1HNYA

The structure of human pancreatic alpha-amylase at 1.8 angstroms resolution and comparisons with related enzymes
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of human pancreatic alpha-amylase at 1.8 A resolution and comparisons with related enzymes.
pubmed rcsb
molecule tags Hydrolase (o-glycosyl)
molecule keywords HUMAN PANCREATIC ALPHA-AMYLASE
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1hnyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hnyA01
3CO4A 5LYRA 2JIWA 4L4PA 3AI0A 1LWHA 3OIHA 4UNIA 4PTMA 4M24A 3ZOAA 5A8QA 2G3MA 3S2CA 1CWYA 2VZTA 1TCMA 1ITCA 1ISZA 3DYOA 4GIAA 2ZXDA 2CBIA 5EMYA 2GVYA 4QAWA 3AYSA 1RH9A 1R46A 5IXEA 2A3AA 1HJXA 1C3FA 2WCAA 3WNLA 2CIPA 2XFYA 4QCFA 3W81A 3KL3A 4JKKA 1ODZA 1V0LA 2WVVB 3VINA 4YPJA 3PZVA 1JZ7A 1OD8A 2YLAA 2CBUA 1QVBA 1W91A 1EXPA 5IDIA 3DHUA 2DDXA 1YHTA 4ZE5A 2PWFA 2F1BA 1XCWA 2UY4A 2XUCA 3TTQA 3BSHA 1R87A 3ARYA 2J4GA 1SFSA 6A3HA 3CTTA 1W1VA 4DWSD 1TMQA 3LMYA 3GH7A 2WC7A 4PMRA 3VD9A 3OLDA 3W6LA 3VD3A 2XG9A 4ZE4A 1SZNA 2WYSA 2WMIB 2BHYA 4OOZA 3WENA 1UQYA 5CXPA 1L8NA 2C7FA 2OSWA 1C8XA 4J3WA 3SCUA 3RO8A 3A23A 3VIFA 1DWGM 2G3IA 2PWEA 1XSIA 1JYXA 4W89A 4BQ3A 1W2PA 4D71A 4R27A 1G0CA 2J8FA 1ISVA 2OLHA 4JKLA 1XD1A 5I5RA 3CH9A 3GXDA 3HN3A 3RMEA 1BYAA 1U2YA 1UYQA 5I24A 1ZBKA 2E9LA 3EDFA 3L2MA 4FLOA 2VRJA 1PBGA 3WY3A 4TUFA 4D6FA 3VO0A 5GNXA 4E8CA 1V02E 2VCAA 4Z2JA 4UQDA 1J0JA 3VMOA 4AZCA 2C0HA 1JZ5A 2WSKA 3OGSA 1QWNA 1QI4A 3VIHA 3BMVA 4PMYA 3VX0A 4HOWA 2G8ZA 3F5JA 1XC6A 5GNZA 3B9DA 3T0BA 3AIEA 3FN9A 3AZRA 3BMWA 3CGTA 3A21A 5A2CA 1DWFM 4RE4A 1MVYA 5KEZA 4EKJA 3AZSA 3RIKA 3QHOA 2VZUA 4HMEA 3A22A 3VIJA 4CVWA 2ZUTA 1M7XA 1JF5A 2WPGA 3TTOA 3T2QA 2Y24A 3VILA 4PN2A 2J78A 2YDSA 3A4WA 4CU7A 1HJSA 1CXKA 1E4IA 1V02A 4F79A 5BXTA 5IFTA 4D6DA 4TOQA 3M7SA 4YHGA 1E70M 3VIKA 2D0FA 3FXYA 3WMCA 2DIEA 3LRLA 2J75A 4MTVA 1X1NA 1UWRA 4ZENA 1NOUA 3ARQA 4N0RA 4PSRA 4MJ2A 2WKLA 4J27A 1UWUA 2NSXA 4JHZA 4KWUA 5CPQA 3O9NA 3AYRA 1EO5A 2W5FA 3RDKA 4QP0A 3DX4A 2UWFA 4FNSA 1KGUA 4U2YA 2GJPA 1GZJA 1OGBA 2EO7A 4GI8A 3BUDA 4GZEA 1VEMA 2W62A 3WDPP 1UR9A 1B3XA 1K9FA 1LF1A 3SUUA 4FNQA 2ZICA 1EO7A 5DFAA 4QDMA 1UASA 2F61A 2D0GA 4GI6A 4UQ9A 3CIVA 3CZNA 1CGWA 5BXSA 4B16A 2WC4A 1UD6A 3MO4A 1KGXA 4AMWA 3ARWA 3CBWA 5M5DA 2XHYA 1XD0A 1EIBA 3AMGA 3WH5A 1WZLA 3EJPA 2FHBA 4U5IA 3H55A 2DSWA 4J3VA 1K6AA 1WNOA 2QHAA 3EJQA 5E09A 3DYPA 1B3WA 4CUCA 2EPMX 3AMLA 2IUZA 3QGVA 4FMVA 4S3JA 3VOCA 1QHOA 1Q6EA 1JL8A 1CGUA 5CGMA 4W8AA 2FH6A 1E71M 5A6SA 4W7WA 1KXQA 1HNYA 2FE0A 2YDRA 2BHZA 1AQMA 1GQLA 4QFUA 3A5VA 2EXOA 2BY2A 3VKKA 2YFNA 2VZSA 4JL2A 4C7GA 5IHRA 1JYNA 3IJ8A 5A95A 1CXHA 3VIOA 2GDVA 1MFVA 1JZ3A 4CN4A 1MW0A 3WF1A 3ARUA 1B1YA 3L4UA 4UR9A 4MB4A 1OD0A 3AHYA 3N17A 4UFMA 1VRXA 3AIVA 2F7QA 1MW2A 3W24A 5A6BD 4MADA 3WF2A 3EYPA 1J0YA 2X09A 7A3HA 1UKOA 1J0ZA 3CZ8A 3KZSA 1EQCA 1KB3A 2WSPA 3I3BA 4FK9A 1K9EA 1QW9A 1J0IA 3GXMA 5CLTA 2V5CA 3UETA 1GUVA 3VM7A 1Q4NX 1R85A 3WFZA 3I3DA 5FOOA 3W38A 3AZTA 3SUSA 2YL9A 3WMSA 3WL1A 2FYVA 5I77A 2GJRA 1TQSA 2G3NA 2WZEA 3GDBA 2V5DA 1BVZA 2J7DA 2ESCA 1WZKA 3O2LA 5ECUA 3CLWA 1V6WA 1SYTA 2WAGA 1UD2A 1JI1A 3SCTA 3T08A 1C91A 5M03A 4NRSA 3VD4A 3GH5A 1CEOA 1FOBA 2E8YA 3OGVA 3LX9A 2JALA 3W27A 2J7GA 4JFSA 4H41A 3VNYA 1XCXA 2FDMA 1W3LA 3WBAA 1CENA 3IANA 5A6BA 1OCQA 1EHAA 1MQQA 3DC0A 2XPKA 3AXHA 1KR0A 4U3AA 4W5ZA 3B9AA 3NSXA 4KGLA 3VIGA 4UQBA 1TQTA 1TA3B 1ZL1A 3A47A 4GPNA 1KCLA 5A8NA 2WNWA 1WDSA 1P6WA 1C90A 1BYDA 2Z1SA 3UG4A 3VSUA 1Y7VA 3PZMA 1CXFA 1UKPA 4FNTA 3RPMA 4TTUA 5CGTA 4IUGA 4AXNA 1W3HA 5I79A 3WUBA 2VVNA 4H8VA 1H4PA 2Y4SA 4MB5A 4JFTA 1J01A 1XGZA 1X6NA 1UQZA 4AZ7A 1GVIA 2WMIA 3QHNA 1W3KA 1NOWA 4AISA 2NW0A 4HA4A 1HJUA 1R8LA 3EMCA 1TQVA 5D9MA 1MW1A 3D4YA 3BC9A 4Z2KA 1GQKA 3CZJA 1JDCA 4TXEA 1UWIA 3RJXA 3EJRA 1W9UA 2YL6A 1HP5A 1H41A 3WNNA 2XTKA 5EB8A 1V6YA 5A1AA 4CD7A 5BXRA 4MDOA 1VB9A 3HU7A 2PWDA 4M8UA 1R33A 1TUXA 4D6EA 3JUGA 2XM2A 5JIWA 1HJVA 3PZGA 4JFUA 2EPOA 3GXPA 4LQ1A 3UERA 5AC4A 4CD5A 2EPKX 1X6LA 4AZBA 5HOSA 2XN0A 2WMHA 4UFLA 4H8UA 4E4PA 3UEQA 3AMDA 2BV9A 2ZUVA 3ZMRA 3OZPA 3WD0A 3WUEA 2OW7A 3EMZA 3PTKA 4AZIA 2OWCA 1MFUA 2EBNA 4EAMA 3CZLA 4WSJA 3IAQA 2BY1A 2F7OA 3EDJA 1E0WA 2TAAA 1GVYA 3A3HA 3HG4A 1HXJA 5IFPA 3F5LA 2Z1KA 4PTVA 2AAAA 2EPNA 2G3JA 3MUAA 3DECA 1U33A 4GO9A 1GHRA 3D51A 3WDHA 3SURA 3DX1A 1JF6A 4PMUA 4AIOA 2D0HA 5F7UA 3WEMA 1ZB5A 3T0AA 1NOFA 1ZU8A 1E73M 1BYCA 3FW6A 1KTCA 1MQRA 3L4VA 3ARVA 5CSUA 1HL8A 2ZX5A 4Q7NA 1QWUA 3KWXA 1GHSA 3AIRA 2J25A 1JGIA 3GZAA 2ZWYA 1G94A 1BVNP 4UQCA 5CLWA 4F9DA 2J79A 3CPUA 2Y8VA 3MV01 1GONA 4BQ5A 4GQQA 1JZ2A 1ODUA 2J7HA 3GM8A 2ZE0A 2PWGA 2WXDM 2WMKA 4PMOA 1HVQA 3DX3A 1HXKA 4F66A 1CGYA 3U5YA 2XN1A 3CV5A 1EDTA 1HN1A 2PBOA 3CZKA 5BYWA 1H0IA 3QOMA 1CNVA 1FH7A 2F7PA 3D50A 3G6LA 1V0MA 2VTFA 5LA0A 2RGMA 3ZT6A 4NZFA 3FHAA 2AMGA 1R75A 2XVPA 4HPGA 3HJEA 1C7SA 2IXUA 3AICA 1JXKA 1V3KA 2YA2A 1J11A 4AMCA 1RP8A 1C93A 2VL4A 5FL0A 4LPCA 1MXGA 3EDKA 3VNZA 3MMUA 3TTSA 2JEPA 4J3TA 1ZJBA 1KGWA 4NRRA 3QR3A 5A8MA 1IZKA 1TA3A 3MKKA 3N04A 2CHOA 3DHPA 4HZ8A 1HX0A 1V3HA 5BXPA 1N82A 3BGAA 4GQRA 1H2JA 2WLZA 3MS8A 4MB3A 5CJ5A 3ARSA 1PIGA 3U7BA 3CZEA 2ZUMA 3AHZA 3TONA 1DWAM 1UWSA 3GNPA 5E6ZA 4FLRA 2XSAA 4E2OA 1S46A 2XSBA 3NSNA 4M82A 2JF6A 3BH4A 3AMCA 4P8WA 1OSEA 3LXBA 1WP6A 1UZ1A 2DSKA 5FCZA 1OBAA 1GOMA 3F5KA 1F4AA 3BAKA 5A6MA 2A3BA 1JAEA 3J7HA 2D24A 3SCQA 3S5YA 2OYMA 1M04A 5I0DA 3ZO9A 3VIMA 2DH2A 1E6SM 4W88A 2OYLA 1UKTA 1E15A 1BYBA 3T2PA 1XYFA 3FHQA 3ZSSA 4AEEA 1E4LA 5D9NA 2W4XA 1ZS2A 1E1EA 2WCSA 3APGA 1E40A 4AIEA 4J28A 2W61A 3NIYA 2BXYA 4C7FA 1V6VA 5DO8A 2EJ1A 1B9ZA 2EACA 4Z2LA 3WFLA 1WDPA 3VDBA 1V6UA 2JIEA 1E6ZA 4YHEA 3AIBA 2Y5EA 1UR1A 3RM9A 3VGHA 1R86A 1B90A 4FLSA 3DDFA 4L4OA 1UR0A 3WH9A 2F2HA 1G01A 3EMQA 1CIUA 4P8UA 4H7VA 5EFFA 1HKJA 2BVTA 2VNCA 1V3MA 2C8NA 1EA9C 1UD8A 4CU6A 1BGGA 2NT0A 1VBUA 1EQPA 3BUBA 4UOJA 3BVTA 3EJTA 4MB1A 1CGVA 3BAXA 3O6AA 2Q8XA 3QHMA 3LPPA 1ZBCA 1UKSA 2D3NA 3WDRA 2WB5A 1ZBWA 3EJUA 2F8QA 3LRKA 4ACZB 2WMGA 3MMDA 3T0DA 2WMJA 1H5VA 5AYIA 4J3UA 4V2XA 3EDEA 2X2IA 4UOZA 4XZWA 4PMZA 3WQ4A 1K9DA 4NXKA 4BF7A 1CGXA 4UFJA 3PTMA 2VQUA 1FA2A 3ZSTA 4AMXA 4PMVA 4X0NA 2X2JA 3VSVA 4RE2A 1DTUA 2FH8A 1JFXA 5BROA 4AEFA 4ZXLA 1CGTA 1UR4A 4FNUA 3N12A 4TTGA 2GJXB 3L4WA 1WPCA 2GSJA 4OIFA 3CHDA 4K68A 5FKYA 4Z2IA 3K8MA 2YBTA 1M53A 4J3XA 1QOXA 3VMPA 3NYDA 3N11A 2G41A 2A3CA 5AC5A 3ZR6A 2UY3A 2J8GA 4JZ5A 4DO5A 1JZ6A 3VPLA 5AY7A 3ECQA 1NM9A 2WM0A 2UY2A 4HOZA 4ZEPA 2VVSA 5GNYA 4DO4A 4NXSA 3WSUA 1T0OA 3BCDA 2VRQA 1JI2A 1HF6A 4AY1A 3POHA 1JYWA 1V0KA 5JBFA 2O92A 1WZMA 3PTQA 3VSTA 4P7RA 1E6NA 2X2YA 1NWSA 1XRVA 1RD6A 1L0PA 2WMFA 2X8RA 1G9HA 2CBJA 4N42A 4FNRA 1PAMA 4W87A 2F1AA 2PI6A 1US3A 5A6JA 2IXVA 3AQUA 1BPLB 4C7DA 4OBSA 3OLIA 2MANA 1C8YA 3WD2A 5EFDA 4B3LA 4PCSA 4X0VA 4LX4A 1AQHA 4ZFMA 1UKQA 3PZNA 4GI9A 1E0VA 3IJ9A 1JNEA 2BVYA 1V6XA 4A4AA 1E4MM 5ABFB 3PZIA 1H3GA 1ITXA 3GNOA 1XYZA 1PS3A 3TP4A 1EOKA 3SUWA 5E9AA 1C8QA 1G5AA 3AXXA 3RM8A 2QPUA 4GKLA 4U31A 3MUIA 3CMJA 3WBEA 1ESWA 3AHXA 4OGZA 1DWIM 2CHNA 1VFMA 3KE0A 3ZJ8A 4WKHA 2BY0A 1B3YA 1H1NA 2V3GA 3SCNA 1FH8A 4AYSA 1W1PA 1PX3A 4W85A 4JFVA 1C7TA 1KBKA 2CPUA 3UESA 4D1JA 1CBGA 1E1FA 1F4HA 4HMDA 4IM4A 4B9YA 1JIBA 2F18A 2JFEX 2A3EA 2WBKA 4UZSA 3LPFA 4NZJA 5A6KA 1QHPA 5A8PA 5GPRA 2D20A 5CQ1A 4DM2A 9CGTA 1CXEA 7TAAA 2J74A 2E8ZA 1E6QM 1A47A 1GOQA 4DUXA 1OGSA 3WH6A 4IISA 1PPIA 4AYGA 1TE1A 4AW7A 4V28A 1W9DM 4YN5A 1HWWA 3U57A 5A6AA 1J10A 1EOMA 4WIWA 3VDAA 1OGGA 4ZXOA 3GXTA 4MAVA 3D52A 3VIPA 3S5ZA 5JBEA 4PMNA 1EH9A 2ALWA 1QX1A 5EBAA 3BVXA 1OIFA 1V3JA 2O9OA 4AD0A 5FL1A 1J18A 5DMYA 2XVGA 1JZ8A 4ATWA 3EDDA 3VDHA 1V0NA 1E6RA 3WN6A 1WB0A 3VU2A 2XGIA 4Z2GA 3ALFA 3WF3A 1OINA 1GW1A 1VFFA 2DT1A 2JF7A 2EEXA 3FY1A 5E0FA 5BRQA 1NARA 2J77A 2X2HA 5HPOA 1D3CA 3CMGA 1BLIA 3GXFA 1BG4A 1FP8A 1TVNA 4W7VA 3DDGA 2W67A 2VC9A 1HL9A 1VJSA 1QHZA 3AIUA 4MNLA 3N13A 4PMDA 5E70A 1TFVA 1IV8A 2EQDA 2HISA 2ZOXA 5I6SA 2WZIA 2D23A 2ZWZA 2YJQA 4U5KA 3WNOA 2ZXBA 3BVWA 2YOCA 2VQTA 3WF0A 3WUFA 4MNKA 1JAKA 1E4NA 3B8SA 3U5UA 1XH0A 2ZXQA 3HMCA 3PZUA 3VX1A 1R47A 1B31A 2DPEA 2VOTA 3OLGA 3VDCA 1PJ9A 3EBVA 4BA0A 3UR8A 4MDPA 1KXHA 3WQ8A 3L4ZA 3LRMA 4F8XA 2F7RA 4QCEA 2VMFA 2WANA 1KCKA 3K46A 1EHNA 3TOPA 3WNKA 4W5UA 1ISWA 3VD7A 4LYRA 2W92A 1MXDA 1GNXA 1HJWA 4ATDA 3IAPA 1R7AA 4D6IA 3BUPA 2GJXA 4ACZA 2J7BA 3LXCA 2EAEA 1UR8A 1GOIA 2YBUA 1MYRA 1RP9A 3CUGA 1JDDA 2DEPA 3GBDA 4MNJA 2GK1B 5I78A 4HP5A 5M3WA 2VRKA 3BAWA 2CETA 1GORA 3VGDA 4LYQA 2XFRA 3ARZA 1HTYA 3N9KA 1OM0A 1OIMA 4DWSB 2ZX9A 3WDJA 2V38A 4CN1A 3ARRA 3B9EA 2XJ7A 5DT5A 4AD1A 1UZ4A 4CD6A 3ALGA 2E9BA 4FNPA 2WK2A 1CPUA 1DWHM 3W53A 1PIFA 3G6MA 1US2A 2XVNA 5JUVA 3WY1A 5CSYA 5D8ZA 1WE5A 2PWHA 4PTWA 1D2KA 4NI3A 2ZIDA 4KRTA 1QI2A 1CYGA 2DSUA 4F9JA 1J12A 1E0XA 4P7QA 3KL0A 1IZJA 4QLJA 1AMYA 1KXVA 4TX6A 3N1AA 5C70A 4P7NA 1E55A 1FFQA 3PZQA 1J0HA 4KH2A 4AZ6A 3NDYA 3WNMA 5DEZA 2WC3A 2FHFA 1V03A 3OLEA 3DX2A 3KLLA 2DGAA 1BQCA 1E9LA 3VM5A 2BNJA 1CTNA 1QNPA 1W9BM 3NDZA 2CYGA 1BSIA 4TVUA 1NP2A 3ZIZA 2BHUA 1OT2A 4AZGA 3AS3A 3SCWA 1E5JA 3VIIA 1ZJAA 3WELA 5I3DA 1E56A 4GINA 1AVAA 2WCGA 1YQ2A 1O6IA 3W26A 4ML4A 1TG7A 1QNQA 3SEPA 3CUFA 4TVCA 3AJ7A 3BVUA 2QMJA 1NP0A 2J7EA 5HDRA 4OOUA 3AS0A 5IHSA 4HPHA 2WBGA 1B2YA 1UH3A 1H0GA 1CECA 4MJ4A 4UQAA 3W29A 3NUKA 4NX0A 4OZOA 4WK9A 3POCA 1KXTA 1DP0A 3OB8A 4UQEA 3VGFA 3CZGA 1KWGA 3K4AA 3VMNA 4GZJA 1UR2A 4IPLA 1E3XA 1UH4A 1BFNA 3VGGA 4WJXA 1CDGA 2WVTA 2GFTA 2DT2A 1BTCA 1UA3A 1GPFA 2DQXA 4OBRA 4QLLA 4XV0A 4RE3A 5A6LA 3AISA 3ZM8A 3WUGA 4CD4A 3CHEA 3L4TA 3VVGA 1JD7A 1BAGA 1DHKA 1IT0A 3D3AA 2OW6A 4RL3A 2OWWA 1CLVA 3HG3A 1BGAA 3WQWA 4HZ7A 1QNSA 3ARPA 1GJWA 6CGTA 2PBGA 2D2OA 3CHCA 3RJYA 2GDUA 4PUEA 1OT1A 4W93A 1R34A 4AZ5A 1KWKA 2DH3A 2CESA 4TX8A 3KL5A 1O7DC 3PZ9A 3MSDA 1GJUA 1W1YA 4W84A 1XH2A 4WF7A 3THDA 3NSMA 3CUJA 1HP4A 3WD4A 3HG2A 2BFGA 4HMCA 3WD1A 3BLKA 3TV8A 2VZOA 1D7FA 3AFBA 3GYCA 2WVVA 4NSBA 3VTRA 2YDQA 4W8LA 5A2BA 1E5NA 4NF7A 4D72A 3ZT5A 2W66A 4URIA 1UD3A 3GTNA 4DWSC 1J0KA 1VBRA 5ABHA 4Z2HA 2CCRA 3BAYA 4WKAA 2V3EA 2VT0A 1J9YA 1H11A 3GBEA 3HZ3A 1XH1A 3CHFA 2VO5A 5CG0A 3MANA 3W37A 2WVUA 2VCBA 1ZBVA 3BUQA 1WO2A 2VI0A 2G4FA 1UH2A 2X0YA 2VCCA 3SIMA 2X1IA 1QPKA 4H04A 1VIWA 3SCRA 4CU8A 1LL4A 1K9TA 5E0CA 4GXPA 1SMDA 4A3HA 2OWXA 1PX8A 4LYPA 1RPKA 1BG9A 4MPKA 2CNCA 5BCAA 4JKMA 2DSVA 3BAIA 3WDQA 4IPNB 5E1QA 2V3FA 4BQ2A 4W7UA 3WL0A 2E40A 3ZT7A 1W3JA 1QI5A 2YFOA 3WMBA 2D22A 1V3IA 4CN6A 4UCFA 1GQIA 1WDRA 2JEQA 3AHTA 2EABA 1VEOA 3WIJA 4UZUA 4M1RA 4UTFA 2ZUNA 2VX4A 4HU8A 5A2AA 3VGEA 3L4YA 3KLKA 3M07A 1EGZA 2WHKA 1NH6A 1XV8A 3RILA 4B15A 4OJYA 3AS2A 1ECEA 3BUIA 4XB3A 5LA2A 4BQ4A 1LG2A 2OSXA 1VF8A 3WD3A 4OKDA 4HU0A 2E0PA 3WH8A 4D1IA 3K8KA 4QLKA 4JHOA 4J7RA 2PB1A 1PZ3A 4M80A 4W8BA 2EADA 4KMQA 1VFOA 2J7FA 5JIPA 3GXNA 1HKIA 1UHVA 5HBFA 4DM1A 1PEZA 3OA5A 1V08A 3WY2A 3GXIA 1OWQA 1H49A 1E3ZA 2X0HA 3W82A 1NWRA 4M29A 3FAXA 1E72M 3EJSA 4CGTA 4P7OA 3SCSA 2BXZA 1DWJM 5FIPA 5AYBA 2D3LA 1G1YA 2W91A 1HKMA 1LG1A 3W4RA 1FHDA 1XSKA 3T09A 2PC8A 2YA1A 3NJ3A 2HVMA 5ABGA 2BY3A 1TZ7A 2WVSA 2J7CA 4ATLA 1JXJA 2J62A 1JDAA 1GCYA 1TQUA 5A3HA 5A8OA 5ABFA 1KQZA 4CKQA 3K8LA 2CKSA 2WLYA 1LLOA 2CERA 5BWFA 4B9ZA 2NT1A 3LPOA 4JCLA 3W28A 4V27A 4CVUA 3NCOA 1JG9A 2Y8KA 3BXWA 1TVPA 2YA0A 3WEOA 4U33A 3UR7A 2QF8A 4UFHA 1WDQA 2XGBA 2XVLA 2DSZA 1VEPA 2DT0A 5D9PA 1E43A 7CGTA 2XWEA 4D6HA 3VUPA 3SUTA 1U30A 3OG2A 3F4VA 5M17A 1WZAA 3VGBA 4BCEA 5CPTA 2EPLX 4HOXA 5JBDA 4PEEA 1QBAA 4U2ZA 2YL5A 3WQVA 2YKKA 2WHLA 4TVDA 3RM4A 1VENA 2WKGA 2D1ZA 1B3VA 3UCQA 1QBBA 3FAWA 1W32A 1TQWA 4PSPA 3II1A 1I75A 4MAZA 1CXLA 3U7VA 4HA1A 4CCDA 2XIBA 4JL1A 3ZR5A 1UA7A 1WCGA 4BS0A 1Q6CA 1FP9A 3ARTA 3BLPX 3PZTA 4PCTA 1HT6A 2XFFA 3T2OA 2BVDA 5HPCA 3OZOA 4JFWA 1W9VA 4XUYA 3ZJ6A 3BVVA 4DUWA 5ABEA 4X9YA 3SCOA 1QW8A 4ACYA 4Y7EA 4EK7A 1Q6DA 5CPSA 2WHJA 3I3EA 2XN2A 1H09A 1KTBA 1I1WA 2E3ZA 4A3YA 2ZXAA 3WF4A 4H8HA 2VX6A 1Z32X 3MSGA 1WAWA 2VUYA 2RGLA 3MMWA 4EE9A 5A94A 1SMAA 3BSGA 4AD5A 4B3KA 1NWTA 1JNDA 1GQJA 3S6TA 1LJYA 1PZ2A 4XZBA 4PRWA 3AHVA 4PTXA 2QPSA 3A4XA 4CD8A 3AIQA 3A6OA 3WDIA 3SUVA 1UWTA 2DIJA 2ZX7A 1A3HA 3RCNA 1HJQA 3MUY1 2O9RA 3TA9A 4JIEA 2VX7A 5I2UA 4Q22A 5D8WA 4LGXA 1ISYA 4R5EA 4WLCA 2OYKA 4MNMA 3WQ5A 3CZSA 3PN8A 4GZIA 3K4DA 3MI6A 3AOFA 5GQBA 1LL6A 5I23A 1CXIA 4PUDA 4D6CA 3AIWA 1MWOA 3CUIA 1GOWA 1AQ0A 2CITA 4FLQA 4U3CA 2O9PA 1DEDA 1HIZA 3THCA 3WNPA 3AMKA 6TAAA 1B3ZA 2CKRA 3D4ZA 4DUVA 3D5HA 1VAHA 2D73A 3OBAA 1JD9A 1VFUA 4XX6A 1VJZA 1BHGA 3GH4A 1M01A 2AOSA 1UD5A 1C92A 3H53A 4AWEA 4FF5A 5KZ6A 3WEZA 2VURA 3AS1A 1TR1A 4CCEA 4AZCB 1FH9A 2VX5A 8A3HA 1GOOA 2QV4A 5HXMA 2CEQA 3MU7A 2X05A 2ZX8A 1I1XA 4PMQA 4H2CA 3AXIA 2B31A 4UOQA 4UFKA 5E6YA 3SCPA 1MQPA 2VR4A 2WHMA 3WQ6A 5BRPA 4KRUA 2A3HA 1JYVA 3UG3A 2XM1A 2WWDA 5FD0A 3IGUA 2Y2WA 1EDGA 1BF2A 3ZJ7A 3ARXA 1OB0A 1E6XM 4LXFA 3KEHA 3PZOA 3M6DA 3FNDA 1CLXA 2QMKA 5DT7A 3W0KA 1M03A 2XYLA 1B0IA 1NQ6A 2WWCA 2UY5A 4JCMA 1W2VA 4M81A 3MV11 1W1TA 3LXAA 2DT3A 3UG5A 3BCFA 2CXGA 2W63A 2VR5A 4OUEA 2WW5A 3CUHA 1R7OA 1HVXA 4KGJA 2ZUSA 1QI3A 4AC1X 4J3SA 1Q6GA 1WKYA 4BZYA 2E9MA 1HKKA 1Q6FA 3CC1A 4HZ6A 4CCCA 3L4XA 1QI0A 4P8XA 3A4AA 2ZUWA 4D6GA 2VJXA 3QOKA 3K1DA 5A69A 3W6MA 5CZKA 1QNRA 2J47A 1KQYA 1XSJA 4HTYA 4AD2A 3N15A 1UOKA 3PHAA 4AZHA 3AROA 4WSKA 1QNOA 3M46A 1GOKA 2OSYA 1ISXA 3PBGA 2YL8A 3TTYA 3VD5A 1SR0A 4M56A 4P8VA 3MUZ1 3GNRA 4PBGA 3L2LA 4AD4A 2V3DA 3IJ7A 2JE8A 3A24A 4AD3A 2FGZA 2ZX6A 2QLYA 4JAWA 2YIHA 2WZHA 1UUQA 4E8DA 3IK2A 1FHLA 4P7LA 5LA1A 5C8BB 1UWQA 2FHCA 4WKFA 1E6PA 1LL7A 1W9PA 1XHGA 2BS9A 3WKZA 3WY4A 3LPGA 1KR1A 5C71A 2GK1A 4AIUA 1JZ4A 1JFHA 3BAJA 2FGLA 2GUYA 4DO6A 2VZVA 1B30A 1UG6A 3OGRA 1EDQA 4NZCA 2E4TA 3W25A 4DWSA 1LQ0A 5D9OA 2IGTA 1CZ1A 1KFWA 1NWUA 1UD4A 2O9TA 5D4YA 3SCVA 3WH7A 2XWDA 3H54A 3ZJKA 1KBBA 4EANA 4W86A 2ZUUA 4HA3A 5DF0A 3HG5A 1V3LA 1LWJA 1O7AA 1W9XA 4PYSA 3BLBA 3DYMA 4D6JA 4GO8A 3DX0A 3N18A 4S3KA 2YLLA 1FFRA 1MW3A 3E1F1 3ZQ9A 1PX4A 4PMXA 4UFIA 2CBVA 2XIIA 5HNNA 2PF0A 2XVKA 5TD4A 8CGTA
chains in the Genus database with same CATH superfamily
1XGQB 2JIWA 3GB6A 4J12A 4B27A 1IFHL 3AI0A 4E3TA 1PKQA 2LVEA 2XX1A 4U6VL 3QUZA 4UNIA 1XW8A 4M24A 1KXTB 2IW0A 4P23D 1QYGL 3RU8L 3II2A 5D96B 3C08L 2G3MA 4ZB2A 2ACQA 1SYVB 3D3VE 3GI9L 5AUMA 3EOOA 1XAKA 5D7JC 1H7RA 4GIAA 1XGDA 2GDQA 5C0CB 3SGEH 1T83C 4KROC 2FWOA 3S5NA 1P6FA 4RMUA 4Y9EA 3WKYA 2VUOA 4M7ZB 3T5WA 4YNYA 1HL4A 1TPWA 4ABUA 1BMWA 3IEBA 3ZTNL 4Z42C 1MQKH 2VEIA 1KGYE 2E9IA 2DY3A 5CEWA 5E56A 4ADTA 2M26A 2DTSA 2FQEA 4CNIA 4QCFA 5F0LB 3KL3A 1TJGL 3NQVA 5F7YC 4ZPVB 1X96A 4LCYB 4PRIA 3RWHA 4FIRA 4L2YA 1I7ZA 2WVVB 3VINA 4FKHA 3WLPA 5LHEA 3P40A 1U8LB 1ZV5A 4NZTH 2G0KA 3SADA 3KJ6L 3BPCA 3L6FB 4ZQTA 5AECA 3NCYP 3NFSL 1KB5H 1QVBA 4XP6L 3SY1A 2HAZA 4P4RB 3HE7B 1VRSA 5CN2A 1FDLL 3GMPA 5CR8A 3TMLA 1AO7A 3W2LA 4B9KC 1E5CA 1X7QB 1YCSA 3BVNA 4G80A 1XLKA 2UY4A 3DHJA 1DXEA 4OTKA 3P77A 1KFGA 2XUCA 1YEIL 4N25A 1P53A 4Y89A 1JHLL 2I26N 4NHCL 4HGKC 4JFHE 5FV1L 4L65A 4H88L 3DC8A 3ZVIA 5EOQL 1JZDC 3PDDA 2O93L 2ICWB 5AZ0A 1W1VA 4DWSD 3EO9L 6A3HA 3IU3A 4OLUL 4NQDD 4XN9A 2DL2A 1YNLH 2E6DA 4PMRA 3VD9A 2HFEA 4BFNA 5BO0D 4JFQB 1T8QA 3B97A 3PP3H 2QQ6A 2CGRH 4FF9A 5CJOH 4HS8H 2KS0A 5JHAA 3QMTA 1JPGB 1SZNA 1RA5A 2WMIB 3Q2VA 2DDQH 5D4JA 3FO9A 4R34A 2BHYA 4IDJH 1NCBH 5SX5H 2WMPA 2L7JA 4Y4KA 3WENA 2DM4A 3EBIA 5KG9B 4DPBX 1QEWB 1MCNA 4L37A 2J6EL 5J12B 2EVIA 1OFPA 2YXOA 1UMLA 2DQ6A 3PABB 1DL7H 2OSWA 4JDEA 4WHYG 1JFQL 5EORL 4PB9H 5H35A 3RO8A 3TCLA 4GBXD 1DWGM 1FL3B 4PD4J 2AXJA 4X99A 1RZKH 2V5TA 3US1A 4BQ3A 2WW8A 2GI7A 2HMID 3ZMNA 1ONQA 1JEZA 4AK1A 3GLCA 1HAUA 1U3NA 3QDJB 2XXMB 1EJRC 4K0OA 4XSLA 4K94L 1FFPB 5I8OL 4OIBA 3HN3A 2GGGA 3CH9A 3GW3A 1BYAA 1F8TL 1PGRB 1QBML 4F2EA 8PAZA 1AO7B 5REQA 4QGTA 3N9GL 3GMLB 1H6FA 1RCXB 4AUJA 1X5MA 4IMCA 2FBOJ 1BVNT 3L2MA 3LZFH 4FLOA 2VRJA 4A2DA 2C3XA 3EYSH 3O6FC 5FF0A 2AEPH 3NL6A 3BDBA 3A3WA 4X6DE 3VO0A 3QI9A 4M7JH 5C7XH 1S7VB 5JTWA 2RDUA 3EWBX 5GNXA 5MKGA 5D71L 2ADAA 4Z2JA 5F3FA 2Y70A 3RVTD 3EEGA 3IXAB 1FCVA 5DCEA 1BQHB 5J1AA 4C47A 2A6DB 3D69B 4E5XB 3GC4A 3L2NA 2ZWLT 3RTQD 3U30C 3W7IA 1QWNA 1AIFA 3HC0B 1OARH 1NLBL 3OZ9L 4WFFE 4Y5VC 5IQ9B 2EXTA 4OVXA 3Q8EA 1DJWA 4MPQA 1RLWA 1I8KA 4ZTPH 4R4FH 3FCSA 1N7KA 4MFEA 1UACL 5IG7A 2X4RA 1R3TA 1A49A 4AH2B 5A2CA 1DWFM 3QF0A 3K5SA 5KEZA 1L9WA 4UM9D 5HY9A 1I82A 1U92B 3BT2L 1D2PA 5MERB 2Q87A 1BGXH 3I02B 3UTZA 2QVHA 4JM2C 2XFWA 2CO3A 2OV0A 2VEPA 3KZPA 3QHOA 2MPVA 3N29A 4KPLA 2VZUA 1BBDL 3F8UB 4JPGA 4S1QH 3CQQA 4PGDB 5JR1L 4QDPA 3DI1A 4IL2A 4CVWA 2YZ5A 3E8UH 2DW6A 2EEBA 4ZO9A 1M7XA 1AR1C 2WPGA 2NY3C 3LS5H 4ELKA 5CG7A 3TTOA 4PU2A 2FRGP 3P3RA 1NSJA 2W65B 2Y24A 4K71B 2B16A 1IT7A 4QOKE 1FX6A 3JR2A 5AW8B 4ZXBA 1ZAIA 4U10A 3FXGA 3W75A 4DZIA 1JJUA 2OMTB 5IHLB 4QQUA 3NIFF 2W6RA 3ZHLA 2K7PA 4PJDE 1HJSA 5HGHA 3SDYL 1CXKA 3BKJH 2VXSH 4F79A 4Z8FH 3EW3B 5BXTA 4N0UB 4FKKA 2I32A 1J88A 1IGCL 3UDWA 3UO8B 3M7SA 4D6DA 3APCA 3PHOA 4FHJA 4NERA 3KBJA 3RUBL 2CO7B 4GP4B 4XVOA 4NJIA 4N9CA 4KKZA 1TX0A 1A4BA 2B1HL 2D0FA 3G9VA 2G96A 5HPMB 1SZFA 3FXYA 2AJSH 3LRLA 4X63A 3WK2A 3CHPA 1ZRUA 5E4IA 1X1NA 2J75A 3G3DA 4MTVA 3SJ3A 5C09B 3SDCC 3ARQA 2ATPA 1BFVL 4JX6A 3IKKA 4PSRA 1E4HA 1W3NA 2WKLA 3QC6X 1PCSA 2NSXA 5DN1A 5F7WC 2ILLA 4Y0GA 1AY1L 2GGJA 4UTAL 1C1EL 1ROCA 1FNLA 4UU9A 5D7SL 1H3TA 1UWFA 5B1CA 1BA9A 1U8QA 1TPB1 5KYNA 1EUAA 3JV4A 5K33A 4BE6A 3H8AA 3WLIA 4A29A 2W5FA 1KRBC 3CQPA 4FQ1L 4KDWA 4R7LA 4DF0A 4ORIA 5SWZD 5E2TH 3TWCL 4PB0H 2UWFA 4AF0B 2XBZA 4U2YA 1YNTB 1GZJA 1OGBA 2P24B 5I17B 1EFXA 2C4FT 3BUDA 5J8OA 1UJQA 4GZEA 4XK2A 3UJFA 2FMNA 5C55A 1JVKA 2Q3XA 3NIFE 2X4SB 3BW9B 3IFOB 1ED3A 2GHWB 4KO5A 1JCXA 3DX9B 3A0OA 3J8F7 3NBNA 1R2TA 2QCLA 4QG9A 3KS0H 3SUUA 2J72A 4GXVH 2ZICA 4L8DB 3D85D 2IPKB 5F6HJ 5DFAA 1S2TA 4QDMA 3A6BL 4ODUA 4V1DE 5D03A 2F54E 3TR9A 4GI6A 4UQ9A 3ABRA 3KTCA 2A0LC 1A4KB 1PSKH 2NMSA 4HGXA 1AR1D 2WC4A 4I3GA 4M6OH 5E51A 3BLIA 3M0KA 2XTJD 4G43A 1QA9B 2I9UA 3N55A 4X4MA 4K5NA 1I1AB 4MCYB 1EGJA 1YUKB 4AMWA 1LJMA 1PXGA 2QDWA 1XF0A 3P5ZA 5CCJA 3WD1A 4QRSB 4HPYL 2L3BA 3D06A 4NI6A 1DE4B 4DPRA 5CZTA 2V68A 3UZXA 2XBTA 2FHBA 4QNPF 1U8OB 3HE7C 3MWAA 4U5IA 3DRQB 1K6AA 2QJDA 2UY7B 1P7KA 1WUNT 1RL1A 3EJQA 3QNYB 1F3RB 1JV5B 4JCWA 5I6PA 3PWUB 4EDWL 2SFPA 5E09A 3IUHA 4X4YB 4AM0B 3DETC 3HUJF 2FQFA 2QCGA 4FP8H 4FMVA 4ODHL 2IUZA 1E2VA 3EOAA 3VOCA 1S7WA 1QHOA 2OLDA 2ZXCA 4F7MB 3QARA 4G1EB 1IXOA 3ML9A 1H5YA 1CGUA 3GFUA 4LLQB 1UM6L 4LMQE 3UVIA 4W8AA 4JUSA 2VM8A 3FT4B 4TNVF 4FQ1H 3LK6A 5CEYA 2XZAH 5RUBA 3MGAA 2OEJA 5BW7C 1D5XA 1HINL 3R4RA 4FQXC 2ATSA 1U4EA 3NQ8A 1MY5A 2EDRA 4IBVA 4QFUA 2XH7A 3CX5K 2FGBA 4BH8B 4BFBD 3QMSA 1RZJL 4E42A 1PFCA 2ZP0T 3HLAB 1H5BC 2VDPL 4QF1A 4UNVA 2VZSA 5GS0H 1UYWL 5I1JH 3OR6A 5KWYC 3ZYOA 3TBBA 2HRPH 2XFGB 3BRFA 3MACL 1M2VB 2YRLA 3UZQA 4ZOCA 5FEWA 4NG3A 3GLAA 3IJ8A 4R0LB 4LH8A 1CXHA 1RPXA 5HR6A 3VD1A 5FEZA 3VIOA 2QSTA 2J88L 4M9OA 4PJ7F 4W6YB 4FMKA 4G43B 2OR2A 2DMKA 1HIML 3LEVH 4GH1A 3HE6C 2GGHA 1BMZA 3ARUA 1Q0YH 2RGSA 4PRDA 3CDFA 4OLWL 1B1YA 2Y7GA 3GRGA 4M7SA 2OMWA 4LHJB 4PN6A 4U6HB 1WDWA 2H3NA 4ZOAA 4LUJA 2GEQA 4PRIE 3KYNA 5G2WA 3MZGB 4FMFA 4RMTA 3W24A 1D9EA 3LTYA 1KBPA 5U7SA 3HFMH 3CDYA 2ZT9C 3ARDD 2PUZA 1E6JL 3CSTA 2D3VA 4D3CH 3U9WA 4ETQB 3WF2A 3QZNA 4NJJA 4IQJA 3EYPA 3WKPA 1WV7T 4G8EB 1NCGA 1F76A 4UIOA 5EMMA 2X09A 7A3HA 4I6KA 4AGMA 3CZ8A 3MUGA 2MQ0A 5AQ0A 1EQCA 4JTIA 3PL6C 2FD6H 4OZHA 4GLRI 3I3BA 5JPNA 4P5TC 3D30A 4TNVK 3U1SH 4WRLA 1DIEA 3G2GA 3K13A 3W1QA 2V8ZA 1J86A 1A9BB 4KJQC 1J0IA 4QAMB 3RFRA 1LO5B 2Z0BA 2V5CA 4KKAC 3IF1A 5SV3A 1GUVA 2E68A 4KQ4L 3F4WA 4HXBL 3NSCA 1U1JA 3DJZA 4XP4H 1A5LC 2XYBA 4BM7A 4ZTPL 4XNZB 3W38A 1UC5A 1I8LC 5CU9A 4C6MA 2E7BA 1Y0LB 1FORH 2J8UB 2B1AH 3NO5A 1UADC 1NLBH 4OLWH 2YCKX 2WV3A 3SUSA 2F74A 3WMSA 1JCTA 1XGQA 5C08B 2HNHA 2BNRB 1HIMH 2CO4A 3LEVL 4XWUA 1PS9A 2WZEA 5DFTA 4XMVA 4ZYKA 2UY6B 1DJHA 2VLME 7PTDA 5LDSA 5D33A 4ADIA 1ET5A 3BPCB 3CHOA 1EDHA 5ECUA 4YH6A 1Q1JL 3UT0A 4WUKH 4M9PA 1EGJH 3RDTC 3FSOA 2ETWA 2OMZA 1UOZA 1BQGA 1EMTL 2GZXA 3SCTA 4NYUA 1UZ8B 3R43A 1T0NB 1YVLA 3Q6FB 4OVVA 3NG5A 1R30A 2GBTA 1JK8B 3L1GA 2CZ5A 2A6KA 1FWIC 3N9GH 3OKKB 2XQ0A 4FXKA 1GZHA 4QRQB 5SWSA 2Q86A 3LX9A 2OB3A 1JWSA 4P2RE 4BFGA 4O1BA 4MA7L 1U8JB 2GITA 3JV6B 1U8NB 4JO3H 3R79A 3NIGB 2Y61A 2ED7A 1FKWA 2CDEB 32C2B 3MOQA 4P0DA 4X5WB 1GZPA 3PGCB 4FFZL 5DD3H 1Q8JA 2Y1ZA 5J8LA 2BP3A 4EQ2A 1CENA 4JFYB 2XDFA 1I9RL 3IYLW 2EO1A 4XB7A 4Q8QA 3GVGA 5HR7A 3V4LA 2PTDA 5FW8A 2D9QB 4JG1H 2DORA 1MQQA 4MDJB 4DPAX 1XM3A 2PW2B 2FVKA 1HILA 1W72B 4RIRA 1TSRA 4KHXH 3RR1A 4W9FC 5IUCA 1KR0A 4KERA 4U3AA 3HNSH 2N56A 1FLRH 4HD9A 5C0IB 1U3ZA 2EYSA 4KGLA 1WTGT 4DVBA 3QAZC 2YWZA 4PJFE 1I85C 1FV1B 1MCPH 4JY8A 1TQTA 1ZL1A 2CUAA 4QNPE 1B3OA 4ZQKB 2DJXA 5SWSE 3A47A 4QWWC 4RBPK 2B7PA 5ANMA 4DT2A 3LVTA 5A8NA 1P6WA 1WFIA 4LSTH 1ASPA 4UT7H 2IPFA 3H4GA 2Z8SA 1CXFA 5JQIB 1UKPA 3RPMA 1BKSA 3W7OA 2NX5E 3ABXA 5CGTA 1O66A 5J4MA 2Z35B 4MD0A 2VVNA 3D0VB 3VKAA 1BZ7B 1H4PA 4G71B 1RK0A 1JPST 4JIHA 3NCFB 1J01A 5IMOB 4B5VA 3DOPA 4Y9CA 3K4ZA 4RESB 3ZTCC 4EO5A 3R6IA 3W7DA 4NENB 3HIZA 1R6WA 4KHTL 2D7PA 4UOW1 5XINA 4AZ7A 1Q38A 4KX9A 4QRTB 1T89A 5CD3A 4QRAA 1KO0A 3OPZH 3VFGH 4HDIA 4TQPA 5FM5M 1NOWA 5C9JA 4OE7A 3LU2A 2VQ4A 3MZ2A 3BUYA 1FNSH 1O12A 3EMCA 3WQDA 3B3IB 3CMOH 1EZWA 1XYMA 3KJ6H 4YEEA 3LBMA 4NASA 3MRCA 1OVDA 4ONFL 4PCKA 4P46A 3LHWA 2X1QA 3G5YB 3OKEA 4PJBE 4UQ2B 1CD1A 3UGXA 2G4JA 4WY0B 4H9MA 1ND0A 1NPUA 2KPNA 3UBXB 5CIPB 1NC2D 2FK9A 1CG9A 5DD5H 2APSA 3U7YL 2O6EA 2I27N 3JTSA 5D7SH 5B22A 2WLNA 3DUUB 5L2KB 1XAUA 3FU5A 3P74A 1VKXB 3LI0A 3NJLA 4C6CA 5IQLA 2B08A 1HP5A 1UXWB 2Y62A 4N6EA 5EMUA 3WNNA 1ZNNA 2VZ1A 4IRJA 3SKNA 1ZLWK 2GT9A 4KDVA 1SN0A 4PJXE 5EMLA 3N1FC 3H6OA 1EHXA 4CD7A 3KWWB 2XZ9A 1M9SA 5AOZA 1UB6B 5BXRA 3CXHJ 4MDOA 2KI6A 3HU7A 2PWDA 4Q4RA 3HKZA 4XMLL 5AYUH 5I15L 4KTGA 1WFMA 2EDDA 2XWJB 4IX2A 3VC6A 4D6EA 4KO9A 5IFAH 1K77A 3B9KB 1P4LA 1BJ1H 3QORB 4F5CE 3J2PA 1A0EA 3PZGA 1R3LA 1V8HA 4R2GB 3D2UA 4KTYA 3IXAA 4XVJH 1BPVA 5CFHA 2P50A 3TIMA 4B9IA 4NQSA 1V79A 4XISA 5SX4I 3S37X 2EPKX 1X6LA 5I18L 3B34A 2XIOA 4GG6A 1YMMA 2WUCL 4JM0A 2XN0A 3SBWC 1QSVA 4KK8D 1A6TA 1XIWC 2W07B 2ZAGA 4KRPC 2ZAHA 3ARFD 3RA7H 3RIFF 4U28A 2X28A 4UFLA 4H8UA 4K3DH 1CFTA 5FEPA 4DSYA 2BV9A 4MJ5A 4FJYA 4O02L 1PUDA 3T8QA 2VDRL 4YHIA 4PIRF 1MCQA 1KFEA 4IICA 3WUEA 3US0A 3EYVA 1A7RH 2OZNA 4EN2A 4FA3A 3UYIA 3R12A 2R69A 4AZIA 4YSOA 4P46B 1WHPA 1XF5B 2OG9A 5H91A 3WJXA 1MFUA 1NDGA 3H56A 3STEA 2Q6WA 4KROD 1A5SA 4ZUWB 2OCJA 4TSBL 3C5JB 3EDJA 3OKNB 1MDTA 3WLRA 1SBSH 2TAAA 2IV8A 4I7UA 5L4JA 5DUBA 5DURB 3A3HA 3FH5A 1P1ZB 3BOXA 1IGTB 1AQDB 4ICMA 2HT2C 1T2JA 4K94C 3F5LA 3MCLH 3X3GL 2Z1KA 4IRJB 4JQ4A 5EGRA 2NY2D 3PUCA 4UTMA 2KC0A 3DGDA 3OZ9H 1O1ZA 3ABSA 3ZGIA 4F8NA 2PETA 1SDDA 4GLEA 2UXVA 1A6UH 3O9WD 3FTSA 5PCYA 1NF7A 1F4YH 1U33A 3DUSA 2ICEC 2CZVA 3D51A 4X22A 1CI3M 4XNQB 4PREA 1REQA 3N2OA 4N2MA 3DX1A 1JF6A 4X6CE 1JERA 2ORBH 3ICJA 3P0YL 3VNLA 1AJZA 5E1AB 2AV1B 3HV8A 4ABQA 1H6TA 1NOFA 2OQYA 3LN5B 4P5TB 3M9YA 1W1ZA 1HZKA 3BPNC 1BYCA 1ECQA 4KK6D 4TKWA 5HDBF 5C0ND 1SZGA 1KTCA 3PBMA 1G0YR 1S78D 5DJAA 2WQPA 1BX2A 1BVLA 1MQRA 3SKMA 1KELH 3IJDA 3FA3A 3SFWA 1AD4A 3GYEA 4PH6A 5F2MA 4YSRA 1HSBA 2ZX5A 3O3BA 5INCA 5K93A 4JRXE 3VNMA 3WXWH 1QWUA 3GVQA 4R8WL 3KCOA 3HAEB 5F8QC 3MNDA 3T0VA 3OVQA 3RWJB 3FULA 4C5ZA 3IDJB 2AL1A 1DVSA 1YMMD 1OEZW 5I30H 2X4TA 2ZWYA 4HF5L 3M0ZA 3WTVA 3CFKA 2OAAA 3ARFC 4MNGE 3KYKL 2ZRYA 1XYLA 3MUXA 5CLWA 2DQUH 3TYUA 2OJEB 2UYLA 3FQXA 4LBEA 5C2XA 1F56A 1M7JA 3TGXA 3CPUA 4X7TB 3W5NA 1TO3A 1NCBL 2QUMA 2Y8VA 2JKEA 1Y18A 1G7QA 4IU3B 1GONA 4JQIH 4XSMA 5IESL 4GI4A 5EC2A 3T44A 4TL5A 4GQQA 3VD2A 4JR9L 2N1TE 4HS8L 4KQNA 4CSSA 5T33L 1VR6A 4JQ3A 1JNLL 1TTRA 4F7KA 4W9JC 4ANKA 1XL6A 1TLMA 4KAQH 5I5MA 5B4MD 2J7HA 4IH3A 3TQPA 1IWAA 4LY8A 1HI6B 2XG4B 3SN6N 5CWSA 2HPIA 5C0FB 1J4EA 3SPCA 2J8UA 1HVQA 4ZDHB 1FJ1B 4M61B 1KJVA 4ZPTA 4IGSA 2ZWKA 1RHHB 2JGYA 3RF9A 1RK1B 1HQ4B 2O4MA 3BDXA 4RSYA 2WKJA 3ARDB 4AKOA 1XIDA 2E46A 5K3VA 1ZLSH 4DVRL 3QJVB 1H0IA 1GKRA 3QOMA 1MHEB 1F3XA 1HGYA 1U5VA 4ZX5A 4QXWA 4F7PA 3NN8B 1KULA 1Z5LA 5F2IA 1G1KA 3EKLA 2DQHL 1BQUA 3BP6A 4P59H 1GVFA 3HGSA 5AAWA 2QZ5A 5I6MA 2WSDA 3WL9A 1TWIA 4HHMA 3PWUA 4DVOA 3O45A 1V0MA 3QIUC 1FWTA 5KJ4A 1HXYB 3ITGA 5AYTA 4K3EH 3L5JA 1N9PA 1IC1A 3P0GB 3ZKMD 1ETB1 8A3HA 1E9OA 1KM6A 2EEFA 1B4TA 3I6RA 2IWEA 3SCMD 4YX2H 4WU7B 2AMGA 4RUBA 5BNXD 1T03L 1R75A 4QDWA 3RR4A 3NSJA 4BEQA 2XT1B 3HJEA 1C7SA 1SSDA 3GRBA 3DPBA 1VBHA 2ZCLH 4A1RA 1UATA 2IXUA 4N0CD 5AFDA 1J11A 1NA8A 1AGBA 4KKCC 2HXUA 4B95C 2XIJA 1BD2B 2HK1A 1RSYA 2APWA 4MDJA 1D7DA 4PMEA 1C93A 3G6DH 3HPJA 5IVNA 1A6WH 1HHKB 3EDKA 4HSQA 1S9XB 3MMUA 4H9VA 5CKSA 1B6UA 8FABA 4J3TA 1ZJBA 2BVPA 1RBAA 5AW2B 4KMTL 4L0PB 1OP5H 1N5YL 4R7JA 1FNFA 2Z31D 4K3JL 5IJKC 1G7JB 5GHWL 3QR3A 5ECGA 4IJRA 5AVTB 1QYGH 4AWJC 4TUKL 3N04A 2CHOA 4N1HB 1RHHA 4HFUL 1MF2H 1V3HA 3FFSA 1MAKA 4JHUA 1S2WA 5BOFA 3QUZB 3QJZA 3BGAA 3MBWA 5LHDA 1N82A 2MNUA 1LO5A 3FDGA 1WA3A 1HHIB 2K78A 3NQ2A 3CFIC 4MB3A 2C3VA 2DQDH 4GW5A 2CKNA 3P93A 5EEUA 3BQUA 4IRZA 1GTEA 1PIGA 2UZXA 1XISA 3WEXB 4D0DB 4JIIX 3U7BA 2D69A 7REQB 4XO5A 2DQGL 5TE7H 3S98A 2D4FA 3RAOA 3TJHC 1OSZA 1C8PA 4Z7IA 3Q58A 4J4PC 3H24A 2WZTA 5LCVL 3TONA 4F2FA 1DWAM 2BNRA 3NA9H 4ETQA 3QEQB 1P84K 4F2MB 2K3HA 3ES6B 3GNPA 3RYMA 5K1VA 5FK9B 3REWB 4EPDC 2QDVA 2VLKE 2DJLA 2XSAA 3OV6A 4E2OA 2XZ7A 4DJDC 4FXJA 4P07A 4NGHH 5FUOH 1OAYH 3QUMA 4Q7BA 3SZ8A 2NZIA 4LKCA 1GHFL 1BJMA 1MJUL 4G7EB 2YPLB 3RDJA 1X8CA 4Z7WF 2PDFA 1EEYB 4WWKB 2YW3A 4XN2A 1U3YA 3G6AA 5IVZA 2JLLA 4HIEB 3T1FB 4JO1L 4PLOB 1S9XA 3I75B 4JO2L 3PR2A 1UZ1A 4HZ7A 5FCZA 1DBML 4FE9A 1EBHA 5FXCH 5J5RA 1F4AA 3WJLC 1LNUB 3D18B 4NZRH 5A6MA 3RPIB 4DIAA 2BW5A 2VZ3A 2LQRA 5KVGL 1MCWW 4ORZC 4EZLA 3J7HA 4JYEA 1D9KD 2X9YA 1D5MA 1A6AA 1S6NA 2H3XC 4N1EA 1KACB 4TNWK 4L29B 3NSDA 1M04A 3U0PB 3UOAB 3IE9A 1P0NA 2Y5JA 4JQ1A 2H0FA 4GVIA 3EJZD 3K2UL 1MEXH 2PO6D 4DCQB 4NQEB 3NVTA 4TQTA 3WYRA 5CJNA 1I8UA 3WEXA 4D0DA 3M1OA 1X4XA 4Z7OF 1OCBA 1QR1A 1TWZA 3H2WA 3FN0H 1NBZB 2PDXA 5B1AB 2WP3T 2AL2B 3UWWA 3WLBA 5E9DB 4GIYA 1E5AA 5C0QA 2ASHA 1CO1A 2WCSA 4G6KL 2A9NL 4FAMA 5CBAB 5HYSG 3TU6A 5IP4A 4AIEA 4X9GA 2XN9D 1OAXL 2WD0A 1UVQB 1OPGL 5GS1A 3TJ4A 2YMXH 1B9KA 4N7QA 2JV6A 1QAPA 1Z42A 2EUXA 2GVEA 2R1YA 2PW1B 1B9ZA 4GUCA 3MOAH 4LAJH 4NKQB 2EACA 4J4PD 2CIIB 4P49A 1T1ZB 2YAFA 3HCVA 1SFTA 1CT5A 4YHEA 1G7LA 4PWEA 1RK7A 2Y5EA 5I1HH 3AIBA 1AQKL 4HCLA 3S1UA 3AU1A 4QMEA 3VGHA 2ZOKA 2JVUA 1R86A 2P5EA 3MNWA 3SSGA 4MAYB 3LCLA 3RVTC 4HG4J 4L4OA 1K72A 4YBLB 3WH9A 5T26A 2RFGA 4MVBC 3V0WL 4C54A 1G9ML 3OEXA 4P8UA 4H7VA 2X4OB 2PLTA 1GRWA 3N06B 3CVCA 1KN2H 4O2EB 4U3SB 4Z77B 2C8NA 4ONFH 3GZ3A 5A43C 5FSEC 3WIIH 3KBNA 3UACA 4N9EA 4B4FA 1TJ0A 1NBCA 3BVTA 4MB1A 5HHPA 4PS3A 2OL3A 3LZQA 4WO4C 5GGSA 1ZBCA 1BF8A 3E2QA 1MCHA 2O4EA 1TEFA 1J96A 2F8QA 3GKZA 4HPOH 1OTTC 3LRKA 2ISWA 3Q67A 5FF2A 4NJAL 5I3JA 3KPNA 3R25A 3FOLB 3O15A 3MMDA 4C1KA 2XSXA 2A7PA 3T0DA 3B9KD 4DXKA 2IDFA 4TLSA 3CPGA 5EWIH 1JF1B 2GCYA 2QHRH 4IMLA 4K2UL 4V2XA 5BOEA 5C2CA 1T5KA 1VACB 2N1KA 2X2IA 5BO1H 4XZWA 2FFIA 1DDHB 4KFOA 3VWKD 4UT6A 4WY0A 1CGXA 1YADA 4DFHA 3QEHB 3O3AA 2KLSA 2ESVD 3PTMA 4XHJC 1A7BA 3HS9A 2DZVA 2E7HA 3CNKA 3KXFE 3NJJA 1MHPH 2ADGB 3PWLA 4KXZI 1NUFA 5HPMA 1F18A 3ZSTA 3H21A 3WLSA 1YAIA 2P5EB 5B7YA 4HHAB 4GKTA 4L8CA 1KGJA 2FPYA 1FLRL 4A6YA 4ELKB 2QJMA 3TH6A 3GS7A 1XDMA 2VJ8A 5EU3A 2CWXA 3FNKA 4IOSA 4E9LA 1CGTA 1M65A 3SOTA 1UR4A 1TTFA 1FPTH 1J5DA 2DWEB 2HT4D 3DVNB 4FA8A 5AENA 2JJWA 2WQSA 1B4JH 1I8MB 1EJXC 2XZQL 3TZVA 4RETB 5F4XA 3C5JA 3OKNA 4ELDA 3NEEA 4F3FA 3KCJA 3LN3A 3H4WA 3ES7A 2GEEA 4BZ1H 1EJWC 5IIEA 4X4KA 4L1WA 2GSJA 1FNEA 2W1NA 4LVOC 4TLUA 3GSOB 4Y1AB 3ZVHB 3H6AA 1JGMA 4AG4H 2RAMA 1ONEA 4O10A 1LEIA 3VXUE 1X39A 4N4PA 5H2BB 5DLCA 4PGLA 4ADGA 1PU0A 1PKYA 3NYDA 1A7PL 4NNPL 2IKIA 4NAFA 3BDYH 3FOMB 4Y96A 2ALDA 5D1XB 4Y5XB 1BD0A 3MY9A 2OMYA 2W0LA 3PXLA 4ANXA 1R9XA 4B9CA 2LGNA 3GSRB 2A1WL 3X11B 5J3HC 3R0UA 5AC5A 2F8IA 1ES0B 4PLNC 1VYPX 1E6OH 1I1FB 3TDFA 1KLFB 5E1AA 4POYA 4MSWB 1DDHA 4N8VB 5AY7A 4WD0A 2EDEA 4WNQB 4R88A 2EDKA 4QTIL 3V55A 3VOJA 4YL4A 5DTFA 2WM0A 2R69H 2GC7C 1AZUA 4F9LA 4L3EE 3F5WB 1JCLA 1NKGA 4Y9AA 1KLUA 4R9XA 3BWUC 5IVXE 1T7XA 1WAPA 4LRIA 3TIEB 3NRPA 4Q7DA 3FSUA 4GT0A 3WSUA 3P62A 1R5IA 3GI8H 2QUVA 5EO0A 3O8XB 3EADA 4Q6YA 4AY1A 4IXHA 3O11B 1BD2A 4G8TA 3Q5OA 3VACA 3N50A 4CJ1A 1J8HE 1V0KA 4ZFCA 3DUSB 1FVEA 2DWDA 1OZUA 2E27H 3PTQA 4AJ0A 1W6LA 5J04A 4K2UH 1LD9A 1IE4A 2PLMA 4O14A 4P4KA 2FD6L 2FX7H 3HBZA 1RD6A 2APFA 5JXEA 1TV3A 5HMEA 2DRUA 4IRSB 3V5KB 4FXGA 5I73B 1C9DA 4XZNX 2BG5A 1WS7A 4Y1SA 1WIOA 4IOTA 2GTZA 1DQDL 1H3UA 3VG9C 3OODA 1CFQB 4ZSOB 1D2OA 3EYUL 4FNRA 3FU7A 4F2BA 3T4CA 3QJFA 1NAL1 4OGXH 1DQML 4TULH 4I9MA 1JV2A 1MNNA 2VXQA 3PBYA 4HYWA 3SRKA 4PJEB 4Y5VB 1YUHA 4JHBA 2CMRH 3GMOA 3WJYA 5DO2C 5C3TA 4DOHE 2BSDA 4GW5B 1AHWC 3OHXB 3WKMH 1F41A 1GIGL 4A7SA 5F1OB 4RCXA 3SN1A 1NPJA 4HJ0C 1GS6X 1SLWA 4GIRA 2ZZ1A 1DL3A 3LV3A 3EFOA 4NNXB 4YVVA 1OAQL 3TFKD 3UWYA 4N8VG 4QYOB 3MBED 5D7KE 2UZ9A 3N42B 4HCRL 3QVAA 5CF3A 1C8YA 3HR5B 4EN3D 4BUQA 2J88H 1AGCA 5FGSA 4YDKH 3EO1A 4OJCA 5IVXB 2V17L 3H9HB 1E0VA 3VTTA 3W1TA 1CGSH 3OIXA 1SHSA 5LXGH 2H9AB 3VFCA 1FNHA 5GJNA 1FGNH 3KLAB 2HG0A 1DSYA 4G7EA 3PZIA 3GSUB 2TSAA 4JLRB 4R84A 1XYZA 3O45B 3UXIA 4I87A 4M5ZH 1N68A 3GUTA 2BOFX 1I8IB 3WUWA 5C7VA 3ISYA 2IXQA 3MRJB 3V6OE 1E9PB 1F8MA 3LKPB 1DJGA 3DX7A 3UZQB 2CHZA 1RQHA 1G5AA 1YDPA 2WYIA 4PFMA 4LL4A 3U4AA 3KXFD 4MG4A 3ZDXE 4CNIB 2AEIT 3WMLA 5DYOB 5CP3A 3AU2A 2VQ1B 1K70A 4JTTA 2AJ3B 2F8OA 5DGRA 1LDPL 4F15C 1X5FA 4P2OB 4EWND 1HQ4A 4JFFB 3MBFA 2DIKA 2CAKA 5DD1L 1JV2B 4NNBA 2R0ZL 2XQBL 4GX8A 5MEQB 3WFEH 5H37G 1MI5B 4ODBD 2GQHA 1OX6A 8FABB 1VFMA 3KOFA 3CAKA 4YXGA 2Z4GA 4XO6A 3S3PA 4GY7A 5CJXA 2P52A 4MCZB 4Q3MA 4MM1A 4WKHA 9RUBA 4BK4A 4ELMA 3VXUA 4WUUA 4AKPA 3UXLA 1KCVH 3II3A 3KEDA 3SCNA 2WBJC 1VKFA 5GZOC 3ARGA 3RTLA 2DBLL 1W1PA 5HI5D 3AAMA 3HI6H 4G8EA 4JN2A 4DP7X 4AQ1B 3DBSA 4O13A 1PX3A 5F3BB 4HZ1A 2NTSP 1IGMH 2GI0A 3A67L 3FQUB 5IVXA 4WXZA 5BVJB 2CPUA 2JIXD 4NZRL 1IAKA 1C5BL 4XP1H 2FVLA 3EX1A 3P80A 3NQCA 2HKFL 1XLFA 4G1MA 3CWGA 4N2CA 3M88A 3MVTA 3PWVA 3G77A 1COBA 2O5NA 2P48B 2YPVA 2FZ9A 2F18A 4C58B 3M64A 3IWPA 1NC4B 2DQCH 4PJ9D 4NGHL 4MA3A 3UPRA 5FUZH 4NFCA 3BAEL 3AU1B 4IOIB 4HJGA 1U9KA 5M95B 1Z89A 3UPMA 3S96A 1P4IL 3VCCA 4O2FB 4G56A 1R19A 5FESA 1BFOB 4M1DH 1EEZB 4DM2A 2KZBA 1Z66A 2VLJE 3UIZA 1MVUA 2PO6B 4NO3A 2PCFA 4JRLA 7TAAA 9CGTA 5HVHC 1N55A 2J74A 1UCBL 2P5PA 1L6ZA 3TVMB 4JQXC 5HDQL 2Y1VA 3MRPB 1A5KC 3U3HA 1DFBH 2H32H 3FVMA 3QC3A 3IJYB 2N59A 2LOEA 4KJYB 3WS6C 2VW7A 2JJSA 4NZ1A 2YUWA 1MUCA 1KFLA 1TREA 2E67A 5BMXA 4YK4B 1UEMA 4YSTA 2OU4A 3KAAA 4D9RD 2CLEA 2NY6D 1F6AA 1J10A 4LAQL 1W8GA 4K8RC 3O07A 3RWEB 3VDAA 4WIWA 1OGGA 5EZPA 1C08B 2WWOA 3GXTA 1TR7A 4ZFZB 5LGKA 2Z2AA 3W11C 3G0SA 4H1LB 3GDKA 5DRXB 2ATKB 5FW6A 3QIWD 3M5XA 5HANA 5I3HA 3S1VA 2NSQA 1C5DA 2P7TB 5F9JA 1XC4A 4IJCA 1U21A 4WCJA 4RKAA 4XCFL 2B7OA 3L17A 5F7NC 1QX1A 2OXGB 4HXAL 1KCRL 2FJHB 2NZ9D 4NNYA 3VXTB 3VZZA 3NZHL 2HTKD 4AQ1A 4NBXB 4GG9A 1W6TA 4G7YL 5MEOB 2QW5A 3F7YA 5FR3A 2DQIL 4MAYD 1SYVA 5M1TA 4DN1A 4Z5RB 3MO1B 2XKNB 4DF2A 4FQXB 4Z7NB 1JZFA 3SGGA 2E7LC 1LO3H 4GAJH 4IJ3B 1JZ8A 4ATWA 5H4ZA 2ZCLL 4N86A 1JGDB 2OMXA 2WZMA 2VO8A 1J9QA 4M6AA 2O6PA 3T1FA 3K1GA 3VU2A 2NQHA 4MQ7A 2VDLB 3DOSA 3C5SA 1AGFA 3PWPB 5E6RB 2QSQA 2HKAA 3LRSA 4H88H 5FKAA 3W39A 2YMTA 4L8CB 4Q8BA 4HKZB 3W0WD 1XFPA 2PP1A 3VG0L 5JR1H 2IPJA 2EEXA 5FYKU 3QQ4B 3UMNA 2ZRZA 3TVMA 5D7JD 1BEUA 4YSQA 3AG3B 3EH5B 4HPOL 5E6ID 5BRQA 4MZYA 3LD8C 1D3CA 3BT2H 4L2LA 3UJ2A 2IGLA 3AAZB 4XP6H 1ACYH 1Z0NA 4OLVH 1IR1A 5IFHH 3O6MH 2Z7WA 3OW1A 4W7VA 1HKWA 3L4CA 3GR8A 2KPWA 1OCCB 1S5IL 1W8NA 2W67A 4IKLA 2XISA 2Z1VA 3N13A 2EQDA 1T99A 2W65A 5FF7A 4I2XE 1K1DA 3VXRD 3OJMB 5DRZB 1FH2A 1KB5B 5CAYB 1RVFL 5DJXB 2ESVB 5C08A 5I6SA 1CDIA 2W59A 1JHTB 3GRWL 4NNYB 5E8EA 4C56D 5C8JA 3VI3B 1RIHL 5GIRB 2YJQA 4KV5F 4J6RL 3SGDH 5FO8A 4L4TD 3SDCD 1OC7A 2ZXBA 4HCGA 3FONB 2R1MA 2F6KA 4JHWH 2X89A 3PL6B 3ITOA 1A6VL 2BC4B 3DSNA 3ES8A 5CNHA 4GG6F 3WUFA 2GKIA 1XRTA 1XTLA 2WZAA 3D39B 4XC3L 2VISB 2A73B 2NDFA 4HT1H 1LLWA 4JFEE 1JK9B 2C9UA 1GGIL 1SDAB 3CFDB 1F97A 4HUUA 1M4KA 5FC9A 4KXZH 4CADA 3P4OA 3X3FH 1NBVL 3VX1A 3QRHA 3PFUA 2RTTA 2JKPA 1R17A 4XPTH 1KLUB 2ZTJA 3F4DA 1UA6H 1U58A 1WWAX 3FPXA 3TYDA 2Z1XA 5AVYB 2R51A 4MAYA 1U8JA 2GITB 4XNZC 3DVIA 4J2QA 2C91A 3CXFA 4BA0A 1IFHH 2OFJA 4E2BA 2WB7A 2DUZA 4XKYA 1AQ8A 4AQ8A 4OSUH 4XKMA 1IWBA 1MCFA 1WBZA 5DLML 4ZFGL 2V8MA 2F7RA 1TJ1A 4DGWC 4F91B 2WANA 2BZCA 3N2TA 3TAOA 2ZF9A 3NABL 4UAHA 1K7EA 1AD9A 4HBQA 2E9JA 3DTXB 3WJMB 3S4SG 4W5UA 2H4EA 1KELL 5AL8A 1Z9MA 2NY5L 5KVFE 4HKPA 5TGBB 3KW7A 4WZHA 4XNXL 5E00B 3ZE1F 1RUSA 1GGTA 4XNDA 1T83A 3KP1A 1LT8A 5REQB 1NIAA 3MGOB 3QR2A 1IVLA 3QBTB 4O58H 5CJOL 4J5VA 1BKHA 1R7AA 5C9XA 1IBBA 4LFHD 4OLEA 3ZTJH 4GFIA 3KVMA 3QXUA 4ODXA 3CUGA 4GUJA 4XNUH 5SWQA 4W9DC 3TA3C 1JDDA 1AH3A 4MXWH 5LXXA 1XF5A 3SDDD 1QPQA 1WV2A 2VDIA 4PYGA 3VXRA 5L2JB 1SDYA 3LCYA 2PPEA 2XQYA 4GRLD 4I7ZC 4C57C 4R9HA 4P3CL 4WK2B 2X38A 4EUPA 2HV5A 4OZHF 4OVUA 2OSLA 4R5XA 4Z0BL 5MF5A 2YPKA 5KOVC 1H8OA 4P5RA 5C9JB 2XFRA 5C0GA 2V67A 3N9KA 1G9NH 1ZT1B 3OKOB 1OM0A 5D9SB 3UBPC 2V38A 4A3UA 1XWVA 3BIBX 1L4IA 4G70B 4NN5B 3P4NB 3C8KA 3LIZH 5EF3A 3L95B 1DBJH 3NPSC 3D47A 2VXUH 2V7HA 3B9OA 3ALGA 1ZS8A 4XTIA 4FNPA 3TEYA 5D1QC 3S3CB 4RZ5A 4YMZA 1KTNA 3GDLA 4HGWB 3W53A 1PIFA 1G6RB 4EI5B 1GC1H 2D7TH 1J5OH 2LU5A 5C3LD 3R19A 3Q2NA 3RVWD 3KDMB 1ETZA 5JUVA 1YTKA 1WE5A 3T4YB 4BWWA 2GT9B 3FTYA 1TNMA 2OCFD 4JN7A 2JCCF 2YXFA 1D2KA 2EC8A 2RALA 4N3TA 4NI3A 2ISSA 4UNKA 4OJFL 4KRTA 4Y8EA 1OY0A 4NUQA 2OP4L 3O3EB 2YK1H 4Y4KC 2AEQL 1E0XA 5I8CA 4LB3A 1G0XA 2G5WA 2H32A 3NZUA 4XMZA 3UTSB 1W0WA 4PJAE 3N4EA 2PO6C 2W80C 3CK0L 4NJ9L 1LCOA 3LLDA 4NQCB 3IDYC 5DX7A 1OYBA 4P7NA 4WI0B 2A6IA 1R3WA 1XUZA 5L2JA 5JW4R 3GBLA 3RRXA 3F6JA 3NIDF 4GJ1A 2EXYC 5ESQA 4LOUC 3PS7A 4Y6GA 1XB3A 5I5JA 3ZDZB 4IGBB 2OLSA 2YZ8A 4ZO8A 4J6RH 1GC1L 2D7TL 3E0FA 2NWSA 1J0HA 1R3JA 4HUXB 3PWIA 3C60C 3ATEA 4GAGH 4KI1A 2XCMC 4YDMA 4RAUA 3KPQB 1EVTC 1LHZA 4X7TA 4AX3A 5I1KH 2FHFA 3EYVB 9PCYA 1A6ZA 1YY8A 5F6IB 4HTBA 1ET7A 3ZFHA 4OFYA 4MSSA 3HA1A 4MY8A 3CPRA 1GYNA 4BK9A 3QSKB 3GAKA 3PP7A 4L3ED 1BREA 1YEGL 4QLWA 1JCVA 3SJVD 5GJPA 2Q8AL 3B03A 1ZTXE 4U1IB 3FYYA 3MHFA 3QTPA 1M3UA 4TMBA 1ZANH 4FFYH 2GUOA 3KGTA 5EULV 4G6MH 2CLFA 1E90A 3QDGE 1F7BA 2ZCKH 5C1MB 4H25A 4DGYL 3HGRA 1YYAA 1X5ZA 4N2IA 3AS3A 2WLKA 1FG9C 3CH1A 1EHLL 1OK6A 1S2CA 5C54A 1O5PA 1OQOA 1XIWB 5I1CL 3RL2A 1HYSD 2ROXA 3M0LA 1OF6A 1S78C 4APQB 1J05A 2NXYD 1YQ2A 4TRPH 6PTDA 1O6IA 2D7QA 4M43H 3OVUB 2IPTH 3AYTA 1LO3L 1R3HB 4GAJL 4NO5B 5D2NC 2CXEA 4HB7A 3SRHA 3W26A 5IBUG 1AJ7H 3SEPA 3VJ6B 4IIQC 3S35H 2WZ5A 2NYYD 4OM1H 3KCPB 3BVUA 3KLQA 1MNUH 5DDHA 4DP8X 5T3XE 3TMQA 4IGBA 1DJYA 4AEHH 4A8LA 3QUYB 4Y4KD 4JKPH 2XZZA 2P0OA 4Y90A 4K7PH 4CDGC 1KCRH 4OCNC 1TTPA 5FJTA 4NL1A 3P9LB 4ZUVB 4Y4FA 5BRZB 5DMKA 2GBAA 2WKOA 3TBWB 4JFQA 4O5LH 5EDSA 5IHSA 5EN3A 3VQ2C 3FTZA 4ONGL 1XGYH 3WTUA 4HVBA 3REQB 3SM0A 3UPWA 4UQAA 2FSDA 4ZXBC 2X4TB 4BZ2L 1M7DB 1PL3A 3RNKB 4H3DA 1B6DA 2GAZB 3OKMA 3MJ9L 4JG1L 5A3ID 4OZOA 3POCA 1KXTA 5E24E 1ZE3C 2NSMA 3REWA 5BMWA 3IWUA 4WTZA 3FJ6A 1HK6A 1C12B 4N2OA 3JUZA 1AD0B 3VZYA 1KWGA 2F8XC 3UEZA 5HI4C 1U91A 2DQJL 4NM8H 4GIPD 4MWFB 1EX5A 3WIFB 2EG8A 5H8UA 5TQLA 2NQJA 1P5UC 3QDAA 4H44C 2IOMA 5ICXA 4M5YH 3UNTA 4ZW5A 2B3RA 5T3ZE 5K69A 1QTWA 4IPLA 1E3XA 1UH4A 1URZA 2KDGA 4L4JA 3S6CA 4AGOA 4YHPA 1G69A 3VGGA 1GCFA 5D30A 2Z1BA 3FGCB 2ICSA 1BTCA 1GPFA 2D31A 2IH8A 3TBYA 3T3MF 3QPYA 4QLLA 3WUGA 4WAFA 4WKZA 2VLLB 1CGSL 5ANHA 1L2UA 2DS4A 4NKMB 4RGNB 4TV5A 2QKFA 1IT0A 4Z1YA 1RK1A 4XP1L 3D3AA 3DRTA 2MOGA 1MG3C 4G9FA 1UXLA 3SE9L 3B8TA 4L1XA 2G30A 1F3TA 5FK9A 2VUKA 2XDHA 1CB7B 2WKOF 3HI6L 2H47C 1ZWIA 2D2OA 3QUMH 3UTPD 1WVZA 3QRGL 4YXKL 2ZUXA 2V2TA 2GDUA 3CHCA 3D46A 4JICA 1R34A 5KVEH 3ZGHA 4P4RA 3TN0C 1P7BA 2VISA 3H2NA 3UF9A 1JUEA 1KWKA 3L9EA 3D12B 3LEXA 5E6IB 2CESA 4YVXA 5IBTH 4DQAA 1O7DC 4OZIB 1AHMA 2SODB 1BOYA 4JZNA 3KD4A 3VXOA 1MFEH 2FX9L 3EBGA 2WYTA 5IB1B 4OGXL 1HXMB 4TULL 1MCBA 5DURD 1IT8A 3EJZC 3MSDA 1GJUA 4J1UA 4Y4FD 5IMKA 1O75A 4HLZG 4Z7VF 2VC6A 5AKQA 1CYWA 3LGGA 3TA3B 3GSXB 3RPIA 2VLJD 1YSOA 5ALCL 1XSOA 3E2HB 4MYWB 2X0SA 4M1CD 3A5FA 3MRPA 1UT1A 4ICNA 4NYYA 3VXPA 4B5NA 4WGHA 1F45A 3TV8A 3V7AG 3GYCA 2WVVA 4OGYL 4L29A 4L0ZA 3EB2A 5D2YA 1MELA 1LOLA 1EK3A 2YDQA 2VXQH 1UENA 1NAKH 4W8LA 3RURA 3W0WB 1E5NA 5F1KC 1N8IA 4NF7A 4NFDA 1P48A 3B8WA 3M47A 2IKJA 3ZT5A 3VCLB 4FI4A 1UD3A 1SW0A 2NWRA 4URIA 2BZNA 4WWOA 2B3IA 2W9EH 1V05A 1BQLH 3GMRA 3H7RA 4KCUA 3FDKA 2K6YA 3BAYA 4WKAA 3SE3C 3HZ3A 1H11A 2Z93B 3MRRA 1XH1A 5HYJE 3R7RA 3H70A 2Q76A 4XMPL 4PPTA 3BI9X 3MA7A 3S1WA 3M1BB 5EBMB 2J1XA 3NP4A 4BSWB 3CXHK 5DO2D 2I14A 3MANA 3KBPA 4OM0H 3O6FD 2HBXA 3WJSA 4AWUA 2EJAA 1WDAA 1MRFH 3G5XA 4XP9H 2CM6A 5GGTH 1A3XA 1PCKA 3BG9A 3HFYA 3TNBA 3W83A 3TNMB 5BW7A 2ZUYA 2Y63A 3RVUD 1KB9J 1HZHH 1AYRA 1UH2A 2G4FA 2VCCA 3TNNB 2CWRA 3SIMA 3AXLA 3EWZA 3VXSA 4BRJA 4ZSUA 3W7HA 4X42A 3H1ZA 1Y0EA 4O11A 4H04A 2J2ZB 4PLKD 4ZSOE 4O18A 1ADQH 3KOXA 5FKPB 4P9HH 4LOEA 1P4IH 1PZSA 3WKNA 4GXPA 1J93A 5F89B 2CDEA 32C2A 5JOFA 3QQ4A 3GVVA 4TV6A 1N5AB 4PB3A 3GKWL 1QD0A 3GBNH 2GPZA 2IADB 4UU9B 3DHFA 5HHOA 3F2LA 4Q9RH 3F3HA 4AENA 3TJPA 2FX8H 3GUFA 3O3AB 3LA4A 2XXFA 1DLFL 4KI5F 2QVIA 4REQB 1ZLVK 2CNCA 4AIZA 3ECVA 3PV6A 3AWOA 4BJHA 4TVPE 4JKMA 3BAIA 1IXNA 3JVGC 1IQWL 3C60B 2HLAB 4R96B 4QPEA 3ATZA 3WDQA 4WIQA 2BSEA 4OUUB 4ZZ9A 3KYMB 3LLXA 2Z4QB 1S2EA 3B83A 3PGFH 5TE4H 3SY8A 2BSSA 4BQ2A 4W7UA 3KBWA 3VFTB 5MENA 5JA9A 1T3FA 5DXXA 2MRYA 4QOKB 3WMBA 4WTWA 2VR2A 2F54D 4EXAA 1D5BA 4FNLH 1TR9A 4C1LA 1GQIA 4EPBC 5HSFA 2C9XA 5DVKA 1FAKT 4TOYL 4YDLC 4RLIA 3UTSA 2EABA 4PJGE 4CQAA 1VEOA 3GHUA 5JU6A 1NUDA 1S5NA 3OG4B 4UZUA 1IIIA 4AKQA 2YDRA 4M1RA 2M1KA 1QDSA 4U1MB 2ABAA 4IOSD 3RWGA 2A6JA 3FU3A 5JPNC 3M7WA 1HH6A 3ME3A 1LDPH 4AM0Q 4Q8UA 4BFRA 3OZKA 4RXFA 3W56A 2Q5BA 5A2AA 3VGEA 4I1PA 4JTCA 1MFDL 3VKCA 3L4YA 4IU2B 4NLAA 5E94A 2A1WH 3VVVA 1K03A 2WHKA 1FZOB 4HJJL 4NP4H 4B15A 4J2XA 1H50A 4I6VA 2DZBA 4Z7QF 2FQDA 5IB4A 2FLRT 3KPSD 1TQBB 2CLIA 4JGNA 1K4GA 1JVNA 3RWJA 4L4VA 5LA2A 4A3RA 4BQ4A 1T20B 4HQVA 4G83A 1HL2A 1VF8A 4OKDA 3FSTA 1ND0B 3WD3A 3WH8A 4D1IA 4B2DD 4BINA 4QLKA 3OAZK 4LRNH 1ONXA 2I7OA 3MJMA 1CLCA 1FE8H 4OM0L 5EA0L 2G2PA 5GGTA 5C09D 3HRZC 1VFTA 3ZQWA 2EADA 2FZDA 4UTLA 2IGFH 4W8BA 2Z8RA 4JUTA 4KF1A 4XRCB 3FB7B 3IFPB 4OUUA 1YYLH 3N4AA 5PAZA 1LO4L 2EC9U 3GXNA 3RDTA 2C1OA 1NCDH 3T8XA 5L0QB 3B8VA 1G4EA 3HGOA 7PAZA 5HNTA 4XBGA 4LCWD 3UX9B 1PEZA 3OA5A 3O8XA 5B1JC 3WY2A 5I28A 5M7QA 5A6TC 4E41A 3BICA 3GXIA 3L8QA 3HBLA 2G75B 2Q9OA 3E6FA 4LRNL 3V0VB 3ZLQC 3MRFB 4IIZA 3FAXA 1KYUA 4M29A 4APQA 4NKOA 1E72M 3RXZA 3U8GA 1MHPL 4CGTA 3UO1L 3SCSA 2YGOA 3UP6A 3R1ZA 5AYBA 4LLAA 1T21A 2VL5B 5D7KD 4U4BA 3NDYE 3ZS4A 2HJLA 1EIXA 1PO9A 1GIGH 5EEVA 3WIHA 3ZE0F 1HKMA 2Y5QA 1J1PH 1FUYA 1I4FA 3RWCA 3FCTB 1I3RB 2J21A 3L54A 3QPXH 4BZ1A 3MREB 1LG1A 2CMRL 1SFJA 3PF3A 3LH2H 3QUYA 1MLBB 4PY8J 1QLFB 2F53A 4DN4H 1KTDB 4OT7A 1UJTA 3QWRA 2CZDA 1M7IA 4RV8A 3TCEA 2J6XA 1F6YA 4GKNA 1F9CA 1ML1A 3AQYA 3S8FB 3MMEA 5D7LB 1I85A 5IBTL 2P45B 4AQAB 2ZKHH 1GW9A 5ICZA 2BY3A 4MZ2A 3TQVA 1E6JH 1MHHB 4XMKH 4LWWA 4FI8A 5L9FA 1GZ1A 3C6LA 3QHTC 2J7CA 3FQTA 4IHOA 4XXWC 4ATLA 1IC4H 2QCCA 3LJ3A 1R3RA 5DYFA 1XIWD 3T0XA 5I0ZA 1LD9B 3BGFB 4QR6A 3R94A 3O0FA 1JXJA 1MHCA 1UUSA 4E68A 2YR1A 1SO5A 3VWJD 4BH7A 3KPSA 5AOMA 1U91B 4M00A 3FC8A 5A3HA 1CFQA 2BM3A 1XLAA 2YZRA 1OC6A 2HJKB 1NCDL 3U1QA 5AC6A 1F86A 2VN6A 4YU1A 2VEMA 3ZDYB 5GRWA 4NRYB 3UJJH 1T89C 1VFAB 2QQLH 2XINA 3VXMA 4QTIH 4FFVC 4JCLA 4B6ZA 5C7XL 1KTJA 4MJHA 4AYFA 3HHRB 1ALDA 3W9ZA 2MQGA 5FUOL 3ESPA 3H7LA 1NFDE 4CVUA 1S2AA 4TIMA 1A1NB 1V7NH 4L1SA 2NQZA 1JG9A 3IGHX 2A3TA 3S34L 1A7PH 3O8XD 1KPVA 4NNPH 2Y8KA 5HHNB 2EG6A 4MJMA 2YA0A 3QH3B 1KLZA 3U4FA 1TPXB 3SO3C 1EL3A 1EX0A 3TJLA 5J9PB 1RJRA 1RHFA 4OZFA 3SOBL 2ADYA 3NOYA 4OV9A 4NLHA 6REQA 3O6LH 2NXYB 1W72L 3CVHA 4G6KH 1KTDA 3KPLA 2XGBA 3NFNB 1MFDH 2YJLA 5I2IA 1HZHL 2XVLA 5FACA 4LVFA 1U8HA 2DT0A 2IQAA 4DJDD 4EPKA 2OR7A 1YY9C 4XD5A 3LTVA 4M03A 4RNRA 1S9WA 3NSFA 1HWGB 2YQ3A 2XWEA 3WIAA 5ICYA 2GOKA 3PB0A 3VUPA 4E0CA 1AP2B 1EZVX 4OFVA 3SD5A 1WFUA 1E9PA 4G6JL 4OT1H 3AY2A 1FCUA 3OG2A 3KCPA 4ONGH 2M83A 5DDHB 4FABL 3GVRA 3UY8A 1XCTB 1K7XA 5CBEB 3W1RA 1RA0A 4BCEA 3VFPA 4ABWA 4WO0A 1W37A 4IDJL 1EAOA 1BQLL 1G1OA 3J27A 4U6HA 5C08E 1QBAA 5ES4B 4H0HB 3APDA 3FUKA 1A2YB 2G4GA 3PF2A 1ZJHA 3US9A 2PNDA 4AEHL 2YPLA 3HZYB 2NW3B 1VENA 3SY0B 2WKGA 4NWTL 1FRBA 2YCEA 5JHDA 3I6TA 1NC4A 1OY3B 2FIKA 1OCWL 3UCQA 2PPAA 1XIWA 5CSZA 3S5LB 3MRHB 4XX1G 1LP6A 1W32A 4PSPA 1AJ7L 1FVEB 2DWDB 3II1A 4XC1H 1XIMA 3MCG1 4GYJA 3UABA 1TKWA 2BVEA 3E3QE 2J8UF 1N4XH 2ZONA 3IM1A 3SN0A 5C9UA 1I75A 4X6CF 5C07A 1VFBA 4MCZA 3VCLA 3IRSA 1CXLA 1QTPA 4H26B 5B3SB 3PUEA 4OD1H 5HYJB 3IJLA 4ZQKA 5I8EB 2VD9A 1AZNA 4YMPA 4HA1A 4QRNA 4CCDA 4IJTA 4HCRA 4JFFE 2FX9H 3IGXA 3MV9E 3IMTA 1PG7W 3UGUA 3H4XA