5FOOA

6-phospho-beta-glucosidase
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
463
structure length
463
Chain Sequence
MLAFPKEFWWGGATSGPQSEGRFAKQHRNLFDYWYEEEPDLFYDYVGPDTASDAYHQIESDLTLLASLGHNSYRTSIQWTRLIDDFEQATINPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQAYGGWESKHVVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYLMQFHYPAIVDGKKAVQVAYNLALATAKVIQAYRRGPAELSDGRIGTILNLTPAYPASQSEADMAAAHFAELWNNDLFMEAAVHGKFPEELVAVLKKDGVLWQSTPEELALIAENRVDYLGLNFYHPKRVKAPDAIPVISPSWSPEWYYDPYLMPGHRMNVDKGWEIYPEAVYDIAIKMRDHYDNIPWFLSENGVGISGEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRPKASAYWFKKVATHNRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 6-PHOSPHO-BETA-D GLYCOSIDASE
publication title Chemoenzymatic Synthesis of 6-Phospho-Cyclophellitol as a Novel Probe of 6-Phospho-Beta-Glucosidases.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 194
structure length 463
sequence length 463
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5fooA00
4CN6A 1DWIM 3PZIA 5A6AA 1Y7VA 4ATLA 5HPOA 1GCYA 2DIEA 3F5LA 1PZ3A 4FLRA 1M04A 1HNYA 1E6RA 4B9ZA 1H4PA 3FW6A 4GKLA 1WNOA 3EMZA 4PMOA 1BYAA 1US3A 3PZUA 3PTMA 3VO0A 3W28A 3WD1A 1CGVA 2HVMA 3CHCA 4UQBA 3NJ3A 3SUVA 1K9DA 1MFVA 4JCLA 1KXTA 4ZE5A 1IT0A 2J47A 4E8CA 4P8UA 2J7BA 1GOOA 2J77A 4TOQA 1YQ2A 3VMOA 1ODUA 2V5DA 4JFWA 4DM1A 5JBDA 5BRQA 1B3ZA 3M7SA 2PB1A 1HJSA 3KL5A 4UOQA 3BAYA 3WEMA 2ZX9A 5AY7A 4HMDA 1UQZA 1H2JA 2RGLA 4A3YA 3CUFA 4B3KA 1PEZA 1OSEA 4UZUA 3VGEA 2Z1SA 4GQRA 4HA4A 1XGZA 2F8QA 2CBVA 5JBFA 1CXKA 2GUYA 1GHRA 1RP8A 4OBSA 3N9KA 1E15A 3WD2A 4AZCB 4JFSA 4AD1A 4F79A 5CQ1A 3VD7A 1CGUA 4MAVA 5D9MA 3U57A 3WSUA 1DEDA 1HJUA 1HL8A 2FHCA 2J7GA 2XIBA 3N04A 3QGVA 4OOUA 1C91A 2A3AA 3CZLA 5KEZA 4AXNA 5BROA 2QV4A 2XWDA 3WMSA 4FF5A 1EA9C 3N15A 3WY1A 2ZUTA 1J0KA 1NP0A 4LYQA 1B3YA 2GJXB 4BS0A 1NWSA 4E4PA 5LA1A 1M01A 1XSJA 1UKQA 5CGMA 5A6MA 4JFVA 3SCTA 3B8SA 1JFXA 2G3MA 2W67A 1YHTA 3WUFA 4CCDA 3IJ9A 1QHZA 1LLOA 3MO4A 4RL3A 2DSZA 1V6WA 1UD6A 3S6TA 1WO2A 5IXEA 5A8PA 3VIKA 2WVSA 2X05A 5EMYA 3PZ9A 1LL4A 1RH9A 2O9TA 3VGHA 3UR8A 1EDTA 1KXQA 3WH5A 4JAWA 5HDRA 3VOCA 4W84A 2ZXQA 4U33A 3BCDA 4D1IA 2WVVA 1DWGM 1X6NA 3L4ZA 1E1EA 2ZUVA 2AMGA 1EHAA 3PZGA 1J11A 2EPLX 1EO7A 2DH3A 5CXPA 4ACZA 3ARWA 3VIPA 1H41A 2E0PA 1ZJBA 4U2ZA 3MMDA 4W85A 1VJSA 4E8DA 3E1F1 2XTKA 2E9MA 2VRKA 3B9EA 2O92A 2FHBA 4OUEA 3WD4A 1VENA 1ZBCA 2DSWA 5DMYA 1ZBKA 5CGTA 1GJUA 2A3BA 1R8LA 4U5KA 2X0HA 4M82A 4AD3A 3NCOA 4MPKA 3UETA 3VILA 3BLKA 3EDFA 4Z2IA 4PMYA 1CGWA 1SMAA 1PX3A 1V6XA 1QI2A 2BVYA 1RPKA 2G41A 1BLIA 2FDMA 3AXXA 1SFSA 4FLSA 1TE1A 4PYSA 1VEMA 3W27A 1E4IA 2WBKA 2YDQA 1M53A 2PWHA 1E6PA 3N11A 4PTWA 3FNDA 5I6SA 4AZ6A 1JXJA 3PTQA 2GJRA 5ABFA 1K6AA 5A6LA 1L0PA 1H0IA 4AEEA 1MW0A 3OB8A 1CXIA 1ISWA 2ZUNA 3W53A 4MNLA 2FGZA 4PTVA 5M17A 5A1AA 2J8GA 5D8ZA 2CNCA 2A3CA 1BVNP 3W37A 2UY4A 1F4AA 1IZJA 4BQ2A 4FLQA 1KCKA 4B15A 4HOXA 3TTQA 4PMDA 3FN9A 1G01A 1OGBA 1XC6A 4PUEA 1CLXA 2X1IA 4ZXOA 1KWKA 3ZO9A 1E5JA 1GQJA 2WWDA 3OA5A 2EPNA 5I2UA 2QMJA 1B3WA 3AXIA 5E0FA 1Z32X 3PZVA 3BH4A 1NH6A 5DFAA 4J28A 4YHEA 3SUSA 3UG3A 3WEZA 1UKOA 5A8OA 3U7VA 2VUYA 3CGTA 1WCGA 2DIJA 2BY1A 2VOTA 5A3HA 1W3JA 3OIHA 1W9PA 1PIGA 2W92A 1JZ2A 1ZBWA 1W3LA 1JAKA 1VEOA 4LQ1A 1UG6A 5LA0A 4Z2JA 3W25A 4GI6A 4ACYA 7CGTA 3WMBA 4D6IA 1V0MA 2EPOA 1MQQA 2D23A 4GO8A 4U3AA 3FXYA 3F5JA 2BY2A 3WDIA 3QHMA 5E70A 1FH7A 1TVPA 1UR2A 5BXTA 3RMEA 1R7OA 1XSKA 2NT0A 4W7WA 1UH3A 3K8MA 3K46A 1JFHA 1PX8A 3MUAA 4A3HA 1MWOA 3SIMA 5FOOA 2FHFA 1JZ3A 2MANA 4AZBA 1PPIA 4L4PA 1BSIA 2CYGA 2YKKA 3MKKA 1E56A 3UESA 3QOMA 1R7AA 4GZEA 4GQQA 3MV11 2VX5A 4NI3A 1XV8A 1J9YA 4DUWA 2DEPA 1E43A 3T0BA 1R87A 2O9OA 4JL1A 4AZ7A 3SCPA 4JFTA 1UD5A 1QHOA 5DT5A 2J7DA 2CKRA 1HVQA 1AVAA 2OLHA 1V3JA 1GOKA 1UWUA 3GH4A 2IUZA 1M03A 1OT2A 4BA0A 4JHOA 3A4WA 2VR5A 1KR0A 4X9YA 4HU8A 2VZTA 1UWIA 3ZMRA 3BMWA 3RDKA 5I3DA 1FOBA 1G9HA 3B9AA 1BG4A 2D2OA 2ESCA 4M24A 2J8FA 4MAZA 4BF7A 2ZICA 5HPCA 3VVGA 1MQRA 1CPUA 2OWXA 4PTXA 2DSUA 1MYRA 4UOJA 1Q6FA 2J7EA 2XVKA 1V08A 4WIWA 5A8NA 3WBAA 5GNXA 1UR0A 3NUKA 5E6ZA 4ZXLA 3WQ6A 1V6VA 2YA1A 4J3WA 4DWSC 2J7CA 4D1JA 1B1YA 1JZ4A 4PCSA 3CHFA 4NF7A 3WH9A 4FK9A 4BQ4A 4W5ZA 4LPCA 1DHKA 4AZGA 4TTGA 3CIVA 2CESA 3CZKA 5E9AA 3K8LA 2EBNA 3THCA 2VI0A 3W6MA 2ZUMA 1QNSA 1BGGA 5A6KA 2NSXA 1CYGA 2CKSA 4UFHA 4HZ8A 4HA3A 1X1NA 3RO8A 1UZ4A 2VCCA 2EXOA 4JKMA 5M03A 3RIKA 3T0AA 2WC4A 5E09A 1G1YA 3WUBA 1E0VA 1DWHM 2PWDA 1V0KA 3BMVA 4WF7A 1GW1A 2JE8A 1QBAA 4LGXA 3BSGA 1HJWA 1XHGA 4PMRA 2ZX6A 3GBEA 1E6ZA 3ZR5A 4PMUA 1AQHA 5BXRA 3AISA 4P7RA 4D71A 3UEQA 1WZMA 3A6OA 3F5KA 3ZJ7A 5CPQA 2WCGA 1QW8A 4ZEPA 4M80A 2UY5A 2QPSA 2WCAA 4HTYA 3GTNA 1V3HA 4AZHA 3K4AA 4U31A 4Z2LA 5ABFB 2XVGA 4K68A 8CGTA 3HMCA 3U5UA 4PMVA 3MUZ1 4AIUA 4HOWA 5AC5A 2XVPA 1E0XA 5CPTA 4AD2A 2YIHA 4UCFA 3APGA 2QLYA 2D3NA 4J3VA 1DTUA 1CGTA 5JIWA 4DWSD 4JCMA 1UQYA 2ZUWA 3IAQA 3CUJA 1K9TA 1CGXA 3MUIA 4FLOA 3OLDA 3VTRA 1M7XA 2XPKA 1QI5A 1J01A 2WZHA 4F9DA 3CHDA 3U7BA 3TOPA 3AHTA 2F2HA 1KQZA 2WHKA 3AS0A 1PZ2A 4A4AA 3WQ8A 1W9DM 4PBGA 2GSJA 1VB9A 1HJQA 5GNYA 3HU7A 1SYTA 1VAHA 1ZL1A 1KBBA 1XRVA 4NRSA 2X8RA 2YJQA 3LPFA 1C3FA 3WD3A 4PUDA 2XFRA 4R5EA 1H5VA 5BCAA 3POHA 5I0DA 8A3HA 1QNRA 2PC8A 5A6BD 3VIMA 2DPEA 5HXMA 4AD0A 3DHPA 3WDQA 3IJ8A 3OG2A 3MV01 4TXEA 4V2XA 1TZ7A 4AD4A 3II1A 1KB3A 1EGZA 3TTYA 3CTTA 4UR9A 1LG1A 4ML4A 2D0GA 3WNLA 3FHAA 2W4XA 4M8UA 4KGJA 3BXWA 3T2PA 5A95A 4B9YA 3VINA 4JIEA 1ESWA 2C8NA 4W87A 2BXZA 4XUYA 1FH9A 1EOKA 2G4FA 3THDA 4N0RA 3DC0A 3OLIA 3WDPP 3VDBA 1NOWA 3WMCA 1C93A 3D5HA 2OWCA 2G8ZA 3M6DA 4HPGA 5A2CA 5LA2A 3VGBA 3JUGA 2GVYA 4MNJA 4DM2A 2JALA 4PEEA 1XCXA 3CH9A 4TX8A 1H11A 2QF8A 1NM9A 3GM8A 1GJWA 1GVYA 2WMJA 3AIEA 3ARPA 3AHYA 1H09A 5A8MA 2BVTA 2PWEA 4YHGA 4IM4A 2JF7A 1JZ7A 1EO5A 4H7VA 3ZR6A 1FHLA 4MNKA 3BGAA 1TUXA 4MDPA 2BY0A 3T09A 1QNQA 1WDQA 4DWSA 1R85A 1CGYA 4EK7A 4CD6A 1PX4A 5CJ5A 3T2QA 2O9RA 1E55A 1CTNA 2E8YA 1DWJM 1OIFA 2J78A 3VM5A 2Y2WA 1JG9A 3GXMA 3RCNA 3SUTA 2VRQA 4HMEA 4PCTA 1CXHA 2CBUA 3CPUA 2WVUA 4PMXA 1BAGA 4WJXA 4CVWA 1LF1A 5CPSA 1KGWA 4AISA 1BG9A 1OB0A 2CCRA 3ECQA 5IHRA 3BAWA 6A3HA 3PZOA 5A6BA 3POCA 3MUY1 4HPHA 1QNOA 1UD8A 1RP9A 2WAGA 1UOKA 3FHQA 1BHGA 1UWSA 1NWRA 7A3HA 2YBUA 1QBBA 4Z2KA 3QR3A 5JUVA 4XZWA 3L4VA 4LYRA 1CIUA 2DSKA 1MW2A 2WYSA 1EH9A 2XSAA 4TVUA 1LL7A 2GK1A 4U5IA 4D6HA 1UR4A 1KBKA 4C7DA 1R86A 3LPOA 3ARQA 4H8VA 3ZJKA 4AWEA 5EBAA 4Z2GA 3WL1A 1IV8A 3WH8A 4TVDA 2Q8XA 4IPNB 3ALFA 1U2YA 3IJ7A 3KL3A 3UG4A 3AZRA 3ARUA 3CBWA 1ODZA 4CU7A 1KFWA 1W3KA 1XH1A 2BV9A 1D3CA 1HJXA 1XD0A 3B9DA 4X0VA 2BHZA 3L4YA 4TX6A 1G5AA 2BS9A 4GI8A 3N1AA 3KL0A 3BAIA 5EFFA 2WC3A 4W86A 2VRJA 5GQBA 1TMQA 2WLYA 3CUHA 3GZAA 1RD6A 3DECA 1E72M 3EDDA 2XJ7A 2OSXA 5A94A 3PZNA 2W91A 1B2YA 1CBGA 1DWFM 4CGTA 4PMZA 2YOCA 2ZE0A 2UY3A 3WIJA 3VNYA 5ABHA 3IK2A 4ATDA 1ITXA 3W4RA 4OKDA 2D22A 1B9ZA 2OYMA 3WN6A 3AOFA 3WQVA 1VFFA 2WMHA 2J79A 1TVNA 5I23A 3ZJ8A 1H3GA 2VZUA 3WDJA 4CD5A 3PZTA 3A4AA 2O9PA 2WBGA 4HOZA 4QCFA 1LJYA 4AD5A 1HL9A 1JYXA 2Y8KA 1X6LA 2NW0A 1ZS2A 1NP2A 3CMJA 2BXYA 3RJXA 2YBTA 2VL4A 1E3XA 1V3IA 3GNPA 1FFRA 3AQUA 2GDUA 2WW5A 2X2YA 3TA9A 4V27A 3W38A 2WKLA 1QVBA 4S3KA 1JZ5A 3WNPA 2F61A 2OYKA 5CG0A 3ARXA 1TR1A 4QFUA 1BGAA 1FA2A 1C8QA 1HP4A 4J3XA 2IXUA 4P8XA 3OZPA 1JDCA 1HT6A 3VU2A 2ZWYA 4B16A 3N17A 2YDRA 1JNDA 3WL0A 1E3ZA 2UWFA 1V03A 4LX4A 1CXEA 1W1PA 2W63A 1HJVA 1JDDA 2XFYA 4D6CA 4EKJA 4F66A 1BVZA 1VF8A 2WPGA 4CCEA 1MVYA 3NSNA 1F4HA 2VMFA 4OZOA 4Q22A 3WELA 1CNVA 1JYVA 2G3IA 3ZT7A 4BQ5A 3BSHA 1FFQA 1UWRA 3OLEA 1H49A 5I77A 2ZUUA 4ZFMA 4P7QA 3I3BA 2CEQA 3RILA 1ZBVA 3VIGA 5C8BB 1JZ6A 4UFKA 4MB5A 6TAAA 3WF1A 1L8NA 1FP9A 2D0HA 1C8XA 4HU0A 3ZSTA 1OD8A 1XCWA 1OT1A 1V02E 4L4OA 4MNMA 4W5UA 4M81A 4DWSB 3VGGA 3N12A 5E6YA 3QOKA 2ZIDA 4W7VA 4AW7A 3VIJA 2WK2A 3L2MA 3AFBA 1XH2A 2ZXDA 1GQLA 3AIBA 5FD0A 1W2PA 3SCRA 1EXPA 1EOMA 2J74A 3VX1A 1XYZA 6CGTA 5A2BA 3WQWA 4AEFA 3W6LA 2EPKX 2AOSA 2E40A 2VURA 3T2OA 1V3KA 5C71A 3IANA 4CVUA 3KZSA 1B31A 3ARYA 3LPGA 4IISA 1E73M 2DT0A 1FP8A 2Y5EA 1UH2A 5FIPA 2V5CA 5IDIA 1B30A 1UD3A 4AZCA 2BHYA 5I79A 3SURA 2YDSA 3EMQA 2XM2A 3FAWA 1E5NA 1V0NA 1WDSA 2VQTA 2WHLA 3GXFA 4W8LA 3AYRA 3VIFA 2YLAA 1WE5A 4XX6A 3WFLA 4D6JA 1O7AA 1TCMA 4JL2A 2WWCA 3A4XA 3WBEA 3EYPA 4QAWA 4D6DA 1C7TA 4PSPA 2JIEA 2WVVB 3QHNA 3NIYA 4YPJA 3RJYA 2G3NA 1U30A 1JYWA 1GONA 2VC9A 3TTSA 2BFGA 1W9UA 4OOZA 4ACZB 3WENA 2PF0A 4QLJA 5FKYA 5C70A 2J4GA 3S2CA 3AI0A 1LL6A 4P7OA 1UD2A 3WEOA 1C90A 5D9NA 4F8XA 5BRPA 5FCZA 2DDXA 3W0KA 2VCAA 2WKGA 5CSYA 1B3VA 3J7HA 4KMQA 2YL8A 4WKAA 3AJ7A 4Q7NA 4WSJA 3WH7A 5D9OA 3VIIA 3VPLA 2V38A 1WKYA 1ISYA 2JF6A 1JGIA 5KZ6A 9CGTA 2V3EA 1VFOA 3LMYA 4LYPA 5ABGA 2VX6A 3SCVA 1JI2A 2DSVA 3I3EA 5E0CA 1XYFA 2WHJA 3L4UA 1GQKA 2DT3A 2XYLA 1Q6EA 3GNRA 1O6IA 2CIPA 1WPCA 3ZT6A 1JZ8A 4MADA 1W1TA 1GOMA 2VQUA 1VBRA 1ZU8A 2CITA 2W66A 2WMIA 4J3UA 1HKMA 3ARTA 4P7LA 1HXJA 2VR4A 3OZOA 5D9PA 3EBVA 3VD5A 1A3HA 1QNPA 2WZIA 1GVIA 1JAEA 2E8ZA 1K9FA 5F7UA 1OCQA 2D1ZA 1U33A 3ALGA 1EQCA 2YL9A 2XGBA 2V3FA 4GZJA 4PSRA 1B0IA 1FH8A 1BTCA 2WLZA 2J7HA 4HZ7A 1JD9A 3DYOA 2ZWZA 4MB3A 3AYSA 1GOQA 3GBDA 4OIFA 1OWQA 3KE0A 3WF3A 2J75A 3WFZA 2EPMX 2YA0A 4DUVA 2EJ1A 1NOFA 2VNCA 3U5YA 2CBIA 3WUEA 3OLGA 1KWGA 2E4TA 1WP6A 5I5RA 1E71M 3AMLA 4P8VA 1E40A 3AS2A 3O6AA 3DHUA 3AIRA 1ISZA 2GFTA 1JI1A 4C7GA 2VTFA 1SMDA 2X0YA 1GOWA 4J3SA 1CWYA 3MS8A 3BLPX 3CO4A 5FL0A 1HX0A 2CBJA 1EDGA 2VX7A 1VIWA 2J7FA 3CLWA 1W1YA 4D6GA 4CCCA 4PRWA 4V28A 5IHSA 3TTOA 1V6UA 4RE2A 3IAPA 3AICA 1JYNA 4CU8A 2VT0A 1HP5A 3BAKA 4JKKA 1QHPA 2XM1A 4F9JA 3W81A 2WHMA 2VX4A 1HN1A 2HISA 4BQ3A 4W7UA 4D72A 4EE9A 1WZLA 2QHAA 2PBGA 4GO9A 1G0CA 1OIMA 2ZXAA 1HKIA 2D0FA 3OBAA 4IPLA 2BNJA 1J0JA 3ZSSA 3NDYA 1MW1A 1US2A 3WF2A 1OGGA 3VD9A 4QCEA 2ZX8A 3VDAA 4UFJA 3UR7A 3CMGA 3RPMA 2OYLA 4QLKA 3VIHA 1ECEA 2Y24A 4TUFA 5ECUA 5A8QA 3O2LA 4NRRA 4WLCA 4X0NA 2VJXA 1UWTA 3L2LA 1NOUA 2XGIA 4WKHA 1J0HA 1UD4A 3CHEA 2PBOA 2XFFA 3AHZA 1V6YA 2VCBA 4U2YA 1PAMA 4BCEA 3VKKA 2FH8A 4GZIA 3CUIA 1OGSA 3I3DA 5ABEA 3MANA 2Z1KA 1QOXA 4GI9A 3AIVA 3DYMA 4ATWA 4ZENA 3GDBA 1TG7A 3VIOA 1GHSA 2D20A 1CXFA 1UA3A 3W82A 3A47A 5HBFA 4Z2HA 2V3GA 3VM7A 1WDPA 4CKQA 3WF4A 1D2KA 2YLLA 5I78A 4CN4A 3EDJA 3K4DA 2J62A 3SUWA 2BHUA 2VVSA 3GYCA 1UR1A 3ZM8A 4BZYA 5CZKA 1JDAA 2WSPA 3SCWA 3MMWA 1LQ0A 3WQ4A 2CETA 3GH7A 2QMKA 1JIBA 1QI0A 2XSBA 1C8YA 4AIEA 4URIA 1VRXA 1S46A 3OGVA 4J27A 4GINA 4EANA 4KRTA 1MXGA 3AMDA 4CN1A 4W88A 1KQYA 1WAWA 2PWGA 1GORA 4UFIA 1E6XM 3K8KA 2XVNA 1W91A 5BWFA 1WZAA 3CZJA 1CEOA 3W29A 4J7RA 1E4LA 2D3LA 4H8UA 4AIOA 2RGMA 2XVLA 1E6QM 3UERA 2PI6A 1I1XA 3RM4A 3KEHA 3WUGA 3VD4A 5CSUA 1UUQA 3MMUA 4H8HA 2X09A 2OWWA 1V0LA 4AZIA 1UHVA 1VFUA 3ZT5A 2CPUA 2Y4SA 4UQ9A 4QP0A 3O9NA 5LYRA 2E3ZA 3AIQA 3AMCA 4UZSA 2Y8VA 3HJEA 2WMIB 4H2CA 4WK9A 1K9EA 4ZE4A 1C92A 1VBUA 3SUUA 5M3WA 3N13A 2CHOA 2XIIA 1JNEA 7TAAA 1OINA 4JHZA 1GNXA 2BVDA 1UYQA 1J0ZA 1E0WA 3AROA 1UWQA 3WD0A 4OBRA 5M5DA 4PMQA 1E9LA 1MXDA 3W24A 4GPNA 1MQPA 3AMGA 2WCSA 3CZGA 3PBGA 4XB3A 1TA3A 3AS3A 3WF0A 2WMKA 4CU6A 4MTVA 1A47A 3SEPA 2WC7A 2OSWA 4W93A 4U3CA 4UQEA 2ZX5A 3UG5A 4TTUA 1GUVA 3BAJA 3GXIA 5HOSA 1W9BM 1CENA 3BCFA 5EFDA 2BY3A 3VMNA 2YA2A 1QW9A 1V3LA 3AZTA 1J18A 2C0HA 5AYBA 5A69A 2WVTA 4JFUA 4P7NA 1GZJA 2WXDM 1Q6DA 1B3XA 1EHNA 1QI4A 1KGXA 3EDKA 4YN5A 1OM0A 1HF6A 5A6SA 4MB4A 1DP0A 2V3DA 1SR0A 3NDZA 4AMCA 2ZX7A 2E9LA 4N42A 2E9BA 5BXSA 4JZ5A 1E4NA 3HN3A 1I1WA 5A6JA 4QLLA 1W9VA 5DO8A 3BC9A 3FY1A 4R27A 1KXHA 1VFMA 2WANA 3SCUA 2DH2A 4NZCA 2YL6A 1LG2A 5AC4A 1E70M 1V3MA 3AS1A 1W32A 2AAAA 3RM9A 1JD7A 2GJPA 1PIFA 1J0YA 1XH0A 1D7FA 2D24A 1GPFA 2YL5A 3MSDA 5DT7A 1ITCA 3AHVA 4E2OA 5JBEA 3ZOAA 3BAXA 2XWEA 5BYWA 1AQMA 2A3HA 4AYSA 1BFNA 3SCQA 1W1VA 4AC1X 3OGRA 4PMNA 1BQCA 3M46A 3LPPA 1ZJAA 4DUXA 5JIPA 1QI3A 1LWHA 1OBAA 2A3EA 3WNNA 3PN8A 1NQ6A 3KWXA 1PBGA 3OGSA 1Q6GA 1V02A 4MB1A 3WDRA 4QDMA 1WZKA 1HKKA 1NWTA 4M1RA 4D6EA 2DT1A 3L4WA 1AQ0A 1MFUA 4H41A 3SCSA 3L4TA 3GXDA 4CD7A 3VX0A 2WB5A 3QHOA 2ZOXA 3TONA 4H04A 4PTMA 3GH5A 3PZMA 1LWJA 5I24A 3WKZA 5IFTA 3T0DA 4JKLA 3AMKA 2FGLA 3ARSA 2XUCA 1CDGA 2WSKA 2DGAA 1B90A 3F4VA 4UOZA 4AY1A 1JL8A 3WDHA 2J25A 1CLVA 2WZEA 5FL1A 2WM0A 3NYDA 3VD3A 1W9XA 1BPLB 1BYDA 1FHDA 1EQPA 1ISVA 4Y7EA 4IUGA 1KGUA 1UKPA 5CLTA 3AZSA 3VUPA 3AIWA 2UY2A 5HNNA 1NARA 1P6WA 3ZJ6A 1PJ9A 2QPUA 2JEPA 4AZ5A 1CXLA 3WNMA 2VVNA 2XHYA 3SCOA 4XV0A 2B31A 2ZXBA 5CLWA 2TAAA 3EDEA 1DWAM 1I75A 2GJXA 1W3HA 1Q6CA 3A3HA 3MU7A 2C7FA 2GK1B 3W26A 1N82A 4M29A 1H1NA 3UCQA 4P8WA 3T08A 2DT2A 2CERA 1BF2A 3FAXA 5EB8A 2WMFA 3WNOA 1NWUA 1ISXA 5A2AA 1QPKA 4EAMA 3D3AA 4C7FA 3ARRA 3MSGA 2G3JA 3PHAA 1MW3A 3SCNA 5D4YA 3AHXA 1H0GA 1CZ1A 1UA7A 3PTKA 1BYCA 3N18A 4WKFA 1AMYA 4B3LA 2FH6A 2WNWA 3AIUA 4CD4A 1J12A 1UH4A 2XG9A 3RM8A 1C7SA 4HZ6A 4CUCA 1UR9A 3GNOA 4W89A 2JFEX 4UQDA 1E6NA 1UZ1A 4KWUA 1TFVA 4WSKA 1G94A 3VDHA 2IXVA 5GPRA 4MJ2A 5DEZA 4GXPA 3WQ5A 2NT1A 1JF5A 1EDQA 3CUGA 1TA3B 4J3TA 2EQDA 3PZQA 3G6MA 2JEQA 5AYIA 1E1FA 4W8AA 5TD4A 4UTFA 2EO7A 3ZIZA 1GOIA 4XZBA 4D6FA 3K1DA 4GIAA 1UKSA 1W2VA 2OSYA 1GQIA 1UKTA 1XD1A 1HIZA 2VZSA 5DF0A 4KH2A 1XSIA 2W62A 3DYPA 4HA1A 1ZB5A 4UQAA 2CHNA 4HMCA 1J10A 1JF6A 2W61A 1BYBA 3M07A 1WB0A 3ARZA 2PWFA 2EEXA 3WH6A 2CXGA 1JXKA 2DQXA 1UR8A 1IZKA 1WDRA 3CZEA 5GNZA 1CECA 3EMCA 4LXFA 3VMPA 4MJ4A 1E4MM 1KCLA 5BXPA 1E6SM 4KRUA 2VZVA 4UNIA 2ZUSA 4UFMA 1KR1A 1KXVA 3VGDA 4CD8A 5D8WA 4MDOA 4W8BA 4OJYA 2WMGA 5IFPA 1Q4NX 3L4XA 3VDCA 3NSXA 3VNZA 3VGFA 3ZQ9A 2GDVA 2JIWA 4RE3A 1HVXA 3TP4A 2VO5A 1HKJA 3ARVA 1VJZA 1J0IA 2W5FA 3CZ8A 4UQCA 3G6LA 4TVCA 3WNKA 2VZOA 4M56A 4RE4A 3NSMA 4S3JA 3AXHA 4HP5A 1VEPA 1OD0A 4FMVA 4UFLA 1EIBA 4PN2A 4NSBA 4KGLA
chains in the Genus database with same CATH superfamily
1I2OA 1DWIM 1XFBA 4ATLA 4FLRA 1AZ2A 1M04A 1HNYA 3RXZA 3UWEA 3FW6A 3R58A 5U4NA 4PMOA 3KBJA 3PTMA 5LIKX 2F2KA 3LD5A 2Y88A 5C9WA 1ML1A 2CWXA 4B5SA 3TN3A 1Z69A 4ZE5A 1IT0A 3KTCA 3FSTA 2EKCA 4IXXA 1RLCL 4JTQA 2FB2A 1FWRA 3R11A 3PBUA 1Q3NA 5BRQA 2FZ8A 3DN5A 3H54A 3HQOA 4UOQA 3BAYA 3WEMA 5AY7A 5LNRA 1OX4A 3LMZA 4A3RA 3OHMB 4HMDA 4XIAA 1UQZA 2RGLA 4HYVA 4B3KA 4UZUA 1ZRQA 2Z1SA 4GQRA 1XGZA 3TV8A 1ME9A 2CBVA 3VZYA 4HK5A 3EOEA 5JBFA 1GHRA 1RP8A 3E0LA 3BW4A 3MWCA 4CNPA 4ZO9A 4AZCB 1Q4WA 1WBHA 1VHCA 2FTYA 4F79A 5CQ1A 1CGUA 4MAVA 4H8NA 1F05A 1XLBA 3EKZA 3N04A 2VDHA 1FBAA 3P0WA 1C91A 2A3AA 3RUBL 3YPIA 5HUPA 4AXNA 4Q4OA 4FF7A 3GTXA 5J5DA 4XD4A 1EA9C 1O4UA 3M5ZA 1KA9F 1FCBA 3N15A 3WY1A 3DENA 4AUBA 2O4MA 1J0KA 1B3YA 2GJXB 1NWSA 2GOUA 4NJHA 4TMCA 5CGMA 4JFVA 1VLIA 2Z2AA 3B8SA 3M0KA 3B4YA 2YDAA 2W67A 4DIAA 3MO4A 4RL3A 1JVNA 4LVBA 4G6CA 5IXEA 4O0KA 4PUNA 1T0OA 2OZTA 2WVSA 2GQ9A 5PTDA 3TJXA 3E2QA 1F3TA 1LL4A 3TMLA 1TMLA 5REQA 3BJSA 4FI4A 3LENA 5H91A 4K8HA 3UR8A 3LU2A 3WH5A 1IF2A 4NHVA 2NQ5A 3SFKA 3BCDA 4D8LA 3IEBA 2E28A 2ZUVA 3W7NA 3PBWA 1J11A 2EPLX 5BMWA 1SO4A 4KS0A 4C6NA 2W79A 1TV7A 1OQFA 1M6JA 3ARWA 4RNHA 3VIPA 3G3MA 3VZXA 4M3PA 2PDFA 3M0YA 1QFEA 3P61A 1OFAA 1OC6A 2VRKA 3W23A 4L6HA 3B9EA 3T42A 2FHBA 4OUEA 3WFAA 3WD4A 3IRDA 4DJDA 5CPOA 5KINA 1R8LA 3WQOA 4ENLA 3NCOA 3VILA 5MF5A 4KWSA 4A8LA 3EDFA 3VE9A 2ZA2A 2VGFA 3OO2A 1PX3A 4GIEA 3RU8X 4PYSA 3N6JA 1R9XA 1E6PA 4PTWA 1VR6A 3VC5A 4AWSA 1LROA 2D2HA 4AZ6A 3G1VA 1JXJA 1VKFA 1YTDA 5C2XA 1H0IA 4GC3A 1ISWA 3FA4A 2FGZA 3EX3A 2FIQA 4F2BA 2POZA 1SVDA 3W3OA 4JN7A 4A2RA 1OGBA 1XC6A 1UUMA 3MI2A 4DF0A 4RDYA 2X1IA 4Y9OA 2YR1A 4L65A 3LSBA 4V33A 1RHCA 5CBJA 4RDWA 5I2UA 3B0UX 1IGWA 3DIPA 3AXIA 4AWTA 2C13A 1K6WA 3STCA 3LCLA 3S5OA 1NH6A 1M3UA 3SUSA 2V30A 5GJNA 3WEZA 5FF0A 5A8OA 2I5QA 5F1UA 5LNWA 1F07A 2VGIA 2BY1A 5A3HA 5C7VA 2XH2A 1W9PA 1PIGA 2O7QA 1JZ2A 3SECA 2DORA 1ZBWA 2TODA 5MKGB 5EMLA 1O5XA 4Z2JA 1E51A 1LUCA 4D6IA 1EFZA 1W8GA 3CQIA 1PWLA 4IIFA 1LORA 3LXAA 2JKPA 3T4CA 4KCVA 2BY2A 3QHMA 5BXTA 3VOIA 4S2CA 1MUCA 3IUDA 4MJZA 4JTEA 4PB3A 3TNOA 1WQ5A 2ZCGA 1PX8A 3MUAA 2QIIA 5FOOA 3GKFA 4S1FA 2ZVIA 2Y7GA 4L4PA 2FZBA 4OUIA 1E56A 3WQGA 3UESA 3VFLA 4IGHA 4B2DD 1EYEA 3U6WA 4GZEA 3MV11 2VX5A 4NI3A 3SQSA 3HPAA 3IS4A 4UMAA 3EA1A 3QW3A 1R3SA 2O9OA 2OO6A 3VOHA 1EWEA 4NZ1A 2AKZA 3ABXA 3UCCA 4MUPA 1NU5A 4NYUA 3W2MA 2YCJA 2W27A 2Y70A 4LSBA 3A4WA 1GWJA 5C7HA 2VZTA 1A0EA 3A12A 3ZMRA 2F6KA 5I3DA 1SW3A 4WY0B 1G9HA 3B9AA 2YZ5A 1AH4A 2NXHA 1M7JA 5A5WA 2ZICA 3UWUA 2FTWA 3TZNA 3S1UA 1IR1A 4UOJA 1Q6FA 2J9XA 4WIWA 3B97A 1G7VA 1RALA 1KV8A 1OF6A 2ASHA 4YMZA 3WQ6A 3ZWSA 2UBPC 1XIGA 5FJUA 4AC7C 4BWLC 1EX1A 4LC6A 3G1AA 3CAQA 4LUTB 2EBNA 1BEUA 1ZCCA 1J2BA 1F5ZA 2OKOA 2PDWA 3ANUA 3MC5A 4R7WA 1CYGA 3CTLA 2CKSA 1TJ2A 2FVMA 4OQVA 2FFCA 3LG3A 4WXYA 1IEXA 2CU0A 2VCCA 3FOKA 3SJNA 1TPH1 3T0AA 5DRIA 5KZDA 4DWDA 3OBKA 1E0VA 3NQGA 3WLSA 3NWRA 1GW1A 4ZZ9A 3LGDA 3W2NA 1O5QA 1XL9A 4B5NA 2OX4A 4FIRA 1XHGA 4PMRA 2ZX6A 1IT7A 1AQHA 3AISA 4ZCWA 1FWJC 3RHGA 5CPQA 2UY5A 5AVHA 1R3RA 1TV5A 1IWAA 3UXAA 5ABFB 8CGTA 4PMVA 3MUZ1 4N6EA 5AC5A 4JTJA 1E0XA 1KRBC 4NZ5A 4AD2A 2ISFA 3M0LA 3F4WA 1Z8AA 3GD6A 1XIFA 2OFJA 2Z1XA 3ZVHB 2QUTA 3CUJA 5FA5A 1BXNA 4MHBA 1QCWA 1KM1A 4NNBA 1M7XA 1S3HA 3S5NA 1S5TA 4RDVA 1TX2A 3W7DA 3TN5A 3W88A 2HPIA 1Y5XA 4D8AA 4IX0A 1OFRA 4LALA 1PZ2A 4DELA 5GNYA 3HU7A 1LZOA 3GW3A 5CEWA 3GE7A 4JDYA 2ZYFA 3OVRA 1H5VA 4KBXA 4LOCA 4RJEA 5BCAA 2OQYA 5I0DA 2H90A 2IPJA 5A6BD 4J2MA 2DPEA 4HD5A 4DI8A 5HXMA 3HPFA 3WDQA 1ICPA 4TXEA 3MV01 4V2XA 4AVNA 1TZ7A 2E5BA 4AD4A 3LX9A 1Q85A 4US5D 3DEQA 2P0OA 3VXGA 1T6MA 1LG1A 2OODA 3FHAA 2A21A 2FMNA 2W4XA 1XRSA 2INFA 3VINA 4LUYA 4XD3A 3W1PA 1ENUA 1FXQA 3VDBA 2ABBA 4JQ3A 5T9BG 3WQFA 3M6DA 5A2CA 1UIPA 3C2FA 1PO9A 5LA2A 1FHVA 4PEEA 2E67A 3CH9A 4TX8A 3TQVA 1RR2A 1KFCA 4IMEA 4KFNA 3NQAA 3GM8A 1GJWA 1VC4A 3G0XA 2WMJA 3AIEA 4IUOA 1LRTA 3AHYA 4M19A 4IM4A 5FEZA 1EO5A 3TLLA 3MY9A 3W7GA 3WQPA 3W7OA 3WLKX 3ZR6A 3M5VA 1O5KA 4NAFB 4GKTA 4EOUA 2E09A 3BE7A 1WDQA 4J35A 1EPVA 4H7CA 3BANA 1CGYA 4XIMA 1PX4A 3GG7A 4C6IA 3NZGA 3KRBA 2Y2WA 1F61A 3FDKA 1LBMA 2CBUA 4ZOBA 3WO8A 3V0TA 3W9ZA 4Q8QA 1LF1A 1IWBA 1KGWA 2QCDB 4AISA 1QOQA 3H53A 3V5FA 3TXZA 3HZ3A 5AC7A 3PSWA 3I7RA 4JD4A 2CCRA 4DZ5A 1EC8A 3VDGA 3BAWA 1R46A 3A5VA 4H6EA 1DJWA 3MUY1 3LBOA 4HPHA 1KTNA 1UD8A 3EEGA 1RP9A 2WAGA 3GC2A 3WLHA 1G69A 1F73A 4DPPA 1OX6A 1YE6A 1NWRA 7A3HA 1S2VA 2J9YA 3FYYA 2P76A 1AUSL 1IXPA 4HT3A 4Z2KA 3QR3A 3LRMA 3STEA 1R3WA 1FWHC 2ACSA 5HAOA 3UWVA 2GK1A 4GA8A 1QRQA 3BO9A 3G5EA 3INPA 3QPEA 3LPOA 4H8VA 4Z2GA 3KBWA 4TU1A 5LHEA 1EC7A 4FSAA 3S0CA 4TVDA 1I0BA 4PBFA 3KAOA 3IJ7A 5K4ZA 4PBEA 3ARUA 2PLJA 3BG9A 2YBVA 3VC6A 5FJJA 3TYCA 4X0VA 2BHZA 3CV7A 3L4YA 2NVCA 4EVZA 1PSCA 1HTIA 3G1SA 2A7NA 1X97A 2WC3A 1TMQA 2WLYA 2QCEA 4Z42C 2OLAA 3VKAA 2XJ7A 3LV6A 3EGJA 2W91A 3GC4A 3I4EA 2GVJA 3QV7A 2DJLA 1B5TA 3IK2A 4ATDA 4OKDA 3LNMA 2OYMA 1QPQA 5DMNA 3WN6A 3AOFA 1VFFA 2WMHA 3FIGA 4NT0A 5CGQA 4GX9A 3RX3A 3M0IA 4CD5A 2IQ0A 1XLDA 4HOZA 3QR1A 1JEZA 1LJYA 1VJIA 4RKAA 4AD5A 2PCEA 1PXGA 3RG6A 2Y8KA 1IIGA 5E0KA 5HULA 1O1HA 2Q3RA 1JUKA 2QV5A 1LTDA 1SO6A 2VL4A 1N8WA 3GU2A 2CXEA 3W76A 3AQUA 4G5DA 2V69A 2WW5A 1XYMA 3U3HA 2QT3A 1EJUC 3H7UA 4LAZA 3A64A 1YDVA 4S3KA 1JZ5A 3KOXA 3WLNA 3JS3A 2OYKA 1LBLA 1BGAA 1HP4A 5E9XA 4HNNA 4QJ1A 1SU5A 4DJFA 1JDCA 2ZWYA 3OZMA 4H4IA 4XQ6A 4B16A 1XFCA 2A7PA 2BB0A 3GZ3A 2UWFA 4GUGA 3TN4A 4D6CA 2CLFA 4F66A 1VF8A 4HJWA 1REQA 1MVYA 3EXSA 4LVFA 3NSNA 1F4HA 3WELA 4OZOA 2FLIA 1JYVA 2G3IA 3ANVA 2FYMA 3BSHA 3MB9A 3OLEA 3V3WA 3GVGA 5I77A 4R85A 1SM9A 2ON3A 1L2UA 2QULA 3JZUA 2CLLA 4OV4A 5C8BB 4UFKA 3WF1A 4HU3A 4JN8A 3ZSTA 3TWBA 1XCWA 1OT1A 4UR7A 4Q33A 3S4TA 2WO5A 1TSIA 3N9RA 2ZA1A 4AW7A 2NUYA 3VIJA 3ISIX 3KVJA 3AFBA 1XH2A 2Z7KA 3ME3A 2XIOA 3BZGA 3CIXA 4MWAB 4B5VA 1EOMA 2J74A 2PWUA 1XYZA 1YDYA 1I6NA 2AOSA 2QUMA 2VURA 3WJXA 3SN4A 5C71A 1VGAA 3BOXA 3KZSA 2BG5A 2Y5SA 1JCMP 3ID7A 1EZ2A 2VD9A 4IGNA 1UD3A 4AZCA 4NUWA 3SURA 2YDSA 2GWNA 4GZ7A 2XM2A 4W8LA 2DZXA 3GXFA 1EGMA 1F7BA 3DXIA 1S2UA 4GVHA 4XX6A 3GXPA 3HPSA 1O7AA 1TB3A 1CCWB 1VFHA 3S1XA 1K70A 1DIEA 3A4XA 4NJIA 3WBEA 3BCJA 3T05A 4JICA 4PSPA 3S6DA 4LAMA 2WVVB 3RJYA 4YPJA 2G3NA 2HNEA 3W7MA 4DLFA 1VBGA 4ACZB 1DJNA 2PTXA 3GTIA 5C70A 3QGAC 3AI0A 4HNLA 5G4WA 5AB3A 4MLJA 1TUFA 3WZ0E 1EJXC 4Z0SA 1ZCOA 1FDYA 3W84A 2WKGA 3L67A 4Q3MA 3J7HA 2YL8A 2OR2A 4YXGA 4Q7NA 4WSJA 3TYAA 2QEZA 3WH7A 5D9OA 4UR8A 2DUZA 3VPLA 2V38A 5KZ6A 1CB7B 1HZYA 4S3BA 2L5HA 1WYIA 1XYAA 4JY8A 1XYFA 2WHJA 2HJPA 3SO7A 2DT3A 3TA6A 4UTKA 5BZAA 3GHTA 4MADA 2EPHA 3QN3A 4C6DA 3RLGA 3C8FA 2VQUA 4WDTA 4QG6A 4J3UA 1HKMA 3LGEA 5M2FX 4AXKA 2QUNA 1FWDC 3NPUA 5D9PA 1IXNA 1TPVA 4DF2A 3MDWA 1IGSA 1OX5A 1TWDA 2CLMA 2X0SA 3RF9A 1ADOA 3ALGA 3NM1A 2YL9A 5AHMA 3ZYZA 4ROPA 4PSRA 1BTCA 4HZ7A 4MB3A 1GOQA 1VLWA 4Q4PA 1OK6A 3V1HA 3WFZA 4O57A 3U5YA 2VEKA 2OVLA 4QJ5B 3NOEA 4HPJA 5G4EA 3SRDA 3GAYA 3UCDA 5EYWA 4DXKA 2CBIA 3PWAA 3WUEA 3OLGA 5XIMA 1KWGA 3U9IA 2G5WA 3LGGA 3AMLA 4JQ4A 1TCDA 3W1UA 1EPXA 2AGTA 3C61A 2QCLA 2YX0A 1JI1A 2DZWA 1GYMA 1G67A 2X0YA 1GOWA 5FL0A 2J7FA 5FF3A 1UZHA 4O15A 3HTWA 4IQDA 2ISWA 4IHCA 3T8LA 1R30A 4PRWA 3BDKA 1G4SA 3TTOA 3IAPA 3MKCA 1JYNA 4FS9A 3FDGA 4YS1A 5MKGA 1M7OA 3W7QA 1QHPA 3W81A 3T44A 1M7PA 1PUDA 2WHMA 3W70A 4P61A 4BQ3A 5JMUA 4EE9A 1RQHA 3LHZA 3N2CA 2HQAA 2ZXAA 1HKIA 3MP5A 2UZ9A 1MW1A 3MSRA 1US2A 4A2SA 1XICA 5DXXA 4XO7A 1OGGA 3VD9A 4DX3A 1PCWA 3E0FA 4LF1A 4MLRA 2ZDRA 3VCRA 1WXZA 3CMGA 4LUSA 4MUZA 4QLKA 3IVTA 4DO5A 5A8QA 1A5UA 3QYSA 4IP7A 3UXDA 4CQBA 1JJKA 3MJMA 2VJXA 3L2LA 1NOUA 3PFRA 6REQA 1M41A 3D46A 3B8TA 4U2YA 1PAMA 2D69A 4S3CA 3VKKA 3W87A 5D2WA 3BOFA 4GZIA 1OGSA 2V5JA 1Y5VA 5IOBA 5ABTA 4PUUA 4DQWA 5KMYA 3MANA 4GI9A 3GHUA 4LVAA 4JIHA 1TG7A 3T55A 5HQMA 1XQLA 3ZZ1A 4GUHA 4YU1A 1RJPA 1UA3A 4DYEA 4EACA 4UWMA 2EHHA 5HBFA 3SQMA 5FEXA 3B8VA 2YLLA 1H7WA 1T5AA 3SUWA 3B0VC 1AD4A 2BHUA 5FF2A 2ISSA 3EWDA 3GFYA 4WY0A 3ZM8A 4BZYA 3QPYA 5AHEA 4L9XA 2B7NA 5CC5A 1QI0A 1C8YA 4CEUC 4AIEA 4J27A 4KRTA 1F6KA 2PAJA 4W88A 4I9JA 3HG2A 1GORA 6ALDA 4DBSA 1MNZA 2OZ0A 4K1GA 3DI1A 4QM1A 4EAYA 2D3LA 4H8UA 4N9CA 4MYAA 2PI6A 1BF6A 3WUGA 4INFA 5CSUA 4H8HA 3T78A 3GO2A 2P1FA 3LM7A 1UHVA 1VFUA 3ZT5A 3N19B 4LUTA 4UQ9A 4G9PA 4NU7A 1Z6KA 2PS2A 4UZSA 2Z6JA 2E1WA 1PYFA 3QZEA 5CG7A 4Z1BA 1XKJA 1JNEA 1EIXA 1Q6QA 4JHZA 3NZPA 1AJ2A 2BVDA 3C3NA 4FHAA 1E0WA 3E5PA 1PKNA 4CNNA 4OBRA 3PAOA 4PMQA 4AVOA 4XAPA 2C18A 2Q3OA 4PGLA 1GYNA 1AG1O 1EL3A 5K3VA 3BARA 3B9OA 3DOPA 4CU6A 2HRWA 4HBKA 4Y9AA 2X1TA 4UQEA 2ZX5A 3E02A 1K1DA 1XGDA 3GXIA 2QGHA 3DESA 1W9BM 3H70A 2AGKA 3S2MA 2BY3A 2YA2A 1WA3A 5FF7A 3IJQA 2C0HA 2IW0A 2WVTA 4JFUA 4Z1AA 1D7KA 3ZVHA 4DJEC 3U48A 4HNUA 1A5SA 4MIMA 1PKYA 4HCLA 4L61A 2YFNA 1DJYA 5A6SA 1DP0A 1SR0A 2PZNA 2ZX7A 3O1NA 3DFHA 3NZ1A 3KLLA 4QX4A 4QLLA 4TV5A 5DO8A 1QO2A 4LBUA 3E2RA 3SCUA 2DH2A 4NZCA 2DZUA 1SUXA 4W4QA 3UYIA 4JEJA 1PKLA 2AMXA 1PS9A 1XH0A 5AC8A 8TIMA 4O1AA 3UXKA 4E2OA 4GABA 3LEPA 3SR7A 3A3XA 1KW1A 1XGEA 1UP3A 2A3HA 4HMNA 3SCQA 4MKNA 2NWRA 3LZ3A 4AC1X 3MWAA 3AJXA 3UPWA 2R1MA 4JYDA 2VC5A 3PN8A 4AY7A 3EX1A 4QJ3B 3AU6A 1PBGA 3OGSA 1Q6GA 1TREA 5T9CE 3WDRA 3E6EA 1XIMA 5K2ZA 3EAUA 4BKNA 1NWTA 3LTPA 3CV1A 3R8RA 4H04A 3GH5A 3PZMA 3ONCA 5IFTA 2FGLA 4GNKB 2GL5A 3HGOA 4JNMA 3NURA 1FWTA 4AY1A 1KBJA 1OY0A 3HO8A 1ELSA 1CLVA 2ISVA 3VD3A 1DQUA 1NF0A 3L68A 4Y7EA 4UUIA 1RD5A 2VR2A 4IUGA 1KGUA 1UKPA 3SGUA 1OC5A 1GT8A 1IR2A 1QR7A 3ZJ6A 4C1KA 2QPUA 4MZYA 3OA3A 1CXLA 4I8DA 1LOQA 3RX2A 1AQFA 3SCOA 2Y7DA 3LHVA 5L6UA 3EDEA 3UD6A 4JQ1A 1DWAM 1LT8A 2I17A 4JGDA 2X7VA 1W3HA 3B8WA 4G1KA 2QCDA 1N82A 1H1NA 1SPQA 1XDJA 3EXRA 2ADAA 2B7PA 1IHIA 4FX6M 3FAXA 2Q01A 4MY9A 2IS7A 4RXGA 3W86A 2WMFA 3ABSA 5A2AA 1QPKA 1R3TA 4C7FA 3ARRA 5DBUA 1RBOB 1MW3A 4JIRA 5DLCA 2BTMA 3SCNA 1KLZA 1ITQA 4AF0B 1BYCA 4YYCA 4IJBA 1PCKA 1A0DA 4WX2A 1V93A 2XG9A 5DRCA 3HOJA 4CUCA 1UR9A 3GNOA 4W89A 4NZ4A 5GJPA 2NQLA 2G37A 1TFVA 3H22A 1DYSA 2PDGA 1O5RA 6TIMA 1G94A 3QSRA 3MCMA 1O1ZA 1IQ8A 4GXPA 3UWYA 3WQ5A 3NO3A 3V16A 4PL2A 4G56A 1F9CA 1JF5A 3KS5A 4I3GA 3CUGA 4JTAA 2EQDA 3V4BA 2ALDA 4GK8A 3ZIZA 2Z1BA 3CB8A 4NP7A 4GIAA 1KTBA 2PLMA 4O4VA 4FXRA 4YLWA 3XIMA 4NJGA 4P2VA 1SFJA 4RNJA 2FQIA 3PBMA 4KH2A 4MFDA 2CHNA 2G4JA 1J10A 2GGJA 1PTDA 1BYBA 3GXTA 4BEUA 3ARZA 2PWFA 3GDLA 3WH6A 1P0EA 3QQWA 3CZEA 3EMCA 1DJGA 2AL2A 3NQCA 3W22A 3LBMA 4MJ4A 2PRLA 1E4MM 1P0KA 5AN7A 7REQB 1KR1A 2A0NA 4ECLA 2X1UA 3HFYA 4CD8A 2WMGA 5IFPA 3GDTA 1Q4NX 3BOLA 4PR4A 3CXOA 3ZQ9A 2NQHA 2JIWA 1H7PA 3CS2A 3IV8A 2PZ0A 3TP4A 3GUWA 4O54A 3GHRA 4FEZA 2VM8A 4TVCA 3E38A 3O0KA 3HFTA 3NSMA 2Z1VA 1EKOA 4QROA 4U4MA 4M5PA 3AXHA 4HP5A 1VEPA 1OD0A 1VBJA 3B06A 1GCYA 5TNVA 2RDUA 3DGBA 3G1DA 3ZWTA 3GQYA 2F6XA 1I60A 1VFSA 1FDJA 3EMZA 1S5WA 3APYA 3VO0A 3W28A 1GVOA 3B8UA 3NJ3A 3C0LA 2DP3A 4POCA 4KT2A 5LNSA 1KFKA 4Q4SA 4P8UA 3PK7A 2J7BA 4IJCA 2XN2A 3CM4A 4TOQA 1ODUA 2DV0A 3G1HA 2V5DA 3OP2A 1MEWA 2B81A 4DM1A 1B3ZA 1XWYA 2PB1A 2R1NA 3KL5A 4DJDD 5C9RA 3GDRA 1BD0A 1H2JA 4A3YA 3L5AA 1PEZA 1OSEA 2F8QA 3N9KA 1F3EA 2BASA 1FCVA 4AD1A 3UXIA 1DEDA 3WQCA 2FHCA 4FB7A 2F9RA 3LS9A 3QGVA 3CZLA 1V51A 1S3TC 2O0TA 3WMSA 4D2JA 1MZRA 3LCHA 3H7RA 3K4WA 1X39A 3BWWA 2ZRWA 1NP0A 4KEMA 4BS0A 1QMLA 4M7SA 1M01A 1XSJA 3O0FA 4UIOA 4DNHA 3F2BA 1JFXA 3W2UA 2G3MA 1YHTA 3WUFA 3IJ9A 1QHZA 1JQVA 1F6YA 1LLOA 3B9NA 2A2IA 1UD6A 2NV2A 2WNZA 1DL3A 3W00A 3S6TA 3WBYA 5A8PA 3GR8A 3VIKA 3TEVA 1JCLA 3EX4A 4CQAA 2OXNA 2AQOA 1SGJA 3TR2A 3PZ9A 1SJAA 3I10A 3STFA 4R7OA 1ALDA 3OVGA 4ZO7A 1XX1A 3VGHA 4XZ9A 4GQBA 5D2VA 3MUXA 4WGXA 3TKFA 2P8CA 2V2HA 2WVVA 1X6NA 1ZUAX 3L4ZA 1U22A 2PDJA 4J2PA 1TELA 4REQB 2O55A 3TU9A 4XD5A 2GGEA 4NNCA 4ZL1A 1EO7A 2DH3A 5CXPA 4A21A 4ACZA 3C2RA 2XZ9A 4J5NA 1KNWA 3FLUA 1UBPC 2E0PA 5C55A 3QSTA 4PFHA 3QKEA 5HMEA 3MMDA 1WUEA 4X60A 1TPEA 1VJSA 4E8DA 1DQWA 3E1F1 3GLCA 2BOGX 4J4KA 4LF2A 1A5NC 1K8YA 4Y8FA 2DSWA 1ZBKA 4QBXA 2A3BA 3T4WA 4S3DA 1ZJHA 2X0HA 3TX9A 3HBLA 4GJJA 4V15A 4PMYA 1CGWA 3E49A 5G2WA 1GKRA 3VYLA 1QI2A 2BVYA 2EG7A 2G41A 1QW7A 1SFSA 4FLSA 1VEMA 1E4IA 3W07A 2PWHA 1SZRA 5I6SA 4J9JA 3FJ4A 3ABOA 3QMRA 2W0UA 3FCPA 5JH2A 2GJRA 1K6AA 1D8CA 1ZNNA 3MYPA 3OB8A 3M0JA 3W53A 4AG0A 1EJ7L 5A1AA 5D8ZA 2CNCA 3W37A 2UY4A 1F4AA 3IGHX 3BPWA 4FR6A 4FLQA 2PDKA 3LCFA 2PLKA 3O8AA 1W0MA 5C2GA 1OYBA 2VDGA 3M41A 5CCZA 1KWKA 6XIAA 3ZO9A 3O05A 2ZE3A 5IBXC 1GYLA 2EPNA 2QMJA 2WOQA 1G4TA 3BICA 1J8VA 5E0FA 3PZVA 3BH4A 4X3ZA 4J28A 3KP1A 1UKOA 2ZC8A 3U7VA 4W9TA 1WCGA 2VOTA 2FZDA 3R0DA 3OIHA 2W92A 3B04A 1R2RA 3R7MA 4Y90A 4RZ6A 3L0KA 5D30A 4H7ZA 4ACYA 3LK6A 3NG3A 3WMBA 2EPOA 4GNVA 4U3AA 4UTIA 4E4FA 1EUAA 3LA4A 4LRSA 2PLCA 3WDIA 5C9XA 1UR2A 1TVPA 4MY8A 4W7WA 1A80A 1X1ZA 3K8MA 2ZRXA 4JY9A 1QK2A 3BJFA 1ONXA 1DORA 4A3HA 5BWAA 3GXNA 1A5OC 2MANA 4AZBA 1B4KA 4KRZA 1ONWA 4K7YA 1BSIA 3B0XA 4L6OA 1L6GA 4S39A 3QOMA 2G3FA 3NL5A 3N2OA 3KCLA 1N55A 3ITCA 3C4UA 1XV8A 3SB0A 1J9YA 2DEPA 1E43A 3TFCA 3ICJA 1QHOA 5DXYA 5DT5A 3EB2A 2CKRA 3QQ1A 3AUJA 3JVAA 2OMAA 3U2EA 3W02A 1GOKA 3GH4A 2WNQA 1GZ1A 1OT2A 3A9IA 3SSJA 4BA0A 4M1BA 2XIQA 2I57A 2VR5A 2Y0FA 1KR0A 4IG2A 5TF0A 1OABA 4I9AA 1H5YA 1Q2SA 2C6QA 3ATYA 2XFWA 5AHIA 1Y8BA 2J8FA 2VEPA 2QCGA 5HPCA 2VDIA 4KW2A 1MQRA 1CPUA 2OWXA 4L1XA 1OZQA 3GYEA 3QZ6A 4GYKA 4C6LA 1MO0A 3DBNA 1V6VA 2QS8A 4EPEC 1BWKA 2J7CA 1JZ4A 1XM3A 3IACA 3C0SA 4GY1A 5BNKA 4GFIA 4FK9A 4W5ZA 4A29A 2TRSA 1FDZA 2CESA 3CIVA 3LLFA 4WCJA 3CZKA 3NXFA 3THCA 3E2VA 3RLVA 2ZUMA 3R6IA 4S3FA 1QNSA 1E0UA 2ACQA 2EF9A 4UFHA 3EWBX 4DHGA 3RPTA 3E0WA 2GVEA 1X1NA 3C3UA 1UZ4A 5M03A 3LSCA 1XG3A 3D47A 5FSDC 3RIKA 2WC4A 2QCHA 3WUBA 2HDJA 3V5CA 4IL0A 1VFLA 3BMVA 1Q6RA 4LGXA 3BSGA 1GPWA 3N6HA 4I5RA 4LAOA 3IARA 4C6JA 4D71A 1NTHA 3TFXA 2VGBA 1Q65A 3ZJ7A 2HVNA 1QW8A 4ZEPA 1EA0A 2WCAA 3QLDA 3TTEA 4NXKA 2PD9A 3A4JA 4U31A 4Z2LA 2XVGA 2VWTA 2PU1A 4XVEA 3U5UA 1JCYA 3GX9A 3R8GA 4BJHA 2PGRA 3SRKA 2Z29A 4N02A 2DZAA 4UCFA 3APGA 1TYGA 1DTUA 1GZGA 4GE8A 1AMKA 1UQYA 1ITUA 3BUVA 4H9YA 2NVDA 1LLWA 1CGXA 3MUIA 2B7OA 3GRIA 4WJ8A 3P82A 3UYCA 1QI5A 4F9DA 3CHDA 3M64A 4Y96A 1Y5WA 2Y6ZA 2RDWA 2WHKA 1PV8A 3AS0A 1FUYA 1XBYA 2V81A 1GJPA 4A4AA 1W9DM 4UB9A 3LXBA 2OEJA 1DIKA 3TJIA 1VAHA 3H2FA 1ZL1A 3NQBA 3TCEA 5D09A 4PUDA 2OU4A 4QSHA 4R5EA 5BU6A 1YPFA 4QAIA 1TWIA 4O50A 3BMXA 2MNRA 8A3HA 2PC8A 5DCDA 4E6MA 4GYJA 1LUCB 2ZTKA 2VELA 1SJCA 1IEWA 3W7KA 1TWZA 3II1A 4HSNA 1KB3A 1EGZA 5F2MA 3TTYA 2QJNA 3CUZA 3VNJA 2D0GA 2YYTA 3KVKA 3T2PA 4B9YA 3FGCB 2BXZA 4XUYA 4I6VA 1YXCA 4L1WA 1XIDA 1EOKA 3THDA 3NQFA 2PDIA 3WMCA 1OFDA 2OWCA 5G1YA 3W01A 3VGBA 3JUGA 3CASA 4DM2A 1UZDA 3VKDA 1XKYA 2ZZ2A 1H11A 3RR1A 1NM9A 4DBWA 3GIYA 1I45A 4WOZA 3SRHA 2PWEA 2OT1A 4XAFA 3KRUA 3T6CA 4LCSA 1FHLA 3BGAA 3SN0A 4GGBA 3QY7A 4H9VA 5DN1A 1QNQA 2PDMA 4DWSA 3CV2A 2EG6A 4LAUA 4H3DA 4ZTXA 3T2QA 3WK0A 1E55A 2E8YA 1OIFA 3UNTA 3VM5A 5HQLA 1WV2A 5D37A 2PDPA 3RCNA 3SUTA 2QDEA 4HMEA 2BDQA 2P53A 3PUGA 1RA5A 4WD0A 5B7ZA 3JZEA 3NZQA 3QRHA 3FFSA 1XBZA 1UR3M 5CPSA 1BVWA 1FWNA 4ERAA 3S3GA 4Q4MA 4Q8WA 4GYPA 2HE8A 1D3GA 3RO6A 2A1YA 4LB4A 3RLUA 1BHGA 1XLKA 5C6MA 3QQ0A 3ZS4A 4NXSA 5D2XA 4DZIA 5KITA 4MG4A 4XZWA 3L4VA 4OWGA 3UWQA 1CIUA 4RR4A 3G18A 3K1GA 2GOKA 4TVUA 1PZ1A 1TO3A 2ISDA 3FK4A 1HL2A 1KBKA 4DJFD 3TW7A 4AWEA 5HINA 1IXOA 4CNSA 3WL1A 3GKAA 3WH8A 4IPNB 1MUWA 3ALFA 1R0MA 3UGRA 2ZZ1A 3QEZA 4DNMA 1WBJA 1XD0A 4XK2A 4YJ5A 8XIAA 3DG7A 4BI5A 4HTBA 4MZ8A 3BAIA 4LNCA 4RX0A 5EFFA 4PTDA 4W86A 1LP6A 5DANA 3MTWA 3EDDA 4GVIA 2Z0IA 3E3HA 1NEYA 3CYVA 4IMAA 3F4DA 1XRTA 1P6CA 1WKFA 5A94A 3PZNA 1AW1A 3QW4B 5HMSA 1B2YA 3L65A 2YOCA 2UY3A 5I02A 3WIJA 1OHLA 4JIQA 1EXBA 4BI7A 2D22A 5CC3A 4ADTA 1XPGA 3CT7A 3ZJ8A 1H3GA 3NL3A 3MDUA 3R94A 4ZVJA 1X1OA 4LCQA 3LHUA 1DV7A 4GBDA 2WBGA 3NQVA 1QO5A 1BRLA 1HL9A 1I4NA 3P5YA 4D9PA 1JYXA 2NW0A 1ZS2A 2BOEX 2X42A 1RPXA 3RYSA 1N2VA 3N4EA 2YBTA 1K77A 3GNPA 2FPYA 2YFOA 3EWYA 1MI3A 2HWGA 2G50A 3UJ2A 2GGHA 2X2YA 2ZZ6A 3PB0A 4S23A 3W38A 1R38A 4F2UA 2WKLA 1JCNA 1TR1A 2GSHA 3W7JA 7REQA 1W5MA 4P8XA 2NQ9A 4HNOA 3CL6A 3NYZA 3VU2A 3ITGA 1CI1A 4HZMA 1WXYA 1K7FA 3MKVA 2YDRA 7PTDA 1E3ZA 1OYCA 4LX4A 5ENLA 4HU4A 4YTRA 5XIAA 4YVXA 1YIXA 4RV3A 1BVZA 2WPGA 3LZ5A 3MW7A 4FOUA 2GDQA 4AY8A 1Q6OA 1DXEA 3EWZA 1W56A 1S5VA 4Q8TA 1HO4A 3H2CA 3KZPA 4ZB5A 1UWRA 3BG3A 1H49A 1DVJA 3G1XA 2PTZA 3ELFA 3I3BA 4ZQCA 2VEIA 4S3EA 4F0MA 1JZ6A 3MP4A 1EP1A 4YVVA 1E9IA 2D0HA 2DZPA 2VFFA 1W31A 4MY1A 3UJSA 4FNUA 4IICA 3LTSA 5E6YA 3QOKA 3L5MA 1OADA 2ZIDA 3NPVA 4W7VA 5AHFA 3WJSA 3K13A 4PB4A 2XDFA 3QTPA 2ZXDA 1GQLA 4G7EA 4DEFA 3SCRA 2TMDA 5HNUA 2YSWA 2Q6ZA 3VX1A 6CGTA 5A2BA 3Q67A 3VKCA 2W6RA 3T2OA 3EWXA 5HWMA 5H1WA 2H9AA 3PPGA 3UPBA 2E6FA 3EX2A 3UGVA 3T0TA 5BW6A 1K03A 1B30A 4ZTYA 1V8EA 3GVWA 2OELA 3OTRA 2QUVA 2DU2A 2DVTA 3DERA 2BHYA 4IMFA 4YWIA 5I79A 1TVLA 3EMQA 2Y8UA 2VENA 2VQTA 3KRZA 4TMBA 1WE5A 3MI3A 4D6JA 1TCMA 1GK8A 3EWUA 3DH7A 1EP2A 4M6PA 4H9ZA 1C7TA 2JIEA 3PUEA 3H4XA 3QHNA 2FVKA 3RPDA 5HMFA 3U2ZA 3NIYA 4ZQRA 1TJ0A 3TTSA 4UC5A 2BFGA 4OOZA 2GVGA 2DVXA 2GQ3A 4HNVA 1UD2A 1SFLA 1MEIA 1C90A 2NUXA 5D9NA 4F8XA 4WY0F 3SGGA 2DDXA 1H62A 4DO4A 1BWLA 2VCAA 5CSYA 4QTGA 3HM7A 1DJZA 1B3VA 3OU8A 4KMQA 3LN3A 4C1LA 2FDSA 2R1PA 1WKYA 3ITLA 1JGIA 1XYBA 4RUBA 4HB7A 1VFOA 4LYPA 5ABGA 5E1QA 1GQNA 3I3EA 1MEHA 4EF9A 4B2DA 2RFGA 2XYLA 4REQA 1Q6EA 4LJ3A 4A3UA 2CIPA 3ITTA 1JZ8A 3NL2A 3TYEA 4AU0A 5D05A 3F4NA 3RR4A 1I2QA 4X22A 1VBRA 2OJPA 2CITA 1F74A 1RBLA 4GMEA 2GVLA 2G0WA 3IUHA 4GC4A 2VFDA 2XINA 4JOMA 3BQ6A 1VP5A 4P7LA 1HXJA 5C0QA 4G1NA 3GR4A 4O11A 3VD5A 2WNNA 4YCOA 2E8ZA 1K9FA 1OCQA 2D1ZA 3TK7A 3UJEA 3Q45A 3N14A 1OJXA 3UU0A 1TTIA 2V3FA 1B0IA 3KM8A 1DIDA 4O1BA 2WLZA 2J7HA 9RUBA 3DYOA 4S38A 4UCGA 3KE0A 2DZBA 3WF3A 3C8NA 2C1HA 2EPMX 4DUVA 4YVPA 3M43A 5MHBA 2ACRA 1KO0A 3IIZA 4GXMA 2PTDA 2INEA 1LRQA 3MCNA 2VWSA 3VNKA 3GNXA 1WP6A 1E71M 1Z9AA 4P8VA 1XIEA 3DHUA 4N9DA 2HTMA 4GQGA 3E96A 3GVQA 2XISA 4Y6GA 4A05A 1CWYA 4O17A 3BLPX 3CO4A 2RDTA 1REQB 1VIWA 4WDUA 6PTDA 2R14A 1TPUA 4JTCA 1V6UA 1YADA 3IUIA 2VT0A 4JKKA 4PRTA 2IKIA 2Y5JA 2VX4A 3T07A 4H9MA 1WZLA 2F84A 2QHAA 3VFCA 1JPMA 4ILSA 1G0CA 1RCOB 2D0FA 4IPLA 2DUXA 1IT8A 3H26A 4LU0A 3AALA 3LQLA 3WF2A 4C6FA 3AUOA 4DBUA 8XIMA 4GIRA 5EU9A 4RW5A 3G2GA 2OYLA 4PH6A 1P1XA 3TC6A 2I5GA 2Y24A 4U28A 1KLYA 4WLCA 3Q37A 4MKVA 5KETA 2ZQ0A 3CHEA 1HGWA 4WGHA 2PBOA 2XFFA 1RZMA 1M5WA 2VCBA 3W83A 3E2SA 4BCEA 3SY1A 4DLMA 2OZ8A 3CUIA 2HV5A 1KRAC 5C5YA 2WSYA 3O7UA 4IQLA 3I3DA 4JTGA 3P8IA 1FWCC 1YTKA 3KBSA 5D33A 1QOXA 3AIVA 1QWGA 2H3BA 2R6OA 4ATWA 2GUBA 3GDBA 4IH3A 4QIUA 2WPBA 2D20A 1EZWA 4CQDA 1HKVA 3CYJA 2E5DA 1GG0A 3W82A 3W1XA 4HSOA 5FF4A 4BHYA 4KQNA 1WDPA 1A49A 4JIPA 4CKQA 4AH7A 1DHPA 3RN6A 3EDJA 1O94A 4B3ZA 3FJLA 1XF0A 3GYCA 5FJTA 3MMWA 4I7VA 1UC5A 3L2IA 3WQ4A 2CETA 3GH7A 3WLQA 4DAIA 1TRDA 4US5A 2QJJA 4Z1CA 3USBA 2QDHA 3OGVA 4H83A 1MXSA 4LS0A 3E5BA 3GAKA 3AMDA 3PUOA 1MDLA 2ZVRA 3CZJA 4AHOA 4J7RA 1E4LA 2XVLA 1E6QM 1SZFA 4V1YA 3UERA 1I1XA 3KEHA 3NPWA 1FWSA 2R8WA 4QG8A 4AZIA 1MDRA 1YBQA 4UMBA 5LYRA 4DRSA 1P1MA 3AIQA 3AMCA 1T7LA 1VBHA 3D6NA 3HQNA 1C92A 2PP1A 3LLDA 4ZQMA 4LYKA 3N13A 2CHOA 3BSMA 7TAAA 2QAFA 3R5EA 4JPGA 2ODOA 3G77A 1XG4A 1MMFA 3CAKA 3MZ2A 5M5DA 4GI4A 4GCAA 3W24A 1MQPA 3MBFA 2IMRA 2O56A 3AMGA 3CZGA 3GVVA 4XB3A 3A24A 1TA3A 3AS3A 3OG3A 3GTHA 1FHUA 2I16A 1KM3A 4W93A 3C0JA 2BSLA 4JBRA 4EWND 3OVQA 1GUVA 3WG6A 4ERGA 4XZLX 1XINA 2QPXA 5LXEA 4GUJA 1CENA 4QISA 4Z17A 3VMNA 1QW9A 4ZB2A 3BGGA 4D8ZA 3AZTA 1J18A 3R2GA 4ZQPA 1GZJA 1RAKA 2QCMA 1Q6DA 1EHNA 1QI4A 2CZEA 4RE0A 2J6VA 4YN5A 1NY1A 3HF3A 1HF6A 4MB4A 2V3DA 2ZRYA 4ZQNA 3NDZA 1OFOA 4AFYA 5K9DA 4NYYA 4F4RA 2E9BA 3IJIA 2IQDA 3GW0A 3W2KA 4O18A 4M6QA 1VQTA 1Z42A 1LG2A 3LTYA 2HSAA 3AS1A 4IZGA 1JD7A 1DPMA 4QS5A 1SZEA 1PIFA 1J0YA 1R3QA 1U5JA 1GPFA 1UB3A 3LM3A 3ZOAA 3BAXA 2GYIA 4NNAA 2XWEA 1JPIA 1NAL1 4YTQA 4IFOA 1KFBA 4PULA 4AYSA 1BFNA 2VKZG 4QHRA 1W1VA 4XKYA 3M46A 1ZJAA 1I2PA 5JIPA 1QI3A 1OBAA 1NQ6A 2V9DA 2YXOA 1YDNA 4LUSB 4MB1A 3TC3A 1W1A1 2FGBA 2IPGA 1LOLA 3FGCA 1HKKA 4M1RA 4D6EA 5B7YA 4DPQA 1RJRA 2WB5A 6REQB 5J5RA 3QHOA 4NJJA 4Q8OA 2CHRA 4PTMA 3MT1A 1LWJA 3UNDA 3SIZA 3WKZA 3T9PA 5CC7A 1NDZA 2OCZA 1ECQA 3KTXA 1RSCA 2XUCA 2A6NA 2WSKA 1A5BA 2DGAA 1AL8A 1EJTC 3UZXA 3WDHA 4HJFA 1Z89A 4ASTA 4HCDA 1DJIA 3NL6A 3TC7A 5FL1A 3NYDA 4XWUA 3Q4DA 1W9XA 1BPLB 2VUNA 1BYDA 4N4QA 3NQDA 1EQPA 4LUJA 3W1AA 1RBAA 4KPLA 5HNNA 3ZLHA 3QFWA 4JHMA 1TPWA 1PJ9A 2V2DA 2QW5A 4FXFA 2XHYA 3W1MA 2EJAA 1K02A 2TAAA 3SDOA 4IMCA 3DUGA 3TOYA 1A5KC 2V63A 1EX5A 7TIMA 3LYEA 3MU7A 2C7FA 4H9TA 4M29A 3GFXA 1ZQ5A 1EF3A 1RCQA 3UF9A 4P8WA 3T08A 1BKSA 3T1GA 4CQ8A 4GNJA 5AYYA 3PY2A 4Q32A 1BF2A 5EB8A 3P67A 2PDBA 1A3WA 4ZOEA 1MZHA 3D3AA 3MSGA 2G3JA 5DY2A 3PHAA 3ONBA 3HG5A 1C9WA 5D4YA 4C65A 4C6OA 2O7SA 4C1NB 4ZO8A 1UA7A 1VCFA 2WJFA 3HGRA 1AMYA 4AHQA 4B3LA 2FH6A 3G1FA 2BXVA 1UH4A 2HXUA 3UG8A 3QF0A 3LI1A 5E5CA 3T0CA 2ZZ4A 3TJLA 4WSKA 3KHJA 1ADDA 2CLKA 5DEZA 4Q4RA 4IT1A 1KBLA 4I5XA 4QGCA 1EDQA 1ZALA 2Y7EA 1Z48A 4LUIA 4J3TA 1Z41A 1XRFA 2JEQA 4IQJA 3REQB 4MFEA 3A9BA 2QVHA 3ABRA 4I8YA 4W8AA 5TD4A 4UTFA 3HIJA 1GOIA 5F4SA 1T96A 3DBPA 4D6FA 4RV8A 3L23A 3AAMA 3MA8A 1W2VA 2OSYA 1S2AA 3FVMA 1XD1A 3M5YA 1XSIA 5AKQA 1ZB5A 3AYVA 4UQAA 1WAUA 3Q2DA 4HMCA 4GQ0A 4ZOCA 1JF6A 2W61A 1YYAA 4JQAA 3KRSA 3SQLA 1K8XA 2CXGA 3H4WA 4DJDC 2NVAA 4MWAD 1IZKA 1WDRA 4LXFA 4DVOA 3VMPA 2YYUA 3WCZA 1ZPTA 2DW7A 1E6SM 2FVLA 2BBFA 4HN8A 1TTJA 4KRUA 5CZ0A 2DFAA 1KKOA 3IIPA 1D8WA 3BGJA 5D04C 5D8WA 3LY0A 4UBPC 4W8BA 1WUFA 3K2GA 1QXLA 4C6CA 1AODA 4MJMA 3PJXA 3VGFA 4Q8PA 4QR6A 1BTMA 3CWOX 4RE3A 3DDMA 1XUZA 4NAEA 2FZ9A 2W5FA 2HK0A 4ICCX 3TMQA 3WNKA 4M56A 4RE4A 3TYDA 2OT0A 4LNYA 3DX5A 4GUFA 4MYXA 5AYXA 4FMVA 4UFLA 4KGLA 3G24A 4EPKA 3N2BA 3IWPA 4DBEA 1HGYA 1Y7VA 4F0RA 3HJZA 5A6AA 3F5LA 2CLPA 1RVKA 1E6RA 4B9ZA 4PUJA 4ONVA 1O60A 1H4PA 3TCSA 1BYAA 1ZSXA 3WLTA 2C19A 4A35A 3QV9A 4UQBA 4DYJA 5F2GA 4JTRA 3V0SA 2E7FA 1MFVA 3I68A 4A3QA 2J6XA 3S2JA 1AA1B 1OCJA 3IV3A 2MUCA 1EGVA 4UXDA 2FTPA 1TJRA 1TV4A 4HPXA 4JFWA 5TAOA 5JBDA 1TZ9A 3SGZA 3M7SA 3NEHA 4JTLA 1V7YA 3IGSA 1P7TB 4CLMA 4KWOA 3MUCA 3S8HA 3VGEA 3TDFA 1O95A 1V5XA 1L2QA 4OBSA 4JTDA 3W2JA 1E15A 4RZBA 3PB2A 3WD2A 4GLEA 1TJ1A 3LXCA 4I90A 5D9MA 2XIBA 3W72A 3VOGA 4FNQA 1OZMA 1DQXA 1B3OA 5BROA 1AJ0A 1X6UA 1UWAA 4FF5A 3DFOA 4MWAE 4RK8A 4AB4A 2OZ3A 1TRIA 3NFUA 4E4PA 5LA1A 1UKQA 3PNUA 4MSSA 2A79A 4O0ZA 1WXJA 3MJYA 3W74A 3KLKA 2DSZA 1A5AA 1V6WA 4M6VA 1NJJA 3VA8A 4LH8A 2OQLA 1WO2A 3BV7A 4XTIA 1O68A 3P84A 5GVJA 4FNRA 4ZOAA 2D73A 4K1WA 4GVGA 1Y65A 5EMYA 1ZFJA 2OQHA 1QPRA 3T7VA 1RH9A 3S42A 4CEXC 2OTDA 4NASA 2Q8ZA 3Q65A 2NV9A 1EDTA 4JAWA 5HDRA 2ICSA 1TWSA 4W84A 3W1QA 4FNSA 4U33A 2D2GA 1GG1A 4D1IA 1DWGM 3CPRA 1W1IE 4UTLA 2OOFA 2FJUB 2AMGA 1EHAA 1Q6LA 4GH3A 3N2TA 4ZA0A 2PD5A 2Z27A 1LOSA 3M16A 3O06A 2Z2BA 1H41A 4U2ZA 1RQBA 2NSOA 4B4HA 4W85A 5SWUA 2G96A 2WJEA 4FOJA 2REQB 2WJDA 2O92A 1VENA 3PFMA 5DMYA 2OG9A 2WJZA 5CGTA 4YTSA 4ALDA 3S5ZA 1A4MA 4M82A 1UPPA 4XUGA 3W1NA 4HHHA 4MPKA 5HK4A 3UETA 3BLKA 2GUUA 4Z2IA 3R79A 1SMAA 3EPMA 3VCNA 3AXXA 3B4UA 4ERIA 1TE1A 5DBTA 3W27A 2A7RA 4B4FA 5LIUX 1M53A 3N11A 2ZADA 1CX9A 3PM6A 3PTQA 1KRCC 1SQ7A 2WQPA 5T26A 5A6LA 2QDGA 3LCIA 9XIAA 1KCZA 1MW0A 1LLZA 2ZUNA 4HK6A 4HGXA 4WZHA 1ICSA 4MNLA 4TO8A 1NELA 2YW4A 4PTVA 3W75A 2PDXA 2PP0A 3QMSA 2AL2B 1RY8A 1IZJA 1UMYA 1I8JA 1KD0A 2DVUA 3TTQA 4PMDA 1G01A 4GIYA 2PSNA 4ZXOA 3P7YA 2CLEA 1SJBA 3UA4A 3QVQA 3OA5A 3H8AA 1TV2A 2XIMA 4DI9A 5DFAA 3CL8A 3UG3A 1V4YA 3CGTA 1RK6A 3PJWA 1JPDX 3TUUA 1W3JA 5EMMA 3R4IA 2NLIA 3UJFA 5AVNA 4AHPA 1JAKA 1UMLA 1VEOA 4GHRA 3M1ZA 1L6YA 5LA0A 3I6RA 1V0MA 3K30A 3OZYA 3GNDA 3ABQA 2I9EA 3PULA 3RRAA 2R91A 1ZAHA 3FSUA 1EC9A 4NX5A 3VKBA 3FXYA 3F5JA 3M0XA 5E70A 1FH7A 3TYUA 1PDYA 1R7OA 1AD1A 3K46A 2G95A 1JUEA 4K8EA 1V7AA 1MWOA 4KIEA 3SIMA 4JIIX 2XH7A 3BTNA 1LQ2A 5BOFA 4Q8VA 4B92A 3FYOA 2CYGA 1M1BA 2YKKA 2ALRA 3CIWA 1W5PA 3RU6A 1R7AA 3BLEA 4LW7A 2Z1WA 3H23A 2XGZA 3QMTA 4DUWA 2V5BA 2PA6A 5FJRA 1R87A 3EB3A 4JL1A 2X16A 1J79A 2XIJA 3SCPA 4JFTA 1LRNA 2J7DA 5G1TA 1A5LC 1HVQA 4YYFA 3W71A 4AIBA 2KZHA 2ZRZA 4LV4A 2B7QA 1AVAA 2OLHA 3IK4A 2NV1A 2IUZA 4E4UA 1M03A 3Q58A 4XKMA 1OG6A 3SW6A 3BMWA 4JX6A 3RDKA 1FOBA 1VFTA 4BF7A 3APTA 3CAVA 3VVGA 2X41A 4IOTA 1TKKA 1OFEA 4PTXA 4LEQA 2DSUA 1GKQA 4XBJA 2ACUA 1MYRA 2XVKA 2FJKA 3HPZA 5A8NA 5GNXA 1UR0A 2XSXA 3CWNA 3NUKA 4L4MA 4FA3A 2PGEA 2Y89A 3MYOA 4J3WA 1DJHA 4PCSA 4LY8A 1TTPA 3CHFA 4LAKA 5EY5A 3L0NA 4NF7A 3WH9A 3N4FA 4LPCA 4C5YA 1DHKA 4TTGA 2I56A 4TQTA 5E9AA 1CW2A 3A22A 3W6MA 2E25A 4JTUA 3GUGA 4FO4A 1BGGA 1FWBC 3B8DA 5T8GA 4O1DA 4RNFA 4IPPA 4XAYA 3RO8A 3B40A 1P43A 1JGMA 5M1TA 3R8HA 4AYGA 3N2MA 2P8BA 4KEUA 1V0KA 1G7UA 1PYMA 2CLHA 4BF5A 1XJBA 4LANA 1A50A 2X1RA 3U4AA 3KFTA 2HS8A 2WQDA 4PMUA 5BXRA 4P7RA 2OO0A 1PDZA 5HATA 3A6OA 3VNIA 2WCGA 3V7PA 2QPSA 4HTYA 2RUSA 3VKJA 1OG0A 1ZZMA 4AZHA 3K4AA 4L64A 4K68A 6XIMA 2AKMA 3QH2A 3C2VA 1BWVA 1DJQA 2XVPA 4BF9A 1YXDA 5EMUA 5CPTA 3EPOA 1TPB1 2YIHA 2QLYA 2D3NA 1CGTA 5JIWA 4DWSD 3CAWA 3BLDA 3CQJA 4R88A 4DYKA 4FLOA 4H2HA 3OLDA 1TZZA 4WDXA 4IP4A 1J01A 3LHYA 3K5XA 3TOPA 1TR9A 4PZVA 2QCFA 4WXZA 1KQZA 4PBGA 1HJQA 4B5TA 2YB1A 3UW6A 1KBBA 1OEPA 1C3FA 2XFRA 2HE5A 4GYFA 4ZBCA 5JVLA 3PG9A 3V0UA 4QDWA 3AC0A 3UZ5A 4IL2A 1QNRA 3NOYA 2OPJA 4AD0A 3IJ8A 2ANUA 2BGSA 1K4GA 1EBGA 3SADA 3HA1A 3NVTA 2BGQA 5FJIA 4QQUA 4LT9A 3H2EA 1KM6A 3RNDA 4UR9A 4UTUA 1S1RA 3C52A 3NGFA 4ML4A 4BFAA 1Q63A 4LTSA 1UCWA 3KCOA 4KGJA 3BXWA 4M8UA 5HANA 5A95A 1ZP3A 2FZMA 4JIEA 5CH9A 1ESWA 2C8NA 1R3VA 4M0XA 4LBRA 4W87A 3ATZA 4XTDA 1IEIA 2VEGA 1NOWA 3FJ6A 1XW8A 4UTMA 4GBUA 1GOXA 3D5HA 3RITA 2G8ZA 5HQEA 5H6HA 2JALA 1ZP4A 2YXGA 3LRKA 1J6PA 2H8ZA 1FWFC 4F0LA 1GVYA 2PFHA 3QLLA 2C14A 5H8PA 5A8MA 5C9ZA 3GC5A 4YHGA 2C71A 1J2WA 1JZ7A 4F0KA 4LVDA 4H7VA 1SW7A 2C15A 4DJFC 4JQ2A 3ZFHA 3V5OA 1TUXA 1ZTVA 3N29A 4MDPA 5HR7A 4FX7A 3UBPC 1YW1A 4JTFA 4IG2B 3R1ZA 1KFJA 3PG8A 2CZDA 5LHFA 2O9RA 1CTNA 1F2JA 3S83A 4BWLA 2GWGA 4HN4A 2J78A 4R34A 3GXMA 4PCTA 5I03A 1R9ZA 1R3YA 4F48A 5I3HA 3HPXA 3CPUA 3SRFA 3U8GA 3EOOA 4PMXA 2J13A 4WJXA 2VFHA 4CVWA 1Z7AA 2PUZA 1BG9A 2QIWA 3KHDA 5AZ0A 1XISA 4PC8A 5IHRA 1Q2RA 1LYXA 3PZOA 3A13A 3POCA 1QNOA 5AHNA 3VAVA 1I2RA 1UOKA 3ANYA 3FHQA 1THFD 1OFQA 1XLMA 1UWSA 4EPDC 1D3HA 1LM1A 4Q7IA 4LYRA 4L9ZA 1Y0EA 3M5XA 3LLXA 4FNPA 2DSKA 3G8RA 1X8FA 7ODCA 2XSAA 1LL7A 4D6HA 4K38A 4EX4A 5BOOA 1UR4A 1XLGA 4EPBC 2Z25A 3W85A 5EBAA 5BRBA 1IV8A 2QUUA 5U7SA 4WRHA 2Q8XA 3L9CA 3LCXA 5CSRA 1U2YA 3KL3A 2BMBA 4KERA 4CU7A 4EXAA 5KSWA 1JRCA 2ZZ5A 2BV9A 1D3CA 1HJXA 3B9DA 4C1NA 4UTJA 1XIHA 4TX6A 2BS9A 4GI8A 1L6WA 3S5SA 3KL0A 2OOGA 1XP3A 4JX4A 5GQBA 3BLOA 3R0KA 3GZAA 3F2DA 2I1OA 1RD6A 3DECA 1E72M 1JRBA 1VIZA 2WSRA 1BSLA 2RHGA 1R6WA 3R25A 4CGTA 4PMZA 2ZE0A 3HG4A 4FOKA 5ABHA 4KESA 1ITXA 5EGRA 1XLLA 3W4RA 1F8MA 2DJXA 2Z00A 1TVNA 5I23A 4TV6A 2VZUA 3URBA 3REQA 1DBTA 1NIUA 2V67A 1I0DA 1OCNA 3PZTA 5I3JA 4YTUA 2O9PA 5LGXA 1XXXA 2I5IA 2Z4GA 3H55A 3UP8A 2ZTJA 2D2JA 4MM1A 2INZA 3QYQA 4OU1A 1PE1A 1H7XA 1X6LA 1NP2A 3CMJA 2BWGA 4ZSTA 2GQ8A 2BXYA 3RJXA 5HNRA 4QXIA 1YE4A 3TN6A 3PPHA 1E3XA 2QJMA 4HVXA 3T8QA 1FFRA 2GDUA 3FVDA 4Z1YA 4V27A 3EOSA 1S5NA 3WNPA 2F61A 5G1MA 3KTSA 5CG0A 3ARXA 3NO1A 1XDLA 2IXUA 1EJWC 1XR2A 1XLEA 1HT6A 5CJMA 1X8CA 3VOJA 3N17A 1JNDA 3F7JA 1S5MA 1V03A 1CXEA 1W1PA 3G0UA 3GR7A 2W63A 4O14A 1HJVA 2XFYA 3CH0A 5K9CA 4GACA 3AYTA 4CCEA 3PR2A 3P60A 3R10A 5T91A 1K3UA 3DFQA 3ZT7A 4F40A 1WX0A 1ADSA 3STGA 4FXJA 3C0QA 1M68A 1IYXA 4I7WA 4ZFMA 5TBOA 3THUA 4P7QA 4YWSA 3C5QA 4MB5A 6TAAA 3PUDA 1L8NA 4HU0A 1C8XA 1E1CA 1KV5A 3S5YA 3G1YA 1V02E 4L4OA 4PUMA 3PSVA 3GVRA 4DWSB 3VGGA 3N12A 2PWVA 4RW3A 2QF7A 3I65A 2QCNA 2F38A 3QPZA 4LV9A 2Z24A 4YTTA 3H6OA 3AIBA 2NZLA 5LNVA 1GTEA 4N6FA 3M47A 3W6LA 2OEMA 2R82A 3R43A 1V3KA 3VNLA 4CVUA 3ARYA 3URAA 3LPGA 1P7TA 3F1QA 4IISA 5CZSA 2DT0A 1MNSA 4GFSA 1FP8A 5JQ9A 3P6LA 1UH2A 5FIPA 2V5CA 3B05A 5IDIA