1HNYA

The structure of human pancreatic alpha-amylase at 1.8 angstroms resolution and comparisons with related enzymes
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of human pancreatic alpha-amylase at 1.8 A resolution and comparisons with related enzymes.
pubmed rcsb
molecule tags Hydrolase (o-glycosyl)
molecule keywords HUMAN PANCREATIC ALPHA-AMYLASE
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hnyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hnyA01
1NWUA 3SCOA 2E9BA 2WVTA 3MO4A 4C7FA 3ZT7A 2DDXA 1UR0A 1W32A 1HJXA 3PHAA 5A8NA 1OGBA 2GDUA 2EXOA 4EKJA 1Q6DA 2DT3A 4MJ4A 3CBWA 4W8LA 3G6MA 1QWNA 3WQWA 2CNCA 3LXBA 4UQAA 1W9UA 1V3HA 4ZXLA 2BHZA 4B3KA 2X8RA 3CHFA 3OB8A 1KTCA 4F9JA 1XSIA 3MU7A 1Y7VA 4LX4A 1JIBA 4JFTA 3A4AA 1LJYA 3NSXA 2WANA 1GQKA 2ZX6A 2YFNA 1ITCA 3FXYA 2HISA 3DYMA 1UR8A 1UD3A 3WNPA 3TTOA 4HU0A 1XYFA 2QHAA 4IM4A 4PYSA 4AZ5A 1DHKA 1UR1A 5AC4A 1B31A 1ODZA 1W2VA 4RE4A 4PTXA 1HKJA 5A6LA 4J27A 3K4AA 3F5KA 2E9LA 1QW9A 3CZKA 1R75A 1BG4A 4KH2A 1CGVA 1CGWA 4DO4A 2AAAA 2F2HA 5I78A 2J25A 1MQPA 2OWCA 3U57A 1LL7A 2EEXA 5CLWA 2YA2A 2WBKA 1VAHA 3CUFA 1TR1A 3WF1A 3AYSA 4WSKA 1C93A 3MSDA 2J7HA 3EDJA 2GDVA 4GPNA 3H54A 1CTNA 2YL8A 3W6LA 2WMIA 5D8ZA 4NZCA 5A8QA 2XN2A 2CBVA 1V6XA 2W91A 4JKLA 3VM7A 2J4GA 1CXHA 2OLHA 2FYVA 2G3MA 1ITXA 1E1EA 5HNNA 1ISXA 2CCRA 3LRKA 1KR0A 1HTYA 4HMDA 2XTKA 4NZFA 1GOOA 3N18A 1HL8A 2DIJA 2V3FA 3KEHA 3OIHA 3VDBA 4AW7A 3VGEA 1SYTA 3SUUA 3KLLA 3T2OA 5IFPA 2XSAA 4W88A 3ALFA 4TOQA 2YLLA 2F1AA 1ISZA 1KBBA 3BAJA 3BAKA 1TCMA 4E4PA 3GTNA 4GIAA 1US2A 4OOZA 1UQZA 2OWWA 4JFUA 4GINA 4ZEPA 4HOWA 4MB1A 4B3LA 4UZUA 5HPOA 4YPJA 2J47A 3BXWA 1PZ3A 4GZJA 1BG9A 1XD1A 1BQCA 5DT5A 2O9PA 1J0ZA 1E72M 3ZQ9A 3GBDA 3DDGA 3OLIA 3B8SA 1LG1A 3AYRA 2YA1A 4X0VA 3SCTA 3UR7A 1E9LA 2ZWYA 5E1QA 4QLKA 2JF6A 3BUIA 2X2JA 4ZE4A 3WD1A 2YL9A 4R27A 1YHTA 5CPTA 4LXFA 3PZGA 3S5YA 5ABEA 1PZ2A 1Q6CA 3IAQA 1BHGA 3BUPA 3OGSA 1OT1A 2J79A 3ZM8A 1MW1A 1OM0A 3ZSSA 3BVWA 3DX1A 4W5ZA 4PSPA 1UWIA 3NUKA 5TD4A 2W63A 4L4OA 5A8OA 1R85A 2WCGA 3GH5A 5I6SA 4HZ8A 1UWTA 1KB3A 3AHVA 3BLKA 2YA0A 4PMOA 3ZT6A 4QFUA 1E6SM 4MTVA 4TVCA 4AZBA 5I24A 3VTRA 3KL5A 1TE1A 1J9YA 1HJWA 3VSVA 2VX5A 2B31A 2Q8XA 2FGZA 3ZJKA 4KRUA 3K8KA 4J28A 1UKQA 5E6YA 5I77A 1M7XA 2J7EA 3NIYA 3VIGA 2W62A 3WH9A 5LA1A 3SUWA 4DUWA 2QF8A 2YL6A 1HP5A 1HJUA 1J0HA 3LXCA 1RD6A 3SCRA 1AMYA 2ZICA 3WH5A 5D9OA 2DGAA 5KEZA 2OW6A 2YBTA 1CECA 4DUXA 4AXNA 3D50A 1W1VA 5M03A 1PIGA 1P6WA 2V3GA 6CGTA 4JCMA 4KRTA 3CH9A 1HNYA 1WZLA 4AC1X 3WH6A 1TA3B 1RPKA 1UWRA 2WW5A 1B3VA 1JD7A 2G8ZA 3MS8A 2ZUWA 4J3XA 4N42A 1QBAA 1QI0A 4PMYA 1NWSA 4MNKA 3AMLA 5BXPA 3ARPA 4M56A 3TTSA 2WSKA 2ZXDA 2UY5A 2C7FA 1F4HA 1PX8A 2XN0A 2XGBA 4E8DA 1R87A 2PBOA 3IJ9A 5DMYA 3VPLA 1ZJAA 5JUVA 4UQDA 5IDIA 4BA0A 3RM4A 3N17A 4W84A 9CGTA 4TVUA 3GYCA 2J75A 4CGTA 4U3CA 1VRXA 4F9DA 2O9TA 5A6BD 1V0KA 2WHLA 2XWEA 3L4WA 4HOZA 4M1RA 1VFMA 3EJTA 4LYPA 4UFLA 4AYGA 4NI3A 4MADA 4CCEA 5A6BA 3VNZA 3RCNA 2X1IA 3TOPA 4HA3A 1Q4NX 1R8LA 3ZIZA 2CBIA 2WB5A 3VIKA 2WXDM 1E4IA 1E6NA 4WKHA 3A47A 3GH4A 3AHTA 1FP9A 1FH9A 2JIWA 2WHKA 3CPUA 4UR9A 1E6XM 4U31A 3K8LA 1MW0A 1V03A 2BY2A 2WC4A 3D4ZA 2XWDA 2YLAA 1TQSA 3AS1A 1NWTA 1E6PA 3KLKA 4QLJA 1JYXA 4HPGA 1GPFA 2VX6A 3WDJA 4YN5A 3HZ3A 4UFKA 4Y7EA 3B9DA 2VX7A 2BHYA 2DSKA 1GONA 1GORA 3UG3A 1NP0A 4PSRA 1KTBA 1W9XA 3GNRA 2D24A 5BRQA 2PF0A 2FDMA 4PMXA 2VVSA 3UERA 4P8VA 5BXRA 4CN4A 3HN3A 1BYAA 3ARUA 2F18A 3ZOAA 1UKPA 3HJEA 2WVUA 3WMCA 2EJ1A 3A22A 1NQ6A 1HWWA 1J11A 3A6OA 1PPIA 2Z1SA 3RJXA 3SCNA 4W85A 3KZSA 2F7OA 3VIJA 6A3HA 3ZJ6A 3OLEA 3ARYA 1UR9A 1H3GA 5CXPA 4AZCA 3CIVA 3CZ8A 2X2YA 4JFVA 4LYRA 1E40A 4HZ7A 4ATDA 4LPCA 1ZB5A 2RGLA 4HPHA 4GZIA 4EK7A 1BF2A 1HX0A 2PWEA 4AMWA 1TG7A 3AIUA 4W8AA 1M01A 2O92A 3WUEA 1H11A 2VC9A 2D0HA 2X0HA 1Q6GA 4P8UA 1V6WA 1TVNA 1J0JA 2D2OA 2VZUA 3PTQA 1GOMA 5DEZA 3SEPA 1VJSA 2E4TA 4AEEA 1X1NA 2DT1A 5CSYA 3L4ZA 1U33A 1BGGA 3PZOA 3IJ8A 3WFLA 3WIJA 3EJPA 3OGRA 3WEOA 2DSZA 1CYGA 2ALWA 4TXEA 3SCVA 1C91A 1ODUA 2ZX9A 3SCUA 1J0IA 3VD3A 5A8MA 1UASA 3BSGA 2MANA 1ZBCA 4PEEA 4UOZA 3SIMA 1V3IA 2CITA 4D1IA 4M29A 3AICA 1H41A 3VSUA 1K9EA 2E40A 4W8BA 4P7RA 2YKKA 2Y5EA 3BVXA 3ARTA 3DYOA 3BMVA 4ATWA 2XG9A 2CIPA 3ARRA 4TUFA 3OZOA 1B3WA 4FF5A 4BF7A 3BUQA 3D4YA 3VGBA 3D3AA 2VR5A 3W37A 3NSNA 3ARZA 1MWOA 4Z2LA 4URIA 1DWJM 2GVYA 3GXPA 4FLOA 5GQBA 1E15A 3WL0A 3CHEA 3W29A 2YBUA 1UKTA 1TZ7A 2PBGA 3WF2A 1UZ4A 4MAZA 5GNZA 3WEZA 4CCDA 4PMRA 4AIEA 5IHRA 1JZ5A 1EO5A 1WCGA 3MMUA 1KGXA 4HZ6A 1JAKA 1WDRA 4PTVA 2RGMA 5EBAA 1JZ6A 2DPEA 2TAAA 1KXHA 2X2HA 1LWHA 2Y8KA 2F7RA 1CEOA 2VL4A 4HU8A 4D71A 1BGAA 1JDCA 3EJQA 1WDSA 3EDEA 1VJZA 4GO9A 4NXKA 1VEMA 4FK9A 3BLBA 3WEMA 3VD4A 4ACYA 3QGVA 3DX2A 4EAMA 2IUZA 4OOUA 1NOUA 4H2CA 1JFHA 1C8QA 3B9AA 2VJXA 2XYLA 1K9FA 1BLIA 3MUZ1 1J10A 4D6JA 2ZIDA 5I3DA 1FFQA 1JZ4A 2QV4A 4MJ2A 5FL1A 3WD3A 1CGXA 1QW8A 2D0GA 1HJSA 1W1PA 4V27A 5AYBA 3VDAA 2WSPA 1GNXA 2W66A 4J3UA 2EPMX 1Q6FA 4WJXA 2WLYA 1CLXA 1UWSA 5A3HA 4IPNB 5CZKA 1CGYA 4JAWA 1H5VA 3WN6A 3FY1A 1CXEA 1MXDA 1R47A 2PWFA 2J78A 2JF7A 4AY1A 2A3AA 1E71M 4UOJA 4HP5A 1V3LA 5DO8A 2WK2A 2IXUA 4RL3A 3VX0A 4AYSA 3UETA 1XGZA 4AIOA 1E5NA 1QI4A 2ESCA 3UEQA 4B9ZA 1GQJA 3HU7A 3ZR5A 2OYLA 4AD0A 5D9NA 3CMJA 3VU2A 3A24A 2BVTA 5A6KA 3VMNA 3WQ6A 3SCWA 3T0DA 2VCCA 2BS9A 4MDPA 3PZIA 1M53A 2AMGA 4FNRA 4D6DA 1UR2A 2JE8A 4AZGA 2WC7A 4QCFA 4BQ5A 2GK1A 3L2MA 1VEPA 5A2CA 2VQTA 3SCPA 2ZXQA 1AQHA 5LA2A 3SCSA 1V0LA 1VBUA 2DSUA 3T09A 3AMCA 3PTMA 1H49A 2F61A 5C70A 1SR0A 4D6HA 2OYKA 3RO8A 3BCDA 2F8QA 1LLOA 4D72A 1KXQA 1KXVA 3BVUA 2XN1A 5FL0A 2VZTA 1G1YA 2FHCA 1DP0A 5ABHA 3IGUA 1CIUA 4ZENA 3SUTA 1CGTA 4CUCA 1J18A 3ZR6A 1EXPA 1WKYA 1DEDA 2V3EA 1VIWA 4DWSC 4S3JA 3W38A 1JFXA 2X09A 1CNVA 4UFJA 1HF6A 5I23A 2DT2A 3SCQA 4LGXA 3WMSA 1R7OA 4AISA 4LQ1A 4P7NA 4MB3A 4P8WA 4WLCA 4C7DA 3WH8A 5D4YA 4HOXA 4BQ4A 1QNPA 3EYPA 2EABA 4MPKA 1PAMA 3PZ9A 4HA4A 1JL8A 1DWHM 3GH7A 4J3VA 1MVYA 4FMVA 1W3LA 1EOKA 3CZJA 2E8ZA 1BVNP 3BAXA 3EDDA 1J0KA 4UNIA 2YDQA 4P8XA 4D6EA 1L0PA 1QI5A 4B16A 2ZWZA 2E8YA 3AJ7A 2J7DA 2F1BA 4UFIA 3W25A 3WFZA 3LPFA 3LX9A 3QHNA 5BXSA 5CGMA 2E9MA 2WBGA 1XCXA 4Q7NA 3FHAA 2E3ZA 1TUXA 2VCAA 1C8XA 2A3EA 3AIWA 3A23A 2PWGA 3W53A 1MQQA 1V02E 1ZU8A 3LPGA 3UG4A 3OZPA 2W5FA 2YDRA 2BNJA 5I0DA 3VGGA 3AIVA 1JNEA 4CVWA 1PX4A 1OGGA 2GSJA 4AIUA 1CENA 4Z2GA 2DEPA 3PZVA 2XSBA 2UY4A 1IZKA 3OLDA 3K4DA 1ZJBA 3WKZA 3A21A 3GXDA 1UR4A 3WD4A 1MW3A 5BWFA 3MV11 2VZVA 1EA9C 1W3KA 2FGLA 1W9PA 3SURA 2D23A 3AMKA 1B3YA 1IZJA 3EJSA 4Z2KA 4UQ9A 1NWRA 3WDIA 4PCSA 1OD0A 1SMDA 2GJXB 3KL0A 1BFNA 4UZSA 1JYVA 2YFOA 2ZE0A 3GDBA 3EJUA 1MFVA 2YOCA 2XM2A 2PB1A 3VGDA 2JFEX 1EQPA 4WKAA 3VIFA 3H53A 2FHBA 1V3MA 3VIMA 1R86A 3VIPA 4IPLA 1HKMA 1EQCA 3RIKA 3WF4A 3AXHA 5E70A 1ISVA 3VUPA 2WMIB 5CG0A 4W7WA 4JFSA 3F4VA 4CU7A 5C71A 5A94A 3ARWA 3VKKA 5GPRA 3CLWA 3S5ZA 4OJYA 3LPPA 2WVVA 3M6DA 4PRWA 1UD5A 3AXIA 1V0MA 1VEOA 2PWDA 4J3TA 2WC3A 4D6FA 1HVXA 3VO0A 1FOBA 4MAVA 3SUVA 1OCQA 3W4RA 3MKKA 2PC8A 4ZXOA 1FH8A 4TTUA 1E0XA 3WDHA 3ZJ7A 1B1YA 1HXJA 3EMCA 3TA9A 1KGWA 4UQEA 2GFTA 2QMKA 3VVGA 5FOOA 2D3NA 2G4FA 1EGZA 1JI2A 3O2LA 4AZHA 2CBJA 4ATLA 3L4XA 2VRQA 1XHGA 2BV9A 4BS0A 5E09A 1RP9A 1LG2A 4CU8A 3W26A 1T0OA 3WQVA 2VRKA 4W5UA 5IXEA 3AZTA 3AROA 4JIEA 5CLTA 4NZJA 2W4XA 3CZNA 1V3JA 1H4PA 1OGSA 3N13A 3WUGA 3BMWA 1BYCA 2XFFA 1VFUA 3D52A 2EPKX 2XFRA 2QPUA 4JL1A 4PUDA 4DUVA 1E1FA 2EPLX 2WCAA 3VMPA 1E55A 2VI0A 1CXIA 1E3ZA 5JBDA 1UD4A 4AD2A 3WD2A 1W9VA 5EFDA 4E8CA 1XH1A 4NF7A 4UFHA 4M24A 2GJPA 2X0YA 1MFUA 4OBRA 2D20A 3W0KA 4X9YA 2J62A 3AHXA 4WKFA 2WHMA 3AOFA 1GOIA 1UZ1A 3DX0A 7TAAA 5ABFA 2VQUA 1UA3A 5A6AA 1G0CA 1KCKA 4FLSA 4QP0A 2DSWA 1W2PA 4MB5A 5D8WA 3BAYA 1VBRA 4QDMA 4F8XA 1U2YA 1WAWA 1C7SA 4PMUA 1O7DC 2ZXBA 4ACZA 1E3XA 1ZBWA 4UOQA 2V5DA 4TX8A 4V2XA 4XV0A 4Z2HA 2Y2WA 3RILA 1GOWA 2VT0A 1Z32X 3CUIA 3CHCA 2A3HA 5M17A 1UH3A 3LXAA 4FNQA 3QHOA 1UD6A 1KWGA 3LPOA 3CUGA 3PZUA 1LL4A 2XUCA 4DWSB 4PBGA 1EO7A 1E6RA 1HKKA 2G41A 2W92A 4XB3A 3WUBA 3IJ7A 4CD5A 4D6IA 1ZS2A 2VVNA 2NSXA 2DH2A 2CHNA 3APGA 3EBVA 3RM9A 3DHUA 5FD0A 4XZBA 3J7HA 1BYDA 2YIHA 3W24A 1ZL1A 3F5JA 4CVUA 2J7CA 1CBGA 3AIBA 3HG3A 1ESWA 3HG4A 3I3DA 3W82A 4H41A 2WKLA 4AZCB 1BPLB 3WENA 4WSJA 1BYBA 4UQCA 2QPSA 1HP4A 4AMCA 1TQUA 1FA2A 4DO6A 1O7AA 3DX3A 4GQQA 1UWQA 5GNXA 4U5KA 4PMNA 3LMYA 4KMQA 3MSGA 3I3EA 4W7VA 3UESA 3MUAA 4UCFA 2CKRA 1MXGA 1PEZA 1W1YA 1OIFA 5IFTA 3BSHA 2AOSA 3WNNA 1GVIA 1J01A 1VFOA 3GXIA 3I3BA 2J7GA 3T0BA 2QMJA 5IHSA 1V6VA 1HVQA 3AMGA 4W7UA 1E43A 2WMHA 2XVNA 1A3HA 3ARXA 5GNYA 1WNOA 4AZ7A 3VIIA 4DM1A 1PIFA 5FIPA 3MUIA 1BAGA 3ECQA 1ECEA 2X05A 1GHRA 6TAAA 2CESA 1UQYA 2VRJA 4L4PA 4AD3A 2DIEA 4OGZA 3MANA 3BH4A 1WDQA 4PMQA 1OIMA 2CKSA 1QNRA 2OWXA 3O6AA 4LYQA 2O9RA 3VD9A 4JKKA 3IAPA 2WM0A 5CPSA 5A1AA 4D1JA 1UWUA 2DT0A 2A3BA 1CXLA 4HA1A 3EJRA 3AFBA 1US3A 3MMWA 5A69A 5A2AA 4OBSA 3VMOA 1CPUA 5JIWA 4TTGA 1UYQA 3CZEA 1FH7A 2JIEA 3II1A 2ZX5A 2E0PA 3CZLA 1JDAA 1BTCA 2PI6A 3AZRA 4DWSA 1H0GA 3JUGA 4OIFA 1UHVA 4S3KA 3U5YA 3LRMA 1PBGA 3GXNA 5A6MA 3WSUA 1XD0A 2HVMA 4OKDA 1XC6A 3U7VA 3N1AA 3S6TA 1NP2A 1JG9A 3FW6A 3MI6A 3HG2A 4NSBA 1EDTA 3W81A 3AS0A 3WF0A 1LL6A 2GJXA 3NCOA 5CQ1A 1KQZA 1E4NA 2Y24A 4JHOA 4GO8A 4EANA 3BUDA 2ZUNA 1H09A 3W6MA 3WUFA 5A8PA 1PX3A 2BVYA 3OBAA 3KE0A 3N04A 3AI0A 5M3WA 1JZ7A 3K1DA 5CPQA 1B3XA 2WPGA 1R7AA 3MMDA 3G6LA 3GXFA 3EMZA 1RP8A 1C8YA 4P7LA 3NJ3A 4C7GA 3DC0A 1YQ2A 1B3ZA 4M8UA 4U2YA 4W93A 3BVVA 1HT6A 4PTMA 1UG6A 5D9PA 3NDZA 4PN2A 1H0IA 2VMFA 3ZMRA 4FNSA 1X6LA 1JD9A 3VINA 2NT1A 3WMBA 1FP8A 4FNUA 2WAGA 1KGUA 3GNOA 2CEQA 4CD8A 4M81A 3A5VA 1K9TA 3WH7A 4DM2A 2ZUUA 3AIQA 3N12A 1E56A 5A95A 1G01A 1QBBA 5ABGA 3N11A 1E73M 1UH4A 2VUYA 2V38A 4U3AA 1MYRA 3NYDA 1XSJA 1M04A 1WB0A 3OGVA 2DH3A 3TP4A 2XVPA 1UD2A 1D3CA 3S2CA 3WY3A 1VFFA 1R46A 3RPMA 4PMZA 2JEQA 4D6CA 2UY2A 3T0AA 2G3JA 2V3DA 1OD8A 3F5LA 2Y8VA 4YHEA 3ALGA 4Z2IA 5HOSA 2C8NA 1D2KA 1NH6A 2WYSA 4TVDA 2EBNA 4BQ3A 5BYWA 4YHGA 3AHZA 1QVBA 5E0CA 1XRVA 1GQIA 4GXPA 4Q22A 3WQ4A 4ACZB 2XFYA 1ISWA 4UFMA 5E6ZA 1W3HA 3FAXA 5EFFA 1JAEA 5E9AA 1GJUA 1BVZA 4JL2A 3VSTA 1OBAA 4GI9A 1NOFA 4H8HA 1XV8A 5DF0A 2D73A 3BLPX 1UKOA 1WO2A 3UR8A 4AWEA 4RE3A 4CN1A 3WNLA 5D9MA 4BCEA 1EDGA 1X6NA 3WD0A 3AS2A 3UCQA 3OG2A 1G5AA 1DTUA 2D0FA 4M80A 1JF5A 3DYPA 4V28A 4R5EA 2CERA 2WMFA 1ISYA 2ZUMA 1C3FA 5HDRA 1A47A 1NARA 3M07A 2EPNA 1KWKA 1LWJA 2EO7A 3KL3A 3PBGA 1FHLA 2EPOA 1JYNA 2D3LA 3CTTA 2OSWA 3CUHA 8A3HA 1S46A 3RDKA 1WP6A 4JCLA 4PMVA 2YL5A 2UY3A 1HL9A 1UD8A 2CHOA 1MW2A 4CU6A 1F4AA 4DWSD 1GOKA 3PZMA 4KGJA 5HPCA 2CXGA 2GJRA 3VX1A 1V3KA 5I2UA 4GZEA 4P7OA 4U33A 1UA7A 1OSEA 1KR1A 3VGHA 5AYIA 1WZAA 2WZIA 2G3NA 3B9EA 4XZWA 1ZBVA 3WL1A 3VGFA 2XJ7A 4OUEA 1UH2A 1VB9A 1KBKA 3WNMA 1IT0A 5JIPA 3A3HA 1QI3A 4AD1A 1KFWA 5LYRA 4UQBA 4N0RA 1ZBKA 4F66A 3GBEA 3MV01 3GNPA 2XVLA 4FLQA 3O9NA 3POHA 3W28A 2XGIA 3CHDA 1K9DA 3VM5A 2CYGA 2WVVB 3GM8A 2FE0A 1EH9A 3RMEA 1H1NA 2CBUA 1B90A 2JALA 1TQTA 1W9BM 3GXMA 5HBFA 3ZSTA 1WE5A 4W89A 5HXMA 4CCCA 1B9ZA 2XVGA 3WQ8A 1XCWA 3RJYA 5CJ5A 1JGIA 2XHYA 4F79A 4FNTA 4W86A 1E5JA 2X2IA 3WBAA 2BFGA 1SZNA 3W27A 3H55A 3CO4A 3EMQA 1E4LA 5JBFA 1TMQA 4CN6A 4MDOA 3BUBA 3U7BA 5BCAA 3MUY1 1EHAA 3CUJA 1GUVA 4AEFA 2WZEA 4IUGA 1G9HA 1GJWA 5DFAA 2WWCA 3NSMA 3BAIA 5JBEA 2WNWA 1SFSA 4PTWA 3M7SA 3WF3A 5A6SA 1HJVA 1W91A 3BCFA 3WBEA 4QCEA 1TQWA 4M82A 3GXTA 1QHOA 2ZOXA 1QHPA 7CGTA 1I1WA 3TONA 2XIBA 5F7UA 4XUYA 1W3JA 1NM9A 3AS3A 4A3HA 3CC1A 4HMEA 3TTYA 1IV8A 2BXYA 1V6UA 3N15A 4NRRA 1AVAA 1CGUA 4QAWA 2WKGA 5AC5A 2ZX7A 4MB4A 5KZ6A 3K8MA 4MNLA 2FH8A 1CWYA 8CGTA 3M46A 3CV5A 1HN1A 2Z1KA 4NX0A 1OB0A 2EQDA 4RE2A 1VENA 1XH0A 1TFVA 5EMYA 1QWUA 1DWIM 3ZT5A 1HJQA 4BQ2A 1OINA 1V0NA 4AD4A 2GK1B 3GZAA 1J12A 1CZ1A 1GW1A 3VD7A 2ZUSA 2F7PA 2Y4SA 3L2LA 5I79A 1DWAM 1O6IA 1G94A 1DWGM 2WMKA 1XH2A 1QPKA 1B2YA 2VCBA 2XM1A 3DHPA 4WIWA 1QOXA 1TA3A 3KWXA 2OW7A 3THDA 1HIZA 1W1TA 3WNKA 3BVTA 2VX4A 1V08A 4AMXA 3EDFA 5A2BA 1I75A 4GI8A 1KXTA 3BC9A 3HG5A 2XVKA 3TV8A 2QLYA 3WY2A 1L8NA 2WZHA 3WDPP 3ARVA 3DX4A 1EIBA 4H8VA 4WF7A 2FH6A 4JKMA 4JHZA 3T2PA 2XIIA 3L4TA 1PS3A 3E1F1 3ZO9A 2BY0A 2V5CA 4H04A 3PZNA 3FNDA 1CDGA 2ZUTA 3WELA 3CMGA 1QNSA 4DO5A 1FFRA 3T2QA 1CLVA 3QOKA 2EACA 3VNYA 1C7TA 1GZJA 2ZXAA 1J0YA 4MNJA 3BAWA 1WDPA 2D1ZA 3L4VA 2FHFA 4WK9A 1KQYA 4P7QA 2WLZA 4OZOA 3THCA 4FNPA 1R34A 1TQVA 4CKQA 2CETA 1B0IA 1WPCA 2BY3A 3FN9A 3N9KA 1C92A 5M5DA 3QHMA 3AXXA 4JFWA 3LRLA 3ARSA 1EHNA 5BROA 4ZE5A 2J7FA 3SUSA 2WHJA 1EDQA 4CD7A 4D6GA 4JZ5A 5E0FA 4XX6A 4H7VA 3WY4A 1M03A 2A3CA 4J7RA 4PUEA 3AISA 1JZ2A 1JXKA 1H2JA 3QR3A 1GCYA 1OT2A 3L4UA 7A3HA 3QOMA 4QLLA 1LF1A 3AIRA 5I5RA 3L4YA 4Z2JA 4AD5A 1V6YA 2EADA 4CD4A 1JF6A 1K6AA 1LQ0A 2VURA 3U5UA 1QX1A 2J7BA 1MQRA 3AZSA 1GHSA 2VZOA 2BVDA 5ABFB 3NDYA 3IANA 2BY1A 1GOQA 3PN8A 2F7QA 1BSIA 5LA0A 1HXKA 2O9OA 4J3SA 3AQUA 1E0VA 2C0HA 1QNQA 4U2ZA 1E0WA 2CPUA 2JEPA 5CSUA 2PWHA 2BHUA 3WNOA 5FCZA 2J74A 4NRSA 3PZTA 3CGTA 2XPKA 1JDDA 3AMDA 2IXVA 2UWFA 2YJQA 1JZ3A 2J77A 4KGLA 3POCA 2YDSA 2WCSA 2OYMA 3VIOA 4K68A 1TVPA 2WMJA 3T08A 4W87A 5ECUA 3D51A 1JXJA 2VO5A 2NT0A 1HKIA 4HTYA 2J8GA 3OLGA 3HMCA 4X0NA 3A4WA 1V02A 3ARQA 1JNDA 1EOMA 4E2OA 1B30A 1I1XA 1FHDA 3K46A 1C90A 1E4MM 4B15A 1UKSA 4AZ6A 1E70M 3VILA 4BZYA 1AQMA 3WDQA 2ZX8A 1UUQA 1XYZA 3DECA 2W67A 2OSYA 2NW0A 4A3YA 1CXKA 3WDRA 4CD6A 3DDFA 3CZGA 4MNMA 1QNOA 2VR4A 4IISA 1W9DM 3PZQA 4GQRA 3WY1A 4AZIA 3FAWA 2WWDA 4EE9A 5EB8A 1R33A 3ZJ8A 5C8BB 1DWFM 4NXSA 2IGTA 3IK2A 3VIHA 3VDCA 4B9YA 1N82A 4PCTA 2EAEA 3TTQA 1JYWA 2BXZA 4GKLA 1D7FA 4H8UA 1JZ8A 1NOWA 3UG5A 2ZUVA 3VOCA 3PTKA 4PMDA 4GI6A 1GVYA 1E6QM 2DSVA 1CXFA 2VTFA 5BRPA 5FKYA 2VZSA 3EDKA 2W61A 5A6JA 1PJ9A 1QHZA 3AIEA 4U5IA 4KWUA 2D22A 3VD5A 2VOTA 4TX6A 3WQ5A 2DQXA 3CZSA 4FLRA 5DT7A 1UOKA 2WVSA 1AQ0A 3AHYA 2G3IA 5CGTA 2OSXA 2J8FA 1SMAA 5AY7A 4J3WA 1VF8A 1GQLA 1KCLA 3FHQA 4UTFA 2VNCA 1JI1A 3A4XA 3BGAA 2GUYA 5BXTA 1WZKA 1OWQA 4ML4A 1WZMA 3D5HA 1QI2A 4ZFMA 3OA5A 3VDHA 1U30A 1E6ZA 2WMGA 1RH9A 3RM8A 1XSKA 4HMCA 1Q6EA 4A4AA
chains in the Genus database with same CATH superfamily
1NWUA 2X4UB 4JR9H 5IEKA 4Q8QA 3SCOA 1X96A 2VN3A 4XXCA 3VE0A 3IU4L 4HPXA 4N90D 1W32A 1KA9F 5AFDA 2JV6A 3FU0A 3L65A 2E9WA 1HYRC 1HJXA 3L54A 3PHAA 4IXXA 5DJ0B 1OGBA 5FSDC 2GC7C 4GKTA 3DX7B 1WCBB 2DT3A 4APXB 2JKTM 4GXFA 4W8LA 2I9LB 2D03H 1HQRB 2ORBL 4HSCX 5KVFL 1DBAL 2YAMA 3ML9A 2RCSL 5AD0B 1PZ1A 1OX4A 3CAVA 4QOKA 5TPWH 3K1GA 1SRDA 2QT6A 3LXBA 3DFOA 3WQFA 3VFOA 1HL5A 3VXUE 4A7GA 2WGNB 4ZXLA 4B3KA 1HHKB 1TVDA 3LEYL 1U1UA 5I1GL 2VW4A 1GHFH 3LY0A 1KTCA 1OGAA 1PAZA 3DX9B 5I8CA 1VLWA 2KUTA 3GNML 5KBNC 4M00A 3MU7A 2GHZA 3T8QA 4BH7A 1XL6A 2GGJA 5AZ1A 5TDNA 3SPVB 4WFHD 1YSOA 2H41A 3NH7H 1DSYA 4KFMA 3LB6D 3N2CA 2Z7UA 3HPJB 4IIDA 2XX1A 4XMTA 2DZTA 3HVNA 5I74B 4HWZA 4R4NC 3E96A 1SHWA 2RKXA 1ITCA 4NM8L 2DY3A 2OQHA 3BSMA 3FXYA 3UXDA 2HISA 2Q2LA 4JRFA 3GTFA 1XR8A 2JGYA 5HHMB 2VJ0A 2BVQA 6REQB 1O6VA 4WK0B 1BQLH 4YDKL 4M7LL 3VRIA 3VXNA 3JZUA 3RA7H 4UMSA 1XYFA 1ZTVA 4HU0A 2DIBA 2V5MA 4IM4A 4PYSA 4XP5L 5IWLA 4PYHA 3RWCA 1AHWC 3L5XL 4N3UA 3IE9A 4GLRH 1OGPA 4N68A 2RB8A 5CKGA 3VC5A 4L8BA 1ODZA 2BSRB 5DHEA 1I8AA 1LEIA 4WWID 3DXAE 1Q63A 3TK7A 3X14B 4Z7QB 2ZONA 3OZLA 2POTA 4S2BA 2ZSVB 4IK7A 1I7UB 3G6JF 4KI5C 3ULAB 4ABWA 3RWGB 1KBVA 3PL6D 2OMTA 3U8GA 1AIFA 4GGHA 5K9XA 3RG6A 1YTDA 4IGBC 3Q94A 4FO4A 2BVOA 1MCBA 3SBPA 3S7GA 3IM1A 4N24A 1ONRA 4HKPA 1M7DB 4POUB 3U57A 1HS6A 3VD1A 2XWBA 3FGCA 3FT2A 2UZIL 4PRBA 3N1MC 2G4EA 2ZDRA 5T3ZE 4M3PA 4LCWB 1RIVH 1YEFH 2EEXA 5CLWA 4MFHA 2YA2A 3TYZA 4APQC 4D2NA 4Z7UE 1MFAH 1P4BL 3SGEI 2AZAA 4WVRA 3BQ6A 1FGNL 4LEXH 3HCVA 1EAPA 3W7GA 1O9VA 3K5SA 1PD6A 1TR1A 2BNUA 2DTSA 3N2OA 3SOTA 4IOIB 2RQ8A 4AJ0A 3AYSA 2KLRA 4RMRA 4W9DC 3TO4A 4N0YL 1MUJB 5AOJA 1JZHA 2CW6A 1U93B 3B9OA 1SW3A 3EDJA 3NFSL 4NKMA 5K33A 3I6SA 3RGVC 4H40A 1QOQA 2GDVA 3BW2A 3FJ6A 2XH0A 1MFAL 2YL8A 1YECL 3BRGC 5EZJB 2DQWA 4TOYH 1F4YL 5GS1A 3WFAA 4IG2A 1TZAA 4LSPL 3BPNB 3ZKMC 5C9ZA 2XN2A 2CBVA 1A3RL 4L64A 2W91A 4F2UA 4JFQB 1FDJA 3FN0H 1NCNA 1OD7A 4DK3A 3F2LA 4KUCD 5D5ME 2YRPA 1W5OA 2J4GA 4IP7A 3T4AB 4WY0A 2GTQA 3M44A 1S7TB 1BAFH 1IEAA 4H4NA 4WO4C 4U05A 3WKYA 2G75B 5HNNA 1N3NB 4PGJA 4NZUL 4FSAA 1IM9A 2HTLC 1ISXA 4UWMA 3LRKA 1FN4B 1YEEH 3WLWC 3QA3B 1UC5A 3S35H 2CXKA 2H0EA 3OSVA 4E5XG 3HB3D 3QFJE 3QIBC 1LEGB 4K15A 4NT6A 4GRWE 3U1QA 4YHML 3QWNA 4NQEA 5IMOA 4NZFA 2Q3XA 3QSRA 1C29A 1J87A 3F5WB 2KBGA 2GJZB 3VGEA 1KJ2B 1ASQA 3V4VA 4JPGA 2ZNWA 3ULVF 1WD8A 1R3RA 2VITB 1KENL 3AVEA 3DO4A 1W8SA 3H2FA 4REQA 5DRXA 1W16A 3FB5A 4WTZG 5DQ9B 4W88A 3U4KA 5HYJA 5T5FA 4XMPL 1R5VA 2ICEB 4IDLA 4CGUB 2BOGX 2R15A 2F6XA 5HGAB 5CJXA 1ISZA 2C13A 3IMVA 1HFBA 3O8XC 1BZ9A 3CV2A 1CFNB 1AJZA 1RQBA 4JQXC 4GIAA 2LLEA 2X1UA 1S7RB 1L5GB 1UQZA 1FO0A 4F48A 3KPPB 4GY1A 2DIKA 2EDTA 2WUCH 2NW3A 1T5KA 4MNGE 1JRHL 4NYUA 3K0WA 5L8JB 5BO1H 1GXEA 4Q4RA 1ORSA 3OKNA 4UZUA 3ILQD 4NQDE 3CIAA 3U2JA 5HPOA 4LBSA 2J47A 5CIPH 1PL3A 2JKAA 3IDJB 4ACTA 3IJSA 1ZWIA 2XH2A 1MJ7L 1SFHA 3EXJA 2NUXA 1PSKL 3G04A 4BZ1L 1P7TA 2Z6FA 1MZZA 3M0HA 1CI5A 3GSQB 1E5ZA 1AW2A 1A65A 2O9PA 2R29H 4Y5VC 5A2FA 1WC7B 5FO2A 1D6EB 2JJVA 3GBDA 3QUYC 5SX4I 3B8SA 3MBEC 1EEZB 4ZFQA 4BD4A 1DUYB 2A6IA 4NBZB 2IWKA 4A38A 2VN7A 5ICZA 4NC1E 1PDZA 2YB1A 7REQA 2NVDA 2Y1HA 5I5MA 2UXGA 4D9LH 4HCHA 5G4EA 3QQ9C 5BV7L 3HVDA 2YUXA 4NBXB 4PR5B 2WNQA 4Z7VF 3UEZA 3OZ9H 3Q48A 2VC6A 3LCFA 4PBDA 5JZ7D 2NX9A 3RK8A 3L45A 3S5YA 3GVWA 1LHZA 1NZRA 4L4TE 3BW9B 3ECVA 1PZ2A 4PJIE 4DQOL 4ERAA 2ITCA 3NN8B 3BWAA 2X4TB 2BNRE 2G5UA 3KYOA 4KO9A 4QIRA 3IAQA 3TL5A 1DKWA 2OK0H 4UDUB 2AW2A 5TF1L 3OGSA 4S3DA 3RZCB 1OT1A 2J79A 3KS5A 1FNSL 3D9AH 5HY9B 3BVWA 4HJGB 5GS3A 1KXTB 2WWKT 2GQHA 1XBZA 2JJSA 2VE6B 4ADJA 3LCIA 5LBGA 4A63A 1REQB 1RIUL 1XDLA 1HI6A 2FT8A 3L1EA 3F4WA 5D37A 2H26A 3P02A 4AV4A 5K9KA 3R0KA 4WDWA 1FSKB 4P2QA 2YCLA 3JZEA 3C2VA 3RVWC 4CC4A 2F53E 1XIWB 3QEQB 5FYLD 1WAEA 4L4OA 2EO1A 1FFOA 5A8OA 2HJLA 2VXQA 2DQEL 2D3JA 1H15B 2QQNL 3ZX1A 1R85A 5ETUB 1A3XA 2P9RA 4IIQB 3GH5A 2WXMA 1MNSA 2Z8WC 3MLVL 1A0QH 5CUSH 1KB3A 4KO7A 3QAQA 2H9AA 2QCNA 2ITCB 3NN8A 2YA0A 3JWDL 3LHAA 4R84A 4GX9A 1A14H 2PW1B 4NUGH 5E8PA 2Q3OA 4H1ZA 1KLZA 4LLDB 4X6CE 2HT4C 3VFUB 3ZO0A 1B0RA 1KYOK 4A6GA 5EU4A 1E4HA 5LGXA 3VTRA 1TTAA 1RUQH 4OLWL 1J9YA 1T04A 1TE1A 4FZ8H 5B1JA 1RA0A 2Q8XA 2UV8G 3ZJKA 4J28A 1JPSL 1NJ9A 4XPAL 4XCEA 5D9SB 1PZCA 4HULB 4MCZA 2AKRB 2N1KA 2V5SA 4AQEA 5XIMA 3MRCA 4FMFA 1SYVA 1R0AH 1V7NH 2F08A 1DVZA 1NFPA 2NYYC 4M5TA 3NQAA 2H5UA 5KJRH 2CC0A 5I1IL 4XAKE 4ZX6A 4J3OG 4H1LH 3NCBB 5D2LB 1MN4A 3U0TA 4AQZA 1Q3NA 1HP5A 1J0HA 5BUAA 4G7RB 1KB5B 1AGFB 2R4SL 1AGEB 2OX5A 3LXCA 4K73A 4XNMA 4YXHH 2DQGL 1ORSB 3OKNB 1TREA 2XU2A 3NQ6A 1CBVL 2X9ZA 2ZICA 1QR7A 4WTXA 2HLFC 1YTKA 3QIBB 4WQOA 4OZIA 2VDKL 3CK0L 1IU1A 4KZDH 3Q7JA 2V2WB 4GSXA 4K5NA 1BZ7A 2Y6ZA 3PV6A 3DSNB 3T8XA 1CECA 4Y5YB 1PYFA 1MWAB 3CHRA 3EYOA 4S3EA 4AXNA 1W1VA 3N9SA 2AV7B 2B59A 1KNOB 1MH5A 1P6WA 3FKUS 3QZNA 2V3GA 4KY1L 4K4KA 1SO5A 3B0XA 4FI8A 4BBWA 3NJLA 3QRFM 2AL1A 3SR7A 4JN6A 5LQBH 4DEWA 4PC8A 2OXHB 2WXFA 1J9RA 2DLTA 2ZOLB 3ES8A 2DN7A 4N2BA 2BP8A 3GT6A 1KSRA 4P2VA 1EBGA 1UWRA 3U1PA 4J8RB 3RL2A 43C9A 1B3VA 4RZCA 3SQRA 1AH4A 3KHJA 1VHPA 4JO8A 4KI1A 4P4KA 2GJZA 3RDTB 5AVSB 3F5WA 2VRAA 4CNNA 1SYSB 4GSRA 2I16A 3DROB 3I50H 4YQXL 4REQB 3LQZB 1S9VA 3UBXB 4C56D 3M6YA 1QZ1A 4PUNA 1N6VA 1TO4A 1O5XA 3HPFA 3RLHA 2D2CC 2BMBA 2F5BH 2Q8LA 2C7FA 5D38A 2Q87A 4ONHA 7TIMA 1XYBA 1FN4A 4ZFOA 2G5WA 1JK8A 1GZPA 4CL7A 2K6ZA 1L8PA 2V2CA 1YNTB 3AC0A 1X44A 3V2AR 3PR2A 3VPLA 2AK4D 4ZUSA 3CBKB 4UQDA 1C5CH 3OAZK 3T4AA 2DV0A 5CGYD 4P4RB 3NK4A 4XGZB 4CNIB 3BKJH 5JMRA 4M4RA 5HVFB 3UTOA 5FEBA 1VESA 2SEBB 1JHKL 1S7WB 1AFVH 1TTIA 4GJJA 2OPJA 5CP7A 3FFCD 1KELL 5F1SA 3BLLA 1N5YL 3AU2A 2FJFB 3T6WA 4A2SA 5T3XD 3UZEA 3ATAA 4WV1A 2O9TA 5CCZA 1I8KA 4BWUA 3FTWA 4BFIB 1V0KA 1KF9B 4AAJA 5TQ0L 4EWND 4H20L 4HOZA 4XNUL 4BE6A 4JZJC 5DFVC 3IIZA 2DYRB 1Q1JL 1WTGT 3BWUF 4I3SL 1FWSA 4JBSA 4KZCA 5H91A 2YAHA 4NI3A 5I17A 1OAYL 1N68A 1MELA 5D7SH 2X1IA 1RK6A 1J2WA 3TOPA 4Z7UF 5B8CC 4B9PA 4K5OA 1EWDA 2PCEA 2V0TA 5K9CA 3VIKA 4JFEE 2DZVA 4O2CA 2C1HA 5HHOE 2FZMA 4PJEE 2TSBA 3I9IA 5FUZH 1TWIA 2QW5A 1T0NB 3ABQA 4FQJH 5JMOC 3VKAA 2RFXA 4K7FB 3VCNA 1FP9A 5E99L 4RSVA 3L7FB 3BLEA 5C1MB 4UTJA 4I0KA 5DK2B 2O0TA 1CLYL 4IKJA 3FGCB 4JFDA 3NQGA 1AO7B 5F7FA 5AW9B 5I8EB 4Y9GA 5LGJA 4EIVA 1V03A 5IUCA 3FCSB 4Z6AT 2VITA 4RR4A 1OTSD 1PNCA 3B7TA 2WM1A 3QO0A 4ZS7H 1NWTA 1M42A 2MCG1 5F9OH 1E6PA 4YZFE 5DXXA 4QLJA 4IJ3B 1A02N 2KAUC 1F8TL 2BSLA 1GPFA 3AWGA 4TYUA 5T5FH 3SKUD 3WDJA 1LEIB 2A73A 2M2DA 3B1TA 3HZ3A 3CEUA 3FPXA 4UFKA 1EERB 4UDTB 4A04A 1SN0A 1EWEA 3B9DA 1FHVA 2BHYA 3NQBA 4Y7EA 3E2RA 1YE4A 2DSKA 1I2PA 1A7RH 4DH2A 1GORA 2IAND 2NXIA 1W9XA 4GP8B 2G75A 3F1QA 1ZHKB 1QZNA 5H35B 3FUIA 5LXGH 3U9UA 5C0CE 3ZXWA 1IT7A 4BQCA 3TCLB 1VCGA 2FB4H 3UPRA 5D32A 2PF0A 2FDMA 3G1DA 2YARA 4WEMB 3LZNA 2YPLE 1XYAA 3LOWA 4HWZB 1IGJA 1ZAJA 3IVSA 3ARUA 1LOSA 9XIMA 2YCKX 1NLDL 4O12A 1JWSB 3NQ8A 1PLBA 2WVUA 4LRTA 4DZ8B 5L2KE 1LO0L 4AIXA 4HSNA 4PJIF 4M1GL 3L12A 2QGYA 4G7VH 3DX9A 5I8CB 3MNDA 1J11A 4UOW1 3CYJA 2Y7NA 3WAJA 4KZ0A 4L5ZA 3T0VA 1XLAA 1IEHA 1KMGA 1AGEA 4XNMB 4UB0L 2QVMA 4WO0A 1BG1A 5TGBB 2VEMA 3KZSA 3J07A 1F9CA 3VIJA 3EFFB 3QEQE 3CBJB 1VFBB 3KXFE 4QRRA 2OJ1A 5D7LD 3QN3A 4L1WA 3GPEA 5DUBB 3CIVA 4XC1H 4ZS6D 4WK2B 5AZ2L 1LORA 4JFVA 5DO2C 2FKPA 4H83A 4LYRA 3MRCB 3R1ZA 4I9MA 1E40A 3E12A 2L7JA 1F1DA 3DJRA 2B08A 2ZKHH 4YL2A 1FVPA 1S39A 3M17B 1KFEA 2GLKA 2RGLA 4J4PC 3GVQA 5DC0A 4FHAA 3QH2A 4PJGB 5D2NB 1KCSH 3EOBB 4HJJH 5AW0B 5HUPA 1I31A 5DYOA 3WUEA 3LNGA 4X80L 1H11A 1CG9B 4M7JL 3T1GA 4M5ZL 1EJXC 1X5YA 2VUNA 3IDYC 1H7XA 4HT1L 1J0JA 3QZWB 2IG2H 3O0RH 1DQQB 3CVHA 4FA6A 1P84J 5AHEA 4EI6A 3PTQA 5DANA 2VXTL 2YXMA 2E4TA 4UUJB 1ZE3C 4H4IA 3W71A 1FYTA 4AEEA 3ZWSA 5GZNA 4HSHA 3EFDH 2Y5TB 4W9ZA 3CXDL 5CSYA 4YLWA 3S1XA 2VM4A 3VRIB 5BOEA 4Z0BL 3UGXA 5FYLH 2QKFA 7ODCA 4HUCA 1YNKL 3ILPA 3PSWA 5E5LA 3OGRA 1V7ML 1SBBA 2DSZA 2A3LA 1CYGA 3IIXA 3AWFA 2W94A 5C07A 4WKXA 3SCMC 3SCUA 1J0IA 1TZIA 3CVHL 5A8MA 1CT8A 1UASA 2FATH 5GRZA 2WXGA 1MRCH 4PEEA 4UOZA 2DVXA 3I6TA 1GVQA 2RH0A 4HAFA 3WJSA 1UXWA 1G7IB 1H63A 3AICA 2DRUA 1IXPA 3ISIX 4H1LA 2F5BL 2XDHA 1OGAB 2DWDA 4XPTH 3UR2A 5LXEA 1ZCCA 4W8BA 2A83A 4GD0A 4UTKA 2R69H 5DQDL 5HGBB 5EN2B 5TE7L 3HQOA 4DVOA 2NUTA 4HS6B 3UGEA 1TO3A 4BCYA 2IPWA 4HX1B 4LSTH 4NIRA 1IVTA 2V7HB 2WLJA 4GIRA 4N8UA 3ZRFC 4AM0B 3BMVA 4OZIF 1SEQH 4UTAH 1OHQA 4DIAA 5MEOA 1DZBA 4APXA 5LGZA 4LUSA 4ATWA 5FJOA 1FNFA 3BZFB 3V0IA 3FTXA 3MDWA 5EZIH 5E95B 1LT7A 1UCBH 3JWNH 4MBOA 5CCKL 5CZJA 5GZOA 2A6NA 2A0NA 3D08A 1XDJA 4PRDB 1SFDA 4LCRA 1EXGA 4FQ1H 5EU6A 2BDQA 2QCMA 3UWUA 3K0YA 2H4EA 1AANA 1JCJA 3PK7A 1ZT7B 4BF7A 3BUQA 3L6FB 5HBBA 2V5YA 4LKXA 4M5SA 4TQEL 4AC4A 5IEKB 2XINA 5CJ8A 4FXSA 2V5TA 2YAFA 3BPOC 3CBRA 3QUZD 1U95B 2MQ0A 5HYJD 5T8IA 3CFKB 1RHCA 1OP9A 3GMOA 2O55A 4G1EA 3CSYB 1KG0A 2OK0L 1KYUA 3OX8B 3KXQA 4HCRA 4WWKC 4JFDD 1WUZA 2CLIA 4WX2A 4F7MB 1CFNA 2GVYA 1S3RA 4FHBD 2ZAGA 2EEFA 1CLCA 1TQCB 2NYYD 1TPVA 5D5MB 4I8DA 3WL0A 4I0PA 3CQPA 4Z95H 3QJFB 2YBUA 5F8QC 4UINH 1TZ7A 2PBGA 2IF7A 2FZ3A 1XUZA 4X0KB 1M05B 4CCDA 5IHRA 4ZXBC 2AGJH 3MMUA 2D7MA 1TEFA 1E4XH 4EMZA 1DQUA 3R06B 3CLFL 2RGMA 4OM0L 4DF9A 3LCGA 4NLHA 1NKRA 4PRPE 3V1PA 4Y4HA 3QNXA 1FWRA 2TAAA 4Y4FB 2DPEA 4LGXA 1LRNA 1D9KC 2WP3O 1OSPL 1OM3L 5L2KB 1ASPA 3AT0A 4TNEA 1LEGA 2DMCA 2Y6SC 1ETB1 3VXOB 3NO5A 5CZTA 5HHPB 2YXFA 5BNKA 4ZNCD 2NNXA 2XWJA 2GK0B 2ZA2A 2O30A 3EX1A 1OT4A 1KJ3H 1WUEA 1FE8H 2O5YH 2R1YB 3IJHB 4BFJA 4JTQA 1GR7A 1U8PA 5JPMC 1NGZB 4E41D 2LHAA 1PE1A 1SQ2N 4MZRA 2VWEC 1VJZA 3V0VB 3VRLE 3QP3A 1Q9KA 2PTTB 3G6AB 1F90L 4EI5C 3WEMA 1S3HA 2A7PA 2HWGA 3SGKC 4GKZA 1R3IL 2YD9A 4ACYA 3LQGA 4L5FE 3DX2A 1J96A 2PWUA 1XMEB 4M3KB 1RSCA 2IUZA 4B41A 3MRRB 5BRZA 4H2CA 3CQQA 1NOUA 3CAQA 4HH9A 1C8QA 3PJTA 4KEZA 1F0LA 4RFOH 3T0EA 3DESA 4NZ5A 4FF7A 3STEA 1M4KA 3MJ8A 5IBUG 1MVUA 4XI5C 1YPXA 1ZGLP 4P23C 1KJ2H 2YKLH 4D6JA 1JZ4A 1FFQA 2KPWA 2H1PH 2QVIA 1AZUA 2JGQA 1N67A 4Q89A 4LWWA 1W1PA 3WQPA 1ZANL 4ZL1A 2F15A 3QUXA 1OG0A 4LH8A 2FLBT 2WSPA 4QRBA 1A4KA 2W80C 3BISA 2ZCGA 4L4MA 4XIMA 5L88H 3MREB 4BF9A 4JQIH 3BW3A 3MWCA 3QUKB 5LJYH 3BJFA 1ITUA 3KVLA 4XKMA 3TQVA 1UWSA 1A66A 3NYKA 5CJXC 3ME0B 1IBDA 3NACL 4PJBB 4FAAB 1KO0A 1QNVA 3TU9A 1EPXA 4MA1C 2WZTA 4QE1A 1YEIL 1IM3B 1XZ0A 3GSUB 2QXWA 4K8HA 1E5CA 3FB6B 3WLWD 4KKQA 5B3JE 1RZGA 4AEOA 4DF2A 1XEDA 3P0VL 1NDTA 4X9SA 3BSZA 3IJIA 3H42L 4QXIA 3FH7A 5IB4A 2PYEE 4OB5L 3W9EB 2FD6L 5I1DB 5FEPA 4NHUB 2R0KH 4I4WA 3W88A 5DEJA 5ADOL 1TEYA 3QS3A 1DVFC 1QRNB 5D1ZC 3U2IA 1OOAA 1OYAA 2R9RA 1N8OE 3TO4D 5GS0C 2WGXA 4IQJA 4KZEH 3V0TA 3RX5A 3II3A 1SSGA 2A6DB 4G9DA 3P9LA 3H23A 5FB8A 4G7QB 4C6QA 1UEMA 4Z1YA 1ADDA 4KNQA 5FECB 2OLAA 1AW5A 3CDZB 1NF7A 2I32A 4M7JH 1B9BA 1UXSB 3M88A 2R69A 4RMVA 1QI4A 5IF0B 2OXNA 3HA0A 3UEQA 2EC9T 4KQ3L 1GQJA 1ACYH 2FWLB 3LKOA 3ZR5A 2HZHA 3SYQA 3L2IA 4AD0A 3NIDE 5D9NA 5D70L 4TTUA 2NY0C 2JVUA 3G08B 4QYOA 4L9YA 2VDHA 1BZOA 2XXMB 4QXWA 5EPMB 3N44B 2PDCA 3FQUA 5F3BB 4O16A 3MHGA 5EOTB 4MD0B 4MNQD 3WQ6A 3DPBA 4MDPA 3TYGL 3H7LA 1OZMA 1M53A 2AMGA 4XVJH 3CUJA 1M68A 2JE8A 5A40E 1ML1A 2WC7A 1S7VA 5T1LA 4JR5A 3RR1A 4QCFA 2EIZA 3SO7A 4S0TD 4H0HB 1OVDA 2GK1A 5HULA 4BQ5A 1BMWA 3PWVA 4KXAA 4XNZB 3W2DL 3WHE0 1E9PA 5A6IA 5A2CA 1B6DA 5DD3L 3ZZSA 2ZXQA 1AQHA 4GVHA 5IQ9A 5CEWA 1CL7H 5D09A 1WT5C 3SCSA 2XZQH 4YLCA 3MBXL 5LHEA 3HI5L 2ZAHA 3Q5OA 4GAAA 5C9XA 1OJXA 4ZS7L 1Z0MA 3BN9D 3DZ1A 5EMJA 2MNRA 3IEAA 2H3KA 2DUAA 4WCJA 2C3ZA 3V0SA 2NNAB 1FZJB 2P50A 3LYEA 4AW4A 2Z27A 7ENLA 1BDYA 3RO8A 5AHIA 1RV8A 2F8QA 1HCZA 1H6TA 4XNQB 3KYNB 3FO1B 1KXQA 1KXVA 4GG6E 2XN1A 4P2RA 1GYVA 5FL0A 5E4IA 2GJJA 5EUOB 2BC4B 4A2EA 3Q05A 3TAOA 1AH0A 4QHPA 5F96H 4HUKB 2VR6A 3OF6D 1ZS8A 5D02A 3D18A 4UM9A 3U6RB 5HP5A 3GUWA 1O7DE 3I6GB 3ELQA 4U1NB 3S37L 1MCOH 4CUCA 5I1JH 2BOEX 4F8QA 1XF0A 2PDKA 3NCFB 3NPZB 4R4BA 4TNWF 3S4SG 1EXPA 3GR7A 4ETQA 5EC1B 5KZEA 3SJVD 1XWYA 2NY3B 4WHCA 3QXWA 3O6FB 1INQB 4LESA 4S3JA 3TN6A 1MFCL 3AQYA 4XD6A 4CNUA 3STGA 5HTSA 2X09A 1JF1B 4IGBD 4LVAA 1I7TB 4MDRA 1L0QA 4PBXA 4AQEB 2ARJB 4PFHA 3ARGD 5I23A 2DT2A 5K9JH 5BZDA 1NJ9B 1KBIA 1MDAA 2HT4D 1N0XH 3CU1A 1Y18B 5DRNB 3ZE2E 5IFAL 1TR9A 5F1UA 3QXUA 3Q2NA 2B7OA 1UWFA 3HNVH 4P7NA 1D3HA 1V77A 4I77H 5LB1A 2M26A 2X7LB 3ITCA 2OL3H 4UQ2A 1EEYA 4MUPA 5LAXA 1UP2A 2ENYA 1K4GA 1RHHA 3WH8A 1YUKB 1QA9A 2W1NA 5D1XC 1Z7JA 4A8LA 4C6KA 1D2PA 4TNWK 4LUYA 4R2GB 3TVMD 4GQ0A 1IQWH 3GM0A 1L9WA 4L4VA 1DUZB 4MPKA 2EC9U 2VIRA 4YN3A 3VZXA 3PZ9A 3C9NB 4KJPD 3IETB 4BH8B 1DWHM 3GH7A 5A8GA 4NUQA 1R3HB 4Z1CA 3UCRA 4FMVA 2K4AA 2VLKE 4Y8DC 2R8SH 2BP0B 5I6NA 1FDZA 2BOCB 4AG0A 4XCYA 3CZJA 1FNEB 2E8ZA 3Q9QA 3L8QA 3BAXA 4P2OA 2B0SH 2VGGA 5E8DH 3IFNL 3B37A 3W84A 4B7LA 2XQYA 5IJKA 1LO4L 3K6SA 2YDQA 4GAFB 1THFD 4N3TA 4P8XA 4X5RA 5JW4R 1PXGA 4XNDA 4D6EA 2E1WA 2NLIA 1NFIA 3AJ7A 3ULSA 3RF9A 5I74C 1E4WL 5DI8A 4F8LA 1G9MH 3P30H 3U4BH 4GUFA 1AQKH 1WDWA 3MLWL 1XPGA 4Z1BA 2WZ0A 2AXGA 3RJQB 2WOBA 3P74A 4Q6JA 4HDIA 3DX6A 4TVPL 5FGBA 1DYSA 3E0FA 3TR9A 3W25A 3W0WE 1H9DA 3DEQA 4AWSA 5BXSA 4TQPA 2OMXB 1XCXA 4NS0A 2PO6A 3FHAA 3GJEB 1Z9SA 2BS71 3MRJB 2WTPA 4UU9A 5FW6A 1XIBA 4QXGH 4EZMA 5SWSA 2XETA 2FRGP 2LQRA 3G9AB 4WWKD 4ADSA 3MBEB 3A23A 3LU2A 4MJJA 3X3GL 4WWNA 3UJSA 3VI2A 1KLUA 1XP3A 1IARB 3QEHB 4XAYA 4TM9A 2VUOA 1MQQA 1KGIA 1V02E 5EZLB 4EUPH 3SDAA 1EFXB 1ME9A 5FDWA 5HNRA 4ROQA 2W5FA 1GS8A 2R1WA 1S2AA 4C1KA 3OQ3B 5DJZB 2KLTA 3I9PA 3BURA 3IPFA 5EUKB 3WO8A 3A67H 4QY8A 4N0CD 2IPGA 1DE4A 1GYCA 5HVGB 4XKYB 3E8UH 5D6CA 1KLFB 2BOBA 3KHQA 1LMIA 4BFRA 2Z92B 2Z3FA 4F3FA 1YEHH 3VG9B 3NPUA 4Z2GA 3G5YA 2CIKA 1VKXA 1S5TA 2CMRH 2LR4A 3QNYA 1D2OA 4F7CB 3OLDA 4DOHB 2YGNA 3NMEA 4MMZA 2JCWA 4J5VA 1RA5A 4PL2A 1DCEA 1MW3A 5HGAA 5E5UB 1WBXB 4P3DA 3MV7B 3N0PB 4JFXB 2PP1A 3QUMB 4L18A 3APTA 1I3RA 3K2MC 4R7NA 3AMKA 1JCXA 5IHBA 5TPWL 5G5IA 1B3YA 3QJRB 2OR9H 4YXHL 2HH0H 2XIMA 3R0DA 4H6RA 1A2YB 4WHTB 1ROCA 3PNUA 2DQEH 1NMAH 1YKWA 4Z2KA 3IJYB 4NRZB 4UQ9A 1GTEA 1RUAL 2C18A 1NBYB 5T3XE 1N5YH 4H6EA 5HWNA 1CO1A 1L6PA 3SN6N 3UA4A 5E2TH 3OR7B 1OX6A 2ZZ5A 3FRUB 3U0PB 1R9YA 5D1ZI 4O18A 1NCTA 4ZOAA 2BMKA 1BFNA 5ENLA 1YPZB 3UGUA 3FN3A 5F1IA 1U3NA 1T2JA 1LO5A 2JCCA 4E9TA 5KSBB 1V7YA 3O0FA 2NWRA 2HBXA 4ORIA 5J5EA 4FTVE 3FU9A 2X6BA 5E9DA 2JTDA 3IPWA 1N3NA 3EWUA 3W1MA 4N0FB 4KDWA 3SRHA 4U0QB 1R86A 3OZ9L 2WW8A 1G4PA 3A13A 5D8JL 5KSAD 3WN5A 3W2MA 1PYMA 3A3WA 1URZA 1G4RA 5J6HB 4G6CA 1CVRA 1J1PL 1EQCA 2FJKA 1BJ1J 2AJUH 5IOPB 3Q37A 4F0SA 2QADB 1ISVA 3OKOA 5EZJA 3TFXA 2PXYA 3F4VA 3SCMA 4N0UB 2JKRM 4CU7A 1K6QL 1XL9A 1EFXA 5C71A 2R1LA 1T5WB 3Q13A 4GNJA 2EKJA 3ARWA 3N25A 4O50A 1K8IB 2VQ1B 1H0DB 3QM3A 4QNWA 3WD2A 4I6VA 1FQ0A 3S5ZA 2VR8A 3L5HA 4OJYA 1Q6QA 1PY4A 4K37A 1RUPH 4KFZC 3LPPA 4UT7L 3MRFA 5FWRA 1JPIA 2BP1A 4S1SH 3ZTNH 4M7SA 3FFDB 4POZC 5MEPA 4XPBH 3SDDB 4K5MA 5AB2A 3QISA 1J5OH 4OCXH 4K7YA 3MSRA 3SN4A 2J88H 3DX6B 2DEXX 5KW9H 4D6FA 1YRRA 1HVXA 3R6IA 1KIQA 1FOBA 3WXWH 1GQNA 3UJRA 3RWEA 1QPPA 5MENB 1NFDE 1ZDSA 4FYTA 3A6BL 1PLCA 2FR4A 1IGSA 3MKKA 4NJAL 4QRPB 2A74B 3P73A 3ZKQD 1CJYA 4ZXOA 2ZE3A 2BNRA 1B4KA 3V4UH 3EBHA 3ZJ7A 1X8CA 2C1OA 3MLSH 4NN5C 4R3SB 4KK8D 3IRPX 3FFCB 1KGWA 2XA8H 3QXDA 4XP9L 3FTYA 3ULUE 4J40A 3O6KL 5D7IF 4NQDA 1VYSX 4WU5B 4DETA 5KSBE 3FKKA 4JBRA 1EGZA 4XPAH 5ELIA 5EOCJ 4HIBA 1A6AA 1D5XB 4RFEA 2ADYA 3FO2B 3S46A 4N0CC 3KLQA 3SSGA 5K4ZA 2A9CA 4AZHA 4Q56A 2CBJA 4N2OA 2DM3A 4KKRA 1E9QA 2X4QA 2DIAA 2APBA 3IFNH 1IIIA 4NO0D 3SDDD 5EU5A 4PYGA 3UP1A 4RZBA 4FZEL 2OMWB 5A8QA 4YNGA 2OP4L 4CU8A 5EDSA 1F05A 2DQCL 4WFED 3W26A 1I1CA 4NQCE 3M0YA 2R2HB 2VRKA 3P30L 5HJ3A 1NCIA 5T8GA 1ZSDB 3LD8B 4M8QA 1UBSA 3SGZA 4PJCB 2VXUH 3QQ3A 3AROA 4I89A 1QR1A 3PJXA 1ID2A 4P99A 1HCYA 2IGLA 3UAJA 4NZJA 1SOKA 2MPAH 3HGSA 4AC2A 4K7PY 1V3JA 2CDGA 3EJZC 4BCXA 1A5NC 1H4PA 4PB0H 4PJ7F 4DKFL 5E8DL 3N13A 3QKEA 4DNMA 4KDTC 4ELDA 4FI7A 3KJ6L 3EGSB 3QDGD 1PCWA 4ZBCA 3D52A 3DGGB 4NKIL 1X9RA 3S1VA 4MX7B 2QPUA 1Q9OA 1H19A 4G8IA 2PDWA 2EPLX 1RMFH 1QG3A 3T4AC 2PRHA 4L4TD 2BO0A 4N2AA 2E25A 5D04C 2VI0A 4FG6C 2AK1H 3VXTB 5SV3A 5JBDA 5CJBA 5F9DC 1EC8A 3DX7A 4FS0A 3WHXB 3RU8X 3SGJC 3S2LA 4E8CA 2ZPKH 3MLSL 3WIHA 4FOMA 3GS6A 2J72A 4UFHA 3RLVA 3LEXB 2P8BA 2JJSC 3MXVH 4MQXC 1PVHA 2HX7A 4OBRA 2VXVL 4WY0F 3VGAB 3OBKA 2E59A 1XCFA 3VA2C 1KPUB 3G8RA 4WKFA 3SBFA 3C2OA 4DZBB 3GMRB 2RD0A 3DX0A 2HG0A 4A37A 3QUMH 3GVVA 3DETD 2Q7YB 4NJGA 3HIZA 4UV7H 2V5CA 1XGTB 1AZRA 4PVMA 4QG6A 4ZTPL 1QNIA 4LARL 4H04A 3PNRB 2DP3A 4DEPB 3D46A 3D25A 2G97A 4HYVA 1V55B 1JCNA 2WOYA 3WIHL 1GRWA 3PY9A 1IC0A 4UBDC 1KBLA 3JU2A 4LUTB 1XF5A 2XN9E 2CUHA 5E6ID 1AGDB 3LH2H 5T1KA 1DLHB 4QP0A 1DANT 4KMLB 4MB5A 1EF2A 2AGKA 5D8WA 1NICA 3GSNB 2AKMA 1USQA 2E1DA 3IUIA 1UACL 1U83A 3MXVL 4NUJA 3TNMB 2G3XA 2QIWA 4ENZA 1JPDX 4YIWA 4DF0A 1ND0A 4IU3A 1U2YA 3S3DB 4NPKA 2PW2B 3SZKC 1TQJA 1C7SA 1WAWA 5GHWH 2GVLA 4O52A 2P8PB 3ESMA 4D94A 4H0IA 1O7DC 4PMUA 1XB6A 2VISA 5DJAA 5EORH 4GVIA 3IF1B 3C60A 2V5DA 4OT7A 1DE5A 2UXVA 1VYRA 4M6OL 3QV9A 4XV0A 2OTUB 4HCGA 4MA8L 3SKNA 1ZV9A 4Z2HA 4Y5XA 3EG9B 4WV1C 4X6DA 3RILA 2C1PB 4K9JA 1I2NA 1XR2A 4CEXC 4LEEA 4X2UA 5FM8A 1RULL 2CLRB 5E24E 4GQGA 2A3HA 1DQJA 3DUUB 4XP6L 5FV2A 5CLZA 3PQYB 3LXAA 1GZHA 1KTKE 5EUOE 15C8H 1XCTA 1EZUA 4R7VA 1HWGB 3APFA 5DWUH 3LPOA 3PZUA 5MKGA 2X1PA 4J2MA 2FO8A 4TMCA 3THMH 3L68A 4CJ0A 4GW1B 3UZVB 3S3SA 4PBGA 4DWSB 1HEZB 1EO7A 1E6RA 4K8GA 1AZBA 2W92A 3BI9X 1WYIA 5KVDH 4WTQA 2B4GA 2VVNA 2IS7A 3VYLA 3RGTA 5D2WA 3V9CA 2N56A 1TO5A 1K85A 2GGGA 3U2OA 2QVHA 1MRFL 3KOFA 3DHUA 1QRNE 4E8GA 1R3VA 4XZBA 3UC0H 4JICA 2NSOA 4C65A 1ZLUK 4KXCA 1DQWA 1N59B 4XH2A 1F58H 1DVFD 3LHTA 4L9LB 5E4AA 3FUDA 3SYOA 4M7LH 1WBHA 5KSWA 2A77L 3QG7L 3F5JA 3F4CA 2AERT 4JDTH 1T89A 4P4KC 3KPRD 3D48R 1FZOB 2LV4A 5GRVL 2Q8BH 3HG3A 5EBGA 1MJJA 3HG4A 1X7FA 4E41E 3AIBA 1KJMB 4P05A 2WKLA 3W82A 4EBQH 1QYGH 1HQTA 4RX0A 1BPLB 3LQAL 4OD2A 4ODSL 3WENA 4L2LA 3DV4B 1RAMA 3GU9A 4N6RA 2ADFH 1X4YA 3CQKA 1SHMA 4B95C 1HP4A 4IL0A 4MAYC 1O5DT 4AMCA 2L7EA 4F3HA 3ULVH 1FA2A 1BD2A 2WBJD 1O7AA 4DJDC 1EEQA 4YCPA 1MFBH 1M65A 2YGQA 2IOIA 4JEGB 3UZWA 3R4IA 2ZYHA 3USBA 4PMNA 5JPNB 3P3TA 4AL8C 5G4HC 2MOGA 3GVRA 1XYMA 3VXSB 5C08B 2FMOA 4GW4A 2DQGH 4H26A 5FPIA 4MFDA 3TYFA 4B96A 1DBAH 4UCFA 2CKRA 2BP0A 1RVKA 2B1OA 1BVLA 1JWMB 2PRMA 1XLCA 2BRQA 4GMSH 4DJEC 2HROA 4E3TA 4B3EA 4E0CA 4QDWA 2X30A 4ATTA 4NC2B 4XCNB 1Q9KB 2PTTA 3BSHA 4HIJA 1SDDB 2CCWA 3Q06A 3DC8A 4K8EA 1T7XA 2J20A 3TO4C 4AQAA 3V18A 5EV7A 2QCFA 3LLFA 3P62A 4GKOA 3QEUA 4ZX5A 3SJVB 3OV6A 1IAOB 2WBWB 3H9HA 2NR6D 3HF3A 4HXBL 2GWNA 4GMTL 4GXVH 5HHPA 4IMAA 2KS0A 4P5SA 2BIIA 2XV2A 5AZ0A 2J7GA 3WIAA 3CJPA 4JO1L 2G4JA 1HZHL 3NPVA 5JQ9A 5D33A 1HVQA 1OP5K 1PKQB 1NMCB 2J12B 4YXKL 3IF1A 3OPZL 4GH3A 4RMTA 1WNOA 3L67A 4AZ7A 1NCUA 4F2MB 3R7QA 4X50A 1OW0A 4ZQKA 5C0AE 3VI3E 2BJMH 4H88H 1Y5VA 1ZRQA 1F6PA 4IFKB 4NUJB 4X7CC 3UJJL 1G7QA 5INDA 2PGFA 4IUOA 4AENA 3BZEA 4HF5H 3ECQA 3AXKA 1E5UI 5C54A 2GITB 4ETQB 2CE6A 4AWJC 4NAEB 3IPBA 4P2OC 3QJTB 2BIMA 4OFDA 4NNYA 5C0FB 2XKSA 4NQVA 4PV1C 2VRJA 2ZUYA 4HB7A 5HMFA 1F2QA 1G7JB 4A6YA 3N4EA 2DIEA 1U92B 3G5VB 1HKVA 3PXHA 4U7KA 1KM0A 4HU4A 3ZDZE 4PMQA 2WLLA 1SM3L 1R2SA 4K3JH 4ES8A 2CKSA 1ZOXA 2H6PA 4MJID 4K55A 1U8OB 2BRRL 5D7IA 5AEAA 4DZBA 1BIHA 5I1HL 5I28A 3DRQA 2OWXA 1BXVA 2O9RA 2E7CA 2QKSA 5E2TL 5IFAH 3VD9A 3FJLA 3LN3A 1EJRC 5CPSA 4UAHA 4PJBE 4BA8A 4UMCA 2PDIA 1FI8C 2CWXA 3O3EA 2R1PA 2NY5C 3F6IA 4XB8A 3PWJB 3ZE0F 1CXLA 4DP5X 5EOQH 5BVJA 4O51B 3KXFB 4EVNB 5I18L 2VD9A 3M86A 1EX1A 4MAUL 5EA9A 3HZKA 2N4IA 4OBSA 3FYYA 1MCFA 3ARDC 3OXSA 4A35A 2CHZA 2Y7QB 5CP3A 4F15C 4PUKA 4HX1A 1FH7A 4Y1AE 3JRKA 1LDCA 1G7HA 3II1A 3PFUA 5FO8A 4Y16D 3M7WA 2PMQA 3STPA 3GMPA 4ANKA 3CNYA 1MRDL 1UHVA 2CBOA 2CLVB 3I6LD 4FQ1L 3GXNA 1N7ML 4HEPA 3HC0B 5A6MA 2EICA 3U2EA 4YUEL 4AL8H 5JQIB 2F84A 3BSZL 2PPDA 1XD0A 5EOTA 2IKHA 2HVMA 5IVXA 1ILUA 1NP2A 4ZI8A 2HFTA 1IBYA 4HW6A 4BDVA 1Z5LA 5F1NB 4NCC1 5K3VA 1YCSA 3AS0A 2PC4A 5F97E 3A4DA 1M56B 1QRND 3WF0A 3VB8A 3RAJH 5F44A 3SKOB 1KQZA 4Y90A 4Z0XB 5GGUB 5CQ1A 4F0HA 3EBAA 2Y24A 5JR1L 4KT2A 3O2DH 4GO8A 4OIIL 5EU5B 4Y88A 4IBQA 5IK3A 5JW5A 3BUDA 2YMOA 3H9HB 4MMXB 2R0WL 2CRYA 1PX3A 4AITA 5ILTH 4JY8A 1SXAA 3VW3H 3OBAA 4XCFH 2EIDA 4YIQB 1K4CB 3QLDA 4M62H 4N7QA 5MHSD 1X1ZA 4OCYL 3GTIA 1KRAC 3SRDA 2OL3L 4QHMB 1A1OB 4TIMA 1ZHNB 3MR9B 3ZTEA 3UTSD 3IPEA 3F2BA 2OTWB 3VCCA 2WAQA 4RNRA 3WBDA 1R7AA 2Z7GA 2WSDA 4RPQA 3UR5A 1XGTA 4WU5A 1DL3A 1KFBA 5E2WH 3BLDA 4PWEA 3MROB 3U25A 3QW4B 1RUKL 1FNLA 1RP8A 1K8ZA 3W7CA 4JPWH 5BOFA 3MRHA 5DFWH 2AJSL 5FYKE 2NYKA 3NJ3A 1HC1A 4WDTA 2W0KA 1Q4WA 3FSTA 5IHHA 1JV5A 4CBZA 3KHDA 4FOUA 3GHEL 4QQUA 3OAUH 3X1EA 3EH2A 3TSDA 3TPUB 1TYJA 1KCUH 4FA8A 1DTNA 1ZALA 4ZQNA 1QLEH 1UFGA 4CVZB 1SQ7A 4JLRA 4JY6B 1ITBB 2Y06H 2WPBA 3NOEA 1RPQA 2VMFA 4YVNA 4HLEA 3UJIL 1X6LA 4CA4A 2AXFB 4NAMA 2IAAC 2WLLB 5CR1A 2Q6ZA 4X6CF 3C0LA 3I7QA 3WMBA 4AY7A 4J3OH 1I1RA 3GO1L 3B04A 2VSMB 1KGUA 3UPMA 3CAFA 2F58H 3LZPA 4FS9A 1UWXK 4AXWA 4M81A 1L0XA 3LSOB 1QUNA 1F8MA 4PW3A 1SNRA 4G80B 4KK5C 2JIXB 3N14A 2Y7FA 4O2FA 4C56E 4MF4A 3HMWH 5HDLA 5AZ2H 4N0UA 5B39A 2KQMA 4U3AA 4QXTB 2V38A 2DM2A 1KZQA 3U2CA 3B7YA 3MLTA 4GKZB 4NQED 4OQTL 1OWRM 4N9EA 4BEQA 5CPNA 5CBEA 2YD8A 1W37A 3O63A 3N9GH 2GBTA 1U3JA 5E2VH 3N34A 3NQCA 2P76A 4IIZA 5L88L 3H2MA 3FEQA 4KQ4L 4I5UA 5F7KC 3QDJB 3RP1A 4XP4H 2YBGA 1LO2L 1QVOB 2APTA 2MIZA 2QGHA 3FONB 4PRIA 1R46A 1F6KA 2ONEA 4NKCA 4PMZA 1E9QB 1T66C 1QPQA 2JEQA 3T0AA 2UY2A 3EPOA 4K2SA 5BMWA 4FC3E 1H7OA 2V3DA 5CINL 1OK4A 3F5LA 3KEDA 2A73B 3OKEA 1Z9AA 3ZFHA 1J8HA 5HOSA 4Y4FA 3NZGA 5FIEA 2O26U 2FTWA 4LCYA 3NDYE 4HLZG 4TVDA 2YK1H 4AV5A 1ZCRA 2WYSA 1R38A 2WMPB 5KVGE 1MLCA 5B1JC 1XVSA 5CEYA 2Z4TA 2I17A 5E0CA 3FFCA 3H4HA 3PNWB 1TWWA 4R9HA 3WD5L 2DZBA 2ZZUT 1XRVA 2H3BA 1F90H 3STZB 3L3KA 1YYLL 5CZXD 5JHDA 2SFPA 3UWYA 4TTDD 2F53A 1BVOA 1ISWA 1FZKA 3U9PH 1OTSC 1CYXA 1TPB1 4TOYL 3MGAA 4JIEA 3QJVB 5EFFA 4Q74A 1BX2B 4NEHB 1JAEA 4X7TB 5AAWA 4DFIA 4PGBB 3RURA 4AGNA 1YQVL 4JMNA 1GJUA 1BVZA 2WO2B 3CSYA 4LSQH 1ZA3B 4L65A 1D7BA 4HHPA 4H8HA 5DT1L 2VR7A 3RUGA 2P44B 4LOFA 4Q8MA 3FT0A 3BVNB 5JOEA 4WI4A 5HINA 4C6LA 5E8EA 4GY7A 3H42H 3E0GA 3GY1A 4JTEA 4Y19A 1BQ5A 4RE3A 5D9MA 1IGML 4DEUA 1EDGA 4BCEA 4IQHA 3P4OB 1JGEA 4OFPA 3AS2A 4AMKL 2OM5A 5LUMA 4C6FA 4XP1H 3HHMA 3QI9C 4P48A 2AJVL 1KULA 4M5PA 3IMTA 4RESB 5D7JD 3SYPA 3VXPB 5GVJA 1GVOA 2DMGA 5C0RH 3S1GA 3KPMB 2IAMC 1RIVL 1YEFL 3PJNA 2ZUMA 3IN0A 4JY9A 1A47A 3KDOA 3PF2A 2WB7A 1K03A 3EYQC 5HVHC 4XZNX 1RZIA 1CB4A 1I3UA 1EJSC 4R2GC 1V6TA 3OB0H 5IZ7A 4Z42C 3KL3A 1PCKA 3K91A 3IU4H 2OZ4L 3C8DA 3V0WL 3LN5A 1JYNA 2EPOA 1RXLA 2D3LA 5FLUA 1Q85A 4N9GA 1A4BA 1U8IA 2OSWA 3BJLA 5JQ6H 2WTOA 4M61A 2TRSA 3CUHA 8A3HA 3MRGB 2CDGB 4KROD 1GKPA 5MF5A 3GIVA 2ZZ1A 1ZTXH 4NO0A 3VFGL 1VFLA 1HL9A 1UD8A 3OB0K 2CHOA 3MRMB 5B22A 5B7ZA 4RRPA 3UTTD 1NCAL 4KRPD 1MCJA 1T8XA 2R2HA 4DWSD 2ZP8A 1GOKA 3SY5A 1PZSA 3MUUA 2KZ1B 5CEYB 1CURA 4QX4A 5HPCA 1OQOA 1PYWB 2IJ0C 3GJFH 5D96B 4RISH 3H9YA 4MNHA 5EUOF 2CBTA 4CVXB 5KYWA 3LLDA 5DELA 1KCZA 1X5KA 4NUMA 4JFEB 4PP2A 4QTHA 4HIXH 3FS9A 1L6GA 3IDIB 1KR1A 3EO1A 3BN3B 3VGHA 5LXVA 1JWUA 1DVXA 2AITA 2R7EB 4FTVA 3TWBA 2PNDA 4GKNA 2G2NA 1FHUA 4K36A 3B9EA 3ZY7A 4DKAA 2XV3A 4PGEB 4ZMNA 4XZWA 4GMTH 4GXVL 1QVOA 4ZQPA 1CDCA 4FQXA 3TV3L 5IMMB 2GJ6A 4P9HL 3BIBX 1ZT1B 3CIQA 1UH2A 1DBKH 2WZ5A 3WNMA 3MW7A 1OYCA 5I1KL 5IHUL 1IT0A 5ESQB 2WQVA 4NQXA 3ZJAA 3A3HA 2ZZ2A 3TW6A 3MP5A 3RB7A 3HMXH 1JRBA 2OOGA 5LYRA 3LGEA 1Q94B 2CD0A 2GPTA 2EH8L 4N0RA 4BFFA 2FYYA 2OCFD 4ZMAT 3G1FA 3MV7D 4OV5A 2EH8H 1RPXA 3MUGB 5DMIH 2OI9B 2FX7H 4P2QE 3MODH 4R0LA 4TULL 1SYVB 3S2AA 1G4MA 1VFBA 4S10A 4XAZA 4GUQA 3GBEA 2ZTKA 1DVQA 4UR8A 4HPYL 4Q9RL 3NSCA 5FA4B 2Q09A 4CEUC 4FLQA 5AW7B 4LRNH 1WBZA 3O9NA 1R3JA 2YEZB 3N44F 1OAUL 4KU1A 2B7QA 4XPBL 1TG8A 3V6OA 3QR2A 4TNGA 5DS8B 1QCWA 3OWEA 2PURA 3DSFH 1P6AB 1QLFB 1TQTA 4HDIB 2P8LA 3AGVA 3BGMA 5E2JA 4Q9QL 1LD9B 2IH8A 2Q1EA 3GXMA 3BPLB 4J3BA 9RUBA 4CVZA 3JWOL 5DRWB 3VFWB 3X17A 2ISWA 4JN2B 4FHJA 4W89A 5GSRB 1IGJB 5G1YA 4CCCA 3C6CA 1F13A 5JHLL 1QR1B 3P11H 3ITLA 4JHMA 5IW6B 4MRCA 2JQXA 3NCCB 1WWCA 4DHGA 3L1OL 1SXNA 2JKSA 4LHUD 4W86A 2R2EB 1RUQL 4MS8D 2CH8A 1R1CA 2X2IA 3ZUNC 3S9DB 1A4LA 1AOHA 1QFUL 5C9RA 5JBFA 4HJGA 4CN6A 4R0LC 4XAWH 4UDTA 5ANME 4LLVA 2WD0A 5CWSA 4LAOA 1XXFC 3HC3H 1BYNA 3SZ6A 3BAEL 1GUVA 4JO4L 5JHLA 1DCLA 4WGXA 3ELFA 4Q52A 4R9XA 1G9HA 1GJWA 4ZT1A 5DFAA 3S4SB 4YFEA 3M9YA 3N2XA 3NFUA 3TZVD 1H5BA 3BAIA 2X7LA 4NQDB 1UZ8B 2ADJB 4DZAA 1TZHB 4RWYL 1SFSA 2OCZA 3M7SA 4QYAA 1KFLA 3GDLA 1A2YA 1HILB 1W91A 4OZHB 5ALBH 3UTSB 2JLPA 2VW7A 4QCEA 2ZD0A 1K3ZA 3EFDL 1GOFA 2XBTA 2AXWA 3IAGC 3S3GA 4M82A 3M1ZA 3OWRA 4EPDC 1QHOA 4K7PX 3FYEB 3EO9H 3N06B 3VQ1C 4WJKB 1DV7A 2QIIA 3DXIA 4H3DA 3ZLFA 7CGTA 4AIZB 3DN5A 3HPLB 1EZVX 3RCMA 2RFXB 4L4VE 3MGTA 5DEGA 1A7RL 1SXSA 2XIBA 3O4LD 5TQ2L 3KX6A 4JYFA 1CICA 4QHKJ 4XUYA 2L7UA 4EACA 3CC1A 3HUJB 4HMEA 3KCPA 4G43B 4XPHL 1IV8A 4TSBH 5DJXA 2WO4A 2Z92A 3R0NA 5FB8B 2X16A 2FQEA 2DQTL 3LNDA 4D9LL 1ZS8B 1MPAH 1UUSA 1XIEA 4X22A 4XXDB 1TV5A 1A21A 2WKGA 3FUFA 2F58L 4I77L 2YN5A 1CDIA 4JDEB 1AI1H 3WGVB 4UV7L 1FQ9C 5JHDE 4LGSB 4R53A 3ZE0E 5IMKB 4P5UA 2Z91B 4R96A 3P4NB 3BK0A 2R24A 4A8NA 3N91A 3EKCA 2HS8A 2H0JA 4HWBL 5DD1L 5T3XL 4PB3A 1MCHA 5HI3D 2VC2B 4LCSA 3QFJB 3M46A 4H25A 8CGTA 1INEH 5I1CL 4W9IC 2VXVH 2Z1KA 1XBXA 1QLEL 3N6YA 2HWZL 5IVZA 5C0EA 5IOPA 2FTAA 4UU9B 5I1LB 4Y9NA 3FB5B 1O5QA 3W1RA 2IANA 4Y89A 3U6WA 1VENA 3MREA 4WI2A 2PSNA 4JG5A 4B5UA 1NC2A 3T0WA 2DKMA 1TFVA 1WFOA 4M5ZH 1U92A 3G5VA 4PJAF 4OVUA 5KWYC 1P1ZA 3ZT5A 1DWIM 1JDEA 5FEXA 4BQ2A 1N8FA 3RTQB 4PJ9D 4YO0A 3PWVB 4NN7B 4AD4A 5BOPA 3TSMA 3NO1A 3KGSA 4NO3B 1NELA 3L66A 3RI5F 1FYTE 1CZ1A 1J6PA 1LQBC 3V5DB 4PUBL 2GITA 3TZVC 3VD7A 1CMOA 2DQ6A 3MQIA 3SE4A 3KRBA 3DHJA 4KNSA 2F7PA 4XHJC 4J1UA 2B1AH 5B4MD 3VXUD 3WFDL 2A4ZA 4AZ8B 1O6IA 2OJPA 1UA6L 5I19H 4KWSA 5HMEA 3AUJA 1R6WA 9XIAA 5LWYH 3NQ2A 43C9B 3O2DL 4BH8A 2XM1A 1OB1B 5D72L 2VL5A 1M41A 2GL5A 1QOXA 5G2WA 3CPLB 2OW7A 1PV8A 1J8HB 2AQ2A 3UZYA 5J9PA 1W5NA 4JQ4A 4LAQL 4F0KA 1S1PA 2VX4A 1IQWL 1HH9B 3EB4A 1TX0A 1YYAA 1X5FA 2J73A 3D7PA 1Z9PA 3FCGA 1IKFL 1CICC 2DL2A 2JI2A 5L0QC 4IIGA 2VDOB 4RZ6A 2QDDA 2ASHA 4K71C 1WZ1H 3G5YB 4OGXL 1YDPA 2DBJA 2YLHA 3GZPA 2Y7EA 4YHIA 5C2CA 1ADQL 3KW8A 3QIBA 3O2DA 5AYQA 3ZHNA 4HK7A 3NA9L 2EUWA 4HBQA 2X4PB 3UX9B 2PXYC 1SXCA 3U0WL 3ZKNC 5FFGA 2FD6H 2MQGA 3NFPA 2BNUB 1I7TA 4G59C 4WFGD 2QJJA 2EEAA 2VGFA 5L6UA 3EOTH 3MRLA 4MZ1A 4Z0JA 2XSKA 4BSVB 4ZMVA 3KH3A 4X6EA 3I6KB 4E68A 2XIIA 4PCYA 3L4TA 4U1KB 1SJXA 4P5RA 2ZTBA 2J57A 3ZO9A 5IV2A 1P1MA 2GVEA 4M8RA 2W0LA 3H6JA 1E27A 1S7XB 4X7EC 1W6TA 2PMZA 2WZ6A 1ADWA 4S1RL 4W9FC 2NV9A 4XODA 1QBLH 3R1GH 3D0LA 4CC0A 4AKOA 4ES4A 4IBTA 1FFRA 1BVNT 4EIBA 4N8PA 4Q6KA 2XPGA 1FA4A 3RWGA 2QDHA 1ZAHA 2EACA 3M1BA 4F92B 2A5UA 2HK0A 3KOWA 4JQVC 4NLAA 5DHDA 1BZEA 3V4BA 3GLAA 1YG9A 1JHTA 4ZYKB 1IFRA 2NY0D 4LHUA 5CSZA 1BD2E 3SE8L 4ESKA 5AB9A 1I2RA 3EXRA 5EU6B 5JXQA 5FAGA 1IXNA 4Z7QE 2P24B 1FZJA 2OMVA 5REQB 4HIIA 4DKFH 4XPHH 3H12A 3VXMA 4MG4A