2PDPA

Human aldose reductase mutant s302r complexed with idd 393.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
315
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLRCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdpA00
2PDYA 2PEVA 2F38A 4LBRA 4LB3A 4WDWA 4R9OA 2BGSA 1AH3A 3UYIA 3ONCA 3LQGA 4JQ1A 3LUTA 4GACA 5C7HA 3RX2A 4WDTA 4ASTA 3O3RA 1OG6A 5LIYX 2PDQA 4DBSA 2IPJA 3GHSA 1J96A 1IEIA 1RY8A 4G5DA 4JQ4A 4EXAA 2PDJA 2R9RA 5HA7A 3MC5A 3UZYA 2R24A 2F2KA 4JTCA 4XK2A 3M0IA 1ZSXA 3LNMA 3R7MA 3WCZA 3O0KA 3KRBA 3V0UA 4EXBA 3LBOA 3FX4A 3F7JA 1EKOA 3DN5A 3H4GA 3T42A 4PUUA 1YE6A 5LIWX 3S3GA 1X96A 3MB9A 2QXWA 1XGDA 1Z3NA 1GVEA 5HNUA 3R8GA 3LN3A 3P2VA 1PWMA 3G1RA 2IS7A 3BV7A 2PDBA 3M4HA 1Q13A 4JQ3A 2FGBA 2VDGA 2J8TA 3CASA 5DANA 2CLPA 1X98A 2PDFA 5LIUX 4JIHA 4XZHA 3UP8A 1RALA 2FZDA 2IKHA 4FZIA 3RX4A 2PZNA 2INZA 4YVVA 3CAQA 1C9WA 1YNPA 1ZUAX 4GQGA 4MHBA 2PDHA 2ACUA 2AGTA 4Q3MA 2DUZA 1FRBA 2HV5A 3DOPA 1LWIA 3R58A 2I17A 3R43A 4ZFCA 2HEJA 4GA8A 4YU1A 3UZXA 2ISFA 4YVPA 4PR4A 2PD5A 5KETA 1S2CA 3LZ5A 3V0TA 4JTRA 3WG6A 4WRHA 2INEA 2IKGA 2IKIA 1T40A 4FALA 4LAUA 4JIRA 4XZNX 5JH2A 3ONBA 1PYFA 3VXGA 3EB3A 3LEPA 4JTAA 4PRRA 2FZ8A 4GIEA 4GABA 3G5EA 2PDLA 3GHTA 2PDCA 1MI3A 3LD5A 1Q5MA 4QX4A 4L1WA 3QKZA 4LAZA 4WDUA 1RY0A 2HVNA 4JTQA 1JEZA 4LBSA 5JH1A 4IGSA 4PMJA 2ALRA 2PF8A 1ZGDA 4DBUA 2WZTA 3UFYA 3V36A 4FA3A 1AFSA 1S1PA 4DZ5A 3EAUA 1Z89A 2PDMA 3BUVA 1QRQA 4QXIA 1YE4A 4I5XA 1PZ1A 1AH4A 3RX3A 3N2TA 1YNQA 2HDJA 2PDUA 3GUGA 2HE8A 3CV6A 5AZ0A 1MRQA 4XZIA 2PDIA 3C3UA 3V35A 2IPGA 1LQAA 3GHRA 1UR3M 4PUWA 1K8CA 3CMFA 3GHUA 2PDPA 5HNTA 4OTKA 2PFHA 2FZ9A 3CAVA 2NVCA 3NTYA 4XO6A 2WZMA 3WBYA 1XF0A 2P5NA 3M64A 4XZLX 2NVDA 1AZ1A 2PDKA 3N6QA 4WGHA 1M9HA 4XVEA 1QWKA 1HQTA 4IJRA 3BURA 1SM9A 1IHIA 3UWEA 1AZ2A 1PZ0A 3D3FA 3UGRA 3B3DA 4QR6A 3Q65A 4JTDA 1XJBA 1T41A 3UZZA 4FAMA 3LQLA 4YVXA 4HMNA 2PDWA 3LENA 2DUXA 2PD9A 4H8NA 3ERPA 2BGQA 1S2AA 2PDNA 2A79A 4DBWA 4L1XA 2ACSA 3WBXA 3R6IA 4JQ2A 4WEVX 2HVOA 4H7CA 4JIIX 4WDXA 3LZ3A 4YS1A 2ACQA 1Z8AA 3R8HA 3H7RA 3WBWA 3U2CA 4RPQA 4XVDA 1ADSA 4AUBA 2PDXA 2I16A 3EB4A 4GQ0A 4PRTA 4ICCX 2FZBA 2PDGA 1VP5A 4Q7BA 4XO7A 2FVLA 2DV0A 3V0SA 2BP1A 2IQDA 4JQAA 1Z9AA 3COTA 1MZRA 2ACRA 1ZQ5A 1HW6A 1EF3A 5LIXX 1EL3A 4IJCA 4F40A 3R94A 4HBKA 4XZMX 4NKCA 3BCJA 3UZWA 4XAPA 3FJNA 1US0A 2IPWA 1EXBA 4QBXA 4LB4A 4GCAA 2IPFA 1A80A 5AZ1A 2C91A 3Q67A 1X97A 2IKJA 3UG8A 1AH0A 2HE5A 1PWLA 1S1RA 3CV7A 5M2FX 5LIKX 1R38A 2IQ0A 3H7UA 1VBJA
chains in the Genus database with same CATH superfamily
4OJYA 4X9SA 4UTHA 2CBJA 3B97A 1UUOA 1POKA 3GU1A 3SM0A 3FJ4A 3RMJA 4US5D 3ONCA 3H70A 3QOMA 1NWTA 1BAGA 4HNVA 5BZAA 2JALA 1IIHA 2XIIA 3S5YA 3EEZA 1F3XA 4ZOAA 1NWUA 4P8VA 3RRAA 4FXJA 4Q7IA 2YL9A 1TZ9A 1IWPA 5E93A 2Y1HA 4MB3A 2VUNA 5CC5A 3AFBA 5XIAA 4IX0A 5HATA 3M0IA 2VR4A 1DHPA 1W31A 4MKNA 1WZAA 4IQLA 1LG2A 4YWIA 4A3HA 1P7TB 1AMYA 2DJLA 1KTCA 2WQPA 3BICA 3OODA 4NZCA 4G1KA 2EKCA 1SJDA 4LSBA 1XGZA 4NYUA 3HQ1A 3R8RA 2J25A 4O53A 2Q01A 4TR9A 1TREA 3S5ZA 2A21A 2INFA 4D1IA 3HFTA 4MB1A 3WFZA 1HGYA 4ZOBA 4QAIA 3AU2A 3N25A 2BB0A 3DH7A 4UOJA 1Z42A 3C61A 3APTA 4LF1A 1IEXA 5A1AA 1IT8A 1XW8A 3EOLA 2OZ3A 1OQFA 4HHPA 1W3NA 1W1PA 5HMSA 2PZNA 3W84A 3FK4A 3B04A 2X0YA 5CJNA 5DQPA 1XHGA 3M0KA 2Y85A 3DKJA 4NAEB 4LFYA 4WCJA 3KP0A 2PBOA 2E28A 2X41A 2WQDA 4C6DA 1SPQA 5HMEA 1XLFA 3MI6A 4BK9A 3CC1A 1AL7A 4JAWA 2E1DA 1NQKA 2DVUA 2GYIA 2RFGA 3E0LA 3NDYA 1A5KC 2OB3A 4WOQA 2FDSA 5FF0A 2ISFA 3WEOA 4NJKA 3QVQA 3LHTA 4MYXA 1Q6GA 1I60A 4M19A 1G7UA 3OLDA 3MJYA 4FX6M 4MNJA 3PZVA 4LAKA 4JIEA 5FSEC 5JH2A 3S5NA 5TD4A 5IXEA 2DSKA 3IVSA 1O94A 1ZBVA 2PMQA 3MI2A 3VOGA 3SIZA 1YTEA 3WH5A 4IP7A 1HNYA 2W91A 3LCFA 4KEVA 3S8HA 1UQYA 3EEGA 2XISA 4C1LA 3IJIA 2OQLA 2G4JA 1W5NA 2GSHA 2E9LA 4LANA 1JEZA 2P76A 3QHOA 5E1QA 4EPKA 2BHZA 1JYXA 1PHQA 4C1NB 4H9VA 4NZFA 4IQDA 3WUFA 4DZ5A 3EAUA 2OWWA 3SY1A 3AMGA 1ICPA 5HMFA 1JDFA 1EC9A 1A3WA 2YLAA 3N2TA 3N12A 5FJPA 3T05A 1ONRA 3TJLA 4IG2A 1O60A 3KAOA 4A2SA 1EWDA 3N6HA 3BCFA 4AHQA 3DG7A 5I24A 2FB2A 4Q8VA 1UR3M 4WQ6A 4GY0A 3B03A 1KA9F 3GHUA 1PTAA 4IIEA 3LPFA 4RNJA 1C90A 4CVUA 4BWLC 4MAZA 4K8GA 1R8LA 3NQFA 1FQ0A 4ACZB 2R8WA 3QR0A 1TMHA 4IGHA 4MFEA 3QM3A 2PDKA 3N6QA 3G1YA 4I8DA 3AXHA 1WX0A 2XG9A 1W9UA 3JW7A 3OHMB 1IHIA 3QTPA 3NXLA 4Q22A 2CYGA 3R25A 1E6QM 3T2OA 4A3UA 2Z7GA 1FWFC 2FTYA 3WMSA 5DF0A 1GWJA 1LP6A 3QQ0A 4HMNA 1JDAA 1MEWA 1PKMA 3PM6A 2HXTA 4WXYA 4Z0SA 1KM6A 2OWCA 4L1XA 3ARRA 3C2FA 4LVAA 4DZIA 3TQVA 2GUYA 4JTGA 1K9EA 4AZCA 4P2VA 1WE5A 2PGEA 1LL7A 2G41A 3AIUA 4IPNB 3ANVA 3KVJA 1O5KA 2E9BA 2O9OA 4RDZA 3DGBA 4XISA 3E2QA 1F07A 4KEMA 2C71A 5JIWA 4DLFA 1E56A 3N34A 3RM4A 3A4XA 2CZEA 3E5PA 4J3WA 3OZOA 1NVMA 4J3XA 5L9FA 1THFD 1L6WA 3AS3A 3H22A 4GZIA 3SCTA 1MZRA 3CHCA 4J3TA 3GLCA 1A3HA 1EX1A 4XX6A 1YDOA 3UJRA 4A22A 4IICA 4TTGA 2VQTA 2YA0A 1TPDA 4F40A 4IJCA 4O13A 3U3HA 3HFYA 5CBJA 4WJXA 3H54A 4DWSC 3PTDA 4JOMA 1GG1A 4NKCA 3ITXA 1JDEA 3KUMA 3FJNA 1J6OA 2GQAA 3W38A 4QSFA 4WUIA 3UG8A 1KCXA 1K9DA 2HE5A 2F7FA 4AH7A 3SCRA 2BY3A 3MSYA 1OB0A 3GVVA 4M6QA 4KBXA 1Q66A 1UH4A 4O0QA 4Q4KA 3ZMRA 4A21A 1E5JA 3NZGA 2F38A 3WQWA 3MZ2A 1K03A 2ZYFA 4UCFA 3M0XA 1AH3A 2VYOA 3M46A 1BYDA 2WJFA 5TBOA 3RX2A 5D38A 1G94A 4U2YA 3GS6A 4R33A 4GO8A 3SO7A 1XRVA 1VIWA 2WZHA 3M5YA 1CENA 2NW0A 4K2SA 3G3DA 2WHLA 3LCWA 2UY4A 4W5UA 1SW0A 2X1RA 1LL6A 2DGAA 1K4GA 3WQ5A 1P6CA 1VFSA 1JPIA 1TELA 2H90A 2Y8KA 2F2KA 5A6LA 2VP8A 3PZTA 3DESA 1RUSA 1LBLA 3PN8A 4WKAA 3WCZA 1R85A 3SQLA 3RDKA 3PZMA 3BVJA 2Z27A 5CBBA 1O68A 2J62A 4GO9A 1LQ2A 5AVNA 1W3IA 4ILSA 3NYDA 3EKGA 4KERA 4O11A 2I1OA 2GQ3A 1EJTC 5A6SA 1OVDA 3KBNA 1IZCA 4OIFA 3S3GA 4H9XA 3LHZA 1VFTA 2HZGA 1UR2A 5GNXA 1XGDA 2F6XA 3MBDA 3VOFA 5I3JA 3CUZA 1TX2A 2YBVA 3LHWA 4Z1DA 1YIXA 3A12A 2WLZA 2X09A 4W84A 4PCFA 2X42A 3NQEA 2Z1SA 4AZGA 4KRTA 2BV9A 1W8SA 2J9YA 2GGEA 4ZQNA 4C6OA 1FDYA 4JKMA 1AVAA 2PGWA 4IHCA 3LCIA 3CAQA 3URQA 1KM1A 3S1VA 2XFWA 4N6EA 1EIXA 4F0MA 3ALGA 2J13A 2GLKA 1IYXA 3S5SA 4DJDD 3D0CA 4PYSA 1K4HA 2D20A 3BPWA 5ABEA 3WELA 1CECA 2OELA 4F4RA 3BSMA 5BYWA 2Z2AA 3M0HA 3NM3A 2PU0A 4PGLA 1L9WA 3SBFA 3C8NA 3NQ8A 2Y7FA 2HROA 3T0AA 2QDGA 1Q4WA 2FHFA 2V68A 5CZSA 3E38A 1V6TA 2VD8A 1US3A 3W7RA 4IXHA 3MYPA 4ZQOA 5DY2A 4EPDC 5IOBA 1A3XA 3CZEA 5CC6A 3BXWA 2AOSA 4GGBA 3LM3A 3E12A 3SQSA 3CWNA 2W61A 3NXFA 1GQKA 3BAKA 2O55A 2ZE0A 1EO7A 4Z2IA 1OFEA 2Z1BA 5CSRA 2ZZ1A 3VK5A 4B5XA 4O28A 3VUSA 1HKVA 3FW6A 1EPVA 1OK6A 2R14A 5FAJA 3Q45A 2WXDM 3E2VA 2BSLA 3MDWA 4RDWA 1N7KA 3LXAA 1KGWA 1J93A 4JTHA 4XB3A 1J6PA 1KWGA 5DO8A 1ZTVA 4EANA 4HK5A 3BGAA 1GOIA 3WQ8A 2AQOA 3WD3A 1BHGA 3WLIA 4JTUA 3RJYA 1K8YA 3RR1A 4IZGA 1YE4A 4UTIA 4I5XA 4AWEA 2E8ZA 1OC6A 3NZRA 3O6DA 3W9ZA 3RX3A 5AECA 4TXEA 1VBRA 2DSWA 1YNQA 2OWXA 4GKTA 1TMQA 4GBDA 3F4VA 1BWLA 3LHUA 1H51A 5CPMA 4B2DD 3C3UA 3NSMA 4FLRA 3M0LA 4PUWA 1FKWA 4GXMA 1KXTA 4L1GA 3W72A 3VMPA 4W86A 5HK4A 3WLQA 5LNRA 5HAOA 4AZCB 3EKZA 2BXZA 2PCQA 4O1BA 1M65A 3CBWA 5D9OA 1FWRA 1JZ6A 5I3HA 4AU0A 3HU7A 4XZ9A 3TH6A 3GR7A 2D0HA 2DZTA 2QF7A 4V28A 4A2RA 4KS0A 3KVMA 4F0KA 2W63A 3HGSA 4TX9A 1UASA 4QE1A 1JQVA 1BGGA 4DUOA 1C8YA 2DQXA 4ZSTA 3I3EA 3OQEA 1JZ4A 3BURA 2C18A 1A5AA 2F84A 4FX7A 7PTDA 5CSSA 2WAGA 3BCDA 3BANA 3QZAA 4EACA 2NQLA 1UD2A 4Q4RA 2RDUA 5I0DA 3A21A 4MWAD 5E9XA 2QEZA 3KLLA 1E51A 2BY1A 1A5BA 3EDEA 4M1BA 2NXHA 3ZM8A 4LF2A 1E40A 3BJTA 1HVXA 3C8FA 1EWEA 1T99A 3OO2A 1IXQA 3ITOA 1IWBA 4Y8EA 5DXYA 4DPPA 1R3VA 4JIIX 2Z26A 1GVIA 1W5OA 4LUTA 2G3JA 1Q6EA 5I7GA 4WSJA 1WPCA 1TX0A 1DORA 2E09A 2ZA3A 3NQVA 4I7UA 1ADSA 3WK3A 3H2EA 4NZ3A 3WF3A 2GDQA 4Q8WA 1JD7A 3TJIA 2OXNA 3S42A 4O54A 5HOSA 1D9EA 1H3GA 1DJXA 2FVLA 2BP1A 3WX7A 1VB9A 4YMZA 4H8VA 3A9IA 5DY3A 2BNJA 3O63A 5CQ1A 2PLKA 2XHYA 4A8RA 4KESA 4FNSA 3S1UA 1OF8A 1OY0A 1LF1A 4QG6A 5EFFA 3STGA 4K8HA 2WMJA 1DWAM 4LUSA 4JD4A 3P7YA 5HDRA 1W6TA 2JGYA 3H7UA 4HNTA 2V5JA 2V6AA 3BV4A 5DRIA 3ZLGA 3W4RA 2Z29A 2O9PA 2XYLA 5HUOA 4ZTXA 2ZRWA 5BOEA 4ADUA 2Z2UA 4LB3A 3VE7A 2V2CA 1V3HA 3HQOA 1FP9A 3PPHA 3S6DA 1AMKA 3QQ1A 5AKQA 1LRNA 2ZFAA 1YMYA 1RD5A 1RP9A 1KKRA 4WD0A 3UWUA 3QW4B 2FYMA 3LHYA 1VPYA 1UYQA 2QPUA 3GW0A 1UA7A 4NL1A 2ON3A 4JQ4A 4AZ5A 4P7RA 3DGRA 1P1MA 2O7SA 4MZ8A 1LG1A 1EOKA 4Z1YA 5A8PA 1JPMA 1K9FA 5AYYA 1EGMA 4B90A 5D02A 1R87A 4QNEA 1S38A 1ECQA 1OIMA 4JY8A 3O0KA 4LWWA 1ALDA 5AFDA 4UQBA 3VAVA 1QASA 3EX2A 4S23A 5FJOA 1PTDA 3TIMA 3GH5A 4S3GA 3WLLA 2A7PA 2PP1A 3W23A 1YKWA 1FWJC 1H41A 5IBXA 1G1YA 1RK6A 4Z1CA 3E1F1 1HJXA 1V6UA 2OG9A 3CTLA 3ARPA 4LYKA 3UA3A 1GHRA 3IWPA 1KXQA 3STEA 3HJEA 3CASA 3TR2A 2Q8LA 3UP8A 5C55A 1VJSA 1XYAA 2O4MA 4D8ZA 4YVVA 1UD5A 1WP6A 3V5FA 1ZUAX 3PG9A 4JDYA 4J9JA 4FF7A 3PUDA 3QQWA 2I56A 2ACUA 2AGTA 2QUNA 4M6UA 2ZX7A 2V8ZA 1CZ1A 2YCKX 1LWIA 2HWGA 1XH1A 4HNOA 3I6RA 3AJ7A 1UHVA 1RA5A 3UCQA 1H7NA 4HHMA 2PAJA 4A3YA 1XS2A 5LGZA 3VNKA 3VZXA 4KWSA 3O15A 3BOLA 4W89A 3VDBA 1TV5A 1P5BA 1NTHA 1UWQA 3VFLA 4QP0A 1R7AA 5H8PA 3LCGA 3BW3A 3TOPA 4GUGA 1H1YA 1V3IA 1C9DA 1DTNA 1QPNA 4LXFA 3NDZA 4ZE5A 3TYCA 4AAJA 1NDWA 4GJ1A 4IMGA 5KZDA 1B5TA 1OCBA 3V7PA 4ZA0A 4QDPA 3AZSA 4D2JA 1HFBA 3A24A 1TFVA 3H2CA 3RUBL 4REQB 3ATYA 4JNZA 4LVGA 4L1WA 3NO5A 1GGOA 4MY8A 4CNTA 1XYBA 1H7WA 3BSHA 4YNGA 3CHFA 4DNHA 3EKLA 2I57A 4BFAA 5HBFA 3WUGA 5BXRA 4HU8A 3F2CA 2JFEX 3DU0A 3NM1A 4ZENA 3HOJA 2D0GA 4CEXC 1W1IE 3P8JA 4ROPA 3TYBA 4QXIA 3G24A 1N55A 4U3AA 2CLKA 1SMDA 4L64A 4YXGA 1YBQA 4LBUA 3M43A 3KX6A 3CIWA 4HPJA 3PTQA 3CV6A 1LT7A 7TAAA 1LRTA 4HMEA 1MRQA 4QITA 4HOWA 3B8TA 1OGGA 4US6A 4P7QA 3MMUA 4Y8FA 4OECA 2J75A 3KHDA 3PG8A 3L4TA 1K8CA 2G97A 3LGDA 1D7FA 4LUTB 4QE4A 1SZGA 1S5NA 1BYAA 1MO0A 5D2WA 2W66A 2QUVA 4IL0A 4NVTA 2AQWA 3VCNA 1V51A 3KP1A 2P5NA 2V2DA 3ANUA 3I4KA 3S1GA 4GIYA 1D8CA 2EF9A 3SUTA 3QV8A 4FR1A 1SJAA 1V0LA 1QWKA 3S2NA 1UD3A 4WSHA 4Q4SA 2Y5EA 2OKOA 2DZSA 1CI1A 4U5IA 1FWAC 5FF3A 3DHDA 4HCDA 4PMZA 4RDYA 2RHGA 4NT0A 1ZAHA 3WSUA 2YB4A 3LRLA 4FXSA 3BQ6A 2GDVA 3L4UA 1QXLA 4ZGYA 3WBAA 3OLEA 4HPXA 4D6IA 2C1IA 3VZZA 5G4HC 4PMOA 5CSUA 3U6WA 2VGGA 5RUBA 4JTLA 3S2JA 4QQ3A 4Y9OA 4D9PA 2WNNA 2YCIX 5FACA 3TNOA 3BLLA 4JDBA 5KZ6A 1XDJA 4M7TA 1UB3A 4OT7A 4Q8NA 1HJVA 1UKPA 2J8GA 3VM5A 2QVNA 3MUXA 2HTMA 2Y61A 1Q45A 1VGAA 1SFTA 2JKEA 4LVDA 3RCNA 1NU5A 1ME8A 4PUDA 2CHOA 3W2NA 1K8XA 3PB2A 4JQAA 4CEUC 8A3HA 1HO4A 3LOTA 1TTPA 2ACRA 1QTWA 3ITYA 3SJNA 1OGSA 6XIMA 1E0UA 2NT0A 1LTDA 3KL3A 3DC8A 3VNMA 1JI2A 1LQ0A 2YXOA 3E02A 2JF6A 4WIWA 4UOZA 4LB4A 1VKFA 1C93A 4Z2JA 1SZEA 3WZ0E 4RZ4A 1P0KA 3CH0A 2CZ5A 1Q6LA 3BH4A 1F05A 2OQYA 4N9DA 2G3MA 5EPDA 1E43A 1XCXA 4GY7A 1A5NC 1AW5A 4W5ZA 5G4WA 1KR1A 1R6WA 2QW5A 2FDMA 1H49A 3SFKA 5I02A 1IGSA 1DIKA 2PEVA 1SJCA 1JGIA 3PBUA 1V6XA 3UYIA 3W27A 3WLRA 1QW8A 3RU8X 3MVTA 3SADA 1XBVA 6CGTA 3GXMA 2WSKA 2ICSA 5CKSA 3GNRA 3RO8A 3CWOX 2KAUC 2QAFA 2WNWA 4S2BA 5F4WA 1FWTA 3B8UA 3K8MA 4F0HA 3RG6A 1FP8A 2YW3A 3BAJA 1HTIA 2P3EA 4R7WA 4KFNA 3GTIA 1FTXA 2PWUA 1QVBA 4XWUA 4QJ5B 3SB0A 4IFKA 4FR6A 4JL1A 1IR2A 3LV5A 1FKXA 2J66A 1TMLA 2BVYA 1QAPA 3MP4A 3A3WA 1M7JA 2E8YA 3FYPA 3EBVA 1SVDA 4XD3A 2VJXA 3UQNA 2J7EA 3GIQA 4AMCA 1ZNNA 4ERIA 1HL2A 3QV7A 4A4AA 1TA3A 2QLYA 2MANA 3QGVA 3VOIA 2OOFA 5CPOA 3GK0A 2WCAA 4H2HA 1VEMA 2HJPA 3GBEA 2B7QA 5AY7A 1JNEA 4ZEPA 4N2YA 1LLZA 1GVEA 3QYSA 2Z7KA 3MSRA 1PWMA 3ABRA 2OZ0A 3ITGA 3WIJA 4K1WA 1W9VA 4KMQA 4Y90A 3M4HA 1L6GA 5EMMA 3TTOA 5D8ZA 5DANA 2VGBA 3WJXA 1XIJA 3T55A 4OBSA 4J2MA 3UR7A 3WDQA 1F6YA 5CZTA 2INZA 3CO4A 2FKPA 4Z1AA 5D32A 3SN1A 1GTHA 2TYSA 5GJPA 2WSYA 1DWJM 3DOPA 1I0BA 2WW5A 2HMCA 2Z28A 5HWJA 4ERAA 4Z0JA 3WEZA 1X8FA 3JRKA 4HTYA 3T0CA 5HINA 3LLXA 3PTMA 5E0KA 1OD8A 3FYYA 4K7YA 4XKMA 3AXXA 3WNMA 4ERGA 2P1FA 4PR4A 1JZ7A 1YBQB 1XRSA 2QPSA 5MKGA 5KETA 1EEPA 1UKTA 2PC8A 4DJFD 1PCWA 5KSWA 1GOMA 3HMJG 5EBAA 4QS6A 2Y62A 4CU6A 2Q8ZA 1W54A 2G8ZA 2DZAA 2WHMA 4XZNX 3T7VA 3ISIX 3QMSA 1KCLA 3U2ZA 4YTTA 4PA8A 3ZR5A 4GIAA 2PWEA 3GKAA 1IQ8A 4V27A 3W1UA 4C6EA 2TRSA 1EZ2A 3OZYA 3H4WA 2J24A 3VIOA 1SO4A 2O9RA 3CQIA 1QI3A 3KRZA 1B54A 2PLMA 1XLMA 2DQWA 2DH2A 1I2OA 1F2JA 1E6SM 3JZEA 1A53A 4QGCA 1J0KA 1HJUA 1RD6A 2YKKA 4DJED 2ZXAA 2XM2A 1NQ6A 2WVUA 3NL6A 2XH0A 3ARSA 3EDKA 1FWDC 2W0UA 1EPXA 3FKRA 2EG8A 4AWUA 3NQMA 2O4QA 3F2BA 4HT3A 3T07A 4DWDA 1ZS2A 4QDWA 1OJXA 5D30A 1OFAA 1FCQA 4C7FA 3NZPA 1LLWA 3IV3A 4KF1A 3LB0A 2CLHA 2NT1A 3FHQA 5DFAA 1PYMA 5I3DA 4UFLA 1EP1A 1G5AA 4FLOA 5AZ0A 4PUNA 1E71M 1WUEA 1QPOA 3GHRA 4DAIA 1WAUA 2F61A 4MNMA 1FWSA 1YDVA 2WMFA 4M82A 2BXVA 1MUMA 3H2AA 2PGFA 1J0ZA 4IIFA 1ZP3A 4JR5A 3QZ6A 3N3MA 2OVLA 4IF2A 2NWRA 4BF5A 4U5KA 4UFIA 4HK7A 2VFIA 3FJ6A 3NEHA 3U5UA 3L0GA 1W0MA 4HCLA 5EMLA 2A3HA 1LORA 1EA0A 4INFA 2RUSA 3M64A 3PHAA 5CGTA 2BFGA 2WNQA 1M9HA 4Y96A 3S0CA 1SW3A 3I10A 3VO0A 1YTDA 4GYFA 4GUHA 2ZUUA 4HNUA 2OGJA 2GVEA 1MW3A 4AIOA 5A2CA 1XJBA 3VOHA 4S2CA 2GOKA 4FAMA 3AIEA 3GC4A 3PAOA 3FSUA 4OVXA 1VRDA 4H8NA 1S2AA 5I06A 3GXTA 3EWXA 3QN3A 3TSBA 4I7VA 3ZSTA 2Q6ZA 2W92A 4FOUA 4H7CA 1FY6A 4D72A 4DN1A 1GK8A 3AIRA 3MV11 4RR4A 1XIGA 3SY8A 1B3OA 4P5UA 3WDHA 4XTIA 4GQBA 1PDYA 4UMAA 4NRSA 1QATA 4MG4A 4I9JA 1XIFA 1WXYA 2FTPA 2VOTA 1H7XA 2QCLA 2PDGA 4PFMA 4B5WA 1H63A 4F0SA 1AQFA 1JVNA 5D04C 2UY2A 3KBWA 2PWFA 4IFRA 1YPFA 3R5EA 1PAMA 3S46A 3WYZA 4O4WA 2CBIA 2WMGA 4C65A 1RJQA 1EL3A 5LA2A 3ZIZA 4HBKA 3WH6A 1XXXA 3OG2A 4OFCA 2XGZA 1IXNA 3FIGA 2J7HA 2IPWA 1EXBA 2V38A 5AZ1A 2CWXA 3MCOA 3GIPA 1FH8A 2OQHA 4LVBA 1W3JA 4J2PA 2QV4A 3AUJA 1E0XA 2E1WA 4PBEA 2Z25A 2HVMA 3GVGA 3N9RA 1TA3B 2RJGA 1TWSA 4GC4A 4LOCA 4ATDA 8XIMA 4P7NA 1VBUA 4PTXA 3SAZA 2RDXA 3L5MA 4B3ZA 2GUUA 2YGYA 2E3ZA 1KO0A 4HYWA 3THQA 3GU2A 3ZO9A 2VFHA 2DZPA 3QH2A 5T8GA 4LTSA 1XLLA 4DBEA 5REQA 3MI3A 4L80A 3KS5A 4U31A 3THUA 5JBFA 4MJMA 1ME9A 4DYEA 3EWZA 4H83A 3WQPA 1FA2A 4JXCA 4J3VA 1U30A 4QLLA 1W1VA 1XYCA 2VFDA 2WV8A 1JUKA 3A22A 1MXGA 4BI7A 4LALA 4M51A 4OZOA 1W5QA 3B9NA 3RYSA 4QFUA 3TOYA 3HO8A 2ZZ5A 2YJQA 3LA4A 2PP3A 4IGNA 4O1DA 4LUYA 4UTWA 1X6UA 3HZ3A 1EJWC 3DN5A 3L2MA 2GJXA 6REQA 4KGLA 2ESCA 1XR2A 5FEWA 4GLEA 1TTQA 3WK1A 4GD0A 3ZT5A 3OQ8A 2E77A 4JX4A 1FFQA 3M16A 3N04A 4RLIA 2RDWA 1DJGA 1P6BA 3AISA 4C6LA 3P2VA 1XIMA 1UBPC 2IS7A 5FKYA 3W24A 1XLBA 3PBYA 4C6MA 1EXPA 5GVJA 4ZCWA 4HPHA 1OX6A 4XUYA 1LWHA 3QKEA 1QPRA 1JQXA 4D6FA 2VDGA 1I45A 3AIQA 1GOKA 1OD0A 4XZHA 1OBAA 4K39A 1XH2A 2XIMA 3A13A 3I3BA 3MMTA 1VLWA 2NX3A 4G7EA 5D9MA 4DQWA 2OSXA 4GIRA 3FVMA 3LS9A 5CPLA 4MOZA 5E09A 2VQUA 5JIPA 3TFXA 1R86A 1J9YA 3R58A 2J27A 4DUXA 4GKLA 1E6NA 3EWBX 1NWRA 4NQ1A 4NAFA 3EOSA 3VIIA 3E0WA 3QZEA 4MVAA 1JZ5A 2VZOA 1Q6RA 2O0TA 3IAPA 1AUSL 3B4YA 2QIIA 5F4SA 2JGQA 2WO5A 1H1NA 2PD5A 1GZGA 4UZSA 1XLAA 4C1KA 2B7NA 3LZ5A 1I6NA 5I23A 4Z42C 4O52A 3P0XA 3TONA 4BQ3A 3W7QA 1TWIA 3W7NA 4FALA 3VD5A 4PEEA 5G1MA 3OEXA 2B31A 5AHMA 4CN6A 4J40A 1CGXA 1DP0A 2VFFA 4AY7A 3EZ4A 4GABA 3AZTA 1PDZA 3W7DA 3WFAA 4HMDA 4W7UA 4B3LA 3TW9A 1JYNA 3MUY1 5H91A 1VENA 4HPGA 7CGTA 2QAPA 4HYRA 3LERA 3ZT6A 2WPBA 3PZGA 3M1ZA 3PPFA 3SUVA 1G9HA 5JH1A 4PMYA 3QJAA 1O1ZA 4HNNA 1A0CA 4Z2HA 4J3UA 1XPYA 2WKJA 1SW7A 3WD0A 3EA2A 3GD6A 4FA3A 3PFRA 1BXNA 4QJ4B 4J4KA 3CQKA 3BUVA 1AK5A 2WVSA 4S3AA 3OG3A 1KRAC 3JU2A 2P8BA 4IT1A 4F2TA 3NVDA 3AHTA 2DIJA 1RLDA 4JHMA 5GJNA 3WNKA 2HE8A 2YZ5A 3W75A 3E0IA 1G4PA 3IRDA 3BLKA 3F4NA 1HIZA 4CQBA 3N19B 4O8RA 1KBLA 2QUUA 5A3HA 4R34A 2CLOA 4UOQA 3HIJA 3WJYA 4JCMA 1U1JA 5HQEA 3SUWA 3AHXA 3UW6A 1F5ZA 2ZRYA 1R9ZA 1TWWA 3IK4A 2V5BA 1PO9A 1PVNA 5IBXC 1UCWA 2GGHA 3WENA 4JNMA 2XWEA 2ZTJA 3CK5A 4O57A 3G1FA 1HQTA 1U5HA 4ALDA 4CQCA 1EYEA 3W2UA 1K70A 5C7VA 4ZBCA 1ZHAA 3O0FA 3WLMA 4WF7A 2FVKA 3P6LA 3B3DA 3NG3A 1P0NA 3W70A 1UD4A 4V1YA 2P0IA 1I75A 3MU7A 1ICQA 4H9MA 5FJTA 2ZTKA 3SURA 1I2PA 1UH3A 2H8XA 1PE1A 1QJWA 2A79A 3TAKA 1UIOA 2XJ7A 1SSDA 3WBXA 4LJ3A 2XZ9A 4WEVX 3W71A 3SI9A 4PCNA 4B9ZA 2JBMA 3B8WA 1Z8AA 3OVQA 2QMJA 1UWSA 4XZBA 2I9UA 3G6LA 3NIYA 3LLFA 3S9IA 2VCAA 3BZGA 4H6EA 3LCLA 5CLTA 3I6TA 3FSTA 1X38A 3TMLA 4L65A 1G0CA 3RLGA 3STFA 1TPH1 2MUCA 4PB4A 2Q3OA 3V5OA 4MLJA 1GEHA 1ZQ5A 3B8IA 3LYEA 3OGSA 1I4NA 1CXIA 2VXNA 1A5LC 2ISDA 1B9BA 4CCZA 2V81A 1GW9A 2FH6A 2YCLA 3AXKA 4P7LA 1HGWA 1D3HA 1R38A 4M29A 4K68A 2GJXB 1VBJA 4L9ZA 6REQB 1S2WA 3E9AA 2V5DA 2E5BA 3LPGA 4AC1X 3AS0A 2NUYA 5C70A 1MSSA 3E5BA 1BWKA 3ITLA 2AMGA 4UNKA 3UG5A 4LCRA 1DYSA 4WDTA 3HB9A 3NQCA 1VEOA 3DYPA 3GYCA 4P8UA 4DJEC 4EWJA 1RQBA 4V33A 3IGSA 3OA5A 3PPGA 1JCYA 3W07A 3AZRA 2OU4A 1H7RA 1DJYA 4Q8TA 1DJIA 3M5ZA 4V2XA 1AJ0A 2J7FA 3LSBA 3LGEA 4QM1A 4HOZA 3SCVA 3W7KA 4ZR8A 4GFSA 3ZVHA 2OYKA 3TSMA 1GJPA 1KTNA 1V7YA 1CDGA 2WPGA 3MO7A 2ANUA 3IJ7A 4H3DA 4AISA 3R0DA 3H53A 1PUDA 1D8WA 4YWSA 3GAYA 1E70M 4Y6GA 1YLVA 4LV9A 1MMFA 1X96A 2P53A 3TYZA 1FWBC 1WZMA 1NDYA 2E0PA 4PFHA 2DSZA 4AZHA 3MUIA 4X0NA 2EO7A 3TCEA 1NFGA 3TTQA 3MSGA 2V69A 2CERA 4UTMA 4OV4A 3IIPA 2J8TA 3VMNA 1TR1A 1CCWB 1YNYA 4UB9A 3NPVA 3GDTA 1K3UA 4MTVA 3RU6A 4Y9MA 3W2LA 4N4QA 2PE4A 3XINA 3QY7A 3U2EA 1R3YA 4GVFA 3STPA 2A4AA 2J7BA 3CIXA 4B5NA 1U1HA 5F4XA 3KOZA 4AW7A 4BQ2A 2OJPA 1EDGA 2EPNA 3PC0A 1ML1A 1WB0A 5FI8A 2DP3A 3IEBA 5JQ9A 3BMXA 3RM9A 1MNZA 3IJ8A 3CV2A 1TIWA 1KM0A 1WZKA 4NILA 3GNNA 4JICA 2WWCA 1IV8A 4RV3A 2WVVA 3UY8A 3C2EA 1KRMA 2C1HA 4G6CA 1EJ7L 2INEA 1PTGA 4JX5A 3NL3A 4HZMA 4EKJA 3EB3A 1W56A 1Q6QA 1EHNA 2QS8A 2FZ8A 1L6FA 2HBVA 4NASA 1B3XA 3RHGA 4F0RA 1SFLA 1XINA 3E3HA 2P88A 2DSVA 3V18A 1Q5MA 3AMCA 2H8ZA 3WLOA 3RN6A 2OGYA 3GM8A 2ADAA 1VBGA 1G4TA 5ABHA 5LYRA 1CTNA 1O95A 3P82A 4FNRA 3TN5A 5K2ZA 2VOMA 5D03A 3QSTA 4YTUA 2OT1A 3T6CA 5C5YA 4YL2A 1TQXA 1KWKA 1CGTA 1E9LA 1F3TA 3HN3A 2HBXA 1T0OA 3AOFA 3N1AA 5EMYA 1H4PA 3AAMA 1TG7A 1ELSA 3KOWA 4KPLA 1W17A 4M81A 3QFEA 1UMYA 2BS9A 2GPTA 3E96A 1QI2A 3F03K 3UZ5A 1GQLA 5I09A 5CZJA 1B2YA 4AD1A 4FMVA 5CSYA 4YCPA 2ZVRA 3ABQA 1KQZA 1Q4NX 3EXSA 3B9AA 2Y89A 4DVOA 3CPUA 5C9WA 5HWMA 2YA1A 1O5QA 3S6TA 4GG9A 1UKQA 3FCPA 3D46A 2GJRA 4QLKA 1CGUA 1WOBA 3NTYA 1FWHC 4LCSA 2BWGA 3WBYA 2BY2A 3VKCA 4C6CA 2QV5A 2HPIA 2BODX 5DBUA 1F4HA 1IT0A 3P81A 1WZLA 4GYPC 2GWGA 1V0MA 2UBPC 3CHEA 2PU1A 5A2AA 2EG6A 1C29A 1Q63A 4XAYA 1PZ0A 3NPXA 1M7PA 2DH3A 3CB3A 3ZSSA 5DBTA 1KRCC 4CGTA 1MYRA 4QIUA 3C3NA 2BXYA 3SDOA 1XIEA 4M8UA 3LQLA 4K37A 4PN2A 1S5WA 4ZMGA 2C15A 4AF0A 1I2RA 2BGQA 3ZWSA 4K7VA 2HNHA 5AYXA 2LLEA 1IXOA 1UOZA 1L6SA 2ACSA 1CB7B 3LTSA 3P62A 2ZC8A 3CL6A 4FK9A 2C0AA 1DPMA 1BLIA 2ISWA 3TR9A 5BROA 5LNSA 1JZ3A 4NZJA 4EWND 3D5HA 2PDXA 2GVGA 4KWUA 4DYKA 1KKOA 3VDCA 4J3ZA 5LA1A 1E72M 2I16A 2BOGX 3V1HA 3WO8A 3H24A 1TWZA 3QV6A 1EJVC 2VRKA 3NJ3A 2OTDA 1MNSA 1GONA 3PBWA 4IGMA 4O0ZA 1E6ZA 5HJLA 4L9YA 3A5FA 5B7ZA 3TTEA 3WK0A 2J8FA 1J12A 1EF3A 4PUKA 1WXJA 2VX5A 3MP3A 3QR3A 2CZVA 5FL1A 5DRCA 5I3FA 2GZXA 3PJUA 2OSWA 1R3WA 4J1OA 2I14A 4KCWA 4G56A 4QBXA 4EF9A 3ZVHB 3DI1A 1GVFA 3T4WA 2V67A 3RCMA 3O2LA 1FWCC 1QBAA 3WLHA 4W88A 3CZKA 1WV2A 4MJZA 1JRCA 1KFLA 1MW0A 2W62A 4AVOA 3PF3A 3UF9A 4OBRA 1P7TA 4I5RA 1WXZA 1M41A 3N29A 5FESA 4I7WA 1F9CA 4TO8A 3P67A 2D22A 3T0TA 5HJYA 2KZHA 4DWSD 1XQKA 3SCUA 1E0TA 1IEIA 3U4FA 2W5FA 2TSYA 5HNRA 2C14A 5E6YA 5EB8A 2J79A 2PRLA 4URIA 2QDHA 3UR5A 4EK7A 1PSCA 4TV6A 1QPKA 4GZEA 3RRXA 2CHRA 4CU8A 1FHUA 4RUBA 4NJJA 2BG5A 3NZQA 3P93A 3V0UA 3AICA 2J7GA 4PB3A 2WJDA 4GK8A 3IGXA 3S1WA 4MJ2A 4H6QA 2YXGA 3LI0A 4NAEA 3WH9A 2TPSA 1QU4A 3NA8A 4DUVA 3AROA 5F2MA 2QMKA 1GOOA 3NDOA 4A8NA 4ZTYA 1BKSA 3W88A 1GJUA 1N8WA 4GZ7A 4HMCA 2DT2A 5LXEA 3R0UA 3M0YA 4I6VA 3LN3A 4UWMA 3G3MA 1VRXA 5AC5A 2J9ZA 4PTWA 2FGBA 2ZDSA 2O7QA 1RXOB 3LPOA 4A3QA 5LIUX 3IGUA 4YIWA 3GBDA 2FZDA 2IKHA 3OPSA 3DEQA 4QS5A 4AY8A 2VL4A 2J7DA 2I7GA 1KNWA 4GVIA 2OR2A 3P14A 2WM1A 3NZ1A 2VKZG 2RGMA 1I9CB 3M6YA 4RZ5A 2DUZA 3WD2A 1LCOA 2ZRZA 3EGJA 4GOAA 3G2GA 2Y0FA 3SY5A 5KINA 3ZJKA 1YDYA 1KFBA 4DM1A 2IXUA 4H1ZA 3CQJA 1WUFA 3B0VC 1VPXA 1I2QA 3BL3A 3HM7A 3UZXA 1AODA 4A35A 2QGYA 3W37A 3VC6A 1JPKA 5KTLA 3KVLA 2W9MA 4NIRA 4WK9A 3V0TA 1QK0A 2AMXA 1XX1A 4PODA 3V16A 2FGLA 1JF5A 1HKWA 2AL2A 1LUCB 4LAUA 1TJRA 1DWIM 5F7UA 1PYFA 8XIAA 1CT5A 3N2OA 3H7VA 1XP3A 3C2OA 3MVIA 3JUGA 4KIRA 1H5VA 3WKZA 3L66A 3OVRA 4JL2A 2JF7A 4GHRA 3ZYZA 2PDCA 3VINA 4E4PA 1X7IA 5IDZA 3NQ7A 3T2QA 4ORMA 4O14A 3U2OA 2VEMA 2C7FA 3C0QA 3W7CA 1CYGA 5BRBA 1G01A 4XBKA 2WZTA 3DFOA 5E9AA 4AWTA 3P61A 4ACZA 3SW6A 1AFSA 2DZVA 5C2XA 4G7FA 5XINA 1S3TC 3L0NA 4GCXA 3E2RA 2PODA 3W28A 2CU0A 2PDUA 4G2DA 4AF0B 1EZWA 3MYOA 2CZDA 2X1UA 3V35A 2IPGA 2WCGA 4PTDA 4V15A 5LHEA 1B0IA 4E8CA 3HGOA 3RJXA 5FEPA 2YOCA 3WNNA 4H9ZA 1N8FA 4GJJA 3TWBA 1QOQA 3M5XA 3E74A 3K30A 4I90A 5H6HA 4GUFA 5ABGA 4AHPA 1ZJAA 1QHPA 1E6PA 1KLYA 1R2RA 5JXQA 1JRBA 4Z2LA 3OW1A 4PMXA 3GY1A 1Y8BA 1ECEA 4O4VA 2GJNA 1B4KA 1XRFA 1QNQA 1E1EA 4DF2A 1BSIA 3VNDA 4UFKA 3MUCA 3VCRA 1A5OC 3W02A 2WKGA 4Z08A 1J2WA 4CNNA 3ORWA 3A5VA 5AYZA 4LS2A 2VZUA 1J79A 1TRIA 3PAJA 1HKIA 3EMZA 2ISVA 2R94A 2Y70A 1YX1A 2V30A 2Y4SA 2Y7EA 4IMCA 3H55A 3W1MA 3UR2A 5A6KA 1EP2A 2SFPA 4JYEA 4DF1A 1KGXA 1NF7A 1NWSA 1A0EA 3HTWA 3W76A 3W73A 4S3EA 5LXXA 3IANA 4LC6A 3AXIA 3R8HA 3GH4A 3H7RA 1XC6A 3BWWA 3VNIA 5BXPA 4RPQA 2XN2A 2TAAA 2ZUMA 3KLKA 4AUBA 2J74A 4MWAE 3EMQA 4GQ0A 4HA4A 3L12A 2ZQ0A 3NSNA 3MCNA 2XVKA 1WDQA 1FWEC 3LNPA 3K13A 5M5DA 1Q65A 3W6LA 5E6ZA 4TX6A 1XCWA 1TPB1 2XVLA 3IUIA 1UBSA 1LDCA 2D0FA 3UEQA 3VKKA 5D4YA 2XFRA 3ID7A 2E5CA 2V9DA 3R94A 4R88A 1SQ7A 2XFYA 3UZWA 1TPFA 2IPFA 4M7SA 3TV8A 1MUWA 3O16A 1MXDA 2VRQA 2W79A 3RNDA 1MFVA 2OEKA 1R3TA 3F5KA 4QG9A 3QPEA 5C54A 1FXQA 5CPTA 3UJEA 4PULA 1WDRA 4O17A 2PRMA 4DX3A 2YYTA 3EPOA 1AD4A 5TF0A 4DUWA 2VZTA 2NUWA 4J28A 1RPXA 5A8QA 5CZKA 5A69A 1LOQA 2FJKA 2CBVA 3FY1A 4GACA 3UG3A 1WNOA 4ZB5A 1XLJA 4DEFA 3RCYA 3O3RA 1SFJA 3WJSA 4DBSA 4JTIA 3RR4A 4FOJA 5A6JA 3UCCA 3DG6A 4C6NA 4W87A 2R9RA 5G4EA 3VZYA 1BYBA 1ONEA 2EG7A 2WMKA 1J4EA 3EYPA 1CNVA 2NWSA 1DXEA 1UZ1A 1ODZA 3IK2A 1Z6KA 4CNOA 3IGHX 3ENLA 3UPWA 3G1HA 2VWSA 4F79A 3WF0A 1IEWA 1Y0EA 3EDJA 3FX4A 4B15A 4KRUA 3GDMA 4BF9A 3WLPA 3VA8A 3QMRA 4TVDA 1UR8A 4EP8C 3H4GA 4LUIA 3CL8A 3N3TA 1B3WA 3M0ZA 4LQ1A 4PUUA 2X0HA 3QXBA 5KZEA 4UCGA 3WLKX 1B30A 3SGGA 1UR0A 1Q3NA 1CLKA 3H26A 3QHNA 4EF8A 3VNZA 5U4NA 2OLAA 2AL2B 1BKHA 5C0QA 4MUPA 5HXMA 3DFHA 4LAMA 1G69A 2GQ8A 3HG3A 1A5MC 1U5VA 4KW2A 1OYBA 4MPKA 1X98A 1Q8AA 1RALA 3RX4A 4DHGA 3IJLA 3IRSA 2D3NA 3BQ5A 3RPTA 2YFOA 4LY4A 2X2GA 2Y8VA 2D73A 4HK6A 1B57A 5CGQA 1GEQA 3ZLHA 4BY3A 3T0DA 2VC7A 4F9JA 1HT6A 3QLDA 5BCAA 1BGAA 1Q7QA 1K77A 1EGVA 4UQCA 3GZAA 4ZO6A 3DZ1A 2A3BA 1OK4A 2HEJA 4YU1A 1EF2A 4JTJA 1WAWA 2ZE3A 6ENLA 3NQDA 5K7JA 4F3HA 5BXTA 2F6KA 3W1PA 3WNLA 2VMFA 1V0KA 4AY1A 4KGJA 3MPGA 4C91A 4E38A 1OCJA 3IS4A 2IKGA 4AZBA 4AD0A 5C2GA 1LYXA 4M80A 4WGXA 1G4SA 1B3ZA 3VX1A 3M0VA 2RGLA 3NWRA 5BOOA 2QUMA 1MRAA 4LNYA 5HJXA 3EXRA 4JHOA 2VDHA 1XSKA 1FDJA 5C71A 3QKZA 4XAGA 4UR9A 1CPUA 3C4UA 4IIBA 4D8AA 4AXKA 1OF6A 5I3GA 4LBSA 4AD3A 2JIWA 3UJ2A 4PMJA 3LMYA 1F4AA 1GVOA 2PF8A 4J3SA 2JE8A 4U28A 2E9MA 1D3GA 2PDMA 4KFPA 1XLHA 3EX1A 5A6TC 3TK7A 1IE7C 5EA9A 5HMDA 2XGIA 5EY5A 2A7NA 3KS6A 3WDIA 3DC0A 4XZIA 2NLYA 3QFWA 4M3PA 2VRJA 3DERA 1B3VA 3TNBA 2EJAA 3B40A 1PKNA 1WBHA 1VHCA 4L61A 4JEQA 2BMBA 3W6MA 4Q8UA 3AHVA 4H2CA 5CZ0A 1GKPA 3CEUA 2EKGA 3KBMA 2GVJA 3W22A 1QK2A 2VCCA 4AB4A 3NVTA 4JHZA 2C79A 3QBUA 3IIZA 3THDA 3LI1A 4LT9A 4ZE4A 1O66A 1X8CA 3WJZA 2WSPA 1GHSA 3CT2A 4TMBA 4X60A 3VVGA 3VKDA 3S5OA 3FVDA 4ENLA 3TYEA 4AQLA 1H2JA 3D3FA 1UJPA 5FJJA 2UY5A 3GB6A 4JN8A 3WNPA 3Q65A 4KCTA 2YSWA 1FCUA 5MHBA 4GINA 3TQPA 1TPUA 5G1TA 4BI6A 2OODA 3Q4DA 4IXXA 4XZWA 1GOWA 3E2SA 5BMWA 1K7FA 5AOUA 4W7VA 1M7XA 1VS1A 4DBWA 4D1JA 5AC7A 4GH3A 1ITQA 1PX8A 2PUZA 2PRHA 1BVZA 2YPIA 7ODCA 3W83A 3P3BA 4I8YA 4GI6A 1K1DA 4YTSA 3LGGA 3LZ3A 2R1MA 4UTLA 1W5MA 1CXLA 4S3KA 3M5VA 4CLMA 4PBGA 3QYQA 2QJGA 1X39A 2XPKA 1WQ5A 5CBIA 2B0MA 1VCGA 1J0YA 3G1AA 1UR4A 3W82A 2JQXA 4OUIA 4PRTA 1Q8JA 4MY1A 4JTEA 5I3KA 4WR3A 1VF8A 1VP5A 2OOGA 3C0LA 3GG8A 2ONEA 4XO7A 6A3HA 1A0DA 3V0SA 2D2OA 3BGJA 2DJXA 4QDMA 3SCOA 1VFOA 5A94A 4GXPA 3C2YA 1IWAA 2YDSA 1HXJA 3H12A 5LSMA 3TN4A 1C3FA 3GXFA 3S2MA 2Z24A 4WKHA 4CQAA 3FAXA 1PB0A 9CGTA 3E0FA 3DG3A 5DCBA 1V02E 4DI8A 1S5MA 3V4BA 3W0KA 3PJXA 4A29A 3AU6A 1RZMA 3TC7A 4GVHA 2ZZ2A 5G1YA 4MKSA 3A64A 1GKQA 2XIOA 1J01A 2NV1A 2YCEA 4FLSA 3UWYA 3FXYA 8RUCA 4Q8OA 4M56A 4MUZA 3BLDA 1BXCA 2QUTA 2E6AA 2PI6A 1S5VA 3GKFA 3WLJA 1FVPA 3HPSA 4HHLA 1Q6DA 2YX0A 4NJGA 3CQHA 3EWYA 5JU6A 1WOAA 1K6AA 3RGTA 5C7HA 2FLIA 2QGHA 4M5PA 3TXVA 1Q6FA 3C5QA 4IMAA 2G50A 1RR2A 3W53A 3V3WA 3VYLA 5IRPA 1RY8A 5GPRA 3UPBA 3F2DA 1V7AA 1CWYA 1R3RA 4S3FA 4C6BA 3IIVA 4CCDA 3QPYA 3PSWA 3MC5A 2R24A 5BW6A 2IW0A 4MZYA 1Q6CA 4FS9A 5ABTA 4O19A 1O4UA 2IUZA 2PTWA 3GNPA 4AEOA 1VBHA 2ZRXA 1V03A 1HJWA 4RJEA 4GFIA 3G77A 3OBEA 4X2PA 1TRDA 2CCRA 4B5VA 1R3SA 4PSPA 3VGBA 5FEXA 4K1GA 1XM3A 5TAOA 5D09A 3CZGA 2PF0A 3ARZA 3CLMA 3FAWA 5A8NA 4QQUA 3DKLA 4F2BA 3AYVA 5CGMA 5CJ5A 3QC0A 3LG3A 2QXWA 4JS3A 4HSOA 5I77A 2A3CA 4KQNA 5JUVA 2CLEA 3ABXA 1NOWA 4H9TA 3G1RA 1TQJA 5BMXA 1FUYA 3BV7A 1IR1A 4E2VA 5B80A 2AL1A 3NGFA 1TYGA 2NXIA 2DZBA 1M5WA 4EAYA 1R46A 3N4AA 4RNHA 2C3ZA 2Z0IA 2AAMA 1PV8A 3UG4A 1XDLA 3R10A 5A6MA 1W1ZA 4RE4A 4EXQA 1P0BA 3NOYA 2W27A 5LNUA 3QTGA 3LK6A 2ABAA 4PE8A 4EPBC 4UTKA 4Z17A 3LTYA 3PK7A 4Q33A 2XFFA 4I9MA 1QI4A 4HGXA 1BWVA 5JMUA 4R9XA 2VFEA 4N4PA 3NSXA 5EFDA 1V4YA 2ZCGA 4REQA 4JY9A 4QRNA 2XM1A 2VX7A 4IWWA 3W7MA 3EXTA 3TMQA 5T91A 3CXOA 3W86A 3TLLA 1ONWA 3GXDA 1TPVA 2UV8G 5LKYA 4U2ZA 1VFHA 4KWVA 5CG0A 2ZX5A 3H21A 1PX3A 2GSJA 4JTRA 2QCDB 2OPJA 2IKIA 5I6SA 4Q8PA 4DF0A 4US5A 3LEPA 3VABA 4HNCA 2GSEA 2A3LA 2CBUA 2NSXA 3OYZA 2R82A 1XKJA 3G1VA 3LD5A 4FHAA 1GT8A 2VCBA 4QX4A 4BS0A 2QPXA 1UR1A 1LOLA 4U4MA 3QW3A 5GJMA 2HVNA 1MDLA 4JTQA 1BTCA 3A3XA 2G4FA 3WN6A 3GIYA 2HK1A 2XSBA 3DFSA 1MQQA 1XUUA 3GAKA 5I5RA 1WDWA 3OB8A 2QR6A 4B3KA 1UWIA 3POCA 1GJWA 4PEKA 4CD8A 1GVRA 2WOQA 3O7UA 2A5HA 3QEZA 5D2TA 1R3QA 3W01A 2NQHA 5I3IA 2I5IA 2F8QA 1O5XA 4UTJA 2C8NA 3R4IA 3KCJA 2EPHA 1V77A 3MV01 5IM51 4ZB0A 2VX6A 1PX4A 3CUFA 1QOXA 3CAVA 3UWWA 1NDZA 3HPXA 4QNWA 1E6XM 3T8QA 4NNAA 3L67A 3N9SA 5FD0A 5HR6A 2NVDA 3S4TA 3NEVA 2BOEX 4ADSA 1W9PA 4R7OA 2VVSA 1U33A 3GXPA 4L56A 4FI4A 4QR6A 1UMLA 1ICSA 1XSJA 3WDPP 2NZLA 1GQNA 2QDDA 3L5AA 2WHJA 1RBAA 3FDGA 3H6OA 4FXRA 3HQNA 4MNLA 1JPDX 4PC8A 1XIHA 4EPEC 4H9UA 2EPKX 3K46A 2PDNA 4P61A 2Z6JA 2BX7A 3WEMA 1JZ2A 4GX9A 2DEPA 1W2VA 3MZNA 4JGDA 3LRMA 4FEZA 1KCKA 1EJRC 2HVOA 3VPLA 3QLLA 4UIOA 2X1IA 4YS1A 3SRDA 4HZ6A 2ACQA 1KV8A 3KBSA 4ZO8A 7TIMA 3ES8A 2BDQA 2D2HA 4IIGA 4UTUA 2OYMA 3R89A 1V79A 4ZQCA 3TJ4A 1PBGA 1E5NA 3UWZA 3UESA 1P6WA 3NL5A 3W1QA 1DJZA 5I78A 3R12A 2YLLA 1Q7ZA 5CAHA 3SSZA 4HIBA 5HR7A 4OKDA 1Z9AA 2DW6A 4DYJA 4B4FA 2GGGA 2XIJA 1NJJA 1AQ0A 3CPRA 3P5YA 5IFPA 2BOFX 3I3DA 3LSCA 1KRBC 1PHWA 4CD7A 4AIBA 1K9TA 5F1UA 1R9YA 1POJA 3OJGA 3FA3A 4MJ4A 3BCJA 3ZR4A 3MW7A 5D9NA 1IGWA 3Q67A 4XUGA 2PWHA 4WY0A 1F3EA 1KM3A 3CQ0A 4KIEA 5AN7A 1S1RA 4H01A 4UTTA 5M2FX 4LYRA 1TVNA 1QR7A 1OYAA 1GPFA 1HL8A 4TX8A 1W3KA 2XSAA 1H5YA 4ZQPA 3YPIA 4R3UA 1EJSC 4OWGA 1B4EA 3GE7A 2BVDA 1EQPA 1F3WA 1QBBA 2WANA 4ZQMA 1GG0A 3OBKA 1SZFA 2ZICA 4HA1A 1WA3A 4AFYA 4B16A 3SUSA 3VIMA 3SGUA 3N2XA 5A95A 1MDRA 1FWWA 3GFZA 2G95A 1KBIA 1E9ZB 1QW9A 3LV6A 3HA1A 1JIBA 2HSAA 3G0SA 3M0MA 1OHLA 3QPZA 1UH2A 3BLIA 1X7FA 1FHLA 1DV7A 4JTCA 3SGZA 1ZRQA 3ABOA 2BASA 3R7MA 1SFSA 2WMIA 3BTNA 1RV8A 3AXMA 3J7HA 2DIEA 1MXSA 3K8LA 4FSAA 1MEHA 5H8MA 3F7JA 1PIGA 3KFTA 3DI0A 3KZPA 4XIAA 3CMGA 5BRQA 3P60A 5D05A 2W4XA 2ZA2A 3ALFA 2CIPA 2VM8A 3HV8A 3EDDA 1OT2A 1VFLA 3NO3A 1RVKA 1QWGA 2CXGA 2QCNA 1H7PA 5HNUA 1WKFA 3PULA 1JUEA 1OX5A 4W4QA 1H62A 2PCEA 4A3RA 4HPNA 1ZCOA 5EYWA 2AQVA 4MGGA 2VR5A 4DO6A 1NFPA 6ALDA 2PPGA 2Y7GA 2ZUSA 1YNPA 4NG3A 2GGJA 4G8TA 4GQGA 5KMYA 5E0CA 1YRRA 4MHBA 4Q3MA 1V6VA 3CZJA 4NNBA 1JCTA 5LZLA 2NQ5A 2VGIA 1C8VA 4XAFA 5HANA 1JCJA 4CD5A 6PTDA 1MUCA 2I17A 3MANA 3T2PA 4GBUA 3WL1A 1TZ7A 2BHYA 3PB0A 8TIMA 1GYNA 3CJPA 1BPLB 3B9OA 1KFKA 4S3BA 2OLSA 3A47A 3GC5A 5B7YA 4YVPA 1DQWA 3IVTA 3TU9A 2QULA 7ENLA 4DAFA 1F6KA 4KKXA 4O1EA 4KEUA 3S2LA 1VCVA 4CCEA 1IZKA 1HKMA 3MKCA 4X9YA 3WG6A 1MEIA 1T40A 4Z1BA 1XYZA 1AQHA 1W3LA 3N17A 1KGUA 3ABSA 1DOSA 4PRRA 1TCDA 1NP2A 4TVUA 3B06A 2B81A 3EA1A 2BY0A 3L5LA 2EBNA 5AVHA 3T8LA 2WSQA 4MDPA 4LAZA 1TE6A 1DJQA 7REQA 3OVGA 3EWDA 3IJ9A 1JYVA 4RNIA 1CLVA 2EHHA 1P48A 2X05A 2VVNA 3EX3A 1GYMA 1CIUA 1JCNA 3NPWA 4PL1A 5DLCA 4H8HA 1DBTA 2REQB 4G1NA 4N9CA 1RHCA 3TFCA 1V3KA 9XIAA 4W93A 4L7ZA 3H2MA 4RDVA 1C7TA 1VPQA 3QGKC 3MKVA 1XFBA 1XYMA 1PKYA 1L2UA 3L21A 2FPYA 5LGXA 3NR0A 5BU9A 3PNUA 1QO5A 3MP5A 3H2FA 2P50A 4R27A 2Z1XA 3WF2A 4NU7A 1XDMA 4HSNA 3ATZA 2BLEA 1EHAA 4RCXA 4OU1A 2PDPA 4LYPA 3ITTA 5CC3A 2PFHA 2Q02A 1T5AA 2QF8A 3WBEA 2XH7A 2DZXA 2J6XA 2NVCA 4ZO9A 3S6OA 4XO6A 5A6AA 1J8VA 2JK2A 5H1WA 3TLQA 3AJXA 1KBBA 3NL2A 3FGCA 1DIEA 4I3GA 4W85A 5SWUA 1S3HA 3OIHA 5JVLA 2QVHA 4JEJA 2WJZA 1EDTA 3VGHA 1MQPA 3UYCA 1PIFA 3HMCA 5CLWA 3JVAA 3ZOAA 1M53A 4LGXA 2VEPA 3CIVA 1RH9A 3RF9A 4HU3A 1UWRA 4DJDA 3UZZA 3URBA 2C1GA 4ZOEA 4QEEA 3U4AA 1RJRA 3LENA 3W1RA 4WY0B 5G2IA 4B5TA 1UD6A 3IACA 4MB5A 3GVWA 2DIKA 1RVGA 3TP4A 1V3MA 4K36A 1J18A 2YBUA 2ZUWA 1QOPA 2V3EA 1W9BM 3UNTA 3USBA 1S2TA 3PZIA 3QHMA 2QCGA 4UR7A 3WH8A 1EP3A 3M7WA 2D69A 5G2HA 9RUBA 3ANYA 1IEQA 1IEVA 3MHUA 1BSLA 4XVDA 3T81A 2Y63A 2G3FA 1GQJA 4P8WA 4MFDA 4U10A 4YJ5A 2Z00A 2IXVA 5HQMA 1EJUC 1C8XA 2WHKA 5XIMA 4F66A 2ZDRA 4AD2A 4PUEA 3RXZA 3TX9A 2GL5A 1QHOA 5IHRA 4Q7NA 4GNVA 4TVCA 3FLUA 1TJ1A 2PTYA 3IJ6A 1JULA 3GR4A 1ZALA 4L6OA 5FJRA 3W7PA 3CYJA 3HQPA 2WMIB 2NSOA 3ZQ9A 1KBKA 3SCPA 2WBGA 1CX9A 3Q58A 2BZNA 1QCWA 3CUJA 2O56A 2OX4A 5FF4A 5TNVA 1ME7A 3QGAC 4LAOA 1TJ0A 3ZJ6A 1TZZA 3IJQA 4B2DA 5AYBA 3BLPX 1G4EA 4W9TA 1NARA 2CKSA 3R1ZA 3KVKA 4WKFA 1BXBA 1JG9A 1JNDA 4E2BA 1EOMA 7XIMA 4XD6A 3KTXA 1TV3A 1RLCL 3TAOA 1HJQA 1E73M 4ASTA 5FSDC 1RBLA 1VFFA 2V3GA 2PDQA 5CPSA 3OU8A 4IIDA 4XV0A 4R5EA 5BWFA 1E4LA 4RK8A 2PDJA 1CXFA 3CZLA 1TB3A 1A5CA 3TKFA 2NQJA 4PUMA 5ABFA 1T8XA 1RCQA 3MWAA 4NYYA 3F4CA 4QSHA 1J0HA 2DY3A 4AX7A 1BQCA 1BG4A 4PTVA 4UNLA 1V6YA 1S5TA 4Y7EA 1KFCA 1TV7A 4GY1A 1FWNA 3QR1A 4NI3A 2VWTA 4MWAA 1AJZA 2PS2A 3R2GA 1DTUA 1PL9A 1D3CA 3CB8A 5AC4A 4PMRA 3NCOA 4CUCA 1PJ9A 5H2ZA 1REQA 5LIWX 5TQLA 3G22A 3QSRA 4Q4MA 3N9KA 4ATWA 4QHRA 3K5XA 1GZJA 3PY2A 1ISVA 4YN5A 3GWQA 4RE2A 3UU0A 1X1OA 2VX4A 3EDFA 4NZ5A 4Q8QA 5G5IA 3P0WA 4UR8A 2PDBA 3UXDA 3PBMA 1FX6A 3PBVA 3KOYA 2ISSA 3AWOA 3CAKA 2QJIA 2D2JA 3GXNA 5I00A 2VR2A 4D71A 3F4WA 2ZX9A 3GU9A 3GX9A 1CGWA 4RNFA 4IFOA 7REQB 3UR8A 1I8JA 1MQRA 3TZFA 4TV5A 4OV9A 3UWQA 2DPEA 2XVGA 1VLIA 2FZNA 2YFNA 3SEPA 3AQUA 1E0VA 1AL8A 3Q2DA 3ZWTA 5C8BB 3XIMA 1XRTA 4LEFA 4D6JA 1KTBA 1UC4A 2PP0A 1XISA 5M17A 1ZY9A 3E6EA 5GQBA 1E15A 3AO0A 1S2CA 3HV9A 2B7PA 4X22A 2C16A 5CH9A 3T08A 2DORA 4Z2GA 1IT7A 2ZADA 2G3IA 1NH6A 1RCXB 3KBVA 3W87A 2EAWA 3PANA 4A8IA 5J8LA 1WBJA 3L4YA 3LDVA 1TE1A 3GFXA 3G5EA 2FIQA 4RZBA 3VGGA 3BGGA 5EMKA 2Z6IA 4XBJA 2B4GA 4O0KA 1FFRA 3ARUA 4K8EA 1MWOA 1RP8A 3FGCB 4WDUA 4PL2A 5CEWA 1UR9A 5LNWA 1Z69A 5A8OA 4ECLA 3SN4A 1QNSA 2UY3A 2ALRA 3BG9A 3IJDA 1K7EA 2WWDA 3BK0A 3CTTA 3MMDA 2PA6A 3AWNA 3MCMA 2G3NA 4UC5A 4L4PA 3NQBA 3GTXA 4BA0A 3I68A 3ARQA 3WUBA 1P0EA 1OADA 4F0LA 1DKWA 1VAHA 1GZ1A 4R85A 4O15A 2X2YA 1EC8A 2DT1A 3O1NA 4E5TA 1YQ2A 4IH3A 1XLDA 5EL1A 1W3HA 5BU6A 3KCLA 3HURA 3ZT7A 3K4DA 2FZ9A 4L4LA 4AC7C 2OEJA 1Z41A 2ATSA 4DI9A 2A3AA 4KETA 2A6NA 2FFCA 1KLZA 1SO3A 6TIMA 2W3ZA 5EKYA 4J5NA 2HQAA 1I1WA 3ELFA 4F2UA 2VC5A 4XVEA 2GFTA 3B9EA 4RE3A 3T4CA 3QRHA 4IG2B 2OMAA 3OGVA 1VEPA 3C56A 1V5XA 5D2VA 3UGRA 5IFTA 1AA1B 4W7WA 2FGZA 4JTDA 4NX5A 4RE0A 2R1PA 1F61A 4W8BA 3OGRA 1M3UA 1V6WA 3IPWA 4GNKB 3A4WA 3SCQA 4CNPA 3HPFA 2FVMA 1JJKA 4LEQA 4PMUA 4D6CA 3AMLA 3R13A 4LS0A 2Q09A 3Q37A 3UCDA 1PKLA 4DLMA 4IMDA 3KOFA 3N2BA 2XTKA 3L68A 3WDJA 4XG1A 4ES4A 3OZPA 1EB3A 4CN4A 3STCA 4DNMA 4ZVJA 1CBGA 3EMCA 5FCZA 1UW9A 1O6IA 3OLGA 1FOBA 1A5SA 1R2SA 4FPSA 3BARA 3U7BA 4B5SA 3VIJA 4JTSA 3W1TA 2WJEA 4L6DA 3TYDA 2POZA 2Z1VA 4Z2KA 2QCMA 1F6PA 4IP4A 3RMEA 3ZJ7A 1JFXA 1JZ8A 3HGRA 4P8XA 1QNRA 2VD9A 5ABFB 5HQLA 4LH8A 1JFHA 3WQFA 3BOXA 3PUGA 4CVWA 1F74A 5CG7A 3TWAA 5FL0A 3VIKA 2CFFA 2QZRA 1G67A 3IV8A 1GVSA 1OZMA 3C2VA 3PSVA 4MWAB 4JPGA 2WK2A 2QDEA 4FXFA 3WLTA 4E2OA 3HG5A 3RILA 3G8EA 5DMYA 3O6AA 1DWGM 1FXPA 3BMVA 4MLRA 1REQB 4JFUA 1CW2A 2FJUB 2YXXA 4IL2A 4WZHA 4R9OA 2BGSA 2GQ9A 3VDHA 2ZC1A 1V0NA 2F6UA 4JQ1A 3PJWA 5AHIA 2JIEA 1ZU8A 3KZSA 4YCOA 3VOCA 3W2MA 1QDSA 2XDFA 5A6BA 3RO6A 1SR9A 4FX8A 1NY1A 2V3DA 1Q7MA 2QT3A 1VYRA 3RIKA 1A4MA 4L4MA 3GDLA 1XGEA 3B0PA 4YTQA 3A4AA 1J96A 5C9RA 3UA4A 1PEZA 1Q6OA 2VC9A 1S46A 2FMNA 4O12A 5FA5A 1V8EA 3FKKA 1FH7A 3L0KA 5FF7A 1OC7A 4RL3A 5D8WA 1VJIA 2C6QA 3TDFA 3ZS4A 4PMVA 4XK2A 2AKMA 3PZUA 3RAOA 1L0PA 1VFUA 4UTFA 4O18A 4LUJA 4I5UA 1Z32X 1XL9A 3P5ZA 4S3DA 1LZOA 4NXKA 3BZJA 1BEUA 2FMOA 4PMQA 1C7SA 4AHOA 2ZIDA 1M68A 4EXBA 3PZOA 3VKBA 1H61A 3N13A 4ZB2A 1VFMA 4XSLA 3DFYA 2VEFA 3WF1A 4IUOA 4MPQA 3U57A 1OM0A 2ABBA 3BDKA 3DYMA 1NIUA 3R79A 2CLIA 1UUQA 2DVTA 4A8LA 4EOUA 5CPQA 3W7EA 3MBFA 4FIQA 1PS9A 1XQLA 4XSMA 1YYAA 4H6KA 4PMDA 2OX1A 3G0UA 2Y5SA 3CUXA 1BG9A 3KRUA 4UQEA 1V02A 2A85A 1KFJA 1XKYA 1EDQA 4CNUA 1J5SA 3MY9A 1VJZA 3G1DA 2D1ZA 4GH1A 5CXPA 1Q2RA 2VZVA 3O8AA 1E6RA 1JD9A 2YL8A 3FOKA 3W2JA 5BWAA 1UWTA 4V1XA 3P84A 4NY2A 4MADA 3KM8A 1GPWA 2HS8A 1TIMA 3BG5A 1A49A 3EWCA 2Y2WA 4H8UA 4QCFA 1ZBWA 1FWIC 3FXGA 9XIMA 2XINA 5BOFA 2WYSA 4CD6A 1YEYA 1E55A 3UVAA 1N82A 3L65A 1W2PA 3AIWA 1GVQA 4XIMA 2GGIA 3DHFA 5HPCA 2YL6A 4A6GA 4L9XA 3MKKA 4YYCA 4ACYA 2QCEA 3AUOA 4RV8A 4D8LA 3DFQA 3WQVA 1ZAIA 3BG3A 1M04A 1ZAJA 1N2VA 3PZQA 3SRHA 1ZBCA 1PCKA 4C7DA 2H3BA 1UP2A 2XIBA 3ES7A 3PWIA 4UTTC 6TAAA 1QUMA 2WB5A 1TPEA 2HCVA 4R53A 5K4ZA 3DHUA 4HSHA 1GOXA 3CUHA 2E7FA 4JTFA 1ITUA 3CAWA 2MNRA 2CNCA 3OTRA 4AEEA 4KEZA 5K9CA 2H3DA 3KE0A 4GE8A 3U5YA 4QTGA 1B1YA 3DECA 1EA9C 4JFVA 1RY0A 1GW1A 4U33A 3W29A 1V93A 1XLKA 2VEIA 5CC7A 4QEHA 2AKZA 3G8RA 4S39A 3KOXA 1H0IA 4ML9A 4AZIA 1V08A 3UFYA 3UXKA 5L6UA 2CPUA 1KD0A 4BZYA 3KDOA 2O9TA 4DZAA 4ICMA 3VILA 1XG3A 2A1YA 3DCPA 1F8MA 4CN1A 3VIPA 3ZXWA 5I03A 3LY0A 1OYCA 4IQJA 1PZ2A 4N42A 3T9PA 1M7OA 3HGJA 3TTYA 4ZFMA 1TTIA 3ITVA 3WQCA 5DCDA 4Y2WA 5F2LA 3BLEA 2R91A 3WH7A 5H8UA 5EBUA 2B7OA 4QAWA 3FFSA 4W8LA 1JGMA 4M6PA 3LLDA 3HF3A 4CQ8A 4ZXOA 2Y6ZA 2AGKA 1VCFA 1XBYA 2NXGA 1KM2A 4Q4PA 1ADDA 1EGZA 1WKDA 4AIUA 5C9ZA 2ALDA 1BF6A 2YDRA 1Z7AA 3W85A 4I9TA 4CQ9A 3SR7A 3VGDA 5FJIA 2FPTA 2IQTA 4IJRA 3CO8A 4DB7A 1ONXA 2L5HA 3EPMA 3OHIA 3I65A 3N14A 3ICJA 2CITA 1JXJA 3XISA 3N4EA 2OKTA 2RJHA 2XH4A 1S2VA 4GC3A 1SR0A 4GMEA 2ZWZA 1R47A 4TQTA 2V82A 4W8AA 1RQHA 3T44A 3UXIA 2PLJA 2J9XA 4IX2A 1IZJA 1BRLA 3DAQA 3KEHA 2GDUA 4BJHA 3IUDA 3L4XA 1NOFA 2NV9A 3W7LA 4JQ2A 4LV4A 3MO4A 1AG1O 3ME3A 4DJFA 1K8ZA 3GYEA 2AAAA 3MTWA 3AS2A 3LXCA 4KH2A 4MNKA 3UY7A 1H11A 4AD5A 1V3LA 4RKAA 3WNOA 4DXVA 4BCEA 4Q4QA 2J4GA 2ZA1A 2XUCA 4NRRA 4JKLA 1OX4A 2E6YA 3RLVA 3HJZA 1ZCCA 3VD9A 4B9YA 4JTTA 4ORIA 4Q6XA 3NQAA 2FZBA 2E6DA 1M6JA 3LBCA 1GTEA 2IQDA 1LBFA 1UUMA 4MSSA 4DJEA 3W74A 4JBRA 2WC7A 4JFTA 1H0GA 2XN1A 2VHLA 5LIXX 2CESA 3MQTA 1QT1A 3ABZA 1EIBA 1H50A 2DSUA 3CH9A 3TC6A 3CS2A 1TTJA 3JR2A 3SQMA 1VC4A 1US0A 1W37A 1CXHA 3C86A 5A6BD 2IKJA 1GNXA 3W7JA 1ZB5A 1ZJIA 2PTZA 1OGBA 1PWLA 5LIKX 1JDDA 1TVLA 1FWGC 3ARTA 2UWFA 4J27A 3EX6A 1EUNA 3AI0A 2CETA 3U8GA 2PGRA 2WSRA 4LBRA 2ZKMX 1HP4A 2ZZ3A 2Y24A 1YDNA 1BFNA 1DHKA 4IOTA 4TU1A 4WSKA 1WYIA 5C9XA 3CM4A 3VM7A 3M07A 4IPLA 4AX6A 3CT7A 1FH9A 5LIYX 3VD4A 3F4DA 4PH6A 4POCA 3RK8A 5U7SA 4C6FA 2QJHA 3APGA 1NF0A 4LUSB 3GDRA 4XQ6A 1QHZA 5HA7A 1H1ZA 5ENLA 4JNYA 3UGVA 3UD6A 3UBPC 4TIMA 4LNCA 3SRFA 3THAA 2X8RA 1HX0A 1GQIA 2CEQA 3FEMA 3S9YA 1EBGA 2DU2A 2PWDA 4NHVA 5BRPA 2GVYA 2ATMA 1ZL1A 2ZXQA 4HN8A 4ROQA 3AMKA 4FNTA 1BD0A 3MT1A 4ZODA 3GFYA 1C8QA 1EFZA 4PBFA 5LA0A 4Y9AA 1HVQA 1ZLPA 4MM1A 5CPNA 4E2DA 1W9DM 4TTUA 3I7SA 1K02A 4EVZA 3THCA 4JCLA 4DJDC 5A2BA 5AC6A 3VNYA 1SO6A 4QISA 3GR8A 3PNZA 1VHNA 3CLWA 5EGRA 2D24A 1JCMP 4UQAA 2WNZA 1W1TA 1BTMA 1UZ4A 1Q13A 3EX4A 3WF4A 4QROA 2OO0A 1LWJA 1YW1A 3IIXA 2CLPA 2PDFA 2PBGA 3G1XA 2VEKA 3AHZA 3IIOA 2DW7A 2Q8XA 5JBDA 3EA3A 4ZO7A 1LUCA 3IAQA 4PSRA 3ECQA 1UKOA 2JEPA 1A4LA 2PDHA 1E4MM 3ARVA 5A8MA 2HS6A 1UPMB 3GC2A 1WDPA 4R7JA 4PMNA 1AW2A 3TW6A 1E4NA 3BAWA 1X6LA 4BQ5A 3UT0A 2VDIA 3VDGA 3K1GA 3LPPA 1GKRA 8CGTA 4O50A 3W7OA 1YADA 1TJPA 3L23A 3S1XA 1TV2A 5I2UA 3ZVIA 4C60A 4EE9A 2E6FA 5FJUA 3UJFA 5DN1A 1KR0A 4O16A 2DFAA 2HNEA 1A47A 4E6MA 2PSNA 3KL0A 4FO4A 1LROA 4IJBA 4HN4A 1JF6A 3R11A 4X0VA 3TQKA 5JBEA 1RK5A 1JR1A 1TV8A 3GW3A 2V0TA 4I6KA 4JTAA 2G37A 3II1A 2VTFA 3KWSA 2PDLA 3CU2A 1UG6A 2RAGA 2GWNA 1SU5A 5ECUA 4XKYA 2GOUA 2CLFA 1W5PA 4Q6JA 4JFSA 1XWYA 5FAGA 2V63A 3KL5A 3MUAA 4ZXLA 4DXXA 4O8AA 3M0JA 3K4AA 1H7OA 2I9EA 3TA9A 3N73A 5A5WA 4TMCA 4FP1A 3V75A 1E1CA 1ODUA 3UJSA 4HHHA 3DYOA 3AYTA 2W67A 3MUZ1 1XLIA 3F5JA 3OIXA 1S39A 3INPA 4RW5A 2P10A 4GYPA 1QPQA 1CGYA 4GQRA 2NX1A 4UMCA 3QV9A 3M44A 5EMUA 3TVAA 3UXLA 3TEVA 4PCPA 4DBDA 3N18A 1GUVA 4GXWA 1RJPA 2ZRVA 3NNTA 4GGHA 4PZVA 3GNDA 2HDJA 5D33A 3D3AA 1J0IA 2PDIA 2XWDA 3TYAA 1R0MA 1BRLB 1QW7A 5HNNA 1W91A 3QF0A 1RA0A 1XV8A 2KX9A 4G9PA 2ASHA 4TUFA 3CMFA 3E49A 3O05A 4MWAC 1MZHA 1U5JA 4H41A 3OP2A 1XI3A 4GJIA 1VR6A 3GXIA 1OIFA 3CZ8A 1W3TA 1ADOA 3W1XA 4WY0F 1BVNP 1FCBA 1R30A 1VIZA 3BJSA 4IMFA 1AW1A 1VZWA 2A3EA 2VI0A 2OZ8A 2A0NA 3RPDA 1ISXA 1O7AA 1OX4B 3H8AA 4DRSA 4BEQA 4NI8A 4LU0A 3TA6A 3JZUA 3L2LA 3H2NA 3HG4A 4UQ9A 4PCSA 1IF2A 4OUEA 1LOSA 4FNQA 4E0CA 2D23A 2PZ0A 2X7WA 4UQDA 3WL0A 3NQ2A 2GK1A 1DWFM 1WKYA 5M03A 1HG3A 4O10A 1TJ2A 2A6LA 3BLOA 3VOJA 2DT0A 3TUUA 3S2CA 3C6CA 2DUXA 1NFBA 4HA3A 1Q2SA 1OSEA 3DFTA 4CD4A 3W00A 2QQ6A 3WDRA 3W6YA 2WCSA 4FIRA 1JPHA 1KQYA 4NXSA 1UQZA 3RM8A 3NQ6A 5AB3A 1EH9A 1HJSA 1TVPA 1CXEA 1YXDA 3GH7A 4IIHA 3N2CA 1W1B1 4RXFA 4L4OA 5PTDA 3B0UX 1RPKA 1DJHA 2V5KA 2WC4A 4FNUA 4ICCX 4IUGA 4UBPC 4N7QA 1KFEA 1E3ZA 3WK2A 2VNCA 4MKVA 4NJHA 2D2GA 5F2GA 5TIMA 4WHBA 1J11A 3H2OA 4DO5A 3W26A 1LRQA 3VUPA 2YZRA 2GVLA 5AHNA 3BAXA 2V5LA 4XBSA 4GCAA 5D2YA 2ODOA 3GRIA 4LRSA 4L5ZA 5DT7A 1YPXA 4C5YA 3M7SA 1B3YA 3ZR6A 3O07A 5G2WA 1HL9A 4IP5A 2NX9A 1WDSA 5I07A 1EUAA 4XTDA 3SCWA 1W32A 4XD4A 1RSCA 1CB2A 4ZL1A 4UXDA 1Y7VA 2EPOA 3DHPA 5M1TA 3W1AA 3PR2A 3L2IA 3CGTA 2QJNA 4WDWA 1DVJA 3PZ9A 4XD5A 3WLSA 2BGNE 2XIQA 3LQGA 1P0DA 4M6VA 1NSJA 2WLYA 3EWWA 4FNPA 3VIHA 3EPNA 4Y9PA 4BKNA 1TCMA 2PC4A 1OCQA 2XN0A 1KCZA 1U22A 3NO1A 3GHSA 3O6CA 5K4XA 3DX5A 4KT2A 2XU2A 3UZYA 4X2RA 4YTRA 1LJYA 5LNVA 3G18A 3FNDA 3RFAA 3LTPA 4JYFA 5LHFA 4MIMA 3URNA 1GOQA 3BAYA 1DXFA 3SSJA 2XZ7A 1L2QA 3KRBA 1JDCA 4AWSA 4YHGA 1DEDA 4LS1A 3MHGA 5AC8A 3MWCA 5F1VA 1EKOA 1R9XA 2PLCA 4EAMA 5DEZA 2CKRA 2FPVA 4BEUA 3T42A 3NYZA 1XUZA 5AHEA 4YPJA 3VTRA 3MB9A 2F2HA 4WOZA 5FOOA 3BC9A 3REQA 3B4UA 3WQGA 5CCZA 1DJNA 3SIMA 4WJ8A 1K7XA 2ZZ6A 1XG4A 5C6MA 1AD1A 4IFKB 4HB7A 4IM4A 1KXVA 5DX7A 1E4IA 3TYUA 1GVYA 3VKAA 1D7KA 4JQ3A 4N0RA 4IISA 1EYWA 4JN6A 2E68A 1O5RA 2DZWA 1XD1A 1NP0A 3A23A 3NUKA 1SZNA 3SZ8A 4XKYB 3PBGA 5KZMA 2BVTA 4IPJA 1T96A 4HA0A 3N11A 1C9WA 3VIFA 4QJ1A 1ISZA 4B91A 4UTWC 1B9ZA 2OSYA 2V3FA 5FIPA 1FRBA 4GI4A 1KFWA 1E1CB 2HV5A 2W6RA 3W2KA 4PRWA 3BMWA 1KW1A 1NAL1 2VFGA 1BYCA 3WQDA 3DBPA 3LXBA 1P4CA 3B9DA 4DPQA 1UWUA 3CHDA 1Y65A 3OLIA 1VH7A 1XIIA 2ZX6A 3VX0A 3TC3A 3T40A 4N9BA 4GI9A 4O1AA 3WMBA 4KFOA 3H23A 2CZFA 4N6FA 3LBMA 3W1NA 4H04A 3WLNA 1UKSA 2G96A 1OINA 4AZ6A 4WVXA 1DJWA 5D2XA 4WRHA 5DELA 4AYGA 4JIRA 3LU2A 1RBOB 2DVXA 2ZXBA 3VXGA 3B8SA 2PWVA 5DT5A 3VE9A 3FV9A 3O9NA 1CEOA 4HD5A 1CXKA 2E5DA 1GORA 3CMJA 4WX2A 3P74A 2X0SA 3G6MA 5J5DA 3VNLA 3QY8A 4LC8A 1H09A 2CXEA 3U48A 3PVFA 4AIEA 5EU9A 3I6EA 2XSXA 1K6WA 1SJBA 1TSIA 5D37A 3DENA 4GUIA 1UPPA 5MKGB 4ONVA 1ZGDA 1ZJHA 3V36A 5I79A 1Y5XA 3NFUA 3GDBA 3WY1A 4LYQA 3WFLA 3GTFA 3RLHA 3RITA 1SUXA 1HF6A 3ARXA 3FDKA 2R6OA 4YLWA 3VMOA 2GK1B 1PZ1A 4HNLA 1SSGA 1EX5A 2ZWYA 4CQDA 1IIGA 4X63A 3GUGA 4NX0A 3SUUA 2UZ9A 5BXSA 1TPC1 2BVWA 4HYVA 4C6KA 5DCEA 1Z48A 2V5CA 3Q94A 1LQAA 3KRSA 1JCXA 2PTDA 3B8DA 1T8QA 4HU0A 4QLJA 2CW6A 4F9DA 2ZVIA 3TW7A 5HNTA 3DUGA 4OTKA 3VNJA 4DO7A 3C2RA 4HOXA 3WUEA 1FHDA 1XF0A 3CHVA 4NZ1A 4C90A 2TODA 4XZLX 2FZMA 2QJJA 4QCEA 4LPCA 3TQ0A 3KDNA 4D6DA 1PXGA 2J6VA 4LW7A 1SM9A 4E8GA 5ECVA 3C0JA 3UWEA 1AZ2A 3BSGA 4RW3A 1TWDA 3VC5A 1OZQA 2OZTA 2OLHA 4GUJA 3IUHA 4H6RA 2PB1A 3T78A 2XGBA 3WQEA 3KWXA 4QG8A 4YVXA 4B4HA 3TE9A 3PS7A 3NQGA 1FBAA 2VT0A 3BJFA 3QMTA 1KV5A 5AHFA 2VC6A 3L4WA 2OCZA 3FS2A 4PCTA 1NDVA 2NQ9A 2YYUA 2YR1A 2YL5A 1XYFA 2P8CA 1JYWA 3TJXA 3FN9A 3FJLA 3WBWA 3U2CA 4KWOA 2CLLA 2X30A 1EQCA 3URAA 1MW2A 4Y9NA 4AG0A 3FHAA 4JIQA 3SECA 1DWHM 1UOKA 3AALA 3LMZA 1F8IA 2H6RA 3GTHA 1KB3A 4RX0A 1JL8A 5T9CE 4OHQA 4GQQA 5KITA 3QOKA 4Q7BA 2DV0A 3COTA 2WZEA 3DXIA 1AJ2A 2QCCA 3VKJA 1YPIA 2OFJA 2WVTA 4JTKA 1XPGA 4WXZA 2QHAA 3GDKA 1HN1A 1P43A 3L4ZA 4XAPA 3AYRA 5AYIA 3M6DA 1A80A 1ISWA 1NELA 2IMRA 5E70A 1TV4A 1AH0A 4HU4A 1MW1A 4HTBA 3RLUA 3SCNA