1ECEA

Acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
358
structure length
358
Chain Sequence
AGGGYWHTSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLPYSDDILKPGTMPNSINFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSGQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDSGDTGGILKDDWQTVDTVKDGYLAPIKSSIFDPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyl hydrolase
molecule keywords ENDOCELLULASE E1
publication title Crystal structure of thermostable family 5 endocellulase E1 from Acidothermus cellulolyticus in complex with cellotetraose.
pubmed doi rcsb
source organism Acidothermus cellulolyticus
total genus 136
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1996-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eceA00
3T2PA 1GOQA 1E0XA 4ATWA 3CHDA 1W9DM 3PTKA 1CGYA 4P8XA 4P7LA 1XC6A 4MDOA 3II1A 3GH4A 2XM2A 3ARZA 4W88A 2XUCA 3EDEA 3GM8A 1M53A 4JHOA 1M7XA 3T2QA 3AIVA 3GDBA 1Q6GA 2J7BA 1E55A 3FNDA 3BSGA 1GJWA 2E9MA 1UWSA 4F79A 1ISXA 1R85A 3TTOA 1V0KA 2J77A 2J78A 3AXHA 3GTNA 1RP8A 3RDKA 1BG9A 3BAIA 2X8RA 2ZXDA 1ZJAA 3ALGA 4LYRA 1G01A 4U33A 4UFLA 2XVLA 5F7UA 4FK9A 4PMYA 4MB3A 4J3XA 2ZXQA 1HJVA 3UG5A 1NP0A 3AMDA 1PEZA 3VIIA 5LA0A 1GUVA 5BWFA 1R87A 4FLRA 2J8GA 3AS0A 2D0FA 5M03A 3CZKA 4CD7A 2WK2A 3DECA 1CGWA 2JE8A 2BY3A 1WZKA 5A6BD 3VGEA 5HPOA 1BF2A 3M46A 1GVIA 4Y7EA 3AXIA 2J7GA 1Q6EA 4NRSA 4D6IA 3BAYA 4GZEA 2ZUTA 1NOFA 3BAXA 1J12A 3WQ8A 4HP5A 5I79A 2VURA 1C7SA 3CUFA 4UQDA 1VFFA 1QNPA 1UKQA 2XJ7A 2WKGA 2Y24A 3VIFA 4UZUA 3OA5A 5E6ZA 4JKKA 3CHCA 1BG4A 1W1VA 2D1ZA 4PUEA 4AZCA 1EDTA 3KZSA 1UKOA 3CHFA 1OGSA 2J8FA 2WHMA 3SCWA 5GNZA 3VIOA 2YL5A 2CITA 4A3HA 5ABFA 1VIWA 1R86A 3F5KA 3AZTA 2OSXA 1D2KA 1J0JA 1UD4A 3IJ7A 4W8AA 1WKYA 4Z2KA 2BVDA 5I77A 1V0NA 1V6WA 4CU7A 5BRQA 3ZT7A 3PZUA 3MSGA 4E4PA 5AYIA 1CLVA 1JZ7A 1ECEA 2GSJA 2W91A 1KBBA 2FGLA 3SUTA 4JKMA 2BFGA 4XB3A 1J0IA 3VPLA 2Z1KA 1MW0A 2DT2A 4E8DA 4MNLA 1HP5A 1JF6A 2BXZA 2E40A 3SURA 5A6JA 4GPNA 2E3ZA 2J7EA 4LX4A 2WVSA 4FLSA 1NM9A 3T08A 1W2VA 1LL4A 1UR1A 3DHPA 1E6ZA 2XVKA 2VT0A 4Z2JA 1GOWA 1H49A 3A47A 1W2PA 1G5AA 1U30A 4JAWA 1AQ0A 5M17A 1W3KA 1JNDA 1JYXA 2VZSA 1QHZA 1UD5A 2GJXB 3WD3A 3WL0A 3LMYA 4BQ4A 3N11A 4UOJA 2XYLA 1D3CA 1UZ4A 3AS1A 1ISVA 3VINA 2Y8KA 2VL4A 1JGIA 4B9YA 4GXPA 4MADA 1FFRA 1XH2A 2W61A 1JZ5A 1Q4NX 1PBGA 1HVXA 3AHXA 4JHZA 3WELA 1CPUA 3SCQA 3WDIA 2PI6A 1VB9A 2XWEA 3WBAA 2E9BA 5AY7A 3SIMA 4AZHA 1HVQA 4AZ7A 1QNRA 2WC3A 1GW1A 3ALFA 3U7VA 1DTUA 3CZ8A 3WEMA 1TA3A 5HNNA 1RP9A 3W81A 3BC9A 3K8MA 3AXXA 4HPHA 2RGLA 1E4LA 2DT0A 1PZ3A 2ZX8A 1CLXA 2OSYA 1JI1A 3VILA 3NYDA 4KRTA 3I3BA 1PX8A 4KGLA 2EPMX 3VD4A 1EA9C 1HKKA 1UUQA 1V3LA 3IANA 3KL3A 5EBAA 4AY1A 5C70A 1E56A 1K6AA 4CCEA 5A2AA 1TVNA 1E0WA 4AD5A 1XSKA 2VO5A 3VX0A 4PMNA 4UFKA 5BYWA 1ODUA 2VOTA 3VMOA 2XGIA 3GXDA 5A6KA 1J0KA 3WNPA 4A3YA 2VI0A 1V08A 1U33A 2BS9A 1J11A 3FXYA 4F9DA 5DF0A 5E70A 3WFZA 5BXTA 5BRPA 3WH9A 5DFAA 1Y7VA 2DSVA 5D9OA 2G41A 4WLCA 4WSKA 1W3HA 3CIVA 4CVWA 1XYFA 1EOMA 1WO2A 4WKHA 3A3HA 4H04A 1KCKA 3AFBA 3MUIA 2ZWZA 3PZGA 4K68A 3CHEA 3WUEA 1KB3A 1EHAA 4H8UA 4AYSA 2A3EA 3ZMRA 3GYCA 2ZXBA 2BY2A 3FY1A 3VTRA 2GDUA 2YOCA 1UWIA 1BSIA 5FKYA 1LL7A 2CBVA 1GOOA 3WUGA 3LPPA 3N1AA 4W93A 1TCMA 4URIA 7A3HA 4CVUA 2OSWA 4TTUA 1VFOA 2WVVA 4KH2A 3EDDA 2QMJA 3LPGA 4KMQA 4UFHA 4C7DA 1E9LA 4PCSA 4C7FA 5A95A 1PX4A 1E6PA 4HA3A 2VQUA 4W84A 4OZOA 1HJXA 2ZE0A 4W8LA 4W87A 1AQMA 3AJ7A 4BQ5A 2CHOA 4TX8A 3CPUA 4RE4A 3AOFA 4B16A 3BCDA 4FLQA 1JL8A 4HOWA 4Q22A 5I3DA 5A8NA 1E43A 4DWSC 1WE5A 1PX3A 3AYRA 4B3KA 2G3NA 3QGVA 3SUWA 3AYSA 1V6YA 2XSAA 3J7HA 1QVBA 1V3HA 1OINA 1WZAA 3SCVA 3WH5A 4DWSD 3MUAA 3TONA 4AW7A 4DUXA 3CUIA 3AHVA 5E9AA 3WEZA 2D20A 3L2LA 5I24A 2EPOA 3L4XA 3WF3A 3ZJ6A 2WAGA 3MUZ1 4AISA 1FH9A 1W9UA 4IISA 2JIWA 7TAAA 1B3XA 2YLLA 1E70M 3VKKA 3AMLA 1UWUA 3VNYA 1J10A 3ARTA 1ZU8A 3GXFA 1QOXA 5ABGA 4J3WA 4LPCA 4ATLA 1OGGA 1CDGA 3BLPX 5I5RA 1HNYA 3WQWA 5AC5A 3ZSSA 2X05A 2D0GA 4MB4A 1KXQA 2GJPA 3WMSA 2VQTA 1W3JA 1GHSA 3B9EA 1CBGA 3SCSA 1UH4A 3NIYA 2FH8A 1C8YA 4J27A 5FIPA 1UD3A 4FF5A 2WWCA 4HPGA 4UCFA 2X09A 3WENA 4GZJA 4ACYA 3ARSA 1V0LA 3K46A 4D6EA 4B15A 5D4YA 1H0IA 3AQUA 1HKJA 3OZPA 1UR4A 4PUDA 1US2A 5EMYA 1DWHM 1OCQA 1C91A 2DPEA 4JKLA 2WANA 1DP0A 1PIFA 2D3LA 4GIAA 5CLTA 1ZBWA 4WF7A 1UH2A 3WD2A 3N12A 2FH6A 2X2YA 3OGVA 4AZCB 2WW5A 3IAPA 1B2YA 1GHRA 3F5JA 1OWQA 1E1EA 4CGTA 3RM9A 5CSUA 3OB8A 5ABFB 4DUWA 3ARUA 2G3MA 1CZ1A 3WDRA 1QBAA 3G6LA 2OWWA 2Q8XA 2UY2A 4U2ZA 4GI8A 1QI0A 5CLWA 1JYWA 5HOSA 3WNOA 3BLKA 4BS0A 5D8ZA 2JEQA 2VCAA 4RE3A 2J74A 3MO4A 3ARYA 4ZE4A 3THDA 1JI2A 4MDPA 2MANA 1E3ZA 1CGVA 2PWFA 4IPNB 4UFIA 1QW9A 1FP8A 5CXPA 2V3DA 4D6CA 2ZICA 1UG6A 4PTXA 3SEPA 3RILA 3CMGA 4ZFMA 2ZIDA 1GORA 5IHSA 5JBFA 3VIJA 4HU0A 4KGJA 2XVNA 1VENA 3W6MA 1GONA 1H41A 1CXHA 2QHAA 3RPMA 1BGAA 4YN5A 3EMCA 1E40A 2VZVA 1KQYA 1ZB5A 3OLGA 1HJQA 1GQJA 3W4RA 3HN3A 2VZUA 3N15A 3W25A 1KR0A 4EANA 3PZTA 5C8BB 1HJWA 1W1PA 5C71A 4AZ5A 1GVYA 1JNEA 1ZS2A 2G3JA 3W28A 4Z2LA 2VRJA 3RIKA 3BAWA 1QHOA 1R8LA 4JL1A 7CGTA 3CBWA 1OBAA 1R7OA 4ML4A 2ESCA 1B30A 1WAWA 2YA2A 5CGMA 3GXIA 4B9ZA 4HA4A 1UQYA 4J3TA 4CD5A 3QOKA 5BXSA 1HIZA 3DC0A 1TA3B 1XV8A 2DT3A 4NZCA 1ZL1A 2E0PA 2RGMA 2CERA 1HKMA 1KXHA 3VGGA 2CHNA 4WK9A 1UH3A 3ZSTA 2ZUMA 1K9FA 3VMNA 4Z2GA 1HL8A 3ZJ7A 1VEPA 1W1TA 1FHDA 3EDKA 4GZIA 2PWHA 1GOMA 2VVSA 2EJ1A 4TVCA 1WZLA 2BVYA 4CD8A 5DMYA 3M07A 1AMYA 4E2OA 1HL9A 1RPKA 2VX5A 1VF8A 3SCTA 4L4OA 2D2OA 1BLIA 1JZ6A 4M29A 1DWJM 1HJSA 1X1NA 3WF2A 3ARQA 1FOBA 3CUGA 1FFQA 3MS8A 2WZHA 4XX6A 3WMBA 3ZO9A 5GNYA 3VIKA 2VX6A 3EDJA 4EE9A 1FP9A 2YDSA 4ATDA 3ZJKA 1UWQA 5DEZA 3WKZA 3WF1A 1WDSA 2QF8A 4JCMA 4HMEA 4W8BA 1I1WA 3NSXA 3QOMA 1JD7A 1UKTA 4XUYA 1TG7A 1Z32X 2VCCA 3B9DA 4BZYA 2DT1A 2WNWA 3AIBA 1OT1A 3UG3A 1LQ0A 3OZOA 3VDAA 2D23A 2F61A 3M6DA 2OYKA 2OYMA 4IUGA 1EDQA 3RM4A 4AMCA 3W0KA 1JZ8A 3CO4A 3BAJA 3VDCA 2X1IA 2G3IA 5M3WA 3BXWA 3VU2A 3VDBA 1XD0A 4DWSA 1NP2A 2CCRA 2O9RA 4EKJA 1E4NA 2WVVB 3AIWA 4QDMA 1MW3A 2ZXAA 3L4WA 3GNOA 2BY1A 3SCPA 3K4AA 3WN6A 1E3XA 3NSMA 1B90A 1CXLA 4J3SA 3KL0A 1EO5A 4HOZA 3ZR5A 1HT6A 3B8SA 4JZ5A 2VTFA 3W38A 4A4AA 2FHFA 2W62A 2CBIA 4M8UA 4CN1A 1E4IA 2PC8A 3K4DA 3WEOA 2G4FA 3AS2A 1BPLB 1K9DA 1C8QA 4R5EA 1V3KA 3PHAA 4W7UA 1FHLA 1GCYA 3VGBA 3O6AA 1M03A 1SMAA 1V6XA 4U3AA 1GQLA 1OM0A 1DEDA 2JIEA 3VM5A 2XSBA 2VZTA 1DWGM 1GJUA 4UNIA 1MFUA 1CTNA 1CYGA 3A4AA 1ODZA 1QNSA 4NI3A 2XFYA 4MNMA 3SCOA 1KFWA 1V02E 5CG0A 1ISZA 3NJ3A 4IPLA 1W9VA 2VX4A 3W37A 1CNVA 1LWJA 1WP6A 2Y5EA 5FOOA 1JZ4A 1MWOA 1UR2A 3AMKA 5CZKA 1HN1A 4QCEA 1XRVA 3PZVA 2WCGA 3TTSA 5I6SA 3SCUA 1C93A 1V3MA 4AEFA 1Q6DA 4UFJA 1ZBVA 3ZM8A 2JEPA 1JDAA 4AIUA 3DYOA 5EFDA 2X0YA 1EH9A 4WSJA 2VNCA 3NCOA 1G1YA 2F2HA 2YDRA 2BVTA 4Z2IA 4GINA 3F5LA 3PZMA 4W5ZA 3BH4A 1BHGA 5DT5A 1KWGA 3EYPA 1P6WA 1JF5A 3OGRA 2DIJA 1HKIA 5HDRA 3ECQA 1XCXA 2VR4A 2CKSA 3RCNA 2JF7A 1BYAA 1NWSA 1I1XA 1SFSA 2UWFA 3ARRA 3T0AA 2YIHA 2W63A 2WPGA 2DH2A 2E8YA 2YBTA 4JIEA 3S2CA 1N82A 3NUKA 2A3AA 1JIBA 1E1FA 4QLLA 4CU8A 3AZRA 3EMQA 4S3JA 4W86A 1L0PA 1OB0A 2CBUA 3L4TA 4Z2HA 3ARPA 2ZX6A 5DT7A 4V2XA 4AZ6A 3W6LA 2W66A 4QCFA 1C3FA 3WUFA 2YJQA 2ZX9A 5I23A 2A3CA 3RMEA 1KGWA 2O9TA 1VRXA 4HMDA 4P8VA 3BCFA 3AHZA 4YPJA 5A8QA 3VDHA 4AEEA 3K1DA 1JFXA 2EPKX 2CETA 3MMDA 4X9YA 1A3HA 4LGXA 2EBNA 4S3KA 3MSDA 4YHGA 4F8XA 3VGHA 1A47A 3POCA 1JYVA 1CGXA 2XFRA 3UR7A 3ZQ9A 3L4VA 2AMGA 2TAAA 1GPFA 1MFVA 4UQEA 3EBVA 1SYTA 1XHGA 3KE0A 1NOUA 4LQ1A 4P7NA 4PMDA 4CKQA 3N9KA 4AD4A 5JIPA 2XFFA 3W26A 2UY3A 2J7CA 2DSKA 3GBEA 4MJ2A 1NWTA 1LJYA 1OIFA 4PMUA 4UQAA 3GNRA 3AROA 5JBDA 1E6NA 2D0HA 4U3CA 2HISA 1WDRA 5IDIA 3U7BA 2XPKA 2VR5A 2BHYA 5CPTA 2WMIA 5GQBA 3CH9A 3PZNA 3VMPA 3WBEA 2WC7A 4W5UA 5GNXA 1WB0A 1W9BM 3KWXA 4PMZA 1JG9A 3I3EA 4OUEA 3WF4A 1HF6A 5AC4A 4QLJA 4AWEA 2W5FA 1BYDA 3ARXA 3FW6A 5A69A 1MXGA 3WSUA 5A6BA 2AAAA 1ISYA 4QFUA 5IFPA 4D1JA 3FHAA 3BSHA 3RO8A 3VOCA 4PEEA 2WC4A 4W89A 3SUUA 1E5NA 1V3IA 2EO7A 3VUPA 1JFHA 1BYBA 1LLOA 1UR8A 2WWDA 5A1AA 2YKKA 5A8MA 2ZUSA 4MAZA 3OIHA 3WQ5A 3E1F1 5A94A 1ESWA 5I0DA 1QI3A 4DUVA 1UZ1A 4PMVA 1Q6FA 1B3WA 1BVZA 1B3YA 3A6OA 2Y8VA 4OBSA 2J75A 3IAQA 4E8CA 4FMVA 4EAMA 4JFSA 2J25A 4KRUA 8CGTA 1WCGA 4OIFA 2XG9A 3AHTA 2GFTA 4QAWA 4B3LA 4F9JA 3OLIA 4UOZA 1NARA 1M01A 4AZBA 1M04A 3N04A 2GVYA 4GKLA 3APGA 3AMCA 2ZUVA 3UERA 2W67A 2OYLA 2DQXA 4JFWA 3PBGA 2D3NA 3BAKA 4J28A 4OKDA 3ZIZA 2DEPA 4N42A 3WY1A 2WYSA 5I78A 5GPRA 3UCQA 2FDMA 4BQ2A 1MQQA 4TXEA 2D24A 2CKRA 1CXFA 1KCLA 5D9NA 3MKKA 2EPNA 2ZWYA 4ZXOA 5TD4A 1UWTA 4DWSB 2JF6A 4BCEA 3AIUA 2CEQA 4HA1A 1D7FA 4HOXA 4TVDA 4CU6A 5E0CA 4XZBA 1YQ2A 3QHNA 2VUYA 1US3A 1OT2A 1OGBA 3WQVA 4CN6A 1CWYA 2OWXA 2J7FA 3CMJA 1O7AA 3AIRA 4QLKA 1CGUA 1KGXA 2E4TA 1H3GA 1LWHA 3CLWA 1CGTA 2OLHA 4CD6A 1UOKA 1G9HA 2YA1A 1EXPA 3GBDA 3W82A 1ISWA 4P7RA 1FH7A 2QPUA 3TA9A 2CYGA 1X6NA 3FN9A 2NSXA 4U31A 1KR1A 3L2MA 3NDZA 3SUSA 4LXFA 4PSPA 4WKAA 4Q7NA 2GK1A 2IUZA 1JYNA 3TP4A 1C90A 2J62A 2G8ZA 3MV11 4HMCA 4V27A 3T2OA 4PMOA 2YL6A 1E6XM 2IXVA 3GZAA 2V5DA 4CUCA 1R7AA 1SMDA 1UD6A 2YBUA 4GO8A 4D1IA 4AZIA 2JFEX 2V3FA 2PWGA 1EDGA 3GH7A 1J9YA 3WNNA 1BTCA 4XZWA 9CGTA 1V0MA 2JALA 2BHZA 4MB1A 1E72M 2WHLA 2F8QA 5IFTA 1DHKA 1J01A 1VFMA 1E5JA 2VJXA 5DO8A 3VGFA 5IHRA 3CZJA 3FAWA 2ZX5A 4AIEA 1PJ9A 4R27A 4MNKA 1MW2A 2WSKA 5CPSA 1UQZA 3DYMA 3CZEA 4OOUA 1HP4A 1JZ3A 3N18A 1F4HA 3VIMA 2YLAA 1QBBA 2Z1SA 3W29A 5A2BA 1H4PA 4V28A 4AC1X 1UHVA 3A4WA 2J7HA 1GOIA 2V5CA 3DHUA 3W24A 2YA0A 4J3UA 1MYRA 4ACZA 3BMVA 3VNZA 3D5HA 1VJSA 1JD9A 1TR1A 3CTTA 1WNOA 4H8HA 1WZMA 2E8ZA 2WVUA 4M1RA 2WBKA 3SCRA 4EK7A 4P8WA 2O9OA 1FH8A 1U2YA 2YL9A 1RD6A 1UWRA 3VO0A 1C8XA 1GOKA 4J3VA 3PN8A 3KEHA 5CSYA 1JDDA 1J0HA 1TZ7A 4WKFA 2XGBA 1CECA 3DYPA 1S46A 2QLYA 5CPQA 3WH8A 5HXMA 2D22A 3IK2A 4TVUA 1E73M 2WMKA 3EDFA 2NW0A 2BHUA 3T0DA 3WNMA 1MVYA 2PBOA 4GI9A 2EQDA 2BNJA 3WD4A 5AYBA 2ZX7A 4CCDA 3QHMA 1HX0A 3WD0A 1V3JA 1H2JA 3SCNA 1PIGA 1AVAA 2ZOXA 5D8WA 4AXNA 2WB5A 1OIMA 3RJYA 3WUBA 1NOWA 3ARWA 5BXRA 2NT0A 3CZLA 1KXVA 4W85A 2VZOA 2CESA 5ABEA 4MJ4A 3WNLA 3WH6A 5ECUA 1BYCA 1BAGA 4JL2A 1BGGA 4UR9A 3W27A 3HU7A 1PAMA 3UESA 4PCTA 4FLOA 2J7DA 3CUJA 1E15A 3OBAA 4OJYA 5LYRA 4LYQA 3VM7A 1RH9A 1W91A 3WIJA 1L8NA 3G6MA 5BROA 2UY5A 1E0VA 1JXJA 4U5KA 1W3LA 2EEXA 4PMQA 4MAVA 1LG2A 4D6HA 2WBGA 1UA3A 3ZT6A 3POHA 1MQRA 4CCCA 1GQKA 2CNCA 1X6LA 2VC9A 4AD2A 3W53A 3ZOAA 3HJEA 2EXOA 3GXMA 3I3DA 1TMQA 1KBKA 2XHYA 2WMIB 1F4AA 5EB8A 4JFTA 2XIIA 4M80A 3QR3A 4QP0A 3THCA 3FHQA 2CPUA 1BVNP 4PYSA 2WCSA 5A6AA 1TVPA 4DM1A 3LPOA 2WLYA 1NQ6A 1WDQA 2VVNA 3WDJA 2EPLX 3BMWA 1V02A 3WFLA 2O9PA 2VCBA 4OOZA 4PMXA 1JZ2A 1B1YA 3VD3A 1IV8A 5A6SA 5D9MA 1VEOA 2YDQA 4ZENA 1UR0A 2QPSA 3WDHA 2VRQA 1XH1A 4ZXLA 1C92A 3PTMA 4MTVA 3CZGA 2V3GA 5FCZA 4M24A 1B31A 1IZKA 5BCAA 1G94A 3VGDA 4D71A 1XSJA 1H11A 2XM1A 4CN4A 3L4YA 5LA2A 5E0FA 1LL6A 1W1YA 1UKPA 2BXYA 3OLEA 2J47A 2PB1A 3SUVA 1C7TA 1H5VA 3JUGA 1W9XA 3F4VA 1EQCA 3UG4A 5CGTA 2E9LA 1PZ2A 1VEMA 2PBGA 3RJXA 1QW8A 2PF0A 3CGTA 4TOQA 1AQHA 2J4GA 3TTQA 1XCWA 4UTFA 3A4XA 5M5DA 5KEZA 1UD2A 4ZEPA 3L4ZA 3WNKA 1JAEA 1QNOA 3U5YA 4KWUA 5FD0A 1UA7A 2DSUA 5IXEA 1V6UA 3UETA 4CD4A 1JDCA 3FAXA 3OG2A 1CXIA 4H8VA 3BGAA 4TTGA 5JBEA 3T0BA 1WDPA 2WMJA 1CEOA 4PRWA 4NRRA 1ZBKA 4GO9A 2W4XA 4PTWA 2ZUWA 5ABHA 4GQRA 4L4PA 2WZEA 3EMZA 2GDVA 1WPCA 2WMFA 4OBRA 1QI5A 5HPCA 1G0CA 4RE2A 4D6DA 1GQIA 2FHCA 3WQ6A 4D6FA 1BFNA 4ZE5A 2CIPA 5A8OA 3K8KA 5A6MA 1CXKA 4P8UA 1H1NA 1JAKA 4LYPA 4AIOA 3VD7A 1EHNA 3S6TA 4JFVA 2FGZA 1NWRA 2GK1B 1CXEA 4HZ6A 4PMRA 1UYQA 3B9AA 2DIEA 2O92A 3TOPA 3WQ4A 1V03A 2WCAA 2DDXA 1PPIA 3AICA 3WD1A 4X0NA 3MUY1 4PTVA 2WM0A 2XWDA 3MMWA 4F66A 4W7WA 4HU8A 1VJZA 4AD3A 2WLZA 5CQ1A 5A2CA 3K8LA 4MPKA 2WSPA 1FA2A 3GH5A 1ITCA 2WKLA 1UKSA 2HVMA 4MB5A 1XGZA 5FL0A 4M81A 4NSBA 4UQBA 1HXJA 2XVPA 2C0HA 3IJ8A 1IT0A 2ZUNA 3KL5A 1LG1A 1XH0A 3WL1A 2V3EA 3TTYA 1B0IA 3AZSA 1TUXA 2QMKA 1LF1A 5E6YA 2BY0A 4D72A 1J0YA 1I75A 4H7VA 4AD0A 2NT1A 3WF0A 1ITXA 1EGZA 4C7GA 1YHTA 4P7OA 2WZIA 4ACZB 3O2LA 3MV01 4IM4A 2DH3A 1QI2A 2WMHA 1V6VA 2GJXA 1VFUA 3CUHA 3U5UA 1MW1A 1H09A 3RM8A 3MMUA 1NWUA 5FL1A 1KQZA 4X0VA 1B3ZA 2GUYA 4UZSA 4P7QA 1GZJA 2WHKA 2VX7A 1O6IA 6TAAA 1MQPA 1B9ZA 3WMCA 3GNPA 2CBJA 1VBRA 3T09A 2A3HA 4HZ7A 2CXGA 1CENA 1DWFM 3N17A 5BXPA 1KWKA 1UR9A 3MU7A 1KXTA 3AS3A 5JUVA 2VMFA 2XTKA 1E71M 1TFVA 3PTQA 1VAHA 2IXUA 1EQPA 1DWAM 3VIGA 3VIHA 5I2UA 1SR0A 3AHYA 3VD9A 3AMGA 1E6QM 4H2CA 5JIWA 2C8NA 4RL3A 1BQCA 4H41A 1K9TA 3NDYA 1JXKA 4NF7A 4TX6A 2ZUUA 4XV0A 3UEQA 5D9PA 4WJXA 3WDQA 4J7RA 2PWEA 2J79A 1W32A 4JFUA 4N0RA 3WDPP 5A8PA 2QV4A 1UD8A 3MANA 3NSNA 3VIPA 3D3AA 1KGUA 5KZ6A 4UFMA 1QNQA 2DSWA 2V38A 3LPFA 3VX1A 3OGSA 4PN2A 1E6SM 1VBUA 2YL8A 4BQ3A 4JCLA 4PSRA 3PZIA 3PZ9A 1EO7A 4D6JA 3VVGA 2BV9A 4HZ8A 2WMGA 3M7SA 2PWDA 1J0ZA 2C7FA 3PZOA 1H0GA 3QHOA 4U5IA 1DWIM 5E09A 2OWCA 1B3VA 2UY4A 2X0HA 2WXDM 4MNJA 3OLDA 2WHJA 1ZBCA 3AI0A 1K9EA 1GNXA 4WIWA 1W9PA 6CGTA 1QHPA 4PBGA 4M82A 2AOSA 1EOKA 1TE1A 4GI6A 1IZJA 1Q6CA 4HTYA 3HMCA 3AIQA 3ZJ8A 5HBFA 1EIBA 3N13A 4BF7A 4YHEA 4U2YA 2XVGA 3AISA 4D6GA 5A3HA 2A3BA 3AIEA 2B31A 1HJUA 1OD0A 3O9NA 2GJRA 4PTMA 5LA1A 3WH7A 2FHBA 1QI4A 2Y4SA 2VRKA 4AD1A 3IJ9A 4TUFA 6A3HA 2XIBA 4UOQA 1OSEA 4AZGA 5EFFA 2DGAA 1QPKA 8A3HA 5A6LA 2Y2WA 1E6RA 4UQCA 3ARVA 1XSIA 4BA0A 3U57A 2W92A 3UR8A 1OD8A 2DSZA 1XYZA 4UQ9A 4M56A 4W7VA 3ZR6A 3PZQA 1NH6A 1J18A 5CJ5A 1MXDA 2WVTA 3L4UA 3ZT5A 1XD1A 4GQQA 1E4MM 4DM2A 1ZJBA 3VD5A 1CIUA
chains in the Genus database with same CATH superfamily
4Q6XA 2FTPA 4ATWA 1F5ZA 3CK5A 1VCGA 1CGYA 3MYPA 3II1A 1MSSA 1REQA 3GM8A 3W88A 4JHOA 5CZTA 3AIVA 4IIBA 2ATMA 4N7QA 3GDBA 3TWAA 2O55A 1GJWA 2VGIA 4F79A 1R85A 2J78A 3RDKA 3BAIA 4KWWA 2WNNA 1YNYA 2Z2UA 1G01A 4U33A 3BG3A 4O52A 4PMYA 4TIMA 3SSZA 4MB3A 4J3XA 1Q8JA 1YLVA 4I5UA 5LA0A 5DMNA 1UP0A 4FLRA 3RN6A 2B7PA 2D0FA 2DVTA 5M03A 4CD7A 2WK2A 3JW7A 3DECA 2BY3A 3EPOA 5A6BD 2AGKA 3VGEA 3UJRA 1LBMA 3GVVA 1TZZA 2PCEA 1L6FA 1ZAIA 2FDSA 4EVZA 2ZC1A 1VH7A 4ADUA 3BAYA 4GZEA 1OK6A 3LS9A 4FXRA 3KS6A 2AAMA 1VFFA 4WUIA 3TN5A 1IF2A 2QV5A 4Q32A 2WKGA 3VIFA 5E6ZA 3MBFA 5EMJA 1U5VA 1LOSA 3S3GA 6ENLA 1BG4A 5F1VA 4AZCA 3PUEA 1W5OA 3DESA 3LK6A 5HNTA 3QEZA 1Q2SA 2YYUA 1EGMA 2XZ9A 4GUFA 5HUPA 1R86A 4IFOA 1O5RA 2QKFA 1GVRA 1E9ZB 4W8AA 4Z2KA 3WLNA 4O4VA 1A5MC 1NF7A 4L4LA 3PS7A 3IRDA 2NXIA 1EJ7L 2R1NA 4E4PA 5AYIA 1ECEA 1HUVA 2W9MA 1LROA 1KBBA 1P0NA 5GVJA 1E0UA 3SUTA 3RUBL 4N9EA 1OQFA 2FFIA 3BICA 4XB3A 4KWSA 2ZZ2A 4E8DA 4MNLA 5A6JA 3E6EA 5F4XA 4FLSA 3NR0A 1E6ZA 2V0TA 4HT3A 1XQKA 3MY9A 2XIOA 3RX3A 2I7GA 2GOKA 2PRMA 4H7CA 1PDYA 3M0VA 4HK7A 3RCMA 1SSDA 4F3HA 1QHZA 1UD5A 2GJXB 3WL0A 1EPXA 1TPDA 1OF6A 3N11A 4HU4A 4WDUA 1UZ4A 3AS1A 5REQB 4IP7A 3FIGA 4IQEA 2W61A 1OYAA 2QCEA 4FSAA 1VB9A 3WBAA 1QU4A 5AY7A 2V6AA 2A1YA 1DIOA 4Q4PA 1GW1A 2VDIA 3ALFA 3MVIA 3GWQA 2QUTA 3WEMA 4LVDA 1TA3A 1K4GA 4C65A 3SN4A 3VKCA 5GJNA 3IUHA 2EJAA 4HPHA 2HE5A 1EXBA 3NDOA 2ZX8A 3L0NA 4JTIA 1CLXA 5BOFA 4FIRA 2YCIX 4KRTA 1XIEA 1PX8A 2EPMX 1CT5A 2P76A 1HKKA 3V4BA 1UUQA 3IANA 2XSXA 5C70A 1E56A 1QUMA 3UA4A 4Q7BA 3V16A 3T55A 3GDRA 5FJPA 4MY8A 4AD5A 3MHGA 4POCA 3UXAA 3MJYA 4PMNA 2CLFA 1ODUA 2VOTA 3VMOA 3ABZA 2XGIA 1A4MA 4MYAA 2BXVA 3B8TA 2VI0A 4FO4A 3MUXA 3H2AA 5F2MA 2BS9A 4HSHA 1H50A 2GWNA 4F9DA 1EGVA 1XDJA 3W7CA 3WH9A 2DSVA 4WSKA 4LRTA 3BG9A 4Q4KA 1YDYA 3AFBA 1HO4A 3FJLA 3HB9A 2H6RA 2HCVA 3R0DA 1EHAA 1R46A 4DBUA 3G1SA 3NO5A 3NQ2A 2A3EA 4XQ6A 1MRQA 2BY2A 3FY1A 1AJ2A 1OC7A 1LL7A 1FKWA 2E6AA 3N1AA 4QG8A 5DMLA 3PVFA 3WG6A 3EKGA 4CVUA 2OSWA 1VFOA 2WVVA 3EDDA 4KMQA 1LLWA 1JRBA 4C7DA 2X1RA 4ICCX 5CC3A 3QSRA 1G7UA 1SFTA 1DQXA 4IPIA 3AJ7A 4GQ0A 1PHWA 4I3GA 1RY8A 5K4ZA 3CPUA 4IOTA 4A3UA 2HBXA 1HGWA 4FLQA 4HHMA 2P1FA 4GGBA 5HINA 2GL5A 4YCOA 4R7OA 4ASTA 1IEIA 3H53A 1E43A 1PX3A 1H7PA 1PL9A 3AYSA 1V6YA 2XSAA 1QVBA 4CQBA 1WBHA 1OINA 1EJVC 3FXGA 4ZR8A 1SJCA 2VD8A 4DUXA 3KDOA 1OYBA 4LNCA 2Z26A 5E9AA 3WEZA 3EOSA 3ZJ6A 3L4XA 2RKXA 3G1VA 1YPXA 1W9UA 4IISA 2JIWA 1PS9A 1REQB 1XLMA 4MKVA 1L6WA 1R0MA 2PTDA 1NJJA 3HIJA 3KHJA 3B05A 3ARTA 4PFMA 3GXFA 4S1FA 3WQWA 3DOPA 1YDOA 5AC5A 2X05A 2ZRXA 3K30A 1F6YA 3BANA 3S1XA 1H62A 1IEVA 3GNDA 4PUNA 2NQ9A 1TTQA 3LQGA 3I6EA 5RUBA 1MRAA 2HJPA 2VEIA 5TF0A 1CBGA 4UTWC 1UH4A 1U83A 3EOOA 1VCFA 1C8YA 2NWSA 3C3UA 3KRUA 1HO1A 2WWCA 4A29A 4UCFA 4ORMA 4ZCWA 4LBSA 3W2MA 3TN3A 3ARSA 1QCWA 4H3DA 4D6EA 3OZMA 4DQWA 1ALDA 1HKJA 1H1ZA 3KWSA 1DJHA 3GKAA 3CV1A 4GMEA 3G1FA 2DPEA 2WJFA 3SB0A 2XH0A 4GIAA 1ZBWA 4B4HA 3N12A 4HU3A 1U1HA 3CM4A 3GX9A 2X2YA 4AZCB 2WW5A 3GFXA 4HHHA 3R25A 1OWQA 1VFSA 3WLSA 4JS3A 4CGTA 1CZ1A 1QBAA 3G6LA 4U2ZA 4GI8A 1GVQA 4BS0A 3ANUA 3VFCA 2JEQA 4HMNA 3S1WA 1A3WA 4ICMA 2J74A 4ZE4A 1JI2A 4A2SA 1E3ZA 2VEKA 4NNBA 3W1PA 2PWFA 4H2HA 2IPFA 4UFIA 4JN8A 5M2FX 1K4HA 1QW9A 2R91A 1FP8A 2V3DA 3BJSA 1JVNA 3TJLA 1T0OA 4DJED 4PTXA 3SEPA 1K6WA 3PPFA 5AHLA 2ZIDA 3RG6A 3C61A 4HU0A 4A8IA 5FF3A 3NA8A 1H41A 3E49A 1BGAA 5A8GA 3RPMA 4ROQA 3W7DA 2PPGA 3GDMA 1E40A 3U3HA 3W2NA 3W4RA 4DI9A 4A2RA 5DX7A 3N15A 2DZBA 3QR1A 1W1PA 2W6RA 2PDJA 3W74A 2VC6A 4Z2LA 2VRJA 3T40A 1OCJA 4EXBA 1R8LA 1A49A 7CGTA 3CBWA 1DYSA 2BBFA 3LGEA 1R7OA 3PBMA 4LT9A 4FEZA 3MHUA 5CGMA 1DE6A 4B9ZA 3KLKA 4HA4A 4HVXA 3PSWA 3R13A 4J3TA 5BXSA 3ITVA 1SO4A 2OMAA 2PRHA 1AK5A 3ELFA 1TA3B 1XV8A 4NZFA 1ZL1A 4LEFA 2OO0A 3BV4A 2CERA 5B80A 1JQXA 2ZUMA 4S23A 4LV9A 3I68A 1LM1A 3HZ3A 4C6CA 4IGSA 3ISIX 3UZ5A 3EDKA 4OGZA 2OX1A 4Z0SA 1XBVA 1TMHA 5HMEA 4CNUA 2FZDA 1LQ2A 4JICA 4GJ1A 4WGHA 3W22A 1HL9A 1RPKA 4Q8QA 1O5XA 3C6CA 2D2OA 1LRTA 5I06A 1DL3A 2ZE3A 3GB6A 4H01A 3EAUA 1X1NA 2EGZA 1V79A 5GNYA 4RDWA 4KWVA 4EE9A 1HFBA 1UWQA 2HTMA 1WDSA 3LCIA 5LSMA 4GUJA 4W8BA 4XIAA 1I1WA 3EA1A 3N6HA 3E9AA 3NSXA 4CQ8A 4RDVA 4DJDC 3NQFA 3H70A 1GPWA 3UPWA 1OT1A 1PCWA 4ZA0A 3VDAA 2D23A 2F61A 3M6DA 2OYKA 1IE7C 3G18A 3FDGA 4JQAA 3B4YA 1KM5A 1MZHA 4Z0JA 4YTRA 5EMLA 2D2HA 3CO4A 4REQA 2ACSA 3MTWA 4NX0A 3BAJA 2X1IA 3TNBA 3BXWA 3ITTA 3VDBA 3E0FA 4ECLA 4EKJA 4CQ9A 1POKA 2X1UA 2E5CA 2W3ZA 2WVVB 3AIWA 4AEOA 1RA5A 1TV5A 3SCPA 3NZQA 3K4AA 3EX2A 3NSMA 3AALA 3T44A 1BKSA 3KL0A 4B5WA 3T4CA 1HT6A 4JZ5A 4DNMA 2VTFA 4S3CA 4KPLA 3M6YA 1W5QA 4A4AA 3W38A 2FHFA 2W62A 2CBIA 3NAVA 3R7MA 2GVEA 3K4DA 3ES7A 1DQUA 4R5EA 3ORWA 1V3KA 1P0BA 1X7IA 1GQLA 3T0CA 3VM5A 5EL1A 1VZWA 1OX4A 1LQAA 1QXLA 5FJTA 2C1HA 1P0DA 4ZVJA 1WXZA 1JPKA 1TYGA 3Q65A 1ZY9A 4MNMA 3A3WA 1SFLA 1YX1A 4XAGA 1ISZA 2FPVA 3QPYA 4UTWA 4OECA 3L66A 3OOQA 1LT8A 4MKNA 3C2RA 4YVVA 3N9RA 1WUFA 1NEYA 3OO2A 2WCGA 2E5BA 3SCUA 1C93A 1XRSA 3DFSA 2E6YA 3KM8A 1S5NA 4MWAC 3ZM8A 3QW3A 3LZ3A 1ZPTA 2X0YA 1VPYA 4BK9A 1G1YA 5GJMA 3W7HA 2YDRA 4QROA 3TOYA 2BVTA 1R3RA 3F5LA 3LI0A 2PUZA 2Q8ZA 4IZGA 3BH4A 1XLHA 5DT5A 2FTYA 3GZ3A 2OLAA 4GVGA 4B2DA 1HKIA 2E1DA 2VFIA 5HDRA 3ECQA 1XCXA 4G7EA 3ITYA 3MQTA 1SUXA 4Q4OA 4C1LA 2ACRA 2ISSA 3ARRA 4ALDA 5FF7A 2WPGA 1YTDA 2E8YA 2YBTA 4M19A 3S2CA 1ZCCA 1E1FA 3E5BA 4LOCA 1K3UA 1BTMA 2D69A 3GU1A 4CU8A 1AD4A 3K13A 1L0PA 1OB0A 2CBUA 4I8DA 4XZ9A 4RCXA 1SO6A 3ARPA 2PDWA 3HFYA 1S1RA 1MEIA 3FKRA 1VPQA 3A5FA 2OLSA 4AZ6A 3W6LA 5AKQA 2W66A 5AFDA 3GG1A 3SN1A 3CWOX 3VAVA 1XDMA 2O9TA 4S2CA 3A3XA 1P4CA 3BCFA 4JD4A 3LXBA 4AX7A 3URBA 4XD3A 3BQ5A 3L23A 1N7KA 3VDHA 1QPQA 3HFTA 3KTXA 3N14A 4LC8A 2ZA3A 1E9IA 4ZGYA 2JKAA 4J2MA 3W1TA 2CETA 5F4WA 3MDWA 1XBXA 4HPNA 4K36A 4LGXA 5AVHA 3VC5A 2QCNA 3UR7A 2O4QA 2AMGA 1MFVA 4OTKA 4LB3A 1Y0EA 5LHFA 3STEA 4LQ1A 4P7NA 4CKQA 3NQDA 4LW7A 5FJUA 2XFFA 4C6IA 4XD6A 4PB3A 3GR8A 4MJ2A 1NWTA 4DXVA 3CIXA 4PMUA 3R5EA 1ZNNA 5JBDA 1E6NA 2D0HA 4PCPA 3ZVIA 2BHYA 1DXFA 2WMIA 2HXUA 3QXBA 3CH9A 4RNFA 3WBEA 1W9BM 3ATZA 1JG9A 3WLTA 4RK8A 4QLJA 2WZMA 4AWEA 4N9DA 5CBBA 1B5TA 4NUWA 3MHFA 2AAAA 4MZ1A 2VDHA 3FHAA 1O68A 3CS2A 2WC4A 3HQOA 3VUPA 4M1BA 3SQLA 3GG0A 4LUJA 5C55A 2C6QA 2DZSA 4I6VA 3CYJA 4GLEA 4JTKA 1TWSA 3ICJA 3I10A 4LVBA 4JIRA 1B3WA 3FYPA 3PJXA 2Y8VA 2J75A 3IAQA 4FMVA 2VFEA 3THQA 2ISVA 2V5BA 4JFSA 2X42A 1EFZA 2BOFX 2V2HA 5HUOA 1Y5XA 2FB2A 4MLJA 2F84A 4DYKA 4OIFA 3AHTA 1NELA 3LGGA 1QO5A 5BU6A 2C13A 4UOZA 3HPAA 2OEJA 2J9XA 4PCFA 3N04A 4GKLA 3Q2DA 1L6GA 2EPHA 2W67A 3PBGA 4FNRA 4J28A 4OKDA 3ZIZA 5DBTA 1GGOA 2DEPA 3VI2A 5GPRA 3LN3A 4REQB 4ZQPA 4IJRA 4NAFA 2QCFA 4PEKA 2R24A 2YB1A 4ZXOA 1UWTA 2JF6A 4BCEA 1FVPA 3N4FA 2RDUA 3T81A 5E0CA 2G96A 3DBNA 4XZBA 3QHNA 4S3FA 1TVLA 4IQDA 4LUSA 1R5YA 3F1QA 4RV8A 3PB2A 2OWXA 3QM3A 3AIRA 1KGXA 3HF3A 2GGIA 1P43A 1R47A 1FWSA 4DF2A 1G9HA 4HA0A 3TYZA 1VBJA 4UTJA 3HO8A 2PP1A 1ISWA 3CT7A 1FH7A 2PTWA 4D8AA 9XIAA 3EWXA 4IICA 3FN9A 1S2UA 1OCNA 1XRTA 4LXFA 5G4EA 2XH2A 1DVJA 4GE8A 2WQDA 3K4WA 2IUZA 2DFAA 1KM2A 3MV11 1UC4A 1KC7A 4ICNA 2YL6A 4N9BA 2IXVA 3GXTA 1R7AA 4MWAA 5LIYX 2YBUA 4EX4A 4D1IA 2V3FA 3TYUA 4O10A 1J9YA 3LCXA 4NL1A 5HA7A 2A3LA 3B0PA 4BY3A 3WLJA 3WLLA 3E2SA 1DXEA 4Z1AA 2A6LA 2J13A 3CZJA 2J9ZA 1PJ9A 3UR5A 2Q6ZA 2FVKA 4MNKA 2YXXA 2WSKA 1U22A 5CPSA 3OG3A 4ES4A 4N9CA 1MO0A 5BW6A 1HP4A 5C9ZA 3N18A 3Q45A 1WA3A 2YLAA 3W29A 1H4PA 3IWPA 5D30A 1UHVA 4GFSA 4GYPC 3SQMA 2V5CA 2O4MA 4O1BA 4A05A 3PPCA 2IPJA 3W1UA 1MYRA 3BQ6A 3GKFA 4B5NA 3TFCA 1X1OA 4L1WA 2P5NA 3D5HA 2YYTA 2P8BA 4G7EB 2ZYFA 1TR1A 4H8HA 1SR9A 3O05A 5D32A 3VABA 1WZMA 4M1RA 4X2PA 1YMYA 4OVXA 2GQ3A 3BOFA 1U2YA 1XLCA 3UXKA 3PANA 4Y2WA 4XAPA 4GVFA 1C8XA 2FZMA 5DQPA 4RZBA 2ISWA 4JX6A 1YPIA 3QYQA 1C8VA 3O3RA 1TZ7A 4WKFA 3UY7A 3DH7A 3U2OA 4XVDA 1PWMA 2GSEA 4TVUA 2V81A 4JQ1A 1MVYA 2EQDA 2BNJA 3WD4A 3QHMA 1R2TA 1MXSA 3WD0A 1ONEA 2ZOXA 5CH9A 4IWWA 4LVAA 2HS8A 3RJYA 3DEQA 2A7NA 3KRBA 1C29A 2ZCGA 2C1IA 4XZHA 2QULA 1A5CA 5U4NA 4PH6A 4KF1A 2CESA 1RXOB 4DN1A 4JL2A 1UB3A 3M9YA 4Z1YA 3W27A 3G0XA 3HU7A 4C6DA 3CUJA 3S9ZA 2G0WA 2P3ZA 3VM7A 1W91A 3G6MA 5BROA 5LNWA 1JXJA 4XSMA 3JS3A 4GZ7A 3M0XA 3FGCA 3LMZA 1XWYA 3CO8A 4D6HA 2JKEA 4G6CA 3NM1A 1MQRA 4CCCA 1GQKA 4G7FA 1XBYA 1X6LA 1IXNA 3QRHA 4AD2A 1ONRA 3TXVA 3I3DA 3GXPA 2WMIB 1XLAA 1F4AA 2PZNA 4AH7A 3M5ZA 4XBKA 3QR3A 4QP0A 1R9YA 1UIOA 3Q94A 1US0A 4NZ5A 3CQHA 3FHQA 3L5LA 2CPUA 5A6AA 4FI4A 3NPXA 5DY3A 4DM1A 2WLYA 3ATYA 1FDJA 1SW3A 1XLDA 4LBUA 2QCGA 3BMWA 4H1ZA 2DJXA 3WFLA 3MI6A 4PMXA 1JZ2A 2QZRA 4GVIA 3M16A 1IV8A 2A2IA 2OTDA 4HYRA 5A6SA 3N2TA 1KRCC 4ZENA 2QPSA 3P84A 3WDHA 1GG0A 1XH1A 4G8TA 5HR7A 1POJA 3T05A 3CZGA 3H8AA 2A6NA 4GYJA 3CAWA 1ADSA 2INEA 5BCAA 1LRNA 3QLLA 4F0RA 3TYCA 4GY0A 5LA2A 1OFPA 4FA3A 5E0FA 1NDYA 3OLEA 1OABA 3SUVA 1FWRA 4JQ2A 3JUGA 3F4VA 3ZVHA 1T8XA 3ZZ1A 2Y7FA 3LEPA 3IACA 4NAEA 1H1YA 3BE7A 1A0EA 2E9LA 1FHUA 1KD0A 3E0WA 1QW8A 3I4EA 5HJXA 4TOQA 3PNZA 2J4GA 2PTZA 1KRMA 3QMRA 5HATA 1XCWA 3UNDA 1UD2A 1VIZA 3QQWA 5KITA 4NAFB 5FD0A 5G2WA 2ZZ4A 4H8VA 5DRCA 1WKEA 3W7GA 4TTGA 5LNVA 4DJFC 3HTWA 5JBEA 3B8VA 1CEOA 1QATA 2D2GA 5AHNA 2JQXA 4JOMA 4PUUA 1Q6OA 2ZUWA 3N6JA 4GQRA 5HK4A 4GH1A 4LUSB 1B9BA 1NU5A 1Q3NA 3TQ0A 1WPCA 1RSCA 2YZRA 3GIQA 3AUOA 1TPB1 1NFGA 3WQ6A 4CNSA 4D6FA 5CCZA 2NV2A 3OYXA 3T42A 5A6MA 1CXKA 1KLZA 4AIOA 1BKHA 2DVUA 4LYKA 2ONEA 1PUDA 1BRLA 1P0KA 4JIHA 5LXEA 3TFXA 2F6UA 3TYBA 1CX9A 4EXAA 1P48A 3W7OA 2XZ7A 1CB7B 3AICA 1EYWA 4PUJA 4MWAB 3S1GA 4HJWA 3DFTA 3ZLHA 3WQEA 3HV9A 5TIMA 2GZXA 1VJZA 4GYPA 3H2MA 2HNEA 2QUMA 5A2CA 1YE4A 3LBMA 5FI8A 1ITCA 3GU2A 1UKSA 2HVMA 3KOYA 5FL0A 2P50A 3OVGA 1HGYA 3IJ8A 2ON3A 3KL5A 4Y9AA 2JBMA 3EB4A 2BGQA 3WO8A 4K7VA 1LF1A 4UNLA 3UZZA 4A8RA 5TQLA 4AD0A 1BXCA 1DQWA 3DBPA 3CL8A 1YHTA 4P7OA 2WZIA 4GJIA 1QPOA 5AC7A 1UPPA 3FLUA 1V6VA 3U5UA 5H8UA 3RYSA 2DIKA 5FF2A 4X0VA 1ONXA 2GUYA 2BX7A 4NQ1A 4NZ1A 4GCXA 4UZSA 2ZADA 3MBDA 1BD0A 2VX7A 1RBOB 1MQPA 3ITGA 3KP1A 3MPGA 2C19A 3IV3A 3UJSA 5F2GA 4PBEA 1DWFM 1KWKA 3UWYA 3SW6A 5JUVA 2XTKA 5CPNA 4DF1A 4NZ4A 3ZR4A 1ONWA 4H6QA 2H8XA 4S2BA 4E0CA 1E6QM 3UJFA 5JIWA 2WJEA 2P88A 1BEUA 2C8NA 1PE1A 1S38A 4RL3A 1VYRA 1XYCA 4NF7A 4AWTA 5D9PA 5G1MA 4M0XA 4J3ZA 4AQLA 3WDQA 3LRLA 4J7RA 3BLLA 5AN7A 3VOFA 4JFUA 4N0RA 1DPMA 3AXKA 3VCRA 1KM3A 3EX1A 4JEJA 3W86A 4XIMA 1KGUA 5KZ6A 5FJIA 2DSWA 3LPFA 1YNQA 4LS2A 2YL8A 1EO7A 4ZMGA 5D2XA 2WMGA 3E2RA 2C7FA 3PZOA 4LRSA 1H0GA 4U5IA 5E09A 4B5SA 1VLIA 1GKRA 1B3VA 2UY4A 3IGXA 3R89A 3M47A 2PDLA 3FGCB 2WHJA 1ZBCA 3QZAA 4I5XA 4YLWA 3O07A 1SJAA 2VKZG 3KUMA 1QHPA 2OQYA 4LBRA 3B8IA 4HTYA 1RZMA 3HMCA 3AIQA 3ZJ8A 5M1TA 5HBFA 1EIBA 1G4TA 1R3YA 1EJUC 4D6GA 2IPGA 2A3BA 1AZ1A 3AIEA 1RJPA 2B31A 1TRDA 1DJNA 5LA1A 2FHBA 3GDKA 4GX8A 1SM9A 4AD1A 3IJ9A 3TQVA 4JYDA 1DHPA 1XYAA 4AZGA 4C6KA 1W1A1 3G1RA 4UXDA 1GT8A 4UQCA 2PURA 3H24A 4AU0A 5I3FA 1EBHA 3NPUA 4QX4A 4FP1A 5AC6A 4M56A 1XLFA 4W7VA 4ADSA 1Q6LA 4TV6A 2KAUC 4LV4A 5I3IA 3USBA 1XD1A 4J1OA 3VD5A 1CIUA 3T2PA 3F2BA 1GOQA 3CHDA 4Y96A 3GC2A 4A3QA 4P7LA 1UBPC 4YMZA 3ARZA 3H2OA 4R9XA 4LAMA 3W2LA 3COTA 3P3BA 1B3OA 2PWVA 2ZA2A 3T2QA 1ZAHA 3ZVHB 1WXJA 3HGOA 1Q6GA 4K6AA 4NAEB 3BSGA 4JQ4A 1KRAC 4LAKA 4DJFA 4LAOA 2E9MA 4JY8A 3TTOA 2J27A 1V0KA 2O0TA 4KCUA 4C6OA 5CC6A 1TB3A 5J5DA 1KM4A 3IVSA 3QTGA 1ENUA 3QY6A 1ZJAA 3GU9A 3S5ZA 3ALGA 4LYRA 1FCUA 3P81A 4YVPA 3W7KA 3UCCA 5F7UA 3IIPA 4GI4A 4HJFA 3UG5A 3VIIA 1R87A 3HQPA 3H2CA 1CGWA 3LV5A 2IKJA 1LYXA 4WGXA 1O5KA 2FVLA 4BEUA 4NRSA 3XIMA 1PB0A 3PJWA 3BAXA 1J12A 2PDNA 2ZDSA 3NOYA 3WQ8A 3AWOA 1C7SA 2Z1BA 2ALDA 2XJ7A 5G2HA 3REQB 1ZP3A 5T9CE 2Y24A 4GQBA 3OA5A 4JKKA 3BMXA 2YCJA 4C5YA 1BRLB 2CFFA 1W0MA 3KZSA 2UBPC 6PTDA 1OGSA 1B57A 4H6RA 4XAZA 2YL5A 2CITA 4A3HA 4O1CA 3UF9A 3LB0A 3TQPA 4WDTA 3F5KA 3QV7A 4RDZA 3IRSA 1XIBA 5D02A 5EY5A 3FCPA 5I77A 2ALRA 1V0NA 3PY2A 1L2QA 1V6WA 3PZUA 2FGBA 3QC3A 3U6WA 3CQJA 2W91A 3S9IA 2FGLA 2BGNE 1KKOA 3CPRA 4ZO9A 2BFGA 2I9UA 3VPLA 1XX1A 4GGHA 3PAJA 2DZTA 2E40A 2BXZA 3HM7A 4GPNA 2E3ZA 2YX0A 4LX4A 2WVSA 4WX2A 3S5YA 1JPHA 3VC6A 2AL2A 1W2PA 4AIBA 3W83A 4O1AA 3IUDA 3WLMA 5HJLA 3H23A 4JTAA 4JAWA 2MNRA 4QRNA 3F7JA 1JNDA 3LNPA 3B0VC 3N2MA 2Z6JA 1PKLA 4BQ4A 1VC4A 2PODA 1ISVA 1UR3M 3GNNA 1XH2A 1RBAA 5G5IA 1Q4NX 1JZ5A 1PBGA 1JUEA 1W1ZA 2XWEA 1HVQA 2WC3A 3MP5A 4DZIA 1GZGA 3U7VA 3S5OA 2EHHA 3VK5A 2PDIA 5TNVA 2QGYA 3G22A 5EBUA 2VFHA 2Y61A 1PZ3A 3CYVA 1JI1A 2XN0A 3LHYA 1ZGDA 4KGLA 3VD4A 1EA9C 1OFQA 2GUUA 1GYLA 4MJMA 4QGCA 3W7JA 3DFQA 5AVNA 1R2RA 5A2AA 4DB7A 4KFPA 1TTJA 3KTCA 3UCDA 1TVNA 1IWPA 1E0WA 1FCBA 4KEVA 1XSKA 2VO5A 3C8FA 3W7LA 1F9CA 2C71A 3WQGA 4UFKA 3QR0A 2A7PA 4I5RA 2OOFA 1Z89A 1KFBA 4A3YA 1V08A 2PLCA 4L6DA 4HK6A 4KBXA 3LM7A 4CEXC 1EKOA 3BW3A 3N73A 1MZRA 3FXYA 3WFZA 5BRPA 3UD6A 4RZ6A 1FWIC 5B7ZA 1Y7VA 2DV0A 2HNHA 3CIVA 1XYFA 1P1MA 3NO1A 4NI8A 3WLRA 1EOMA 3Q58A 3L21A 2I9EA 4H04A 3W76A 3MUIA 2ZWZA 4K68A 3CHEA 3QFEA 1OCBA 5EU9A 1O1HA 2OZ0A 3KOFA 4TQTA 1XI3A 2JGQA 2GGHA 3UZJA 4HHLA 1E9YB 4N4PA 3GYCA 2ZXBA 4NJGA 3TMQA 2VD9A 4F2BA 1UMYA 4QE4A 1UWIA 5FKYA 2XN2A 3WUGA 3LPPA 4W93A 4O0ZA 3O6DA 4URIA 7A3HA 2WO5A 1A50A 4DVOA 1GYMA 4KH2A 4UFHA 3CV7A 1HJXA 4A8NA 1AQMA 3TC3A 4H9MA 3H55A 1FHVA 3AOFA 4OV4A 3BCDA 3S1UA 3H22A 3ABQA 1JL8A 5H1WA 4HOWA 4Q22A 7PTDA 2X1TA 4DWSC 2I5GA 3EXRA 3G3MA 2CZFA 3AYRA 1TZ9A 3QGVA 3SUWA 2Z2AA 1VQTA 1V3HA 3WH5A 3TONA 4PC8A 3H2NA 3JVAA 3AHVA 2D20A 2RAGA 3GS6A 3L2LA 5I24A 4AISA 1Y65A 7TAAA 1B3XA 2EF9A 1TPEA 4ZOBA 1UWUA 2HK1A 4GK8A 3VNYA 3FJNA 4KT2A 1RV8A 2CLKA 4J35A 5ABGA 4J3WA 2BVWA 1U1UA 4LPCA 4GYKA 1CDGA 5FESA 4KETA 5JMUA 3ZSSA 4MB4A 2RDWA 3KS5A 2GJPA 3WMSA 3P8IA 4C6BA 1W3JA 2ZVIA 3U8GA 3MA8A 1GHSA 4NASA 1O95A 3SSJA 3C2OA 3O7UA 4QITA 1TMLA 5A5WA 5EA9A 3WMLA 1X97A 1JQVA 2Q71A 3FEMA 3RR1A 1DKWA 5FIPA 4YCPA 1LDCA 4HPGA 3WENA 1PKYA 4O1EA 1WOBA 3O63A 1PKNA 3LSCA 3F03K 4LY8A 1EUNA 4B15A 3PBWA 3OZPA 1UR4A 1VPXA 3BV7A 1US2A 2R9RA 1DWHM 4G5DA 1W8GA 5HMDA 5BOOA 1MNSA 5BNKA 2D3LA 4H19A 1UH2A 3PJTA 4FOKA 2FH6A 3L5AA 3BLIA 5FSDC 3IAPA 1B2YA 1A80A 1GHRA 3WCZA 1QFEA 3RM9A 4UCGA 5CSUA 1QDSA 1I2OA 4DUWA 3WDRA 1W5MA 2UY2A 1QI0A 2NVAA 1JYWA 2WZTA 1GTEA 2V5LA 3QY7A 1RK6A 3UPBA 4OT7A 2V67A 3I65A 2X16A 3VKAA 3Q37A 1MI3A 1P5BA 2P10A 1M6JA 4Y9OA 4YTQA 4ZFMA 3VIJA 1J5SA 3M4HA 2C1GA 3NFUA 4F0LA 4RNHA 3UG8A 4DUOA 2QHAA 2Z0IA 5HR6A 4YN5A 3EMCA 3TYEA 1ZB5A 2L5HA 3OLGA 1GQJA 2AL2B 3TMLA 1KR0A 1FRBA 5C8BB 1HJWA 1K03A 5C71A 1TPUA 2VGBA 4AZ5A 3UZXA 4I9JA 3BW2A 1AW2A 4K2SA 1LOQA 1JNEA 5DXXA 3RXZA 1QHOA 3P62A 1SSGA 4JL1A 2QUVA 1RCXB 3ES8A 2HWGA 4IFKA 3IJLA 3A24A 2YA2A 1UQYA 4CD5A 3NEVA 9XIMA 3DZ1A 2FIQA 2G4JA 2VENA 3GVGA 3DC0A 4F0HA 5BU9A 5XIMA 3R11A 4IJBA 3EEZA 3KOXA 2DT3A 4NZCA 2RGMA 5MKGA 3SIZA 1KXHA 4LY4A 4C90A 5MF5A 1UH3A 4FHAA 3ZSTA 4HNUA 1K9FA 1P6CA 5JU6A 4NYUA 1VCVA 2DZAA 4K8GA 1KV5A 4KERA 3ZJ7A 4H8NA 1W1TA 1BQGA 3IVTA 3HPZA 4S39A 2PWHA 2YSWA 4TVCA 2EJ1A 2VC5A 4CD8A 4IMAA 1Q8AA 3SY5A 2R1MA 3F4NA 4K38A 3SCTA 1T7LA 4H9ZA 1JZ6A 4DLMA 4C91A 3WF2A 5AC8A 1FFQA 3MS8A 3ZO9A 3W9ZA 1PXGA 1TUFA 2OR2A 1W3NA 2VX6A 1FP9A 1HQTA 4DX3A 3WF1A 2QJHA 3N25A 4JCMA 4R88A 1GTHA 3IGSA 9RUBA 3CV6A 1TG7A 2Y70A 4LCRA 3KAOA 2NX3A 4BZYA 3MCNA 3PB0A 2E68A 4WCJA 3A4JA 1LQ0A 3HGRA 3OZOA 4DJDD 3B0YA 3QC0A 1H63A 3B97A 4IUGA 2X41A 1EDQA 3RM4A 2PDPA 3EWUA 2OCZA 3M41A 5JH1A 2G3IA 3BPWA 2BGSA 4O13A 4XG1A 2PAJA 1XD0A 4DWSA 1NP2A 3GY1A 4UMAA 2CCRA 2O9RA 4JNMA 2ICSA 3UXLA 4WD0A 1UW9A 3R43A 4M3PA 2BY1A 1E3XA 3IJDA 1CXLA 1D7KA 5EGRA 3CQIA 3ZR5A 4Y90A 1XICA 4US6A 4CN1A 1RJQA 4C60A 1C8QA 3HJZA 3PHAA 3E0VA 4QG6A 1KFLA 1SMAA 4DZ5A 3B8WA 2JIEA 2PSNA 4F4RA 4FNSA 4YIWA 5AB3A 2XSBA 1GJUA 4Q6JA 1HG3A 1CYGA 1ODZA 1QNSA 3R79A 4Z42C 2V5JA 2DZUA 3KDNA 4B4FA 3T6CA 4GNJA 4IPPA 3TAKA 5DCBA 3M7WA 5CG0A 2CW6A 3NJ3A 2Z6IA 4ZOAA 3OHMB 4UTMA 1EZWA 2BTMA 3GXNA 2VX4A 1CNVA 2C18A 1WP6A 3V1PA 1R3WA 3A23A 5CZKA 1JCXA 1TV4A 2PGEA 4RUBA 3TTSA 5I6SA 2CC0A 1FTXA 4H9TA 4IGHA 2QDEA 1FXQA 1NY1A 4RZ5A 3PC0A 3DN5A 1ZBVA 4AIUA 3R2GA 1A3XA 5F2LA 3F4DA 1OX6A 3ZLFA 4Z2IA 3NL2A 3PZMA 2EG8A 2A0NA 4I9TA 2W27A 1KWGA 4J4KA 4O15A 5G4WA 1JPDX 4WDXA 4FXSA 3LLXA 1FWWA 3UW6A 3RCNA 2VEFA 1V5XA 1NWSA 4HK5A 3WLPA 1XLJA 1YYAA 3LCWA 4H83A 2HVNA 2DUXA 3BK0A 2X30A 2YIHA 1YXYA 3IV8A 4RW3A 2V82A 4QJ3B 3VNLA 4JIEA 3NUKA 3QZEA 3QMTA 1V6TA 1JIBA 5HMSA 4QLLA 3IGHX 3AZRA 2QJIA 4W86A 3ABRA 3H7UA 3L4TA 2VUNA 3U0HA 4AVFA 3IK4A 2Z24A 3E5PA 4OQVA 3WUFA 2YJQA 3MB9A 2ZX9A 4O28A 4OWGA 2A3CA 1VLWA 1GEQA 1VRXA 4P8VA 4HSOA 3W84A 4FNTA 3AHZA 3VZXA 5EMMA 3LU2A 4YPJA 3WLHA 2XINA 1JFXA 2F9RA 2RUSA 2WSYA 1UASA 3MMDA 4X9YA 4IX0A 3FSTA 4WVXA 3M0KA 2Z29A 1TREA 3NQEA 1A47A 3FOKA 4XZLX 1JYVA 1CGXA 2X1SA 4EPDC 3C0QA 3DFPA 3EZ4A 2TAAA 2Z28A 5HNRA 1SYTA 1FDYA 4TO8A 3KE0A 1AFSA 5L9FA 3N9KA 1FWAC 4QM1A 3WQCA 3W26A 4LNYA 3GAYA 4NXKA 3GBEA 3LCFA 1LBFA 4ZTYA 4UQAA 3ABXA 4LS0A 3C0LA 3GR7A 2CZ5A 4DO6A 2HISA 3U7BA 1TQJA 2XPKA 3N19B 5CPTA 4XO6A 1JDEA 5GQBA 3T7VA 1UC5A 1IT8A 3PZNA 3VMPA 3GTFA 1DV7A 1WB0A 3DG3A 4PMZA 4M6QA 4MHBA 5AC4A 5MKGB 2W5FA 2ZRYA 1EX5A 1OJXA 3GDTA 5A6BA 1ICSA 2PC4A 4PEEA 2WSQA 4Q4SA 4W89A 1E5NA 2EO7A 3ERPA 2ZQ0A 1LLOA 3DFYA 5A1AA 4Q8WA 4L56A 2ZUSA 1X8CA 5F2IA 3OIHA 3FA3A 1Q45A 3E1F1 1FDZA 3TEVA 4UTTC 4ZQNA 3TN4A 2PEVA 2DUZA 4O57A 1Q6FA 1B3YA 3A6OA 4OBSA 4EAMA 4Y9PA 4XBJA 4DAFA 4YYCA 8CGTA 1WCGA 4AVNA 3CAQA 3OU8A 1KTNA 1S3TC 1YIXA 4DAIA 1XLBA 4F9JA 3CEPA 4LSBA 3T1GA 3PTDA 4H9VA 4A35A 1M01A 5HAOA 3PAOA 2GVYA 4MPQA 3AMCA 3VCCA 2DQXA 4O19A 3CQKA 2D3NA 3BAKA 4GACA 5D2WA 3WY1A 4DZAA 5I78A 3UCQA 1F8MA 4JY9A 2ISDA 4TXEA 1K7FA 5CZ0A 3T8QA 2D24A 2CKRA 1ZALA 3M5VA 3MKKA 2ZWYA 3IEBA 4DWSB 3DGBA 3FK4A 1DIDA 2CEQA 4HA1A 1LUCA 4TVDA 4AG0A 2FJUB 2IKIA 2GOUA 1TPFA 1JPMA 3DU0A 5CBJA 1OGBA 2OT1A 3I7SA 1CWYA 1R3VA 1PKMA 4JTDA 1WBJA 2QVHA 1LWHA 1CGTA 4YNGA 4CD6A 3KVKA 1ZQ5A 3GIPA 2YA1A 5AZ1A 4P7RA 1XYMA 4O12A 3TA9A 1QPNA 4WOQA 4U31A 3L2MA 1ZHAA 2PD9A 4QSFA 1EF2A 5HQLA 4PSPA 2X0SA 1H60A 4WKAA 1GEHA 1MEWA 2V8ZA 4M6PA 4B5TA 2GK1A 2Q8LA 2XIQA 1C90A 2G8ZA 1IZCA 4HMCA 2NLIA 4GX9A 2QXWA 3NO3A 1K77A 1YKWA 2FQIA 3QN3A 2QGHA 1UD6A 3N2CA 3KCJA 3F2CA 1M41A 3GH7A 1OC5A 3QVQA 1BTCA 1X96A 4PULA 1V0MA 2JALA 2Z00A 3THAA 3URAA 2F8QA 1VFMA 1E5JA 4EWND 3FAWA 2CLLA 3LHWA 4O17A 3DYMA 1ZFJA 3LOTA 4IXXA 2FPTA 4OOUA 4IL0A 3W00A 1F4HA 2HDJA 5A2BA 4HCDA 4J2PA 4AC1X 4GWEA 3TVAA 4CQCA 3DHUA 4J3UA 4J5NA 4NG3A 1NDVA 3O06A 3BSMA 3AWNA 3R8RA 3KRSA 3W1NA 3CTLA 3CTTA 3U2EA 1W3IA 4WR3A 2WBKA 1XFCA 4LFYA 1X38A 1FH8A 3GVRA 1NF0A 1K8CA 1UWRA 2GWGA 1RALA 5CJMA 5BMXA 2QNEA 1NFPA 1SQ7A 3P5YA 4PFHA 1DJIA 3KEHA 4CNPA 4GH3A 5CSYA 1JDDA 1VFTA 2XGBA 3DYPA 4Q8MA 1YXDA 5LIKX 2TYSA 5HXMA 3W2JA 5K3VA 2D22A 1Z42A 2NW0A 2BHUA 1RJRA 3QF0A 3SGUA 2PBOA 4L7ZA 2OODA 3SRKA 1V3JA 3E0IA 2PDYA 3IS4A 1XC4A 1V77A 4AXNA 2AGTA 5D8WA 3TCSA 3C2YA 2YGYA 4JHMA 1TV8A 3ARWA 2QR6A 2NT0A 1XQLA 1TIMA 1KXVA 4W85A 4QAIA 1QASA 3KRZA 3SJNA 3WNLA 4P2VA 1PAMA 3T78A 5C2CA 3TLLA 2OELA 4K1GA 4OJYA 1I0BA 3FEQA 3WIJA 8XIAA 3DAQA 1E0VA 4U5KA 1I2PA 3R8GA 2R1PA 4DHGA 5I02A 4C5ZA 2PTXA 3STFA 2Z2BA 2WBGA 5FA5A 3ZT6A 3POHA 4PUMA 3ONBA 2CNCA 4RJEA 2VC9A 3HJEA 1TMQA 1KBKA 2XHYA 1M9HA 5EB8A 3TZFA 1O66A 3R94A 4JFTA 2VHLA 4UTTA 3THCA 3TXZA 5AHEA 1BVNP 2CZEA 4MKSA 5FJRA 1TVPA 3LPOA 2PDHA 2X7WA 2DORA 4M6VA 5D2YA 2EPLX 2DP3A 4H9UA 2IW0A 4ZQCA 3PPGA 3NVDA 1PTGA 4RPPA 3VD3A 4H00A 5D9MA 4KFOA 3QV8A 2YDQA 3KXQA 4JX5A 4ZXLA 4AF0A 1C92A 3N34A 3PTMA 8RUCA 2AL1A 1QR7A 4FR6A 1ITUA 4RNIA 4IPJA 2QCCA 2SFPA 3LI1A 5FCZA 3B3DA 4F2TA 1W31A 1XSJA 2Z25A 1PVNA 7REQA 4M5PA 1RUSA 1ELSA 4FZIA 1LL6A 1UKPA 2BXYA 3CHVA 4LEQA 2TODA 3RAOA 1XUZA 4QE1A 5IRPA 5CGTA 5PTDA 3AU6A 2FKPA 4E2BA 3MSYA 5D2TA 1Z7AA 3BURA 1PZ2A 3S9YA 4CLMA 4V15A 2OFJA 4LAZA 2PF0A 3CGTA 1RVKA 1AQHA 4FIQA 1J2BA 3W7IA 1IEWA 4IMDA 4UTFA 5M5DA 2DY3A 4ZEPA 3L4ZA 3WNKA 2DSUA 3GUWA 4ZB0A 3BGAA 3P7YA 4Q7IA 1G7VA 1LUCB 3T0BA 2WMJA 4K8EA 4IG2B 2QDHA 1NQKA 3HMJG 3W7RA 3OQ8A 1ZJIA 4DJFD 1H7WA 2J8TA 1MMFA 3PSVA 1QI5A 5HPCA 4D6DA 1GQIA 3QV6A 4U10A 1N8IA 2FVMA 2ZVRA 1BFNA 1YRRA 3GFZA 4GFIA 4JNZA 5A8OA 1XPYA 1OK4A 2XISA 3GYEA 3K8KA 3I6TA 3VD7A 1SZGA 1EHNA 3PWAA 3S6TA 1NWRA 1RK5A 4C6PA 2DW6A 2GK1B 1F2JA 2CZDA 3R4IA 1AL7A 4PMRA 4AC7C 2V5KA 1XIGA 1J6PA 2O92A 1Z41A 2ISFA 2WCAA 1W6TA 5XINA 2W0UA 1JCTA 3B04A 3BO9A 1X98A 3H2EA 4PTVA 4IQLA 3UZWA 2EAWA 4C1NA 4ERIA 4UB9A 3KVLA 1QK0A 4QQUA 3MWCA 2WLZA 5CQ1A 4UIOA 4MPKA 2A4AA 4LANA 4QJ1A 3P80A 3F4WA 1QW7A 1XGZA 4PTNA 1WUEA 1UUOA 4QISA 8TIMA 1XH0A 4HB7A 4INFA 2V3EA 3TTYA 3WL1A 3AZSA 3DGRA 4L9YA 3DFOA 5E6YA 1GG1A 4QQ3A 3D47A 4C7GA 1KNWA 2PD5A 4QS6A 4U4MA 3O2LA 2JGYA 2DH3A 3NGFA 1QI2A 3IVUA 1VFUA 3ZS4A 3RM8A 4JTLA 2D73A 2GSHA 3FA4A 1NWUA 5FL1A 4DF0A 3NQVA 4XVEA 3GIYA 1TWZA 1HKWA 2NUYA 2WHKA 3N4AA 1N8WA 4GG9A 3WMCA 2VGFA 2VEGA 1TJ1A 4LU0A 4O1DA 1VR6A 3W7QA 2CXGA 3RF9A 3QGKC 1CENA 1KBJA 3N17A 3IUIA 1KXTA 4O8AA 3OBEA 3R0UA 1KFEA 2IS7A 3PTQA 4WQ6A 1JJKA 4KCTA 3N2XA 2B7OA 1SJBA 3VD9A 1YTKA 3AHYA 3AMGA 3LCHA 1L8PA 1BQCA 4LF2A 4N2YA 1K9TA 1JXKA 5J04A 1M1BA 4DRSA 4UTUA 4TX6A 2PGFA 3GW0A 3W7EA 4XV0A 4HNNA 2ZZ7A 1EJRC 1OY0A 1Q6RA 3S2MA 4JIPA 3P60A 2J79A 1W32A 3RPDA 5A8PA 1TWWA 3TX9A 3MANA 3GVQA 2V9DA 4XZNX 4JBRA 4UFMA 3OGSA 4PN2A 1E6SM 1XP3A 1R2SA 4JCLA 1IXPA 3IIOA 4HBKA 2E09A 3UWVA 3TKFA 1SO5A 1J0ZA 2LLEA 1W17A 2BODX 3QHOA 1AA1B 4JR5A 6REQB 2ZRWA 4DBSA 3M5YA 5GJPA 4WY0F 5E0KA 2WXDM 3C4UA 1GNXA 4GOAA 4UTKA 1J4EA 3KZPA 3STCA 6CGTA 3V5OA 4EF9A 4M82A 2WNZA 5KSWA 4GI6A 2E25A 3VDGA 4EF8A 1Q6CA 5CAHA 5IDZA 3T9PA 3N13A 4BF7A 4YHEA 3MP4A 4Y8EA 1OVDA 4FX7A 3SO7A 1KCZA 4CEUC 3W75A 4PTMA 1W5PA 3WH7A 3SY1A 2A7RA 3ITLA 2VC7A 2Y4SA 3KBJA 5HQEA 3RMJA 3SR7A 4Q8PA 2P8CA 2IQDA 3RNDA 1OSEA 3OODA 8A3HA 2OO6A 2IMRA 3BWWA 3NG3A 1XSIA 3U57A 4JIIX 3M1ZA 3UR8A 1OD8A 2IPWA 3PNUA 1XYZA 3GE7A 4AF0B 3K2GA 5CJ5A 5CKSA 2PCQA 3UWWA 2WVTA 3ZT5A 4GQQA 2KX9A 4NIRA 1ZJBA 3M64A 4FNUA 3B9NA 2GUBA 2F6XA 3R10A 3UGVA 3S2JA 4S3DA 4LB4A 1FKXA 1OFDA 7REQB 3PTKA 4B5VA 1YE6A 1P6BA 1XC6A 3LHTA 3RHGA 3GH4A 2XUCA 3EDEA 2Y7GA 4NX5A 2ANUA 1W37A 1M7XA 3LRMA 3TYDA 3URQA 4DEFA 4DLFA 3FNDA 1RQBA 3RX2A 1AG1O 1UWSA 4WZHA 1ISXA 5J5RA 3AXHA 5D38A 4NJJA 3GTNA 1RP8A 2PDQA 2X8RA 2ZXDA 3L0GA 4YJ5A 3PWIA 3UVIA 3CNYA 4FK9A 3APYA 3E0LA 1HJVA 3AMDA 1PEZA 4M7SA 1GUVA 3AS0A 3EEGA 3MI3A 3EGJA 2JE8A 1WZKA 1Q85A 3UWEA 3N9SA 3V0UA 3M46A 4NYYA 1GVIA 4Y7EA 3AXIA 4BWLC 2J7GA 1Q6EA 3L67A 4Q3MA 2ZUTA 1NOFA 4IMEA 4IMGA 4HP5A 5I79A 3CUFA 1QOPA 3G3DA 2AQVA 2NQ5A 1JULA 2XGZA 2ACUA 4UZUA 4KESA 4GCAA 3CHCA 3E2VA 1V7AA 4UTIA 1EDTA 4JQ3A 3MKVA 3CHFA 2J8FA 2WHMA 3SCWA 4R34A 5GNZA 3VIOA 4ML9A 4IMCA 5ABFA 1VFHA 2P3EA 3UJEA 4YWIA 3ENLA 1J0JA 4MZ8A 2BB0A 2QIIA 2BVDA 2QCLA 2R6OA 3TR9A 1K1DA 2AMXA 4PE8A 3W2KA 4JYFA 4W4QA 4C1NB 3ZT7A 3MSGA 4KEUA 1UP3A 1CLVA 1JZ7A 2BSLA 1XR2A 3TW7A 1JCMP 4AWUA 3C52A 4L6OA 4ZQMA 1JCLA 1XUUA 1ZJHA 1WQ5A 1M68A 1MW0A 4IUOA 2RDXA 3E2QA 1HP5A 1JF6A 2J7EA 4HCHA 1XFBA 1NM9A 3T08A 1W2VA 3BLEA 1LL4A 3DHPA 2Z1VA 2XVKA 2VT0A 4Z2JA 1H49A 3A47A 2GLKA 3HGJA 4JTGA 1G5AA 1JR1A 5FEPA 3HPXA 1U30A 4ZOCA 5M17A 1GJPA 3UU0A 3WD3A 3DKJA 4UOJA 3C2FA 4YXGA 2WJZA 2XYLA 4X63A 3FJ4A 1D3CA 3VINA 2Y8KA 3TW9A 3G1XA 1T6MA 4GXPA 4CNNA 2WNQA 1FFRA 1HVXA 1BWKA 1ZRQA 2OEMA 3CC1A 3WELA 5EYWA 4DIAA 3SCQA 3WDIA 2NQHA 2E9BA 3SIMA 1JUBA 3LG3A 3BGGA 1QNRA 4RDYA 1EB3A 1DTUA 3CZ8A 3N2BA 5HNNA 1RP9A 3W81A 2EG7A 3BC9A 1IYXA 2RGLA 1TSIA 4Q33A 1UPMB 2DT0A 5AYZA 5BWAA 1RPXA 7XIMA 3FV9A 1EWDA 1V3LA 2E6FA 2JK2A 4AY1A 2XH4A 3A9BA 3MCOA 5I3JA 3WX7A 1PZ1A 1XIHA 3K1GA 1OF8A 4R9OA 2J66A 2TMDA 3L9CA 4UBPC 2QQ6A 3KBWA 3O16A 5F4SA 1M7OA 5KINA 1DIKA 1U5HA 3VX0A 2PLMA 1GYNA 4L61A 2J9YA 3LQLA 1ME8A 3GXDA 3G24A 3SM0A 4D8LA 4EXQA 5A6KA 2E28A 3WNPA 3A5VA 3D6NA 4JPGA 5EKYA 1J11A 1UWAA 5DF0A 3GAKA 3M5XA 5DFAA 3QW4B 2G41A 4WLCA 1W3HA 5H8MA 1EZ2A 3C5QA 2J6VA 4O50A 4FB7A 5D03A 3VNKA 3UYCA 2QYGA 4YU1A 3WUEA 1KB3A 4JTFA 3V75A 4RZ4A 4FX6M 4AYSA 5HANA 2CU0A 1V7YA 3ZMRA 3VTRA 2YOCA 4EPBC 1BSIA 1AW5A 2R8WA 2CBVA 4F40A 4N6FA 2OXNA 4FXJA 2OB3A 2ACQA 2QMJA 1E9LA 5A95A 1E6PA 4W84A 4W87A 5DELA 1TPVA 3N6QA 4Q4MA 4G1KA 4X60A 4BQ5A 4TX8A 2BP1A 1LCOA 1IR2A 2PE4A 3V36A 4RE4A 4X3ZA 1LORA 4B16A 3IGUA 3L12A 3T4WA 4AHPA 3R8HA 5A8NA 1WE5A 4LUYA 3WLOA 4B3KA 3PUOA 1NTHA 2ZA1A 3J7HA 5BMWA 1WZAA 3SCVA 4G9PA 4QHRA 4DWSD 4GABA 3B4UA 4AW7A 1UIPA 1BWVA 2YB4A 3BCJA 3NQGA 2EPOA 4HIBA 1FH9A 2NQLA 3KW3A 1HZYA 4XTIA 1E70M 3VKKA 1TWIA 1J10A 4MMWA 3TJIA 1OGGA 4RNJA 4JYEA 4PRRA 3MYOA 2D0GA 1KXQA 4BWLA 4GY7A 1A5OC 2ZBTA 1XIMA 2EKGA 2VQTA 2NX9A 4D8ZA 1Q66A 1OFOA 5CZSA 3TUUA 3KOWA 3HQNA 4QJ4B 3ZYZA 1EC8A 3NIYA 3O0FA 2I56A 3VOHA 3LLFA 4ERGA 3GR4A 5EMUA 2FMNA 5XIAA 2X09A 4KIRA 1X8FA 1SFJA 4GZJA 4ACYA 1RHCA 5KMYA 1V0LA 3K46A 4QNEA 5D4YA 4AXKA 3AQUA 5EMYA 1OCQA 1AH3A 4IIEA 4QE5A 3TSMA 3BW4A 4JKLA 4HN8A 1DP0A 1PIFA 4G1NA 1PCKA 2R1LA 1CI1A 3PUDA 2HROA 1XM3A 3VOGA 3KOZA 3OGVA 4PGLA 4YWSA 1XL9A 1I4NA 1DOSA 1O94A 3F5JA 3TQKA 4GKTA 3OB8A 5ABFB 4GXWA 5LXXA 2G3MA 1OG0A 4O11A 2Q8XA 3WJXA 5CLWA 5AOUA 5HOSA 5D8ZA 2XIMA 3MJMA 2VCAA 3ANVA 4Z1BA 3O6CA 3OPSA 4ENLA 5DANA 4N4QA 2Y8UA 4HD5A 3ARYA 3THDA 4MDPA 2ODOA 5CXPA 5LIUX 3V1HA 1Q63A 3M0MA 2HPMA 3OP2A 1WYIA 3PF3A 4US5D 2ZICA 4D6CA 3EWDA 3RILA 3CMGA 4Z08A 3HG4A 4PA8A 5IHSA 1UZDA 4KGJA 3W6MA 1GONA 3NL6A 1F61A 2VZVA 1XLKA 3DI1A 2Y85A 3HN3A 2VZUA 3KBMA 3WK2A 2GQ9A 1S2VA 3LTYA 1GVYA 4EPKA 2QJJA 1ZS2A 1MEHA 3B40A 3JRKA 4CCZA 3W28A 3RIKA 2YBVA 4YYFA 1TV7A 2OG9A 4XAYA 3GG7A 3M0LA 2PDGA 4ML4A 2ESCA 3IARA 1B30A 3PFRA 5C9UA 1WAWA 3GXIA 3KVMA 3SADA 1GZ1A 1Z44A 4DZHA 2G50A 1HIZA 3MCMA 3FVMA 4S3BA 3PG9A 4MUPA 2UZ9A 3AU2A 2WM1A 4K39A 2E0PA 3WJSA 4NJHA 3CEUA 3LXAA 3GUGA 2CHNA 3ABOA 5EPDA 5AYYA 4GZIA 3V5CA 5CJNA 4HQVA 2GYIA 1YDNA 4E6MA 3ME3A 4GYFA 2VVSA 3DKLA 3O1NA 5DMYA 3M07A 1AMYA 1WXYA 5LNRA 2OEKA 3LCLA 1VF8A 2NLYA 5FF0A 1BLIA 2VOMA 3GC4A 4M29A 3T8LA 4TU1A 3F4CA 3ARQA 3VCNA 3CUGA 2GGJA 4XX6A 1OFRA 3Q4DA 2ABAA 2B7NA 3VIKA 3BZGA 2C91A 3S83A 2YDSA 3GFYA 4ATDA 1Z48A 3WKZA 1A0DA 1UP2A 2QF8A 1G4SA 4L64A 1X39A 1ICQA 4MFDA 1JD7A 4XUYA 4AYGA 3EOUA 3SGGA 4PR4A 3B9DA 4M51A 2WNWA 4J9JA 3UY8A 4EP8C 2OYMA 3E12A 2NVCA 4XD4A 3CT2A 1XS2A 4QXIA 4AMCA 3W0KA 1JZ8A 2Y5JA 5M3WA 3VNDA 3VU2A 4NVTA 4IIFA 4GJJA 3MDUA 4ZB2A 3UR2A 3NL5A 2WOQA 1J6OA 1E4NA 1GVSA 2RFGA 3BJFA 4QDMA 4FAMA 1MW3A 3L4WA 3GNOA 7TIMA 3A13A 3WN6A 1VYPX 2VWTA 3KX6A 6TIMA 3B8SA 3KCOA 4NZJA 2PC8A 3NZRA 5D04C 2G4FA 3AS2A 4W7UA 1FHLA 1GCYA 3OEXA 3W1XA 5HWJA 1OM0A 4GXMA 3KBVA 1ZAJA 3W23A 3L68A 2PFHA 1CLKA 1MFUA 1CTNA 3WZ0E 3NQ7A 1L9WA 3NQAA 2XFYA 1V02E 4O14A 4IPLA 1F07A 2PDMA 2QS8A 3KBNA 2OQHA 2QEZA 3BARA 1LWJA 3RLUA 4DWDA 2OQLA 3W37A 4PCNA 2HS6A 3A12A 5FOOA 1MWOA 1UR2A 2Y6ZA 1HN1A 2C79A 1IT7A 4ZSTA 1S2AA 1L6SA 2QPXA 1V3MA 1XLIA 4HN4A 2Y88A 4AEFA 1GKPA 4TX9A 1Q6DA 3LA4A 1QAPA 3C2EA 3DYOA 4WJEA 1UOZA 3VA8A 5EFDA 1EH9A 3UBPC 4E2DA 1M5WA 4GINA 3APTA 4W5ZA 3W01A 4ZZ9A 3DERA 1BHGA 5K9XA 3EYPA 5IBXC 1P6WA 4IJCA 1M3UA 1JF5A 2Q02A 1ZP4A 3MZNA 1TTIA 2VR4A 2CKSA 1Z69A 3SZ8A 1SFSA 2MUCA 3T0AA 5I07A 1W1IE 1A5UA 3TAOA 3GO2A 2QUUA 1Q4WA 5AHMA 5CEWA 1NSJA 2IQTA 3VKBA 4V33A 1EA0A 3EMQA 4S3JA 4QIUA 2H3BA 4Z2HA 4HYWA 4GIYA 2ZRVA 4M7TA 3S4TA 1ZENA 4XK2A 2ZX6A 5DT7A 4MUZA 2VGGA 4HSNA 4B5XA 4QCFA 4GC4A 4AX6A 4Z1CA 5K4XA 5FSEC 3FKKA 3H7VA 5I23A 1KGWA 4DBWA 1FWJC 4S3GA 1DJYA 2Q09A 2I17A 1FWBC 3ZWTA 4GNVA 3CB8A 3K1DA 1SZEA 2EPKX 3V35A 1XG3A 4KKXA 3REQA 1RCOB 1IGSA 4KEMA 3ZXWA 4S3KA 3MSDA 4N02A 3BDKA 4F8XA 3VGHA 5AHIA 4ONVA 2XFRA 1H7XA 3WJYA 4C6LA 4JXCA 3ZQ9A 1KM0A 1GPFA 4UQEA 2BLEA 3LENA 4AD4A 1ME7A 3VFLA 2DJLA 2J7CA 1VS1A 4O4WA 1UCWA 1OIFA 3NNTA 3KTSA 2XH7A 3GNRA 4GUHA 5KTLA 2XN1A 3W1RA 5IDIA 1WDRA 2OJPA 2NSOA 1A0CA 5LIXX 1KM6A 4O8RA 1AH0A 3H7RA 4WJ8A 1JEZA 2WC7A 4W5UA 3I3EA 3WF4A 2FZNA 4DNHA 2VM8A 1BYDA 5IFPA 4D1JA 4YS1A 1EIXA 3RO8A 1BVWA 4PBFA 3VOCA 1IQ8A 3RU6A 3SUUA 5A6TC 1V3IA 2INZA