5FOOA

6-phospho-beta-glucosidase
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
463
structure length
463
Chain Sequence
MLAFPKEFWWGGATSGPQSEGRFAKQHRNLFDYWYEEEPDLFYDYVGPDTASDAYHQIESDLTLLASLGHNSYRTSIQWTRLIDDFEQATINPDGLAYYNRVIDACLANGIRPVINLHHFDLPIALYQAYGGWESKHVVDLFVAFSKVCFEQFGDRVKDWFVHNEPMVVVEGSYLMQFHYPAIVDGKKAVQVAYNLALATAKVIQAYRRGPAELSDGRIGTILNLTPAYPASQSEADMAAAHFAELWNNDLFMEAAVHGKFPEELVAVLKKDGVLWQSTPEELALIAENRVDYLGLNFYHPKRVKAPDAIPVISPSWSPEWYYDPYLMPGHRMNVDKGWEIYPEAVYDIAIKMRDHYDNIPWFLSENGVGISGEDRYRDETGQIQDDYRIQFLKEHLTYLHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRPKASAYWFKKVATHNRLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemoenzymatic Synthesis of 6-Phospho-Cyclophellitol as a Novel Probe of 6-Phospho-Beta-Glucosidases.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
molecule keywords 6-PHOSPHO-BETA-D GLYCOSIDASE
total genus 194
structure length 463
sequence length 463
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5fooA00
4PMVA 3PZ9A 1MW2A 2Y2WA 2ZE0A 3AJ7A 1RP8A 3U5YA 3GH4A 3QHOA 2UY5A 4PSRA 2CETA 1PEZA 1ODUA 1JZ8A 4UNIA 5A8OA 4YHGA 5KZ6A 5A8MA 2VURA 2ZX9A 5A1AA 3TP4A 1GOQA 5IFPA 4W87A 4TTGA 5E6YA 4PUDA 4UQDA 1BYAA 4LQ1A 5ABFA 4AMCA 3WKZA 1E6SM 4OOUA 2VZSA 3VIOA 1U30A 1JD9A 3AHZA 4CD6A 2VRKA 1GPFA 2DGAA 1C3FA 2GK1B 1UKOA 2XHYA 3S2CA 4W85A 2BFGA 1M04A 5A6SA 1C8YA 4HOWA 3AHVA 3MUIA 1JDDA 3PZGA 3VNZA 1FP9A 4D1IA 2FGZA 4JFVA 5A2AA 1V3IA 1SMAA 1W3JA 1ISZA 1CDGA 3TTQA 1V6XA 4W8LA 1VB9A 4P8WA 1X6LA 3LPOA 1W1TA 2J7DA 2VZVA 3KE0A 3N13A 3OLEA 4UQCA 1J0YA 1W32A 3B9DA 2J25A 1R85A 4QLLA 2VZTA 3LPGA 3UETA 4IUGA 2D22A 5EBAA 1JD7A 2GJXA 4LYRA 3WUGA 1M53A 1HKMA 2GSJA 3TA9A 1GCYA 1MFUA 1B0IA 2ZUMA 1V0KA 4ZXOA 3UEQA 3L4WA 3WQVA 2XYLA 2FH6A 3AISA 1C7SA 4P8VA 2CXGA 4JL1A 1QNRA 2IUZA 1GOMA 1UWIA 4BQ4A 4C7DA 1YHTA 2WKGA 2WWCA 3ZIZA 3AMKA 3CZ8A 3APGA 4TVUA 4HOZA 3BH4A 3AIEA 1VFMA 3CHCA 1RD6A 1Z32X 5JIPA 4WKAA 1UZ1A 1LLOA 1V02A 1HF6A 4FK9A 1HL9A 5I3DA 4V2XA 4S3KA 5IDIA 5CXPA 2V3GA 3DYMA 4OUEA 3QOKA 4D6JA 1US3A 3CZEA 4PMOA 1E5NA 4KRUA 1VFUA 1OGSA 4QAWA 4UQEA 1S46A 2W61A 3AS0A 1E40A 3ARRA 3WQ4A 2VQTA 3WL0A 1GNXA 2YA2A 3L4ZA 5GNZA 3OLIA 5A6KA 2XWDA 4H41A 4A3HA 5E0FA 1EA9C 2DT1A 2BHUA 5CQ1A 4ACZB 1JZ3A 2DT2A 3WMSA 4PYSA 1UKSA 2A3CA 4Q22A 2ZX5A 1J12A 1J18A 1GJUA 1QI3A 2EBNA 2WWDA 1J9YA 1H4PA 3W29A 1I1XA 2OWCA 3BAWA 2G3NA 2OWWA 3VD3A 2X0YA 3J7HA 1KGUA 3K8KA 5AC5A 1K9EA 4ML4A 1MYRA 1Q6DA 4M24A 5I2UA 2WHLA 4UOZA 3WY1A 1W3HA 3KWXA 4DWSC 1FHDA 4GQRA 2PWDA 3I3DA 2NT0A 2Y8VA 5A6LA 1TE1A 5EMYA 1E4IA 2BVTA 2VJXA 1UUQA 3D5HA 3U7BA 3RO8A 2A3HA 2WZHA 4AW7A 5AYBA 3SCQA 3ARVA 1XYZA 1GHRA 3SUVA 3L4YA 1UH2A 2VR4A 4D6EA 2ZWYA 3MSGA 3W81A 3CO4A 4PMRA 2PWEA 5D9OA 1ZS2A 1KGXA 2G3MA 2DDXA 4AD0A 2PBGA 1VEOA 2F61A 1GQKA 2ZX7A 1LWJA 1CECA 4CD4A 2VRQA 4PCTA 1BTCA 2G3IA 4GIAA 4D6DA 3WDQA 1VBUA 4M80A 1E3ZA 5A3HA 1BLIA 1MW0A 2XSAA 5C70A 2D0HA 1E4LA 4AYSA 1OB0A 1NQ6A 3OLDA 1IV8A 1NOWA 2WHKA 2DH2A 1FHLA 3CHEA 3GXMA 3L4XA 3T2QA 3WUEA 1QW8A 2WW5A 2GDVA 4AZCB 4U5KA 5I24A 2F2HA 3AYSA 1VAHA 3VIFA 4PCSA 1PZ2A 3WQWA 4W7VA 1JDAA 2CIPA 1SYTA 1JYVA 2EO7A 3GZAA 4QLKA 3NCOA 1QI4A 4IPLA 5JUVA 2JALA 3OZOA 4HMDA 1MWOA 2TAAA 5D9PA 4V28A 5HXMA 1XGZA 3CZLA 4GZJA 4FLRA 3VD7A 1BGGA 2WMKA 2ZOXA 3QHNA 4TOQA 2YDRA 1UD8A 3NDYA 4B16A 4MJ2A 1V3MA 1UR8A 1WDQA 1I1WA 3CZKA 2J4GA 4CCDA 1NOUA 4HMCA 5HDRA 2JIWA 2YL6A 1HXJA 2VVNA 3VU2A 1VRXA 5ABHA 1J0KA 2J7HA 2ZXQA 4GI9A 4GINA 1E0XA 3WELA 1L8NA 2JIEA 2BNJA 3TTSA 2J8GA 1RH9A 2CBVA 2YIHA 1G5AA 3CMJA 1JZ2A 5DFAA 4NF7A 4BCEA 3AZSA 1FOBA 3BC9A 4J3SA 2WSPA 3VMPA 1J01A 4N0RA 1R7OA 3AZTA 3WIJA 5A8PA 4AWEA 3U5UA 4Z2KA 1ODZA 3UERA 1KBBA 5JBFA 1KBKA 3VGFA 3D3AA 3T0BA 3VGGA 4YPJA 7CGTA 1ESWA 3K46A 2YBTA 1J0HA 3M46A 1WDRA 4AZHA 1E6RA 4AD4A 3RCNA 1KQZA 3VDHA 1UD2A 4PN2A 3DYPA 1RP9A 5GPRA 1LL4A 5M3WA 4U33A 3LPPA 1E43A 1R86A 2J7FA 3IAQA 2WSKA 3AIQA 1A3HA 3RMEA 3HJEA 5D9NA 3O2LA 1ISXA 4AD3A 4UFJA 4AD1A 5KEZA 4MJ4A 3EDJA 2EXOA 4MPKA 1JG9A 1JDCA 3THDA 4HA4A 1CLVA 1UKPA 2XGBA 4J3UA 3DYOA 1UWRA 1JYWA 4JKLA 2WPGA 4BQ2A 4UQBA 4WKHA 1FH9A 5I23A 3KL5A 5I79A 1UR9A 5F7UA 4ATWA 2W63A 1V6YA 3SCPA 1DWGM 5TD4A 2WNWA 2BHZA 3WUBA 3ZJ8A 4B3KA 4GZIA 3GYCA 1UR2A 1TVPA 1OM0A 1EDQA 4FMVA 3BGAA 2DT0A 4CVUA 3BAIA 1ZU8A 4PMYA 1PX4A 2VCCA 1ZL1A 3VINA 4ATLA 2J7CA 3SCSA 2JFEX 3B8SA 4D1JA 4OBRA 1GQLA 3A6OA 4WIWA 3ZSTA 2O92A 4JHOA 3GXDA 4Y7EA 4JFWA 4CN6A 4DUVA 4OOZA 1LWHA 3RIKA 3N12A 4BS0A 3AS2A 1CIUA 4XB3A 3SCWA 1E6QM 3SEPA 3PN8A 1E72M 4OZOA 2G3JA 2W62A 2X09A 1FFRA 4KMQA 1BVNP 3WNPA 3PTKA 3IJ7A 3KEHA 1B3YA 2XTKA 5M17A 1W91A 4Z2LA 4X0NA 1VFOA 4HPGA 5ABEA 1H49A 3MANA 3TTOA 3UG3A 1B31A 4AZ7A 2VQUA 2PBOA 2CBUA 2X1IA 1E71M 2OYLA 2V3EA 3VIKA 2UWFA 3CUJA 3JUGA 4H7VA 2YJQA 3WNNA 5HOSA 1OSEA 2VZOA 2BV9A 3WDJA 3A47A 2XGIA 2XVNA 2A3EA 1K9TA 1QBAA 3EYPA 3PBGA 3GDBA 1UOKA 3ARYA 1VIWA 1X6NA 3VM7A 3OBAA 1E1FA 4N42A 1KXTA 2WB5A 2GJRA 3EDFA 1Y7VA 2BHYA 1W9BM 5AYIA 1G01A 3AHYA 3L2MA 3UG5A 1QNQA 5I0DA 2V5CA 4LX4A 3AYRA 4Q7NA 1ZBVA 1ISVA 1CLXA 1QI2A 1BYDA 1FH8A 3AROA 4C7FA 2ZIDA 2DT3A 5FOOA 3MO4A 1TUXA 1HJQA 4PSPA 3WD3A 3ZQ9A 2XUCA 3EMCA 1JFHA 1PX8A 5M5DA 1AQ0A 5A94A 4W5UA 4QP0A 1R8LA 1V3JA 2XFFA 1TCMA 2QHAA 1VJZA 1TR1A 4RE3A 2FHCA 1HL8A 3FY1A 4CD7A 4KRTA 1LL7A 3VD9A 3AIUA 1DWFM 4CD8A 4P7QA 4XUYA 4UQAA 1BYCA 2D20A 3HN3A 4TVCA 5LYRA 4AZIA 4ZE5A 3GNOA 3VMOA 3W25A 2ZXAA 3SCVA 2J74A 1GW1A 3MU7A 2WC7A 4JL2A 3WBEA 2JE8A 2WCSA 2GUYA 4UFLA 1EQPA 4PTWA 4S3JA 5FL0A 7TAAA 3SIMA 3O9NA 1BPLB 1ISYA 1HKJA 3MV01 4JFUA 3AMGA 3VX0A 3MV11 1EH9A 2E9BA 4NI3A 3RJXA 2WC3A 3WF3A 4CCCA 2NW0A 3WN6A 1OT1A 4UCFA 5CSUA 2PB1A 2HISA 5BWFA 4H8VA 4URIA 3BLPX 1WZAA 2VT0A 3ZJ6A 3AIVA 1KR0A 1QW9A 1ZBCA 3W6MA 1CPUA 2CYGA 4M8UA 3CBWA 1SR0A 1FFQA 2WMFA 2VX5A 2WYSA 2WMGA 2FHFA 5FD0A 3SCOA 4EKJA 3AS1A 1B30A 4JAWA 1V3KA 3NUKA 1CXHA 3WD4A 4ZXLA 1F4HA 2YDSA 1TFVA 5D8WA 1K6AA 2E4TA 4HZ7A 4V27A 1E6PA 4EE9A 5E6ZA 2BXYA 5A95A 1DEDA 4UFMA 3HU7A 1WE5A 1NWUA 5A6MA 1JYXA 1PZ3A 2F8QA 5CJ5A 2VRJA 3ZM8A 1LJYA 1OIMA 2VCAA 4W5ZA 5A69A 2WLYA 3SCTA 1CXEA 3N17A 4W8BA 4R27A 3VPLA 1CXIA 1Q4NX 2QF8A 3OGVA 1GONA 4D6FA 3A4WA 2JEQA 5ABFB 1JIBA 5LA0A 3T0AA 3ARTA 3TTYA 2YDQA 1XH0A 3CIVA 3PZUA 3W6LA 4M82A 5C8BB 2IXUA 2XG9A 1WDPA 1O6IA 3RILA 1CGVA 5IFTA 3UR8A 3ZR5A 6A3HA 2V38A 3FAXA 2Q8XA 4HP5A 5ECUA 3VKKA 3F5LA 3ARPA 3AXXA 2DEPA 2FHBA 1CTNA 1TVNA 4QLJA 3CMGA 3VMNA 2WBKA 4MDOA 1OD0A 1DWIM 1UA3A 1BSIA 4J28A 3EDEA 4BQ5A 1BGAA 1XSIA 1LG1A 1WAWA 5CGMA 1D3CA 2ZICA 1MQPA 3NSNA 4C7GA 1UZ4A 5DT7A 4J3TA 3VD5A 1M7XA 1C8QA 1HKKA 2D0FA 2QPSA 3GBEA 3QGVA 5JIWA 5CZKA 2DIJA 4KGJA 3A3HA 4F9DA 1UYQA 1WZKA 4NRRA 2J8FA 1E6ZA 2WLZA 2B31A 4DM1A 3DC0A 3BLKA 1RPKA 1E3XA 1JXJA 4LYQA 5CPSA 3PTQA 1QPKA 4AZGA 3AMCA 1W2PA 2AMGA 3TOPA 2XWEA 4RE4A 3AHXA 1CXLA 1GOKA 4HPHA 3F5JA 4UFHA 2W66A 2WM0A 4F8XA 4OJYA 2XM2A 3WSUA 1KQYA 4J27A 5E09A 4EAMA 4M56A 2OYKA 4P7NA 3OGRA 2YLAA 4HU8A 1Q6FA 3PZMA 2XIIA 1GOOA 3AICA 3L4UA 4XX6A 3G6MA 2Z1SA 3EBVA 1UD5A 1M03A 1UA7A 3VVGA 4CU8A 2Y5EA 1C7TA 2WAGA 2C7FA 2GVYA 5IHSA 4OKDA 2NT1A 4A3YA 3SURA 3FHQA 3BAKA 1V6UA 4CVWA 1OGBA 1Q6EA 2UY3A 2ZUUA 4PMQA 4BF7A 3W37A 1KWKA 1NM9A 4IPNB 5GNXA 1UQYA 4ZE4A 2D24A 2EPLX 5AC4A 3VIJA 4LGXA 3VDCA 3WFLA 3AHTA 4W89A 5BRQA 1WKYA 6TAAA 2ZWZA 1B1YA 1JYNA 1H1NA 4PBGA 2VTFA 1E4MM 1E5JA 3E1F1 3GXFA 3II1A 1E15A 5D4YA 3I3EA 5FKYA 1JAKA 1E6NA 3AIWA 1H3GA 2XVLA 4JFTA 3VDBA 1C90A 5DMYA 2OWXA 5HPCA 2X8RA 3PZTA 1EOMA 2J7BA 3OLGA 1B3ZA 1AVAA 2WVUA 1EOKA 4CCEA 2Y8KA 2JEPA 1MQRA 2CPUA 4AXNA 2CBIA 1PPIA 1ZBWA 3ARQA 2WMIA 3WF4A 3WD1A 2GJPA 2WMIB 4W93A 4W86A 4XV0A 2W4XA 1OT2A 3GNRA 1D2KA 3N11A 3K4AA 3OIHA 3ZT6A 3VNYA 3T2PA 4TUFA 3GH5A 4W84A 1VBRA 1E4NA 4P8XA 3G6LA 1JNDA 1TA3B 2YKKA 1LQ0A 4QCEA 1GORA 1AQMA 4B15A 1TG7A 3VIIA 3LMYA 2VX4A 3WNMA 1WNOA 3FHAA 3BSGA 1NP0A 2VCBA 1DWAM 4ATDA 1QHPA 3GNPA 1J10A 3VIHA 4BQ3A 4B9ZA 2QMKA 4U3CA 3VIGA 3UCQA 3SUSA 8A3HA 1QI5A 3AMLA 1W1PA 4MB3A 3NSMA 3GTNA 3ZT5A 1NOFA 1DWHM 1TA3A 3EMQA 3RDKA 1MFVA 1B3VA 3NSXA 1H5VA 1E9LA 3MSDA 5I6SA 4WK9A 1G0CA 2YBUA 4MB5A 1C93A 1BG9A 1H41A 4HA3A 2WVTA 5BXPA 3WDRA 1MXDA 2VZUA 2C8NA 1YQ2A 3UR7A 1VEPA 5EFFA 3WNLA 4MNLA 3T0DA 4P7OA 2XJ7A 2ZXBA 2J62A 3K4DA 3QOMA 1BAGA 3VGBA 3K8LA 4ZFMA 4AZBA 1BVZA 3SCUA 3VUPA 2G41A 5I78A 3W26A 3PZQA 2XSBA 2J47A 4UZUA 3WD2A 3WDHA 2W67A 4D6CA 1V03A 3IJ9A 3K1DA 1B9ZA 4CU6A 2PC8A 2VX6A 3CHDA 3BMVA 1EO5A 2OYMA 1Q6GA 2WC4A 4K68A 3ZSSA 3CLWA 4QCFA 2QMJA 3BCFA 4MB4A 4AD2A 3AFBA 3AMDA 4CN4A 3MUAA 4PMXA 5M03A 1JGIA 4WSJA 1PBGA 2XFYA 4AEFA 1CYGA 1J11A 2MANA 3KL0A 3ZMRA 1PAMA 3WH5A 2JF7A 2XPKA 4WLCA 3WH6A 2FDMA 4RL3A 2V3FA 4U2ZA 2AOSA 1CENA 4MADA 4UFKA 3RM8A 1DWJM 3LPFA 3NYDA 1JF6A 3MMUA 2QV4A 1ITXA 1W1VA 1QHOA 2Y24A 3VGEA 1KXHA 3W28A 5BYWA 3WNOA 3SCNA 3AI0A 3B9AA 4H2CA 5DF0A 3DHPA 1E55A 7A3HA 1CGXA 1WCGA 2UY2A 5FL1A 4CUCA 2J78A 3NJ3A 2E8YA 4PUEA 1JNEA 1CEOA 1XSJA 3EDKA 4CD5A 1KCLA 2EPMX 3PZNA 1M01A 3CPUA 1W9XA 1XD1A 3GBDA 1J0JA 1P6WA 1BHGA 3GM8A 5ABGA 1B3XA 3ARSA 1E73M 5BXSA 4HOXA 3BMWA 2EPOA 4U31A 2W5FA 1W9DM 4JIEA 4HZ8A 1B3WA 2OSWA 1J0ZA 2CEQA 1L0PA 3MUY1 1FH7A 4M81A 5A6JA 4M1RA 3WH8A 2X0HA 4QFUA 3L4TA 2BY1A 3WNKA 1UD4A 2WXDM 1H0GA 1LF1A 2J7EA 2BXZA 3HMCA 1WZLA 2WMJA 4X9YA 4GI6A 4Z2GA 2X2YA 1PIGA 3NDZA 1EDGA 3VILA 3RM9A 2WCAA 3AZRA 1W1YA 3FW6A 3RPMA 3WL1A 4UR9A 2WZIA 1ISWA 3IK2A 1ZJAA 1HN1A 4GI8A 1QHZA 1GHSA 8CGTA 1VF8A 5A8QA 1B2YA 1ZB5A 3CUIA 2ZUSA 2G4FA 1UWUA 9CGTA 2A3AA 4W8AA 1UD6A 5CLTA 2BVYA 3CH9A 5BXTA 1UD3A 1WDSA 2YOCA 1OD8A 4HMEA 2ZUTA 2FGLA 4LXFA 2W91A 3BAXA 1CWYA 4J3XA 4LYPA 3WEZA 4H8UA 3N1AA 1BG4A 4AC1X 2NSXA 1IT0A 4CN1A 3IANA 1GVIA 4CKQA 1VJSA 4H04A 1JZ5A 1OGGA 3K8MA 4GO8A 5HPOA 1OBAA 4BZYA 2CBJA 3L4VA 2WCGA 2XFRA 2VC9A 1V0NA 4PTXA 2O9TA 1UWQA 3AXIA 1WPCA 4UTFA 2ZUWA 4PMZA 3MKKA 2VL4A 3T2OA 5GNYA 4YN5A 2WKLA 4MDPA 4JKKA 3ZT7A 4JFSA 2ZX8A 1C92A 3WDPP 1C8XA 1XSKA 5CG0A 2VUYA 4KGLA 1GOWA 3AQUA 4HA1A 3WDIA 2YLLA 2D0GA 3BCDA 1UG6A 3CTTA 5A8NA 3ARXA 3FAWA 1XH2A 3M7SA 1CBGA 4JZ5A 4E4PA 1LG2A 4KH2A 3WMCA 1ZBKA 1B90A 1NARA 5IHRA 3MMWA 1DP0A 2PF0A 1SMDA 2DSVA 2GDUA 1HKIA 1U2YA 3AIBA 1MQQA 1WO2A 1E70M 2BVDA 3U7VA 1GOIA 4BA0A 1AQHA 3PTMA 1PX3A 3UG4A 5DT5A 1XCXA 1OCQA 4AZ5A 5HBFA 1CGTA 2CKSA 2E0PA 3ZOAA 2YA1A 4OBSA 2PI6A 1QNOA 4D72A 4IM4A 1MVYA 3OZPA 3OGSA 2BY2A 4D6HA 1UKTA 3WENA 1KXQA 1J0IA 2CCRA 3ZJ7A 2E9LA 3CGTA 2WK2A 3IAPA 5D9MA 4U2YA 4B3LA 4CU7A 4TX8A 2D2OA 2DIEA 3ZJKA 2YL9A 2E40A 4JHZA 3M6DA 4MAZA 4ZEPA 1HIZA 4D6GA 4RE2A 1XHGA 1A47A 1IZKA 4GKLA 1OINA 3MMDA 2HVMA 2CERA 4E8DA 4D71A 4AD5A 3W27A 3N15A 4NRSA 4UFIA 1H11A 2VO5A 1JL8A 3EDDA 1XRVA 4FLQA 1V0MA 1HNYA 1KWGA 1KXVA 1KR1A 4PTVA 3S6TA 4OIFA 4YHEA 1VFFA 4AZCA 3KZSA 1UR0A 1KCKA 2VX7A 2BY0A 1GQJA 1V08A 3F4VA 2ZX6A 5DO8A 2ZXDA 1CXFA 1NP2A 3BSHA 5A6BA 1ITCA 1CGUA 3ARZA 2CITA 4AIOA 5I5RA 1G1YA 4MAVA 3ZR6A 1CZ1A 1VEMA 3THCA 3PZIA 2ZUVA 1E0WA 1QVBA 3W53A 1XH1A 4MTVA 3BXWA 4JKMA 5IXEA 5CLWA 1MW1A 1UR4A 1BFNA 1FA2A 5CPTA 1W3LA 3MUZ1 5E0CA 4AZ6A 2WMHA 2O9RA 1OWQA 1E1EA 2UY4A 3FXYA 5D8ZA 4MNJA 2QLYA 1GQIA 2YA0A 1U33A 4WSKA 2QPUA 3GH7A 3BAJA 1NWSA 1WP6A 1KGWA 1FP8A 5EFDA 1H09A 1GZJA 1JZ4A 4WKFA 1X1NA 6CGTA 2D1ZA 1BF2A 1Q6CA 3CUGA 3VDAA 3AOFA 3WQ8A 1JXKA 3O6AA 4P7RA 5A6AA 2OLHA 4AIUA 4FLOA 4AEEA 4DM2A 5JBDA 2EPKX 3UESA 2XIBA 3WEMA 1KB3A 1E56A 4FLSA 4DUWA 4J3WA 3B9EA 4J3VA 3WF0A 1BQCA 2O9OA 3AS3A 3WFZA 3CZGA 3ALGA 3SUWA 1UH3A 3KL3A 3PHAA 3W82A 3W38A 2J75A 4M29A 1XD0A 3ARWA 4IISA 3F5KA 2GJXB 4PRWA 3VTRA 1OIFA 4L4OA 4AIEA 1XV8A 1QNPA 1JZ7A 1H2JA 2CNCA 2DPEA 5DEZA 1W9PA 5E70A 2VOTA 3WMBA 1I75A 2W92A 4UOQA 2DQXA 3L2LA 4U3AA 5A2CA 4JCLA 4Z2HA 1EDTA 2VMFA 1DTUA 1EHNA 1MW3A 1QOXA 3A4XA 3QR3A 4EK7A 2WZEA 3WH7A 4E8CA 1HJUA 2CESA 2OSYA 4PEEA 4A4AA 1V6VA 3CHFA 4DWSD 1JI2A 2GK1A 2IXVA 2V3DA 3I3BA 4AISA 3WH9A 3WF2A 1N82A 1HJSA 2XVGA 3DHUA 3AXHA 1F4AA 5FIPA 2VVSA 3NIYA 1ZJBA 2A3BA 3OB8A 1TMQA 1HT6A 1PJ9A 5A2BA 2JF6A 4NZCA 1V3HA 3ARUA 3ALFA 2C0HA 3N04A 1XC6A 2WBGA 2AAAA 4GQQA 1PIFA 1EGZA 3VD4A 1EO7A 4UOJA 2EPNA 3U57A 2WVSA 2J7GA 4Z2JA 3VX1A 5E9AA 2D3LA 1D7FA 4PMNA 4W88A 4TTUA 3N18A 1EXPA 3FN9A 1NH6A 5CSYA 5LA2A 4ACYA 5BRPA 2VNCA 5FCZA 4L4PA 2G8ZA 2DSWA 2RGMA 4MNKA 2CHOA 3WBAA 1DHKA 2PWFA 2EQDA 3POHA 3VGDA 4E2OA 2DSKA 4GPNA 1V6WA 1UHVA 4PMUA 2OSXA 2ZUNA 3T09A 3ECQA 4ZENA 4JCMA 1UR1A 1NWRA 1E0VA 1XCWA 4HTYA 1W3KA 2E3ZA 2O9PA 2CHNA 4EANA 1GVYA 3RJYA 1HVQA 1G9HA 4GO9A 4F66A 1K9FA 1G94A 3WQ6A 1ECEA 2D3NA 2E8ZA 3GXIA 2Y4SA 4P7LA 4HU0A 4QDMA 4HZ6A 3OG2A 5JBEA 1CGWA 3VM5A 2GFTA 1AMYA 4X0VA 1UH4A 1EIBA 5HNNA 3VO0A 2DSUA 4J7RA 1HX0A 4F79A 3AIRA 4KWUA 4Z2IA 3PZVA 1V02E 3A4AA 1UQZA 1IZJA 2J77A 4PTMA 2PWGA 2V5DA 1BYBA 2BS9A 3BAYA 1W2VA 1HJWA 4B9YA 1JF5A 1JI1A 1HJXA 2VI0A 3WD0A 1QBBA 2EJ1A 2WVVA 4UZSA 1MXGA 1EHAA 1LL6A 3MS8A 1HJVA 3SUTA 4UQ9A 1GJWA 1HP5A 1R7AA 1WZMA 4W7WA 1HP4A 1VENA 3SUUA 1NWTA 3CUFA 4AY1A 3VOCA 1SFSA 4U5IA 2RGLA 3VIMA 1CXKA 1WB0A 1EQCA 3WQ5A 3N9KA 3POCA 3SCRA 2WHJA 5C71A 3T08A 1TZ7A 4H8HA 3TONA 3ZO9A 1O7AA 2DH3A 4XZWA 4DWSB 2PWHA 2J79A 2WHMA 1JAEA 2X05A 2ESCA 4TXEA 3IJ8A 3RM4A 4WJXA 1W9UA 5EB8A 5LA1A 3CUHA 3VIPA 4TX6A 4D6IA 1E6XM 5BROA 1CNVA 4MB1A 1UKQA 2D23A 2E9MA 3WEOA 4MNMA 2CKRA 1V0LA 1QI0A 1V3LA 4CGTA 2XM1A 2DSZA 1W9VA 4GZEA 2FH8A 1R87A 2XVPA 4W7UA 5BXRA 3FNDA 3WUFA 3M07A 4DWSA 4TVDA 1QNSA 3W4RA 2BY3A 2VR5A 3PZOA 4PMDA 3W24A 1GUVA 3QHMA 3W0KA 1K9DA 5CPQA 2YL5A 3WF1A 5A6BD 3OA5A 4WF7A 1C91A 1HVXA 5AY7A 3EMZA 1US2A 4NSBA 4R5EA 4ACZA 2XVKA 2WANA 5I77A 3VGHA 1JFXA 2Z1KA 4XZBA 4LPCA 3CZJA 5CGTA 3DECA 4GXPA 1KFWA 4DUXA 1UWSA 4FF5A 1CGYA 1UWTA 2WVVB 4F9JA 1JZ6A 5BCAA 2EEXA 2YL8A 1XYFA 4P8UA 1H0IA 5GQBA
chains in the Genus database with same CATH superfamily
2GQ3A 5ABTA 1PL9A 1YDYA 4IGSA 2Y2WA 2HEJA 1JR1A 1LTDA 1OF8A 3MHUA 3AJ7A 4HNUA 2O7QA 2GOKA 4D2JA 1T7LA 4XAGA 3QHOA 1ODUA 1TPH1 2PLJA 4LBUA 5A8MA 3XIMA 1R9ZA 3G8EA 2QF7A 4TTGA 1BYAA 2VD9A 3IS4A 3HPZA 4GG9A 4JTEA 3R8GA 4G1KA 3WKZA 1PS9A 4GIRA 1YE4A 1JD9A 3AU6A 1RJPA 3IIVA 4CQCA 3MWCA 2GK1B 2DV0A 3C56A 3HG4A 3O7UA 4W85A 2BFGA 5A6SA 1R3YA 2A0NA 2R1LA 2XFWA 3H22A 3AHVA 3MUIA 3GAYA 4GUIA 1DXFA 2QCDB 2X42A 4IXHA 2HROA 4H3DA 1E1CB 1V79A 2B0MA 5HWJA 1Z7AA 3M16A 4IP4A 3B8VA 3TTQA 1EYEA 2OX4A 1VC4A 1X6LA 3GTIA 2VZVA 3LDVA 4QISA 1CB7B 5CEWA 1WDWA 4WGXA 1J0YA 1L6YA 5G2HA 1A5LC 2D22A 3Q58A 2IMRA 1M53A 1OC7A 4Y2WA 1GCYA 3H4GA 5C7VA 2ZUMA 3R13A 3EPOA 5AKQA 2HRWA 3WQFA 1C7SA 4HNLA 2E67A 2CXGA 4JL1A 5CC3A 2NV2A 1YBQB 4M51A 1HO1A 1U1HA 3W2JA 3M7WA 4C7DA 4MFEA 1A53A 4KESA 5EMMA 3TCEA 5MKGA 2WWCA 3ZIZA 4Q3MA 4TVUA 3BH4A 1RK5A 2XIMA 3WLLA 2O56A 4GQGA 4LBSA 4L6HA 1LLOA 4DNMA 5I3DA 4S3KA 5CXPA 3DYMA 4A22A 2OO6A 3OODA 1KKRA 4PMOA 2YX0A 1E5NA 1K4GA 3M0MA 3RPTA 4YTQA 4UQEA 1AH3A 1E40A 3WL0A 2A4AA 1VIZA 2XH2A 4YVXA 1EX5A 3WLSA 1GVFA 1FWNA 1M3UA 2DT1A 5CQ1A 4PTNA 3CYJA 4QM1A 2A3CA 4Q22A 1QI3A 3AUJA 5FEPA 5AECA 3W29A 3VA8A 4IGHA 3V75A 2PWVA 1KD0A 4A2RA 4G56A 3VAVA 1MYRA 1EJRC 4M24A 5I2UA 4JTIA 2WHLA 3ZS4A 3PUEA 4UOZA 3WY1A 3KWXA 3BMXA 5EA9A 4DWSC 1W1IE 2PWDA 1E0TA 4TV5A 1A0EA 3FJ4A 1EIXA 3WLQA 5DQPA 2DZAA 2VJXA 3D5HA 4IICA 2VC5A 4WJEA 3YPIA 2WZHA 4I6VA 3ARVA 3G1HA 1YTKA 1EBHA 2VR4A 4FIRA 3LQLA 3W81A 3CO4A 4OFCA 2PWEA 5FF4A 1ZS2A 4H6KA 3EXSA 4HSHA 2FTYA 2PBGA 3GAKA 5LIKX 5CBJA 2ZX7A 4EPBC 4RDWA 5HNUA 1CECA 2BOGX 1M5WA 1OFEA 2G3IA 3KUMA 4GIAA 3H2AA 4D6DA 1X8FA 1EJSC 1VBUA 1E3ZA 1Y5WA 2DJXA 3M5ZA 1EA0A 1MW0A 1E4LA 1OB0A 4AU0A 4IMDA 3QV8A 4KKXA 1ZJHA 4S3EA 5I3GA 1Q8AA 1GTEA 3LHWA 4NZ5A 3G3DA 4AZCB 4D8ZA 1CB2A 3AYSA 3UPWA 2D2GA 2WQDA 3QPEA 1JDAA 6TIMA 3GNXA 2EO7A 3VNDA 3CL8A 4ECLA 3NCOA 1TRDA 3ZVHA 3FDGA 3W7OA 1MWOA 2DW7A 2TAAA 4FNSA 4V28A 1XGZA 3CZLA 4WJ8A 2V67A 4FXFA 3T4WA 1KM3A 1VD6A 3O0KA 2WMKA 4RCXA 2YDRA 4MWAA 1WDQA 4HYVA 4GFIA 4CCDA 3NEHA 4GLEA 5HDRA 1D9EA 2JIWA 1LQ2A 2YL6A 2VVNA 3CEPA 4G7EA 5ABHA 1ELSA 5LNVA 2J7HA 1WKEA 4C6BA 2ZXQA 4AX7A 2V82A 5A6TC 2XN1A 1E0XA 3WELA 4Y9OA 3TTSA 1NDYA 3TCSA 2YIHA 4E4FA 1G5AA 3BSMA 4XAPA 3TJXA 3URNA 2E6YA 3MHGA 3CMJA 4NF7A 2LLEA 4I5RA 3DFNA 3M0ZA 2OTDA 1FOBA 4J3SA 2GGIA 4O0KA 1JCXA 1B4KA 3CPGA 4HHHA 5A8PA 4KW2A 4AWEA 5T91A 3UERA 4FNQA 3PY2A 1XP3A 3VGFA 3VGGA 1ESWA 3E49A 4NZJA 1XLHA 4AZHA 3RR4A 4MUPA 3OW1A 1RP9A 2H8ZA 2OZ0A 3GHTA 3SRHA 1TPFA 2A7RA 3V4BA 5G1TA 2W0UA 3DGBA 3HJEA 4AD3A 3VZXA 5D2YA 1IEIA 4JBRA 4O1EA 1R3VA 1F5ZA 5J5DA 2TRSA 3LUTA 5KEZA 4MJ4A 3R6IA 3RFAA 4KT2A 2GJNA 1UKPA 4ES4A 1VLWA 2QJJA 3GRIA 2NVDA 3DYOA 1UWRA 2NUWA 1P0EA 3EOLA 1ZCOA 4CLMA 4PODA 3U0HA 4WKHA 5I23A 2GOUA 3LM7A 1K8ZA 1XISA 1UPPA 3SW6A 1PUDA 2C3ZA 4O16A 3NPVA 3ISIX 1UMYA 4K1GA 5JQ9A 3I7SA 3SCPA 4S38A 2WNWA 4U10A 3BOXA 5U7SA 3TC6A 5D32A 3TC7A 4KWVA 3V16A 3TH6A 1TYGA 4R33A 1RBOB 4NNBA 5HMSA 1AH4A 2J6VA 3BAIA 4CVUA 4A8RA 4PMYA 1PX4A 1ZL1A 2V63A 3VINA 1MMFA 1Q8JA 2JFEX 2TODA 4DBSA 1KC7A 1GQLA 4TMBA 3LCIA 3GXDA 1IEQA 1EJ7L 4ZO7A 4AWTA 3W7CA 4DUVA 4QSHA 1LWHA 3DUGA 1E6QM 3SEPA 2W62A 2R9RA 4ZOEA 1G7VA 2OEKA 3WNPA 3DFOA 3JRKA 1PDYA 5M17A 4O4WA 4X0NA 1VFOA 1H49A 5CG7A 1U5VA 3TTOA 3UG3A 4X63A 3W1RA 2VQUA 2PBOA 3P93A 2CBUA 2X1IA 1E71M 2OYLA 1GJPA 2GVLA 3VIKA 2UWFA 3LZ3A 1IXQA 5I09A 3WNNA 2BV9A 3FVDA 2XVNA 4UBPC 3ITCA 1K9TA 1QBAA 1XBVA 3EYPA 1IGSA 1E1FA 2WB5A 4LUTB 3R94A 3NL2A 4O8AA 3LU2A 3STCA 1RZMA 2GJRA 5CZSA 1W31A 3HZ3A 1W9BM 1O5KA 2E77A 4KBXA 2J6XA 5HR6A 4NZFA 5J8LA 3UG5A 1W17A 1LM1A 4DEFA 1ZBVA 1R3SA 3W6YA 3QRHA 1BYDA 1FH8A 3AROA 4A8LA 3A9IA 3W1XA 5FOOA 2V5JA 3MO4A 5CGQA 1TUXA 5D09A 1XICA 3CC1A 4QEEA 1JFHA 4HHLA 5M5DA 4QP0A 1DE5A 2XFFA 4C5YA 3QJAA 2G96A 1VJZA 1NDZA 4RE3A 2FHCA 4MKVA 1HL8A 3WZ0E 3MTWA 1DWFM 4G7FA 4CD8A 3TQVA 3F4CA 3FJNA 3KW3A 4ZQMA 2J9ZA 1GZ1A 4Z42C 3W25A 2BODX 3LCWA 1TX2A 1QPQA 1X97A 4D9PA 3NOYA 2INZA 4RKAA 1GW1A 3IGXA 1F61A 3HGSA 4UFLA 4PTWA 1CW2A 1Q6QA 4LCSA 3GO2A 2IPJA 1WX0A 4S3JA 4REQA 5FL0A 7TAAA 4JTGA 3SIMA 2VP8A 1EX1A 3MV01 3AMGA 3MV11 1EH9A 3WF3A 4NI3A 2WC3A 4GJJA 4H2HA 3SN4A 4UCFA 3S2NA 2PB1A 3GIYA 2XU2A 1EGVA 2RFGA 2FZ8A 3R25A 3C3UA 3OOQA 3AIVA 3BV4A 1EP1A 3CAWA 1A4MA 4MGGA 4POCA 3CBWA 1SR0A 4X60A 2VX5A 4GC3A 2WMGA 3NQCA 3LD5A 2FHFA 2PZ0A 3BJSA 4PB3A 2V30A 1CXHA 1LBMA 3DDMA 3G1YA 4CQBA 1FCUA 2FMNA 2PP0A 3LOTA 3S1XA 3Q45A 3L5AA 3MT1A 1KTNA 1QPRA 5I02A 1PZ3A 1I2QA 1RHCA 3W7DA 1LJYA 4HJFA 2VCAA 3MP5A 3GTFA 3SCTA 2I5IA 3NQ8A 4UNLA 3N17A 2GDQA 1YDVA 3GG7A 3A4WA 4UTKA 4ENLA 1LBFA 5ABFB 1G7UA 3M41A 2VEIA 1JIBA 3WQEA 3SRDA 3T0AA 3ARTA 4GVHA 4K38A 4M82A 3W84A 2XG9A 2NQZA 3MA8A 1CGVA 3UY8A 1JUEA 1SFTA 3ZR5A 3IIPA 1GVRA 3U3HA 4LC6A 3GR8A 3MDUA 4JN7A 1UUMA 3AXXA 4H83A 2DEPA 4N9EA 1CTNA 3VMNA 6ALDA 1OD0A 2ZZ6A 1BSIA 2DORA 4UXDA 3LXCA 2DZPA 2PDJA 5HMFA 1SO6A 1D3CA 1BEUA 2ZICA 3N2TA 5DT7A 5D33A 1IWBA 2E1DA 2D0FA 4QX4A 2F38A 1LBLA 3QGVA 1O12A 4FNUA 4L4LA 1YIXA 1VYSX 2HQAA 5CZKA 2DIJA 3A3HA 4XWUA 1WZKA 4EPEC 4NRRA 4LAUA 2B31A 4DM1A 3BLKA 2P76A 1QW7A 2UZ9A 4K2SA 4AY7A 2FZMA 2CWNA 4ZQOA 1S5NA 4Y9PA 3R89A 4JN6A 1QPKA 2DFAA 2VEGA 1R6WA 4O19A 3TOPA 4UTUA 1UMLA 1FHVA 4MZ8A 2P10A 4GX9A 3W7MA 4HPHA 5XIAA 1GQNA 4UFHA 3EXRA 2WJFA 4JTJA 3OVRA 4I9AA 2ZTJA 4M56A 1ADSA 4OQVA 1Q6FA 2XIIA 3S47A 3AICA 4QG9A 2Z1SA 3M44A 1IGWA 2VEFA 3C8NA 1UD5A 5C54A 2Q02A 4Q8MA 3VVGA 5AB3A 2Y5EA 2PAJA 3E0WA 3KRSA 4A3YA 5C2XA 1V6UA 3T42A 2CHRA 2ZUUA 3RPDA 1S2WA 1TMHA 3KBJA 4HKPA 4NNCA 4BF7A 3BGGA 3W37A 2Y62A 5EPDA 2O0TA 1KCZA 4IPNB 4EOUA 1UQYA 3TLLA 2INFA 5AC4A 5HWNA 3WFLA 2PTXA 5BRQA 5FACA 2XZ7A 1SFLA 4WR3A 2HVNA 3C2EA 3L67A 1E4MM 1E5JA 3E1F1 3GQYA 3GXFA 3WLTA 1E15A 5FKYA 3I3EA 4JFTA 1C90A 5HPCA 2JBMA 1DPMA 1GVEA 2J7BA 3OLGA 3DI0A 4ZBCA 1EOKA 3VKDA 1VHCA 4XIMA 1O1ZA 5H8UA 3W75A 1AW2A 1UIPA 1ZBWA 3ARQA 3PBMA 2NQ9A 3WF4A 2GJPA 1W56A 2WMIB 5AZ0A 2DJLA 4CEUC 2HCVA 3BW3A 2VFIA 4W86A 1IF2A 2W4XA 3WK3A 3SJNA 4PCNA 3K4AA 3ZT6A 4C6CA 3LM3A 1XYCA 4W84A 4N4PA 1E4NA 1GYMA 1PCKA 1JNDA 1T99A 5TIMA 4B15A 1TG7A 5K9DA 2AQWA 2OFJA 1BRLA 4Q4QA 1WNOA 3RXZA 2DZXA 5D30A 5AVHA 2W6RA 1TPC1 1Q3NA 2Z29A 5LGXA 4U3CA 1VJIA 4EWJA 1PZ1A 2C1GA 4C1NB 5G4HC 3FA3A 3R0DA 1VCGA 4GNVA 1H1ZA 4Z17A 1OHLA 4JIPA 5KTLA 4MB3A 1UCWA 3NR0A 3ZT5A 1NOFA 1DWHM 1XKJA 4JN8A 1H5VA 1E9LA 3MSDA 5I6SA 1FDJA 3WYZA 3QYQA 2YSWA 3ZXWA 4B2DD 2GGJA 3UA3A 2ODOA 2VZUA 2AL2B 4DJDA 3H2CA 3NQ2A 2C8NA 1YQ2A 3UR7A 3BURA 4DPQA 4E8GA 5T26A 4ZOBA 4PUMA 3KRBA 2YDAA 4JYDA 2XJ7A 2Z1XA 3K4DA 3QOMA 3TW6A 4ZFMA 5JU6A 3SI9A 5I78A 3PZQA 3U2OA 2P3EA 4S23A 4NZ1A 1IYXA 4D6CA 1ITUA 3K1GA 2J27A 2PC8A 5C5YA 2WC4A 3ZSSA 3NZ1A 1DJWA 4MB4A 1FWDC 4WDXA 3KLKA 1FWIC 1A5KC 3BQ5A 4G7EB 4EPKA 5M03A 4WSJA 5JVLA 4J9JA 5BMWA 3BPWA 2PDUA 3MQTA 1H63A 1KM2A 2C15A 1CYGA 4EF8A 1J11A 3FJ6A 1XFCA 4AUBA 3WH6A 4DO7A 3AWNA 1XRSA 2AOSA 3GIPA 4MADA 4JIIX 2E5BA 1ITXA 1W1VA 2O4MA 3MI6A 1QHOA 3B0VC 5CPOA 4WOZA 1MI3A 4DO6A 4BI6A 1KXHA 5BYWA 1RCXB 5DF0A 1KA9F 1CGXA 1WCGA 3H8AA 3A13A 3F4NA 4NX5A 4K1WA 5J04A 3ZR4A 4PUEA 1JNEA 1OC6A 2PUZA 3W1LA 2H6RA 1A5CA 4C1NA 4Y6GA 1IR2A 8XIMA 2FFIA 1M01A 2PF8A 1IQ8A 6XIAA 1J0JA 4LUSA 1UP2A 5BXSA 3DFSA 3BMWA 2EPOA 1KCXA 5H8MA 1H7XA 9RUBA 1L0PA 1Q7QA 1XPGA 3K5XA 3MUY1 4EIVA 4ZTXA 3WNKA 1FX6A 1LF1A 2J7EA 3HMCA 1RY0A 4IIDA 1ZGDA 3OZMA 2X2YA 3G1AA 2OVLA 2VWTA 1YPXA 5FF3A 4QGCA 2WCAA 3AZRA 1XYMA 3RPMA 2KX9A 1S38A 3ONBA 1LDCA 1DIOA 3PVFA 3TR2A 5LXEA 2EG7A 3MSRA 2G4FA 1UWUA 1VGAA 3CH9A 4LAMA 4C6MA 2P88A 2RUSA 3N3MA 3I6TA 3MHFA 3M43A 3OYXA 5EMUA 5I7GA 1KBIA 4H8UA 5G1MA 3N1AA 4AC1X 2NSXA 1IT0A 4TQTA 4CKQA 1OGGA 3K8MA 5DCBA 3UPBA 1GZGA 3S2MA 2HS6A 4IMCA 1TTQA 1R30A 1A5BA 2XFRA 1XLBA 4PTXA 2TPSA 5EYWA 1WPCA 4UTFA 1W6TA 2VL4A 4F2TA 4YN5A 4LU0A 4JFSA 1PB0A 1C92A 3SGUA 2PP3A 1HQTA 3WLJA 4XBSA 1XSKA 3NG3A 2VUYA 1OYAA 1GOWA 4HA1A 1XLGA 2D0GA 5LXXA 2A79A 1TPDA 3LBOA 1S3HA 3MP4A 1XH2A 1CBGA 4E4PA 3S9YA 3THQA 1Q63A 2W9MA 1B90A 1NARA 1DP0A 4Q7IA 1HKIA 1U2YA 3BTNA 4MZ1A 4KWOA 4ZB2A 2ISFA 4XBJA 3A24A 2QUNA 4BA0A 1LLWA 1SJDA 5AN7A 2YW3A 2QGHA 3LMZA 4HHPA 2Y7DA 1AJ0A 4O52A 4OBSA 4LV4A 3WENA 3TQPA 4H7CA 3ZJ7A 2CCRA 3T4CA 3T55A 2PODA 2NQLA 2WK2A 3C5QA 3IAPA 3PAJA 3SY8A 4U2YA 3DHFA 4TX8A 3E0VA 3KVKA 4RJEA 1OYBA 3TTEA 2YL9A 3P5ZA 1HIZA 4R34A 4D6GA 2VC6A 1DQXA 3BLEA 3USBA 1OINA 3MMDA 3GVQA 3VNJA 1OCBA 3BZGA 3UP8A 1J2WA 1TRIA 4XZMX 3V36A 3B3DA 4GH1A 4UFIA 1H11A 1JL8A 4MY8A 3DX5A 1F74A 1VP5A 1XRVA 5EGRA 4IX2A 3E5PA 4C6PA 1FKXA 4AZCA 2A85A 3KZSA 4CEXC 2PCEA 1UR0A 3VKBA 1WDDA 2RJGA 2NLYA 4NASA 3K30A 5FAJA 1XRFA 3BSHA 3ES7A 3ARZA 1Q65A 4XG1A 1DJZA 1K6WA 1CZ1A 3KWSA 3IJQA 2ALRA 1E0WA 3D0CA 3W53A 1XH1A 3GWQA 1UJQA 4IIBA 4U4MA 3UT0A 1MW1A 1UR4A 3OTRA 1BFNA 1JPDX 1MRQA 3R7MA 5KINA 1X38A 1E1EA 2Q8ZA 4C65A 3G22A 2VDHA 1S2VA 4DN1A 3GH7A 4LF1A 1NWSA 1WP6A 4HU3A 1FQ0A 1FP8A 2XINA 3QY8A 4GYFA 5DY3A 5AHFA 1H09A 4DPPA 4LB3A 1F8MA 6CGTA 3HM7A 1BF2A 3MW7A 2BX7A 1ZP3A 4MHBA 4M6PA 1VFSA 4AEEA 1AJ2A 5H2ZA 1TPWA 3UESA 2XIBA 3WEMA 1JGMA 1WYIA 1E56A 2C19A 3LY0A 3B9EA 4J3VA 4GD0A 4FPSA 1FRBA 3WFZA 3ALGA 3PHAA 4M5PA 4M29A 1ZAJA 2GZXA 3LCXA 2GJXB 4YJ5A 2R1NA 1JPHA 5HR7A 4HPJA 1KM0A 3T8QA 4WSHA 4L61A 3PNZA 3UR2A 3PG8A 4PH6A 3LSCA 3LXAA 4UC5A 1SVDA 2GPTA 4UOQA 3WLMA 4JXCA 2DUAA 4C6JA 1ME9A 1SUXA 1IEWA 1OFDA 3H24A 1XUUA 3AYTA 3GUWA 3UWWA 2XIQA 3ZZ1A 2QIWA 3QR3A 4EK7A 2VENA 2WJDA 2CESA 4O18A 5AYXA 4PEEA 4R9XA 3CHFA 1ZFJA 3SM0A 3CAQA 3D46A 4DWSD 4C6FA 1AL7A 1PKMA 1GTHA 4YL2A 1VYPX 3VI2A 4UTHA 4DVOA 1H61A 1L6GA 2WPBA 3OB8A 4DAFA 3JZEA 4WY0A 1HT6A 1PJ9A 2QCMA 1WQ5A 4NZCA 4QEHA 4TMCA 2VYOA 1V3HA 3FSUA 3N04A 2AAAA 4GQQA 1AZ1A 1EGZA 2PZNA 2QT3A 3W01A 1EO7A 5HK4A 3WBYA 4UOJA 2ZA2A 3BICA 4ROPA 1VHNA 3A12A 1I2RA 4PMNA 4W88A 4AIBA 2YB1A 4EXQA 3CT7A 4C91A 3DGRA 3PP7A 5HJXA 1XLEA 2VNCA 5FCZA 2G8ZA 2RKXA 2DP3A 4E0CA 3R1ZA 1TIWA 3TYCA 4B5TA 1DHKA 4MF4A 3V0UA 4B5XA 2ZYFA 4E2OA 2G50A 4GPNA 4QR6A 2VC7A 2PD9A 4ZENA 5G4EA 3N2XA 4JCMA 1M41A 3QW3A 1N7KA 4H6EA 1W3KA 2O9PA 2CHNA 3T1GA 4EANA 4GIYA 2YYTA 5I03A 3MB9A 3FCPA 2E8ZA 2NUXA 5FEWA 3TSDA 1CGWA 2GFTA 2PDLA 2DSUA 4J7RA 1HX0A 4F79A 2X2GA 4AC7C 3PBVA 3PZVA 4MM1A 4PTMA 1AZ2A 1FWWA 3UJEA 2ZZ3A 5FF2A 2PWGA 2V5DA 1BYBA 4B9YA 3OBEA 1JF5A 4IL0A 1JI1A 1HJXA 3SADA 4ML9A 4BWLA 1E51A 1E1CA 4FOKA 1MXGA 3AWOA 1LL6A 3L65A 3SUTA 2D2HA 4UQ9A 3V1HA 5LNUA 2FPYA 3E0IA 1EZWA 5F2LA 1XG4A 5LHEA 4FOUA 1LRNA 2RDUA 3SSJA 4FR1A 4QG6A 3GD6A 2B7PA 1EQCA 3N9KA 3SCRA 2WHJA 4GA8A 3TONA 2Q01A 3EEZA 3ZO9A 4RNIA 1NF7A 4Q4KA 2DH3A 4PFHA 3HPAA 2Z1WA 5CBBA 2OEMA 2J79A 1TJ0A 4TXEA 3RM4A 4GISA 5AC6A 5LA1A 2XH7A 2FTPA 2VKZG 4M19A 4D6IA 3B04A 1CNVA 2BWGA 4CQAA 2CKRA 1V0LA 1EF3A 4RE0A 2VEPA 4HZMA 1XDJA 4B2DA 3MJYA 1W9VA 3VNKA 1DIDA 2XVPA 2GVGA 2YCLA 2Y0FA 5CZ0A 2Y7EA 4DWSA 4TVDA 1R9YA 4GIEA 4MLRA 2BY3A 4DXKA 3QHMA 1LZOA 2D2JA 5CPQA 1Q2RA 3FYYA 1DBTA 5A6BD 2PDFA 5AY7A 4NSBA 2AL1A 2OO0A 3PPHA 3TAOA 1JFXA 4DO4A 2Z0IA 5CGTA 2FVMA 3CZJA 3DECA 3LK6A 5C9RA 1UWSA 3TJLA 4L5ZA 4F9JA 3V5OA 2B4GA 3VNLA 1XYFA 4G8TA 5GQBA 4PMVA 3LERA 4K3ZA 4DXVA 3H2FA 3HURA 1I0DA 3BANA 4FX7A 2ZE0A 3EWWA 3NYZA 4ZCWA 1GKQA 4FHAA 4PSRA 1JZ8A 1H50A 4NAEB 4UNIA 3ATYA 5A8OA 2NVCA 3OIXA 3S0CA 5A1AA 1LRTA 4R7WA 3LCGA 4R85A 1GOQA 5IFPA 4HK7A 3UF9A 3TDFA 1UB3A 4UQDA 5HUOA 2QZRA 3EX2A 4LEFA 4A3RA 4AMCA 5BOOA 1HTIA 4OOUA 4GY7A 3C86A 2VZSA 2Y6ZA 1KFBA 3G3MA 3N4FA 1HKWA 3PK7A 4DI9A 3AHZA 2Z6JA 1J2BA 3W1UA 5KSWA 3V5CA 2H3DA 3GVWA 4JY9A 1YYAA 1M04A 4Q8QA 1C8YA 3NQVA 4HOWA 3PZGA 2PDWA 4E4UA 3COTA 2REQB 1PYFA 3VNZA 1FP9A 2VGIA 1V3IA 4LT9A 1SMAA 3MKVA 1Q66A 3M5XA 1C8VA 5I06A 1V6XA 3RG6A 3KE0A 4HNTA 3REQB 2CZ5A 2J25A 1FBAA 2BGQA 2VZTA 4GUHA 1VFLA 1R2SA 4K8HA 1JD7A 4LYRA 3WUGA 2BXVA 3TA9A 2QW5A 1KTBA 3WK0A 1V0KA 1W1B1 3ANYA 3UEQA 3L4WA 4ROQA 2XYLA 3CAKA 3B8IA 1E9IA 3QSRA 1KRAC 1UWIA 2WKGA 3L0GA 4X3ZA 1XR2A 3AMKA 5HNTA 3AIEA 2QS8A 3EZ4A 1VFMA 1RD6A 4NAFB 4Q32A 1N8FA 1Z32X 3W1NA 3FA5A 1QWKA 3UGRA 3W07A 2GJLA 1V02A 4HQVA 6REQA 4FK9A 1HL9A 3BARA 4OUEA 3QOKA 4S3CA 1R2TA 1US3A 2PGEA 4HSOA 4KRUA 1VFUA 1OGSA 2DVUA 4QAWA 4GXMA 3HBLA 1S46A 4A21A 3ARRA 3NTYA 2YA2A 5DMNA 5A6KA 2XWDA 3EXTA 4H41A 5E0FA 3IWPA 1Y65A 2FKPA 2BHUA 1ONEA 1M7PA 2DT2A 3BG5A 4CNOA 3CWHA 3SR7A 1TWDA 3C0JA 3EB4A 4PYSA 1UKSA 1FDYA 4CCZA 1MUMA 3R0UA 1YW1A 1QOQA 1I4NA 4NQ1A 2GQAA 2EBNA 2WWDA 1H4PA 2Y88A 3KM8A 5AC5A 4JOMA 4ML4A 4KWWA 2DZVA 3THAA 3T0CA 1TMLA 4FF7A 4GQRA 3NZQA 1X7FA 1NEYA 3UQNA 2NT0A 1KO0A 3AALA 2BVTA 3CIXA 4AW7A 2FYMA 4UIOA 1XYZA 4A2SA 4B5NA 3SUVA 1F76A 4D6EA 2F6KA 2WSRA 2WOQA 5M2FX 3NQMA 4AFYA 3C52A 5D9OA 3LGEA 1KGXA 2G3MA 2REQA 4AD0A 1GQKA 1K7XA 5C9XA 1H1YA 3PPCA 1LWJA 4XSMA 2VRQA 2CLPA 3B0PA 1UWAA 4W9TA 4YMZA 1Q85A 2PDYA 3F2DA 1BLIA 1OFRA 1BD0A 2XSAA 1I6NA 4RXFA 3W1PA 3C61A 1W8SA 5HJYA 1FHLA 3CHEA 3GXMA 1F9CA 3WUEA 1AL8A 2WW5A 2AL2A 4DAIA 5IBXA 1RPXA 3B8UA 1I0BA 1FWTA 2F2HA 2ASHA 1PZ2A 2FPTA 3RX3A 3KOZA 3FLUA 1S2CA 1MNZA 3GR4A 5DXYA 1P6CA 2PE4A 2MUCA 5BOFA 1QI4A 4IPLA 5JUVA 3OZOA 3CPRA 1Z6KA 5D9PA 3VFCA 2DZBA 5HXMA 2A6NA 2ABAA 4JTAA 2NX1A 3GVGA 4LSBA 4FLRA 3M0JA 4CNTA 2ZOXA 1JPKA 1U1UA 3NDYA 4MJ2A 1K03A 5CBIA 1V3MA 5F4SA 1MEIA 1NOUA 2QDGA 4O10A 1J0KA 4JEJA 1X6UA 4ZFCA 2OR2A 5DRIA 3VC5A 3IGSA 3KOFA 2HMCA 1ADDA 2GSEA 1RK6A 5DFAA 3HJZA 4IHCA 4ZZ9A 5CJMA 3PM6A 3P84A 4XVDA 1M1BA 1AD1A 1YMYA 2WSPA 3VMPA 2Q71A 2R94A 4GMEA 4Z2KA 1ODZA 5G4WA 1KBKA 3H7UA 4YPJA 1J0HA 1WDRA 3M46A 2Z7KA 4AD4A 3RCNA 2ACQA 4QRNA 4BI7A 2EKCA 5K7JA 2OQLA 3W85A 3LPPA 1E43A 3N9SA 4YXGA 2WSKA 1XIJA 3RMEA 2YZ5A 4IZGA 2NX3A 5D9NA 5D2VA 4AD1A 2OQYA 3EDJA 1OG0A 2EXOA 3I68A 3ICJA 2ISWA 1JDCA 3THDA 4HA4A 3KBWA 1TJ2A 4ZOCA 2XGBA 1U22A 1O5RA 1JCNA 1HGYA 1T40A 1JYWA 2OZ8A 3A9BA 5AC8A 2OKTA 1XLAA 2VR2A 3LHUA 3MPGA 5I79A 1UR9A 1W5OA 2HNHA 1PSCA 1VRDA 1D8CA 1DWGM 3Q65A 1ZRQA 2YBVA 4OUIA 1P0NA 4JIHA 4S2BA 5HA7A 3QYSA 4GZIA 5I3FA 1I2PA 1OM0A 2V0TA 4JX6A 2PGWA 3BGAA 4EWND 4PCFA 1ZU8A 4Q4MA 2VCCA 4IPJA 1U1JA 3EAUA 4ATLA 2J7CA 4AHOA 1GWJA 3ZSTA 1FWBC 1YKWA 4JHOA 3U8GA 4C1LA 1QR7A 1AA1B 1WBHA 4CN6A 3QY6A 3ONCA 2WV8A 4OOZA 4BS0A 3AS2A 4XB3A 3SCWA 3PN8A 1E72M 1GVSA 4OZOA 2V6AA 2X09A 3EKZA 3DFYA 3N3TA 5F1VA 2H9AB 4FXSA 5SWUA 4PTDA 5ABEA 3PPGA 4DIAA 4OECA 4X22A 2E7FA 1B31A 3RYSA 4F0HA 2NXIA 3R11A 2Z25A 4G1NA 3RN6A 3WLHA 3JUGA 3NURA 5HOSA 1Q7ZA 4HB7A 8TIMA 3QV7A 3WDJA 3A47A 2A3EA 3PBGA 3CQJA 1UOKA 5FJPA 3TC3A 3VM7A 3V0SA 3GHRA 4L9ZA 3TVAA 1RQEA 1NTHA 1G4TA 1Y7VA 1YNQA 1XLDA 2BHYA 3GY1A 5KZDA 3NXFA 1G01A 1FY6A 3L12A 5I0DA 3C0QA 2DQWA 3GLCA 2V5CA 3LGGA 5DRCA 3UWUA 4Q7NA 3C2VA 4HK6A 4PUKA 4B91A 2E68A 1OY0A 5TF0A 4LVBA 1A80A 4NYUA 3MZ2A 3ZLFA 2XUCA 1DORA 3WJZA 5K4ZA 1TTPA 1NF0A 4B4HA 3KBMA 2RDTA 3FY1A 3SN0A 3GKAA 1JULA 1LL7A 1WXZA 2VM8A 3AIUA 2OB3A 3S5OA 3O63A 4XUYA 3C2RA 2D20A 1SZRA 4J3ZA 4RV8A 5GJNA 3NVDA 3H55A 3VOIA 1RCOB 2ZXAA 3ATZA 3WMLA 3CM4A 3SCVA 2J74A 2WC7A 4JL2A 2ACUA 3TKFA 2YCJA 4E2DA 1H60A 1ISYA 1ME7A 3V5FA 4CCCA 2E9BA 3RJXA 4OBTA 1P0KA 4URIA 1WZAA 4S2CA 2VT0A 4L65A 3O05A 1TV5A 1TWSA 1LOLA 4RK8A 3NGJA 4DWDA 3W1MA 4JDYA 2ICSA 3HQNA 1LRQA 1QK0A 4YTRA 3ZWSA 3ES8A 1M6JA 3SBFA 5E5CA 5I07A 3LV6A 4F3HA 4JAWA 2R14A 4ZXLA 1Z48A 1F4HA 5D8WA 1K6AA 4HZ7A 4XO6A 1K3UA 4EE9A 2BXYA 3O3RA 2HPMA 1NWUA 4DX3A 2G97A 4IFOA 4ADSA 3W02A 2X1RA 3OVQA 1MEHA 1O4UA 5CJ5A 1RVGA 1OIMA 5A69A 2WLYA 1OQFA 1JQVA 1CXEA 4H6RA 3E0FA 4W8BA 4R27A 2H8XA 3OGVA 5F4XA 1GONA 4D6FA 3UWYA 1M68A 4LS0A 3MUCA 3DBPA 4PULA 2WNQA 3DFPA 3TTYA 6ENLA 1EWEA 2IPFA 1EUNA 2C71A 4YU1A 2I17A 6A3HA 3FIGA 1PKYA 3FAXA 2Q8XA 5ECUA 3VKKA 3FK4A 3ARPA 4QLJA 1FWSA 4MDOA 3REQA 4L1WA 1LCOA 3S1WA 2BSLA 4BQ5A 1BGAA 1WAWA 1HZYA 2P0IA 2X7WA 1W1A1 5C6MA 1MQPA 2ZFAA 3KDOA 3NSNA 4YWSA 3DENA 4UTTC 3CMFA 1OFPA 4IUOA 1C8QA 1HKKA 3GBEA 5I3HA 5JIWA 4XSLA 3C2OA 4KGJA 3NO3A 1X8CA 1AG1O 1RALA 5DBTA 3DC0A 2QCEA 1E3XA 1XXXA 4X9SA 5L9FA 1JXJA 5CAKA 5CPSA 1IT8A 4L9YA 1EL3A 2FFCA 3K4WA 4LB4A 3AMCA 3R8RA 2XWEA 4RE4A 4F0LA 1GOKA 3KOXA 5HNRA 3HPSA 4ICNA 3F5JA 3LBMA 4F8XA 3UWVA 4LUIA 3WSUA 3QFEA 1TKKA 1KQYA 4RPPA 3P61A 5E09A 1MSSA 4AYGA 4HN4A 4PUUA 2JGYA 3NL3A 4P7NA 3OGRA 4LY4A 4LTSA 1GOOA 1ML1A 4YVPA 3L4UA 4XX6A 3A5FA 3G6MA 3AYVA 1PTDA 3T81A 4BR1A 3P8IA 1MUWA 1OF6A 1WBJA 5IHSA 3KBNA 3FHQA 4ERIA 1Q6EA 2UY3A 2PMQA 3NQGA 4PMQA 4MZYA 3RCMA 3RLGA 3A4JA 4AF0A 4GH3A 1NM9A 2QJMA 2EPLX 5AHIA 2OPJA 2FJUB 1L6SA 1YADA 3AHTA 2OZ3A 3VABA 4AQLA 4INFA 4QG8A 3IVSA 2QDEA 4UNKA 4PBGA 2VTFA 4NIRA 2VEKA 1L2UA 1WUFA 4J1OA 3II1A 3WG6A 1JAKA 1E6NA 3AIWA 1XC4A 4Y9NA 1H7PA 4Z0SA 3VDBA 2XZ9A 3UJRA 4KFNA 3PZTA 4XO7A 3BLLA 2WVUA 4OU1A 1SSDA 1LOQA 5LSMA 4CCEA 1XLKA 2Y8KA 4NJIA 2CPUA 4AXNA 1PPIA 3CQ0A 3HGRA 3TIMA 4C1KA 3T6CA 1UP0A 1TV8A 1ITQA 5CPNA 5I3IA 1OT2A 2QAPA 3N11A 5D2XA 5E93A 2QKFA 4TUFA 3F4DA 1VBRA 4L6OA 3ELFA 4I7WA 1MRAA 3MUXA 1GORA 1Y5XA 2PC4A 3LMYA 4H9YA 2BZNA 1OYCA 1Q13A 1WV2A 3M9YA 2R91A 3BQ6A 4MY1A 3BSGA 3MMTA 1NSJA 4D8LA 1DWAM 4WOQA 3VK5A 3AXMA 3UZJA 4BQ3A 4B9ZA 2QMKA 3EKGA 4TU1A 2RJHA 3UW6A 2G95A 3DG6A 3SUSA 2ATSA 2QCDA 3Q94A 1QI5A 3AMLA 3HOJA 4I6KA 2VDGA 3SY1A 1W1PA 3EPMA 3GTNA 1EJXC 2VWSA 4WDTA 1ZSXA 3EMQA 1B3VA 3LHVA 4HU4A 3NSXA 4JTHA 2YBUA 2PFHA 1C93A 3H70A 1BG9A 2YFOA 1F6PA 2ZRXA 5BXPA 1MXDA 4GC4A 4UR7A 2HVOA 3STEA 3IEBA 5EFFA 1EJTC 3GS6A 3WNLA 5D2WA 4MNLA 4QJ5B 3T0DA 2O4QA 2J62A 3W3OA 3K8LA 4F0RA 2ISSA 2G41A 1W5NA 3DC8A 3G1DA 1EP2A 3F2CA 3WD2A 2J47A 1V03A 5CC7A 3K1DA 3HTWA 3CL7A 1R9XA 2OYMA 4M6QA 3WLIA 3CLWA 4AD2A 4JTLA 4F0MA 4MSSA 5H91A 2CLEA 3MYPA 3NQEA 3AFBA 3AMDA 4CN4A 4PMXA 2XFYA 3PBUA 2MANA 2PDPA 3KL0A 1H5YA 5D2TA 4MMWA 2FDMA 1FWFC 1CENA 2VFGA 2PSNA 3QQ0A 1GEQA 1IHIA 4GQ0A 4OVXA 1WUEA 1JF6A 4Z0JA 2V81A 5FSDC 4NI8A 4OHQA 5JMUA 2Y24A 3VGEA 4I5UA 4UTWC 4HCLA 4IIFA 3P7YA 5FL1A 3H4WA 5E1QA 2J78A 4JICA 3NJ3A 3GFYA 1XSJA 3GSMA 1OCJA 3EDKA 1GGOA 4ORIA 3I7RA 1P6WA 1BHGA 1PIIA 5ABGA 1B3XA 4ADUA 1PE1A 3VOHA 4HOXA 5K2ZA 1DJHA 4WGHA 4U31A 1X1ZA 1W9DM 1S1RA 4WEVX 3TW9A 3CL6A 1B3WA 3OQEA 1VCVA 3MBFA 3DHDA 4IWWA 4M81A 3WH8A 1S5VA 1XBYA 5F1UA 4PUNA 2IKHA 2Q6ZA 1WZLA 2WMJA 4X9YA 4GI6A 3VKJA 4ZODA 1XYLA 1PIGA 3NDZA 4US6A 3VILA 4WRHA 1EKOA 4O13A 3WL1A 4NJHA 1KM5A 4UR9A 1UPMB 1C9DA 4QQ3A 1HN1A 4I3GA 1QHZA 1GHSA 2F2KA 3NL5A 4B4FA 1B2YA 1ICSA 1ZB5A 1Q4WA 3AXKA 9CGTA 2A3AA 4W8AA 1OFOA 5I00A 2DW6A 2YOCA 1TPEA 4C6DA 3RRXA 3Q37A 1YX1A 2OT1A 4HMEA 5G2WA 1F8IA 4NL1A 1MUCA 4GXWA 2HE8A 5AHLA 4UB9A 4GUGA 5EKYA 2PEVA 3N14A 4JD4A 3BG3A 4FEZA 1JZ5A 5HPOA 4BZYA 2CBJA 3L4VA 5FEXA 2VC9A 1V0NA 1O68A 2GGHA 2ZUWA 3PWAA 4JQ4A 3ZVIA 3RLUA 1YTEA 2WKLA 4MDPA 1P0DA 4JKKA 3ZT7A 2ZX8A 2HXUA 3WDPP 2PDIA 3OU8A 3SIZA 3CTLA 2JK2A 3M5VA 3TQ0A 3AQUA 3ID7A 1IIGA 3CB3A 2CW6A 4DZAA 2BOEX 3ARXA 2E1WA 3TU9A 4JZ5A 3A22A 3QFWA 3HQOA 3WMCA 5IHRA 3MMWA 2PF0A 1SMDA 5FSEC 1VPYA 4AWSA 2GDUA 2POTA 4JX5A 1I2OA 1Z3NA 4JTSA 2FMOA 4HIBA 1WO2A 2Z7GA 5ENLA 2BVDA 2ATMA 2Y85A 4XZIA 1XCXA 4JHMA 3I4EA 5FF0A 5HBFA 3TQKA 4J4KA 3ABXA 2A7NA 1S39A 1U5JA 1XDMA 2E0PA 2YA1A 4D72A 2GVEA 1MVYA 4LAOA 4JGDA 4NJKA 3OGSA 2BY2A 3GG8A 4EACA 1X1OA 4IGNA 4YYCA 2I16A 2C79A 4XZLX 1J0IA 2X41A 3W7HA 3QBUA 1WKFA 1Q6OA 4A35A 3W88A 3M6DA 4JHZA 3TUUA 2IPGA 3FEMA 3LTSA 3W22A 4RE2A 1XHGA 1A47A 4GKLA 2C16A 3ABSA 3W27A 3B9OA 3ZVHB 3THUA 4JIRA 1MEWA 4QE4A 3EDDA 4DUOA 3IACA 1KWGA 1QAPA 1KR1A 2Z2BA 1VBJA 2XDFA 1GQJA 1V08A 2PTWA 3PBWA 2ZX6A 5DO8A 2ZXDA 2FQIA 1ITCA 4JTFA 4Z1CA 1G1YA 4QS6A 3ZR6A 1VEMA 3THCA 2POZA 3PZIA 4O50A 4H7ZA 4R3UA 2ZUVA 4PBFA 2QIIA 3TEVA 3F4WA 4QHRA 3WQDA 4ASTA 3KDNA 3O0FA 2ZCGA 1FA2A 1W3LA 3QMSA 2CLMA 4IP7A 2WMHA 1S2UA 2UY4A 2QNEA 3U2EA 3LNPA 4ICCX 1U33A 4WSKA 3TAKA 5HQEA 5C7HA 1KM1A 1R3WA 3LBCA 4GY0A 1DV7A 2OGYA 4B5VA 4HBKA 1X1NA 1H62A 2DZSA 3VDAA 3WQ8A 1JXKA 3O6AA 4AMAA 5A6AA 2OLHA 3EWYA 4N2YA 4MLJA 2FB3A 3P0XA 4PFMA 1QFEA 3V7PA 3QZEA 4DO5A 3W7PA 1GYNA 3AS3A 2C18A 1UH3A 4V33A 4GNJA 3W82A 3MI3A 1XJBA 4Q8UA 1XD0A 3VNMA 3LV5A 1O5QA 4JS3A 2V8ZA 1X7IA 2G5WA 4QJ4B 1OIFA 1TWIA 2GQ9A 4L4OA 1XV8A 1F07A 1QNPA 2CNCA 4GJ1A 1KFKA 4AG0A 2FGBA 2AMXA 1I75A 5IRPA 2L5HA 1OFQA 3QV9A 1AQFA 3TOYA 4BJHA 4H9XA 4DHGA 5G5IA 4JCLA 4C6KA 4Z2HA 1EDTA 4ERGA 3LXBA 1MW3A 1L8PA 4RNHA 1RQBA 1QOXA 3A4XA 4M7SA 3H54A 4E8CA 2Y8UA 1ONWA 4IIGA 1QU4A 2Z00A 1OJXA 5C9ZA 3O8AA 3ANUA 2GK1A 2IXVA 1REQA 2V3DA 3WH9A 2QJIA 3PC0A 3WF2A 5BOEA 1EJVC 2IPWA 3OVGA 3DHUA 4IQLA 4BFAA 4NJJA 3N34A 3GYEA 4AX6A 3NA8A 1TSIA 4HPNA 2HV5A 4BKNA 2JF6A 1TQXA 3ARUA 2OT0A 1S5MA 1XC6A 4PA8A 3E2SA 2YCKX 1PIFA 3ERPA 2RH9A 4LVGA 3JS3A 2WVSA 1SZFA 2J7GA 1XIFA 3DH7A 3I7QA 5E9AA 2ZRWA 1QRQA 3I6EA 4AB4A 1B4EA 4ZOAA 5XIMA 5FI8A 5LA2A 4RXGA 4FS9A 4Z1YA 3E2QA 4HSNA 4RDZA 2W27A 2RGMA 4AF0B 4FNPA 9XIAA 3I65A 3EWUA 3PG9A 3Q2DA 1BTMA 3S6DA 5D02A 1DHPA 3IUDA 3VGDA 2DSKA 1UZDA 1UHVA 4PMUA 3T09A 3NQ6A 3NZRA 4Q4RA 5BNKA 3EX4A 2QXWA 1E0VA 1TVLA 4HTYA 2E3ZA 3UXAA 1XX1A 1SJAA 4C6IA 1G9HA 2ZZ4A 1B57A 1OEPA 4GI4A 3DAQA 1G94A 4F2UA 3ANVA 1TE6A 4QDMA 3DOPA 3OG2A 5JBEA 3VM5A 4QBXA 4MG4A 1AMYA 3LN3A 4HNNA 1GVQA 5F2IA 3W71A 1SM9A 1KV8A 1FXQA 2BMBA 4DBWA 3A4AA 2IS7A 3UCCA 1QK2A 4JQ2A 1IZJA 1ZQ5A 2J77A 1XLJA 3O16A 4K8EA 4QJ1A 2PTDA 1EC9A 4ALDA 4UMCA 3LB0A 2PWUA 3HA1A 2NUYA 2ZE3A 4Q33A 3KRZA 1HJVA 1AD4A 1SGJA 1XLCA 4K7VA 3W7RA 4AY1A 4MKSA 3VOCA 4U5IA 5A8GA 2OLSA 1SO4A 5AYYA 1TPVA 4XTIA 3T08A 2QYGA 4H8HA 4Q6JA 1GKPA 1FWAC 4LVDA 3ABRA 2PWHA 2WHMA 1A4LA 1JAEA 7XIMA 2ESCA 4WJXA 4E2VA 4LBRA 1J93A 3VIPA 4C6QA 4MB1A 1UKQA 2D23A 2EAWA 3NEVA 5GJPA 3ITGA 4BI5A 2XM1A 2DSZA 4GZEA 5IDZA 1DJGA 3HPXA 2FH8A 4E5TA 3M07A 4JIQA 1QNSA 2VR5A 4PMDA 1GUVA 3SDOA 1QWGA 4QXIA 1V93A 3E2VA 2YL5A 1K8XA 3CK5A 3V18A 3OA5A 1C91A 1KBJA 3INPA 1W0MA 3EMZA 1US2A 3M47A 2EG6A 4R5EA 3ZFHA 4LPCA 2WM1A 3WK1A 4GXPA 4DUXA 3VE9A 3N6HA 4FF5A 1CGYA 4Q4PA 3MC5A 2YL8A 3PZ9A 1XWYA 3ITLA 3EA1A 2QJNA 4XTDA 3URQA 3T0TA 3U5YA 3GH4A 3BJFA 1TUFA 2P5NA 1FUYA 1QXLA 1EBGA 3S6OA 1PEZA 3H26A 3G5EA 3O1NA 5CC6A 2X16A 5KZ6A 1L6WA 4Q8PA 1EF2A 3RLHA 3BL3A 3U4AA 2VURA 2X7VA 2VHLA 5KITA 4JR5A 2DVTA 1TZZA 2YW4A 5HQMA 4ICMA 4W87A 3ITTA 3KVJA 1KFLA 5LIYX 2ZDRA 4H9VA 4LQ1A 3G1FA 1RUSA 3PWIA 1UBSA 4H6QA 1N55A 3BW4A 2NSOA 3UU0A 3VIOA 4CD6A 2VRKA 1GPFA 3PFMA 1K7EA 1UKOA 2XHYA 2Y89A 1Q5MA 3C0SA 2TMDA 4JDBA 2ZVIA 3QC3A 3P14A 5HMDA 3GW3A 5A2AA 4YLWA 3GXNA 3EA3A 1W3JA 3Q4DA 4O15A 5DN1A 4H9TA 4LAZA 3JR2A 2J7DA 3N13A 5CPMA 1KFCA 3UXDA 1LUCA 3QW4B 4JTRA 4LAKA 2C1HA 4QLLA 3W1AA 4YTTA 3LPGA 4IUGA 4QJ3B 4YCPA 3OHMB 1Q6RA 1MFUA 2PD5A 3WO8A 1B0IA 4DF2A 2X30A 1J5SA 5JXQA 7ENLA 5LNRA 1VZWA 1QNRA 2IUZA 3G1VA 4XKYA 4MFDA 1R38A 4JNZA 1P6BA 4BQ4A 1YHTA 3S2JA 3CQIA 3MI2A 3CZ8A 4HOZA 2PDXA 3CHCA 1MDRA 1OZQA 1JUBA 5JIPA 3M0KA 4WKAA 3GW0A 1HF6A 2BASA 4S3BA 4V2XA 4RZBA 2KAUC 2TSYA 2V3GA 1RSCA 4D6JA 3CZEA 3W2LA 1XM3A 4I8YA 4DZ5A 3TJ4A 2R6OA 4Y9AA 1ECQA 1GNXA 2TYSA 3L4ZA 5GNZA 2ZA3A 1DTNA 3MCNA 4XZHA 4A3HA 1K77A 3GC4A 2OZTA 1EA9C 4LWWA 5BW6A 2F7FA 1JZ3A 3WMSA 5K9XA 2O7SA 5I3JA 1J12A 1GJUA 1V4YA 5CPLA 4KWSA 1V5XA 1J9YA 3R10A 1I1XA 2OWCA 2OWWA 3VD3A 3S5ZA 3K8KA 4M1BA 5AFDA 5TQLA 3SO7A 2C14A 3CWOX 1Q6DA 3VKCA 1W3HA 1FHDA 3UBPC 1OZMA 1UJPA 1RBAA 2PP1A 3I3DA 2V2HA 3APTA 4GGHA 4IGMA 4LW7A 1E4IA 3U7BA 2A3HA 4GBUA 3TNBA 3SCQA 2NWRA 3F2BA 1O1HA 1UH2A 5G2IA 2ZWYA 3MSGA 4PMRA 5AHNA 4QDPA 3ABOA 2DDXA 4AXKA 2F61A 4ZL1A 3BLFA 4RW3A 2Y5JA 1BTCA 3QVQA 1S2TA 2ZKMX 3WDQA 2FDSA 2BDQA 4LJ3A 5DX7A 1SU5A 2X0SA 2GGGA 2QAFA 5A3HA 2F84A 4NXSA 5C70A 2D0HA 2G0WA 1NQ6A 1NOWA 2WNZA 1HFBA 4UMBA 2WHKA 4RW5A 3RLVA 5J5RA 4LY8A 1SZGA 5I24A 2GVJA 4PCSA 1I9CB 2ISVA 4PBEA 4W7VA 2CIPA 1Z44A 2GLKA 5LIWX 2OELA 3QEZA 2CZFA 1SW7A 3E5BA 1KRCC 3MY9A 2JALA 4HMDA 4WY0F 4QROA 1EB3A 1BXCA 1FVPA 2V2DA 1OX6A 4L9XA 3RMJA 3QHNA 1EPVA 3CQHA 2CXEA 2J4GA 4A05A 4ONVA 4GUJA 1A5NC 1HXJA 1VRXA 1ZAHA 2I7GA 4GI9A 5LNSA 4IIHA 4I8DA 3MO7A 2ONEA 1XGEA 2EGZA 3NQDA 1JZ2A 4CNPA 3BCJA 5LZLA 1PV8A 3GX9A 4F48A 3E6EA 4DXXA 1NFPA 3LLDA 4N0RA 1R7OA 3AZTA 3WIJA 4BEUA 1FCBA 4UTLA 4C90A 2GYIA 3I10A 2ZRYA 2OOFA 4DBEA 3ABQA 3B40A 4NXKA 2D73A 3DIPA 5HWMA 1Q45A 1KQZA 3VDHA 1UD2A 5GPRA 3GHUA 1JDEA 3A3WA 5M3WA 4U33A 1R86A 3M6YA 2J7FA 3AIQA 1A3HA 4DLFA 4YTSA 3OP2A 1QATA 1VBHA 5LHFA 3OJGA 5HMEA 4XD4A 4MPKA 1CLVA 3IJLA 1EZ2A 4J3UA 4JKLA 2WSQA 3KP0A 4JYFA 2WPGA 4ZGYA 1M65A 3AAMA 5FJJA 4UQBA 6PTDA 3DERA 3KL5A 3CO8A 3T05A 2PPGA 4ATWA 2W63A 5TNVA 2C0AA 1JPIA 1OCNA 5BU6A 1HGWA 2HK0A 2BHZA 3U6WA 2XH0A 3WUBA 3C0LA 3IGUA 1TWWA 1DQUA 1WXJA 2P1FA 3OQ8A 1UR2A 1TVPA 1EDQA 4FMVA 4GJIA 4IG2A 2DT0A 4KRZA 4ZO9A 1LOSA 1ADOA 2PDBA 4EAYA 3RU6A 4XD5A 2PU0A 3P2VA 3SCSA 3IRDA 5BWAA 3A6OA 1OK6A 2O92A 4Y7EA 4JFWA 4A8IA 4N6FA 4GYJA 3EX3A 3W7JA 1C29A 3RIKA 3N12A 1CIUA 1VYRA 4PL2A 3V1PA 3UXIA 3LYEA 2G3JA 4B3ZA 3LHYA 4HCDA 3WQOA 2PCQA 2PDKA 2Z4GA 4B92A 3IJ7A 3W7LA 3P82A 3PSWA 1W91A 4Z2LA 4HPGA 3UR5A 3T07A 3MANA 4Z1AA 2HE5A 4HD5A 1B5TA 2I56A 1TJ1A 1L6FA 3QTPA 3GK0A 2CLOA 2QR6A 4H7VA 1R46A 1AK5A 1IWAA 4GK8A 2XGIA 1GYLA 2XIJA 4H9MA 3GDBA 4FOJA 1VIWA 3OBAA 1SPQA 1KXTA 4N42A 2QEZA 1F3XA 4FA3A 4B90A 3EDFA 2PDGA 3BVJA 5AYIA 1D8WA 4S1FA 2HZGA 1QNQA 4XK2A 3E02A 4LX4A 3AYRA 1ISVA 1CLXA 1QI2A 1T8XA 2HK1A 1G4SA 3C3NA 3PNUA 3BG9A 3V0TA 4Y8EA 1TV4A 4QNEA 3WD3A 3ZQ9A 4W5UA 1V3JA 1TCMA 2QHAA 4DJFD 4EPDC 4KEZA 4CD7A 1Z9AA 1RQHA 3G2GA 4KRTA 3LI1A 3TV8A 4P7QA 1OADA 3DU0A 4UR8A 2AGKA 1Z69A 4UQAA 1BYCA 3R8HA 3HN3A 2PDMA 5D04C 3OA3A 4TVCA 3RGTA 3CASA 4GWEA 4ZE5A 3LEPA 3VMOA 3IV8A 3NQFA 1DYSA 4JTDA 4KERA 3S9IA 6REQB 1ONRA 2WJZA 4R7JA 3WBEA 3GDRA 2JE8A 2WCSA 1EQPA 3VXGA 2VDIA 3ITXA 1HKJA 4JFUA 4IT1A 4CQ9A 3VX0A 3M64A 5BWFA 2B7OA 3S5SA 3GUGA 1V7AA 4H8VA 3H23A 4I9TA 4NJGA 5LGZA 4RZ6A 4QSFA 2P53A 4LRTA 3IRSA 2CYGA 2CU0A 3KRUA 1EXBA 3LLFA 1FFQA 3NFUA 3W87A 2WYSA 4DYJA 3WLNA 1AH0A 3SCOA 2JQXA 1LT8A 1JVNA 3NUKA 4HJWA 1XGDA 2YDSA 1E6PA 4FSAA 5E6ZA 1DEDA 4UFMA 4CNSA 4GQBA 4LS1A 3HU7A 5CJNA 1KLYA 3CWNA 2AQOA 2EPHA 3C6CA 2F8QA 2VRJA 3SQLA 4NILA 1XIGA 4ZR8A 3LX9A 1BWVA 1IEXA 2VFEA 3LTYA 4IF2A 1QOPA 3GU1A 2E6AA 3U48A 4JTKA 3D47A 1XG3A 3CIVA 3PZUA 4WX2A 3W6LA 5C8BB 3L2IA 3HMJG 1YXCA 1ZPTA 4C5ZA 4LV9A 3FDKA 3PF3A 1JQXA 4B5SA 3DESA 3L9CA 4NZ4A 1V8EA 4HP5A 1TB3A 1YPIA 1HUVA 1TVNA 1PHQA 3CMGA 4LFYA 3O6YX 5CAHA 1DWIM 5T8GA 3UPMA 4HMNA 3PULA 4J28A 3EDEA 2G4JA 3FXGA 5E9XA 2ZRVA 2EJAA 1ZP4A 1XSIA 4BHYA 5T9BG 1GK8A 3W2MA 2ZZ7A 4RR4A 4C7GA 3W7EA 4LNCA 3DBNA 2B7QA 2QPSA 1O66A 3NO1A 2GUBA 3TA6A 1K70A 2XISA 4IMAA 3EOSA 1DJIA 4F9DA 1UYQA 4OGZA 2OGJA 2V5BA 2J8FA 1E6ZA 1OFAA 1RPKA 3VDGA 3UXKA 3B9NA 4LS2A 4NT0A 3QF0A 3EWXA 4AZGA 1W2PA 3QQWA 1I60A 3AHXA 1CXLA 1FCQA 2KZHA 4E2BA 1XF0A 2QCHA 2FVLA 3A64A 3LCHA 3QPYA 2PRLA 1TJRA 4OJYA 3TWAA 2XM2A 1KBLA 1SO5A 4R88A 4J27A 1KTCA 2V5LA 3P60A 2Z26A 3L21A 1NDVA 4PE8A 2OYKA 5REQA 3RK8A 2YLAA 3HGJA 4HU8A 3PZMA 4CQ8A 3IARA 1E0UA 4MOZA 4M7TA 3QGAC 3EBVA 2P50A 4GCAA 1M03A 1UA7A 4CU8A 1C7TA 1EEXA 2WAGA 1JPMA 2GVYA 1EEPA 4OKDA 2NT1A 3ZLGA 3TMLA 1RJQA 3GFZA 3SURA 2FZNA 3BAKA 3CS2A 1OGBA 3FYOA 3G24A 3PWGA 1ZNNA 3N6QA 2R1MA 4B5WA 1TPUA 1KRMA 5GNXA 2PTYA 4ZE4A 2D24A 2PGFA 3LRLA 3VIJA 4LGXA 2HTMA 4PCPA 2ZDSA 3VDCA 4R7OA 4W89A 1WKYA 3QKZA 2ZWZA 3H2NA 3KFTA 2DVXA 2A2IA 1B1YA 4RV3A 3TN3A 2V9DA 1BF6A 1F6YA 5D4YA 1X39A 3NQBA 1N2VA 1UIOA 1P0BA 3ITYA 1P7TA 5DMYA 2OWXA 3KCJA 2X8RA 1EOMA 3N25A 2SFPA 2JEPA 3G0XA 1MQRA 3MZNA 3Q67A 2CBIA 2YXGA 1VR6A 3WD1A 4HVXA 2CFFA 4W93A 3JZUA 1NVMA 4XV0A 1NFGA 5FJTA 2IKIA 4Q4SA 3GNRA 1A3XA 1D2KA 5MHBA 1NQKA 4OV9A 3FFSA 3VNYA 3T2PA 3GH5A 2NXHA 3IVUA 2J24A 3LHZA 1KM6A 3G6LA 2YKKA 4EP8C 1LQ0A 4GYPC 2VX4A 2PLCA 4WHBA 1WOAA 3FHAA 1NJJA 3M0YA 4ATDA 3N9RA 2CLKA 1J10A 3VKAA 3QXBA 4A3QA 3O6DA 3EWDA 5B7YA 2OODA 3VIGA 3UCQA 3N2BA 4HA0A 3R2GA 4PRTA 1IE7C 3W1QA 3CV6A 2YCLB 1SO3A 3RDKA 3QN3A 4FR6A 4Z1DA 4O8RA 2VGFA 1VH7A 4DB7A 1T8QA 1G0CA 2OMAA 5CC5A 5AVNA 4MB5A 3S2LA 3MSYA 1H41A 1TQJA 4DJDC 3PJUA 4ILSA 3WDRA 4IQEA 4AVFA 4H8NA 4YS1A 1PCWA 4AVNA 4QE5A 2QV5A