5FOOA

6-phospho-beta-glucosidase
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
463
structure length
463
Chain Sequence
MLAFPKEFWWGGATSGPQSEGRFAKQHRNLFDYWYEEEPDLFYDYVGPDTASDAYHQIESDLTLLASLGHNSYRTSIQWTRLIDDFEQATINPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQAYGGWESKHVVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYLMQFHYPAIVDGKKAVQVAYNLALATAKVIQAYRRGPAELSDGRIGTILNLTPAYPASQSEADMAAAHFAELWNNDLFMEAAVHGKFPEELVAVLKKDGVLWQSTPEELALIAENRVDYLGLNFYHPKRVKAPDAIPVISPSWSPEWYYDPYLMPGHRMNVDKGWEIYPEAVYDIAIKMRDHYDNIPWFLSENGVGISGEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRPKASAYWFKKVATHNRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemoenzymatic Synthesis of 6-Phospho-Cyclophellitol as a Novel Probe of 6-Phospho-Beta-Glucosidases.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
molecule keywords 6-PHOSPHO-BETA-D GLYCOSIDASE
total genus 194
structure length 463
sequence length 463
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5fooA00
3M6DA 4AISA 2O9OA 1JYVA 2CETA 3M07A 1GQIA 3T2QA 3S6TA 4JCMA 4W87A 1EOMA 1GOOA 4ACZB 3BAXA 5C70A 1WZKA 3VIGA 1EXPA 4QP0A 4BZYA 4UR9A 4AZIA 2WZHA 3KL5A 1MW0A 3AXIA 2V3FA 4KRUA 3FXYA 1E56A 1KBBA 1KBKA 3NJ3A 3PZUA 2VZVA 3WNKA 4XZWA 4F8XA 2XVGA 5D9PA 3F5KA 1JYNA 4M81A 2XGIA 3WNNA 3WY1A 1V3IA 1OGBA 3OZPA 3PBGA 1CXHA 4C7DA 4TOQA 5BRPA 1JL8A 2VRKA 1HP4A 4CU8A 3CZJA 1ISVA 1LWJA 5BXPA 1JZ3A 2FH8A 2C8NA 3G6MA 1QI2A 4OJYA 4D6CA 3WDQA 4IPLA 2YKKA 7A3HA 3NUKA 2J62A 3AHVA 1NWTA 4RE3A 1EA9C 3N12A 1UWSA 1MFVA 1UR4A 1XCXA 2EEXA 1PIGA 4PSRA 4NRSA 4P7NA 3THCA 4WSKA 3FN9A 5A69A 1W9VA 2C7FA 3CO4A 4D6DA 2QHAA 4J3VA 2CKRA 3WMSA 4W88A 1JZ5A 2XSBA 4BQ3A 2J78A 1UA7A 2JIEA 2FDMA 3APGA 4UZUA 2JIWA 3RM4A 3ZT6A 4CCDA 3QOKA 4H8HA 3BSGA 4W86A 4U31A 3GXDA 3ZT7A 3AISA 3VD5A 4P7LA 5BXTA 2WAGA 4LGXA 4P8UA 5A8MA 1GCYA 3W82A 3CLWA 1O6IA 4X0VA 1TA3B 1UR2A 3OGSA 2OWWA 5ABFA 3OGRA 2XSAA 1QOXA 5DFAA 4KMQA 4P7OA 2WC7A 3WF0A 2EPLX 2J7HA 4CN6A 2D3LA 4TX6A 2EPOA 1BTCA 1CDGA 1NOFA 1GHSA 2WHJA 4KGLA 4PMQA 5D8ZA 3L2LA 2XVLA 3AXHA 6A3HA 4Z2GA 1ESWA 4HA4A 3SUSA 4BQ4A 5HDRA 1HJWA 5LA0A 3G6LA 5I3DA 1PJ9A 5HPOA 4W8LA 4J3SA 1E6XM 5A2AA 2ZWZA 4OOUA 3B9DA 3MUY1 2OWXA 1JZ7A 3UR7A 4Z2HA 1BHGA 1EHNA 3HJEA 4HA3A 1TA3A 4J3TA 7CGTA 3W38A 2D0FA 1CXFA 1K9DA 5AY7A 3UCQA 5A1AA 2A3HA 1UOKA 1RPKA 3SCQA 1QBAA 4L4PA 2VCCA 3VUPA 2GDVA 1J0JA 2Y5EA 3KWXA 1BYAA 1RP9A 1CEOA 1WB0A 4V27A 4HOZA 1OD0A 1IV8A 3CPUA 3PTQA 4ZXOA 2OYMA 3RJYA 5LA1A 5I78A 1C7SA 1E6RA 1ZBWA 2WHKA 3L2MA 1K9FA 4UFIA 1AVAA 3GH7A 1VBUA 1JFXA 4PN2A 2XYLA 4AZ6A 2PBOA 1W32A 2ZX7A 3A4WA 4JAWA 2Y8KA 1OM0A 3W26A 2XUCA 1SYTA 1W9XA 3NIYA 1W9DM 4PMVA 1QI3A 4PBGA 1J0IA 4J3WA 4H04A 1H5VA 3CZEA 4CD4A 1ZBCA 1GW1A 1H0IA 2FHFA 1JI2A 2WKLA 1BFNA 1US2A 1C92A 2OSYA 3ZO9A 2XM2A 1VJSA 2WCSA 2EQDA 1PIFA 2CNCA 2E8YA 4B16A 1K6AA 4U3CA 1UR1A 3KL0A 3VDHA 2X0HA 2DSWA 1VENA 4WKAA 1E72M 3VX1A 5CG0A 2WLYA 3BC9A 2PF0A 1W3LA 1H11A 3OBAA 4RE4A 5I77A 5GQBA 1BG4A 1R85A 2OLHA 3WUFA 3WQ8A 1BAGA 1VAHA 1BYBA 2WW5A 3FAXA 1JF6A 5ABHA 4AMCA 4A4AA 2YLAA 1UZ4A 1GZJA 2WMKA 1W9BM 2ZWYA 1EH9A 5A8PA 3BSHA 4JL2A 3K8LA 4MNLA 3WL0A 2UY3A 4OZOA 4HOXA 3IJ8A 2CCRA 1ECEA 2E3ZA 4J3XA 2ZX6A 1QHZA 4PYSA 2WMIB 3VMOA 2G3MA 1OBAA 2A3BA 1L0PA 1PZ2A 4JCLA 3CMJA 2W62A 2ZOXA 1GVIA 4AZCB 3HU7A 2YL6A 3LPFA 4UOQA 2A3CA 1LLOA 3ARYA 3IANA 2YL5A 3S2CA 4V2XA 1UD4A 4OUEA 3WD2A 3BLPX 1Q6FA 5DF0A 4AZHA 5BXSA 1M01A 1W1PA 4LXFA 4K68A 1QHPA 1BLIA 4UTFA 1RD6A 1PBGA 4D1IA 3MV11 3SUWA 2J25A 1BF2A 1C90A 1ISYA 3ZJKA 4E2OA 1UWRA 2WK2A 4E8DA 1J9YA 1W1TA 3PTKA 2J8FA 2GK1B 3AIQA 3LMYA 1UKQA 5AC4A 2W61A 1I1XA 3WD3A 2G3NA 1V3MA 3NYDA 1J12A 2VCAA 3EDKA 3TP4A 1KQZA 4UQCA 3AS3A 5E09A 1R7AA 2V38A 4CCCA 2BFGA 3ARRA 4S3JA 3CUJA 3ZOAA 1B3XA 3WN6A 4UFHA 1XH0A 2PWEA 2QLYA 3N11A 2CHOA 5FD0A 3VGHA 1JNDA 1TR1A 1V0NA 1U30A 4AD5A 4YPJA 2WZEA 3ARWA 1JNEA 3PZTA 2GFTA 4AIOA 3CUFA 3ECQA 3WBAA 1SFSA 4P8VA 3WKZA 1MQRA 5LA2A 2DT3A 1LF1A 3WF3A 2DSUA 3N15A 3WEZA 2VL4A 3LPOA 3AOFA 4TTGA 4UQBA 2ZX8A 3UR8A 3PTMA 5IHRA 4W7WA 3ZM8A 4HP5A 2W66A 1LL7A 2VZOA 5HNNA 3AMDA 1UR9A 1GPFA 4F79A 4PTWA 4CGTA 1NM9A 3AIUA 4V28A 2BHZA 3WF4A 2F61A 3WNMA 3UG4A 1E5JA 1PPIA 1E71M 3DYPA 2CBVA 3RMEA 1JZ6A 5A94A 2X8RA 5I5RA 3RDKA 1F4HA 3VIMA 1FP8A 3K4DA 4WJXA 4B3KA 1H4PA 3BAKA 4UFKA 5A6AA 4U3AA 5JBEA 1KR1A 3AIEA 2XWEA 2QPUA 1ZU8A 4P7RA 3CTTA 1IZKA 4OOZA 3WFLA 4UQDA 3EDJA 2VRJA 4AIEA 2PI6A 3ARQA 4CKQA 2YBTA 3DC0A 3BLKA 5E0FA 3N13A 3VIPA 3PZNA 4QDMA 1MQPA 2E9LA 3N17A 4J28A 1CGXA 1EIBA 3A6OA 4J27A 9CGTA 3VINA 1OINA 2WBGA 3MMUA 1OGGA 3SCVA 1SR0A 3VIFA 2DDXA 1C93A 3PZ9A 1CPUA 2VJXA 4AYSA 2ZX9A 2O9TA 3NCOA 4PMRA 3CZLA 1Q6CA 4Q7NA 5IXEA 1EGZA 4TXEA 2OYKA 3WNPA 1KQYA 3NSNA 2HVMA 4RL3A 3ZR5A 4M82A 1VFOA 2D2OA 1W3KA 1QW8A 3WH6A 2WSPA 4TVUA 3RCNA 3U7BA 1EOKA 4CUCA 4KWUA 1QI5A 1RP8A 5I23A 2Z1KA 1WPCA 3EMCA 5EB8A 1JXJA 5E6ZA 1V6VA 4MJ2A 5D8WA 4PSPA 1EO5A 4AEFA 1V08A 4FF5A 1QNPA 3E1F1 4N0RA 1J18A 3TTYA 4B9YA 1W9PA 4H2CA 4MJ4A 3AHYA 1NOUA 1ZBVA 2YL8A 1DTUA 3W28A 4ATDA 1WNOA 4FLQA 3QGVA 5I0DA 1CECA 1A47A 3WFZA 1LWHA 4W5UA 1VBRA 1XSJA 2G8ZA 3RO8A 1UA3A 1XD1A 4MDPA 4IM4A 1EDGA 1TZ7A 3W24A 3L4WA 2YDQA 3AIVA 1UH3A 3SCWA 1D2KA 2V3GA 1FH8A 1NOWA 3VD9A 1V3JA 1FA2A 3DYMA 4BQ5A 2J7EA 3FHAA 3NDZA 2YBUA 3WDPP 3GH4A 2JEPA 5TD4A 3VU2A 3CUHA 3VM7A 3F4VA 1W3JA 1J0ZA 1B3YA 3AROA 3MMDA 4E4PA 2EBNA 4LYPA 1E6PA 4DUVA 5KZ6A 5ABEA 2VMFA 1B3WA 1DWFM 1UWUA 3U57A 5CQ1A 3ARZA 3WNLA 1OB0A 1UWQA 4W8AA 2YL9A 1I75A 5BXRA 3TTOA 3AIBA 3TTQA 1JGIA 4UCFA 1W1VA 2DSKA 2PWGA 2ESCA 5M3WA 1GNXA 4MNKA 1JIBA 2ZE0A 3AZRA 3T0AA 4D6GA 2VX6A 3A47A 3ZT5A 2A3EA 2FGLA 1B90A 4GO8A 3W4RA 3SUTA 1E6QM 1CGTA 1TVPA 1OGSA 2W92A 4PCSA 1KGXA 2BY0A 4AD4A 1V6UA 2J7BA 1LQ0A 3OGVA 5CGTA 3AMGA 4BF7A 1GQJA 5AC5A 5JBFA 2E8ZA 1V0LA 1FP9A 4JZ5A 1WZAA 5F7UA 3DHUA 1E6ZA 5EMYA 1TE1A 2WMIA 1JZ2A 2Y2WA 3KL3A 1L8NA 2DEPA 3GDBA 3SUVA 1BYDA 2FHBA 4MB5A 1J01A 2XVNA 3CGTA 4CU7A 4GZJA 1O7AA 1OIFA 3M46A 1WAWA 1V02A 1JYWA 3RPMA 3GYCA 1UD3A 3OLDA 4QCEA 3KE0A 2VR5A 1FH7A 1US3A 4ACYA 4D6EA 1KXVA 1XHGA 1WDRA 2XGBA 1V0MA 1B0IA 3ALGA 2DSZA 1JG9A 4NZCA 5KEZA 5HOSA 1VEPA 4UOJA 4HTYA 4TVDA 3CBWA 5E70A 1M7XA 3VNYA 5IHSA 5FKYA 1JDAA 4M29A 3ALFA 5A6MA 1SMAA 2WNWA 4M8UA 1GQLA 1HKKA 2F8QA 3VGEA 4UQ9A 1WKYA 3L4UA 3GM8A 3VIJA 3WENA 4CVUA 1EO7A 4H8UA 5A6BD 3WEMA 5DEZA 3VGFA 4AD3A 1TG7A 5D9NA 1EQPA 4AZGA 3VIKA 2WSKA 1BGAA 1W9UA 1E4NA 3RJXA 2NSXA 3KEHA 2G41A 3L4XA 4CD8A 3U5UA 3B9EA 3I3DA 4H8VA 4EAMA 1V02E 3VO0A 3PZMA 8A3HA 4MADA 1IZJA 2WANA 3K8KA 1A3HA 1UD5A 1VB9A 2VRQA 2BS9A 3WUEA 3AZSA 1B1YA 1DEDA 4W84A 4ATLA 4U2YA 3WD4A 4CD6A 2VZSA 3VVGA 5BCAA 5I79A 1LG1A 4YN5A 3SCTA 1R7OA 2E9BA 4R5EA 1CTNA 1CXIA 2EJ1A 3AYRA 2CEQA 5DMYA 2OSXA 1Y7VA 4W85A 1CBGA 1ISXA 4HZ6A 4UQEA 5HBFA 4MTVA 2WCAA 3ZIZA 4UFMA 1N82A 4LYQA 2D23A 3JUGA 4W89A 2WVUA 1NARA 4D6FA 4JL1A 1H0GA 1GQKA 4W7UA 3MU7A 2YA2A 1YQ2A 3AIWA 5IDIA 2DT2A 1GJUA 1Q6DA 2VX7A 2PBGA 3MSGA 1G01A 2WVSA 2W91A 5JBDA 1WDPA 1HVXA 2IUZA 1EDTA 3QHMA 1E1FA 3CHDA 1VEMA 4YHEA 5A95A 4JKLA 1AQHA 3M7SA 4TTUA 2DT0A 5GNYA 3VD3A 3VKKA 2BY3A 4F9JA 1XV8A 5DT7A 1E55A 1RH9A 1GONA 3CHCA 4U5IA 1R86A 3WL1A 3T2PA 3KZSA 3VIIA 3QHNA 4M56A 2VVSA 1S46A 2X05A 3WSUA 4EANA 3VDCA 1X6NA 5CGMA 1PX8A 3T0BA 3AXXA 3SCRA 2GDUA 1KWKA 3AI0A 4WF7A 3VNZA 2G3IA 4R27A 2IXVA 3ARVA 3UESA 3BGAA 1NWSA 2WPGA 4H41A 5CPQA 3PN8A 1UD2A 1XCWA 3W25A 2YLLA 1ZJAA 3WQ6A 4LQ1A 2VOTA 2AOSA 2GK1A 4PMXA 1MWOA 3BMWA 1W1YA 1GVYA 1HT6A 1JZ8A 4ZE4A 2WC4A 3A4XA 2WM0A 1ITXA 1BGGA 5A6SA 2G3JA 4PMOA 1VFUA 3GBDA 1GHRA 4PMDA 1U2YA 2DQXA 4CD7A 2QMKA 3AZTA 3OIHA 3GNOA 1CGUA 3SCNA 3ZQ9A 2WLZA 1XH2A 3VTRA 2BHYA 1WZMA 1J10A 2EO7A 2CHNA 1KB3A 4FLRA 4D6HA 5ABFB 3AYSA 1PAMA 2J47A 2EPKX 4GO9A 4KGJA 4QFUA 2WKGA 1UUQA 1UWTA 5A8NA 4MNMA 4EE9A 3BAYA 3DHPA 3K46A 4IUGA 1J11A 3W6MA 1DP0A 1QNRA 1JDDA 1E6SM 4XUYA 3DYOA 1G9HA 1NP0A 3EDEA 2J79A 3GNPA 5EFDA 1CGVA 1E40A 2VNCA 1FH9A 4AWEA 2O92A 2DH2A 2BXYA 3AS0A 3QR3A 1JYXA 4U5KA 3BCFA 3GNRA 3MUZ1 4HU0A 4ZE5A 4AZ5A 1UWIA 1HL9A 1DWIM 4M80A 1C3FA 2A3AA 4QLJA 1NWUA 3VIHA 4FLSA 2VZTA 2JF6A 3RIKA 4WK9A 3TA9A 1BYCA 4HMDA 4PRWA 3MUIA 4KRTA 1GOKA 4FMVA 4BQ2A 5JIPA 4Z2LA 2C0HA 4GIAA 1JXKA 2W4XA 2CBIA 2O9RA 5A8OA 1WDSA 5JUVA 1UYQA 2CESA 2WVVA 3I3EA 3ARXA 4CU6A 4GI8A 1HN1A 2BVTA 2CIPA 3EDFA 2PWFA 5DO8A 3K1DA 1EDQA 2J8GA 1FHLA 2WWDA 4JHZA 2YJQA 4PMNA 2QV4A 1DWGM 3OG2A 3GXMA 2DIJA 5M17A 2WMGA 2OYLA 4NSBA 4S3KA 4Q22A 1B3VA 3OLEA 3WF2A 1UR8A 1C8QA 3WH5A 3VGGA 1E3ZA 2CPUA 2ZUVA 3AHTA 3OZOA 1J0KA 3N04A 3EDDA 1TUXA 5A8QA 1XYFA 3LPPA 3CHFA 3T08A 2UY5A 1AMYA 1MVYA 5D9MA 3UEQA 2WC3A 2ZIDA 3SIMA 4L4OA 1JD7A 3WQVA 4RE2A 3WDHA 2W63A 1KGUA 3VGDA 4M1RA 4EKJA 3MSDA 2RGLA 3U7VA 2JE8A 4Y7EA 1R87A 2QMJA 3ZJ6A 4OBRA 4AZBA 3D5HA 1FFRA 1W2VA 2ZXQA 1JF5A 3CMGA 2DIEA 1MYRA 2CITA 2WBKA 3O2LA 3GXIA 3WDIA 2BV9A 3II1A 3UERA 1JAEA 1MXDA 2B31A 4WSJA 1KCLA 2PWHA 3GBEA 4Z2IA 2XJ7A 1NP2A 2F2HA 3VMNA 3AMKA 4DWSC 1ZL1A 3FNDA 4P8WA 2BNJA 4U33A 1KCKA 2CERA 2VR4A 1KWGA 2CBJA 4KH2A 1H09A 4MB3A 1UKOA 3OLIA 2ZX5A 4XB3A 4J7RA 3A4AA 2VX5A 4IPNB 4TVCA 4P7QA 1OIMA 1JD9A 2IXUA 3GH5A 4QAWA 2ZICA 3ARUA 5ABGA 1H49A 3ZSTA 3WELA 4XX6A 5FL0A 4BA0A 3AJ7A 5A6BA 3SURA 5E6YA 4D1JA 2X09A 2GJRA 1E0WA 1HVQA 2D1ZA 3RM8A 1B2YA 2WHMA 3NDYA 1CXEA 3ZMRA 5HXMA 2E40A 4BS0A 1LG2A 2PC8A 2E9MA 4AC1X 2DSVA 3IAPA 3SCPA 3RILA 1QHOA 3VOCA 3W53A 4ZFMA 3WEOA 2VQTA 4YHGA 2J7CA 3N9KA 1W2PA 1C8YA 1KGWA 2PWDA 4X9YA 3QOMA 1TMQA 3O6AA 2CXGA 1HJSA 3WDJA 3TOPA 2Z1SA 3SCOA 1WCGA 1AQMA 2XFYA 3PZOA 3N1AA 1VF8A 1VEOA 1TVNA 1HF6A 3HN3A 4ZEPA 2YDSA 1ZB5A 3CH9A 2J74A 5C71A 1JI1A 3BAWA 4C7FA 1VIWA 5CLWA 3FAWA 5EFFA 1V3KA 3IJ9A 2J7GA 5FCZA 5M03A 3AHXA 4UFJA 4URIA 1XD0A 2XM1A 4DUWA 2E4TA 1PZ3A 1UD6A 1HKJA 5D9OA 4DWSB 3EBVA 3UG3A 1E0XA 1UD8A 4CVWA 1J0YA 1E1EA 1VFMA 1YHTA 5IFPA 4TUFA 2V5CA 1BPLB 1GOQA 5DT5A 2EPNA 1DHKA 1HJXA 2MANA 2UWFA 2YIHA 2D0GA 4TX8A 3L4VA 1PX4A 1JFHA 3WD0A 3W6LA 4PCTA 2DPEA 1NQ6A 4OBSA 5HPCA 1HNYA 2WMFA 2J7FA 3K4AA 7TAAA 1HKMA 1LJYA 1QBBA 5BWFA 1GORA 1UKSA 3UETA 2JFEX 5IFTA 3WH8A 5A6JA 2AAAA 3PZGA 3SUUA 2WMJA 3OLGA 1XH1A 3F5LA 1DWHM 4ACZA 4NI3A 1VJZA 1KXQA 1CNVA 3MO4A 4JHOA 5LYRA 3CZGA 2WCGA 1TCMA 2TAAA 5FL1A 1E4MM 1HXJA 4CCEA 3VPLA 1MW2A 6TAAA 4PMYA 4F9DA 3WNOA 5E0CA 3W29A 1WP6A 1H3GA 2BHUA 2Y24A 3WH9A 3W0KA 4GQQA 2UY4A 1P6WA 3BXWA 1I1WA 3IK2A 4D72A 4CN4A 3QHOA 3U5YA 3BMVA 4HMCA 2BVYA 1ISWA 3TONA 2WXDM 4UQAA 5EBAA 1QVBA 3AHZA 2BVDA 5A6LA 3ARPA 1CIUA 2QPSA 4WIWA 4DM2A 5I2UA 1C7TA 1VFFA 1E43A 4BCEA 2ZUUA 3AQUA 3AICA 1CWYA 3VD7A 3BAIA 1ODZA 2HISA 4C7GA 1M03A 4MB4A 3GTNA 1D7FA 3WMCA 1OCQA 2CYGA 1GJWA 3I3BA 3N18A 3B8SA 4P8XA 1Q6EA 2DGAA 4H7VA 1V03A 4D71A 1NH6A 4E8CA 1E70M 1AQ0A 1HJVA 4OKDA 2FGZA 1UH4A 5CSUA 4UFLA 2NT1A 1B3ZA 1NWRA 4JIEA 4WLCA 2Q8XA 3L4ZA 1BSIA 4MNJA 2GSJA 1UQYA 4AD1A 4HU8A 2ZUTA 1CGWA 2BY2A 2O9PA 2YA1A 2VZUA 4DM1A 1GUVA 3PZVA 3WDRA 1IT0A 5CSYA 2WB5A 1GOMA 5A6KA 4HZ7A 4N42A 3EYPA 3D3AA 5FOOA 3J7HA 3AS2A 1V6YA 5CZKA 4HZ8A 2PB1A 2GJXB 2XFRA 3EMZA 3OA5A 3BCDA 1MFUA 4U2ZA 2VT0A 4WKFA 1CENA 3MMWA 2V5DA 3L4YA 1SMDA 3MKKA 4LX4A 4QCFA 3WBEA 1UR0A 2V3EA 4ML4A 4M24A 5BRQA 3MV01 1Q4NX 1KR0A 4AY1A 2VVNA 1CZ1A 4AD0A 3VMPA 1UH2A 2VX4A 3ZSSA 1PX3A 3K8MA 3FY1A 2WYSA 4AZ7A 4W7VA 4MPKA 2RGMA 4JFTA 2XPKA 1M04A 5BROA 3IJ7A 3T09A 3VDBA 1HJUA 4ATWA 2VQUA 1UKPA 4GINA 1XGZA 3MS8A 3EMQA 1WE5A 3A3HA 2YDRA 4XZBA 4PTMA 1JZ4A 3HMCA 4HMEA 4DUXA 1MW1A 3WUGA 4LPCA 4GI6A 3DECA 3TTSA 4A3HA 5CPSA 2XHYA 2WVTA 4JFSA 3ZR6A 2D3NA 1ZBKA 1B30A 4FLOA 1V3HA 1BVNP 3LPGA 2AMGA 5CJ5A 4B9ZA 1QI0A 2G4FA 4WKHA 4HPGA 1WZLA 3ARSA 3NSMA 1GOWA 2FH6A 2V3DA 3W37A 1UHVA 1D3CA 5M5DA 2GUYA 2VUYA 4AEEA 1XSIA 1HJQA 2J77A 2XFFA 3UG5A 2J75A 4B15A 2XVKA 2XIIA 2X2YA 4FK9A 2FHCA 1E4LA 2Y4SA 1PEZA 2X0YA 5E9AA 2VI0A 1TFVA 2J7DA 1W3HA 5AYBA 1J0HA 1QNSA 3SCUA 2WMHA 4CN1A 5JIWA 4UNIA 3CZKA 3POCA 3VX0A 2ZXAA 1QW9A 4OIFA 4ZXLA 1LL6A 2GVYA 2JALA 1XRVA 5I24A 4Z2JA 4PUDA 3T0DA 1GOIA 3FW6A 1OT2A 2X1IA 1B31A 1HP5A 1QNQA 4D6IA 8CGTA 2ZXDA 1E73M 2D24A 3L4TA 2EXOA 1CGYA 3NSXA 4MAZA 4IISA 3WQ4A 2D20A 3F5JA 3ZJ7A 1KXTA 3VDAA 2BXZA 1F4AA 1HL8A 1MW3A 4UOZA 1FFQA 3B9AA 6CGTA 2WWCA 2ZUSA 2BY1A 3ZJ8A 3THDA 4GPNA 2W67A 4A3YA 4HPHA 1B9ZA 4F66A 2XWDA 1KXHA 2ZUMA 1K9TA 2JEQA 4PUEA 1OT1A 4GQRA 1H41A 3RM9A 2YA0A 4AW7A 2E0PA 2NW0A 3VD4A 1ZJBA 3CUGA 1QPKA 3FHQA 1UG6A 1HKIA 5GNXA 4JFUA 4W8BA 1OD8A 1ZS2A 3WH7A 2XIBA 1QI4A 4EK7A 1CYGA 1G94A 1M53A 1BQCA 2XG9A 2ZUNA 1CXKA 3WF1A 1E0VA 2QF8A 2Y8VA 3WMBA 1G0CA 1WO2A 2XVPA 4W5ZA 4MB1A 3OB8A 1V0KA 1LL4A 3WQ5A 1JAKA 4PEEA 2VO5A 5FIPA 3WUBA 4PTXA 2DH3A 1XYZA 1FOBA 3VM5A 2WHLA 4J3UA 4DWSA 1C91A 3O9NA 2VC9A 3WIJA 1V6WA 3AS1A 1H1NA 1Z32X 3AIRA 3CHEA 1E15A 4MDOA 1XC6A 5D4YA 1MXGA 1E9LA 1HX0A 4QLKA 4UZSA 3VIOA 2D22A 1MQQA 1H2JA 1K9EA 4GXPA 1E5NA 4GZEA 2ZXBA 3PHAA 1E6NA 5A3HA 2ZUWA 3CIVA 1ITCA 3CUIA 2VCBA 1ISZA 5A2CA 2UY2A 4PMUA 5AYIA 3AMCA 4HOWA 4Z2KA 2DT1A 1FHDA 1OSEA 4JFVA 1BVZA 1UQZA 1U33A 3MANA 4ZENA 3GZAA 1QNOA 3AMLA 3PZIA 4AIUA 4CD5A 1EHAA 4MAVA 1CLXA 5CPTA 3WD1A 4NRRA 1ODUA 1UKTA 4AZCA 4PTVA 3CZ8A 1X1NA 1CLVA 4B3LA 4QLLA 3SCSA 5GNZA 5A2BA 4PMZA 1JDCA 1E4IA 2WZIA 3IAQA 4LYRA 3MUAA 4GZIA 3VILA 1BG9A 1G1YA 1G5AA 4X0NA 1EQCA 2NT0A 2W5FA 3BAJA 3PZQA 3W81A 4JKMA 1CXLA 1V6XA 1E3XA 5BYWA 4W93A 1DWAM 4XV0A 3BH4A 1WDQA 1XSKA 1W91A 3GXFA 2D0HA 2CBUA 4GKLA 4HA1A 4NF7A 2YOCA 2VURA 3WQWA 5CXPA 2GJPA 5GPRA 3POHA 2CKSA 3VGBA 1DWJM 2GJXA 3ARTA 3SEPA 1VRXA 2VTFA 1X6LA 3AFBA 2XTKA 4GI9A 2JF7A 2J4GA 3T2OA 1C8XA 1HIZA 4JKKA 4D6JA 5CLTA 2OSWA 4AD2A 1V3LA 2OWCA 1KFWA 1UZ1A 4AXNA 2EPMX 5C8BB 1OWQA 4DWSD 1Q6GA 5ECUA 4JFWA 3W27A 1R8LA 5I6SA 2WVVB
chains in the Genus database with same CATH superfamily
3M6DA 1XBZA 2LLEA 2WV8A 2CETA 1JYVA 3S6TA 4JCMA 4W87A 1EOMA 4ACZB 2J9XA 3BAXA 2MUCA 3RLHA 3VIGA 3H54A 1EXPA 1TO3A 1RCXB 1E51A 4KRUA 3AXIA 3GXPA 3FXYA 1NIUA 4S3BA 1KBKA 5B7YA 1BXCA 3NJ3A 4JTIA 2VZVA 3WNKA 3C61A 5D2YA 4JDBA 4M81A 2XGIA 1AH0A 4N7QA 2QCLA 3WLRA 3WY1A 3TROA 1W5NA 1XLAA 3PBGA 2BLEA 3N2TA 3VC5A 4IIDA 3WX7A 4LJ3A 4D6CA 3WDQA 5AC8A 4RNFA 4O15A 5I09A 3NUKA 3TQKA 2OR2A 4D8AA 4A2RA 3R1ZA 4ZZ9A 1EA9C 3N12A 1UR4A 1XCXA 3NEVA 2MNRA 3P81A 4WSKA 3IRDA 3N4EA 1GVFA 3IJ6A 3UR2A 2C7FA 1HTIA 3WLNA 2ZA2A 2CKRA 3E74A 3V1HA 3A23A 2VGGA 4BQ3A 4OV4A 1IQ8A 2J78A 2JIEA 1QWGA 1Z48A 4R7WA 3DFNA 3QJAA 2E28A 4CCDA 3QOKA 3BSGA 4IFOA 4GYPC 2EAWA 2V5KA 1N8IA 1DJHA 4RW3A 3D46A 3AISA 4HIBA 2WAGA 4LGXA 4NUWA 3O16A 3CLWA 1H62A 3BZJA 3OGRA 2XSAA 1QOXA 4KMQA 3MVIA 4P7OA 3Q94A 3RGTA 1X97A 4NXKA 1S2WA 1Q7ZA 3GD6A 4JTAA 2XSXA 4CN6A 1BTCA 5A6TC 3N34A 4ZMGA 3PJUA 1NOFA 4ORMA 4PMQA 4AY8A 1HG3A 4IGHA 3AXHA 2ISDA 4HA4A 1ZCCA 4GJIA 5I3DA 1PJ9A 4W8LA 3ITCA 5A2AA 5FJTA 2ABAA 3P61A 4LCRA 1UBSA 3W6YA 1RQBA 1CXFA 1K9DA 4Q33A 3T05A 1M6JA 3ANVA 2GDVA 1J0JA 3KWXA 4CNUA 2ZRVA 2VDHA 4KWOA 1UUMA 3DGBA 3UPWA 4BJHA 1WB0A 2RKXA 2CWNA 2DUAA 4DJFD 2I9UA 1VYRA 5EKYA 3CPUA 1EJTC 1F6KA 3BE7A 5I78A 5G4HC 3L2MA 4UFIA 3GIYA 3LDVA 1AVAA 2HCVA 1VBUA 4GKTA 1JFXA 4DRSA 3CM4A 4QBXA 3BLDA 3TTEA 4DNHA 1LORA 5G1MA 2IQDA 3DH7A 2ZX7A 3LCXA 4JAWA 4HKPA 4QE5A 1XGEA 3NIYA 1UUOA 4TR9A 1QUMA 4H04A 2POZA 1QOQA 4FPSA 3TSMA 3SDOA 2GOUA 3DHDA 2E25A 1BFNA 3ZO9A 3WBYA 4L56A 3SGUA 5C9RA 3T81A 3LCIA 2VFHA 3V0TA 2EQDA 4JN7A 1K6AA 4FXRA 4IWWA 3KL0A 3EA1A 2X0HA 2DSWA 4WKAA 1E72M 2YYUA 4Y2WA 1YEYA 2XISA 1PCKA 3BC9A 1GJPA 2PF0A 3V3WA 2E7FA 5I77A 2Z1VA 5GQBA 2WW5A 1DJNA 4FALA 3IUIA 4NJHA 1UZ4A 4JD4A 1PYMA 2WMKA 1W9BM 1QK0A 1EH9A 1GVQA 5G2IA 3AU2A 4JL2A 4PUUA 2QCHA 1Q6OA 3WL0A 1JCYA 4JTGA 4DJDD 3AALA 4FF7A 2ZX6A 4Y96A 4HPJA 2BSLA 2WMIB 2GGGA 3KBSA 2G3MA 3JS3A 4EPEC 4HA0A 4UTLA 5EMLA 3RG6A 3TQVA 2W62A 8TIMA 2Q6ZA 4GGBA 1TPH1 4JTQA 1KM2A 2FPYA 2PRHA 4MZYA 3S5NA 5DRIA 3A64A 2A85A 4V2XA 1UD4A 2B7OA 3M6YA 1EJXC 1KRMA 1IEQA 4WDXA 5DXYA 2AMXA 2QZRA 3E3HA 4M51A 2PDMA 1BLIA 1RD6A 3R89A 3GHTA 1TR9A 1FWCC 1XXXA 4GHRA 2QR6A 2ZQ0A 2GQAA 5HUPA 1LUCB 4WSHA 2OKOA 2G3NA 3PF3A 3TEVA 2KAUC 4J35A 1M41A 3EDKA 4UQCA 3AS3A 5E09A 1EJUC 1B4EA 2ZRYA 2BFGA 3ARRA 3VNIA 3ZOAA 4MSSA 3WN6A 2ZRZA 4MFEA 1T8QA 3C3NA 1XH0A 3I10A 3N11A 2HNEA 1V0NA 4A8IA 4JTKA 2FVLA 2XH7A 3ARWA 1QOPA 1JNEA 3PZTA 3CUFA 4KRZA 1NDZA 3ECQA 1ZJHA 1YNYA 4ML9A 1X6UA 4ZOEA 3WKZA 1MQRA 5LA2A 1KM6A 4DPQA 1Z44A 3N15A 3AOFA 3THUA 5I00A 3PTMA 4W7WA 1RY0A 3ZM8A 4X61A 5HNNA 3AMDA 5C2GA 1GPFA 4ROQA 4B3ZA 1NM9A 1Y5XA 1JPDX 4ERGA 1PYFA 3RMEA 4ERIA 1SSGA 4BI6A 2PDJA 1FP8A 4WJXA 3EWZA 1G7UA 2RDXA 3BMXA 3BAKA 4UFKA 2NX3A 5JBEA 3AIEA 1PKMA 4IIHA 1QXLA 1UWAA 4QDWA 7REQA 3K2GA 3K1GA 1XG4A 2V2DA 3EDJA 1EJ7L 1NU5A 3LCFA 4JHMA 3WBWA 4DELA 3QV8A 4QNEA 2W79A 3BLKA 4HHHA 1AH4A 5E0FA 4IMFA 2OT1A 4ASTA 1R3RA 3RR1A 1GGOA 2E9LA 3A6OA 1OINA 2WBGA 5T91A 3MMUA 3LA4A 3PWIA 3SCVA 3R10A 3KOYA 3VIFA 3DCPA 4ZQPA 1LLWA 4AYSA 4QHRA 3NCOA 1U22A 5FJOA 4PMRA 1TX0A 5AHNA 1Q6CA 4Q7NA 4O28A 5REQB 2VHLA 3TX9A 2V9DA 3QM3A 5K9XA 4DO7A 2HVMA 5LNUA 3L0GA 1TV3A 5F4XA 1OQFA 4IICA 1TV2A 5HMSA 1BSLA 2Y85A 1XBXA 1YLVA 1QW8A 1XX1A 3H4XA 5M2FX 1XGDA 4C6MA 1JXJA 4ZO6A 5E6ZA 4XZNX 3VKAA 1MEWA 3PULA 4HNUA 1VLIA 2E68A 4GUGA 4S2CA 4C5ZA 1J18A 4Q8VA 4DYKA 4MJ4A 3LXCA 1WNOA 3V36A 1KNWA 3QGVA 5I0DA 2QDGA 3GR7A 3FA5A 1XSJA 3NGJA 2AGTA 3VKDA 2JQXA 1OG0A 3RO8A 1XD1A 4MDPA 4IM4A 1ONWA 3W24A 3L4WA 1RSCA 3AIVA 4WDTA 5FEWA 1O12A 3SCWA 1D2KA 2ZKMX 2V3GA 3N6QA 2JGYA 1FDZA 3BO9A 3FHAA 3KWSA 2YBUA 3LBMA 4I6KA 3ITYA 3QW3A 3VM7A 1W3JA 1B3YA 4G8TA 3AROA 1O94A 4E4PA 2QW5A 4EPKA 5ABEA 1XFCA 1B3WA 1DWFM 1TPB1 3QV7A 3U57A 1Z6KA 1R5YA 4PRRA 3ENLA 5BXRA 1LUCA 1O66A 3TTOA 1RVKA 5AHLA 2GUBA 4PB3A 1W1VA 1OFQA 1QPOA 2ZE0A 3QC0A 3T0AA 1OC5A 2TSYA 4RDYA 1S2AA 4EPBC 2A3EA 1DORA 4GO8A 4KCTA 1E6QM 2W92A 1JCLA 2BY0A 2PCEA 2BGQA 5AYXA 3OGVA 4Z1BA 4CNNA 5CGTA 3AMGA 4B90A 2CLPA 2GGJA 4JPGA 3VNKA 1V0LA 5BZAA 3SSZA 2CLMA 1TE1A 2WMIA 3KL3A 3QEZA 1KA9F 3W1AA 1X8FA 3B0XA 1J01A 3CL8A 3CGTA 1LT8A 7ENLA 3S46A 4A8LA 1O7AA 3BTNA 1F61A 3M46A 2FLIA 4RCXA 1V02A 3UCCA 2RH9A 3BG9A 3RPMA 4Y90A 3OLDA 2Z7KA 2I14A 2QYGA 3KE0A 1Q8JA 3UGVA 3NQMA 2O55A 3VKBA 2XGBA 3R5EA 1B0IA 5CC6A 5CAHA 4NIRA 3W7KA 4O1FA 3TAOA 3CBWA 5E70A 2QNEA 4FX8A 3NL2A 4JX4A 4GD0A 5CKSA 4M8UA 1GQLA 2DORA 2F8QA 4MM1A 3L4UA 3VIJA 2QUMA 3W7QA 5A6BD 3WEMA 3LHVA 4AD3A 2V2CA 1TG7A 3A13A 4LH8A 2WSKA 1E9IA 1BGAA 1W9UA 1E4NA 1IHIA 3RJXA 5K4ZA 3IIOA 1E1CB 1GTHA 5C9UA 1QT1A 1RBOB 4PTDA 3U5UA 3I3DA 4H8VA 1KW1A 4EAMA 1V02E 3W74A 4MADA 3K8KA 3DGRA 1A3HA 4ES4A 2BP1A 3TN4A 3GFXA 1VB9A 2HXTA 3UU0A 3VOGA 2P8BA 2ZDRA 4JYEA 1B1YA 2P10A 4ATLA 4UTJA 4U2YA 1LG1A 5BOEA 4YN5A 4LY8A 2E9BA 4R5EA 4F4RA 1MDRA 3AYRA 3PM6A 5LHEA 3CT2A 2CEQA 1FWJC 5RUBA 3P7YA 3G1SA 5K2ZA 1V4YA 2Y7GA 4HZ6A 4UQEA 1A5AA 5HBFA 4UFMA 4O0QA 4MWAB 5CZJA 3GNNA 4JNMA 4JL1A 2PU1A 2ZTKA 3AIWA 1GJUA 1G7VA 3HFYA 1ZUAX 3R2GA 9XIAA 2W91A 2F7FA 1HO1A 4I5RA 1HVXA 4XD6A 2IUZA 5C54A 3LGDA 1E1FA 1VH7A 4QTGA 2AKZA 4K6AA 4RNIA 2PLCA 2A7NA 3OEXA 3ZLHA 2HK0A 3VOIA 1S2TA 3VKKA 3MWCA 2GLKA 5DT7A 1E55A 4MIMA 1RH9A 1GONA 3RRXA 1TRIA 3BG3A 2VVSA 2CXEA 3MBFA 5FI8A 3WSUA 1AQFA 3BVJA 3AXXA 4W4QA 3AI0A 1JULA 2G3IA 4R27A 2IXVA 1XC4A 4LRTA 2WPGA 3C4UA 3TW6A 3PN8A 3S1WA 4PRTA 3VOFA 2AOSA 3BMWA 3QY6A 1DYSA 1HT6A 3CPRA 4QM1A 3ATYA 3W7LA 1VS1A 3A4XA 3TIMA 3MWAA 3V4BA 1UZDA 1U2YA 2DQXA 2Y61A 4CD7A 3AZTA 3LUTA 3GNOA 3SCNA 4AG0A 2WLZA 2OOGA 3VTRA 3ZVIA 3Q4DA 1GPWA 4JQ1A 4D6HA 2YBVA 5DMMA 3AYSA 2XH4A 4JOMA 2EPKX 5A8NA 4BI7A 3TYZA 1PDZA 3DG6A 2ZA1A 1ZCOA 3LU2A 3NQBA 3OBEA 3T6CA 1QNRA 4JEJA 3CWHA 5DLCA 1I8JA 3DFYA 5FAJA 3FYYA 3MA8A 1SJAA 1A5CA 1FVPA 2O7QA 4B5TA 1FWNA 2VNCA 1FH9A 2O92A 2DH2A 4MY8A 2YB1A 2IKHA 2HTMA 4E2BA 4U5KA 1ZFJA 4KESA 1LM1A 4HU0A 4LTSA 4AZ5A 1HL9A 2E09A 2G0WA 3UVIA 1A3XA 4D9PA 1DWIM 1UW9A 3M0VA 4QLJA 4FLSA 4BWLA 2JF6A 5DELA 3LEPA 3RIKA 1BYCA 4HMDA 5F1UA 5CG7A 3GWQA 2QT3A 4G1NA 4FMVA 4GIYA 4XKMA 3UWVA 4Z2LA 3ABSA 2C0HA 1VQTA 4L4MA 1UYQA 4HNNA 5AHIA 3I3EA 1OX4A 2XN2A 1POJA 4CU6A 1F73A 2BVTA 2CIPA 3EDFA 4IFKA 2PTZA 1WOAA 4JHZA 2YJQA 4H9UA 3CUXA 2GL5A 3GXMA 1VCFA 5AECA 1E0TA 2WMGA 3N9SA 2OYLA 4NSBA 3PAOA 3VCCA 4HTBA 1UR8A 1KRCC 3NQCA 2WSRA 1DQXA 3WH5A 5BOOA 2Q8ZA 1M7JA 3EKGA 2Y89A 2PDCA 1E3ZA 4JTLA 3EDDA 3PG8A 3NA8A 3LPPA 3R8GA 4JN6A 4N6FA 1GK8A 4MY1A 4RE2A 2W63A 3VGDA 2RGLA 4Y7EA 3UJFA 2QMJA 3ZJ6A 4OBRA 4C6CA 1EBGA 4YIWA 3D5HA 4IIGA 4GACA 3IGXA 3GXIA 2BV9A 1A53A 3M5XA 2PFHA 3VMNA 2J13A 5C55A 3AMKA 1LLZA 1TQJA 4U33A 5FJUA 4B5XA 1KCKA 2VR4A 2HE5A 2VC7A 4QG6A 4F2BA 2CBJA 3WJSA 1FX6A 4KH2A 1UKOA 3CS2A 5JU6A 4IPNB 2AQVA 2VWSA 3QXBA 4IGNA 4E2DA 1JD9A 2P3ZA 1RBAA 4I7WA 2IXUA 3W1TA 3KDNA 5ABGA 3GSMA 3ZSTA 4XX6A 5FL0A 4LUJA 4FS9A 3HTWA 4BA0A 3SURA 3TXZA 3NQ7A 1UBPC 3RM8A 3NDYA 3NM1A 1IXNA 1XS2A 4KERA 1LG2A 5T9CE 4BS0A 4GUIA 3O1NA 2CC0A 1JJKA 3MPGA 3IAPA 3SCPA 3RILA 2QIWA 3Q37A 3KOZA 1YW1A 2X2GA 2WM1A 3H22A 4OQVA 2NX1A 2HVNA 1C8YA 3QOMA 5E9XA 2QJGA 1V77A 3NFUA 3GAYA 2CXGA 3OYZA 1HJSA 3TOPA 3GXNA 3C3UA 5F4WA 2Z1SA 3GIQA 1FQ0A 1OX5A 1WCGA 3TYUA 3G22A 3DI1A 2DUZA 1F6PA 3MB9A 4F2UA 4J2PA 3N1AA 1VF8A 4IQJA 1TVNA 1H51A 3IGUA 2BX7A 3KRUA 3LSBA 3RR4A 4A05A 1THFD 1S3HA 5CLWA 4G2DA 1QASA 5IBXA 4NU7A 4QDPA 3CAVA 4M1BA 3W23A 4C6IA 1ZALA 5FJRA 1XD0A 4C6OA 1CB7B 2HS6A 3A5FA 1HKJA 3RX4A 1DJGA 4A21A 2PS2A 3IJIA 3UG3A 3F2CA 3R94A 4ZQRA 4NZ5A 4DEFA 4LVGA 4XZMX 1ITQA 4TUFA 4LU0A 4FEZA 1B54A 2EPNA 5AC7A 2GQ9A 2UWFA 3M0JA 2ISFA 1FHVA 2D0GA 3RN6A 1PX4A 4IMDA 1DIDA 2HEJA 4OBSA 1HNYA 2WMFA 5G4WA 7TAAA 1HKMA 1SO6A 5BWFA 1QU4A 2JFEX 3DOPA 1OFRA 4IP4A 3PZGA 3HG5A 4PL1A 1XH1A 3F5LA 2V81A 3EX2A 4WDWA 4FP1A 3TUUA 3AJXA 6ENLA 3MO4A 5LYRA 1EPXA 3LX9A 3CZGA 2PSNA 4HBKA 3M44A 1TJ1A 5HJLA 3APYA 1QNVA 2PDYA 1FUYA 6TAAA 4F9DA 7REQB 3WNOA 1R3SA 1UJQA 3QN3A 4LEQA 1AH3A 3BXWA 1I1WA 3DFOA 3IRSA 4NY2A 3BMVA 4HMCA 5ECVA 2BVYA 2QCNA 3JR2A 3S83A 4DBUA 2F84A 4DLFA 3ONBA 5ENLA 1TPWA 1IT8A 4PCFA 3ZWSA 3LHYA 2C1HA 4GQGA 4HCLA 3H24A 4RX0A 2BMBA 3NQGA 3VD7A 3W87A 3DFSA 4MB4A 5HWJA 3KP0A 3GG7A 1MO0A 1GJWA 3PS7A 3MVTA 3O05A 1Q6EA 4IJBA 1V03A 4E8CA 3MUCA 1E70M 4OKDA 1EYEA 4UFLA 1SVDA 5BNKA 2Y70A 1NWRA 2Z7GA 1SO4A 1LWIA 1XRSA 2Q8XA 4MNJA 1BSIA 3ANYA 3IVSA 1XIMA 1B57A 3UZWA 4AD1A 3NNTA 4N2YA 1CGWA 1IWAA 2YA1A 5SWUA 3PZVA 4QS5A 3S2LA 5FF0A 1IT0A 3NXLA 2QIIA 4HPNA 1X1ZA 3J7HA 3E02A 3AS2A 4R88A 3P6LA 2PRLA 3PUDA 3U2CA 3THAA 1OC6A 3G2GA 3EMZA 2H9AA 5HR6A 3BCDA 4DIAA 2HDJA 4N9CA 3MMWA 4DBEA 1A4MA 4LX4A 2IKJA 2J6XA 4FB7A 3NVDA 2EG6A 5DMNA 3HQPA 5BRQA 1Q4NX 3GNDA 3RU8X 1GKPA 3H4WA 3UXIA 1PX3A 3K8MA 4EIVA 2WYSA 1SJBA 4W7VA 4MPKA 3W7NA 1T99A 2V69A 5FF7A 3IJ7A 3OVRA 4GK8A 1HJUA 4ATWA 5JVLA 4GINA 3BUVA 3EMQA 2ON3A 4F40A 4I9JA 5DCBA 5E0KA 3H70A 2F2KA 2YDRA 3H2AA 3E0VA 2BGSA 3W1MA 3H7UA 1UZHA 4KPLA 4NG3A 4HK7A 1EJWC 1FWSA 3IJDA 4XBSA 4A3HA 2OX4A 2XHYA 1BKHA 4JQ4A 3G8RA 1C9WA 5BRBA 1ZBKA 4FLOA 1BVNP 3NURA 3UXLA 4B9ZA 2G4FA 2VR2A 1R47A 4V1XA 4B2DD 1D3CA 3IJLA 1O5KA 2VFDA 1W37A 5C6MA 1Q2RA 4IIBA 1HJQA 1Q13A 3N29A 1WKFA 3T07A 3T1GA 3UG5A 3RCYA 3PUEA 1SO3A 3IGSA 3E9AA 1PEZA 4NQ1A 2A1YA 5D09A 1K02A 5E9AA 4Y8FA 5EL1A 2J7DA 4HPXA 4NAFB 3IIPA 4CN1A 4NYUA 4UNIA 3TVAA 3IJQA 1UCWA 3POCA 1T8XA 4G9PA 4AWTA 4XAPA 4DBSA 3C2OA 3W22A 4H9YA 4ZXLA 3TJLA 5G1YA 1RBLA 2OOFA 2VELA 1GOIA 5FJPA 1AL7A 2YCLB 1NQKA 1W5MA 2PD5A 2EXOA 1CGYA 3OG3A 3WQ4A 1FWGC 4Q4QA 2OLSA 4HSHA 1KXTA 3H2OA 1F4AA 2PPGA 1DIOA 4H4IA 4HPHA 2W67A 4A3YA 4GY7A 1B9ZA 3W1RA 5CCZA 1KXHA 2EHHA 4GC4A 4PUEA 4E5TA 4CLMA 3RM9A 4UMBA 2E0PA 3CUGA 1KCXA 1A5LC 5GNXA 3R0KA 3I68A 3WH7A 1I60A 4X63A 3CQHA 1TTJA 3DBNA 4I7VA 1G94A 1BQCA 2ZUNA 1HZYA 3JRKA 4QQUA 1XKYA 1PSCA 2C13A 2RDWA 4N4QA 2QCDB 1WO2A 2XVPA 4QJ5B 3H6OA 3KVJA 4O12A 1H7NA 2PGRA 2PWUA 1LL4A 3EXTA 3LGEA 1QW7A 3TW7A 1JAKA 4PEEA 3QYSA 2KZHA 3T40A 4PTXA 2X1RA 2DH3A 3UT0A 2Q02A 3WLLA 5AZ1A 3FJNA 1TQXA 2VC9A 4GH1A 3WIJA 3AS1A 2BB0A 3EPNA 3GFZA 1H1NA 4YNGA 3B8WA 1OYBA 5AN7A 1Z32X 1OCJA 3CHEA 1E15A 5D4YA 1MXGA 3CQKA 2FZ8A 3UR5A 1HX0A 4QLKA 1RPXA 2D22A 4CQ8A 1XBVA 3DG7A 4GXPA 4E6MA 4IG2A 4BR1A 2R24A 1ZPTA 3QPZA 2X7VA 1HQTA 3H21A 3CUIA 4CQDA 2H9AB 2DW7A 5AB3A 1EB3A 2OQYA 4Z2KA 2DT1A 4JFVA 3L23A 1BVZA 1U33A 3MANA 4HT3A 2E6YA 4GY0A 4ZODA 1A80A 3GW3A 5LIUX 3CL7A 3C5QA 4HK5A 3YPIA 3SI9A 2WO5A 3SCSA 3TOYA 4QQ3A 1JDCA 1E4IA 2PODA 4LYRA 3MUAA 3VILA 3RFAA 1FRBA 3ES7A 1EQCA 3BAJA 2PU0A 1CXLA 5H8UA 3P82A 3FYOA 2V2HA 3BH4A 5I3FA 5FEPA 2D0HA 4F0SA 2CBUA 3BGGA 1GVEA 4F48A 2FZ9A 4YTSA 4NF7A 5CC5A 3GQYA 1NFGA 2XN1A 4KS0A 2CKSA 2B7NA 2HVOA 2GJXA 1AJ2A 1KFCA 2PTYA 3C56A 2HPIA 3CYVA 1X6LA 4MJMA 2XTKA 4KCUA 3PVFA 5E93A 1XIBA 4O50A 1XISA 4A3UA 5HJXA 4GI9A 2J4GA 2YYTA 1BWKA 5CLTA 1E9ZB 3EXSA 3W27A 2GQ8A 1R8LA 2EJAA 1PIIA 3HPSA 4AISA 2GVEA 3S2MA 5I03A 3T2QA 4PULA 3TYEA 4YU1A 3H2FA 2NWSA 1IR2A 1ICPA 2RJGA 3TC7A 2OGYA 1TIWA 2OG9A 1ME7A 1GG0A 3NTYA 3WCZA 5C70A 3VC6A 1WZKA 1XIIA 1U5HA 4UR9A 4BI5A 1RLCL 3KHDA 5AHFA 4DXVA 3AWNA 1PO9A 3CC1A 3PZUA 3G1XA 3BCJA 4F8XA 3GVGA 4S38A 4GNKB 2XVGA 1QO2A 2HBVA 3F5KA 2ASHA 1T40A 1JYNA 1SPQA 4ENLA 4E8GA 1V3IA 1DVJA 4NKCA 2VD8A 5I3JA 1I0BA 3BV7A 3N2BA 2YW4A 1W54A 2ICSA 2V63A 1AW1A 1MRQA 2HS8A 1O95A 4LVFA 1LWJA 3LQLA 1S2UA 4IPJA 2OGJA 3ZXWA 3G6MA 2FDSA 2VEKA 2C0AA 1EF3A 3A9IA 3WQEA 4S3EA 4ZTXA 2W27A 3A24A 1P0BA 1Q5MA 3O6CA 4R34A 3WBXA 4CNPA 2EEXA 4DI8A 1LT7A 4PBFA 3D6NA 4NRSA 4P7NA 2X42A 3FN9A 4BFAA 1SW7A 3MUXA 3WFAA 1W9VA 3ABXA 3CO4A 1Q7MA 4D6DA 2QHAA 4J3VA 1JQXA 3WMSA 4XTDA 4O1DA 4LAMA 4W88A 3QV9A 1U1HA 3HQOA 2PZNA 4FX7A 4MMWA 4MWAD 5E5CA 3ZYZA 4INFA 3KCOA 4LANA 4LVDA 1CLKA 4U31A 5CZSA 2YXGA 3ZT7A 5HUOA 4LUSB 5JQ9A 1EPVA 1A5KC 1G69A 2Z24A 3ES8A 1TA3B 4LNYA 2DZAA 4AMAA 5DFAA 3TAKA 3S9IA 2EPLX 2J7HA 1MUCA 2YW3A 5FF2A 2D69A 2EPOA 5JMUA 1CDGA 3NR0A 4JIIX 1S3TC 2WHJA 4ERAA 5BW6A 3EX4A 3UWYA 5D8ZA 3L2LA 1UASA 3FCPA 6A3HA 4Z2GA 4H6RA 4WOQA 1H7PA 3G6LA 3MP5A 1P4CA 5CZ0A 2PEVA 2ZWZA 3EWXA 1KBIA 3FXGA 4FO4A 1JZ7A 3BWWA 3HFTA 1C9DA 5EGRA 4Z2HA 4KFNA 1BHGA 1EHNA 4HA3A 3TYDA 1EJSC 2D0FA 1Z69A 3WQCA 2OX1A 3W72A 4C90A 4PBEA 1RPKA 2XZ7A 1QBAA 4POCA 4DJEC 3VUPA 2Y5EA 4C6NA 2YFNA 3H2NA 3MT1A 1CEOA 4V27A 3Q67A 3NO3A 3N19B 1IV8A 3PTQA 4GGHA 1C8VA 3IACA 3OU8A 3T44A 1E6RA 2IKGA 2WHKA 4FA3A 1ELSA 1YRRA 3GH7A 4DJDC 3KLKA 2XYLA 4AZ6A 2Y0FA 5KZEA 2ZADA 1PZ1A 1Y5VA 3W2KA 3FYPA 2YCEA 2Y8KA 3W26A 3E5PA 1OC7A 2OZ0A 1QI3A 2GVLA 4YYCA 1H5VA 3W88A 2FJUB 4LCSA 1H0IA 4DBDA 5LSMA 4DJFA 2FVKA 4GYFA 1JI2A 5JH2A 1US2A 2OSYA 4C6KA 5T9BG 1XINA 1DJQA 1D3GA 2WCSA 2CNCA 2E8YA 1UR1A 1FWBC 4HK6A 3FA4A 4F0KA 3WK1A 3W7EA 2WLYA 3R7MA 3Q2DA 2WJZA 3OA3A 2ZCGA 2QVNA 2A4AA 1W17A 1BG4A 3WUFA 4Z0SA 1VHNA 3BSMA 1BAGA 2OPJA 2XIOA 4IIEA 3BV4A 4MG4A 3HPAA 4AMCA 3P8JA 5DQPA 2ZWYA 4MZ1A 5A8PA 3UZZA 6PTDA 1XLJA 3KVKA 3T42A 1H1YA 3EEZA 3FA3A 1YXCA 1ECEA 4MLRA 1QHZA 3CAQA 4A6GA 3CASA 3TJIA 3VZYA 4S3AA 1B4KA 2A3BA 2V5BA 1PZ2A 2OQLA 3CMJA 2Y1HA 3M0LA 1GVIA 2OO0A 1EL3A 4AU0A 3HU7A 1DXEA 1R9XA 2YL6A 4IGMA 1IWBA 2HBXA 3ARYA 3IANA 3UP8A 1JUBA 2Q3RA 4RPQA 2X0SA 3WD2A 5D2VA 5FSDC 3BLPX 2BDQA 3EOSA 1QHPA 1IXPA 3NQ2A 5CBJA 3MY9A 3CXOA 4D1IA 3AYVA 1W8SA 4H9ZA 2PUZA 3MCOA 1OX6A 1ISYA 2C18A 3NQEA 4KWWA 2VDGA 4RZ4A 1R3QA 3CQ0A 1W1TA 2A6LA 3I7SA 3LMYA 4J9JA 3IV8A 3T55A 1I1XA 5EY5A 3WD3A 3NYDA 3RITA 1J12A 3PBYA 3B9OA 1K7XA 4S3JA 3CUJA 1FWAC 4JTJA 1FKWA 5FD0A 1OCNA 2CHOA 1TR1A 3NZGA 4YPJA 4MZ8A 1WXJA 3QR0A 2IPWA 1SFSA 3WJZA 3M41A 3SRDA 1LF1A 1ML1A 5KINA 3A9BA 2DSUA 3WEZA 3UR8A 3LK6A 1OADA 4Q8WA 4F0RA 4MUPA 1LL7A 1Q85A 4H83A 3G1DA 5HULA 4MKNA 4CGTA 1TZ9A 4V28A 2VFGA 2BHZA 3LLXA 5CJNA 3WF4A 2F61A 3WNMA 4C91A 3R12A 1E5JA 7TIMA 1E71M 3DYPA 4H9XA 9RUBA 3RDKA 2ISWA 5LIKX 3K4DA 1GKRA 1H4PA 4ICNA 3V5FA 5A6AA 4U3AA 1LDCA 5J8LA 4JY8A 1ZU8A 4OOZA 4BHYA 1OY0A 1N55A 3WFLA 4C6QA 1FDYA 4KIEA 4K1WA 3DHFA 1I2OA 1M68A 3SIZA 3STPA 3UWWA 3SFWA 2BBFA 1F07A 3WLIA 4H8NA 3ARQA 1OZMA 2HZGA 2YBTA 3PUGA 3DC0A 3DFQA 2Y88A 2X41A 4GLEA 3O7UA 3PZNA 5HWNA 3DFPA 3N17A 4J28A 5U7SA 3VINA 1FCQA 4E3VA 3LI1A 4HU3A 4HN8A 1OGGA 3W86A 1C93A 3XIMA 3M5ZA 1Q6QA 4GZ7A 3EWCA 4RNHA 4TXEA 2OYKA 1ADOA 4IH3A 3NSNA 4M82A 1VFOA 1FWTA 1F76A 1W3KA 5KZMA 3WH6A 2WSPA 5CC3A 3DFTA 3CT7A 4TVUA 3E2SA 1QI5A 1RP8A 5I23A 2Z1KA 3EMCA 1G4EA 3SW6A 1DQWA 1SR9A 1V6VA 4NI8A 4FNRA 5D8WA 3NL5A 1VCVA 3CUZA 1EO5A 4Z0JA 1PL9A 1V08A 5FJJA 1T7LA 3CV1A 2PP3A 3E1F1 4N0RA 3W75A 2QKFA 4B9YA 3CEPA 1ZBVA 3W71A 4ORIA 1IF2A 3W28A 3SGZA 1YPXA 4MJZA 4FLQA 3D3FA 4WX2A 3KLLA 1A47A 4AVOA 2FTWA 2G8ZA 4G1KA 1JUKA 2I5QA 4KEZA 1EDGA 4J4KA 3I6EA 3MTWA 1TZ7A 2CZFA 3QZAA 1UH3A 1S5TA 1VCGA 1V3JA 1SZGA 4BQ5A 4ADUA 3DU0A 3FS2A 5AVNA 4IJCA 5TD4A 3L67A 2V6AA 3BK0A 2IPJA 2QDDA 3F4VA 1J0ZA 4F0HA 1A0EA 2YCIX 3KDOA 4ZVJA 4O1CA 4PUNA 1A0DA 1RLDA 1SFLA 1PS9A 5KZ6A 1S39A 1QK2A 5HNTA 4QG9A 3QQWA 2R94A 1UWUA 2V8ZA 4REQB 2NWRA 5CQ1A 2FB3A 3GDMA 3MBDA 2NQ5A 1PWMA 3EKZA 1UB3A 2IPFA 3ERPA 2TYSA 1EFZA 3EPMA 3AIBA 3SECA 3TTQA 2Z1WA 4JQ2A 1JGIA 4NT0A 1PWLA 2R1NA 1GNXA 1TSIA 3WJWA 4E0CA 3A47A 5LGXA 1PVNA 4IX0A 1X98A 1B90A 4ICCX 2C19A 3SN1A 1CGTA 1IE7C 3FJ6A 3OP2A 4PCSA 4IXXA 4AD4A 2O56A 4EVZA 1Q45A 3M0XA 4YL2A 1LQ0A 3U2EA 3QGAC 4DO6A 4UTMA 1K8XA 1X39A 4AWUA 4O11A 2C14A 3SZ8A 4DHGA 4BF7A 4FXSA 2E5CA 1AW5A 2E8ZA 4Y9AA 3W73A 3D47A 2P76A 5F7UA 1ICQA 4I7UA 3DHUA 1E6ZA 5EMYA 1GW9A 4JTCA 1JZ2A 4LV4A 5B80A 2DEPA 4MUZA 4MB5A 1FWDC 1R3WA 3GU2A 4NZ3A 3FDKA 4DBWA 4GZJA 2EF9A 4C5YA 1OIFA 1WAWA 5D2XA 2QGYA 3QPEA 1K77A 1A5SA 5HINA 1JYWA 1DJIA 1TREA 1UD3A 1WDWA 3GTFA 2KX9A 3CIWA 3NGFA 1RJPA 4ACYA 4D6EA 5KSWA 3B03A 1V0MA 4OWGA 2G95A 2DSZA 1UOZA 3CB3A 1XLIA 1GOXA 4NZCA 5KEZA 4HNLA 4TVDA 1FCVA 4XISA 1M7XA 3M0MA 5IHSA 1OHLA 4NXSA 2JK2A 4AF0B 5A6MA 1SMAA 4BY3A 2GGIA 3W1QA 1WKYA 1GVOA 4HU4A 4XQ6A 3GM8A 3V0UA 1OK4A 4S23A 3T7VA 4CVUA 1ZY9A 1NVMA 2VFIA 1XPGA 4X22A 5D9NA 1EQPA 4O19A 1NJJA 3HURA 2QUVA 3KEHA 2G41A 3MMTA 1W56A 5XINA 3SJ3A 4YYFA 4JICA 3VO0A 5E1QA 4RR4A 2WANA 3S47A 3M9YA 1UD5A 4PL2A 4UCGA 3KS6A 4O0KA 3HA1A 2VRQA 4PZVA 1DEDA 3TNOA 2R1PA 3WD4A 2VZSA 3VVGA 1YX1A 1KM4A 3LQGA 4G56A 1PXGA 1CTNA 4XBJA 3EX6A 1X38A 2ZA3A 3CJPA 3HIJA 4PFMA 2OSXA 5D03A 1CBGA 5K9DA 5EPDA 3M5VA 4B2DA 1ZAIA 3QF0A 2D23A 3JUGA 4W89A 4DZ5A 5CPLA 1WX0A 3MU7A 4M7SA 2PMQA 3TH6A 1XYMA 3GDLA 2VX7A 4CNOA 5G5IA 2WVSA 4MVAA 3L65A 5JBDA 3DAQA 2Y6ZA 2P1FA 1GEHA 2XZ9A 4ZL1A 1EJVC 4PGLA 3CHDA 6XIAA 1VEMA 3GVVA 3M0IA 1TWIA 3LV5A 1XLKA 3UWQA 3M7SA 1VLWA 5GNYA 1M65A 1FDJA 2BY3A 1XV8A 1S5NA 2Z4GA 4ZOCA 3N6JA 4U5IA 2WQDA 3T2PA 2C16A 3VIIA 3QHNA 1DIKA 1S5VA 1NELA 1PX8A 4LUSA 2D2HA 1KWKA 2D2GA 4GA8A 3L0NA 2REQA 4UTTC 3TW9A 1J96A 1EC7A 1ZLPA 3TSDA 3W25A 4A3QA 3EXRA 4LQ1A 2VOTA 4C6LA 3MHFA 4N4PA 1UR3M 1MWOA 1KM5A 4JN8A 2ONEA 4ZE4A 3GUGA 1AFSA 1IR1A 2VM8A 3OZYA 5A6SA 4US5A 1GHRA 3MDWA 5D33A 3NM3A 2RAGA 2DUXA 3LZ5A 3AO0A 3KCJA 4GIEA 3FEMA 2CLFA 2OZTA 3OIHA 5H8MA 3ZQ9A 3CH0A 3H7RA 4ECLA 1O60A 1J10A 4LOCA 2EO7A 3COTA 3BW3A 1FCUA 1IGWA 5ABFB 1PAMA 3LHWA 3W1PA 1OABA 4HMNA 4QFUA 2A3LA 4MNMA 4EE9A 3K46A 4IUGA 4M6UA 4FHAA 1DP0A 1E6SM 1S2VA 1T0OA 3DYOA 3THQA 3KBNA 2I7GA 1NP0A 2PDPA 2J79A 3A3WA 3GNPA 3T8QA 3GZ3A 1E40A 1IEXA 5J5DA 5H2ZA 3KXQA 4OU1A 1L2UA 1KFKA 3MI6A 1EEPA 2ZZ7A 1JYXA 4Z17A 3BCFA 1S5WA 1WUEA 5HMFA 3SRFA 3LN3A 4WUIA 1UC4A 1YE4A 1C3FA 1M7OA 4EACA 3LRMA 4PRWA 3HQNA 3MUIA 5CSRA 1L2QA 3G1AA 4LUIA 2W4XA 2CBIA 3UA3A 2O9RA 3CK5A 4HD5A 1WDSA 4GX8A 4FOKA 4M7TA 3ARXA 1HN1A 1ONEA 2QAFA 1EYWA 2J8GA 2WWDA 1J6OA 2XH2A 2FFIA 1YTEA 3OG2A 2DIJA 3NOYA 2O4QA 2H3BA 4S3KA 3W01A 2PDGA 4DAIA 4NILA 1XYCA 3KRBA 4GE8A 5T8GA 4GJ1A 3AHTA 2ZUVA 1F2JA 3AYTA 1XYFA 2QULA 3HZ3A 4CQAA 5FACA 3NYZA 3SIMA 4L4OA 4QEEA 3NQDA 4DY1A 4C6JA 4K36A 3WDHA 4AFYA 3MSDA 4GNJA 3ZVHA 4LY4A 4KIRA 2XIMA 4XIAA 4B5UA 4G7EA 3RX2A 2R82A 4AZBA 2PCQA 3GX9A 1KFJA 5C0QA 3MYOA 2WBKA 3LXAA 3WDIA 4FNUA 3REQB 5PTDA 4S1FA 3II1A 1MXDA 1KCLA 2PWHA 4L6HA 2F2HA 5EA9A 1EZWA 2ZYFA 5HMEA 4XTIA 3P60A 3LB0A 4GVFA 3Q45A 4DQWA 1LQ2A 5AVHA 2CERA 1KWGA 1X7FA 3GC5A 3GVWA 4IQEA 1I0DA 2XDFA 3C2YA 3EGJA 2ZX5A 2A21A 4QIUA 3A4AA 3LG3A 4DZIA 4TVCA 1UC5A 1OIMA 3SSJA 3GH5A 3UZJA 3O6YX 4KQNA 3NPVA 1EP1A 3VNDA 2ALRA 3ZWTA 1NF7A 3F4DA 1IZCA 1FXPA 2EG8A 1E0WA 2E40A 1QMLA 2PC8A 2E9MA 2J66A 3TXVA 1ADSA 1XIJA 1LOLA 1XPYA 3VOCA 1ZAHA 4ZFMA 3N9KA 2OTDA 4RXFA 3WJYA 1KGWA 2PWDA 4DN1A 3WDJA 4B5WA 4WZHA 3PSWA 3SCOA 1EZ2A 2GZXA 3L21A 3GAKA 1ZRQA 1JCJA 2YDSA 1ENUA 1F6YA 3PPHA 5C71A 3IUDA 1YDNA 3BAWA 4DO4A 4WQ6A 4C7FA 1VIWA 3KW3A 5EFFA 1K7FA 3LTYA 2I56A 5M03A 5EMJA 4B4FA 3EKLA 4L6OA 1BXNA 4URIA 1F3TA 2NVAA 1RCOB 4DJFC 1PZ3A 5D9OA 4DWSB 4PMJA 3TFCA 1QTWA 3EBVA 1UD8A 4KF1A 3Q65A 4GRSA 2NXGA 1YHTA 2VGBA 2V5CA 1KFEA 4LS1A 5DT5A 2PP1A 1R3YA 3VUSA 1DXIA 3MQTA 4L9YA 4TX8A 3L4VA 3WLTA 3WD0A 3W6LA 2DPEA 1R0MA 3WQFA 4PFHA 5HPCA 3K4AA 4ILSA 3WQOA 3N2CA 3RF9A 1GORA 2J9ZA 1MZRA 3BOFA 3T8LA 3SUUA 2QCGA 3TNBA 1LYXA 1DWHM 3AAMA 2FZMA 3GFYA 4ACZA 3C0JA 1KXQA 1TMHA 2R1LA 2WCGA 4GYPA 2ZZ5A 1LBMA 1TCMA 4LC8A 2YPIA 1E4MM 1HXJA 2E5BA 4N6EA 4CCEA 1MW2A 4LS2A 3W2JA 3MHUA 5K9CA 3O07A 2DVXA 2BHUA 2Y24A 4BKNA 4K37A 4TU1A 3TE9A 4US6A 3VA8A 4CN4A 3U5YA 4ZO9A 2TRSA 3N2OA 4LYKA 2WXDM 1XYBA 5EBAA 1QVBA 3AHZA 1CIUA 4UTUA 4O53A 4WIWA 1VFFA 3WLPA 3AQUA 3F03K 4L7ZA 3LRLA 1QR7A 3HG2A 1ODZA 2HISA 3EOUA 5HQMA 3G1FA 1OCQA 2CYGA 2Z2UA 3BLOA 4LAZA 2ZVIA 4XAGA 5HANA 1EBHA 3NOEA 1P0DA 2ALDA 3L4ZA 2GSJA 3NPUA 1T5AA 1JPMA 1NDVA 1S1PA 2O9PA 2R91A 5LIYX 3MJMA 3WZ0E 2VZUA 1DL3A 1O5QA 4DM1A 1GUVA 3WDRA 4UTHA 2NXHA 5A6KA 5CGQA 3EYPA 4YVXA 4I5UA 4TMCA 4H9MA 2GJXB 2XFRA 3H26A 3P67A 1RCQA 4L1XA 1BF6A 4QG8A 3B0YA 4MFDA 4AX6A 4KW2A 1CENA 2V5DA 1UIOA 1HFBA 1SMDA 4A8RA 3MKKA 1BQGA 4ZBCA 2NUWA 1BKSA 4QCFA 1UR0A 1S5MA 1KR0A 4WY0F 5FEXA 2VVNA 2E6DA 1V6TA 1ME8A 1UH2A 2VX4A 3VMPA 3ZSSA 3SADA 4AZ7A 3VNMA 2DZWA 4KETA 4JFTA 3T09A 3VDBA 2OVLA 4K38A 3UZYA 4UTIA 5HQLA 2OEMA 3MS8A 1AD1A 3ME3A 3A3HA 4XZBA 4PTMA 1G4TA 2Y7FA 3LCWA 3I6RA 1JZ4A 3HMCA 3NO1A 3KHJA 4HMEA 1P5BA 3R0DA 4HNCA 2G3FA 4LPCA 4GI6A 4LBRA 3E0FA 4RW5A 1PE1A 2WVTA 3DN5A 4X3ZA 1B30A 2C15A 1V3HA 2AMGA 4BEQA 4WKHA 4HPGA 4KCWA 2CLKA 2V3DA 3K13A 1UHVA 1P48A 3R4IA 3CPGA 4PUMA 2GUYA 4XK2A 1LZOA 4EF9A 3W9ZA 2J77A 2Q71A 3UBPC 4A29A 4FNTA 4DAFA 2J75A 3LOTA 4B15A 2XIIA 2X2YA 2Z1XA 4FK9A 1E4LA 2NVCA 1BXBA 3C52A 1YMYA 1TFVA 1WBJA 3W76A 3GC2A 3V0SA 3SCUA 1KV5A 2ZC1A 1WKDA 6ALDA 3VK5A 3VX0A 2ZXAA 1Z8AA 1QW9A 2PTWA 3P62A 1VFLA 5HAOA 1LL6A 2JALA 1XRVA 3O0KA 5I24A 4Z2JA 4F0LA 3QY8A 3PFRA 3T0DA 3B8DA 2X1IA 1B31A 4NJIA 4D6IA 3MI2A 1E73M 2D24A 4RPPA 4B91A 3NSXA 4IISA 1Q65A 3NO5A 4E4UA 1KLYA 2E1DA 1PHWA 2D20A 3ZJ7A 3IWPA 2BXZA 3B9AA 4TO8A 2ZUSA 4NHVA 4QRNA 3HPXA 3THDA 4Q3MA 3DKLA 2WZTA 4GPNA 3SO7A 2R6OA 3BJTA 4A3RA 5F1VA 1K9TA 3B04A 4PEKA 3QFWA 4ZR8A 1OT1A 1K70A 3EEGA 4WY0A 2XN0A 1XDMA 4ZB0A 2YA0A 1ZJBA 1QPKA 3FHQA 4LVAA 1UG6A 1AJZA 3O6DA 2H3DA 1W1IE 1ZS2A 3ZR4A 2XIBA 5KMYA 4EK7A 3E2RA 1M53A 4EAYA 3NQFA 4H1ZA 1CCWB 1E0VA 2QF8A 3WMBA 1IEWA 1H50A 1G4PA 4ZO7A 3NPXA 3KFTA 3S3GA 2R14A 1HUVA 3TN5A 3P5ZA 3PJWA 3E6EA 3LHZA 1AJ0A 1W8GA 2VO5A 3WUBA 3ZLGA 1RV8A 4NAFA 1FOBA 3USZA 2HMCA 1ZTVA 3GU1A 4LAKA 2WHLA 1DJWA 3B8VA 4HYWA 1OK6A 3O9NA 3BICA 4H6KA 1HGWA 3HO8A 3WJXA 3MCMA 4JTEA 4MDOA 3L0KA 4GG9A 1KBJA 5FF4A 3H53A 2PLJA 5EMMA 4WRHA 4GNVA 3ZS4A 3CU2A 4DYJA 1Z42A 2WZMA 3S8HA 3UVAA 3W2MA 3OZMA 3PHAA 4NZ4A 2ZUWA 2AL1A 1NF0A 5DBUA 2FJKA 4I90A 2VCBA 1MNSA 3ITLA 1AK5A 5A2CA 3FK4A 2A6NA 4KFPA 3TN6A 4O1EA 3N25A 4IMEA 3PZIA 1QNOA 4JTFA 4WGHA 4GCXA 1EHAA 3VKCA 1XICA 1CLXA 3W70A 4AYGA 3WD1A 4NRRA 1I9CB 5JH1A 3INPA 4TX9A 1UKTA 1LCOA 3OIXA 1RZMA 4AZCA 1X1NA 4RZ5A 1CLVA 2WOQA 3GR4A 3JW7A 3EB3A 1BG9A 1MMFA 4X0NA 1TTPA 4PR4A 3NAVA 4IPIA 3N73A 1E3XA 5BYWA 1TPFA 2ZVRA 1D8CA 3UZ5A 4UTWA 4YVVA 1XLDA 1UP3A 2DZSA 3B0VC 3CNYA 1KTCA 4HA1A 2YOCA 5D2WA 2P0IA 1VPQA 3W84A 3WQWA 3POHA 1Q8AA 4MYXA 3VGBA 1DWJM 3ARTA 1VRXA 5I3KA 5D32A 3M47A 3TLLA 5LIXX 3B40A 3EWDA 3T9PA 3OOQA 3HGRA 4JKKA 3BOXA 5FF3A 3RYSA 3D0CA 1V3LA 4RDWA 1KFWA 2OWCA 4N9DA 1OWQA 4DWSD 1OX4B 2DZBA 1QWKA 5I6SA 3RRAA 5TQLA 1XLBA 2ZDSA 3AXKA 3PG9A 4HNOA 3SQMA 3UWZA 2FZNA 3AUJA 4JDYA 2JKAA 4AQLA 2V0TA 3BDKA 2I5IA 3GDKA 1FWIC 4KEMA 2WZHA 3KL5A 3PBWA 2V3FA 2QAPA 3CV6A 1CI1A 1E56A 4XZHA 3M1ZA 2QQ6A 4H9VA 1TB3A 1EP3A 2HQAA 5BWAA 4XZWA 3MP4A 3TR9A 2EGZA 5HK4A 3R43A 5D9PA 2QCEA 3WNNA 4GYJA 1BEUA 1R2TA 3C86A 2E5DA 1VC4A 1PKYA 1SZEA 4C7DA 1CXHA 2CHRA 4GOAA 1JL8A 1FWEC 4D8LA 2OEKA 4C1NB 2DZXA 3PWGA 4CU8A 1ISVA 5BXPA 4XWUA 1XRTA 4XIMA 1JUEA 1QI2A 1H61A 1XJBA 3OW1A 6XIMA 2ACSA 3U6WA 1Q6RA 2J62A 1VFHA 1NSJA 3AHVA 1BRLA 1JDFA 2VDIA 3SB0A 2INFA 3IK4A 1PIGA 4PSRA 5DMLA 3IIXA 3S2NA 3THCA 3FGCA 4GQ0A 3LCHA 1FWFC 5HNUA 2VP8A 4C6DA 3QC3A 1KRBC 1JZ5A 1W6TA 3FKRA 4JX6A 3ITOA 4MGGA 2ZZ1A 4DJED 4UZUA 2PA6A 3ZT6A 5L9FA 2ZZ4A 3W2UA 4H8HA 3UNTA 1WXZA 4W86A 1XLGA 4Z1AA 3VD5A 4HSNA 4P7LA 4UUIA 3WQDA 4P8UA 4PE8A 4RLIA 3URAA 1GCYA 1X96A 3W7CA 5F2IA 5BMXA 3N2MA 3U0HA 4X0VA 2DVTA 1KM0A 3OGSA 2OWWA 3SM0A 4GXWA 2QS8A 4Q6JA 4O4WA 2GWNA 2IKIA 2VFFA 3TYBA 2CLOA 4TX6A 3W2NA 3PPGA 4L4LA 2PTXA 4BK9A 3RLVA 1ESWA 3SUSA 1F05A 2RHGA 3WK3A 5HDRA 2JGQA 1HJWA 3L66A 4ZOAA 1E6XM 1R2RA 4Y6GA 3OODA 4M19A 2YB4A 2YZRA 3B9DA 4E2VA 2OWXA 1Y65A 4HHLA 3UR7A 5LXEA 4YVPA 3EB4A 1TA3A 7CGTA 4HYVA 1QCWA 4RK8A 5AY7A 4OBTA 2F6KA 1UOKA 3EWBX 4QXIA 3SCQA 4DX3A 4L4PA 1JPHA 2OLAA 1LQAA 1BYAA 5T26A 2ISSA 2Z2AA 3ICJA 4HOZA 1R3TA 1TE6A 2PGFA 3EB2A 2OYMA 3JU2A 2YCJA 3RJYA 5LA1A 1C7SA 8XIMA 5FJIA 3HB9A 3CMFA 1GWJA 2H8ZA 4PN2A 2NLIA 1L6SA 2PBOA 3M0YA 3TK7A 3S9YA 1W32A 4EWND 4LEFA 3A4WA 5G4EA 4C6FA 1OM0A 1L8PA 5HQEA 1SYTA 1W9DM 2P50A 1J0IA 4LW7A 3QBUA 4Q4SA 1ZBCA 1UP0A 3H2MA 2FHFA 2IPGA 1ZP4A 3G1HA 2WKLA 4O10A 4RV8A 2RDTA 3STEA 3ABRA 2Z28A 1HGYA 4U3CA 2ATSA 3VDHA 3M64A 3VX1A 5DANA 4A8NA 3C2RA 3TQPA 1W3LA 1R85A 2OLHA 2BWGA 4Y9OA 4ZSUA 3W7PA 4S3CA 1LROA 3KX6A 2VUNA 3FAXA 3VXGA 4US5D 2INZA 1O68A 3M0ZA 1XI3A 3L5LA 2DIKA 4NP7A 4A4AA 4OECA 1FHUA 1ONXA 4JIPA 2V5JA 5G2HA 3UW6A 3K8LA 4MNLA 2ZC8A 4HOXA 1RK5A 3IJ8A 2CCRA 4J3XA 3VFLA 1MXSA 1XBYA 1O1ZA 1L0PA 2B7QA 1J6PA 3LPFA 4XD4A 2TPSA 4DYEA 2A3CA 2VWTA 3EWYA 2YL5A 1ZJIA 4K3ZA 4DXKA 5CBBA 3SN0A 1Q6FA 5DF0A 5BXSA 1M01A 1KV8A 4LXFA 3ONCA 4O4VA 3QLDA 4JTTA 3GHUA 2BOGX 4KBXA 3QSTA 5H6HA 4UTFA 4Q4PA 3LHTA 4HJFA 4ICMA 3STCA 1LP6A 1PBGA 4IUOA 3MV11 4O1AA 5MF5A 2J25A 1BF2A 1NFPA 1ZENA 1C90A 1ZGDA 4IMCA 3ZJKA 4E2OA 1UWRA 2WK2A 1J9YA 3JZEA 3IEBA 3PTKA 3PK7A 1FBAA 2B0MA 4QROA 2J8FA 2GK1B 4Q4KA 1XDJA 2W61A 1EA0A 3PSVA 1VP5A 4Q4MA 3KM8A 2VCAA 3TP4A 1ZAJA 4D2JA 4X9SA 3V1PA 4H19A 2OQHA 1R7AA 2V38A 1U1JA 2HWGA 3LLDA 3UPBA 3N3MA 1B3XA 3VE9A 3SRHA 1XLHA 2XIQA 3QTGA 3KTSA 2OXNA 4AD5A 1Y8BA 4HNTA 1YBQA 2WZEA 3HJZA 4AIOA 3P80A 3XINA 2FKPA 5GJMA 4P8VA 2X16A 2DT3A 1RD5A 2VKZG 4O8RA 3LPOA 1TPUA 5HMDA 2ZX8A 2CLEA 3TWBA 5IHRA 4HP5A 2W66A 1AL8A 3GKFA 2ZRWA 4PTWA 4JS3A 3EA3A 3L7RA 1YE6A 3GHRA 1RJQA 3E96A 3FLUA 1PPIA 2O0TA 1LBFA 4GWEA 2X8RA 2PDXA 5I5RA 5LXXA 3CL6A 1F4HA 3VIMA 3PNUA 1DXFA 2VC6A 1KR1A 2RUSA 5D05A 4REQA 3O0FA 3B8TA 2ATMA 1DJYA 1AD4A 4UQDA 1KM1A 3A3XA 3ELFA 3OYXA 4AIEA 2PI6A 4CKQA 1KD0A 3G1VA 3N13A 3VIPA 1K1DA 3F4CA 4OV9A 5I7GA 1MQPA 1P6CA 1CGXA 1VPXA 4QAIA 1ECQA 4MKVA 2ZRUA 2VYOA 8XIAA 4XSLA 4FSAA 4ADTA 1TJ0A 1IIHA 2PF8A 2W0UA 5IXEA 4YTUA 1J4EA 1DBTA 1KQYA 5AOUA 4ZB2A 4RL3A 3ZR5A 4R33A 1TJPA 2X40A 1POKA 2J27A 3U7BA 1EOKA 4Z1CA 3G0XA 4KWUA 2HJPA 1XLFA 2XU2A 2DZUA 5EB8A 4MJ2A 2YSWA 4UR8A 4AEFA 1EUNA 4FF5A 4AHPA 1QNPA 3RPDA 3UYIA 3QQ1A 4AUBA 3TTYA 4H2CA 1A5NC 3AHYA 1NOUA 4CQ9A 1DTUA 3FJLA 4EPDC 3NQVA 1GKQA 3TQ0A 4R3UA 2CZVA 3WFZA 1GEQA 4AWSA 1LWHA 2GWGA 4A2SA 1S1RA 3SR7A 1UA3A 3G3DA 4J40A 3UJ2A 1FH8A 3VD9A 1FA2A 3DYMA 2A5HA 3WDPP 3VU2A 4Q32A 1YPFA 4OE7A 1A5OC 4R7OA 4YLWA 3RO6A 4LYPA 1E6PA 1JPKA 2C79A 3GK0A 2YZ5A 1EP2A 4JTDA 2RJHA 4ZCWA 1H60A 4XSMA 3CQJA 5D02A 3VNJA 3N4AA 3IGHX 3FOKA 2J24A 4QSFA 5LKYA 2YL9A 4OT7A 4DB7A 3NXFA 2C3ZA 2QEZA 4AVFA 3DG3A 2DSKA 2PWGA 4K8EA 4AB4A 3S1VA 4D6GA 4RKAA 3S6DA 3I4EA 3DC8A 1GVSA 2FGLA 2JKPA 1TVPA 1OGSA 4FR6A 2DFAA 3ZZ1A 1LBLA 4UTWC 4H9TA 4PCNA 1GQJA 2VENA 4IIFA 2I9EA 4HZMA 2VEIA 5AC5A 5JBFA 1DV7A 3FFSA 1WZAA 2BTMA 1XFBA 4ZFCA 2Y2WA 3S5YA 1XIFA 1XM3A 1BYDA 1ZP3A 3PB0A 4QNWA 3AC0A 3VCRA 5EYWA 4CU7A 3NWRA 3G24A 5DX7A 2FGBA 4AXKA 4IQDA 2Q09A 4K7VA 5DN1A 2F9RA 5I3HA 2GJLA 1X1OA 3RPTA 4LF1A 4EX4A 3LNPA 4QCEA 2VR5A 5LGZA 3NVTA 1US3A 4IF2A 1GG1A 1KXVA 1XHGA 1WDRA 1BD0A 3ALGA 3V35A 3CAWA 4C1LA 5HOSA 1QO5A 4UOJA 4HTYA 3T0TA 4NZJA 3VNYA 1XP3A 3LM7A 5F4SA 2E1WA 5FKYA 3FIGA 2FPTA 5F2GA 4DXXA 2WNWA 3VGEA 3G1YA 4GFSA 2HPMA 4KFOA 5F2LA 3WENA 4DWDA 5DEZA 5XIMA 3VGFA 4NL1A 3DKJA 4KEVA 1FWWA 2Y5SA 3U48A 3VIKA 3L4XA 3B9EA 4NNCA 3IARA 1XG3A 1GZ1A 4RNJA 3H7VA 3PAJA 1IZJA 4Z1DA 1R46A 3ORWA 1EEXA 2QJHA 3WUEA 4Q8QA 4W84A 2PDBA 5BCAA 2DZVA 4WJEA 3SCTA 1R7OA 4NAEB 3TMLA 1CXIA 4PA8A 3SQLA 4KWSA 1L6YA 3C8FA 4DUOA 1Y7VA 1ISXA 3W7DA 1O5XA 1L6FA 4MTVA 2WCAA 2FYMA 4JX5A 4J1OA 2WVUA 1B3OA 1NARA 4GISA 2ODOA 2YA2A 1H5YA 5GJPA 5IDIA 2DT2A 3KVLA 3RHGA 3LI0A 4TV5A 4XO6A 3GC4A 4PUJA 1P6BA 3QHMA 4O8AA 1Q66A 1W0MA 3VZZA 4YHEA 4JKLA 1EXBA 1DOSA 4TTUA 2DT0A 3VD3A 3W3OA 4MOZA 3P84A 4F9JA 5D04C 3HOJA 1TWDA 1R86A 2FQIA 3WL1A 3TSBA 1YBQB 4M56A 4JIQA 2X05A 4EANA 1X6NA 2F6UA 3SCRA 2GDUA 5B7ZA 3VNZA 3HM7A 2A2IA 5CC7A 2ISVA 3BGAA 5CPQA 4H41A 2PURA 1UD2A 1XCWA 3WQ6A 5CPNA 4Q8TA 1SO5A 2CLLA 3U3HA 2GK1A 4JNZA 1GVYA 3BL3A 2XH0A 1D9EA 3DUGA 3OVGA 2WM0A 1BGGA 2G3JA 1KCZA 4PMDA 3P0XA 2V82A 1CGUA 5IM51 3DDMA 3ID7A 3H8AA 2Q01A 4E38A 1WZMA 4ZSTA 3M0KA 3UJRA 2CHNA 1KB3A 3U4FA 5LNVA 3MKCA 4KGJA 1UUQA 1UWTA 3GHSA 2EKCA 3TR2A 3C0SA 3EPOA 1J11A 3E49A 1XLLA 3W6MA 3GDRA 2BVWA 4XUYA 3RAOA 4IQLA 2C6QA 5EFDA 1CGVA 3MI3A 1GZGA 3WLOA 4O1BA