1ECEA

Acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
358
structure length
358
Chain Sequence
AGGGYWHTSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLPYSDDILKPGTMPNSINFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSGQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDSGDTGGILKDDWQTVDTVKDGYLAPIKSSIFDPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of thermostable family 5 endocellulase E1 from Acidothermus cellulolyticus in complex with cellotetraose.
pubmed doi rcsb
source organism Acidothermus cellulolyticus
molecule tags Glycosyl hydrolase
molecule keywords ENDOCELLULASE E1
total genus 136
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1996-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eceA00
3TONA 2X05A 2AAAA 1OINA 2WK2A 3AFBA 1VEMA 1NH6A 3UERA 3WDQA 3WF1A 2ZUUA 1Y7VA 4P7RA 3THCA 1AQMA 1BLIA 2HVMA 4N0RA 1E43A 4UFMA 4HA3A 3SIMA 3AXXA 2ZOXA 1CWYA 2YDQA 2DGAA 3CUHA 1FFRA 1PIGA 1HKJA 4D6EA 1B3VA 3GBDA 1EDGA 3VM5A 4J7RA 1VF8A 3OZPA 4MNKA 1J18A 4M24A 1C90A 2BXZA 5CLWA 2YDRA 2YA0A 1CGXA 1Q4NX 5LA0A 3FN9A 1IV8A 5LYRA 4MNMA 1QI3A 3ARTA 4HPHA 4UOJA 2YBUA 3VNYA 4WIWA 3S6TA 1V6UA 5BCAA 3WH7A 4UOZA 3ALFA 1NOFA 2V3FA 1E4MM 3AHVA 4WSKA 3CUGA 1CYGA 1OD0A 4Z2LA 3L4XA 1GVYA 1FFQA 1E4LA 3KE0A 4WSJA 3WENA 4V27A 4Q22A 3OLDA 2PBGA 4HPGA 4GIAA 1ITCA 3AZSA 3WUFA 1B2YA 4AD0A 5JBEA 3BCFA 3BAIA 1W2VA 5M17A 2BY3A 4PMVA 1LWHA 3SCPA 1HN1A 4EKJA 1OIFA 1C7SA 3OB8A 4L4PA 4CN1A 3PTKA 2DPEA 3IJ7A 1XH1A 1LQ0A 4BS0A 2G4FA 1WDSA 3MS8A 4PTWA 1W9XA 5HDRA 3W37A 4GZJA 3MMWA 1EOKA 2WHJA 3TOPA 2PB1A 8A3HA 3CUFA 4FLQA 2DT2A 3TA9A 5I0DA 2NT0A 1J0JA 1WCGA 4D6IA 5A1AA 1CIUA 1TZ7A 2WHLA 3KWXA 3DC0A 1VENA 3PZMA 2D3LA 4TOQA 2OYMA 2VZVA 3LPPA 1MW3A 3PHAA 3RIKA 1VB9A 3A4AA 1XYZA 1OBAA 2WZIA 1KGXA 4TUFA 5LA2A 3BLKA 4ZXOA 2D23A 3WQ5A 3OLEA 3DYMA 5EMYA 3WY1A 1OCQA 3PZTA 3TP4A 1E6RA 2E40A 1KR0A 2UY2A 6CGTA 1WB0A 2J74A 1MVYA 3MSDA 4W7VA 2CPUA 2XVKA 3VMOA 5LA1A 1HJVA 1JNEA 5IHSA 4WK9A 1E9LA 1L0PA 3EMCA 1DWAM 2XVNA 3ZT5A 4DUWA 1I1WA 4C7GA 1QHOA 2E9LA 3RJYA 3PZUA 3UG4A 2FH6A 1K9FA 3WH6A 4XUYA 2FDMA 4E2OA 3S2CA 4P8VA 5IFPA 3L4YA 3N15A 2GFTA 2PBOA 4NRRA 3GXDA 2DIJA 1OWQA 3WEZA 3MUAA 2NW0A 1C8YA 2WPGA 4Z2GA 3WEOA 4PMDA 1JF6A 5JIPA 1EH9A 4PMOA 1UWUA 3MANA 5I23A 2QMKA 1LJYA 2J79A 3RJXA 3GH7A 4JFTA 1J12A 1U30A 3B9DA 1DWJM 2DSWA 4M80A 2OYKA 1NWSA 1VIWA 4CGTA 4CD5A 1GCYA 3PZIA 1VJZA 4L4OA 4MNJA 3SUUA 1BFNA 5BROA 1CLXA 2VR5A 2VX7A 1LL6A 1P6WA 3AIWA 2YDSA 3OLIA 2XFRA 2W62A 2ZUMA 2WC3A 2ZWYA 3WBEA 4AMCA 4DWSA 4UNIA 3OG2A 4MADA 3CZKA 3SCWA 5D4YA 2W66A 1B3ZA 2WVTA 3VPLA 1D2KA 4GI6A 3EDKA 4AZGA 3AIUA 3MUY1 3VTRA 2D24A 3AHYA 4Y7EA 1UA7A 5I5RA 4CU6A 2V3GA 3RMEA 4R27A 3AHXA 3AMGA 5E9AA 4B16A 9CGTA 4UFLA 2DT1A 1PIFA 3WMCA 3TTOA 1E4IA 4UFIA 4P7QA 1PEZA 1TUXA 1WZLA 1UHVA 4R5EA 2WB5A 3L2MA 5E6ZA 2VQUA 1DTUA 1B3YA 2A3BA 5CJ5A 2Y8KA 3VDAA 2W92A 1GOWA 1CDGA 3QHNA 2XFFA 5KZ6A 2XUCA 3VD9A 2DH3A 3ZQ9A 4DWSC 1W1PA 1Q6CA 1QNOA 1BGGA 1OGGA 1YQ2A 2DT0A 2V3EA 3AHTA 5GNZA 2ZX7A 4JL2A 2VX6A 1SMAA 5FKYA 3PN8A 5I3DA 5A6AA 5A6BD 1C92A 4EAMA 1ECEA 3W82A 3PZGA 4WF7A 2VX4A 5CPQA 5C71A 5E6YA 5A6LA 1UQZA 1C8XA 2QLYA 2VURA 3T2QA 1UD4A 4CN4A 5C8BB 2W67A 7CGTA 3T09A 1H49A 1HJSA 5E70A 3OBAA 4MDOA 5DT5A 4GI9A 3MO4A 3B8SA 3U5UA 3FAXA 4ATDA 1V0LA 2BHYA 2FHFA 1FH8A 1E73M 1ZU8A 3BSHA 3DYOA 4AZBA 5CGTA 1E55A 3FXYA 3RDKA 3BGAA 2XWEA 4HZ7A 2WMJA 5CGMA 3AIQA 5I79A 3AS0A 1JYWA 4JFVA 1BHGA 3BCDA 4GI8A 1CEOA 2J62A 3BC9A 4GPNA 5HNNA 1V0NA 1W2PA 3F4VA 4PTXA 4AZIA 5A6JA 3L2LA 3OGSA 2DEPA 3N04A 2JIEA 1PZ2A 5C70A 3AMKA 5CG0A 5CXPA 3PTQA 4CU7A 2QPSA 3PZOA 5F7UA 3ZT7A 4BQ4A 2GJRA 4D72A 5D9MA 1VEOA 4YHEA 4KWUA 3VDBA 1V03A 1E6PA 4BF7A 4F9JA 1UKQA 4M81A 4PMZA 2CBIA 3ARWA 3ALGA 2WCSA 4PCTA 2DSZA 3VGFA 1JAKA 1YHTA 3WD4A 2DSKA 2JIWA 3MMUA 3WKZA 2F2HA 1B1YA 1ZBCA 1PPIA 1HNYA 1BTCA 2VI0A 5A8OA 3BSGA 3EMQA 3ZT6A 1JZ6A 1BG4A 1HKIA 3VGDA 4PMXA 1UWQA 4QLLA 3MUIA 4ATLA 1LLOA 1UZ4A 1G01A 4D1JA 1XH2A 3BAXA 3WF4A 5BWFA 2Y2WA 5FCZA 3A47A 1TE1A 1R7AA 3ZR5A 1V0MA 3SURA 1V6VA 1UD8A 3VGBA 5DT7A 1W9BM 4U2YA 1V3LA 3PBGA 3BAYA 2CXGA 4UCFA 1GOOA 1E6SM 3GXFA 4YHGA 2VT0A 4BQ3A 4HZ6A 1DWHM 5IFTA 1MFVA 4FLSA 2WMIA 1JYXA 1E0VA 2J7BA 3EDFA 3AS2A 3VGHA 3SCOA 4PTVA 2VJXA 3NIYA 4PMYA 1NOUA 5CPSA 4ZFMA 3GNOA 5EB8A 3WSUA 4KRUA 3KL3A 4JCLA 5AYIA 2CEQA 3AS3A 5A8MA 1QNRA 1ZJAA 4H7VA 2WKGA 1GZJA 4UQDA 1GQLA 1QI0A 4MB3A 3NCOA 2ZWZA 4U3AA 1UR1A 2GJXB 1E72M 2XJ7A 4AZCA 1JF5A 3DECA 2XGBA 5BYWA 4W86A 1R86A 1JYNA 3APGA 1GHRA 4LXFA 4PUEA 3MV11 5E09A 4ML4A 3GM8A 4HOWA 4KRTA 1OT1A 2J78A 3AMLA 2ZUTA 4W84A 1Q6DA 1PX3A 1VFOA 4JFUA 4AEEA 3T0DA 1CXLA 1V3MA 1E40A 1W9PA 1DWFM 1E6NA 3N12A 2WCGA 1XCWA 5A8NA 1ITXA 1W32A 3A3HA 3QHMA 1XD0A 4D6JA 4LYRA 5CSYA 3WQWA 4FF5A 4HMDA 3VIMA 2WVVB 3K8MA 4PEEA 4LPCA 3F5JA 3T08A 1CENA 1E3ZA 2A3EA 2D20A 1TVPA 4E8DA 1GUVA 5A6KA 1O6IA 4XX6A 1M01A 1UH4A 4LYQA 3ZMRA 2WC7A 1A47A 2GK1A 4Z2HA 3M7SA 4EE9A 2CNCA 2VVNA 2XM1A 1KGWA 1KXQA 3OIHA 1UH3A 2XSAA 4M29A 5EFFA 4JCMA 1X6NA 1J0ZA 2J7CA 1E0XA 1E0WA 3W29A 2EPMX 4KGLA 5A6MA 1TVNA 1GOIA 3GH4A 3VKKA 3VIFA 4W8BA 3WD2A 3AQUA 3NSNA 3G6LA 4WLCA 1MXDA 1QW8A 4AY1A 2G8ZA 2J7GA 3W26A 4MB5A 2VR4A 1NARA 4UTFA 3CZJA 4U5IA 2AMGA 4HA4A 5GPRA 3VD3A 4RL3A 2ZUWA 1KCLA 1HVQA 5M5DA 1UA3A 5ABGA 3WQ8A 4B15A 2BHZA 2WLZA 1H0GA 3ZJKA 1GOKA 5FOOA 4RE4A 1WZAA 1X6LA 1CGUA 2CCRA 1JDCA 4C7DA 2O92A 4NSBA 1PX4A 1ZL1A 3N9KA 1J01A 3WNOA 3WNMA 4OZOA 2ZIDA 1IZKA 1TR1A 4W7WA 1F4HA 3FAWA 1C8QA 2XGIA 1JYVA 2CBUA 1B3XA 1CLVA 1W3KA 1XSJA 2VRJA 4H8VA 4F79A 2W91A 3SUWA 1AQHA 1KBKA 2WMKA 1E5NA 4B3LA 4D6CA 3W28A 1J0IA 2EQDA 2TAAA 1EDTA 3N13A 2BY2A 1OD8A 5ECUA 1G1YA 4TX8A 3UEQA 3VDHA 5E0FA 3MV01 2GJPA 2VVSA 4JFWA 2DDXA 1GORA 3A6OA 2W61A 1B9ZA 2YL8A 1WZKA 1J9YA 2XTKA 3B9EA 1KFWA 3WFLA 1I75A 1V0KA 4W93A 1IT0A 1UKPA 4GQRA 1GQKA 3AS1A 1LG2A 3QGVA 2X1IA 3VM7A 3QHOA 4QLKA 2VO5A 5CZKA 2CERA 2EPOA 3RM9A 1OIMA 3UESA 4U2ZA 1VFFA 2O9TA 2UWFA 1US2A 2YL6A 1UUQA 3AIVA 3FHQA 4CD7A 4P7LA 3SUTA 2QF8A 2ZXDA 2YKKA 1QHZA 1FOBA 3CLWA 3WMBA 3WDHA 3OLGA 1HIZA 1UKSA 1D3CA 1HJWA 2ZX6A 4TVCA 4AD1A 4LGXA 2DIEA 2E8ZA 1W3LA 1J11A 1HL8A 1V3JA 5M03A 4CKQA 3UETA 3AZRA 3VINA 2WHKA 2CBVA 1W9UA 3ARUA 1WDRA 2WWDA 4KMQA 5JUVA 4XB3A 4X0VA 4WKHA 3SCUA 2QMJA 3WMSA 1K9DA 5JIWA 1GVIA 4P8XA 2G3MA 3WDRA 2WAGA 1SR0A 5IDIA 4TVDA 3AISA 4ACZA 4W85A 5D8WA 1E1EA 1EQPA 2D1ZA 1KBBA 1HKKA 5BXPA 1DEDA 2WYSA 4GO8A 3UG5A 4GZIA 1W3HA 2B31A 5BRPA 2VL4A 4Z2KA 1US3A 2WZHA 4CD8A 2RGLA 5BXSA 1KXHA 4M8UA 4PMUA 2CKSA 1E3XA 1JXKA 5D9PA 3HMCA 3WBAA 1CBGA 3F5LA 5DFAA 4AW7A 2E9BA 4AZ6A 1MQQA 4Z2IA 1RH9A 2C7FA 1J0YA 1BGAA 2WBKA 3WDPP 4OBRA 1EO5A 4UQEA 4W8AA 3EYPA 1G94A 3VIKA 2Y8VA 1M53A 1UQYA 1LL4A 4F9DA 5FD0A 3VIHA 2J7EA 3I3DA 4PMNA 4H8HA 4CN6A 4D1IA 1XV8A 2XG9A 3RILA 3WQ6A 2X0YA 1H0IA 1NM9A 3FY1A 4OBSA 1KCKA 1VJSA 1WPCA 2OWXA 4GKLA 3VD5A 3OGVA 1ZBWA 1XGZA 3VMNA 2ZXBA 2YL9A 3HJEA 5D9NA 3AROA 2X8RA 2WWCA 4BQ2A 3ZJ6A 2WBGA 2E4TA 2X09A 4JL1A 4JFSA 3ZOAA 3VIJA 2IUZA 5CQ1A 3WF2A 4YPJA 3CHCA 3W4RA 1NP2A 2ZUVA 3ZO9A 1L8NA 2J47A 1G5AA 5FIPA 3PZNA 1XC6A 3BAWA 2BV9A 4MB1A 5D9OA 1AVAA 3W6LA 4P8WA 2JALA 1V02E 3L4WA 2VRQA 3PZQA 2WVUA 3ARSA 5BRQA 3AYSA 5AY7A 4ZE4A 1MW1A 4CD4A 5A95A 4AISA 2CYGA 1BYDA 1GHSA 4IM4A 3CGTA 1BQCA 4GZEA 3VUPA 1ZS2A 3EMZA 2ZX8A 1NP0A 4DM1A 4U5KA 2CETA 3SUVA 4EANA 3ARRA 3U7BA 5A2BA 4P7OA 2D0GA 4H41A 4U3CA 4J3UA 3TTQA 4M1RA 4JKKA 1QBAA 3ZSSA 3QR3A 4UQCA 1TFVA 1CXHA 4PMQA 1SMDA 1VBRA 4AZHA 1QI4A 4A3YA 3K1DA 2F8QA 1XSKA 4HA1A 4AIOA 2BVTA 1W1VA 2CHOA 1EA9C 5AC5A 1UOKA 3WNNA 1U2YA 1XCXA 2OWCA 4MAVA 3CIVA 3UCQA 1MW0A 6A3HA 1QNSA 5FL1A 2Q8XA 5IXEA 2WW5A 3NSMA 1VRXA 1GW1A 1ISXA 3MKKA 1W1YA 4AIEA 2BS9A 3CMGA 2OYLA 5CLTA 3KEHA 4XV0A 4CU8A 3FNDA 5E0CA 1GJWA 4P7NA 1MWOA 3EDEA 2NT1A 1TG7A 2OWWA 2WM0A 5A2AA 3AYRA 4TX6A 1JNDA 3AHZA 4W5UA 1LF1A 4PN2A 5A6BA 3CBWA 3N1AA 4PRWA 1V02A 1OGBA 3GNRA 2CIPA 3M6DA 3RM4A 3AIEA 2Y4SA 1TMQA 2QPUA 2ZXAA 2VZTA 4UOQA 4A3HA 3N18A 1UR2A 2E9MA 2JF7A 3POCA 4DWSB 2E8YA 3WUGA 2VOTA 1E6ZA 3CMJA 3I3EA 3NSXA 2RGMA 4U33A 3UR7A 1JFXA 2O9PA 3L4ZA 1E6XM 1UD2A 1CXEA 5JBDA 1FH9A 1XYFA 2VRKA 4FMVA 3SCTA 2VUYA 1EDQA 2VMFA 2W5FA 4AZ7A 2D2OA 2WC4A 3AXHA 2BHUA 2BY1A 1FH7A 1H09A 2IXUA 4NI3A 3W53A 3NDYA 4D6GA 4NZCA 1JZ3A 3BH4A 3GNPA 2EO7A 4HP5A 1F4AA 3VD4A 2OLHA 2VZSA 2PWHA 2WANA 1XH0A 5D8ZA 3VNZA 4U31A 2Y5EA 4DWSD 1HP5A 1W9DM 5A8QA 4AXNA 2JE8A 3AZTA 4AC1X 4MDPA 2OSWA 3CUIA 1EO7A 4ATWA 3SUSA 1C91A 1UKOA 2VCBA 4K68A 1JG9A 5HPCA 1UD5A 3GXIA 1BSIA 5DEZA 1UR9A 1HL9A 3CHFA 3AMDA 1UWIA 2UY4A 2C8NA 1Q6EA 5I6SA 3WFZA 2W4XA 4HU8A 1GNXA 1HXJA 2ZE0A 3NJ3A 2PWEA 2J8FA 3GYCA 3VIGA 2FHBA 3GH5A 1K6AA 1Z32X 1FP8A 2XSBA 2EEXA 1KQZA 3K46A 3GTNA 4TTGA 3PZVA 1W9VA 1JFHA 3MUZ1 3K8KA 1TA3A 4HMCA 3AMCA 3LPOA 4HMEA 1EHNA 3O6AA 3UR8A 4OOZA 1R8LA 2OSYA 1KXTA 2ZICA 1ISWA 4J27A 3QOMA 4TTUA 5ABFA 3WIJA 3WQVA 4CCEA 3VVGA 2YOCA 3DHPA 3BLPX 1GOQA 1A3HA 1QPKA 3WNKA 5A6SA 3II1A 1KR1A 4JKLA 4B9ZA 1MYRA 2WHMA 1M04A 2BFGA 3CH9A 3DHUA 2WKLA 3NDZA 4UZSA 1IZJA 1S46A 2A3AA 1JI1A 4J3WA 1JI2A 3VIOA 1H41A 4AZCB 1DP0A 4AZ5A 5KEZA 1VFMA 1NWTA 2XIBA 4IPLA 1UG6A 3ARYA 4OOUA 3W6MA 5IHRA 3CTTA 1ODUA 1XHGA 4UR9A 4J3VA 4V2XA 2CITA 4J3XA 1V3HA 2ZUNA 4ZXLA 2IXVA 1HP4A 1SYTA 3EBVA 1G0CA 4D71A 4AD5A 1XRVA 1KXVA 2G41A 1E6QM 4W89A 5HPOA 5ABEA 2G3IA 3IK2A 1JIBA 3U57A 1DHKA 1NWRA 2BVYA 2YLAA 4DM2A 3VGGA 1WKYA 1XSIA 1WDPA 3ARVA 4MTVA 2PWGA 3VD7A 2V38A 1WO2A 4AD2A 3K4DA 5JBFA 1BYBA 1OB0A 4URIA 1W3JA 3WEMA 5I78A 2J4GA 3ARXA 1CTNA 1LL7A 4TXEA 1CNVA 2FHCA 3AI0A 3GDBA 2VCCA 4MNLA 4ACYA 3W38A 2CESA 2HISA 1JAEA 4B3KA 3ARZA 3PZ9A 2D3NA 1UZ1A 1V6YA 3BAKA 1R85A 1JZ8A 2PWFA 5A3HA 2O9OA 3LPGA 4PMRA 3SCVA 2GJXA 2J7HA 3WNLA 1M7XA 1C93A 3IANA 3W24A 4JHOA 1BVZA 4ZEPA 1QVBA 3J7HA 2XVLA 3VGEA 1ZB5A 1HT6A 4ZE5A 4BQ5A 1FA2A 4P8UA 1MXGA 4W8LA 1FP9A 3CZGA 4WKAA 2GVYA 2QV4A 1J0KA 1H2JA 2XWDA 4JZ5A 3UG3A 1AMYA 2PF0A 2PC8A 1ESWA 3VX1A 3CZLA 4W87A 4D6DA 1KWGA 3VDCA 2DH2A 1EHAA 1JDAA 1E56A 4F66A 1OM0A 4PTMA 5A69A 4CVUA 1HJQA 1X1NA 1NWUA 1DWGM 3WH5A 2EPKX 3SEPA 5DF0A 1UR0A 3WH9A 5FL0A 2NSXA 2EBNA 4NF7A 2GK1B 3WF3A 3M46A 1KGUA 2FH8A 1LWJA 1CXFA 1KWKA 1Q6FA 3WQ4A 5HOSA 1JGIA 1GQIA 1U33A 4X0NA 3WL1A 4H2CA 3ARPA 1TCMA 3GZAA 4IUGA 3K4AA 4QCFA 1QOXA 1WZMA 2D0FA 4WJXA 3U5YA 4MJ4A 1BYCA 4GINA 3BAJA 2CKRA 1N82A 3AOFA 3FW6A 1UD3A 1ZBKA 1QNPA 2YIHA 4HOZA 2JEPA 5M3WA 1QI5A 4FK9A 4WKFA 3TTYA 3OZOA 6TAAA 3RPMA 3AIBA 3WD0A 4UQBA 1BF2A 1E15A 2D22A 1B31A 3L4VA 1CGVA 3VILA 1UWTA 1CGWA 4C7FA 1MQPA 3CPUA 3I3BA 2X0HA 3O9NA 5ABHA 5AYBA 4QDMA 3CO4A 3ZJ7A 5EFDA 4MPKA 3QOKA 1JZ2A 1EIBA 4OUEA 5DO8A 3VO0A 4JHZA 2BXYA 1OGSA 5A8PA 1JL8A 2ZUSA 1OSEA 1C3FA 1B3WA 3LPFA 1BYAA 4FLOA 1J10A 3KL5A 3EDDA 2ZX5A 2QHAA 3CUJA 3A4WA 4CD6A 1QHPA 2J7DA 1JD7A 2JFEX 2J7FA 4Q7NA 2VCAA 4W7UA 3VIIA 3ZR6A 4M56A 1ODZA 4OKDA 1WDQA 2WNWA 3BXWA 1ISVA 1GOMA 2J77A 3IJ8A 2A3HA 2GDUA 1WE5A 3SCQA 4AWEA 2V3DA 1SFSA 3VX0A 4NRSA 1CZ1A 3HN3A 4X9YA 4CCCA 5BXRA 3WUBA 3NYDA 1HJUA 4S3KA 4KGJA 2XHYA 2WZEA 4JKMA 2EXOA 3SCSA 1VEPA 2DT3A 2YBTA 3ECQA 1E1FA 4IPNB 4J3SA 1B0IA 1H1NA 4V28A 4BCEA 1K9TA 1HJXA 1DWIM 2MANA 2WSKA 4UQAA 5AC4A 1TA3B 4RE3A 4PSPA 4Z2JA 3K8LA 5I77A 3KZSA 3W25A 3EDJA 2DQXA 1LG1A 4MAZA 5CPTA 2ZXQA 3IJ9A 4PCSA 3OGRA 3WDIA 1MFUA 3CZ8A 3T0BA 4JIEA 2GSJA 2OSXA 1UH2A 4QCEA 3BMWA 1HF6A 4MJ2A 3WDJA 1GPFA 1WNOA 3RO8A 1GONA 3MU7A 1PJ9A 1WP6A 3IAQA 1MQRA 2UY3A 2XVPA 2FGZA 3WNPA 1QNQA 4IISA 4QP0A 3WN6A 3IAPA 1CGYA 1AQ0A 2EPLX 2WMIB 4EK7A 3T2PA 4H04A 3AICA 4LQ1A 1RP8A 1FHDA 2ZX9A 4GQQA 1CGTA 1I1XA 3RM8A 4PSRA 1GQJA 4GO9A 2XVGA 2VZOA 3WH8A 4LX4A 1KQYA 1KB3A 2O9RA 3M07A 2E3ZA 1D7FA 1EQCA 3B9AA 1B30A 1HKMA 4QFUA 5DMYA 4AEFA 3AJ7A 3D3AA 5A94A 1G9HA 1RPKA 4UFJA 2PI6A 4JAWA 1UR8A 4FLRA 1B90A 4DUXA 4RE2A 2VNCA 1HVXA 2DSUA 3T0AA 2YJQA 3DYPA 4E8CA 1W1TA 2BVDA 1E4NA 1V6WA 4W88A 1JZ7A 3OA5A 3ZJ8A 4PUDA 4W5ZA 2WLYA 2XYLA 2EPNA 1JXJA 1VBUA 3MSGA 1CXKA 1XD1A 2XIIA 1JZ4A 3RCNA 1E70M 2ESCA 4ACZB 1RD6A 3D5HA 4XZBA 3ZIZA 2JF6A 2XM2A 1V3KA 4AD4A 3N11A 1JZ5A 1ISYA 3WD1A 2WSPA 4A4AA 3TTSA 2XPKA 2JEQA 3A4XA 3POHA 2Y24A 3SCNA 1J0HA 2VQTA 2X2YA 5I2UA 1PX8A 4HZ8A 2G3JA 5I24A 1EOMA 3KL0A 4LYPA 1H4PA 5HXMA 3SCRA 4J28A 2GUYA 4QLJA 1ZJBA 1VFUA 2BNJA 1W91A 1E71M 5GNYA 3N17A 1OT2A 2V5DA 3NUKA 2VX5A 3LMYA 3L4TA 3JUGA 1NOWA 2PWDA 3ZM8A 4E4PA 1M03A 2WXDM 4OIFA 5TD4A 1K9EA 1PBGA 3ARQA 1R7OA 4H8UA 2WCAA 2G3NA 2XFYA 4CUCA 2J25A 1UWRA 4S3JA 3BMVA 3T2OA 3L4UA 4MB4A 3U7VA 2D0HA 4PBGA 1H3GA 1QW9A 4F8XA 3PTMA 4D6FA 3WL0A 2DSVA 3CHDA 4QAWA 4UFKA 5ABFB 2CHNA 2YL5A 5A2CA 1PZ3A 3WF0A 3GBEA 4GXPA 2WVSA 2YA1A 4BA0A 4B9YA 3CZEA 3WUEA 3HU7A 1VAHA 4N42A 5HBFA 4OJYA 1UKTA 4TVUA 2WMFA 4DUVA 1PAMA 2A3CA 5EBAA 3FHAA 1ISZA 1BAGA 4YN5A 1CPUA 4AD3A 1UYQA 3THDA 3E1F1 1HX0A 2Z1KA 3O2LA 1ZBVA 1BPLB 3VMPA 4M82A 2J75A 4HU0A 7TAAA 1Q6GA 3MMDA 1CXIA 4CCDA 2F61A 2EJ1A 4HOXA 8CGTA 4J3TA 1UR4A 1JD9A 4D6HA 3W0KA 4ZENA 4UQ9A 2UY5A 1CECA 1BG9A 2C0HA 2J8GA 1QI2A 2V5CA 1H11A 3W27A 7A3HA 1FHLA 2FGLA 3AXIA 2WVVA 3WD3A 2YLLA 3GXMA 1EGZA 3W81A 3CHEA 5CSUA 1O7AA 4AIUA 1QBBA 1V3IA 1UD6A 1JDDA 2E0PA 2VZUA 4HTYA 2VTFA 4AYSA 2YA2A 1UWSA 4XZWA 2AOSA 2W63A 5GNXA 2WMHA 4KH2A 3AIRA 1H5VA 1C7TA 5GQBA 4CVWA 4BZYA 2Z1SA 3VOCA 1RP9A 3G6MA 4PYSA 1BVNP 1GJUA 3WELA 1V6XA 3VU2A 1NQ6A 1E5JA 5BXTA 1R87A 1EXPA 2BY0A 1WAWA 3F5KA 4UFHA 2VC9A 4UZUA 1MW2A 3ZSTA 2CBJA 2WMGA 2GDVA 1V08A 3VIPA
chains in the Genus database with same CATH superfamily
4N02A 1P1XA 4JIQA 3OZMA 3D0CA 3FV9A 3UERA 3WF1A 2CZEA 3UZ5A 3NQBA 4RXFA 1FQ0A 3QYSA 4H00A 1Y7VA 4P7RA 2PU0A 1NELA 1AQMA 4C6BA 3B0UX 4N0RA 2DZXA 2BGNE 1GYMA 1DPMA 3H21A 4XO6A 2DGAA 2PDUA 1PIGA 1HKJA 2BGSA 2IPJA 5L9FA 1ME8A 4DI9A 4FX6M 1ZHAA 3RF9A 4A6GA 1OQFA 5LA0A 1IV8A 3ANYA 4IX0A 1QI3A 3REQB 4HPHA 1NDZA 3GW0A 4XIMA 5BCAA 1IIGA 1RA0A 3H2AA 3WH7A 4DY1A 4O16A 1NOFA 4HHHA 4WSKA 3STCA 2NQZA 1PTAA 4GC4A 2PDYA 3GFXA 1XWYA 5G5IA 3AZSA 2C15A 4U28A 1DQUA 1W2VA 2DUXA 4JTEA 4LU0A 3GKFA 3DG7A 4LUIA 5CPMA 5I06A 4Q33A 3AXMA 1HN1A 4EKJA 3RAOA 2W0UA 3E0WA 2VYOA 4QXIA 3OB8A 3G3MA 4L4PA 2C19A 4JGDA 3U3HA 3S2NA 1LQ0A 3S5YA 2QDDA 1H5YA 2Z24A 3LD5A 1I60A 4PCFA 3VKBA 3TOPA 3CUFA 4FLQA 3P60A 3S2MA 3ABRA 4D6IA 1CIUA 2DZSA 4JTRA 1XDJA 1XRFA 2WHLA 4GXMA 3NVTA 2D3LA 1REQA 4LEQA 3PPHA 1OK4A 3LPPA 2WQDA 2QJHA 4ZB2A 1T6MA 1AL7A 4YS1A 3LLFA 2Q3OA 3BLKA 5BRBA 2HQAA 4DQWA 1RY0A 3TJLA 3N14A 2Q71A 2AGKA 3TWBA 5EMYA 3WY1A 1IR1A 3JRKA 4MY1A 4RV8A 1KR0A 3C6CA 1W37A 3HF3A 6CGTA 4LB4A 1MVYA 5HQMA 2CPUA 2XVKA 5LA1A 5HMDA 2NV2A 2ZDSA 1E9LA 3JZEA 1L0PA 3H53A 1DWAM 4DUWA 2E9LA 3KVMA 5F1VA 3PZUA 2FH6A 4K39A 1LUCA 2CWNA 3T4CA 1UZHA 4YTUA 2FDMA 3S2CA 4P8VA 5IFPA 3IGHX 2GFTA 2PBOA 4H9YA 4A21A 1M9HA 2WV8A 1E1CB 2ONEA 1CCWB 1GEHA 4PMDA 1JF6A 3CQHA 2HVNA 4DZIA 4PFHA 1LBLA 2J79A 3RJXA 1DJQA 4ILSA 1O66A 1NWSA 1WA3A 3PZIA 3TEVA 2EGZA 3SUUA 4H6QA 2DZTA 5BROA 2VX7A 1LOSA 1K8YA 3QW4B 1UUMA 2PD5A 2ZUMA 2Z7KA 2PDMA 2JGQA 4MADA 1B3ZA 2WVTA 3EX6A 1D2KA 2Y5SA 2Y7EA 1Q3NA 1BKHA 4E3TA 3SRFA 4UB9A 1AZ1A 3AHYA 3OHMB 2QCMA 4FS9A 3AWOA 3E0IA 2P3EA 4R27A 4AG0A 4GI4A 1PIFA 3WMCA 3TTOA 1O5XA 1VPXA 4P7QA 1PB0A 1UP2A 4Q4SA 1UHVA 4RDWA 2QF7A 5E6ZA 2VQUA 2HNHA 1ZZMA 1FXPA 1EX1A 1S2VA 2Y8KA 3WLPA 1CDGA 1YNQA 2XFFA 4HGXA 5EA9A 4CNNA 2DH3A 3A64A 1KFBA 1VBGA 5LGXA 1ZFJA 1MUCA 1W1PA 3W1LA 4I3GA 4CQ9A 2OX4A 1OGGA 4JYEA 5KTLA 3H54A 2V3EA 2QS8A 3O05A 1EF3A 3AHTA 4FNQA 2QPXA 1SMAA 3PN8A 1ZPTA 5A6AA 3W83A 4DUOA 1C92A 4AWSA 2ACRA 1UC4A 1UROA 4WF7A 2I5GA 4O1DA 1IXNA 1FWDC 2VURA 4HJWA 4JIRA 1XP3A 3RPTA 4OFCA 3TUUA 3W07A 2W67A 3OBAA 4C6QA 4M7SA 4ATDA 3G0UA 1V0LA 1XPYA 3O0FA 1ZU8A 3BSHA 1AMKA 2YBVA 1E55A 3FJ6A 3K1GA 2XWEA 4HZ7A 2X16A 5HUPA 1ECQA 4F0SA 1F76A 3CC1A 4PA8A 3AS0A 3LTPA 1KA9F 2I14A 3BCDA 4GI8A 1Q8AA 3E0LA 4C90A 3PFMA 1W2PA 3LI1A 1Q6QA 3L2LA 3OGSA 4IMEA 2VGGA 2BODX 2DEPA 2OEMA 4ADSA 2B4GA 3SW6A 4MLJA 4WY0B 4CU7A 4K7YA 5XIMA 1A3XA 2GJRA 1UJQA 3M9YA 4F9JA 4QE1A 3GYEA 4M81A 2QUUA 3DX5A 3WJYA 1I45A 2CBIA 3TFCA 3W00A 3L66A 3MB9A 4PEKA 3WD4A 1TPWA 3R2GA 1XBXA 2DSKA 1G4TA 3WKZA 3FS2A 1TPFA 3S8HA 1XKJA 1BTCA 2VI0A 4BY3A 2NXGA 4DI8A 3W1QA 3TZFA 3ZT6A 2ZKMX 2R82A 1BG4A 1JPDX 1HKIA 5G2WA 1PKYA 5U7SA 3PBUA 1G01A 4Z1YA 1XH2A 3KWSA 4NXSA 4US5A 5XINA 2A3LA 3I65A 3GVWA 3A47A 4QJ4B 3ZR5A 1HFBA 4NZ5A 2PLKA 1DKWA 5A8GA 3JU2A 5DT7A 1V3LA 2VDHA 1PS9A 2PLMA 4FIRA 1D3GA 3KM8A 1GOOA 1XISA 2VT0A 4BQ3A 3DFTA 1WOAA 2WMIA 2NQ9A 1AH0A 5LHFA 2ZC8A 3EDFA 5RUBA 3SCOA 2HNEA 2CLEA 2OR2A 1ML1A 2NXHA 4ZFMA 2B0MA 2E67A 4JDBA 3RYSA 2PTDA 5FI8A 3O3RA 5CGQA 5EB8A 2P76A 4KRUA 3KL3A 4O11A 4P2VA 3KTXA 3CV6A 1C29A 5A8MA 1S3TC 3JR2A 3R0KA 1DVJA 3P0XA 5D09A 3PTDA 4YNGA 4EPEC 2OO0A 1T5AA 3IK4A 4UQDA 1GQLA 3DKJA 1EX5A 1QNVA 4XKYB 2ZWZA 1KBJA 4W86A 3QV8A 5FF2A 4REQB 1A5SA 1A5MC 3MV11 1MEIA 1T99A 4RZ6A 2J78A 3AMLA 2ZUTA 4W84A 1PX3A 3HBLA 1A80A 2OGYA 1W9PA 3KDNA 3G1VA 5A8NA 1ITXA 3A3HA 4L1WA 3QHMA 1XD0A 4ZO6A 5T8GA 2NQJA 3OVGA 4NJJA 3DCPA 2WJZA 1VLWA 3GDMA 3SFWA 2A3EA 2D20A 2PCQA 1TVPA 1LLZA 4D2JA 4E8DA 1GUVA 2FTYA 2NUXA 3S9ZA 4XX6A 2QJGA 1TV3A 4IQJA 2WC7A 2Z29A 4Y9PA 3M7SA 2QUVA 4EE9A 4YCOA 1GVRA 2PGRA 2CNCA 5FJOA 4MLRA 1UH3A 4QDWA 4M29A 1X1OA 3Q94A 2J7CA 4LAOA 4KGLA 1RPXA 2BXVA 1TVNA 3EOUA 1GOIA 3GH4A 3VKKA 1FHUA 3R0DA 1DHPA 4QSFA 3WLHA 1KM4A 2A5HA 3G6LA 3EPOA 1FVPA 3S1WA 1QW8A 3O7UA 2G8ZA 1X38A 3UA3A 2PEVA 4MB5A 3W7JA 1OZMA 1W8SA 1NIUA 3BZGA 4RV3A 1FCVA 3VD3A 3QQ0A 4GA8A 3TNOA 1KCLA 3GG0A 1HVQA 3SBFA 4OV9A 4F48A 4XD4A 3WQ8A 4B15A 2QW5A 1T96A 2HMCA 3GC5A 2E6AA 2Z00A 2VOMA 1MUWA 2DVUA 4IGNA 4C7DA 2O92A 4GVGA 3N9KA 2PDBA 2QJIA 5H8PA 1C8QA 1B3XA 1V4YA 1W3KA 3FYYA 3L0NA 2EQDA 5ECUA 3BURA 3N13A 1MDRA 2A6LA 1HO1A 4TX8A 4BWLA 4K6AA 4A8LA 4DJED 2I57A 1J5TA 2RFGA 2FQIA 4JFWA 1GORA 2A0NA 4TMCA 1I75A 4W93A 1IT0A 1UKPA 4BHYA 4GQRA 3I68A 2VDIA 1XCFA 2Y7FA 4KPLA 4YTSA 2QDEA 4XO7A 1K8CA 2F6XA 4IT1A 4U2ZA 2J27A 1VFFA 3E49A 4US5D 1OC7A 4N9BA 3U4FA 2ZXDA 2YKKA 2POZA 3GHTA 3EB3A 3CLWA 3WMBA 3WDHA 4QSHA 1G6CA 3GVRA 1HJWA 4AD1A 3SSZA 1J11A 3LS9A 1V3JA 4ZO9A 2P10A 4CKQA 2WHKA 3DAQA 1W9UA 3ARUA 1WDRA 4CCZA 3W6YA 5JUVA 1SO3A 3IV3A 5BW6A 2GVJA 1YW1A 3GD6A 1D8WA 4D8ZA 1K9DA 5JIWA 4IP4A 2OOFA 4WEVX 1MSSA 2OOGA 3PWAA 2GZXA 3TQVA 1E1EA 3QPZA 1BWKA 1EQPA 1HGWA 3W70A 1HKKA 3F4NA 4I90A 2ASHA 4B91A 1DEDA 1A50A 2WYSA 2GQ8A 4YJ5A 1MNSA 4TIMA 3UG5A 4RNIA 4JTAA 4OVXA 4TR9A 1G4SA 1LT7A 2EF9A 1US3A 1HTIA 3NQ2A 1NTHA 3UY7A 4HJFA 2IPWA 2CKSA 2OTDA 2UV8G 1LQAA 3O07A 3PBYA 3T44A 5DFAA 4AW7A 3T7VA 4GQ0A 2VELA 3PULA 5C2GA 1J0YA 4GY1A 5LGZA 1EGMA 1PDYA 2XISA 3UW6A 2Y70A 4UQEA 4IOTA 3VIKA 2Y8VA 1M53A 4NZJA 2Z7GA 1LP6A 4NNBA 3BLLA 4CEUC 2FZMA 1UQYA 4OQVA 1NY1A 1M41A 3MYOA 1W1B1 2E6DA 1ZNNA 3TAKA 1VLIA 4KEMA 3ZWTA 3I3DA 1XFCA 4WGXA 1FWNA 2INEA 1TCDA 2VEFA 4LAUA 1XKYA 4DN1A 5GJMA 1AG1O 1XBVA 3WO8A 3ITOA 3C61A 1PE1A 4MYAA 1WPCA 3O6DA 4CLMA 4GKLA 5AHFA 1KM0A 2YL9A 3HJEA 1VRDA 1E9YB 4KWWA 5CJNA 3HGJA 4WGHA 5MF5A 1KV8A 2CFFA 3N29A 4JL1A 4JFSA 3SY1A 2VENA 3BW4A 3VIJA 1A3WA 1BXBA 3P81A 4YPJA 3BLOA 4AF0A 3VOHA 3WG6A 4G8TA 2ZUVA 4GBDA 4GFSA 3ZO9A 5H8UA 4XD3A 1YPIA 2J47A 4UMBA 1XC6A 4XIAA 2BV9A 1K70A 4N2YA 1VZWA 3A9IA 1TWIA 3W6LA 1XW8A 4F0LA 1K7FA 5F4WA 4LBSA 4CD4A 2QVHA 5AB3A 3CGTA 1BQCA 3VUPA 3UU0A 1ZS2A 2XIJA 3EXTA 3EMZA 2HWGA 5EMKA 1T0OA 5DCEA 4Y8FA 4U5KA 1KCXA 3MI2A 1TSIA 3GY1A 5MHBA 4OU1A 2Y85A 4DYEA 3DFYA 2Z25A 5CPLA 1PXGA 3HG5A 1KM1A 4DJFC 4UQCA 1FWWA 1TFVA 3GXNA 3UJEA 3U2ZA 1VBRA 3B05A 1SO4A 4S1FA 4AZHA 1RJPA 1FDZA 2BVTA 3H22A 1R9ZA 4HHLA 4I9JA 1XIFA 5FESA 3UCQA 4ZVJA 5KETA 5IXEA 3RRAA 3CWNA 4RDYA 4H3DA 4ROQA 3N2OA 3MKKA 3OHIA 5CLTA 4JTLA 1Q6RA 1GJWA 3U0HA 3EA2A 5CC7A 3MP4A 4TO8A 3AYRA 1LT8A 3I7SA 1XQKA 2Y7GA 2YZRA 3A12A 3GNRA 3U6WA 4G5DA 3UR2A 2VFHA 4LRSA 4ADUA 2A7PA 3IJQA 3RM4A 3E2RA 4A3HA 1B4EA 3POCA 4DWSB 1KTCA 2YXGA 3GTHA 3QMSA 3BE7A 3QM3A 4XBSA 5F4XA 1ZRQA 1E9ZB 2IKGA 4ERIA 3FVDA 3EX4A 2HCVA 3L4ZA 1GYLA 1CXEA 1YEYA 5HQLA 3SCTA 2AKMA 2VUYA 2WC4A 2QCDA 2O55A 3KOWA 2BHUA 1POKA 2BY1A 5FEWA 1NF0A 4D6GA 4NZCA 1QOQA 4NZFA 4Y9OA 3GNPA 1VHCA 1XJBA 1TJ1A 4BR1A 2HXUA 2WANA 3OYZA 4DAIA 1UOZA 1HP5A 1W9DM 3LQGA 1ME9A 4KW2A 2JE8A 1J2WA 1QO5A 1Y5WA 4MVAA 1A0CA 3HO8A 2ZBTA 3VZXA 4ZO7A 2CLHA 3LHWA 3QLDA 4RXGA 4FOUA 5CPNA 3S1VA 1JDFA 1UKOA 2VCBA 4AX6A 1FY6A 1VPQA 1YRRA 5HPCA 5HANA 3DESA 3GXIA 2FMOA 1BSIA 1P0EA 4Q7BA 4RCXA 2C8NA 3O16A 3APYA 4H9MA 2XH7A 4ZO8A 1QK2A 1HXJA 1VD6A 3GYCA 5C7HA 1F7BA 3SQSA 3VIGA 2ACSA 2BBFA 3OQEA 3GH5A 3RR1A 2I7GA 4XBJA 3QZAA 1Q2RA 4MWAD 1KQZA 4AFYA 3PPFA 3K46A 3T0CA 1DV7A 1EKOA 3PZVA 1XRTA 4IP7A 4C6JA 1JFHA 3MUZ1 3GLCA 4GD0A 3LCLA 4L9YA 4Z1CA 2FZDA 4HMCA 4DXVA 3LPOA 1EHNA 2ZYFA 4DBEA 1KXTA 3L12A 2YSWA 3BICA 1ISWA 3DUGA 3GR8A 4TTUA 3WQVA 1RBOB 3KVKA 4J1OA 4ICMA 3MZ2A 3VVGA 4TQTA 4BK9A 1GOQA 3II1A 1P0DA 3H4WA 2WHMA 4B5XA 1JQXA 1ZY9A 3W75A 4HYWA 5C55A 1R3QA 2X0SA 4WDXA 2RDXA 4J3WA 4AMAA 4JTIA 4XK2A 3BW3A 2F38A 3G8EA 3LHVA 3N34A 3SQMA 3WK0A 4IPLA 3T78A 4RR4A 3QGAC 4OOUA 1HW6A 5HWNA 2W27A 1ODUA 4UR9A 1OHLA 4IPPA 1V3HA 1GKQA 2ZUNA 2X41A 1H60A 1SM9A 3BQ5A 4NI8A 4ZZ9A 4AD5A 1FDJA 3W86A 3U2OA 1FCUA 1Z3NA 1E6QM 4HYVA 3BG9A 3VCRA 1DHKA 1NWRA 2BVYA 4NILA 3VGGA 1XSIA 3GXTA 2V38A 4AD2A 5EMLA 5JBFA 1W3JA 3WEMA 1O60A 2DQWA 2J4GA 1CTNA 3O63A 3RLVA 1CNVA 4K36A 3AU6A 4JTHA 4J5NA 2CESA 1O5KA 1JAEA 2YB1A 4MWAB 2Z6JA 3ARZA 3JS3A 1XLEA 3LHUA 3MCOA 3QR0A 4IPIA 4XZ9A 4HCHA 2P0OA 2GJXA 4XAYA 3WNLA 2FTPA 1FWTA 1M7XA 3E2QA 3IANA 2PA6A 2QCDB 3S5OA 1BVZA 4ZEPA 1QVBA 2NUYA 4R9OA 1ZB5A 1FA2A 1MXGA 3CZGA 2GVYA 4PZVA 1J0KA 1H2JA 3L68A 4RW3A 1UPPA 1BXCA 4QX4A 4S38A 5B80A 3OODA 2ZRYA 1K8ZA 1KM3A 1V6TA 3F1QA 4D6DA 1OX4B 4HK7A 1GG1A 3W02A 4F0KA 3VDCA 1NDWA 1IGWA 2R94A 1RHCA 4MKVA 2F6UA 1E56A 2QJNA 3M47A 4PTMA 1MDLA 3A24A 3PR2A 3U9IA 1HJQA 1DWGM 2VFFA 4IMGA 5AC6A 2YB4A 5DF0A 2NSXA 2EBNA 4O8AA 1D9EA 3DENA 4NF7A 3E02A 4JTJA 3WF3A 3M46A 1KGUA 1CXFA 3NEVA 3UYIA 1WUFA 4GABA 4NJGA 3WL1A 4H2CA 4JTGA 3ARPA 1A5BA 4UTTA 4BJHA 3L65A 3K4AA 3LB0A 4QCFA 3NO5A 2D0FA 4WJXA 3SRDA 3NWRA 3BAJA 4HK5A 4FAMA 1XFBA 8TIMA 1XDMA 1WQ5A 4JIHA 4ZBCA 1RQEA 3G24A 4JTUA 1GZGA 3RPMA 3M64A 4OUIA 3TJ4A 3ZXWA 4J2MA 2D22A 3L4VA 4Q8VA 1CGVA 1GVSA 4G2DA 1CGWA 3D47A 2PDJA 4C7FA 1MQPA 3I3BA 5ABHA 4QDMA 1ZQ5A 3CO4A 3ZJ7A 3OVPA 5C9XA 4CEXC 1YX1A 3DDMA 3TYDA 4KKXA 5A8PA 4I9AA 4YL2A 1KD0A 4HNCA 4RNFA 3SSJA 4AVFA 5CBJA 3LPFA 4WHBA 4QEHA 3WX7A 1BYAA 1YTEA 2YPIA 4IXHA 3EDDA 3M0MA 2V68A 1M7JA 4LF2A 3A4WA 1EPXA 1AW5A 1QHPA 1YDYA 2J7DA 1QJWA 2PRMA 2NV9A 3LM7A 1UMLA 8RUCA 4AHOA 4JOMA 1ODZA 1R46A 3BXWA 4ZQOA 2J77A 3O6YX 2A3HA 2GDUA 3TW7A 1TV7A 3EGJA 2V3DA 1H7WA 3CH0A 4NRSA 3KX6A 3LQLA 3LSCA 5EMMA 4F2BA 4C1NA 3WUBA 4S3KA 3V5OA 1U83A 4BI7A 4JKMA 2VC5A 3ECQA 2WNNA 4HSNA 5MKGA 4NHVA 4OT7A 3H6OA 1DWIM 2WSKA 4CNPA 5AC4A 4L65A 4QS6A 1SJAA 4GXWA 3GX9A 3W25A 5HJLA 3FXGA 3SJNA 3KTCA 1MFUA 5CZ0A 1VKFA 2GGGA 1JEZA 4IIBA 4WDTA 3W1XA 1S5VA 4EXBA 4IPJA 4Q8TA 1VBHA 3ANUA 2GWNA 2Z28A 3RLUA 4QCEA 3R4IA 1GPFA 2R1KA 3SN0A 1WNOA 1JPKA 3FEQA 1WP6A 4NY2A 2QYGA 3IIZA 1QNQA 4XG1A 4IISA 1AQ0A 3RGTA 2ACUA 4FALA 1UASA 3ISIX 3C4UA 2J6VA 3SRKA 1RP8A 4FXRA 3GC4A 5HWJA 1I1XA 3RM8A 4PSRA 1X97A 1GQJA 3NPVA 3OTRA 1I2RA 3TXZA 5HA7A 2VFDA 2O9RA 3GHUA 3HPSA 2C1HA 2GQ3A 5DMYA 3VE7A 5M1TA 4TX9A 3AJ7A 3ENLA 1G9HA 4K8GA 2FLIA 3B03A 1EF2A 4FLRA 1B90A 5HR6A 3DYPA 1W1TA 2BVDA 1H1ZA 4DEFA 5AN7A 4PCPA 4PUDA 4W5ZA 4QG6A 4IIHA 2ZVRA 1XLJA 2EPNA 4IFOA 3MSGA 5FF4A 4N6EA 1CXKA 1JZ4A 3THQA 4IGMA 1H7PA 1E70M 2ESCA 4ACZB 1RD6A 1RJQA 3CM4A 2PTYA 2QT3A 1AJ0A 4Q8UA 3S47A 1YBQA 2BWGA 1IXQA 3BTNA 4C6MA 1V3KA 4KFPA 2WKJA 3GAKA 1ISYA 3WD1A 1O68A 3TTSA 2ALDA 2XPKA 2JEQA 2Y24A 3SCNA 2X2GA 3KS6A 3MO7A 4HZ8A 5IDZA 2G3JA 3UNTA 2VKZG 3TC6A 1H4PA 5I03A 4WDUA 2GUYA 2ISVA 4BEQA 5B7YA 1ZJBA 2X1RA 4HMNA 5GNYA 3N4FA 3PY2A 4FNTA 3DBPA 1NOWA 2L5HA 4E4PA 3PPGA 1K9EA 3QXBA 3FSTA 2AKZA 3SGZA 1TV4A 1I2NA 4CUCA 3DGBA 2QUTA 1J2BA 2J25A 2DP3A 3FSUA 1GWJA 2YXXA 3T05A 2UZ9A 4F8XA 4D6FA 3T9PA 1D8CA 1NQKA 2DSVA 4QAWA 4UFKA 5ABFB 1JPMA 3UJ2A 3SN4A 4AF0B 4BA0A 3WUEA 5HJYA 1B57A 4ZMGA 5LIYX 3NFUA 1PAMA 2A3CA 3SY5A 2HS6A 3GIQA 5EBAA 3FHAA 1ISZA 1KRBC 2XZ7A 2Z1VA 3M16A 1DIEA 3CL7A 4QBXA 4M7TA 5CZSA 4LAMA 1OX4A 3G3DA 4PR4A 1EJWC 3TSMA 2H9AB 4PB5A 4L1XA 4RPPA 3P2VA 1CXIA 8CGTA 1TPB1 4J3TA 1B3OA 2GQ9A 3OOQA 4LEFA 1JD9A 3R8RA 4BI5A 3TE9A 5AECA 3F2DA 3B8DA 4FZIA 4ZENA 5TNVA 1CECA 1F2JA 3DC8A 2WZTA 2ZADA 5DMNA 3W27A 2XN1A 4PODA 2ADAA 3EPMA 3LXCA 3SQLA 3ATYA 1JDDA 2E0PA 2VTFA 4FO4A 4XZWA 1SZGA 2AOSA 2W63A 5GNXA 3LNPA 1C7TA 5GQBA 1W6TA 3QMTA 2DZBA 5JXQA 2IQDA 1YYAA 3YPIA 3N19B 1EXPA 3VFCA 4NU7A 4IG2A 4HHPA 2EPHA 3NVDA 2ON3A 3L5MA 2WMGA 3EB4A 4L6DA 1RV8A 1H63A 1OINA 5FJUA 3G5EA 1VEMA 4ZL1A 4V33A 3N4EA 2E77A 4EXAA 2A7RA 4O12A 1BLIA 2YDAA 2B7PA 4HNUA 1E43A 2QAPA 3H70A 4DHGA 3QY6A 5EPDA 2YDQA 3CUHA 3C2RA 1B3VA 1TMLA 1EDGA 3VM5A 3F4DA 5SWUA 1J18A 2YFNA 4LC8A 1C90A 3N25A 2JQXA 3EAUA 1Q4NX 3I10A 3TQKA 3E96A 4UTJA 3FN9A 3LLDA 4MNMA 4C6DA 1F8IA 4RDZA 3I6TA 1SW3A 4G9PA 3R6IA 4UOZA 3RFAA 3V16A 4DJDD 3TN4A 2V3FA 3NQEA 4GVHA 1KNWA 4BKNA 4M6UA 4E2BA 3CJPA 3CUGA 1POJA 1FFQA 1E4LA 1SW7A 4HYRA 2V2CA 3WENA 3MI3A 3KUMA 1U22A 1JUBA 2OCZA 1S2AA 1Q2SA 1EJVC 4L6HA 3WQPA 3WLSA 1AL8A 2QKFA 4GK8A 4K7VA 3MYPA 2BY3A 4XTDA 4PMVA 3SCPA 4O53A 4ZSUA 1C7SA 1ZTVA 2OKTA 1HG3A 2YZ5A 4CN1A 5BOEA 5AZ0A 3O6CA 3KP0A 1EZWA 3VOIA 3G0SA 3ZZ1A 4BS0A 2G4FA 3MS8A 3GTFA 1W9XA 3G77A 3W37A 2GVGA 2DVTA 4GZJA 4LANA 3MMWA 3B04A 4IGSA 2I56A 2DT2A 3V75A 3BDKA 5I0DA 1WCGA 3S0CA 1EUNA 4NASA 1VENA 4DBUA 5XIAA 3PC0A 4AHPA 4DYKA 1I9CB 1TJPA 1JCTA 1TTJA 1K1DA 1OBAA 2WZIA 4TUFA 1LBMA 5LA2A 5CJMA 1GKPA 2D23A 4QNWA 3RITA 3UVIA 3OLEA 1XLFA 3DYMA 5CAKA 3USBA 4GY7A 3DOPA 1QOPA 1E6RA 1WB0A 2J74A 3ITCA 3V0SA 3CYJA 2R1MA 3NM3A 3BGGA 2WQPA 2ISWA 4HBKA 4KFOA 1TRIA 3GR7A 3ZLGA 3A22A 3STEA 3KAOA 3RJYA 3UG4A 4QTGA 2ZDRA 2DU2A 1V5XA 5LIUX 3WH6A 3EKZA 3R89A 1QASA 4XUYA 3NDOA 3UPBA 3N15A 1XICA 3B8UA 1OWQA 3MUAA 1UBPC 3CL6A 1U5HA 2J13A 5J5DA 1P48A 4PMOA 3MANA 5I23A 4M1BA 2QMKA 5FEXA 4G7EB 3N2XA 3M4HA 1AUSL 1DWJM 1GCYA 2BOGX 4L4OA 2FB2A 3R1ZA 5C5YA 1BFNA 4PRTA 2RAGA 2XFRA 3C2VA 3CK5A 3WBEA 1LM1A 3ATZA 4UNIA 2PDWA 2PP0A 3UR5A 5I3IA 4GI6A 4JIPA 2PDQA 3W71A 1TPUA 3LHYA 3AIUA 2YCIX 1ONXA 4CU6A 3RMEA 1BTMA 3AHXA 3AMGA 4B16A 9CGTA 2DT1A 4UFIA 1PEZA 5BNKA 3L2MA 4NAFA 1DTUA 3PFRA 1I2OA 1OX5A 2Z2BA 2A3BA 3S3GA 2W92A 3OG3A 1GOWA 1J79A 4GYJA 3W7EA 2XUCA 3VD9A 4WSHA 3R12A 4UMAA 3ZQ9A 4ZOEA 3H2MA 4LV9A 3NG3A 3CV1A 3PWGA 3CIWA 2HE5A 2OZ0A 3TV8A 1OFQA 2IPFA 1KV5A 1YE4A 5I3DA 5IM51 1W1IE 1MMFA 1TWWA 1X39A 3W82A 2VX4A 5A6LA 4WZHA 1UQZA 2ICSA 1AQFA 7CGTA 5C8BB 1H49A 3L7RA 1AFSA 3BANA 4GIRA 3U5UA 4JR5A 3BGJA 4OBTA 3CO8A 3FXYA 3RDKA 3BGAA 3W2JA 2ZZ1A 5AHEA 2QGHA 3AIQA 5I79A 3FDKA 2C3ZA 3L5AA 4JFVA 5EY5A 5CEWA 1CEOA 2J62A 5HNNA 4GPNA 3STGA 4DBDA 1LRNA 1QAPA 4PTXA 4AZIA 2DUZA 3N04A 4Q8WA 2JIEA 3AMKA 4PH6A 1E9IA 5CXPA 4R7WA 3ZT7A 1I2PA 3IUDA 1S5NA 1VEOA 2HK1A 4KWUA 4UWMA 4BF7A 1UKQA 4PMZA 1YDVA 4LAZA 2WCSA 1XG3A 5AOUA 2DSZA 4L61A 3P14A 3TW6A 3IIVA 5AHLA 3I4KA 1ZBCA 1LOQA 4ZGYA 5FSEC 1IEXA 2F7FA 1G67A 6PTDA 3BSGA 1QR7A 1VR6A 3NQ7A 1JZ6A 4Y96A 4QLLA 3MUIA 4ATLA 1ADOA 1LLOA 1PKMA 3CQJA 1VS1A 1J4EA 3N73A 3GIYA 4IWWA 2VGIA 2VXNA 1BRLB 1VC4A 1V79A 1TE1A 1R7AA 1V0MA 1V6VA 2JK2A 4HB7A 3VGBA 3GNDA 4U2YA 2QJJA 4UCFA 1E0UA 4JQ1A 2FPVA 1E6SM 3M0KA 1J5SA 4HZ6A 1DJIA 1DWHM 4FLSA 1ONWA 3KOYA 1JYXA 4AHQA 5AZ1A 2R24A 3V18A 3KZPA 4H01A 1DQWA 3GU1A 4PTNA 2BTMA 3G1DA 4PMYA 3P61A 3P7YA 5K9DA 4JN8A 3P5ZA 5I3HA 1OADA 4JCLA 3E5BA 4GIEA 5AYIA 2CEQA 2PDPA 3H2NA 3K13A 3VCNA 1EJSC 3CWOX 1RSCA 1KTNA 5G2IA 1OVDA 4MB3A 3NCOA 4U3AA 3C0LA 1UR1A 1OYBA 2XJ7A 4G1KA 4AZCA 3U48A 2AL1A 1EJRC 3DECA 2XGBA 3LCWA 1JYNA 3APGA 4Q32A 1GW9A 2GQAA 4ML4A 2OZTA 4O15A 3A21A 3LBMA 3HM7A 1XYCA 3V1HA 4HNVA 4D8AA 4AEEA 3TCSA 1I4NA 1V3MA 3W7KA 2J9ZA 2PD9A 1E6NA 3ONCA 1XCWA 4EP8C 1W32A 2C1IA 4EIVA 1XIGA 3VNKA 1LRQA 3FGCB 4LYRA 2VP8A 4O14A 4HMDA 5DY3A 3K8MA 2XZ9A 1BVWA 4LPCA 3WJZA 4A35A 2YX0A 3DXIA 1YXYA 1ZCOA 1E3ZA 1A5OC 3A3WA 1Q45A 3VXGA 3H7UA 1OY0A 3TYEA 1UH4A 2G3FA 4LYQA 1ZJIA 1A47A 4Z2HA 3EXRA 3HPFA 5CZTA 4MIMA 2ZZ6A 2O0TA 2VVNA 2XM1A 4JEJA 3S1GA 2XSAA 5T9CE 1J93A 4B5VA 4WD0A 4MMWA 4GUIA 5EFFA 1X6NA 1JULA 3I7RA 2EPMX 1TJ0A 2A1YA 2G37A 3S1XA 1VFHA 1TTQA 1JRCA 4W8BA 1DTNA 1WKEA 3M7WA 2I16A 3VC5A 3AQUA 3NSNA 3R10A 4ENLA 1LDCA 1XI3A 1ZCCA 3W26A 3CZJA 4U5IA 3SB0A 4HA4A 1P0KA 3GDRA 2DJXA 1LCOA 1QCWA 2V5JA 1R3TA 5ABGA 1TVLA 2BHZA 2WLZA 5FEZA 3ZJKA 3DKLA 1GOKA 5FOOA 4RE4A 1WZAA 1X6LA 1CGUA 2HPIA 4XZMX 3WJWA 3HQOA 1JDCA 4DF2A 1TE6A 1Q65A 1RD5A 1ZL1A 3WNOA 3QZEA 4OZOA 1G4EA 2ZFAA 2XGIA 1JYVA 2NVDA 5CG7A 1XSJA 2RH9A 1E5NA 4B3LA 5K4ZA 1GPWA 4B4HA 2BY2A 3PB2A 3O06A 4AQLA 2PGEA 1CB7B 5E0FA 2GJPA 1ZLPA 2VVSA 4WXYA 2Y89A 2W61A 3BOFA 1J9YA 3WFLA 4NG3A 1Q5MA 1GQKA 3AS1A 4MWAA 2X1IA 4JQAA 2FGBA 3N9RA 1ENUA 1VH7A 2YL6A 1VBJA 2DZWA 5CZJA 1SPQA 3AIVA 3FCPA 3FHQA 4P7LA 3TYAA 3FFSA 2VD8A 1QHZA 4JEQA 1FOBA 4PL1A 2P53A 1PYFA 4YCPA 1VGAA 4PCNA 2VHLA 2ZX6A 1ZP4A 1SSGA 4LGXA 3CLMA 3LGDA 4ZB5A 2DIEA 4PBEA 1A5KC 3ANVA 3RMJA 1HL8A 5M03A 3UETA 3B8IA 3VINA 2CBVA 3IUIA 4QG9A 2A2IA 1F6KA 3SCUA 3HTWA 2QCCA 1RZMA 2B81A 1L2UA 4P8XA 4GX9A 2G3MA 2ZZ4A 1QPQA 2WAGA 4Q4OA 1SR0A 1XYBA 1R38A 4TVDA 3AISA 4XWUA 4AH7A 4ALDA 5D8WA 3TU9A 1VIZA 1KBBA 1TWSA 1XLKA 4IX2A 4BF5A 4GO8A 3W1AA 1Q85A 3MDWA 3FA4A 2OU4A 3S5SA 5BRPA 4JYFA 3LG3A 4PUUA 4KERA 4M8UA 3IGSA 1XL9A 1E3XA 5K9XA 3WBAA 4AZ6A 3MVIA 2GOKA 3ES7A 4UTKA 2ZRXA 1TMHA 4A8NA 2WBKA 3LRMA 1EO5A 4X22A 3EYPA 1G94A 1XIHA 3FKKA 4AX7A 4C91A 5AKQA 1ICQA 4R7JA 1ALDA 1YXDA 1ZAHA 1QATA 2E1WA 1W3NA 2J7EA 2QDHA 3FKRA 1ADDA 2FVMA 3TKFA 5I07A 3OVQA 5CH9A 1H0IA 1P43A 2OWXA 4UR7A 1JQVA 3BL3A 3EWYA 1XGZA 1EJ7L 4MFDA 1X7IA 3TSDA 2R14A 4FF7A 3GTIA 4BQ2A 3ZJ6A 3UBPC 1RUSA 2NQ5A 5CQ1A 3LDVA 5G1MA 3QMRA 4Q4KA 1NP2A 1EJUC 2OLSA 2W3ZA 5FIPA 4WVXA 1YADA 1XS2A 3TOYA 3B40A 3GW3A 4P8WA 3K2GA 1YDNA 5BZAA 4E2VA 1AJ2A 3COTA 2WVUA 4ASTA 3AYSA 1KLZA 1MW1A 4LNYA 1SZNA 4JIIX 3T07A 1BYDA 3M0HA 3ABSA 2OT0A 1NFGA 1RK6A 4DM1A 4LRTA 2PPGA 3UGVA 1GZ1A 3ITXA 3SUVA 4EANA 5D03A 4J3UA 4QISA 4M1RA 4JKKA 3ZSSA 2V5LA 1CXHA 2R91A 4HN8A 2ZA3A 3K1DA 5LXEA 2V6AA 1R5YA 4DB7A 4AIOA 5T91A 4LS0A 3A9BA 5AC5A 1UOKA 3P0WA 1TWDA 4LUSA 3CIVA 4MAVA 1QNSA 3NOEA 2Q8XA 2Z1BA 3NZQA 2PLCA 1VRXA 2HE8A 1GW1A 4JTFA 1ISXA 4AIEA 5HWMA 3KEHA 3E0VA 3QY8A 5E0CA 4ZQCA 4P7NA 3EDEA 2NT1A 5G4WA 2WM0A 4K1WA 5A2AA 3PUEA 4TX6A 1JNDA 4B92A 4PN2A 2RKXA 3W7CA 3AWNA 3FJLA 3EEGA 2CIPA 2X1TA 3UWWA 3TVAA 4PTDA 3M6DA 3AIEA 3UP8A 1VHNA 2Y4SA 4YIWA 3PUGA 1OFBA 2QPUA 4JBRA 2E9MA 4ZR8A 3CPGA 3CEUA 4KCWA 2F6KA 4GBUA 2PTZA 1E6ZA 3NL2A 1RQBA 2CLLA 4M6PA 3STFA 3NSXA 1TV2A 3H7VA 3CV7A 5HNRA 5IBXA 1UD2A 3WLIA 5JBDA 4FMVA 1AK5A 2QZRA 2VMFA 3UG8A 6REQA 1PZ0A 3N2MA 3KRBA 1UP0A 4NAEA 1FH7A 1H09A 1QT1A 5ENLA 3W53A 2WM1A 2I9UA 1KRAC 2EAWA 3NDYA 3W7RA 4S3EA 1JZ3A 2CZFA 3HQ1A 3OEXA 2EO7A 4JICA 2VZSA 2PWHA 1RLDA 4DWSD 4WY0A 3XISA 1NEYA 3GU2A 3PG9A 3NZGA 1G69A 4C5YA 4A8RA 4G7EA 1QU4A 4Q6XA 3LX9A 3CUIA 2QR6A 4ATWA 4QJ1A 4N9DA 1XLMA 2C14A 4MGGA 4LAKA 2PDGA 4A22A 2NQHA 1W8GA 5HNTA 2E1DA 3V4BA 1N2VA 1UR9A 3QH2A 1KM5A 1NAL1 2UY4A 4YTQA 1Q6EA 1DJYA 2ZE0A 4DLMA 2FHBA 4O17A 2OGJA 2VWTA 3S5ZA 1K6AA 3DU0A 2XH4A 4QEEA 4NNCA 4G56A 4IQDA 3K8KA 4RZ4A 5FSDC 3PANA 4HMEA 1TRDA 3GVGA 5LSMA 2VGBA 3VC6A 2OSYA 4J27A 3O1NA 5ABFA 4ZOBA 2GL5A 4GH3A 1SJBA 3DHPA 3GWQA 2R6OA 4PUWA 4X63A 4O13A 3WNKA 4Q4MA 1KR1A 2OFJA 4B9ZA 3Q37A 3F03K 2P8CA 1MZHA 3NDZA 3ITLA 3NQGA 4LBRA 2A3AA 4HU4A 4E0CA 2GYIA 1VFLA 3SN1A 5AFDA 3KBWA 2KX9A 4AZ5A 3NOYA 1VFMA 4HZMA 1NWTA 3MKVA 3ARYA 4W9TA 3W6MA 4GE8A 3PNZA 2J6XA 4R9XA 3CTTA 1KFEA 1XHGA 4PE8A 3SRHA 4AWUA 3NYZA 4K1GA 1HP4A 3EBVA 1XRVA 4C6KA 2BG5A 2WZMA 3QV9A 4W89A 5ABEA 1KCZA 3WLOA 1GG0A 3FA3A 5F2LA 3U57A 3H2OA 4F2UA 1F05A 2YLAA 2SFPA 1WKYA 4MPQA 4GNKB 3S4TA 2PWGA 1F8MA 1OB0A 4E4FA 7PTDA 3ZVIA 3ARXA 1LL7A 2A85A 4WOZA 4MNLA 2Q09A 2HISA 3UWQA 1PWMA 3PZ9A 1V6YA 2VC6A 4Z1DA 1R85A 1JZ8A 3LPGA 2PZNA 3SCVA 1P5BA 3HIJA 2J7HA 1A0DA 3ZWSA 1OYCA 1FKXA 2QCHA 4ROPA 1C93A 3W24A 3J7HA 2XVLA 3CAVA 1Q63A 1HT6A 3W7NA 4BQ5A 3K30A 4P8UA 4W8LA 1X8FA 4GJIA 3HOJA 1AMYA 2FVLA 4QR6A 3TMQA 3VX1A 2QIIA 2PRHA 2DH2A 5K7JA 5C9ZA 3HJZA 3NQ8A 2OODA 3MJYA 1EHAA 3HPZA 2Q8LA 5EMJA 3P8IA 4NIRA 4XBKA 2PC4A 3INPA 5A69A 4HNOA 4CVUA 3EOEA 1X1NA 1NWUA 2QUNA 2EPKX 3SEPA 3UWUA 1UR0A 3WH9A 5FL0A 1Z41A 3L23A 4AU0A 1LWJA 4LOCA 5HOSA 2FIQA 2QJMA 1JGIA 4FR6A 1WX0A 1OF6A 1U33A 1TCMA 4H6RA 3TDFA 4MFEA 4IUGA 1QOXA 3S1UA 1DJHA 4Q4QA 4MJ4A 1BYCA 5F4SA 4UC5A 1QNPA 3G1HA 4IP5A 3MY9A 2YIHA 4HOZA 3UCCA 4ZQNA 2C16A 3V1PA 4WKFA 3BG5A 3OJGA 5H91A 1F61A 1FWFC 2X40A 2NX9A 4ZQMA 4UQBA 3TJIA 2FFCA 1KKOA 5T9BG 4DZ5A 1B31A 3GVVA 1UC5A 2PUZA 4OTKA 3LBOA 3UYCA 1YIXA 3CPUA 3E5PA 2X0HA 3O9NA 4WOQA 3WLQA 4NL1A 5EFDA 1DJXA 1K4GA 1XM3A 1CX9A 3ABQA 1QW7A 5DO8A 1R9YA 4JHZA 4J9JA 1VPYA 3L5LA 6REQB 1QXLA 2QQ6A 4NQ1A 3QW3A 3GR4A 3PBMA 4LUSB 1J10A 3KL5A 2WJFA 1LBFA 3PG8A 4CD6A 2PF8A 5AHIA 2XH2A 1JD7A 2JFEX 2J7FA 3W7PA 1F74A 3ZR6A 4HT3A 4C65A 4OKDA 2WNWA 3N6QA 3NPXA 3IJ8A 1SUXA 3QSTA 2ZTJA 1RCXB 4AWEA 3IWPA 1E1CA 4Z08A 4P61A 1IEIA 2I1OA 4J2PA 3TXVA 4QITA 4X9YA 2D69A 1HJUA 4KGJA 2REQB 4HN4A 3V35A 1I0BA 2DT3A 5BMXA 1Y5VA 1SGJA 1W5OA 3B0XA 3MHUA 1HJXA 4D8LA 2GOUA 3BPWA 2MANA 3HPAA 2FZBA 1G4PA 1EWDA 3QR1A 1IWPA 4IMAA 1JGMA 1WBHA 3U2CA 4Z0SA 3EDJA 2DQXA 5CPOA 5CPTA 3IJ9A 3KBMA 3W1RA 5D04C 3QJAA 3E74A 3CZ8A 4GCAA 1EP1A 3T0BA 4INFA 3HV8A 2X1UA 1BRLA 2GGIA 1UR3M 1UH2A 1K8XA 3BMWA 3ZR4A 1VJIA 4PGLA 1MQRA 2XVPA 3O8AA 3H2EA 2EG7A 1W1ZA 7XIMA 3QSRA 3IAPA 3JZUA 1KRCC 3GHRA 2NVAA 2EPLX 3BWWA 4NZ4A 4EK7A 3R0UA 4H04A 3V3WA 4LQ1A 2GPTA 1XIEA 5U4NA 7REQA 2XVGA 2VZOA 3WH8A 3KVLA 4Y90A 3W74A 1KQYA 4XTIA 1UPMB 3B9AA 1HKMA 3QV6A 4QAIA 4AEFA 2GSHA 3D3AA 5A94A 4KEUA 1RPKA 5BWAA 3VFLA 4ZTXA 2PI6A 3TR2A 5I3JA 1UR8A 2HV5A 4DXKA 3P80A 1H61A 1HVXA 2YJQA 4E8CA 1UB3A 2G0WA 1V6WA 5TIMA 4PULA 4H2HA 3MUXA 4W88A 2PTXA 3ZJ8A 4IGHA 2PODA 4AVNA 3WMLA 5I3KA 2Z4GA 1WUEA 4O10A 1XD1A 3IVTA 4Y6GA 3RCNA 1P0BA 2YCJA 3LOTA 3M41A 2PS2A 3G2GA 1C8VA 3ZIZA 2JF6A 5CC6A 2HDJA 4JQ3A 3T81A 3T1GA 4JX4A 2FKPA 4Y8EA 4RNJA 1O4UA 2BP1A 4LJ3A 1C9DA 4HCDA 3G1AA 3QV7A 4M19A 3FIGA 4R3UA 3POHA 4GWEA 1J0HA 1ELSA 4IMDA 2VQTA 2X2YA 4KEVA 4CQ8A 1EOMA 3IJLA 4LYPA 1EA0A 3TSBA 2RHGA 5HXMA 2TMDA 4QDPA 2VGFA 2PE4A 3OO2A 1JCNA 1VFUA 3TN6A 3W87A 1K6WA 1OT2A 2VX5A 3AO0A 4DX3A 3M43A 3WK3A 1XQLA 1X96A 3N3MA 5HQEA 3ZM8A 1PBGA 3ARQA 4H8UA 1MEHA 3EWDA 1TELA 5LHEA 2XFYA 1A5NC 1W17A 5AC8A 1UWRA 3F4CA 4S3JA 3QRHA 5DXYA 3T2OA 3L4UA 4GY0A 3PP7A 1QW9A 3ABOA 4GFIA 3A13A 2OB3A 1T41A 2Q8ZA 3S42A 1IQ8A 2CHNA 4L7ZA 3PUOA 4UTMA 2RDTA 2REQA 1UIPA 3C2FA 4GXPA 2WVSA 3VDGA 3CZEA 3HU7A 1VAHA 5HBFA 4E4UA 1OFAA 1XPGA 4TVUA 4HU3A 1ME7A 4RE0A 4CQAA 1CPUA 1SQ7A 1UYQA 2QCGA 1TUFA 2B7OA 4KWVA 3R94A 1V7AA 2IQTA 1Y8BA 4YTTA 1ZBVA 3KCJA 3VMPA 5EYWA 4M82A 1Z6KA 7TAAA 2EJ1A 3GDTA 2Y5JA 4RK8A 4AXKA 3DFHA 1TB3A 4UQ9A 2UY5A 4C1KA 1FKWA 1RBLA 5BOFA 1F73A 3EWCA 5C9UA 1QPOA 1QI2A 2J8GA 3TYUA 3H24A 4RJEA 1EC8A 1XGEA 1O7AA 1TIMA 4GG9A 1V3IA 3DI0A 4HTYA 4AYSA 1UWSA 1UBSA 2WMHA 4KH2A 3AIRA 1H5VA 4A3RA 4NNAA 2FFIA 3VOCA 3UJRA 1RP9A 3G6MA 3LI0A 1GJUA 4IIFA 5LXXA 1V6XA 1JUEA 4UNLA 2HZGA 5BXTA 1R87A 4Q4PA 2V30A 4GOAA 4LFYA 3QZ6A 1DXEA 3F5KA 2VC9A 1XG4A 4UZUA 3LZ5A 3SR7A 3HV9A 4KFNA 2GDVA 2YCKX 1A4MA 2PLJA 4ZOCA 4QE5A 4DPQA 2IMRA 2V5KA 3TONA 2CLPA 4WQ6A 2WK2A 1NH6A 3WDQA 4DVOA 5C9RA 2ZUUA 2NVCA 3THCA 2HVMA 2PDNA 1S2WA 4UFMA 4O19A 3W84A 2B7NA 1FFRA 4HPXA 3MTWA 1ZAJA 4EX4A 4J7RA 1JPHA 2A6NA 4R7OA 2OLAA 4MNKA 2PAJA 2YCLA 4M24A 5CLWA 2AQOA 2YDRA 5FJRA 1CGXA 3DHDA 3FJ4A 5LYRA 4E38A 3ARTA 2NSOA 2YBUA 2CLIA 2Y6ZA 1L8PA 3BLEA 4GGHA 3ALFA 4DO5A 5DBTA 3T6CA 1XIIA 2DZUA 1OFOA 2KAUC 5PTDA 3AHVA 5BOOA 4Z2LA 3L4XA 1DOSA 3WQFA 1GVYA 3AAMA 3GNXA 3B0YA 1WKFA 1EIXA 4V27A 4Q22A 3OLDA 2PBGA 4B5NA 1L9WA 2AQVA 1ITCA 3WUFA 2FJKA 1B2YA 4AD0A 3BCFA 3AALA 4JD4A 4DO6A 5M17A 1XUZA 3P62A 3K5XA 1LWHA 1OIFA 3BUVA 2C71A 2D2JA 3PBVA 3UXDA 2DPEA 3IJ7A 1XH1A 4H19A 4PTWA 1WDSA 2XIOA 3CQ0A 5HDRA 4XZNX 2PB1A 4UUIA 8A3HA 3EWZA 2NT0A 1J0JA 5A1AA 3V5CA 1TZ7A 5AYXA 3DC0A 4JTTA 2DVXA 2OZ8A 3F7JA 1FDYA 4ZODA 2VZVA 1G7UA 5K9CA 1MW3A 3PHAA 3RIKA 1VB9A 3A4AA 4N9EA 3IVUA 1DIOA 1KGXA 3PAOA 3MA8A 3H23A 4XUGA 2J9XA 1H7OA 4C6NA 1TPDA 3WQDA 3PZTA 1F5ZA 3C8FA 4L4MA 2XSXA 2DZAA 2E40A 5JVLA 3UWEA 1PVNA 4W7VA 3VMOA 2ATSA 4BF9A 3FJNA 2BDQA 2AAMA 2ACQA 2XVNA 3JVAA 3SI9A 4REQA 1ZAIA 1Z7AA 1QHOA 2CC0A 4LUJA 4O1AA 5AC7A 2CZVA 4LS2A 1R47A 2W79A 3GTXA 2E7FA 5D37A 1G7VA 3WEZA 2POTA 2XFWA 3EWXA 3W7DA 2C1GA 4Z2GA 1CW2A 1WXJA 1OX6A 2PMQA 3GSMA 1HUVA 3DBNA 5JIPA 1EH9A 3WLRA 4HD5A 4FB7A 2NX3A 5I00A 4JTDA 4MWAE 5KZDA 3UT0A 2GWGA 4JFTA 1J12A 1U30A 2DZVA 3B9DA 4M80A 2OYKA 1I2QA 1VIWA 4CD5A 3KRZA 1VJZA 4MNJA 5F2GA 4EACA 2I5QA 4HNNA 2VR5A 1LL6A 3BCJA 3QLLA 2ZTKA 4AC7C 2YDSA 3GDKA 3OLIA 3RU6A 2ZWYA 2WC3A 3HA1A 3CL8A 3SCWA 4BI6A 1PYMA 1Z44A 5D4YA 2W66A 4TMBA 2E25A 3EA1A 5J04A 2CW6A 1YXCA 3VTRA 2D24A 1KKRA 4B5WA 2V3GA 2H3BA 4O52A 4FNPA 1PO9A 5E9AA 4Q8OA 1OFRA 1E4IA 1TUXA 1WZLA 5K4XA 4R5EA 2WB5A 2G5WA 4MKSA 4A3UA 3FOKA 3CNYA 5CJ5A 3VDAA 5FAJA 3QHNA 3BVJA 4DWSC 1Q6CA 1QNOA 1KM6A 1BGGA 2W9MA 2DT0A 1JJKA 2ZX7A 2VX6A 4C6LA 1FWAC 1IEVA 4YTRA 5A6BD 4GHRA 4Z0JA 3KTSA 4EAMA 4K38A 2NQLA 3PZGA 5C71A 5CPQA 5E6YA 1IF2A 3N6JA 1C8XA 2QLYA 3W1PA 3B9NA 3T2QA 2V67A 1UD4A 1QDSA 4CN4A 2ISFA 3G22A 2XGZA 4UXDA 1HJSA 3SJ3A 4ZQRA 4O28A 3UPWA 4MDOA 3S6OA 5DT5A 4RX0A 4GI9A 4GQGA 3B8VA 1XR2A 3FAXA 2VEMA 3NAVA 2BHYA 1YBQB 2X42A 1XC4A 2IKHA 1E73M 1XLGA 4MG4A 4ZSTA 5CGTA 2JKPA 3S2JA 3ONBA 2OT1A 1JYWA 3BC9A 4QHRA 1AA1B 3TYBA 2PDHA 5A6JA 1FX6A 4YLWA 4FNSA 1EXBA 4GH1A 1PZ2A 4JXCA 5C70A 5CG0A 1YTKA 4L9ZA 2FDSA 4LCSA 2QPSA 4GGBA 1SW0A 5F7UA 4F40A 4BQ4A 4KCTA 5D9MA 1E6PA 3NZRA 1X7FA 3ARWA 5H2ZA 1PTDA 3NA8A 3VGFA 1JAKA 4ZA0A 1Y65A 1Z8AA 2JIWA 3MMUA 2ZZ2A 1B1YA 1PPIA 2E28A 1HNYA 4M51A 5A8OA 3ORWA 3BOLA 2BX7A 3M0VA 2FZ8A 1UZ4A 3HZ3A 3MCMA 3SGGA 1BKSA 4Q8MA 2BOFX 2Y2WA 3IUHA 2PFHA 3U2EA 3GRIA 2R1LA 3W7IA 1TPEA 4IQLA 3CEPA 1UD8A 1TTIA 4WR3A 1W9BM 1XBZA 3MWCA 2CXGA 3G1SA 3GXFA 4YHGA 5IFTA 4JTQA 4EF8A 1MFVA 4A3QA 5D2WA 3IJDA 2J7BA 1REQB 4RZBA 3VGHA 3GB6A 1FXQA 4PTVA 1VP5A 3TA6A 1TX0A 5D30A 4H9VA 5CPSA 3GNOA 3WBXA 1WDWA 3WSUA 3WLLA 1L6WA 3REQA 1A0EA 4RKAA 4JY8A 2IKJA 4XQ6A 4Q7IA 1QNRA 2NUWA 3LY0A 1ZJAA 2VUNA 3H4GA 3QFEA 4H7VA 1TKKA 4K8EA 3Q67A 1GZJA 1T8XA 2IPGA 4B2DA 4IG2B 1DXIA 1E72M 1R9XA 4EPBC 1JF5A 5BYWA 3W76A 1GHRA 4O1FA 1UIOA 4IICA 1XXXA 5IOBA 2Z0IA 1LUCB 3GM8A 3G1YA 4KRTA 1OT1A 2IS7A 4DPPA 1OEPA 3WQOA 3OW1A 1VFOA 3ZVHB 3T0DA 3EWUA 5HATA 1CXLA 1DXFA 1O1HA 1E40A 3N12A 3ITYA 3QTGA 4YVPA 1XLLA 3WQWA 4FF5A 3VIMA 1OCNA 1GQNA 1UUOA 5LNRA 1CENA 2QDGA 3MHGA 4I8YA 5LKYA 3MCNA 5I3FA 4DO4A 5A6KA 1ZSXA 2PURA 1M01A 1S1PA 3FK4A 3ZMRA 2GK1A 5JH1A 1KXQA 5LNSA 3OIHA 2X7VA 3RO6A 1QPRA 4JCMA 2ANUA 3SECA 1E0XA 1L6FA 1E0WA 3UWZA 3W29A 2PZ0A 1DJGA 4BFAA 1AJZA 3EX1A 3F2BA 4DF1A 2QVNA 3Q58A 3EZ4A 4MUPA 3AXKA 2OG9A 3U8GA 3URQA 2FJUB 2XU2A 4WLCA 3BJFA 4AY1A 2P1FA 2J7GA 2VR4A 1NARA 3MUCA 5G1YA 2AMGA 4MHBA 5GPRA 4FNRA 1IT8A 1F6YA 4IFKB 3TN3A 4RL3A 1KFLA 2ZUWA 4CQBA 3BLFA 1EL3A 1EZ2A 2V2HA 4FSAA 2P3ZA 5M5DA 1UA3A 3PVFA 3LCHA 4DF0A 5EL1A 3GKAA 1QFEA 3EOOA 4NSBA 1RXOB 1PX4A 5D38A 3GUGA 2ZIDA 2O56A 1K4HA 1TR1A 4H83A 1F4HA 3FAWA 3OIXA 2CBUA 1HKWA 2OO6A 2NWSA 1CLVA 4S3CA 4F79A 1AQHA 3SUWA 2OJPA 1XIJA 4D6CA 1X98A 1JUKA 3GVQA 3W28A 1J0IA 4H8NA 1KM2A 1EDTA 4R53A 1JVNA 2GDQA 3XIMA 1F3TA 2DDXA 4WJ8A 4AUBA 3A6OA 1B9ZA 2YL8A 1NDYA 1WZKA 2HBXA 2RDWA 1KFWA 3B9EA 1NVMA 2BVWA 1V0KA 2Y1HA 4GQBA 4NJHA 3QGVA 4LCQA 3QHOA 3M0XA 5CZKA 2V2DA 1VCGA 2HXTA 2CERA 2VR2A 3KLKA 3RM9A 3GHSA 3BLIA 4FNUA 3RG6A 3LCXA 1DIDA 2UWFA 1US2A 4WRHA 4Z1AA 3HB9A 4HPJA 3SUTA 1VYPX 2QF8A 4IF2A 1R6WA 2Y62A 1MNZA 3OLGA 3ME3A 1HIZA 1VFTA 1WOBA 1YLVA 5J5RA 1K77A 4FEZA 3KS5A 1R0MA 2NLYA 5IRPA 1W3LA 2BMBA 3P82A 4MY9A 1EBGA 5K2ZA 4MSSA 4YU1A 4KMQA 4XB3A 1P1MA 2EKCA 4X0VA 3U4AA 2QMJA 1RJRA 3NO3A 2BZNA 3HQNA 1A53A 1NU5A 3WDRA 2ATMA 3AJXA 5IDIA 4ACZA 4W85A 4HPNA 3WZ0E 5C2CA 2D1ZA 1HQTA 1UW9A 4C6IA 5BXPA 4M6VA 5EKYA 1W3HA 2B31A 3FDGA 2VL4A 3DZ1A 3GG8A 4Z2KA 4B2DD 3GAYA 5BXSA 2RGLA 3EWBX 1KXHA 4PMUA 5EU9A 2O4QA 3W7QA 5D9PA 1CBGA 1PV8A 1MQQA 3VOJA 4Z2IA 5AVNA 4LT9A 5F2IA 2C7FA 1BGAA 3KRUA 3WDPP 4OBRA 5F2MA 4W8AA 3I6EA 4FI4A 1TV5A 4L5ZA 1E51A 1A4LA 3Q2DA 1BXNA 3V36A 1W5NA 4G6CA 5FD0A 3VIHA 2PP1A 3GC2A 4PMNA 1RCOB 5H8MA 4D1IA 3MHFA 3NM1A 2XG9A 2CZDA 2OVLA 1OC6A 1KRMA 4ORMA 4H7ZA 2O7QA 3SY8A 3FY1A 4MOZA 4GRSA 4OBSA 1HKVA 1VJSA 2OELA 1V77A 3E3HA 3NR0A 3TJXA 4H6KA 3OGVA 3VMNA 3W73A 5CSRA 3BLDA 3LXBA 2O7SA 5D9NA 3HGSA 3WK1A 1RLCL 3AROA 2X8RA 3URAA 1LWIA 2WBGA 4DWDA 2PU1A 2AQWA 2E4TA 3R13A 3ZOAA 1EJTC 2IUZA 3WF2A 3UZXA 3AUOA 4HQVA 1L8NA 2PWUA 1G5AA 3PZNA 2A4AA 4O0QA 4MB1A 5D9OA 3ABZA 3NQAA 4L9XA 1AVAA 2C13A 4LYKA 1V02E 2VRQA 2H6RA 3ARSA 5BRQA 5AY7A 5FJTA 5A95A 4AISA 1ZP3A 2CYGA 4IM4A 4C6FA 4GZEA 3QGKC 2ZX8A 1NP0A 3LZ3A 3RX4A 4I9MA 2RUSA 3ARRA 1BD0A 1ZJHA 3U7BA 2H8ZA 5A2BA 4PB3A 5TQLA 1Q4WA 3T4WA 1PDZA 1QBAA 4UR8A 5E9XA 3QR3A 2ZQ0A 1SZEA 4PMQA 4HSHA 1XIBA 1QI4A 3W7HA 3DG6A 2F8QA 4XAZA 1AD1A 3LTSA 3M0IA 4A2RA 2CHOA 4XAFA 5C2XA 1M5WA 1B9BA 1LOLA 1U2Y