2VFGA

Crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase with 3-phosphoglycerate bound at the dimer interface
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHHERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 90
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vfgA00
3NQCA 2V82A 3NPWA 1EWDA 1GVSA 1SSDA 3VCRA 4LC8A 3BARA 3DFTA 1A5AA 1FXQA 3N73A 1ME7A 4JD4A 1EWEA 5D2XA 3PUEA 1LOQA 3C52A 1TV8A 4LNYA 3G0XA 1SFJA 2FLIA 2ZZ1A 3GNNA 2OT1A 1LZOA 1DQWA 4O54A 5D38A 5DBUA 4R34A 4K36A 1NFBA 3BV4A 1B4EA 1SU5A 1QNVA 4FEZA 2Z6IA 3SIZA 3R5EA 2V5LA 1P4CA 1XI3A 1KFEA 1KTBA 3PBWA 3OVQA 3E02A 1G67A 2RDWA 2RDUA 3ANYA 3PUDA 2P0OA 5DN1A 2GVLA 1GZGA 3QW4B 4Y9AA 3QZEA 2CFFA 4OHQA 2CWNA 5TBOA 2OX1A 1Q6OA 3IVSA 2JKAA 3O1NA 3TA6A 1R2RA 2X1SA 2VFEA 3A5VA 4MPQA 3B4UA 5T26A 1Z44A 3S5NA 3UY7A 3MO7A 3A21A 4AH7A 3B8DA 5K2ZA 5G2WA 1TSIA 5FEWA 4N6EA 3IGUA 4CQ8A 3PULA 1O4UA 3MWAA 3NA8A 2FB3A 3W7JA 5HR7A 1JCNA 3CQ0A 2Z0IA 4ZQCA 4FHAA 1G4PA 4JICA 2DZPA 1DKWA 1TPUA 2ZFAA 1W5OA 4CQAA 3KHJA 4ZQOA 2J9ZA 2NV1A 3B0UX 4FXRA 1QPRA 1JQXA 1TPB1 2G97A 3LCFA 3FLUA 2PC4A 4M6VA 3GDLA 1L9WA 3W86A 1EUAA 2J24A 4MZYA 4Z08A 1OF8A 4AHPA 1K8XA 2ZZ6A 5I3KA 4PL2A 1TRDA 3NQFA 1LBFA 3LI1A 3EB2A 1QMLA 4NNCA 1TPVA 3TC6A 1W3IA 1O95A 1WX0A 2I1OA 1I45A 4JS3A 2GOUA 1X6UA 2QCNA 4IOTA 2QF7A 2IQTA 1D9EA 4UMBA 3S5OA 1SZFA 5AHEA 2Y62A 3THAA 3GDKA 2VFGA 4GRSA 2NX1A 3O6DA 5D2TA 3UQNA 2VC6A 2HSAA 2YW3A 3EWYA 3SJ3A 3LHYA 4CNOA 3O63A 1JUKA 4NX5A 5FI8A 5HNRA 5AHNA 1SO4A 5D05A 2ZZ2A 1DBTA 1Z41A 4RXFA 5H2ZA 5EMUA 3VE7A 3MHFA 2YYTA 3KOFA 1LTDA 4K6AA 1S3HA 2CLEA 3EXSA 2A0NA 5DXYA 2BSLA 2YDAA 3HGSA 3NPXA 4DXVA 3WJWA 3G0UA 2I9EA 2TYSA 4Y8FA 4AHOA 3EXRA 1QO2A 1SZGA 3RNDA 3NM3A 1UCWA 1UUOA 2ZRXA 1W5QA 3F03K 3LBMA 1DHPA 1C29A 1JVNA 5EL1A 4XKYB 1FCVA 1B9BA 1H1ZA 5CZJA 3AJXA 3LBCA 5IM51 3IVUA 4NXKA 4ZZ9A 2E5DA 2QKFA 3LXAA 1FWTA 2A4AA 4DO4A 1G7UA 2QUTA 3EKZA 3TKFA 3STGA 2FIQA 1M5WA 4HNNA 1H7PA 5HINA 3A5FA 4WXYA 4GC4A 3SECA 2AQWA 3L2IA 4O8RA 1YTKA 2B7PA 1TPDA 4DBEA 5C55A 3EXTA 4KWWA 1WXJA 4JYFA 3NQ7A 1SPQA 2CLLA 2DJLA 4ICNA 1L6SA 5D2VA 1KW1A 2I14A 3VNDA 5AC8A 3MI6A 4RJEA 4FIRA 4MY1A 1W3TA 3Q94A 4MVAA 2B7NA 1O60A 3HG4A 3ZFHA 4UMAA 5F4SA 4K7YA 3SW6A 3EEGA 5HWNA 4MFEA 1XFBA 3SR7A 4I7WA 3ABQA 5G4EA 1SO6A 1V7YA 3W1XA 4XZ9A 5I3GA 4N9EA 4AXKA 1KTCA 3UPWA 2QJIA 3E12A 5LZLA 3DXIA 4A2SA 1O5XA 3A23A 3BLEA 3TXZA 1A53A 4W9TA 4UTMA 5I3HA 2PRHA 3NDOA 2B0MA 4QQ3A 3NOEA 1A5CA 2QCHA 3A9IA 3AO0A 2E5BA 1VGAA 4E2BA 4P2VA 2ZA2A 3W9ZA 1JULA 4N9CA 3NL5A 1XUUA 1HTIA 4O10A 5LNRA 1OFPA 1OFDA 3RF9A 1CX9A 3TV8A 2GVJA 3SSJA 3HOJA 3MI3A 3PG8A 5K9CA 3EX3A 3TJLA 3G1HA 4Z1AA 5LHFA 2QCMA 4WD0A 2C15A 4Z1BA 2FPYA 1VHNA 4QSHA 2ZBTA 1R47A 1TYGA 3W7CA 2GQAA 4XUGA 4MLJA 2X16A 3LTPA 4LV9A 3N2XA 3RLVA 2CLFA 5C6MA 1B4KA 2PURA 1OFEA 2ZZ4A 5AHFA 2V2HA 3O6CA 5FF0A 3M5ZA 1EPXA 2J27A 3IRDA 1MZHA 4JYDA 2FJKA 5C2XA 1XDLA 3C61A 4JX6A 4AF0A 4H3DA 4U4MA 3HGJA 4ORMA 2EAWA 1SO3A 5AN7A 1TTQA 4UFIA 5FF2A 3R89A 1V5XA 1VQTA 3N9RA 4UFKA 1KM1A 3G18A 3TR2A 2V0TA 1SSGA 1S5VA 3E96A 4LWWA 4NT0A 3NQMA 1KA9F 1LCOA 3PR2A 5AC6A 3UNDA 2FPVA 1TJPA 5CSRA 1Q3NA 1IGSA 4JTGA 2PRMA 3TJXA 4WUIA 1YXDA 2C0AA 3M5YA 1OF6A 3CHVA 1FDZA 4WY0B 3HG2A 4NUWA 3LHWA 2ZRYA 1G6CA 1TQXA 1ALDA 2VEIA 2EPHA 3B0PA 1TTPA 3TFCA 2QCDA 4JTKA 1VHCA 3W7QA 4TR9A 3EX1A 1ZAHA 2WKJA 2CZDA 1K3UA 4Y6GA 5HQEA 2ALDA 3QH2A 2V30A 5FF4A 4MUZA 2QCCA 1KLZA 1GT8A 3QPZA 2FTPA 2DU2A 5BMXA 1CI1A 4N2YA 2WO5A 3R13A 2OCZA 2NXIA 3BG5A 4YMZA 3W3OA 2X30A 3VFLA 2ZRZA 1GWJA 2NWRA 1HL2A 1XBVA 3W75A 4ADTA 5DLCA 1G69A 1OX6A 3I68A 3L5MA 1T96A 4G1KA 3N19B 1TCDA 3TQKA 1LROA 4NJGA 4UUIA 3C0JA 3FA5A 3SI9A 3CC1A 2ZA3A 5D33A 4NQ1A 4UTUA 3BW3A 1JCJA 4UC5A 3VE9A 3I7SA 3LCWA 4LW7A 4FB7A 3LV5A 2VFHA 3E49A 2NXHA 2ISWA 3MJYA 3TUUA 5HWJA 2XFWA 1ONRA 3O06A 1PCWA 1R46A 5EKYA 3S8HA 4PH6A 3W1RA 3FKKA 4WY0F 4JIQA 3QM3A 3LB0A 5D02A 1XUZA 1KM0A 2YYUA 2V81A 2YFNA 3GLCA 2YCEA 2DZXA 2V5BA 2VKZG 1EUNA 1TV7A 1W1ZA 3C8FA 1FCBA 1UBSA 1WQ5A 2Z6JA 1GVQA 4BI6A 3LCLA 1ZALA 5G1TA 3UZJA 1GOXA 4JTLA 1H7OA 1RQEA 4MLRA 4ZVJA 1OFQA 3WK2A 2V8ZA 2WQPA 3C2VA 1LBLA 3U2OA 3EWBX 4ML9A 3STFA 3M1ZA 2ATSA 4N4QA 3IIVA 1SW3A 2WSQA 4O4WA 3KVLA 4JEQA 5AHLA 3R8RA 1W37A 3NM1A 4XTIA 1AG1O 4OE7A 3G1SA 4CNNA 2DZTA 1XBZA 2YPIA 2YW4A 1TO3A 1ZAJA 2CW6A 4WJEA 3C4UA 1C8VA 1QPNA 3NZ1A 3TAOA 4LVGA 3CIXA 4YCOA 3B05A 2C19A 2KZHA 3K30A 2CLHA 3PB0A 4EWND 1RVGA 5CPNA 4UTHA 5G2IA 4AB4A 3W7DA 3BG3A 1F05A 1JCLA 2V2DA 1M7PA 5LNVA 1YPIA 2NUXA 3GK0A 1ML1A 4HSOA 5HJLA 2E68A 1IXQA 3CM4A 1ZY9A 6ALDA 2QAFA 2CZEA 3QQ0A 8TIMA 5HR6A 2JK2A 4ORIA 4XBKA 3NQ8A 4LT9A 1VR6A 4HPXA 1EIXA 1JCXA 1ICQA 3QQ1A 4N4PA 3ZWSA 4WOZA 3W2JA 3WK0A 3W1TA 3O8AA 2AAMA 4K37A 5EA9A 5LGZA 1GTEA 2A2IA 2YFOA 4H6KA 4O14A 2DZSA 3W85A 3BLIA 5G4WA 3DFNA 3M44A 4IXHA 3H54A 4O0ZA 3HGOA 1TQJA 1W56A 1F73A 1EP1A 5KTLA 3DFPA 2VXNA 1VJIA 2QCFA 4A3UA 4LUJA 1RR2A 2HTMA 4K7VA 3ZWTA 1K8YA 1RV8A 3FFSA 4PFMA 2RFGA 3BGJA 1W5PA 1EX5A 3LLFA 5K3VA 1HO4A 2YGYA 3S42A 4EF9A 4EVZA 1S5WA 1KBIA 3W2UA 1EEPA 4O18A 1WBJA 1OFRA 1OFAA 4UR7A 3GR7A 3P5YA 5D30A 1F5ZA 1RD5A 5TIMA 3S1VA 3BG9A 3P67A 1J5TA 1K7XA 4UFMA 5TQLA 4IQLA 3WK1A 1I2QA 3P8IA 3W84A 1LOLA 3TIMA 1M6JA 1QR7A 4MYXA 3OBKA 5DXXA 1UASA 2E6AA 4O1DA 4ADUA 4A2RA 1TIMA 3TX9A 2WOQA 1ME9A 3EX4A 5K7JA 4OWGA 3M5VA 5E1QA 2HMCA 3LM7A 3OVPA 4DBDA 3F4NA 1WOBA 4HHPA 4JXCA 1TJRA 5D37A 3DHFA 5U4NA 1OX4A 1ZAIA 3DKLA 3IIPA 4QIUA 3MHUA 1A5SA 5HUPA 3GXPA 2DP3A 1WV2A 4MYAA 2VFDA 3W1MA 3TSMA 3W7OA 4MOZA 2ZTKA 2NX3A 4XTDA 1R2SA 5L6UA 3L0KA 4JR5A 1RZMA 3HMJG 2Z1BA 4JTTA 4WXZA 1EP3A 5KZDA 3I7QA 1VCVA 1XC4A 4XKYA 2EHHA 5DELA 3E9AA 4FXSA 1K7FA 3W23A 1GG0A 5BMWA 2H8XA 4JTFA 4M5PA 3GZ3A 3HJZA 1W54A 1NF0A 1DJQA 3OHIA 4LS1A 3DFQA 4JX5A 5F2MA 3W7EA 3NQEA 2YSWA 5A8GA 3RFAA 1AW5A 1DV7A 3QMRA 2V9DA 4PTNA 3G24A 4OQVA 3IV3A 5F4XA 4AHQA 3UWZA 3V1PA 1J2WA 1KFLA 3L68A 3GXTA 1VYPX 2ZZ5A 4IJBA 5KSWA 1AL7A 2G96A 3NQ2A 5C5YA 3M5XA 4UNLA 4YXGA 3B0VC 1TPFA 3VKJA 1KM2A 4GNJA 3JR2A 1THFD 2P10A 4IPIA 2ISSA 3S6DA 1FDYA 3NZRA 3W07A 3QPYA 4FNRA 2HS8A 5LNSA 2PCQA 2NLIA 4E38A 4KFNA 4CNPA 5LNWA 3G1FA 2Y6ZA 3ELFA 4IGHA 1NF7A 5CZTA 1ZHAA 4UR8A 1U5JA 3G1YA 3GX9A 3LTYA 3QSRA 3P82A 5KINA 3M0ZA 3G1VA 1JR1A 1QPQA 3SGZA 1W31A 1DJNA 2Q3RA 4R33A 1FWRA 3EWUA 3S5ZA 4OGZA 3P60A 2VFIA 3EWWA 3LCHA 2GPTA 1LLZA 1LRQA 4UTTC 5BOOA 1W0MA 3N2MA 3LXCA 1XBXA 3NR0A 4HN4A 1A50A 1F74A 3C2RA 3G22A 1T8XA 3LHVA 1DL3A 3FKRA 4O57A 4S2CA 4NZJA 1P0KA 2OZ0A 1FUYA 3LRKA 2P1FA 1XBYA 3HB9A 3LHTA 4QITA 1FWSA 1K8ZA 4QAIA 4TU1A 2Y88A 4HT3A 4TIMA 3W1LA 3IIXA 2ISVA 2NXGA 1MXSA 2V2CA 2A6LA 3IEBA 3JRKA 5MHBA 1LRTA 1AK5A 2J9YA 1B3OA 3A22A 2CU0A 2O7SA 3TDFA 2DORA 4GUHA 2RKXA 3W74A 4GBUA 4GUJA 3W1QA 1Q45A 3BGGA 1WAUA 3KRZA 3TW7A 2ZYFA 2WNNA 3QMSA 4NJJA 1CW2A 2E77A 3T4CA 4LVBA 1YTEA 5DCDA 4RZ5A 1FDJA 1PL9A 3DENA 1ZENA 1KM5A 3IIZA 4JYEA 1SUXA 4IXXA 1YDOA 3CIWA 1NAL1 1VYRA 3N14A 3STEA 3FEMA 3PC0A 2WSYA 1UB3A 2GVGA 3KRSA 3NQAA 5IBXA 2D73A 3MBFA 3TH6A 3CEUA 4LTSA 4JDYA 3W7LA 3TMQA 3W7GA 4HNVA 4MIMA 3GVGA 1XXXA 4MZ8A 4WY0A 3UWUA 3G8RA 3W76A 1QAPA 1Z42A 1QDSA 3UWYA 1MSSA 1Q6LA 2QJHA 5AC7A 4FO4A 4TO8A 1H1YA 3FYPA 4UFLA 5LSMA 2QCEA 2J9XA 1XDMA 4O53A 5F2LA 2RHGA 4CCCA 3DU0A 1YYAA 4L4MA 3MMTA 3KX6A 3CWOX 3P61A 4LV4A 5CZSA 3CT7A 4FNUA 1H51A 3UY8A 1I2OA 3PBUA 4O1CA 2JKPA 1I2RA 3NGJA 3L66A 5AFDA 3TQ0A 4A21A 2BXVA 3O6YX 3C2EA 4MJMA 3QEZA 3BO9A 1KV5A 3C3NA 3M47A 1AMKA 1YADA 3Q58A 3N3MA 3W2NA 3BLFA 3YPIA 1ZJIA 3L0GA 3BW2A 2Y85A 2TRSA 3M43A 1TV5A 1GJPA 4POCA 4DF0A 4LVDA 1G7VA 4OV9A 3Q2DA 3W6YA 4O12A 4DO6A 4N9DA 4B5NA 5BRBA 4J9JA 3DFSA 4S1FA 1P5BA 3ABRA 1SO5A 3N9SA 4PEKA 2WSRA 4QJ1A 1T99A 3DH7A 3V75A 1FY6A 4FNTA 1I2PA 4O13A 2DZWA 4CLMA 3TMLA 4LS2A 3UXDA 4O0KA 1DORA 1SW7A 4MFDA 3FIGA 4E0CA 4C1KA 1G4TA 5H91A 5FESA 1QFEA 3W2KA 4I7VA 3TXVA 3U6WA 2J6XA 4UTWC 1PHQA 1HG3A 3ABOA 5HUOA 2NX9A 3KVMA 1I8JA 3FJ6A 4O1BA 4QM1A 5DCEA 1OK4A 2WNQA 3PWAA 2JGQA 3KVKA 4IMDA 3NVTA 1H7WA 4BFAA 5D32A 3CB8A 2GUUA 4N9BA 1H61A 3KVJA 3GAYA 4KFPA 1J4EA 3WJXA 4IWWA 3IIOA 1VPXA 4ZQRA 1JQVA 3HO8A 3SGUA 3W7KA 4YCPA 4O4VA 3MP3A 5U7SA 4DQWA 3KAOA 1IXNA 1NSJA 2QJGA 2QUVA 3NL2A 1BEUA 1Q6QA 3I6RA 3W7PA 3LX9A 3RU6A 3P81A 3KRUA 1SZEA 5G5IA 3GAKA 5D09A 4BWLC 1LP6A 3PB2A 1H7RA 1TPC1 3P5ZA 1GEQA 2TSYA 2A6NA 2TPSA 1X1ZA 3S5YA 2E1DA 4WOQA 3ABSA 5AYYA 3MYPA 1N55A 1NVMA 2QUUA 4NX0A 4TX9A 5LHEA 1GPWA 4EF8A 5HWMA 2A5HA 3I7RA 1KM3A 2AGKA 4D2JA 2ZQ0A 3WK3A 5CG7A 3FYOA 1VH7A 1BWLA 3NQDA 3DBPA 4JTHA 2VELA 1H60A 3R12A 4IMCA 1RQBA 2X2GA 1SZNA 2G95A 3N34A 3PAJA 3TW6A 2H90A 3NXFA 3RLUA 3S1WA 3GKFA 4UMCA 2CLKA 4UFHA 3M6YA 1PHWA 4O15A 5GVJA 1G4SA 3GYEA 1GG1A 4EIVA 3FOKA 4JTSA 1OYBA 1LDCA 4BR1A 4S2BA 2Y7EA 3IGSA 2CLIA 4JTJA 4RKAA 3G1XA 3TQVA 2XN1A 1AL8A 2NUWA 1TPWA 5G2HA 2GJLA 2CZFA 3DKJA 1YLVA 5E0KA 1RQHA 2YZRA 3USBA 2ZZ3A 3PF3A 4PC8A 1ME8A 1GVFA 5EY5A 1QOPA 1OJXA 4EOUA 2EGZA 2ZCGA 4TMBA 2E6YA 1MEIA 3PVFA 2UV8G 3W7NA 4LRSA 2X1TA 3MBDA 3CU2A 3NO5A 4M7SA 4JY8A 5FF3A 3NQ6A 4UNKA 3L0NA 2VFFA 2EF9A 3W72A 4RCXA 4JTUA 1AW1A 4DEFA 1W8SA 1IXOA 3WJSA 2GQ9A 3MP5A 4IPJA 2ZRUA 3GXNA 5K4ZA 1E51A 1ICSA 3H55A 2QCLA 3OVRA 5AYXA 5J5DA 3ZS4A 1F76A 2Y89A 4DELA 4DF1A 2VEKA 1B57A 1OABA 1W3NA 4K8HA 3UWWA 4XQ6A 3EX2A 2LLEA 4UFJA 1JRBA 1N7KA 3O16A 3W71A 3BW4A 2RH9A 3SFKA 3LHUA 3P7YA 3DI1A 5CKSA 4XWUA 4Y90A 1EP2A 2J88A 1FX6A 3DHDA 1HUVA 1OK6A 1SR9A 2VEMA 3QSTA 4K38A 4NJKA 4HKPA 5CPOA 3O15A 1SQ7A 4UCGA 2FQIA 4ONVA 1QPOA 1VRDA 2ABBA 1L6YA 1TPEA 1YTDA 4Q32A 4NNBA 4JY9A 1AW2A 1IIGA 4QISA 1ZCOA 4LS0A 2B4GA 3M41A 3MYOA 3T40A 1TMHA 3TNOA 3S9YA 2R8WA 1JJKA 5FEPA 3VI2A 4XBSA 1H63A 1OX5A 3G1AA 5DCBA 5DBTA 4AWTA 4AMAA 3LRLA 4MY8A 2RDTA 4NXSA 3CPRA 2VEPA 1OYAA 5E93A 3WJZA 5G1YA 5A5WA 4FNQA 3PSVA 4RV8A 3QMTA 1JRCA 2X1UA 3MW7A 3RMJA 4FNPA 3NNTA 4UTIA 4WX2A 5ABTA 2VENA 1VCGA 3LLDA 4K8EA 4FNSA 5FEXA 2OT0A 5KZEA 3E0IA 2ZZ7A 4QNEA 4RXGA 1OVDA 4JX4A 3HIJA 4NVTA 3C2OA 5EBUA 2QCGA 3LDVA 5FEZA 3QF0A 3MHGA 2B7OA 2DZUA 1FWNA 4ZQNA 1GYNA 3NEVA 3HPZA 3W22A 5EYWA 4NJHA 5F4WA 4ALDA 4UTJA 3IVTA 3GIYA 1Z48A 3L9CA 3MP4A 2FB2A 2QAPA 2A85A 4CQ9A 4FF7A 4IMGA 4UXDA 2F7FA 3PS7A 1H5YA 5CSSA 4X9SA 2E5CA 4JTEA 1QWGA 3HF3A 3LI0A 3LXBA 4FIQA 4LC6A 1R30A 1D3GA 3W88A 4PA8A 1F2JA 1R2TA 4WQ6A 3T44A 4NU7A 1GVOA 2H3BA 2QDHA 2YXGA 3R2GA 1QO5A 3L21A 5KMYA 2JKEA 4H4IA 5F1UA 1SW0A 1DVJA 4BI5A 1JUEA 1ADOA 3W7IA 5CPMA 1U83A 5L9FA 4JNMA 3Q37A 5D04C 4JGDA 1PVNA 5AHMA 2W0UA 4O19A 3C56A 5DY2A 1WDWA 4RZ6A 3P74A 1JUBA 4HIBA 4HPJA 2QR6A 1LBMA 4GUGA 4I9AA 1VYSX 2WPBA 3W7MA 3W1UA 4LVFA 5D2YA 3W1PA 3W2MA 4HNUA 3LHZA 3QFEA 2GJNA 3NPUA 2QDGA 3U8GA 1PCKA 2NWSA 3G3MA 2ABAA 3HQ1A 2G5WA 5CPLA 4UTTA 1LRNA 3C6CA 1K7EA 2H3DA 1L2UA 3GDMA 1PE1A 3T55A 1X8FA 5FF7A 1LORA 1YXYA 1JCMP 2C1HA 1F6PA 1YXCA 2FFCA 1MEWA 2NZLA 1OX4B 1P0NA 3ATZA 4M6PA 1TRIA 3NAVA 2FPTA 4LUIA 1W5MA 4RX0A 4Z1CA 1QOQA 4DPPA 4O11A 2CLMA 2W6RA 2H6RA 3W87A 1FCUA 2OMAA 1KFCA 3T7VA 2GQ8A 3TSDA 2Y7FA 1TPH1 4GWEA 4MKNA 4AVFA 3F1QA 4LY8A 1DQXA 2JGYA 1ZFJA 5I3IA 1QCWA 1VCFA 2E6FA 6TIMA 5KITA 2NUYA 4UTKA 1KM6A 4AEOA 2C3ZA 3L65A 2WNZA 3NQGA 4GUIA 1X7FA 1VC4A 4AWSA 1YPFA 1N8FA 4OT7A 2Y7DA 2ZA1A 3A24A 2O7QA 3SZ8A 3GKAA 4ZMGA 4M6QA 2H8ZA 1H62A 1F6KA 3TSBA 5AOUA 3UXAA 5CGQA 5AHIA 1VZWA 1WOAA 1KTNA 4LRTA 1FQ0A 1DOSA 3G0SA 2XN2A 4NZFA 2Y7GA 4YLWA 1ZNNA 4KKXA 3LGEA 1GVRA 3NL6A 3B04A 4HNTA 1XM3A 1UJPA 1YDNA 1T0OA 3QRHA 5D03A 3BK0A 3LCIA 4PL1A 3UZ5A 1FCQA 1RPXA 1UUMA 3QW3A 4PODA 4Q4KA 3QJAA 1EB3A 3S1XA 4CCEA 1TTIA 4YL2A 1K02A 3TE9A 1IXPA 3B06A 3OG3A 1TTJA 3UD6A 3P80A 4E2DA 4IUOA 3EKLA 1WBHA 2PE4A 3ATYA 4AWUA 1GQNA 1OHLA 2ZDRA 2E6DA 2A7RA 4O28A 4Z0SA 5EPDA 5K9DA 4K39A 3L67A 3WJYA 1KLYA 3LRMA 3F4WA 1WYIA 1M7OA 2Z2UA 4GXMA 4LOCA 4A29A 1VLWA 2YX0A 4ZQMA 2Q3OA 3DZ1A 4UIOA 3T78A 3O05A 3TU9A 4BF9A 3CLMA 4M19A 1KFBA 3BVJA 1IIHA 3TC7A 2NV2A 4FX6M 4QNWA 4RK8A 3QYQA 3HG3A 1WA3A 1C9DA 3FS2A 4IMFA 3PUOA 3IGXA 2C14A 5F1VA 2ZRVA 4NJIA 4O1AA 3W7RA 3H53A 3UWQA 3W2LA 3B03A 3KFTA 4N02A 4UTWA 2A7NA 2BLEA 1NEYA 4WZHA 3THQA 1H7NA 2Q8ZA 1W5NA 3WFAA 3GR8A 2C13A 2XN0A 5IBXC 1H50A 3P84A 2JBMA 1TREA 3W1NA 4C1LA 3NG3A 4DF2A 3CWNA 3INPA 4I7UA 4YWIA 1P1XA 2FDSA 2WV8A 1BKSA 4GJ1A 5AYZA 1FXPA 2ZTJA 1HO1A 3C2FA 1VS1A 2ZRWA 4M7TA 3M9YA 3CEPA 3PBYA 3O07A 3W7HA 7TIMA 3DI0A 3UWVA 4N6FA 4LU0A 1XKYA 3MUXA 2OJPA 4GE8A 4KWVA 4IX2A 4O16A 1PV8A 4FX7A 5HULA 3M16A 3PM6A 3PSWA 4BWLA 4CCDA 1IF2A 1F7BA 4GFSA 3HBLA 3W1AA 4IX0A 3HPXA 2VOMA 4BI7A 4X3ZA 1GTHA 3DFOA 2C6QA 2Y61A 3TFXA 3NPVA 3OA3A 1ICPA 5DY3A 3CTLA 5F2IA 3M7WA 2E09A 1BTMA 3NL3A 2EKCA 4Z0JA 3TCEA 3LCGA 3LERA 4JDBA 1VLIA 3HGRA 1G4EA 1MO0A 4BK9A 2X1RA 3P62A 2B7QA 1YDVA 1SFLA 3TROA 4PCFA 4AF0B 4A22A 2BTMA 4KFOA 3PG9A 4JTIA 3HG5A 5D2WA 1XCFA 3G1DA 3LV6A 4LVAA 1KFJA 4TMCA 1Y0EA 3LCXA 5AB3A 3EX6A 4NNAA 5I3JA 3UPBA 1GYLA 1K03A 3NQVA 1O5KA 4IMEA 5K4XA 2BX7A 4P61A 1OFOA 3GB6A 2R94A 3ZR4A 1OFBA 2BWGA 2WJZA 3S0CA 3D0CA 4OBTA 3JS3A 1I4NA 5HMSA 3TK7A 2BZNA 4Y96A 5I3FA 3TAKA 3NYZA 1OG0A 1EA0A 1FBAA 2QCDB 3FJLA 3W83A 4ZQPA 4R53A 4FX8A 2R14A 4Z1DA 2PRLA 3LTSA 1JCYA 2YR1A 2A7PA 4MJZA 4L4LA 1PIIA 1L6WA 3GDTA 5LNUA 4R7JA 3LOTA 3S1UA 2Y63A 3W70A 1BWKA 4MZ1A 2CZ5A 3QC3A 3OEXA 4ZL1A 4U28A 2ATMA 3G8EA 1LYXA 1LOSA 1S5TA 2R91A 1TB3A 4RR4A 2HS6A 3EWZA 5LGXA 5C54A 1I2NA 3G3DA 4ADSA 3GDRA 5CZ0A 2A21A 3W73A 4O52A 3L5AA 4JN6A 1LLWA 5BNKA 2A1YA 1KBJA 3OIXA 1KM4A 3EWXA 1OYCA 2TMDA 5J5RA 2CLOA 3I65A 2F84A 2QEZA 3P8JA 4O17A 2Q8LA 4DO5A 1KFKA 1X1OA 4OV4A 3GNDA 2Y70A 4GUFA 1FWWA 1LM1A 2C18A 1A5BA 3L5LA 4HSNA 5KZMA 1MEHA 4RLIA 4MY9A 5F2GA 3PY2A 4DPQA 5LKYA 3DGRA 3KXQA 3HPSA 1XL9A 5SWUA 1Q6RA 3UYCA 1HFBA 2DZVA 4X2RA 4OU1A 4Q33A 1PS9A 4JIPA 3BPWA 4UTLA 4O50A 3SY5A 2DJXA 3DAQA 4RZ4A 1KV8A 2W79A 1H7XA 5BW6A 1O94A 3STCA 3MI2A 3PBVA 2C16A 4X22A 3RK8A 4AAJA 5K9XA 1D3HA
chains in the Genus database with same CATH superfamily
4AX6A 3NPWA 3VCRA 2V6AA 4IIHA 2EPMX 4ZOCA 1EWEA 3E0LA 4QR6A 1SFJA 3FSTA 2F6UA 4HA4A 4S3DA 1PZ1A 1DQWA 4R34A 3BV4A 3RDKA 4K2SA 3SIZA 3EOSA 3R5EA 3CH0A 1P4CA 1XI3A 4UOQA 2BDQA 5C7VA 2EJ1A 3PUDA 2NQ9A 4PCSA 1X6NA 4DNMA 2CNCA 5A94A 4B9YA 2Z4GA 4Y9AA 3KBJA 2QDDA 2WMGA 2CERA 1Q6OA 2IXVA 2BV9A 4MJ4A 2VUNA 3TA6A 2X1SA 1S46A 5HQMA 1W9VA 1UP3A 2VFEA 2WLYA 4MPQA 3B4UA 2FMOA 3S5NA 1FHVA 1F4HA 1GUVA 4M6UA 3NJ3A 3A21A 5K2ZA 3U57A 5G2WA 4S39A 5FEWA 4UNIA 4HYRA 4CQ8A 4JFWA 4RNJA 4PE8A 3PJWA 3A3XA 1O1ZA 2FB3A 5HR7A 4LFYA 4FHAA 2DZPA 3VZYA 2D0GA 3ARUA 4PRRA 1UD3A 3KHJA 4ZQOA 2XH2A 3RO6A 3SJNA 1TPB1 2VOTA 1L9WA 2XSXA 3OGRA 1RCOB 1K8XA 4KWUA 5I3KA 3H7UA 4PL2A 3NQFA 4DJEA 1QMLA 1TPVA 1XLIA 1XDJA 3AS1A 4QCFA 2AOSA 3L2MA 1X6UA 1KQYA 4UMBA 3S5OA 1SZFA 3WLNA 1V51A 4GRSA 3J7HA 3EBVA 5A1AA 3O6DA 1MW0A 1PKYA 2VC6A 3RILA 3EWYA 3VZXA 4HPNA 1Z7AA 3MUIA 1EOMA 4F40A 4HZMA 5FI8A 1SO4A 2Y2WA 4HBKA 4PULA 2ZZ2A 1Z41A 2WCGA 3G5EA 4RXFA 5D9MA 3VE7A 5A6BD 3NIYA 1Q66A 2BSLA 4QE1A 3C3UA 1FWFC 2QV5A 4DXVA 5AC4A 3QHMA 3WJWA 3G0UA 2I9EA 3BZGA 2TYSA 1ISYA 3U0HA 4AHOA 3GM8A 3EXRA 1EJ7L 1QO2A 1SZGA 4ICCX 3NM3A 2ZRXA 3ARWA 4QJ4B 3LBMA 1DHPA 1KRCC 4LX4A 4XKYB 3WY1A 1FTXA 3LBCA 4MTVA 5IM51 1XX1A 3CHCA 2PWUA 3IVUA 4NAEA 4P7LA 1PBGA 4ZZ9A 4LYQA 3GC5A 1E9LA 1SFSA 4DO4A 2A4AA 1G7UA 5I0DA 2XGZA 3EKZA 2FIQA 4GVFA 3VYLA 4A3RA 1H7PA 4WXYA 3UR7A 3U2CA 3WUEA 3SECA 4KERA 4O8RA 1V79A 1YTKA 1TPDA 4QQUA 1ECQA 3EXTA 1WXJA 2GDUA 4NY2A 5JU6A 2W63A 1TR9A 1GVIA 2R1NA 2XU2A 2PDNA 5D2VA 3SCRA 1CB2A 2OFJA 3VNMA 5AC8A 1ZTVA 3FX4A 1W3TA 4W85A 4CNTA 1A5MC 2ODOA 1RPKA 1JDDA 4JCLA 5F4SA 4ATWA 4IIGA 5LXEA 4HYVA 2OZTA 1EOKA 1FVPA 3EDFA 3H22A 4XZ9A 2PWFA 3FY1A 1KTCA 2WC7A 2WKLA 2QJIA 2A3BA 4PMVA 4E2VA 4XK2A 3MKVA 1A53A 1TUXA 2O9PA 4IIFA 1AJ0A 3ZLFA 3MSRA 4KETA 3A9IA 3AO0A 4C6FA 1VGAA 1F9CA 1TE6A 4N9CA 2YCIX 3IV8A 3VOGA 4DAFA 2VM8A 1MVYA 1OFDA 1CX9A 3RJYA 4AD0A 2YZ5A 3REQA 3MI3A 4IPPA 2WYSA 3CAWA 3PG8A 3TJLA 4H9VA 4ATLA 4Q8PA 4AX7A 5LHFA 2CPUA 1VHNA 3GVRA 3AROA 3W7CA 4AIUA 1Q4WA 3XINA 3LTPA 1TWDA 4JL2A 5KETA 3LG3A 4D71A 3V35A 3T2QA 3RGTA 3M5ZA 2J4GA 4V27A 3S3GA 4JX6A 4H3DA 4AZ6A 4PUJA 4H7CA 1VQTA 2PGFA 2VRJA 4A05A 3N9RA 3S47A 2OLHA 1CGTA 1SSGA 1TG7A 3BQ5A 4LWWA 5HMDA 2XPKA 3UNDA 1HKMA 1Z8AA 1PTAA 1P7TB 2XH4A 3POCA 3VIPA 3TJXA 1QNRA 4JQAA 2C0AA 3GNPA 1E4NA 2OPJA 1OF6A 4WY0B 2MANA 1G6CA 2ZVRA 4GKLA 4D6EA 1TTPA 2W9MA 3RIKA 1VHCA 1UKPA 5GJMA 2DT0A 3BSHA 4Q4RA 3VX1A 3RCYA 1WKEA 3GTNA 1UH4A 5HQEA 1U33A 4MUZA 2HISA 2QCCA 3WN6A 4B4HA 2FTPA 3L7RA 2WJFA 3R13A 3BWWA 4HB7A 2JF7A 4AXNA 3RMEA 1EIBA 3R25A 1E6SM 1XWYA 1XBVA 3CIVA 4ADTA 4Y9OA 3SCOA 3VGBA 1B5TA 1YQ2A 3WQPA 1JNEA 3C0JA 3RM9A 3SRKA 1WZKA 3SUVA 1XIIA 1XYCA 1JCJA 4UC5A 4UTUA 2HPIA 3I7SA 1EQPA 4YN5A 4WGXA 3ARYA 3AIVA 2ISWA 3TUUA 5HWJA 1ONRA 3V1HA 5GQBA 3VD5A 1PCWA 3CZLA 1H41A 3S8HA 1E70M 4L64A 4HK5A 1IWBA 3QM3A 3LB0A 5D02A 1XUZA 5A6BA 1TVLA 4HTBA 2V3FA 2OB3A 2QIWA 4XAGA 4ENLA 4DLMA 2VKZG 2WVVB 3A6OA 1OG6A 4S3EA 5G1TA 1PTDA 1VFFA 4ZO9A 1GOXA 3T9PA 1WXZA 4ZVJA 2WPGA 2I16A 2V8ZA 3EWBX 5FL0A 3M1ZA 4N4QA 1W32A 4O4WA 4JEQA 3R8RA 1XIDA 1KRBC 2DZTA 2OGJA 4HMNA 4WJEA 1QPNA 2CXGA 2OG9A 1M7XA 3NO3A 3PB0A 2WM1A 4XSLA 3BG3A 1H0IA 1F05A 3F2CA 2NSXA 3WEZA 1M7PA 2NUXA 5HJLA 1GQLA 1XLJA 2NSOA 1IXQA 4XZLX 3CM4A 4IISA 3MU7A 2QAFA 1US0A 4W86A 2JK2A 2CBUA 4RPPA 2YXXA 4GO9A 1EIXA 1JCXA 1BG4A 3KBSA 4ASTA 2WMIB 4A4AA 2Z25A 3WK0A 3GXFA 3CUGA 3K8MA 3S9IA 4QDWA 2EPLX 3N18A 5EA9A 4EWJA 6PTDA 2A2IA 4UQAA 4H6RA 2YFOA 1TV3A 1CXFA 2CITA 3O7UA 4O14A 3E74A 1UUQA 2ZUSA 2XG9A 3K46A 3BLIA 2TAAA 3DFNA 5HOSA 1ADDA 1GJUA 1TQJA 1F73A 1IGWA 1EP1A 3DFPA 3ZSSA 2GYIA 3LQGA 3OHMB 3WF4A 3BGJA 3WH7A 2O9OA 5ENLA 1HO4A 2YGYA 1VP5A 1XD1A 4GIEA 3P5YA 4V1YA 2Z24A 2VD9A 5T91A 5TIMA 1HKVA 4AZ7A 4WR3A 5FJUA 2VMFA 4IQLA 4S3FA 1I2QA 1JZ8A 1LOLA 3OLIA 3SUSA 3ZR5A 1B3VA 1QR7A 1P43A 3KP0A 3UG8A 4ADUA 1TIMA 3VUPA 3WMBA 4RZBA 1EKOA 2X09A 4OWGA 5E1QA 4GZ7A 3L4ZA 2QUNA 4BQ2A 5RUBA 5T9BG 1WOBA 3W00A 1JDEA 3H4XA 1CT5A 2AAAA 4Z2HA 1YBQB 3NUKA 2P8CA 2G4JA 4IGNA 1WV2A 3K1GA 3W7OA 3L2LA 2ZTKA 4PCPA 2PDPA 3L0KA 4JR5A 3HMJG 3TC3A 4JTTA 2WC3A 3LSBA 4GI6A 3ZVHA 3I7QA 2VCAA 2XTKA 3K5XA 4H8HA 1E71M 4G7EA 4FXSA 1PYFA 4S3GA 1QJWA 1P6CA 3URAA 1F3WA 4G7FA 3TYAA 3OHIA 2BY0A 3NYDA 3NURA 5A8GA 3RFAA 1DV7A 3AYRA 2V9DA 3QMRA 4AQLA 4XZNX 4HOWA 3FEQA 2HBXA 3LPFA 3V1PA 1KFLA 4H8UA 3GXTA 3SCPA 5IFTA 2ZZ5A 1HJSA 4M81A 4IJBA 1V6UA 1FFQA 5KSWA 1XIGA 3CT2A 2P10A 4NIRA 3EAUA 3UFYA 5CJNA 2VCBA 4V1XA 3NZRA 3N4FA 1UZHA 3QR0A 1WUFA 4E38A 4CNPA 2ACUA 1K8CA 1WZLA 2PGWA 4RDYA 4DJDC 3TN5A 3ELFA 4IGHA 2JFEX 4GH3A 2P76A 2WXDM 2Q02A 4WK9A 3GX9A 4MPKA 3M0ZA 3G1VA 1QPQA 3ITXA 1BGAA 1DJNA 3BCJA 3E3HA 2Q3RA 3EWUA 5I5RA 3S5ZA 3P60A 2VFIA 5I6SA 4FOJA 2GPTA 3PFRA 1E5JA 1LLZA 4UTTC 5BOOA 3N2MA 1DPMA 3M0LA 3AHXA 1F74A 3C2RA 3BAXA 1XISA 1OD8A 3GU9A 4I6KA 1FUYA 4PTMA 3LRKA 2P1FA 3VMNA 1NOWA 1NFGA 4QAIA 1K8ZA 1M9HA 4PUEA 3EGJA 1WO2A 4TIMA 3IIXA 3DECA 1MXSA 1UIOA 4Q6JA 3TYUA 1YIXA 2QIIA 1OIFA 3LA4A 2D2OA 2J9YA 2DSVA 1KD0A 2CU0A 1NH6A 3W74A 4GBUA 5BU6A 2IMRA 4MWAD 1Q45A 3BGGA 2ZYFA 4NJJA 4ZB5A 3KZPA 3DENA 1R3SA 2EG8A 4IXXA 1YDOA 4J27A 2WSYA 4J3ZA 5BWAA 4IQJA 3WUBA 2GVGA 1XLKA 2P8BA 3PPCA 4WVXA 4LTSA 5EMYA 3QC0A 4RDVA 3GVGA 2XHYA 1K9EA 3PFMA 3EZ4A 1MQRA 2DT3A 1H1YA 1L8PA 4KMQA 4UFLA 5A95A 2PWVA 1A4LA 2QCEA 4L4MA 4JBRA 1JPKA 1HJUA 1TJ2A 3GFYA 3CWOX 4XKMA 3WDHA 1W1TA 3VILA 3PBUA 2PTWA 1JEZA 2BXVA 1QHZA 3C2EA 1ODZA 4MJMA 5FJTA 4M3PA 3QEZA 5HJYA 3OODA 3C3NA 4DJFC 1AMKA 1ZCCA 3ZJ6A 1Q6EA 3N3MA 1Y8BA 4IIDA 3R8HA 1TWSA 1ZJIA 2Y85A 2TRSA 4CQCA 1TV5A 1W1B1 1XGDA 2EBNA 2RAGA 2WSKA 4Z2GA 1IEXA 2CWXA 3SY1A 3GXDA 1EBHA 2W5FA 2OEJA 5BRBA 1UOZA 4S1FA 2CHRA 1P5BA 3R6IA 4K1GA 1SO5A 3MVTA 4PEKA 2NW0A 1T99A 3LMYA 3DH7A 1H3GA 4O13A 1JYWA 4CLMA 2BHZA 1PX3A 4R5EA 2FZNA 3B3DA 2DSWA 4I7VA 3U6WA 1P6WA 2WWDA 3KVMA 3UCQA 1PIFA 3FJ6A 4PMDA 3W81A 4Z2IA 3UJRA 1XC6A 1XGZA 5DCEA 3BE7A 4QCEA 2PWDA 4BFAA 2VO5A 1H61A 2OOFA 4QJ5B 1K6AA 4C5ZA 3A47A 4IWWA 3IIOA 1VPXA 3H2EA 1XLLA 4ZQRA 3HO8A 3SGUA 3QV9A 3W7KA 1V3MA 4O4VA 3EOLA 1W1PA 2DGAA 1WXYA 3W7PA 3CAQA 2ZUVA 5G5IA 1R9YA 2VR5A 3GAKA 3GUGA 5D09A 4HVXA 4JNYA 5IFPA 5FACA 3DFYA 2BXYA 4D6CA 4W93A 3ABSA 1LJYA 3MYPA 1NVMA 2QUUA 3CZKA 4NX0A 5GJNA 1IT7A 3P14A 3SO7A 2A5HA 3I7RA 3APTA 2AGKA 3PWGA 1HXJA 3U4AA 2ZUWA 5I07A 3BJFA 1V0NA 2XIQA 2I9UA 1H60A 2R1MA 2X2GA 3F2DA 1CGXA 3OYXA 4E5TA 3N34A 5E70A 3GKFA 1BG9A 1XSIA 2CLKA 2HE5A 4RE2A 3M6YA 4CNSA 1VBUA 1G4SA 3GYEA 3GIQA 1TCMA 1EH9A 1LDCA 2XM1A 4S2BA 3IGSA 3G1XA 4XZWA 3ARSA 2NUWA 4Q4SA 2CZFA 2I7GA 2YZRA 3B8VA 1NJJA 4UQCA 4ERAA 3IJDA 1K6WA 3FGCA 3CV1A 3BSMA 1GVFA 5EY5A 2DW7A 2I56A 3ANUA 3O6AA 2OSXA 2EGZA 5CPQA 2FZBA 1MEIA 5IOBA 4JTRA 4F8XA 1UMYA 3NO5A 4JY8A 3VC6A 1ONWA 2VFFA 3W72A 3WNNA 4DEFA 1RY8A 2UY2A 4M29A 2ZRUA 3GXNA 1KCLA 1A49A 1BSIA 5K4ZA 4BY3A 2X42A 2Y89A 4DF1A 3NTYA 2UY5A 1MUWA 2PTDA 2AGTA 1E0XA 1W3NA 4N7QA 4K8HA 5AVHA 3DHPA 1MNZA 1VBGA 2WVUA 3EX2A 1ISZA 1N7KA 1W2VA 1JF5A 1XLDA 2INZA 1F3TA 3F5LA 3SFKA 3P7YA 5JIWA 5CKSA 2J88A 1OK6A 2VEMA 5BXTA 4NJKA 4E4UA 2D2JA 1P1MA 1FWGC 1SQ7A 4AYGA 4ONVA 4GH1A 4S23A 4PUWA 2ZVIA 2ABBA 5XINA 4F3HA 1MQQA 4NNBA 4JY9A 1HJQA 4HGXA 1IIGA 5TNVA 4QISA 4ACYA 2WQDA 3QZ6A 2B4GA 3VIMA 3WBEA 3O2LA 2R8WA 2VURA 5DBTA 5EMKA 4XD3A 3WQWA 5A69A 3LK6A 3GRIA 3RXZA 5AKQA 3CPRA 1M04A 3V3WA 3AJ7A 4AU0A 4DWSC 5IXEA 5G1YA 2ACQA 4FNQA 3UJFA 5C70A 2OLAA 1B1YA 3CYVA 3NWRA 1CXHA 1V0KA 3GVWA 4JQ1A 3VD4A 3C8NA 3MW7A 1AUSL 2OGYA 3NNTA 4GIRA 6A3HA 5T9CE 1VCGA 5CPTA 5E6YA 5CPSA 2YXOA 2AL2B 5KZEA 1WPCA 1JZ2A 4AZCA 1IT8A 3W82A 2ZZ7A 4S3KA 4QNEA 2EQDA 4JX4A 2PODA 3I3EA 3T0DA 3PNZA 2FGLA 2ZUNA 3MHGA 2B7OA 2DSZA 3EMZA 4ROPA 4KEVA 4ZB0A 3WLKX 3HPZA 1RP8A 3IVTA 5CH9A 5BYWA 2QAPA 4WGHA 4B5UA 4CQ9A 1P0DA 4UXDA 1T8QA 4DNHA 3OQEA 4MAVA 4IFKA 1XSJA 3VFCA 1JYVA 5CSSA 3QLDA 4R3UA 4JTEA 1QWGA 5F7UA 3GIPA 4TV5A 3GG7A 4LC6A 4PMUA 2EO7A 3K2GA 1UR1A 3AXIA 4JTAA 4NU7A 3Q45A 3KRBA 4DRSA 1W9PA 3EYPA 4H4IA 1DVJA 3IUDA 4DI8A 1U83A 2CXEA 4JNMA 5D04C 3IAPA 3E6EA 3SGGA 3JW7A 3WIJA 3C56A 5DY2A 2W92A 2VI0A 1FHDA 1WDWA 2FTWA 1QPKA 1T6MA 2PFHA 1ISXA 3KOZA 4HIBA 4HPJA 4W8AA 1L6GA 3W1UA 1RK5A 1RJRA 4M56A 3QFEA 1SJBA 2QDGA 3EA3A 2HBVA 2ABAA 2G5WA 2YDSA 5HDRA 3C6CA 2WW5A 4PMOA 1W3HA 2P0IA 2WKGA 4DM2A 5FF7A 4IG2B 1LORA 3R58A 4IP7A 3UW6A 1HL8A 4FALA 1JZ5A 4M6PA 3QBUA 2FPTA 4DJEC 2WNWA 3TW9A 3NCOA 3SBFA 1NDZA 3IUIA 1X7IA 2CLMA 3PZUA 1TPH1 1OADA 1WAWA 1FRBA 1JPDX 1EXBA 3T05A 2R1PA 4QP0A 1VCFA 1VF8A 2QF8A 1VPQA 5ABFA 4PTVA 3DC8A 3PZMA 2PMQA 4H7VA 1HNYA 3V4BA 4AD3A 2YOCA 5BXRA 3SCQA 3T4WA 3WBXA 4DBSA 5HQLA 3L65A 2CHNA 3NQGA 4GUIA 1X7FA 2XIIA 3ITTA 4AYSA 1YPFA 3TZFA 1VRXA 1JIBA 3S2MA 2O0TA 3GKAA 1D7FA 4HMCA 5I3DA 4HCDA 4JHOA 3FVMA 1F6KA 3WLSA 3TSBA 1NP2A 1MW3A 1VZWA 2Z28A 3VTRA 3G0SA 4CN4A 3URBA 2WLZA 4NZFA 1R3RA 3LGEA 4LUYA 2J7GA 4AIBA 3ARPA 4D6GA 1H2JA 3QRHA 4JIHA 2PWGA 1HW6A 3BK0A 3BLLA 1GQJA 1UUMA 5G1MA 1UH3A 3N2CA 2F38A 3QW3A 1M01A 3S1XA 4CCEA 1DIEA 1J11A 4YTUA 3W6MA 3B06A 2XFRA 3UD6A 1Y7VA 1WBHA 4FSAA 1OHLA 1RHCA 2DFAA 3DHUA 5E6ZA 2A7RA 2QGYA 4DN1A 4K39A 3L67A 3WQDA 1UG6A 2XH7A 3UA4A 7REQA 3LRMA 3UT0A 1VLWA 4F0LA 4ZQMA 2Q3OA 4L9ZA 3WD1A 1ZPTA 4BQ4A 3O05A 2WZMA 2NV2A 4RK8A 1UD2A 1SJAA 1V3JA 4GMEA 2VX7A 1V6YA 1XF0A 3TQPA 4NJIA 4O1AA 3H53A 1OQFA 3EMCA 3ONCA 3UWQA 2BLEA 2FFIA 3IJ6A 3UEQA 4Z2LA 3GR8A 4B2DD 1F8IA 4F2BA 2XN0A 5IBXC 4FLQA 4C1LA 3W1NA 4GVIA 5A6SA 2FDSA 2GGGA 2WV8A 4GJ1A 1HO1A 3WQEA 4M7TA 4JKLA 3CEPA 1A3XA 4LU0A 1XKYA 3MUXA 4GE8A 4KWVA 4O16A 3PSWA 2W4XA 3WLQA 1KC7A 1E4MM 4BWLA 3LN3A 4KRZA 3AXHA 4ILSA 1U2YA 5T8GA 1PPIA 3CBWA 4LB3A 3H2FA 4HJWA 1Z89A 3NPVA 1E43A 3F4VA 2C8NA 4H7ZA 5DRIA 4TXEA 1UKOA 4H6QA 5CAHA 5DY3A 4Z0JA 2EKCA 3LCGA 4JDBA 1PKMA 1VLIA 4KPLA 2ZX6A 1D8CA 3GBEA 4ERGA 1ZQ5A 3WNMA 1KGWA 4IQDA 2OQYA 4D8AA 3OIHA 3W0KA 1TWZA 4PMYA 4LVAA 3WF3A 1KFJA 4YYFA 2REQA 3CS2A 5AB3A 4ZB2A 2HNEA 3EX6A 5CBBA 3SRDA 3BQ6A 1O5KA 4IMEA 5K4XA 4PCTA 1I1XA 1NQKA 2R94A 1PSCA 2G3IA 2HJPA 5M03A 5FSEC 1RSCA 1HX0A 1LWHA 3AXKA 1MMFA 1BQCA 2V3GA 3TK7A 5I3FA 4Y96A 5DFAA 1EJRC 4MF4A 4MWAE 2C79A 2R14A 2VRKA 4Z1DA 4QFUA 3LTSA 4HK7A 3SRFA 1RA5A 4ZFMA 2BOFX 1PUDA 4Q4OA 2Y63A 3QOKA 3W70A 3BICA 4LALA 1EJXC 3MANA 3QFWA 1XYLA 2VEGA 1B90A 4IPLA 5B80A 1BF2A 1BFNA 1CGVA 1LYXA 2PLJA 2DZAA 2R91A 3AZRA 2HS6A 3UR5A 4R9OA 2DH3A 4O52A 3L5AA 1UR3M 2DDXA 3F5JA 2G41A 5E9XA 4D6JA 1KBJA 3E2VA 1K4GA 4PFHA 3Q4DA 2TMDA 5J5RA 4HSHA 3GXMA 4C6EA 4O17A 2Q8LA 4AEEA 4DO5A 1KFKA 1X1OA 3TYBA 2FDMA 2PU1A 1VEMA 4GUFA 3T09A 1R3QA 5KZMA 3F2BA 4R88A 1MEHA 5DRCA 3KCLA 4J2MA 5JBEA 5F2GA 4NYUA 1KKOA 1VFTA 3TYZA 1HFBA 1TZ9A 2DZVA 2Z00A 4UZUA 4B92A 3AZTA 4ML4A 3SFWA 4YTSA 2X0SA 1NELA 4ZGYA 2PDFA 3SY5A 1C3FA 3QY7A 1KFWA 1CDGA 4W7VA 4IQEA 3P3BA 2C16A 3RK8A 1D3HA 2DT1A 4PMRA 2DT2A 1GVSA 4JFSA 3U5UA 1CXLA 3GTFA 3DFTA 1FXQA 1GOKA 3B4YA 3CLWA 2IKHA 2EPNA 5E9AA 3UG5A 4UWMA 5D2XA 1LOQA 3G0XA 1I60A 3EWCA 3GNNA 2OT1A 4O54A 5D38A 4K36A 1C93A 2D0FA 1B4EA 1SU5A 1QNVA 5JMUA 2Z6IA 5I09A 1KFEA 1PX4A 2Q01A 4UQ9A 1CENA 4YJ5A 3E02A 1G67A 1HKJA 1YRRA 5FOOA 2RDWA 4LF2A 3DEQA 9XIMA 4J1OA 3TJIA 4P8VA 2GVLA 1FKXA 3QW4B 3WD0A 3SQSA 2CFFA 4OHQA 2CWNA 3UERA 1Q13A 2JKAA 1R2RA 4OECA 2OWCA 3B9OA 1V7AA 3VA8A 4V33A 4H6EA 4B2DA 2OELA 5LA1A 3UY7A 4C6CA 4YHEA 4QEEA 1GOWA 2GVYA 4JHZA 4AH7A 3IGUA 4I9MA 4HD5A 4NHVA 1E72M 2YDRA 4JN8A 4LJ3A 5HPOA 2X0HA 1PZ0A 1DKWA 2YL9A 2ZFAA 1W5OA 4CQAA 5JQ9A 2R9RA 2NV1A 3B0UX 5CEWA 3GU2A 4NRSA 3LCFA 4AEFA 4V28A 5GJPA 2YKKA 5CSUA 2PC4A 1ISWA 3VAVA 4MZYA 2J24A 4Z08A 3CTTA 3AHYA 3PPFA 4AHPA 3DYPA 1TRDA 2WVTA 1LBFA 2YLAA 4IGSA 3AWNA 1VKFA 4GQBA 3TC6A 1O95A 2I1OA 3T0BA 4LXFA 2GOUA 3ITGA 4PUNA 1HN1A 3UXLA 3KL5A 3ALGA 1BAGA 3ARRA 2WB5A 1SM9A 1RBAA 3N12A 5D2TA 3UQNA 1FH8A 3SJ3A 3LHYA 9CGTA 4CNOA 5E0FA 2Z1KA 2OSWA 4GYPA 3GHTA 5HNRA 3VKAA 5HNUA 1EJSC 5EMUA 5LIWX 3V16A 3UVAA 3MHFA 2YYTA 5H8UA 2X05A 4K6AA 3N13A 2YDAA 3HGSA 2BODX 3UXKA 2E28A 4REQA 2BG5A 1UC4A 1MDLA 2HVMA 3E0WA 2NT1A 3RNDA 3KWSA 1UCWA 4C7DA 1W5QA 1EDTA 1JVNA 5EL1A 2FZ8A 3QLLA 1H1ZA 1GZ1A 2NQLA 2GUBA 1RD6A 2WM0A 4LSBA 3CPGA 3EOEA 4C6BA 3W24A 3OBEA 4F4RA 3MPGA 3N6QA 3OLEA 3LEPA 5ABEA 3WD4A 2O4QA 1TVPA 3L4TA 2GVEA 2D2HA 2B7PA 5C55A 2P3ZA 2WZHA 4KWWA 1JI2A 1AZ2A 2QMJA 1SPQA 1DWJM 4ICNA 1KW1A 1UHVA 2J8FA 3U3HA 4GZJA 3MZ2A 4RJEA 4FIRA 4D6FA 3VMPA 3ZFHA 1Q6CA 3ARVA 1A3HA 3B9DA 3TN6A 3R7MA 3SW6A 4QE5A 3N17A 1H1NA 1XD0A 3CAVA 3ABQA 1YE6A 4RUBA 3MZNA 3A3HA 2J8TA 4N9EA 1W9BM 4GNKB 4KEUA 3E12A 1Z9AA 3DOPA 2ISFA 5BXSA 2HROA 3TXZA 4W9TA 3TLLA 5EMMA 4UTMA 5I3HA 2PRHA 3WUFA 1BYDA 3NOEA 3HFTA 1J0KA 4Q8TA 4B15A 3S46A 4GQQA 2UWFA 3W9ZA 1JULA 5ABFB 3NL5A 3VDBA 1SYTA 4O10A 3G1RA 1OFPA 4P5UA 3ZMRA 5LNRA 1E56A 4OKDA 3N04A 3TV8A 3D46A 1S2TA 2GVJA 3GY1A 3EX3A 4FOKA 2J78A 4Z1AA 3JVAA 3DFHA 3QQWA 3PTQA 4Z1BA 1OEPA 1KQZA 1ITCA 4EPKA 3VIJA 2GQAA 4J7RA 4MLJA 4XUGA 2X16A 1OFEA 2ZZ4A 5AHFA 2V2HA 1J18A 1MNSA 2J27A 1QI2A 3AZSA 4E8CA 1BXBA 4Y9MA 3OA5A 3W26A 3TWBA 1JPHA 1R3VA 4ORMA 5AN7A 1POKA 5FF2A 3R89A 4DLFA 1FHLA 1GPFA 4UFKA 3G18A 3LY0A 3N25A 3E96A 5AC6A 3FAWA 1Q3NA 3DESA 4XZIA 2R1LA 3M5YA 5JVLA 4QRNA 1UR9A 2XGIA 1FDZA 3HG2A 2HZGA 4LQ1A 2A3CA 1TQXA 1RK6A 4LAUA 4Y8EA 4MB1A 3TFCA 1R8LA 4PYSA 3MQTA 2ZUTA 1R7AA 3QH2A 4X9YA 4NI3A 4JAWA 6REQA 1PDZA 2DU2A 1CI1A 4N2YA 5ABHA 1JF6A 3TTEA 3NGFA 2NXIA 2WMJA 3BG5A 4YMZA 2Q6ZA 3W3OA 2E9MA 5CQ1A 3AIEA 1F61A 3TCSA 5JH1A 3NXLA 5REQB 3SN0A 5LA0A 2OWXA 1G69A 1OX6A 3I68A 2YDQA 3L5MA 3ES8A 3BMVA 3IJ7A 4L61A 3N19B 4C1NA 1W2PA 5LYRA 4NJGA 4W88A 3VKKA 3SI9A 3CC1A 4U2ZA 2ZA3A 2I17A 3WBWA 4BEUA 1O1HA 2QGHA 3VE9A 3OZPA 3LV5A 1E0VA 3IJ8A 4LYKA 1IZJA 3MJYA 1O12A 2XDFA 2XFWA 5JBDA 1J0ZA 1R46A 3TTQA 4CU7A 1BYBA 4PH6A 4Q7NA 1JGMA 4QX4A 2BFGA 4XZMX 1J5SA 4ZTXA 1UP2A 1EHNA 2YYUA 3RCMA 2YFNA 3H4GA 5GPRA 1ODUA 4W87A 1F07A 3CGTA 1EUNA 1TV7A 4DUVA 3VDAA 2CCRA 4EXBA 3UZJA 4W7UA 2HK0A 1P6BA 4JTLA 4MLRA 4XVEA 1OFQA 3WK2A 1P48A 3C2VA 1LBLA 1V08A 3U2OA 2O4MA 1FA2A 1EJUC 4ML9A 3IIVA 5BRPA 3EDKA 1KXTA 4XTIA 1XLBA 1AG1O 3E2RA 3G1SA 4J40A 5I03A 1XBZA 2YPIA 1TELA 1TO3A 1ZAJA 2DUZA 3CO4A 3D3FA 4HJFA 3TAOA 4LVGA 3PBMA 4YCOA 2C19A 2KZHA 3K30A 5AY7A 2CLHA 1W3JA 5CPNA 3R43A 4UTHA 2IPJA 4P7OA 3AIWA 5AC5A 3TR9A 5LNVA 2A3LA 2RGMA 3CUHA 3O3RA 1MDRA 5BU9A 6ALDA 4OOZA 3QQ0A 8TIMA 5HR6A 4PUKA 2KX9A 4XBKA 4HN8A 3NQ8A 3KL0A 4GQRA 4ZOEA 4DJFD 1ICQA 4N4PA 4WOZA 3CQKA 2VDHA 2WBGA 1FH9A 2QPUA 1DJWA 5LGZA 2FHBA 2VR2A 1J8VA 3B9AA 1A5LC 5I24A 3UF9A 3EB3A 1W56A 2Z1VA 4F9DA 4KWSA 3WLHA 3BLPX 4KWOA 4LUJA 2HTMA 4K7VA 1LWJA 1K8YA 1RV8A 4PZVA 2Y5SA 3LLFA 3DN5A 1UMLA 3VZZA 5D9PA 4O0QA 3RRAA 5DEZA 3CL7A 4HA0A 1Y5VA 2FYMA 3GR7A 3C0SA 2DIKA 1RD5A 1N8WA 1AD1A 2J7HA 3P0WA 1K7XA 2CBIA 1X1NA 2X41A 4ZO6A 1GCYA 3P8IA 2V67A 3GQYA 1S5NA 1DJZA 1E9IA 2E6AA 4RV3A 4O1DA 4A2RA 4GLEA 3TX9A 2ACSA 3F7JA 2QMKA 4LAKA 2WOQA 4U3AA 3EX4A 3H26A 5K7JA 3BAWA 3QTGA 4PB3A 2E25A 3GNXA 1XLAA 2MNRA 1O68A 5D37A 3SADA 1OX4A 4M1RA 1T41A 4QIUA 1A5SA 5HUPA 4DVOA 2AQOA 2PDWA 2DP3A 2DSKA 3GG8A 2J8GA 1F3XA 2VFDA 4RDWA 3TSMA 2HRWA 4XTDA 1XV8A 1GYMA 1UBPC 1EP3A 4I90A 3LUTA 5KZDA 4ZODA 3FNDA 3E2SA 3E5BA 4XKYA 2NQZA 4GPNA 1VFHA 1K7FA 1E0TA 2G3FA 1GG0A 4U10A 1W1IE 2H8XA 1MRQA 3G2GA 4M5PA 4JHMA 3DFQA 5F2MA 2E9LA 2YSWA 2VGFA 1AW5A 3AMGA 3NDYA 2E4TA 3WL0A 3N6JA 2Y8UA 3G24A 4OQVA 1CECA 3VK5A 3FDGA 1DIDA 4XG1A 3L68A 3IRSA 2YL8A 2ICSA 2OZ8A 3L23A 5EB8A 1FHUA 1DXIA 1AL7A 1Q2SA 1UC5A 2G96A 1QATA 1PWMA 4TV6A 1SFTA 3B0VC 1TPFA 3VKJA 4PUMA 2XM2A 4GNJA 3NSXA 4YWSA 1TZZA 4IPIA 1FDYA 2R24A 3QPYA 3RJXA 2PCQA 2WVSA 3WF1A 3WZ0E 3NO1A 2WCSA 1NF7A 1U5JA 1VIZA 2I5QA 1PTGA 3LTYA 3K4AA 4F9JA 3PZIA 2NVCA 4BZYA 1E5NA 3APYA 1UWIA 1EHAA 4DWDA 1LRQA 3LXCA 5EFDA 1XLGA 3NR0A 3FHAA 3G22A 4ZTYA 1POJA 3LHVA 4S2CA 1P0KA 2OZ0A 1S2WA 3CYJA 3KE0A 3CB3A 4X61A 4X60A 3LHTA 3KDOA 4DBUA 1TV2A 2Y88A 2EPOA 4GQGA 2NXGA 3WFZA 4O1EA 4AD5A 3SUWA 1OT2A 3WQFA 3ES7A 4B91A 1RBOB 1B3OA 4QS5A 3A22A 2DORA 1A5OC 4GUHA 2RKXA 1OC5A 1WAUA 3O9NA 3ZZ1A 4P8WA 3KRZA 2OZ3A 2VNCA 2WNNA 4DWSD 1V02E 4LVBA 3G77A 4DYKA 4JYEA 1SUXA 3BDKA 4H00A 3CIWA 2BY3A 3N14A 3STEA 3VX0A 1EDGA 2Q09A 3FV9A 3NQAA 2V5KA 3W27A 1OT1A 1P7TA 3OLDA 3CEUA 1S5MA 3AI0A 1ITUA 3OBAA 4RE3A 3W7GA 4HNVA 5DMYA 1XXXA 4WY0A 3UWUA 2VX6A 3AYVA 2D1ZA 1QDSA 4WSKA 2O9TA 2QVHA 1QHOA 1AJZA 2E7FA 4L80A 5AC7A 4PGLA 4FO4A 4AD1A 1HIZA 4MM1A 5F2LA 5IDIA 4CCCA 4CNUA 1UZ1A 2VZVA 2PDYA 4S38A 3MMTA 4TQTA 1MW2A 5CZSA 4LV4A 3GWQA 3R11A 1H51A 2BGSA 4DM1A 1AH3A 1I2OA 4DUXA 5CZKA 2JKPA 2G8ZA 1I2RA 3NGJA 5AFDA 4IHCA 4WJ8A 4K8GA 6CGTA 1WP6A 3FSUA 4LCRA 2ASHA 3AFBA 3PTDA 4LY4A 4XAYA 2ZX5A 3NZQA 3W2NA 3BLFA 4H41A 2POZA 3L0GA 1HP5A 3VNLA 3FDKA 4G2DA 2V5JA 4KCWA 1TJ0A 2R6OA 1UQYA 4N9DA 4E6MA 2EPKX 3DFSA 4Q22A 3ABRA 2ZOXA 3N9SA 4OUIA 3QHOA 1BPLB 1KXQA 4RW5A 3LMZA 1DE6A 4URIA 4CD5A 4LS2A 4O0KA 3NZGA 5FESA 1IEVA 3I3DA 2BBFA 2J6XA 5HUOA 3WX7A 1A5UA 3GHRA 3JZEA 1XIEA 4U5IA 1QNQA 2DQXA 2JGQA 3KVKA 3NOYA 1FWAC 4QSFA 4JN7A 1QTWA 1FWEC 2WVVA 4N9BA 4J3SA 3OTRA 3MV11 5D9NA 4ZOBA 5BWFA 2XIOA 3BLKA 4DQWA 3ENLA 3KAOA 1IXNA 3ISIX 1NSJA 2HK1A 3NL2A 3LX9A 3BTNA 5AYIA 4BWLC 3UR8A 1LP6A 4Y7EA 2ON3A 1H7RA 1IE7C 2GK1B 1TPC1 3SY8A 1DWIM 1V03A 2TPSA 3S5YA 2XVPA 1Q5MA 1ZS2A 4WOQA 3VPLA 1N55A 2VL4A 5LHEA 4EF8A 3FXGA 4RNHA 4D2JA 3VXGA 2YBUA 1WE5A 2OEKA 2Y5JA 1LT8A 3NQDA 4P8UA 3DBPA 4JTHA 2VELA 1XGEA 1R9XA 3VIGA 1UZDA 4WDWA 1L2QA 1SZNA 2G95A 3PAJA 2WCAA 4UMCA 3PJXA 3AHVA 1PHWA 1F8MA 1KBKA 1QT1A 2PDHA 3S6TA 4GY1A 5C0QA 1E3ZA 2FTYA 2WMIA 2ZXBA 2CLIA 3TQVA 4CVWA 1AL8A 4PUUA 4LB4A 3GVQA 6ENLA 2A3EA 2XVLA 3PANA 1B54A 2PD5A 4Q8WA 1ME8A 5AZ1A 3GNRA 1SJCA 1QOPA 4EOUA 4NZ4A 1QI3A 1S38A 3N1AA 3G6MA 1Q8JA 1BD0A 1EDQA 4S3AA 4TMBA 2BASA 5CGTA 7PTDA 4UNKA 3L0NA 4RCXA 3LNMA 2F61A 4J3UA 1HGWA 3NDZA 2PF0A 1ICSA 3H55A 1NIUA 3OVRA 2W66A 5AYXA 4K68A 3ZS4A 3E0FA 1YNYA 3TTOA 4CD4A 4G6CA 1Q7QA 2Z1WA 4UFJA 3W71A 3O16A 1ZJAA 3ORWA 1KO0A 4ATDA 4JOMA 4AY1A 2QYGA 1S2VA 7ODCA 4F0SA 4DYEA 1FX6A 1LL7A 3UBPC 3DHDA 1BRLA 4GZIA 1SR9A 3GC4A 3IJIA 5FJRA 3HQNA 3QSTA 1N82A 2YA0A 3CPUA 4HKPA 5CPOA 4YTRA 3DG7A 3O15A 2FQIA 1BYAA 3CAKA 4C6QA 4B5WA 1L6YA 1YBQA 1AW2A 1UWUA 2PDQA 3M41A 1TMHA 3TNOA 2VX4A 2PLKA 4GCXA 5FEPA 3VI2A 4XBSA 3ZIZA 1OX5A 3BLOA 5DCBA 4ROQA 4AWTA 3K8LA 4NXSA 1AMYA 2F6XA 5A5WA 4WEVX 1R86A 3WJZA 5LIXX 3KP1A 1JRCA 3CASA 3DERA 2JEQA 4FNPA 1EO7A 3UWEA 4KESA 3DUGA 2PPGA 2FGBA 5AVNA 4MWAB 1QW7A 3AUJA 3GXIA 3T81A 3WDRA 3S83A 3TOYA 1OVDA 5BXPA 3ABZA 2F6KA 1XSKA 3HIJA 3C2OA 2FVMA 3LDVA 1ZLPA 3WEOA 1RP9A 2DZUA 4LF1A 3AHTA 5I02A 3OLGA 3LQLA 1ZBVA 1Q6DA 3T8LA 2WJDA 2VWSA 5EYWA 1S2UA 5F4WA 4W7WA 4F0MA 5TD4A 6XIMA 3GIYA 1Z48A 1HKKA 4EPBC 4LUSB 2PB1A 2A85A 4O8AA 4FF7A 4IMGA 2DUXA 4DX3A 1J79A 2CLPA 2F7FA 2GQ3A 3PS7A 5MF5A 1YNPA 4IFRA 3ZT6A 3LI0A 1V6TA 1IT0A 1KBBA 3LXBA 4FIQA 3BMXA 2GJXA 4J3TA 3SCVA 4PUDA 3W88A 4PA8A 3R79A 3AMCA 4WQ6A 3TA9A 3T44A 2DPEA 3L21A 5KMYA 4BI5A 4FK9A 2EXOA 3WBAA 3MKKA 4QAWA 2YBVA 3O0FA 1G94A 5H8PA 3L4UA 2QR6A 1ZP4A 1LBMA 1UKQA 2QVNA 5D2YA 4HNUA 1BXNA 3AMLA 1IZCA 1OCJA 3TYDA 4LBSA 1MWOA 1BVWA 2BOGX 5DT7A 1K7EA 1CZ1A 1L2UA 2OQHA 3T55A 2Y24A 3GYCA 1JCMP 1ZBKA 1OX4B 2QPSA 1L8NA 3ATZA 1TRIA 3M0KA 1NWUA 1W5MA 4RX0A 3WG6A 4Z1CA 4DPPA 2J74A 4LBUA 5CC3A 3T7VA 2FJUB 4I5RA 2PWEA 2Y7FA 1MYRA 4GWEA 4MKNA 2F2KA 3F1QA 1DQXA 3AAMA 4Q4PA 2JGYA 3WL1A 4HMDA 1QCWA 4AZ5A 2QJMA 3FYYA 1EJTC 3WLOA 2VJXA 1FWBC 4DXKA 3BANA 3WLRA 2XVGA 5A6TC 4GYPC 2JQXA 4XX6A 3FN9A 1N2VA 3OPSA 3HJEA 2HPMA 3OYZA 2I5GA 5LXXA 3KCOA 1O5QA 4WCJA 3UJEA 1B2YA 1GK8A 1VC4A 4GQ0A 1N8FA 3BOFA 2ZA1A 3QKZA 1R38A 4CEUC 5CLTA 4PMZA 3CMGA 2ISDA 1IEIA 5AHIA 4LRTA 1FQ0A 5HJXA 4LYRA 3SCSA 1XICA 1JCTA 5KZ6A 5EMLA 2Y7GA 1ZNNA 1XH1A 2Y1HA 1GVRA 1LT7A 1HL9A 4DI9A 4HNTA 1XM3A 1UJPA 1E73M 1JFHA 3EKGA 4PL1A 1GKQA 1FCQA 1RPXA 3ABXA 2VZSA 1H49A 2XWDA 3VM7A 3AIBA 4L6DA 2XVKA 1EZ2A 5HMEA 2INFA 4CD7A 3GBDA 3P80A 4E2DA 3MUZ1 2FZ9A 2P3EA 5JH2A 4YTQA 5C8BB 5EPDA 5K9DA 3WJYA 3CZEA 1M7OA 2Z2UA 1FWHC 2FHFA 2B81A 2YX0A 3DZ1A 1JD9A 1YX1A 2QJNA 3DX5A 3WQ5A 3AMDA 4BF9A 4M19A 5AYBA 4H9XA 1R87A 5TF0A 3R1ZA 1E15A 3SIMA 4IMFA 3W01A 3HV8A 2P88A 2QW5A 5F1VA 2ZRVA 4XB3A 1SJDA 2WHJA 3W2LA 3WQ8A 4UTWA 4B16A 1K9DA 1W5NA 3CHDA 3M46A 3QR1A 4BHYA 3P84A 1UZ4A 1TREA 3CWNA 2OKTA 3INPA 4CN1A 4Q8VA 3T08A 2OYMA 3TYEA 2GGHA 4HNCA 2ZE3A 1TMLA 4XD4A 1KBLA 3PBYA 3TVAA 4US5A 7TIMA 3QKEA 3VC5A 2OJPA 3AS0A 4IX2A 2Y0FA 5A6AA 3QPEA 9RUBA 2XYLA 3WEMA 1IF2A 1IWPA 1F7BA 4GFSA 4H2CA 3CJPA 3HBLA 1LLOA 3W1AA 3HPXA 2VOMA 1A5NC 1MW1A 4BI7A 4X3ZA 3UXIA 3AMKA 3DFOA 5C71A 1TE1A 2XIBA 2PLMA 4FXFA 4PMNA 3SAZA 3XIMA 3A12A 1TX2A 3M7WA 3FXYA 3PTMA 3NL3A 3TCEA 6XIAA 2Z1XA 2X1RA 2PDMA 3P62A 2B7QA 4CGTA 3FW6A 3T1GA 1EGVA 4AF0B 4XZHA 3R0DA 5ABGA 4JTIA 1XCFA 4TMCA 1Y0EA 5CAKA 4XIAA 4PB5A 2HNHA 1K03A 3M0JA 2XFFA 1JG9A 5HNTA 1OFOA 3L4VA 4HU4A 4Q6XA 3ZR4A 5CC6A 4GVGA 2WJZA 3D0CA 1QASA 3KOXA 2DV0A 1AFSA 2XSAA 1UD8A 4UOZA 1H5VA 1R5YA 3VOFA 1FBAA 2QCDB 3BURA 3FJLA 3W83A 3G6LA 5I77A 3B97A 2B31A 4M51A 3HQPA 1BGGA 3LYEA 4MJZA 4LCSA 2GWNA 4WKAA 1TVNA 4ES4A 2YCJA 4QEHA 4R7JA 5LNUA 3S1UA 4FR6A 1XH0A 2HDJA 2CZ5A 3QC3A 3ITLA 3OEXA 2BXZA 2GSHA 2HQAA 3GDBA 5CC7A 3G8EA 2IPGA 3AOFA 2IKGA 1S5TA 3U48A 3ERPA 4Q8QA 1OWQA 5DF0A 1I2NA 3G3DA 4NASA 4ADSA 3GDRA 4C6LA 1NWTA 3C0QA 3WENA 3TYCA 3EWXA 4PSRA 4C65A 3T07A 1QWKA 3P8JA 3D6NA 1M7JA 4OV4A 4QDMA 2Y70A 2G3JA 4RLIA 4MY9A 4DPQA 5I06A 3DGRA 3RR1A 3HPSA 5SWUA 3UYCA 5HNNA 4EPDC 3AS3A 4X2RA 4DZAA 3ZR6A 4H9MA 3RG6A 2AL2A 4B3LA 1PS9A 2PBOA 1OC7A 3BAKA 3HA1A 1UR8A 3AIQA 1DWHM 1QK2A 1WKFA 2GOKA 2E0PA 3DAQA 1XIHA 4XSMA 2E8ZA 4ZO7A 3FVDA 4KRUA 3PZQA 8A3HA 4F0KA 4QTGA 3QXBA 5BW6A 1OZQA 3EOOA 3MI2A 3PPGA 4OIFA 2HEJA 3B9NA 4GXPA 2BVTA 3NQCA 1C92A 2V82A 4INFA 1SSDA 3ZQ9A 3BARA 3N73A 2Z1SA 4DYJA 4GCAA 1ME7A 4JD4A 2FLIA 4AC1X 1WNOA 1LZOA 3SCNA 1U1HA 4FR1A 4JTCA 5DBUA 4A3QA 1O6IA 1NFBA 3VIFA 2ZUUA 3R94A 4FEZA 4ZENA 5FL1A 4F66A 3OVQA 3ZO9A 2RDUA 3ANYA 2P0OA 5DN1A 1GZGA 2PTXA 3ZLGA 3QZEA 4CD6A 4PMQA 2YCLB 1E6ZA 1PX8A 1HJVA 5TBOA 3IVSA 1NDWA 3PNUA 4ACZA 2YL5A 1E6PA 3B8TA 3A5VA 4GG9A 1FWCC 5T26A 1Z44A 4NZ3A 5C2GA 5I23A 3IJLA 5BOEA 1BRLB 1OD0A 4F2TA 3VIIA 3OP2A 4HPGA 1BQGA 2Z27A 1QW9A 4IG2A 1O4UA 3MWAA 3NA8A 3CQ0A 4ZXLA 1TIWA 4ZQCA 1G4PA 4JICA 3KZSA 1TPUA 1XH2A 1RLDA 4EAMA 6TAAA 4E8DA 1QPRA 1AJ2A 3H70A 5DT5A 4NSBA 3PZGA 4I9JA 4M6VA 3GDLA 3SCUA 3W86A 1EUAA 4D8ZA 1UWAA 2C71A 1EXPA 1OF8A 2FZDA 2XWEA 4DJDA 3F4CA 3MCOA 2IQ0A 3LI1A 3EB2A 1EYEA 3S2NA 2GL5A 3L12A 4Q8UA 3GG0A 1W3IA 1WX0A 1E9YB 1Q2RA 2P5NA 4JS3A 5G4HC 2QCNA 4LCQA 2QF7A 2IQTA 3WQ6A 5KEZA 4MNKA 2Y62A 3THAA 4AZHA 1DXFA 1G0CA 2VFGA 5DQPA 2D3LA 2VC9A 4DZ5A 1Q85A 3IANA 3A13A 4J2PA 2HSAA 2YW3A 3OO2A 4HNOA 3GE7A 3O63A 3M6DA 3FJ4A 5A2BA 3SCTA 5HATA 5D05A 3TOPA 3HFYA 3T2PA 2PP1A 5H2ZA 1CGYA 1ZRQA 4YS1A 1S3HA 2CLEA 3EXSA 5I78A 2BGQA 4D6DA 4XO6A 5DXYA 1IR2A 1FWDC 4EP8C 3NPXA 1LL6A 1E40A 1Y5XA 3HU7A 4Y8FA 1QBBA 2L5HA 3FJNA 1B3ZA 1XPYA 4W5ZA 2GJXB 1R9ZA 4BS0A 1DXEA 1IR1A 3KOYA 1U5HA 3W37A 3NZPA 5CZJA 4HA1A 3VNKA 4NXKA 3WD2A 2QKFA 1FWTA 4A3YA 5A2CA 4IP5A 2QUTA 5AZ0A 3TKFA 3STGA 3UG3A 1KR0A 1M41A 1M5WA 5HINA 2ZDSA 3WQGA 2AQWA 4PSPA 2OYKA 3L2IA 3VKBA 1JDCA 4DBEA 5HAOA 4BQ3A 2VQUA 4JYFA 2DJLA 1L6SA 4KCUA 1CB7B 4CCZA 5BRQA 3UCCA 2WZEA 2PDKA 3ZT7A 3A3WA 2Q8XA 3UPMA 3HG4A 1O60A 3CXOA 4XD5A 4XAPA 4K7YA 5HWNA 1PO9A 1XFBA 4GGBA 2X7WA 1SO6A 1V7YA 4KEMA 4AXKA 2PDXA 4YVXA 3UVIA 4TX8A 4M82A 2ACRA 1O5XA 3BLEA 2BY2A 3KDNA 3TTSA 3NDOA 2B0MA 3N4AA 1L6FA 4J28A 1CCWB 1UKSA 4P2VA 2ZA2A 2ADAA 2PBGA 2J6VA 2YLLA 4M24A 1XUUA 4JQ2A 3N6HA 1WDRA 3V0UA 1HTIA 1XW8A 4F48A 4JIIX 3POHA 3SSJA 4I8DA 1X39A 4GXWA 4HCHA 3G1HA 1BWVA 1ITXA 4WD0A 2C15A 3WNLA 2FPYA 1R47A 2DVTA 1TYGA 5J04A 3PK7A 4JKMA 4HOZA 3R0KA 2XIJA 2YIHA 3N2XA 1J93A 2CLFA 5C6MA 2PURA 2QV4A 1NOFA 3AWOA 3O6CA 1ONXA 1EPXA 3IRDA 3AU2A 1MZHA 3PZVA 3HPFA 4EACA 2FJKA 1H09A 1XDLA 5C2XA 2GSEA 4JFTA 4H04A 4MDPA 4U4MA 4HHLA 3HGJA 1SO3A 2Z26A 1TTQA 3SN4A 3U7BA 1B0IA 5E5CA 3TR2A 1HJWA 2V0TA 1S5VA 4NT0A 4HP5A 1KA9F 2CHOA 3GH4A 1XJBA 5CSRA 1IGSA 2PRMA 4M8UA 4WUIA 3GR4A 4MADA 1YXDA 3UGVA 3CHVA 4JFVA 4MKVA 4A8RA 2A3HA 1ALDA 5C9WA 3AIRA 2EPHA 4GKTA 3B0PA 3N2BA 2BHUA 4NI8A 4NL1A 1S3TC 3CZGA 3W7QA 3EX1A 2J77A 2WKJA 4IH3A 4Y6GA 2V30A 5FF4A 4IJCA 1JZ7A 1KLZA 1QHPA 5GNZA 1NP0A 1XYAA 2OCZA 4QG8A 2Y4SA 3T0CA 4IMAA 2X30A 3HTWA 3OGVA 1IHIA 2NWRA 3CHEA 1W9DM 1WDQA 2V3EA 1NQ6A 1D7KA 1T96A 1VJSA 4PBGA 1TCDA 3TQKA 1LROA 1KGXA 4HOXA 4C6IA 4UUIA 3PPHA 3D47A 4PEEA 5HA7A 2BOEX 3QHNA 4NQ1A 1W17A 4LW7A 1YDYA 2VGIA 3GW0A 1UWTA 2VFHA 3E49A 3GHUA 3N15A 5C7HA 2NXHA 1A47A 4TVDA 1SR0A 2J47A 1X6LA 3O06A 1ZJBA 5EKYA 4QLJA 3W1RA 1WZMA 4WY0F 4JIQA 1KM0A 1ENUA 2V81A 1C7SA 4GC3A 3WLLA 4FAMA 1W3LA 3MDUA 1W1ZA 3SQLA 1FCBA 1WQ5A 2Z6JA 1AQFA 2WHMA 3QZAA 1RQEA 5A8PA 1CLXA 1JPMA 2WQPA 4CKQA 1EF3A 4IIEA 2PDIA 1ZU8A 4GGHA 4B5SA 2ATSA 1SW3A 1DP0A 2WSQA 3KVLA 5AHLA 4BF7A 3NM1A 3KOWA 1EBGA 1E1CB 1TZ7A 4XISA 3THDA 1OIMA 2YA1A 2CC0A 4CNNA 2CW6A 1C8VA 4FI4A 4X2PA 2QUMA 3EDJA 1KB3A 1RVGA 4RE0A 4IT1A 3GO2A 3W7DA 3M7SA 1HGYA 1NTHA 1RVKA 5B7YA 1W1A1 1ML1A 2E68A 1KR1A 1UR4A 3DG6A 2CZEA 3H2AA 1RH9A 3EOUA 3AXXA 1PEZA 4LT9A 3BOXA 4AMCA 3QQ1A 3H24A 4AD4A 3N2OA 3WF0A 2O56A 4W89A 3O8AA 2DY3A 2ESCA 4NZCA 2XJ7A 2AAMA 1E0UA 4K37A 5IHSA 3NFUA 1GOIA 8XIAA 4MAZA 4H6KA 4GX8A 2FMNA 4Y9PA 5MKGB 4IXHA 4YTTA 1OGGA 4GYFA 3IJ9A 2ZXDA 1VJIA 1RR2A 4M1BA 3FFSA 4H2HA 3VIHA 1W5PA 1EX5A 1YNQA 5K3VA 1JI1A 4EF9A 4EVZA 1UPMB 4PTXA 1R0MA 2UZ9A 1S5WA 1KBIA 4RDZA 1EEPA 1OFAA 1V3HA 4UTFA 1PZ2A 4NAFB 1A80A 5TAOA 1F5ZA 2XINA 1Q63A 3BG9A 3P67A 1ZJHA 4GI4A 4UFMA 1JZ3A 3C2YA 4FOUA 5TQLA 3WK1A 2BVDA 3W84A 4J4KA 2QS8A 1S39A 4KGJA 4JTDA 1UASA 1XQLA 2J7CA 3CUJA 2PZ0A 4A6GA 1ME9A 2OOGA 4ECLA 5CCZA 3M5VA 1C91A 5A8OA 3VD3A 3LM7A 5GNXA 1LQ0A 4UZSA 4DZHA 3F4NA 4M80A 1KCXA 4HHPA 2VT0A 1Q8AA 1TJRA 3DHFA 5U4NA 2Y5EA 4GA8A 3A64A 3H2NA 4WRHA 2HE8A 2J7BA 3GXPA 3OZOA 1GOMA 4JZ5A 3U7VA 4MYAA 1UIPA 3W1MA 4BJHA 4MOZA 1R2SA 5L6UA 2Z1BA 4HK6A 3H4WA 4JKKA 1US3A 5FSDC 3S9ZA 1VCVA 5DELA 2EHHA 4C91A 3E9AA 3W23A 4JTFA 4XBJA 3GZ3A 3WH9A 3UJSA 3HJZA 1NF0A 1DJQA 3AS2A 3ZT5A 3EA1A 4JX5A 3W7EA 3NQEA 1OZMA 3U9IA 3II1A 4PTNA 1VENA 4N42A 1WDDA 2EEXA 3IV3A 5F4XA 4AHQA 1HT6A 3UWZA 4ACZB 1VYPX 1LUCB 5M3WA 3MS8A 1K77A 3MDWA 4NF7A 4KS0A 5XIAA 3M5XA 1KM2A 3JR2A 2F8QA 1QUMA 3USZA 1IEWA 2CKSA 4AIOA 4A3HA 3CZJA 4FNRA 2HS8A 1KWKA 1QNPA 2NLIA 2PDLA 2XSBA 3G1FA 3VDHA 5CZTA 1ZHAA 2D22A 2NV9A 4KW2A 5HK4A 3QSRA 3RM8A 1W1VA 5KINA 1JR1A 3SGZA 3URQA 1W31A 2TODA 4LAOA 1FWRA 1W6TA 3WO8A 4V15A 4WSJA 4NILA 5HPCA 3V0TA 1W0MA 1LQ2A 1XBXA 3WH8A 5IRPA 3THCA 2PAJA 1T8XA 2ANUA 2OSYA 1DL3A 3FKRA 4NZJA 1UOKA 4FMVA 4QITA 1FWSA 4RNFA 5BROA 1Z3NA 3VOJA 4HT3A 2ISVA 3I4EA 2A6LA 2OLSA 1PB0A 5MHBA 3KM8A 1LRTA 3BJSA 1XS2A 1AK5A 3TDFA 1REQB 3WMCA 2YL6A 4I9TA 2CIPA 3W1QA 4FLOA 4K3ZA 3PJTA