2PDPA

Human aldose reductase mutant s302r complexed with idd 393.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
b'ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLRCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdpA00
4JQ2A 2A79A 3UZZA 1ADSA 3WCZA 1HW6A 2FZBA 1ZSXA 3V36A 4IJRA 4XZMX 4ZFCA 4YVXA 4DBWA 3T42A 4EXAA 3ERPA 2WZTA 3G1RA 4L1XA 2IKGA 4XO7A 4JTDA 4JTRA 4H8NA 2IQ0A 4DBSA 3QKZA 4JTQA 3RX3A 4Q3MA 2C91A 2BGSA 3N2TA 3UYIA 1YNPA 5M2FX 2PDIA 5HA7A 3CV7A 1R38A 2QXWA 5LIUX 2PDKA 4JTAA 2PDWA 4WEVX 4XZLX 4JQAA 1A80A 2PDHA 5LIWX 2IQDA 2IKHA 3ONCA 4FALA 4PUUA 1T40A 4GCAA 1RY8A 4GQ0A 1K8CA 4JIHA 3R8GA 3R6IA 3GHUA 3ONBA 2PDCA 1HQTA 1Z89A 3WBWA 2FGBA 4Q7BA 4XK2A 4XZHA 1IHIA 2IPWA 4PUWA 4XVEA 2ACSA 1ZGDA 3EB3A 5DANA 4GIEA 2DV0A 4HMNA 4ICCX 3C3UA 3LQLA 3NTYA 2HEJA 4PRTA 1JEZA 4FZIA 5AZ1A 5HNTA 4XAPA 4WDTA 1Z8AA 4IJCA 1Z9AA 4LAUA 4YU1A 2F38A 3WBXA 2CLPA 4XZNX 1J96A 3GHRA 4WDUA 1PZ1A 2PD9A 3LEPA 4LBSA 3UZYA 3N6QA 1M9HA 2ALRA 4H7CA 4R9OA 2IPFA 1Q5MA 2FZ8A 2PDJA 3CASA 3LQGA 3UGRA 1ZQ5A 3BCJA 4RPQA 3U2CA 3BV7A 3CMFA 2PDQA 1IEIA 3EB4A 3V0UA 4JIIX 3CAQA 3LD5A 2PDNA 1EF3A 4JQ1A 4WRHA 3V0TA 5JH1A 3O0KA 3RX4A 2HE8A 4WDWA 3M4HA 1AFSA 2NVDA 1XGDA 2IS7A 1VBJA 4WDXA 2PD5A 3COTA 1MRQA 3GHTA 4I5XA 1XF0A 1MZRA 4HBKA 3LNMA 2PDGA 5JH2A 3H7UA 5KETA 3LENA 1SM9A 4XVDA 3Q67A 2HDJA 4OTKA 1AZ2A 4AUBA 4LB4A 4PRRA 3WG6A 2PDFA 3FJNA 1EL3A 3EAUA 3R8HA 3LZ5A 3S3GA 4GQGA 1PZ0A 2I16A 2INEA 3G5EA 4JQ3A 1S2AA 1EKOA 3V35A 1RALA 2PDPA 3LBOA 2PDBA 1AH4A 3UG8A 5LIYX 3DN5A 1AH0A 1PWLA 2INZA 1MI3A 2ACUA 4JIRA 2DUXA 2PDLA 1AH3A 2FZ9A 1EXBA 4MHBA 3MB9A 1YE6A 4WGHA 4ASTA 2PF8A 1RY0A 3F7JA 4DZ5A 2R9RA 3UWEA 4DBUA 4GABA 3RX2A 2IPGA 1PWMA 1X97A 2I17A 5C7HA 2AGTA 2J8TA 3KRBA 2PDYA 1XJBA 1QWKA 3GHSA 3GUGA 3Q65A 1VP5A 2HVNA 4G5DA 3B3DA 3WBYA 2IKIA 2R24A 3R43A 3V0SA 4JQ4A 4QXIA 4LB3A 4XO6A 2FZDA 1X98A 3R94A 5HNUA 1YNQA 3M64A 4YVVA 2F2KA 4QX4A 4QBXA 3BUVA 4QR6A 2HE5A 3FX4A 3VXGA 2DUZA 3P2VA 2VDGA 1YE4A 1LQAA 1UR3M 2PZNA 3LN3A 3D3FA 1PYFA 2PDMA 4EXBA 4LAZA 4LBRA 4YVPA 3CV6A 4FA3A 3DOPA 1T41A 1AZ1A 4FAMA 2FVLA 4L1WA 4NKCA 2BP1A 4XZIA 2HVOA 3CAVA 2ISFA 2IPJA 2WZMA 2ACQA 2IKJA 1X96A 1C9WA 4GA8A 1US0A 4PR4A 3R58A 4YS1A 3UZWA 3UFYA 1S1PA 1S2CA 3UZXA 2PEVA 2PDXA 1OG6A 2PDUA 4JTCA 5AZ0A 3O3RA 3H4GA 1LWIA 1Q13A 3H7RA 2NVCA 1QRQA 3LUTA 3LZ3A 3MC5A 2HV5A 4PMJA 1GVEA 3M0IA 1FRBA 1ZUAX 2PFHA 3R7MA 1S1RA 5LIKX 2BGQA 1Z3NA 2P5NA 4GACA 3BURA 2ACRA 5LIXX 4IGSA 3UP8A 4F40A
chains in the Genus database with same CATH superfamily
1MUWA 4ZTYA 2YXGA 4L64A 2VDIA 3VKDA 1UHVA 4JR5A 2R8WA 3HQNA 1JDEA 1GHRA 4MOZA 5C71A 3WJZA 1H2JA 2YFOA 4EK7A 4ZA0A 1VJZA 3LGDA 4O19A 3NO1A 4Z0JA 3I7RA 4E38A 1KM2A 1XL9A 4B91A 3MSGA 5G5IA 3VCNA 3GFYA 3GE7A 1C8QA 4H8NA 1PEZA 4C65A 1LROA 5DT5A 3SI9A 4CNPA 4JTQA 2QKFA 2HMCA 5CSUA 4TXEA 1VHCA 3CV2A 4LSBA 1RZMA 3MUIA 1R38A 3MKCA 4JTAA 3LMYA 3CK5A 3VD3A 4IG2B 2XSAA 1XSJA 3IANA 5E6YA 6TIMA 4H6KA 3S4TA 4EKJA 1KM6A 4WY0A 4R88A 3NVTA 1H49A 4H9ZA 3QF0A 4UNLA 1KFWA 2X8RA 2R1NA 3GTNA 2POTA 3TX9A 4O4VA 3DHFA 1QPNA 4W7UA 4WXYA 3HPZA 1J4EA 3P6LA 1W2VA 2BZNA 3W1UA 3KOZA 4MB1A 1C29A 4S38A 4G6CA 4QDMA 3CXOA 3EB3A 4HMNA 2ZZ3A 4O57A 4YN5A 3REQB 4I6KA 2ZX7A 1RJRA 3PPHA 1JEZA 5HNTA 1VBRA 3C0JA 1Q7ZA 3UZJA 2CU0A 3SRDA 3II1A 1XLHA 4YU1A 5HATA 4XZNX 1LUCA 5CAKA 3VMOA 3BGGA 1PHWA 3RN6A 2OYLA 3ARSA 1H41A 2XISA 2DZPA 1TWDA 1AD4A 1XLDA 4AXKA 3KVKA 3CHFA 3VNZA 1EIBA 2CHNA 1K9FA 3AIQA 2E5CA 1G4TA 4C1LA 1E0UA 2ESCA 2X2GA 3OIXA 1TVPA 4PBEA 4XBJA 4Q6XA 1VFTA 2QDDA 3ME3A 5CC5A 2XM1A 4Q7IA 2V5BA 4HZ7A 2CKRA 4DF1A 4HA0A 2NXGA 3NQAA 3T44A 3F2BA 3WLMA 2Y8UA 1D8CA 2NT1A 4WDXA 3AUOA 1XLGA 3KZSA 4AY1A 2XJ7A 3IK2A 4DJFC 4C6CA 2CLLA 5KETA 4FO4A 2OR2A 2YX0A 2BV9A 3B06A 4LVDA 4Z17A 3HMCA 1PTAA 1V3HA 3T0DA 4QQ3A 1EJ7L 3E2QA 3UJ2A 4GI9A 3S3GA 1MEWA 4GCXA 2INEA 4C90A 2ZRZA 4FHAA 1YPFA 3VKAA 2V5KA 3NQ2A 4INFA 3LBOA 3NL6A 3L4YA 5FJJA 3K8KA 3IVTA 4U3CA 1RHCA 3LCLA 3EZ4A 2VX4A 4HU3A 1P7TA 3EOSA 1NQ6A 3OTRA 5E5CA 2DUXA 1YKWA 2WVVB 1JIBA 3TWAA 2BDQA 4MHBA 2FPVA 1XLEA 1BSIA 1RR2A 3WLOA 1B3OA 3QM3A 1C3FA 2WSQA 3V7PA 3SADA 1FTXA 2VC5A 4H9YA 1OC5A 3RX2A 2VJXA 1EGMA 4QJ3B 1A3WA 1DJWA 4K37A 1DJXA 3CGTA 3WL1A 3F5KA 2GQAA 3B0PA 3BMWA 1TPVA 3A24A 1HJWA 3PAJA 4G5DA 2WMIB 3E5PA 2HQAA 1PHQA 2J25A 3D5HA 1PX3A 4BI6A 3O16A 3TTOA 3TIMA 4XKYB 4GZJA 1PO9A 4RE4A 4J2PA 1TJ1A 2ZOXA 1KCKA 3WLKX 2ZYFA 1AW1A 5DCBA 3N25A 9CGTA 3W4RA 2BBFA 7PTDA 2X41A 5F4WA 3MP3A 4LXFA 5DXYA 3W27A 4WOZA 4AC1X 1UJPA 3TJ4A 3VMPA 4MF4A 1YE4A 3L12A 4ACZB 4C7DA 3P67A 3W29A 3R0DA 2WHKA 4Y9PA 3OU8A 3OBKA 5EBAA 5U4NA 2YBUA 4Y2WA 2C13A 1OHLA 4FLSA 1BRLB 3TJLA 4R34A 1KKOA 4Q8VA 3S5ZA 1QI4A 4H6RA 3FFSA 1UZ1A 2AQWA 1C9WA 4AB4A 4U28A 4US5D 3UERA 2PGEA 5FEPA 4F79A 4O18A 3NNTA 5DXXA 4PSRA 2PTWA 4RNJA 4B90A 2YW3A 2PDUA 4NUWA 4LUJA 3RXZA 4LWWA 5HMEA 3PB2A 4FXFA 2Y4SA 3M0VA 2OSXA 1HKJA 1ODUA 4M5PA 1DIDA 1DWJM 3BCFA 3N2MA 4KERA 2OWXA 2Z28A 3T0CA 2PLKA 3IUIA 3E2SA 2QPXA 3HFTA 4JCLA 2BOEX 3BG3A 1K6WA 1TTPA 4OVXA 1FWJC 5EPDA 1WUEA 3W7HA 2E77A 2QPUA 2Y8VA 3GC2A 1YTKA 3XINA 3R8RA 3WD0A 3TTEA 2TSYA 2CLKA 3MI3A 2XSBA 2J7CA 2A7NA 4QCFA 2ISSA 3WLTA 5CC3A 3I65A 3OA5A 2OLAA 1Y5WA 2CYGA 3L9CA 3PTDA 5CLTA 3GY1A 3PBUA 3ERPA 3ARZA 3WKZA 1HO4A 3FEMA 4REQA 1F6PA 1LOLA 3NPXA 3OVRA 1WKFA 3ZVHB 4Y7EA 1Y7VA 4Y9AA 2OMAA 2RJGA 3WNNA 3HU7A 1QNVA 4K7YA 3LX9A 2WVSA 1EPXA 3AHVA 4AHOA 3TR9A 1XUZA 2V3DA 1A47A 3TUUA 3VABA 4LUYA 1S2VA 3M5VA 1OFDA 1SMAA 2QT3A 1A80A 3H2FA 1I2NA 3NURA 3WEZA 4HIBA 3W1TA 1A5OC 3O8AA 2VEFA 1UUOA 1LZOA 4FNRA 1YXDA 1IWBA 1LRQA 3W7QA 1YDVA 1M7OA 4BCEA 3NZGA 6CGTA 2EPMX 2R6OA 5FF3A 2Y7DA 4IOTA 1NP2A 5ABFB 3TC7A 2CLFA 2J88A 1IXNA 3IGSA 4MUPA 2Q3OA 4CQAA 2E8ZA 4AVOA 1RCQA 2IPWA 4E2VA 4FLQA 1H0GA 4CNTA 3ARUA 4N9BA 2DZWA 4PB3A 4PRTA 4TMCA 2GQ3A 1BPLB 4O0KA 2X42A 2NXIA 4Q4KA 3AIEA 1YEYA 3UWWA 1AMKA 1E6NA 1VEPA 1UR4A 1XIEA 2VKZG 1S5MA 2VGIA 3WMBA 4O1DA 1FBAA 3L5AA 5D2VA 1C9DA 2PWDA 1HX0A 1N55A 4MZ1A 4LQ1A 2VI0A 4GYPC 3URBA 1LBMA 3QV6A 1Y5XA 4AD4A 3QPEA 5REQB 3UZYA 3WLSA 4DVOA 2H8ZA 5C9WA 1HG3A 1GW9A 3L23A 4PSPA 3KE0A 5XIMA 1JPKA 3FDKA 4KFPA 3GK0A 2BWGA 3RJYA 1O68A 5HANA 4NNBA 1IZJA 2Q02A 1LG1A 2Y88A 3BV7A 2O7SA 3CUHA 3KP0A 4ICNA 4H9TA 3PWIA 5CBBA 3M0ZA 3VX0A 4LY8A 4UTUA 3XISA 4DJEC 3RR4A 2X0YA 1EQCA 3MJYA 2DVUA 3RMJA 1AL7A 1MZRA 2WSPA 1LT7A 4NZJA 3BTNA 4TR9A 1TFVA 4E6MA 4HHLA 3E0IA 2XN1A 4CN6A 2CWNA 1AZ2A 3MW7A 2W9MA 2NXHA 3WQ5A 3BMXA 1WZKA 4J4KA 1UZDA 4LYQA 3HURA 1IE7C 3BXWA 1F73A 1J11A 2ZXDA 3ITYA 1F8MA 1JAEA 5A2CA 5AC8A 2JKAA 3WH7A 6XIMA 3EMCA 1EKOA 4LAMA 2Q01A 4FNQA 4IGMA 2V82A 4IT1A 4PUJA 1QNOA 3WLJA 2V69A 1K4HA 3SCUA 1GKPA 4OZOA 2C14A 2C15A 3UWQA 3M5XA 4YWIA 4CD8A 2YCJA 4H00A 4C1KA 4JKKA 4JFUA 4GJ1A 4O0ZA 1YE6A 2JEQA 1TV4A 3ELFA 1W9VA 2GVJA 1I1WA 3VVGA 1ZBCA 3BANA 4XIMA 4A3QA 1AW5A 5DN1A 4AEFA 4IGHA 1E0XA 1V03A 3WDRA 2WVTA 1KBBA 2INFA 1IYXA 1PWMA 3AC0A 4S3EA 1VC4A 2CEQA 4KWSA 5C7HA 2J8TA 4UWMA 4KGLA 5M17A 4QTGA 4TTUA 3W2MA 4S3AA 2PLCA 3UY7A 2OYMA 3WX7A 1R3QA 4O0QA 2VQUA 4QEEA 3P80A 4NY2A 2Y24A 3PY2A 3SRKA 4LB3A 4DWSB 3N9KA 2HXTA 4H83A 3VNJA 1K6AA 2QMKA 3E02A 3IJDA 3SGUA 4W87A 3O6DA 4IWWA 4WJEA 1H63A 2WSKA 1TCDA 4Z1AA 4LBRA 2JKEA 1UH4A 3RHGA 4FAMA 4ZB5A 2J66A 4XZIA 3CAVA 4NAFA 4DYEA 2IPJA 1TO3A 1ZJAA 3UG3A 5TBOA 2BXVA 4KIEA 4G7EB 5HWJA 3R58A 2XFFA 3S5NA 2G97A 2E9BA 4XSMA 1RQHA 4H01A 2I56A 3QBUA 4HHPA 3TN3A 4IM4A 3MTWA 1KFLA 1CB2A 2P88A 3U2OA 1XIFA 4UZSA 1W3JA 2VCCA 3NQFA 1KGXA 5JUVA 3OPSA 4NAEA 5D2XA 3V1HA 3O3RA 2VTFA 2QJJA 4KS0A 4HOXA 1SZGA 4WY0B 1F4AA 4JX5A 1FRBA 2XFWA 1R7OA 5FCZA 1YX1A 3GW0A 4RV3A 4TVDA 3G6MA 1XGEA 3EPNA 1PXGA 4AWUA 5AHEA 6PTDA 5AYBA 4DWSD 3CYVA 3EOOA 4LW7A 4F2BA 4DNMA 1IZCA 3KDNA 4C6FA 1XIIA 5LHEA 3WD4A 2BB0A 3ZFHA 2V8ZA 3RDKA 3TYUA 3B4YA 2PURA 2Z25A 3VCCA 1FCBA 2FMNA 3BG5A 2YSWA 1LL7A 2J9YA 4S3JA 1ZSXA 3T81A 3N9SA 4GHRA 2Z2AA 1WAWA 1L0PA 2KAUC 3OG2A 2EPLX 3BO9A 1AD1A 7XIMA 2ODOA 3MS8A 1SR9A 5LXEA 1Q8JA 3B9OA 3G1RA 1LUCB 4X0VA 2RHGA 4AY7A 2CESA 4AZ7A 1GPWA 2HNHA 3LBCA 4CQ9A 3W37A 1T8XA 1JCLA 4I9AA 1Y5VA 5FEXA 3EX3A 3ZR4A 4DBSA 1E15A 2UY3A 4C6JA 1GYMA 1JPMA 2PP3A 2QCLA 2VUYA 4Q4OA 2DSUA 3N04A 4DZHA 1WE5A 4CNUA 5JXQA 1XLIA 1H1ZA 4E2DA 3CV7A 2PDKA 2BFGA 1L9WA 4O8AA 3VOHA 1FQ0A 4P7NA 4D6FA 4W4QA 3LMZA 2ZUMA 1B1YA 2WBKA 1VFHA 4JN6A 1Y8BA 3R13A 4IFOA 3WK3A 4PL1A 4ENLA 2J7GA 4JTHA 2D0FA 2BASA 2EF9A 3WO8A 4QIUA 4JICA 3A12A 1KXVA 1N7KA 1Y0EA 1K8CA 5D03A 4HK6A 2QUNA 4A8NA 1Z89A 5I06A 3LNPA 5EMJA 1SZRA 4B5NA 3NPUA 2F7FA 4JTTA 2CLMA 3CLMA 2O7QA 3KBMA 4NIRA 3M7SA 1BFNA 1DWGM 3FKKA 4XVEA 4QSHA 2VGFA 4WVXA 4MJMA 4MWAA 2PTYA 3GDKA 3MUZ1 1SPQA 4OV4A 3G1XA 3EWXA 4B92A 4J3SA 4HHMA 1VJIA 1BKSA 3GXFA 2VC7A 3GNXA 4ECLA 3FYYA 3W82A 2FDSA 3PUDA 3ARRA 4M7TA 1HJQA 1FWAC 2GZXA 3AZTA 3CL8A 3QH2A 3BQ6A 3HA1A 4KWWA 2DT1A 1RA5A 1HFBA 2EJ1A 3N3MA 2ZZ5A 3RMEA 1I6NA 1RBLA 3BCJA 4O28A 4NZ4A 5ECVA 2Z26A 3IIPA 1DWIM 1ZZMA 1LP6A 1QPRA 3EB4A 3S2LA 5DBTA 3LD5A 4W7VA 5DBUA 1EF3A 4B3ZA 4FOJA 1US3A 3G0XA 4JQ1A 3V0TA 3WYZA 1QI2A 2HE8A 3PHAA 1AQMA 4M7SA 1VR6A 4HNTA 1VBJA 1BTMA 2VYOA 3HM7A 2CFFA 1BAGA 3CTLA 1XCXA 2NQZA 4FS9A 4M6UA 3HFYA 1YLVA 4ZO9A 1SM9A 1TPUA 3DC8A 3WH9A 4OJYA 3WD2A 4Y8FA 1PX4A 2HROA 2VRKA 3C5QA 3WG6A 3GG1A 3UGVA 3THDA 3H21A 5CKSA 3P74A 2QJGA 5EA9A 4V27A 4BI5A 2PUZA 4PE8A 3OYZA 3OJGA 1SJBA 3GXPA 1WQ5A 3RCNA 3V35A 1W5QA 1DOSA 1RALA 4GO8A 2PDPA 1V77A 1XPGA 3W87A 3IRSA 1TPFA 1E6SM 1ONEA 1ECQA 2V5CA 1M7JA 4BZYA 2G3FA 1CX9A 1VQTA 4S3KA 3IUDA 5BCAA 5I78A 2A3LA 3IIVA 2A6LA 5KITA 1L6GA 4MLJA 2QUTA 1EDQA 2FHFA 3UVIA 1T7LA 1D7FA 2WPBA 3UG4A 3LDVA 4GO9A 3ZMRA 3BK0A 3LS9A 3WD1A 1QAPA 4HT3A 1H1NA 4GH3A 4OBTA 3GUWA 3FS2A 5C9RA 3ID7A 2OT1A 3URNA 2OLSA 5I3KA 2QJIA 3W76A 2PS2A 5A2BA 3VD4A 1UR8A 1OX4B 1F3WA 1Q6QA 3NZRA 4OUIA 2Z27A 3W88A 3B3DA 4DIAA 1ZAHA 4DF2A 2YB1A 3V0SA 1VCVA 3RIKA 1EQPA 3A3XA 3FDGA 3VOFA 2Y2WA 4O16A 2YL8A 1NOWA 2QR6A 1ISXA 4FP1A 4PBGA 3VKBA 1TWWA 5D9OA 5F4XA 5K9XA 2XVPA 1KXTA 4F48A 2Z24A 3EXRA 7TAAA 4Y6GA 1OCBA 2XU2A 4JY9A 2C8NA 2IUZA 1ZS2A 2Z7KA 3HGSA 5FL0A 3DERA 3C3NA 4ZENA 3FYOA 1M65A 5LHFA 2PDMA 3MT1A 3M5YA 3C0LA 4F2UA 3CIWA 2QUMA 5LYRA 2ZRVA 2EJAA 3MMUA 4MY1A 3FLUA 2H3BA 3B0YA 4ZFMA 3BOFA 4FB7A 3G3MA 2OOGA 2WLZA 4ZO7A 4JAWA 2I5GA 3T0AA 3CNYA 4PR4A 1BVWA 3OB8A 3NQDA 2CZFA 1AMYA 1UR1A 3MCOA 2V9DA 4QFUA 1QW7A 2WHJA 4AQLA 1FWSA 1MUMA 4YCPA 1XC4A 4IQDA 3M7WA 4AZCA 1VPQA 3VMNA 5E9XA 1H09A 3WH6A 4Q22A 3FEQA 4HNVA 3NZPA 3OZYA 5I77A 2QDHA 4HA3A 1HF6A 3LUTA 5G4WA 3PBVA 4BEUA 5DELA 3GKAA 4GFSA 4ZEPA 2PZ0A 1UROA 2GSHA 3QSTA 2W79A 3R7MA 3EBVA 3E0LA 4KCVA 2UY2A 3AXXA 1QW8A 1GG0A 3M43A 3QY6A 4J35A 5LIKX 4PBFA 4PTDA 3FK4A 1N2VA 5D2TA 1Q8AA 4O12A 2FKPA 3CC1A 3W1AA 3G1AA 1W5MA 1ELSA 1XG3A 3UESA 1KV8A 2DY3A 5LNUA 2O4QA 2Q3RA 5LIXX 1OK4A 1VBHA 2OCZA 2POZA 1VCFA 3UP8A 1DXFA 3CPRA 4XUGA 1KV5A 2D2HA 5J5DA 1JXKA 2XIBA 3H2MA 4L4OA 3KFTA 8TIMA 3LY0A 3UU0A 4XZMX 2BY3A 3NDOA 1T6MA 3M47A 4DBWA 2CZVA 2C1HA 3LV5A 1WDSA 3AHXA 3OZOA 3AYTA 3T55A 2ZUUA 1U5JA 4GC3A 4BFAA 3JZUA 5GJMA 1WB0A 1G4SA 1W8GA 4ZO6A 1D8WA 4OGZA 4DELA 4NJGA 2C91A 3VIPA 4NYYA 1TZZA 3UYIA 4GG9A 5MKGB 4UTFA 4LC8A 5A1AA 4H9MA 5A95A 5BU9A 2CHRA 3GXMA 1WXYA 3PPFA 3HG2A 3S46A 5AHIA 3OEXA 1DIEA 4S2CA 1TJRA 4RW5A 1JZ4A 4ILSA 1NF7A 2MNRA 3S1UA 4CLMA 3SFWA 5CC6A 3GIPA 3VNLA 1WP6A 4NILA 4MKVA 1VENA 1GVQA 2VP8A 3W71A 1NF0A 4Z0SA 4Q7BA 3ARTA 3TN5A 4W8AA 2XWEA 2ACSA 2Z29A 2QLYA 1AODA 2WC4A 4K8EA 4XKMA 4IGNA 4TV6A 1W1A1 2FTWA 4W86A 3KHDA 1TCMA 3C4UA 4XAPA 4B16A 1GT8A 3MBFA 1XLAA 1DVJA 1MEHA 1T5AA 3E96A 2FTYA 4C6MA 3PAOA 2P76A 3ES7A 3C61A 3L4TA 1WZLA 4BKNA 3W83A 1RLDA 4NXSA 2V81A 2EEXA 4RXGA 5U7SA 1L8PA 5CAHA 4HYRA 4UFJA 6REQA 3BOXA 4EAYA 3BOLA 2OO0A 1Q4NX 1VS1A 3W1XA 1GOKA 1KXHA 3WDHA 2VFFA 1TKKA 3AYSA 1E0VA 1HUVA 3VOIA 1YIXA 4ZO8A 3DFYA 2GVLA 3G1HA 3PUOA 3K5XA 3TMQA 3KBNA 3QGKC 3MBDA 1TYGA 1SZEA 2ZC1A 3B0VC 4Z1DA 1OBAA 4K39A 4W85A 5JVLA 3SGGA 2PD5A 2XH0A 4L1GA 2D73A 3B0XA 3H2OA 3TV8A 2RKXA 7REQB 3N11A 1CENA 3LCIA 3BJTA 4PCTA 3IVSA 1V51A 1WOAA 3GB6A 3BH4A 2ZTJA 2G3MA 2BVTA 5A94A 3VX1A 3LHZA 3EAUA 1LLOA 5HJYA 4DZAA 1WX0A 1ISWA 1V3KA 3OOQA 3GIQA 3QRHA 4PUMA 3GDLA 2NZLA 3PSVA 1UR9A 5E09A 3VFLA 2E8YA 3H4XA 4DJDD 1O5RA 3AJXA 4IUGA 1E3XA 1NELA 4FI4A 3N4FA 4JFTA 3WFAA 3RITA 2ZVRA 3L5LA 4M51A 3NAVA 2NSXA 4C6DA 4O53A 1VRDA 2FZ9A 2ATMA 1NVMA 4ZQRA 3EA2A 5GJNA 1V3MA 2XWDA 4NAEB 4XAYA 4AY8A 4PC8A 4LBUA 1V3IA 3FGCB 1KO0A 4B3KA 3TOYA 3H70A 1GG1A 1IGSA 3WQDA 1MNSA 5K9DA 2OQYA 3PVFA 3W7NA 3O9NA 1QWKA 4IPPA 3TYDA 2GL5A 3NZQA 4ZR8A 3PTQA 4PL2A 1VP5A 3GR8A 3LXCA 5T9BG 3TZFA 4ZTXA 2FIQA 4S23A 3KVLA 1BF2A 4JQ4A 3DCPA 4K8GA 5E9AA 1NJJA 3TH6A 1ALDA 4HPJA 4X22A 4LTSA 2GGEA 4KF1A 3GD6A 3ATYA 3PNZA 4G8TA 4CCEA 1ITUA 2CIPA 3M6YA 3O05A 3P8JA 1VBGA 1N8IA 2E9MA 4K7VA 4MM1A 1S2TA 4XAZA 1I4NA 3AI0A 3NEHA 1W37A 4Q4RA 1OFRA 3H2CA 3D3FA 2NSOA 1E70M 1YPIA 5DRCA 1SO4A 3IARA 3QY8A 1FHLA 1SYTA 5T26A 1I60A 5F1UA 3WY1A 2V5JA 4C91A 1X96A 4GA8A 1V8EA 4WOQA 1FP8A 4YTTA 3EWYA 4HSOA 3GBEA 3U8GA 1K1DA 1PSCA 4J3WA 4KWOA 1YXCA 4AMCA 5KMYA 1H7XA 4JS3A 3UZXA 3GU1A 2DIJA 5IFTA 2VHLA 3NVDA 1B54A 4H04A 3T05A 4R7JA 1V6TA 2NVCA 2G41A 4EOUA 2X05A 1UZ4A 1JNDA 4PMJA 3BSHA 3L4XA 1VKFA 3KL3A 5LKYA 5A6KA 1RQBA 5F2GA 3WDQA 3VILA 1OC7A 5ABTA 3G8RA 2BGQA 3L21A 4LVAA 1VFSA 1MNZA 2GOKA 1UKPA 3AROA 1ME8A 5CZKA 4GE8A 4GX9A 3CAWA 4FR1A 3RO6A 4P7LA 1TZ9A 2EO7A 3WIJA 5F7UA 3WUEA 3NM3A 2OSYA 2O55A 3VD7A 3UZ5A 4QHRA 4JDYA 2OO6A 5CEWA 5C7VA 3PC0A 1E1CA 1ZB5A 1FHVA 4RR4A 1XYMA 2OT0A 4RUBA 1U30A 2Z1VA 3TXVA 3V4BA 1ADOA 3A4XA 5LNWA 2EBNA 2REQB 2QCDB 2OOFA 3HOJA 4KFNA 4BQ3A 3POHA 5DCEA 3LHWA 3DI0A 4L1XA 4XO7A 7TIMA 4S3BA 3N4EA 5IFPA 2YYTA 2E5DA 3U2ZA 2DQXA 4CD6A 1F05A 4C6KA 3C2RA 4MWAE 3VIHA 3RX3A 4Q3MA 1LG2A 4AEOA 4NRRA 3I4KA 4J27A 4C6NA 3AZRA 4KETA 4D71A 4MIMA 1OCNA 3I10A 1TUXA 3NQCA 4LV4A 3BLLA 1POKA 4LS1A 1TIWA 3BW2A 1BYCA 2PWVA 2V68A 1IR2A 3LI1A 1PTGA 4LRTA 4AD5A 4D1IA 2PODA 3ZYZA 2WNWA 1ZPTA 4UOQA 5CPSA 1W5NA 4WCJA 4IMAA 3QC3A 4GQ0A 1V6WA 1WO2A 1RAKA 3HV8A 1E56A 1GVYA 3ZZ1A 2B0MA 1QI5A 2ZUNA 3H7VA 4XZHA 3QPYA 5AVHA 2DW7A 4ZOEA 1MXGA 2IQTA 1CXFA 3HIJA 3GX9A 1FDYA 4LOCA 1FCQA 3H2NA 2B7NA 2BVDA 1BLIA 1ZCCA 1E4NA 3RAOA 3W7JA 3CMJA 2XZ7A 3F2DA 1QOPA 5BU6A 4NG3A 3M46A 1DE5A 4UTJA 1SZFA 4LUSB 2YL5A 2PD9A 1TPWA 4LBSA 3N2CA 1AG1O 5I6SA 2DP3A 3PZMA 5AHMA 4PCNA 4G7FA 4ONVA 4RNIA 1TVNA 3PZVA 2WAGA 3AXMA 1YYAA 4WXZA 1POJA 4L6HA 1L2UA 4LEQA 5D33A 3W25A 3NFUA 4AD3A 1M04A 5KTLA 3DKJA 1HL2A 4KBXA 2P3ZA 3CHEA 1UD5A 3TNBA 3CMFA 3L4UA 3LHVA 3N2OA 1AQ0A 5EMUA 3WMCA 4RCXA 1C90A 4BF9A 1T0OA 4YXGA 1B57A 2PTXA 4QGCA 1AFSA 1W9UA 2IS7A 3COTA 3CO4A 2Y5JA 1E3ZA 1F8IA 1FCVA 4ZSUA 3PNUA 3W6MA 1X8FA 1MYRA 2PRMA 2ZRWA 1CIUA 5ABGA 4J9JA 3TQVA 2DVXA 2AKMA 3IV8A 1NU5A 4I9MA 3U7VA 5KZ6A 3W07A 3QXBA 3TDFA 2DT2A 2G37A 2GVEA 2WWCA 1JZ7A 4PMOA 4A3YA 4JTKA 1XRSA 3FVDA 1EWEA 3G5EA 1H7WA 2WHLA 4N4PA 4CCDA 3LHTA 2DSZA 4I90A 2WOQA 5M03A 3UG8A 2J7EA 4L5ZA 3UVAA 2ATSA 4LYRA 1XDJA 3HQOA 4KCWA 4CU6A 3I68A 2WM1A 4R27A 3VE7A 4GIYA 1B9BA 1KM4A 1AH3A 2XH7A 1X38A 1OJXA 3B9DA 5DO8A 3BGJA 2WKGA 1F3EA 3S8HA 1DYSA 1KM3A 1CTNA 4AW7A 1X1OA 4D8LA 2QCGA 1HT6A 5LZLA 2X0SA 3BQ5A 3FA5A 3KTXA 2NUYA 5JMUA 1TQJA 1JGIA 5G2WA 1Q6LA 3DFPA 4UFHA 4ATDA 1JG9A 3MU7A 3EWCA 2EG8A 3SCOA 2GJXB 3RK8A 3S5YA 3FA4A 1MO0A 2O92A 4S39A 1YBQA 3M6DA 1OFBA 1HVQA 3NO3A 3WJYA 1ZJHA 2EQDA 1WBHA 1YDYA 3SAZA 2JIEA 2EHHA 4ZE4A 2ZXAA 1Z42A 3WL0A 4IIHA 3RLUA 1PL9A 1R3SA 4PFHA 2Q71A 1E73M 3FX4A 2CBUA 3CU2A 1BSLA 2VZUA 5HXMA 2PZNA 4HZ6A 4C6LA 3LN3A 3O63A 4Z2IA 1JPHA 1T41A 3SY5A 2D22A 1B3WA 4C6EA 1GVOA 4HCHA 3GU2A 1S2WA 3ZLHA 3QFWA 5KEZA 4LUTA 1DWFM 3MYOA 3G24A 2W5FA 4JTFA 2WC7A 3TQ0A 3WQEA 3IV3A 1T99A 1KTBA 4P8UA 3TU9A 4QLJA 2ZKMX 3QV9A 2EPNA 3P84A 3AWNA 3H2AA 5DT7A 4ZBCA 1ONRA 3H4GA 1Q13A 1TUFA 4U2YA 3A6OA 1JF6A 1L6WA 1XIHA 1P6WA 3CB3A 2OZ8A 3VCRA 4F0LA 4MKSA 4X0NA 3OYXA 2QEZA 1UMYA 2VC6A 1JNEA 1RLCL 3GZAA 4NZ5A 1K7EA 4B5SA 4PRWA 1PVNA 2F6KA 1QNQA 1A0DA 2BVWA 9XIMA 2PB1A 2WHMA 3N1AA 3BURA 3NR0A 5HWMA 1ZCOA 3SUWA 2WSRA 1OT2A 1HTIA 1S3HA 3B9EA 5IM51 3W81A 4WUIA 1CI1A 3GIYA 3GR7A 1NFGA 1XHGA 2NUWA 3URQA 4LCRA 5G4EA 5EB8A 1QASA 3VGDA 1PYMA 4R33A 1A5NC 1R0MA 4L56A 1DIKA 2PBGA 3MVIA 1Z6KA 4Q8PA 3KHJA 2YZRA 2QVNA 3QVQA 1E5NA 1HJUA 3KUMA 5MF5A 4IG2A 4OECA 1FWTA 3J7HA 4X61A 1ITCA 2YZ5A 5AC5A 5T8GA 5DCDA 4D6GA 5EBUA 3THAA 1UKSA 1GWJA 1BXCA 2JGYA 3K13A 1PCWA 4FXJA 4GGHA 4QE5A 2DZSA 4OIFA 3UXIA 3A9BA 2PDWA 4GKLA 4JQAA 1Z32X 4GZEA 4YCOA 3NQMA 5CSYA 2XINA 3WDJA 1V6UA 3IK4A 4MPQA 5CPTA 2ZRUA 2Z2BA 2H3DA 2VWSA 3S2CA 5DFAA 2YLLA 3A21A 3LG3A 3REQA 3IIXA 2QF8A 1ZP3A 3MMDA 3NUKA 2WMKA 4XSLA 3FAWA 4WR3A 4OU1A 1Q6EA 1VAHA 4P7OA 3UJFA 1H61A 5TD4A 4H6QA 4QP0A 4PMUA 1WDQA 3IJ6A 2YYUA 3GAYA 4IP7A 3T0TA 2C18A 1Y65A 5AHFA 3IAQA 1JXJA 5AVNA 3NTYA 5AZ1A 2V30A 1PKYA 4PFMA 4JN8A 1KRBC 4MWAC 3UEQA 3B04A 3Q58A 1J01A 1YADA 1X1ZA 1FOBA 1C92A 5IHSA 4CNNA 2CLPA 2QCEA 1Q7QA 3H2EA 3R2GA 3P0XA 1W3KA 4ATLA 3I4EA 4GJIA 2VEIA 3MANA 3GHRA 1E71M 3P8IA 1PZ1A 2EPOA 4DM2A 2VEGA 5CZTA 4O1EA 3GDBA 3NG3A 1BF6A 4QM1A 1VLIA 4W8LA 4R9OA 5J5RA 1W9DM 1HXJA 4AYGA 3QKEA 3FJ6A 4KESA 1QBAA 1UZHA 1TTJA 4HMCA 1E9ZB 3EEZA 4AD1A 3TCSA 4DHGA 2PDQA 1AJ0A 2Y8KA 3KLKA 4GJJA 1ADDA 4FLRA 2Y70A 4L7ZA 2G5WA 3VGFA 3CUZA 2H6RA 3ENLA 3IIOA 4DY1A 1XF0A 3M07A 1P1MA 4GGBA 5HQEA 4PTMA 5JH2A 4I5UA 1BXNA 1KR0A 5JIPA 1A0CA 3UF9A 2HVMA 3SSJA 1R9YA 4KPLA 3LBMA 4IMDA 2EAWA 4JDBA 2OKTA 1IIGA 4ZGYA 1K4GA 1TMLA 1G4EA 4HYWA 3EXTA 1R30A 3ARWA 4P61A 2WVVA 1EZ2A 4UQ9A 1CBGA 1FFRA 2A2IA 3OO2A 3G3DA 4US5A 3YPIA 3BARA 3PR2A 1AH4A 3PM6A 3ORWA 2W6RA 1IXPA 1EJWC 3EWBX 3ALGA 1C91A 1O94A 3WQ4A 2C71A 3AISA 4R3UA 4O8RA 4X9SA 3OLIA 4B2DD 3AIBA 4UB9A 4W8BA 4HNOA 4AZ6A 1H5VA 2D0HA 1B3VA 1YMYA 4K68A 1EXBA 4OWGA 2FPYA 3JS3A 2BY0A 1ONWA 1J0YA 6XIAA 3L67A 1HGWA 1LBLA 2R1PA 2JF7A 1OYBA 2CBJA 2WMIA 2R9RA 3CTTA 1ECEA 1VEOA 4H7ZA 4DBUA 1VGAA 3KS5A 2P53A 4V33A 4XKYA 4ZB2A 3ITVA 1X97A 1GVSA 3ZVIA 2VMFA 3NDZA 1FKWA 1VBUA 1TPC1 2GYIA 3QHNA 4LCSA 4IXHA 3Q65A 2HVNA 2OB3A 2VCBA 4TO8A 4MZ8A 3VAVA 2VQTA 2X30A 2A3AA 1UMLA 1VYPX 4UTTA 1UP3A 3BVJA 3KEHA 1FWHC 4YTQA 2ZX6A 4XB3A 1DJQA 3C2YA 2FHCA 4DEFA 1E1CB 3WUBA 1BRLA 1WKEA 1U33A 1TRIA 2E1WA 1EYWA 3VXGA 4AMAA 1I45A 4Y8EA 2VDGA 1FH8A 1EWDA 1QNPA 2E6YA 1CGYA 4CD5A 5CLWA 1R2TA 4ROPA 1MWOA 3DFHA 1E9IA 1MFVA 3WZ0E 4YVPA 1SUXA 4GFIA 5EU9A 4ZE5A 2BP1A 5JU6A 3N73A 3LGGA 1P6CA 3SIMA 4IMEA 5D2WA 2SFPA 4V1YA 2NX3A 5ABEA 3LTSA 4JHOA 4WF7A 2ADAA 2QMJA 1K8YA 3U48A 3IJQA 2H8XA 2I57A 4NL1A 3W72A 3G77A 3RM8A 4B5TA 4ROQA 4QS6A 1JUBA 3AS1A 3AMGA 1MQPA 3EWWA 4DUOA 4RZ4A 2XFYA 2WMGA 3KBWA 4KFOA 4ZSTA 3STFA 1ONXA 4J1OA 1BVZA 4UQAA 5HBFA 3ABQA 1BGGA 3ZOAA 2FFCA 4AIBA 1Z41A 3LA4A 2RDTA 1KFBA 4J5NA 5EMKA 2YXOA 4JTGA 4CCCA 4E8GA 1O4UA 2VGGA 5JQ9A 2A79A 5HAOA 4MMWA 1J0IA 2OZ3A 2XGIA 2JK2A 2CBVA 3ZVHA 4GNJA 2PLMA 3QW3A 1FWEC 2YA1A 3ATZA 1W1IE 3VNMA 2YOCA 1WYIA 3M44A 3EWUA 4C6PA 2WJZA 3O15A 3PJTA 5D30A 3Q94A 1GTEA 3IWPA 3KOYA 4D2JA 4UCGA 3NPWA 3B8DA 5TAOA 2AKZA 3CMGA 4E2BA 1TPH1 3T07A 2QAFA 4AHQA 3LSCA 2C19A 3RFAA 4AZ5A 1ZBKA 3ANYA 2FZMA 4Q32A 3LTYA 4KT2A 2NX1A 4V15A 4B9ZA 4EF8A 5HPCA 2PDIA 7ODCA 1UKTA 2VD8A 1UIOA 2VX6A 1QR7A 3UCQA 3CWNA 3L0GA 3P14A 5IRPA 3I7SA 3O6CA 3FXGA 5LIWX 3U5YA 1NTHA 5ABFA 4OUEA 1W1ZA 4GVFA 2WLYA 4Z2HA 4HSHA 4FK9A 4MSSA 3KAOA 1RY8A 1UR0A 3FN9A 1MUCA 4ADTA 3R6IA 4G9PA 1PX8A 2PDCA 2YL6A 1N82A 3LHYA 3VDGA 1A5AA 1IGWA 1JJKA 4PN2A 5LA1A 4PB4A 3HPSA 3TSMA 1EDGA 4JOMA 1VIWA 2IXUA 2QUUA 2YA0A 4JXCA 2WW5A 2PTDA 1AQFA 3UG5A 3AIUA 2W0UA 3BWWA 4C1NA 3AUJA 4CNSA 1UP0A 5LA0A 2FDMA 1EFZA 3TKFA 5I3JA 5REQA 2D20A 3SQSA 4V28A 5LNVA 3PZQA 5B7ZA 2XN2A 1JRCA 1XISA 5A5WA 2GJNA 4UMBA 3TCEA 2ZIDA 1WOBA 3VIFA 4XISA 4IUOA 1Q6FA 1TVLA 3SURA 4WKAA 1LBFA 3DFOA 1XLJA 3T2PA 4XTDA 4GUGA 3T8LA 3GW3A 3OBEA 3W7DA 1AJ2A 3PG9A 3N29A 3L7RA 3W6YA 3EA1A 1SW7A 2NV9A 3TTYA 1DXEA 2PDNA 4M6QA 1DE6A 4PTNA 3ABXA 5JH1A 1RK6A 1J0ZA 4LV9A 3USBA 1JYWA 1KA9F 4N0RA 3B9AA 4K38A 4UOZA 2ZX9A 2X09A 3DEQA 2QCNA 1FHUA 3H7UA 1XBVA 1IEXA 1ZAIA 5HNRA 3EX6A 5IXEA 4E8DA 3TTQA 5H1WA 3UPWA 3EDEA 2C3ZA 4QJ4B 2GDVA 4Q6JA 4NZCA 2V3FA 3KWSA 4L80A 1XCFA 3W1LA 1KBLA 3QR0A 3AXHA 1KKRA 1XLFA 1ME7A 1W17A 2PDBA 3F5LA 4PMYA 2J8GA 1DJZA 3VDBA 5M3WA 2D0GA 4PMXA 2PE4A 3VZXA 3MUY1 5JIWA 3T09A 1NWRA 3EB2A 1OIFA 3FY1A 2FGLA 2RFGA 3LB0A 3Q2DA 4BR1A 1KGWA 1KCXA 1JCMP 2X7WA 3EPMA 3ZSSA 1CXLA 4E8CA 3P60A 3THUA 3SQLA 1QK0A 3UWEA 3UCDA 4KWVA 4CN4A 1UW9A 4ZOBA 4WSJA 2VENA 1UH2A 3W7EA 4OV9A 4DWSA 1Q63A 1NIUA 2VZOA 3ZLFA 3JRKA 1OG0A 4IFKB 1MXSA 2YDRA 1DPMA 4QJ1A 3SCSA 1GW1A 4C5ZA 1XLBA 2HK1A 2OX1A 3UJRA 3LCHA 3TYZA 1JZ2A 1GGOA 4I9TA 1EP2A 3AHYA 4NZFA 2QGYA 3FHQA 4BEQA 4Q8TA 4C6QA 4B9YA 2ZC8A 5HJLA 1DHKA 2FZDA 1DQUA 3N6HA 4PUNA 3THCA 3URAA 1HKWA 1FWFC 1HZYA 2HE5A 3DC0A 4TV5A 3LI0A 3W02A 1I9CB 3L2MA 4G7EA 2GVYA 1A4MA 2VFHA 3M1ZA 1G0CA 4EXBA 3AU6A 2EKGA 4L6DA 4FA3A 4UTLA 1XDMA 1YTEA 4HZ8A 2WJDA 4NKCA 3M0KA 2ISFA 1ML1A 2E25A 2VRJA 3CEUA 3F2CA 1CXEA 2GVGA 1TX0A 5TF0A 1CB7B 1P4CA 1EC7A 4QAIA 4ADUA 3HPXA 3R10A 5E93A 4QITA 2R91A 1NM9A 4K36A 1KBKA 4DPPA 1WA3A 3C52A 4C6OA 4ATWA 2GGIA 3WJSA 3W1PA 4BQ2A 4NI3A 4HP5A 3MC5A 2HV5A 3MUAA 2EXOA 3M0IA 3AS0A 2Y61A 1S1RA 4UMCA 3GYCA 4F9DA 1Z3NA 2WKJA 3T40A 2J7DA 1V0MA 1A50A 4N9CA 1U83A 5I07A 5CG0A 4W9TA 3A3WA 4AFYA 4GACA 5CC7A 5E1QA 1SW0A 2PGFA 3CT7A 4S2BA 5I23A 3UWZA 3QLLA 1A53A 4DLFA 4FNPA 3RPDA 3FSUA 3GNRA 1W1B1 2CWXA 3HN3A 3N15A 4LFYA 4UTHA 4RXFA 3UD6A 2FZBA 4H3DA 1ZJBA 1TE6A 3QR3A 4UMAA 1G69A 1KFJA 2OLHA 4GVGA 4U3AA 1D3GA 2FB3A 4AD0A 1DTUA 1HJSA 2W63A 4UTMA 3UJSA 1V5XA 3L2LA 4EXQA 4HOWA 3W2NA 3MQTA 2WKLA 2YA2A 2XIMA 1DJIA 5EMMA 5HWNA 1GZ1A 1D3HA 3BLPX 4JTUA 5EFDA 3VKJA 3S2MA 3MHGA 2WZHA 4MNLA 3W1NA 3QMSA 2VR4A 2FH8A 5LIUX 1F5ZA 5FF0A 4JIEA 3N14A 1UP2A 4WEVX 2WMHA 3JW7A 3FIGA 2DZBA 3WSUA 3L0NA 4Z1YA 1ESWA 4HCDA 3U3HA 2IQDA 3W6LA 1LWJA 3AAMA 3H26A 5C6MA 2GDQA 1OFQA 1T40A 1XWYA 2Z4GA 5G1YA 1XIDA 2ZZ4A 3NYZA 4GISA 5AC7A 4IIGA 1L2QA 4BF7A 1J18A 3BL3A 3RNDA 1ZGDA 4K1WA 3E0VA 3EOLA 3KM8A 3AZSA 1KTNA 5HK4A 1JCJA 2OFJA 5E70A 1Z8AA 3QLDA 4LAUA 3GS6A 3TW7A 1KQZA 4R5EA 3OQ8A 4PUEA 1UA7A 3CBWA 1OIMA 3TYEA 1F74A 4E4FA 3CIXA 4MJ4A 4FEZA 4IX0A 4QS5A 4KKXA 4F0MA 3CYJA 3IGUA 3T7VA 3GDMA 2VUNA 2ZA3A 3AALA 3TVAA 1E9LA 2XSXA 1OC6A 2AL1A 4JL1A 5IBXC 4D72A 3CQKA 2DT3A 4AIUA 5I2UA 1Q66A 1UKQA 2PDJA 4LVFA 3R25A 4RKAA 3RILA 4NVTA 1E51A 1PDYA 3BLIA 4EP8C 2GGHA 2A7PA 4NJJA 1ZQ5A 1IV8A 1NDWA 4H8VA 3RCYA 3G0UA 1JYVA 4JNMA 3B8TA 3SUSA 1IEIA 1CLVA 2PWFA 4HPNA 1Q65A 7CGTA 5M5DA 1DTNA 2R1KA 3IJIA 5AYXA 4WKHA 2GUUA 5CH9A 4LYKA 3RRXA 3FYPA 4S3FA 4EANA 2A4AA 2ZA1A 1XYFA 4LB4A 3E9AA 3O06A 3VIKA 5CZ0A 4KEUA 1MZHA 4LX4A 4MNJA 3KBVA 1M7XA 1JRBA 4FOKA 3CZGA 1MSSA 3F4WA 4GYKA 5D38A 3ZT7A 4TX8A 3NSXA 3SCVA 2KZHA 3ICJA 4GY7A 3AICA 3P93A 1UOKA 5A8OA 1AH0A 2W92A 4ZOCA 3GWQA 1ZFJA 3OHIA 4GY0A 3SJNA 2WCSA 3N18A 2PDLA 2ISDA 4LVBA 2RGMA 4N9DA 1FHDA 3DENA 4UFKA 1OX4A 1CGVA 3NQVA 1KLZA 3W2UA 1G7VA 3L2IA 4IMFA 3R0KA 3NPVA 2F84A 1JFHA 2DSKA 5ENLA 5BYWA 2DFAA 5F2MA 3UJEA 2CPUA 1HIZA 2ZUSA 3BG9A 3EDKA 2GDUA 2OXNA 1VPXA 2G96A 1R9XA 3B4UA 1H7PA 7ENLA 3R43A 1H7OA 2WANA 5DX7A 2FVMA 3SW6A 3MP5A 1RP8A 3SZ8A 5LA2A 3BLFA 1HN1A 1EJTC 1XFBA 1OZMA 2F2KA 1MXDA 1O1ZA 1X6LA 1I2RA 1GJWA 2UWFA 1LRTA 3AXIA 3DGRA 5EMYA 4DPQA 1YPXA 1S5TA 1KLYA 3P2VA 2YXXA 3PUEA 4JNZA 2ZXQA 2DEPA 2AAAA 4YTSA 3HMJG 3BCDA 1DP0A 5I02A 4IX2A 1RVGA 1UH3A 4D6CA 1XG4A 1B2YA 1E6RA 1ME9A 3M0LA 1GOOA 3K2GA 2Z1BA 3B8SA 2ZE0A 3B40A 4ZB0A 4NP7A 1IIHA 3PUGA 1VFUA 1CGTA 3WF2A 2WM0A 1SFSA 3KOFA 4H2HA 3EPOA 3CEPA 5AHNA 3TEVA 5AHLA 1ZBWA 2DZVA 1GVIA 2NQ5A 2VM8A 3DKLA 4F9JA 4GVHA 1D9EA 1WV2A 4MKNA 4TQTA 1R9ZA 2Z2UA 3CM4A 4K3ZA 3DYMA 3MY9A 1V6YA 3A3HA 1LM1A 3S5OA 4Q8OA 1SO6A 4B15A 1MDRA 4U4MA 4DM1A 4O10A 4Z08A 2PP0A 4F0KA 2W4XA 3CWHA 2XM2A 1XUUA 1YDOA 1LL4A 5FAGA 3H54A 1XLMA 2D69A 1X39A 4GH1A 1D3CA 5AECA 1OF8A 5FEZA 1FY6A 3T9PA 2OGJA 1OEPA 1PIGA 4C1NB 3VKCA 1RCXB 5ABHA 4KRTA 1P6BA 1A5CA 4XD4A 2C0HA 1UWQA 4XUYA 4KMQA 3WF1A 3VNDA 2BVYA 1TJ0A 3SCWA 4AZHA 3UXLA 2G3JA 3W38A 3FV9A 4ALDA 1IT8A 2PP1A 1QVBA 4CU8A 5MKGA 2ON3A 1K7XA 3KRUA 4BWLA 4ES4A 3W3OA 4JTRA 3MKKA 4EAMA 4RDWA 4WD0A 5I3HA 2AL2B 1DWHM 4TVCA 3U4FA 1QTWA 1B30A 2D24A 3BPWA 2WNNA 4W93A 4MB4A 3DX5A 4E5TA 1P0KA 4RE3A 1W3LA 1P48A 1F76A 1PPIA 2PDHA 3HTWA 2DH2A 5TQLA 1MMFA 1WUFA 2UY5A 3T4CA 5A6TC 3H6OA 1P0NA 4GXPA 5D05A 4OFCA 2QV4A 2IKHA 3B8WA 3ZQ9A 4PUUA 4FIQA 4DX3A 2OQHA 4M6VA 3ZSTA 1US2A 2VVSA 3KWXA 3BAYA 3GC5A 4NQ1A 3STEA 3WQGA 1N8WA 4IPIA 1JDAA 3DDMA 4PTXA 3T8QA 1OX6A 3WNLA 4AXNA 1ZNNA 2VRQA 1XYZA 1TV7A 2HBXA 3TLLA 4PUWA 1VZWA 4X60A 3UR7A 1GJPA 4AVNA 4GIEA 1GZJA 1CLKA 3E0WA 3VYLA 4ICCX 5BZAA 4IIEA 3OGSA 5GVJA 4MNKA 1R2RA 3W2JA 2IW0A 1KM0A 4DJDA 2HEJA 4N6EA 3EGJA 4D8ZA 3KOXA 3VDHA 5GJPA 4O54A 3VD5A 3DFNA 2F6UA 1R6WA 1OD8A 2FZNA 1BXBA 4QJ5B 1XXXA 3BDKA 1LRNA 2BNJA 4GMEA 3K8MA 1TA3B 6TAAA 1ZALA 4WDUA 5LNRA 3T6CA 3Q45A 2XHYA 5I3IA 3S9ZA 2PWUA 1G6CA 3QTGA 3P3BA 1M9HA 4GBUA 2ALRA 3TQKA 3KXQA 1GQJA 3WJXA 2BXYA 2IPFA 4HJFA 2E1DA 3R11A 4IP4A 3UGRA 2HCVA 5AYZA 3KLLA 1QO5A 7REQA 4HTYA 3G1FA 4WLCA 1ISVA 4ERAA 2FLIA 4AYSA 2CHOA 4HPXA 3WK0A 1NP0A 3CL6A 3O0KA 3RX4A 2ZQ0A 4JNYA 5T91A 4FIRA 3SR7A 4PB5A 3NQ6A 1V3LA 4RZ6A 5D2YA 4HB7A 2NVDA 1MRQA 2BLEA 2EKCA 5K4XA 1E5JA 2C7FA 4YPJA 3QJAA 4RK8A 2XIQA 1I0BA 4KCUA 4Z42C 4ZVJA 2V2DA 2VR5A 4MFDA 2X1TA 4A4AA 3A4JA 4PCPA 1K9EA 1SQ7A 4F4RA 1J0HA 3FJNA 3DFQA 1JUKA 4WX2A 3N19B 1ZJIA 1TTIA 1S5NA 1LCOA 1WDDA 5AOUA 3RM4A 4I9JA 3P5YA 4A6GA 5CZJA 3P7YA 2NLYA 2BHUA 5E0CA 1FUYA 1R5YA 1OGBA 2HTMA 1XICA 1XI3A 3FGCA 1PWLA 2INZA 3RU8X 3HJEA 3QQ1A 1PKNA 1EF2A 2QS8A 5A8GA 5BMXA 2FH6A 4FLOA 1ZHAA 3LRLA 1ZY9A 4JBRA 1J5SA 1GYNA 1BWLA 2J8FA 4UTIA 4IH3A 4DZ5A 5A8PA 1K8XA 1PBGA 5BRQA 2Y7FA 2I5IA 4QNEA 3QC0A 1SJCA 1EP1A 4O1FA 4ZZ9A 3W7OA 3LK6A 4J7RA 4IL2A 3QEZA 1CDGA 1H7RA 2RDXA 1IEWA 4JTEA 1QPOA 3GHSA 3F4DA 4AZBA 3WQCA 3MUXA 3TR2A 1NEYA 2C79A 5GQBA 3VGHA 3D6NA 4QXIA 3WNKA 3LRMA 2P1FA 5CXPA 3W7GA 4CGTA 3E1F1 4GZ7A 4GKTA 4JYFA 2I1OA 4YVVA 1JULA 4QX4A 4B3LA 1S46A 4DJFD 2FGZA 5DF0A 4M56A 2QF7A 3ITLA 4UTTC 3SN0A 5CG7A 4AU0A 3W84A 2DZAA 4Q8QA 3ARYA 5GPRA 4MJZA 5G4HC 4UTWA 3DHPA 1HL9A 1L6YA 3F4CA 5XINA 3S9YA 2ZZ7A 1AZ1A 3TAOA 1IXQA 4ZQNA 1J9YA 3QV7A 3PZGA 4Y9OA 4X3ZA 4XG1A 1PB0A 4JFVA 1KQYA 3AYVA 5C2GA 4FXSA 4PMZA 4F66A 3DAQA 4E3VA 4J40A 2Z1WA 3WUFA 2FQIA 1P1XA 1SGJA 2A3CA 4MYXA 4BA0A 1TR9A 4A8IA 3BZGA 3LZ3A 4G1NA 1JCNA 8RUCA 2W91A 4AWTA 4GXWA 1KC7A 3ZM8A 2H9AB 4UQEA 5JBDA 3WD3A 2G3IA 3B9NA 3V75A 3CQ0A 3NSNA 4JN7A 5BMWA 3TFCA 1XIMA 1WPCA 1FWBC 1A5SA 3K1DA 4MG4A 3GNNA 3PZ9A 2REQA 2YW4A 1RV8A 4I7UA 2QCDA 3T78A 3VKKA 1OINA 1U2YA 2DIEA 1GUVA 3PK7A 1RP9A 3NGJA 1QT1A 2J24A 3V36A 1K03A 2V5DA 2OKOA 1HVXA 5C2XA 3T42A 2BX7A 4U5IA 3C0SA 2JFEX 2PRHA 1UOZA 1E4IA 1FWWA 1JCTA 4HPHA 4JTDA 2XH2A 4OOZA 2V38A 3G1YA 4H1ZA 3LTPA 1WXZA 4WZHA 5K9CA 5HMSA 2XVLA 1A49A 1R86A 2CITA 1UPMB 3N2TA 3CHVA 4FF7A 3A4AA 4GNVA 3MO4A 3VIIA 4GI8A 2QXWA 4LAKA 3TSDA 4FX6M 1E6ZA 4NHVA 4I8DA 1H4PA 2PC8A 3TNOA 1JQXA 5K7JA 2Z1XA 2NWSA 1UYQA 4QDWA 1Q6DA 3TW6A 2DJLA 3MI2A 1UR2A 4J28A 4B4FA 5JBFA 3HBLA 1UB3A 1GEQA 2ZBTA 1V93A 2BMBA 4A8RA 1CZ1A 3BLKA 1YXYA 3LYEA 2X1RA 4G1KA 3JZEA 1OX5A 3RM9A 4J3TA 4A35A 3EDFA 4HA4A 3WMLA 2FJUB 1F61A 3MCMA 1G9HA 4XK2A 2AOSA 4XTIA 1EGZA 3ITGA 3UBPC 2VO5A 2O9TA 3A22A 3LLXA 2JKPA 3KP1A 3C3UA 5I09A 2OEKA 4TTGA 4CU7A 3UW6A 4LUSA 5HUPA 3R5EA 3W7RA 1JUEA 1P43A 5CJMA 3LPFA 1Q6CA 3E12A 5D9NA 4M1BA 4IIFA 1V7YA 1J5TA 3UA4A 3EEGA 3FVMA 3ZR6A 4IMCA 5H91A 3IS4A 5D09A 3SCQA 2C0AA 2ZDSA 2V6AA 1XC6A 3VA8A 1MDLA 4DI8A 2B31A 5H2ZA 2D3NA 1BQGA 5A69A 2ZZ2A 3S1XA 1SR0A 5CBJA 1XYBA 4BQ4A 1TIMA 1NH6A 1WZAA 4LY4A 5CGQA 4YYCA 3EX2A 5HR6A 4DXKA 1HP4A 3UNTA 1DORA 3ECQA 4O50A 3GVWA 4PH6A 3B03A 3ES8A 4J3XA 3KS6A 3AHTA 2O56A 2Y85A 4WRHA 5PTDA 3U57A 2E09A 2R1MA 3C2OA 4RX0A 3LPPA 2I5QA 3ABOA 3VIGA 2WK2A 3GHTA 4NRSA 4RJEA 3LCGA 2ZDRA 3U6WA 4MZYA 4XVDA 5AYIA 3W7LA 4C60A 5HMDA 3UPBA 1BG9A 4AUBA 1QHPA 3VD9A 4PMDA 3NDYA 4DUXA 1A5UA 1UD4A 1EC8A 2PRLA 1QK2A 3CLWA 4UR8A 1EL3A 3BW4A 2QCFA 3IRDA 1FWNA 1MVYA 4JQ3A 4ERGA 3KTCA 4FNUA 1GOXA 2X1UA 4UIOA 1PV8A 4EWND 3IJ9A 4JHMA 3KL0A 4JIRA 1IF2A 2HPMA 4F0HA 2OSWA 4Q4MA 3MCNA 4QRNA 1X6NA 1AL8A 4JFSA 1EGVA 2GK1B 1XSKA 3E6EA 1OT1A 4RPPA 2GJXA 5EMLA 3AO0A 4LC6A 2XVNA 2YCLB 2J13A 4IISA 3W0KA 5DMMA 2FHBA 4A2RA 1XH0A 1GOWA 1REQB 2GOUA 3APGA 3BMVA 1XJBA 3WK1A 1LWHA 3GUGA 3O6YX 1XW8A 4DWSC 4JKLA 4MAVA 3TA9A 4NASA 2R24A 3KVMA 4W7WA 4O14A 2E3ZA 2WCAA 3BV4A 4DJED 5FJRA 2FMOA 4XO6A 4XBSA 3W2KA 3Q4DA 1V02A 3LV6A 2ICSA 2J9ZA 1W2PA 3NSMA 3PWGA 1TMQA 2PMQA 1VD6A 4B5VA 5HQLA 2KX9A 4H4IA 2QJHA 2RDUA 1O5QA 3V16A 3W74A 2E6AA 2Y6ZA 3EKGA 4YTUA 3EMQA 5HR7A 1UWTA 2OELA 3SCPA 1OCQA 3R1ZA 2HWGA 1JI1A 4IXXA 1I75A 4ZQMA 4L1WA 4ICMA 4NI8A 5D8WA 4NXKA 3WNPA 2H90A 1M03A 1ZU8A 4XAFA 3R12A 1H60A 3UFYA 2Q09A 2ZADA 1ZTVA 2Y89A 1V0KA 1W3HA 5KZMA 3WFZA 1RSCA 2W67A 2BTMA 3H7RA 1JPIA 1O5XA 2CXGA 2D2JA 1EUNA 4TIMA 5CSRA 4LCQA 3O07A 3NL5A 1ZUAX 2XVKA 3ZLGA 1EBGA 1Q6GA 3TXZA 4GI4A 4L4PA 3R89A 3UWUA 5HPOA 1NSJA 1V6VA 3S1VA 4AZIA 2J7BA 4EF9A 5C2CA 3PZTA 3PJUA 3T0BA 4N7QA 4QG8A 3MA8A 5CPNA 1W91A 1P0EA 2VOMA 3PTMA 2UV8G 1UKOA 2F9RA 4KRZA 3NQEA 3P61A 1JDCA 3AYRA 3MHUA 2FYMA 3TYAA 4CVUA 4MTVA 1VFFA 3W28A 2F6XA 3DIPA 4HU4A 5FJIA 2VOTA 4D1JA 3SB0A 1FCUA 4WJXA 4JTLA 5AB3A 3WCZA 1C93A 3GLCA 2X1SA 4IJRA 5FI8A 4DAIA 4KEZA 5BXTA 1EEPA 2VX5A 1OF6A 3QGAC 5MHBA 3STGA 2DSWA 1J10A 2GSJA 4DBEA 2X16A 1GORA 2EG6A 3RCMA 1SSDA 1FWGC 1YRRA 3CAKA 2VDHA 1JQVA 3SN4A 4EPDC 3EDJA 1Q4WA 1JI2A 1CXHA 1R2SA 3MUCA 2ANUA 4Q4SA 3NEVA 3PJWA 5K4ZA 2HXUA 2JE8A 1TV3A 1E4MM 4ERIA 3LM7A 3SJ3A 5FJPA 1QUMA 3FHAA 2ZUWA 1WCGA 2D2OA 3RO8A 4FALA 5FOOA 5CJNA 1X8CA 3UETA 2J62A 1SSGA 5BOEA 1A3XA 1BYBA 3UQNA 4HMEA 2I14A 2CNCA 1RPXA 3WELA 5JBEA 3QPZA 3H4WA 3GHUA 3G22A 4WSKA 1HQTA 1EX5A 3VPLA 3I7QA 4YHGA 3WBWA 1IWPA 3TA6A 4F3HA 4DZIA 2DU2A 1GYLA 4ZQOA 3SCTA 1LORA 3G1SA 1F9CA 3AMDA 1K3UA 3KRSA 3UT0A 1TR1A 4K1GA 4N4QA 4C6BA 4DUWA 2B7QA 1EJSC 1W56A 1YNYA 4Y9NA 1ISZA 1CGUA 1ODZA 6ALDA 3LQLA 3N12A 2YCIX 1UIPA 4WDTA 4HOZA 2VNCA 4B2DA 2YCKX 1JYNA 3AOFA 1RUSA 4O15A 1AA1B 9XIAA 1XD1A 3KRZA 1J8VA 4IZGA 8A3HA 3ANVA 1SVDA 1IZKA 1XYCA 1BHGA 4U10A 3TW9A 3TN6A 3LEPA 1J2WA 1R3TA 3GM8A 3NXFA 5A6BD 1KBJA 1LQ2A 1OFEA 3GO2A 2Q6ZA 1JZ6A 6A3HA 3V3WA 3W2LA 2BODX 2XTKA 2BGNE 2JBMA 2G50A 3EXSA 2CETA 2OU4A 1VF8A 1XBYA 4JIQA 1Q5MA 2UBPC 1K77A 1TRDA 4GINA 1ISYA 2X2YA 3QMTA 1ZENA 2WQDA 3N6JA 3NL2A 4U5KA 5LGXA 2NLIA 4HYVA 4S3GA 3G6LA 3GTFA 3F5JA 1DL3A 2NUXA 1LT8A 3CAQA 1R3YA 2G95A 2ABBA 3VU2A 1TWSA 3TAKA 3QGVA 3G18A 1Q2RA 1TWZA 2BOGX 1C7TA 2DIKA 4HBKA 3VGBA 3SUVA 1C8VA 4R7WA 2QJNA 1THFD 2E68A 2ZICA 4L9XA 1UG6A 2HDJA 3JR2A 5ECUA 2GFTA 3T2QA 2E9LA 1PKLA 3ZT5A 5DEZA 4J3VA 1R3RA 3U7BA 2A7RA 3HV9A 1XGZA 4KH2A 1GOMA 1KCLA 4QE4A 3PANA 3CH9A 3DH7A 3F4VA 1C8XA 1F07A 2HPIA 3R8HA 3ALFA 4OT7A 1XV8A 4YIWA 1O66A 1ENUA 3BJSA 2QQ6A 2BG5A 3KDOA 4HNLA 5BWFA 1A5BA 1GOIA 5I03A 1MI3A 4HN8A 3NXLA 2WJEA 3P82A 5GNZA 2OZTA 2PCQA 4WGHA 3GH4A 1BGAA 4IFRA 4ASTA 4TMBA 4HQVA 1NFBA 2G8ZA 3U9IA 1W31A 1PZ3A 2QULA 1VYSX 4M19A 2GJPA 5CQ1A 2RAGA 3LLFA 2Z6IA 3OIHA 3U2EA 3TONA 3L4WA 2ISWA 2ZZ1A 1W3NA 4M80A 4EPBC 4GABA 1F4HA 4AIOA 4QQUA 1JPDX 3PULA 2XUCA 2WC3A 3DUGA 4EPKA 4X2PA 2J7FA 4EWJA 1CWYA 1W9BM 3UPMA 1S3TC 3O1NA 3ZS4A 1QI0A 2V67A 3WLHA 4IQJA 2IKIA 3CB8A 1BVNP 3CQJA 2HBVA 3HF3A 1MQRA 1TX2A 2W61A 3ITTA 4UR9A 3VFCA 5J8LA 3R94A 2NV1A 2DZXA 3M64A 2Q8XA 3QHMA 4DNHA 4NX0A 3PTKA 2VEKA 2VFDA 1D2KA 4UBPC 4Z1BA 4PMNA 4P8XA 4C7GA 1GNXA 1YHTA 2ZA2A 1KRAC 1LQAA 4GUIA 1B31A 2VT0A 2VZVA 4MVAA 3AHZA 2Z00A 3RF9A 2B7PA 2VFGA 1ZAJA 4H41A 4NNCA 4ZCWA 1HKVA 4ML9A 1ITXA 5A8MA 4A22A 9RUBA 2CXEA 1GVFA 4GPNA 1W9XA 1S5WA 3AFBA 3LU2A 2WYSA 2OZ0A 3K30A 3CH0A 3TP4A 1QPKA 3ZJKA 2TPSA 3EOEA 3VE9A 3LLDA 1E40A 3QFEA 4G2DA 3W24A 4U2ZA 2VD9A 3CUJA 2OYKA 1TV2A 3VIOA 2VZSA 1HNYA 3OLDA 3PZUA 4WIWA 1QRQA 1NY1A 1KD0A 1BWKA 4AF0B 5HNNA 1ZP4A 3CZ8A 3ABSA 1B9ZA 5E0KA 1G7UA 3APYA 2PFHA 3TK7A 4BY3A 4CUCA 2Y5EA 2VEPA 1VCGA 2YIHA 5A6SA 4NJHA 2GGGA 4KEVA 2P5NA 1ZBVA 1I2QA 5AN7A 1IEVA 2FB2A 2XZ9A 1FFQA 4U33A 1OFAA 3VIMA 4O1BA 1FWRA 3H22A 1WXJA 2ACRA 4UQBA 3T1GA 5AFDA 2WB5A 3RRAA 1QCWA 4AHPA 4UFMA 2XFRA 4FMVA 3CQHA 4P7QA 3BSGA 2Z7GA 1UQZA 1FX6A 1XBZA 3DZ1A 4JTSA 5FJUA 3SM0A 5A2AA 1EDTA 4Z2LA 5C8BB 4CD7A 4PMQA 3IPWA 2E6DA 4AX7A 1NFPA 1XD0A 4LVGA 5A6MA 3QZEA 4XAGA 3W53A 4MNMA 1UPPA 7A3HA 1KWKA 3QKZA 2FTPA 4BWLC 2C6QA 1BQCA 3VNYA 4XIAA 1EZWA 1PDZA 4I6VA 4Q4PA 1U5VA 3G1DA 1KM1A 4DYKA 1RPKA 1E55A 5DMLA 4GD0A 4F8XA 4BQ5A 5M1TA 1UD6A 5F4SA 3PS7A 3BW3A 2YDAA 3VIJA 4GCAA 3W1MA 4V1XA 3CV1A 4KWUA 2YDSA 4MUZA 5HMFA 4HK5A 3C0QA 3AIWA 2OQLA 4IL0A 1F6KA 2C1GA 4AEEA 1FH9A 3BE7A 3WLNA 3QZAA 3WQFA 3PB0A 3DG3A 3NOEA 5DRIA 1UD8A 1CXKA 5I00A 2DT0A 1UWIA 1Q2SA 1NAL1 3VI2A 1VLWA 3S6TA 3OQEA 4N9EA 4RDVA 4DJDC 1Z9AA 3SFKA 3GG0A 2DVTA 1IQ8A 1EOKA 3CPUA 4DRSA 2QCCA 4HZMA 3W73A 4IQEA 3QQWA 1BEUA 1CGWA 4S3CA 2ASHA 1VHNA 1FWCC 3CIVA 1P5BA 3N3TA 2PAJA 1JAKA 3MKVA 4LRSA 5C55A 4LF1A 3PWAA 1OZQA 3DI1A 3D46A 3N2XA 1BD0A 5BXRA 5TNVA 3B8UA 4H7CA 1EO5A 2FZ8A 5I7GA 1JYXA 3LQGA 3CS2A 1JD7A 5BWAA 4GOAA 1JCYA 1Q85A 1C8YA 1JDDA 5HDRA 1I0DA 1CLXA 3B8VA 3W7MA 4D6IA 3DHDA 1LYXA 4GUFA 3PZIA 1DQXA 3HGRA 2PTZA 3AS3A 4L65A 3WEOA 3LCXA 4WDWA 2P8BA 4BS0A 1FH7A 1C7SA 4HTBA 2DQWA 3JUGA 4Z2JA 3VO0A 1WNOA 1Z69A 3QHOA 4WK9A 2FPTA 1RA0A 2HISA 3ARPA 3Q67A 1J12A 2I9EA 3PPGA 1EX1A 4RV8A 3S1GA 1XP3A 1GK8A 5AY7A 3PBYA 1KB3A 1M53A 4JIPA 1W1TA 1SO3A 1EPVA 5F2LA 3C2FA 1N8FA 3LZ5A 3B97A 3ABZA 1S2AA 4PODA 4IPNB 3LM3A 3POCA 2MUCA 4A3UA 3AMKA 4GNKB 1QXLA 1V02E 3V18A 1BG4A 2BOFX 2ACUA 8CGTA 5CGTA 3I3BA 4GC4A 3AS2A 3LXAA 3TFXA 3THQA 3SUTA 5FJOA 1GKRA 4IFKA 1RY0A 3PPCA 4KCTA 4UC5A 2E4TA 1UWSA 2WWDA 5FJTA 2OPJA 1P7TB 3LRKA 1GQIA 1E6QM 2BXZA 2C16A 5D04C 4G56A 4DYJA 2DJXA 2I17A 5J04A 3B05A 4JGDA 2PDYA 4MAZA 3W23A 3DBPA 4N2YA 4QEHA 4H8UA 2D2GA 3HQPA 4LAOA 2W3ZA 3M0MA 1BYAA 2NVAA 3SCNA 1TPDA 1LJYA 1EHAA 3GVQA 4X2RA 4HU0A 4DB7A 2QCMA 4UXDA 4B4HA 4PEKA 1OQFA 3KW3A 4A3HA 4ACYA 1MW1A 1E1FA 1O7AA 1OVDA 1EB3A 1HKMA 4QR6A 3W75A 2OWCA 1FWIC 3E5BA 3BAIA 1GHSA 2DUZA 3S9IA 4QISA 4WKFA 1HKIA 3ARQA 3ISIX 1EOMA 3KL5A 3GQYA 1UWUA 1W3TA 3E49A 3BLEA 3CZEA 4YTRA 4KGJA 3FKRA 3DU0A 4L9ZA 4O1CA 3MYPA 3HPAA 1NWSA 3LSBA 4P8VA 4UTWC 1X7FA 2HSAA 3PZNA 3DHUA 2WZMA 2P0IA 3ZJ8A 3MZ2A 4PULA 4XBKA 4RDYA 3WUGA 2ZVIA 3TTSA 1OFPA 3NQBA 2ZE3A 2VCAA 1B90A 4YS1A 3P5ZA 3SUUA 5A6LA 1VEMA 4XV0A 4J3ZA 1MW0A 3NQ8A 3QOKA 4S3DA 1E6XM 1OG6A 4KIRA 1M3UA 2R94A 1O95A 1GQLA 2WO5A 5AZ0A 2P50A 3OVQA 3GKFA 3ZXWA 2CLEA 3SIZA 3ITXA 2RH9A 1NDZA 3E0FA 4ZOAA 1EA0A 1H1YA 2IXVA 1W5OA 4UQDA 3H8AA 4ML4A 2PWGA 2CERA 1DJNA 3EKZA 1A4LA 2GGJA 1QU4A 4F2TA 4BJHA 3RJXA 3OP2A 3KBSA 3MV01 1H3GA 3VTRA 3A4WA 2PGWA 3QYSA 2PSNA 3LCFA 4GIRA 1RH9A 1QO2A 1G94A 2WMFA 1UJQA 3K8LA 2NQHA 4B5WA 3WQ6A 1QW9A 4HVXA 4DI9A 1XRTA 2NX9A 4OHQA 4YWSA 3NGFA 4MADA 3GU9A 2W27A 2ALDA 4PMRA 4YVXA 4EXAA 4W84A 2QGHA 3ARXA 1R46A 2HS6A 3MPGA 1K7FA 4Q8NA 4GRSA 2IKGA 2J9XA 3IGXA 3VZYA 1H0IA 4MDPA 4D9PA 4IHCA 2YB4A 3EDDA 1W1PA 2V63A 1D7KA 4Q8UA 1KBIA 5SWUA 2VGBA 2PF0A 3GAKA 1WZMA 3K4AA 4I7WA 3TSBA 4CQ8A 1UQYA 3MJMA 2NQJA 1B4KA 2OX4A 2XVGA 4REQB 5HA7A 4C7FA 3DYOA 3OHMB 3DFSA 3XIMA 3NQGA 5RUBA 3HG4A 4XZLX 2QPSA 3GVRA 3PFRA 1F7BA 4LT9A 1TREA 3HGOA 2WSYA 1KTCA 3TYCA 5DY3A 1AW2A 1ICPA 1E4LA 1TPB1 4YHEA 1S2UA 1OADA 3WJWA 3SSZA 1XIJA 1AK5A 2PGRA 1JZ5A 4IQLA 1VFOA 4PTVA 4UCFA 4LUIA 3TN4A 1T96A 1SZNA 4O4WA 1QFEA 2ZX5A 3E3HA 2DORA 3RUBL 3A9IA 1H62A 2EG7A 3WEMA 4ZODA 3AJ7A 1AVAA 4UR7A 2V0TA 3LXBA 4I5RA 4XZWA 2Y0FA 2DV0A 5CSSA 2RUSA 3KOWA 2ZWZA 3OW1A 1V3JA 4L4LA 4M82A 5G1TA 1J0KA 1SFTA 4IPJA 3TE9A 1Q7MA 5A8QA 1UCWA 3C6CA 1TPEA 4IJCA 1XIGA 1NOFA 1MEIA 1SJDA 1WKYA 3QSRA 1GCYA 3CL7A 3NYDA 5T9CE 4WGXA 1QWGA 3FNDA 1V4YA 3DG7A 1QPQA 3IJ8A 1K70A 1NARA 3CJPA 4QG9A 3WLRA 3R0UA 5DMNA 3T4WA 4Y90A 2OEMA 2ZZ6A 3VGEA 1R47A 4FR6A 2CZDA 2AQVA 2A85A 2A3BA 3VK5A 4H9UA 3W00A 4A8LA 3VC5A 3L68A 4GI6A 4RPQA 3KTSA 1HKKA 3OA3A 1R3VA 4NJKA 3ZIZA 4NU7A 4DN1A 3IJ7A 3V0UA 5GNXA 1HO1A 4JIIX 4A29A 4TX9A 1OGGA 5FAJA 4WJ8A 4CEXC 4XZBA 3VOJA 3QY7A 1XGDA 1G01A 4Y9MA 1CCWB 3GNDA 3LNMA 2PDGA 5EL1A 3STCA 2BY2A 3MWCA 1PTDA 1XLKA 3CT2A 1HP5A 3UR5A 1G5AA 4LJ3A 1XYAA 3IEBA 4MB5A 1XS2A 2XGZA 2PDFA 3S47A 4D6HA 1FKXA 3F4NA 5BXSA 2Y7EA 4M8UA 1UA3A 2OWWA 2ZWYA 1RK5A 1MW2A 4D6JA 3W7PA 1L6SA 4IICA 2XDFA 3SEPA 4FSAA 3VOCA 3WNMA 2I16A 1VIZA 2AAMA 3P0WA 3LERA 1F2JA 2E40A 4O11A 4DF0A 1NWUA 4AX6A 1SFLA 3GG8A 4HD5A 3OGVA 3NOYA 3FXYA 1V08A 4Y96A 4UFLA 2ZUTA 4EE9A 3NM1A 2J79A 4JD4A 4UZUA 1AJZA 1MQQA 4AC7C 4LEFA 2A3EA 1W32A 4HA1A 2G4JA 4BK9A 5FSDC 2YR1A 3GDRA 5KZEA 5LXXA 4UNKA 5LGZA 4H19A 2I9UA 2J47A 5AYYA 4IMGA 1UWRA 2JIWA 3HGJA 4L61A 1XQLA 2DSVA 3N17A 2HK0A 3G0SA 4PTWA 4HJWA 1EIXA 1GQNA 1EJRC 4PMVA 4DXXA 3AIRA 5K3VA 4ZL1A 2Y7GA 1JCXA 1VB9A 4LF2A 2CZEA 3B0UX 4GY1A 4DQWA 1WBJA 2QIWA 3GZ3A 4H9VA 4IIDA 3O2LA 3PP7A 3PG8A 1EHNA 1S5VA 2J6XA 2XIJA 3AMCA 4BHYA 5BOOA 2E6FA 2DGAA 2QDEA 3OZMA 1O5KA 5HNUA 1TELA 3BUVA 4JYDA 3N9RA 3CUXA 4NYUA 5FIPA 4QAWA 1JZ8A 2GWNA 2WZEA 3MWAA 1UR3M 4JPGA 4MY8A 4AAJA 2P3EA 1PYFA 1DIOA 1KGUA 2YL9A 1B5TA 4YNGA 4DO6A 3DOPA 1OYCA 2C1IA 4FNSA 5CGMA 4LGXA 4JCMA 1F6YA 3SGZA 1A5MC 4CVWA 2YDQA 2GJLA 3UWVA 5HUOA 3ZT6A 1L6FA 1S1PA 3M5ZA 2CLHA 2QW5A 3HPFA 4FPSA 2HRWA 3WFLA 2PEVA 3TOPA 4NAFB 4C6IA 1LTDA 4QSFA 5AKQA 1G4PA 2R1LA 2A3HA 5FEWA 5CBIA 4FX8A 4RE2A 3F1QA 1QI3A 4HMDA 1PCKA 3L66A 3ZWTA 2JQXA 4HCLA 1XRFA 2PLJA 4PA8A 4Z2KA 4CNOA 1VJSA 1TJ2A 5DMYA 1DEDA 1WKDA 4W88A 3LOTA 1DJGA 3C8FA 2DH3A 2ZTKA 4JQ2A 2Z0IA 1SW3A 2PCEA 1X7IA 2QIIA 4IF2A 1GVRA 1ZL1A 4GQBA 1KWGA 1E6PA 3NL3A 1XYLA 1OCJA 2NQLA 5CPLA 2AL2A 3M0XA 4ZXOA 3BLOA 1EUAA 2VR2A 1E43A 1DV7A 3CUFA 1LLZA 3BAWA 1DXIA 1H51A 1S38A 3DBNA 1XLLA 4PCSA 3VINA 4CCZA 1DHPA 3G8EA 3JVAA 3WF4A 3WF0A 4A21A 1U1UA 4GX8A 4E4PA 4F0SA 2AMGA 2W62A 2V3EA 2VL4A 1OY0A 1QBBA 4LANA 1XINA 4XD5A 3L0KA 5D32A 2Z1SA 2Q8LA 3ZO9A 2VZTA 3DYPA 3EWZA 1TG7A 2OVLA 4DWDA 2A6NA 2E0PA 3GTXA 4KEMA 2PU0A 1KM5A 2B81A 3ONCA 1UBPC 4GZIA 2BHZA 2WZIA 4D6EA 4JL2A 1J0JA 4EVZA 1SFJA 4I8YA 1UC4A 5D9MA 3WQ8A 4TUFA 1X6UA 3B8IA 4BF5A 2W66A 3EKLA 3H12A 1FA2A 1CGXA 2FGBA 3CQIA 4MY9A 1YQ2A 3P81A 4CKQA 3ZJ7A 1SU5A 2GJRA 1IHIA 1QHZA 4NJIA 4RW3A 1PS9A 5DANA 5D9PA 3WDIA 1RVKA 4H8HA 2WCGA 3GTHA 1TA3A 4POCA 3WQVA 4TU1A 4DO7A 3RYSA 2QUVA 4FZIA 3N2BA 1GEHA 1I1XA 2PU1A 2VVNA 4I3GA 2XN0A 4D8AA 3W86A 2DZUA 4DO4A 3QR1A 1TB3A 1DQWA 5EY5A 3FJ4A 1O1HA 3CUIA 3BJFA 3W7KA 3RLHA 3WLLA 3MV11 4MWAB 2XYLA 1Q45A 1TJPA 4GUJA 1EEXA 2V5LA 3PSWA 2PBOA 2EPHA 2HS8A 2QYGA 3N6QA 4CQBA 2F2HA 2UY4A 3JU2A 5C70A 2YKKA 3SY8A 3GNPA 1KXQA 3CASA 3V1PA 3R79A 1W6TA 1KCZA 3LPGA 2J75A 4DO5A 1K8ZA 5CPOA 3U2CA 1HL8A 3MMTA 1FVPA 3EMZA 3WLIA 3C2EA 4P5UA 4UTKA 5A6JA 1TWIA 3K4DA 4QCEA 4DJFA 3KVJA 3C2VA 5DY2A 3M4HA 3WK2A 1AQHA 1RQEA 3LCWA 2QCHA 2YGYA 3VGGA 5FESA 3VUSA 5I79A 1BTCA 1A3HA 1T8QA 4PRRA 3GNOA 2JF6A 4A2SA 2QVHA 4JEQA 3L65A 1Q3NA 1EJXC 2V3GA 2UZ9A 5F2IA 4JKMA 1XCWA 3RR1A 1U1HA 5FL1A 3UWYA 2A21A 1PZ0A 1OGSA 1K9TA 4HSNA 1I2PA 1E1EA 3TJXA 4Z1CA 1QNSA 3O0FA 1FXPA 3AWOA 3GXDA 4MWAD 3DN5A 5LIYX 4K2SA 3K1GA 2V2HA 5BOFA 3FJLA 4R53A 1OK6A 2WNZA 2GQ8A 3DECA 5G2IA 2J78A 2WV8A 3PZOA 4AZGA 2CLOA 4W5UA 3MB9A 1ZRQA 3LHUA 1RBOB 5A6AA 3RGTA 3OGRA 2PWEA 4Q33A 3MSRA 2EPKX 4LNYA 4URIA 3S2NA 2D23A 4E3TA 3D0CA 2NW0A 3CHCA 3CUGA 3VDAA 3CZKA 2ZX8A 3BSMA 3QN3A 3V5FA 1QOXA 1K9DA 1XFCA 2DPEA 2AGTA 4HN4A 5IBXA 2VX7A 2ZFAA 5IHRA 2A1YA 2AMXA 1FDZA 1MW3A 3DG6A 3QW4B 1XR2A 4AVFA 4NF7A 4GQQA 3VM5A 4HNNA 1OD0A 5B7YA 1CEOA 1NDYA 3TQPA 4QBXA 3SDOA 1J79A 4E2OA 1V0LA 1EA9C 4FXRA 4CEUC 1JFXA 4FNTA 2CC0A 5IOBA 3TLQA 2E5BA 3D47A 3WQPA 3ITOA 2O9RA 2GUYA 4XX6A 4UUIA 2VFEA 3CV6A 3GXIA 3QQ0A 5K2ZA 2TAAA 3MSDA 4X9YA 2YLAA 2HVOA 4OBRA 3CWOX 5CZSA 1CECA 1GZGA 1US0A 3UCCA 3WBEA 1TV5A 3INPA 3O6AA 5GNYA 3IJLA 1CYGA 3UXKA 3PJXA 5FD0A 1EH9A 1W0MA 2X1IA 4MPKA 3M9YA 3H55A 3V5CA 5D37A 1OFOA 2BSLA 2PDXA 2H9AA 4RDZA 5H8MA 3UR2A 4DAFA 4GYFA 5CCZA 3UR8A 3NO5A 3U4AA 3WQOA 1RJQA 2AGKA 1GVEA 3HG5A 1UUQA 4LALA 1PIIA 4QLKA 1JZ3A 4AZCB 4FX7A 1XRVA 2WNQA 3AXKA 4AWEA 1V79A 4HPGA 1R87A 5C0QA 3E74A 5HINA 1XKYA 2E7FA 2Z1KA 4RL3A 1TE1A 2Y5SA 4P2VA 5A8NA 5FF4A 5BRPA 3A13A 1R85A 2HNEA 1M1BA 3RG6A 4IGSA 3LPOA 1XBXA 4F40A 3ZJ6A 2YCEA 1HW6A 1QHOA 4HNUA 1UBSA 8XIAA 1M68A 2PC4A 5I3GA 4NSBA 1HJXA 2DDXA 2WZTA 5D4YA 1Q6OA 2F61A 3EX4A 4GQRA 5C9XA 2F8QA 3W70A 4EX4A 4UQCA 4R9XA 1WDRA 2FJKA 1K02A 4ORIA 3VNKA 4QROA 1QATA 2D3LA 4N02A 1XIBA 1HGYA 4MDOA 3I6TA 3CHDA 1KNWA 1KRMA 2CBIA