1HNYA

The structure of human pancreatic alpha-amylase at 1.8 angstroms resolution and comparisons with related enzymes
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HUMAN PANCREATIC ALPHA-AMYLASE
publication title The structure of human pancreatic alpha-amylase at 1.8 A resolution and comparisons with related enzymes.
pubmed rcsb
molecule tags Hydrolase (o-glycosyl)
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hnyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hnyA01
4URIA 1PZ2A 5I79A 1HWWA 1V02E 1PX8A 3NSNA 1Q4NX 5FL0A 3AI0A 3BAIA 2D24A 1C7TA 3AMDA 3SCOA 4Z2HA 5I6SA 4AD1A 3LXBA 2J62A 2J7FA 3CUJA 2F18A 5E70A 4W7VA 3PTQA 2VRQA 1V3KA 3W27A 3A4AA 1L8NA 3IAQA 2ZX5A 2WHMA 4FNRA 3WQ5A 1NWSA 1OM0A 2J7BA 4JCLA 1R85A 3EMQA 4IPLA 3T0BA 1CXFA 5E0CA 3WEMA 1PEZA 3ZJ7A 1OIMA 5EMYA 2YL8A 2DH2A 3OZPA 2A3AA 3T0AA 4IM4A 1UWSA 3S5ZA 2BY1A 3PBGA 1BG4A 4LQ1A 2WZIA 2DGAA 1QW8A 3DC0A 3VO0A 2FDMA 1QI0A 3AIWA 1ZBVA 2PWGA 3TONA 2WSKA 4D6CA 4M56A 2CITA 1KFWA 3B9EA 2CEQA 4MB1A 2Y24A 4CN6A 2GVYA 1JYXA 2EABA 3BVTA 2YFOA 4YN5A 2EPMX 4CCDA 4LGXA 2VRJA 4GI9A 2CETA 3ARTA 5A8PA 1W1PA 3O6AA 5IHSA 4QLKA 2PWHA 2ZX8A 4AMWA 2J7CA 3AHTA 2JALA 2X05A 4B9ZA 4JKMA 4J27A 3WKZA 4MNLA 2J79A 5CLWA 4UTFA 3N12A 4LX4A 5A8OA 1UR0A 1JF6A 2E9BA 1KBKA 1QWNA 3G6MA 4P7QA 3WUFA 2W61A 2OYMA 4RE4A 3SUUA 4HZ8A 2GK1A 4FNQA 5TD4A 3VKKA 4ATDA 2V38A 2ZXAA 3AYSA 4DO4A 1DHKA 2A3HA 1UR1A 2YDQA 5A6KA 3CV5A 2EEXA 5AC5A 4D6IA 2E3ZA 3AMGA 2G3JA 4R5EA 1E55A 5IXEA 5A6AA 4JFSA 4H04A 2XGBA 2WK2A 3LMYA 3U7VA 2WSPA 2ESCA 4AEFA 2ZUVA 1KCLA 1XSKA 1W9XA 3DX1A 1WO2A 3VGEA 2WC7A 3MU7A 1CXKA 1VIWA 2WLZA 3S6TA 2FYVA 3GTNA 3ZT7A 3VPLA 1TE1A 4WF7A 5CXPA 3MSGA 2D0HA 3BSGA 2YL6A 1HF6A 2AAAA 1KWGA 3MUIA 2WWCA 4XZBA 3VSUA 1UZ4A 3F5KA 2QV4A 1JF5A 4J3SA 2XHYA 3WDRA 2CBVA 3CZKA 3AIQA 3GZAA 3SCNA 2C8NA 3I3BA 3S5YA 1O7DC 1PIGA 3CMJA 1GJUA 4H2CA 4B15A 3W6LA 3WQ6A 4ZFMA 1WZAA 3SUVA 5HOSA 3UEQA 1J11A 1WDPA 1B3XA 3VD4A 1ISXA 3PZIA 1G94A 4HPGA 4GZJA 4A4AA 1M04A 3VGFA 1CXHA 3VMOA 4JZ5A 1UQYA 3RM9A 1FH7A 2DDXA 3ALGA 1EH9A 4PTXA 3BVVA 3TTSA 2NW0A 1LF1A 2DQXA 4OZOA 1Q6EA 4HA4A 1BAGA 4GIAA 4N0RA 3RIKA 1MQQA 1JDCA 1NP0A 2WHJA 1HKMA 5AY7A 5A1AA 2VX7A 1VJSA 1K9EA 4AXNA 2F61A 3IK2A 2VL4A 1JI1A 4KGJA 2VZSA 3DX3A 1HJUA 1R87A 4MDOA 3B9AA 1WPCA 1CTNA 3AZRA 1J0YA 1P6WA 1E5NA 2VO5A 4M29A 1WNOA 4AZ6A 1V02A 4BQ5A 1PIFA 1VF8A 4WLCA 1GPFA 1GZJA 5LA0A 4RE3A 2XVPA 4HP5A 3THCA 4Z2KA 4MTVA 2D73A 2WVSA 4JFUA 2ZOXA 4E2OA 3APGA 3PZMA 1E1EA 3EDJA 2O9RA 3WL0A 1PX3A 4TTGA 5E0FA 1E6RA 1WZKA 4A3HA 3W25A 2VZTA 4HMCA 4HOZA 3NDZA 4OGZA 1ZU8A 3DX4A 3SCPA 1KGXA 1K6AA 2D3NA 5I3DA 1H1NA 5ECUA 2UY3A 4U5IA 1XCWA 1H5VA 5FOOA 4S3KA 3DHPA 3UG3A 3ZO9A 1W3LA 1QNPA 4R27A 3VIJA 3VNYA 4DWSA 2DEPA 4HOWA 1ITXA 4HA1A 3BC9A 3EDFA 1VRXA 2EQDA 2G3MA 3WNLA 3OLGA 1WKYA 4W89A 2XPKA 3BLBA 2BVYA 4QFUA 3AS0A 3HU7A 1CGTA 2DPEA 1V0NA 1KCKA 1OD8A 2PF0A 3CZ8A 5D9PA 5BXTA 1LWHA 1W9VA 1HIZA 3W81A 3KEHA 1X6LA 1NWUA 2JE8A 3ARZA 1OWQA 2ZUUA 1VBRA 4JCMA 5GNZA 2XM2A 4W86A 2E40A 3ZR6A 1V08A 3VGHA 3EJSA 1E9LA 3AXIA 3CUIA 1H3GA 4AD0A 3F5JA 3WD0A 5A3HA 1NP2A 4JL2A 2VI0A 4MNKA 1UKTA 3W29A 1J0HA 3LRMA 1GOOA 1S46A 3CBWA 3PZNA 3N9KA 2WMKA 2AMGA 3WNPA 5IFPA 2VNCA 1NWRA 3K8LA 3NJ3A 1VFMA 4ACZA 4P8WA 1H41A 1GOKA 3AHYA 3QGVA 4UQAA 2DIJA 2VQUA 1E4MM 3A24A 4S3JA 1US2A 1T0OA 2CKRA 3UCQA 4KGLA 3DYPA 2O9TA 3WDHA 4IUGA 2JF6A 2GJXA 2OWWA 3L4WA 5A6BA 3VSTA 2VQTA 4B16A 3B9DA 4GI6A 1E71M 4AC1X 3CC1A 3PZVA 3A21A 1L0PA 3T2PA 3ZM8A 8CGTA 2BVTA 3FAXA 1TQVA 3MO4A 4GPNA 2A3BA 4IISA 1BVZA 4DUVA 4E8CA 3GH4A 1E0XA 3A22A 4W7WA 2WMIB 3PZOA 4OKDA 1V6VA 2XVKA 4KMQA 4V27A 3WDQA 2Z1KA 4DUXA 5I78A 1H11A 1JZ4A 3N11A 2RGMA 3BMWA 2GUYA 3LXCA 1OB0A 1KBBA 3O2LA 2Y8VA 4B3LA 3OLEA 3AIVA 3EMCA 4CUCA 5FCZA 1HXJA 4WKHA 3K4DA 4N42A 3QHOA 4H41A 3N1AA 3RM8A 3BLKA 3LPPA 1C90A 2EADA 2EPLX 4CGTA 3U57A 3BUPA 4U3CA 3PTKA 1BSIA 4QLJA 2QLYA 5CSUA 1XD1A 1BGAA 3WD2A 4PMRA 1ODZA 2D0GA 2JEPA 3T08A 3SCTA 1QOXA 1BTCA 1RPKA 2ZX7A 3AISA 4TX8A 1J10A 1W9UA 3MV01 2X8RA 3WQVA 3ZJ6A 3SCSA 4IPNB 1EQPA 4P7RA 3TTYA 4LYRA 2WHLA 4UFIA 5DT5A 2WBKA 1B3ZA 1HTYA 3ALFA 5CSYA 3LRLA 4AZBA 1GQIA 1WDRA 2XWEA 3AHZA 3K8MA 1V0KA 1YQ2A 3WH5A 3ZT5A 2EXOA 4QP0A 2WBGA 2F1AA 2WVVA 4JHOA 3GXFA 3AHVA 1R47A 5FIPA 7TAAA 1R86A 5JIWA 2Q8XA 2YA0A 1VJZA 3CUFA 3VD5A 4DWSC 1HKIA 5HBFA 1V3IA 4LPCA 2DSUA 3SUSA 4Z2JA 4CVUA 1FA2A 4W84A 1V03A 4ACZB 5DO8A 1OCQA 2OSWA 1BGGA 2J74A 3BSHA 1E3ZA 1BVNP 1WP6A 3L4UA 3VNZA 1I1XA 2GJXB 4MNMA 2CCRA 2WPGA 1UR9A 9CGTA 3CHFA 1ZB5A 1UHVA 1J18A 2VVSA 2G4FA 3GBDA 1IT0A 3W24A 3WMCA 3MUY1 2J7DA 2WMFA 3IJ9A 3ZSSA 2WHKA 3VGBA 3VUPA 2WZHA 4HTYA 1EHAA 5F7UA 2VVNA 4KWUA 3D3AA 3D52A 3JUGA 2VC9A 1HVQA 3KL0A 1MW3A 2Y5EA 5JUVA 3EJRA 3M07A 1A3HA 1XH2A 1XC6A 1IZJA 2J78A 4D6FA 1DWJM 5E9AA 4D6JA 4V28A 4CCCA 4FMVA 1G5AA 2UY2A 3HZ3A 5A6LA 1TG7A 4Z2IA 3BAXA 1J0JA 4FLQA 1ZBWA 4JFWA 1N82A 1JFHA 1R7OA 4J28A 1V6WA 3W4RA 3ARVA 2VZVA 1HKJA 2JEQA 3EYPA 3B8SA 1W2PA 5A8NA 1QPKA 1B3YA 5DEZA 1JYVA 2UY4A 1QX1A 1HJWA 3MMUA 3J7HA 4RL3A 3FHAA 3I3DA 3A23A 3AMCA 2G8ZA 2PWEA 1FOBA 1E6SM 3GNPA 4AY1A 3UETA 1Q6CA 4AIUA 4AIOA 4W87A 5HNNA 1RP8A 4GI8A 5A69A 1FFRA 4UCFA 1JAKA 5AC4A 3AS2A 3VMNA 2WW5A 2W62A 1WDQA 5BRQA 3OZOA 1EHNA 2OW7A 2J25A 3F5LA 3LXAA 1KTCA 3CHCA 2VX6A 2ZXBA 3CH9A 5A8MA 3WDIA 4BQ3A 2CHNA 3AROA 5I24A 1ISVA 2WVVB 3PZ9A 4HMEA 3N15A 1WAWA 3AZSA 5CZKA 4WSKA 2UWFA 5EB8A 1B2YA 2XVLA 5E09A 3OGSA 3OBAA 2XN2A 4TUFA 3VOCA 3EMZA 3H53A 3AS1A 1HJQA 3ZJKA 2F1BA 4BZYA 3GH5A 4XX6A 2OYLA 3KLKA 4NX0A 1ISWA 3VIIA 1E70M 4BS0A 4DM2A 3WY3A 5D8WA 1MXGA 2W4XA 2EPKX 2WYSA 5CPSA 4U3AA 3CZJA 1E1FA 3NCOA 1AVAA 2XSBA 3VM5A 1QHZA 3DYMA 4E8DA 1QI3A 2GSJA 1QNQA 2YOCA 4PMVA 5BXRA 4HPHA 1Q6GA 3N13A 4EE9A 1V3HA 3FAWA 1U30A 1V3MA 4NXKA 1CDGA 4GZEA 1MVYA 2DH3A 2A3CA 2WVUA 1U2YA 3BUIA 1J01A 2EPOA 3RMEA 2NT1A 2WB5A 4J7RA 5DFAA 5HDRA 1J9YA 4FNUA 4U2YA 2CNCA 1KQZA 4UQDA 1B9ZA 1E0VA 1H09A 4ZXOA 1QBAA 3BLPX 2HVMA 4OUEA 3EJUA 4CD5A 4D1IA 5A2BA 1CLXA 4PMOA 1US3A 2ZIDA 3GXTA 6CGTA 2OSYA 3BMVA 2YLLA 5A6MA 5LA1A 3AXXA 3M6DA 4U5KA 2V3DA 3ZQ9A 4J3TA 2WC4A 2GJPA 1LQ0A 2XVGA 4X0VA 4JIEA 4H8UA 4H8HA 2J47A 1GNXA 3GXMA 2CESA 4CU7A 3BGAA 1SR0A 4D6GA 1GONA 4JKLA 4QCFA 3WQ8A 2O9OA 3WL1A 2EO7A 5CGMA 4Q22A 4TVDA 3FY1A 3MI6A 2IXUA 3T09A 1WCGA 4JAWA 1LL7A 1FH8A 5BROA 1LJYA 1UWUA 1NOUA 5E1QA 3L4VA 3AOFA 1HKKA 1LG1A 1PBGA 1RD6A 2OW6A 4FNTA 4W85A 3W38A 1OD0A 3AQUA 2O92A 4U31A 2XG9A 1EO5A 1H0IA 1MFUA 3SEPA 2W91A 1KGUA 1BG9A 1MWOA 3AIRA 4MPKA 1UD4A 4AD5A 1YHTA 2NT0A 5A6SA 1JZ3A 4CVWA 2WCAA 1PJ9A 4ACYA 3CO4A 1CLVA 3LX9A 5EFFA 3W82A 3AJ7A 1UH3A 3A6OA 2OSXA 1QBBA 2XN1A 1UA7A 1XSIA 2WCGA 4AZ5A 1EXPA 2D22A 3D50A 1V6UA 1ODUA 1DWGM 4M82A 1HX0A 1UKOA 3BVXA 4CD7A 1V3JA 1UWQA 1ISZA 2PB1A 1E3XA 3IJ7A 3WH9A 3MV11 1JD7A 1JFXA 1NOWA 4MB3A 3ARRA 1XH0A 3HG2A 4W5UA 1SMAA 3WBEA 1GOMA 1CECA 4GO8A 5GQBA 1AMYA 5JBEA 2IGTA 3CZNA 4EAMA 2PWDA 4BCEA 1JDAA 3H54A 2GK1B 4UQEA 5GNXA 3WD4A 2EAEA 3H55A 5IFTA 2O9PA 2XWDA 3WUEA 3BVUA 5A6JA 3ARWA 1E15A 1VAHA 5HXMA 2GDUA 4CKQA 5C8BB 2ZWZA 4BA0A 4BQ4A 4PTMA 3OB8A 3FXYA 4OOZA 3PTMA 3L4XA 2CYGA 1PAMA 4FK9A 3AIUA 2TAAA 4WKAA 3BAKA 3DX0A 3CLWA 4JHZA 3BCFA 3PZGA 4ATLA 5ABHA 3POCA 1KXQA 4UOJA 1KR0A 1BFNA 2EACA 2W67A 1CXLA 5JIPA 4P8VA 2F7QA 1W91A 4ZEPA 1CGUA 2XFFA 2XSAA 1NQ6A 3OLIA 2ZUNA 2F7OA 3W0KA 1TVNA 3MUZ1 1G01A 1B31A 2UY5A 3L2MA 3G6LA 1JD9A 3VVGA 2F7PA 3MS8A 1KB3A 2BS9A 2WAGA 2QF8A 5E6ZA 5ABFA 3AICA 1X6NA 3IANA 3U7BA 3FNDA 3DDFA 2DSVA 4H8VA 2VR4A 1VB9A 4DM1A 3EJQA 5LYRA 3OLDA 1W3KA 2FHCA 4BF7A 4CN4A 5BXPA 1GW1A 1V0MA 1FFQA 3BCDA 1NWTA 1KTBA 3VIMA 2BY2A 3PHAA 1Q6FA 2PBOA 2E8ZA 1JXJA 3KL3A 3QHNA 3HG3A 4CD6A 4Z2LA 3WY2A 1TCMA 1W9DM 4K68A 3VINA 3WELA 2XUCA 3OIHA 1BYBA 3WNMA 2VURA 2QPUA 4YHEA 3RJXA 2XIBA 3L4ZA 2D2OA 4FNSA 2AOSA 1HL9A 2ZXQA 1C8QA 4D71A 2XGIA 3WF2A 3AYRA 3CHDA 4PBGA 1TFVA 4AWEA 3GBEA 1ITCA 3ZJ8A 5M5DA 3VILA 3VU2A 2YLAA 3BVWA 1UR2A 3WN6A 1QHOA 3W6MA 1BYCA 3L4YA 1OBAA 3U5YA 4AZGA 1GQKA 5DF0A 1JGIA 2X1IA 1MFVA 1UD6A 1NH6A 3TA9A 3MSDA 1GHSA 1UR8A 2VMFA 1ZBCA 4UR9A 2G3NA 5CPTA 2NSXA 4F79A 3RM4A 1R33A 3UERA 2PI6A 2ZXDA 5IDIA 2Y2WA 4OBSA 4UQBA 4MB5A 4MNJA 3WF4A 4E4PA 1Q6DA 3L4TA 2ZUTA 1UWIA 1IZKA 1U33A 1TQUA 2JIWA 4WKFA 4C7GA 2C7FA 3POHA 2YDRA 3WFZA 1CGYA 1QHPA 2Y4SA 1KXHA 1OSEA 1UOKA 1V6XA 1G0CA 3ARSA 2VR5A 2VRKA 2F2HA 1HP4A 1TZ7A 2J7HA 3CMGA 3GYCA 2XN0A 1QWUA 4DWSB 1DWAM 3KL5A 2B31A 4PCTA 2VTFA 2YIHA 1H0GA 1NARA 1JZ8A 1MW2A 3KLLA 1JI2A 1UWTA 4AMCA 1W1YA 2J75A 4XV0A 2ZUSA 4XUYA 2HISA 4JKKA 2J8GA 1W9BM 4GXPA 2X09A 3NSXA 4LYQA 2ZUWA 4ZENA 3TOPA 2ALWA 1HVXA 5ABEA 2D20A 3GM8A 3CUHA 1AQMA 1E5JA 1FHLA 3BAYA 3MANA 3VDCA 3HG5A 5C71A 3MUAA 4PMZA 3BUDA 1EA9C 1FHDA 4PYSA 5CPQA 1ZJAA 3UR7A 5C70A 1BHGA 1D2KA 5CJ5A 1M53A 2WANA 4P8UA 3QHMA 2DT1A 4NRRA 1M03A 1CYGA 4AD2A 5M3WA 4TTUA 5GNYA 2WM0A 1W1TA 4YHGA 4ML4A 1J0KA 1G1YA 5GPRA 1QI2A 4TVCA 4HZ6A 4MADA 2J77A 1UWRA 3D4YA 2FH8A 4ATWA 3DECA 3EDEA 1R46A 4PMYA 4QLLA 1C8XA 2W63A 1OT1A 1HJVA 1LWJA 4NZJA 3VD7A 1CBGA 1DP0A 1GJWA 2CXGA 2D23A 2E8YA 1EIBA 2CBIA 4MB4A 2ZE0A 4M81A 3FN9A 1E6NA 4AIEA 2YL5A 1E4IA 4HOXA 2W5FA 2GJRA 5FKYA 4CU8A 1PZ3A 4Y7EA 3WNNA 2BVDA 1TUXA 4JL1A 1KXTA 4H7VA 2OYKA 2VX5A 1UUQA 1EDTA 4AEEA 1PS3A 1MYRA 4CD4A 1QNSA 4GQRA 4UFHA 5A8QA 1VEOA 4AZ7A 2WKLA 1JIBA 3W37A 2J7EA 4B9YA 5BXSA 4OJYA 2DT0A 5KEZA 2IUZA 4D6DA 1DWHM 1EGZA 3RDKA 4NXSA 2BHUA 4LYPA 3DYOA 1E73M 1QI5A 1J12A 1GORA 5D9NA 1KQYA 1UA3A 1X1NA 3E1F1 3NIYA 4NSBA 1W1VA 3VD3A 2JIEA 5CG0A 2QPSA 4BQ2A 1EOKA 3ZT6A 3TP4A 4L4OA 1ISYA 1Z32X 1SFSA 5LA2A 3SUWA 3WIJA 1WZLA 4AZCA 1GVIA 5JBFA 3NUKA 4KRTA 2VZUA 4FNPA 4TOQA 1SYTA 3T2QA 5A2CA 2J7GA 3K1DA 2ZWYA 1KWKA 1HXKA 2WKGA 3IGUA 4AZIA 1H4PA 2ZX9A 2QMJA 3D4ZA 2XJ7A 3VM7A 1JAEA 2CPUA 2XIIA 3BH4A 1CGVA 1CIUA 3DDGA 2YDSA 3WMSA 3D51A 4UQCA 3PN8A 1BF2A 2VZOA 2E9MA 4FLOA 1W3HA 4X9YA 3WD1A 5FD0A 3CZEA 5CQ1A 1M01A 1PPIA 2WMHA 4PUDA 1VENA 4UFJA 3GH7A 2YJQA 1OGBA 1W9PA 3IJ8A 4AZHA 1UQZA 2XYLA 4ZXLA 4J3XA 5JBDA 1J0IA 4W8AA 1A47A 1UG6A 2PBGA 4TVUA 4JFVA 1LL4A 3AMKA 1WZMA 1DEDA 1NM9A 2D3LA 2ZX6A 1LLOA 3KE0A 1E72M 3VGGA 1HN1A 4M1RA 1XHGA 3CUGA 2WZEA 3S2CA 1BYDA 4KH2A 5I23A 4MJ2A 2YBUA 2JF7A 1UKSA 4TX6A 1TVPA 1CWYA 1C7SA 4Z2GA 3PZQA 3F4VA 1UD2A 1ZS2A 1UKPA 1TMQA 3CPUA 3LPOA 3UR8A 2D0FA 5AYIA 2EPNA 3K4AA 5BWFA 3WUGA 5BCAA 4AYSA 1JZ6A 4NZFA 3ARYA 2F7RA 4PUEA 3ARQA 3HMCA 1XSJA 1HNYA 4M8UA 1GQLA 3EBVA 3II1A 1ZL1A 3CGTA 4HA3A 3EJPA 4EKJA 1UZ1A 3D5HA 3WD3A 3VMPA 4FLSA 2QMKA 4AW7A 4PCSA 4FLRA 1ZBKA 3QOMA 4UFLA 1CXIA 3WFLA 1VFUA 4UQ9A 4OBRA 1UYQA 1I1WA 1V3LA 2YL9A 3AHXA 3FW6A 3WH6A 1JZ5A 3K8KA 3ZIZA 3KZSA 5D9MA 3FHQA 1F4HA 2BY0A 4QAWA 3UG5A 4DO5A 4P7LA 2V5DA 2YBTA 1VFFA 1C8YA 4UZUA 4PMDA 3SCRA 2CKSA 3GDBA 1CGWA 3VIHA 2FHBA 3VSVA 3TV8A 4W93A 4PMNA 1C92A 4D6HA 4PTVA 3VTRA 1TA3A 3UESA 4F9DA 5D9OA 1EQCA 3W26A 3VDHA 1JG9A 4YPJA 1VEMA 3TTQA 1UH2A 2X2IA 4AZCB 4WSJA 5BYWA 1QNOA 2BV9A 4LXFA 1UASA 1EDQA 3SUTA 2WNWA 2BXYA 1GUVA 3CHEA 4A3YA 1R34A 3DX2A 1TQWA 4J3WA 4GKLA 3VGDA 2CIPA 1SZNA 5ABGA 2RGLA 3T2OA 1XGZA 2V3EA 1K9FA 4ZE4A 1RP9A 1J0ZA 3WH7A 1W2VA 1QNRA 1GCYA 1B3WA 2X0HA 4PRWA 3AIBA 2X2HA 3BUBA 1XD0A 4NI3A 3ZR5A 3ARUA 5A95A 2X0YA 2XM1A 3WUBA 3UG4A 3M7SA 4HZ7A 4HU8A 3WQ4A 1JYNA 4UZSA 3CTTA 4W8LA 3WY1A 7CGTA 3HN3A 1M7XA 3ARXA 4P8XA 3SCUA 5FL1A 3WEOA 2VCBA 3CIVA 1UD8A 1KXVA 1UR4A 1JNEA 4AISA 3WENA 1HP5A 4W7UA 3WSUA 4UOQA 1V6YA 2W66A 3L2LA 3OG2A 1B3VA 3WNOA 3MMWA 5A2AA 3OGRA 2EJ1A 1UD5A 3VX0A 1VFOA 1OGSA 2BHYA 4RE2A 5EBAA 3VIKA 2WMIA 1GVYA 3N18A 1H49A 2ZUMA 5M03A 3VDBA 1BPLB 4GO9A 2WLYA 2X2YA 1GQJA 3VIPA 4D1JA 5CGTA 5HPOA 5I5RA 3O9NA 1PX4A 3VX1A 1WDSA 1GOQA 4WIWA 4GINA 2BXZA 2DSWA 1NOFA 2QHAA 3W53A 1E6ZA 1EOMA 1I75A 1W32A 1JNDA 3MMDA 3GXPA 2VCCA 4HU0A 1E6QM 3NYDA 1VBUA 2VCAA 5D4YA 1B0IA 3AIEA 1GOIA 1XCXA 2YFNA 3WMBA 1QVBA 2FE0A 4PSRA 3SURA 1WB0A 2X2JA 2OWCA 2WMGA 3CZLA 1F4AA 1V0LA 4DWSD 2DT3A 2J4GA 2G3IA 3AMLA 3A47A 3NSMA 1UH4A 2CHOA 1OGGA 2CBUA 1XRVA 5CLTA 4U2ZA 1ESWA 3ZMRA 1CPUA 4OOUA 5BRPA 3VIFA 4J3VA 3WNKA 4P7OA 1OIFA 3M46A 5E6YA 4NZCA 1XH1A 1TA3B 2FGLA 3VIGA 1TQTA 5D8ZA 1H2JA 4QDMA 2CBJA 1R8LA 3EDDA 1LG2A 3WF3A 1CNVA 3HG4A 3WBAA 1QW9A 4C7FA 4CU6A 3RO8A 3RILA 3EJTA 4UFMA 1BYAA 4U33A 4W5ZA 1B90A 4MDPA 4OIFA 1EDGA 4D6EA 3A5VA 2F8QA 1AQ0A 5DT7A 1E4LA 4M80A 4W88A 3NDYA 1E4NA 2VUYA 3SCVA 1Y7VA 2WVTA 1C3FA 1MXDA 4UFKA 2WCSA 2XFYA 4CCEA 2DIEA 8A3HA 3GXIA 5A6BD 4UOZA 4V2XA 1HJSA 3N04A 3QOKA 3WH8A 1AQHA 3KWXA 1TQSA 4PMQA 3TTOA 3MKKA 2OWXA 1EO7A 1CZ1A 4WJXA 1XYFA 1VEPA 1BQCA 3VDAA 4HMDA 4EANA 3K46A 2YA1A 1JYWA 4DO6A 2GFTA 1B1YA 2XVNA 1QI4A 2E4TA 3DHUA 1LL6A 2DSKA 1ZJBA 1D3CA 4DUWA 4AMXA 1C93A 3A4XA 1G9HA 1E6XM 4PSPA 3WEZA 4PEEA 1E56A 2E9LA 4ZE5A 4MAZA 2PWFA 4CN1A 2YA2A 1DWIM 3RJYA 1CEOA 4F66A 4XZWA 2WWDA 5AYBA 2VX4A 2WMJA 3LPGA 3GXNA 2MANA 2A3EA 1CXEA 3A4WA 4PN2A 3GNOA 3AFBA 1W3JA 3WF1A 3OGVA 1FP9A 4W8BA 1K9DA 4EK7A 4AD3A 2C0HA 2BHZA 1E6PA 2G41A 2BY3A 4F8XA 1HJXA 4GQQA 3VIOA 2XTKA 3ECQA 3CZSA 3EDKA 1MW0A 3GXDA 4MJ4A 1ECEA 1JL8A 3HJEA 4GZIA 3ZOAA 2V5CA 1JDDA 1C91A 3WQWA 1UD3A 4M24A 1DWFM 1E0WA 4PTWA 2YKKA 2Z1SA 1K9TA 4PMUA 4X0NA 1OINA 3BAWA 3VD9A 2BFGA 5KZ6A 1GOWA 5DMYA 2OLHA 3WY4A 3OA5A 3WF0A 4CD8A 2D1ZA 3LRKA 3SCQA 1D7FA 4FF5A 5ABFB 1XV8A 1O6IA 3RCNA 3CZGA 1XYZA 3GNRA 1HT6A 1CGXA 2GDVA 3SIMA 3SCWA 2PC8A 2WXDM 4TXEA 1SMDA 4XB3A 1MW1A 4NRSA 1HL8A 3PZUA 4JFTA 2VOTA 5A94A 6TAAA 1RH9A 3U5UA 3PZTA 2XFRA 2FH6A 3RPMA 1E40A 3AS3A 1MQRA 3W28A 3WDPP 5I77A 2FGZA 3ZSTA 1OT2A 3BXWA 1UKQA 1R75A 2CERA 1KR1A 1FH9A 2E0PA 2DT2A 2BNJA 2VJXA 5IHRA 1GHRA 7A3HA 2J8FA 3A3HA 4QCEA 1KGWA 2EBNA 6A3HA 4J3UA 1JXKA 2ZICA 1E43A 2DSZA 3QR3A 4WK9A 3WDJA 3T0DA 4P7NA 1R7AA 3I3EA 2VT0A 1BLIA 3BUQA 2IXVA 1MQPA 5I2UA 3AZTA 4MAVA 1IV8A 5HPCA 5EFDA 4L4PA 3N17A 4F9JA 3AXHA 4KRUA 5I0DA 4NF7A 4UNIA 3ARPA 4PMXA 4D72A 2V3GA 4Q7NA 2FHFA 1CENA 2V3FA 1O7AA 4AYGA 1JZ2A 4AD4A 3IAPA 1JZ7A 1DTUA 2WC3A 4C7DA 3THDA 1WE5A 1FP8A 3BAJA 2W92A 3LPFA 2Y8KA 4B3KA 1B30A 5M17A 2JFEX 1TR1A
chains in the Genus database with same CATH superfamily
3CYVA 5FM5M 4G8FB 2EECA 1P4IH 4B9CA 3BAIA 2WXKA 4ZUWB 4PW3A 1IBFA 2NNFA 1JV2A 5LNEA 3IPEA 1T6MA 2VRQA 4OQVA 1YMHB 5EEZA 3JYBA 3BSZA 1AZBA 4F7TA 4DZBB 3VE9A 4GFSA 3SJVD 1BQGA 1OIMA 2A3AA 1JUBA 4NM4L 3ZDXE 1CT8B 4NYYA 3ES6B 1PL9A 4ZB2A 5JIDA 5HVFB 1P48A 1XBYA 2HYMA 5ENLA 4W1TA 3B9EA 2Y24A 4DAGH 1FNSL 2EPMX 1UZ6E 1S2TA 4PY8J 4HDIB 4WUUD 5I8OL 3WKQA 5DXWA 1XF1A 4F2MB 5C08B 1YRRA 3WS6A 2VUKA 5FO2A 4QIUA 2XFGB 2YD3A 1UR0A 5I1LB 4JFZL 3BKJH 3QZ6A 2W61A 1RA5A 3SUUA 4NC1E 3SYQA 4K23L 5I15H 3WXWL 1MG3C 2XSKA 1K4CB 5EO0B 4W9DC 3GKZA 5I1DB 1FHUA 4JVPA 4B27A 4GK8A 1BFSA 4AXWA 1H5BC 4WW2C 1BEYL 4ZFQA 3TFXA 5IR1A 5IOBA 3BZGA 3G1XA 5DUBA 2G97A 4PUUA 5KVDL 2XZCL 4PJDF 2CZ5A 1DOSA 3IDGA 2QPFA 3MUIA 4LLUA 3R58A 3VSUA 3GAYA 2AK4E 5MKGA 2J4WH 5GGRA 2MPVA 5DQJB 4NUWA 1HTIA 5D93B 5FV2A 3FA3A 5HVHC 3V0VB 1G6RB 5DBUA 1WZAA 1J11A 3CNKA 4TLSA 3RWIA 4MYPA 4LSQH 3ZE2F 4ERAA 3I50L 3NZSA 5A2FA 1BWVA 3WLRA 3QR2A 2WLIA 3O6LL 4NQDA 4N0RA 3QZOA 5BZDB 5E2VL 5I16B 1KY6A 2OMUB 4M8VA 5K5YA 4AXNA 1WC7B 1I0DA 4XXDB 1CTNA 2J13A 3VU1A 2VO5A 3QV6A 4ADTA 1ZKAA 2TRHA 3P0YH 4AZ6A 3HI5L 2OTDA 3V7PA 4IKLA 4KH9A 4E2OA 3WZ0E 1RUPL 4Q6KA 1ZS8A 1IFHH 5J1SC 1R24B 3KYNA 1KEGL 1RUMH 5ERWB 1URIA 1NAKH 4N85A 3AUJA 4X6BB 5TGBA 4RDZA 1XLDA 3GYRA 5F2IA 2B7OA 2RTTA 2VB5A 3H9ZA 9XIAA 1ITXA 5GGSB 3BQUA 2G3MA 2CK0L 3FN3A 3WS6C 3UJJH 2WINB 3WNLA 4PUBH 4M00A 3WXVH 4JTJA 1SOQA 4AUJA 5ESQB 2Z4QA 3SW6A 4DQOH 5E6SB 3CZ8A 2B5IB 3KEHA 2KZHA 2JE8A 3B8DA 1E9PA 5ESVB 3ZR6A 3FK3A 4LVDA 1XGQB 2YSTA 3QJOA 1E9LA 2O6EA 3TEUA 5C9JB 3R0DA 4Z7VF 2VI0A 3QUYA 2OK0L 1NUDA 1UKTA 1S46A 1DQMH 4PRAA 3GLEA 4G43B 3K8LA 2I9TB 1VFMA 3CMFA 4A3UA 3QGVA 4KV5E 3G8RA 4WQOA 4HLZG 1US2A 2GQAA 3UCQA 1S2VA 3H0TA 3L6FB 3E6HA 1DVFD 3UF9A 5IZ7A 5H2BB 1FFTB 4HWZA 3A21A 3PP4L 3T2PA 4KK5D 1P84J 3QEHA 1CLYL 2E59A 1J96A 3LMJH 3CHVA 4O00A 4DGWC 1W5QA 1F58H 1S9XA 2XQYG 4NJ9H 2OXGA 3OXSB 2QKIA 1I7UA 5C0CB 3I7QA 3WNIA 3PB0A 2MTAA 3SB0A 4LQFL 1XGPB 5D1QE 5AVZB 3BUPA 5CSUA 1BGAA 2X3CA 3WD2A 5DQDH 1NBVL 1K7FA 3Q65A 4KCTA 1ODZA 1CFSA 3GDTA 3B2UC 1KYDA 1RJLB 1QOXA 4D0CA 4TX8A 1J10A 3CX5J 1EWDA 4MJZA 2J1KA 1GIGH 2R0ZL 4Y1SA 2H3XC 1TTCA 3Q9PA 2DWEA 1CE1H 12E8H 4LPXA 2ZCZA 1TEFA 4JUSA 4LC6A 1VDGA 1ICPA 2Q87A 2DV0A 1E27A 4ES8A 1SLUA 3NYZA 3N44B 2WXGA 4Q8TA 3T9WA 3SUSA 3BQUC 1I3GL 2Q1EA 3MHGA 1I1AB 1LL1A 1KN4L 3JV0A 4AVHA 2ZCHH 1QLEL 1PZ5A 2GQ9A 1TIUA 3SY5A 3QUYC 3IJ9A 4X8JB 4YSUA 3AWNA 3EO1A 2IGFL 4Z76A 1F4YH 3K5XA 3QV7A 4JY8A 3REQB 3L5LA 4LLDA 3LNGA 4QWWC 5AHFA 5EU7E 2PRLA 1UZ8B 3I74A 5D2LB 1NDYA 3HQPA 1VCAA 4OAWB 1UM5H 4JQ4A 5CBAB 4PJ7F 3EYUL 3H3PH 5J57B 5KBDA 4AH2B 1S7QA 4XPGL 2EXSA 2UY4A 3MMUA 4RL3A 1N26A 5DJAB 4KJQD 5D4IA 1Q6CA 4AIUA 4S39A 4XNBA 2QKIC 1BF8A 2CRZA 1FL5A 4XNYL 5BQ7B 1H62A 1CK0H 1YXDA 4G7YL 2BSBA 1KTCA 1EFZA 3DO3A 2CLRB 1AS7A 3SDAB 2I1OA 3VFGH 3SO7A 5EOCH 2VLMD 1DFBH 5EB9A 4RV8A 1U8NB 1SFDA 4KO9A 2V9RA 1ISWA 2B77A 3P6LA 3NJJA 2DEYX 5LIUX 1S3TC 3E7JA 3H4WA 4BQCA 1R3IH 2Z25A 1DN0B 4QHNA 1FORH 3M0LA 2WKOF 2F54B 1QLRA 5JORB 3TS8A 2X4NA 5LGXA 3NJXA 4LU5L 4PJIB 3COTA 1BXXA 4IHBA 3CFIC 1Y18A 4IRJB 1M1SA 6CGTA 3MSRA 1L7TH 2FDSA 1LQ0A 3VOJA 3KZ8A 1TTIA 3MRNB 4PTUB 5FDYA 5K4XA 4PJXF 2YXWA 5EMMA 1QJWA 2NY6D 4IJ3C 4D8OA 5C9RA 4DKEH 1MO0A 3QEQA 2INZA 1OCZB 3IJEB 1TTAA 2IXUA 4Z7WE 1FKXA 3E5BA 1EZVX 2YUWA 1HI6B 2NNXA 2ENJA 1XSOA 2MOVA 3O3RA 3MOBL 5A6SA 2Q8AH 4AG4L 1T1ZB 5DRWB 3FA4A 1QLFB 2PPDA 4K3EH 4YFEA 2XN1A 2GBAA 5J11C 4PRHB 4MNGB 5DEGA 1UKOA 3W7QA 2WZ0A 1V3JA 3V6FA 2QJHA 2D9QB 3FQRB 1JULA 3W9DA 5JBEA 4U1NB 2ZRWA 1CD1B 3GZ3A 2Y06L 2P7TA 3CSYB 1JPEA 5I03A 4MYXA 2JIXD 2XWDA 5EUOA 3L95B 3WNJA 2PXYD 4GYPC 3QUXA 3BVUA 2EIKB 2I7OA 5BUGA 1KLFB 4OWGA 4CKQA 4AZUA 4YSSA 2EH7L 4ZMWA 2CDGB 4WKXA 3CLWA 3CMOH 1JCMP 3POCA 1P1ZA 4UOJA 1A7PH 2IFFH 1DE4A 3OPSA 5JIPA 1E2WA 3OLIA 2LVEA 4PG2A 5F7WC 1Z42A 2GJJA 3BKYL 3OKNB 5ID1A 2ZG3A 1TQCB 1MY5A 4H9TA 3QH3A 3FNDA 3DDFA 5TK4A 3PJNA 3I9GL 3SBPA 5ISZA 5BOOA 4H0HB 2ZSWA 4Z2LA 2QJNA 3VINA 1XBDA 4LANA 3MXWH 2ZOTA 4OJDH 3WNMA 4DERA 1LBLA 2NNCA 3KCPA 4BWLA 1IO4C 3ZTEA 4P04A 4LUTB 2X4RB 3CFDB 2Q02A 1T0NA 4JPKL 3WQGA 4KEVA 4AJWA 2APBA 5FX3A 5IFHL 3FSUA 5GS0L 1GQKA 2OR8A 1Q6LA 3UZVB 1IGYA 2OYPA 5A2LH 2OL3B 4S3DA 4GNKB 4FX5A 1SXCA 3THUA 1IL1B 4H5SB 2LE9A 4IDLA 4PJFA 2AQNA 3V4VH 3VXSD 1RV6X 4OBSA 4MNJA 3WIFB 3CAWA 1M9HA 1TQUA 2OGYA 2X9YA 1DCEA 2Y4SA 4OCSH 1FH5L 4HJ0D 1C5DA 5LG1A 4UT6L 4G8FA 2VRKA 3MYZA 4H3DA 2F2HA 4C6FA 2IJ0C 4QRRD 1DWAM 1UVQB 4Z7IA 3SGKA 1KMGA 1GW0A 4DZBA 2XH2A 2QZQA 3QMRA 3CLFL 2XU2A 4HQQH 2DVUA 4CQBA 4RJEA 2AQTA 3IMBA 1U92B 3ES6A 4JTDA 2W88A 3BAYA 1TNNA 1QR7A 5GRJH 3QUXC 4JQVA 4K5OA 1AW5A 4KRLB 4TULL 3SDXE 1QK0A 4TTUA 1FWGC 5GNYA 2WM0A 1N2RB 3T0EB 4FMFA 4DFHA 4JJHA 2YXVA 4F2MA 1RZIB 5C08A 1FI8C 3HZVB 1EEYB 1JERA 4PG2C 1N64H 3H3KA 2FMNA 3LZ3A 3VD7A 5I1LA 5B1BB 1EIBA 3G5ZB 32C2B 4ZUSB 2Z7KA 1HW6A 3DA0A 1K4CA 4XG1A 4GQRA 2VDMH 4JTRA 2FZMA 3MROB 4B9YA 4B7IA 4RFEB 5I1DA 1HS6A 2VEPA 1DLFH 5KEZA 1FX6A 4BWLC 4S3GA 5D9NA 1GORA 3LNIA 2ZKXA 2XWRA 3R0NA 3UBGA 1ML0A 4FZEH 3C52A 4OW6A 2VD9A 1U21A 2L04A 4H7CA 1LRTA 1YEIL 1ZUAX 2FBRA 3Q44A 1E5UI 4GBUA 1N6VA 5KS9E 1GTNA 4MOZA 4MJIE 2XIIA 2DQCH 5DQJA 1CLOL 3NR0A 5MP6H 3V0VA 1G6RA 1AG1O 4L4MA 4PD4K 4JR9L 4PUDA 1ITBB 5DURB 3LI1A 1QEWB 3UWUA 2IPUG 1ECQA 4J2PA 4YC2B 3PAJA 2COQA 4WOZA 1GGUA 3UP8A 1A47A 4S10A 5SWSD 1ZAHA 3SGKC 1UFUA 5AOUA 3CDYA 5I16A 2OMUA 3E9TA 1UKSA 3UPCA 1YPXA 1WC7A 5D7KD 2IDSA 2APWA 3PXHA 4XXDA 4Q8MA 5BZAA 2CXKA 1P5BA 3CPUA 2BVUA 3ALXA 1JZJA 3OTRA 4X83A 3S42A 1JCXA 5I02A 1AR1B 3GS0A 3QY7A 3FXIC 5GS0D 5HI4C 4YHKH 1MRAA 1A7OL 3PFMA 4JQVC 1R24A 3NEHA 4RNJA 3BOLA 3ONCA 5ERWA 3K5RA 3S96B 4X6BA 4UFLA 3DX5A 3ECBA 1U8OA 3STFA 1VFUA 3QDAA 3ZIZA 3KZSA 4G1MB 2Z7GA 3MBFA 5GGSA 4OFYA 3EO9H 4AMKH 2AGTA 1ZLEA 2FHBA 4EACA 3PSWA 2OR7A 4MZRA 5I0WA 4IEFB 5ESQA 2CLEA 4Q8VA 1FQ9C 4JVUA 3IWPA 5ESVA 4JHAL 1UACL 2TRSA 2DMKA 3MRPB 2BXYA 4TUKH 4OUIA 5C9JA 1ZGDA 4TRPH 4DSYA 5JTWA 2YGQA 1K9FA 4ZO7A 3VAEA 3P67A 1W72H 3I75B 4G43A 3GC2A 5GS1B 2BWDA 2I9TA 5AW4B 2OOGA 1CU4L 2NR6A 4QXWA 3WUBA 4HZ7A 1LO3L 2WO3B 2HQAA 2FUTA 4PRPD 5BVJA 4LPWA 1EO8L 2VCBA 3L6FA 2CO1A 3QW4B 3HNSL 4FYTA 3ZYOA 2CO2A 5LIWX 1KFGA 4LSUL 4NL1A 1PBYA 3VTAA 2IALB 3U25A 5D93C 5FJUA 3TN3A 3FT3B 4LARL 3ARFD 4NFDA 1OG0A 3V0TA 2WUBH 3TFBA 3R5EA 3OXSA 3QC5X 3L12A 2PN5A 1M9WA 4RWYL 3UCDA 5EEWA 4JGDA 3M4HA 2VCCA 1XGPA 3NYDA 3W7JA 2H3BA 4POUB 1C1EH 1K8ZA 1E9YB 3WMBA 4J12A 4MXQD 3S88L 4YDNA 1RJLA 2YXMA 1IFRA 2NUPB 2V82A 2KQNA 1M7JA 4AC4A 3MYOA 4JN6A 5I1IL 4U6VH 3KBJA 5BMWA 3TV3H 5DUPH 3ZTNH 1OIFA 5TDPB 3NJFA 5EWIL 1XH1A 3GUWA 4P9MH 2O93L 2ARWA 1CNVA 4HD5A 2M83A 5DVLA 2R1LA 3MNDA 3LLXA 4W9TA 3WIIL 2ZC1A 4D6EA 2AZUA 1R4XA 2WJ7A 1E4NA 1I1AA 4JM2D 3FFCE 2Z92B 4YUEH 4XRCB 3GSVB 3KWXA 1EXUB 2X4QB 3R0MA 1T1YB 3ZE0E 4DK5A 2UY7B 2TRYA 3W11C 1EF2A 1WG3A 4U3SB 1LMIA 4X8JA 4IU3A 3UL4A 2RQEA 4WUUE 4KI5C 1WCQA 2NR6C 2WQSA 5D7SH 3REQA 4R3SB 4PSPA 5D1ZB 2CR6A 1KCSH 4KS0A 1UZ8A 5I00A 2C16A 2MANA 1MIMH 4OAWA 4AENB 3AFBA 5CBAA 1TOXA 5DD0H 2AK4D 2E7CA 1D7DA 3NMEA 4QM1A 3P8IA 4L65A 1FCUA 4LVGA 5E94B 2XTKA 3B37A 1KLUB 3GXDA 1C91A 3WQWA 1IBZA 1LYXA 1K8DB 3GI8H 4C4UA 2GI7A 3V0WL 3XIMA 1GOWA 1OAYH 3UADA 3GUTA 5H6HA 2XX0A 2WO5A 2ZJSL 2HS8A 5F0MB 3KCWA 2GKIA 4Z3HA 4QEEA 2J20A 4UNTA 2CLPA 1W0VB 3L5XL 4Z95H 1SOSA 2XFRA 2CLRA 2JXMB 4XP9L 3GO2A 5F7AA 4LF2A 3L1OH 2IV9A 2VJXA 1SM3L 4KK8C 3FO9B 2IANE 2Q9OA 4Q58C 4U0QB 1DE6A 2A9CA 2XT1B 1HUVA 2YMXL 2V2CA 5HDOA 3VXQA 5BS0A 2VLKB 3WDJA 4EZKA 5KOVC 1SQ7A 3NNTA 3CHXA 4NO3A 3HS0B 4GOAA 3I68A 3TX9A 3QDJA 3EOLA 1DN0A 4M1CC 3C8NA 3E8VA 3IMTA 2KLTA 3VFCA 4ODSL 2F54A 5JORA 2PPGA 3W7EA 2FWSA 1JZ7A 1EYEA 1UG9A 1U1UA 3NURA 3FN0H 3LAFA 1WE5A 4PJIA 2NQ9A 3ITTA 3IVUA 4IRJA 4LSPH 4P5MB 2Y8UA 2Y0FA 1I1AC 2ZKHH 1HWWA 3OAUH 3Q6FB 2IPFA 3V8OA 1BZOA 3EJYC 4GBXD 1LEGB 4BFIB 5I6SA 4PTUA 5B4MD 2Q76B 2J7FA 2CCLA 3CUJA 2CU0A 4W7VA 2OV0A 3DXAE 3CV1A 2R27A 4C1NB 4CADA 1UTDA 4KNSA 1NY1A 4E9SA 3NTYA 1EBAA 3WLMA 3IJEA 1SVZA 2D7OA 1MCWW 3CVIH 3AQDA 4IGNA 2PP8A 2DKSA 4M02A 3L3IB 4LQ1A 1HI6A 3LLDA 2H9AB 2BXVA 2B3RA 3GU1A 1TWWA 3TONA 3OGOE 1DFXA 2C4FT 2PNDA 3CXHK 3KPSE 2QCMA 3FRPB 5DRWA 3PAZA 3H2OA 2XBDA 1RA0A 1QLFA 1DQVA 3QUGA 4PRHA 2J7CA 4MNGA 3QAZB 2VXQH 4KRPD 1H5BB 3RUBL 3H6OA 1BQHB 2W81C 5ADOL 4ABWA 4WW2B 5IVXE 4M7SA 3FQRA 3F7RA 5CINH 4XAFA 2XFXB 1KBKA 5D1QD 4Z7OF 4Q8QA 4U1NA 4FQ1L 4JNYA 1CD1A 4WEMB 1MHEA 3GZKA 4TOYH 3CSYA 2YGPA 4TXVB 2V38A 2BX5A 3NEEA 5LBSL 4IFOA 1DJWA 4XBGA 3L95A 3V10A 2R0WH 3KCLA 1KLFA 1FAIL 3GO1L 4ZW6A 3P30L 1RCYA 4X7CC 4QGCA 1YNKL 1OFQA 3P3YA 3AU2A 1E55A 2GQ3A 4K9EL 3U7VA 3VKBA 4LP5A 4YR6B 3HCVB 2ESCA 2TMDA 1ZT7B 4JDZB 3MU7A 5D70L 3DGBA 3ISWA 4M4RB 1UWYA 1UOWA 4KVNH 3MSGA 2D0HA 1Q94B 3OKNA 1KWGA 2QVIA 4XP4H 1T3FB 2LQRA 4HGMA 1SO5A 2NQCA 5D2TA 3CZKA 3QC3A 5I28A 1I0BA 1YQVL 1NGPH 4IRJC 3W6LA 1YLVA 1B3XA 4DK6A 2X1QA 1RZFH 1OCJA 2AGJH 1MEXH 4DJFD 3GKFA 1M7DB 1UQYA 4LUTA 4L80A 2X4RA 3GIPA 1AY1L 2PP0A 4GXUN 3HPSA 1MXSA 4NWTH 1QWGA 4KY1L 1HKMA 3AQYA 1SOXA 1ONXA 1MFCH 2OL3A 4KQ4H 3DKHA 1N8FA 4MDOA 3AZRA 1NCBH 4H5SA 4ZZ9A 1J0YA 4K1GA 3HR6A 3NQ6A 4WCJA 4IBVA 4RE3A 3WIFA 4O28A 4ROPA 2I27N 1NUFA 4RZBA 3PGCB 2W0KA 4OGZA 1U8HB 3ITYA 3H70A 4U5IA 3WL9A 5FOOA 4S3KA 1ZNNA 1X39A 3UG3A 4OCYH 3TXAA 4F2UA 2MRYA 4QDPA 2BG5A 4AXWB 3CV2A 3RJQB 3TU9A 4Q52A 1ZVSB 5JW3H 1IEVA 3HUJF 4PBWD 2HJKA 4W89A 4AKOA 5EDXA 1JNNL 5IR1B 5JHMA 5DGRA 2QADD 2PF0A 5J6GB 1HIZA 4LAQL 5F9OL 4UTLA 5ALCH 4FG2A 3ULUL 1VBRA 3T6VA 3E6EA 1U92A 3LCYA 3E9UA 1OCWH 1H3XA 4JQ1A 3O81A 3Q4DA 1RI8A 1BECA 5GGRB 3BRGC 4U1LB 1ZCCA 2AQVA 4DXXA 4MKSA 1JUEA 3QQ0A 1N2RA 3PUEA 5HUOA 3T0EA 1ME7A 4FYQA 1T0OA 2HFGH 3RWIB 1TZ8A 2Q6WB 1D5RA 2JF6A 1RZIA 5EZOL 1DZBA 1EEYA 3G1HA 3ZM8A 1TQCC 4NNPL 4NQDB 3G5ZA 3FF7A 2NTFB 32C2A 2Y9RT 4GSDH 4QEHA 3QIUB 1L9RA 4ZUSA 4PJFF 1DEEA 4EAYA 2BASA 1LT8A 4I13B 3PFQA 3MROA 4M3KB 2XQBH 3Q13A 3V1HA 4QISA 2Q2EB 3KYNB 1EPVA 3WMQA 3NZHH 3OL2A 2QCGA 2PAJA 4AYFB 3M1CA 1TITA 2JEPA 2Z29A 4FAAB 4IF2A 4XTIA 2ZX7A 1NA8A 3IGSA 4XMKL 3WQVA 3ZJ6A 1QKZL 1IKFH 3FL7A 3ME0B 5EMLA 2OP4H 1QPNA 5AB3A 1QQDA 4O1AA 3K74B 2VDOH 3RN6A 1QEWA 5DMIH 2L5HA 4DEUA 5FJTA 2ADYA 4JYEA 1IBDA 3VD5A 3PUGA 4PRAB 5HBFA 1KV5A 3T4CA 1OK6A 1V03A 1OCQA 2J74A 1HAUA 4N2DA 4AQOA 1BVNP 3K1KC 3VNZA 3E6HB 2IQ9H 4IXHA 5IB4B 5DJCB 1RUKL 4HWZB 2J9XA 1UHVA 2YPIA 4IRZL 5SV4A 3G3LA 2LFEA 1DVJA 4UTWA 3PCYA 2XIMA 1A2YB 1P69B 5I1HH 3RX8A 4UT7H 3S96A 2HS6A 1S3KL 5T1LD 4PGJA 3T0EC 4MVBC 1A3HA 4G1MA 1GYWA 2R4RL 2Z35B 1JS4A 1FZOA 3ORWA 4Q6JA 4A8IA 4E9QA 4FLQA 1VGEL 4CC1A 2ATKB 1R7OA 4J28A 3SYAA 2Y72A 4YHIB 2YPLE 2YCJA 1F42A 3IJSB 2VDRH 1KUMA 1HKJA 1CE6B 3T6CA 3PY2A 4D0CB 3BW4A 5JUEL 3MRPA 1TPC1 4ZQTA 1AW1A 4P5SA 1G1KA 3MLPA 1FFRA 4BI5A 1PKQA 4P46D 1KXQE 3I75A 5CO1A 2DWEB 3MLTB 3GK8L 3F5LA 3ULUD 4HAKA 1J1PL 5AYZA 4C83B 5JHLL 5L9DH 2HX7A 1TO4A 4Z7QB 2BC4A 3BV7A 2GDQA 4F92B 2F8XC 1ZVYA 3AZSA 4NC2B 5HDLA 4TUFA 2XN2A 3VOCA 3RLVA 4BZYA 2L3BA 1XLLA 1PDYA 1SEBB 2IALA 3CZJA 3NCOA 3ZIMA 3GPSA 2AHIA 3FT3A 5KUKA 5DJYA 3Q5OA 1KJ3L 3VVWA 4P23D 4BKTC 3FCUB 4IJ3B 1XQ4A 4YC2C 3RMEA 2NPLX 2G5WA 3D3FA 4E9YA 1J9YA 3PXLA 4LT9A 3LEYH 2DL9A 3WFHA 4Q4KA 4CD5A 2GB2A 2R1KA 1M2OA 4OLEA 4L2YA 5I1CL 1OXYA 4LLDB 2YAQA 3M6DA 2GJPA 3KVJA 1IM9D 1FIEA 4H8UA 5KAQF 5LZLA 1DQWA 1EYWA 3MUXA 3FUJA 4D6GA 2DYPB 1AR1C 4EO5A 4H88L 5TDPA 4QXVA 3LGEA 2VGGA 3O3DB 4Q22A 4HUCA 4UTWC 4JN1H 2F5BH 5J5DA 2O0TA 2VDPH 1WCGA 3O6KH 5BROA 1IC4H 2K9UA 2YX0A 4IM8A 1JCYA 1JGUL 3KBMA 1Z9OA 5E56A 3L4VA 2XPZA 2ESVD 1FL5B 1NCHA 5IROA 1E8XA 3LZFL 2JK5B 3UTZB 4PJCE 1FFPB 2FB2A 4O1CA 2PP7A 4TQPA 5F96H 3MGTA 3RXZA 1JZ3A 2Z92A 4HWEH 1HU8A 1J8RA 5A2IH 3A6OA 2PTWA 1NMCB 4AWSA 3KX6A 4QRUB 2WSYA 1EXUA 2X4QA 2EDOA 5IW3A 4TNFA 4UF7C 1HX0A 4UTBA 1T1YA 4XB7A 1N7ML 2HBVA 4OQTL 2UY7A 3WH9A 5DY2A 5JW4Q 3WBEA 5GRVL 1ED3A 3C5ZB 5ALBH 4YLCA 2GK1B 4PB9L 3ZU8A 1KEML 2ORBL 4R3SA 4JO4L 5FF7A 2EICA 3B8WA 2I60L 1QLRB 1UIPA 1FNLA 4AENA 4XZ4A 2X4NB 4C57C 4FK9A 4MJID 3C4UA 3LSBA 5E94A 4BD4A 4RKAA 3PZGA 3LZOA 2ZYIA 1KLUA 1LO0L 3QXUA 5B1JC 5ICUA 2PGRA 2EACA 4FALA 4YSCA 3TEWA 1NQ6A 3PL6B 2YAFA 4IFRA 1OTTC 1G7PB 3CPGA 3TWBA 3UGUA 3V6OE 2F7PA 3NEVA 4HCRL 5F9JA 3N44F 4N0YL 1MEHA 2FBJL 1EMTH 1W0VA 1KTBA 1UBPC 3PHAA 3GPEA 2JXMA 3CK0H 3FT9A 2FO8A 2REQB 2RA1A 5C0FB 1NMBH 4KX9A 3FO9A 3M17B 2XGIA 4GEJA 3GNDA 3LBOA 1HE8A 2VLKA 3CFEA 1J8VA 1UR2A 2IH3B 5DA4A 3FC8A 3HS0A 4HKXB 4DP7X 3PUCA 3TA9A 1G4PA 1VFLA 3MSDA 5DEGB 2XY2A 3FS9A 3F6IA 2EKCA 2CBMA 4H0GA 3JTTA 4UT9A 3DI2B 5IDIA 5IROC 1XGEA 2HT4C 4L3CA 4HV8B 5D7KE 3VFLA 3K6FA 5F8RC 2YDRA 4FYRA 3SO3B 4P5MA 1KXHA 5D2LF 3M1ZA 3Q6FA 3VKDA 4E3TA 4KXBA 5EUOB 1LEGA 4BFIA 5BOFA 2Q76A 4FQQB 3KHDA 1VADA 1A14H 3D4GA 1JZ8A 3LHZA 1W17A 1YSOA 2UYLB 5ACLA 3WIHL 2AKMA 2ODIA 1SFHA 1VPXA 1P1ZB 4CNUA 3IRZA 5LN8A 3GZOA 3L3IA 2F74A 3P73A 2ZUWA 3I02B 4IJTA 4OJFH 2Z4TA 3T42A 2H9AA 1TJIL 3NL2A 3QUML 4DRSA 4FP1A 4QAIA 2F7FA 1FHDA 1JMZA 5CJ5A 1QZ1A 2DQEL 3QXBA 3QQ9D 4UNKA 3KVLA 3HOJA 4CQDA 1BZDA 4WEBH 3SGGA 1DQTA 1BQHA 4WW2A 3UO8B 4JTQA 3ALWA 4PCYA 4WGVB 2D23A 5HI3C 3LKOB 3T9PA 1SFLA 4PRPE 1H9VA 5LDUA 2YL5A 1E4IA 1IGYB 1DDHB 3W0WE 4JL1A 1EEUA 5A8QA 4PJIF 1LORA 4ZO9A 2EC9U 4KERA 5ABAA 3G1FA 2VN3A 4HPOH 2RH0A 2DL2A 3PF3A 3ARBB 1KQYA 5I76B 1C5DB 3I6LE 5D8JL 3MYJB 1A5SA 1W1VA 1FTXA 1GGBH 3HBZA 4YR6A 3HCVA 1Z32X 1ZT7A 4JDZA 5L6YL 3HS0C 3CBJB 1GVIA 4M4RA 1Q94A 5A2CA 2E28A 4HSQA 1K8IB 2YCLB 4Z1BA 1H8LA 2EP6A 3IGUA 1T3FA 4XN8A 4LSSH 4B5TA 4GLRI 1VQTA 3ZWTA 1ICQA 3WMSA 2RQ8A 1UM4L 4FLOA 3GBML 4LS0A 1GKEA 1L6XA 3FFCD 4QHLA 2NY5L 1EANA 3UCRA 1VENA 5EOCJ 3L3OB 1OGBA 4JJOA 3G9VA 1BM7A 1M7DA 3PNUA 4DBWA 4QXTB 5D71H 3CS2A 3MDUA 1J0IA 4NASA 5IIEB 1WAPA 4DGVL 1WBZB 1OGTB 2GWGA 5FLUA 1UD2A 5IJCC 3KWUA 3W1PA 2WPBA 1OFOA 4B60A 1KCZA 1XSJA 4M8UA 5G4MA 4DBUA 3GU2A 1A0EA 1NUNB 3EA3A 3UBXI 3PGCA 3WD3A 4RMRA 4LPUA 3RB7A 5C7VA 2E76C 1U8HA 4XZNX 3WFLA 5JXAL 3WH6A 4HGXA 4G8GB 4S38A 2Q8LA 1SBSL 3OG3A 4O0QA 3QAZC 4HU4A 2IPJA 2G2NA 1ZVSA 3MCNA 4N7QA 1HIML 1C92A 5T5NF 4HIHA 1TA3A 4NPKA 2C1OB 5CH9A 2PABA 5J6GA 3P3RA 4DVRH 4FI8A 4Y2OB 1ECYA 4LXFA 1ZTMA 4K7PY 4QQUA 2WNWA 1GUVA 4HXBL 4G7SB 4H0LC 2B1HH 1XGZA 2ADJB 4U1LA 4HK5A 2IAND 2VEMA 4AYID 1HO4A 2V2DA 5HUPA 1G7UA 1D5MA 4OIIH 1L9OA 2J55A 3V79C 3TIEA 1CCZA 2Q6WA 4FFYH 3LV6A 3IJ6A 3KBNA 2QGBA 4WKZA 4Z7NE 1B3VA 3QDMB 1FBIH 2WZ5A 4IKIA 1PKLA 1I2OA 3OVQA 3W39A 2NTFA 1DYZA 2YKLH 3BW2A 1QRQA 3UY8A 3QIUA 1GVYA 3MUCA 1CFMA 3QQ1A 5DK3A 4D1JA 5G2WA 5T5FL 1FLTX 2DSWA 1EOMA 5TE6H 4IIFA 3MMDA 3GXPA 3DXAD 4K7PH 5AZEH 4GZ7A 4KCWA 3AITA 2NY1D 2X1UA 4AYFA 5I1JL 1ACXA 3ECBB 3HFMH 1U8OB 3A67L 4NC0B 2AW2A 2WMGA 3CZLA 1PZAA 3CIXA 5CBIA 3RKDC 2CBUA 5IBUB 3GRBA 4O15A 1W80A 4A7QA 4XBEH 3EH2A 3ME0A 3RB5A 3VZXA 4L4JA 4ENED 3KPSD 3M8OH 5C0AE 3O3EB 3FQTB 1BAFH 4AF0B 3GLCA 5IJBC 3UZQB 2WLLA 3P0VL 4ZMLA 3L5JA 3W7NA 4QR6A 3TBSA 3LA4A 3WSQH 3C86A 1KM4A 4W88A 1A0QL 3NZ8B 5IF0B 3F05A 1LK3L 2RMNA 2V37A 3O3AB 1MXDA 3NSFA 5BVJB 4ZX6A 8A3HA 3H3BC 3QS2A 5IB4A 5DJCA 3LYRA 4LY8A 4ALAH 1AQHA 3NTCL 1AKPA 3MKKA 3PC0A 3LN3A 4UTUA 1KB5L 3TBYA 5F71A 4EI6B 3NOYA 1A2YA 4LOUC 1MPAH 1RQBA 1D3CA 5H2ZA 5FEXA 2XWZA 5DT1L 3ZKNC 2K3HA 1NIFA 1PYWB 4WU7A 2Z35A 3QIBA 2ZBTA 1VESA 4MNQD 3GXNA 2ATKA 3WF1A 3KCOA 1CQYA 2R51A 4YHIA 5AL0A 5KUMA 3IJSA 2H32B 1E2ZA 1SXBA 3DX7B 1SHXA 1CE6A 3QIUC 2QVHA 2H1PL 1ECEA 1KENL 2HRGA 1BM3L 1JRHI 1E0WA 3BZEA 4BE6A 4QG9A 3ZVVA 2P80D 4JPSA 3VD9A 5DD1H 3OA5A 3MLTA 1PCKA 2BB0A 1HT6A 1X44A 3CVHA 5DHVH 1BD2B 3V52H 4OV6F 3D39E 3G5XB 4C83A 2C9PA 1H7PA 3BOVA 1M7OA 4QJ1A 2ZD0A 5TAOA 4DPPA 4Y2WA 3ZSTA 3MBDA 2DT2A 4AI7A 2XYBA 3W7CA 1N3NA 1KGWA 1S7SB 2VHLA 1E43A 1QRNE 5H8UA 1SEBA 3BUQA 1QTYT 4MAVA 4WY7H 3H2AA 3GDMA 4LSTL 3TJHD 2KZBA 3M45A 3MBXL 4Q7NA 4XN9A 4OZIF 1MH5A 4RA0C 2H26B 3BQ5A 5KN5B 1XKYA 4IU3B 4NT6A 2OJEB 3HMXA 4GIRA 1JPTL 3HPAA 4R53A 2X1WL 2Q8BH 4S0HA 3APCA 2DYPA 5ES4B 4D9LH 4JCLA 1YJDC 2F19L 4RDBA 3O3DA 5FUOH 4BH8B 4XPFL 4EXAA 4N5ED 1FL3B 2BK8A 5HHOE 4NX5A 1WEJH 4K8RL 5E99H 2VC2H 3R1ZA 1MDAA 1WS8A 4G71B 1U83A 2JK5A 1QI0A 4ZS7L 3QIBC 3GUTB 3UTZA 1FFPA 2F5AL 3KP1A 2P3EA 5CPOA 2NV2A 4HT1L 2CEQA 3SDYH 1MJ8H 2AQSA 4WUKL 1RK0A 1HKWA 2CETA 4GYPA 3RO6A 3PQYB 4QRUA 3O2DH 4DZHA 2G3XA 3T07A 4HD9A 4K8HA 1KT2A 1E9QB 4I9AA 5HP5A 4UDTB 4MNLA 3TLQA 5CLWA 3WLLA 3VXQB 5CP7B 5BS0B 2IQ0A 3FO2B 5EGRA 2ZXGA 3HBQA 2FZ9A 3C5ZA 5LO7A 4NO3B 3QQ3A 3M0XA 2GK1A 1F1AA 2PS2A 3QDJB 3NIFB 1IZCA 3EXLA 1WRFA 5JH2A 1W1ZA 2JNZA 1MCPL 1A3ZA 4M0XA 1RZMA 4GP5B 2RIKA 2QTVA 3HC2A 4PD4J 1EVUA 1BOYA 1FVCB 2E3ZA 3WFBL 4L8SB 4ETQB 3PDGA 5L4JA 4XIMA 3BH8B 2O5NA 1KCLA 1YYAA 3DX1A 1J8HE 2GQ8A 4WCYH 2WLZA 3PL6A 2ZCKL 3GTNA 4HQVA 1RLCL 15C8L 1G7PA 3ZHKA 1OC5A 1NFDA 4IMCA 2YAMA 2Z6JA 4CADB 1A0DA 2VLRB 1UZ4A 3RGVB 2CBVA 4O0ZA 2ADFL 1MVFA 2B1AH 3BD5A 3KPLB 3DFSA 4DPCX 4KUCD 5BOZG 2REQA 1PWMA 4J2MA 2WTPA 3PZIA 5C0FA 2APVA 2AJXH 4I2XE 4ZNEA 5EC1B 2VN6A 2EH8H 4P3WA 3M17A 4PIRF 4HZAA 3D08A 3W76A 4XO3A 1THFD 2IH3A 2H6UA 1MQQA 1O95A 2P44B 2O5XL 4O57A 2F61A 4HKXA 2BRRH 4YX2H 3T04D 3B5HA 3AVEA 3MLYL 3QNFA 3BURA 4BQ5A 4GXVL 3SY6A 1ZANL 2XVPA 2WVSA 3WE1A 3APGA 1E1EA 4HV8A 4JHUA 4B7LA 3KGSA 4GW5B 2HUEA 1MHEB 1TE6A 1OZUA 2YPLD 4YHOH 1RZKH 4XBGB 1PDKA 1R5IA 4N6RA 2PDMA 1NMCC 4FQQA 2CWNA 3LVTA 1OPOA 5C92A 3EDFA 2XTJE 1TZAA 1EHLL 4PB0H 2UYLA 5CFHA 4K94C 3E3QC 3CPLA 2CG9X 3G0SA 2Z7ZA 5ETUB 3C5ZC 4YSEA 4TSBL 2HTKD 4HX1B 4S1SL 1X6LA 3C60B 1XCQB 1H3PL 3I02A 2FTYA 3W2KA 2ZOKB 2Y25A 2GIMA 3UTTB 1O5XA 3CQ0A 1K6QL 2P26A 5IHZB 4K8RD 4B95C 3ASWA 2DQUL 1A3WA 2QJGA 4PY7B 1Z41A 2C26A 5F7FA 2O9TA 4FZ8H 4ONGH 3PL6C 2CW6A 2CO6B 1L0PA 1JJUA 3ULUE 3L23A 1D8CA 3W1LA 3E0WA 4HK3N 3QXDB 3LKOA 3A22A 2BS71 1BFTA 1A4AA 1DDHA 1H11A 1JZ4A 4NJJA 3KYMB 3LHVA 4HC1A 5D2NC 3WS3B 2BIHA 4DBEA 4GY4A 3NN8B 4Y96A 1H7XA 4MASA 2DKUA 1ERNA 1XAUA 2W59A 3LPPA 2JH2A 1J86A 3ARBA 1MCNA 1ZAIA 4TKWA 5E1GA 1JCJA 3I84A 5I76A 3MYJA 1CN4A 4JRXB 3B40A 1FXPA 4OFQA 1BSIA 4XD6A 2OODA 1QFWM 1AK5A 1YG9A 2Z3FA 1RZ7H 1X96A 3WL9B 2OEJA 4O58L 3OMZA 2HJFA 2EHHA 3AISA 3II3A 1W9UA 4GUPB 4ORZC 4OGQC 1WKFA 2E7BA 1K8IA 2PCEA 2YCLA 1IRAY 3QVQA 3CFKB 1OAKH 2AV1B 3UXLA 5T1DL 2HJKB 4N6QA 4F48A 1Q7ZA 1C8PA 2UUDK 3SO3C 3MODL 4QP0A 5ADPH 3L3OA 2BWGA 5IDZA 5DFVD 5E4AA 3P3TA 4LEQA 4QXTA 4HJIA 4J3OG 5AW7B 1SY6A 1HKIA 2FX7H 4Q8UA 5IIEA 2UX7A 1TPDA 1FA2A 1WBZA 4EN3A 3SGZA 3KW7A 1F07A 3NRPA 1OGTA 3WI9A 5FW7A 5MENB 3UJFA 4WW2F 1LOSA 2ESVE 1G9MC 3EXJA 4GIEA 2VMJA 1F18A 3IDIA 4KQ0A 3B8IA 2BVQA 1NU5A 1J18A 4F24A 1M7PA 3W24A 1P4BL 2B7PA 2W60A 3DUHA 1QA9B 1FVDA 3QULB 3GIZH 2WZHA 2YPVA 3LUTA 3LKSB 3JV5A 1ZLPA 4L4TD 3S36L 1DEEB 4Q9RH 1A5LC 4ELME 2Y5EA 3G1VA 3OF6A 4G8GA 4TUOB 5HGAB 3VXUA 3FQXB 1Z66A 4HCDA 4V28A 1YC7A 4L5FH 1G5AA 5IBLC 2J5LC 2K6YA 3BW9B 3BAXA 4BHYA 4BI7A 1EHKB 2UUDH 4WDXA 3FUIA 4XNAA 2C1PA 5TE7L 3BD4A 4DN4H 2C1OA 4ES4A 4NKCA 3DTUB 4BFRA 4Y2OA 1ND0B 3MV9E 1MRCH 5AVTB 1JPGB 3AMCA 3B8UA 2VDLH 4GVFA 4BWTA 1A22B 2FD6H 2ADJA 1MCKA 1DQDH 1WGOA 2A79A 3OZOA 5T8GA 1QQDB 3Q9QA 4F27A 3ARBC 5FF0A 3EWCA 3D3VD 4Q33A 5DCDA 2DPKA 1P0EA 4L3EA 3GTHA 3QJXA 4XOAA 5CZKA 3W22A 4XBJA 3OBAA 3BD3A 2VELA 4QXUH 4BSJA 3QDMA 4J3OD 5C3LD 2OYLA 3H8NA 4JTKA 4GXUM 3VM5A 3PNZA 3QW9A 5E2JA 1V3HA 2G96A 4APQB 3CTLA 2FPVA 4N0UA 2NX1A 1UP3A 2ILLA 3L3OC 3CLEL 2WOBA 1BGXH 1A6VL 4X7EC 3RTLA 1E8WA 2WJ5A 4P5TD 4FG6D 1KQZA 4GBDA 2ICWB 1E0VA 1XLKA 4EI5B 4XPAL 1NQBA 1FCBA 3ZW3A 3V5HB 1NEPA 3RVTC 5KWYC 4EN3C 5D7LB 3WK1A 1XLIA 2ZZ3A 4EXKA 3MRHA 3GLZA 3G2GA 1FZOB 3CXHJ 4Q14A 5DMGC 4NWUL 1MWAH 4BK4A 1KV7A 1ONEA 4D9RE 4O8RA 3UBFA 3QFJB 2YD4A 1LL7A 1NC2B 3V4LA 3O3EA 3FQTA 3SE9H 2ZPKL 4AF0A 5I5JA 1SW7A 2A9BA 3UZQA 4JNXA 1PKQB 4JPWL 3W7OA 1R3QA 2XG9A 2QGYA 3NZ8A 5IF0A 5DCEA 2F15A 4GHRA 2CD0A 3O3AA 4JDEB 5KSUB 5CLZA 1LO2L 2BC4B 3LX9A 1AI1H 1MFBL 3W0WD 3JZ7A 3HF3A 1JE6A 2CZVA 2GUUA 4P2OA 4GKNB 4Y16D 5DLLA 3K6DA 4XWGL 1FNFA 4EI6A 5C2BH 5JXED 3UPBA 1CECA 1IAKA 3SCMD 4RW5A 4BCEA 3I6LD 4Q4OA 5I07A 5DJYB 4EF8A 4YAQA 1AD4A 1PYWA 3MFGB 1NEUA 3A6CH 4G7RB 4TNEA 4HT3A 2RAGA 4OGXH 3LNDA 2EDMA 4C8XA 4YQXL 4ZFZA 4N1CA 2FNWA 1F6AA 3WFHB 1ZDSA 3SPCA 4FQLH 1Q1JH 3K2GA 2H32A 3BCFA 3DX7A 4WX2A 2M8XA 3TO2B 3SD2A 5T9BG 1Q3NA 4KKXA 3SAZA 1EAOA 3DHFA 1V5JA 4AYEC 4P8VA 2CXEA 3SDDB 1CGUA 1SPDA 5JQIB 3GR7A 3TIDB 2MH4A 3LH2H 1F3TA 1K77A 2DSVA 1BD2A 3EJQA 4ZA0A 1S5TA 3G5XA 2CHXA 4HEME 4IOIA 1Q6FA 1CD9B 1U9KA 4M7KL 4Q4SA 1GKPA 1I8KA 2VURA 1MRDL 1KB9K 3M0VA 5DMJB 4MMZB 1WSST 1S7SA 1ZIBA 2QDGA 1Z5YD 4WRHA 3O2WH 3KPOB 1TEGA 3GBEA 3MGTB 4ZTYA 3VU2A 3NZPA 3I6KB 3NZQA 3PBVA 2AQPA 1IE4A 3L4YA 5TDOB 4P0DA 4P59L 3NABL 4UR9A 3C0JA 3WQCA 1NAMH 4F79A 2BOEX 2AANA 3NDOA 3QPXH 3PPFA 1YECH 3DKLA 5ANHA 4V15A 2IKIA 2H26A 3GMOA 4P9HC 2ZUTA 5KN5A 1ED3B 2E27H 2EILB 3W01A 1TT6A 4L8CB 2C7FA 2OJEA 1QHPA 3VI3E 2NQHA 3S98A 1OSEA 5EDSA 2HMIC 4NZ1A 2GSGB 4ERSL 5KYXB 1DZ0A 2OZ4L 1AH4A 1X97A 4DWSB 4P2OC 4XVUD 3G0UA 1RULH 1UWEH 4PV9B 3QYMA 3MGAA 3ANUA 3QWRA 4AMCA 4BH8A 5GZNA 3QXTA 4ZOEA 1FL3A 2FJGB 3DXIA 1FXQA 2ZYSA 4ZX4A 3GTVA 3HZYB 5HMSA 1IFGA 3DETD 4AVNA 1NOAA 2PDNA 1BZEA 4MXVE 4BRJA 3HNTL 4Z7QF 5F9JB 2ITCB 3ZLHA 1E5CA 1R3WA 4P8UA 5I6NA 4LNYA 2IDTA 3GW0A 3HI6H 3PQYA 4PVNA 4ML4A 1CFVL 2FQIA 4X0KB 3LDVA 5D7IE 3BN9D 4DGUA 3S8FB 1INEL 1E9QA 1UWRA 3S9YA 1SVCP 1AA1B 4UDTA 3FO0L 5CP7A 3CFEB 3FO2A 1NVMA 4I3SH 4OD1L 1E6NA 3F4NA 5LQBH 1VKXA 5CU9A 4Q8BA 2BVDA 5CGYD 1UC5A 2LFGA 1KGIA 4C5YA 2I5YH 1J8SA 4E41E 3JTTB 8RUCA 2GT9B 3RVWD 3MC0A 3WJLA 5CIPH 1MHPL 4L3CB 1FVCA 3F65A 3KLAB 4L8SA 4F58L 1QI5A 4ETQA 4GMSH 4Z7UE 3BH8A 1FYTE 1U3YA 5C0AD 5CM1A 2VZUA 4N2EA 1VADB 2J7GA 2PDKA 5AVWB 4F7MB 4KETA 1ENUA 1L6YA 3PWAA 2VLRA 5EO1B 1PYMA 5CZXD 2P76A 2XJ7A 1DQLH 1LXMA 3IFNH 4G3YL 3RGVA 4Z1YA 2AEIT 2NYYC 3K3QA 3FSWA 2E9MA 3W1NA 3KPLA 1HHIA 2F74B 3ATYA 3P73B 5AOMA 3V5KA 4OKVB 4QR7A 4ZSTA 1HINH 1KNWA 5DRNB 2OMAA 5EC1A 4OLXH 3FONB 5JBDA 2BSSA 5C0BD 4W8AA 4DP1X 3AMKA 3WGUB 1WZMA 5HHVL 5U7SA 1Y65A 4KH2A 4F3HA 1AG0A 4LSBA 5MHBA 5BU6A 5GZNC 3KW3A 2BWQA 2FUQA 3DFHA 3V6BR 3NZGA 3MCMA 3HC0A 2CMRL 3IFOB 5G2NA 1W5PA 4GW5A 4FXLA 1G1CA 2R1WB 3QJUB 5F0LB 4K5NA 1MAML 5T3XE 4N68A 2OO0A 3HBLA 3GFZA 2FVMA 3HGOA 1IAII 4QHKJ 4Q4EA 3AHXA 3FW6A 1X3DA 4O19A 1F4HA 4TNVF 4JG1L 1SZEA 1LP9E 4AJ0A 4L37B 4UZUA 3DURA 5AOJA 4JFDB 5FGSA 5T1JA 4OR1A 4D6HA 5BJTB 2OMBA 3FSOA 4KPHL 3II2A 5ETUA 4OLYH 4U6TA 2GI0A 4XPTH 3D39D 4HX1A 5I30H 2XJKA 2X2IA 2CKBL 4RR4A 4PWFA 3C60A 1XCQA 4K7PX 4MNQE 2ISFA 5E6IB 2ZOKA 5HYSG 3UTTA 4GKLA 1TVLA 3MA8A 2V3EA 4E2BA 3WJLC 3DU0A 1QNRA 5IHZA 3EYQC 1B3WA 1KM2A 2CUHA 2WO2B 4L8SC 1QRND 4LAJH 1VZHA 3S3JA 4QHLB 4PY7A 5T1KB 1EP3A 1K02A 4BZ2L 4W7UA 4GRLD 2CO6A 5D5MB 1V6YA 3P7YA 5D09A 4L05A 2X9XA 1OQOA 4LEOB 3WFDL 1ONQA 4B91A 3QXDA 4FQXD 1UD5A 1VFOA 3RGVC 5FJRA 1TXKA 3U4KA 2PGFA 2BFVL 1BPLB 1JPSH 1CZ8H 2F53B 4BFAA 3F03K 3KYMA 4XVJL 3WS3A 3EW3B 5F0JB 1L8PA 3NN8A 4X99B 4OZFH 1B2WH 1KRAC 5EUOF 5C0ND 4Z42C 5EA0L 4JRXA 5C0QA 5GXBB 4FX6M 4R96A 3GX9A 4DJMA 3SYCA 1V0LA 2C9RA 4CEXC 3G04A 2QSQA 2CBPA 1AXTL 3GMNB 3NSMA 3R13A 4GUPA 5HHOD 1WTLA 1Z2KA 5GISH 2HEJA 2QGHA 2O6PA 4BHUA 3CFKA 4URKA 1I7TB 3TURA 2AV1A 1IXNA 4HWBL 2HTLD 4HIHB 5GZOA 1TA3B 1UWGH 3N6YA 2CBJA 2AXJA 1FGVH 1P7HL 4LDLB 1O7VA 3PBMA 2COVD 1FIGH 4BK5A 3JZEA 3MPGA 4U33A 4PJGE 4UV7H 3A5VA 1EBPA 1BJ1J 1K4GA 4HJSA 1D5MB 5MENA 3TIEB 4I18B 4PFHA 3KPNB 3K71B 3C60C 4WKZB 1SJVA 2JK2A 1CICB 1CZ1A 1AGEB 2IWFA 4LHUG 3VRJB 2YD6A 1QA9A 3LRSB 3QULA 3W39B 1CQKA 1H8SA 3LKSA 4R5XA 4IDJL 2Q3AA 1ZJBA 4ELDA 4TUOA 1S2CA 5HGAA 1J8HD 3FQXA 4EXQA 5K7JA 4Y4FD 2VX4A 3BW9A 3U9WA 4PN2A 4KITB 1W3JA 2M2DA 4AZ8B 2AQ1A 5GRZA 4W81A 3NG3A 1M1BA 5K9OB 2MOQA 4Y6GA 3CZSA 4UAOB 43C9A 5H1WA 3I4KA 1ND0A 3ZOAA 3L81A 2NY2C 1XYAA 1JPGA 1C5CH 4F9LC 5DRIA 1V8EA 4PH6A 1L9SA 1XLHA 3W5MA 4XB3A 4XWUA 4NRSA 3T8VA 4FS0A 1JXFA 4KFOA 4OF6A 4L3AA 2Z27A 4YJZL 1RH9A 2FH6A 2BERA 3L5HA 4UTIA 5I77A 2WLLB 4B9GA 1FH9A 3LNHA 1FG9C 3RWEB 3TBSB 2P8PB 2X4OB 5F6HI 1G9NC 2OA9A 2XV0A 5ABTA 3QR3A 2ZYFA 1MCOL 1T5WA 3L21A 5GZOC 4W68A 2CHDA 5JQ6L 2ZNWA 4LBEB 1VA9A 3AZTA 4APQA 1IC7H 4DP6X 4RFOL 3IARA 4X8CA 3K91A 2H4EA 4NN7B 2J5WA 4BK5C 3EB4A 3TBYB 1O7AA 2R39A 1HZHH 2WC3A 4XBPB 2ICWA 4KIEA 4EI5A 1MCJA 2XTJD 3IJHB 4LHUD 3V5HA 1RY7B 2BRQA 3DENA 4NLHA 5D7LA 1TR1A 2H1XA 2CE6A 2ZRYA 2XUWA 3F7QA 1PX8A 4YOKA 4WU7B 4H0IA 3VJ6B 3PJLA 3AMDA 3QIBB 2I69A 3G22A 2DZTA 2VR3A 4NY2A 1PAZA 4KZEL 2GL5A 3TJEH 1ETZB 3GTIA 2WP3O 3FGCB 2A6DA 5C7XH 5HYFA 1R85A 1QVOB 2E7LA 5E51A 3KBEA 3QFJA 4WWNA 1NC2A 1XBRA 4IM4A 3ABKB 4MHHG 3AT9A 3GWJA 3BZEB 1H6FA 2FRGP 5GRUL 2DJ4A 2DGAA 1WOBA 3WV0A 2FLBT 2EDRA 3CVHB 4YGAB 2PC4A 4CQ9A 1U6AH 1EB3A 3UZXA 2B4CH 3F58L 1P4IL 2N7BA 1JYXA 4JDEA 3UD6A 2R7EA 5KSUA 4LIQE 3W7MA 4L7ZA 3C2AH 1KELH 1IGWA 3M16A 4FKEA 2VRJA 4X5PA 4AL8H 4QNWA 3PGDB 1S5MA 1KGJA 4GKNA 3AHTA 1G4EA 1N3NB 1CBVL 4NZDA 1X38A 4AY0A 5B1JA 6FABL 1NGYB 3ULAB 4FFTA 4FXGB 3GKAA 4M6ML 4X4ME 1ZIAA 3HR5A 2Y07H 4KKRA 1MH5B 5BO1H 1OP3K 5A6KA 4AX6A 5FDWA 1ILUA 3SGDI 2VZ1A 3DUUA 3QZNA 4NT6B 1YNTA 5IW1B 3BESR 3TO2A 4F8QA 4XMZA 2R0KH 3NQ8A 1M3JA 5CLXA 3QVAA 2DTML 3P74A 3SDDA 4APQC 4KAQH 2R9HD 3WLPA 4E6MA 2VXUH 3TIDA 4HLJA 1YEHH 4TVSa 1IBGL 4NENB 3QZBA 4OGAD 4YHLH 2ZKYA 2G0WA 5I15L 4EI5C 7FABL 4UWQB 1A50A 1TUPA 2EPHA 1S38A 4KI5F 4A8NA 1E5AA 4O1BA 3VCRA 2Y5TB 4NDMB 4JN2B 4A4AA 4MMZA 4OGYH 1E4HA 4J6RH 2C13A 1OD7A 3DSFL 2Q71A 3KPOA 2JGYA 1LF1A 2DQXA 4OZOA 1BAGA 3I6KA 1RK0B 4Q3MA 5TDOA 3NCXA 2W9EH 2E7LC 5E4IA 5FEWA 1KT2B 1OP3H 3AQZA 5ABDE 2J4WL 2OR2A 1WNOA 2J72A 4WAFA 5TE4H 4L8CA 3QQ3B 4GSQA 2V69A 1B0RA 5E0FA 4L6OA 3NDZA 2EZ0C 2GSGA 2HDJA 5KSAB 4YXLL 4Z0JA 4LC8A 5KYXA 3MV9D 4DWSA 1GYNA 4H9UA 4PV9A 5BNXD 5FA3B 4L4TE 4W9KC 1MCFA 3OLGA 4C6MA 4O4VA 1BZ7A 3T6ZA 1FCGA 3BP4A 1KCKA 1OD8A 2FJGA 3BGFB 1L3WA 4YZWA 2FKPA 5E2UH 3HZYA 3HAEG 3P0YL 1NFDB 1IFHL 1XS2A 5G1TA 4DZAA 5G4NA 1DVXA 1KTKE 3QV8A 1NP2A 3WUWB 2ITCA 3BARA 1RUML 3N9KA 3UH8A 5LGKA 4H2HA 1F0LA 1XXFC 4P8WA 1YEDB 5AW9B 4UQAA 4KCUA 3D48R 5D2NB 1LQ2A 3L66A 3N14A 4X0KA 1RMFH 5DD3H 3SDDC 3P11L 3H23A 1QSZA 3UZZA 1BJ1H 3D3VE 2LVCA 1IT9L 2WMIB 4Q7DA 1S1RA 2CWXA 1MKFA 3WDQA 2PUQT 1YYLH 5JMRA 3B6SA 2RGMA 2WXMA 3B8TA 4HETA 3KRBA 2VDQH 3QORD 3W70A 4TN9A 3AIVA 4H8NA 2GT9A 1P2CB 3EMCA 1GG0A 4WHDA 1OAQH 3QHZL 3N1FC 3WBXA 4MMZC 3N6JA 4H20L 3NAVA 2DJLA 3KLAA 4OM0L 3IIXA 3ZE1E 3HC3L 4D9RD 1JVNA 3IMVA 5HHXH 1PDKB 1R5IB 1F05A 4N6RB 4JQAA 3GGWB 3NK3A 3OVUB 1UPMB 1INQB 2HJPA 3UTSE 6PAZA 4IPNB 4F7MA 1EQPA 3DSNB 5EO1A 2R9RA 3TR9A 4KKCC 1F58L 3CPLB 4BZ1L 1HTYA 2BSRB 4KEMA 1WDRA 1FWJC 2C3ZA 3SGEH 1R5WA 3IRCA 3LKRB 4OKVA 4Q74A 4P5KB 5DO2C 2ZYRA 5DRNA 2YAOA 5FIPA 4R0LA 3FONA 2X6CA 5KANI 4OT1H 3GD1C 4DWSC 1K1DA 4WQ6A 2DZEA 2P5WB 3QUZB 1XPGA 4Q8NA 3H2MA 4OF5A 1FWTA 4DI8A 1OAUH 3VFOB 1TEYA 4JRWA 2J5LB 2PD9A 3N91A 1JZEA 2E9JA 1FO0L 1Q2RA 3IN2A 2WPGA 4ZQRA 2Y7FA 1IAIM 3IFOA 1CE1L 3NIFF 2VVSA 5EIIB 3FUDA 5U4NA 3IYLW 2BW5A 4AKPA 3EHBD 4AQZA 2R1WA 2OT0A 1XMWA 5E2WL 3IKKA