2VFGA

Crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase with 3-phosphoglycerate bound at the dimer interface
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHHERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 90
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vfgA00
5H91A 3IV3A 4GWEA 2OX1A 3OBKA 4NJJA 4EIVA 1H50A 2VFIA 2Y62A 2ZBTA 4Y8FA 4K38A 4ADSA 1KLYA 4FEZA 5CSRA 2C14A 1SO6A 3NM1A 4E38A 4LVDA 1YXYA 3W1RA 1OF8A 2DP3A 3LERA 1LTDA 3BARA 4O53A 3O06A 5E1QA 3EKZA 1DHPA 1Q6LA 3G0SA 3LRLA 4KFOA 3O63A 3G24A 1P5BA 4DO4A 1R46A 1TV7A 2VXNA 5ABTA 5E93A 1W5OA 4IXXA 3UWQA 3PM6A 4MYXA 1N55A 4R53A 4GFSA 3L0NA 1G4TA 5HULA 1LZOA 1ME7A 2ZZ2A 5CPOA 5AC7A 4QISA 3VNDA 3W3OA 1OYAA 2D73A 2WSQA 4UIOA 2QCDB 3TC7A 2V5BA 3W7HA 2GQAA 2A21A 3S5YA 3C3NA 4A21A 4I7VA 4IQLA 2GVJA 2Y89A 2EKCA 1B4KA 2RH9A 5D37A 3SSJA 5HUOA 3LHUA 1SZGA 4LOCA 5LZLA 3M5YA 3SFKA 3TFCA 4DXVA 1JCNA 3C2OA 5LNRA 4UUIA 2VOMA 2OZ0A 3W7KA 3I68A 6ALDA 3VE7A 1QCWA 3W07A 3W7PA 2J9XA 3FYPA 4TMCA 1G7UA 4UTTC 3T4CA 3S0CA 4GC4A 4IMEA 3UQNA 1I2QA 2R94A 4RZ6A 2FPTA 1W5QA 4UTHA 3FJLA 1FWTA 3NQVA 3STEA 5FI8A 1ZAHA 5C5YA 5CZTA 1NEYA 3YPIA 1QNVA 1WA3A 3FYOA 4LC6A 4RXGA 2Y70A 3B0PA 3DGRA 4OV4A 5D02A 1H63A 1KM1A 4J9JA 3TAKA 2G95A 2F84A 5IBXC 1JULA 2V5LA 3QSTA 1LROA 4XUGA 1LOQA 2DZTA 4JTEA 2R14A 2Z1BA 2CZEA 1VYRA 3GDKA 3NM3A 2VEPA 4AHPA 2BX7A 3N14A 1S3HA 3USBA 1QWGA 3C2FA 5I3GA 1OFBA 4Z0JA 2G5WA 3FJ6A 3G22A 4ALDA 4I7UA 3H53A 1DJNA 4Z1AA 3TK7A 4NZFA 1GPWA 4HN4A 2CLMA 4XKYA 3PB0A 4HHPA 4WY0A 1W37A 4JIPA 3A9IA 5D33A 5AHLA 4FNQA 1D3GA 4P61A 4GJ1A 5TQLA 2ZTKA 2GOUA 3RK8A 4O54A 1VHCA 1XM3A 2A7NA 4HNNA 4O11A 4NXKA 2EAWA 3QW4B 5KINA 4IMCA 4MFEA 5KZMA 3G8EA 4JD4A 2QJGA 1VR6A 2Y6ZA 3KRSA 1TTIA 2C13A 2QKFA 4AB4A 2C1HA 2X1TA 3TJXA 1OX6A 2W79A 4RZ4A 5D32A 2JGQA 1Q6OA 1RQBA 5H2ZA 4FNTA 3SZ8A 2ATSA 5CGQA 1EUAA 4K8HA 2YZRA 5U4NA 3SI9A 5C55A 1OYCA 3ZWSA 1EEPA 1SU5A 3EWXA 2ABAA 2J9ZA 3PAJA 1EP2A 3RFAA 3I6RA 1TRDA 1LDCA 1MSSA 3W2MA 1R2TA 3W83A 1N8FA 2AQWA 4M19A 1XXXA 3LTSA 1ZENA 1I2RA 4XTDA 1SUXA 3IIPA 5DN1A 1F2JA 3TMQA 5LNVA 5AYYA 4IPJA 5G4EA 1MEIA 4MZ8A 5EYWA 4NJKA 2CWNA 4YLWA 2J24A 1NAL1 1F5ZA 3NG3A 3BPWA 3W2KA 5DCEA 3U6WA 3TXVA 1YDOA 2CLFA 3MI3A 5BMXA 3GR7A 5K3VA 4UR7A 1VJIA 4UC5A 3TCEA 3KRUA 3EKLA 2QR6A 1U5JA 1K03A 3MP3A 4QQ3A 2C16A 5CZSA 3QSRA 2OJPA 2RDWA 5EL1A 4POCA 3P5YA 4Q32A 4UTMA 3STCA 3W88A 2A2IA 3W1MA 2ZQ0A 4LS0A 1TPVA 3N2XA 3G8RA 4PA8A 1SQ7A 3W1XA 2YPIA 1VZWA 1QPNA 1JCMP 2IQTA 3NPVA 4O0KA 3LRMA 1H7PA 4Z0SA 2VC6A 5KMYA 2FLIA 2G97A 1KA9F 2NLIA 1JJKA 5AHNA 4JXCA 5AB3A 1BWLA 1TV8A 5SWUA 2VKZG 2C15A 4ZQRA 3DKJA 2GPTA 3MWAA 1YXCA 3L2IA 3QC3A 3M5ZA 1IIGA 3NOEA 4O19A 1LRQA 3TJLA 3NEVA 4KWVA 3F4WA 3M44A 4KWWA 3SY5A 2LLEA 5EBUA 2YFOA 4FNRA 1TV5A 4K6AA 1SO4A 3S5OA 5HNRA 3MP5A 2A4AA 5CG7A 1FCQA 3UPBA 4ZQNA 5CPNA 4YWIA 4NJGA 2E5CA 1TJRA 1YTEA 2DZPA 3BW2A 4YXGA 2ZRUA 5DXYA 2VFGA 4AEOA 2GVGA 3GDTA 4LT9A 3O15A 4ZQCA 2B7PA 1KTBA 3GB6A 4CCEA 1YYAA 3FEMA 4WD0A 2Q3RA 4C1LA 4UFJA 3RF9A 1ZJIA 4JTLA 4JTSA 3TQVA 3DXIA 1F73A 1WBHA 1GTEA 3SGUA 2NZLA 3RNDA 5AFDA 1VLIA 1GVSA 4M6QA 2H3DA 1T8XA 3HPSA 3CU2A 5I3HA 1DQWA 3KVMA 2HS8A 1JUKA 4UXDA 4E0CA 4ICNA 3B8DA 1GVFA 2ABBA 1LCOA 4UFLA 4XZ9A 1KTCA 2PURA 4LUJA 1KFBA 4CNPA 3DFPA 3TV8A 4LV9A 1A53A 5I3JA 4GUJA 2ZZ4A 4O15A 4S2BA 3QFEA 3LCGA 4A2SA 3TC6A 3NL2A 3CEUA 3W7NA 3PSWA 4NQ1A 2NX9A 3UPWA 1YADA 3UWVA 3G1AA 1QO2A 1XBXA 3PR2A 4OE7A 2QDGA 2ATMA 1E51A 3CTLA 2Y7FA 5EA9A 4UTLA 3HIJA 5TIMA 3GZ3A 3P60A 3KOFA 4NZJA 3NYZA 3PBVA 3CHVA 1W1ZA 5CSSA 1NFBA 3LV5A 2ZRYA 4NJIA 1NF0A 2E5DA 1FDJA 4IX0A 2OCZA 1H7OA 4X9SA 1TO3A 3O16A 3W7GA 4L4MA 4MZ1A 1CW2A 5IM51 3BGGA 4JTGA 5HJLA 5HMSA 3NQDA 4GUIA 3G3MA 1QMLA 4CNOA 1DJQA 2JKAA 1WBJA 4YMZA 1UB3A 2TYSA 5LNUA 3RMJA 4N9CA 3QMRA 1WOBA 4XWUA 3HG4A 3A22A 3GLCA 3MHFA 3PUEA 2V2DA 3MHGA 1SZNA 1K7EA 1VRDA 3C6CA 3G1VA 4WOZA 3NPUA 3N73A 2NUWA 3EWZA 3W7EA 2E6DA 2X1RA 5K9CA 4OGZA 1A5BA 4CCCA 4IOTA 1B9BA 1X1ZA 4HSNA 1UUOA 2P0OA 1DV7A 1RQHA 3CIXA 1TQXA 2ZZ5A 3N34A 1FBAA 1GOXA 3DFTA 5D2TA 4Z08A 1VCVA 2X30A 3CEPA 1GTHA 1WQ5A 4ZZ9A 4BWLC 4GUHA 1OFQA 3W1QA 1OF6A 3NQEA 3QF0A 4I9AA 3S5NA 5K4XA 3G1FA 1SFLA 3TA6A 1OFPA 3NR0A 2B0MA 2J9YA 4GE8A 5BNKA 4AHOA 4CQ9A 3MP4A 5FEPA 1O60A 3OA3A 4EF8A 2FPVA 2QCLA 1K7FA 3DENA 4LVFA 4MY8A 3LBMA 3NQ6A 4NJHA 5LSMA 2Z6JA 1M6JA 2QCCA 1PS9A 2XFWA 1LRTA 3FA5A 3NA8A 4DO5A 1SW3A 3N2MA 2CLOA 5DLCA 5F2MA 4O1DA 3N9RA 3W73A 1FWRA 3CLMA 1TPH1 4MUZA 3B4UA 4KFPA 2Z6IA 1O5KA 4UMBA 3NNTA 4UFMA 4WY0F 4UTIA 2WO5A 5F1UA 4UMCA 1PIIA 3M41A 4AAJA 4OBTA 3TH6A 3LCWA 3PULA 2WNNA 1I2NA 3RLUA 2E77A 5EY5A 2QEZA 5G1YA 2YX0A 3PS7A 4WXYA 2KZHA 3W7DA 3OEXA 2PCQA 5CZJA 4ZVJA 4UR8A 2ZFAA 4JDYA 1KLZA 2W0UA 1OABA 2BSLA 1XI3A 3TROA 1MO0A 4E2BA 5HWMA 4M7TA 1ZALA 3NQAA 4MVAA 3M0ZA 4GXMA 4RCXA 3O1NA 1YPFA 2QJHA 2Y7EA 1YDNA 2A85A 3EEGA 3UZJA 1GVQA 2I14A 1GVOA 3M43A 2A5HA 2GQ8A 1TJPA 1JUEA 3S6DA 3KVKA 3ZS4A 2YGYA 4DF1A 2QCMA 5BW6A 4TR9A 3DZ1A 3KAOA 1AW5A 4DELA 1DL3A 2YW4A 1NVMA 1YDVA 1K3UA 1BWKA 1F76A 4ZQMA 3W2UA 3NDOA 2CZDA 2BWGA 3FS2A 4PEKA 1TIMA 3LHWA 4AF0A 3HPZA 5AYZA 3TNOA 3TUUA 4K8EA 4S2CA 3WJWA 1SW0A 2HMCA 1DBTA 1XL9A 2XN2A 1C8VA 4N9EA 3VE9A 5KITA 3TSDA 3S9YA 4TMBA 1BKSA 5BRBA 4JTKA 4JNMA 1PHWA 3DI0A 5CKSA 1RZMA 5LHFA 1W5MA 1H7NA 5E0KA 4HNVA 3PB2A 1X1OA 2BXVA 1IXQA 3W1TA 2QDHA 3MBFA 1TPC1 1K8YA 1XDLA 1LOLA 1HO1A 1KW1A 3IVSA 1H7XA 1RQEA 1AMKA 1G69A 1SZEA 4JX4A 3HF3A 2J6XA 2ZZ7A 3DFSA 4MLRA 1CI1A 3NQGA 3Q37A 4DQWA 1HG3A 4FF7A 3A23A 4O52A 1PCWA 4M6VA 3L67A 3E96A 2CLKA 5HQEA 5D30A 3W7OA 2NX1A 3OVPA 3NL5A 4HSOA 1JR1A 3ZR4A 4NVTA 4UTJA 1H62A 1F6KA 3G1XA 2ISWA 3GAKA 1KFEA 3MUXA 2R91A 1HTIA 1TTQA 2ZA3A 3WJXA 8TIMA 3HGRA 3LLFA 1EWDA 1EUNA 2YFNA 1MXSA 2DZXA 4NNCA 5HWJA 4A29A 1SW7A 4O17A 1OFRA 3KFTA 3NVTA 3W72A 5FF7A 3FIGA 3TX9A 3UXDA 4UTWA 3A5FA 1OFAA 3WK2A 5HR7A 3LXBA 3P8JA 3A21A 3QMTA 2A1YA 5BMWA 2V82A 4C1KA 4JX5A 3O07A 1VQTA 1Z48A 4GUFA 3QPZA 1ADOA 1EB3A 4UNLA 2YXGA 3PBWA 4WQ6A 1VYPX 3DFOA 3HPXA 7TIMA 2PE4A 5G2WA 2YYUA 3FKKA 4QSHA 4AWTA 3U8GA 3HG2A 5U7SA 3FLUA 6TIMA 3L5LA 3W7JA 4JR5A 4O1CA 2GJNA 1P0NA 4DPQA 3H55A 3DFNA 2WSRA 1TPDA 3KHJA 4FIQA 1DKWA 2V2CA 4Y96A 5I3KA 2CZ5A 1SPQA 1TRIA 4O16A 5G2IA 3BLEA 4Z1DA 3TU9A 3B0VC 3BVJA 4O12A 1PHQA 1WAUA 3CPRA 5FF2A 2Y61A 2E09A 4PH6A 4AH7A 1F7BA 1N7KA 5AN7A 3P67A 1BTMA 4N4PA 4O10A 4MIMA 2V81A 1J2WA 5F4WA 1FX6A 3P80A 5HUPA 4K7YA 4YCOA 1GZGA 1ZAJA 3ATZA 1TSIA 5D2XA 5DCBA 1QPOA 2HS6A 4A22A 1QDSA 3AO0A 4LTSA 3EXSA 1TB3A 1Q6QA 2WPBA 1L6SA 4U28A 3TXZA 3LCXA 2Q8ZA 3V1PA 1W54A 5FEZA 4HIBA 3W85A 3B05A 3L5MA 4RX0A 3PBYA 3P5ZA 3EX1A 4N2YA 4NU7A 1W0MA 3PSVA 1WDWA 4H6KA 4HT3A 3B06A 4O4WA 4JY8A 4MKNA 1ME8A 1PE1A 5AHIA 1FDYA 1W5PA 3QW3A 2WJZA 1AW2A 4AVFA 1Z44A 4FNSA 3TW6A 3W87A 2Z0IA 4WJEA 4UFKA 1QPQA 2CW6A 3T55A 3PUDA 3WJZA 2DZUA 2ZA1A 1HL2A 1W3NA 3DAQA 1LBLA 1J5TA 3W7IA 4PL1A 2QCDA 2NXHA 1PVNA 1G4EA 2FB2A 2YR1A 2ISSA 3M7WA 1KV5A 4ORMA 3NAVA 1KTNA 3C2EA 4Z1CA 5KZDA 3GXPA 2QCGA 3ABOA 1JQXA 2V8ZA 4GBUA 3G0UA 2WNQA 2E6AA 1FCVA 3MI6A 1XUZA 2ALDA 3O6YX 2P1FA 2A6LA 1IXPA 1A5CA 1KM6A 1EIXA 1OX4B 1R47A 1PL9A 4OU1A 1Z42A 2J27A 1XFBA 3BG3A 4MFDA 4CLMA 4O0ZA 3W7QA 5LGZA 4FNPA 3UYCA 1W8SA 4LRSA 5HR6A 1OVDA 4U4MA 5F2LA 5I3IA 3EWWA 2DORA 2X1UA 5EMUA 2QF7A 1FCBA 5D2VA 4DPPA 3HJZA 3QM3A 4ZQPA 3IGSA 3GXTA 1F74A 2FDSA 2ZRXA 4UTWC 3QPYA 1P1XA 3OVQA 5CZ0A 4R33A 4JN6A 2NUXA 3QQ0A 1NSJA 3LB0A 3ANYA 2XN0A 1AL7A 4HKPA 1L6YA 2FJKA 2PRMA 1H7RA 4FX7A 3E49A 3W1UA 3GYEA 1R2RA 3G1DA 1I8JA 3P81A 2FQIA 3WK1A 3KXQA 2GJLA 3PUOA 2ISVA 2NV2A 4M6PA 3S42A 2X2GA 3CT7A 4LWWA 4RR4A 1TTPA 3P62A 4UFIA 2YDAA 1IIHA 1C29A 1UUMA 4MJZA 3L5AA 3G18A 4IJBA 1UBSA 1RPXA 4EVZA 4G1KA 1CX9A 2QAFA 1EPXA 4CNNA 2A6NA 4ML9A 3JRKA 5F1VA 4BI5A 2QJIA 2ZCGA 3Q58A 4MZYA 1KFLA 3LXCA 3THQA 1JCYA 3VFLA 1A5AA 1VLWA 1ZFJA 1VC4A 2TMDA 5BOOA 3DBPA 3UZ5A 3QYQA 5FEWA 2Q8LA 4ADTA 1H1ZA 2Z2UA 1EA0A 4WX2A 2TPSA 3P8IA 3W2NA 3O05A 2NV1A 3SJ3A 4OWGA 5LKYA 3GK0A 3BLIA 2VFFA 1XBZA 3BK0A 2CLIA 4KKXA 4FO4A 3R12A 3CWNA 1LOSA 3R13A 2I1OA 1VGAA 1VS1A 4N6EA 3SR7A 1KM0A 2QCNA 3L68A 3C0JA 3STGA 4UTUA 2NUYA 2ZYFA 4WXZA 4ZMGA 3SECA 4P2VA 4TU1A 2GQ9A 1H1YA 4DF0A 2AAMA 1K8XA 5HINA 4AWUA 5AC8A 4ZL1A 2OT0A 4JTTA 2JK2A 5AHMA 4O13A 4N9BA 4R7JA 1B3OA 4FHAA 3QJAA 1YTDA 3EX3A 5C6MA 2DJXA 4AWSA 5LHEA 3NQMA 1LRNA 2YYTA 2EHHA 5KSWA 2H6RA 3NZRA 3P74A 1G6CA 4DO6A 3S1VA 4UCGA 4XQ6A 3AJXA 2RDUA 1HFBA 1VHNA 4EOUA 4O1AA 3IRDA 4O14A 1YXDA 1XCFA 2OMAA 3S1UA 4EWND 3CB8A 2FIQA 3R5EA 1A50A 3W1PA 3WJYA 1TPWA 2Y63A 3D0CA 4L4LA 5DELA 1QFEA 2F7FA 1HO4A 5GVJA 3QEZA 1ME9A 3C8FA 1WYIA 1JRBA 1VPXA 3CQ0A 3V75A 1W31A 2E1DA 2A0NA 1OK6A 1SSDA 3O6CA 1PV8A 2W6RA 1G4PA 3UWZA 4OT7A 3W71A 1O4UA 1JVNA 3OVRA 3EX4A 3B0UX 3HO8A 3WJSA 1TPUA 3NGJA 5DY3A 3LOTA 5I3FA 2ZA2A 3LCIA 1XC4A 4FIRA 3BG9A 4WUIA 4JYEA 3W6YA 2PRHA 2B7QA 5D38A 4RKAA 5D03A 3DH7A 2QCEA 3NO5A 3W76A 1FQ0A 4TIMA 4JTHA 2E6FA 2C6QA 3MBDA 2VFEA 3QZEA 4RJEA 3F4NA 4IUOA 3LV6A 4PFMA 2ZTJA 5AHEA 1M7OA 3SW6A 4OQVA 2YSWA 2PC4A 1C9DA 1AL8A 3M16A 3C2VA 4UNKA 1TREA 3GX9A 3BO9A 1H60A 3BG5A 4CQ8A 4XKYB 1JUBA 1SR9A 2CFFA 1IXOA 3MI2A 4WY0B 1AG1O 4LY8A 1G7VA 3C52A 4X22A 3MHUA 3UY8A 5DXXA 2FFCA 4ORIA 3M6YA 1UASA 5G2HA 3W2JA 1TYGA 1GJPA 3KRZA 4O28A 3F03K 5IBXA 4LVAA 3GKAA 1Q3NA 4PL2A 3EXTA 3IIOA 4QNEA 3NL6A 4IMGA 3R8RA 1OK4A 5FEXA 2UV8G 1GG0A 3LCHA 4QNWA 2JKEA 3ABRA 2JGYA 4JGDA 5K4ZA 2NX3A 3C4UA 2EGZA 1KBIA 4LW7A 3GR8A 1T99A 3JR2A 3LM7A 5K9DA 3P7YA 5K2ZA 3TQ0A 3M9YA 4LVBA 1L6WA 1TPEA 1I45A 4IGHA 4MOZA 4PC8A 4HPJA 2V0TA 3B03A 2A7RA 3TR2A 2G96A 4LNYA 3T44A 2CLLA 3LXAA 2QUUA 3A5VA 1J4EA 3LHTA 4FXSA 4JY9A 5A5WA 2X1SA 1RD5A 3CC1A 4MJMA 5C2XA 2B4GA 3W1LA 4JYDA 3RLVA 3HGSA 1IF2A 3NPXA 3UNDA 1RV8A 1TQJA 2JBMA 3G1HA 3ZWTA 2Q3OA 4IX2A 3N19B 2TRSA 4NT0A 2B7OA 3C2RA 5F2IA 2P10A 4EF9A 1T0OA 1FWWA 5F2GA 5F4XA 2C18A 1GQNA 3T78A 2ZDRA 3S1XA 4Z1BA 1XUUA 3M47A 3HMJG 1Z41A 1OJXA 5MHBA 3S1WA 2EPHA 3W22A 2FB3A 4ADUA 3S8HA 2O7SA 4M7SA 3IIXA 1SO5A 4X3ZA 4UFHA 4H3DA 3OIXA 2YCEA 1V7YA 2QCFA 2C19A 3WK0A 2E68A 1KBJA 1P0KA 2FPYA 1D9EA 3BW4A 5D09A 5DCDA 2ZZ3A 1LLZA 1MEHA 2BTMA 1VH7A 3MW7A 3IEBA 3TAOA 3W75A 1Q6RA 5C54A 2QUTA 3GAYA 1PCKA 1EP1A 4K37A 1B57A 2DZVA 4GUGA 1LORA 3IGXA 3E12A 4NX5A 1ONRA 2E6YA 3B04A 3LHVA 1QR7A 3PVFA 4FB7A 4IMFA 4TO8A 3T40A 1G4SA 2QAPA 1ZNNA 3LI1A 2DJLA 4BR1A 3LX9A 3W7LA 4QIUA 3H54A 1KV8A 1ICPA 3PG8A 2VEMA 4Y6GA 4YL2A 1S5TA 1O94A 3OHIA 3U2OA 1RVGA 3E9AA 2RFGA 3WK3A 5EPDA 2AGKA 3E02A 3R2GA 2HTMA 3O6DA 1UCWA 4HNUA 1VCGA 1QPRA 3MJYA 1FY6A 1ALDA 1YTKA 1UJPA 5DBUA 1SZFA 2PRLA 1M7PA 3WFAA 1EX5A 3INPA 1DORA 3LHZA 3FOKA 1WOAA 4RZ5A 1I2OA 3L65A 4BFAA 1IXNA 3G3DA 2ZRVA 1VYSX 4O8RA 4BK9A 4JX6A 2DU2A 5G4WA 1OFEA 1OFDA 3W1NA 4DEFA 3TSBA 4NNBA 3LTYA 3Q2DA 1ZY9A 4O4VA 3W23A 4N02A 5EKYA 3DFQA 3W2LA 1OG0A 4RV8A 5T26A 2CLHA 4TX9A 2TSYA 3THAA 4BI6A 3QMSA 4MYAA 2GUUA 4IWWA 4RLIA 4LU0A 3NL3A 3NPWA 1W3TA 3LI0A 4XTIA 4O18A 1FCUA 3P61A 3PBUA 4QAIA 1K02A 4OV9A 2DZSA 3TFXA 5TBOA 2VELA 1G67A 2NXIA 2R8WA 2CLEA 1R30A 1I2PA 2H8XA 3N3MA 3GXNA 3TW7A 3FKRA 3VCRA 2H90A 2WKJA 4WZHA 4RXFA 1ICQA 3T7VA 1TPFA 1BEUA 4Q33A 1H61A 1GG1A 4LUIA 3QQ1A 3QRHA 1Y0EA 3EX6A 1GYNA 3BV4A 4MLJA 2VFHA 1TCDA 1X6UA 3EXRA 5AYXA 1DQXA 3TKFA 3DKLA 3TQKA 3EX2A 3A24A 3I65A 4JICA 3TDFA 1NF7A 3BGJA 3NQ8A 1F6PA 1GEQA 1JRCA 4W9TA 2J88A 3W84A 5DY2A 4BF9A 1WXJA 4DF2A 1KM4A 4GRSA 1YPIA 3GIYA 3EWUA 4FXRA 4K39A 1WX0A 2OT1A 2WSYA 5J5RA 4KFNA 3OG3A 3R89A 3LHYA 1ZAIA 4O57A 3P84A 1RR2A 4JTJA 3ATYA 4QM1A 2Y7GA 4AXKA 5FF4A 1XBYA 4UTKA 2Y88A 3SIZA 1H5YA 2ZRZA 4IMDA 4AMAA 2CU0A 5K9XA 4CQAA 3G1YA 4AHQA 3L21A 2VEIA 3TE9A 5AHFA 4CCDA 5L6UA 4IPIA 1QO5A 2Y85A 1JCLA 3PG9A 4QJ1A 3L0KA 3G1SA 3KX6A 3EWBX 3UWUA 4NXSA 3UD6A 3P82A 2V9DA 5L9FA 3GDRA 3W9ZA 1XBVA 2NWRA 2HSAA 1SO3A 3FFSA 2C3ZA 3SGZA 3I7SA 1WV2A 3W7MA 3M5XA 1QOPA 3TMLA 1DOSA 4N9DA 4UMAA 3BLFA 3DHFA 3F1QA 1XKYA 5D05A 2C0AA 4HPXA 1EP3A 1FUYA 1TTJA 5CPLA 3W7RA 3DU0A 4S1FA 4BWLA 1VCFA 1ML1A 1LP6A 3CM4A 3EB2A 1GWJA 2CZFA 1KM5A 1D3HA 4JTIA 3QH2A 1X8FA 5FESA 1KM3A 1ZCOA 2RHGA 4ZQOA 1GYLA 1KFKA 3PF3A 4IXHA 1FWSA 1HUVA 1R2SA 3LTPA 5D04C 4JTFA 4XBSA 1QOQA 1QAPA 3K30A 3LCLA 1AW1A 1FXQA 3ABSA 3IGUA 4XBKA 1OHLA 1K8ZA 3G0XA 4FX6M 3CWOX 2Y7DA 3LLDA 3ABQA 3LRKA 3GDMA 3PY2A 3C56A 4MPQA 4B5NA 3HQ1A 1O5XA 3IVTA 1LYXA 2B7NA 5A8GA 1ICSA 2YW3A 4FNUA 1FXPA 4M5PA 3W74A 1F05A 1AK5A 2VEKA 3TIMA 5LNWA 5FF3A 3NZ1A 4BI7A 1TPB1 1GT8A 2ZZ6A 3N9SA 1OFOA 4K36A 3W1AA 2EF9A 1Q45A 3MMTA 3NQFA 3M5VA 4LC8A 3EWYA 2WOQA 3I7QA 4Y90A 5KZEA 1LBFA 3W86A 5KTLA 1L2UA 4YCPA 1B4EA 2DZWA 2X16A 5F4SA 1SFJA 3GKFA 2E5BA 3VI2A 4N4QA 4RK8A 1FDZA 1YLVA 2VFDA 4LS2A 4ONVA 4JTUA 4JIQA 4AF0B 3CIWA 4QITA 4R34A 4X2RA 3I7RA 4LS1A 4MY1A 1THFD 1MZHA 2NWSA 4A3UA 4PCFA 3STFA 1JCXA 4E2DA 3IIVA 1S5WA 3C61A 3GNDA 3HBLA 3Q94A 1DVJA 2V30A 2A7PA 3KVLA 3DI1A 3HB9A 3BW3A 4PTNA 3UY7A 5LGXA 1OYBA 3L9CA 1LLWA 3NQ7A 4WOQA 3LBCA 4I7WA 1LBMA 3HG3A 4MY9A 2GVLA 3LDVA 3ZFHA 4NNAA 4JS3A 1W5NA 2RDTA 1OX5A 4LV4A 2H3BA 3PWAA 2BLEA 2BZNA 4H4IA 5FF0A 4NUWA 5CPMA 3VKJA 3PC0A 1KFJA 3NQCA 5D2WA 4Q4KA 4NX0A 1EWEA 2RKXA 3IVUA 3W70A 3IIZA 5LNSA 1H7WA 1FWNA 3L0GA 5AC6A 1KFCA 1M5WA 3MO7A 1OX4A 2JKPA 4DBDA 4FX8A 3RU6A 3MYOA 4Y9AA 5G1TA 3HG5A 4N6FA 4HNTA 2WV8A 1KM2A 5K7JA 1JCJA 2WNZA 1GVRA 4K7VA 3NQ2A 1O95A 3HGJA 3JS3A 4JYFA 5HWNA 1IGSA 2ZZ1A 3KVJA 3TSMA 4O50A 4UTTA 3HGOA 2VENA 3E0IA 3LCFA 4GNJA 1I4NA 4A2RA 3LGEA 1A5SA 4JDBA 3O8AA 5G5IA 3UXAA 5DBTA 5AOUA 1S5VA 1U83A 2O7QA 2WQPA 2QCHA 3UWYA 3UWWA 2NXGA 1JQVA 1LM1A 2I9EA 5D2YA 4DBEA 4OHQA 1SSGA 1XDMA 1P4CA 4D2JA 1MEWA 1W3IA 1V5XA 4O1BA 3W7CA 3NXFA 1L9WA 3S5ZA 1K7XA 1X7FA 3GDLA 2ZRWA 3DHDA 4LVGA 2FTPA 3L66A 3HOJA 5J5DA 1T96A 3GVGA 1W56A 1ZHAA 2H8ZA 2QUVA 1H51A 1TMHA 4JEQA 4PODA 3ELFA 2V2HA 3MYPA 2XN1A 3GNNA 4LRTA 3M1ZA
chains in the Genus database with same CATH superfamily
1UR4A 5BWFA 3IV3A 4GWEA 1HKKA 3OBKA 2Z2AA 2PLMA 3H2FA 3QGAC 3R0DA 1KLYA 3CQHA 5CSRA 4LUSB 1S2WA 4LVDA 1YXYA 3VDHA 1OF8A 3AHXA 4BY3A 2EPKX 1LTDA 2Q71A 3BARA 1CLKA 3N2OA 4X63A 5AZ1A 1QW8A 4DJDA 1R46A 5ABTA 2Y8KA 5E93A 1GQLA 5LIYX 4D1JA 2G4JA 4MYXA 1TMLA 4R53A 5HULA 2J8FA 4RDYA 1NFPA 1DHKA 2ZZ2A 4AX6A 2BVYA 4FR1A 2GVYA 4XO7A 2WMKA 1ZJBA 2QGHA 1DJYA 4PBEA 1A49A 3M6DA 2GQAA 3IJ8A 3SADA 4CN4A 3BZGA 1MQPA 1N8WA 1L2QA 2OSYA 3UG4A 2PD5A 4XBJA 2PGEA 5HUOA 1SZGA 4LOCA 3T2OA 4PMOA 3CUGA 1G0CA 1H5VA 2C79A 3LM3A 3W7KA 3AZRA 3DOPA 4HBKA 3VE7A 3W7PA 3H70A 3ZR6A 4HMDA 1E9IA 3GW3A 2D3NA 4GXPA 2R24A 1G7UA 4UTTC 4IMEA 3W6LA 1I2QA 2R94A 3RU8X 4C5ZA 1W5QA 3WQ8A 1CGUA 3MSRA 3KZSA 3STEA 5FI8A 1ZAHA 4UQEA 5CZTA 3DC8A 5JBFA 3YPIA 2HK0A 3FYOA 2ZE0A 4RXGA 1J10A 4I90A 3B0PA 3DGRA 1KM1A 4J9JA 4LAZA 2XSBA 3TAKA 4YU1A 4G7EB 5IBXC 2DGAA 3ITOA 3QSTA 3RN6A 1WUFA 2WW5A 1L6FA 3GC5A 1V77A 3NM3A 2OZ3A 4H2HA 3N14A 3L7RA 2G5WA 1QATA 4ALDA 4Z1AA 1IGWA 1S38A 2FH8A 3REQB 1DYSA 2WJDA 4XKYA 3PB0A 3LU2A 2BHUA 3AU2A 2CZVA 1B9ZA 4HYWA 3A9IA 5D33A 1EBGA 4S38A 4GJ1A 3QGVA 3WEZA 4J5NA 1UP2A 1XM3A 3QV8A 4TX6A 2WC7A 2ZUTA 4NXKA 5FAGA 1P7TA 1B90A 4O8AA 2GGHA 1C7TA 4JD4A 2QJGA 3KRSA 1TTIA 3ZT6A 1TA3B 2X1TA 3RR4A 5JVLA 4HHMA 4CQBA 3UJ2A 1CWYA 3WNOA 2E0PA 5H2ZA 2CERA 1XH1A 4FNTA 5CGQA 2O4MA 1QNOA 3ANVA 5C55A 1OYCA 2JEQA 3MQTA 3ZWSA 2NW0A 2J74A 4LUTB 2J9ZA 1TRDA 4PMNA 4M19A 1KFWA 1ZENA 4HOWA 3WH7A 4F79A 1J93A 1DJIA 2WXDM 5AYYA 3TN3A 1MEIA 3FA3A 4ICMA 5HA7A 1IV8A 5EYWA 4P7LA 4B4FA 3WLNA 5ECVA 1CLXA 1WDPA 1N82A 3ITGA 2NQLA 1UMYA 3EPOA 1V6YA 2J7DA 3PNUA 3VNKA 3MI3A 4ZOAA 1EDGA 4GLEA 2XJ7A 1XIDA 5D9PA 4XAYA 2YB1A 3KRUA 5REQB 5AECA 4M82A 3MP3A 1EZWA 4GI8A 3SCPA 2OJPA 3U4FA 5EL1A 2INFA 1TPVA 1W2PA 1TX0A 3G8RA 2IQ0A 1QPNA 1JCMP 3PPGA 5HMFA 2FLIA 1KA9F 2NLIA 4CU6A 4KCWA 1BWLA 2VKZG 4E6MA 1M41A 4ZQRA 3DEQA 2QLYA 3T4WA 3L2IA 4P8UA 1IIGA 4EXBA 4IT1A 5KEZA 4NP7A 4KWWA 1UWRA 2VNCA 4EX4A 4PUUA 1SO4A 4MWAB 3RM8A 5HNRA 4ZTYA 1CYGA 1FCQA 3WQVA 2IPGA 3B8TA 4NJGA 5FL0A 2G3IA 2JE8A 4LSBA 1U1JA 5FJRA 4DJFD 4PCTA 5DXYA 2VFGA 2FZDA 4ZQCA 4CCEA 1N2VA 4K68A 4WD0A 3CV6A 5LXXA 1E43A 4S3FA 3VNMA 4I9TA 1F73A 1WBHA 1C93A 4LCRA 2XIBA 1S1PA 1R7OA 4JFSA 5AYIA 4GNKB 4PMJA 4Q8TA 1V6WA 3EDFA 3BAJA 1XR2A 1GVFA 3JZEA 1LCOA 1EXPA 2IMRA 3WH9A 2PURA 3WQ6A 4RNHA 4HNLA 2PMQA 1V7AA 3KOZA 3R8HA 3UPMA 2P88A 1OT2A 3NL2A 3CEUA 3UPWA 3O6AA 1DTUA 4UBPC 2Y5EA 3QKZA 4OE7A 2Y7FA 3HIJA 4B5XA 3CAKA 3RHGA 3VYLA 3SRDA 4KWOA 1BGAA 1W1ZA 2YOCA 2OQHA 2C0HA 3UYIA 4KH2A 2PWGA 2ZRYA 1TO3A 4H83A 1MRQA 2AMXA 3O16A 3N6HA 2DW7A 1CW2A 4MZ1A 5LIKX 3WQDA 3VOFA 3WQCA 4JTGA 4F0KA 5HJLA 2XVPA 5HJYA 3L2LA 4Q7NA 4UTFA 1G9HA 1QMLA 1WBJA 4YMZA 1UB3A 4V33A 4N9CA 3SCSA 3DG7A 4H9XA 4JHOA 3A22A 4G7FA 3B0XA 1QW9A 1A4LA 1XYLA 6TAAA 1PB0A 4F2BA 1K7EA 4JZ5A 4WOZA 4JCLA 2DT0A 2NUWA 1F6YA 2E6DA 4M51A 3K1GA 1A5BA 1DWAM 4OGZA 2XVKA 3P0XA 1I1XA 4DAFA 4HSNA 4IIEA 3BAYA 1UUOA 4V15A 1M3UA 3CIXA 1FBAA 4Z08A 3RRAA 1XLBA 1D2KA 1OF6A 1RA5A 3NQEA 4JQ4A 4D6HA 3G1FA 5IDIA 5BYWA 1OFPA 3NR0A 3AUJA 4FSAA 2J9YA 4GE8A 1WDSA 4AHOA 5BXPA 1DTNA 3MP4A 1MI3A 3VDCA 2Z1KA 2NVDA 1JL8A 4NAFB 1K7FA 1JFHA 1OCBA 3DENA 1IT7A 3CB3A 1XLDA 1WNOA 1VIWA 2QCCA 2XFWA 1JAKA 1JXJA 4CKQA 5DLCA 4LF1A 2ZX5A 2DSWA 3VMNA 4MUZA 3B4UA 1HQTA 1PZ3A 1GVEA 4UFMA 4WY0F 4HJFA 3QHMA 3VMPA 4AAJA 5A94A 3TH6A 3WCZA 3LCWA 4HU3A 1HJSA 2E77A 4ACZA 5EY5A 3DFYA 4H6QA 2A3LA 4WXYA 4JNYA 1HL8A 3QY7A 3TTEA 4UR8A 4CD7A 3EB3A 3KLKA 5XIAA 1O7AA 1ZPTA 3DG3A 4JDYA 4HPGA 1CENA 1XI3A 5CZKA 3TROA 2P3ZA 2MNRA 4DHGA 1B3WA 3KCOA 3PPCA 1J11A 1X1NA 4M7TA 4US5A 3M0ZA 4GXMA 4GHRA 4IGSA 4QTGA 4QJ5B 4PMYA 4MNMA 3EEGA 3UZJA 2I14A 2YIHA 2Y2WA 2GQ8A 1E71M 4IZGA 4L9XA 1NU5A 1VBUA 4WDWA 1JUEA 5BZAA 1WKFA 1DXIA 3VIIA 3ZS4A 4W93A 1YEYA 4CD8A 1ZBVA 1EYEA 4TX8A 1DL3A 4GX8A 4KETA 4RV3A 3CZLA 1F76A 3W24A 1KGWA 4ZQMA 3AXHA 4S23A 4YYCA 3E5BA 3FS2A 1TIMA 3H4WA 4INFA 4AF0A 3TNOA 1ZSXA 4S2CA 2YLAA 3T0TA 4H00A 1KO0A 4GCAA 2XN2A 3BLOA 1A5KC 3OBEA 4KIRA 3NCOA 3TSDA 4YNGA 4F0SA 5BRBA 4JNMA 3V0SA 3DI0A 2CHRA 3C0SA 2HVMA 1QU4A 4PE8A 1I60A 4C7DA 2BXVA 3MBFA 1ZUAX 3IVSA 1TJ2A 4L6OA 1UIPA 3W6MA 3OQ8A 3M07A 1RQEA 1AMKA 3LQLA 5I03A 1VBRA 4XVEA 4JX4A 3HF3A 2P8BA 4LJ3A 2ZZ7A 4LNCA 4C6JA 1CI1A 1W1VA 3NQGA 2WWCA 4RUBA 2ZUMA 3ES7A 4XZLX 2CLKA 3R6IA 2G0WA 4C6CA 4CEXC 2KAUC 1JR1A 2ISWA 1HTIA 3WJXA 4XZBA 3LLFA 1EWDA 2YL9A 1EUNA 1IWPA 2YFNA 4PRTA 4NNCA 3SAZA 1E6RA 5HWJA 4H19A 3BLDA 1S2CA 4Q8NA 2G41A 5FF7A 4FMVA 3TYEA 3WY1A 3A5FA 1OFAA 3WK2A 4GYPC 3LXBA 3GW0A 3A21A 2R82A 4C6LA 3G6LA 2POZA 2V82A 2GSHA 4JX5A 3SCRA 3V18A 1Q7MA 5HATA 3WDQA 4B9ZA 1EB3A 2WVTA 2YXGA 3PBWA 4S3BA 5HQMA 3HPXA 5FJOA 7TIMA 3R7MA 5G2WA 1T40A 3VILA 3U8GA 3S1GA 3L5LA 1GQJA 2GJNA 4DPQA 4QJ4B 2WSRA 4HPHA 1P6WA 3KHJA 4Y96A 1UP0A 2CZ5A 3ITTA 1UWIA 1UMLA 5A95A 2PDLA 3B0VC 3WH8A 3WELA 1WAUA 3CPRA 2E09A 1N7KA 3R43A 3FHAA 3B4YA 1J2WA 4RZBA 2RGLA 2FZMA 2R1MA 1RHCA 4N42A 4ZXOA 3WLPA 1GZGA 3AMDA 3ATZA 2WVSA 4L64A 5DCBA 2ZIDA 2Z24A 2HS6A 4XSMA 1IZCA 5E0CA 3RAOA 1TB3A 1LLOA 2HBVA 1ADDA 1BRLB 2O4QA 2Y5SA 5BROA 3TXZA 1Y5XA 3LCXA 4QG6A 3IJ6A 2VUNA 3LZ5A 3PZOA 3KW3A 5FEZA 2OSXA 3PBYA 4NZ5A 4WKHA 4GY7A 1S5MA 1A5MC 3B06A 4MKNA 1FDYA 4ZO8A 1Z44A 3W87A 4YIWA 4WJEA 2RUSA 3PFMA 3ARSA 2P3EA 3IAQA 2CW6A 4XX6A 3T55A 3WJZA 2ZE3A 4EPBC 1W3NA 5C71A 1G01A 1J5TA 1MWOA 5JU6A 4V28A 1G4EA 4ORMA 2ISSA 1KTNA 3ME3A 4JPGA 4A3YA 4D6FA 2DSZA 3ABOA 1JQXA 1EBHA 2J8GA 4HP5A 1QPKA 2XH4A 2BB0A 3MI6A 4KGJA 4IIGA 2VZSA 1QOXA 2P1FA 3KBJA 3CUIA 3XISA 4OU1A 1Z42A 3BG3A 1CXKA 4CLMA 3MB9A 3WN6A 4U4MA 3N4EA 5D8ZA 3EWWA 3ZOAA 2DORA 2X1UA 2QF7A 4J35A 4E3VA 5XINA 1TELA 4F2TA 2OQLA 3IGSA 3SRFA 4UTWC 2B81A 3OVQA 5CZ0A 3BCDA 1NSJA 3ANYA 2PTXA 1AL7A 4HKPA 4AEEA 1L6YA 2FJKA 3PZIA 4U2ZA 1H7RA 4ICCX 4C7FA 3SCUA 3VXGA 1XRFA 1R2RA 1TJ0A 3DC0A 2OYLA 2W92A 2GJLA 4F0RA 2ISVA 4M6PA 2X2GA 1POJA 4LWWA 1RLCL 4RR4A 4GI9A 1IIHA 1UUMA 3L5AA 3G18A 5ECUA 1W3HA 1UBSA 3NJ3A 1W9BM 4EVZA 1FKWA 2QAFA 1EPXA 4QAWA 3JRKA 3BDKA 4BI5A 1XF0A 2QJIA 5EMYA 3LXCA 1QBBA 1W8GA 3R58A 2TMDA 1RLDA 5BOOA 3UZ5A 5HANA 5D4YA 2NT0A 2WMHA 4MNJA 1J0HA 4WR3A 3MVTA 1ECQA 1FWIC 4AZGA 2J7CA 5LA1A 2TPSA 3H2NA 5FSDC 2F6XA 2NV1A 1TE6A 1TV4A 4ZO6A 1B30A 3TWBA 3U4AA 5LKYA 4J28A 2XGBA 3BLIA 3TC3A 1DJXA 1LL6A 1UROA 1XBZA 2PEVA 2VFFA 3BK0A 4KRTA 1EOMA 1S2VA 3CH9A 4H2CA 4L9ZA 4KKXA 4B3KA 4FO4A 3GVVA 3CWNA 3KBVA 2I1OA 1VGAA 1G1YA 2D69A 2QCNA 2O9TA 4H9UA 3STGA 2NUYA 3K5XA 4WXZA 4NI8A 2XIQA 1R6WA 2GQ9A 3DYOA 4C1NA 1AQHA 1OY0A 5EMJA 5AC8A 1V51A 1H2JA 3UR7A 1A47A 4W4QA 1KXTA 2DSKA 4H9TA 1YTDA 2DSUA 3UVIA 2DJXA 3N12A 1G6CA 4G6CA 4DO6A 4NRRA 4UCGA 4IFKA 5CPSA 1PBGA 1KD0A 4LB3A 1KCXA 1OCJA 4ROPA 3IRDA 2IKGA 3UGVA 4QE5A 2SFPA 4X0VA 3VABA 4NHVA 2ZC8A 3DX5A 2PWDA 5I09A 1A50A 3W1PA 5B80A 4L4LA 5DELA 1QFEA 2F7FA 1HO4A 1JRBA 5M3WA 3EDEA 4QLLA 3R8GA 1L8NA 1OK6A 4A8RA 1KBLA 2R6OA 1M7JA 3DIPA 1WAWA 1R9ZA 1E6PA 1XJBA 1UOZA 2Y8UA 5JH1A 3LOTA 2E9LA 5I3FA 2ZA2A 3VX0A 2X8RA 3BG9A 1XLMA 4W89A 3QR1A 1RJQA 2PDXA 5CCZA 1A3XA 1DIDA 2OO6A 3DYPA 1MYRA 4RKAA 3DH7A 2QCEA 2PDHA 4C6OA 3W76A 3N2CA 4JTHA 4WDXA 3MBDA 2CWXA 3F4NA 4IUOA 4PFMA 1CIUA 1ECEA 4QE4A 3B9AA 2I5QA 1M7OA 3SW6A 5EMMA 3SUSA 5AYBA 1C9DA 3QY8A 2CETA 4UNKA 2WNWA 1E3ZA 3JZUA 1H60A 3BG5A 3TYCA 4XKYB 4CQ8A 3W25A 3CNYA 4KT2A 1PDZA 2OWCA 4W86A 1PIGA 4K3ZA 2W5FA 2FFCA 1EDQA 2VZOA 1V79A 3GKAA 2G3NA 1P7TB 3EXTA 4QNEA 2YBUA 3DHUA 4HA1A 5FEXA 3IUDA 1GG0A 3LCHA 4PUKA 3E0VA 4LH8A 4W85A 3V36A 1GHRA 3JR2A 2ACQA 2E67A 5E9AA 5K9DA 4J3VA 1L6WA 2UY5A 4P7OA 4QP0A 1TPEA 4IGHA 5DT5A 3RLGA 1MQQA 3BAIA 3VC6A 4LNYA 3CBWA 2QUUA 4FXSA 1J4EA 3LD5A 1XLLA 1EIBA 4XUYA 2X1SA 4H8NA 3U7BA 4MJMA 4A8NA 3TTOA 3VNJA 3RLVA 3HGSA 1IF2A 3NPXA 1TQJA 2GOKA 4H1ZA 5H6HA 4NT0A 3C0QA 4OJYA 4B91A 2P10A 2UY3A 1Y65A 1XUUA 3M47A 2A3BA 3EMQA 4AUBA 3AZSA 3O2LA 3W22A 4HU8A 2FB3A 4ADUA 3F5KA 4X3ZA 3SB0A 4H3DA 2YCEA 1V7YA 3CHDA 1KWGA 2QCFA 2FZBA 2C19A 5T8GA 3GR4A 2PODA 3OP2A 1KR1A 2P0IA 4C91A 1NOFA 2GZXA 1M04A 3ZR5A 9CGTA 4FXFA 5C54A 1OT1A 3GAYA 3GUWA 4K37A 4ZXLA 1GEHA 4RNIA 5E0FA 2GUBA 1ONRA 5IOBA 2O0TA 5I07A 4XK2A 3SCVA 4I6VA 2QAPA 4XB3A 4ZO7A 5HAOA 1WE5A 1GQKA 4YJ5A 3GXDA 2XGZA 3LX9A 3W7LA 3SGGA 4QIUA 2P53A 3H54A 1YX1A 1JPMA 8CGTA 2J75A 3HTWA 3OHIA 1WB0A 3WK3A 1UWUA 2RDXA 1FTXA 2QPUA 2RFGA 5EPDA 4PB4A 2HTMA 1BSIA 4XO6A 1M65A 3UCQA 1J0JA 1YTKA 1UJPA 1EXBA 2EPMX 2CBIA 4DZAA 3NIYA 3RO6A 3FK4A 6XIMA 4IHCA 1WOAA 2NSOA 1T6MA 5A8PA 3MKKA 3NDZA 3PUGA 5HBFA 2HV5A 2PLCA 3BTNA 2W4XA 2QDDA 2WMFA 4BFAA 1IXNA 2W63A 1HZYA 3G3DA 2ZRVA 1Q6CA 4CQDA 3BOLA 4JX6A 1RAKA 2DU2A 1UWTA 1OFEA 1OFDA 3S4TA 4W7WA 3LG3A 4WHBA 3TSBA 3H22A 3O0KA 4NNBA 3N9KA 3A3WA 1OG0A 4YTQA 4IPPA 3F7JA 5IDZA 2CLHA 4C6BA 3MV11 3THAA 2GUUA 3W29A 3LN3A 1RA0A 3TLLA 2GYIA 3HZ3A 3P61A 1UPMB 2HPIA 3KL0A 2CLEA 1XRSA 1D3CA 1DIKA 3E6EA 3N3MA 2I7GA 2CPUA 2Z26A 4WZHA 3CL7A 2VD9A 5CC7A 4J7RA 4AZIA 1TPFA 4C7GA 1Q85A 3EX6A 1GYNA 3N29A 2Q6ZA 2VFHA 3W02A 1TCDA 3MKCA 4HNOA 1T8QA 5AYXA 4EPEC 3DKLA 3GSMA 2Z4GA 3NDYA 3BGJA 4BQ2A 2AAAA 1F6PA 4OTKA 1JRCA 3W84A 3GIQA 4BF9A 3IARA 3GTFA 2P76A 3EOLA 4FXRA 1WX0A 5M5DA 1SGJA 4GH1A 4HVXA 3VX1A 3LHYA 3VIFA 2J79A 4FOJA 1ITQA 4JTJA 5FF4A 4Q8QA 4TUFA 2ZRZA 4PTWA 4AHQA 4QBXA 1SJCA 4ML4A 1B2YA 4WKFA 2VEIA 3TE9A 1OZQA 4CCDA 2Y85A 1JCLA 4QJ1A 4QEHA 3TOYA 3KX6A 3A47A 3WLHA 3EDKA 1JF6A 1W1PA 4QSFA 1IHIA 3N13A 1GPFA 1UPPA 2JF6A 3FDGA 3GHUA 3RIKA 3M5XA 3RCYA 1BVNP 4M3PA 4FZIA 1DOSA 4J40A 1BXNA 3K8LA 4MB1A 2R1NA 5D05A 1FUYA 3LGGA 4DZ5A 2QNEA 1DWHM 3W7RA 3DU0A 1O1ZA 4BWLA 4ERIA 5CGMA 1W9DM 2IQDA 5ABFA 3TOPA 3EB2A 1J5SA 1GWJA 3MSGA 1VBGA 1KM5A 3AU6A 1D3HA 3EWDA 3NYDA 4PUMA 1VEOA 2VR4A 4DM1A 4MG4A 4ACZB 4ZENA 4M6UA 1P6CA 2DH2A 4XV0A 2RHGA 2QJJA 1KFKA 3E2SA 5FJUA 1HUVA 3V1HA 3GXFA 4GQQA 1TMQA 1R2SA 3KS6A 2PUZA 1WO2A 1SR0A 4JTFA 2C1IA 3BLLA 1JZ8A 4V27A 2F9RA 3SQLA 3EGJA 4IPLA 4H01A 2CKSA 4IFOA 1Q2RA 2YKKA 3WNLA 3MZNA 3G0XA 3C86A 1VFFA 1DPMA 3GDMA 3C56A 3HQ1A 4M5PA 3OBAA 3W74A 1C7SA 3II1A 1VJSA 1GT8A 2CNCA 2ZZ6A 1OFOA 2E7FA 3MMTA 3NQFA 4S3AA 1UUQA 4F8XA 3OYZA 2WOQA 4NI3A 4HCLA 4Y90A 4L61A 4B92A 5KTLA 1M1BA 4S39A 1Q6GA 2Y0FA 2VFDA 4KWUA 3MCNA 4DZHA 3QBUA 4GA8A 3ARWA 4AF0B 3P2VA 3CIWA 4UNIA 1R3QA 3I7RA 4OVXA 4MY1A 1THFD 3K46A 2JEPA 4KCVA 4PCFA 1FVPA 4WLCA 1HJXA 4E2DA 4ENLA 4PMZA 4S3JA 1B0IA 3UJEA 3BSMA 7REQB 5LGXA 4R9OA 1OYBA 3NQ7A 4I7WA 4QG9A 2PGRA 2IPWA 3MANA 4Q4OA 5DQPA 1T41A 2FGBA 1EQCA 1UZHA 4LV4A 5FD0A 1G94A 2BLEA 3FW6A 3GU2A 1P0EA 5CPMA 3VKJA 3PC0A 3ABZA 3NQCA 5DRCA 2WB5A 2RKXA 3NURA 1IT8A 4J4KA 3OVGA 3EPMA 4XKMA 3L0GA 3MO7A 3PK7A 1ITXA 5G1TA 4G9PA 4BF7A 3Q67A 4PCNA 2GQ3A 4E8GA 5K7JA 3GG8A 3HGJA 3AUOA 1QHZA 3L4YA 3TSMA 4UTTA 3WEOA 4QLJA 3LCFA 3W0KA 1ZS2A 1BFNA 3BURA 3UG8A 4GY1A 4UZUA 4ERGA 4LYPA 4MDOA 4RW5A 3O8AA 5G5IA 3UXAA 2XH2A 4TVCA 1UD4A 5DBTA 5AOUA 1S5VA 3UWYA 4XZMX 1JQVA 3NGFA 4OHQA 1XDMA 5CAKA 4D2JA 1MEWA 1W3IA 1XICA 4O1BA 3NXFA 3S5ZA 4NKCA 2GL5A 1BQGA 1BGGA 3B40A 3DHDA 1JF5A 3L4XA 1RY8A 4LVGA 3VCNA 1T96A 3JW7A 3GWQA 1W56A 1ZHAA 3IPWA 1M01A 3QR3A 4LUYA 1TMHA 4JEQA 4LYQA 1US3A 3WD1A 4PODA 3MYPA 4GCXA 1XLFA 5A2AA 5H91A 2D2JA 2VC9A 4EIVA 1J0YA 3BMXA 2PB1A 2VFIA 2Y62A 4R88A 4ZOCA 1IEXA 4GZIA 4HMNA 4JN8A 4YS1A 3KOYA 3NM1A 2QJNA 2DP3A 3LERA 2JQXA 1KBBA 5E1QA 1HL9A 1DHPA 2YBTA 3G0SA 3LRLA 4Q3MA 2DEPA 3UWQA 3OZMA 2HCVA 4GFSA 1G4TA 3ARUA 4BQ3A 1PXGA 3ARTA 1ISXA 5CPOA 3IJQA 4QISA 3R0UA 4GIAA 4AY7A 2CXEA 3OW1A 5M2FX 1UKSA 2XUCA 2V5BA 1JZ3A 4AZBA 3C3NA 4PTDA 1MNSA 4I7VA 3DERA 2Y89A 4CEUC 1MZRA 2EEXA 5CEWA 1B4KA 2RH9A 1BF6A 3V3WA 1T7LA 5D37A 3SSJA 2PDCA 1L0PA 5CBBA 2D2OA 4XG1A 3M5YA 3OLGA 4HK6A 1JCNA 3C2OA 5IFTA 4IIDA 2FYMA 4W8BA 2E25A 1QRQA 2A3AA 2J9XA 4MSSA 2UBPC 3FYPA 1VFHA 1UOKA 5I06A 4K1WA 1AA1B 4IGMA 4MWAC 2HNHA 4HSHA 1KCZA 2JIWA 3B97A 2FPTA 1LWHA 3S9IA 4QEEA 4UTHA 3FJLA 1FWTA 3COTA 2GDVA 5GJNA 2J62A 4DWSB 3VMOA 4AYGA 1KNWA 1QNVA 2WVVB 1V3MA 2ZX9A 4LC6A 4AD5A 4I8YA 1AMYA 1JZ2A 2ZXQA 4L1WA 3VIGA 3MSYA 2ALRA 5DMNA 1JULA 1EJUC 1XIEA 1LOQA 4GK8A 1ELSA 2WSKA 1PKMA 3H12A 1RBLA 1RP8A 1QWGA 3C2FA 1OFBA 3AHTA 3FJ6A 1UD6A 5BXTA 1DJNA 3GS6A 3TK7A 4NZFA 3E2QA 3C3UA 4HN4A 1HKWA 4B2DD 4WY0A 1QNPA 1J18A 3TA9A 2ZX8A 5AHLA 2BOGX 1D3GA 5TD4A 1W17A 5TQLA 2CYGA 1XLGA 4O54A 1BPLB 1VHCA 3BJFA 4QR6A 3SCNA 1OBAA 2A7NA 4O11A 5A6KA 4R7WA 2EAWA 4CN6A 1GKQA 2WPGA 3VCCA 2Y6ZA 4ZE5A 4AB4A 4H7CA 4L65A 2PFHA 3TJXA 3B8WA 1OX6A 2W79A 4K1GA 1V4YA 2JGQA 3I3BA 5D32A 3N6QA 3SZ8A 4Y8EA 4K8HA 3SI9A 4U2YA 1TV2A 3MKVA 1EEPA 1SU5A 1JPKA 4FOUA 3WBYA 3PAJA 4IMAA 1EP2A 3I6RA 1N8FA 1XXXA 3LTSA 1HN1A 1F2JA 2DUZA 2O92A 3VZZA 1XSIA 4IPJA 5G4EA 4NIRA 5TF0A 2BASA 1VPQA 4EE9A 2XM1A 2J24A 1NAL1 4Z17A 3NG3A 3W2KA 5DCEA 3U6WA 4LX4A 4IFKB 4YVPA 2QXWA 1XLHA 1X6NA 3H2MA 2XWEA 3WLMA 5K3VA 3WQFA 3NTYA 2OLHA 5DFAA 1EKOA 4FPSA 2C1GA 4POCA 3PZQA 4Q32A 1F07A 3W88A 3W1MA 4LS0A 1PO9A 3LZ3A 4GIYA 1UH3A 4YVVA 3NPVA 1E72M 5RUBA 4PUEA 5KMYA 3N04A 2VP8A 4G56A 1XGZA 5AHNA 3JU2A 5SWUA 5CJ5A 1J6OA 1UD8A 4B3ZA 1XYMA 1A5OC 2FJUB 3AAMA 1BYBA 3OLDA 2VDGA 3NOEA 4O19A 1LRQA 3TJLA 3NEVA 3F4WA 2AKZA 1NOUA 2YFOA 2QJMA 1UP3A 2J6VA 4K6AA 2OZTA 4N7QA 3S5OA 3FN9A 1GQIA 5T9CE 5CPNA 1N8IA 2E5CA 4S3EA 4J3ZA 3L2MA 3BW2A 2Z7GA 4YXGA 4IH3A 1UZ4A 2XVLA 4AEOA 5CQ1A 3O15A 3R25A 2B7PA 3KBMA 3FEMA 2Q3RA 4UFJA 1E4LA 3KBWA 5A8MA 3SEPA 3SY8A 3R1ZA 4HN8A 4JTSA 3TQVA 1GTEA 2NZLA 4DJEC 1GVSA 3CHEA 4M6QA 4KERA 1F9CA 1T8XA 3HPSA 5IHRA 4DIAA 3BCFA 2W62A 2YBVA 3KVMA 3HN3A 2HS8A 4Q4MA 4E0CA 1RSCA 2BY2A 4LALA 3OQEA 3QLLA 4DUVA 1UH4A 1NY1A 4CNPA 3DFPA 1PKNA 2PDKA 5I3JA 4GUJA 2OWXA 1TE1A 8A3HA 3VZXA 3QFEA 3LCGA 2YCIX 5F7UA 4L56A 4MPKA 2OFJA 4Q8UA 3W7NA 2NX9A 4DX3A 5CLWA 1A3HA 3UP8A 1XBXA 3D46A 3PR2A 1UWSA 2E9BA 2QDGA 3OZOA 2ATMA 3RO8A 2EQDA 4FAMA 1JI1A 4NF7A 3MMUA 2VHLA 4Q8MA 5DT7A 3KOFA 4NZJA 1PZ2A 3CHVA 2QVHA 5CSSA 1NFBA 4NJIA 1FDJA 3WF4A 1NFGA 2OCZA 4JHMA 1V02E 3CV2A 4Q8PA 3MC5A 2J7FA 4LBUA 5IM51 3BGGA 5HMSA 1OZMA 2EO7A 2WVUA 2WYSA 4GUIA 1JPDX 3AMGA 2WCSA 4CNOA 1DJQA 4LBSA 3GE7A 4LYRA 2W66A 1ZL1A 2JFEX 2YDRA 2V2DA 3AFBA 1KXHA 1SZNA 3MHGA 3MUCA 3C6CA 1BYAA 4GNVA 3N73A 1WKEA 3K4DA 2OU4A 4JTDA 2X1RA 5K9CA 5I6SA 2V3EA 1X1ZA 2P0OA 2V5KA 1WKYA 1GOXA 4FOKA 3RX4A 2GJRA 2V6AA 1VBJA 3W28A 4AD3A 2GVEA 3RPTA 2PI6A 3W1QA 1IEIA 8XIAA 2DQXA 3QF0A 4I9AA 1ZGDA 1DE6A 3GXMA 1SFLA 3TA6A 6REQA 2J4GA 3WG6A 4CQ9A 4KRUA 4RDVA 3GY1A 1MNZA 1O60A 2VC7A 4PR4A 1R87A 1IWBA 4HGXA 1EYWA 4LVFA 3URBA 1X98A 1NQKA 3I6TA 2AOSA 4NJHA 2Z6JA 3E0FA 3UJSA 4Y9MA 1PS9A 3B9DA 1SW3A 1GKPA 2CLOA 4HB7A 3BANA 2NVAA 1FWRA 3CLMA 4KFPA 1O5KA 1XIIA 1OGSA 4UTIA 1C8QA 1PIIA 3VOHA 5GNXA 1L8PA 3UCCA 3RLUA 1YBQA 2F6KA 1S5NA 5G1YA 3PS7A 1EJTC 3FJNA 3OEXA 3M0HA 3AROA 5CZJA 4ZVJA 1BVWA 3CUFA 1O5QA 4ECLA 1KLZA 1V0LA 1OABA 1F3XA 3V5FA 4E2BA 1NDZA 5CG0A 3UU0A 2PDGA 3IJIA 2V68A 1RUSA 2Y7EA 4KCTA 1A5UA 1YDNA 2A85A 1GVOA 5JBDA 2A5HA 1TJPA 1T5AA 3SBFA 3S6DA 4YYFA 3M7SA 5FJIA 3ZT7A 2YGYA 4DF1A 1MDLA 2QCMA 5BW6A 3S9ZA 4L4OA 1AW5A 4DELA 1S2AA 2YW4A 1YDVA 1K3UA 4GC3A 3EWCA 3URAA 3D3AA 4PCPA 3CT2A 2CZDA 1FHLA 4PEKA 3HPZA 2WQDA 2VZUA 3H26A 1XW8A 1NP2A 4TMBA 1CGWA 3CAVA 1HVXA 1PHWA 3AYRA 1W2VA 3ZJ8A 3VOJA 3IGHX 3QFWA 1IXQA 3ERPA 4GZ7A 2VC5A 1V3HA 2HJPA 1BG9A 2DVTA 1XQLA 1R3TA 2BP1A 3VDBA 4E5TA 3UERA 5C9WA 5MKGA 1E0XA 3DHPA 3GBDA 4ZA0A 2J6XA 1SJAA 4FF7A 2QUNA 1P0DA 1GOMA 3L67A 2WZIA 4Q6XA 3E96A 5HQEA 5D30A 3OVPA 3ZR4A 4ZB2A 3IJ9A 4UCFA 4UR9A 1KFEA 1POKA 5ABFB 4GACA 1TTQA 1QI2A 2ZA3A 8TIMA 4A29A 1C90A 1ZQ5A 2GGGA 1QW7A 3TX9A 1RCQA 1HJVA 2WC4A 4UTWA 5JXQA 1FWAC 3SN4A 4A35A 5HR7A 3QMTA 2A1YA 2VM8A 4XD6A 4XVDA 3WBAA 3O07A 1Z48A 3FAXA 4GUFA 2FHBA 1Z9AA 3F4CA 4UNLA 3WFZA 4AWEA 1K1DA 2EPNA 5A6LA 2YYUA 4QSHA 5U7SA 1GOQA 3UZWA 1E6QM 3W7JA 4O1CA 1ONEA 4RNJA 1P0NA 1B5TA 2WKGA 5I3KA 1SPQA 1TRIA 4O16A 4WGXA 5G2IA 3W26A 4Y7EA 4Z1DA 3BVJA 5EU9A 4AH7A 1XFCA 4PH6A 1EL3A 1F7BA 5E6ZA 1BTMA 4N4PA 2EPOA 3TJIA 3BLKA 4YPJA 2WMJA 2V81A 4MADA 1W3JA 5DRIA 1FX6A 5HUPA 4K7YA 4YCOA 1TSIA 2HRWA 2VI0A 1QPOA 3EXSA 1L6SA 2DUAA 3I4EA 3MO4A 2HQAA 3CZJA 3V1PA 3QOKA 1IQ8A 4OECA 5FJTA 3EOOA 4PMUA 1V8EA 2C7FA 3L5MA 4RX0A 1BAGA 1XRVA 3P5ZA 3BZJA 1W0MA 4GQRA 4HT3A 1DIEA 1ME8A 1PE1A 1KBKA 1JCTA 1W5PA 2X0SA 1AW2A 1TKKA 2YCKX 1E56A 4AW7A 3S2MA 2DZUA 4Q7BA 2ZA1A 3DAQA 1DXEA 2NXHA 4GGHA 1PVNA 3AIWA 3CMFA 2YR1A 4S3GA 3GXPA 2QCGA 4GBUA 5CJNA 2WNQA 1JDDA 2FDMA 1FCVA 1HGWA 1XUZA 2OEKA 3WQWA 1IXPA 1W32A 2A6LA 4G2DA 1KM6A 1V0KA 4AZ6A 1XFBA 4MFDA 3H7VA 3TTSA 5LGZA 4O0ZA 3O9NA 3EYPA 4FNPA 3UYCA 3W7QA 5HR6A 1LUCA 3ZMRA 1GORA 5EMUA 3QC0A 3UGRA 3B9NA 2NV9A 5D9NA 3AIRA 1FCBA 4H7ZA 5D2VA 1DJZA 5LA2A 2BHYA 3HJZA 3TJ4A 4YTUA 4ZQPA 1I9CB 4CQCA 1PZ0A 2ZRXA 4GI6A 1C9WA 1B3ZA 2PDNA 3IS4A 2V3FA 3P0WA 4DRSA 2NUXA 1IT0A 4L80A 1U5HA 4FX7A 5HNTA 1SMAA 3E49A 3XINA 3CZKA 1Z89A 3M64A 2ESCA 1WZMA 2PWUA 3P81A 1RH9A 2FQIA 5A6BA 1QASA 3WBWA 4W5UA 2A3HA 1QT1A 3CT7A 3T1GA 4V2XA 1TTPA 2D3LA 3V0UA 2YDAA 4DN1A 3GDBA 4JIHA 1C29A 4PB3A 4MJZA 1NQ6A 2X40A 1UBPC 1XD0A 4OOZA 1XP3A 4YTSA 3RITA 1ZJAA 4G1KA 4HOXA 1R5YA 3GFZA 3TN6A 2A6NA 2ZCGA 3BMVA 1KR0A 4WSHA 1XLJA 3THQA 1VFOA 3VFLA 1RK6A 2PDMA 6CGTA 1YE4A 5B7ZA 3K4AA 3ZIZA 3GTNA 1J01A 5LYRA 4AVNA 4ADTA 2PA6A 1EA0A 3WDJA 1V0NA 3SJ3A 4PN2A 4JOMA 3GK0A 1YKWA 3H7UA 3R12A 1CTNA 3R13A 3VK5A 1VS1A 4N6EA 4U3CA 4HOZA 2XZ7A 3L68A 3T42A 2ZYFA 4HHHA 1V6UA 3SIMA 1H1YA 1A0CA 1K9DA 2AAMA 1BWVA 1LQ0A 3WL1A 1KXQA 4M56A 4ZL1A 3AHZA 2VCCA 1B3OA 2BDQA 4FHAA 5C6MA 2YYTA 5LIWX 5KSWA 3NZRA 2X7WA 3P74A 3AYTA 3AJXA 3ZJ7A 4AXNA 4EOUA 2WAGA 3B9OA 1YXDA 3S2LA 2DZBA 1XCFA 4EWND 9XIAA 3CUZA 4DI9A 2FIQA 3PZGA 3R5EA 3WJYA 2Y63A 4AEFA 3PZTA 3QEZA 4KEUA 1WYIA 3CQ0A 1E0TA 1W31A 2E1DA 2A0NA 2VL4A 2YXOA 1SSDA 2BVDA 3UWZA 2CXGA 1BVZA 3B0UX 5DY3A 5A2CA 4D71A 3LCIA 4FIRA 4Y9PA 4JYEA 3H2AA 3KLLA 3TLQA 2B7QA 3CH0A 3D3FA 5D03A 3NO5A 3POCA 1FQ0A 3M0LA 4Q8WA 4TIMA 3GD6A 1RPKA 1VPYA 3MA8A 2ANUA 2VFEA 3QZEA 3PTDA 1CT5A 1GJWA 2YJQA 1IEWA 4R5EA 4OBSA 3APYA 5AY7A 4OQVA 3ICJA 1AL8A 1TREA 2PBOA 6A3HA 1TWIA 3LA4A 1SR9A 1E9ZB 4DM2A 4WY0B 2BVTA 4GZEA 3FNDA 4LY8A 1W1TA 1XLCA 3C52A 4X22A 5PTDA 3UY8A 2HWGA 3C2YA 4F4RA 3F5LA 4DY1A 1GJPA 3KRZA 2BOFX 4O28A 3L4WA 2QMKA 4LVAA 4U5KA 4MWAD 1Q3NA 2QV4A 4IMGA 2UV8G 3CLWA 2BHZA 2FH6A 3ABRA 1RALA 2UWFA 3C4UA 2EGZA 2F38A 3LQGA 1PAMA 1ZBCA 1T99A 3GR8A 3LPOA 2J78A 2XU2A 3K4WA 4GYKA 4IF2A 5K2ZA 3TQ0A 3M9YA 1LF1A 2Z2BA 1I45A 4HPJA 2GSEA 2V0TA 2A7RA 1MW2A 3GH5A 1XLAA 3H2EA 3T44A 4F9DA 1F8IA 3A5VA 2Q09A 2WM1A 4JY9A 3OHMB 7ODCA 3VD4A 2DV0A 3ONBA 1UR1A 2PTZA 2B4GA 3TYUA 2VT0A 3APGA 1TCMA 3GHTA 4Q4QA 2JBMA 3G1HA 2Q3OA 3N19B 1DXFA 3KTCA 3V7PA 2WC3A 5I24A 2VZVA 4WJXA 2GK1A 3VKCA 4EF9A 1D7KA 1FWWA 5F4XA 2XGIA 4AQLA 5A6MA 4KWSA 2YCJA 2YCLA 3S8HA 4M7SA 1SO5A 4GJIA 3KP1A 3PJWA 1CPUA 4UFHA 1J9YA 4Q4PA 1XIJA 3RPDA 2RGMA 3LUTA 1GVYA 2ZZ3A 1I1WA 1UR2A 2BTMA 3IEBA 1X39A 2VRKA 4B4HA 3W75A 3V16A 1UKQA 3ZXWA 1PCKA 1B57A 3VNLA 1XX1A 2DZVA 4MWAE 1OEPA 3NO1A 2IKIA 4NX5A 2E6YA 1QR7A 3AS3A 3SUWA 2GJPA 4W88A 3CUXA 3T40A 4B5VA 1GUVA 3TONA 3HFYA 3TYAA 1EQPA 3H23A 1XS2A 3AQUA 3CV1A 4JN7A 4S3CA 1PX8A 1EJWC 3LS9A 2V3DA 4Y6GA 4YL2A 1S5TA 1RVGA 3LMZA 2AGKA 4ZO9A 3E02A 1GVIA 1PDYA 3R2GA 3SUTA 2WZTA 3ANUA 4HNUA 1VCGA 1QPRA 4LYKA 1FY6A 1ZRQA 1ALDA 1OC6A 4IIHA 1M7PA 4H9YA 1UR3M 3INPA 3LHZA 1BQCA 1Q5MA 1GK8A 4RZ5A 3PBMA 2I16A 3SY1A 4H7VA 1W3LA 4BK9A 4L6DA 3W1NA 3WMSA 3IUIA 1EH9A 2W91A 1A80A 2YDSA 3W2LA 5T26A 1MFUA 2TSYA 4QDMA 4LPCA 4MYAA 1XHGA 4LU0A 1W3TA 3LI0A 2Z1SA 4XTIA 2DH3A 1REQA 2ZXDA 4QAIA 2Z29A 1CGYA 2QF8A 4AZHA 3EOEA 3N4AA 2HXTA 4FS9A 2OGYA 2NXIA 3GVWA 4ZB5A 4EANA 1YE6A 2VWSA 3CO8A 1I2PA 2H8XA 5FKYA 3TW7A 3FKRA 2CITA 3VCRA 2H90A 3AIEA 4MKVA 3N2TA 4EACA 4ATWA 4DJED 2WHMA 4AYSA 2PDFA 2QGYA 4MLJA 2VR5A 4WJ8A 1X6UA 5A2BA 1DQXA 4PTVA 3RM9A 3EX2A 3I65A 3PPFA 4JICA 3T0AA 1ISWA 3TDFA 3E5PA 3MUIA 4W9TA 4K8GA 2ZKMX 4DF2A 4URIA 1KM4A 4GRSA 1YPIA 3GIYA 3K8KA 3BLPX 2OT1A 2WSYA 4KFNA 3QZAA 2J7GA 3R89A 1Q7ZA 5M17A 5FIPA 4O57A 1QTWA 3ZJKA 2Y7GA 1AJ0A 1XBYA 4UTKA 4IP7A 1H5YA 4WF7A 4CQAA 4AIOA 3G1YA 2J66A 4TVDA 4JQAA 4DBWA 1W9PA 5L6UA 1QO5A 4GIRA 6REQB 1B1YA 2IUZA 3KHDA 3AI0A 3UWUA 5CJMA 4F0MA 2NWRA 2HSAA 4AIUA 1VFMA 1XLEA 4PEEA 3TMLA 2G3MA 2PS2A 4DYJA 3F1QA 2C0AA 4HPXA 1EP3A 5CPLA 1RCXB 1VCFA 2IPFA 1LL7A 2A79A 5BRQA 1KCLA 3KOWA 4M0XA 2CZFA 4ZODA 1ONWA 3ZVIA 3FY1A 4I6KA 4P8WA 4P8XA 1KM3A 2VQUA 2OOGA 1SVDA 4CNTA 3PF3A 1FWSA 2E3ZA 3NZGA 2HZGA 4HZ7A 4GGBA 3LTPA 5D04C 1JI2A 1ODZA 1QOQA 2PWFA 1QAPA 1AW1A 3I3DA 3MWCA 3ARPA 1K8ZA 2Y7DA 3CWHA 1F3EA 2V5JA 3PY2A 4MPQA 4GH3A 1O5XA 3EOSA 1ICSA 2YW3A 3CASA 5BU9A 1F05A 1IZJA 2VEKA 3TIMA 3RX3A 5FF3A 2MANA 3QN3A 1TPB1 3NZQA 2CESA 1TA3A 4K36A 2VUYA 2EF9A 3NSNA 4WKAA 5I3DA 4LC8A 3GH4A 4R9XA 1HKVA 1TG7A 1L2UA 4YCPA 3WX7A 4CD6A 5F4SA 4V1XA 4Q8VA 2PU1A 1TZ7A 4RK8A 1FDZA 3CK5A 1YLVA 1ZBWA 4LUTA 4JTUA 2IPJA 4JIQA 1E5JA 2YB4A 4QITA 4X2RA 2AL2A 3VIOA 5BXRA 2NWSA 3AMKA 3STFA 4IQDA 2QS8A 1EJRC 3GVRA 1DVJA 1OD0A 5C9ZA 3WZ0E 1J2BA 4BS0A 1F4AA 3UY7A 1E6ZA 3S2NA 1UQYA 3HG3A 4Q22A 2DIJA 4HPNA 3ITVA 4XAPA 1DIOA 4IL0A 3ZO9A 4KW2A 2H3BA 3WF1A 5MKGB 4EPDC 1Q66A 1KFJA 2DDXA 4IP4A 3EA1A 2VDHA 2J7BA 5D2WA 4Q4KA 3MDUA 4EAMA 3VZYA 4LAKA 4DWSC 3L4ZA 5AC6A 1KFCA 1M5WA 5HXMA 5A6SA 1KC7A 2JKPA 2YL5A 4FX8A 4DBDA 1KGUA 3H4GA 3CYJA 4KEZA 4QCEA 3R4IA 4H8HA 4PYSA 4HNTA 2WV8A 2YL6A 3W00A 1KM2A 4J3WA 1V6XA 1EJVC 2E8YA 3JS3A 3CS2A 3OOQA 5HWNA 2Y8VA 3UG3A 5LIUX 1ITUA 2QZRA 3DESA 2VENA 3UFYA 3GFYA 1MDRA 4MWAA 3BOXA 1I4NA 3LGEA 4GVHA 5BWAA 4JDBA 3AZTA 1SFTA 1E0WA 1U83A 1V93A 2XIJA 2Z7KA 2NXGA 2I9EA 4DBEA 5JUVA 1P4CA 3WUFA 3A3XA 3WLKX 1V5XA 2WCAA 4H8UA 2X05A 4JFWA 3CUJA 1XPGA 4NASA 1EGVA 1HVQA 2QUVA 2OOFA 2EG8A 2HBXA 1M68A 2XN1A 4LRTA 3M1ZA 3DFOA 4E3TA 4FLQA 1H1NA 4GISA 3DYMA 2OX1A 1DEDA 2YL8A 4EAYA 2PD9A 5FAJA 1X96A 4IICA 4YHEA 2GGIA 5I7GA 4U5IA 4Y8FA 2WMIB 5C9XA 4ADSA 1W1YA 1CXFA 3RMEA 2C14A 1SO6A 4E38A 4O53A 3TZFA 3MTWA 4JHZA 3KZPA 3O3RA 1ISZA 4KFOA 4WGHA 5HOSA 1AQ0A 1W5OA 3NXLA 4IXXA 1JZ5A 1NARA 1Q8JA 4LY4A 5EMKA 1CB7B 4GYJA 4C65A 1ME7A 3STPA 3W3OA 5CXPA 1OYAA 3MV01 4IG2A 1A4MA 1UR9A 1K9FA 3UW6A 2DT1A 5GQBA 4PUNA 2A21A 4PZVA 3S5YA 2FTWA 3DUGA 4WVXA 3WDHA 4IQLA 3T2PA 2GVJA 1VFTA 3E74A 3T0BA 3LHUA 3F2CA 5C8BB 4MJ4A 4PUWA 3SFKA 4DXVA 2DW6A 5LNRA 1UD5A 3KEHA 2ASHA 1LUCB 3ES8A 3T6CA 3W07A 1S2TA 3AWOA 2WBGA 3JVAA 2L5HA 4TMCA 3T4CA 3TEVA 3S0CA 4GC4A 5C9RA 2OLSA 4WDTA 1EC8A 3UQNA 2GUYA 4DYKA 4RZ6A 4AD1A 1JYXA 1XIGA 2F6UA 3BAWA 3DDMA 1XSJA 1Q2SA 3WD0A 5C5YA 1NEYA 3SSZA 3CQIA 1WA3A 5I77A 2Y70A 3T9PA 4OV4A 5D02A 2C91A 3AHYA 1LROA 2IKHA 2DZTA 4F3HA 3BQ6A 2R14A 2Z1BA 3E0LA 1MMFA 1UD3A 4AHPA 2BX7A 2PDIA 1S3HA 1NWTA 3USBA 3S46A 4QCFA 3UNTA 4Z0JA 3WQPA 4KF1A 1HW6A 3G22A 3VD5A 3H53A 2BBFA 4HZ8A 2DT3A 2WHLA 3LNPA 1GPWA 1EEXA 3WENA 1CXHA 3PAOA 2CLMA 4HHPA 1W37A 1DJWA 2IXVA 4JIPA 4IQJA 4ZTXA 4FNQA 1XIFA 2ZTKA 2GOUA 3RK8A 1O66A 1XIBA 4AVOA 3RJXA 4HNNA 3GFXA 4Q4SA 5KINA 1CEOA 4IMCA 3WUBA 4MFEA 4CNSA 5KZMA 1VR6A 4NG3A 1GGOA 1QNSA 2QKFA 2C1HA 3BXWA 4RL3A 1YQ2A 3SJNA 1IEVA 2HE8A 4RZ4A 1Q6OA 3B3DA 4GABA 4CNUA 3AXMA 2ATSA 2O9PA 1XWYA 2BV9A 5EFFA 3W81A 2TODA 4PMVA 3EWXA 3H6OA 4UOJA 3GNRA 4IPNB 2Q8XA 1LDCA 1MSSA 3W2MA 1R2TA 3W83A 2NLYA 3LENA 1I2RA 2EKGA 1SUXA 3IIPA 3SUVA 3OPSA 3WLTA 3TMQA 5LNVA 1FA2A 3KTSA 3FDKA 1EFZA 2W61A 1CGXA 4MZ8A 2R1KA 3EA3A 4NJKA 2CWNA 4PFHA 4RW3A 3THUA 2G3JA 1FHDA 3LPGA 1F5ZA 1V6VA 1FFRA 1FWJC 2R9RA 3SCWA 1EPVA 1QI3A 1Y5VA 1YDOA 2REQA 2CLFA 4JKKA 1M53A 1EJSC 4UC5A 3TCEA 3EKLA 2ZC1A 1U5JA 1K03A 1UR0A 5CZSA 4D9PA 1UC4A 1FWEC 2WCGA 4HA0A 4HZ6A 3QSRA 2RDWA 3P5YA 4UTMA 3KE0A 3ECQA 1I0BA 2XSAA 4PMXA 2ZQ0A 5CC6A 3ABXA 3N2XA 4PA8A 1PTGA 1SQ7A 2YPIA 3W1XA 4X0NA 1VZWA 3VKDA 2Y24A 2IQTA 4O0KA 3LRMA 4Z0SA 2FGZA 4PUDA 3S47A 3W38A 4V1YA 2G97A 3ZVHA 1JJKA 4DJFA 1QBAA 3LPFA 2VCBA 5DANA 2GPTA 2QV5A 3MWAA 2HK1A 3QC3A 2ZUSA 4KWVA 3SY5A 5EBUA 4FNRA 4X9YA 3HMCA 3MP5A 2A4AA 2VVSA 3UPBA 4D1IA 1CB2A 1TJRA 1YTEA 2DZPA 3M0XA 1YNQA 2ZRUA 1JPHA 1M7XA 1I0DA 1XH2A 3GDTA 4LT9A 1KTBA 2BS9A 3CJPA 3RF9A 3MCMA 2PTDA 1A0EA 1E1EA 4JTLA 1E40A 3SRHA 2DVUA 2WZEA 4HD5A 2R1PA 1VLIA 4JTAA 3K2GA 4O0QA 3I10A 2H3DA 3EAUA 3R94A 1DQWA 4MTVA 4WK9A 1CZ1A 3USZA 4I5RA 1JUKA 4R27A 1LT8A 4ICNA 3B8DA 4UFLA 4XZ9A 4KCUA 2ZXAA 3NWRA 4LUJA 4NAEB 4GBDA 4QX4A 3TV8A 4LV9A 1GONA 1A53A 1NDWA 4TVUA 1GZJA 1I75A 3UG5A 4A2SA 1JD9A 4NQ1A 1YADA 5T91A 1TWWA 3Q65A 2QYGA 4F2UA 3GG7A 3CTLA 1J0KA 5EA9A 5TIMA 3P60A 1OADA 3HV8A 3S2CA 3BMWA 3NYZA 3PBVA 4HA3A 2NQZA 1PZ1A 3LV5A 3OLIA 1NF0A 2E5DA 5JMUA 1UD2A 5CPTA 1K4GA 4X9SA 3AISA 1H11A 1EO7A 4Q7IA 2PC8A 4RE0A 3W7GA 1K9EA 1LG2A 2GK1B 3CHFA 3V0TA 3CIVA 3N6JA 3G3MA 5CGTA 3KM8A 5LNUA 2XDFA 7XIMA 1JDFA 2Z25A 2YCLB 4XWUA 3BAXA 3O7UA 4PRRA 2ZX6A 3S5SA 3MHFA 3PUEA 3VIKA 4GVGA 1VFUA 1VRDA 1DJGA 3EWZA 3E3HA 1W3KA 1ZB5A 1J8VA 1J79A 2Y5JA 5CLTA 1Q8AA 4QFUA 2ZZ5A 3AIUA 1YNYA 3BJSA 4KGLA 3FX4A 1WQ5A 4BWLC 1OFQA 4AZCA 1XIHA 2WBKA 1VD6A 4JKLA 1AJ2A 2B0MA 5BNKA 3ZT5A 2UY2A 4W8LA 5FEPA 4UOQA 1CXLA 3OA3A 2QCLA 3FEQA 2VRJA 3ORWA 2RJGA 1AH3A 3NQ6A 3VDGA 2FKPA 2OGJA 1KQYA 2DPEA 4DO5A 3MUAA 5BRPA 4DUWA 2DUXA 3N9RA 1FRBA 1TPH1 4IISA 3WD4A 3T8LA 4H9VA 1AD1A 3CTTA 6PTDA 2WHKA 2XTKA 1QXLA 4UMCA 5F1UA 3M41A 1XYCA 4OBTA 3PULA 2WNNA 2ZDSA 2QEZA 2YX0A 2FZNA 2KZHA 4XD4A 3CQJA 2PCQA 3AC0A 1O12A 3PHAA 1REQB 1MO0A 3VIHA 2I57A 1ZALA 4RCXA 2QJHA 4YVXA 3OGRA 5JBEA 1GVQA 3ALGA 1AQFA 5E5CA 3UESA 3M4HA 3TW9A 3KVKA 1NH6A 1RBAA 4FP1A 3FJ4A 3IK4A 4TR9A 4Z2GA 1E9LA 3GBEA 3DZ1A 4BJHA 3PZ9A 3F4DA 4KRZA 4QXIA 3KDOA 4EWJA 4A8LA 2CCRA 2QW5A 4US5D 1MW1A 2GSJA 2HEJA 3SCTA 3W2UA 4A3QA 4LCQA 5GJMA 2BWGA 3LHWA 5AYZA 3TUUA 4K8EA 2DVXA 4OUEA 1WZLA 1AODA 4CU7A 1C8VA 5KITA 3S9YA 4JTKA 2RAGA 4XAZA 5CKSA 4M24A 4XD5A 4P7NA 1W5MA 4QJ3B 1H7NA 4B90A 5E0KA 4ZGYA 3V35A 4HNVA 3PB2A 4Z1YA 1CNVA 2E9MA 3WNPA 1TPC1 4E2VA 1LQ2A 4I5XA 2YA2A 1HO1A 5KETA 1H7XA 3UXIA 1SZEA 2XG9A 3EBVA 3KOXA 1P43A 3DFSA 4Q4RA 3L12A 3Q37A 4DQWA 2WSPA 1HG3A 3WLSA 3ZM8A 4O52A 4M6VA 4XD3A 4GPNA 3P14A 3AXIA 3W7OA 2NX1A 4L1XA 4BQ5A 3Q4DA 1X6LA 3RM4A 1R3VA 2QQ6A 4HSOA 4NVTA 4UTJA 1Z7AA 1H62A 2P50A 5E9XA 2AKMA 1ODUA 4DVOA 1JYVA 3AICA 2DZXA 2WLZA 4O17A 1GNXA 3KFTA 1V3JA 3W72A 1OM0A 3MU7A 3LLXA 5ABHA 2J77A 3EEZA 3TYDA 3P8JA 4I8DA 2CBVA 2WK2A 1QI5A 4DUXA 5BMWA 5DEZA 4C1KA 1HX0A 3NOYA 2ZADA 2VYOA 3QPZA 3U0HA 4GINA 2PTYA 3BOFA 4WQ6A 1VYPX 5A1AA 2PE4A 4Y9OA 1E9YB 3FKKA 3WQEA 4AWTA 5FL1A 3HG2A 6TIMA 2FFIA 2HPMA 4JR5A 3IV8A 4NRSA 1B3YA 3DFNA 5T9BG 4PMRA 2V2CA 3G1RA 1PWMA 3BLEA 3TU9A 4O12A 5FF2A 2Y61A 1W9UA 4XAGA 3VU2A 1XYFA 3P67A 1I6NA 2RJHA 4O10A 4MIMA 3ZSTA 4PMDA 4I9MA 3TYZA 1WDRA 1ZAJA 1IE7C 3DCPA 2AL2B 2UY4A 4Q8OA 4A22A 4AFYA 5ABGA 3N11A 1JFXA 1EJ7L 4NY2A 4U28A 2I5IA 2Q8ZA 1Q13A 4AC7C 1W54A 2XFYA 4GOAA 1YNPA 5H8PA 4HIBA 3W85A 3B05A 4JNZA 3OODA 2XIMA 3RLHA 1DQUA 4N2YA 4NU7A 3PSVA 1WDWA 4H6KA 2YZ5A 3GZAA 4O4WA 1HP5A 5AHIA 3HQOA 1UZDA 4Z2KA