OWCA 1KXHA 2OEJA 2VZUA 1QOPA 2CHNA 1JDAA 2X1UA 2YGYA 5I3KA 2FZ8A 4N6FA 1VC4A 4S2CA 3A4XA 2RGMA 4PE8A 4DWDA 3AZRA 4XZIA 3T0CA 2XN0A 3UPBA 1H3GA 5CPQA 2ZKMX 5A69A 1A5UA 1J79A 3SCSA 2VFIA 4HD5A 5GNYA 4KFNA 1E6PA 2XFWA 4LFYA 3HG2A 3MKKA 3EKLA 3UQNA 4N7QA 1XIGA 2JBMA 3MHUA 5CBBA 4IP5A 3VZZA 3ZYZA 3VMOA 3QV9A 3JR2A 4GIRA 4DN1A 5LYRA 4KPLA 1K8XA 4Y9MA 3E0FA 4JX5A 4DNHA 1UP3A 1CB7B 3L9CA 4PCTA 4IF2A 3W22A 6REQB 1I2QA 3WH8A 3T0BA 4E2OA 2ACQA 4DM2A 4GJ1A 5DN1A 4FMVA 3WH7A 1J0ZA 4B2DD 4Q8TA 3GTIA 1PDZA 2NSOA 1C9DA 3TNBA 4UFHA 4A6GA 1QPKA 1VAHA 1C91A 3E0LA 2ZX6A 3A6OA 1ICPA 3MVTA 4F0KA 2X1RA 5J8LA 4NQ1A 3BL3A 3CZJA 4S23A 5AKQA 4QRNA 1NELA 3VKDA 3WQCA 1R6WA 3IIZA 1V6UA 5HNUA 4AU0A 4YNGA 4ZO6A 4ZQRA 3AHVA 4ZO9A 1Q45A 2WKLA 4ZB5A 2BMBA 2OWXA 3RO8A 3TSDA 1J4EA 4D6EA 2V3EA 4W88A 3EWZA 3EPMA 4WXYA 4X3ZA 5EPDA 1EEPA 8A3HA 4DBSA 3BLEA 4MNJA 2PDLA 2VD8A 1SJDA 3F4DA 1IXNA 2FMNA 5I00A 1MNSA 3PTQA 4LV4A 4JNZA 3PFMA 3SQMA 1AQHA 1G7UA 3PSWA 1HW6A 4GD0A 3TU9A 2YSWA 2ZUUA 1NM9A 2ZX7A 1TR1A 1ZJAA 3KCLA 4GIYA 3U2EA 4MZ1A 4C65A 2WQPA 3BW3A 3B9AA 2QPUA 1WKDA 4OIFA 5D09A 3S6TA 1Q6OA 4IPIA 4WDUA 3N15A 3ZVHB 4EOUA 1XYZA 3ANUA 4JGDA 1F3WA 4J5NA 1R2RA 5E6ZA 1K7FA 4E6MA 3R2GA 3LZ3A 3UR5A 5ABHA 4A22A 1XI3A 3N2XA 3UZXA 4L80A 4KRTA 3QHMA 3BCDA 2GDVA 2XWDA 3NZQA 5G5IA 1VPYA 1YX1A 4Y96A 2HXTA 3SCPA 3LQLA 1JXKA 1K9DA 1H51A 3H2AA 4CN1A 4UNLA 4HHMA 2VI0A 5D2TA 2VWSA 5KMYA 2Y7GA 2A1YA 1PHWA 4GKLA 3PZQA 1VFSA 1ZP4A 1XXXA 2QEZA 4P8VA 3O6AA 1KFJA 3WFAA 2PCQA 1R3TA 2GPTA 3HN3A 5ABEA 2XWEA 2VM8A 1P7TA 4S3FA 1XRSA 4CU6A 1HQTA 1U83A 3C3NA 2E9MA 2JQXA 1DORA 3CUFA 4WJEA 1A5MC 3AXXA 2GJNA 5ENLA 4MVAA 1JUEA 3TTQA 5ECUA 1K7EA 4MWAA 3S6OA 4WSJA 5ABFB 3L67A 5HA7A 3R0UA 3UNTA 1DIKA 4RDVA 2AQOA 5EMJA 1B3ZA 1CYGA 1PZ2A 4TVUA 1D9EA 3LNMA 1VJSA 1GG0A 3GG8A 1TV2A 2VX5A 4UTTC 1JVNA 4DPQA 3I6EA 2O9RA 1H0IA 4WXZA 2CERA 4L9ZA 4RNIA 1JL8A 1Z9AA 3FVDA 4PMYA 1J01A 3GM8A 4F9DA 3QHOA 3O16A 1WCGA 4JL2A 3I6RA 3XINA 3PPFA 3ZZ1A 4KH2A 5LA2A 5D8ZA 1R86A 2WLZA 1RBOB 2BODX 4J7RA 1G0CA 3V5CA 5A8OA 4NT0A 2O4QA 3WQGA 4ZGYA 4Q7IA 3E96A 3WQ6A 1K77A 3VZYA 4B3ZA 2J7DA 1PWMA 3ISIX 4PCPA 4L6DA 3R89A 2W5FA 3CUZA 6CGTA 2EPLX 1FHVA 1V4YA 1KXTA 4ZO8A 1QPOA 3VFLA 1LWHA 4P8XA 2J7CA 2UBPC 4LAMA 3BUVA 4L65A 3LCFA 4FNTA 1JXJA 5FEXA 3LMYA 1KFKA 2FH8A 1V6WA 1QNSA 2Z6JA 4TX9A 1Z44A 1NWTA 3TNOA 3S2MA 1Y0EA 4PMNA 3W7EA 1ISVA 1TJ0A 3UD6A 4A3YA 2J79A 4RW5A 2XJ7A 4MM1A 5IOBA 3W7NA 2ZDRA 4E4UA 4ZODA 3MMUA 2BV9A 4Z17A 3WLKX 2X2GA 3PAOA 2IPGA 1TPVA 1LLZA 5GJMA 3UXKA 4ZR8A 3VPLA 1XIEA 4R33A 1M7JA 2HK0A 2V69A 3AQUA 1JRCA 3L23A 5G4WA 3OU8A 1GPFA 3HZ3A 4IPLA 3GG1A 5H8PA 3AJXA 3K8MA 3E5BA 1OT2A 3B03A 1DWFM 4OBTA 4L9YA 1G01A 4PMRA 3WUGA 5CSUA 3S1GA 2DV0A 3IUDA 4XZNX 4NUWA 2FVMA 1HT6A 3G8EA 3P5YA 3MBFA 1SZGA 2YCJA 1G69A 3IJ7A 4HNOA 3ZLGA 5C7VA 3B3DA 4S38A 4I7WA 3PZIA 3G22A 1AZ1A 1E6ZA 4WGXA 2ADAA 3M7SA 2ZOXA 1W17A 2GZXA 2MUCA 2OSXA 3O9NA 3W76A 1KQYA 1NF0A 3SBFA 3LCLA 1WP6A 4DBUA 2R82A 5EFDA 4ZFMA 1H4PA 4IMGA 3R12A 1PX8A 3TTOA 2GQAA 3HPAA 1OGSA 2QULA 4AD4A 3GC2A 2ZRYA 3WLJA 2FKPA 1U22A 2D69A 2ZX8A 3OO2A 4IP7A 1EA9C 5TIMA 4HKPA 1VZWA 4ML4A 1S39A 2E6YA 5FL1A 1JPIA 2Z1BA 5C70A 3LPFA 3CV2A 1M65A 4JHMA 3LENA 3GDKA 3EWUA 2PMQA 1JR1A 1U5VA 1WAWA 3FEQA 2BY2A 1DIDA 4UZUA 3RMJA 3CV1A 3AWOA 1GEQA 4PMVA 4MJMA 1WX0A 2JKEA 4OFCA 5JMUA 5HULA 4C6LA 2PD5A 4LF2A 4GNJA 2QGYA 3NXFA 2J8TA 1XIMA 1DJGA 4MHBA 4QE5A 2FZNA 3G5EA 2W4XA 4AZ5A 2WMJA 4CNNA 2TMDA 2OQHA 4NAFB 4WY0F 2VMFA 4K38A 4W8AA 2J9XA 4WGHA 3TKFA 3EB2A 1SW7A 4D6IA 3M5YA 4M81A 1XLMA 2NQHA 2XPKA 3VNZA 1GOMA 4Z1CA 2ZUNA 2VGBA 3AUOA 1SQ7A 3RM4A 4H83A 4Z42C 1NOUA 5JU6A 4E0CA 3VIMA 3W71A 3AIWA 3PAJA 4LUIA 1MDLA 3K8LA 4HU0A 4JY8A 3KM8A 3BLIA 5CGQA 2GGGA 4F4RA 1CXLA 4LS2A 4UOZA 1H60A 3NSNA 1QI0A 2BHUA 3B8DA 4C6EA 3IJQA 3CB8A 1HX0A 4X9SA 1W1TA 3ANVA 1C8QA 2VUNA 1BD0A 4XISA 3FYOA 4FO4A 3A5VA 1NTHA 2IMRA 4FXJA 1MQPA 4HJWA 1YEYA 2DDXA 2F6UA 4S39A 1T5AA 5FSDC 2OEKA 4WSKA 4AZHA 4DYKA 1ODUA 3JZUA 4AWSA 2A3LA 1IWAA 3ZWSA 1ONXA 2ONEA 1A80A 5B7ZA 3PB2A 1EF2A 4A3HA 1GGOA 3B0YA 4ZQMA 3RILA 1KC7A 1IGSA 2Y0FA 4MKVA 3GKFA 4O18A 1HIZA 1EA0A 4K3ZA 3RM8A 1PJ9A 2CKRA 1XM3A 5DLCA 3U2CA 2ZZ2A 1B3OA 4AHPA 4ERGA 4JZ5A 3QY7A 4IMFA 3N2CA 1JFXA 3NQ7A 3IVSA 2DORA 3H7VA 1CENA 5HR6A 1F8MA 4FLOA 4MY8A 3DG3A 3FV9A 2Y1HA 5AYXA 3OG3A 4E8GA 4HK6A 1VH7A 3KBSA 3JVAA 1TWZA 3UW6A 1K4HA 2XU2A 4CD7A 1J2BA 3AHXA 1RXOB 5E09A 5H91A 1H7XA 2VVSA 2NZLA 3QPEA 4B5XA 4WK9A 5G2IA 3W6YA 4F2TA 2F84A 2I9UA 2XIMA 3KWSA 1QOQA 3L5LA 4N02A 1EJRC 1EO7A 4HK5A 4A8NA 3FK4A 3W2KA 2FHBA 3TCSA 2Y7EA 2XGZA 2GGIA 3VXGA 4DWSA 4GYJA 2OWWA 3SEPA 2OEMA 1OFEA 1N7KA 2CWXA 1NFGA 1TTIA 1TB3A 1P6WA 4H9UA 1UPMB 4LJ3A 4GABA 4NI8A 4GI6A 3OZYA 2Q71A 3LMZA 1X6NA 2QCNA 4PTNA 4GINA 4AXNA 4M1BA 5CLWA 2NX1A 1XFCA 3T8QA 1XLFA 1FWTA 3QPZA 3UR8A 2X09A 1J2WA 4DRSA 4DXXA 3PR2A 3ELFA 2A4AA 4S3AA 2NSXA 3MCOA 3RR1A 5I3FA 4O53A 4DLMA 2ZWZA 4JQ4A 3SFWA 4QNEA 2VZSA 3STPA 3MZ2A 1HVXA 3R1ZA 1CIUA 1T96A 3SIMA 1GJUA 3MSDA 1EOMA 1LL7A 1N55A 4JS3A 2QDHA 1AH4A 1W3TA 3UCCA 3WFLA 3PBWA 3GFYA 3HQ1A 2JE8A 3RX4A 4G6CA 4AEOA 4F9JA 1P7TB 4AX7A 3BCJA 1OB0A 4RLIA 2AAAA 4HB7A 5CG0A 4JTLA 3T8LA 3Q2DA 3BAYA 1P43A 2XN2A 3DEQA 2R24A 1GVQA 2J9YA 4MWAB 1EWEA 3TQKA 2F6XA 3C8NA 3LS9A 2FPVA 4KWSA 3M47A 2E6DA 2HS8A 1RJRA 3QXBA 5JIPA 4RE4A 2PP0A 1RBLA 1XRFA 2FDSA 3ZS4A 1QNQA 3FIGA 1JNEA 1MO0A 4YLWA 1IHIA 4GRSA 1OG6A 1POJA 4QAIA 4KCWA 1KNWA 3AS0A 1VR6A 3UF9A 4AZ7A 3HG4A 4U2ZA 4UOJA 3G1YA 3WSUA 4POCA 2ZZ1A 4H6KA 4IPPA 4K39A 1PIFA 3MI6A 3AO0A 3F03K 3NL2A 3H2CA 4G1KA 3BCFA 1GG1A 1H5YA 1BSIA 3RNDA 4ZBCA 2J88A 2QUNA 1BVZA 2JIWA 5ABGA 3RLUA 3GE7A 2R1KA 3P0WA 5BOOA 4P7RA 2PB1A 1KQZA 4UZSA 4JIEA 1LORA 3GXIA 4BF7A 1FXQA 3CAKA 4UFJA 3IIPA 2XM2A 1DPMA 2WZTA 2TODA 1OF8A 2CIPA 4NZ5A 3SN4A 3V1PA 1M01A 2WSQA 5AOUA 5I3DA 4H04A 3QLDA 2BY0A 3UVAA 2A3HA 1LQ2A 1BVNP 3QY6A 3T07A 1PS9A 4M7TA 1JGIA 3W73A 3INPA 5D02A 2G3MA 4GVGA 3QPYA 1V0NA 3LG3A 2WNQA 3TONA 1DJXA 5BCAA 1R2TA 3TYBA 4US6A 3DFNA 1X98A 4JTTA 3A22A 1Z42A 5A8PA 2Z1XA 3H7UA 1IE7C 3LTSA 2XVNA 4EP8C 1MMFA 4D6JA 1E0TA 1CGUA 2CLHA 3QZEA 3GIYA 4JTAA 3KBJA 4LUSA 3B0XA 1PKMA 4KCVA 1EKOA 4F0LA 3EMZA 1XSIA 4KIEA 4NZFA 3BK0A 1XS2A 2PLCA 1XKYA 2ANUA 4IFRA 1KM3A 1UD2A 1H49A 4TX8A 2YYUA 3EX4A 5F7UA 3CT2A 4EWND 3URQA 4NIRA 1XQKA 2IUZA 5CZ0A 1R7AA 1YTEA 3WEOA 3QLLA 4JN6A 5I06A 4I9AA 1Q7MA 3FS2A 2BXZA 2DT3A 2GK1B 3W1QA 3SCVA 4NYYA 4UTHA 2F9RA 3QHNA 5A6LA 2PP1A 4WR3A 3OLGA 4HA1A 3TW7A 1ZL1A 3D47A 5EMLA 1L6YA 1ZHAA 1OGGA 1EBGA 1IZCA 1UR4A 2VENA 1OFRA 3G1FA 1VENA 1LG1A 3MPGA 3NQVA 3KL3A 3LV5A 4R3UA 3LN3A 3UR7A 4WY0A 3NEVA 2RGLA 3S5SA 1YNYA 1JUBA 1RVGA 1UKTA 3BW4A 3GXPA 1P0BA 3JS3A 3NVDA 1OX4A 3H2MA 4MB5A 4TTGA 1EC9A 1TV4A 3C2EA 1Y8BA 2NQLA 2GDQA 4QJ5B 4IISA 4IWWA 3VFCA 3KBVA 1HL8A 1NFBA 4LYPA 1K6WA 1VS1A 3BLFA 2E9LA 3S9ZA 3HFYA 2VNCA 1ZS2A 4UFKA 4AF0B 3P74A 2QCLA 5IXEA 1KBIA 4C6NA 1OFAA 1VPQA 3SGGA 1M1BA 4V1YA 5BXPA 1P0NA 3GR4A 1ZCOA 4QP0A 2FB2A 2NXHA 1LF1A 9XIAA 5KINA 1W2VA 2VO5A 4M82A 3RPTA 3GDBA 1V3MA 1GOIA 3LPOA 3OA5A 3N29A 2WHMA 3CTTA 3MT1A 3FW6A 3N2TA 3I10A 1OFOA 3EDFA 2PLMA 1XDMA 2BVYA 3RFAA 4YIWA 1J5TA 1GYNA 3LHTA 2DH3A 3MYOA 5CJMA 4DB7A 2NXGA 6XIAA 4WHBA 3NQCA 1U1HA 4FR1A 3HPXA 3UWYA 2Y6ZA 5D8WA 4ZXLA 1UWRA 3W6MA 5HNTA 1LWJA 4PR4A 3VDAA 2WO5A 1EJVC 4DJDC 4DJFA 4DI8A 5TAOA 3I4EA 4LBRA 5FL0A 3U5UA 4ZVJA 5F4WA 1QASA 1QK0A 3TAKA 5BROA 4OWGA 2FZDA 4ZOCA 3WBEA 3LQGA 2AGKA 1ELSA 2EG7A 4DUVA 1S2CA 3U4FA 4XD3A 3W1XA 2D3LA 1FKXA 2XH7A 1UR0A 2VCCA 2PD9A 3U4AA 4O14A 2ISSA 2W92A 1IWBA 4U5IA 4W86A 3E0VA 1HGYA 4GXMA 3FDKA 1FRBA 3TYEA 3AMLA 2XGBA 1V6YA 4OGZA 4J3WA 5JIWA 4RE0A 3GIPA 4C1NA 2VYOA 1OBAA 1MQRA 2PU1A 1PZ0A 1CW2A 5KZEA 2GFTA 4ATDA 4AQLA 3TYCA 4F2UA 3DAQA 3D6NA 4OZOA 2QGHA 5E0FA 4K8EA 2YL9A 1D2KA 4MDOA 4RDYA 4RZ4A 4HU8A 2VGIA 4FLRA 3QQWA 3SN1A 2W0UA 3QY8A 3O6DA 2J7HA 2GOUA 4H8NA 3WF3A 1UBSA 2PC4A 4LBSA 2WJEA 1N2VA 2ZA3A 1I2PA 1HKKA 2X1SA 2TRSA 2P8CA 1LROA 1KFEA 4AEFA 4RDZA 3DGRA 5U7SA 3PZ9A 4Q4MA 4NNCA 4PUUA 3CIXA 3GZ3A 3LRMA 4DWSB 1OT1A 3N11A 2Z2BA 3MB9A 3VIJA 3HQOA 3L12A 1OC6A 2ATMA 4MYXA 2YKKA 3GZAA 5D9MA 3L5AA 4P5UA 1TX2A 1VHNA 4IPNB 1QPQA 2WM1A 3CS2A 5DT5A 3E2RA 1NF7A 4EKJA 3M0LA 3TSBA 1FCUA 2Y62A 2BS9A 3LM3A 4OBSA 1UQZA 1ZPTA 4CN4A 1IZKA 3WN6A 1Q8JA 2VC9A 2V68A 3W1RA 1KLZA 2WWCA 3BLOA 4LUTA 3LYEA 4KFOA 1NEYA 4EXQA 1B3XA 4RE2A 5I3GA 5LXXA 2LLEA 3DGBA 3TOYA 1QI2A 1VYRA 1FFQA 1RPKA 2CBIA 4S3GA 2Y61A 5D05A 2OT1A 2B7NA 4GNKB 3ZT5A 1I0BA 5I24A 3QKZA 2VHLA 5HMEA 4C1LA 4N9CA 2CZFA 2E28A 3W70A 2PWGA 3LHWA 3LHUA 4BWLA 4JFSA 4QJ1A 1ICSA 1VHCA 3H8AA 2ZYFA 4NVTA 3BARA 3N2BA 1EX1A 2EXOA 3VIPA 3VIKA 2Y85A 2NVAA 3DBNA 2X0HA 2POTA 2QV5A 1EXPA 1UOKA 4MADA 1G94A 2UY3A 2YB1A 3II1A 2Y5JA 4V1XA 3LSCA 3S5ZA 4FXFA 1ALDA 4HSHA 4ICNA 1YTKA 1TPFA 1V0LA 4AIEA 4CVUA 1QATA 3TDFA 4BEQA 4GQQA 3QW3A 1A4MA 2P10A 5DMLA 5CC3A 4V15A 3PSVA 1RH9A 2E6FA 2JALA 1CNVA 2C19A 1XUZA 2DVUA 2YA2A 3PK7A 1LBFA 3IARA 1KR0A 4W85A 3M0KA 3GTXA 4QFUA 3WDPP 4ZOAA 5AHFA 1G4SA 1HO4A 2DZWA 3BLLA 4G7EA 5C9XA 4HSNA 3AS3A 4M3PA 1YW1A 3R5EA 3RIKA 1EYEA 1WAUA 2A3EA 3WLTA 3L4XA 4AWEA 3WBXA 3E5PA 4QDMA 4GO9A 4MYAA 1WZAA 3MYPA 3MUAA 2JF6A 3BAKA 4OUEA 1SZEA 1C7TA 3W83A 4IIBA 1Z48A 3VKKA 2GVEA 1E4NA 2C91A 3N13A 1L6FA 3BGGA 2V5DA 1MXGA 1QVBA 2F38A 1Z32X 3CMFA 1F76A 4DO6A 4B92A 1UOZA 4ATLA 3U2ZA 2VEMA 1FWNA 5LKYA 5IM51 3E0IA 3QEZA 5LIUX 2V2CA 3PBUA 2E0PA 1UH3A 2DZBA 3VCCA 1CGXA 1RA0A 5E9XA 4IFKA 1CXEA 4EF8A 3H2OA 1JG9A 4NHVA 1KCKA 2BWGA 2XISA 1XCFA 3TCEA 2WK2A 1WB0A 3GU2A 4O1EA 1QT1A 3GU1A 3THUA 1QHOA 1LUCA 3HGSA 2MNRA 2VOMA 1VFHA 1BRLB 1IIGA 5D32A 2I16A 1PIGA 3GX9A 3ZLFA 4XVEA 4PL2A 1B0IA 3GU9A 2VP8A 4E5TA 3M64A 3W7MA 4Q8MA 5L9FA 4IGSA 1RCQA 2Q8XA 4Y8FA 4ADTA 3TFXA 3C2YA 1QNOA 1L8PA 4EPKA 1U1JA 3EKGA 1Q7ZA 3W2MA 4ZE5A 1E55A 1I2OA 4UTFA 2XIQA 5HDRA 4D1IA 2Q3OA 5IHSA 1VYPX 1JCJA 1RK5A 3GXTA 2EHHA 3E6EA 5E93A 5H6HA 3LDVA 3W0KA 4PB5A 2NQ5A 2CBJA 2PTYA 2VQTA 1OZMA 2YL6A 1XIBA 1DV7A 3OPSA 1B3WA 1KFBA 3LXAA 3WELA 4HHLA 4CCCA 3WUFA 3LPPA 4XAGA 3GY1A 2ISDA 3TTEA 1G1YA 1WO2A 3RCYA 1YXDA 2DEPA 4JNMA 3M0MA 3CLMA 3DFPA 1KBJA 4C6FA 4O11A 3S4TA 1QPNA 4XO6A 3VX1A 3ABRA 1SO5A 1O5KA 3E1F1 4PUKA 1KV8A 2W27A 3WUBA 2I57A 3ABOA 1JJKA 3APGA 1R9YA 5DMNA 2ALDA 1M03A 1OVDA 2HPIA 1XIFA 3MSGA 4WY0B 4CCDA 1N8IA 1LWIA 1XP3A 4PBGA 3URNA 1NQ6A 5KEZA 3D46A 6TAAA 4DI9A 4TMBA 1OX4B 3GNOA 3G0SA 1PPIA 1G4TA 1W9DM 1L0PA 3V35A 4ZB0A 1GVSA 3LB0A 1DQXA 1KRAC 3MQTA 2R1MA 4NJGA 4H9ZA 3UXDA 4QGCA 1US0A 2QVNA 1DEDA 1UP0A 1ZFJA 1EB3A 3ITYA 3VNJA 3UR2A 2VRJA 3O2LA 3CU2A 1EDGA 4PMJA 4CN6A 2RH9A 2CITA 4Y6GA 4Z2GA 5EB8A 2QCMA 3GAYA 3V18A 1ESWA 3Q4DA 4E2DA 3UWVA 3MTWA 5EBUA 4UFIA 3A21A 1Q8AA 2O56A 1GOKA 3OEXA 1OEPA 4FP1A 2ZUWA 2C79A 4AG0A 4FOUA 4GCAA 5XINA 1W5MA 3NIYA 4JIQA 3KAOA 4P7LA 1H1ZA 5HUOA 4QEHA 1AH0A 2J75A 1BAGA 1VIWA 4AZIA 2HBVA 3H26A 2PPGA 3TAOA 2OFJA 1TPUA 1MSSA 2O7QA 1DIOA 4GZ7A 4KETA 5D37A 4Q8WA 3W00A 4GVIA 1MQQA 2A7PA 2WMIB 3S2NA 2NQZA 7A3HA 4M19A 1KRMA 3QMSA 3ANYA 1TE1A 1S1RA 4NI3A 1J18A 3DC0A 3RPDA 3LXCA 4RUBA 3EOSA 3LEPA 2EG8A 2FQIA 4GZJA 1W8SA 1ZENA 3VD7A 7ENLA 4BI6A 1KGWA 3QZ6A 4D8ZA 1RA5A 3MP3A 1FP8A 4IQJA 4MNKA 3DFSA 1UC4A 3GH5A 4QROA 1QUMA 2ASHA 3R8RA 5FCZA 3FA5A 2PDXA 3B06A 3PJXA 4JTUA 1D3HA 3PANA 4OE7A 3R13A 2UY2A 4JCLA 4JTCA 2C8NA 1F74A 4CEUC 4BJHA 3NJ3A 4P8UA 4C1NB 1CCWB 3PBVA 3TWBA 1F7BA 1VBJA 4GZEA 3UWQA 3L5MA 4DXKA 2G0WA 3N6QA 3W7JA 3FX4A 3UXIA 1T0OA 6PTDA 3VOCA 1OINA 3NA8A 3P80A 2OKTA 1EX5A 3W7OA 3RUBL 1E6XM 4QS6A 3NGFA 2FFIA 1YE4A 5C2CA 3VDHA 4GY1A 4IGNA 2E25A 4LRSA 4DWSC 3G3MA 1ODZA 3SY1A 1OHLA 2BX7A 2EPHA 3AALA 1UMLA 4IG2A 1F9CA 1M7OA 3IVUA 5JVLA 3MV01 4GXWA 4MJ2A 1W3JA 3GG7A 3VIOA 4S1FA 2ZC1A 3W1NA 1PB0A 2EEXA 5CJNA 1K3UA 4WZHA 1TPEA 3M46A 3T09A 3VGDA 3GYEA 3MCNA 3F4VA 3QTGA 2GJPA 4PUNA 3IJDA 4NZ4A 4Z1AA 4F0RA 1YPFA 1HF6A 3TR9A 4AIOA 4I6KA 3TMQA 4C7FA 1L6GA 3SJNA 4S3BA 1R3WA 4QSHA 1B9BA 1US2A 3UWWA 4ZQPA 3THAA 4O1FA 1VF8A 4W5ZA 5EYWA 3LD5A 3B8TA 1DIEA 1S38A 3UESA 2VDHA 1W1IE 4FLQA 3APYA 1OM0A 3FYPA 3ME3A 4UWMA 3XIMA 4O17A 1N8WA 2P76A 1GW1A 3USZA 4Q8VA 1RALA 1HKWA 1LM1A 2XVKA 5AHEA 3AU6A 4PEEA 4F0MA 2JF7A 3C6CA 3U7VA 4E8CA 3OW1A 3I4KA 2DIKA 2GQ3A 3WD4A 2A21A 1H7NA 4M24A 3BGJA 5AVNA 1A5AA 2Z2UA 1A5OC 4Q8UA 4PN2A 1QMLA 5BU9A 3LZ5A 5FJIA 1TA3A 3CMJA 2OZ8A 3SAZA 3DYOA 2DY3A 1B54A 2FGBA 4LX4A 4QAWA 3NPWA 3R6IA 5I5RA 1T6MA 1EQCA 2VFHA 2ZZ6A 3S2LA 3SCQA 3RPMA 2DJXA 4BQ5A 2P3EA 4NZ1A 5C71A 4J40A 2Z00A 3S2CA 1PIIA 5KETA 3AYSA 3STGA 3V5OA 1AUSL 4H9TA 2CBVA 1TIMA 1I75A 4C6KA 5CEWA 3UP8A 5AHNA 1XLCA 2PI6A 1E0WA 1OSEA 1OF6A 3POHA 2AKZA 4J28A 4L6OA 4NJJA 5D9PA 4XUGA 1DWAM 4YWIA 5CPMA 3J7HA 3HPSA 4WDTA 3KVJA 3GVGA 1WDWA 2X7WA 3ARQA 4HNCA 4YPJA 4LXFA 1VLWA 2AMGA 2CLLA 3M0ZA 1OIMA 3HMCA 3SIZA 3NPXA 4JN8A 3NDZA 4AAJA 5IDZA 2I9EA 2CFFA 4FEZA 3JW7A 4A8LA 3QVQA 4M0XA 1YIXA 2ZUVA 1BG4A 2Q8LA 2PFHA 4QDWA 1EIXA 2R94A 3SM0A 4AB4A 4EPEC 2BB0A 3NL6A 6ENLA 1QO2A 3FSTA 3DKJA 4M5PA 1UJQA 2PLJA 1GZGA 1PAMA 1KKRA 4H9VA 3WNOA 3F5KA 3LRKA 4UR8A 2QJMA 3VNMA 4HHPA 3PG8A 4ECLA 2WCAA 3UPMA 3WMCA 2ZUMA 4IPJA 3U2OA 1V3HA 3WNMA 4Y9PA 4TV5A 2XINA 4M6UA 4IIGA 3EWDA 3CBWA 4LY4A 3AXMA 4GH3A 4ZO7A 2QCDA 5A2BA 3NSMA 4IFKB 2EPKX 5I03A 1KM5A 3PZOA 1KM6A 4IFOA 2RDWA 2ZA1A 3H7RA 1Z69A 3W26A 5DRCA 4XIAA 2INEA 2YFNA 1JZ3A 5C54A 4HNLA 1LUCB 1S2AA 1UJPA 4JTGA 1I9CB 1K7XA 3W4RA 1KO0A 5LNSA 4HNTA 2PEVA 3F2CA 3A9BA 1MI3A 1RBAA 3W9ZA 5LNWA 3KOXA 5HPOA 1QW9A 5GQBA 2B81A 1L9WA 4A3QA 5A6MA 2YCKX 3T6CA 1HKJA 1FDYA 3Q65A 1C7SA 4TV6A 1KM1A 2R1PA 4YXGA 1V02E 3BDKA 5EA9A 3PZVA 1XYCA 5DY2A 1QNRA 3GNPA 4UB9A 1PCKA 3UWZA 4LB4A 2PP3A 3CUIA 5LNVA 3TZFA 1A3HA 1RQHA 1WZKA 4IM4A 2HV5A 4UTWA 2ZA2A 3WNLA 1J5SA 2QCFA 2YX0A 1EO5A 4F66A 4W7WA 3PUEA 1TPH1 4CD6A 3ZO9A 3PBGA 3PWIA 1CX9A 2VZVA 1EC8A 3KS6A 3FA4A 4FNPA 4HIBA 1HJWA 1OCJA 1UMYA 4DJDD 5AYYA 2O9OA 1TPWA 1VJIA 1RP9A 1SFJA 5JH1A 4JL1A 3MMTA 1G7VA 3N25A 2FGLA 2G3IA 4LVFA 1MUWA 3HTWA 3BW2A 2Z1VA 3EEGA 3QJAA 1MRQA 4UTJA 1SSDA 2DZXA 4K8HA 1XYAA 4OECA 3S9YA 1SJAA 1X1NA 1Y5WA 2BDQA 3PC0A 3EB3A 4A29A 5C5YA 1R3QA 2YPIA 1EHAA 3OLIA 5DELA 1VGAA 4XUYA 1CTNA 3QGVA 4HZ7A 4LYKA 2G4JA 2YOCA 4D8LA 3E2QA 4O8RA 1XLBA 2DT1A 4QIUA 4ZXOA 1GKRA 1HUVA 1QTWA 4GGBA 3ITGA 1ZNNA 3DESA 4F0SA 1Q2SA 3KL5A 4GUJA 1CXIA 2W61A 1JZ5A 3TP4A 4QE1A 1DXEA 3N12A 3G1HA 4FIQA 1XYMA 3AZSA 1G9HA 2GVLA 1KBKA 5RUBA 4J3VA 3TFCA 2Z6IA 3LERA 2Z28A 1EXBA 3IV8A 4CU8A 4DJFC 1ZBWA 1EPXA 2P88A 4ORIA 1CZ1A 2V5BA 3UA3A 2QCCA 3XISA 3N4EA 3N4FA 3GKAA 5HJLA 2O4MA 1WBJA 5HOSA 2I7GA 2VC6A 4GC4A 5I23A 4GHRA 1JPDX 5HQLA 2X41A 1W1YA 3M5VA 3IK2A 3SRDA 3V0UA 4AY8A 4LRTA 2VEGA 3WQWA 2QF7A 5M03A 3VUSA 4WF7A 4S3KA 1S3HA 4RNJA 4ACZA 3POCA 1ZAJA 3KVMA 5DBUA 1ZGDA 3OQEA 3FJ4A 2XSBA 4KWWA 4OBRA 1FFRA 4KGJA 5TF0A 4ZOBA 2QPSA 3TJ4A 1OCNA 1H5VA 4CQBA 5CGMA 1UPPA 4D6FA 3V75A 3ERPA 3MO4A 3LM7A 4EPBC 4EE9A 1F5ZA 1P48A 4Q7NA 1MW1A 2NX9A 4QCFA 1OYBA 2HNEA 4PRWA 4Q4RA 4PYSA 1O6IA 1LCOA 3URAA 1O1ZA 4NASA 2G3JA 4Q6XA 2ZCGA 1TQXA 1IEXA 4YTSA 3DFOA 4XV0A 3CHVA 3EYPA 3GD6A 3C2VA 3KVKA 1BWLA 1VFMA 1A5KC 2Q01A 4IT1A 3WEZA 4HA3A 2ZE3A 1XLGA 4B4FA 2OX4A 4JKMA 3KL0A 4DF0A 4BQ3A 5FF3A 4IX0A 2MANA 5D2XA 4IG2B 4B5VA 2E7FA 3KHJA 2Y88A 1ADDA 2ZADA 4I3GA 3BSHA 3KFTA 2DSWA 2QDDA 1EGVA 4A3RA 4YVVA 2QIIA 3EAUA 4W84A 3O07A 3K30A 1OIFA 2PDIA 3EX6A 4EACA 4IJRA 1H7OA 3OYZA 3WMBA 1FWFC 2XSXA 1QJWA 3SGUA 3CHEA 3DFTA 2OMAA 3NO3A 4MB1A 2HDJA 4PC8A 1J0YA 3W2LA 3S8HA 3Q67A 3T2PA 5EMYA 3R11A 3SN0A 3LXBA 3CT7A 3LGEA 4AVOA 1E15A 3BG5A 1XSJA 1LQ0A 5DXYA 4LV9A 3W25A 3ZVHA 1IV8A 1LOLA 1YBQA 1A53A 1PHQA 4D8AA 1DWJM 3GHUA 3QQ1A 3P61A 4DJEA 3AHZA 1UG6A 1W2PA 2OGYA 1X1OA 2XHYA 2PGRA 4PMOA 3OQ8A 2QV4A 3THQA 2VX7A 5HQEA 1WUEA 3F4CA 4HTYA 2Z1SA 1W9UA 3BPWA 1YRRA 3LLDA 4BWLC 1NWRA 2YIHA 1SJCA 5C9UA 2EJAA 4FXRA 5CSRA 3FHAA 2DSZA 2BP1A 4OQVA 1YYAA 2E1WA 5C8BB 4LTSA 1XIHA 1JPHA 2HEJA 1KWGA 3IEBA 4C6DA 3E0WA 1AH3A 4FX6M 5HQMA 2O9TA 4MPQA 1VEPA 1E73M 4L1GA 2NT0A 3TQVA 1TA3B 2BVTA 1J0HA 3HURA 2F61A 5C9WA 2B0MA 1I2RA 3DI0A 3DECA 4IGHA 1UR9A 2EKCA 4R9OA 4PH6A 2FHCA 4GJIA 3UXAA 4OOUA 5HATA 2WVVA 5FJTA 1EP2A 1RLDA 2VJXA 3PM6A 1Z8AA 4L56A 4UQAA 2VQUA 1XYLA 3H23A 4FNQA 2J4GA 1PUDA 5DCDA 4CLMA 4PB4A 4WDXA 3VE9A 1UP2A 2ODOA 4GG9A 1SFLA 3DHUA 3W1MA 2W79A 3YPIA 5GNXA 4YVXA 5JBEA 1ADOA 4IL0A 1UZ1A 3QKEA 2QJIA 1W9XA 3EXTA 3OBKA 4RPPA 1WNOA 3CL8A 4QTGA 1YXCA 3WF4A 2C1IA 4D6DA 1FTXA 3DUGA 3UA4A 1B31A 4HYRA 5D2YA 4HN4A 2JK2A 3T05A 3K8KA 3C0JA 5HAOA 5MKGA 3NQEA 3MU7A 1YNPA 3OGRA 3RLGA 2B7QA 4GFSA 4K1WA 3M16A 1QU4A 1MW2A 3TXVA 3OOQA 1BGAA 1T8XA 1BF2A 1D3CA 2H3DA 3M0YA 4RV3A 3ZJ6A 2QKFA 1JF6A 2VFFA 3FJ6A 1S1PA 3GTHA 2WBGA 1KRBC 5AC4A 3H22A 4R34A 4F40A 1X39A 1Y5XA 2DH2A 1GT8A 5EKYA 3W87A 5I07A 5IFTA 4KIRA 4QJ4B 2QCHA 3W2NA 3CZLA 2WOQA 2R6OA 4EXAA 4G8TA 1ZAHA 5M17A 4V2XA 3LPGA 5D2VA 3P62A 2HVNA 1MUMA 2OYLA 4BR1A 3RAOA 5FEWA 2DZTA 1HZYA 2FB3A 2PTZA 3T44A 1OFBA 4CQAA 3U48A 4JNYA 3PHAA 1R30A 3ID7A 3CIVA 4W93A 4JTQA 4HSOA 2FZBA 3KRUA 3FHQA 4MY9A 4TXEA 3TYAA 4F0HA 1EIBA 2RUSA 2E6AA 2HS6A 4H01A 1K03A 1E72M 3C56A 1LZOA 3HM7A 3O63A 1FBAA 2YXXA 4IIEA 3U8GA 5AECA 2HVMA 4AIBA 1GVOA 3CMGA 3KTCA 3VABA 4H7VA 2O0TA 2BASA 4AY7A 3LUTA 1GCYA 1L6SA 4LF1A 3EXSA 3R4IA 3CQ0A 3GDRA 2ZE0A 3MJMA 1HNYA 5BRQA 4QNWA 3CAVA 4DF2A 4UCGA 1FKWA 1QR7A 2A85A 3C4UA 1T8QA 2F2HA 2P3ZA 8CGTA 3UJEA 1J8VA 3NQ2A 1HO1A 4CVWA 2D0HA 3W07A 4E38A 4UTUA 2O9PA 4JQ3A 3PUDA 3WDJA 1GHSA 4WJ8A 4DUOA 3B0UX 4M80A 2C15A 2YL8A 5I3JA 1EPVA 4LCSA 1OADA 3OBAA 5FF4A 2WC4A 4UFMA 2J74A 3W28A 1I45A 3M6DA 3TYUA 4GVHA 3AMKA 3E3HA 4JTHA 4H9YA 2QUVA 1OFDA 1X7FA 2CNCA 3NM1A 1GQIA 4U2YA 3VOFA 1RVKA 4L4PA 3K1DA 4C5YA 3A9IA 4X0VA 4HU4A 1KFWA 4DM1A 3QOMA 5U4NA 3VIFA 2TAAA 3L0KA 1I6NA 5BXRA 4NAFA 3IIOA 4DAIA 2R9RA 3E74A 1F3TA 4KT2A 3W24A 4GNVA 3T55A 1M04A 1GQLA 3MP5A 4QLLA 3T0AA 9CGTA 1JDDA 1DTUA 2C14A 5H8UA 3NQ8A 3IJ8A 4A4AA 1F4HA 1XGZA 2Q09A 4MNLA 4WIWA 1Z3NA 1ZCCA 4LB3A 3OLEA 3UJFA 4N42A 4DBDA 1R46A 2J8GA 4RZ6A 3NAVA 2E67A 4GLEA 5A94A 1KV5A 4GJJA 2GSHA 4UQ9A 3O06A 2D73A 4TU1A 3WJZA 3N1AA 4DWSD 2J25A 3L4TA 4GE8A 4BKNA 1E1CA 4A21A 1MYRA 1W5NA 2VKZG 3ABZA 1J6OA 3IJ6A 1S5MA 2EPNA 1BGGA 5CPOA 1JNDA 3G6MA 1TCMA 1XW8A 2GDUA 4GI4A 2OELA 1NP0A 3EZ4A 4WKAA 1K1DA 1Q13A 3PZNA 1TTQA 2W6RA 2X40A 3CUJA 3ZVIA 4H9XA 4QITA 2X7VA 3MKCA 1W5PA 3RXZA 4J3XA 3S9IA 1QI5A 2W91A 3N17A 4EANA 2C71A 1NDZA 4JFWA 4ACZB 1PTDA 2UWFA 1HG3A 1OQFA 4ES4A 4RPQA 1HN1A 4HCHA 2V63A 3ARPA 1XLIA 3A3WA 4JEJA 6ALDA 5J5DA 3OVRA 3GIQA 1FWJC 4U28A 2D2OA 8RUCA 3VIHA 4UXDA 4DJDA 1LOQA 3WK1A 2PU0A 1XD1A 4AZBA 1P4CA 3H12A 1BXNA 2C18A 2X8RA 3KCOA 3B9EA 3PBYA 3P6LA 4K68A 4DLFA 4WLCA 2HQAA 4E2VA 2CW6A 4HA0A 2R14A 5DX7A 3MUXA 1W6TA 1TO3A 1E6QM 1LG2A 4NL1A 4CNPA 3UVIA 1GQNA 3UJ2A 2G97A 2ZRZA 1EJSC 4P7NA 4NP7A 3T40A 5FESA 3HO8A 2Q6ZA 2XFFA 5TQLA 3N34A 2V3FA 4LY8A 1QI4A 1PDYA 4K7YA 4I9MA 3SJ3A 4P8WA 1WV2A 3MKVA 1JRBA 2QT3A 1ZALA 1J11A 1MEIA 5BWFA 3KWXA 3DCPA 4MKSA 3KTSA 1BYAA 1H7RA 1LQAA 4Y90A 3H6OA 1RD5A 2V3GA 1FWBC 1ZY9A 2ZFAA 4HPNA 2GQ8A 1CI1A 1ICQA 5T26A 3QR1A 1KLYA 3OA3A 4GVFA 3AHYA 5BNKA 2QHAA 3AUJA 4UFLA 2CKSA 3N6HA 2TPSA 1EC7A 5LNUA 3BAWA 5LIYX 4X0NA 2QAPA 4L9XA 3KBNA 3WNNA 1YBQB 3H53A 1UR2A 2CC0A 1K4GA 3EEZA 3VD5A 4BZYA 4NY2A 3F2DA 4ZSUA 1K9TA 2VWTA 5CZSA 3LCIA 2J47A 3VUPA 2OXNA 5BXSA 2FLIA 3CZKA 4JTRA 4LVGA 3TH6A 2J77A 2Z25A 7TAAA 1C8VA 3BO9A 4HQVA 4F2BA 4HOXA 3W6LA 4YYCA 4ILSA 3VCRA 2OO0A 3S1VA 3BAJA 3OLDA 5CPTA 2CEQA 3UERA 4Q4SA 4GY7A 1BVWA 2UY5A 1RUSA 1UZHA 3LCWA 4XD6A 1S3TC 1KCLA 3EA2A 1X1ZA 1EZ2A 4A2RA 1BPLB 4MNMA 4CKQA 3RLVA 4XQ6A 1XR2A 4C6BA 3AS2A 4NYUA 1D7FA 1FY6A 1R85A 4MOZA 4I9JA 4N0RA 2W3ZA 3RHGA 3N19B 5LIWX 4D9PA 1E4MM 1E0UA 1VKFA 3CUGA 2WVVB 1TUFA 5D33A 1KTBA 3WQEA 1T7LA 5FSEC 1LT7A 2VDIA 4UR9A 3VM7A 1BQCA 4HA4A 3LTYA 1WYIA 1GVIA 1FHLA 3S1WA 3F5LA 1Q6RA 5IBXA 4FALA 3GXMA 4JQ1A 1U30A 5H1WA 3S2JA 1TJ2A 4NX5A 4IIFA 1W5QA 2EF9A 3CQKA 4Q4KA 3IUHA 1B5TA 2HSAA 3EMCA 1E6SM 5TNVA 3CJPA 3PNZA 3G0UA 1B4EA 2OTDA 1Q6GA 2WSKA 1AG1O 4XAPA 4FOKA 1K02A 1FOBA 4FK9A 4LC6A 3MUY1 3TA6A 5M2FX 3NOYA 5DMMA 5MKGB 1V5XA 2WNWA 2Q3RA 5F2LA 4J35A 2X2YA 5BMWA 4CGTA 4TO8A 4OOZA 4J2MA 4R9XA 1Q6QA 4FIRA 2E5CA 3RX3A 1V6XA 3PZMA 4AD2A 1IEWA 2PWUA 4TX6A 5DANA 2A3AA 1P0DA 3MBDA 2E68A 1TRDA 5D03A 3W37A 3EPNA 4U10A 1KW1A 1AW5A 1P1XA 4LNCA 3AIUA 3I7SA 4JKKA 3ZIZA 4H8HA 4INFA 4YYFA 3OZPA 2VXNA 4PFHA 3RCNA 3VNIA 2ISFA 2CLIA 3LBMA 4U33A 2DQWA 2FMOA 1SM9A 1A0CA 3QZAA 2WZIA 4IQDA 1V93A 1IXQA 4S3DA 3EWBX 4H00A 3W27A 1XWYA 1FCVA 4JIPA 4GI9A 1DHPA 4S2BA 1JCMP 2VD9A 1CGVA 1UD8A 1TREA 1BKSA 4QBXA 2O55A 2WCGA 1XLEA 3FJLA 1SO6A 1CGWA 3BVJA 4Q33A 1K70A 1XPGA 4JCMA 3IAQA 3WJWA 3WNKA 3EOEA 1ME7A 5JBFA 2A3BA 3TIMA 4O52A 2OJPA 2HZGA 4NF7A 4QJ3B 4DX3A 3D3AA 4UTWC 3PUOA 3PZTA 3AYRA 3O8AA 1DWHM 4DEFA 3G1AA 4C1KA 4H19A 4B5SA 1XBZA 3NM3A 1SO4A 1PE1A 2PDNA 2YJQA 1O95A 4AYGA 1RP8A 3ZXWA 1E4IA 5I2UA 3TN5A 1W1PA 1M53A 3VM5A 4H4IA 3TMLA 1X6LA 1CXHA 2GK1A 1IEQA 4DJFD 5LHFA 1UROA 3FA3A 2OPJA 3VTRA 3W84A 1EWDA 3URBA 4AZCA 2F2KA 3W7LA 3C8FA 3W1AA 2FZ9A 1GOXA 5TBOA 2X05A 1CDGA 1X7IA 1C92A 3KDOA 4XWUA 3QYSA 3W75A 3VZXA 3MS8A 1KD0A 3IJ9A 3KEHA 1TV7A 1F4AA 4CNUA 3QBUA 4FF7A 4GK8A 3A5FA 4FI4A 4LALA 1LP6A 1E9YB 2WAGA 1O60A 3NL3A 3AYVA 3B40A 4LVAA 4PBFA 4Z2LA 4QLJA 2PUZA 1E5NA 3DIPA 2R91A 4XB3A 3CPRA 3K46A 3ITTA 1V02A 4RL3A 4DZIA 3WD2A 2XH2A 3BANA 3DFYA 1A5NC 5KZMA 2VGFA 4Z2JA 3KX6A 4MLRA 3EX1A 5K9CA 2J8FA 3VMNA 1DOSA 4I90A 4LBUA 4WOQA 3HGJA 4GQGA 4AF0A 1L2UA 2QJHA 2XUCA 3TWAA 1X8FA 2GSEA 1GK8A 1RY8A 4HNUA 1OFPA 1KFCA 2PWFA 1MUCA 3P60A 2EAWA 1H7WA 4FR6A 4URIA 1AFSA 3KLLA 3GC5A 3WJXA 4D6CA 4ONVA 1AL7A 2NX3A 2OB3A 3BOFA 4U3CA 3VNYA 3PB0A 4D1JA 4J3TA 3ZJ7A 1RQBA 1WKEA 5FF0A 1JULA 5A6AA 1E1CB 1YDYA 3EWCA 3SUUA 2XVLA 1FA2A 1XQLA 3NNTA 2NWRA 3R10A 1AQMA 3V0SA 3ABQA 1XSKA 3PFRA 2ZVIA 3LLXA 1XICA 3A4JA 4HTBA 2PZ0A 3HF3A 1W91A 3MC5A 4DIAA 3CYVA 2DVXA 4RCXA 3H2FA 3SGZA 1FWDC 3WLSA 2WKJA 3U5YA 3TLLA 4GFIA 3AIVA 4PGLA 3ZLHA 4XAYA 3KOWA 1H1NA 3AWNA 1R5YA 3VDBA 4G56A 1FCQA 5LSMA 4ZL1A 3NQDA 4IH3A 2PA6A 4BF9A 4IZGA 3Q94A 5GPRA 5H2ZA 3IIXA 1A50A 3PWAA 1SW3A 4I7VA 1HJUA 1JPMA 3RX2A 4HBKA 1VJZA 4A8IA 3MSYA 4GIAA 3CB3A 3GVRA 4YTRA 4Q6JA 3TXZA 3GBDA 1KB3A 3AI0A 5FOOA 4JY9A 3WDRA 4ZA0A 5J04A 1GVRA 4DAFA 3CZGA 1REQA 3HMJG 5BOEA 4UNIA 4IIHA 1H41A 2VC5A 4MJ4A 1XG3A 2PZNA 4O4WA 1NJJA 1L8NA 3WDQA 3PTKA 5HBFA 5JUVA 1D8CA 5C0QA 1H11A 5CZKA 1QI3A 3RN6A 2VRQA 2PF8A 1A0EA 3W7DA 4DUWA 3FY1A 4HNNA 4AW7A 2JEPA 3V1HA 3FEMA 4J2PA 1UD4A 2JFEX 1XDJA 3IGHX 1M68A 5CSYA 4PCNA 2TYSA 2PC8A 1Z89A 5GJPA 5LIXX 4ORMA 5K4XA 3QV7A 1HGWA 3C0QA 5LNRA 3GDMA 3STFA 1YDVA 4NSBA 4C7GA 1F05A 4LAZA 1OC7A 4DJEC 4MFDA 1JI2A 1SVDA 3VIGA 2B7PA 5AN7A 3SECA 1DXFA 5CJ5A 3OZMA 3GAKA 1WPCA 3VKAA 1QDSA 3CAWA 2EGZA 3LV6A 3CIWA 4IMCA 3ZWTA 1V51A 4W89A 2VEKA 2CWNA 1CPUA 2BOFX 3AIBA 5GNZA 1HKVA 1UIPA 4CNSA 2HISA 3TROA 4HZMA 1GZ1A 1GZJA 3I7QA 4TOQA 1UWIA 1P6CA 4CU7A 1TSIA 3KRBA 2ABAA 2X0YA 2PDBA 1CXKA 4MAZA 4MTVA 3K4AA 4JYEA 1ZP3A 3RK8A 1TZ9A 5HJYA 1V3KA 3WDHA 3W3OA 5I78A 4JTEA 1I8JA 3V36A 5CSSA 3VO0A 1AVAA 3ZJKA 4DHGA 3T7VA 2RAGA 1O5XA 4UBPC 1JZ2A 4XG1A 3C5QA 1HXJA 4GH1A 3EDKA 4J3ZA 3OZOA 4IP4A 3GW3A 2FPTA 3LCGA 1PTGA 4HYVA 4LEQA 5DEZA 1E70M 2WVS