1HNYA

The structure of human pancreatic alpha-amylase at 1.8 angstroms resolution and comparisons with related enzymes
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase (o-glycosyl)
molecule keywords HUMAN PANCREATIC ALPHA-AMYLASE
publication title The structure of human pancreatic alpha-amylase at 1.8 A resolution and comparisons with related enzymes.
pubmed rcsb
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hnyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hnyA01
4CCCA 3OB8A 2FE0A 2OYKA 3WEOA 3RJXA 3PZ9A 5DT5A 1WZMA 1GHSA 1HJQA 4H8HA 4Z2HA 4MB4A 4ACYA 3M07A 3TP4A 2PWDA 3KLLA 4XZWA 1WO2A 3VMPA 2DDXA 3PTKA 3L2LA 3ARWA 3W81A 2F61A 3T2QA 2BY1A 1ZBWA 1FFRA 1WDQA 2X8RA 2W66A 1UA3A 1HWWA 1TMQA 1W1YA 6CGTA 4E8CA 2EADA 1JXKA 1E6XM 5JBEA 3RM8A 1Q6FA 5AC5A 1UZ4A 2EJ1A 3BSHA 1R7AA 5CG0A 3K8MA 1JD7A 1HXKA 3DHPA 4W88A 1MWOA 1FHDA 1V6UA 4HP5A 3WF3A 3DX2A 3MMUA 3MANA 2CCRA 4AC1X 3WDIA 5LA2A 4CD4A 2XN0A 3WL0A 3EDKA 1O6IA 1VJSA 2D2OA 4Z2JA 1EDQA 2Y2WA 3LRLA 3I3DA 3NYDA 3QGVA 4GQQA 4J3UA 4LYQA 2F2HA 1UOKA 1Q4NX 3HG4A 4H8VA 4CD6A 5E70A 1EO7A 2W62A 1V0LA 3WQWA 3K46A 4M8UA 4TUFA 4C7DA 4EKJA 1JG9A 1BPLB 1EDGA 4GI8A 1W2PA 4UZUA 3SUWA 1QHZA 2VURA 3OGRA 4KMQA 4YN5A 1UD6A 1FH8A 3D4ZA 4UOJA 4WSKA 4AW7A 3DYMA 2XHYA 1JAKA 1UH2A 2VCAA 4PSRA 1J10A 3OLGA 3DYPA 4PMXA 1ZJBA 2WCSA 1EQCA 2WC7A 4NX0A 5BRPA 4Y7EA 3WMBA 4AZIA 4D1JA 1CECA 2D22A 1GPFA 2W92A 1GW1A 2DEPA 2ZX9A 4AD5A 2CHNA 5A6MA 1RPKA 4PMNA 4LXFA 3LPPA 3L4WA 5JUVA 2F1AA 4F9JA 4PCTA 1D2KA 1LL6A 4P7RA 1K6AA 1OT1A 2PBOA 2DIEA 4PMVA 5JIWA 4AD1A 3NIYA 2J47A 4TX8A 4AY1A 2WWDA 2C7FA 2XFRA 3F5JA 1V02A 1D7FA 4UOQA 3AZRA 5E1QA 4W87A 2Y8KA 4D6HA 1QWUA 4UQAA 2OW7A 2GDVA 1J0HA 3WNPA 1HJSA 1EOKA 4GZJA 4W8AA 1GHRA 3T2PA 2G3JA 1WDPA 3A23A 3TA9A 3BVTA 1E56A 2J77A 1XSIA 4UFKA 1JFXA 2ZUTA 2VOTA 1ZBVA 2GK1A 4D72A 4H41A 3PZOA 4AZ7A 1AVAA 4H04A 1JD9A 1CBGA 5D9NA 5IDIA 2UY4A 3VGGA 3WD0A 2C0HA 1QI4A 4P7QA 3CUJA 3CZSA 4FLOA 3PZVA 1OD8A 1BAGA 4HMCA 1E72M 4JKKA 1ISXA 1ISZA 3AS2A 2DSUA 5CGTA 1BFNA 2IUZA 2RGLA 1UD3A 2VZOA 2VX5A 4AZCB 1HF6A 4F8XA 3OZOA 3WY1A 1WPCA 1PX8A 4WIWA 4W84A 1US3A 4UFJA 1B90A 3M46A 1HXJA 3L2MA 1VAHA 4MB5A 3DX0A 4KGLA 3BAIA 1E43A 4FLQA 3WNNA 1I1WA 1TE1A 2O9TA 1HKKA 1M04A 4EANA 3RDKA 2BXZA 2YA2A 2QV4A 1JYNA 4W5ZA 4NXKA 5A95A 3T0DA 3MSDA 4AZCA 1GJUA 1JAEA 2Y5EA 5KZ6A 1R87A 1W1PA 2YFOA 3FAXA 2JIWA 3ARUA 3VILA 2J4GA 1ODZA 3VIGA 1C8XA 3MKKA 3WD2A 1BQCA 4A3HA 2QPSA 4OOZA 1J18A 4F79A 2W67A 3A21A 3PZTA 4GO8A 3N04A 1Q6DA 3TV8A 4U2ZA 1E6QM 2YLLA 1HP4A 4X0NA 1QOXA 1UH4A 4R27A 3NSXA 1ZL1A 3EJRA 4GZIA 4CUCA 1PAMA 3MS8A 1XHGA 1TQWA 1JNEA 1WDSA 2JF6A 1ODUA 4FLRA 2PWFA 2WMKA 2Z1KA 4PMZA 2DIJA 3LRKA 4ZEPA 4X9YA 3ZR5A 4A4AA 1UQYA 1R33A 1Q6CA 3HG2A 2OYMA 2XGBA 4L4OA 4JAWA 1TUXA 3CPUA 5GNXA 1MW1A 1NWRA 2XWEA 1HVQA 3WENA 3CZNA 2GSJA 5IHSA 2CBIA 2XM1A 1C8QA 3AICA 2W5FA 3A4WA 1E6ZA 3WDPP 4QCFA 7A3HA 1J0YA 1QBAA 1EA9C 4HZ8A 2HISA 3ALFA 4DM2A 1J9YA 1OGGA 2BHZA 4PYSA 1KXVA 1J12A 4JFTA 4AXNA 2YFNA 4OOUA 1TA3A 2O92A 2NT0A 2WLZA 2XIBA 2ZXDA 1O7AA 3OBAA 3VD3A 3HZ3A 1W32A 3W0KA 4P8WA 3W25A 1V08A 1XV8A 3BUPA 5CGMA 3AHZA 4AD0A 3FXYA 3VDCA 2DPEA 1HL9A 3D52A 1E1EA 1W9DM 2WW5A 4NXSA 3VINA 2WHKA 2ZUMA 1GVYA 2XWDA 3WNKA 2Z1SA 1KWKA 2EPMX 1PX3A 1GQLA 5HBFA 3AYSA 1AQHA 3ZMRA 1BVZA 3CZ8A 3D3AA 1V3JA 4BQ4A 3CZJA 4AYSA 4HU8A 4GO9A 4P7LA 5ABFB 1XCXA 1LF1A 1MYRA 1VBRA 2WMIA 2OLHA 5DT7A 4W85A 2EAEA 4HPHA 1NH6A 1B3XA 3NUKA 4J28A 1R7OA 1CXFA 2NW0A 4WKHA 1HX0A 3WUGA 2QPUA 2D24A 3CMGA 5BRQA 3ARQA 4HMEA 4MPKA 2XSAA 3CZEA 1JYVA 1ZB5A 3OG2A 4GIAA 4HOWA 4D6DA 4CU7A 3TONA 5CLTA 3ALGA 3RM9A 3ZT7A 1VFUA 2PBGA 3DDFA 1FFQA 1DWJM 4U33A 1W9VA 1BYCA 1UA7A 1FH7A 2J8FA 6A3HA 5I77A 3ARTA 1JF6A 1QI5A 2O9PA 3KE0A 5BCAA 1XH0A 2FYVA 1TVPA 1C7TA 1B0IA 3ARSA 1V3MA 1HT6A 1GCYA 4ZE4A 1CZ1A 2CBUA 2WVTA 4NRRA 2WC3A 4UFHA 5I0DA 2J25A 5EFDA 1GZJA 5FCZA 1QW8A 2W91A 1MXGA 1A47A 4BF7A 1ZU8A 4XX6A 3HG3A 4JIEA 3UEQA 1JNDA 2FGLA 3WMSA 4MAVA 4JHOA 4FK9A 1GOMA 3BVVA 4ACZA 2JEPA 3CZLA 1EHAA 3VMNA 1LG2A 3OLDA 1H5VA 3IGUA 2CITA 3BUQA 2BY2A 5JBFA 1KTCA 1MVYA 5CSUA 4E4PA 1CGUA 5I24A 3A4AA 5A8OA 2O9OA 1NWTA 3S2CA 1QI0A 1KWGA 3BAJA 3U5UA 2ZUSA 4P8VA 4DUWA 4W89A 1AMYA 1JZ6A 3SUTA 1C3FA 4MDOA 3VU2A 4UZSA 1UYQA 1H2JA 1TVNA 2YBTA 3B9EA 2X0YA 5CJ5A 1VBUA 3GXDA 3AI0A 4HZ6A 4U5KA 1CXIA 1QI2A 1UKPA 3B9DA 1PS3A 3WMCA 1UWTA 1HJUA 3DX4A 3CH9A 4BCEA 1BGAA 3IK2A 3F5KA 1SYTA 3WBEA 4CCDA 1DWAM 3N18A 2EO7A 2CERA 3WKZA 2XYLA 2J8GA 2WMJA 2WKGA 1VFFA 3H53A 3BVUA 1QBBA 1YQ2A 4YHEA 1KB3A 3AMKA 3GXMA 1LQ0A 3OIHA 4CGTA 4FF5A 4U3AA 3CLWA 3WD1A 2XVKA 3WL1A 2VX6A 2J7DA 3CC1A 3WY3A 1UKOA 4JFSA 4AD4A 1PEZA 1BGGA 1IT0A 3UG5A 8CGTA 1M01A 1GQJA 3WQVA 2ZXAA 3D51A 4M80A 2Y4SA 4W93A 4W8BA 3DX3A 4PCSA 1E6SM 5IHRA 3UCQA 2DT2A 1J0ZA 5FIPA 3EJQA 3NCOA 3L4VA 2BHUA 3W27A 5HPCA 4OKDA 3AMGA 2AAAA 3EYPA 3BH4A 4J7RA 1QHPA 2D0GA 2PB1A 3WDQA 1RP9A 5A6AA 4L4PA 3WF1A 1GOKA 4S3KA 4BA0A 4M29A 1JIBA 4MNJA 1JZ4A 2ZOXA 4J3WA 4PSPA 4Q7NA 4D6EA 1DWGM 4CD8A 4D6FA 1PIFA 1PPIA 1TG7A 4HPGA 1JZ8A 1MQRA 3FY1A 2WHMA 1QNSA 3CUFA 3W37A 3E1F1 5HNNA 4IPNB 1VEOA 1HNYA 3U57A 1JDDA 3GXNA 3VD9A 3CUIA 1EXPA 2RGMA 2XVGA 4A3YA 4D6JA 2V3FA 3UERA 4CD5A 2Q8XA 1UR4A 1SZNA 3W6LA 1T0OA 4Z2LA 3SCSA 2WVVB 3CIVA 3WUFA 1TQTA 5M5DA 2BVDA 1HKIA 1L8NA 1OM0A 3ARVA 1U30A 3BUDA 2VCBA 3N9KA 4XV0A 4WSJA 4FNQA 1B3VA 3SCNA 1UR1A 1GORA 3BMWA 5A8NA 2ZX7A 2WNWA 4AIOA 2ZIDA 3ARYA 2CYGA 1G94A 3U5YA 1W9PA 2D3LA 4J3TA 1KBKA 1JYWA 4QLLA 2JE8A 3AIRA 1EIBA 2TAAA 1EDTA 2PWEA 4M1RA 1US2A 3EMZA 1R8LA 3VD7A 3ZT6A 5A8QA 3LX9A 4R5EA 3ZJ7A 2WAGA 2WXDM 4QP0A 2CESA 4JFUA 1V6WA 1BF2A 1CEOA 2CPUA 2E40A 4BS0A 4OZOA 7CGTA 4QCEA 2XN2A 5LA0A 2OSYA 4JCLA 2WANA 3KZSA 4P8XA 3A6OA 2VRJA 1PZ2A 4CU8A 2EQDA 4B9YA 4AMCA 3B8SA 4UQEA 3VSUA 1OCQA 3W6MA 3II1A 3OLIA 2E8ZA 1KCLA 2HVMA 1V6YA 3UG3A 3EDFA 2AOSA 3SURA 2V5CA 3ZJ6A 4CKQA 5A6JA 5E09A 2JALA 5D8ZA 4MADA 5A6BD 5IFPA 5CPSA 5BXRA 3AFBA 2WZHA 3OLEA 4EE9A 5BXTA 2W63A 3PTQA 1ZJAA 1G1YA 1NWUA 2V5DA 4PMUA 2ZX8A 3CZGA 1JYXA 4KRTA 2YA0A 3CHEA 1CXHA 7TAAA 3WFLA 1CXLA 4ZXOA 1NQ6A 2PC8A 4M56A 3T2OA 3BVWA 1XH2A 4HA3A 3BLPX 3APGA 5E9AA 3A22A 1ITXA 2WZIA 2V3GA 3WH5A 2IXVA 3AS3A 2VTFA 3MO4A 2YL6A 2WM0A 1B9ZA 2XFFA 1EHNA 2VR5A 1GJWA 3M6DA 1CGYA 1VB9A 1FP9A 3U7VA 5JIPA 3W24A 3WDHA 4GI6A 1VFOA 3POCA 4K68A 3VDBA 5EMYA 4GXPA 3RCNA 4D71A 5DFAA 4FNSA 5FKYA 1MQQA 1JDAA 4OBSA 1W3LA 4NSBA 4B16A 3EMCA 5M3WA 1H3GA 4AD3A 3K8LA 3L4UA 1ECEA 2CBJA 3T0AA 3ARPA 3WIJA 1E6PA 3WNLA 1W3JA 4FNUA 3WUBA 2WYSA 3BGAA 2WVUA 3A47A 3BAWA 3SCVA 3VD5A 1ZBKA 4IUGA 2YJQA 4OBRA 5A6LA 3NSNA 4PRWA 3MUAA 2BVTA 1DHKA 1KR1A 1MQPA 4GKLA 4U5IA 1G9HA 4HMDA 1D3CA 1H0IA 4TX6A 1NOWA 3TTQA 4JFVA 1UWSA 4PN2A 3WSUA 3QOMA 1R34A 4RE2A 1UWIA 4UQ9A 2F7PA 1QHOA 4HA1A 3HU7A 3WH8A 3QHOA 4LPCA 2J62A 3W28A 1DP0A 1FA2A 2WK2A 3VM5A 1GUVA 4CCEA 3W82A 4XZBA 4M81A 2VJXA 2F8QA 4TVCA 1QPKA 1HJVA 2CKSA 2WLYA 4LYRA 4FNRA 4PTXA 3W26A 1XYFA 3EBVA 3A24A 5A69A 2JIEA 5BYWA 3SUVA 2VT0A 1E1FA 1ESWA 1XD1A 4JKLA 4BQ2A 5BWFA 1Q6GA 3LPFA 2VUYA 1WNOA 9CGTA 3ZOAA 1UASA 4AZGA 3AISA 2D20A 1UQZA 4AISA 4AEFA 3AIBA 1VFMA 1TCMA 4KWUA 5D8WA 3CTTA 5A2BA 1NOUA 2UWFA 2JFEX 1NWSA 1R86A 3ARXA 4UOZA 3VGFA 1QVBA 3VX0A 5ABEA 2VZUA 1CPUA 3MI6A 1E6NA 3SCQA 4DUXA 1M7XA 1I1XA 4MNLA 3RO8A 4WF7A 3G6LA 4WKFA 3FNDA 5A94A 4U3CA 2YLAA 1UR9A 1J0IA 1NARA 5A2AA 1UKQA 4PMOA 2J7GA 2D3NA 5HDRA 2IXUA 5A2CA 3VIIA 2QHAA 2WCAA 5E0CA 4M24A 4JL1A 3BCDA 3FW6A 2F18A 1BHGA 4Z2KA 3HN3A 4DWSB 3VO0A 2E8YA 1BG4A 3PZIA 5EFFA 2ZXBA 2ESCA 1RH9A 4KH2A 1MW3A 3VIKA 4QAWA 4OIFA 2BV9A 1J0JA 1TQSA 5TD4A 1SFSA 4LYPA 3NDZA 3AZTA 3SCTA 1JZ3A 1V3LA 1KXHA 1E73M 2Y8VA 4CU6A 3IJ9A 1CYGA 5CSYA 3S5YA 5GPRA 2DQXA 3DECA 1CLXA 3AIVA 4UNIA 2PI6A 3CZKA 1H09A 3SEPA 1R47A 2ZX6A 4NZJA 3QHMA 5ABFA 1C93A 4P8UA 1IV8A 3WBAA 1RD6A 2J7HA 1FHLA 4GQRA 4H8UA 4X0VA 3DC0A 4MDPA 4CVUA 4DM1A 2DT0A 4MTVA 2BXYA 3MV01 3VGHA 1HTYA 2JF7A 4E8DA 2OW6A 1B1YA 2EBNA 3KL3A 4TVDA 4J3XA 1JI2A 3LXAA 4W86A 1VEMA 4JHZA 4BQ5A 1B30A 2WBKA 1QWNA 1LWHA 4D1IA 1KBBA 4DO5A 5CPQA 1GQIA 3CUHA 2ZUWA 3K1DA 1CLVA 1UR0A 4KGJA 2J7BA 1WZKA 2VX7A 5CZKA 3WQ6A 5ABHA 4C7FA 2XUCA 1CXEA 3K4DA 4AIUA 1HVXA 3AXHA 3OZPA 4GINA 2XVLA 1GQKA 3AYRA 3POHA 3VD4A 1WP6A 4QLKA 3SUUA 1V03A 4AEEA 2ALWA 2J75A 2ZE0A 1R75A 3RILA 4MJ2A 2XSBA 1BTCA 3T09A 2D0FA 2BHYA 3VX1A 2YL9A 3AZSA 5I23A 1EH9A 2EPKX 3AQUA 1KQYA 1UKSA 1CENA 3WH7A 3GXFA 3ARRA 1SMDA 5BXSA 2F7QA 3IJ7A 1C90A 1BSIA 2VNCA 2ZUUA 1PJ9A 3AMLA 3EJSA 5AC4A 5I6SA 5M17A 2EABA 4YHGA 3K4AA 2BFGA 5A8PA 4JL2A 1E5JA 1HKJA 2OYLA 3VIMA 4DWSD 3VGEA 3PHAA 1B31A 2G3IA 3EMQA 2D73A 1YHTA 1FP8A 3ZJKA 3WN6A 6TAAA 1JZ2A 1C92A 3BUIA 2ZXQA 3SCRA 4DWSC 3LPOA 1KGXA 1E0WA 3PZNA 4TTUA 5FD0A 2WVSA 1WE5A 1BYDA 3S6TA 3VSVA 3WUEA 3VVGA 2CHOA 2YDSA 3CGTA 1CTNA 1OSEA 2WSPA 2WZEA 2V3DA 4V27A 3VM7A 1E4MM 3BC9A 5BXPA 1W3HA 4AZ5A 3TTOA 3W4RA 4PMRA 1UD4A 5BROA 3BCFA 3DYOA 1XRVA 3F5LA 3NSMA 3AXIA 1TR1A 1WZLA 4N42A 3WF2A 4BZYA 4RE3A 1E40A 1E4IA 4PTVA 3THDA 4DO4A 3L4XA 2WCGA 4PTMA 1OWQA 5HPOA 4GZEA 1KQZA 1TFVA 3U7BA 4Q22A 5DF0A 3CHCA 2BVYA 4LX4A 3AJ7A 5E0FA 2ZWZA 1XGZA 2VR4A 3T08A 3SIMA 4UQBA 2CKRA 3SCPA 1UWUA 2F7OA 1EQPA 3SCWA 1ITCA 1UD5A 1UR2A 2XVPA 3AHXA 3ZM8A 3BAKA 3NJ3A 3AS0A 2BNJA 1ZBCA 1NP0A 1CIUA 1QW9A 5A6BA 4ATLA 5LA1A 3K8KA 3LXCA 2G3NA 3KL5A 3VGBA 3VNZA 1WKYA 1K9EA 4H7VA 1W91A 2UY3A 1QNPA 3O2LA 4AZ6A 3JUGA 3TTYA 5CXPA 2DSKA 3RMEA 4OJYA 4FNPA 3I3BA 1KXTA 2VVNA 2YDRA 1VJZA 2VZSA 1B2YA 4UR9A 1B3WA 1V3HA 2XM2A 4MNMA 1S46A 3GNOA 4QDMA 2XIIA 3FHQA 3BLKA 2XPKA 3UR7A 1E5NA 2WVVA 4UTFA 1NP2A 4AD2A 3ZJ8A 1MXDA 1XSKA 8A3HA 2E3ZA 3WY2A 1K9TA 3AXXA 4ZFMA 3KLKA 2WC4A 4AIEA 3OGSA 3IJ8A 3RIKA 2WB5A 3WF4A 4EAMA 4J3SA 4IISA 3EDEA 4HA4A 4HU0A 1ZS2A 4UQDA 3W29A 3LXBA 2YL5A 3WQ8A 1OGSA 5I3DA 3GTNA 1HIZA 2YDQA 2D1ZA 1KGWA 2EPLX 1GOWA 4PEEA 3HMCA 1ISVA 4PMDA 3CUGA 2CXGA 1FH9A 2J79A 3T0BA 2GUYA 4B15A 5D9MA 5A3HA 2FDMA 1H41A 1UWRA 4JKMA 2E9BA 1KCKA 4NF7A 1WAWA 1DWIM 3VMOA 2EACA 3AHTA 2XTKA 4XUYA 4NI3A 2GDUA 2PF0A 1G01A 1XC6A 1E0XA 1HKMA 1L0PA 2IGTA 2WMGA 4HOZA 2X05A 5I5RA 1JZ5A 1MFUA 1E3XA 1LL4A 2ZWYA 2FHBA 1UD8A 3QOKA 1V02E 4QLJA 3MMWA 5E6ZA 3WF0A 3IAPA 1C7SA 3SCUA 2XG9A 1DWHM 3N1AA 1KFWA 3DDGA 3ZQ9A 5AYBA 5A6KA 3S5ZA 2DH3A 4MAZA 3PZUA 1W1VA 5AYIA 1Y7VA 1W9XA 2QLYA 1JFHA 4C7GA 1KR0A 2CEQA 3AHVA 3VIPA 3H55A 4JFWA 3A5VA 2DSZA 5GNYA 3VIFA 1HN1A 1AQ0A 1B3YA 5ECUA 4WLCA 1OGBA 1X6LA 1FOBA 4W7WA 1F4HA 1CGXA 1OIFA 3WEZA 4QFUA 2JEQA 3TOPA 1EGZA 3N11A 2J74A 3LMYA 4WJXA 2X2HA 2VVSA 4EK7A 4UQCA 3GYCA 3EJTA 5CLWA 1VF8A 1I75A 2XN1A 1IZKA 1V3KA 3AIEA 4AWEA 2UY5A 4B9ZA 1WB0A 2UY2A 1TQVA 1GONA 2J7FA 4B3KA 2GK1B 3WDRA 2DGAA 2GVYA 4NZFA 1E3ZA 1AQMA 1WCGA 3VIJA 1SMAA 3DHUA 1U2YA 5FOOA 3ARZA 3MUZ1 1UHVA 4AZBA 3WQ4A 4M82A 3PTMA 3N15A 4CVWA 3PZGA 1GVIA 5A1AA 1K9DA 3AMCA 4Z2IA 1UKTA 5F7UA 2GJXB 2VRQA 3PZQA 4DO6A 4WKAA 3OGVA 2F7RA 3PN8A 3BAXA 2V38A 3VTRA 1BG9A 4JCMA 1DTUA 2WKLA 2EXOA 4AZHA 5A6SA 4ATDA 3WH6A 2A3AA 2GFTA 3QR3A 2XVNA 2D0HA 2EEXA 1QI3A 3CBWA 3MSGA 1C91A 2A3BA 2J7EA 2J78A 1BVNP 3H54A 2GJXA 3L4TA 5C8BB 3ZR6A 1OIMA 1QNRA 3UESA 1R85A 2BS9A 4Z2GA 5E6YA 2W61A 5D4YA 2EPNA 1XCWA 1V3IA 1B3ZA 1JGIA 2WPGA 3A3HA 1SR0A 3GXPA 1BLIA 4HZ7A 1PBGA 4HTYA 3VOCA 3CO4A 2FH8A 2FHCA 5DMYA 4MB1A 4GI9A 5IFTA 3VNYA 4UFMA 2QMKA 3VGDA 2ZICA 3EDDA 3WFZA 1GOQA 3EDJA 2VMFA 1ISYA 4TOQA 1J0KA 3KL0A 2CIPA 2VRKA 4FNTA 5DEZA 3N13A 1RP8A 1WZAA 3IAQA 4AYGA 1E71M 1W1TA 1VENA 2WWCA 3MUIA 2ZX5A 1H0GA 2G4FA 2J7CA 1CWYA 4AMXA 1N82A 4RE4A 2F1BA 2NT1A 1JI1A 2XGIA 5EB8A 5I78A 1TQUA 5C71A 2XFYA 4FMVA 2OSXA 4CD7A 4V2XA 2GJPA 3MU7A 1M03A 4AMWA 4TXEA 3D5HA 1TA3B 2G3MA 2PWGA 3I3EA 3PZMA 2O9RA 1CGWA 4B3LA 2VI0A 1CNVA 3WH9A 4E2OA 1DWFM 1OT2A 3GBEA 4UCFA 3UG4A 1GOIA 4XB3A 3AOFA 1QNOA 1UH3A 4KRUA 1QNQA 5GQBA 4WK9A 3GXTA 3CHFA 3SCOA 1VRXA 5I79A 1W9UA 1PX4A 2X09A 3B9AA 2DSVA 1O7DC 2VL4A 4JZ5A 1K9FA 1NOFA 5EBAA 4MB3A 1F4AA 1H4PA 5CPTA 3HG5A 2VC9A 2WMIB 3VPLA 1HJXA 2AMGA 2WHLA 1A3HA 3GBDA 3FN9A 1H49A 2B31A 2QMJA 5AY7A 2WMFA 4MNKA 2VZTA 1LWJA 3FAWA 4PMYA 3MUY1 1OBAA 2X2IA 3MV11 2VZVA 4FLSA 3NDYA 5ABGA 1LL7A 4W7VA 4DWSA 3O9NA 3GZAA 4D6CA 2A3CA 5IXEA 4OGZA 4P7OA 4W7UA 4NZCA 1MFVA 1Z32X 4IM4A 2V3EA 3KEHA 2FHFA 1P6WA 3N17A 3GH4A 3MMDA 3D4YA 1Q6EA 3DX1A 4N0RA 2FGZA 1M53A 3ZSTA 3GNRA 1H1NA 3VDAA 4J3VA 1KGUA 3L4ZA 4CN1A 1V0NA 5KEZA 3BVXA 2CBVA 2D23A 3AHYA 3N12A 2VO5A 1IZJA 3AROA 4ZE5A 4LQ1A 3WNOA 1UG6A 1HL8A 1UD2A 3QHNA 1W3KA 4H2CA 1UR8A 5LYRA 1CXKA 2MANA 3GH7A 1UZ1A 4P7NA 2FH6A 2Y24A 3EJPA 2YL8A 4UFLA 1BYAA 2BY3A 5GNZA 5I2UA 4U2YA 3W38A 1EOMA 5CQ1A 3EJUA 1CDGA 3IANA 3BSGA 2BY0A 4CN6A 2VQUA 1PIGA 1E15A 2DT1A 1JZ7A 4ACZB 1HP5A 2X2YA 4ZENA 1OB0A 3GM8A 3WD3A 4LGXA 1EO5A 1KTBA 4PMQA 1VIWA 3VIOA 2YKKA 4W8LA 1V0KA 3L4YA 4YPJA 3G6MA 3WEMA 1R46A 3UETA 2OSWA 5A8MA 4PUDA 3SUSA 1X6NA 2E4TA 4RL3A 5M03A 1LLOA 1CGVA 3VUPA 4BQ3A 3GXIA 3HJEA 3ZSSA 4CN4A 1TZ7A 2W4XA 3ECQA 3VDHA 2CETA 3VIHA 1QX1A 2C8NA 3GDBA 3CV5A 1E0VA 2ZUNA 2QF8A 4F66A 5HOSA 1HJWA 5FL0A 4D6IA 5D9PA 3VSTA 4GPNA 2G8ZA 2E0PA 1H11A 1W2VA 1JF5A 2VQTA 1LG1A 1DEDA 2PWHA 3AIWA 1KXQA 4PBGA 4TTGA 1XSJA 2YIHA 1JDCA 1XYZA 5FL1A 3WNMA 2NSXA 3BLBA 3AIQA 3BXWA 3BUBA 2DT3A 3RJYA 5HXMA 2OWWA 3OA5A 4PUEA 2YA1A 1J11A 3AMDA 3VKKA 3RPMA 2DH2A 1UUQA 1V0MA 5D9OA 3WELA 1E55A 2A3EA 1MW0A 1E4NA 4PTWA 5JBDA 4NRSA 3M7SA 3FHAA 1U33A 2ZUVA 1G5AA 5DO8A 2YBUA 3WD4A 1UWQA 3D50A 3KWXA 1PZ3A 2WHJA 1V6XA 1E6RA 2XJ7A 3CHDA 3TTSA 2VX4A 2VCCA 3ZO9A 2X0HA 2DSWA 3UR8A 5C70A 3LPGA 2WBGA 3BMVA 4IPLA 1BYBA 1G0CA 3WQ5A 4ZXLA 3AIUA 1XH1A 1GNXA 2A3HA 2EPOA 1JL8A 1JXJA 1V6VA 2X1IA 4HOXA 4ATWA 3WDJA 3ZIZA 4D6GA 2CNCA 4F9DA 1CGTA 3LRMA 3AS1A 1WDRA 1MW2A 3GH5A 2GJRA 4TVUA 4DUVA 3PBGA 2E9MA 1ISWA 1VEPA 3CMJA 3GNPA 3F4VA 1W9BM 4URIA 2WMHA 1E70M 3A4XA 4MJ4A 4OUEA 4V28A 3BAYA 1E4LA 2E9LA 3J7HA 1OINA 1OD0A 4S3JA 1E9LA 1X1NA 4ML4A 4UFIA 1XD0A 1GOOA 2X2JA 1LJYA 3W53A 3THCA 2G41A 1NM9A 2WSKA 2YOCA 4W5UA 4J27A 3O6AA 3RM4A 3WY4A 1J01A 2OWCA 1C8YA 3ZT5A 2OWXA 4U31A
chains in the Genus database with same CATH superfamily
4CCCA 4ADUA 2X1QA 3ETBJ 2X9WA 5HDBE 1BKHA 3TXZA 2VDNL 3K72B 4N6RA 3QI9D 2DLFL 3TYUA 1KTNA 2BRRH 4Q4SA 3QZEA 1AFVL 3E2RA 3KLLA 1CE6A 1P7TA 3DARA 3NIGE 3G22A 2EH8L 2DB8A 1XFCA 3CL6A 2AL1A 1UA3A 4G6AD 3OKOB 5CBAA 1AZCA 1JXKA 3R2GA 5B39A 2F53B 3GX9A 1CMOA 4ZMTA 1OAXL 2PP0A 2ICWI 4MRBA 2OXHB 1CE1L 3EG9B 4F7PB 3DENA 1V6UA 1SFHA 4X80L 3P6LA 1F3RB 5MEPA 3VD2A 5IT2L 3WL0A 4UM8B 3D34A 3UY7A 3MHZA 3UOAB 3MKGA 4LHQB 1EDQA 4WNSA 1LGVA 2XH0A 1X6UA 3AUVA 3VU1A 5D1ZC 3HC4L 3K46A 4G80B 4UT9A 1EDGA 3U9UB 3T1FB 3FJNA 3OGRA 4LCVA 4WI0B 3UXAA 4WI7A 1WHPA 5BOPA 1PYFA 4GQPH 4JFZH 3P11L 1VBGA 3DV6B 5CBEB 4TQEL 4GC4A 5E2VL 3G04A 1NEPA 4JGNA 2P8BA 3RWJB 5HMFA 4F2EA 3EA3A 3ZKMD 5XIMA 4LSVL 3IDGB 1E8YA 1EJXC 2DWYA 1GHRA 1R3IH 4NVTA 1NDYA 2GJJA 5IBXA 4UFKA 2V2HA 3BG9A 4RMVA 1X7QB 2QDDA 4L3FA 4NENB 2BERA 3V5KA 1GQNA 1BIIA 1Z89A 4G9FE 3QMSA 1QI4A 3CUJA 3QMTA 2GGHA 4MAYB 3UVIA 4H8WH 4QRPD 1MZHA 4ZUVB 3NCWA 4Z3IA 3ULUL 2QPEB 4A7UA 4L18A 1FYHB 4OJEH 4KFNA 1H7WA 3FYIB 4PJDE 3MRCB 1JYNA 2OZ8A 3CFQA 3U48A 1KGCE 3QC0A 4ZQKA 4JQAA 1W1PA 3C6CA 2JIWA 1X1ZA 1KLUA 1IFRA 1PTGA 4ZDHB 1FZJA 5D1XA 1VFBB 4PD4J 4PJEF 5CZ0A 4R2GC 3B4NA 3ZLQC 4BRJA 4ZTOL 1XIMA 4GSQA 5DEFB 1ZK9A 1ODUA 4WU7B 2WMKA 1TZGH 3UJSA 5I1HL 1B57A 4XWOC 5DJ2A 4A4AA 4M1GH 5JHDD 2G37A 2J44A 3PPHA 2EDKA 3CIQA 2WBXA 4PG2C 3Q45A 3SDDA 3D85B 2AGKA 3GTIA 4FR1A 4M0XA 3LS4H 4XHJD 3WL9B 3TBVB 3LN4A 3IV8A 3THUA 3I6GB 1Z6KA 4JS7A 2QADC 3NXFA 5K4ZA 1IGCH 3L3KA 4AD0A 3QV6A 1INEH 3OHIA 3GUTB 3QISA 1M71A 3D52A 3ORWA 3B37A 3CM4A 3ZN6A 2EJAA 5HBFA 3VA2C 2OTUA 4MRCA 5DQJA 3KYAA 1XCXA 3UX9B 5ALCL 2Z31C 4Z3EA 3MV8E 1CXFA 4ES8A 2GBVA 3RGVD 1G1OA 3P5YA 3W3BA 3N91A 2HG0A 1R3YA 2MUCA 3UT0A 3N2XA 4HOWA 4LCCB 3TONA 4OZIB 1XLMA 4FE9A 5DD6A 3CSTA 2I5GA 3W83A 4QCIB 4H2HA 2R0ZH 1VZWA 5BZWB 2JQAA 4FS0A 2WNXA 4GUQA 3RL1B 3KE0A 1OVZA 3ZE1B 2PABA 1YEIH 1PDZA 3BW4A 3U2IA 4Q8NA 1L9NA 1MCQA 3NA8A 3CFJA 3LI1A 2CJTA 1ET5A 3ABZA 3BKCH 1XIEA 4QM1A 4BF7A 2YGQA 3LIZL 3TA4D 1NFDA 4HCIA 3UGRA 2YO3A 1CBJA 2NQ9A 3E9UA 5CJ8A 4OM1L 4F3HA 3KRUA 1MVYA 3OGCB 1ZT7A 5DRXA 3W7EA 5BNKA 4XI5D 3UTOA 4OLWL 6REQB 4FOKA 1JZ6A 3TJXA 4PJ8C 1UYQA 2YBTA 1MWAH 5E6IA 1D8CA 3WTTA 3AABA 3SQBB 3LS9A 3T4AB 4HJTA 2NTFB 1BGAA 3RWIA 3V0DA 2EO7A 4LFHG 1EA0A 3QUMB 5TDNA 3AADB 5D2LF 1YEJH 4PLNC 3WD1A 3TFBA 4O58H 2XN9D 1VPOH 3IKCB 1YPFA 3TOYA 4HUXA 1POKA 1KCSH 2V5MA 3N4EA 1JGLH 4H8NA 4M80A 4A2EA 1AD0A 4DJEC 2BHUA 4OKDA 1QPOA 2FTPA 3C0SA 4Z7UE 4Z17A 1RP9A 3KPRD 2OEMA 3IDNA 4F15B 3E0WA 4KEUA 1NGXB 3DV4B 3U9PL 4WV1B 2A9AA 3UH8A 3O3AB 2AQNA 5F3BB 2Z91A 3QO0A 4OFPA 3RAOA 1WUNT 1TTFA 2A83B 1S7XB 3LV3A 5DCDA 5AKRA 3WJMA 2PW1A 2ZWLT 4Y2DC 3QV7A 1SRDA 1L8NA 3ULUC 2HVNA 2EICA 1XS2A 4NHUB 1A6WL 3HC3L 5C9UA 2XXMB 4QLLA 3AIRA 3SOBL 3EMZA 3S97C 2VXQL 3OKOA 4QP0A 3WEXA 3VE0B 1W1ZA 2F53A 3FQ4A 4PRHD 4C56B 4JN1H 1XIBA 2OSYA 3KZSA 3EG9A 4F7PA 4PGCB 5D32A 3F7RA 5GSRB 4ABUA 2DQMA 1G5GA 5LIUX 5DJXB 1OCRB 3K0YA 1MJUL 3U1QA 1ZIBA 3NFUA 2GPZA 3GB6A 1S7TB 1T1WB 5B3JF 1ACYL 1ECYA 4LESA 2NLYA 3TEYA 2A38A 3EOTL 1IF2A 3FO0L 1B2WL 1GAFH 4YDJB 2K9UA 3PTQA 1ZJAA 4ZTEA 1QWGA 4QE5A 4NY2A 4NLAA 1T6BX 4G80A 2ZVRA 2OEJA 3DOPA 1CXHA 3T1FA 1O1ZA 1WZ1L 4DK6A 1WYJA 1R38A 3I9PA 1T3FB 2QVMA 5J1SC 1GIGH 4HT1L 3VXRD 3KLDA 3IGAB 1P48A 3PPGA 4J2QA 3W24A 1IEAB 2AEPL 3D48R 1M2VA 1WIPA 3VNLA 3C2RA 3FOLB 1HUVA 3DV6A 5CBEA 3OG4B 3W73A 3L17A 2WKJA 5I1GL 4NFDA 5AKTA 1SLWA 3RWJA 3URQA 5IWLA 1E6PA 3TWCH 3BGAA 1J1XL 2D8KA 3SCVA 1IM9B 2F8XC 4TMBA 3FONA 5D03A 1W8SA 4PJFE 3MOAL 3S35H 3RURA 4Q33A 1QO2A 1ANUA 3VFNB 1X1OA 3NQCA 1A5FL 1QACA 2DQ6A 4PJBB 4MAYA 2MNJB 4PWJA 4ZUVA 4UTAL 3DX8A 1OOWA 5DK0B 4CCEA 3GIVA 2HT3C 5D7KD 5LIXX 4FFWC 4H20H 4I9AA 5FYJE 5EU7E 3WLRA 3T6QC 2FATH 4LEQA 2E27H 1WFJA 3O9WC 4IOFD 2F7FA 4JKLA 1HOCB 2D7QA 1FWTA 1JZGA 1XIFA 3VXME 1WNOA 4Z1DA 1VFBA 3ZLFA 4QTIL 1NGQH 3D0VA 4TOYL 4L8SA 4EI0A 3ILPA 1O9ZA 1AGEB 2Z35A 4KH9A 3DN5A 4O1FA 5DEFA 5ACMA 4N2EA 4WU7A 4H8PA 1ZJHA 4MXQC 1KCRL 1Z5HA 1JRBA 3UW6A 2X4SA 4KZDH 2ZXGA 5TGBB 5J3HC 3O4LE 4KW2A 3FW6A 4NJJA 5HJ3B 3WL9A 3TBVA 1QFOA 1MN4A 3AG1B 3I6GA 2Y2YA 1A1NB 1DJIA 3GHSA 2IAMD 4O54A 2B1HH 1OD9A 4U4MA 15C8L 1UM5L 1ADOA 3L9EA 4AQ8C 3S37X 3AIVA 4X5WA 1TCRA 2E7BA 2B7OA 1R47A 4BFAA 2Y0FA 1KLGB 4ILDA 5HHPA 5I1AB 1RD6A 1UGNA 3MRMB 3AAMA 1K6WA 2Y7SA 3WQFA 2VR6A 2J6VA 4Y5YC 3ARDD 2ADGB 2GITA 2GUOA 4HJSA 1IIKA 2DRUA 4KKLD 1FYTB 1MREH 3C60D 4LCCA 1RJZB 3GM0A 3RFZB 1GQIA 3QIBA 1I9RH 3MVIA 1YAIA 1QTSA 2AQTA 4QCIA 5BZWA 4Q56A 1JTTA 3RL1A 3UBPC 2R23A 1SVCP 1ZP4A 1GQKA 1BMWA 1B4LA 1R3JB 4AEEA 2UXGA 3DFYA 1LNUB 1IQ8A 1AOZA 3UR5A 5LBGA 4XZMX 4M5PA 1F02I 3UJJL 1PTDA 2IWGA 1T4KB 3BRDA 4BI7A 2G9HA 2ZUUA 3S6OA 5AW6B 1IBBA 4LGSB 3OGCA 3V4VB 2RJHA 1XF2B 5LUMA 1L3WA 3WG6A 2VJ8A 4EXPX 5CU9A 6REQA 3WN6A 3L21A 4NJKA 3NJKA 5IF0B 3RZCB 1VGEL 3TCXA 4UU9B 1FNSL 1L6WA 3T2NH 1FDYA 1Q1PA 2EEFA 3SQBA 2WZEA 4FQXA 4XNUL 3T4AA 1EFZA 4K8HA 3VFOB 4NQCB 3O3RA 4JOMA 1UB6B 2X1RA 1DYSA 5C6WH 3RBGA 3PC0A 2GTQA 3ABRA 1SDAB 3M64A 2WXOA 2YW4A 4NZTH 3KHJA 2CXEA 3N85L 2VDKB 1IUZA 3FB6B 4XVTL 1L9TA 3AHXA 3QTPA 1KZQA 2WOQA 3G6JB 3K8KA 1TTBA 4AX7A 3P2TA 3SDCD 1R5WA 2ACUA 4E9VA 2G4GA 1NFIA 3KNBB 3VJ6A 1GGOA 4NRYB 2NDGA 4DFHA 4IXXA 3DV4A 4N9EA 2WZ0A 4QJ5B 1JCTA 4WV1A 3O3AA 4PY8I 1XGUA 4IP4A 5EPDA 3WIFB 5DR5H 2A83A 5SX5K 1E5NA 4HSCX 3QXBA 2MTAA 2L7QA 2D4DA 3WN5B 1DDHB 4HF5L 5H4ZA 3RIKA 5FX3A 4TRPL 3RPDA 4NHUA 3SO7A 4PU2A 2VXSH 4BM7A 1C29A 3R7MA 3TYGH 1AO7B 3LB0A 2Q09A 2ALAA 5EY5A 2GQAA 4B15A 1O60A 4GYFA 1DWIM 1G7MB 3CMOL 5I5RA 3W88A 1MCPH 4C56A 4OFDA 1UG9A 4PCPA 4PGCA 5GSRA 1VPYA 3DDGA 5DJXA 5JH1A 3IRSA 4YDZA 3H9SB 2YCKX 1T1WA 5F9OL 5GNYA 1F90H 1NVMA 1O7DE 1B3YA 3PDOA 4XNDA 1WBYA 1Y18B 4YDJA 4M7KL 2JEQA 3CN2A 1AR2A 4WJXA 1DVFD 5D2XA 3MROB 4ANWA 1GONA 5REQB 1T21B 1YUHB 4W9JC 1K72A 3QULB 1I53A 5DQPA 4HNOA 1EERB 1W80A 4LB3A 4DGYL 4L65A 1O75A 3MUZ1 5CD5D 3ECBB 5GGVY 1IEAA 1E6JL 4YDMA 4A2GA 5D8JL 1I4NA 3CNKA 4ZOAA 5KSUB 2AJXL 1ZLWK 3FJTA 3IFOB 3W57A 3VTRA 5CEXB 1JF1B 2NX1A 2PGRA 4G9DB 2YZ5A 3L3IB 5MKGB 3L45A 3CCHB 2J7EA 1W6TA 4KUCD 1IM9A 3L4TA 3EXRA 1IAII 4C1KA 4Z2GA 3CUPA 3LZPA 1LE5A 1RLCL 3WS6C 4FAMA 5E6SB 3HC4H 3NQGA 3VFNA 4TUUA 3EDDA 4N85A 4KXBA 1ISYA 2GI7A 3D0LA 4PJBA 3W7KA 3KTSA 4FNTA 4RDQG 3LG3A 4OT7A 4P5TD 3NSCA 3L23A 4I5XA 3SW6A 4O9HL 5DK0A 5CUSH 4L3AA 3MAWA 4DN3L 1GGUA 3EYOB 4I3RH 5J7CC 3SJ3A 1J1PH 3NK3A 4FQCL 2DQTL 1XIWB 4KVPA 4HYWA 2R2EB 4FEMA 1HOCA 3B8IA 1KO0A 2PWGA 1FVDB 3UAFA 1DWFM 4MMYA 3W86A 3VWKB 4D2JA 5HR7A 5C7VA 5IROC 3SPHA 3VOIA 1JZHA 3UBXI 1W9UA 2DSVA 3LQGA 1O7VA 3UZJA 4K71C 1MFCH 1EJVC 1QSFD 3MDUA 3OP2A 5DMJB 1CBVH 2IANB 2AC0A 4PJIB 4DGIH 3QDGE 1XGYL 1DLHB 2MOVA 5I66B 4O2CB 4XP4H 1OBAA 1DN2A 1HC1A 4YXLL 5KYYB 1A1NA 4NN7C 4KHXH 3IFLH 5C0GA 3QUXB 3DX1A 1TYJA 3LNDA 1YDNA 4C6MA 4J3VA 1R0AH 3BV4A 3AROA 2BPBA 1DN0B 1MCHA 4PV1C 1CR9L 3G5ZA 2O4EA 4H2CA 2P50A 5LYRA 5I1AA 2MANA 4UFLA 4ZTOH 1HP5A 1BQLH 2ZOKB 2ADGA 1MCFA 4H0LC 1FYTA 3HNTL 1GHFL 1RJZA 3SUSA 4RL3A 2XWRA 5FJRA 3GDBA 5D2TA 4F66A 3S2AA 3IJYB 1OX5A 1PFOA 3MGTB 5DUBB 5D9PA 4FG0A 3RWDB 4RBPK 2BRRL 3D12B 1R3JA 2PWHA 4TTGA 4G6MH 1PZCA 2CK0H 4AE0A 5FL1A 1LNUA 3BUBA 2HEJA 1JZDC 3TF4A 2VABB 1LYXA 5FEZA 1J9RA 5AB9A 1GVOA 5I02A 1E4NA 4BKTC 1LTXA 5E2UH 4RNFA 4MNGA 3FHAA 1MCOH 3V4VA 1EQWA 5KYWB 4HLZH 2XIJA 1NPJA 1XLHA 4JTUA 4H4IA 5KSBA 3AIUA 2YARA 3ARBC 4UU9A 3ZIZA 3CE1A 2G0LA 3B06A 4XBKA 2E9MA 1VEPA 5KN5B 3VFOA 4Z7OF 1E70M 3ZTJH 1G67A 3Q8AA 3Q58A 1MHHA 3SKOB 1UB6A 1PB0A 1LJYA 5HDBF 4AKQA 4MJ6B 5E6RB 3CFIC 2GG1A 4H1LH 4JFZL 2CLFA 3CDZB 4C55A 2NOYA 3FB6A 3NIGF 4F9PC 3FU8A 4WD0A 4Z18A 5CPMA 3E0GA 4ANXA 1KW1A 2PURA 5GRUH 4OFQA 1WO2A 4NQEB 2NNXA 3F2LA 4OLWH 1WUZA 4APQB 1AD4A 3OGOE 2PCYA 4XX1E 4Q4RA 1RZFH 3TPKA 4NRYA 2Y3AA 4NQXB 1R3IL 1IXPA 1WAUA 2JXMB 2HT4D 5IHHA 1UBPC 1JD7A 4UILH 2ZZ5A 4XVEA 3WIFA 4HCRA 2EE9A 4ZW6A 5DBTA 1T7YA 3VYNA 4MCMA 3QWOA 3WDIA 2XWTA 2YMXH 4C6KA 3WN5A 3AREB 1E28B 4S38A 4FQJH 3SO3B 2ZDSA 3ZFHA 4AM0B 1Y5VA 3ERXA 1EO7A 2VD9A 4M6OH 3I75B 1W0WA 5IVNA 3C52A 1G7MA 2FVNA 4FQIH 1QHZA 1G4EA 3ITVA 4HETA 4L5FE 1PD1A 4FFYA 2V2DA 5A40E 1ZJBA 3AALA 5DTFB 4NX0A 1U3ZA 5EF1A 3TYEA 5G4MA 4CKVX 1EGMA 5D7SH 4K3HA 1FP5A 4MJIE 4NRZB 4PWKA 2PP3A 1TZGL 1XXXA 4Y5VB 4M1GL 4N25A 2YCEA 4UQAA 3RPIB 4GZJA 3EGSB 2R4RH 3ZUCA 4LLWB 3MROA 2XXCB 1FE8H 5REQA 1T21A 4QF1B 4D0BA 4HH9B 3IK4A 3LS4L 1RY7B 3EPNA 4UTLA 5C0AE 1EBGA 2D4FA 1CBGA 3CLFH 1U8JB 3R7RA 4L7ZA 1IGCL 2NMSA 1INEL 4KFMA 3PJWA 4KK9D 1MEWA 4PJDF 1PX8A 4JQVA 1JF1A 4R5XA 4MB5A 4G9DA 2K0RA 3KVDD 4M6PA 2BNQE 3BAIA 3L3IA 4X98A 2GYSA 2I9EA 1BWKA 3BUVA 3E96A 2ZYHA 3MSDA 2Y5EA 2V37A 1XHHA 3ARUA 1SPQA 3VILA 1B2WH 2B9BA 3VWJD 4ZB2A 2Y72A 1T8QA 2VFDA 4F79A 4BFGA 1W5QA 3FUNA 1BVKB 1E4JA 4U2ZA 5F1IA 3LEYH 2R0ZL 1QOXA 4KMTH 3AXMA 4BELD 1YEIL 4OF3A 3HTLX 2PWFA 3Q43A 4G70B 1BGXH 5DVLA 1J5SA 1TUXA 3BKCL 5TQ2H 5JMRA 2AJYL 2XM1A 1O7SA 2BWDA 5DT1H 3H4GA 3EYOA 5I1GH 2YEZB 5FYKE 1LDCA 3QFDA 1XIWA 3O6FD 2R2EA 4UNTA 1FVDA 1NDZA 4L1TA 1SSDA 3W25A 5L7XH 2GWGA 3AHZA 1WX0A 4P4RB 3VWKA 1W9DM 9XIMA 2QJNA 2ZG1A 5C0CE 4BXSV 2PYEE 1MWAL 1B3XA 3BPCB 2QDVA 2CRIA 3VG9B 4U1LB 4PJIA 2C34A 3CZEA 4CILA 1YEJL 2R2BB 3QJQB 1GVRA 2XPGB 4O58L 1VPOL 3B3IB 4GIRA 1CICB 3DDFA 1KCSL 4KRPB 1W9VA 1RULH 1EDHA 2J8FA 1JGLL 3IIOA 5I3JA 3F7QA 3QUXA 1WD9A 1F41A 2VGIA 1CZ1A 4IMFA 5DC2A 4PR5B 1DN0A 5EOTB 5T3ZH 1QW8A 4DBEA 1MI5E 1JERA 1AH3A 4WEMB 1NEZG 3W1MA 2FGLA 5K33A 4XNQB 3MJ6A 1KPUA 4DLFA 2ZOKA 4AG4H 2XPZA 1GMEA 4YFDB 3NR0A 4P2QE 4DP0X 3W84A 1UOWA 3T3PF 4YHYB 4H8WC 4RGND 3M0JA 5IW6A 1TMHA 4EF3A 5KSAB 1M4KA 3EO0B 2J55A 3Q2NA 3IJYA 1GZ1A 2E47A 2QCFA 1H2JA 3RWDA 1WT5A 3UWZA 4FTDA 1XLEA 3WIAA 4HZ6A 4Y1SA 1S7RA 5F2FA 1I4FB 2P5EB 1JS4A 3LU2A 4DVRH 4EUPG 1TPUA 2ZNWA 3IGHX 3DVNB 4IBQA 1TJ1A 1THAA 3VD0A 4JN1L 4UMCA 5SX4H 3RIFK 3GHUA 2Y1AA 4XODA 1DIKA 4B27A 1KPRB 5KYWA 4Z7UF 1S7SB 5HMDA 2MNWA 3OZMA 3RX7A 1LYQA 2DT2A 1TZOA 2KPNA 4ZFFB 3PNZA 4B3ZA 2VDIA 32C2B 3HZKA 5EZJB 1G84A 3DDMA 4R7WA 1NU5A 5T1MB 1GAFL 4E9TA 2DY3A 4YDVB 1ELSA 3DX7A 4A8RA 1M7UA 1VA9A 1CYXA 3WJXA 4MJ6A 2AQWA 1YYAA 1GIGL 3BGMA 1HDMB 3AB0B 5IVXB 2HNHA 5M95B 2WBWB 2HB0A 4I6KA 1QQDB 1XTMA 3DMMD 4FADA 1NUNB 4LDLB 3SCNA 4OD3H 4YIWA 5A8NA 2WNWA 4KRNA 4NQEA 2DQEH 4APQA 5TK4A 3Q9QA 4PRBA 3IB4A 3KTXA 3TWCL 4BJLA 1E8ZA 2EEAA 5G4NA 5I19H 5CP3A 3N55A 3MC5A 3O0RH 2CPUA 4BS0A 4QCEA 1VRDA 3S35L 4AX3A 1FPTH 4JVPA 4B9YA 4EXKA 3BW2A 3G3MA 2E7LC 3QQ9C 1SJMA 1UJTA 1F4WH 2Z2BA 4M6MH 3AREA 4GLRH 1TZHB 4EBQH 1CK0H 1AW2A 4EE9A 4AM0A 2WLLB 1KFBA 3I75A 4H20L 4KRTA 1EF2A 3WFLA 1CDCA 2FATL 2GJ6E 2NSQA 2E27L 2IXVA 1UT1A 3FB5A 4OCYH 4ENEC 1J1OH 5DTFA 3W7HA 1NGQL 3ARFC 3POCA 4DZIA 4K68A 4HX1B 1ZHAA 4NRZA 4OIBA 4DAGH 1J5IA 4KI5E 2NXYD 3FK4A 5IQOA 4HF5H 1EWHA 3RPIA 4PJFF 3EGSA 1NC2A 1E0OB 3ESVF 4KZDL 4A22A 4YSTA 2GEQA 2Y5QA 4QF1A 1MQPA 4HH9A 3DFNA 1RHFA 2XBDA 4MY1A 2ZZ6A 1D3CA 3L3HA 4Q2ZB 1FNLA 4MX7B 2CZFA 5E5LA 4YPGB 2GHZA 2B1HL 3R4RA 2L7EA 2B59B 3BQUB 1ZSDA 2VXVH 3R58A 1FL3B 3W2JA 1HU8A 3QHOA 3W28A 2XIDA 2P0OA 1E51A 4HS3B 2IV9A 5D1QA 2V5BA 2INEA 1HJVA 3IMUA 4H44C 2YS4A 2WLYA 3BYYA 1HL4A 1ESWA 1O9VA 1OCJA 2BDQA 5IUSA 3PQYD 3F2DA 4Q97A 1QATA 2Q6WA 4PRIB 4QHUB 3AISA 2RHGA 3HMJG 1I9RL 1I1AC 1BVKA 3AIBA 3SY0A 4PEKA 5ABEA 3VX0A 1E6NA 1GTFA 1SZFA 4GHRA 2PPGA 2TSAA 1W8OA 5I0VA 4JG0H 3DUHA 4BUHA 3CHPA 5FGCE 1TQCB 5IBLD 2AJXH 1JJUA 3DTUB 2YEZA 5FUOH 4B4HA 3DEQA 1BG4A 2ESCA 5C3TA 1WVZA 1XZWA 1GGBH 4F27A 3QF0A 4LLUB 4P2RE 1G7PA 1PGRB 4IRJB 1JZ3A 1U8HB 3W7GA 4P4RA 4QXVA 4EZMA 5HI5C 1U92A 4MLRA 3CXHJ 1SQMA 4ENZA 1J8HD 3T2NL 1GS8A 2Q8ZA 5F1VA 2ZX6A 5D05A 4NZJA 2PN5A 1I45A 3REWB 3GTVA 3NJLA 4YWGH 3L1FA 3P4NB 3FCGA 4ICCX 2FBRA 3BPCA 5IGXH 4U1LA 3TZVD 3EGXB 3RTQD 3J07A 4JX5A 3LXAA 2R2BA 1T5WB 3WKYA 2XPGA 3B3IA 3FJ4A 3FU7B 1YDOA 3BFQG 4NZTL 4XNZC 3D87B 3G0SA 4JTGA 3GC3A 4KOBA 3ZHFA 3MNDA 5C09B 3Q8BA 4AIUA 1SDYA 4JO8A 3POHA 2HXAA 3MP5A 4U0RC 4PR5A 4Y4KC 5EOTA 3DU0A 2OZ4A 2WXQA 2SEBA 3VI4E 2X89D 3WKPA 4XNQA 4WY0F 1AH4A 4ERSH 2EDHA 3MCYA 1GC1H 5DR5L 5JW3H 1HKJA 5LSMA 1KPVB 2COQA 3ITOA 5KSAA 3EO0A 4PV9A 1JZ2A 4JYDA 1EWEA 4DWSC 2XJLA 2WIIA 4H9UA 2VXSL 3TYGL 1IC7H 4QUOA 3WFHA 1P1MA 2P5EA 4TVPD 3R0NA 4GAFB 3TTOA 4GRWE 3PABA 3OTTA 3MRGB 1IKNA 1A4AA 1Q9LB 2P8CA 3DVNA 4MTMA 1MCPL 3G77A 4ESKA 1XC4A 4X6DE 4XX5A 5E0FA 1UXMA 1TQXA 1AR1C 1EVUA 4QISA 3OXRA 5DVPA 5A8GA 2CK2A 4DF2A 4NZUH 1N6UA 4ZFFA 3P69A 5EO1B 3E6HB 1RJRA 2ODIA 32C2A 5LA1A 1F90L 4Y9MA 5AVNA 1OE1A 2B5IB 4KWVA 2AQPA 1QNPA 4WHDA 1KV7A 4YDVA 2X4PB 3G2GA 4OJYA 2GUUA 5ISZD 3EOSA 2H8XA 5C9JB 3SKJH 3EZ4A 1B3WA 5CIPB 4FQ1H 4GH1A 5LKYA 5AOUA 2Z7GA 3P3BA 2OR2A 1KLYA 3RLGA 1HDMA 3BDYH 3SSZA 3VCNA 4LKCB 5DK3A 4ZFMA 1QQDA 1AI1H 2NTSP 4NKQB 2ZONA 4HA4A 1BF8A 5AYTA 4UQDA 4BI6A 4XN1A 2EKSA 4QRRE 1YNTF 1BP3B 1YECH 5MENB 5FYJL 4JKMA 1H41A 3O0LA 5ACZA 1KG0B 4U3SA 4GNKB 3CQ0A 1L0PA 1QOQA 4MUPA 5IB5B 5C07D 1UD8A 3GR7A 1C7SA 1EUNA 4W6WB 5FYLD 2I24N 1M9HA 4MAZA 2V8ZA 4NUGH 2TMDA 3IDMB 4C7GA 1ADQA 3VIPA 2B4CH 3L95B 4LOVA 3QIUB 4HK0B 1HN1A 5DJZB 4GPVA 4BSVB 1GXEA 5CUSL 4Z1BA 2VDQH 1Z9SA 2UY2A 2ZZ1A 4I3RL 2VM3A 4JKWA 1J1PL 4NB7A 2GVYA 4D9RE 4NKDA 4Q9RH 5C7XH 3M5YA 4M48H 2D7TH 3ZW3A 2VC6A 3LSOB 5EIIB 3AXLB 2R4SH 4GVGA 3X1EA 3DWTA 1UKTA 5B22A 3LHVA 4D7PA 1MCWW 1OTSD 2QSTA 2Z92A 1X7FA 3LY0A 1A6PA 1TNNA 2H9GA 5EU3B 1MFCL 2D0HA 5I8KH 4F24A 3MJ8B 3CBWA 1U8NB 1CBVL 2GJXA 2Y7NA 4YVXA 4DGIL 1NGYB 3QPYA 1J87A 4N8VG 4XP4L 2Y69B 1OF0A 2C16A 1FKWA 4HTYA 3VOCA 3CO4A 1EVTC 4Q9CA 4YPGA 4KHXL 3IFLL 2B59A 3BQUA 1J0KA 4WW2F 1EPFA 3FT3B 4LKXA 1R0AL 4JHBA 4HS3A 5EUOE 3HPZA 1VFSA 2YPKB 3NEEA 4XZUA 2RDWA 3LEVH 3LLDA 4QXUH 1Z48A 3OF6D 3NEOA 1BQLL 1CD1B 2GJPA 4BGDA 1KV5A 4HEPG 1CNVA 4OLZH 1JFQH 1K3UA 1KTJA 1GOIA 1SOSA 4PRIA 4QHUA 4XB3A 3T0WA 3AVEA 4W9CC 1UH3A 3X17A 2EILB 2DU2A 1ITUA 4PB4A 2FO4B 3LENA 1PX4A 1TSHA 1MG2C 4DGUA 3VA8A 4JZ5A 1FF5A 1AKJD 3VI2A 4G6ML 1WAPA 2CK0L 1GKPA 5GRZA 5U4NA 5B4MD 2IPGA 2DW7A 1H49A 4JX4A 2HKFH 5BZAA 1GS6X 2YMOA 4QO1B 1LWJA 3MRHB 2DN7A 2EE2A 3DKJA 1RUSA 3NDYA 1I8IA 3MI3A 5E2UL 1VPXA 3PP3H 1OC5A 1MCOL 5E9DD 3HEIB 3NO5A 1F86A 3MP4A 1F3JA 2FHFA 4LLUA 3DIPA 3BSZL 4IRJA 3D4YA 3X3GH 4B7LA 3PG9A 5D4IA 5CC5A 3ROLA 3M41A 1V0NA 4MWAA 2D23A 4M7ZB 1M7OA 3AHYA 1P7QB 1V5XA 5DHVB 4ZE5A 4AIZA 1UG6A 1NEUA 1FO0H 1TNMA 3W2KA 4D8OA 1I31A 4P7NA 3RKPA 3P4NA 4NUMA 1CDGA 1F76A 3NIDE 2MNRA 4ACZB 5LNGA 2K1MA 1IBGH 3M44A 3EGXA 4GAAA 3BJTA 4A2SA 5IV2B 3JV5A 4LCIH 3KHQA 1T5WA 5AKSA 2FTAA 2WXRA 2AJYH 3E2SA 3WEMA 4F8PA 1XGDA 1X5HA 4DHLA 3VUPA 3OC5A 4ADIA 5A3ID 1QDSA 4S3GA 5BJTB 3HQOA 2RHEA 5HHMD 1HJWA 5EU7C 1IGYB 3E2HB 1ND0B 2VDMB 5GRUL 3T71A 1P5UB 2B8OT 2A0LC 2B0SH 2F6UA 1WDWA 2BNUB 4O12A 3INUH 3W2UA 2HROA 1RZFL 2LFGA 4AGLA 4XMXA 1YVLA 1SGJA 4YIQB 2EXYC 5CEZD 2KLRA 4AW4A 1U21A 1YCSA 4UILL 5DRWB 3QC6X 4Y9CA 2WHJA 3KPSB 1E6RA 4KIRA 4AWTA 3DBSA 1PZBA 1KV8A 1I1RA 3WQ5A 2YMXL 4FZEH 3K2UH 4L1GA 4KEZA 2PMZA 1SM9A 4ATWA 4FQJL 1TPDA 2ZCZA 4LY8A 2J8TA 1Q7MA 1XG4A 2CALA 4TLTA 2FJKA 8XIMA 3PUDA 1EFQA 1QTYT 3PM6A 2G3ZA 4M6OL 3GO1H 1Q9LA 4IIZA 4FQIL 2DMBA 5K69A 3PK7A 3THCA 1TQBC 2FJGB 4IMEA 3O6AA 3G1AA 4L37B 3N9RA 4C60A 2OWXA 1ZWIA 4U31A 3CFMA 2Y61A 2Y7EA 4PGZA 2WLHA 1YMYA 5D7SL 1GHSA 5EO1A 3BJSA 1A25A 3E6HA 2HMIC 4LF2A 4FOJA 3WI9A 4FHAA 3IE9A 3K72A 3O45B 4Z1PA 5FGBC 1HWWA 2VITB 4PJ7B 2CW6A 2R4RL 2POZA 3U4KA 4CQ8A 5C9JA 1Q6FA 1R7AA 1FE8L 5CIPA 4F48A 4HP5A 3V7AE 1I85C 1DVSA 3CLFL 3QSTA 4CD4A 1BFTA 5BS0E 4OU3A 2H41A 1WISA 1AGBB 1DL3A 1E5CA 4LFHD 2OXHA 2BMKB 4DY1A 4A67A 5HD8C 4CD6A 5MENA 4Q8MA 4E3VA 4UM8A 3WE6B 5FR3A 4X60A 2WPBA 2WN3A 1H1YA 2Q71A 2F8IA 4B90A 1F45A 1BVLB 1S9YB 4AW7A 2OU4A 1JAKA 4U3XA 3UWWA 3RUGB 4AZIA 1TV5A 3U9UA 3LEYL 3IDMA 4KMTL 2P5WB 4WI0A 2F1AA 3L95A 3QIUA 4HK0A 5JIWA 1P0DA 2JI1A 1DUYB 1O6TA 2J47A 1FWAC 5DJZA 4MCNA 1BGXL 4JRYD 2PDBA 1ZVHA 5TQ2L 1RQEA 4QG8A 1WDPA 4MAUH 5DT1L 5GZNC 2HH0H 5C1MB 2CO3A 2WJ7A 2DJMA 3DIFB 2WY3B 1HSAB 4BKSC 3RI5F 2M2DA 4MMWA 3IDGA 4HZLB 4QWWC 4DNMA 4UBDC 5L7XL 5EIIA 3AXLA 3V5CA 2QSVA 1X7QA 4AZCB 2XYBA 4NENA 1KB5B 4LUSB 3WY1A 3I50H 1B90A 3M46A 3O15A 1PD6A 1Y6MR 5IMMB 4PTNA 5KVEE 1OEZW 3MJ8A 3CBRA 5DJ6B 3WNJA 4IGBC 1NGYA 1ODZA 3MKKA 3WD2A 5GZOD 1VKFA 3FYYA 2PPCA 5GJSH 2XG4B 3N04A 4JTSA 3MRCA 3NQKA 1RULL 4LARH 1T7VA 1GTHA 4QRTB 1RUAH 3BD5A 4ADGA 4A39A 4YEFA 5EIQA 3MCNA 1XHGA 4POCA 3FT3A 5EU6D 3LA4A 4L4VB 4ZDHA 1UQYA 1TPC1 3HG2A 5T3ZL 4JAWA 3CDGB 2V0AA 3W85A 2KLSA 1I3RB 2GSJA 3PE9A 3A4WA 3WDPP 4ZNEA 1CDJA 4GMSH 2OQHA 2HISA 4ZUSB 1XBRA 3TO4B 3S8FB 4AG4L 2JKRM 3C4UA 3FEQA 2VELA 3TC3A 4AVJA 2WO2B 3QCVH 3KFTA 1O5RA 3CFDB 4HULB 1E1EA 2CJ3A 3D85A 2EPMX 2YD1A 2FO4A 4WU5B 3NEXA 2BP0B 1QMLA 2E4FA 1BVZA 2C3WA 3GBNH 2WLKA 3JWOH 1BZQK 1P4UA 3E2VA 1P9MA 4DVRL 4IBZA 5F88B 3GUTA 1Q65A 2QTVA 4GMTH 1PG7X 4KQ3H 4QO1A 1VCFA 3C5JB 4MPKA 5D09A 1QO5A 3GBLA 1UWEH 3I7SA 4F37F 2W5PA 3MVTA 1YEKH 4GIAA 4TNEA 2OMBA 2G5RA 3P0WA 3CHSA 2WUCH 1L9MA 4TTDC 1RSFA 1N8WA 3MZNA 4RCXA 2DVXA 1PVNA 4DQWA 1DUZB 2ERJC 5DHVA 1ZKAA 1IAIH 4OZIA 2WWMD 4U1GB 2QDEA 4XX6A 5DVKA 2YGOA 4IPPA 3DZ1A 4FK9A 2ZYSA 3OZYA 4Y9BA 5I1CH 3BVVA 4ACZA 2OZNA 2TYSA 3CZLA 5JHLA 1AGDB 1ILSA 3KRBA 4LCSA 4E4PA 3A4AA 1M7PA 4PW9A 1KWGA 5CGYD 4ETQB 4J5VA 1I7UB 4WW2C 3O8XB 3LBMA 5BJTA 2ATKB 2NV1A 5AECA 4UZSA 4LB4A 1OAZL 4X4ME 4OD3L 1ND0A 3MNWB 4WFED 2ZZ3A 5BUGA 3DNKA 4WUUD 2MRYA 1ZLEA 1P5UA 2DQEL 4N26A 2BNUA 3HUJB 1TTGA 4Z7VE 3SDAC 3GMOB 3BZGA 1FX6A 4N2CA 5I19L 5G2NA 1LQ0A 4CGTA 3SADA 3AG4B 3K13A 4YIQA 2G3FA 4UMSA 5TK2A 3O0RL 3CC1A 5T9BG 1UKOA 4AD4A 4US6A 3PL6C 2NTFA 3M0VA 5CJNA 4XPBH 3KPSA 1FPTL 3OODA 4W93A 4W8BA 2XVBA 3QUMA 4PCSA 5TAOA 1A7PH 4N28A 4U6VH 1F4WL 3NG5A 3EJQA 4M6ML 2GSHA 2CDFB 3ZR4A 3IKCA 2X2UA 4EBQL 1CK0L 3QY7A 2QLVB 3ATZA 3OMAB 1CDBA 2NXZB 2YZ8A 2CRMA 4CD8A 2V8LA 3PANA 3EH2A 2QCMA 2J8OA 3QZ6A 3CSYB 3VKDA 1N0LB 3U57A 2FJGA 1H3XA 3V79C 1D7BA 4L37A 1JPEA 1J2WA 4OCYL 2C18A 2ENJA 1DQQB 1J1OL 1HKIA 1NGXA 1OK8A 3KW8A 1P4IH 1GY2A 4JG9A 5JIIA 4JG5A 4KJPC 5F3BA 1IHIA 4LVAA 4DAGL 1S7XA 3C5ZD 5DMNA 3F04A 1A21A 3LCIA 2JB5H 2NX5B 3LCYA 3TBBA 2DY2A 3BJ91 2DKMA 3O45A 1UB5B 2VITA 4PJ7A 4XAKD 1QLEB 1A7QH 4HIQA 4ZFOB 1NM4A 1IEVA 2ZUQC 5DXWA 2VW6A 2QCCA 2VR7A 2WANA 3QCTH 1URLA 4A2DA 2APVA 3LCXA 1T96A 4F7CB 3NM1A 4FMFA 4G8FB 3VE0A 2R8WA 4DZ5A 2VXVL 4O4YH 2FJFB 5AW7B 4JFED 1AXIB 1IB5A 3HE6B 5CPSA 3QWNA 3FN3A 2XTLA 1OXYA 4HGXA 4JPSA 3WE6A 3F8UB 4MCYB 5J12C 4R34A 1S7TA 3M16A 1NQ6A 1BVLA 1S9YA 3V4PH 5EA0H 4I1PA 3AS3A 2VTFA 4P07A 5G55A 4X6EB 3RUGA 4TUOB 4LS0A 1OY0A 3II2A 3H7BB 1XCFA 5EMYA 4KI5F 5AVZB 2P5WA 1T3FA 3EMCA 5KVEH 4RDZA 2WZAA 4DESA 1DUYA 3VGAB 3IGAA 4JG0L 3GZ3A 3FOLA 3D0CA 5I7GA 4GE8A 4IIDA 5FFGA 1X4YA 4A3RA 4PRWA 2HE8A 5FUOL 1YXDA 4C6NA 3I7QA 3SR7A 4L8CB 5FYJH 3FUDA 4JD4A 3S8WA 3L7FB 4M1CD 3AQZA 5C6TH 4HZLA 2E5CA 1GGBL 3WSUA 2H6PB 1L3NA 1QASA 4WHBA 2PXYD 3L5WB 1OGAD 4B5NA 4FFVD 4LUSA 3MCOA 7PTDA 2XBZA 2ZUYA 3MOBH 5IMMA 4Z1YA 3A6CH 2VJXA 4ZODA 3QUHA 3L9YA 4YWGL 2NYZA 3IARA 4PTXA 2PP1A 5IGXL 3MXVH 2HN7B 4IBLT 4G5AA 2YLHA 3DXAD 3OYZA 2O0TA 1XUZA 3R25A 5ALBH 3U25A 5ADOH 3JZYA 4YVUA 3N1GC 1E7VA 4ODWB 1TCMA 2AITA 3ITGA 3EBHA 2UWFA 3BT2H 4QRTA 3W7CA 2GI0A 1PCWA 4OLVH 2AXJA 1USQA 2N56A 4L4VA 1TWDA 4WOZA 1UR9A 1I3RA 3GDKA 2VYRE 1V7NH 4N86A 2AJUH 1PWLA 1AGEA 5HDRA 4M6VA 2J7GA 2C13A 5F3HB 2VKWA 4KS0A 5E0CA 3TO4A 4ERSL 2DVUA 1GC1L 4WCYH 1NAKH 5JW3L 3BICA 5JPNB 2A6NA 1J0JA 5DGQA 3AYVA 3NDZA 3FYOA 3CFDA 1OK0A 4LVGA 4W9TA 5TGBA 3UTSD 3X13B 3ZVVA 2BWGA 5ID1B 1M9WA 5IQ7H 5LNSA 3VKBA 3LHPH 2Q86B 4EN3D 4OQVA 4WU5A 5HJ3A 3RITA 3FO9B 2J57A 1WAEA 3VDGA 1IC7L 3PREA 2ABBA 3EOYG 4A1RA 5F88A 3SE4C 4H19A 1E7UA 5C0ND 2BSLA 4GBUA 4DM1A 4K5NA 4MS8C 3VGHA 4Y0GA 3WFEH 3IU4H 1MCNA 3JW7A 1KLGA 4N6EA 4W86A 2HWGA 1K7FA 1G6RH 4CC1A 5CSGA 2XZAH 3L5LA 3MRMA 2OR9H 1DANT 4KGJA 2PTVA 1PCXA 4MKVA 3BE1H 2PTDA 4NP7A 4NZUL 3NIFB 3DBXB 4QLKA 5F9AC 1NSNH 4XZ4A 3RFZA 3RILA 1FN4B 2Y63A 1TDQA 3WLKX 1K8IB 3F00A 4KPHH 1J6OA 2WXFA 1AGDA 3SKJL 5AC4A 4Y5XB 4FQ1L 3QJRB 2BC4B 3FT1A 4ETQA 3WCZA 3PHAA 4Z7IA 2HE5A 3SY5A 3GD6A 1T4KA 1YHTA 3BDYL 5TQLA 6TAAA 1Z5YD 3OAYK 1XISA 4XBPB 2ATKA 1AI1L 1KRAC 4K23H 1IT8A 4HZMA 1KCBA 1KBPA 3S6TA 3MNWA 3D09A 3CVHB 5LAPA 5JHAA 3KRZA 1XF2A 1OSEA 4JBSA 3ZMNA 4O5LH 4QHKJ 3SCMD 3BSZH 1YECL 3IGXA 5BROA 2E6QA 1REIA 4FP1A 3HUJA 3NJVA 3GMOA 5IF0A 3RZCA 4N4QA 4JRXE 4NO3B 2BVYA 5LNVA 1BQKA 3PWUB 4LEEA 4NQCA 4P46B 3CDFA 3VXOB 3SE8H 4B2DD 3HAEG 4B95C 4NUGL 5C0BB 2O6EA 2AV1B 1XT5A 4E9QA 1AC0A 2B4CL 3R1ZA 2JKJA 1EGJA 1NBVL 4LPTA 4MQXD 3CSYA 1PF3A 2VDQL 4JDTH 4PJGB 4WO4B 1ZVNA 3BN9D 1CQYA 2BZDA 1N0LA 3G6JA 1TJIH 3QFGA 4E3TA 2G5WA 4NCDA 4PB0H 3MCLL 2ZD0A 3APMA 3KNBA 1DQQA 4AD2A 4Q9RL 4S39A 5C7XL 4M48L 2D7TL 4BWLA 1K9TA 4NO0D 1ZV2A 2R4SL 3WF4A 2I16A 1QVOB 2F6XA 4AHQA 4QRAA 1U8PB 2ADJB 3HMCA 1TZIB 1GOWA 1ISVA 2NX5A 3HB3D 3QO1B 5A3HA 1UWRA 1XDMA 1IXNA 5I8KL 1DDHA 1UB5A 2P44B 4YSOA 5D9SB 4X8GA 4ETYA 3NQ6A 1AO7A 4R33A 4JGJA 4FXJA 4LL4A 4YK4C 5LO7A 1SY6A 1R3HB 4F7CA 2A6IB 4NQDE 4IUOA 4G8FA 1MHCB 4F8QA 2WWKO 2OLAA 1BVOA 1AQ0A 2FJFA 3HE7D 1FOBA 5IJVB 5LG6A 3P1VA 1GC1C 1KDJA 1BBJB 1VF8A 3H9SA 4MCYA 1HKLH 3LEVL 4L1WA 4QXUL 2I5IA 3WDRA 2XFWA 5I6OA 2Z4GA 2BIHA 4X6EA 1Y18A 3DHUA 1PU0A 5D7LB 5KW9H 4GJIA 4OLZL 3T0EE 1JFQL 4TUOA 1VLWA 4JEGB 3PZGA 1SFTA 3H7BA 4AYID 4GY4A 1YUHA 2LTQB 5G4WA 3QULA 4LC6A 4AIXA 4JFFD 5G2HA 1CFSB 4AZHA 4Y2NA 3ECBA 5EV7A 5CJMA 3LSBA 2EEXA 3MRDB 4GXUM 3MSGA 2VDPH 5KSUA 4UNLA 3B0YA 2J73A 5G4EA 3NL6A 2BS9A 2HKFL 2W61A 3IFOA 1MZRA 5CEXA 1NANH 1BX2B 2XQ0A 4L8CA 1SR0A 2PCEA 4JFDE 1TR9A 4L9LC 5MKGA 2FHCA 5E99H 3CCHA 2P48B 4HJIA 3CU2A 3VGDA 1WFTA 4D9PA 4M1DL 2H6PA 5F96H 4Q8PA 3X3GL 3NESA 5EUOF 3SGEI 2JK5B 1XLGA 5J06A 2LOEA 3FO2B 4W9EC 2ZE3A 4POUB 1WZAA 2BM3A 4IKLA 5EZPA 1F0LA 1X5MA 1FO0L 1T0PB 2WWCA 5FDWB 2XQYA 1H0GA 2Z8VC 3QRGH 4AMXA 4JZJB 1TITA 3BKJH 5I78A 4UNVA 4I5BB 5IW1B 1WC7B 4PODA 1IBGL 3LHAA 5D5MB 1HKWA 4AMWA 1X38A 4LCIL 3EYQC 1DQJB 1CGWA 2VI0A 5J04A 4ODWA 3PHOB 3N41B 4GS7B 4XAYA 1YPZE 1SW7A 4R9XA 3GUGA 4DLMA 1NOLA 4ZGYA 2W0FB 1FY6A 2ESVE 3B9AA 2LFEA 4O53A 1TTAA 2B0SL 1YX1A 2AK4D 3INUL 3G5EA 3DIDA 2QMJA 5F3HA 1BQGA 2NQLA 3MV11 3ILQC 1BVWA 4W7VA 2WMPB 1Y1UA 3JUYA 5CPNA 2QW5A 2B4CC 1WCBB 1Z32X 2DJLA 2MIZA 4FG6D 5JPNA 4HB7A 2IANA 2QJJA 1QZ1A 1DLHA 5I66A 5HDLA 3TFKD 4EPEC 3X13A 4O2CA 4DBUA 4FZEL 5ID1A 5JXAH 4CN1A 3K2UL 2IO5A 2Q86A 5KEZA 3WKNA 3NACH 5IQ9B 4HU3A 3FO9A 3NIDF 1B4KA 3CDYA 2F54E 5KYYA 3FV9A 3QIWD 5K9DA 2E9IA 1M3UA 4N6FA 4YGVB 5HJDA 1KRMA 2DT1A 1KTDB 2HTLD 3GO1L 3BOXA 1GZQB 2YKKA 4W8LA 3AY4C 4NHCL 2FEEL 2BOLA 2OSWA 5BRZE 1A5KC 3JR2A 4ZAKB 4XZ9A 1PQZB 4M8QB 2W4XA 1QFHA 3QS2A 5BO1H 5HJXA 1OB1B 3QDMD 4X6CE 3GMPB 4GXMA 3N1MC 3ME3A 3AAZB 2PDIA 1XBXA 2TODA 1UJ3B 1LT8A 4ZSOB 3OA5A 1K8IA 4PUEA 1A5CA 5HYJD 1TJPA 1A7BA 3MUHL 3D47A 5CKGA 2C26A 3MGTA 5DUBA 4Y5XA 2BC4A 2AXHA 3MXWH 1HZKA 3NYZA 2AFNA 2VABA 3KLSA 4JHVA 4RSVA 5C70A 2WBGA 4L4MA 5AW2B 2R69L 4J1UB 6PCYA 4ZXLA 4XBPA 3KYOB 2EPOA 4WX2A 2X1IA 1OTUC 2DD8H 3CFNA 3CVHA 2CLMA 1WDRA 3OW1A 3UYIA 1OG6A 2W0PA 2RFGA 3KW7A 1TV4A 3DHMA 1PZAA 2JB6B 1OW0A 2HBXA 3HQPA 4IJ3B 5KN5A 2A9CA 4PWGA 3IGLA 3G5WA 3NQEA 4BE5A 2OYKA 3EB4A 3SKOA 1XB6A 5C0BA 1AC6A 4I13B 4XE0A 5B38B 4IBSA 4PLJC 1GVSA 3WJWA 3CDZA 1YMMD 2Y62A 3WYZA 4E8CA 3M17B 5BNXD 1OAZH 4MMXC 4WO4A 4PR4A 4MAUL 1J5DA 1UZ4A 1T7WA 2HH0L 2QPDB 4K8GA 1HXKA 1M1SA 3HV9A 1ZPLA 1F6YA 1MWOA 1KTLB 3KS0J 2ZG3A 3A4JA 5LA2A 1UT9A 4W9LC 3IS1X 4NQXA 3MJ7B 4L5FH 4WOQA 5T5NF 4OAWB 2JXMA 4EACA 2D2OA 3ENLA 4C58B 2Y89A 4CNUA 3UR2A 1GOFA 1YA5A 1QVOA 3CIXA 4ZPTB 4OUIA 1ETJA 3I50L 4ZZ9A 2ADJA 3FSWA 4IQHA 1Q4NX 1TZIA 3UGUA 2O7QA 3QO1A 3WQWA 3EJYD 4NZDA 2DYPB 1QOPA 2VWTA 3TC7A 4KI1A 1E28A 5D9SA 2XG5B 3SPIA 1C9WA 2C1IA 4WSKA 5ITFB 1VHCA 4KDVA 1JRHH 2XTJD 1EEZB 4WGVB 4RFEB 1PV8A 3ESPA 5GJSL 3DYPA 1R3HA 4YN3A 4Y16C 3B4YA 2A6IA 4ODTH 3HFTA 4L29B 1GPFA 4LARL 1RUAL 5E5RB 5FO9B 5BUAA 5J1AB 3UXDA 4AD1A 3MB9A 4IL0A 1DO6A 1D7FA 4J4PA 3RVWC 4QSHA 5JQHC 1BBJA 2G3JA 1Z5LB 2EC9T 4AQLA 4ML9A 4GNJA 3BVTA 1QLFB 4XMTA 3PIQB 4GMSL 4HBKA 4FX6M 1KGJA 1S3RA 1BCIA 1KM2A 1Z7JA 5SWSE 1UOVA 4N3TA 4Y5VA 5D7LA 3TVMB 2E9GA 4UTCA 2ZCHH 3GJFK 2R8SH 2HFGH 1XLCA 2EKJA 3PWGA 3K74B 4LLWA 3QCVL 2HT2D 2IUZA 2W59A 4P23C 4WTQA 1O95A 3EX4A 4E41D 2QQNL 1US3A 5H37A 1CFSA 3GBNL 2X6VA 4K2UH 3JWOL 1U8JA 2JSFA 1OPGL 3TBTB 3MRDA 4HH8A 5T33H 4GMTL 4PUUA 3UA3A 1XSOA 1JPMA 4KQ3L 3SJNA 4ORMA 2CLZB 1KB9J 3UNTA 4UV4H 1UWEL 3S1XA 1ZUAX 1YEKL 1F6PA 2EIEA 5FYKH 2WUCL 3G24A 4C6JA 3ABSA 3FFCD 4AY0A 3NSXA 1IGIH 4YSCA 1T2JA 3FO2A 1TQWA 1SXZA 4FIQA 5EU5B 3PNUA 1I60A 1IAIL 3K6NA 5FDWA 4K6AA 5JW4Q 3KOXA 3CZNA 3GSNH 4JZJA 3NCYS 2C3VB 4G6FD 5I1CL 4QS6A 4I5BA 5E56A 1P4CA 1WC7A 2QADD 3PS6A 4LP4A 4CJ1A 2BHZA 1J12A 4GRLC 4TMPA 2JKXA 3HMXH 4DWHA 2ZVIA 3Q8CA 1W32A 3DFPA 4BQCA 4XMPH 1B0RB 2VDGA 3KWTA 3PHOA 5IKCB 2HJKB 3SPJA 4G6JH 3QW9A 3SE3C 2JLLA 2ZUMA 2W0FA 3IT8D 3RHWF 4DX3A 4DO7A 4YXGA 2LLLA 2Z26A 4BQ4A 4GO9A 4P7LA 1MYRA 4GUCA 2JKTM 2AEIT 1IGSA 5IB4B 5F97E 3PG8A 4Q4EA 1FHGA 4JM2D 2WYTA 1NELA 4G6CA 2VC2H 4YYFA 5T5FA 2GB2A 1LMKA 4XPBL 4JIIX 1BEXA 4KO9A 2MQGA 1KULA 5F7KC 3BCJA 4IU2B 1A7PL 5HNUA 1B0IA 1V3MA 4U6VL 1UACH 4U10A 2BBFA 4KK5C 3TNMB 3L2NA 5EFDA 4QG6A 1CICA 3MA7B 2BASA 5IESH 3GSVB 1A2YB 1BXNA 4YGVA 4JHOA 3QI9B 2XSXA 3DO7B 5HSFA 1GZQA 2KC0A 5I16B 1H5VA 2CITA 4N4YB 3R18A 1CN4A 4HN8A 3PPEA 1TPEA 1PQZA 1L6FA 1P4IL 4OR1A 3QJVB 1QSED 3GMPA 4Z7VF 3AAZA 5H94B 2DPKA 4K3ZA 4M7LH 1UJ3A 2JB5L 1F5WA 5D2NE 5J11B 4OLXH 4ZSOA 3STGA 2NZIA 3GW0A 3GXMA 1A7QL 3D18B 1I4FA 2GIXA 8CGTA 1M01A 3QCTL 4DJED 5TBOA 3V1HA 3F4WA 5E5CA 2Y4SA 2R27A 4LS1A 1OWRM 4J1UA 5KBLA 3QDJD 3KYOA 3L4VA 3PWPD 4MA7H 1AL7A 4O4YL 3QRLA 4NNYB 2XZQH 4UCGA 3GHTA 4S3KA 1KPRA 1U3YA 1S7SA 4YYCA 3HB9A 3Q6GH 4TN9A 2J71A 2JB6A 3UZEC 3VFSB 5EZJA 1JDDA 1G7UA 1WDDA 1L9SA 2APFA 4M6NH 3V4PL 5EA0L 1EPVA 5JORB 4YJ5A 1SZNA 5K93A 5T1MA 5JQIB 1T0OA 3SCSA 5C5YA 2B9AA 4MKMA 4B7IA 4XVUD 1OM0A 1ES0B 3MUJA 3H3BC 3JWOC 1A0DA 3N9KA 5CR8A 1GORA 2ZX7A 1G94A 2IH9A 4OZHB 5K4XA 2EUXA 4JBRA 1JYWA 5KVEL 4ZJ9A 5EWIH 4DJFA 2E77A 4KPLA 5IVXA 5AOJA 5D2WA 3EA1A 4N2LA 3RAJH 3WLHA 5MHSD 3ZJ7A 4ZO8A 2R9HC 4B5SA 4QRPB 1BF2A 3ZL2A 3V0UA 2JKEA 4Z7WB 1KTLA 1EYWA 5EG6C 2FZ8A 4P8XA 1PKQB 4PVBA 4ZD3H 2RDUA 4U1IB 3UYRH 2ACRA 5C6TL 2WWNA 2QKIB 3VCLB 5BUPA 4OAWA 2A74C 4XMKH 1H0DB 4PBVC 2DDQH 2ACQA 4XVDA 1V93A 1W54A 4YVNA 5FSDC 5A6JA 5JOPD 4F40A 4ZPTA 5D8ZA 3I6TA 1UROA 5BXTA 3MOBL 3A6CL 2EUVA 1ZTXE 3M0XA 2DYPA 4QE1A 1NJ9B 3CZGA 3F84A 7TAAA 2VDOH 4NKIL 1JZIA 2XG5A 1BZDA 5D2YA 3MXVL 1TZHA 1XH2A 3H85A 4JDEB 5ITFA 4B0MB 1GJWA 5ALBL 5HI4D 3M6DA 4RFEA 3T1GA 4TYUA 1NBVH 5ADOL 3UMNA 2WLLA 4HN4A 3E5PA 4WK2B 4WEUD 4TLUA 3W22A 3K6FA 3L16A 4L29A 5FA3B 2Z64C 3BT2L 5FO9A 4EIZC 4OLVL 4EF8A 3IDUA 3N1PC 4YC2C 3MCLH 4DP1X 4BGLA 2ROXA 3ZYOA 4ZRGA 3W9ZA 1EZWA 2KS0A 2NPLX 4MCZB 3D3VB 1T03H 4B53A 4CSSA 4B92A 3A47A 1OX4B 3BZJA 1V7NL 2P76A 2AJUL 2YJQA 3LKRB 4HX1A 1QLFA 1G4TA 3PIQA 4GQ9H