1ECEA

Acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
358
structure length
358
Chain Sequence
b'AGGGYWHTSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLPYSDDILKPGTMPNSINFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSGQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDSGDTGGILKDDWQTVDTVKDGYLAPIKSSIFDPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDOCELLULASE E1
molecule tags Glycosyl hydrolase
source organism Acidothermus cellulolyticus
publication title Crystal structure of thermostable family 5 endocellulase E1 from Acidothermus cellulolyticus in complex with cellotetraose.
pubmed doi rcsb
total genus 136
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1996-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eceA00
1E73M 1GOQA 2WM0A 1TUXA 3TTSA 5EMYA 1OIMA 1E5JA 1JDAA 3W6MA 2XWEA 2WK2A 4AD5A 3ARRA 3WD0A 1E1FA 4PSPA 2BFGA 5E70A 1ZJBA 1MXDA 4HP5A 2D0FA 4OKDA 3U5UA 5HNNA 5ABEA 3THDA 3RM8A 4F8XA 2G8ZA 4U31A 3WF0A 3UG5A 2VCAA 1KXVA 2UY2A 8A3HA 3BAWA 5DEZA 4XV0A 4CCEA 1VB9A 2WZHA 1SYTA 4OOUA 3IJ8A 4R27A 3ZO9A 4CVUA 3VM5A 1ZBWA 4WSKA 4W7UA 5LA0A 1JYXA 3N15A 1XH0A 4UFHA 1KR0A 3K8LA 3KEHA 1VFUA 2E40A 3WDRA 1A47A 1W3JA 3L2MA 2UY3A 3SCNA 4TVDA 4PTXA 5DMYA 4F9DA 1V6WA 2OSXA 3GZAA 2ZUTA 2VX6A 2XFYA 3GXFA 2XGIA 3K46A 3N17A 1BGAA 3L4XA 1JYVA 4PRWA 2VZSA 2WANA 5CJ5A 1G01A 5BRPA 2XIIA 2ZXAA 3NUKA 4JFSA 4M8UA 3PZVA 4DUXA 3AIUA 2QF8A 4Z2LA 1C93A 5DF0A 4AD4A 5A6AA 1AQHA 3WEZA 3SCTA 1ITXA 1E0XA 2ZX6A 1I1XA 4D6DA 4NF7A 4A3HA 1EH9A 1U30A 1HF6A 1JDDA 4UFJA 1WNOA 1HJWA 3VOCA 1NOUA 1WE5A 1UR1A 5M3WA 3W27A 2D3LA 4KWUA 3AIEA 1HIZA 5A2BA 1I1WA 3BLPX 4PBGA 4E4PA 3GBEA 4JFVA 5ABFB 3CGTA 1KXHA 3CHEA 5M17A 1GVYA 2J47A 1GW1A 4CD5A 4AY1A 2AOSA 1AVAA 2AAAA 1XSKA 2J7BA 2XVNA 3CUHA 3OB8A 1J0ZA 2UY5A 1V08A 2VO5A 1V6VA 1QPKA 4V27A 1HKIA 3N1AA 2CXGA 1VBUA 1KXQA 4UOZA 3CZ8A 1VFOA 1BTCA 1UR2A 4UFLA 1U2YA 5GNZA 4UFMA 2XHYA 1C7TA 4OUEA 2DSWA 1NWUA 1GHRA 4XUYA 3CUGA 2J78A 1UR0A 3FN9A 4MDOA 3UCQA 3K4AA 1J0IA 4MB3A 4UQEA 2PF0A 1QBBA 4FLRA 2JE8A 3QHNA 4J28A 4W87A 2X2YA 1XSJA 4JKKA 3VDAA 3U5YA 2E9BA 2PWFA 4UFIA 2XSAA 4TVCA 4EE9A 3VMNA 3VU2A 2ZWZA 3M46A 1E72M 3U7VA 1PX3A 1BHGA 1EDQA 1V0MA 2GJPA 5IHSA 1CDGA 1H4PA 5IHRA 3AS0A 1RP8A 3NDYA 2W66A 2XG9A 4XX6A 2FH8A 2ESCA 2XJ7A 4J27A 4M56A 2JFEX 3OBAA 3MUZ1 1MQQA 1JNEA 3WN6A 3OLDA 1KGXA 1H0IA 3WH6A 2XVKA 1UA7A 3OG2A 4WF7A 4H04A 4CN4A 1ZBKA 3RILA 3WENA 5CGTA 2J62A 4UCFA 5IFPA 2FGLA 4CU6A 4CU7A 4AXNA 3PZMA 3VMOA 3VPLA 2WVUA 3EDJA 5D9OA 1K9EA 2DH2A 3WD4A 1CXHA 1EHNA 1UH4A 4QFUA 2D20A 2ZUNA 1LG2A 1NOFA 2VC9A 3KL3A 1WZLA 2IUZA 4MNKA 1HL8A 1RPKA 1GQJA 2G3NA 2XYLA 1CZ1A 2CERA 2FHBA 4TOQA 1JFHA 1PAMA 2B31A 2GUYA 2WHJA 4YHEA 3VGEA 4JZ5A 3RM4A 4ZE5A 4LQ1A 4UOJA 3L2LA 4AIEA 4GI8A 1EO7A 1PZ3A 1MW2A 2EO7A 1US3A 1NARA 5I77A 2E9LA 3AHZA 3AMDA 4M1RA 1NQ6A 1Z32X 1LF1A 5I79A 3VGGA 7TAAA 3TONA 3RIKA 3FAWA 8CGTA 4ZXOA 3WNPA 1ISYA 3UERA 4C7DA 1XH1A 1KQYA 4PSRA 4J3WA 1NP0A 4L4OA 4TTGA 1L0PA 1B2YA 6CGTA 1OT1A 3HJEA 3WNOA 1CENA 1TR1A 1EIBA 1CGVA 1JZ6A 4KGJA 4ZFMA 1UA3A 4TX8A 5ABGA 4C7FA 2VT0A 2DT1A 1JNDA 3BAJA 4X0NA 4LPCA 3A3HA 4JFUA 1QNRA 1G9HA 4W89A 3SUVA 3DYPA 6A3HA 3AIVA 5C71A 1ZU8A 3DHUA 4H8UA 4M81A 1LWHA 3UR7A 4Z2HA 2OYKA 5BROA 1R7AA 1TZ7A 1CXFA 1B90A 4IPLA 3VIMA 2VZVA 5DT7A 4P7OA 3B9EA 1QNQA 3WF3A 5CGMA 1DHKA 5A6BD 5CPTA 1C92A 3WL1A 3AHYA 3MMDA 2W63A 3WH5A 2X0YA 2DIJA 5IFTA 1MFVA 1E0WA 2BVDA 4PTWA 1D7FA 2F8QA 1N82A 1QOXA 1E71M 4W7WA 1GOWA 3W37A 1CGWA 3VIGA 5GNXA 3A6OA 1TVNA 1W1VA 2WZEA 4GINA 3ZSTA 4P8XA 2WSKA 2DSUA 2CNCA 3SUUA 2J7EA 2O9TA 3CO4A 4FF5A 1BVZA 1W9VA 5ABHA 4LX4A 1AQMA 1LQ0A 3S2CA 1QNPA 2WLYA 4D71A 2CBJA 4QLJA 3NDZA 5A6JA 2X09A 1QI4A 3A4WA 4C7GA 4P7QA 4ACZA 2QPUA 2ZE0A 1AQ0A 3F4VA 1E4NA 1W9DM 3NYDA 2GK1B 4V28A 2WB5A 4QAWA 4PMRA 1VFFA 3WUGA 1EXPA 1H1NA 1X6NA 2YKKA 2GFTA 4PUDA 2YLLA 1WKYA 4EAMA 3EDEA 3WFLA 3RJYA 3GH7A 1VAHA 2YIHA 2XVGA 3I3DA 3GNPA 2W92A 1OM0A 5JBEA 2VX4A 4Q22A 4H41A 1UD6A 2J4GA 1E4MM 3VDBA 3CMJA 3LPPA 4AZ6A 1YQ2A 3LPGA 3T0DA 5LA2A 2W67A 1TA3B 3MMUA 3L4TA 4P7NA 3SCOA 5D9PA 4EKJA 1J0KA 3ZT6A 1OGGA 1BFNA 3RJXA 1ITCA 5A6LA 4AEFA 1SMAA 1GPFA 2JEPA 4PYSA 5A94A 1HT6A 2WSPA 1KWKA 2BHZA 2BV9A 3WMCA 1E6PA 1A3HA 1GVIA 2PWEA 1WDSA 4JCLA 3N18A 2GVYA 1MFUA 3MV01 4PMVA 4AYSA 1R8LA 1XD1A 3EDFA 3HU7A 1GCYA 3SUSA 1LL4A 4JFTA 4JFWA 4WKHA 1PBGA 5A6MA 4A3YA 4DUWA 3T0AA 4TTUA 1UZ4A 3W38A 1G5AA 2GJXA 3VGHA 1C91A 1J12A 2WAGA 3ZJKA 3MUIA 4HA1A 1E6QM 4GZEA 2CETA 3BMVA 2WHMA 3ZQ9A 1NWRA 4F79A 1RH9A 3WQVA 1ECEA 2WW5A 4H2CA 1QI3A 2BXYA 4LYRA 4CVWA 3LPOA 1V6XA 2JEQA 3ARYA 3VVGA 4HMDA 2ZUUA 5AYBA 2X8RA 4YN5A 4J3SA 3OGVA 3CBWA 1E6ZA 2WHLA 4HZ6A 2CKSA 4LYPA 2J8FA 3GH4A 4TUFA 4WLCA 3QHMA 4B9ZA 3AZTA 2J7GA 3MUAA 1RP9A 3WUBA 2BY3A 1W9BM 1FH8A 2ZXQA 1LL7A 4E2OA 1GOKA 3DC0A 2NT0A 4XB3A 4K68A 2VZOA 4H8VA 3NJ3A 2VVSA 3BC9A 1W3KA 2WC4A 3WDIA 2EPLX 1MW0A 4NZCA 3EYPA 5FL1A 1KCLA 2WMGA 4D6GA 3BCFA 2VURA 3DHPA 1JAEA 1GQKA 4BS0A 1DWFM 1QNSA 4U5KA 3AFBA 3AQUA 5A3HA 2V38A 5EB8A 4UQDA 3PZQA 4BCEA 3WH9A 3VX1A 1NP2A 4WK9A 1WPCA 4FK9A 4HU0A 4U3CA 3SIMA 4GIAA 2QLYA 3AXHA 5C8BB 3OLGA 3M7SA 1JDCA 2PBOA 1JI2A 4DM2A 1PZ2A 1K9DA 1MWOA 1ISXA 1W9XA 2BVYA 2CITA 4AISA 3VIHA 4JHZA 4GO9A 3PBGA 3AICA 1W9PA 3RM9A 1JZ5A 3FHAA 1D2KA 3CZLA 1E56A 4Z2GA 4UQCA 4U5IA 3EDDA 4PCTA 4AZ5A 2ZIDA 4B3KA 4TX6A 3CZGA 4OIFA 4D6CA 1HVXA 1VENA 5CPQA 1W2VA 4ACZB 3VD3A 3ARZA 4N0RA 4IISA 3VKKA 1LL6A 4ZXLA 5BXPA 1HP5A 2V3DA 2WVSA 1HN1A 2BY2A 3KL0A 1ZS2A 2ZICA 1OINA 5JUVA 2WMIA 3L4ZA 5A2AA 2WLZA 1AMYA 3VINA 1R87A 1HJUA 4WIWA 4JL1A 1W1YA 1UOKA 3VIPA 4MADA 5A8PA 4E8CA 1EGZA 1VEPA 2WMJA 1CPUA 4FLSA 3RMEA 1ODZA 3W24A 3ARXA 2YA0A 5A8QA 1J18A 3EMCA 2QMKA 5FKYA 4OBRA 3GTNA 3LPFA 3VIKA 1MVYA 3W81A 2E8ZA 4URIA 5E0CA 3ARWA 3PTQA 3SCQA 1EDTA 2CBIA 5E0FA 2WCSA 1CGTA 1G0CA 4TVUA 4UQ9A 2FGZA 5F7UA 3VIOA 1HNYA 1TG7A 4PMNA 5A6BA 5D4YA 3CHDA 3W82A 3II1A 2BNJA 4Y7EA 2WWDA 1XC6A 2V3GA 2HVMA 1IV8A 1Q6GA 3AJ7A 1V0LA 2XFRA 1CXLA 1KGWA 2OYMA 4FMVA 3ARPA 1UQZA 2C7FA 3PZIA 3UEQA 3VILA 1PIGA 2J79A 3VMPA 3WQ6A 5BWFA 4HZ7A 4L4PA 1B3VA 1PEZA 3AS1A 1XV8A 2YOCA 2DDXA 3FW6A 3SEPA 2E4TA 3WEMA 3WNKA 3VO0A 3WD3A 2A3CA 5D9NA 3SUWA 2ZX5A 3F5JA 1E9LA 4YPJA 4NRSA 4S3KA 1BVNP 1XH2A 1UR9A 1HJVA 3ARVA 5GPRA 3BH4A 1UWUA 3ZJ6A 2O92A 1XHGA 1HX0A 4AW7A 4BQ3A 3GXIA 5I5RA 1FP9A 2CKRA 1JIBA 2EQDA 4GO8A 4H7VA 5I23A 1NOWA 2J77A 5HXMA 1KCKA 1V3LA 2VTFA 5ABFA 1OB0A 3SURA 4BQ2A 2XFFA 1I75A 2QHAA 3K1DA 3QOMA 4H8HA 4WKFA 3MSDA 1C8YA 3OZOA 2D2OA 4ZE4A 3FXYA 3ALFA 3MANA 1G94A 4GI9A 1DWIM 3GH5A 4HTYA 1EO5A 1NM9A 1UG6A 4X0VA 1BPLB 1ZL1A 2IXVA 4BZYA 3NSNA 2AMGA 2CPUA 3WH8A 3MMWA 4AZ7A 1BYBA 3TOPA 4QCEA 1GJUA 1DEDA 2EPNA 3ECQA 4AZCA 3PTMA 4AIOA 2PC8A 3T2PA 3ARTA 5A6SA 3VM7A 1XGZA 2VRQA 4CD8A 1MQPA 1BYAA 5KZ6A 3M6DA 2CCRA 1KWGA 1CLVA 1W3LA 1FH9A 3A47A 1M01A 3PZ9A 2OSYA 3ZR5A 3AOFA 1TVPA 1MW3A 5DFAA 3CMGA 4D1JA 4JIEA 3KE0A 1BQCA 1LG1A 2BY0A 3DYMA 5IXEA 1JI1A 1F4HA 5DT5A 2Y4SA 2VMFA 3VTRA 1M03A 5FL0A 4U2ZA 1UH2A 2VZUA 3ZSSA 1H09A 1B30A 2VX7A 3VDHA 4HOXA 2WMHA 3QR3A 2CESA 3IAQA 3WY1A 2GDUA 4KRTA 4AZCB 1HKMA 3J7HA 3W0KA 5AC5A 2NW0A 1CGUA 3O9NA 3WD1A 1JXJA 3OIHA 5BXTA 2FHCA 4GKLA 1F4AA 5A2CA 4JL2A 2BHYA 3BSGA 3B8SA 3N9KA 4W84A 2W62A 3BGAA 3WBEA 4E8DA 4W7VA 2J7HA 3RCNA 1DTUA 1JYNA 1CWYA 2DGAA 2YJQA 4HMCA 1UYQA 5CSYA 1V3HA 3NCOA 3M07A 3AS3A 1BSIA 1IZJA 2DSKA 1V02E 4WJXA 3CZJA 5D9MA 2Z1KA 3VD7A 3VNZA 1OT2A 4DWSD 5I24A 1JZ3A 2FH6A 5A8MA 4UNIA 4MPKA 4UQBA 5FD0A 4ZENA 3L4WA 5M03A 3OGRA 3WFZA 3E1F1 1C3FA 1UD4A 7CGTA 1UD3A 3W26A 1JG9A 2YA2A 3SCUA 1M53A 3I3BA 4W8AA 3NIYA 5D8ZA 2XSBA 2VZTA 1QHOA 4AC1X 4MB4A 1XSIA 1E1EA 4LYQA 3AIRA 3TTYA 1GOOA 5D8WA 4HOWA 1ZBVA 2XGBA 3CZKA 2WKLA 4AD3A 3EMQA 2CBVA 5LA1A 4MJ2A 3T2QA 2YA1A 3QGVA 1Q6EA 2CBUA 1DWGM 1GQLA 5CQ1A 1WDRA 2A3HA 4P7LA 5ECUA 6TAAA 3IK2A 3WKZA 3KZSA 5AYIA 1GONA 1OBAA 2VCCA 4U33A 4EK7A 2TAAA 1VEMA 1VFMA 1V03A 3WBAA 4DWSA 4PMYA 1PX8A 4DWSB 1DWHM 2Y8KA 4J3XA 4J3UA 3AYSA 2YDRA 2VR5A 3NSMA 1JZ7A 1TFVA 2RGLA 4W8BA 1UWTA 3LMYA 5I6SA 3D5HA 3WNLA 3EBVA 2VNCA 4UTFA 1BYDA 3ZIZA 1Q6FA 1GUVA 3L4VA 1JD9A 1R86A 1UKPA 2E3ZA 3VDCA 1O6IA 1BGGA 3VUPA 2QPSA 2O9PA 3RO8A 1UKSA 4BF7A 2WVVB 1H49A 4MB5A 2ZUMA 4J3VA 4AD1A 4CKQA 1WB0A 1B1YA 1XRVA 1UKOA 3T2OA 2VRKA 3CH9A 3CHCA 2GK1A 1BF2A 2WVTA 4CCDA 3AXXA 4AWEA 4A4AA 2EJ1A 2W5FA 3SCVA 3L4YA 3MU7A 2CIPA 4P8WA 1TMQA 1UH3A 3PZNA 3W53A 1US2A 4D6FA 1JZ8A 4Z2IA 3VGBA 3U7BA 2FDMA 1J9YA 3UG3A 1R7OA 1UQYA 1DP0A 1HP4A 1BG4A 3WUFA 5EFFA 4AZIA 1WZKA 3WH7A 2V5DA 1QBAA 3PN8A 3MSGA 3U57A 5JBFA 1GOIA 2HISA 3CIVA 1EA9C 3ZR6A 3DECA 4JCMA 3W6LA 4M80A 1UD8A 2ZUSA 1X6LA 3T0BA 2O9RA 4GZIA 1LJYA 2J7FA 1PIFA 1CBGA 2DPEA 2ZXDA 1CGXA 3SCPA 1V02A 3GYCA 1M7XA 4PUEA 2D3NA 2EPOA 4KH2A 1DWAM 3AIBA 4PTVA 3ZOAA 3QHOA 1U33A 3ARUA 1OCQA 3VNYA 3WQ8A 3IJ7A 2JIWA 2WBGA 1SR0A 2WMFA 3GDBA 1WCGA 2Y5EA 3AMKA 1V3JA 2WVVA 4PCSA 1V3MA 1GOMA 1FA2A 1FFQA 1MYRA 2FHFA 2UY4A 4ATDA 1E4IA 1BYCA 2VL4A 3B9DA 1Q6CA 3VGDA 4BQ5A 4W85A 3AMLA 4UZUA 4GQRA 3FHQA 5A95A 1CXKA 1ZBCA 1WP6A 2JF7A 4HZ8A 4LGXA 2OWCA 4B9YA 1QHZA 1OD8A 4BQ4A 3ZJ7A 3ALGA 1HKKA 1W32A 2D24A 3WQ5A 1J01A 2YL5A 4W86A 5I0DA 2VQUA 1J10A 1KGUA 4U3AA 1UWRA 2Y24A 4P8VA 2WC7A 1E6XM 1P6WA 3T09A 1VEOA 4UOQA 3BAXA 4W8LA 2EPMX 4W93A 3AHVA 1FHDA 1C8XA 5GNYA 1JL8A 3B9AA 5HBFA 1ISZA 2W61A 1XCXA 4EANA 5CLTA 4HOZA 4AD0A 2VI0A 3CZEA 1GHSA 1KR1A 1J0YA 5CLWA 1W3HA 4DM1A 1KBBA 3GNRA 1M04A 1E3ZA 3UESA 1TCMA 2ZOXA 5A1AA 2WXDM 1FP8A 1R85A 3I3EA 1B9ZA 2VVNA 1JYWA 2XUCA 4CN6A 1O7AA 3WMBA 2BS9A 4NSBA 3OLEA 3BMWA 4PMXA 3GXMA 1OGBA 2E0PA 3S6TA 4LXFA 3D3AA 4JKLA 1QI0A 3EMZA 4NRRA 5A6KA 3ZT7A 4MTVA 3VD5A 2J25A 3AMGA 1E0VA 3W28A 2DSVA 2GSJA 2YLAA 3CPUA 4QP0A 2VUYA 1EHAA 3SCRA 1NWTA 1XYZA 5A8OA 2V5CA 4M29A 5E6YA 3T08A 1H11A 1FOBA 5A69A 2ZWYA 2DT2A 3G6LA 4M24A 5EBAA 5I3DA 3SUTA 1ISVA 3VD4A 1ESWA 5HDRA 2ZUWA 3PZOA 1S46A 4AZGA 1UKQA 3HN3A 3CUJA 4M82A 4OJYA 2PBGA 4MB1A 1KBKA 1OGSA 1W2PA 5LYRA 2WKGA 2YL6A 1E6SM 3K4DA 2OWWA 3JUGA 1VJZA 1UWIA 4GZJA 3AISA 3MKKA 4Z2JA 3OZPA 4UZSA 4IUGA 1QNOA 1WDPA 1JF6A 1K6AA 1KB3A 1B3YA 4AD2A 5I2UA 1G1YA 1GQIA 1FFRA 5M5DA 2PWGA 4R5EA 3POCA 3O6AA 3AIQA 1V0KA 4KMQA 1ODUA 3TTQA 1FH7A 1E40A 3IJ9A 2G3JA 3ARQA 1E15A 2YDSA 2GJXB 2IXUA 4AEEA 1WAWA 3KWXA 4PTMA 2YBTA 1PX4A 4HMEA 4D1IA 1ISWA 5CZKA 1UD5A 4UFKA 4Z2KA 3UETA 1LLOA 2BHUA 4S3JA 2PWHA 1V6UA 4J3TA 2WCAA 4MJ4A 2DT0A 2DT3A 4KRUA 3ZT5A 4MAZA 4QCFA 4GXPA 2BY1A 4ATLA 1XYFA 2CHOA 4FLQA 4UQAA 3AZRA 4W5ZA 4N42A 4PEEA 4UR9A 2BVTA 1J0HA 1UHVA 2WBKA 1WZAA 4TXEA 4CU8A 5A8NA 3WD2A 4P8UA 1JD7A 1Q4NX 5AY7A 2J74A 5C70A 1E55A 1XD0A 4Q7NA 2XTKA 4X9YA 3EDKA 1L8NA 1V0NA 1UKTA 2WHKA 3GXDA 2UWFA 3A4XA 1CXIA 5BXRA 5JIPA 1SFSA 3BAIA 1BLIA 2OLHA 1CECA 4IM4A 1HKJA 1OD0A 2WCGA 3WIJA 1CYGA 4AZHA 3AS2A 1NWSA 3VIJA 4CGTA 1B31A 1FHLA 2XM2A 3PHAA 2A3BA 4OOZA 4RE2A 3A4AA 4F9JA 2PI6A 5HPCA 2YL9A 1EDGA 4D6EA 1X1NA 2WWCA 4ACYA 2DIEA 1RD6A 1H41A 2WPGA 4D6JA 1W91A 3WDHA 4MNLA 2VQTA 1CNVA 1PJ9A 3N12A 5FOOA 3SCSA 2OYLA 2ZX7A 3MO4A 1E5NA 2YBUA 1HL9A 4PMZA 1UR8A 4OZOA 1QW9A 1TA3A 4WSJA 3ZM8A 2X1IA 1V3KA 1EOKA 3WDJA 2CHNA 2DQXA 3WQWA 4P7RA 2E8YA 1KQZA 5E9AA 1UR4A 1QI5A 2DEPA 2YL8A 3BSHA 3G6MA 1IZKA 1CTNA 5BXSA 2J8GA 2XVLA 3MS8A 1HJSA 3AMCA 3OA5A 4PMOA 4RE3A 1HJQA 2ZX8A 2V3FA 4B3LA 2ZX9A 4AZBA 3N11A 1B0IA 1QHPA 5KEZA 3WDQA 1JZ2A 5FIPA 2WMKA 1W1TA 2Q8XA 3W25A 3N04A 2G3MA 1VJSA 5BRQA 1NH6A 3AHTA 1QVBA 2XVPA 2EEXA 3F5LA 5TD4A 3WEOA 4QLLA 1HJXA 2W91A 2XWDA 2JIEA 3CUIA 4B15A 1QW8A 2VX5A 1CXEA 1DWJM 5IDIA 4MDPA 3TP4A 2ZXBA 2G3IA 1C90A 1ZJAA 4HA3A 3RDKA 2NSXA 5BCAA 2J75A 1VF8A 3VD9A 3AIWA 4XZBA 2WC3A 3FY1A 1IT0A 2J7DA 3AROA 9CGTA 1UUQA 3PZUA 4PMUA 3WNMA 1V6YA 3VX0A 2CYGA 2VRJA 1JFXA 1J11A 3WF2A 1GORA 2F61A 3GM8A 3WF1A 3ZMRA 2D0HA 2Z1SA 3IANA 1E6NA 1HXJA 2W4XA 4PMQA 2DSZA 3WQ4A 2G4FA 1MW1A 3K8MA 1K9FA 3NSXA 7A3HA 5JIWA 2X0HA 4PN2A 1E43A 3FNDA 2BXZA 5JBDA 2JF6A 1UZ1A 2NT1A 1JAKA 2OSWA 5HOSA 4D6HA 1H5VA 1UWQA 2Y2WA 1OWQA 1LWJA 4DUVA 2C0HA 3BXWA 4JKMA 2QMJA 5E09A 3THCA 3N13A 3ZJ8A 3CUFA 2A3AA 1OSEA 1CLXA 5E6ZA 4QDMA 2G41A 4AMCA 4IPNB 3GBDA 1GZJA 4XZWA 3OLIA 4V2XA 1WDQA 2GJRA 1VBRA 4JHOA 3IAPA 1H2JA 4HA4A 2XPKA 1GNXA 3WDPP 3WELA 1D3CA 3BCDA 1B3XA 2XM1A 1EQCA 1C7SA 1Y7VA 3PZGA 2EXOA 2GDVA 4HPGA 4RL3A 3WL0A 1PPIA 1HVQA 1JXKA 4OBSA 4U2YA 2JALA 2OWXA 2WZIA 1WO2A 2CEQA 2PB1A 3DYOA 1E70M 3AYRA 5CSUA 4WKAA 2J7CA 3F5KA 4MNJA 3BAKA 2D1ZA 1XCWA 4ML4A 4D6IA 3AZSA 4JAWA 1E4LA 1YHTA 3UG4A 5CXPA 2A3EA 2Y8VA 1CEOA 1WZMA 4CD7A 2WMIB 4GQQA 4RE4A 1QI2A 3VIFA 2EPKX 1VIWA 1ZB5A 4ATWA 4FLOA 3CHFA 3BLKA 3OGSA 1K9TA 5I78A 4F66A 2D23A 1C8QA 3WF4A 4CCCA 3BAYA 5CPSA 3W29A 4MAVA 1KXTA 1B3ZA 3K8KA 3SCWA 1E6RA 3W4RA 1Q6DA 1TE1A 3VGFA 3AXIA 4W88A 2VOTA 2MANA 3MV11 3RPMA 2PWDA 3L4UA 4HPHA 1JZ4A 4HU8A 3ARSA 4CD4A 1GJWA 1KFWA 4GI6A 1W9UA 4QLKA 1UD2A 5EFDA 3TTOA 2VCBA 1W1PA 3AHXA 5BYWA 1H0GA 2WNWA 1BAGA 2XIBA 4W5UA 3WNNA 1JF5A 2VR4A 1VRXA 4CD6A 2ZUVA 1EQPA 4J7RA 1BG9A 4B16A 3TA9A 2F2HA 1UWSA 3PTKA 2VJXA 4YHGA 5AC4A 4AIUA 1V3IA 4ZEPA 4CUCA 5DO8A 1CIUA 4KGLA 1JGIA 4CN1A 4DWSC 1MXGA 1SMDA 4BA0A 4PMDA 2DH3A 4GPNA 1E3XA 2YDQA 3CLWA 3QOKA 4D72A 3APGA 2WYSA 5GQBA 2RGMA 3GNOA 3PZTA 3WUEA 3MUY1 2C8NA 3HMCA 3CTTA 2V3EA 1H3GA 3AI0A 2E9MA 1CGYA 2D0GA 5CG0A 2O9OA 1J0JA 3POHA 2D22A 5FCZA 4NI3A 3VIIA 2EBNA 3WSUA 3O2LA 2X05A 2QV4A 1OIFA 3WMSA 1MQRA 1B3WA 4MNMA 3KL5A 3UR8A 5HPOA 1EOMA 3FAXA
chains in the Genus database with same CATH superfamily
2WM0A 2XH0A 2HK1A 4OQVA 1KM4A 1EBHA 4O1EA 1E5JA 3B8IA 2BLEA 3W6MA 2XWEA 3MJMA 2PP3A 3QMRA 1E1FA 4IMCA 4PSPA 4D9PA 2R6OA 3MUXA 1R6WA 3AXMA 2FDSA 4HP5A 2D0FA 1WBHA 2NWSA 3U5UA 4GNVA 3WYZA 3M0VA 3ZLFA 3RM8A 4F8XA 2D2JA 2G8ZA 3PBVA 1CI1A 1WDWA 1GTEA 8A3HA 2EG7A 1E1CA 1XIHA 3R2GA 1FDYA 2ON3A 4CCEA 2WZHA 1M3UA 1SYTA 2ZBTA 5L9FA 4MY8A 1JYXA 2R14A 1XH0A 3CL8A 3STEA 3K8LA 5FF2A 1A47A 1M41A 3ITVA 3URBA 1Q6OA 1KTBA 3L2MA 1DJZA 3OOQA 3TH6A 4DNHA 1BQGA 1WQ5A 2DW7A 2RDXA 2Z27A 4LUSA 5HUPA 3O15A 2XGIA 4PRWA 2E67A 3RLVA 5CJ5A 4CQAA 1OFDA 1YNPA 3UZYA 2ZXAA 3NUKA 3V7PA 2ZVIA 2XIQA 4O13A 4ZR8A 4ZCWA 3B8WA 4H9XA 1A4LA 1AQHA 4GUFA 3E2QA 1VYPX 5SWUA 3USBA 3WEZA 2UZ9A 3FXGA 2ZX6A 3FJNA 2J66A 1EGMA 4O0ZA 1U30A 1JDDA 1PDZA 1WNOA 1XLBA 4AEOA 5M3WA 4RDVA 3R94A 1HIZA 3PJUA 1I1WA 3BLPX 4PBGA 1RUSA 3EEZA 3G0XA 5CC5A 1KXHA 2ANUA 2J47A 1GW1A 3DG7A 4G5DA 4AY1A 4JTFA 4HNVA 2AOSA 4HNOA 1AVAA 2Z7GA 1JCNA 5EMJA 3XISA 1J0ZA 1V6VA 4BF5A 3SI9A 1QPKA 1YYAA 4IZGA 4UOZA 3CZ8A 3NTYA 1VFOA 2EHHA 3OBEA 3B0PA 3PAJA 3KP1A 3MVIA 5GNZA 1C7TA 4XUYA 1UR0A 3XINA 4BK9A 3K4WA 1J0IA 5MKGB 1J96A 3QHNA 1UB3A 1XSJA 3UZXA 3INPA 3GUGA 4HGXA 2PWFA 4LTSA 3VU2A 1PTAA 1XLMA 3AWOA 4MSSA 3M46A 1E72M 1BHGA 3B06A 2OPJA 4NZ4A 5I02A 5IHSA 1CDGA 1K7FA 1L8PA 5IHRA 5BMXA 4ONVA 3AS0A 1AD1A 1FCVA 4Q4SA 1RP8A 3D3FA 4S3CA 3SFKA 3KBNA 4B5VA 1R2SA 2G50A 5EPDA 5KZDA 4LCSA 4M6UA 1J5SA 1RA0A 2XJ7A 4M56A 3WLNA 1XRSA 2X30A 2HBXA 1MQQA 4LVFA 1KGXA 2HS6A 3WH6A 2RJHA 2XVKA 1UA7A 5AYYA 3TW9A 3OG2A 5G4EA 4WF7A 2R1MA 1VLIA 3RILA 1YLVA 1WXJA 3QKZA 1VJIA 3LLFA 1DJNA 5H8UA 3QW4B 2E6FA 4MJMA 1A0EA 1K8YA 4HT3A 3PZMA 5RUBA 4BI6A 1K9EA 3WD4A 3GG8A 1EHNA 5HK4A 3RGTA 1LG2A 1T96A 3KL3A 3DC8A 2PTZA 2IUZA 3WLPA 1RPKA 1OCJA 1CZ1A 3L68A 3LEPA 4HN4A 1JFHA 2B31A 2GUYA 3MT1A 3RM4A 2VDHA 4ZE5A 4LQ1A 4AIEA 2CHRA 4DN1A 1PZ3A 3RX4A 1PS9A 3V4BA 2B7OA 2PDCA 4N9CA 1Z41A 3VGGA 4FOJA 1TTPA 2PSNA 3NQ2A 3TONA 2QCCA 1UIPA 8CGTA 4ZXOA 2QZRA 5F2MA 4B3ZA 1PTGA 3K13A 3PF3A 1XBYA 4A3RA 4O1BA 3QJAA 1BWKA 4YIWA 2L5HA 3C56A 4ZZ9A 4L4OA 3S42A 3KVMA 2Z2AA 3HJEA 4RZ5A 1CGVA 1KM0A 2RDTA 4TX8A 5ABGA 2DT1A 1JNDA 3WFAA 3BAJA 4LWWA 3DCPA 1QNRA 4AAJA 3QV9A 4JQAA 3KP0A 5C71A 1RBAA 4QEHA 4H8UA 4R7JA 4DJED 3ABOA 1R7AA 3VNKA 4QG6A 3FIGA 4C6FA 3WF3A 2FB2A 4FOKA 1C92A 1Q63A 3VZZA 2DIJA 5E1QA 2HZGA 1E0WA 3NURA 1A50A 3LSCA 3NFUA 1XX1A 3THAA 1F61A 3FVDA 3W7HA 3PVFA 4XTDA 3W37A 1NFGA 1TPWA 3RN6A 4M1BA 3VIGA 1RK5A 3A6OA 1EX5A 2ZZ4A 1EJWC 2WZEA 3WLRA 3MHGA 2DSUA 2QJGA 2CNCA 3NO5A 3MZ2A 1IEWA 4Z1YA 2O9TA 3N25A 3B0VC 4JX4A 4PC8A 4C6MA 3P5ZA 1EB3A 2H3BA 1QNPA 4D71A 4MYXA 1OJXA 1PWLA 5A6JA 2PZ0A 4DO5A 3QGKC 3W7QA 4P7QA 3BGJA 1FWRA 2W3ZA 6XIMA 2DZPA 4B90A 3JW7A 4MY1A 2WB5A 3LCHA 4O16A 1K03A 4QISA 1RVKA 1X6NA 3TZFA 5G1MA 3SRFA 4XD6A 1REQB 1VAHA 4RPQA 3W01A 3EX2A 1VIZA 4ZSUA 3TR9A 2QJNA 2C71A 4WZHA 3VDBA 1UPMB 3LPPA 4N9DA 4AZ6A 2QCNA 2V68A 1JEZA 1WXYA 1TA3B 4XO7A 3S5SA 5LGZA 3SCOA 4X60A 5D9PA 1J0KA 2QCDA 1TPH1 2XH4A 4PEKA 4LNYA 1EIXA 2DQWA 2GGJA 4FOUA 2QCEA 3AUOA 4IGMA 2YZRA 1JULA 1KWKA 5BOFA 1GVQA 1O5XA 4CNPA 2V6AA 1VKFA 4C1NA 4EPEC 1ADOA 5KITA 1T0OA 2FZ9A 2PMQA 2GVYA 3MV01 1H1YA 1I6NA 3Q58A 1EJTC 4PMVA 3U2ZA 4AYSA 3HPZA 1Z6KA 5H8PA 1U5VA 3UA4A 4WR3A 1MEIA 1TUFA 4DPQA 4PCNA 2EKCA 4WKHA 4A3YA 1Q3NA 1RLCL 2E5BA 3PSVA 2PRMA 2OFJA 4OUIA 2HXTA 3W38A 9XIAA 4FX6M 2OGJA 3UG8A 3T05A 4MIMA 3C6CA 2E6DA 1XCFA 2CETA 4BWLA 2WHMA 3ZQ9A 1NWRA 1S38A 2BDQA 3QQ1A 4MF4A 1RH9A 3QLDA 1QI3A 4LYRA 4CVWA 4AX7A 2GL5A 3PFRA 4HMDA 4Y9NA 2X8RA 3HG4A 4YN5A 4J3SA 4WDXA 1E6ZA 2WHLA 4HZ6A 4FS9A 4DZAA 3QHMA 3CAWA 1XICA 1O1ZA 2J7GA 1RP9A 3G1YA 3C86A 4FB7A 3S4TA 2ZRZA 4GD0A 1LORA 4Q7IA 4GXWA 5ECVA 1LL7A 4U28A 1GOKA 1VQTA 4ZMGA 2I17A 3C5QA 4AQLA 5D2YA 1T40A 2A21A 4H8VA 3NJ3A 2VVSA 2WC4A 3R89A 4JDBA 1KLYA 3O16A 4C5YA 4DJEA 1KRMA 2Z25A 3N2MA 2Z0IA 4RZ4A 4AXKA 1QWKA 4JIRA 3WO8A 4DHGA 1VBGA 3MSYA 4U5KA 3AFBA 5A3HA 1GK8A 5EB8A 3PZQA 3WH9A 1C8VA 3I7SA 1NP2A 3SIMA 4HU0A 4L4MA 1W37A 2QLYA 3B04A 4A8RA 3QY8A 3C0SA 4LEFA 1JDCA 3SGGA 2HCVA 1JI2A 3S6OA 1Z69A 3T42A 4ASTA 2QUTA 3DKJA 1ISXA 3O1NA 4NVTA 3TJLA 1FWNA 3VIHA 4GO9A 3AICA 1W9PA 3RM9A 1JZ5A 3CZLA 1A5UA 4TX6A 4XAPA 1NFPA 5CPQA 1IT7A 4ALDA 4N0RA 4IISA 1YPIA 4ZXLA 1TV7A 1HP5A 4EF8A 3MI2A 2IPFA 2WVSA 4DO7A 1ZS2A 3HJZA 2ZICA 1OINA 5JUVA 3MJYA 2IQDA 4V1YA 5A2AA 4AVFA 3VINA 4DWDA 2VFDA 1Q85A 4WIWA 3MWCA 1UOKA 3VIPA 4MADA 4REQB 3LDVA 1VYRA 2WMJA 1VEPA 1CPUA 3W7NA 4E4FA 4U10A 3G24A 1JPIA 1J18A 3EMCA 4QJ4B 3M0XA 3GTNA 3DGBA 3WQDA 2E8ZA 1V8EA 4F2UA 1FDZA 4FZIA 4XSLA 3N4EA 2PGRA 1ICSA 5E0FA 2WCSA 5AHIA 1CGTA 5AYZA 2V82A 3FGCA 2PGFA 2QIWA 1ZLPA 4WHBA 2WJEA 1YBQA 2HVMA 4NHVA 4PTDA 4CNSA 4TMCA 4MZ1A 3G18A 2XFRA 3NZ1A 4O57A 2VOMA 1KGWA 4KPLA 4BI7A 2H6RA 1TO3A 3ABXA 4FMVA 4EX4A 1XPYA 2J13A 6REQA 2J79A 4L4PA 1FWHC 1YDNA 2BB0A 4HZ7A 3EEGA 4DJFD 1PEZA 4DJEC 3U4FA 3AS1A 3NQ7A 2XZ7A 3F4NA 1Q5MA 2GSHA 3G0UA 1QAPA 4WDUA 3WD3A 3LD5A 4RXGA 1E9LA 2HK0A 3FEMA 4ZQNA 4NRSA 4S3KA 1RV8A 1QFEA 1HJVA 3RMJA 3ARVA 5GPRA 3BH4A 2GQ8A 4BQ3A 3W2UA 3GXIA 4H6QA 4M51A 3VZYA 4IP7A 1A5OC 5HXMA 3ZVHA 1KCKA 1V3LA 4I5XA 3O63A 3BV4A 4YTSA 1C8YA 2PS2A 3QGAC 4J4KA 3LM7A 1DWIM 4GI9A 4CEUC 1EO5A 3FYPA 2H9AB 3GW3A 5AVNA 4C65A 2CPUA 3WH8A 5D02A 4IX2A 3TC6A 3M64A 1DEDA 2EPNA 1ZP3A 4AZCA 3PTMA 2PC8A 3LI0A 5DN1A 3ARTA 3JZUA 5A6SA 2ZA3A 2INEA 1P0KA 1VR6A 3DKLA 2CCRA 4JIQA 3QSRA 3BK0A 2ISFA 1FH9A 5U4NA 4ZB2A 4DI8A 1M01A 2OSYA 3MKCA 2GUBA 1Q8AA 1MW3A 5DBTA 1KD0A 5DFAA 3D47A 4D1JA 3W74A 3DYMA 5IXEA 3FK4A 2O0TA 1HFBA 4Q8TA 5FL0A 4B5NA 3QFWA 1RXOB 3RU8X 1TSIA 3HB9A 3ZSSA 2CLPA 4O1CA 3N9RA 3VDHA 3S46A 1U1JA 4DZHA 4IL0A 3S8HA 5CSSA 2GDUA 4JQ3A 1SU5A 1OZQA 5T8GA 4GE8A 3UNTA 2PDUA 5AC5A 1X39A 3ANYA 1H7PA 3KZPA 2ACUA 4C6CA 1F4AA 3LV6A 5A2CA 4QRNA 1QPNA 1N8FA 1K8CA 3CV2A 3BGAA 4E8DA 3WK3A 2YJQA 3EXRA 3W7MA 2QUUA 1U83A 3FCPA 2DUAA 1UYQA 1V3HA 3M0MA 3H8AA 1IZJA 4WJXA 2PLCA 5HQEA 4MUZA 1DE6A 2Y61A 3VNZA 4DWSD 4F48A 3BURA 4ROQA 1DORA 5FD0A 4ZENA 4R88A 4KFNA 4QM1A 7CGTA 2QCDB 1MEWA 3SCUA 3U9IA 1J5TA 1A5BA 3B0YA 3I3BA 4W8AA 2DU2A 2VZTA 4DLFA 5EKYA 3CL7A 3WJZA 2Y5JA 8XIAA 4DF2A 4E2DA 1YPFA 2CBVA 2DZBA 2VP8A 3T2QA 2VELA 3AALA 4ILSA 1GQLA 1TX2A 1WDRA 2V63A 2A3HA 4HNLA 2RH9A 4P7LA 1KV5A 5ECUA 3L5LA 6TAAA 3IK2A 3WKZA 5AYIA 1GONA 3CO8A 2VCCA 3LTPA 3SN1A 2TAAA 4EK7A 3EB3A 3H7UA 1VEMA 4F40A 3NA8A 4UMCA 3G5EA 3UWZA 4DWSB 3IVUA 1DWHM 5F2LA 4KCVA 4J3UA 2P3EA 1R9ZA 3ATZA 3HQPA 5I00A 2DP3A 2RGLA 2H9AA 3Q94A 1BYDA 3W02A 1AL7A 4N7QA 2OEMA 2O56A 4MKVA 2E3ZA 3TU9A 3NM3A 4KWVA 3G8RA 1H49A 4JTTA 7TIMA 3TSMA 2QVHA 4CKQA 5GJPA 1B1YA 3PNUA 2GK1A 3CHCA 4A4AA 4I8DA 2YCLA 4FP1A 4US5A 1ML1A 5CC7A 3C3NA 4R85A 3MU7A 2VUNA 4WOQA 3BQ5A 1TMQA 2ZC8A 3W53A 4D6FA 4Z2IA 1AJ2A 2X42A 2OR2A 1KW1A 5D2WA 4KIRA 2FMNA 3ORWA 4GY0A 1BG4A 3UNDA 2QDHA 5JBFA 1KBJA 3CIVA 4JHMA 1EFZA 3DECA 3MSRA 1R5YA 4OHQA 3E5BA 4M80A 5FJRA 4O52A 1JCJA 3VCNA 3H53A 3IJLA 1PIFA 2Z1VA 3M0IA 4TQTA 3GYCA 4PUEA 4XD4A 2D3NA 4KH2A 4OTKA 3AIBA 3FGCB 4ERGA 3RUBL 3ZOAA 4LBRA 3QVQA 3WQ8A 1OCQA 3IJ7A 2JIWA 2VEFA 2WMFA 5A5WA 1JCLA 4RPPA 1PVNA 2Y5EA 3AMKA 1V3MA 1GOMA 1FA2A 2PDIA 3B9DA 1XIGA 2NVAA 1CB7B 2ISWA 1VPYA 3KHDA 1UUOA 1I2PA 1W1B1 3GS6A 4LF1A 3WQFA 2NVCA 4UMBA 1ZBCA 4FR6A 5C2GA 3NO1A 4O14A 2YDAA 3MI6A 4HZ8A 1W56A 1B3OA 2OWCA 1QHZA 3ZJ7A 1YMYA 1W32A 4E8GA 1KO0A 4UC5A 1FWJC 4O0QA 4FR1A 1S1PA 1Q7ZA 2WC7A 3UF9A 4UOQA 2J9ZA 1XISA 4H9ZA 3BLFA 4GC3A 3CH0A 5GNYA 3S2JA 3B9AA 5HBFA 3PPFA 3MYOA 3WBXA 1IHIA 3Q45A 1XCXA 1TB3A 3TQKA 3GDRA 4H7CA 3KVJA 2E6AA 1DBTA 4HPJA 2H90A 4PUUA 4NAEA 4ZOEA 4WVXA 2E77A 4BWLC 2IW0A 1MNZA 1X96A 5AKQA 1O7AA 3PG9A 4JTAA 1TV4A 4AVOA 3V5CA 5KZEA 1S2VA 1AZ2A 1UZDA 4UWMA 3M4HA 2OQHA 1IGSA 2A4AA 4NZJA 4TV6A 4KERA 4CQ8A 1G6CA 4LXFA 2PCEA 4QE5A 1KBLA 4NRRA 3P0WA 3MDWA 3TN3A 2INZA 3LRMA 1E0VA 3FKRA 4X3ZA 3S1UA 4WCJA 3CPUA 4IXXA 3A21A 1EHAA 2QUNA 3SCRA 2QJIA 1DV7A 2QS8A 5A8OA 1I2QA 4M29A 2RFGA 4O1FA 1FOBA 2DT2A 4L9YA 2CC0A 3DUGA 4M24A 5EBAA 2Q6ZA 2CLKA 1FBAA 1ESWA 3G3DA 2ZUWA 3PBMA 4XZLX 1RALA 3HN3A 4M82A 4MB1A 3QV8A 1KBKA 1OGSA 4GABA 4PTNA 3M5YA 1ONRA 1E6SM 4ZBCA 3K4DA 1KRCC 2OWWA 3VKDA 4PUNA 3E2RA 3LB0A 3HGSA 4GZJA 3AISA 3MKKA 1XIFA 2DZAA 4QEEA 3LXBA 4IUGA 2Z4GA 3W3OA 4H2HA 4GJIA 3FX4A 4LF2A 4MM1A 1OFRA 2FZNA 1KM5A 4XUGA 2DVXA 1GVOA 3AO0A 4LNCA 1VBHA 1JRBA 4N6EA 1ZAHA 3UY8A 3KBWA 4C60A 1FFRA 4R5EA 4K36A 4DYKA 3R0DA 3QC0A 4LRSA 1BTMA 1FH7A 3ARQA 3ENLA 3QEZA 1WAWA 1J79A 7ENLA 2EF9A 1ISWA 1EC7A 4LS1A 3N2TA 3UETA 4I9AA 1N2VA 4S3JA 5LSMA 5F2GA 4CLMA 4J3TA 2ZZ6A 4GUIA 1W1ZA 1SO6A 4KRUA 1F05A 4KQNA 1LZOA 4ZFCA 2AL2B 3A4JA 4QCFA 3BOFA 1ME9A 2VEIA 3SQLA 1I0BA 4QQUA 4UQAA 3AZRA 4N42A 2HV5A 4P2VA 5ABTA 3OHIA 3QLLA 4B2DA 4JNZA 3FLUA 1IGWA 1UHVA 2YW3A 4DO6A 2HQAA 3TFCA 4LRTA 1Q4NX 5AY7A 2J74A 5C70A 4FNPA 1XD0A 3VKAA 4X9YA 3EDKA 2QJHA 1SJDA 2PE4A 3GIPA 3GXDA 4CQ9A 1SJAA 1KV8A 1CECA 5FF0A 4IM4A 2EKGA 1Y5XA 2VWTA 3WLSA 3C2OA 3TAKA 4Y6GA 2XM2A 4E38A 4Y2WA 1LUCA 3GR8A 2XIJA 3TK7A 4D6EA 1DYSA 2G97A 4ACYA 3CB8A 3ZLGA 2WJZA 4IQEA 5FACA 4PULA 4D6JA 1PJ9A 4QJ1A 4K3ZA 3N12A 3SQSA 5FOOA 2Y6ZA 5DY2A 1UMLA 4PMZA 2DZUA 1EJVC 1TA3A 3BPWA 1GZ1A 1I2OA 1V3KA 3GHTA 3BE7A 1EOKA 2CHNA 3T8QA 4BFAA 3GB6A 5EMUA 3BW4A 4B4FA 1TIMA 2ZTKA 3IIOA 1BXNA 1UR4A 3BSHA 3DFHA 1IZKA 3JZEA 1XLCA 5BXSA 2J8GA 3BVJA 2I57A 3BG9A 1EP2A 2GVEA 3W2NA 4AZBA 5KEZA 3WDQA 1PKMA 1ZNNA 1D8CA 3IPWA 4EAYA 2O4MA 3P0XA 2G3MA 4JYFA 1EGVA 2HRWA 2X40A 2WO5A 5TD4A 3P2VA 2RAGA 3E2VA 4QLLA 3H55A 4WQ6A 1O5RA 3A64A 3U2OA 4WY0B 5HQLA 1M7OA 3CUIA 4I5RA 3ZVHB 3Q67A 1QW8A 2OLAA 4R33A 4W9TA 1DWJM 4IL2A 3GR7A 3TP4A 4UTUA 2XDFA 5I09A 1K7EA 4ZA0A 1R3TA 3E38A 1S3HA 1EJ7L 2NUXA 1AA1B 3VD9A 4XZBA 1BD0A 3EWDA 4N02A 1X8FA 3UWQA 1UUQA 3HFTA 3PZUA 3S0CA 5FSEC 3WNMA 4UTTC 3VX0A 2CYGA 4CNUA 1O68A 3BOLA 1R46A 1UMYA 1G4SA 3IANA 1D7KA 2XH7A 1HXJA 2W4XA 2G4FA 3K8MA 1J8VA 2VD8A 7A3HA 2XZ9A 5XINA 3SRKA 3UBPC 3FNDA 2JF6A 4GGBA 2NT1A 1JAKA 2NX1A 3GRIA 1JDEA 4DUVA 2C0HA 3THCA 1TYGA 5C6MA 3G1HA 4XK2A 3TNOA 3EX3A 4BI5A 1EYEA 3SAZA 4N9BA 4IPNB 1IYXA 1NELA 3OLIA 3RFAA 2GJRA 1VBRA 3LNMA 5I7GA 1FWAC 5T91A 4PODA 1JR1A 3WLJA 3WELA 3GX9A 3BCDA 4XWUA 1B3XA 3RF9A 2XM1A 2OX4A 3NYZA 3CAQA 3IUDA 2D69A 2PRHA 5KZMA 3NQVA 1LUCB 3QM3A 4HK5A 1MRQA 4OBSA 5KINA 4POCA 4J35A 2XFWA 2CEQA 5J8LA 3F5KA 3O0KA 4MNJA 4WJ8A 3LM3A 4IPIA 4JAWA 1E4LA 4YCOA 3F4DA 3V16A 1ZUAX 1IEVA 3OODA 1F6KA 2WMIB 3EA2A 1VHNA 2C1IA 5G4HC 2EPKX 1KLZA 3NAVA 2OZ3A 4Q8UA 1K9TA 3W7GA 3WF4A 5DANA 2P0IA 1OCBA 2GVGA 3LA4A 3W29A 1KXTA 3O7UA 5J5DA 2Q8ZA 4PCFA 1Q6DA 4QIUA 4DLMA 3N4AA 3UJRA 6PTDA 3MV11 5TQLA 2PWDA 4MFEA 1CB2A 3KBSA 2PDHA 1WKFA 1GOXA 3E12A 1UD2A 1BAGA 1V5XA 2VR4A 3R25A 1AW1A 1VRXA 3EB4A 4GYJA 4B16A 1BG9A 3UWYA 2NXHA 5LGXA 2BWGA 2Y0FA 5DO8A 4IH3A 1CIUA 3VK5A 4KGLA 2PF8A 3AYVA 1B54A 1SMDA 2XISA 1YX1A 1V93A 3VE9A 4GNJA 4GKTA 3KTSA 1UR3M 4DNMA 3GNNA 5GQBA 1US0A 4K8EA 3MUY1 1JPHA 3GG7A 3CTTA 2H8ZA 2V3EA 3NPUA 1H3GA 5HMEA 2E9MA 2J9XA 5CG0A 2FVKA 3PPHA 4JTRA 2O9OA 3POHA 3KLKA 2WZMA 4RZ6A 4NI3A 3ABSA 1LLZA 4S1FA 4HYVA 3WK2A 2MNRA 4MNMA 3UR8A 4E6MA 5HPOA 1S3TC 1H7WA 3FAXA 4GFIA 3TTSA 3BMXA 2R8WA 2E1WA 4ZSTA 3L7RA 1TV2A 1XRFA 3ARRA 3WD0A 1G4TA 2O4QA 3TFXA 2ABAA 5HNNA 4AY7A 4KEVA 2NQHA 2TSYA 4IXHA 1QK0A 1SJCA 2VCAA 1KXVA 3VCRA 2V2CA 4XG1A 2F9RA 1W5QA 2X0SA 1LP6A 3W00A 3S83A 4EXQA 3IIVA 3U3HA 3FS2A 3EOUA 3ZO9A 1KFBA 4QDWA 2C0AA 4WSKA 2OO0A 5LA0A 2CLMA 3R12A 2YR1A 3PWIA 2E40A 5BU6A 4TIMA 4QNWA 2CLFA 3PJWA 4KBXA 4GOAA 2GUUA 4GUGA 3P67A 1VRDA 2ABBA 4IOTA 3GZAA 1GGOA 2ZUTA 1KM2A 1MUCA 4IP4A 4J9JA 3NR0A 3TUUA 1M65A 3A9IA 1OVDA 3IGUA 2I16A 1NY1A 1CT5A 1U5JA 1OC5A 4JFSA 3U0HA 4A8IA 4UTHA 4RKAA 4DUXA 3AIUA 3IGXA 4G8TA 4Z2LA 4CNOA 4B92A 2PLKA 1EX1A 2HE5A 4IFOA 3THQA 3H2NA 3VOFA 1ZAIA 3R11A 4D6DA 4ZQMA 3BLLA 4A3HA 1IXQA 2V2DA 3VOCA 4HIBA 1HJWA 2OZTA 1KC7A 4KWUA 3UCCA 3STGA 3B4UA 1AH3A 4E4PA 1UC5A 4EIVA 4JFVA 1AL8A 4CD5A 3F2DA 3PWAA 1ICPA 2XN2A 4HJFA 3PANA 2YYTA 2AAAA 3NQDA 4HJWA 2J7BA 2XVNA 3CUHA 2VO5A 3EB2A 4V27A 3N1AA 1KXQA 4LVBA 1FWTA 3W1AA 1BTCA 4UFLA 1LOSA 1U2YA 4KRZA 1OFPA 4UFMA 4JTIA 1LCOA 2XHYA 5REQB 4OUEA 2DSWA 1GHRA 3L21A 4MDOA 1VFTA 3IV8A 3FJ6A 3BOXA 1QXLA 3QZ6A 4MB3A 2JE8A 4W87A 1T7LA 4G1NA 1BRLA 2E9BA 3U5YA 1QASA 4TVCA 3M5ZA 2DZXA 2PTXA 4HB7A 3VMNA 3C3UA 3U7VA 1E9IA 3FEQA 3NZPA 1QATA 5KSWA 3LCGA 2VDGA 1V0MA 4R7OA 4X22A 2P8CA 3XIMA 1YDVA 1UPPA 3G2GA 1S5MA 4JOMA 2FTWA 5I03A 2RJGA 2P8BA 1C29A 1TPFA 2P50A 3OLDA 2QPXA 3PS7A 3LHUA 3BDKA 5DQPA 3TCSA 4AWTA 3UZZA 4OU1A 2NVDA 5HNTA 3WENA 4E3TA 4UCFA 4DZIA 5MF5A 4FALA 3VNDA 2YCIX 5CBIA 2XIMA 2ZZ1A 3EDJA 5D9OA 1XDMA 3AAMA 2DH2A 4NUWA 3EWXA 2D20A 5FJPA 3WLTA 1DIDA 1NOFA 2FB3A 3ERPA 3DU0A 1F3WA 1KM6A 4MNKA 4IICA 2YB4A 2KX9A 2C19A 2WOQA 3BL3A 3PFMA 4FAMA 2CERA 2FHBA 2POTA 2WHJA 3L9CA 3VGEA 3R10A 3OVGA 3MI3A 1P5BA 4IPJA 4S3DA 2B4GA 4GIEA 4GI8A 1EO7A 3QPYA 1US3A 4MOZA 2NWRA 1NARA 3HIJA 4M1RA 2Q09A 4EOUA 4LV9A 3P14A 4O54A 7TAAA 3W2KA 1ISYA 3UERA 4C7DA 1K1DA 1S2CA 3BTNA 1L2UA 3G1DA 3S5ZA 1VD6A 3QPZA 1YKWA 4PUWA 1NP0A 1L0PA 6CGTA 2HSAA 1OT1A 1TR1A 4ZQPA 3E2SA 4GVFA 5CPOA 4J5NA 1JZ6A 1UA3A 1T99A 1XYMA 4JFUA 3TLLA 3SUVA 3DYPA 5AOUA 6A3HA 4JR5A 2PDNA 2Y7EA 4MMWA 4BEUA 3AIVA 3DHUA 1A80A 3IEBA 4D8ZA 1IXOA 4LCQA 4YMZA 1M7PA 4M81A 3UXDA 2OYKA 3NQAA 1TZ7A 4E5TA 4IPLA 5DT7A 1XM3A 4WDWA 3W1TA 5CGMA 2GVLA 1DHKA 5CZJA 3AHYA 2W63A 3UWEA 2QUMA 4DF1A 4DEFA 1T8XA 1F3TA 1LRNA 1K4HA 1MFVA 1C9DA 1JCMP 5T26A 2PTWA 1O4UA 1IF2A 3WLIA 3STPA 3QXBA 3QTPA 5G1TA 4Q4RA 4O28A 1W1VA 4GINA 4P8XA 2R1PA 2J7EA 3CO4A 3VI2A 2GVJA 1RR2A 1BEUA 2AQOA 1LBMA 1F7BA 3W07A 2CBJA 4QLJA 4S38A 4Z08A 3LCLA 3TMQA 3CQKA 1XIIA 2X09A 3TQ0A 3UVIA 1QI4A 3KOWA 4CNNA 3TYZA 3G1AA 3PUEA 1R30A 1R3QA 2QPUA 1AQ0A 1E4NA 1UBPC 1W9DM 3NXFA 1RA5A 4XAFA 4PMRA 4TMBA 1EXPA 1H1NA 4PUDA 1E9YB 4YTQA 3WFLA 3GH7A 3A12A 3IVSA 3NPWA 1PWMA 5HWJA 3E0VA 3LGGA 2W92A 1OM0A 5JBEA 2VX4A 3KS6A 2V5KA 2W67A 3A9BA 3UGRA 1OFOA 2NUYA 3I10A 2PDYA 4EKJA 3O6CA 2ZZ3A 4P61A 5A6LA 3W7PA 1SMAA 3CYJA 2JEPA 2ZTJA 3GVGA 3P80A 2ZADA 2BHZA 4LS0A 1RCQA 3N4FA 1GVIA 3W71A 3S1GA 1WDSA 4ERIA 4JCLA 3N18A 2Y1HA 3LI1A 4FXSA 3EX6A 2WSRA 4PGLA 1QMLA 1Z48A 4A8NA 4JFTA 1HGWA 2ACSA 1H60A 4KEUA 1J6PA 1JUKA 2C79A 4ADSA 4O19A 1UZ4A 1G5AA 3LX9A 3VGHA 2WAGA 3W2MA 4HA1A 3LBCA 4TR9A 1PO9A 4WSHA 2P53A 1ITUA 3RYSA 3WQVA 5LNVA 2WW5A 4YWIA 3WBWA 1I4NA 4XZMX 4I6VA 1RSCA 1V6XA 2JEQA 3VVGA 4IQLA 3CBWA 2V8ZA 3RG6A 1P4CA 2BTMA 4LYPA 3GH4A 4TUFA 4B9ZA 5H8MA 3WUBA 3S2NA 3CC1A 1JRCA 2BY3A 2YBVA 3HA1A 2YPIA 4E2OA 1UASA 4K1WA 4XB3A 2OLSA 4B5TA 1IE7C 4UB9A 3W1QA 3BC9A 4FHAA 1DVJA 1MW0A 1PTDA 3B8UA 3I7RA 4NZCA 5FL1A 2WMGA 2EG8A 4HN8A 3ITGA 4RV3A 1JAEA 1UZHA 4S3EA 4EWJA 4N9EA 4FK9A 4U3CA 1GKPA 3AXHA 2FZBA 3M7SA 4ADTA 3KRUA 3OG3A 4DM2A 2BODX 1MWOA 2BVYA 4AISA 3GVRA 3PBGA 5CC3A 1YBQB 1D2KA 4UQCA 4F0SA 4U5IA 3EDDA 3MCMA 2ZIDA 4QBXA 3I6RA 1FXPA 4OIFA 3V3WA 4D6CA 1HVXA 1VENA 1W2VA 2YGYA 4IMGA 2V3DA 1XR2A 2OEKA 1HN1A 4LUTB 5CGQA 1AMYA 2KAUC 2EGZA 5LIUX 3C0LA 4JL1A 1W1YA 4GACA 1EGZA 2C1GA 4FLSA 3RMEA 3AU6A 1ODZA 5HA7A 2AGTA 2YA0A 5A8QA 1XBZA 3UGVA 5FKYA 3HO8A 1TPEA 1LBFA 3Q4DA 3GDLA 1MVYA 3SZ8A 4RK8A 3BICA 3PJXA 4URIA 4MWAA 1FKXA 1FRBA 4E0CA 3DBPA 3SCQA 2CBIA 3UZJA 1GYMA 1TZZA 4S2BA 1HNYA 1MUMA 3CHDA 3C52A 5HULA 1S5TA 4V15A 5C2XA 2AQVA 1IV8A 1W0MA 2VHLA 4Q8WA 3WZ0E 3MY9A 3DH7A 3PR2A 3QV6A 2NV1A 2C7FA 3UEQA 3VILA 3VMPA 1B3VA 1PHWA 1OFBA 3B40A 3W87A 2DDXA 3GD6A 3F4WA 3WEMA 1KM3A 1ICQA 1LQAA 3VO0A 2A3CA 3ITOA 4LYKA 2ZX5A 2ISSA 3F5JA 1C9WA 3T0TA 4UR8A 2A6LA 2GDQA 3ZLHA 3UWVA 1UR9A 2BVWA 3PP7A 1UWUA 2GQ9A 4AW7A 1HX0A 2DUXA 5TF0A 1U5HA 1OFEA 1RCOB 5CSRA 5EMLA 1F9CA 1FP9A 1JIBA 2EQDA 4H7VA 1NOWA 2HE8A 5ABFA 1OB0A 1FWIC 3SURA 1O60A 2FQIA 5HQMA 1I75A 2E68A 2QHAA 4WKFA 3KOYA 3GTHA 2AGKA 4ADUA 5I3IA 3ALFA 4O17A 3MANA 1O5QA 4HTYA 1UG6A 1NM9A 4X0VA 1ZL1A 2V67A 3G1XA 2OOGA 1R47A 1PZ1A 2JKPA 4GY1A 2Y70A 2X16A 3TOPA 4QCEA 3H2OA 1FHUA 1YXYA 1E0UA 1YE4A 4R3UA 4MYAA 3TJIA 3T2PA 1IWBA 1EL3A 5DMLA 4ERAA 3HV9A 2AKMA 5AHLA 2POZA 4TV5A 4XAYA 2REQA 3GUWA 1KWGA 3CQJA 3PUGA 1IR2A 3S1VA 1R38A 4JTLA 4Q4MA 1PSCA 4YYCA 3KE0A 1BQCA 1LG1A 1B4EA 1J2BA 2IS7A 4IMDA 2ZVRA 3VTRA 3UW6A 1G7VA 1SFTA 3TN4A 3IIZA 5LNSA 2BXVA 3VYLA 3PSWA 1QOQA 4XIAA 4KRTA 3ITYA 3NEVA 5TAOA 3FJLA 1RD5A 2Y7DA 1CGUA 3WD1A 4NX5A 5G5IA 3OIHA 5BXTA 2FHCA 1JQVA 4WX2A 3FVMA 4QHRA 3BO9A 1RY8A 3B8SA 4W84A 2NQ9A 2HXUA 4W7VA 2DGAA 3GC4A 4PUJA 4LVDA 1PCKA 5AC7A 1VFLA 3W75A 2RDWA 5LIKX 3TN6A 1V02E 2Z1KA 3RNDA 5D30A 1OT2A 3P3BA 5A8MA 4UNIA 1SO4A 1FCUA 4FNSA 2PDPA 4UQBA 3LZ5A 5I3JA 1P43A 4I9TA 4UTMA 4Y8FA 1PZ0A 4BY3A 1GVSA 4WXYA 1M53A 2ZZ2A 4MGGA 2XSBA 1QDSA 1UJPA 4AC1X 1XSIA 3M0LA 1GW9A 3AIRA 3TTYA 3W22A 4K8HA 1O66A 3ITCA 8XIMA 2XGBA 3CZKA 3EMQA 5LA1A 4D8LA 2FVMA 3KFTA 3RAOA 1HUVA 3ITTA 2CBUA 5CQ1A 4I7WA 4PR4A 3CU2A 3E6EA 2P0OA 5JVLA 4FNQA 1VYSX 1VFMA 4AMAA 1TE6A 3IJ6A 1OZMA 3M0ZA 1HO1A 4IIBA 2Y8KA 4J3XA 2HTMA 4EXAA 3O6DA 4NP7A 5DBUA 3NSMA 1JQXA 3O0FA 3LMYA 1TPDA 1KKOA 3EBVA 2VNCA 4UTFA 1NQKA 1XIJA 3NZGA 2VEMA 2I5IA 1BGGA 3VUPA 2J9YA 3RO8A 4BF7A 4XTIA 4L1GA 5CPMA 4J3VA 1WB0A 3T2OA 4GZ7A 2VRKA 1BF2A 1ENUA 3AXXA 2EJ1A 4L65A 4A8LA 1SSDA 1VCFA 3QTGA 3ONCA 3GZ3A 1XKYA 3UG3A 1J9YA 1R7OA 3N3MA 4BR1A 1HP4A 3O8AA 5EFFA 1QBAA 3FJ4A 2YXOA 3CQ0A 4UNLA 1LYXA 1GOIA 2HISA 3ZR6A 2XGZA 5CAHA 1Y8BA 2A0NA 4FEZA 3T0BA 4C6IA 4GZIA 5LNWA 2OZ8A 3GIYA 1SZGA 1CBGA 2ZXDA 1CGXA 2EPOA 1DWAM 2NSOA 1W5NA 2F38A 4FF7A 4G6CA 4ICMA 5D33A 3SY8A 1YNYA 1BWLA 2WBGA 1SR0A 3M41A 4NY2A 3GAKA 4NX0A 2WVVA 4PCSA 2FHFA 3WLHA 2I5GA 4RNJA 2GYIA 5KETA 4K8GA 2QDDA 4ZO6A 1S5NA 3CT7A 1WBJA 3CL6A 5GVJA 1WP6A 4GVHA 2JF7A 1PV8A 2QGHA 1ZALA 4DVOA 4RW3A 5LZLA 3STFA 1J01A 2YL5A 1J10A 1KGUA 2Z24A 1W8GA 2Z26A 2Y24A 3APYA 4H6EA 1ZY9A 4KIEA 3IJIA 3T07A 1VEOA 3T09A 4Q8PA 2XINA 1R3YA 4ENLA 2GWNA 4ICCX 3NL2A 3KUMA 4W93A 3HFYA 3AHVA 1ZZMA 2Y89A 1FHDA 2FTYA 4WRHA 1ISZA 3YPIA 4HKPA 2WM1A 4GBDA 3R7MA 3GXPA 1GHSA 2GJNA 1J0YA 4UTIA 1FQ0A 5KMYA 1W3HA 1K77A 4NAEB 3RLHA 1M04A 3CT2A 4GUJA 3IARA 3R0KA 3W1XA 5A1AA 1W31A 2PLMA 1XYCA 3B9OA 1FP8A 1TMLA 2I9UA 3HV8A 3LN3A 3SN0A 2BS9A 1EP1A 2AL2A 2YB1A 4H3DA 4YCPA 3OLEA 2VFEA 3BMWA 4PMXA 1FTXA 3PBYA 2BG5A 3S6TA 4R34A 3D3AA 2QDGA 1QI0A 3EMZA 4JKLA 4J3ZA 3H26A 4A6GA 3BJSA 3UWWA 3ZT7A 3DFSA 3VD5A 4PE8A 3AMGA 1P0DA 4H01A 4C6PA 2P88A 3V35A 2W79A 3F03K 2X1SA 4XSMA 4FNRA 3IWPA 2OEJA 2V2HA 5A69A 1RVGA 3CJPA 3CHVA 1DJIA 5I3DA 3Q2DA 2YFOA 4JEJA 3SUTA 4YVXA 1ISVA 5HDRA 1S46A 4AZGA 1XBVA 3UXKA 2FIQA 3N34A 3EKZA 5EL1A 4J1OA 1JPDX 2CZEA 1MO0A 3ZWSA 1TX0A 1Q66A 4Y9AA 4NILA 3APTA 3JUGA 3P7YA 4JQ2A 4AIBA 1Q6RA 1RJPA 3OEXA 3QY6A 4Z2JA 2NLYA 4IIDA 2ZDSA 2DUZA 4UZSA 1WDPA 1S39A 5L6UA 1L6GA 3VAVA 5CPLA 2PWUA 1GQIA 5M5DA 3POCA 3QRHA 3R4IA 1V0KA 1TWWA 5FEPA 1E40A 3DFNA 2PD5A 4NNAA 2GJXB 3KWXA 4PTMA 4N4PA 3DOPA 1PX4A 3NOEA 3NL3A 3W76A 3E0IA 4CNTA 3JRKA 4DAIA 3QKEA 1KFKA 1S2UA 4DJDA 1ADSA 2PWHA 3F4CA 2VKZG 3N6QA 4MJ4A 2DT0A 2DT3A 3ZT5A 3RRAA 4ATLA 4XO6A 4EPBC 2CHOA 4FLQA 1VS1A 3VNLA 3CLMA 4UR9A 1MDLA 2BVTA 1J0HA 1Q8JA 2WBKA 4CU8A 3S5OA 1EJUC 4L80A 5XIAA 3LUTA 3WD2A 1JD7A 1E55A 1SFLA 3R8GA 5T9CE 2P76A 1R0MA 1JGMA 2CU0A 3DIPA 4UMAA 1V0NA 2WHKA 2PFHA 3M1ZA 4IHCA 1NAL1 1BLIA 4Z1DA 2OLHA 3QF0A 3SFWA 2V0TA 2F6XA 2ONEA 3KDOA 3VIJA 4PMJA 3TAOA 2VDIA 2YX0A 3MCNA 4OOZA 3H7RA 4RE2A 4F9JA 3PPCA 1HG3A 5HPCA 4UNKA 1V51A 3LENA 4LS2A 1G4PA 5I3GA 2DIEA 4AC7C 3NGJA 4UTKA 1H41A 3NGFA 1W91A 3HG5A 2VQTA 3H23A 3SCSA 1ZRQA 3QYSA 2OYLA 4F0MA 4XKMA 1E5NA 2X1IA 1H50A 5AVHA 3WDJA 3D46A 5AHFA 1HTIA 1VCGA 3WQWA 3VKCA 3CAVA 3Q37A 3P82A 3TKFA 1UIOA 2DEPA 4F2TA 1UW9A 1CTNA 3I4KA 2XVLA 3MS8A 5J04A 1QO5A 4RE3A 4DYJA 1B0IA 5CJMA 5FIPA 2WMKA 4M6QA 3W25A 4CQBA 2R82A 5BRQA 4IIGA 4A2RA 3AHTA 1QVBA 2XVPA 2EEXA 3F5LA 4KCTA 3SIZA 1OX4A 5DXYA 4JIHA 3T8LA 3WEOA 5AC6A 4IIFA 4QAIA 1HQTA 4UTTA 2XWDA 4QITA 1EF3A 1EWDA 2YXGA 1P48A 4GUHA 4F0KA 2BBFA 3NQFA 4M5PA 4MDPA 1ZCOA 3CUZA 3VABA 1X97A 1GYNA 3RDKA 3VFCA 1S5VA 2J75A 3AIWA 2IQTA 2WC3A 2F2KA 1GJPA 1IT0A 4S3AA 4B4HA 5HJLA 3AROA 3ZR4A 3C2YA 4QTGA 1V6YA 1TR9A 4FNUA 4OBTA 5FEZA 3P8IA 2VRJA 4YXGA 4HNNA 1J11A 1TQXA 3WF1A 2IMRA 3G77A 2D0HA 4AHQA 3A5FA 3WQ4A 4LEQA 4AUBA 3R58A 1K9FA 3IIPA 4PN2A 1H7NA 1XLHA 3H2EA 1GPWA 2BXZA 1UZ1A 2OSWA 5HOSA 2VWSA 3BXWA 5E09A 3EAUA 3ZJ8A 3HQ1A 3SQMA 4REQA 2FFIA 1UP0A 4NJJA 1AH0A 3PB0A 2BSLA 2G41A 4AMCA 1GZJA 1WDQA 2I5QA 3UJFA 1H2JA 4HA4A 4N4QA 4C6OA 2Z6IA 2AMXA 1GNXA 4YL2A 2Y8UA 3DEQA 3LOTA 4OWGA 1D3CA 3WJSA 3ABQA 1XGEA 1LLWA 4KKXA 1EQCA 1LQ2A 4LBSA 4QR6A 1Y7VA 2EXOA 4HPGA 3DFOA 5D03A 3WL0A 1PPIA 1HVQA 3P5YA 1JXKA 2D2HA 4L1WA 3K30A 1H7RA 4ZVJA 3UJSA 2CLLA 3CQHA 1E70M 3P84A 3BCJA 3CWOX 2ZC1A 4JD4A 2QKFA 3TV8A 4CQCA 2PLJA 1JJKA 3BAKA 1PDYA 2D1ZA 3TYEA 4ML4A 3AZSA 4BEQA 4BHYA 3IRDA 5CXPA 2A3EA 5FEXA 4IFKA 4Y9PA 2I9EA 1CEOA 1NDYA 1WZMA 1NEYA 2OKTA 4GQQA 1K6WA 4RE4A 4EXBA 1S2AA 3VIFA 4ATWA 4FLOA 5A8GA 4F66A 4MUPA 5DRCA 4CCCA 1WUEA 2A79A 2VENA 1EP3A 3DERA 4MAVA 3SCWA 2G4JA 1E6RA 3W4RA 5EGRA 1I8JA 1S2WA 4IQDA 2VC6A 3GC5A 2PGEA 1A5LC 2P5NA 1JZ4A 4GQBA 4WGHA 1GJWA 4LOCA 4GI6A 4MWAE 4DPPA 3L67A 1VFSA 3AHXA 5BYWA 1H0GA 3S2LA 2XIBA 3WNNA 2QF7A 3KOXA 1QTWA 1EQPA 4NASA 3TA9A 4GXMA 4L6OA 3BSMA 1UWSA 3PTKA 2VJXA 1PKYA 1V3IA 3S5YA 2QDEA 1K7XA 4ZEPA 1SZRA 1O12A 2DORA 4HMNA 4LAKA 5IBXC 1VHCA 1XLLA 4DWSC 3CIWA 1XW8A 1UBSA 4FX7A 2DH3A 2YDQA 1JUBA 1GVRA 3WUEA 4HHPA 5BWAA 3WG6A 1FWWA 3FYOA 4Z0JA 4GQGA 1UC4A 2ICSA 2VFHA 5HWNA 1SUXA 1TV5A 3DI0A 3AI0A 4B5SA 1WX0A 1J0JA 2GGHA 2D22A 1WOBA 1OK4A 1JDFA 1LOLA 5K9XA 1F8MA 4I6KA 3QMSA 3F2BA 3VIIA 2EBNA 3NL6A 2HBVA 3O2LA 4OECA 2QV4A 1OIFA 4LCRA 3WMSA 3LHTA 4H8NA 3BQ6A 1T41A 1EOMA 2AAMA 3N14A 1X1ZA 2OTDA 5HNRA 5EMYA 5CH9A 4JX5A 4AD5A 2WK2A 4O8AA 2VFGA 2BFGA 3AYTA 1ZJBA 1FCQA 3S3GA 4JICA 3IUIA 3G1VA 1F73A 4K2SA 3KBMA 5ABEA 3THDA 3R43A 2CWNA 4XZIA 4U31A 3WF0A 3UG5A 2PTDA 5AYXA 2UY2A 2ZRUA 3BAWA 4KEMA 3LTSA 1XXXA 5REQA 1A0CA 4JDYA 1HKVA 3EZ4A 4XV0A 4A21A 1VB9A 3LNPA 4OOUA 4UTJA 4CVUA 3VM5A 3THUA 4WJEA 4W7UA 3N15A 4KFOA 1XQLA 2VD9A 4NT0A 1J2WA 3SRDA 1PB0A 3FSUA 4J40A 4RNIA 3KEHA 2DW6A 2CWXA 1IT8A 4UXDA 3I7QA 2UY3A 4ZL1A 1Q2SA 3N6JA 4D8AA 4HYWA 1AZ1A 4PTXA 4DBSA 1Q6LA 4D2JA 1V6WA 2OSXA 3FSTA 1JCTA 2XFYA 3KBJA 3GXFA 3C8NA 1VLWA 3B03A 1K8XA 4XD5A 5E5CA 2OELA 3K46A 1GVFA 1BGAA 3VNJA 4QE4A 1JYVA 2VEPA 2VZSA 2HWGA 2WANA 4A3QA 1G01A 3W1LA 3NPVA 2XIIA 1XLIA 2YW4A 3ZWTA 3GU2A 5IBXA 3EWCA 5FF4A 1C93A 3W7OA 5DF0A 2CFFA 1DJYA 4AD4A 4IT1A 5A6AA 4LAMA 3P62A 4WEVX 3SCTA 3OPSA 1ITXA 3QZEA 3WX7A 4NF7A 3VA8A 1EH9A 1R3WA 1ZP4A 3GHUA 1HF6A 3KVKA 1NOUA 3CEPA 3W27A 2XH2A 3L0KA 3AIEA 3HG3A 3TWAA 5A2BA 3TNBA 4PCPA 3GBEA 1H63A 5ABFB 3NZQA 3CGTA 3CHEA 5JMUA 1GVYA 3HG2A 4Q8VA 2OU4A 3T1GA 3WLOA 3EA3A 3TYUA 2P1FA 4DYEA 1XSKA 3OB8A 1TZ9A 1V08A 1AFSA 1HKIA 1VBUA 4I7UA 4FNTA 2PTYA 4G1KA 1UR2A 4OE7A 3G8EA 3CV1A 3M0JA 4HQVA 4ORIA 1NWUA 5BU9A 1PL9A 3CUGA 3PG8A 2J78A 4DI9A 3UCQA 4IF2A 3LCWA 3K4AA 1H61A 1FCBA 4UQEA 4ORMA 1QBBA 5K4XA 4FLRA 4J28A 3NL5A 2XSAA 5D38A 3BJFA 4A29A 1IEQA 3N2XA 5B80A 1XFBA 3A5VA 3KX6A 3CK5A 1P0EA 3AJXA 3PBWA 1EDQA 5DLCA 1THFD 3HMJG 3SR7A 1EC9A 3CS2A 3V5FA 1L9WA 4MKNA 2IKIA 2DV0A 3V18A 2Y7FA 3NDYA 4PB3A 2W66A 2XG9A 4ZTXA 3CWNA 1U1UA 3E02A 4IJBA 3MBFA 1A5AA 5CKSA 4FA3A 2ESCA 1WYIA 1MEHA 3OBAA 3VZXA 1DTNA 3S1XA 3OJGA 3QYQA 1XIEA 2TRSA 4JGDA 2HROA 2HVNA 2ZCGA 4CN4A 1ZBKA 2RDUA 4B5UA 3BLOA 4LY4A 5JH1A 4LAZA 2J62A 3DI1A 5IFPA 4KEZA 4GQ0A 3W1NA 4MFDA 3VPLA 1DJHA 1CXHA 3UVAA 3T4WA 4GISA 3TX9A 1AJZA 2ZUNA 4HYRA 1WZLA 1HL8A 4G56A 1GQJA 3TA6A 3EWYA 3T6CA 2Z6JA 4TOQA 4YHEA 4MZYA 4M7TA 3S9ZA 1TPUA 3L2IA 1F76A 3B0XA 2VGBA 3QQ0A 4DIAA 4Z17A 2ZRYA 2A6NA 3AHZA 1VP5A 3AMDA 1EPVA 1Z32X 1LF1A 5I79A 3OQEA 2CZDA 1DQWA 3RIKA 3FAWA 4LAUA 2PP1A 1Q65A 5TNVA 5BOOA 1QO2A 1KQYA 4PSRA 3R8HA 4J3WA 3FV9A 4C6NA 4TTGA 2F7FA 4M6PA 3ANUA 1CENA 3R13A 3PK7A 3S9YA 3T9PA 2A2IA 4NQ1A 4ZFMA 5KTLA 4MHBA 2G3FA 2V9DA 7REQB 1G4EA 4X0NA 2HEJA 2NV2A 4Z1BA 4AYGA 5CC6A 1BKHA 4PBFA 4JX6A 1K3UA 2QGYA 3M6YA 2W6RA 1FWDC 4PL2A 4A22A 3UR7A 1RAKA 1OC6A 5BROA 5K4ZA 5G2HA 1CXFA 2I7GA 3VIMA 1P6CA 4HPNA 4GJ1A 5CPNA 2HNEA 1QNQA 1R2RA 2FJUB 3KOFA 4DY1A 4IMEA 5A6BD 4O12A 1SR9A 3WL1A 3EPNA 1QOPA 3WH5A 3EOEA 1TIWA 2X0YA 3IVTA 3I6TA 5IFTA 5HANA 2VEGA 1P0BA 3H4XA 1D7FA 2F8QA 4PTWA 2PU1A 1N82A 1E71M 1W6TA 3S5NA 3LK6A 3MB9A 1JCXA 2ASHA 5GNXA 4H1ZA 2O7SA 4FF5A 1W9VA 1OYCA 4OGZA 4L6HA 5ABHA 4LX4A 3VDGA 3QW3A 3S2CA 4RE0A 4Z1AA 3TMLA 1F07A 1LT8A 2ZE0A 3F4VA 1RQBA 3W84A 2GK1B 4V28A 4QAWA 3L65A 4O0KA 4E2BA 1VFFA 3WUGA 4GRSA 1PYFA 4M3PA 1NJJA 4A35A 1WKYA 1LTDA 4EWND 3RJYA 2YIHA 3ATYA 3WK1A 2RKXA 3WJWA 2NV9A 2F6UA 1PKLA 1UD6A 3P6LA 3CMJA 1YQ2A 3LPGA 2EAWA 4JTUA 3T0DA 5LA2A 5HR7A 1O95A 4C1LA 3VXGA 3USZA 3MMUA 3L4TA 3FDGA 3LMZA 1QT1A 4PRRA 1TJPA 2GSEA 3ZT6A 3A23A 3RJXA 3QC3A 4QE1A 4AEFA 2QNEA 4PYSA 4JQ4A 3ABZA 1ZQ5A 1HT6A 3R79A 3P93A 2WSPA 3E3HA 3DHDA 1A3HA 3K2GA 2Z1XA 2OQLA 4I9JA 1DKWA 4Z1CA 5CG7A 4C90A 2JK2A 6ALDA 2FLIA 4BF9A 4I9MA 1XD1A 3EDFA 3EWWA 3HU7A 2YCJA 4JIPA 1GCYA 2XSXA 3KS5A 3SUSA 3OVRA 2ADAA 1LL4A 1TJ2A 4JFWA 1PBGA 3IGSA 1ZJHA 3ONBA 4DUWA 4WY0A 2BGNE 3T0AA 4X63A 2OB3A 2GJXA 1F3XA 3UY7A 3ZJKA 3MUIA 4C6KA 4GZEA 3BMVA 3WBYA 2ZA1A 1KA9F 5F4WA 4ZGYA 4F79A 1OF6A 3KAOA 3SW6A 1ECEA 4H2CA 1V7YA 3N29A 1CW2A 4IIHA 2PD9A 1EXBA 3LZ3A 3GHRA 4FSAA 2ZUUA 5AYBA 3OGVA 1DJXA 2F84A 5AHMA 5EU9A 1GQNA 3VOGA 2CKSA 4ZODA 3AZTA 1LM1A 3MUAA 2FZDA 3G1SA 1Q4WA 1Q45A 4MG4A 1XLGA 3VFLA 2ZXQA 3DC0A 2ISVA 2VFFA 2JGQA 2VZOA 4Q7BA 3WDIA 2EPLX 3MA8A 3EYPA 4AHPA 5HUOA 1AJ0A 4GA8A 3QV7A 4HA0A 3IACA 4NL1A 1QJWA 1GQKA 2PRLA 2HDJA 4BS0A 1DWFM 3H2FA 3AQUA 3F7JA 1XYAA 2V5JA 3OW1A 4UQDA 4BCEA 3VX1A 3GC2A 3SGUA 1XC4A 2C18A 3TQPA 3V1PA 1BVWA 5C8BB 3OLGA 1EYWA 4EACA 1K9DA 1XPGA 3QN3A 3AC0A 3MC5A 3BLIA 3WLLA 4JHZA 1P1XA 2DVUA 5LIXX 1E56A 4U4MA 3LBOA 4AFYA 1X1OA 4AZ5A 1IIGA 1YDYA 4H9MA 2FTPA 4PA8A 2PAJA 3EKLA 3HTWA 4ACZB 3ARZA 3VKKA 5BXPA 1LL6A 3TIMA 2JKAA 1QPOA 2F6KA 2BY2A 2VGIA 3FKKA 1DJWA 3SY1A 9RUBA 2FGBA 4PRTA 2ZA2A 2WMIA 3IJQA 1DPMA 1Q6QA 5C7HA 2WLZA 2GPTA 1RZMA 4LH8A 3VOIA 3TEVA 3LHVA 1BF6A 5A8PA 3GO2A 3W24A 3ARXA 3UXAA 2QMKA 1XG4A 3C8FA 3PUOA 4AX6A 3HPSA 1TELA 5C9WA 1FUYA 3W81A 4C6JA 5E0CA 3ARWA 4MWAB 2GZXA 4AY8A 1G0CA 1W5OA 2FGZA 3B97A 5F7UA 1TG7A 3PWGA 2PUZA 3W82A 3V75A 4GFSA 4Y7EA 3ES7A 1K4GA 1XC6A 1HW6A 3WMLA 5FAJA 1Q6GA 1V0LA 3KRZA 4GIYA 2IPJA 3ARPA 1UQZA 3T44A 3SN4A 3WQ6A 5BWFA 3HQOA 3M47A 1DJQA 4GHRA 1EUNA 1XV8A 2Y63A 2YOCA 2PDKA 3BV7A 1KFJA 1FX6A 4NYYA 1A49A 2FPYA 3V1HA 1W3NA 4O50A 3SUWA 5D9NA 4LJ3A 2NLIA 4YPJA 1YW1A 1EJXC 1KRBC 3C0QA 1BVNP 3CIXA 2VC7A 2BP1A 1PCWA 5EMKA 2IPWA 4L7ZA 4F4RA 1XHGA 1XINA 1MNSA 3RRXA 1VGAA 6TIMA 3W7DA 3ITLA 2G95A 1KFCA 1FY6A 4YS1A 2VTFA 3M43A 1W3IA 1GEHA 4BQ2A 2XFFA 2IPGA 3TN5A 3K1DA 3QOMA 4H8HA 3MSDA 1M7JA 3FXYA 1FWCC 3LG3A 5BW6A 3G22A 4AF0B 1TCDA 4R7WA 1TRIA 5H6HA 4BZYA 5IRPA 2NX3A 3W1MA 1BYBA 4S39A 3TROA 2ZYFA 3DN5A 3VE7A 5AFDA 3VM7A 4HHLA 3LRKA 2B81A 4CD8A 5KZ6A 4ECLA 4WD0A 3IGHX 3RPTA 2IQ0A 3TOYA 1CLVA 1W3LA 1TJ0A 3PZ9A 2HPMA 3ZR5A 3AOFA 2CXEA 4IG2A 3T78A 3WLKX 4JIEA 4H6RA 2BY0A 1L6FA 3A22A 2C3ZA 2JGYA 1LT7A 1F4HA 8RUCA 3URQA 2VMFA 4E3VA 4JY8A 3C61A 1XUZA 1UH2A 3KWSA 1H09A 3QR0A 1A3WA 3SSZA 4HOXA 5F1VA 3ME3A 4IJCA 4HBKA 4KESA 3QR3A 2CESA 3IAQA 4EVZA 5D09A 4CEXC 3WY1A 1ELSA 3PTDA 3J7HA 3W0KA 3TC3A 5FEWA 4GKLA 1TVLA 1EEPA 4JL2A 1PKNA 1GG1A 4LFYA 5IOBA 1EWEA 1KRAC 1JYNA 1CWYA 4HMCA 5FSDC 3HOJA 4R53A 1GT8A 3G1RA 5C9XA 5D9MA 3KRSA 5I24A 1OK6A 2FH6A 3CXOA 3E96A 4CQDA 4MPKA 4QG9A 4KFPA 3OGRA 3PB2A 3UA3A 3E1F1 1C3FA 1XS2A 3OVQA 1UD3A 3W26A 1Z44A 2YA2A 5JQ9A 3QR1A 3NIYA 5D8ZA 1AG1O 4MB4A 1E1EA 5FF7A 4ZO8A 3K1GA 3LXCA 1OYBA 3NZRA 1GOOA 4XD3A 5D8WA 2QEZA 3OA3A 4FPSA 4HOWA 2WZTA 2WKLA 3NQ8A 4MJ2A 5DX7A 4JN8A 1G67A 1DWGM 4DBDA 3SRHA 4DUOA 1XUUA 3W88A 1W8SA