1HNYA

The structure of human pancreatic alpha-amylase at 1.8 angstroms resolution and comparisons with related enzymes
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HUMAN PANCREATIC ALPHA-AMYLASE
publication title The structure of human pancreatic alpha-amylase at 1.8 A resolution and comparisons with related enzymes.
pubmed rcsb
molecule tags Hydrolase (o-glycosyl)
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hnyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hnyA01
2AAAA 5DF0A 3J7HA 3VVGA 5A6BA 1Q6FA 4HTYA 1A3HA 3WDQA 1VBUA 3L4TA 4W8AA 1CTNA 4UQAA 3T0AA 2YFOA 3ZJ8A 3BVXA 1GZJA 2ZOXA 1F4AA 5A8NA 1B3VA 3AJ7A 1NARA 4UCFA 1LL4A 3SCRA 4H2CA 2EJ1A 3OLGA 3TOPA 1E40A 2FH8A 3WL0A 3K1DA 4FMVA 4HMDA 3RM4A 1JZ7A 5A6MA 4HOZA 2W67A 2E9BA 4HA4A 5ABHA 1JZ4A 3S6TA 2CXGA 1QNOA 3VUPA 4UOJA 5BRQA 2YLAA 3DHUA 1QNQA 3DHPA 2WVSA 1HF6A 2E3ZA 3WKZA 1E6PA 2X05A 3NSXA 3PN8A 4W5ZA 1SMAA 2FHBA 3DX1A 5BXPA 2OYKA 3WNKA 1GONA 4DO6A 2CEQA 3SCQA 3L4UA 4AZIA 2F8QA 3HG2A 3MS8A 4LGXA 1WDQA 3EMCA 1Z32X 1QWUA 1BGGA 2VX4A 3W25A 2XN2A 1XD1A 1UWRA 2YLLA 4M1RA 4CU6A 1M03A 1EH9A 1H11A 3KL3A 1N82A 4R5EA 4WLCA 2BHZA 2WVVA 1WDPA 5EMYA 3DDFA 4AZCA 5I77A 3VX1A 3AI0A 2XN0A 1UKPA 2IXUA 5CQ1A 4WKAA 1HXJA 3WD3A 3WH9A 3WDJA 2O9PA 4LXFA 5EBAA 3ZJ6A 3CZEA 3CZJA 4RE2A 1E56A 5GNXA 4UFMA 3WH5A 4MNLA 1B9ZA 5CPQA 3ZO9A 1JYNA 1NWSA 4V28A 1CYGA 4AYSA 1UOKA 2OSYA 5BRPA 3A6OA 2YL5A 2VZOA 3OZOA 1E6NA 3VD3A 1B2YA 1BFNA 2A3CA 3KL5A 3BVVA 4B3KA 2UY3A 2E40A 5GNYA 4YPJA 4WK9A 5IHRA 2YDSA 1B3XA 4B15A 1PBGA 3DYOA 2VVNA 3WH7A 1C90A 2YJQA 4GINA 2WAGA 1R86A 2WCSA 1WKYA 3W29A 3W6LA 4H8UA 3WNMA 1LL7A 2D3LA 2WVVB 1UG6A 7TAAA 1OBAA 3UETA 3LPOA 2WYSA 1GORA 5D8ZA 1WDRA 2VZTA 1UZ4A 4GIAA 4AZCB 1M01A 4FLSA 1YQ2A 2ZX6A 1XSKA 1V6WA 4Y7EA 2WK2A 3GH7A 3VNZA 1QPKA 4PMQA 2YFNA 5D9PA 4GO9A 3I3EA 1TVNA 3GDBA 2WZIA 4AZ5A 2XM1A 3ARVA 1JZ8A 4AZ7A 1NWUA 3RDKA 1XCXA 4FLOA 2VZUA 2ZX8A 1MQQA 4CU8A 1ISYA 3LX9A 2X0YA 2C0HA 2D0HA 2BS9A 5HPCA 1MW3A 5I78A 2YBTA 4NZCA 1B3YA 1AQMA 3RM8A 3VIIA 1M53A 3S5ZA 2FYVA 1D7FA 4UZSA 1H41A 4M24A 2PBGA 3OBAA 3U7BA 1HJQA 2WZEA 1EIBA 3A21A 1V02A 4W7WA 5AY7A 3IJ8A 4AW7A 1OIFA 4GI9A 4W89A 4DUXA 3BLPX 5M03A 4GXPA 3BLBA 3N13A 3WNNA 4AISA 3WEMA 1UWIA 3FNDA 1XD0A 2YA0A 1TZ7A 2ZUNA 4HU0A 4PTWA 3SUVA 1LWJA 5A95A 3VGDA 1ZJBA 1TA3A 3U57A 1BF2A 1G1YA 1C8QA 3BH4A 3WQ6A 1E15A 1UA7A 2GJXA 1DWIM 3EMZA 1CLVA 1AQHA 4B3LA 2E9LA 3M46A 4W7VA 4FNQA 4NXKA 3GXTA 1JD9A 3WH8A 4GZIA 4W8LA 1ISWA 1M04A 1SFSA 3D52A 4WKHA 2XGIA 4D72A 4MTVA 2MANA 4BQ4A 1BQCA 4PCSA 2Z1SA 4AIOA 3TONA 3CO4A 1CGUA 1W9DM 3MANA 2ZUWA 1KXQA 3SCUA 2D24A 2W66A 4JFWA 2ZUSA 1JI2A 5GQBA 4UFKA 3BAWA 1KXHA 4AWEA 3ARUA 3K8LA 1V3MA 3EJRA 1TQUA 1GJWA 3W6MA 3VDHA 5HXMA 3T09A 1ECEA 1UHVA 5I0DA 5LA1A 1V3JA 2XVKA 1OT1A 3VIGA 2XVLA 1A47A 1V03A 1NOFA 1OT2A 3GTNA 3BVWA 1LQ0A 2EPMX 4URIA 2WMGA 3OGRA 2PI6A 2GFTA 1FFQA 1OD0A 4ATDA 2DSZA 5ABGA 1C8XA 3S2CA 1FFRA 2J7DA 3WDHA 4AEEA 2GJXB 3I3DA 5HPOA 1GOWA 3CPUA 1JXJA 4IISA 3GXNA 4ZE5A 4A3YA 1HP4A 3GXPA 1UQYA 3EDEA 3T2OA 2CBJA 1Q6DA 2WVTA 3BVUA 3CV5A 5FD0A 3VGEA 1W9PA 1GHRA 5A6KA 4M8UA 2CHNA 3A3HA 4AD0A 2EACA 2QPUA 3M6DA 1KQZA 1VB9A 4X0NA 2WXDM 2XYLA 2VZVA 2JEPA 1OIMA 1JD7A 1VFUA 2F1BA 1R87A 4QLJA 1J01A 2VRQA 3MI6A 3FXYA 3IAPA 4P8WA 1HT6A 6TAAA 4D6EA 5D4YA 2ZXBA 1PIFA 1V6VA 1V3LA 5BWFA 4JFSA 5JIPA 2DT1A 4MB3A 3KL0A 4F79A 4IPLA 2JF7A 1XCWA 2O92A 1G9HA 5FIPA 5FL0A 4PMRA 3CTTA 2WMKA 1UD2A 2WHKA 3UERA 2XVNA 3WDPP 4ACYA 1GNXA 2WCGA 1R33A 2XVGA 4KWUA 1OINA 1MQRA 1CXEA 4GZEA 3A4AA 4UOQA 1KGWA 5C70A 4DM1A 3FW6A 1JAEA 1V0MA 1V02E 2J74A 1FHLA 1E9LA 1CWYA 4CGTA 1DHKA 3WBAA 1IV8A 2RGLA 1UKSA 3ARWA 1C8YA 2X1IA 2G3JA 3GZAA 1UUQA 3BUQA 5CGTA 3QOKA 4AZ6A 3GBDA 4JKKA 3OA5A 3MMUA 2ZXDA 3L4XA 2V5DA 1ZBVA 1CGVA 3WD0A 4BF7A 4WKFA 4WF7A 4AZGA 2ZXAA 2DQXA 2D0GA 5E1QA 1C93A 2XPKA 4HPGA 3K4AA 4GKLA 2OSWA 3L4ZA 1G01A 3K4DA 2QLYA 4E2OA 1JAKA 4D71A 3CUHA 4HPHA 5I6SA 2DEPA 1TE1A 1R46A 3CHEA 3LXCA 1VJSA 2CERA 4U33A 4AD1A 3MUAA 1B1YA 3ZR5A 2DSKA 1XSJA 2F7QA 4U3AA 3EJPA 3AYSA 5A2BA 4MADA 1EDQA 1GQIA 3IAQA 4L4PA 1EHAA 4H41A 4KRTA 4S3KA 4PUDA 5BCAA 5I23A 4AD3A 3B9EA 2FHCA 2BV9A 1HVQA 3WQ4A 1JG9A 1E1EA 5FCZA 3WDRA 1JZ6A 2WPGA 1QBBA 2ZX7A 4CD4A 1PZ3A 2BXYA 4ZFMA 1JYVA 4XUYA 1GQLA 2J8FA 3AHZA 1E4MM 3WSUA 4GI8A 1H09A 2VX6A 5A8QA 2OW6A 3BAYA 2C8NA 4UFIA 4AXNA 4D6CA 2WNWA 2O9OA 2CNCA 1DTUA 1GVYA 3MU7A 3L4VA 3WD2A 2O9TA 4P8XA 3PBGA 5HNNA 3WF4A 2WSPA 2ZIDA 2EQDA 1CGTA 1FOBA 3ZT5A 4YHGA 4DO5A 3WQWA 4BCEA 3VOCA 3ZMRA 2V3GA 2CESA 1XH1A 3GNRA 1MQPA 1E6XM 3CHDA 1OWQA 1E6QM 2V38A 4WSJA 3QHOA 3WMCA 3WBEA 3UESA 3AHYA 1WZLA 2D1ZA 3VDAA 5E0FA 1GOQA 1QW8A 2PWHA 4DWSA 3AMDA 4CU7A 4BQ5A 2WW5A 2YA2A 1L0PA 5C71A 2UY4A 4TX6A 2DSVA 3SCOA 1BYCA 4CD7A 2EBNA 4TTGA 1WPCA 1HJSA 5M17A 5IFTA 3CZNA 2CKSA 4PCTA 4CCEA 4WJXA 1G94A 2XWEA 4ZEPA 5A6BD 2JALA 1SYTA 2VR5A 1U2YA 2FGZA 3AYRA 2G3IA 1DWJM 2GJRA 1PAMA 1B3WA 2IXVA 4XX6A 1HJXA 3PZ9A 4F66A 4C7DA 3I3BA 1UH4A 4DUVA 4CVUA 1K9TA 3DX0A 1ODZA 4H8HA 1JZ5A 2YKKA 2BVDA 2X2JA 3EJQA 3LRLA 3DX3A 1LL6A 2BXZA 2BNJA 4TVCA 1E6ZA 2NW0A 2X0HA 1WCGA 3VIMA 3D4ZA 3ZQ9A 3PZIA 1WZKA 3GXFA 4JCLA 5I5RA 1D2KA 2G41A 1MW2A 1GVIA 4JFVA 1WO2A 1CEOA 4JKLA 3S5YA 2WMFA 3WFLA 1UASA 4QFUA 2OWCA 1JIBA 2D23A 3KWXA 4DWSB 1O7AA 3THCA 7A3HA 3WIJA 1C7SA 2J77A 2FH6A 1E0XA 4UQCA 1JZ3A 3N1AA 4DUWA 2F1AA 1QHZA 3WQ8A 4JL2A 2PB1A 2D20A 8A3HA 2PWGA 4B9ZA 5DT7A 4ZENA 4LYRA 2XIBA 2GDUA 4J3UA 5GNZA 3BAKA 1V0LA 3A4WA 1W3HA 3SUTA 4LYPA 1LG1A 3AICA 1JL8A 1OB0A 3BUPA 3VX0A 4UQEA 1E5JA 1UR2A 3PZQA 2CBVA 3AIQA 4HP5A 5CG0A 4B9YA 1VIWA 4PMDA 1SZNA 4QAWA 2F7RA 3ARRA 3SCPA 3W82A 4UQDA 5A6JA 4X9YA 1UWSA 1LG2A 1KTBA 3K8KA 1GOMA 4HOWA 1JDDA 1VEOA 4MJ2A 1DWGM 4HZ8A 3WY4A 3ZT7A 4FK9A 1V3HA 4W8BA 3BMVA 3DYPA 1JI1A 3KEHA 1ZS2A 3UCQA 5LA2A 3ARYA 2A3EA 3HMCA 2J7BA 3AQUA 1XHGA 1R34A 4F9DA 3IJ9A 3LRKA 1CECA 1J11A 4PYSA 3E1F1 5CPSA 4GPNA 1QI0A 9CGTA 1VFOA 1BGAA 2WLYA 1PIGA 2QF8A 5AYIA 2E8YA 2VNCA 1BSIA 1QX1A 2WM0A 4QLKA 2WB5A 3MUY1 4KMQA 2A3HA 3SUUA 1ESWA 4LPCA 1OD8A 3WF3A 1JDAA 3VD4A 4AIUA 3N17A 3WF2A 2GDVA 5KZ6A 3M07A 3ARXA 8CGTA 3DC0A 4JHZA 2J62A 1XSIA 2VR4A 4D6FA 3VNYA 5CSUA 1DP0A 2J7FA 4U5KA 2VO5A 1C92A 4AD4A 1J12A 2YL9A 7CGTA 3EMQA 2YL8A 3ARTA 3IANA 1W9VA 4AEFA 3VIFA 2XJ7A 3FHAA 3WENA 3O2LA 3PTMA 3WUBA 1QI5A 2ZICA 3AXHA 2WMJA 2J75A 1Q4NX 3ZOAA 5JUVA 2XFYA 2VRKA 2DIEA 3CZGA 5AC5A 1HL9A 3BGAA 3CMJA 3G6LA 3UG3A 1JNDA 3ZT6A 4PRWA 4PMOA 3SIMA 1KCLA 4U2ZA 3AIWA 2WSKA 1OM0A 1UWUA 3IGUA 3LXAA 4X0VA 2W5FA 1QNSA 4MB5A 3AZSA 3GH5A 2Y8KA 3WUFA 1PPIA 3VD5A 2UY5A 4YN5A 1UD8A 2CKRA 3VSUA 2WC4A 1J0JA 1K9EA 1KWKA 1TCMA 1NOUA 3H55A 1EGZA 4B16A 1RD6A 2ZUUA 2XGBA 5JBDA 1QNPA 3O6AA 3W27A 3BAJA 1MWOA 3GNPA 3HG4A 3BUDA 4GQRA 1VRXA 2BY3A 1TQVA 3AZTA 1PZ2A 3D4YA 4GZJA 1W9BM 4LYQA 5JBEA 4UR9A 3D3AA 2JIWA 4Z2IA 4OUEA 1AMYA 4AZHA 4MB4A 4PMXA 1UR4A 2VCAA 1ITCA 1XC6A 2XSAA 1ITXA 3CZ8A 3VIHA 1E73M 2F61A 3DX2A 5EFDA 5CSYA 1CGWA 4AYGA 2WVUA 4W87A 1QW9A 5D9OA 4ATWA 5BXTA 3N04A 3BLKA 2WHJA 6CGTA 4HU8A 3VKKA 4ZE4A 4W84A 3W26A 2XTKA 4QCFA 2JF6A 3WD1A 1HTYA 1E3ZA 3AXIA 3NDYA 4N42A 3HJEA 3MMDA 1WNOA 5IXEA 1O7DC 3GH4A 1JYXA 2CITA 1V3IA 4AMXA 1W1VA 3NCOA 3WELA 3W37A 2XHYA 3VD7A 2QMJA 4NXSA 4N0RA 3D51A 5CJ5A 5FL1A 4AIEA 4HMEA 2WBGA 5CLTA 5E6YA 1UR8A 5JIWA 1JF6A 2ZX5A 4WIWA 4PMZA 3AS2A 3DDGA 5CGMA 1PX3A 1MVYA 1AQ0A 4JFTA 1G0CA 3RJYA 1QVBA 1WP6A 3VM7A 2DPEA 3F4VA 1DWFM 4JAWA 5A2CA 4D1JA 1E4IA 3GNOA 2WHLA 3TTOA 4WSKA 4HZ7A 4UQ9A 3BAXA 4MNJA 5E0CA 3EDJA 4KH2A 2YDQA 1H49A 4W88A 1UA3A 1E55A 2PBOA 4GO8A 4H8VA 1OCQA 4PTXA 3SCTA 2CCRA 1ZU8A 1H2JA 2F2HA 2YOCA 1HL8A 4PN2A 4MPKA 1GHSA 4Z2GA 2GSJA 3KE0A 1CXHA 3BXWA 2VTFA 4P7QA 4BA0A 1WB0A 2D0FA 2WKLA 4Z2JA 2ZWZA 1LLOA 2BFGA 2AOSA 2VURA 1UD6A 1F4HA 5CXPA 1JZ2A 1VEMA 1UKTA 2PC8A 4PTMA 4ATLA 3ARZA 1RH9A 3VM5A 1IZKA 3AZRA 1PJ9A 4CD8A 2PWFA 1V0NA 2G3MA 2XIIA 1J18A 1H5VA 1ZJAA 1EOMA 5AC4A 4D6HA 3VILA 2W61A 1E43A 4K68A 3VMNA 3L2LA 3LMYA 3MKKA 2GUYA 1ZBWA 2EPOA 1AVAA 4C7GA 2BHUA 4GI6A 3WEOA 4CKQA 3OGVA 1Q6EA 2WC3A 2HVMA 4UTFA 5A69A 3EBVA 4TX8A 5GPRA 3VPLA 1EXPA 1LF1A 5DT5A 4KRUA 3AIEA 1E0WA 3OG2A 4DM2A 3ZR6A 3AROA 1GOKA 4XB3A 2YIHA 2X2IA 2V3EA 2FGLA 1J0HA 2XVPA 2C7FA 3UR8A 3BSGA 4NI3A 1OGGA 2EEXA 1LJYA 1KR0A 3LXBA 5I79A 4A4AA 4C7FA 4W93A 2W91A 4RL3A 4BZYA 1BG9A 3ARPA 1NOWA 2J25A 1VENA 2W4XA 3ECQA 3FY1A 1JDCA 3UG4A 2OW7A 3N12A 1EO7A 1W9XA 2WKGA 1R7AA 3HZ3A 3GXDA 2VOTA 2W92A 3KLLA 1MXDA 4ZXOA 1HKJA 3WMBA 5TD4A 1JNEA 3N9KA 4PUEA 2Y24A 2J7CA 3QOMA 4OGZA 1V6UA 3MO4A 1CZ1A 3SCNA 3L2MA 1MW1A 1Q6GA 3ZSSA 5DFAA 2E4TA 4MJ4A 3PZMA 1BPLB 3CHFA 2A3BA 2PF0A 4FNRA 4QP0A 3M7SA 3VSTA 5ABFA 3VMOA 4R27A 3FN9A 4JKMA 2VCBA 5DMYA 4D1IA 3NIYA 3D50A 3DYMA 1J0IA 1H4PA 1R47A 3CHCA 1EQCA 1X6NA 4UNIA 1UKOA 4M82A 2E0PA 1K6AA 1E4LA 1R7OA 1ISVA 1O6IA 4PSRA 4IUGA 2PWDA 4D6IA 1ZL1A 1JYWA 4HA1A 1DWHM 3W0KA 1HIZA 3B8SA 1UWTA 2CBIA 2ZUTA 1VEPA 2XN1A 1W3LA 2QMKA 3PZTA 3VSVA 1UR9A 4EANA 1NWRA 1EDTA 4DWSD 5E70A 3T2PA 5ECUA 4MDPA 2VUYA 2GVYA 1E72M 1MFUA 3WQVA 3AIRA 3WQ5A 4BS0A 1EHNA 2XFFA 3MV01 4OZOA 3AS3A 3VGBA 3IJ7A 3A47A 1W2VA 1YHTA 3RIKA 1Q6CA 2EXOA 1EA9C 4CUCA 1NWTA 4A3HA 4EK7A 3II1A 5ABFB 3AS1A 4E8CA 2YBUA 2FHFA 2PWEA 1B31A 3WD4A 1IT0A 3AIBA 3RPMA 5A6LA 2CETA 3QR3A 1UD4A 1UR0A 3G6MA 2WANA 1KBBA 1HVXA 3QHMA 5E6ZA 5CZKA 1DWAM 4Z2HA 3MSDA 2J79A 2ZWYA 1QI4A 4M56A 1B30A 1OGBA 3VGFA 3F5KA 5EFFA 1XV8A 2V3FA 3CUGA 2OWWA 4J7RA 1BVZA 2OWXA 3LPPA 4Z2LA 2W63A 3SUSA 4PMNA 1T0OA 1ZBKA 1UH2A 2J7HA 4U31A 3WL1A 1EO5A 2VJXA 3A4XA 1W1YA 4OIFA 3AMKA 3OZPA 5A6SA 3OLEA 3HN3A 3ARSA 5FOOA 1GCYA 4YHEA 4QCEA 4Q22A 1KGXA 1FH8A 1CXIA 4UFHA 2BVYA 4J3SA 1GOOA 3W28A 3SURA 2ZUMA 3AIVA 3CBWA 5BYWA 1I75A 1CNVA 1DEDA 5FKYA 4MAVA 2D22A 3PHAA 4OOZA 3EDKA 1RPKA 3MMWA 3GXIA 3EJSA 2OLHA 3W81A 3MUZ1 4U5IA 4QDMA 5A1AA 5M3WA 4L4OA 3CGTA 3ALFA 3NSNA 2WHMA 1UH3A 1V08A 1I1XA 2GK1B 4J27A 3N11A 4AC1X 2ZUVA 3NYDA 2VC9A 3DECA 2ZE0A 1H3GA 1FP9A 1CGYA 4W85A 4M80A 3BCDA 3T0DA 3WFZA 2YA1A 1TFVA 2ZXQA 3KLKA 1EDGA 1EQPA 5JBFA 4D6DA 2Y8VA 3ZJKA 3SUWA 1XRVA 1VAHA 1BHGA 2TAAA 2VQTA 1J9YA 3PZUA 4CCCA 3PZVA 3BUIA 1V6XA 2YDRA 3OB8A 3K8MA 2DSUA 2J78A 3BSHA 1HX0A 2BY2A 3WH6A 2AMGA 4H7VA 3PZGA 4ACZA 3VINA 1W3JA 2B31A 2BY1A 3QHNA 4KGLA 2ESCA 3OGSA 4J3TA 3WMSA 3O9NA 1MFVA 1US3A 4D6JA 4PMYA 1B0IA 3MUIA 4XZBA 2VZSA 1IZJA 2EABA 1CPUA 4S3JA 3VO0A 5D9MA 2DT2A 3T08A 3RCNA 1B3ZA 1PS3A 5A3HA 1ODUA 1C91A 1G5AA 2D73A 1E4NA 2WWDA 2DGAA 4J3WA 4HA3A 3SCVA 5D9NA 2J7GA 3A5VA 1CIUA 4V27A 4UFJA 3IK2A 3QGVA 4TUFA 1NQ6A 1VBRA 1KBKA 1SR0A 2WMHA 1E6SM 2VMFA 4NRSA 2F7OA 1WZAA 2NT1A 4JL1A 1X1NA 1W2PA 1BAGA 1JGIA 3TA9A 3THDA 3UEQA 3ARQA 1V6YA 3APGA 3ZSTA 1M7XA 2BHYA 4HOXA 5I3DA 4EE9A 2G4FA 3L4YA 3OIHA 1VFMA 3MSGA 3WN6A 3VIOA 1CLXA 1H0GA 1UWQA 1HKMA 4FLRA 3CC1A 3WNLA 4ACZB 4AD2A 2WZHA 4OBSA 5DEZA 1ZBCA 4NZJA 2DT0A 3AMLA 4CCDA 2JE8A 1WDSA 2X8RA 3EJTA 1C7TA 1RP9A 1U33A 2CHOA 4NSBA 2X09A 5CPTA 2CBUA 1TQSA 3HG5A 4EKJA 3WNPA 4IPNB 4PBGA 1JFHA 1OSEA 1KFWA 4RE3A 3T0BA 3A22A 2JEQA 1JXKA 3CUFA 2QHAA 2FE0A 2VCCA 2DH3A 1GJUA 3K46A 2OYMA 5BXRA 2QPSA 1W1PA 4FNSA 4MB1A 2VL4A 2WBKA 4ZXLA 3ZIZA 5IHSA 1CXFA 5KEZA 3CZKA 1UD3A 5CLWA 1WZMA 3CUIA 3AMGA 3HG3A 2VQUA 4AMWA 5DO8A 3EYPA 1BYBA 4Z2KA 1E71M 3L4WA 3PTKA 1TG7A 3AHTA 2WLZA 3AS0A 1FA2A 1LWHA 3A24A 1GPFA 1E0VA 4QLLA 4MAZA 4TOQA 2VT0A 1VFFA 4JIEA 2FDMA 4HZ6A 1CENA 1W32A 3TTSA 3WY2A 1E3XA 4W7UA 1B90A 2F7PA 5HOSA 2ALWA 5A8MA 1U30A 1K9FA 2BY0A 4NRRA 4U3CA 1ZB5A 3WDIA 3B9DA 3HU7A 1MYRA 1CXLA 3A23A 4M29A 3T2QA 3FAWA 4P8UA 3WUGA 3B9AA 5LYRA 4OBRA 1K9DA 1P6WA 3CZSA 3W38A 3U5UA 1WE5A 3WY1A 1BLIA 1UR1A 3CUJA 2WC7A 2DDXA 3ALGA 4PEEA 3BUBA 4AY1A 1KQYA 3NSMA 3NUKA 2DSWA 4CN4A 1HKIA 3W24A 4LQ1A 5D8WA 1I1WA 4P8VA 2EADA 1HN1A 4E8DA 3VGHA 1J0YA 3GYCA 5F7UA 3EDDA 1KGUA 4UOZA 3W53A 2EO7A 3TTQA 2G8ZA 4MNMA 5C8BB 1BG4A 2XG9A 3WY3A 2NT0A 2VX5A 5HBFA 4CD6A 1PX8A 4FNPA 4H04A 4EAMA 3FAXA 1TA3B 1KCKA 3VGGA 4TXEA 3U5YA 3UG5A 4GQQA 4UQBA 1J10A 3CZLA 5BXSA 3BCFA 3SCSA 2E8ZA 1KWGA 1CGXA 1XGZA 3VDCA 2HISA 3VDBA 1HJUA 4MNKA 1NM9A 4JZ5A 1XH2A 4BQ3A 3LPGA 5E9AA 2VRJA 2RGMA 1C3FA 2DIJA 3WUEA 4PSPA 4RE4A 2O9RA 5HDRA 4JHOA 5EB8A 2Z1KA 1PEZA 3OLDA 5E09A 3AHVA 4OOUA 1FH9A 1RP8A 3AOFA 1TQTA 2Y4SA 2EPLX 3MV11 2UWFA 1BVNP 1KXTA 3PZNA 3F5LA 1BYAA 1E1FA 4D6GA 1R8LA 1GQKA 4W5UA 1V3KA 4XV0A 2IGTA 5I24A 1H0IA 1J0ZA 4XZWA 1X6LA 3TV8A 1GUVA 1L8NA 4CVWA 3VIPA 3KZSA 3F5JA 1TMQA 4E4PA 4TVUA 2XFRA 1NP0A 4CD5A 4KGJA 1CXKA 4P7OA 1VJZA 4M81A 2V5CA 1ISXA 3BAIA 5BROA 5M5DA 1W91A 4CN6A 1SMDA 1CDGA 4Q7NA 3RO8A 1XH0A 4NZFA 1PX4A 3NDZA 3POHA 1OGSA 4JCMA 4U2YA 1JFXA 2OYLA 5IFPA 1WAWA 1H1NA 3AFBA 1KXVA 2V3DA 4PMVA 4P7RA 1TUXA 1Y7VA 1CBGA 1JF5A 1R75A 3UR7A 5A2AA 3RM9A 2Q8XA 3AMCA 3EDFA 4TVDA 1W3KA 1HJVA 5IDIA 4LX4A 4DO4A 1E70M 4W86A 3H53A 1GW1A 1FP8A 4BQ2A 2WWCA 1D3CA 2CPUA 3WF0A 1KTCA 2CIPA 2E9MA 3CH9A 3TP4A 1S46A 3SEPA 3U7VA 1TR1A 3RJXA 4IM4A 1E6RA 5A94A 3LRMA 1TVPA 3N18A 2WMIA 4PMUA 3SCWA 4FLQA 1TQWA 1HWWA 3CMGA 2VVSA 3WEZA 1KR1A 1FHDA 2XSBA 1UYQA 2D2OA 1QHOA 4P7NA 4UFLA 2EPNA 1BYDA 5ABEA 1HJWA 1US2A 1XYZA 3GBEA 2GJPA 2CYGA 2DT3A 3N15A 4NF7A 3DX4A 2XUCA 1XYFA 1W1TA 1VF8A 4J28A 1QOXA 3AXXA 1W9UA 3ZM8A 3FHQA 2X2HA 1QI2A 5AYBA 1V0KA 4F8XA 1FH7A 2YL6A 2EPKX 1J0KA 1GQJA 5A8PA 3VMPA 4J3VA 2F18A 4MDOA 1ISZA 3AHXA 3EJUA 5LA0A 2J4GA 3BVTA 4OKDA 2UY2A 1HNYA 1MW0A 1HXKA 3RILA 1KB3A 2QV4A 4JFUA 3TTYA 2BVTA 2WCAA 3GXMA 2JFEX 5A8OA 4TTUA 2JIEA 5I2UA 6A3HA 2VX7A 2WMIB 4F9JA 3VIKA 1QWNA 4ML4A 1NH6A 2DH2A 4PTVA 3W4RA 1HKKA 3OLIA 3CIVA 1UD5A 4CN1A 2D3NA 1GOIA 4FNTA 3H54A 4FF5A 3VD9A 2XM2A 2Y2WA 3POCA 3VTRA 2IUZA 3PTQA 4NX0A 4AD5A 1HP5A 3BMWA 1MXGA 1BTCA 1UKQA 3ZJ7A 4UZUA 2J7EA 2XWDA 1QBAA 4P7LA 2A3AA 1NP2A 1R85A 3LPFA 3JUGA 4DWSC 1UQZA 4OJYA 3PZOA 3NJ3A 2VI0A 3WNOA 3WF1A 4HMCA 3GM8A 2G3NA 1QHPA 2Y5EA 2GK1A 3D5HA 2EAEA 4J3XA 3CLWA 4AMCA 1EOKA 1QI3A 2J8GA 3VIJA 3AIUA 4AZBA 2J47A 3VU2A 4FNUA 3RMEA 2X2YA 3BC9A 2ZX9A 1E5NA 3AISA 5A6AA 2NSXA 4V2XA 1UZ1A 2OSXA 2W62A 1QNRA
chains in the Genus database with same CATH superfamily
1C5CL 1VCGA 2N7SA 4OI9A 4DVRL 3IM1A 4LU0A 4WQOA 4FEIA 2H9GA 1GZJA 4L65A 4ILSA 1JGUL 3UYOD 1FX6A 4GJTB 1EZSA 3AABA 1HZLA 2IJ0C 3MJ6A 5A6MA 4FQ2H 4JFYA 3VUPA 4Z7WE 3C8NA 3V7AE 3L3KA 3VWJC 3ESMA 3CV2A 3WSQH 4NM4L 1O1ZA 4YHOL 1MQKH 3MHFA 3AACA 4FHAA 3SCQA 4Q8QA 1EJWC 3KPOB 2F8QA 4WHTA 3CHSA 5F9DC 2JLLA 2VX4A 4HWNA 4ZSTA 5E5UB 2Z6IA 3HJ0A 5CZXC 4CU6A 1M03A 2EKGA 3ENLA 5FDWB 3QISA 1IFHL 1X7FA 4AFYA 5AVHA 3RWGA 4AMAA 1PIIA 1O6TA 5I77A 3L3IB 4KNUA 4WOZA 5DFVC 2GCYA 1N8OE 3SKNB 1B2WH 5DBUA 5GRYA 4Z7VA 3W86A 2ZKHL 1SJDA 1G7LA 1J5TA 3ZO9A 2PPAA 1CYGA 4YSCA 4E9LA 2GJNA 1YN7B 3B4NA 5BV7C 1F3JB 1E6NA 4DPCX 1B2YA 4MNGA 2E7LA 2J4WH 4Z95H 3Q2CA 4Y1SA 3PXJA 4M4RA 3QZWA 2P1YA 2K9UA 5GZNC 3LRSB 1UWAA 1LOQA 4DB7A 2WVVB 3KLQA 2VLKA 3FLUA 2FJHB 1JPDX 1ZHKA 3LCWA 1XSKA 2HJKB 4DP1X 2ZUYA 1QPKA 4Y2DC 1NCWL 1EERB 4MXWH 3LHVA 4XH2B 1BG1A 1J9SA 3VE0B 2FZ3A 5H8PA 2X0YA 2BS9A 1AQMA 4CEXC 1DQQA 1INQB 4OCNC 3B8UA 5DCBA 4JRYE 3VABA 3OBAA 1S9WA 1MHHB 3ROOB 4ZW7A 2OPJA 4F8PA 5F8RC 4RRPA 3CFKB 4GI9A 4W89A 3B9OA 1GYNA 3U1QA 3FUFA 2OFJA 1UWIA 1R5IA 2ZUNA 1FRGH 2NR6C 3SUVA 3ZFHA 1G4RA 4FE9A 4E5XG 1C8QA 2YPKA 3L5LA 2WSQA 3MNVA 5KSBB 4PD4K 5I17B 1ET5A 4CC0A 3TC3A 4NXKA 3B3IA 1X44A 3GSNL 3MREA 1ISWA 3G6JA 4QYOA 2AZAA 3H2MA 3D52A 4H8PA 2QKIC 4D72A 1WFJA 2GJZA 3NNTA 4NQSB 4TNGA 4FFZH 3UJJH 2QDDA 2XA8H 4QRPD 3QBTB 1EFZA 4CQAA 4M61B 1FDLL 5EZJA 3LNEA 1C9DA 1XIBA 3VIGA 2Q09A 1V03A 4U1JB 4WY0A 4XPAL 4J3OC 3NPZB 1ZWIA 4Z5RA 4MXQD 1P0EA 4QXGL 2JCCB 2BJML 3GSVB 2Y5TA 4XPTL 2WXFA 3ZO0A 5L6YL 3OW1A 3F7KA 5CAKA 4OT1L 1ZANH 4IRZL 1ONWA 5C2BH 3MR9A 4P4RB 4NAQA 5D7KD 1IYXA 4XCEA 4C5ZA 2YD4A 5L7XL 2ZXBA 1V6VA 1C9SA 2ADJB 4YX2L 2QBWA 2YZ1A 3RVXD 4JQ1A 1MCWM 3CFBA 3FDKA 2ZTJA 3QA3B 3JVFC 3U82B 3FA5A 3KYOA 3XIMA 1BVOA 1OWRM 5FECA 1YHPA 5HMSA 1EZLA 5DWUH 3UERA 4AK2A 1KCUH 4ACYA 3OU8A 2UXGA 3PFQA 1MQRA 2E5EA 1KGWA 3QNXB 4HSAC 1JAEA 4NRYA 2W3ZA 4QIRA 5LIWX 1S1PA 4Q8MA 3IK4A 2HUHA 1DVZA 3HUJE 2GT9B 3VFSA 4YS1A 1EAQA 3FJ6A 5LZLA 4OJAA 3L4XA 5K39A 4MNQA 5I6XB 4R9OA 3WV0A 4ONFH 3BEVB 3UAFA 1C93A 1AE6L 1CICA 4FYSA 3AUJA 4NT0A 1VJSA 1TNNA 1I2RA 3U2OA 3EO0B 3DGCR 3VDGA 4Y9NA 4FL4C 1ZHLB 5IHLB 4X6CE 4YCOA 2CO2A 4H41A 4IWWA 4S3KA 5TJWK 3BN9C 1UIOA 3QE5A 3FYYA 5FA5A 3QXWA 4CD4A 4AE0A 2VHLA 4I8DA 2P53A 2QF7A 1KELH 1H15B 1T6BX 1UA6H 4OF6A 1NCGA 3UPCA 4FQCH 4R6UA 4BJHA 5AZEL 5T3XL 2WBXA 4IEFA 1S5IL 4JXCA 4F2MA 2X4UA 5FJUA 2X4TA 2V3GA 4ROPA 2JKPA 2L8AA 3ETBF 3FOMB 1I53A 2ADFH 2D1ZA 1NEZB 3LEVL 4NJIA 1QW8A 5A2KH 3AMDA 4BQ5A 4O10A 2BNQE 3WKNA 1ENUA 2PGRA 1R19A 2NY4B 2IDCA 3NQCA 5IWLA 1T1XA 4AWSA 3REVB 1CK0L 1UT2A 1LQ2A 2JKRM 1OC6A 4HQVA 2DQIL 3SE6A 4C7DA 2A3TA 3WFBL 4GUCA 1ODZA 3FQNB 4ZQCA 2BVDA 4HAKA 1JNLL 4H7CA 2A73B 5I8KL 1E6ZA 4JPIB 3Q8EA 5C0AE 2A21A 2E68A 4I9AA 3PZIA 1KRBC 4G83A 4MS6A 4Y5XB 12E8H 4PIRF 3KWXA 5BXFA 2AJZB 1O7AA 1AKJA 3N85L 4ZTXA 4KNQA 3WQ8A 2VFHA 2VSDA 4NO3A 2DLGA 3FO1A 4J3UA 2QIWA 5F2FA 3IFNL 3SUTA 4LYPA 3I75A 2RFGA 1GZHC 4M3HA 3BOFA 1S78C 3KGUA 1EEYA 2LHAA 3NCBB 3ABZA 2FJGB 4TQTA 2J6EA 2X89D 4XMUA 1RALA 5IW3A 4KEUA 2A9NH 2NVDA 3BUTA 2MWCA 1TOXA 3OZYA 3RY5A 3BG3A 4V1DB 3G5XA 4AVHA 4NKOB 1FWXA 2C9PA 3HMCA 3TOYA 4PJXF 5JA8B 3NK3A 3MRJB 4MA8H 4PMJA 2R4RL 3SDAC 1BGAA 3O07A 4NNXA 4ZD3H 1UB3A 3MUY1 1ELSA 4HULB 1ESWA 3IJDA 3V4UL 4KTDL 2P88A 1P5VB 3ARXA 3M07A 4LYKA 3TEUA 1RZPA 1LJMA 3WZ0E 1TPXB 5CSUA 4AD4A 4HSOA 1BZ7A 3ZL4L 7CGTA 4DCQA 1LP9F 2VITA 2YL8A 5HNUA 3BT2L 4MS8C 2XZCH 3PDOB 5C0JA 1KIPA 4AVIA 4X9GA 3W73A 3BGAA 2WMPB 1MAML 4ELKB 3SIMA 3ZZ1A 3KS5A 3WK0A 1U8QA 1QNSA 3WEAA 3LS5H 3IDXL 5ESVB 3LENA 4KQ3H 1MAJA 1ZEAL 3LU2A 3SD5A 5BJTB 4BF5A 2W95A 3ZU8A 4NP4H 3O6AA 3ULUH 5TF1L 1WA0X 5E7FA 5AAWA 3CUXA 4M6AA 4ZUSB 4OFYD 3THQA 2NQLA 4P5RA 3HKZA 1R24B 1SQMA 5TE4H 2E7HA 4NNBA 4Z2IA 4OUEA 3GSRA 2J2ZA 4HHGA 3LLDA 1ITCA 4XOAA 3HG1A 2GY5A 3CZ8A 2F61A 3CN3A 1FQ0A 4O57A 3OGCA 1VESA 2R6OA 1SHWA 3GUTA 5D1XD 1CBVH 3WD1A 1HTYA 1E3ZA 3NDYA 6XIMA 2XPGB 1JZIA 3MYJA 4KHTH 2PLTA 3L65A 4NNYA 3D9AL 3WELA 4N0RA 3P11L 1I1RA 4TO8A 4NPJA 2EUZA 2XTJC 4YBLC 1J88A 2E6FA 1R0MA 4X98B 3L3GA 1ZCRA 3U30B 4X8GA 3KPNA 1SJEB 2WJ5A 3FB5B 4HK0A 2N0MA 3CXHJ 4X6BA 5MEPB 4XOEA 4P7QA 4P5TB 2ZWZA 4LSUH 3ZPDA 4HTBA 3IE9A 2A7RA 1MCHA 1IR2A 1N2RB 4UT9H 3NOYA 1NAML 4N4QA 2OM5A 2AL2B 4HF5H 3EOLA 3V0AC 3WO3B 2WKOF 1P48A 3CPLA 2IO5A 5CZJA 2FECL 2DS4A 3Q44A 4PVLA 1HHGB 3S34H 4JR9L 4LKCA 3CVHA 2C4FT 4WGHA 1R3LB 1K8DB 3UR8A 1LXMA 1FG9C 4JPWL 4LSVL 1QKZH 1KR0A 2VLRA 3FT9A 1CF8H 3TGXA 1WBXA 1KLYA 1BG9A 2YB1A 1Q0EA 3H7LA 3WLNA 1FE8L 2X1QA 1AS7A 3QQWA 3GXDA 4AH2A 1SRDA 3OKLA 5MI0B 4ADIA 4WHDA 2Y24A 4QE1A 4PVMA 5H4YA 2QZ5A 4IIQC 3EKCA 2PF0A 1WAAA 5K59F 3QQ4B 3LEPA 4P99A 4M6QA 4NZUH 3MCLL 2E46A 3ZDZB 1Q9LA 3CHCA 1RJLB 1H7OA 2GSMB 3ILPB 3ZIYA 1OIOA 2QEJA 1Q6RA 3ZLFA 1R7OA 5FYKE 1R0AL 1KN4L 4MHHI 3CAFA 3HNTL 2IANA 1POJA 2OMTB 4A29A 2MSPA 4LC8A 5LNVA 3QEUA 2CDEA 4AEIH 2NCEA 1UWFA 4GKOA 3LNFA 4L1GA 4JDVA 1P7HL 4LCYA 4N2FA 2ITEA 4C83B 4C56A 3NG3A 1EHNA 3FUKA 3AS3A 4R0LC 3ZGHA 3A47A 5I75B 1XIWC 4MYPA 2W81C 4CUCA 4JCWA 2ADIA 4NKDA 1CS6A 2C7UA 4P2OA 4LEOA 3GG1A 3ARBC 2ORBH 1ZALA 3U7YL 5FR3A 3VZXA 1UR0A 2Q9OA 3VXRB 3FONB 2IAAC 2ZCZA 3F5KA 4OQTH 1XV8A 3WS3A 4O02L 3HS0A 3H3PL 2AQWA 2W63A 2IWEA 3SE8H 4AYEC 3L95A 1KCBA 3N3MA 1UACL 1UWEL 3SQBA 3MUHL 4EF9A 1J05B 1TV7A 1GG0A 3KVKA 3TBSB 3DX7A 2ZWKA 1MH5A 4QCEA 3OZKA 2QEZA 3FQ2A 2FUQA 3MXWH 3SURA 4O12A 4KV5F 1RPKA 4JTSA 3GXIA 3EJSA 3MUZ1 1QYGL 1Q66A 2DQHH 5A1AA 3NSNA 3IUDA 4Y9EA 3O6FD 2PTYA 4LJ3A 4R88A 1AJ7L 1FNHA 2XETA 4YTUA 3FT3B 1AHWC 1Q6OA 1A1NB 1KB9J 1VFAA 2P50A 4AYFA 3QH2A 1FVEA 4JNZA 3FOKA 2H2SD 3L1OL 5HYSA 2AMGA 4H7VA 1OC5A 3PZGA 4FQXA 3V7MA 4GJ1A 4QQUA 3IVSA 1NLDL 4MKMA 2DT2A 3T0EE 2CNYA 4PJIF 1R3WA 2YAMA 2BP0A 2E5CA 3FBKA 3H2OA 3RA7L 4X5XA 3O6FB 1CIUA 4RPQA 5JHLH 2BSLA 4PR5A 2A9MH 5MEQA 1KBKA 2D31B 3ITYA 1UZDA 5F1UA 4LCIH 3UEQA 1UYWL 4LQFH 3C2FA 4QMEA 4XP1L 4KETA 5K9OB 2WO2B 5ALBL 3O4LA 5SWZE 3VU1A 4OBSA 4XPFH 4P2CG 3OX8B 3WKMH 1W8OA 2JE8A 3KRSA 1SXBA 4ZFGH 2X8RA 3LNPA 4G7SB 2X40A 3RRXA 3QYCA 3CUFA 3D2UD 1T5WB 5BXRA 2OYMA 4PLJD 3QV6A 3STZA 5CLWA 4KDTC 3WTVA 1NWOA 5F2GA 3PHQB 2X1RA 1HYSD 3RK8A 4YVVA 1DSYA 3RMJA 1KG0A 3PGCA 2F7PA 4LU5H 4WTQA 4YIQB 1E2VA 3ZW3A 3HU7A 2CCVA 1WAUA 3A23A 3T2QA 4JN8A 2HX8A 3NZRA 2WWMD 3TQPA 3JVAA 2AJYL 2PUZA 3ALGA 1JDFA 4MD5B 2C15A 5B39G 1I1YA 2D3VA 3MRLA 2BRRL 3QEQD 4X0KA 4PY8J 4JTLA 4NUGL 1DHPA 1UWXH 4KK5C 5F7UA 3D2UB 3EDDA 4QRRD 3W53A 1RUPH 3NQ8A 3PUEA 1NFPA 4UUJA 1BG4A 5HHXL 5HBFA 1Q13A 1OZTG 2NY3D 4H04A 1TA3B 1K5NB 3LKRA 4DJEA 1ADSA 4LAQL 1WJ3A 2XYBA 3GMRA 4H26B 3T6CA 3B6SB 2N59A 5I6NA 2CH8A 2LFEA 4KFPA 2VRJA 2CDGB 3WCYA 1A5KC 1UQSA 4BFIB 4WFGD 2NUTA 4N0YL 2P4AB 2EPLX 5C1MB 1C16A 2CK0L 4ZUTB 4UMCA 4HUKB 4W5UA 2G30A 3K81A 1U8HB 5IFHL 1BVLB 3QEQB 5DS8A 4P2VA 4TTDC 1JHTB 2M2DA 4ONVA 2X4NA 1GGBL 5IK3A 2V5CA 3HV9A 4KDVA 3FB6B 1MUJB 4KXAA 4Z1AA 3GDKA 2ESVE 4KKZA 5I30L 4Q4SA 1HI6A 3QMSA 3POHA 3SKUD 2OYLA 1D5RA 3JXAA 2YMXL 4NKMA 1YRRA 4QXUL 3M17A 4ECNA 2WWCA 4JFDB 4LPUA 5D6DA 2V69A 1S46A 1XB3A 3WUZA 1ZLWH 1G7IA 4MQSB 4JICA 1E9PB 1S4IA 2Q01A 1QHOA 4WXYA 5D96C 4XAGA 1KOAA 2G3XA 2DT3A 1U41A 4IRSA 1XYFA 4GBUA 3P2BA 4AHPA 3PUOA 1TZIB 4EF3A 1KBLA 4DW2L 3FU7B 4Q8TA 5EBLB 3B5HA 2O1AA 2V37A 1S1RA 1RSYA 2WNQA 5LA0A 4LRIC 4OCXH 4XWUA 4WUKL 4U6XB 5C8JB 2NY5L 4J8RB 3P69A 1IEXA 4IMEA 3TASA 4GEIA 4X6DB 3DK0A 5J6SA 4H9ZA 4F5CE 4ELDA 2F08A 5F7DA 2CLIA 2FVKA 4JIPA 4Z0BL 1U8JB 1I7ZA 4NQXB 1I4FA 3PZOA 3UNDA 1ECZA 2OQJB 1II4E 3I4KA 3EBHA 3HEIB 5L6UA 2YAPA 5DTFB 2P8BA 1KJMA 3CAQA 3BW9B 2KLRA 1YYMH 1HXYA 5HP5A 3VVGA 3KPPB 3C12A 4JRYA 4EN2A 4NY2A 4L48A 1FG2A 4UQAA 4OLZH 2DRUA 3WLRA 3QHTC 3W7PA 2QGYA 3WGUB 1E40A 2PXYD 5HBBA 3QXAB 1S7UA 2QQLH 1GOXA 2V63A 1Q9KA 4I1RA 3DHUA 2AANA 3U0PA 2E3ZA 3NA9H 5EMLA 3KDPB 5HDOA 3W7GA 3DO7A 2DW6A 1HH6A 4XTIA 3NCYS 4FQ1L 2VR8A 4MHBA 1ZVSB 1H5BC 1CBJA 1Q38A 4GKSB 2R69A 2OR2A 3LBOA 4Z7NB 1XCTB 4JGUA 1ZLVK 1U8IB 4M1RA 4YK4C 3K80A 4U49A 5C0CE 4LT9A 3KL3A 1GOFA 3EGJA 4JUSA 3V0WL 1OARH 1XEDA 2POZA 4EACA 2H9GB 5FW8A 2X6AA 3W2NA 1HO4A 2PTUA 1T04A 3HA1A 4K71C 4JFYB 1W72A 3P3BA 4X99A 4E0CA 2CK2A 3M4HA 4I77H 4PBDA 1SXNA 4Z7QB 7PTDA 2OL3B 4XP6H 3FU0A 4LRTA 4G1MA 5HDBF 1O6VA 3FS2A 1XIHA 4UTTA 2DBLL 2YDSA 5F9OH 3ANVA 4P8QA 3K2UL 4R7NA 4HMNA 4F92B 2L7UA 2VLKD 4IMDA 1LL7A 2CO6A 1KT2A 2LR4A 4YHKL 3LPOA 1I8AA 1UZ4A 2GCYB 1HKLL 1TVNA 1JPTH 4Z7VB 3MUJA 3MRFA 4KT2A 1HJBC 3UU0A 1MW3A 5JTWA 4YNGA 4UINL 1MFDH 1H41A 3S88H 1P6CA 4MNGB 2P8LA 2RGSA 1YEGH 4ZFFA 1EIBA 3QDJA 4DF2A 3TJPA 3QZWB 4E41E 2P8CA 2YBGA 4DESA 3PWIA 3HUJA 3ZTCC 3GIQA 1BQUA 3DBXA 3VOFA 1XFCA 3H4WA 4L1BA 5SX4H 2VLKB 1JZFA 4IGBA 2V2CA 3TA3C 4GSUA 4WUUE 2Z28A 1ZHKB 4UDTA 2YUXA 2Z4GA 5JHBA 2YAQA 5AB9A 3NJVA 1EWHA 4N25A 5LG6A 3AQZA 4B2DA 2FZ3B 3D3VE 1QFOA 2BX5A 3RWIA 1J79A 1VBHA 1DQQB 4N5ED 4HFUH 4Y2WA 4JFWA 3T6ZA 3G9VA 2AK1L 1HINH 3QI9B 4X6CA 3K8LA 1NUDA 3GMOB 1S9WB 3UF9A 4ZZFA 1V3JA 1OAZH 2WQAA 3PJLA 2YZ8A 4YZFF 2X88A 1R5IB 1C8VA 1F41A 1YPZF 2PABA 2YPKB 3PDGA 5HHPA 2NVCA 1QPPA 3MNVB 3GS7A 1PHWA 2NRDA 1PVNA 3HNVL 2PP0A 1TUPA 3B3IB 1Q6DA 2WBJC 1LBFA 3G04B 3MREB 2ENJA 3G6JB 4QYOB 3QJXA 5AZUA 1OQXA 3IPEA 2FIKB 2GJZB 3NQ7A 1EVUA 1BXNA 2QJGA 1NCHA 1W0YT 3HM7A 3E8VA 1CB2A 2H3BA 1A6UH 2D2JA 4LE8A 2VRQA 4JJOA 3G5YA 1OCRB 5EZJB 3ZS4A 3MOAL 2BNQA 4X5PA 4NQEE 4Q8BA 2JF7A 5DD1L 1O5RA 4PMRA 2QDEA 3CWNA 1JFQH 4LLYA 2VC7A 1XF1A 5FF4A 3V9EA 3LK6A 1YEEL 2Y5TB 5T91A 3ZLGA 3U4BL 3OHXC 4JTDA 4XX5A 4RDQF 3OF6A 4JG0L 5C7ZA 1CWYA 4RCAA 3WBAA 4GQZA 3WMLA 5C0AA 3ARWA 1RZMA 1C8YA 1NBVH 2G3JA 1LDPH 1MZZA 3MR9B 1KKRA 4XBSA 5TGBA 3KTCA 4OGAD 2QTVA 4XCEB 1ZBVA 2UYLA 3WD0A 4B27A 4MUZA 2ZA1A 4AZGA 1DANT 4XZNX 1CICD 2G2PA 1I7UA 3CFBB 1HSAA 5LNGA 4DN4H 4K8RL 4E0RB 5FGBC 4FB7A 3KYOB 3LG3A 3IGHX 3WFDL 4H7ZA 2Y23A 1UZ6F 5FECB 4UV7L 5IVNA 1XTMA 3GHEL 2VDQH 4AQ1C 1N26A 5KSVA 4H88H 2IALA 3GNDA 4PWJA 4NRYB 1RI8A 5AOJA 1YECH 4PRHD 2FHCA 3FCBA 3DI3B 3WOVA 4ERAA 4OU1A 3LSBA 3DKLA 2ZX7A 4DPBX 3HBLA 1AS8A 3WQCA 3VFSB 4BZ2A 4G8GE 4YO0B 4QOKE 5IMLA 1SDAB 2V68A 2UX6A 5K39B 4MNQB 1OX5A 1Q45A 1FCBA 3WD2A 5L0QC 2VSKB 2IKGA 2ZIDA 1CICB 5ERWA 3N06B 1FOBA 1SDYA 1EJSC 2FT8A 5KVEE 3MRGA 1TZGL 3CHDA 3R43A 3PL6C 4TPRH 2HN7A 2WTRA 5E0FA 3RZWA 3VKBA 5C71A 3BHBB 4L64A 5HDQH 3IGFA 5GS1C 3TYEA 4RV3A 4R4ND 4WJXA 1SYTA 2X0UA 3HI6L 4Y8EA 3LTYA 5E2WL 5IHUH 4POZD 3SPGA 1Z6KA 5LNSA 3CH8A 2VXSH 2D03L 2X9WA 5F7WC 3FSAA 2E67A 4F2MB 2X4UB 2X4TB 2ODOA 3BX7C 1BAFL 3L3OC 3BKJL 3GXFA 1WIPA 3S5YA 3NRQA 1J5SA 1AKJD 3SGUA 2KBGA 3VOJA 1TWDA 1PLAA 5KBDA 5IQ9B 4D9RD 4CILA 3KBJA 4Q6IB 5D2TA 1L7IL 1W3HA 1T1XB 5B1AB 3TBYA 4BY3A 1XLGA 4EP8C 2PU1A 3RKDD 5CD5D 4XP5H 1NMAL 4DP0X 2PW2B 5E08H 3NFUA 4XI5C 1VIWA 2FTAA 5AZ1A 1U3ZA 2Z64C 3RG1C 3EYSH 5I03A 3HGRA 1X5FA 1L6XA 3R0MA 2DTMH 2DQUH 3TA6A 2X87A 3F12A 4BK4A 4HZ8A 4YXHL 2XTLA 5GRVK 5BXFB 4I2XA 1YY8B 3RU6A 4LNCA 3HN5A 1AKJB 2PP9A 2FFCA 4F40A 5CPSA 2YGPA 1NGPH 4IQDA 3FO1B 5JZ7D 4WDTA 3I75B 4C4BA 4FMFA 3NCJH 2WB5A 4S2SA 3EFFA 1R3JA 2HFTA 2NNFA 1EEYB 4LBAA 2J6WA 1GPOL 5EN3A 3WEBA 8CGTA 7TIMA 1EJ7L 1SPQA 4N2EA 2YD1A 3GRIA 2SFPA 2FQDA 3EMQA 2ODIA 5K9JL 2VABA 2Q3ZA 2VRKA 1HL9A 4HIBA 3ZT6A 4KRPC 3AIWA 1AD0A 1NCCL 2ROXA 1UWUA 2I25N 4NNXB 2R51A 4MB5A 2Y8KA 1OGTA 3BFQG 2CIKA 5EBWA 5I8OL 5AWNH 4LVAA 3BAJA 4YFLF 4W9GC 4B7LA 4RISH 4DCQB 2VITB 4RJEA 1AMYA 4AZHA 1E28A 4O00A 3B3BA 2R91A 3MGOA 1KIPB 4BRJA 2ISWA 3GLEA 4XCNA 1Z44A 1GGCL 5DRZA 3GVVA 1CI5A 1F6PA 2IQDA 3U48A 2OCZA 2WHJA 4KUZH 3LBCA 1IO4C 1FVCA 5LCVL 1DORA 2XHYA 4QRRA 5CJ5A 2RCSH 3XISA 3Q65A 1S2EA 2R39A 1R2TA 4Q8WA 4WIWA 3QVQA 4Z76A 3P2TA 1QVBA 1G4TA 4FX5A 5I1EH 2J43A 1K4GA 4JAWA 4RE0A 3GSRB 2J2ZB 4UTJA 3HG1B 3QV7A 1RLCL 4IJTA 3OGCB 2WPBA 1T22A 4UYPA 3LTVA 5DC4B 3IDNA 4KZDL 4H8VA 4HVBA 3GUTB 1BEUA 4TULH 4BA0A 1NMCB 4M5ZL 1LLOA 4JDTH 3MYJB 3IGSA 4NNYB 2VMJA 4ERSH 3U0TA 4CQBA 5C9KA 2HKFL 3I6GA 1PJ9A 4ZUVB 3WLOA 2QVTA 4OF8A 3SQOH 3VMNA 1PG7X 3MKKA 3MC0A 4JTUA 1AVAA 1PG7L 4GI6A 1SMOA 1EHXA 4QG6A 5DMGC 4KFOA 2Y62A 5T5FH 3L3GB 3NFSL 3UY8A 3KPNB 4JMXA 3ULVF 4PJHE 2C7FA 2KZ1B 5E9DE 2VLRD 3F2LA 2OMZA 4ZQOA 4HK0B 3EJZC 4KXBA 4L18A 1VHCA 4KRNA 3NJMA 4K8HA 4Q9CA 2EH7H 1YNYA 4KU1A 4L8CA 5CCZA 2Z8RA 4C6NA 2BVOA 1ZOXA 4OECA 1RCOB 3EH3B 1RIUL 4PJEB 1V6UA 4QD2E 2E4TA 4OV6F 3PZMA 4GQ9L 4YEEA 3CPLB 5LBSA 4P46A 1M7DB 3RDJA 3TN0D 4JKMA 4QWWD 1M68A 1BOYA 2V0TA 4LKCB 4C6CA 3CVHB 4PB9L 3O3AA 1BQHA 4ENEC 4A8IA 1F4YL 3S35L 5E9NA 3MBFA 1QOKA 4EO5A 2YXVA 2VLRB 5HWMA 2H8ZA 1EBHA 3T0EA 3GTXA 4GT7A 4Y2OA 3OYZA 4AH2B 3DJTA 3VSVA 1UR9A 3BH9A 1K2DA 4C56D 5HI4D 3OKLB 1I4NA 4Y7MA 5AENA 4TSCL 1H62A 3AIRA 3UP1A 5K69A 4IP7A 4P2OD 5AAMC 3WJWA 4PBXA 1T0NA 3AS1A 1V5JA 3WKYA 1MRFL 1POKA 2HQAA 3EX1A 3G77A 2NXYD 3EXTA 4RNRA 1Q9LB 5D37A 5SWZA 1WQVT 2FVLA 4WK4B 1IBZA 4GY1A 5I71C 2N7AA 1KGCE 2OWXA 3MI3A 2XT1B 1UIPA 2IANB 4MGXA 1AMXA 1T0OA 1ZBKA 3ML9A 1EAPA 2KQNA 3QEUB 2CDEB 4LSTL 35C8L 2ZKYA 4KITB 4JDVB 2QUNA 2F5AH 2Z34A 4X4YB 4ADTA 4LCYB 3U2JA 1UJTA 3U7WL 5T33L 1XGUA 2PXYA 3WIIL 2VXUL 2ADIB 4NKDB 2C7UB 3GNNA 3BXNA 4AKQA 2E47A 5KJ4A 4JKWA 3QEHA 1H3GA 1DE6A 3WFZA 1W5NA 4H8WH 2C9AA 3WS3B 5JBFA 3QUKA 3HS0B 1AJ2A 3TWBA 3L95B 3HBGA 3UG8A 1J87A 3SQBB 4DZBA 3SQSA 2JKJA 5EG6C 3UIZA 4DBSA 3DX7B 1MH5B 1MRDL 2YDRA 4FQXD 2E7MA 4HT1H 3URNA 4DNHA 2X1SA 1W3JA 1KN2L 2NW2B 4W68A 2XIOA 4LGRB 1G84A 4PJAF 4F9PC 1B3OA 5GGRY 1OLLA 2OXGA 2DN7A 5EA0L 5I74C 4BXVA 3RCYA 2VERN 1WFNA 5K9CA 2ZNXA 1RPXA 2Z91B 3N1PC 1CO1A 3PF2A 1SN0A 2LU5A 3B5GA 1VBRA 4ACTA 1VFAB 4UNKA 1YDNA 4OLXH 4AYFB 4F93B 4XXWA 3JQOB 1QO5A 3N43F 1DBKL 3GMMA 4YIWA 5I3DA 3D07A 3O4LD 2G4FA 4Z1PA 1NBCA 1UWQA 5HYSB 4Y0GA 1JK9A 1FO0L 3CC1A 1M3IA 2HT2D 2V9QA 4FQXB 3L0KA 1KM4A 1YCSA 1WDSA 3BSZA 1C7TA 1A5BA 5CPTA 4AY7A 4EKJA 2BP0B 2Z29A 2JEQA 1NDYA 5ETUA 4X5XB 2CALA 4JTIA 4XAKD 2NLJA 3APTA 1WZMA 2F8XC 5CH9A 2OXHA 3PQYE 4NZTL 3CQIA 2WUCH 2R0WH 1SVZA 1TG7A 4EX4A 3SSZA 1KFJA 3G3DA 2H3NA 1QZNA 3OKOA 1F6KA 1DXEA 2NY5C 3K6SA 4NPYB 1FYHB 4RWYL 3O4LB 3HMXL 4Q0XL 3M0YA 3UJFA 4G71B 5E6IA 4MMZC 2MKLC 3M5YA 2VWSA 4GPVA 3PK7A 3LHWA 1PDYA 2R2HA 2Z92A 4YGAB 4OBRA 1OYCA 1IAII 1S9VA 2N3JA 5F96H 5AKSA 3P0XA 4P8VA 1EZVX 5EIVA 4OFDA 5G2IA 4DRSA 2CUMA 1Y1UA 1EYEA 5CS7A 1NSJA 4DJED 4FNPA 1JPEA 5EU7C 3MLYL 3R5EA 4GKZA 1TU2A 2C13A 4LARH 4APQC 1KG0B 3PGCB 4H9YA 2GQ8A 2ED6A 3VDCA 3CLFL 2RGMA 2VN3A 2ATPA 1C3FA 5IB4B 4OIIH 2Y5QA 4KKLC 1MCPL 3OLDA 4MJID 3KJ6H 1JMXA 3UZ5A 4PS4H 4OD3L 1I1YB 3MRLB 2P5EE 1CLOL 3FTYA 4QRPB 4X0KB 3RI5F 3NIGF 3BAEL 3EB3A 4OFCA 2DLTA 3B2UD 3WHE0 4Q9RH 3KZSA 1J9CT 4UUJB 4KQNA 5FSEC 3V4VL 1PSKH 4KPLA 3LKRB 2JXMA 4ZZKA 4ZFOA 4Q7NA 3GMRB 1TO4A 1YE6A 1JFXA 3C09C 5IFPA 5I6PA 1BEYL 1U22A 4PP2A 3BICA 1UQSB 5CZTA 3W7DA 2NUTB 3B8WA 4UZGA 5IDIA 5FUCC 4FQJH 3VD2A 4O9HH 4W86A 2UWEF 1C16B 1OAUL 2DQJL 1FFNB 4K37A 3WF0A 2ISFA 3HI1B 1EXHA 4IHCA 1TR1A 1E6RA 5A94A 5DS8B 3WMQA 1H63A 2E6PA 1TQWA 3WYRA 1YAIA 5IK3B 4IRSD 3ABRA 4JHUA 1XYZA 1Q72L 1UCWA 1TREA 2ZZ2A 1LO3H 1HI6B 1JSYA 1NCOA 2BGSA 2X2HA 4NSKA 1HW6A 4K07A 1FPTH 1EJ8A 1IQDB 3PG9A 2F5BH 4NKMB 3BVTA 1YC8A 2DJLA 1US0A 3M17B 1A80A 4PRHA 2ZWNA 5E95B 2QXWA 3P74A 3RLVA 1T66C 3MXVH 4OLYH 3D2TA 5EIIG 5I3IA 5FK9A 3MJ9H 3KEDA 1V7NH 1D6VH 4IRSB 1W6LA 4K8EA 4HQQL 5B8CC 5DCDA 1MF2L 3JSSA 3AXLA 2QQNL 1CDBA 4IBVA 4OJYA 4Z7OE 4HMCA 4WZ9A 2A99A 4F7MA 1YIXA 4PTUB 3MU3A 4N1HB 3CSFA 5EBGA 1URLA 1A5FL 2VMCA 1EBAA 5A6AA 4PGEA 4RZKA 4Z17A 2FSDA 4JRYD 1T5XA 3E0IA 4WI6A 4K5OA 1YY9C 2J1XA 4YH6A 4W8AA 5ECVA 4PI2A 1E5YA 2MJWA 5F7DB 1LK3L 1JZ7A 3QIUC 4E41A 4WO0A 1FIGH 2CXGA 5XIMA 1XF3A 3RX4A 3S0CA 1SHSA 1L3NA 4IJ3C 2MQGA 1I7ZB 3PPCA 4TUUA 1U5JA 4Y5VC 3TJHD 4DHGA 2EDRA 3HPSA 1NF7A 2CEQA 2B14A 2Q87A 5CPNA 3TPUA 1WUFA 2B77A 3HLKA 1KJMB 2DKUA 1XD1A 1ESOA 5D55A 1HXYB 4X7EC 4PP1C 4DEPC 4ZQMA 1KPUA 4LCRA 4MCYA 4HWBH 3UWUA 3TXZA 1FG2B 4KMTL 4UMAA 3KPQB 3DIFA 5C0NC 4J9JA 5IUSA 3JTBA 3B1TA 3VX1A 1S7UB 3GRWL 4WKAA 1HXJA 4EBQH 3FK3A 3NFNB 3HGJA 3DO7B 3G7TA 5BMFH 5BRPA 1HH6B 2BIOA 4RQQB 4AQEA 2WM1A 3KL5A 3FL7A 2R83A 4KS0A 4UIKL 4U28A 3MUUA 1F13A 1U3HC 2FRGP 1H0DA 3BPLB 3UCRA 2J88H 3UGEA 1ZXKA 4NHUA 4WQ6A 3GSMA 4IS6A 4RZ4A 1M01A 1YQ2A 3T42A 2WK2A 1T04B 1TX2A 5AW3B 1NCIA 1OALA 1W72B 4NQEA 2RFXA 4GT0A 3QPZA 1H3WM 4K8RC 3EZJB 4JG1H 2D0HA 1SXAA 1LP9E 2R2BA 2NUWA 2FYVA 4PUBL 2DDQL 5GZOA 1DVYA 3QDJD 4LP8A 2MPAL 1TJPA 5CFHA 3LGGA 3VTAA 3A21A 4GLRI 4IQJA 1RPUA 1W0MA 4JJHA 2AEWA 3KBMA 4ZXBC 3KYMA 2CWNA 4IGBD 2CO6B 1KT2B 4ODSH 1D7KA 2DW7A 2R0ZH 2EDHA 4LIQL 1EJOH 3BEWA 2C9QA 5F7AA 1ZDSA 5B4MC 3PU7A 3R8HA 4B2DD 5LO7A 4ZOCA 3MRFB 1RIVL 1SFSA 4IIZA 4G8EA 2MANA 4BQ4A 4MKNA 1BQCA 2HH0H 2Q0ZX 4U4BA 2IQAA 3R12A 4Y6GA 1UCTA 2P8LB 3DETC 3KOWA 3ZHLA 2I9LA 1KIRA 3EHBD 4M7ZC 1E7UA 1WIUA 4ZFFB 5HXMA 2FATH 3GTHA 3QDJB 2HRGA 4YDZA 3F84A 1INDH 3SDXB 3DOSA 1N55A 5ENWA 1TJIL 3HUJB 3DBXB 3S97C 5HDWA 4G8GA 1SJVA 3MFFA 4QOKA 1FFQA 4IGBB 3BIKA 1C8XA 3RGVC 1J5HA 4UDTB 1X5JA 1OSYA 4A3YA 5GGSB 1QQDA 1OJXA 2WVTA 3Q6FA 4U3HA 5FD0A 3VGEA 2FZ9A 3VFTA 4JO4H 3PUDA 1WQ5A 1F3EA 3RWIB 3TT1L 3E6FA 4R2GC 5I28A 2GAZA 3BISA 4ZMOA 4X6CB 3FX4A 1ERNA 1U42A 3FCPA 1VS1A 3NA4A 2BNQD 3EHBB 4XMKL 3QDHA 4S0HA 1X7QA 5D1XB 2R9HC 1V7MH 4RMBA 2QFRA 1LO2H 3OKKA 1EZWA 3CTTA 2NV2A 5HVFB 5IB2A 2G9KA 5HHPB 3WDPP 2AGTA 5B7EA 4KWUA 3OF6D 3LUTA 5IT2H 3VNLA 2CKBA 4JPVH 1MEHA 1V02E 3GG8A 3WLJA 4LFHG 1E9LA 5C0AD 2X4PA 4OCSL 1L5GB 3FFCE 3GZAA 4MDRA 1F4WH 1UUQA 3IUHA 4ZX6A 3QJFA 4FQIH 2AQTA 4BKTC 3FCTA 2ABAA 3G5YB 5FW6A 5B7MA 2BNQB 3KHJA 2OSWA 3RI5K 1G6VK 3NFPB 5LNEA 4BR1A 2I1OA 5I6SA 3N41F 2K3TA 3ZWSA 3AQYA 5G4HC 5E4AA 4B3ZA 4LLYB 2CQVA 4HN4A 3MUAA 5E2VL 3PJTA 4EI6B 2NNCA 1IE7C 4J3OF 1BEXA 4G6KL 1KBGH 1HEZA 4AD3A 2DZAA 5DZOA 2TSYA 1I8KB 5C0AB 2DD8H 5IMKA 5K59E 4H0HB 2OVLA 4PV9B 4U6HB 1JYVA 4XUYA 1GQLA 1F86A 3TN0A 5TGBB 3UGRA 1A1MA 4E5XA 1ML1A 4RX4A 1ZXQA 4GW5A 2CNCA 5JPNA 3K6IA 2YRBA 4K7PY 3VI4F 3S3CB 1FLRH 3DMMA 1H3TA 1E6XM 1OWQA 4HNNA 2V38A 2JKSA 5F1OB 4YLQT 4HXBH 1CMOA 3TCLA 4KPHL 2AL1A 1F3RB 1YJDH 2B08A 5KSVB 2VM9A 3EA1A 2IALB 3GC2A 1LD9A 1AGEB 3MRCA 1SSGA 1L2QA 4O52A 1SZEA 5IMLB 1G94A 5AYZA 4DQWA 1VR6A 2FGZA 5T5NF 4XMLL 1R3RA 3UTPE 3RUBL 2IWGA 3HQNA 2BVEA 5ERWB 2IPGA 2CZ5A 4H00A 4OJFL 3MRGB 3FYPA 1IEQA 2G41A 4AV0A 2HN7B 2WTRB 3O1NA 3LVTA 3PV7A 1F5WA 3QFWA 1SN2A 4UQCA 3HJZA 1AGBA 1T6WA 1MJ7H 4KV5E 4LYRA 2GDUA 3N40P 1ADQH 2NDGA 3SY6A 3L0NA 2Y5JA 4KZEH 2Q86A 1W3IA 2GPZA 5L9FA 4PG9A 3K30A 1BVKA 3O2DA 4AUJA 5HMFA 3W82A 2CPCA 4BQ8A 4QCIA 5DQDL 5F7BA 4NUWA 2JV6A 4HJ1A 1PKOA 1MZHA 2J27A 5ESAA 1JI1A 2ADGA 4GAGL 3LRKA 4UR7A 9CGTA 4WDUA 5DT1H 1SEBB 3TBYB 2MQCA 3ZZLA 3MO7A 1WZ1L 3ZJAA 1OGPA 4PJIE 2VH5H 3COOA 1UENA 4ZZ9A 2XWBA 5K5YA 4S1QL 1A4JA 3LIUA 3QDMA 4Q8OA 3MV8E 3QPQC 5SV3A 1UP0A 4JGMA 2DIKA 1IGCL 4QRBA 3H1ZA 4D0BA 5GJTH 5DO2D 2ZZ4A 5EU3A 7PAZA 4XZIA 4MVBC 4HLZG 5IQOA 4QNEA 5I1JH 4U1HA 4I2XB 4GXFA 3WAJA 2QYGA 2X7LA 3CZGA 1P5BA 2FB4L 4O58L 2B0SL 1OM0A 3LXAA 3LA4A 1I9JL 1G1KA 4HJ0D 4P9HL 3QZNA 4S2SB 2H9AB 3EFFB 1N6QH 1UOLA 3VSUA 3ZKSD 1KWKA 4R8WL 1IEBA 2XOTA 2OL3H 4EUPB 5IJVA 4GUGA 2A4AA 4PJHA 3W2KA 4NM8H 2R14A 3OQEA 4O5LL 1GVRA 4RGNC 4LYQA 1A6WL 2HVBA 1V10A 5CLZA 5KYXA 3F2DA 3GI9L 3PLYA 3K2GA 1GIGL 5EPMA 1I82A 4UV4L 2VABB 4KEMA 1L0YA 5DD0L 1E8ZA 4AYGA 4HDIA 2C3VA 1UOVA 3O3UN 4UTMA 4JFHE 3WIAA 1GW9A 4G6FD 3TFKD 3N0PB 4BH7A 1Y18A 3TS8A 4WO4A 1RV8A 2Z8WC 3VOGA 4PYGA 3U4KA 5EBWB 3LZ3A 4LEXL 5TDPA 1ZT4A 2CITA 4ZQRA 4BCYA 3F2BA 4YHML 5FYKD 5CLTA 3E0VA 2PC4A 4E9TA 2QADD 1FBIL 5EUOF 3MGOB 2DLFH 1ZAJA 2G2NA 4WJ5A 5DRZB 4MNJA 4AGOA 4H6KA 1YYCA 4WNQA 1QR1A 1UA3A 3G3MA 2HPMA 2NSMA 4MJIA 4Q4EA 2F2HA 1KM3A 3E1ZA 3U9PH 1GHSA 4G6FB 2X4SA 1CXHA 3P9WB 4Z0XA 4HIEA 3UJIL 4PUNA 1A25A 1FFTB 4QRRB 4Y5YA 5DMMA 4NYLB 2IMRA 3UAJA 1E43A 4Z76B 3M6YA 5FM5M 2NY3B 2EPOA 1KY7A 1Q1JL 2QADB 1ACCA 3KVDD 3QHZL 5A69A 3FQUA 1DVJA 4HK7A 5IM51 2OMYB 1X3DA 4F9LA 4KRUA 3B9KC 3FUJA 3UBXB 1TPDA 2DF3A 1XZ0A 1KXTB 4Z7WA 3VH8G 1LJYA 1KA9F 2DWXA 1TSIA 4BZYA 3V4PA 5AFDA 5CC5A 4O18A 2ZOKA 2WINA 3U0TB 1R7AA 1ML0A 5HPMA 1OFQA 3I6GB 4JN1H 2FO1A 1J93A 3PPHA 4UTWC 4IU3B 3W3BA 4AQOA 3SCNA 1Q6GA 3ZSSA 4P46D 4AT6A 2O4EA 4CVZA 3TVMA 3L7EA 1KM2A 3NIYA 3PXHA 3S1UA 5LGZA 2HPTA 2WLMA 4QDGA 3S1XA 4QYAA 4P23A 2OMZB 1O6IA 3T0ED 1FFOB 4D3CH 3MLSH 5BU6A 4Z3IA 3QYNA 1T2XA 2FD6H 3BOXA 2CBIA 2GG1A 1AYRA 2BVOB 5AW7B 5HJDA 1W5OA 2B7OA 4NWTL 3QP3A 3T2PA 1DVUA 4GIPD 3CLEH 4N8UA 3MV01 1F74A 1G7MA 3DLQR 4QJ1A 4H0GA 2IPJA 2EZ0D 4QRSA 1Q6CA 5CILH 4P46B 3IVUA 2ASHA 4Z0JA 5HULA 3SE4C 5SWZD 2W6RA 1BQHB 2D7OA 3QHMA 4HUNB 5E6ZA 2QAFA 2FJSA 2H41A 2ZWYA 1QI4A 3LQAH 1B30A 4B0MB 1NCAL 2OT1A 2X16A 4CMMA 3GKFA 4KK6D 1CVSC 4NJGA 4OV4A 2OULB 3QLLA 3T0EB 3V0DA 3M0IA 4ZOBA 3D0LA 3EFDL 3DUUA 1ALDA 3KCPA 4Y2OB 3DO4A 3BH9B 3GKZA 3VXNA 5FOOA 2OMUA 1GCYA 1GH7A 5AVSB 3U6WA 1B4RA 3W28A 1FWJC 4DAIA 3DOHA 3PQYA 5BYWA 3IDGB 3CC5B 1KTNA 1T0NB 5T3ZL 7REQA 4U5IA 3HBPA 3WN5C 1OAQL 4TMBA 4L8DA 1AQFA 4RNRB 3T6XA 5SWZB 4TQEL 4OGXH 4YHLL 4A3RA 4Y8DC 4QTFA 1DTNA 1EAPB 4A22A 4ZMNA 2AZUA 4I18C 2IV8A 5JHAA 2GTWA 3AAZA 2O7QA 4ODVH 2ESCA 1X9QA 2PXYB 1T2QL 3L3KB 1US3A 5C07E 4XZBA 1YMME 5FGCE 3BXNB 5T5NG 4XSMA 3D33A 3M0MA 3ZKNC 3UOAB 4WHTB 5HDBE 4V27A 1F18A 4UOW1 1NQ6A 3NEVA 3ME3A 4HVXA 1IWPA 1ZSHA 4JNXA 3STPA 3THDA 1RZ7H 3RWGB 4NGHH 2ZZ6A 1M7XA 2P5EA 4JTRA 1YN6A 4GJIA 1HCYA 4FAAB 4QHPA 5FPIA 1IZCA 1PY4A 4IMKC 1H0GA 1IGMH 5H1WA 3P80A 5DJ6A 4A2DA 4NZJA 3WJLA 5AW9B 4YEFA 1N3NA 3MA7A 1G7LB 4YFLI 3TN5A 3WNPA 4RE3A 3OAYH 2FE0A 1W1PA 3EWXA 3AYVA 3EOTH 3O3DA 3PB0A 4AL8L 5GRZA 4M4RB 3EYPA 4HLEA 5KVGE 4DXVA 3GMMB 3B2XA 2VKWA 3BP6A 1W32A 3C61A 5E6ID 3Q1SL 1JK9B 4BKLA 4FA8A 1U30A 1PZUB 2ZP9A 5JHDE 1MYRA 1D8CA 4M29A 1R3SA 1TYJA 3P62A 4D9PA 3APYA 2J6EH 3NH7H 2CM5A 5E00A 4L5FE 3MHGA 1RAMA 3NUKA 1ECQA 5ETUB 1J0YA 2YZRA 4TVPE 2OXHB 4U6YA 5I1GH 4GYBA 2ANUA 4GSDH 1OFRA 5HQMA 5AVWB 4GY7A 4Y4KC 5I2IA 4YZFE 1HHHA 2H3NB 3U5YA 4GQQA 3CZLA 3OKOB 3SCSA 3K6SB 1KDIA 1YPZE 4RZ6A 1SEQL 4N90E 5E6IB 3SDDA 4G1EA 2DMCA 1AYOA 2Q71A 4XMPL 3B9NA 3WUEA 2Z92B 3PWPE 5KOMC 2L04A 5EB8A 1EWDA 1S9VB 4GP5B 1FH9A 1T96A 4EWJA 4AIBA 2Q7YA 1F45A 4A7VA 3R11A 4KROD 2XRAL 4GQBA 3G18A 1OCBA 1J9RA 4ZOAA 4G2DA 4M0XA 3H21A 4Y19E 1ZGLA 3THMH 3NQ2A 3BAIA 3N6YA 4N3TA 4YLBA 4WY0B 3OVGA 1D7BA 3KOYA 3MTRA 5I1HH 3QT2A 2REQA 5E9XA 1ZWIB 4JTHA 2NXZD 4Z5RB 3BKMH 4Y4FA 4LGSB 2XG5A 5D2WA 4MSSA 2ATPB 3RGHA 3W56A 2BK8A 1CZ8H 1FHNA 4LUTA 4FTVE 2PPGA 3NPXA 2I85A 4X5RA 4DP9X 3RJXA 4CVXA 3TYGH 3X3GL 1IF2A 3PWUA 1AQ8A 4PMUA 4GOSA 4Y9FA 1W5QA 5IFAL 1RFDL 4OW6A 3QRGL 3SIKA 5F9WB 5ABEA 3BKYL 3MLXH 3WQPA 3GBEA 2XUCA 4ZFOB 4G56A 5C0CD 3WBXA 3INOA 4AUBA 4F8XA 1DQWA 1NDZA 3N4FA 2NXZB 3VFNA 2INEA 4LRSA 5J8OA 2HT3C 2J4GA 2OCCB 3RX3A 3RILA 4MA7H 4DJMA 3X11A 2XV0A 5HD8C 4JY6A 2WLKA 1D2OA 3CN4A 3IPFA 4FFWC 5I2UA 1BZOA 1E8XA 4CN1A 3YPIA 1IM9A 4D9LL 3QAZB 1QLRA 5DZVA 4U10A 4A7QA 3QMRA 3K1KC 2K8QA 2IG2H 1E67A 1NJ9A 1NP2A 5B39A 3PUCA 4UQIM 5IOPA 3CHRA 4N2NA 4PJ9D 3W84A 1CI1A 1MWAA 4GFXA 2Y8UA 4PRHB 2FO8A 2J47A 4O50A 1BM7A 1TJHH 4QAMB 5FOBA 5T1DH 4PJGF 2VXQA 3CK5A 1MFAL 3E3QC 3CVIL 5DVMA 5FK9B 3B2VL 4AY8A 4B9GA 4QDPA 3CVHH 4YGVA 2N56A 4HWEH 4F0RA 1OG6A 4E41D 1G0XA 4IEFB 3FQ1A 2FH8A 5ABHA 4MD4A 1OKEA 2FX8H 2WGNB 4Y4HC 3CFMA 3PWGA 3K6OA 4F7MB 2YS4A 3L4UA 3R1GL 2V7NA 5K9DA 3MODH 3KBVA 3RVUD 1BGGA 3UL4A 4KI5F 1NTHA 4QF1A 3N40F 4YSAA 5IB3A 1EH9A 1T5XB 4N1CA 2Z0BA 1I8IA 1SJMA 3ZKMD 3VXME 4A6YL 1SW3A 3AU0A 2Y1ZA 3DDFA 2H26A 1OHLA 4IT1A 4LDLB 3JTSA 3E0FA 4E41B 1A7RH 2GZXA 3NTYA 4WGVB 1XF3B 2G3FA 1P4BH 2OMXA 2D9CA 2FDSA 4MZ8A 4WDIA 2P44B 3A6OA 2ALAA 3RG6A 5DD3L 1GC1H 5AHMA 3CU2A 1T83C 4LSRH 3TPUB 4K2UH 4NO3B 5BUGA 1ZCCA 1A9EA 5IHRA 1SHXA 2QLVB 1OF8A 5AYTA 3I9GH 4JZJA 1M42A 5A16A 3SY8A 1R38A 4MCYB 4HPOL 3MLTA 4XVJL 3DIFB 4F3FA 4IL0A 2V5TA 2AMXA 4NQED 2K0RA 4TQPA 2IDUA 3IDIA 3ABSA 3W2LA 5IEKA 1O7VA 1WT5C 2FEEI 1XM3A 2EXWD 4OCLC 1NAKH 4DN3L 5GZOD 3G5XB 2AXHA 1U9KA 2D2HA 4AQEB 4BBWA 1V02A 5AY7A 3AWOA 1OXYA 1W37A 2P47B 4Q8UA 1TFHA 3BLBA 1H0DB 1RCXB 2WXKA 3NJJA 3FFCA 4NHUB 2A4EA 3NCXA 4IS6B 3HNSH 2GJXA 3GZOA 4F0LA 3I9AA 2E9LA 4HHAA 1YTKA 3E8UL 2RFXB 1Z7AA 1BZ7B 4OM0L 2Z1SA 3GLCA 4M7KL 2R2BB 5JLZA 4DJFA 1DANU 4JFZL 5ISZE 4WVRA 3W2DL 5C0JB 2ZA3A 5KVFE 3T09A 4EPSA 1U8QB 1I2OA 3NQEA 2XZZA 3RHWF 4NN7B 3KYMB 2X1UA 1N0LA 4G8GD 1B9BA 4QOKD 3EKLA 3BVWA 1LQ0A 1AW2A 3KH3A 4A66A 3TEWA 3LY0A 4E4FA 1JPST 1D9KC 3B40A 1BF8A 3BEWB 3GIPA 2IFGA 1JPHA 3BVUA 4G8EB 4Q6XA 3AVEA 5C86A 1S7QA 1P4IH 2B8OT 2WXDM 4Z7IA 3PTDA 4CNSA 4B91A 4QXVA 2I9LB 1KIRB 2J5LC 1J01A 5FYLD 3FXYA 2OGJA 3MOQA 3P84A 3CXDH 3WNIA 1PGRB 3QYMA 1X7TA 3DOSB 5I6OA 5ENWB 3OSVA 4KFZC 3SBWC 3RX2A 1T8QA 1LBLA 1L6FA 5JIDA 1DQDH 4GRMA 4QOKB 3BIKB 3IEAA 2QHRL 5HWNA 1Q6LA 1QQDB 3L5MA 3Q6FB 3FW6A 5CJBA 3VFTB 3HTWA 2RTTA 4YN3A 4Z3FA 3JW7A 3E6FB 2JLPA 4RXGA 4D8PA 2X1IA 4K1GA 3QCVL 2GAZB 3B7RL 5D2VA 4DETA 4OM1L 5LXGL 4X2UA 1F3DJ 4JKPL 1CGVA 2ARWA 2F8IA 3ULVE 2V5LA 2FLBT 5E1QA 3DZ1A 5FAAA 1X7QB 5I8EA 5DVNA 3K4AA 4X6BB 3L4ZA 2CGZA 3GDTA 1JAKA 4OLVH 3QUZA 1B88A 1NDMA 3OKKB 5AW6B 3O0RH 5IB2B 1HAUA 2QZRA 2D7TL 2Y89A 4KY1L 2WAQA 3LQMA 2CKBB 5AVUB 4LSSH 4B5TA 1I3VA 2HB0A 1IBFA 2EG7A 2CBOA 3MMTA 4MYAA 1MCDA 1KY6A 5KVDE 4RBPK 2IF7A 1HVQA 4XTRC 4YSDA 5I3FA 1BTMA 4NOFA 2PRMA 4HUVA 3QJFB 1S9YA 4RX4D 3FCTB 2VUOA 2OW6A 5D33A 5E2UL 2W9MA 3ML8A 5BVPL 1X5AA 4JIIX 1WBXB 2EIDA 3DMMD 2FGBA 4JTQA 2V7HA 4KJWD 4PYHA 1P7TA 3GHPA 5EEZA 1BVWA 2FGWL 4P9HC 4GP4B 4WW2C 4EIVA 1W0VA 2AJVL 5JW4M 4RDQG 3MV8A 2CMRH 4CU7A 1HEZB 2IADA 5D09A 4TX6A 2WD0A 4F8TA 2P5WE 2LV4A 3EYQC 1NL0L 2CJUH 4HUCA 2PTVA 5IMKB 1BBJA 5IFTA 1HQ4A 3TWCL 3TN0B 5FAGA 1A1MB 4WOQA 4ZEPA 2BNUA 4E5XB 2VXTH 4XP9L 1RZIA 3SE9H 3T8MA 2XQBH 4G7VH 2GJRA 5JW4N 1N5YH 2YKLH 2PURA 4GW5B 3AWGA 2AI0H 5JPNB 3CJPA 3RYMA 3I3BA 3HTLX 4I13B 4YUEH 1P43A 1IWAA 3LRLA 4QE4A 3DMMB 1AJ0A 1DQLL 3OAZK 2CLZA 4GZ7A 4XO6A 2KYIA 4PB5A 3WS6C 1JQVA 2OTWA 3FU9A 3LKQA 4JFVA 1UASA 1BXUA 4C56B 4B5NA 1KPVA 2Y1HA 2FH6A 1LD9B 1E0XA 2KERA 2IQTA 2F1AA 2YD3A 2NQHA 1FWRA 5BO1H 4P2OB 4JPGA 3NQBA 5BWAA 4LEOB 3A4WA 2Y63A 1JL8A 2NXYB 3GR7A 4YBQC 1XLKA 3FSWA 1VSCA 2ZOTA 2OTPA 4I8YA 4HP5A 5FKPA 3UDWC 1I85A 1HZHH 3L67A 2R56L 2DQEH 5D8JH 1VEOA 3LN9A 3GRBA 1ANUA 4X8XA 3BMVA 3PPGA 1AGBB 3NQMA 4F9DA 1J11A 5DS2A 3CZUB 3QW4B 2AXJA 3E5PA 4CAGA 5ANME 3QDMD 2OZ3A 1HL5A 1G7HA 4XC3L 3SUUA 2LE9A 4TSAH 1I7RA 4LSPH 1JV5A 4PG9B 2ZT9C 1EHLH 1BVKB 1ZLEA 3NN8A 2NUPA 3L12A 3ABGA 1FVEB 5EU9A 1QNVA 3D1MC 3NACH 3ZWTA 5IBTL 4QCIB 1E90A 1A5OC 4QRNA 1X39A 2W0FA 4AEFA 3KPMA 4I0PC 2Y69B 3TJEH 4MVAA 3IGLA 4JE0A 1FWWA 2FTWA 3BPWA 2EG6A 3DTDA 4J6RH 2ESVA 3QZAA 4L6DA 1M71A 3GH5A 3SYCA 2P48B 1S5NA 4HG4K 1A4JB 1R3HA 3QDMB 3H55A 4PR5B 2WOYA 4D9QE 5MEQB 1XP3A 4G9FE 2MPVA 1BBDH 1OYAA 2R69H 2JTDA 1VGKA 5DEFA 4UT7H 1W9BM 2EH8H 5JBEA 3AJXA 2VZ3A 2FLRT 1OLZA 4AC4A 3DHMA 4U1HB 1E51A 1CB7B 3RPTA 1QFHA 4LT7A 3H4XA 1ITXA 5D1ZC 2VGIA 5E99L 2ICWJ 3PAJA 2X3AA 1P7QA 4XXCC 3GBMH 5BXTA