1ECEA

Acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
358
structure length
358
Chain Sequence
AGGGYWHTSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLPYSDDILKPGTMPNSINFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSGQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDSGDTGGILKDDWQTVDTVKDGYLAPIKSSIFDPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDOCELLULASE E1
publication title Crystal structure of thermostable family 5 endocellulase E1 from Acidothermus cellulolyticus in complex with cellotetraose.
pubmed doi rcsb
source organism Acidothermus cellulolyticus
molecule tags Glycosyl hydrolase
total genus 136
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1996-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eceA00
1BYBA 4Z2HA 8CGTA 4WLCA 4XUYA 3MUY1 3RPMA 3WDHA 4AZCA 1JYXA 3MU7A 2AOSA 3RMEA 4CN4A 4MJ2A 1V6VA 5E0FA 3UERA 4HPGA 1OBAA 1VBRA 4UOQA 5IDIA 4B3LA 2ZICA 3K8LA 1HVQA 2ZUTA 2VZSA 1M53A 3GBDA 2B31A 2X1IA 2GJPA 1HX0A 3VM5A 3WNNA 2WVSA 1UR1A 3AYRA 2CXGA 1V3MA 4JFTA 3SUWA 1GQKA 1PAMA 1CDGA 2ZX8A 4FLSA 5FD0A 1KBBA 1FP9A 1E71M 1GOWA 1R87A 3UCQA 2YBTA 1MFUA 3VGBA 3WNKA 1E6SM 1UOKA 4URIA 1EXPA 1OCQA 1KCKA 2G3IA 2YDSA 5KZ6A 1KWGA 2UY2A 1FH9A 2J7FA 1V0KA 1L0PA 3PTMA 5E6YA 1W32A 2PI6A 3NDYA 4XZBA 5A2BA 1XC6A 3UESA 1NWSA 5IHSA 1QNPA 4HOXA 2VZOA 3QR3A 4LYPA 4AZ5A 4F9DA 4DUXA 2YL6A 2HVMA 1W9VA 1E55A 2XFRA 1K6AA 4BCEA 3AJ7A 1E6XM 4YHEA 2ZUWA 3BAYA 2WMHA 3AHYA 1GQIA 1W1VA 1EQPA 2DEPA 3E1F1 2XTKA 1ESWA 2OYKA 3L4UA 2ZWYA 4AMCA 3AIQA 4V28A 1RPKA 4OOZA 5EBAA 2YKKA 3GH7A 3IK2A 1KR0A 1TG7A 1UKSA 2G3JA 5CZKA 1KGWA 4GQRA 3VGFA 4CU8A 3GXFA 4W86A 2DDXA 1G1YA 2FHCA 1UWQA 4F79A 1AQ0A 1HJSA 1W1TA 5E9AA 1JXJA 1F4AA 1TMQA 1W1PA 4ML4A 4CU7A 3VIMA 1A3HA 4UFLA 2EPOA 4HP5A 2Y8VA 4GI9A 1SMDA 3MMUA 5I6SA 1F4HA 2Z1KA 1WZMA 3CZGA 1QPKA 4U3CA 3NYDA 3WH9A 1HJVA 3VMPA 2PBOA 2BXZA 2NT0A 1V02E 2XVGA 1Q6EA 2ZUNA 1ZU8A 1E73M 4UQDA 3BCDA 1HL9A 3EDJA 3VGGA 3AMCA 4H04A 1DTUA 1HJWA 2D0GA 2YBUA 3T2OA 5ABEA 1WKYA 1IZJA 3CUJA 4TX6A 3WMSA 5D9OA 2Y5EA 1GJUA 4EANA 1W3JA 1MWOA 4JHOA 1J0IA 3GYCA 1HP5A 3F5JA 3PZOA 4AC1X 1I75A 2CETA 2CERA 1JZ4A 2XHYA 1EO5A 4AD1A 2ZX9A 1C90A 3CUFA 3AMGA 1GOIA 1W2VA 1E6QM 4W88A 1ISZA 1JF5A 6A3HA 3OBAA 2GDVA 5I77A 3NCOA 4W7VA 5EFFA 2XM2A 5CLTA 3VDAA 3W37A 1VEPA 3ARXA 2VC9A 5F7UA 3WH6A 4UZUA 3WMCA 3EDEA 4GZIA 4HPHA 3I3BA 1XH2A 4J27A 4CU6A 1DWIM 1BPLB 3PHAA 1AMYA 3CHCA 1FFRA 3VIFA 4U2YA 1EDTA 3KL5A 4CD7A 5A6AA 3GXDA 1NOWA 3N11A 3PZUA 5FKYA 1LL7A 3VUPA 2GK1A 1BG9A 2J47A 2CIPA 3WF4A 1PZ3A 1W9XA 3AI0A 1C8YA 1C8QA 4QCEA 2YA0A 4XB3A 1H09A 1XCWA 1W3LA 1BYDA 2YDRA 2VCCA 3CHDA 4IISA 3AHXA 1QI4A 1ISWA 1UH3A 1PX4A 1GCYA 1LLOA 1C92A 1NP0A 4MNLA 3GXMA 5A6BA 1EGZA 2C0HA 1IT0A 2E0PA 2PF0A 2D24A 2DT2A 3CUGA 1ZBCA 2XGIA 1J0YA 3FN9A 1BVNP 2XIBA 4CGTA 1BFNA 1SMAA 2VQUA 3ZR5A 2EPLX 4RE2A 4P8UA 3VOCA 1E15A 3RILA 1E3XA 1JFXA 1QI5A 5HDRA 4A3YA 2ZXDA 1B3XA 1E4LA 3I3DA 1E0VA 4H8UA 2PC8A 1UR8A 4UQAA 3MMWA 2Q8XA 3IJ9A 4V27A 3VVGA 3AHZA 1BTCA 1BGAA 3WF1A 1XSIA 1OB0A 2RGLA 3IANA 1QW8A 4BQ2A 2WHKA 5KEZA 2BS9A 1UD8A 3WMBA 1V6XA 4X9YA 4OUEA 3L4TA 4W7UA 2EPMX 1VEMA 4GPNA 5AY7A 1KFWA 5HNNA 3ZJ7A 1BG4A 3WQ5A 1MW2A 1EOMA 3VNYA 2W92A 4P7NA 1V3KA 4C7GA 4WK9A 2X05A 1VJSA 2GJXB 5M17A 3GH4A 5GNXA 1E5NA 3VX1A 1R85A 3OGVA 4D71A 4ATDA 1V6WA 4UOJA 1K9TA 4FLQA 2VVNA 3T0AA 3IAPA 3EMZA 2CEQA 2VL4A 1TA3B 1G5AA 3CPUA 4R5EA 1B1YA 1OWQA 4PMVA 1OIFA 3AIUA 3B8SA 4GIAA 3ZM8A 2Y24A 3L4ZA 3ARZA 1HN1A 4QLLA 4EKJA 1J01A 3ZSSA 2CKSA 4M82A 1XGZA 5I78A 3ZSTA 1G01A 4GO9A 1DP0A 1XD1A 4Z2GA 3AOFA 2J7CA 1NWUA 4PSPA 1MW1A 4HU0A 1JL8A 1XHGA 4J3XA 4D6DA 2PWGA 4MNMA 3W38A 3AS0A 4X0VA 1VFFA 5A1AA 5HPOA 3WD2A 1JD9A 1HF6A 2ZOXA 3B9AA 4PTWA 3ARYA 2AMGA 2WB5A 3DC0A 1HJQA 4P7OA 4J7RA 1UH4A 3VIOA 3QHOA 3AXXA 4IPNB 7A3HA 2WVTA 2X2YA 3POHA 5A95A 3N04A 2IUZA 4UQEA 5BCAA 1I1XA 4RE3A 3M6DA 3W0KA 1GVIA 3CZJA 3MO4A 1UD4A 4W7WA 1R86A 2VX4A 4R27A 1D3CA 1NOUA 1E43A 2CESA 2A3BA 3W82A 3W27A 1RP8A 1TA3A 1WDPA 5D4YA 5BXSA 3ARRA 3M07A 1FHLA 3IJ8A 1ZJAA 1W9DM 1J18A 3WD0A 1TUXA 2XIIA 3KL0A 2BHZA 3WDQA 2JEPA 5DF0A 4Z2IA 3T09A 1B90A 3GH5A 4QFUA 4ACZB 2XFYA 4GKLA 4JHZA 2WYSA 3PTKA 5BROA 4PMUA 2V3EA 2NW0A 5ABFB 3K4DA 2EBNA 3AHTA 4PMNA 3AISA 5ABHA 3PZ9A 5D8ZA 3NSXA 2BY2A 5I2UA 1TZ7A 1QNQA 4MB3A 4YPJA 2GSJA 3U7VA 2VNCA 1X1NA 2WAGA 4AIUA 5AC5A 2FHFA 1W3HA 1US2A 2FHBA 5M5DA 4PMOA 5BRQA 5E70A 4B15A 1XSKA 4J3VA 4BA0A 3ALGA 1QI0A 1QBAA 2J7BA 1TCMA 3AIRA 4DWSD 3GZAA 1KB3A 2QPSA 2J75A 1GHSA 1EIBA 3AZTA 1CXIA 1L8NA 1QHOA 4QAWA 4AISA 3B9EA 3BAIA 2UY5A 2J7DA 3II1A 4NRRA 3PZMA 4P7LA 3VO0A 4Q7NA 4JFUA 4TUFA 3D5HA 1UR9A 4HZ8A 3WNMA 1DWFM 4FLOA 1TFVA 1WAWA 2V38A 3QOKA 2BVTA 3RM8A 1Q4NX 4HZ6A 3HMCA 4PEEA 4DUWA 3T2QA 3IJ7A 4E2OA 1UKOA 3QGVA 4PSRA 6CGTA 1H3GA 1PPIA 1V3JA 4X0NA 4C7DA 2GDUA 3TTQA 2ZXBA 3FHAA 3AQUA 1B2YA 1QI2A 3EDFA 1JXKA 9CGTA 5E0CA 5ABFA 2VRJA 3TP4A 1OGBA 4XZWA 5DEZA 2J7GA 2WK2A 5CQ1A 3SCQA 3W29A 3WNPA 3G6LA 4ZEPA 2VX6A 5GQBA 3VD4A 4TVCA 1YQ2A 1WP6A 3BMVA 3L2MA 4JCMA 4PMYA 2YL9A 3VD5A 1C7TA 3VD7A 3MANA 2VZTA 3QHMA 4P8VA 3AHVA 2PBGA 1UKTA 1X6NA 1PX8A 3NJ3A 3W6MA 4LYQA 2J7EA 3A6OA 3SUTA 1PIFA 2IXVA 4UFJA 3WQ4A 1JZ2A 2OWWA 1OT1A 1EHNA 1B3VA 2VRQA 4DUVA 1Q6GA 1V08A 3GBEA 4GI6A 5BWFA 2WZIA 3W81A 4PCTA 4TTGA 1CECA 2JALA 1HJXA 3RIKA 1V03A 4UFHA 1BSIA 1KXTA 1NWTA 1PEZA 2X0YA 4UOZA 4J3WA 1OIMA 3EMQA 3THCA 1VFUA 2WC7A 2DT1A 2YA2A 3AMDA 4PMRA 3RM9A 3N12A 1N82A 2VI0A 1R7AA 3WQVA 3WFLA 4MAVA 4W5ZA 1C8XA 2W4XA 3WN6A 4EE9A 1E1FA 1CBGA 1JG9A 4J3TA 4PTXA 1PZ2A 4PN2A 2GJRA 3ZOAA 1E0WA 3W53A 2WMFA 4JZ5A 4OOUA 1JDDA 1OGGA 2F2HA 3WD1A 1HIZA 1ZJBA 1UWTA 1GORA 3PTQA 2D3NA 3SCPA 2DIEA 4P8XA 3SCUA 1BVZA 4KGJA 4EAMA 3DYPA 4BF7A 1VFOA 2DSWA 3N13A 2VURA 4B3KA 2V3GA 3L4WA 4W87A 1UR0A 2XWEA 1M01A 1TVNA 1JYVA 2V5CA 1VBUA 2CITA 2EXOA 3RJYA 3UG3A 3OZOA 3HJEA 2EPNA 3F5LA 3VIPA 4JFVA 4M8UA 5DO8A 3WDIA 4GI8A 3NUKA 5E6ZA 3VPLA 4GXPA 3K8KA 1HL8A 3GNOA 3VMOA 1KXHA 2DGAA 4AD5A 4D1IA 2D23A 2X09A 3ZMRA 1UWRA 2ZWZA 3FAWA 7TAAA 4AZHA 1KXQA 3TOPA 2GK1B 1FH7A 3N9KA 2A3HA 3CUHA 1DWHM 3POCA 1BQCA 4QDMA 1JZ7A 5A8MA 1MW3A 4UNIA 1DHKA 1K9EA 4PMDA 1GQJA 1VF8A 5A3HA 1CIUA 1HKJA 1OGSA 1EHAA 3OB8A 1E0XA 3DYMA 4TOQA 1H11A 4RL3A 1ECEA 3TONA 1AQMA 4CKQA 1JZ5A 4JIEA 5TD4A 2J62A 3OG2A 3MUIA 1E9LA 1WNOA 3GNRA 2RGMA 8A3HA 1CWYA 2CHNA 1NARA 1J9YA 3WH5A 3PZQA 1LL4A 4CUCA 5HBFA 1AVAA 3OGRA 4ZFMA 1HVXA 1W9PA 4HTYA 1JYWA 3W24A 1O6IA 4M24A 1MVYA 2Y8KA 2PWFA 4AW7A 2YJQA 3VNZA 3T2PA 3MUAA 3CMGA 2XUCA 3QHNA 4MB1A 4ZENA 1UD3A 3WEMA 1Q6CA 1E1EA 3BAJA 2WMJA 4QLJA 1HKMA 1U30A 3RDKA 3BXWA 1ITCA 3CHEA 4JAWA 3AYSA 4H7VA 3UR8A 2BFGA 2ZUUA 4HMEA 3TTSA 4P7RA 2WANA 3DECA 2WKGA 5D9NA 4D6FA 2W91A 2J4GA 1GOOA 4ACYA 1W3KA 1MXDA 1LL6A 3WUBA 4D1JA 4WKHA 5A8NA 2WWCA 4U5IA 2XM1A 5JBEA 1W91A 1S46A 1M7XA 4TXEA 1WE5A 1VJZA 3L4YA 4AWEA 1TR1A 3TTOA 3VIKA 1CZ1A 2VT0A 1JZ8A 2CBJA 1HKIA 2DPEA 1QVBA 3WKZA 1UWUA 3OIHA 2CNCA 2PWDA 1ISYA 2EO7A 5I5RA 3ARQA 4KGLA 1FH8A 3BMWA 4JKKA 4BQ3A 5JBFA 3CHFA 2JFEX 3ZR6A 1LG2A 1D7FA 4MTVA 2VX5A 1E56A 2YLAA 1XCXA 4XX6A 5FL0A 2YOCA 4S3JA 1Y7VA 4UFMA 1P6WA 3WD4A 4ZE4A 2QF8A 2OWXA 3CMJA 5ECUA 3RCNA 2JIWA 1R8LA 4CCDA 1EA9C 4LQ1A 1UHVA 1HT6A 4IPLA 4OBRA 3WBAA 3BLPX 5FIPA 1V3HA 3HN3A 1JYNA 1HXJA 1QNRA 3B9DA 3CUIA 3LPPA 3WDPP 3BGAA 2J77A 3OGSA 1JI2A 1V0MA 3NDZA 3WNOA 4KRUA 1EO7A 4U31A 1UKQA 2E4TA 3MSDA 1VIWA 1DWAM 1LQ0A 3WEZA 1GW1A 2VX7A 7CGTA 1JF6A 2VZVA 1CTNA 1E40A 2OSXA 4M1RA 1H0IA 2ZX7A 4MPKA 5C71A 1LWJA 4MNKA 4FF5A 3BC9A 3ARUA 1OT2A 2F8QA 2QV4A 4HMDA 1CENA 2BY1A 2DT0A 1GHRA 1WDRA 1OM0A 2O9OA 2WBGA 3WH8A 2YL8A 3AICA 2F61A 5M03A 4K68A 4DM1A 4TVDA 3W26A 3ZJ6A 3VIHA 1XSJA 2PWEA 3PZVA 4Z2JA 5LA0A 4OJYA 2WMGA 1KCLA 1BLIA 1IZKA 4A4AA 3WL1A 3WY1A 3VM7A 2QHAA 5AYIA 1WDSA 5EB8A 1U33A 4CD5A 2FH8A 1JNDA 5C70A 4E8CA 1OINA 3PZNA 4QP0A 4DWSB 1UD5A 1QNSA 3ECQA 5CSUA 2WXDM 1C7SA 4W8BA 2D20A 3WDJA 2DH3A 2JE8A 2WVVB 4E4PA 4NI3A 5I0DA 2XVNA 2YA1A 1UZ1A 1PIGA 2BV9A 4Y7EA 3LMYA 1QHZA 4W89A 2ZE0A 3A4AA 3SUUA 4MNJA 4FLRA 4W84A 2XJ7A 1MQRA 4L4PA 1JFHA 4HZ7A 2AAAA 2WCGA 1US3A 1E4NA 3VD9A 3I3EA 1ITXA 2WHMA 2CBVA 3ZJKA 3ZIZA 2J25A 2VTFA 3D3AA 2WM0A 1UR4A 3N18A 3ZT6A 3OLDA 5D9PA 5A94A 2J7HA 2G41A 1MQPA 1HJUA 3FNDA 5D9MA 2XYLA 4CD6A 5HOSA 1I1WA 5I3DA 2HISA 3PN8A 2YIHA 3CZ8A 2FGZA 2WHJA 1UUQA 2WSPA 3WFZA 5EFDA 3SUSA 2WZHA 4M80A 2WLZA 3F5KA 3OZPA 4HA3A 1XD0A 1V6UA 4J28A 2E9MA 1K9DA 5A6MA 1ODUA 5A2CA 1HNYA 1M03A 1PJ9A 1V02A 1ZBVA 3A4WA 4AZIA 4HOWA 3WF0A 2XSBA 2D1ZA 4PUDA 1LF1A 3PZIA 1UQYA 1LG1A 2OSWA 5ABGA 1BGGA 1GUVA 1VRXA 4DWSA 5IXEA 3THDA 1EQCA 2FGLA 3WD3A 1OD0A 3L2LA 2EQDA 2G8ZA 1CGYA 3T08A 1UZ4A 2QLYA 1J11A 2E3ZA 3JUGA 3KZSA 2WVVA 4PBGA 2WMIB 3U5UA 3J7HA 1CLVA 1UA7A 3T0BA 4ATWA 2D0HA 4UFKA 3BAXA 3K46A 3MUZ1 3VGDA 3RO8A 1DEDA 2D3LA 1VEOA 2QPUA 3M7SA 5IHRA 2OLHA 1J0ZA 2W63A 2PB1A 1R7OA 2X0HA 1UG6A 4MAZA 3VMNA 3GDBA 3VD3A 3MV01 3KL3A 2DH2A 2XSAA 3KE0A 3IAQA 2J8FA 1YHTA 4QLKA 4CD8A 2WWDA 1E6PA 3ZT7A 5BXTA 1C93A 3GXIA 3SIMA 4P7QA 3ZO9A 2ESCA 4CN1A 4AZ6A 2CCRA 4UCFA 2BHYA 5CGMA 3WUEA 2VCBA 1GZJA 2CPUA 3L4VA 4W5UA 1IV8A 2EPKX 2UY3A 4UR9A 2ZX6A 1MQQA 5A8OA 2WLYA 4LX4A 1JZ6A 3ARSA 1EOKA 1KGUA 4ZXLA 1CLXA 2WCSA 3T0DA 1GQLA 2VR4A 3MMDA 1TE1A 1K9FA 2WMIA 3FAXA 5BYWA 3VU2A 4PTMA 1JD7A 2O9PA 3ARPA 4U2ZA 2O9TA 4UQ9A 4D6EA 4WIWA 4D6HA 2ZIDA 2V3FA 1SR0A 2GVYA 4WSJA 2JF7A 3AS3A 4LGXA 1FA2A 3U5YA 2WPGA 1OSEA 5I79A 3AIVA 5DT7A 2ZX5A 5A6LA 2JEQA 3CLWA 4OKDA 4PMXA 1M04A 3WSUA 3CZEA 4BZYA 4BQ5A 4D6GA 2Y4SA 1UWIA 2UWFA 2VCAA 4UFIA 1LWHA 1HP4A 4U3AA 1CXLA 4D6JA 3NSNA 5D8WA 4PCSA 1E3ZA 1H2JA 2JIEA 4AZBA 2W62A 5BRPA 3AIWA 4AIEA 1VFMA 5CLWA 2EJ1A 1H0GA 4Q22A 1ZS2A 1CXKA 3DHPA 3OLEA 4D6IA 5FL1A 2XPKA 1CPUA 3A47A 5I24A 5C8BB 5A6SA 3VINA 4AEEA 4GZEA 2C7FA 3EDDA 3CZLA 4AD2A 3AROA 5CGTA 1JNEA 1RH9A 3WUFA 3FHQA 3GM8A 1WDQA 1KR1A 3AIEA 5A6KA 5HXMA 1W9BM 3K1DA 4GINA 3KEHA 4E8DA 1W2PA 1J0HA 3ARVA 1G0CA 1FHDA 3AZSA 4UQBA 1QW9A 5A8PA 4W8LA 2G3NA 1LJYA 2OYLA 1GONA 2W5FA 3OA5A 4WKAA 3SURA 1H41A 2VUYA 1AQHA 3S6TA 3ALFA 2GFTA 1PBGA 2CBUA 4PYSA 1FFQA 2BVYA 3AXHA 3BSHA 1VAHA 4FMVA 3EDKA 1Q6FA 2WZEA 4M29A 3RM4A 1CGWA 5CJ5A 3WQ6A 1WZAA 1XRVA 3A3HA 5E09A 3WIJA 3WNLA 1QBBA 4UZSA 3VX0A 4WSKA 1J12A 4UTFA 3UETA 4FK9A 2OWCA 1B3WA 2A3AA 1GOKA 5GNYA 3ZJ8A 2XVLA 4KMQA 2CHOA 3UG5A 1WO2A 4GO8A 1SFSA 3DHUA 3UEQA 1CGVA 4A3HA 1FOBA 1C91A 1DWJM 4B16A 3CBWA 1GOQA 3WF2A 2QMKA 1QOXA 5JBDA 1J10A 4LYRA 3AS1A 1JGIA 1H1NA 2Z1SA 4AXNA 1NH6A 2NSXA 3BAKA 4CVWA 1E6NA 4TX8A 3WF3A 2JF6A 1X6LA 3OLIA 1NOFA 3VTRA 3CGTA 1VENA 1QNOA 3AIBA 2QMJA 1MFVA 1V0NA 5FOOA 1RD6A 1BYAA 1ZBKA 1MW0A 4NZCA 2DSKA 1RP9A 3A4XA 1WPCA 4J3SA 2YL5A 4YN5A 2O9RA 4D72A 2XWDA 2E8YA 2DSZA 1CGUA 3K8MA 3PBGA 4L4OA 1VB9A 1CYGA 4PUEA 1JAEA 3ZQ9A 1Z32X 4EK7A 5LYRA 4N42A 2OYMA 3WBEA 2OSYA 1GPFA 1UH2A 1H5VA 2FH6A 4KRTA 4AZGA 4PTVA 1WB0A 5A8QA 3UR7A 1NM9A 1U2YA 2V5DA 4HA1A 1MYRA 3UG4A 3SCRA 3MS8A 4H41A 4AD0A 4Z2KA 2E40A 4H2CA 3N17A 4JFSA 4JCLA 1QI3A 1E6ZA 2GUYA 4WKFA 1XYZA 2ZUSA 3SUVA 4XV0A 1GJWA 1UD6A 3K4AA 3O2LA 4JFWA 3LPGA 2BY3A 3EBVA 3AMLA 3BCFA 1JDAA 4UQCA 3OLGA 3BLKA 3SCWA 2YDQA 3LPOA 3FXYA 3SEPA 3KWXA 4TTUA 4M56A 2IXUA 3EYPA 2DSVA 1UWSA 2UY4A 1W9UA 1BHGA 4TVUA 4DM2A 1BAGA 1GVYA 4IUGA 1J0JA 2J8GA 3WQ8A 1MXGA 3WL0A 1V3LA 5M3WA 4AZ7A 4F66A 3TTYA 3MV11 4NRSA 4CCEA 2ZUVA 1BF2A 4H8VA 2DT3A 3CH9A 1H49A 4AD4A 1NQ6A 5CPQA 2BXYA 2G3MA 4AY1A 4IM4A 1WZLA 1V3IA 4V2XA 4HA4A 3U7BA 4JKMA 2BY0A 2BHUA 3W25A 4C7FA 1JI1A 2J74A 1G9HA 4BS0A 4ATLA 6TAAA 4JL2A 1B31A 5EMYA 3MKKA 3SCNA 3FW6A 3WEOA 4KH2A 1E6RA 1B3YA 4KWUA 5AC4A 3BH4A 2XVKA 2X8RA 4DWSC 1UYQA 2ZUMA 3VKKA 2NT1A 1TVPA 3AXIA 1WCGA 1JDCA 3PZTA 4M81A 1E70M 3VIIA 4J3UA 1XH1A 2XGBA 3ZT5A 1CNVA 4W8AA 4GQQA 1EDQA 1JAKA 1BYCA 4HMCA 3DYOA 3FY1A 3O6AA 1O7AA 3CO4A 2EEXA 2ZXQA 3L4XA 2BNJA 1D2KA 4H8HA 5A6BD 3CIVA 3EMCA 3SCVA 4AYSA 4U33A 2A3CA 3AFBA 4BQ4A 2WBKA 3SCSA 1KXVA 2G4FA 2VR5A 4JKLA 3N15A 5CXPA 3W6LA 4RE4A 4MDPA 1EDGA 1EH9A 3VGHA 3PZGA 4F8XA 3CZKA 5JIPA 4PMQA 3RJXA 2E9BA 1JZ3A 4F9JA 1SYTA 2J79A 2BVDA 3BSGA 1UKPA 3CTTA 4Z2LA 3VDCA 1ISXA 3HU7A 2MANA 3GTNA 5LA2A 4JL1A 5CSYA 2WC4A 5I23A 2O92A 3WENA 4PRWA 2YLLA 3VILA 1UA3A 1C3FA 4B9YA 3VGEA 3BAWA 5JIWA 1A47A 5A69A 3MSGA 2VO5A 1CXHA 1B30A 2CKRA 4MDOA 4NSBA 3S2CA 2W61A 1Q6DA 5DT5A 4AIOA 4MADA 3ARWA 3U57A 2WVUA 3WELA 4MB4A 5DMYA 2D22A 1E72M 1HKKA 5A6JA 4W85A 4MB5A 1KWKA 3ARTA 2W67A 1CXFA 5JUVA 1OD8A 2VZUA 3NSMA 4OBSA 1ZL1A 2ZXAA 1W1YA 2E8ZA 4WF7A 4N0RA 1B0IA 5HPCA 4P8WA 2WCAA 1FP8A 4S3KA 1KQYA 2WW5A 3SCOA 4AD3A 3VDHA 3VIJA 1UQZA 3O9NA 5BXPA 2WMKA 5BXRA 3QOMA 2C8NA 2WSKA 3GNPA 2WNWA 2DIJA 1GOMA 3TA9A 1UR2A 2GJXA 1UD2A 1KBKA 1GNXA 4QCFA 2VJXA 2WKLA 3LPFA 1NP2A 1WZKA 4LPCA 1V0LA 1E5JA 4B9ZA 3VIGA 3SCTA 5AYBA 2PWHA 5FCZA 1E4MM 3VDBA 2XVPA 1XV8A 2VOTA 1J0KA 4HU8A 1NWRA 2VMFA 1CXEA 5GNZA 2J78A 4YHGA 4CD4A 5CPTA 5IFTA 2W66A 2VVSA 1KGXA 4AZCB 5LA1A 1ISVA 2WC3A 1CGTA 1XYFA 2XG9A 2FDMA 4AEFA 4CCCA 1KQZA 2A3EA 2CYGA 4CN6A 3AZRA 1V6YA 1B9ZA 3AS2A 4ZE5A 4W93A 3APGA 3WUGA 2XFFA 4MJ4A 1XH0A 3G6MA 1H4PA 5DFAA 2V3DA 1DWGM 1JIBA 1B3ZA 5CPSA 2DQXA 5CG0A 1E4IA 3WDRA 1ZBWA 1ODZA 4LXFA 1CGXA 5GPRA 4ZXOA 1G94A 1CEOA 1ZB5A 4OIFA 4OZOA 4PMZA 4HOZA 2CBIA 4NF7A 2D2OA 2E9LA 4D6CA 3W4RA 3WQWA 2Y2WA 5IFPA 2DSUA 3NIYA 2VQTA 4WJXA 2TAAA 4GZJA 5A2AA 2D0FA 4U5KA 3AMKA 4CVUA 3F4VA 2WHLA 3N1AA 3WH7A 2VRKA 1PX3A 3W28A 1QHPA 3M46A 4ACZA
chains in the Genus database with same CATH superfamily
4WOQA 3UXAA 1IIGA 3VNLA 4Z2HA 4XUYA 3RPMA 3MUY1 5CZSA 3MU7A 2OZ8A 3IPWA 1OBAA 1VBRA 4B3LA 4RNFA 3MBDA 3G1FA 5KITA 3VOJA 3M0HA 3IJQA 4TU1A 1HX0A 4F0HA 3PBYA 2GVJA 4JDBA 3EOSA 3EKZA 3TJXA 1PKYA 5KINA 4AG0A 3MDUA 3B04A 4S3BA 1JJKA 1GJPA 2P88A 4Q33A 1CDGA 2ONEA 4FLSA 3ICJA 5FD0A 1FP9A 1XLAA 3SGGA 4YTQA 3UCQA 2ZZ6A 3VGBA 1PYMA 2YCIX 4DPPA 4URIA 1TE6A 2Y61A 3TSDA 2G3IA 5KZ6A 2ZRUA 2UY2A 1V0KA 4N4QA 1VBGA 2FZMA 5BRBA 3PTMA 3DI0A 3U3HA 3AAMA 5FESA 1FWRA 3R13A 2Z7KA 3GFZA 4MF4A 4MYAA 3GTFA 2P3EA 1FVPA 2CZFA 2Z28A 3QR3A 2GPTA 1LCOA 4DUXA 5FSEC 1D8WA 5FF2A 2SFPA 1K6AA 2XFRA 3DFNA 4PE8A 3AJ7A 1AQFA 1E6XM 3UWQA 1W1VA 1GOXA 2DEPA 1NELA 2XTKA 5A5WA 2OYKA 3S83A 4HYVA 2A7RA 1PVNA 4AMCA 1RR2A 3AIQA 4WQ6A 5AYZA 5FF0A 1HKVA 3IK2A 1H7OA 4IOTA 3L65A 4JTFA 5HMDA 1UKSA 4H3DA 2G3JA 1KGWA 4FO4A 4PBEA 2DDXA 5FF4A 3KBJA 2FHCA 1Q13A 3O0FA 3WG6A 1AQ0A 4HPNA 1W1TA 1YPXA 2HBXA 1TMQA 3F7JA 4QAIA 4CU7A 1TPEA 1XINA 3NZRA 4UFLA 2EPOA 2NQ9A 1XYMA 5I6SA 5D04C 3W7IA 2Z27A 4U3CA 3NYDA 4AWUA 3RRXA 4LRSA 1G4PA 4C1KA 4X9SA 1ITQA 1H7RA 1V6TA 2LLEA 4QBXA 1LQ2A 1TYGA 3C2RA 5KMYA 2Y89A 4QJ5B 3ZLHA 3UJFA 3BCDA 4JEQA 3EDJA 3PWGA 4DZHA 4H7CA 1DTUA 4LY4A 3T2OA 3KCOA 5DMMA 3CUJA 3LI0A 4TX6A 3WMSA 4B2DA 4XZHA 4QSHA 4EANA 4DBWA 1W3JA 2CLLA 1TO3A 5FAGA 1ZNNA 4GXMA 3PZOA 2YX0A 2CETA 2QR6A 4DYJA 1I2RA 5I3JA 1JZ4A 3W9ZA 4NAEB 2OXNA 3PP7A 3CUFA 3AMGA 3FYOA 1E6QM 1JF5A 1JQVA 3OBAA 3CLMA 1E9YB 5CLTA 3QY7A 4DXXA 5FSDC 3UCCA 3GHUA 4EF8A 3SECA 4WHBA 3WZ0E 1BPLB 1AMYA 3ITYA 1NF0A 1MMFA 2VD8A 3B8UA 2ABAA 1TWDA 4G8TA 4O1FA 3V7PA 4US5D 2AKMA 5LIXX 1P0BA 3B8IA 3VUPA 2D2GA 1BG9A 4PTDA 2CIPA 2XN2A 4JTQA 3WF4A 1UP2A 1W9XA 4QCEA 1AL7A 4JGDA 1JPIA 1YW1A 1F6KA 3B4YA 1P6CA 3CHDA 4H7ZA 3AHXA 3GE7A 3UZWA 1O5RA 3M5VA 1IEQA 2DU2A 3E0VA 1NP0A 2DUZA 3TA6A 1VP5A 3N2OA 3CUGA 3COTA 3HFYA 3I7SA 3R12A 4PFHA 2XGIA 3MJYA 4NZ1A 5HQLA 5LGXA 1DV7A 4TMCA 5C2CA 2Z6IA 1JUBA 2Y7FA 4AFYA 3NOEA 3VOCA 5JH2A 5HDRA 1ME9A 4QIUA 3QKEA 2WO5A 1DJGA 4H8UA 4JNYA 2IPWA 2R1PA 4L1XA 4GQGA 3MMWA 2VEFA 3MVIA 5TBOA 3IVUA 3AHZA 3VVGA 3N4AA 1BGAA 1KKRA 1KV8A 1X96A 2Z6JA 4L9YA 4QX4A 2GGGA 5KEZA 4Z1YA 3K1GA 2J9ZA 2NV9A 3O7UA 5DY2A 4X9YA 5H8UA 1K3UA 4W7UA 3QYQA 1LLZA 1KFWA 4X3ZA 1BG4A 3WQ5A 4YTTA 4S2CA 2GQAA 2W92A 4C7GA 3LY0A 3H2NA 1S5NA 2IPJA 3ZLFA 1S5TA 3LCWA 5M2FX 1W31A 3C0SA 4XD4A 1R47A 3EMZA 2VL4A 1IXOA 1G5AA 1F3XA 1SGJA 4K39A 3CPUA 3LTPA 1RLCL 1PSCA 1S3HA 3A64A 3QGKC 1JRBA 2Y24A 1HN1A 5ABTA 3F4CA 4HPXA 4M82A 2ZZ3A 4H6QA 1J5TA 5HNUA 3LCXA 2IKGA 1IWPA 1U83A 5D2XA 3V5OA 3WD2A 2ZOXA 3W7OA 4M6UA 1IEWA 2AMGA 5MKGA 3TYUA 1OHLA 3FK4A 3TTEA 2QAFA 4BI6A 4MFDA 5HJXA 2GQ9A 3N2TA 4ZO9A 3AXXA 4IPNB 3W2NA 3SSZA 3SJ3A 2X2YA 3POHA 3SN4A 3ABQA 2AQWA 1I1XA 1ADOA 2C14A 1WBJA 3W0KA 3G5EA 4IPPA 1MRAA 3Q37A 2PAJA 4H9MA 2XSXA 3VZZA 1EBGA 4X22A 4GVHA 4DJFA 4ZO8A 3M07A 1FHLA 1ZJAA 1AD1A 1RK6A 2HRWA 1J18A 3UCDA 3WDQA 2BHZA 5DF0A 4QFUA 4ACZB 1VD6A 3PTKA 3P62A 1EEXA 3KOYA 3K4DA 2EBNA 3WLSA 4JPGA 2Q71A 4JIQA 5J5DA 1QPNA 1H5YA 1V8EA 1YEYA 2VNCA 2CLKA 1G69A 4AIUA 5AC5A 4YL2A 1US2A 1POJA 4J3VA 3MA8A 2J7BA 1TCMA 2QPSA 2J75A 4GK8A 4EPBC 3AZTA 1SFTA 4AISA 1MEWA 3BAIA 5BMWA 3B0PA 1ZSXA 2YCJA 4DYKA 7TIMA 3NR0A 2FPVA 1XRSA 2XIQA 4KIRA 1WAWA 2NV1A 2V38A 3QOKA 1LRTA 4GYPC 4PEEA 4DUWA 2BLEA 3T2QA 3IJ7A 7REQB 3TC7A 4YXGA 1I0DA 4R7JA 4X0NA 6REQB 3RLGA 2Z0IA 2X1SA 2ZXBA 2NX1A 3G77A 1QI2A 1IR2A 3DKJA 1ICSA 2HMCA 4J35A 3VNIA 4CLMA 3TW7A 2GOKA 5CQ1A 3SCQA 3WNPA 4ZEPA 3PFMA 2VX6A 1FY6A 1YQ2A 3L2MA 4AF0A 2YL9A 3VD5A 5I3KA 1C7TA 3I4EA 2OZ0A 4Q4OA 1X6NA 2HROA 3CAKA 4LVBA 3UF9A 3OYXA 2HXTA 3SUTA 4OQVA 4Q8QA 1TMHA 1FDZA 1LP6A 4UFJA 1JZ2A 2OWWA 4LYKA 1V08A 3MYOA 5BWFA 5AYXA 3E0FA 4TTGA 2JALA 5HANA 4YNGA 3VKDA 4DELA 1LBFA 1HJXA 1V03A 3WYZA 3N19B 1TPDA 2ZZ2A 2QJJA 3T78A 1KXTA 3BLOA 4UOZA 4J3WA 1VFUA 2WC7A 2VDIA 2YA2A 4HK5A 3N12A 5DBUA 4S3CA 4QISA 5HNRA 5DX7A 4KKXA 4MAVA 3SZ8A 1E1FA 1CBGA 1R3YA 1UWAA 1E0WA 2E6AA 1EL3A 1H61A 3EPMA 1VS1A 3KHJA 1OGGA 4HCDA 2JKPA 5TAOA 1EKOA 1GORA 2OX1A 5EKYA 2R1MA 1A0EA 1UROA 1TJ0A 3VFLA 1AODA 4KGJA 1K4GA 1XIEA 3W7KA 2DSWA 4XK2A 1KLYA 4B3KA 1K8YA 5DN1A 4W87A 1UR0A 1BF6A 4MKNA 4PRRA 1ZGDA 1KTNA 2CITA 2EXOA 3RJYA 3KZPA 3MP5A 1Q8JA 1X8FA 4JQ1A 3VIPA 1J6OA 3RNDA 3NUKA 3R8RA 1XIMA 3N4FA 4HNUA 3K8KA 1HL8A 4OV9A 4C5YA 4UTHA 1KC7A 3WJXA 3RN6A 5K9DA 3LHYA 1B9BA 2B0MA 3GTIA 4AD5A 4PBFA 4AWSA 4QJ1A 1UWRA 2ZFAA 7TAAA 4AZHA 4E4UA 2POZA 4RPPA 3N9KA 4DUOA 3XINA 2CHRA 1TPH1 4NZFA 2GGIA 1TPUA 3P0XA 5A8MA 1MW3A 1SSGA 1LYXA 1A0CA 3OBKA 1CIUA 4ORIA 4TOQA 2QCCA 4NJJA 5CC6A 3K30A 2QQ6A 3DG7A 3W7EA 4JIEA 2PDQA 3M0LA 4PB5A 2PGFA 1CWYA 3STGA 1R2SA 2CHNA 4GVIA 3A9BA 1NARA 1J9YA 4YLWA 1AVAA 3QTGA 4ZFMA 4HTYA 1W0MA 2Y8KA 2E28A 2YJQA 3ANVA 1R38A 5G5IA 4I9JA 5FEZA 5AHNA 4IT1A 3T40A 2FZDA 1GVSA 2XUCA 5T8GA 4MB1A 1T0OA 3WEMA 1Q6CA 1E1EA 1O5QA 2FFCA 2WMJA 1HKMA 2Y85A 1JPKA 3NQEA 2YB1A 3BXWA 4Q4SA 4JAWA 2J66A 3E2QA 3KXQA 2X16A 4H7VA 3MI6A 4F2BA 3P93A 5D9NA 5C0QA 4IX2A 2AQVA 4Y9NA 1BKSA 1LL6A 1ZP4A 3WUBA 4CQCA 4WKHA 3TZNA 4XD6A 1SW0A 1XFCA 4KFNA 1Y65A 1S46A 4TXEA 1TR1A 2H8ZA 3L21A 3Q2DA 3VIKA 2CLIA 1CZ1A 1JZ8A 2DPEA 1QVBA 3WKZA 3OIHA 2CNCA 3EWYA 3NOYA 2YCLB 3B05A 5I5RA 3QTPA 3UWZA 4YYFA 2P8BA 3CHFA 2JFEX 2E5DA 1Z44A 3S8HA 1IEXA 3W7HA 1DVJA 3B3DA 3QQWA 3AALA 1POKA 3QJAA 3TZFA 2VX5A 4XX6A 4H6KA 1XCXA 4LVAA 3RF9A 1QMLA 3CV6A 1Y7VA 4LUSB 3WD4A 1IXNA 1NDYA 2QF8A 4HYWA 3CMJA 1UZHA 4GH1A 2JIWA 4YVVA 3G1DA 1XI3A 3HGJA 1XIBA 3PANA 1XDMA 4EXAA 9XIAA 3QZAA 1TIWA 4XTDA 5BW6A 3WBAA 5MHBA 3VOGA 3B9DA 3GW3A 3LPPA 3A3WA 3OGSA 3IACA 5D2YA 3A22A 1V0MA 4JTEA 4NILA 3NDZA 2P50A 3WNOA 1OC6A 1UKQA 3MSDA 3D46A 1WAUA 1TPVA 4LAKA 1DWAM 5XIMA 5AN7A 3KTSA 3PY2A 3S1GA 2VX7A 4I5XA 4AYGA 4O8AA 7CGTA 2IPFA 4J2PA 1JF6A 2VZVA 4P61A 1QAPA 1E40A 3N2BA 4QGCA 3MZNA 4MNKA 4JICA 1OT2A 3SM0A 5H91A 4C90A 1V79A 1CENA 1ZLPA 4H6EA 1WDRA 1OFAA 2YL8A 3P6LA 2F61A 4K68A 4TVDA 3W26A 1WKDA 2PURA 3PZVA 3E0WA 4DBEA 4JTGA 1U22A 2PP1A 5CPMA 4WR3A 1BLIA 4A4AA 2QHAA 2CLOA 5AYIA 4JX5A 1U33A 1DQXA 1JNDA 4E8CA 1J8VA 1OY0A 1OINA 4A35A 3KM8A 5HQEA 4QP0A 3EXTA 2ZRXA 1QNSA 5CSUA 2XDFA 4QE1A 1KM5A 1ZAJA 1V7AA 2PDJA 3FS2A 3RO6A 3I6TA 4RLIA 4NI3A 5I0DA 3SQLA 1UZ1A 1PIGA 4Y7EA 2HPMA 2PDCA 2RFGA 2ZE0A 4W84A 3GR8A 1MQRA 4L4PA 1JFHA 4C6QA 4Q4PA 2WCGA 1E4NA 1WOBA 4UMAA 4X63A 2VR2A 3I10A 4DO6A 3SW6A 2J25A 1Q65A 3PF3A 5LNWA 4NL1A 2CU0A 1KRCC 3N18A 4GVFA 3ZT6A 5D9PA 4HJFA 5AHMA 2J7HA 4MOZA 3FNDA 2NXHA 1EJ7L 3RX4A 1WYIA 4HMNA 1RJQA 5EFDA 1U5JA 3CPGA 2WLZA 3OZPA 1XD0A 1V6UA 5A6MA 5EGRA 1ODUA 1QUMA 1M03A 3O16A 4HOWA 1R9ZA 2D1ZA 3OPSA 4PUDA 4O16A 3GG8A 1GUVA 3LGDA 1XUUA 3NPVA 3NGJA 4DWSA 4XAYA 5IXEA 1D8CA 1V7YA 3VUSA 1I8JA 4Q4QA 1CGYA 3EGJA 1TPC1 5D2VA 4D8AA 1CLVA 2BB0A 4O1BA 4ATWA 3W1AA 5H8PA 4UFKA 4DJDC 1AFSA 3BAXA 3K46A 4NXSA 1OFRA 1RALA 3RO8A 1XLDA 4HBKA 1ZCOA 1J0ZA 5BOFA 2NXGA 1YBQB 1R7OA 2X0HA 4A3UA 3U2CA 4MAZA 4UNLA 3W7DA 4L5ZA 3BTNA 2OTDA 3H4XA 2FJKA 2DH2A 3LRLA 2CC0A 3TSBA 1YXYA 1YHTA 1IT7A 3B9OA 4CD8A 2WWDA 4LUTA 5HR6A 3GXIA 4G7EB 3M0ZA 4AHPA 4RV3A 1GKQA 4FSAA 3T55A 6XIMA 5CGMA 1JCTA 3WQDA 3PUOA 1EYWA 1BTMA 2Z2BA 4IMDA 1S2TA 4KFOA 3EKLA 1GEHA 1RJPA 1IV8A 3VNDA 3ZVIA 4UR9A 2ZX6A 4HNTA 3EWZA 4ZOCA 5G4WA 1J93A 4POCA 2ZRVA 4WGHA 5G1MA 4AMAA 2I17A 5K3VA 4LJ3A 1XXXA 3VKAA 4IMCA 2I9EA 1CLXA 3WFAA 3CQKA 1JVNA 3UWEA 1TE1A 4O0ZA 3QV6A 3R0UA 2C16A 1EJVC 1YYAA 3DHDA 3FAXA 4DWDA 4ZZ9A 3LI1A 3VU2A 2BX7A 3EB3A 4LUJA 3TAKA 2O9TA 4NX5A 4MVAA 4RZ5A 1UIPA 2JF7A 1MNZA 3H2EA 3GC2A 2XIOA 1BSLA 3KBSA 5I79A 3LRMA 2QCMA 5A6LA 2JEQA 3IWPA 1PTAA 4IIHA 3B0YA 4OKDA 4PMXA 1OK6A 1KCZA 3CZEA 1IXPA 1UWIA 3W1MA 2V5JA 3G22A 1TX0A 3T7VA 4FIRA 1RK5A 1CXLA 2R82A 5JVLA 2A6NA 2O7SA 2C0AA 5D8WA 2ZYFA 3P3BA 3HG5A 1Z69A 3WK0A 2V68A 5BRPA 1RLDA 2PUZA 3AIWA 3P84A 5CLWA 4N9BA 4DJEC 1H0GA 5HUOA 4MWAC 3OLEA 4C6MA 5FL1A 2D69A 3A47A 5I24A 5D02A 5I3GA 2BMBA 4AEEA 3E12A 5CPLA 3FVMA 1VLWA 1SSDA 3ANYA 1H60A 1FTXA 3WUFA 4JBRA 9RUBA 1OFQA 4INFA 3HGSA 3K1DA 2B7OA 5T9CE 4JTLA 3KEHA 4E8DA 1H1YA 2P10A 5J04A 1FWAC 4QNWA 3ONBA 4UQBA 3PUGA 4HCHA 1TWZA 1GONA 3OA5A 4WKAA 2OB3A 2NWSA 1F61A 1YE6A 4F0KA 1ONRA 2CBUA 4PYSA 2NUXA 4N6FA 4Q7BA 3EDKA 3N6QA 2VXNA 5A6TC 3PPFA 1I6NA 3BK0A 2BASA 3A3HA 1FWSA 4M19A 3WNLA 3VX0A 4UZSA 3QR0A 3UETA 1F9CA 3N29A 3C5QA 2VD9A 4NUWA 3GS6A 4F0SA 3S1UA 4I6VA 1WO2A 1SFSA 4DRSA 3CIWA 3UEQA 1YDOA 4EPDC 1G4TA 1F6YA 1C91A 4X2PA 3C2OA 4JTSA 1GOQA 3WF2A 2CWNA 1GZ1A 4JNZA 2QVHA 1W3IA 3AS1A 1JGIA 1H1NA 4GBDA 2Z1SA 4Y2WA 2PTXA 4TX8A 2VKZG 3N9RA 3PJUA 1M9HA 1I45A 1GVOA 3OLIA 1NOFA 3FSTA 1VENA 3AIBA 2ISFA 4LVGA 4AHQA 5FOOA 2P3ZA 1RD6A 1Y8BA 4LBUA 3UJ2A 3W2MA 4C6DA 4NZCA 2DSKA 5H8MA 3MCMA 1RP9A 3A4XA 2CLPA 4B5TA 1TJ2A 1BXCA 3WQOA 2YL5A 2O9RA 4UUIA 4D72A 2XWDA 1JULA 2ACUA 3DUGA 3ZQ9A 4CEUC 5LYRA 3UT0A 4ZB0A 3M44A 1L6FA 1UH2A 2FH6A 4XZ9A 1H50A 3OU8A 3STCA 5A8QA 3MSRA 1VPYA 5FJJA 2V5DA 1MYRA 4K8EA 3N3MA 4H41A 3VNJA 4AD0A 2CZVA 2HE8A 4JFSA 1XYZA 1YLVA 4B5VA 4PRTA 1LDCA 3QEZA 3GR4A 2DVTA 3CYJA 4MLJA 4RNJA 4J4KA 4XBSA 1KO0A 3LUTA 1JDAA 3GVWA 1KLZA 3EOUA 3BLEA 3OLGA 4B2DD 3MQTA 3LPOA 3FXYA 5F4SA 1R3TA 4M56A 1PWLA 2DSVA 5AHFA 1UWSA 4KEMA 3B8DA 2HTMA 1BAGA 1GVYA 4IUGA 3HOJA 1J0JA 3PJXA 4GGBA 3CT7A 3C86A 4NRSA 4CCEA 1EP1A 3GXNA 1A5NC 1BF2A 2QNEA 3C3NA 1NQ6A 5CPQA 2BXYA 4IM4A 4LB3A 3H2CA 3UU0A 4V2XA 1CCWB 2I5GA 1DE6A 3BW3A 4HA4A 4PMJA 2PLJA 4LANA 3RITA 2V67A 3U7BA 4JY8A 2MNRA 1GYLA 2PEVA 1JI1A 5TF0A 4UTMA 4DI9A 1G9HA 4DN1A 2C1HA 2BGSA 3VCNA 4BY3A 3WEOA 4NAEA 4YIWA 4KWUA 3BH4A 3WLRA 4QE4A 3N2MA 1WCGA 1OF8A 3UXKA 4I7VA 3R25A 3TQ0A 3VIIA 3NPXA 2B7QA 3NM3A 3TYZA 2WQDA 2OEMA 3WQEA 5I07A 2G3FA 3PUEA 7ENLA 4QM1A 2ALRA 3BGJA 4K38A 4XZIA 3DH7A 2ZXQA 1EZ2A 1K7EA 5GJPA 3SCVA 3EMCA 1K7XA 1QU4A 2A3CA 2X30A 2AAMA 5CKSA 1DJZA 5HR7A 1TTIA 2VR5A 1QR7A 3W6LA 3TJ4A 2TMDA 2PLMA 3QPEA 4HSOA 2Y62A 2GLKA 4PCNA 4I3GA 5G1YA 3T81A 1SFJA 3TU9A 1ITUA 3VDCA 4V1XA 5I23A 2E67A 4MYXA 3S2MA 4PRWA 5CBIA 1XLJA 1PB0A 3TYEA 1UA3A 4P2VA 1C3FA 4B9YA 1D7KA 1A47A 4MDOA 3LNPA 4KEZA 5DT5A 3W72A 4AIOA 4M6PA 1A0DA 1XQKA 3WQFA 4ECLA 4GGHA 1Y5VA 3CL6A 1HKKA 1DXEA 3BVJA 3FX4A 3PWIA 5A6JA 1F74A 4QSFA 3F03K 3PBVA 2J6XA 3PNUA 4ICCX 4W85A 2W67A 3M0YA 3TQKA 4PR4A 2NUWA 2OU4A 3NSMA 4L4MA 4ERAA 1ZL1A 1EX5A 1K8CA 2E8ZA 3GAKA 4FF7A 4N0RA 1B0IA 4ZB5A 3ID7A 3VZYA 4JEJA 3FA3A 1CB2A 3NPWA 3FJ6A 3G2GA 4DZAA 3TW6A 1H51A 4R53A 2WMKA 4HYRA 3R8GA 2E6FA 3QOMA 3NZQA 4I8YA 1XLCA 3A12A 1UD2A 5EMUA 4H9ZA 1GNXA 3OVPA 4QCFA 3NQBA 2ZCGA 4CNSA 1IR1A 1NP2A 1V0LA 1VBJA 4EVZA 3VIGA 1GGOA 2V9DA 4XTIA 4CEXC 2PWHA 1I0BA 3GVRA 1J5SA 3NQAA 3VDBA 1XV8A 4LAUA 1NWRA 1U1HA 4NZ3A 5CPTA 2NV2A 3NEVA 5IFTA 1A5KC 4MFEA 2YCKX 3VA8A 3W1XA 4L4LA 3QV7A 1KQZA 5LZLA 1N8FA 4GJ1A 5K4ZA 3AS2A 3GK0A 2WSRA 3T0CA 3GNNA 5DFAA 2V3DA 4DJFD 1B3ZA 4IZGA 3CXOA 4RJEA 1KFCA 1W17A 2AGKA 5EY5A 4AH7A 3AU6A 1CGXA 1GVQA 4FB7A 3KWSA 1PL9A 3M0MA 4Q32A 4I9AA 4NJGA 4NP7A 1YPFA 2HV5A 3WQCA 2E9LA 1LBLA 2DV0A 3DERA 2Y2WA 2V63A 4IHCA 2DSUA 1FX6A 3RAOA 1DE5A 4GQBA 1RY8A 3RYSA 2D0FA 4U5KA 1KM6A 3FGCB 3SRKA 2WHLA 3V75A 3N1AA 4BEUA 3MO7A 3UGRA 3RLHA 3BLLA 1SUXA 3BJFA 1PTGA 4ACZA 3L0KA 8CGTA 1EX1A 3AXKA 4WLCA 2E5BA 1K77A 2AOSA 3UNTA 4MJ2A 3PBWA 4HPGA 4ZCWA 4XQ6A 4O28A 1TMLA 3K8LA 2ZUTA 5BOEA 1ZCCA 1NIUA 4H9UA 3UY8A 2FYMA 1WXJA 2GQ3A 2TPSA 2V69A 3Q58A 4OBTA 3GQYA 3QV8A 3WNNA 2WVSA 1UR1A 3AYRA 3KOFA 1DJQA 2CXGA 3DAQA 2X40A 4LVDA 1ALDA 4BR1A 1V3MA 3GXPA 3O3RA 4JFTA 3TR9A 1YDVA 3SUWA 1UMYA 1HL2A 4C1LA 3V0TA 3I6EA 3WLJA 3WLKX 2Q8ZA 4GHRA 4J3ZA 1QT1A 3MI2A 1F5ZA 2YBTA 3WNKA 3VFCA 2VUNA 3BLDA 2YDSA 1WKFA 3N14A 3GUWA 1XIIA 4JR5A 7REQA 4HZMA 2HS6A 1AJ2A 6REQA 3GU1A 4XZBA 4FA3A 3FDGA 1AJZA 1J6PA 5I3IA 1B57A 3UESA 1NWSA 3KVMA 2ANUA 2FTWA 4LYPA 4AZ5A 2YL6A 2HVMA 1W9VA 1E55A 4FZIA 4Y6GA 4BCEA 2XIJA 3I7QA 4KESA 2C18A 4J40A 4YHEA 2ZUWA 1BKHA 1EQPA 4ICNA 3L4UA 2ZWYA 1PS9A 4Y9MA 4FAMA 3W71A 5U4NA 4OOZA 2F9RA 4C6EA 1XCFA 5CBBA 6TIMA 5CZKA 1RVGA 3VGFA 4CU8A 4W86A 1DJXA 4KETA 1UWQA 3TN5A 4Q7IA 1HJSA 5E9AA 4RDVA 1F4AA 3KFTA 4ZOEA 3M41A 4HP5A 4GI9A 3DHFA 2Z1KA 3CZGA 1QPKA 1HJVA 3NQ6A 3E74A 1UBSA 1B4KA 2NT0A 4HJWA 1Q6EA 3S2LA 4DX3A 2W0UA 1HL9A 4F0MA 3BPWA 3AMCA 3HTWA 4H04A 2D0GA 1E9IA 1IZJA 2PGEA 2XZ9A 4DO5A 3FVDA 5D9OA 3JVAA 4IIFA 1JCNA 3THQA 4JHOA 1XJBA 3PSWA 1GTHA 1JUEA 2PF8A 5HJYA 8RUCA 2GUUA 2XHYA 4YU1A 1TQXA 3EX3A 2NQ5A 1C90A 3SQSA 3NL6A 1W2VA 2Q8LA 3IIPA 1NEYA 5C2GA 3E38A 1EPVA 2GDVA 3NCOA 4TV6A 3W37A 3IUIA 1VEPA 1LWIA 1UBPC 2VC9A 2OQYA 4GZIA 3ENLA 1Z41A 4HPHA 3I3BA 4J27A 4OVXA 1XW8A 2PDGA 1DWIM 3PHAA 4YVXA 3HGOA 4XVEA 3BO9A 3VIFA 1NFGA 3S1WA 4U28A 3KL5A 4CD7A 3W70A 3PZUA 3CU2A 3GW0A 1SJAA 1LL7A 3OIXA 3G1SA 1XYLA 1PCKA 2OT1A 2R1KA 3UZZA 1O1ZA 4YYCA 1Q4WA 1F8IA 1OFOA 3AI0A 1C8YA 3MJMA 1KCXA 2PP3A 3T6CA 1XCWA 5C55A 1W3LA 3VC5A 2YDRA 5ECVA 1DQUA 1H7PA 3BOLA 1EJTC 4QTGA 5L6UA 3W2KA 1UH3A 3LM3A 1LLOA 1C92A 3KUMA 4MNLA 1ZZMA 5A6BA 2C0HA 4R7WA 2PF0A 4AB4A 4ZO6A 4OHQA 1J0YA 5D32A 4V15A 2FB2A 2E25A 5C9ZA 2DZVA 2NVAA 1BVNP 1T7LA 3M0JA 4C5ZA 1HGYA 1KM0A 4WXYA 2QGYA 3W1PA 3ZR5A 3EWDA 3V18A 4PUKA 1KFBA 3BLFA 2QDHA 1PZ1A 4NX0A 2PD9A 3W86A 1IGSA 1UR8A 3GZ3A 1O5XA 4UQAA 2Q8XA 3CB8A 3UXLA 3IJIA 4B91A 1OCNA 4FS9A 4BQ2A 3MCNA 3CH0A 1SJDA 1V6XA 3L4TA 4N9DA 2EPMX 4GPNA 5AY7A 3HPAA 3S47A 3UWWA 1RBLA 1V3KA 4PC8A 4WK9A 1UZDA 2IQTA 5JU6A 4MZ1A 2GJXB 3QMRA 5GNXA 3N6HA 3K5XA 3A24A 4UTWC 4ATDA 1V6WA 4ZR8A 3W74A 4UOJA 4IP7A 1K9TA 3H24A 3NO1A 4L6OA 3BV7A 1GVFA 4BWLC 1XG3A 2ZVIA 2HNHA 1W1ZA 1OABA 3HPXA 5E5CA 4QNEA 3RLUA 4PMVA 3B8SA 4S38A 3ZM8A 2H9AA 1S2UA 3L4ZA 1J01A 3ZSSA 5C9RA 2CKSA 3HPFA 3KBNA 5GJMA 4ZOBA 3HQ1A 4WCJA 4A2SA 4IQJA 3ZSTA 4F4RA 3G3DA 4O17A 4NU7A 2J7CA 4GUJA 1QXLA 1MW1A 3T1GA 1A49A 2PWGA 4GC3A 3NA8A 4ERGA 3R8HA 1HF6A 1I2OA 5RUBA 3W83A 1HJQA 4FIQA 3AU2A 2FZBA 5G2HA 4S1FA 1H63A 7A3HA 1W54A 1OADA 4Q8TA 4RE3A 4E38A 1GVIA 3PPCA 1UD4A 1AG1O 1R86A 4ZB2A 3T4CA 2HCVA 3GIQA 2CESA 4LALA 1VFHA 3W27A 1RP8A 1WDPA 5BXSA 2R24A 3ARRA 2PRLA 4EXBA 2XIIA 3URNA 3KL0A 4Z2IA 1B90A 3GH5A 2XFYA 2YXGA 4LB4A 1SO3A 5BROA 4PMUA 1UMLA 3L5AA 1YIXA 3AHTA 2Z25A 5CPOA 1AD4A 4PMNA 3PZ9A 3H21A 4UCGA 5D8ZA 3EB2A 3NSXA 2C79A 2BY2A 4LH8A 3KAOA 1TZ7A 4O53A 1EC7A 2Y7EA 3CQHA 4YPJA 3T42A 3U7VA 1TSIA 3S2NA 1X1NA 2Z1VA 5F4WA 5BMXA 4PMOA 5BRQA 3BOXA 5E70A 4B15A 1XSKA 1T40A 4BA0A 3EPOA 3AIRA 4DWSD 4LAMA 3ABOA 1L8NA 1QHOA 2P1FA 4REQA 3RHGA 2UY5A 4H9XA 4C6PA 3PZMA 1UR9A 1XBYA 4HZ8A 4JXCA 5B80A 1U5VA 3NM1A 1DWFM 1MZRA 3EWWA 5C5YA 2BVTA 2UBPC 1IGWA 1C9WA 1OK4A 3RM8A 1Q4NX 4HZ6A 3HMCA 4GYJA 4E2OA 1H3GA 2ZZ7A 3M7WA 1V3JA 2IKJA 1BD0A 1B2YA 1JXKA 3LCGA 4I9TA 9CGTA 1XYAA 2ZRWA 3SADA 3E5PA 3DFPA 2PRHA 3CTLA 3HGRA 1T41A 1R3WA 3OQEA 3KHDA 3QFWA 3S0CA 4IGNA 2YW4A 4PMYA 4JN8A 1X7IA 4IP5A 4C65A 3W1QA 2VZTA 4CNNA 1YBQA 3CEPA 4P8VA 1ZTVA 3W76A 2PBGA 4RDZA 1PX8A 3TROA 2J8TA 5IBXC 2ZQ0A 1FBAA 4IH3A 2PTZA 1OT1A 3L2IA 1Q6GA 3W00A 3W81A 3SSJA 1QO5A 3GDLA 2P76A 2A79A 5KZEA 1YTKA 2EGZA 4QROA 3AMDA 1TV7A 4IGHA 4H9YA 4PMRA 3SN0A 1N82A 1Q8AA 5C2XA 1IE7C 3RLVA 1G67A 3LBMA 4IPJA 3WFLA 3WN6A 4I7WA 3UZYA 4PN2A 2OPJA 3GDTA 1TZ9A 3TN3A 2WMFA 4OOUA 2XINA 1V77A 3WD1A 4WDUA 1UWTA 3MT1A 4S23A 3C52A 3E0LA 3ISIX 2FIQA 4EPKA 3SCPA 1S5VA 2DIEA 1GK8A 3SCUA 1BVZA 3W2JA 2O0TA 1TPWA 2XN0A 3PAJA 4M0XA 4EAMA 3DYPA 4BF7A 3BG3A 4GYKA 1ZP3A 2FLIA 5G2WA 3L4WA 1M68A 4DPQA 2EG7A 1XIHA 1P0EA 1M01A 2YPIA 1Q7QA 3TN4A 4M8UA 1R46A 2GDQA 2HK0A 4GI8A 3TR2A 3NEHA 3QMSA 3VMOA 2R9RA 3HQNA 4WY0B 2OVLA 4HN8A 2A3LA 5LHEA 2D23A 4FP1A 2ZWZA 2VC7A 4H83A 3TOPA 3DENA 2A3HA 4H6RA 3G18A 3CUHA 5HAOA 2NQJA 3POCA 4XSLA 1IWAA 4CQAA 4QDMA 1HW6A 4GABA 2BTMA 4UNIA 2WOQA 4WJEA 5I7GA 1DHKA 1K9EA 4PMDA 5A3HA 6PTDA 1WKEA 1OGSA 1PIIA 3WLIA 1E0XA 1DXIA 2ZRZA 4RL3A 3M0VA 4AVOA 3TONA 1AQMA 4XSMA 4CKQA 4F48A 1QPRA 1UUOA 5TD4A 3TUUA 2HJPA 3MUIA 1E9LA 2RGMA 1KTCA 4PUWA 4FOJA 5A8GA 4B4HA 1JYWA 3TCSA 4M24A 1MDRA 1B54A 3PG8A 4FXJA 1O68A 3CMGA 4K7YA 2H3BA 3QHNA 4AVNA 3N25A 4K1GA 4QLJA 3BAJA 2KX9A 1U30A 3RDKA 3WJSA 3CHEA 1A53A 4QG6A 4QE5A 3H26A 3E2SA 2BFGA 3UR8A 3TTSA 2WANA 3DFQA 2DVUA 2WKGA 4DXKA 1JCYA 1GQNA 3NO5A 3KOZA 3H7UA 3WLMA 3ZWSA 1W3KA 3W7QA 1EPXA 4D1JA 4GNKB 5A8NA 2WWCA 3QV9A 4AWEA 1ADSA 3L4YA 5AC8A 3UWVA 1UC5A 1DTNA 1ISYA 3S5ZA 2PD5A 2Q6ZA 3MVTA 2H3DA 4HN4A 1FDJA 5REQA 4KGLA 2AL2A 3UP8A 4BQ3A 3ZR6A 1EXBA 1CX9A 1D7FA 4JQ2A 1LRNA 2YOCA 4UFMA 1A4LA 4ZODA 3P74A 3EAUA 4D2JA 1DKWA 2HNEA 5EBUA 3RCNA 5G4EA 1A5LC 4O19A 3QC0A 1R6WA 4LQ1A 1VYRA 1UHVA 1Q3NA 3U9IA 3MP3A 3SFWA 3CPRA 4IPLA 4OBRA 3IGUA 3BLPX 1V3HA 4QDWA 3GU9A 3HN3A 4L65A 2PPGA 3BGAA 2J77A 1QJWA 1JI2A 3QQ0A 3S5OA 3GDRA 3HBLA 1SVDA 4KRUA 1EO7A 1VC4A 1XPYA 1LQ0A 4QEHA 6XIAA 3T8QA 3WLLA 4IIGA 2OOGA 3QF0A 4M1RA 1H0IA 4MPKA 1LWJA 1EUAA 4O1CA 5FF7A 3BC9A 1TELA 3NL2A 3FA4A 2QKFA 3BOFA 3PK7A 1S2CA 2DT0A 3TJIA 3RMJA 2NX3A 3AICA 4GRSA 1US0A 2WPBA 1M7OA 1OJXA 2DUAA 2PWEA 4Z2JA 5IRPA 4V1YA 4YCOA 3BLIA 5EB8A 2FTPA 1QOPA 2XH0A 2NLYA 4LV9A 1EJRC 3FV9A 4DWSB 2PDPA 3V3WA 3ECQA 1PUDA 4Q8NA 2JE8A 4KF1A 8XIAA 1ICPA 3LTYA 3MP4A 2XVNA 3LHZA 3SUUA 2HXUA 4MNJA 1TB3A 4FLRA 2RDUA 2VFFA 2VC5A 2QDDA 1BWKA 4C1NA 4IUOA 4LSBA 3ZXWA 3D3AA 2CW6A 2WM0A 4R34A 1B5TA 2O7QA 4GJIA 2J88A 3NZ1A 3W75A 3A13A 1HJUA 3OEXA 2V2CA 2XYLA 3Q4DA 3O63A 1EEPA 3CZ8A 2WHJA 1TV3A 4UTKA 1UUQA 2YW3A 3WFZA 2YSWA 4M7TA 3F5KA 1FWTA 4Q3MA 3TFXA 4O52A 5A2CA 1V02A 3A4WA 1MSSA 1VYSX 1F3EA 4GWEA 4Q8PA 3L67A 1UQYA 3L66A 2AKZA 5ABGA 3K2GA 1H7WA 1EQCA 2FGLA 3WD3A 4UTTC 3L2LA 2EQDA 2NVDA 4M6QA 4WUIA 1PKLA 1UZ4A 2QLYA 2E3ZA 1PCWA 4PBGA 3CC1A 4PUNA 1UW9A 2RHGA 3KCJA 4YTUA 2ISVA 3B40A 1WBHA 2Z1BA 2X42A 2QPUA 3M7SA 3U0HA 2PB1A 1DYSA 1UG6A 3VMNA 2XISA 3IAQA 3B9NA 5LNRA 4Y9AA 4MWAE 4O12A 3W73A 5BXTA 1TRIA 3ZFHA 3SIMA 4CN1A 2CCRA 3H2OA 1QTWA 3PUDA 1GZJA 2YGYA 2QW5A 2P0IA 3QKZA 1ONWA 2EPKX 1VFSA 5CPNA 1MQQA 3SGZA 5AB3A 5A8OA 2ACQA 2WKJA 2GOUA 2PCQA 2Q02A 4ADUA 3F4DA 4ZXLA 3T0DA 3RGTA 4JQAA 2JBMA 1BRLA 3CL7A 2EPHA 4K6AA 3NZPA 3VE7A 5BYWA 1FHUA 1L6GA 3BZJA 4D6HA 3A4JA 2ZIDA 1G4SA 2GVYA 3GR7A 1I60A 1FA2A 3FCPA 7XIMA 2WPGA 3H53A 3E5BA 4K37A 1WXYA 3QZEA 4HNLA 5DT7A 2ZX5A 4Z1BA 4PUUA 3W01A 4JTKA 2PDYA 2DY3A 3A21A 3WSUA 4GA8A 1SZFA 4BZYA 2Y4SA 3VOFA 2VCAA 5HK4A 1LWHA 3LDVA 3M64A 4U3AA 1GWJA 4RW5A 1TJPA 1UCWA 2OT0A 3DG3A 4WSHA 1LOLA 4JYDA 2A85A 2HQAA 4G1NA 2V5LA 5D30A 2W62A 1VFMA 2EJ1A 5FJRA 3FJLA 2PGWA 1Z8AA 3PG9A 1ZS2A 3DHPA 2HBVA 2PTWA 2XPKA 2RDWA 1WX0A 4PGLA 4R33A 4GXWA 3VINA 4A21A 3EDDA 1KW1A 4JOMA 3QBUA 1L2UA 3Q65A 3IIXA 1EWDA 1JNEA 1KR1A 1P4CA 1YTEA 1MZHA 3HURA 5HXMA 2ISSA 3HG2A 1IHIA 4I5UA 3FGCA 3ARVA 4EIVA 3IIOA 2OX4A 4QEEA 5CBJA 2G3NA 1LJYA 2OYLA 1RQHA 3ONCA 3SURA 1H41A 3ALFA 4X61A 3P67A 2XN1A 2FMOA 2GVEA 1VBHA 2A21A 3ATYA 1OC5A 1VAHA 1X1ZA 4NIRA 5KZMA 2WSQA 3Q45A 1CGWA 1NQKA 1UUMA 1FUYA 1QBBA 2BZNA 4FK9A 2NXIA 4GCXA 1OCBA 1GOKA 3ZZ1A 2XVLA 1Q6QA 1K02A 3DHUA 3TOYA 1CGVA 5HWMA 5IDZA 4JD4A 3RK8A 1DWJM 4JN7A 1FWJC 3QFEA 4YJ5A 2QMKA 4C60A 1TTQA 1HG3A 4ILSA 2ZA3A 1KNWA 1RBOB 1E6NA 4ICMA 4GVGA 3VTRA 2ZTJA 5CJMA 1UJQA 1MFVA 2A0NA 4ZBCA 3JR2A 3C3UA 3DG6A 1WPCA 1RY0A 4YN5A 3BARA 2E8YA 4W9TA 3LLFA 2QZRA 2Y5JA 4ZTYA 1CYGA 2BVWA 2EAWA 2EG8A 4N42A 3S9YA 2OJPA 2OSYA 3LB0A 2PS2A 2V30A 3WLPA 4GUGA 3ES7A 3B8VA 3KOXA 5T91A 2YYTA 1VHCA 4PTVA 1EJSC 3ITCA 4N9CA 1JGMA 1NM9A 1U2YA 4HA1A 3IVTA 2WZTA 3MS8A 3REQA 3TKFA 2QGHA 1G6CA 2E40A 5FJPA 4EOUA 4JCLA 4WKFA 3FA5A 1G7UA 2ZUSA 4GLEA 3CQ0A 3SUVA 2Y63A 4XV0A 3O2LA 1UD6A 1AUSL 3K4AA 4PUJA 1VKFA 3UY7A 4IMAA 1J79A 5BU6A 1E9ZB 4RK8A 1E1CA 4O13A 4TTUA 4QS5A 2PA6A 4BFAA 1G7VA 4D8LA 3WQ8A 1MXGA 4UC5A 1V3LA 5M3WA 4F66A 3TTYA 1RAKA 2DZXA 2ZUVA 3QQ1A 3RR1A 3QSTA 3CH9A 4B5NA 1RQEA 3H4GA 3SFKA 5FJIA 2V6AA 1FWHC 4AY1A 2E68A 3I4KA 2G4JA 3GIPA 3H2FA 4PB3A 4RUBA 3PNZA 4MGGA 3N6JA 1Z48A 2BY0A 1QPQA 4FX8A 4C7FA 4ATLA 4JL2A 3TYDA 1B31A 2V5BA 2VFHA 2GYIA 3T05A 3MKKA 5D2WA 4DQWA 3TC6A 5T26A 4KH2A 1KD0A 1N55A 1B3YA 5HINA 5AC4A 1WDDA 2GVLA 1MRQA 3P14A 3AXIA 2DZUA 4DB7A 1XPGA 3UJEA 3BV4A 1JDCA 3PZTA 2VFIA 4QDPA 4KT2A 3OYZA 5DCDA 1XUZA 1XDJA 2E1DA 4J3UA 4LWWA 3ZT5A 1CNVA 4GQQA 4RV8A 4M3PA 4NNCA 2NUYA 2WJFA 1BYCA 1K6WA 3LXCA 4GUFA 1RA5A 4GE8A 4MZYA 4WDTA 3VNMA 3FY1A 2Z29A 4HHLA 2EEXA 3ITVA 4XBKA 1F3WA 5A6BD 4H9TA 1SQ7A 3MUXA 3MBFA 2ZTKA 1W6TA 3UWUA 1OYBA 4ZGYA 1QPOA 2G4FA 4JKLA 4UR8A 3CK5A 3PS7A 5H2ZA 4R9OA 5CXPA 2QJNA 3T07A 1XRTA 4MDPA 3PULA 1EH9A 3KRZA 3QZ6A 4M5PA 1W37A 1S2WA 3R7MA 4PODA 4XAGA 4EF9A 4Z2LA 1N8WA 3HZ3A 1LQAA 2FZNA 1ISXA 2MANA 5LA2A 3V4BA 3WK1A 3RPTA 1EGVA 3LM7A 2REQA 1UP0A 1NTHA 3VNKA 2CKRA 4NSBA 3EX2A 1IT8A 2W61A 3EXSA 3V1HA 4MADA 2X0SA 1OFDA 3KRBA 3PB0A 2WM1A 4MB4A 1S2AA 3BQ5A 3Q94A 1MUMA 2D22A 2OEJA 1TV2A 4N02A 4MB5A 1KWKA 3ARTA 5JUVA 1N2VA 4UMBA 4CNTA 3G1HA 2FVLA 4P8WA 3L12A 1S3TC 3UVAA 3UPMA 4S3KA 4L64A 2Y0FA 4AD3A 2PLKA 2Z26A 5BXRA 2C8NA 1EJXC 2DIJA 4IWWA 1A50A 1GOMA 1UR2A 2GJXA 3W84A 1SO5A 1ONXA 1NF7A 2A1YA 4AX7A 3W1NA 1PHQA 3LPFA 2INEA 5AKQA 1XM3A 1E5JA 4HQVA 4E2BA 1B3OA 4MUPA 5AYBA 3QC3A 1WQ5A 1V51A 3CHVA 2QJGA 3EEGA 4FXFA 2IKIA 3IJLA 2AGTA 5K9XA 3NPUA 3PBUA 2VVSA 4CQ8A 4DBDA 4Z1CA 1GEQA 4OGZA 2I1OA 5LHFA 1ISVA 2WC3A 1JCLA 2VFEA 2XG9A 3BDKA 4NT0A 5XINA 4CCCA 2A3EA 3NURA 4RR4A 4US6A 2JKEA 5J5RA 3LMZA 1W1A1 4NYUA 3WUGA 3NQ8A 1NY1A 3OQ8A 1XH0A 4A8RA 1H4PA 1DWGM 1BVWA 2GJNA 5F2IA 2ACRA 4Q8MA 4HU3A 5CG0A 1E4IA 3QVQA 2FFIA 3P61A 1ZBWA 3W85A 2NQZA 3U6WA 2J6VA 4LXFA 2JQXA 4HB7A 4QG8A 4ZXOA 1G94A 1CEOA 1VQTA 1ZB5A 3FJNA 3BW2A 3GC5A 4OIFA 4OZOA 3GG1A 4HOZA 2CBIA 4NF7A 3CAWA 4QQUA 3RXZA 3R58A 1WUFA 5IFPA 3VCCA 1HQTA 2Y5SA 2ZE3A 3S6OA 1XDLA 1UPPA 4IL2A 5A2AA 3VXGA 3P5YA 3AMKA 3AUJA 5AFDA 3UG8A 4KWVA 1X6UA 1VH7A 2ICSA 1S5MA 3WH7A 4I90A 4PL1A 2DUXA 4FX7A 2PDLA 2VRKA 3AUOA 1XR2A 2EKGA 4RDWA 2GSEA 1ONEA 3QSRA 2ODOA 2QEZA 1JYXA 2OEKA 3PSVA 4AZCA 3RMEA 4CN4A 1V6VA 3PC0A 3BL3A 2DVXA 2VWTA 3LQLA 4UOQA 3WLNA 2ZICA 4RE0A 2VZSA 1M53A 3R11A 3VKBA 1FRBA 2IMRA 5BOOA 3WBWA 5JH1A 1TV8A 1NDVA 3VOHA 1IYXA 3K4WA 4O57A 3GDMA 3DBPA 2ZC8A 1GQKA 1PAMA 4D8ZA 1P0DA 1UR3M 1EP2A 4K1WA 3C4UA 5K2ZA 2ZX8A 1E71M 4O1DA 1R87A 1ML1A 1BXBA 3KBVA 4A3RA 1RVKA 2DZAA 1EF3A 1LORA 5AC6A 4UB9A 5E0KA 5BU9A 3A3XA 1E6SM 1UOKA 4Q8WA 1XGDA 3GXTA 1KCKA 4YCPA 1KWGA 1FH9A 3T0TA 1L0PA 5E6YA 2DP3A 4MY1A 1RCQA 2PI6A 3NDYA 4FOKA 5A2BA 2R6OA 3GO2A 4OE7A 3E0IA 1RHCA 4HOXA 1TPB1 2VZOA 1ZAIA 5TIMA 4F9DA 1I2NA 2G5WA 2BGQA 2GL5A 1R2RA 3KLKA 1GZGA 3BAYA 3W02A 1KFJA 2WMHA 1GQIA 4Z08A 3E1F1 2GJLA 1ESWA 2PLCA 4LS2A 4IMFA 4GNVA 3RRAA 4LU0A 1EJUC 4V28A 3DFYA 2YKKA 3GSMA 1KR0A 4O15A 3P8JA 3IJ6A 4GQRA 4F79A 4E2VA 4GYPA 1JXJA 4MY8A 5FACA 3PTDA 1W1PA 3KRUA 4LFYA 2OELA 5EA9A 4DF2A 2Y8VA 1YPIA 1F4HA 1A3XA 5TQLA 4JTCA 3O6YX 2IPGA 2QIIA 3ABXA 3CASA 1YNYA 3VMPA 2PBOA 1VJIA 2BXZA 1TCDA 4DO4A 4IIBA 1TVLA 2HE5A 3ITGA 1OG6A 3VGGA 1NSJA 5H6HA 1X98A 2PTYA 1HJWA 5ABEA 4KERA 2R1LA 2Y7DA 1YE4A 1F6PA 4GX8A 3H8AA 3AJXA 1MWOA 1AL8A 1HP5A 3F5JA 3RCYA 4MUZA 1W5PA 3HFTA 2CERA 2QPXA 1LOSA 2XH7A 1I2QA 1XYCA 1EO5A 4G5DA 2PE4A 2ZX9A 1GOIA 4RNIA 4W88A 4KW2A 2E6DA 4JQ3A 4W7VA 5EFFA 2XM2A 1KKOA 1UIOA 2FPYA 5B7ZA 2ZA2A 3ARXA 1XLKA 1JDFA 3R6IA 5F7UA 2RUSA 3WH6A 3M5YA 4X60A 5FA5A 1P1MA 3UD6A 4Z1AA 5EMMA 1AW1A 1RQBA 4N6EA 3CHCA 3GVVA 1FFRA 5CJNA 3CIXA 4WY0A 5A6AA 3GXDA 1VR6A 1NOWA 3N11A 3UPWA 3WLTA 1NFPA 2J47A 3ITOA 4FI4A 3KVLA 3D0CA 4D9PA 3UZJA 1QOQA 2WJEA 1C8QA 3UXIA 4XB3A 1H09A 3F1QA 2NZLA 4A8NA 4LRTA 3CWNA 2YFNA 1QI4A 1CI1A 2QV5A 2XZ7A 3H22A 3QR1A 1W8SA 4ASTA 3BG5A 1VLIA 3GXMA 2VGFA 1UPMB 2VC6A 1IT0A 3W7JA 3O8AA 2D24A 2DT2A 3VKCA 3STEA 3ZLGA 4TIMA 2PGRA 4N4PA 3FN9A 4CGTA 1BFNA 2Z2UA 1H7NA 1KTBA 2VQUA 1SW3A 1XLLA 2OGYA 3OP2A 2H9AB 2VYOA 4IXHA 4DBUA 4O1EA 3G8RA 5LXXA 1JFXA 4A3YA 3I3DA 1B3XA 3TJLA 4S3AA 4IPIA 5K4XA 2PC8A 3M0KA 3VZXA 4B92A 3MUCA 3VC6A 3WF1A 1XSIA 1OB0A 5FAJA 1W1IE 2RGLA 3IANA 4UXDA 2I7GA 2WHKA 2PWUA 5LSMA 2BS9A 1UD8A 3WMBA 4OUEA 1VEMA 1E0TA 3OZMA 4GY7A 5HJLA 3P0WA 3ZJ7A 4CQ9A 3VNYA 3B4UA 4KWWA 4P7NA 3OHMB 4HA0A 3UA4A 4WD0A 5CC5A 1LUCA 1IEVA 2Z00A 1R85A 1Q6LA 3OGVA 3ERPA 4P5UA 2V8ZA 3LV5A 3KTCA 2VVNA 3C6CA 3IAPA 2J24A 2HZGA 2QAPA 4R5EA 1OWQA 1OCJA 1PTDA 3ABRA 4JIPA 3AIUA 4GIAA 3ARZA 1GKRA 3VKJA 4QLLA 2YXXA 1SO4A 3H12A 4FNQA 4LNYA 5I78A 1MEIA 2G37A 4IIEA 1ME8A 2PDFA 1G01A 4GO9A 5MF5A 4S3GA 1XD1A 4JN6A 4Z2GA 1QRQA 1P0NA 3TSMA 4PSPA 5K7JA 4HU0A 4D6DA 4NJKA 3NQFA 1A5SA 4RW3A 4X0VA 5A1AA 1BXNA 1WDWA 3B9AA 3I6RA 3ARYA 2WB5A 1KFEA 3V0UA 4P7OA 1ADDA 4J7RA 3ZR4A 3VIOA 2BWGA 3LLDA 2OZTA 1X39A 2WVTA 4REQB 2IUZA 4UQEA 3M6DA 4DF0A 2NVCA 3DXIA 4UWMA 1ZJHA 4R27A 3LSBA 3AWNA 1E43A 2A3BA 1EFZA 3W82A 3IV3A 1TA3A 1VFTA 3N2CA 2R94A 4HKPA 2QCHA 3WD0A 1TUXA 3GIYA 4O4WA 2JEPA 4G2DA 3T09A 1P6BA 1E51A 3NZGA 3P8IA 3FSUA 4GKLA 4JHZA 2WYSA 3WJZA 5EYWA 2NW0A 2XIMA 3HG3A 1ECQA 3IARA 1SM9A 3AISA 5ABHA 3E2RA 5I2UA 1RCOB 4XD5A 3CUXA 2GSJA 1ZAHA 2GZXA 1JUKA 1O95A 5AHLA 1W5QA 2FHFA 3VOIA 2FHBA 4LTSA 1W5MA 4FALA 2DZPA 1DORA 4IP4A 3ALGA 3ZVHB 3E02A 3W22A 2PZ0A 3ABZA 5F1VA 1EIBA 2ASHA 4XKYB 1XISA 4QAWA 3B9EA 4O8RA 1Z9AA 3II1A 4ROPA 4NRRA 4IQEA 4P7LA 4I9MA 4MMWA 1ZPTA 5C7HA 1RXOB 4FLOA 3QW4B 4MIMA 4J1OA 3ITXA 2VFDA 4DEFA 1F05A 1UKOA 3QGVA 2ISDA 5CGQA 3R79A 1L6WA 6CGTA 1PPIA 5FEPA 4FNRA 2TRSA 5C9WA 4FNSA 3TTQA 3AQUA 2VEKA 3MB9A 3SDOA 4ZSTA 4IFKB 5ABFA 3TP4A 1OGBA 3M47A 4XZWA 5DEZA 2J7GA 3DIPA 2NWRA 1KA9F 3W29A 3G6LA 5GQBA 3VD4A 4TVCA 3MHGA 1WP6A 3BMVA 3EX1A 3PWAA 1K4HA 2OO6A 1LZOA 1FKWA 3IK4A 3IVSA 4JCMA 3SRFA 3LHWA 3QHMA 4TV5A 3AHVA 1O66A 3W6MA 1KM1A 1EWEA 4LYQA 2OFJA 2P53A 1YKWA 3A6OA 2IXVA 3ZS4A 3W1UA 3WQ4A 3FYPA 5HUPA 4HGXA 3TN6A 2W79A 3UW6A 1UJPA 2AQOA 4NJHA 2WZIA 3MMTA 4EPEC 6ENLA 1CECA 5EPDA 5F2MA 1ZJIA 4UFHA 1TWIA 2TODA 3M1ZA 1PEZA 2X0YA 2DT1A 2IQ0A 2W9MA 4OTKA 3LS9A 4XKMA 4A2RA 4A8LA 3NQDA 2BOFX 1R7AA 3V16A 2G96A 3INPA 1T96A 1C8XA 2W4XA 4EE9A 1TV4A 4DJDA 4ZQOA 1JG9A 4J3TA 3ZOAA 5LGZA 2E7FA 3W53A 3CNYA 4GACA 4JZ5A 5LNSA 4ZA0A 3LA4A 5CZ0A 1ZJBA 2VFGA 4JIHA 2X41A 3T8LA 1X7FA 3PTQA 4F2UA 5DY3A 1FWCC 2H90A 2ZA1A 3TH6A 4BEQA 4M1BA 1DIEA 3C61A 1L2QA 1VFOA 3N13A 2VURA 1FCBA 3E3HA 1TVNA 1HFBA 1JYVA 4GFSA 3S3GA 3MHUA 3O07A 1W5OA 3UG3A 1A4MA 3HJEA 1RA0A 2EPNA 3F5LA 4JFVA 4O1AA 5E6ZA 3VPLA 4GXPA 1WOAA 5T9BG 1LBMA 2BXVA 2X09A 3IUDA 3ZMRA 3TYBA 1KXQA 1XG4A 2GK1B 2FZ8A 1FH7A 4LCQA 4HTBA 3IRSA 3BCJA 1BQCA 1VF8A 4XZNX 3GNXA 3FEQA 4E3TA 1EHAA 3UFYA 1H11A 4XIAA 5REQB 2AL2B 3CQIA 3UA3A 1JZ5A 1EF2A 3AWOA 5EU9A 4AXKA 3E9AA 2BDQA 4ZQCA 1MNSA 1WNOA 5D09A 3NL5A 4RX0A 4DBSA 2EKCA 3WH5A 1LL4A 3SIZA 4CUCA 1TIMA 2ZZ5A 5HBFA 2BP1A 4IJBA 3WBXA 3YPIA 1W9PA 1O6IA 4DI8A 2ZC1A 4L80A 4AW7A 3GRIA 4LCRA 3T2PA 1GKPA 2B7PA 3TNOA 4PFMA 1XIGA 5GVJA 5AC7A 4DJEA 3ATZA 4RZ4A 4MWAA 1Q63A 2OQHA 3W7MA 4OWGA 3JZEA 4KWOA 3JRKA 3NGFA 2W91A 1AW5A 3O15A 1MXDA 3HPSA 3W2UA 2CLHA 3RCMA 3LRKA 2YBVA 1V4YA 4GIEA 1DPMA 3CAVA 4IQDA 1SZNA 2XM1A 5JBEA 1W91A 1M7XA 3VYLA 1VJZA 1S38A 1HO1A 4AAJA 3S42A 3NQ2A 1UWUA 2EO7A 4S3FA 3ARQA 4ZQRA 4F0LA 1FH8A 4WOZA 3BMWA 1DJHA 4JKKA 4C6NA 3QY8A 2V0TA 3GTXA 2INZA 1LG2A 3GG7A 2F7FA 4MTVA 1E56A 2YLAA 3MW7A 3U2ZA 1P6WA 5HWNA 5D37A 1NFBA 5ECUA 4NZ5A 1QO2A 1Q6OA 1R8LA 5F1UA 1EA9C 4CCDA 3THUA 3IIVA 1HT6A 3FLUA 1TQJA 4DJFC 1C29A 3HF3A 1ME7A 1XKJA 1XX1A 1JYNA 1HXJA 3WDPP 2R14A 1HGWA 1J4EA 3UYIA 3IRDA 3WMLA 2PDMA 5G2IA 4C1NB 4QR6A 1MI3A 3LLXA 2EF9A 3V36A 4O0KA 4MHBA 3JU2A 1CTNA 4UR7A 3ORWA 2PU1A 2CLMA 3CWHA 3OG3A 2ZX7A 2P0OA 2ACSA 3U4AA 3A9IA 4FF5A 2GSHA 1OX4A 5EMLA 2F8QA 4HMDA 2BY1A 1YDNA 1GHRA 4YWSA 1OM0A 2C71A 2O9OA 3UBPC 2A4AA 3CWOX 4DM1A 3ZJ6A 4Q8VA 3H7VA 1XSJA 4ES4A 1IZKA 3WL1A 3WY1A 3HQOA 3MKCA 4J2MA 1PZ0A 2FH8A 5C70A 3SB0A 4WVXA 1R0MA 1QATA 4JTRA 3HA1A 1C7SA 3WDJA 2DH3A 1YX1A 3O06A 5DXYA 4HD5A 1OZMA 4ZVJA 4ZQPA 1QHZA 3STPA 1FXQA 4G6CA 3CT2A 1US3A 2I5IA 4Z42C 3VD9A 4GI4A 1YMYA 1XBVA 2CBVA 3ZJKA 3ZIZA 2XGZA 3TC3A 2VTFA 1UR4A 1ZQ5A 3LX9A 2I9UA 1GVEA 3WLHA 3OLDA 2BGNE 1R3VA