2IW0A

Structure of the chitin deacetylase from the fungal pathogen colletotrichum lindemuthianum
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
226
structure length
226
Chain Sequence
VPVGTPILQCTQPGLVALTYDDGPFTFTPQLLDILKQNDVRATFFVNGNNWANIEAGSNPDTIRRMRADGHLVGSHTYAHPDLNTLSSADRISQMRQLEEATRRIDGFAPKYMRAPYLSCDAGCQGDLGGLGYHIIDTNLDTKDYENNKPETTHLSAEKFNNELSADVGANSYIVLSHDVHEQTVVSLTQKLIDTLKSKGYRAVTVGECLGDAPENWYKAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHITIN DEACETYLASE
publication title Structure and Mechanism of Chitin Deacetylase from the Fungal Pathogen Colletotrichum Lindemuthianum.
pubmed doi rcsb
source organism Colletotrichum lindemuthianum
total genus 89
structure length 226
sequence length 226
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2iw0A01
3CL6A 4NZ1A 1Z7AA 1W17A 2NLYA 3HFTA 4NY2A 4LY4A 4HD5A 4WCJA 1W1B1 4U10A 4NZ4A 1W1A1 3CL7A 2J13A 4NZ5A 4V33A 1XW8A 2VYOA 5JMUA 5BU6A 4L1GA 3CL8A 2CC0A 4F9JA 1NY1A 1V6TA 3RXZA 4F9DA 4NZ3A 4NYYA 3WX7A 2Y8UA 2XU2A 3QBUA 2C1IA 2QV5A 2C79A 2C1GA 2C71A 4NYUA 4OUIA 4M1BA 2I5IA 3VUSA 2IW0A 2W3ZA 2E67A 3S6OA 2DFAA
chains in the Genus database with same CATH superfamily
5HMEA 5HJLA 1ONXA 3TP4A 4NILA 3HJEA 3R10A 2PI6A 4UQDA 4EPBC 4P7NA 2ACQA 2VT0A 3VGEA 1UBSA 1BQGA 2D0FA 4GNVA 4F4RA 2IXUA 3VKDA 4LXFA 4JXCA 1E43A 1I1XA 3LCLA 4GYKA 4Y96A 2WMJA 3URNA 4GNKB 3P60A 4NZ5A 3LG3A 2PLKA 1YPFA 4MY9A 4J2MA 3U6WA 3I3BA 1ZENA 4HHHA 2X41A 3B9EA 3A9BA 1IEIA 1F8MA 4CEUC 1QXLA 4V2XA 1R7OA 1MYRA 2ZZ6A 3J7HA 5G4WA 2CHNA 2Z7GA 1JYWA 4QNEA 1A5BA 2XJ7A 3B0UX 4YTRA 1FQ0A 1CCWB 4J28A 4H2CA 1MXGA 1JUKA 1PPIA 1B1YA 3HQ1A 4EXQA 3N17A 1VFHA 1YBQA 4XKYB 3S1GA 4DZAA 2JALA 3DI0A 2C14A 2HSAA 2UY2A 2QCDB 2VZOA 5C0QA 1UMLA 1ZNNA 1A4LA 2O0TA 2JGYA 2DZXA 4CU7A 1H5YA 1P0DA 2Z0IA 3R1ZA 2R14A 1Q63A 3TVAA 1GHRA 1ODZA 5DMNA 4HHMA 1FXPA 4JBRA 4O50A 1V4YA 1YW1A 4BQ5A 1BD0A 3LHZA 3OOQA 1C9DA 2ZZ7A 3C0LA 3PZGA 4TMCA 3TYEA 2Z27A 5K3VA 4NNAA 3LDVA 4UFIA 4IWWA 2ISSA 4GPNA 2NWSA 4MPQA 2HWGA 3BLKA 4C6EA 2PWHA 2BOFX 3VXGA 1BSIA 3I6RA 1FCQA 4O1AA 4QG9A 3BLFA 2Q01A 1L6FA 2QCEA 3C4UA 1V79A 2FGBA 3WH7A 2ACSA 1RHCA 1H3GA 2WLYA 4D8AA 1CEOA 1TWWA 5JH1A 3BL3A 5AB3A 4HJFA 3NVTA 1KW1A 2ZDRA 2QCFA 3S2MA 3LLXA 1XIIA 3MI2A 2XVLA 4YTSA 4KCTA 2CKRA 4DB7A 3BV7A 4S3BA 2WV8A 2WNWA 2FLIA 1M01A 5GPRA 4D1JA 4WKFA 2EKCA 1O66A 4O1EA 1LOQA 2J4GA 1C8VA 4WRHA 4DZIA 1PTGA 3DHFA 3NL2A 4JFWA 4HNCA 2BG5A 3VDHA 2Z7KA 4NL1A 4LAKA 2VQUA 4ORMA 3G1FA 3WLPA 4G1NA 1RJPA 2WAGA 1GOIA 3K8LA 4OWGA 5BU9A 4U4MA 4M51A 5DXXA 3MA8A 3VNIA 3HN3A 6A3HA 1A5MC 3MYOA 3VTRA 4IPIA 2ZC1A 2ZC8A 3PAJA 3CWHA 1TJ2A 4NG3A 1E1CB 3SUWA 4KT2A 4GABA 2CLPA 3LU2A 3FVMA 3C52A 4XSLA 3LMYA 5AHMA 1A5SA 5E6YA 1DV7A 4XAGA 2V5JA 2D2JA 4TU1A 4PUWA 4XO6A 3W53A 3SCSA 4HA0A 3AMDA 2A3CA 3QLLA 2P88A 4GK8A 4D6GA 1VBHA 4HK5A 3KLLA 3PBYA 4XAZA 3DN5A 5TQLA 1I0DA 4FX7A 1MEIA 2NQLA 8XIAA 3R8GA 4P61A 1J12A 1M6JA 3OG3A 2QJHA 4KGLA 1K7XA 1OT1A 1LG1A 2A3LA 3AMCA 4GXMA 4AQLA 1EEXA 1F61A 1LDCA 3SCRA 1H7NA 1ISXA 5JU6A 5T8GA 1R3QA 3VA8A 4D6EA 2EPNA 4KEZA 2G37A 2V3GA 1GTHA 3NSXA 2C7FA 1AD4A 4P7LA 2POTA 2HCVA 4GCAA 3WD4A 3K5XA 1TVPA 2ZIDA 1TCDA 3G77A 1BFNA 5LNVA 1U22A 1UPPA 2OWWA 4MHBA 3LB0A 1JF6A 4MJZA 2HBXA 4Y2WA 4PUNA 2OZ3A 5IM51 1W1IE 2CW6A 3T81A 3TC6A 4XZHA 3S2CA 3VFLA 2XSBA 1Q2SA 4KRZA 4PC8A 4BQ4A 1GT8A 3NUKA 3MHGA 4MWAB 3SCOA 3DHPA 9RUBA 1KXTA 2FHBA 4WXZA 1G69A 2QCGA 3FSTA 1HP5A 2C1HA 4Y9OA 1M7JA 4LNYA 1E9IA 4AYSA 1X1NA 3LPFA 4UNLA 1E4NA 2O4MA 1DJZA 4OJYA 4GINA 2PRHA 2OZ0A 3D3AA 3NOYA 4P7RA 1XLGA 2A0NA 1EP3A 4FLOA 5D37A 1KRCC 3V4BA 1OK6A 3LOTA 2NQHA 2WBGA 5BWFA 1FKXA 3WFAA 3MQTA 5U4NA 4K6AA 1OIFA 2I1OA 1LF1A 2RDWA 4TO8A 4KF1A 4OV4A 1QU4A 4JTUA 1CIUA 1AQMA 1DPMA 5HA7A 4INFA 7REQA 4PL1A 3NL5A 3C2YA 1D8CA 3MUCA 3OZYA 1WA3A 5AC4A 4PUUA 2VEPA 3ABQA 1JZ7A 3W01A 3M0KA 2XG9A 5JBDA 3LQLA 1XLJA 1FHDA 1KLYA 2X1SA 5FEPA 3N13A 4EK7A 1RQEA 1W54A 4PYSA 1NWSA 4R9XA 1EZ2A 1SMAA 2YLAA 3E2QA 1TV2A 4Q6XA 1JFXA 5LA2A 1OSEA 4CD6A 4HA1A 4O11A 3H21A 4JQ3A 2QDEA 5DY2A 4MKSA 1I8JA 4F0KA 2Z1VA 1LJYA 3S83A 1Y5WA 1TREA 4NYYA 2OR2A 4UQ9A 1Q13A 3NQFA 1GKRA 3PUDA 4NAFA 5BOFA 4IUOA 4QM1A 5D9PA 1T5AA 5DY3A 3N04A 3PTMA 3S2NA 4ICMA 2GJRA 3LLFA 2ZADA 1RP9A 1CTNA 4DYEA 1K6AA 3WLIA 3AQUA 4U28A 3T1GA 3S3GA 3O7UA 4OV9A 2PDGA 3S5NA 5BOEA 1HFBA 2D2HA 3KEHA 3CV2A 4WIWA 2NUXA 5HXMA 5AHNA 3GYCA 4CNTA 3PVFA 3LXAA 1ZB5A 3P5ZA 1RLDA 3EOEA 1O5QA 4QCFA 2NXGA 3EMZA 2AMGA 5CPNA 2PDHA 4MB1A 2VWSA 1XLEA 1TYGA 1XG4A 4DJDD 3L0GA 3NL3A 4BEUA 1C92A 1MDLA 1FWTA 4PSRA 3EMCA 2YL6A 3EDDA 1WKDA 3GKAA 4V15A 2VC7A 5C9WA 2H6RA 4MZYA 2WSYA 3FCPA 4W7WA 1W1TA 2VCBA 2C3ZA 4O14A 3UY7A 3ARYA 3TYAA 5FJPA 1PKYA 3W07A 1QUMA 1LUCA 3PUEA 2V5KA 1XBXA 3DDMA 1B4EA 4JN8A 1FUYA 3N9RA 2TMDA 3SCQA 3NM3A 1OYCA 2ALDA 3OGVA 3N25A 4LY4A 3FEMA 1OT2A 3FHAA 4UB9A 4C60A 3O3RA 5AHFA 3DI1A 2FPYA 1XV8A 3WBWA 2GPTA 4I8DA 1UR3M 2FPTA 1LOLA 2C16A 1PXGA 2C19A 1X7FA 4ZOAA 3CM4A 3TYDA 1TVLA 2ESCA 2FTWA 1PX8A 2X1IA 3S2JA 2AQVA 2CBJA 3NWRA 2XM1A 3K2GA 1OYAA 4C1NA 3ELFA 1WO2A 3SY5A 3S9IA 1MI3A 2DVXA 2YCJA 3GXIA 2XIIA 1XYLA 3ARUA 2PFHA 3ANVA 5EFDA 3ZR4A 2GGIA 4UTTA 2IQDA 4GWEA 1S3TC 2GUYA 1P0EA 4I9MA 5A6LA 5H8UA 2PDPA 1YADA 3CO4A 3H2NA 1V6XA 3TYUA 1TFVA 4RXFA 1H7PA 2GSEA 3C2OA 1TA3A 1ZBKA 1BKHA 2FZMA 5FSDC 1KM4A 3EWZA 4PRRA 5DMMA 2VYOA 3W1MA 1MW1A 1RAKA 2D1ZA 1OWQA 5FL0A 1MXSA 1CB2A 3BZGA 3JR2A 3QOKA 5D2WA 1W5NA 1TUFA 2PSNA 1VH7A 3P5YA 4OECA 3MWAA 2ICSA 4U3AA 3WQ6A 1WZKA 3BJTA 5BZAA 3KOXA 1FWJC 3N9SA 1N7KA 1XRSA 3MMUA 1SJDA 5CGMA 2J8TA 4FNPA 1Z9AA 3QQ1A 3VD4A 3WNMA 4BFAA 2VGFA 1FH8A 2EXOA 3I4EA 3BG5A 3LX9A 3XIMA 3CZGA 3FA5A 2QS8A 3JZUA 3U4AA 3KBNA 2Y7GA 1PZ2A 1XLLA 1OHLA 1XW8A 1IXOA 2GL5A 3OEXA 4O0KA 5M2FX 4DRSA 3TTEA 3GHSA 1BRLA 3LUTA 4K8GA 4P7QA 4Z08A 4ASTA 3RRAA 4UMAA 3W7GA 2WM1A 4D71A 1X6UA 2Z6IA 4GY1A 1YBQB 4GQBA 1GUVA 5D8WA 1N8FA 4OQVA 3W7HA 1W3JA 4HPXA 2H9AA 3OIHA 4YHGA 1XLDA 5HINA 3S9YA 5CPSA 2IQTA 3QHMA 4JYFA 3SUSA 2XH0A 4PTDA 1JZ2A 5M03A 3H2FA 1O5KA 1NDYA 1DWAM 3UESA 1JFHA 3LHUA 3A21A 1BF6A 2V0TA 3L21A 4ZENA 5AFDA 5H1WA 2H90A 2Z25A 5EL1A 4RW3A 4HN4A 3UZXA 3FGCB 4XBKA 2JF7A 1GZGA 2R24A 1XUUA 5HANA 1H7OA 4RL3A 1YIXA 1OFEA 2G3JA 3E5PA 1ZFJA 3MUIA 3QHNA 2ANUA 3PBWA 4BQ3A 1Q5MA 3A12A 1ZBCA 5E70A 2DQXA 4QJ4B 4XZMX 3RRXA 1O7AA 3W85A 4HCLA 1BF2A 1YDOA 3TCSA 4QTGA 2Z28A 4RZ6A 2GVGA 3EBVA 2E4TA 3E2SA 4OZOA 1NFPA 1TIMA 2FMOA 4EAYA 5DCBA 1M1BA 2WCSA 3VC5A 3BW3A 3UCDA 3LPGA 3PK7A 2HS8A 4XD4A 3NPVA 1XGZA 3BURA 3TIMA 4IISA 1CLXA 3G1HA 4IG2A 4G8TA 4IFRA 2A1YA 2GSJA 4MWAD 4NNCA 3GXFA 1SZRA 4HPGA 3TYBA 1GVFA 4C90A 4ERAA 2ZRWA 3QR1A 5CLWA 2HVNA 4QCEA 5HJXA 4DF2A 1S5NA 2JKPA 2RHGA 4DUWA 4AYGA 2DQWA 2VX5A 1SGJA 2D3NA 5HNNA 4QP0A 1UR1A 3H26A 3VX1A 3P74A 2SFPA 2NVAA 1N8WA 1UIOA 1H63A 3GH7A 1HJSA 5GNXA 3GNXA 1PHWA 1C91A 4D9PA 2HDJA 3W75A 3VDAA 1M7OA 1S1RA 1OC6A 3FKKA 3F4VA 2CLFA 1G67A 2G8ZA 2Z2BA 3GFYA 1KB3A 4GZ7A 4GQ0A 3AICA 4YS1A 3GTFA 5A95A 5CAKA 1M41A 3TLQA 3LCFA 3KS6A 2QMJA 5AHLA 1QWKA 1RCXB 3UCQA 4GIRA 1WCGA 1AODA 4EWND 2JBMA 2ALRA 4CCCA 3UY8A 1VENA 4AD0A 2CFFA 2PDFA 3G6LA 1YDVA 4BZYA 3TN5A 5E09A 3DC0A 3LV6A 2IPGA 1VHCA 4HT3A 3G0SA 3TA9A 4AWUA 1Y5XA 4CD4A 3T0TA 5C8BB 2R1MA 1JI2A 3MS8A 4B16A 1C8YA 3M5XA 1H1YA 1NF7A 3UWYA 3I7SA 2J7GA 2INEA 1DHKA 1ME9A 1UWRA 3KBMA 4GZIA 1Z48A 4LQ1A 1EOKA 4IMFA 2X09A 1V0MA 4GC3A 1AK5A 2BODX 1DIDA 1S5VA 2Z4GA 3MP5A 4XZBA 4C5ZA 2OGYA 1LQ2A 4ERGA 4HNTA 3NGJA 2XVPA 2QW5A 3PTQA 3SBFA 2CITA 2XYLA 1DORA 4FXFA 2PC8A 1H50A 1HJQA 1YXDA 2XGBA 2G3FA 4W86A 1UD4A 3E0LA 1OCNA 4EOUA 3DCPA 3CZEA 5G5IA 5I07A 3QN3A 1TV3A 5GNZA 2BMBA 1OX5A 9XIMA 1Y65A 3T07A 1Q4WA 5D33A 1C8XA 3CQIA 3NNTA 3FHQA 4JIPA 5HPCA 3RJYA 1XRVA 2HXUA 5IHRA 5I77A 1SYTA 4I9TA 2OZ8A 3H2AA 1IT0A 1E6NA 2G0WA 4PUKA 2V9DA 3FYPA 4ZZ9A 3MDWA 3Q58A 4IQEA 2YDRA 3BQ5A 7REQB 1MUMA 3W7PA 2BGSA 1F4AA 1RJRA 4PCPA 4AIOA 1QI3A 4B2DD 1HVQA 1R3VA 1FOBA 4WY0F 3WQWA 4MY1A 2HE5A 2WKJA 1ZHAA 1UD8A 3DG7A 3L4UA 4Z1YA 2YCKX 3W2JA 3UZZA 4CNUA 3LS9A 4JQ2A 3R25A 4MADA 4MAVA 3WBYA 3B4YA 4LB3A 2E0PA 1FWEC 4J35A 1G6CA 1KM5A 3QGKC 1V6TA 1XG3A 2DPEA 3OGRA 1SM9A 1QPKA 3GTXA 2QCNA 3ZYZA 1W2VA 2PRMA 2X40A 3QV9A 4EPKA 4RLIA 3LCIA 3V36A 2HE8A 3QV6A 4CD7A 3RM8A 3VZXA 3M4HA 4E0CA 3S47A 3V3WA 3VMPA 3TKFA 3ZWTA 2WVVA 1XSKA 4BI6A 4GIEA 1GZJA 1V0LA 3L65A 2DGAA 4B15A 3T55A 3SUTA 4WD0A 3MP3A 3F5LA 3S1VA 2VFGA 3ANYA 2OELA 4GKTA 4F40A 1DIEA 3KCJA 4Z2JA 5I5RA 1LQ0A 3CAWA 1E0TA 2OJPA 1VAHA 1FWBC 4GH1A 4FMVA 4BCEA 3MHFA 3U7BA 1O5RA 1J8VA 4H8HA 1PKNA 1L6GA 3QV7A 1ESWA 5AOUA 5GQBA 1TPC1 4UTMA 3P61A 4TXEA 4K2SA 4HSNA 5A5WA 3LSBA 3WQPA 2JIEA 3ZOAA 4IH3A 3CUJA 1H61A 2A7PA 1B30A 3EZ4A 4ROPA 4GC4A 4LUYA 1LRNA 1QNQA 1VFOA 1XISA 1EO7A 3W1RA 2HBVA 3GHUA 5FF4A 3KRBA 1M9HA 1W2PA 2NVDA 4DHGA 3URAA 3UG8A 2XVKA 3E96A 4JYEA 2QGYA 1I75A 3CPRA 2BOEX 4M6QA 1EH9A 1F4HA 4HNOA 1ISWA 2BY0A 3WQ4A 5CC3A 1KFLA 3B8TA 4QS6A 4MJ4A 4IFKA 1SUXA 5DBTA 5DANA 4XTDA 2EPOA 1RCQA 1U5VA 2HMCA 4A2RA 1R2TA 2AOSA 3OU8A 3O6DA 1ONWA 2WQPA 1F6PA 2GJNA 4I7WA 1PYFA 3TOYA 1KFCA 4L6HA 1X6NA 3F5KA 4OHQA 4B5UA 3PANA 2AKMA 2YOCA 3AS2A 4S3CA 1R9ZA 2BGQA 3WF3A 3KVJA 1VEOA 5EMLA 4C1NB 3RR4A 1RZMA 3W2UA 3OHIA 1KXVA 2PDNA 2QHAA 2WSPA 1H60A 2BB0A 2PDKA 1OGBA 4PFMA 4Z1BA 2OLAA 2O92A 2E6FA 4LCRA 3U2OA 4B5WA 3GNRA 3PUOA 1QHPA 2OGJA 1TV5A 4A35A 2AGTA 4JFSA 1VRXA 4V1XA 3P84A 3RX4A 4O1FA 2YBTA 4XWUA 2PCEA 4ROQA 1V3KA 1O60A 4KEUA 1FRBA 3SR7A 3I3EA 4C6IA 4KWUA 3OW1A 1ZY9A 4P8WA 4WCJA 2EAWA 4CNNA 1HP4A 4ENLA 1JD7A 5FF2A 1OFBA 1H7XA 1FWNA 4I5XA 4ACZA 1LG2A 4ZL1A 3WBEA 4WXYA 4Z2HA 1RALA 3M16A 5DRCA 1JYNA 3T40A 5BRQA 4C6QA 1Z3NA 5IFTA 1XIEA 3WLMA 2WKGA 4RJEA 4MIMA 5H6HA 1NOUA 4DELA 3ZR6A 3EA3A 3TQKA 3BAXA 5EMKA 2Y88A 3GNDA 3QQ0A 3BCJA 1KO0A 1TV8A 4KIRA 3B06A 4BF7A 1Z44A 3CV6A 2WZMA 4ML4A 3I65A 2BP1A 1GEHA 3CIXA 1JCTA 2WVTA 3PZNA 1TPEA 3SGZA 2Q8ZA 4IIGA 4H3DA 4MB3A 3PWIA 1E9LA 1QBAA 3OGSA 3QGVA 1H2JA 4B5SA 3A64A 4W93A 3LD5A 4AEEA 2PWVA 4Z2GA 3AXXA 1XKYA 3WLSA 1SU5A 3QZ6A 1BVZA 3EB3A 2PA6A 2B7PA 3FXYA 1J5TA 2BHYA 1XL9A 1VP5A 1U30A 3GXMA 5G1YA 3SB0A 3JVAA 3O6AA 2QCHA 3BICA 1FH7A 3WD0A 4IPPA 3MI6A 3NO3A 1P0NA 3DGRA 4O16A 5BRBA 4PUJA 2VCCA 3PWGA 3T9PA 4M7SA 4PB3A 2ZZ5A 4CQDA 4H1ZA 1OCJA 3GB6A 3PBUA 1NARA 1K77A 5FL1A 4WUIA 5I3DA 2IXVA 2VOTA 2BVWA 3GU1A 4AHPA 1WQ5A 4IIFA 4JIIX 4BWLC 1YNYA 4JGDA 1PDYA 2V5LA 3DZ1A 2D22A 1GQIA 1R3SA 1PBGA 4RUBA 3MANA 4W88A 4HPNA 3R4IA 4D6JA 1NELA 4IG2B 5CSYA 2VZSA 3K13A 1QHZA 5IXEA 1QNPA 1QVBA 1DXEA 3WMSA 3LY0A 1LZOA 4AVFA 1UROA 4BJHA 3TU9A 3HV8A 4PZVA 4U33A 3INPA 2FQIA 1EKOA 3AS3A 3SQLA 1B2YA 1H62A 3WLTA 4CD8A 3KTSA 4IX0A 1R9YA 4X22A 1XYFA 3MSGA 3TW7A 5I3KA 3MT1A 1JD9A 2HTMA 4ZO9A 3UA3A 2WO5A 1DVJA 7CGTA 5I00A 2VR5A 3E1F1 3HOJA 4Q8WA 2QR6A 2XH4A 2H3BA 1EYEA 2FHCA 4YHEA 4EPDC 1UWUA 3E0FA 2QIWA 5I79A 4QDWA 3GQYA 1W5MA 2PPGA 5JBEA 1AJ0A 3PFMA 3LA4A 2VCAA 1IZCA 4KWSA 4PRTA 3WDQA 3KBVA 2BWGA 3VUSA 1ZU8A 2QYGA 3PNZA 2Y2WA 3LGEA 3O1NA 1UA7A 3D0CA 1YMYA 4XZNX 3M5VA 4XD6A 4S2BA 4ADTA 2EEXA 1G01A 3UGRA 4RNJA 2CLHA 2D3LA 1WAWA 3TEVA 3LYEA 4E3VA 3W2KA 1JCNA 4UQBA 2PDJA 2WNQA 3CHVA 4F2BA 3G1YA 4QITA 3NQ8A 1P7TB 4YVXA 3ABRA 3ICJA 4D72A 1HQTA 2EG7A 2PDBA 3KUMA 1UP0A 1DKWA 2E40A 5GJMA 1HKWA 3MY9A 4WDWA 3SCTA 1VYPX 3FYYA 4Q3MA 5AYZA 4HK7A 5AYBA 4M3PA 1YQ2A 1L8PA 4PBGA 3TN6A 3I68A 4H6KA 1TPUA 4I8YA 3KHDA 4J3TA 1XRFA 1J79A 1EJUC 1YXYA 4MYAA 2EPLX 1V3MA 2NVCA 3LHVA 3UF9A 4FEZA 3LRLA 3KRSA 4GVFA 1TX0A 1WYIA 1OADA 3QC3A 4RNIA 2ISWA 1W1A1 4LUJA 3PNUA 2PB1A 4DJDC 3BAIA 1PUDA 1EBHA 4QIUA 3W1XA 5FJUA 3H4XA 1N82A 1IT7A 2CPUA 2Q02A 2V6AA 1F8IA 4G7EA 2WHKA 4UNKA 4F2TA 4AC7C 2PLMA 4A21A 1I2NA 5LSMA 1R86A 2NW0A 3L2MA 3BANA 4LFYA 3SJ3A 1A50A 1YPIA 3IUDA 4NVTA 4WK9A 4R34A 1DWGM 1HGYA 3QJAA 4JKKA 4Y6GA 3UVAA 1IXPA 3W37A 3WSUA 4FZIA 5E0KA 2CLMA 2PCQA 2WYSA 4S3KA 1BYCA 5FJRA 4ICNA 2E9BA 3KRZA 3GVGA 2VGIA 2EO7A 1R85A 3MCMA 4I9AA 4LAOA 1CGTA 3IIXA 2IKIA 3WBAA 4H4IA 2IPWA 3SI9A 4GYPC 3CIWA 4LAUA 4JIEA 4GBUA 2H8XA 2G4JA 2A3EA 2VHLA 2Y7FA 1IE7C 3U2ZA 4FSAA 3U9IA 2Z00A 2IQ0A 1TV4A 2WC7A 1EBGA 1W9BM 1PX4A 3HU7A 4JY8A 1HJWA 4E6MA 3OIXA 3M5YA 4BK9A 3YPIA 4FI4A 3GHTA 2YBUA 1T0OA 3E2VA 2VFIA 2VENA 4LSBA 1RP8A 4RDYA 1GKQA 3TK7A 2AKZA 2ZWZA 3SRHA 1Q8JA 2DFAA 1TIWA 2WVVB 4ATWA 1I6NA 1EIXA 3VNDA 1B9ZA 1F2JA 1TUXA 1RPKA 2AAAA 3HB9A 2XDFA 3EX4A 4RDZA 4A22A 2VVNA 4GG9A 1QNRA 1WUEA 3FIGA 4L4LA 4DEFA 4RNFA 2J88A 1OBAA 1ALDA 3AHZA 1VGAA 3VDBA 3LLDA 1PIFA 4E2OA 2JKEA 1TZ9A 3ZMRA 2AAMA 3ANUA 2P8BA 4XZ9A 4LV4A 2Y5EA 4EVZA 4EANA 1MO0A 1VPXA 1W0MA 2PTWA 5TIMA 1E1EA 4Q4MA 2C1GA 4WJXA 4H04A 2FB2A 1Q45A 4JNMA 1GW1A 1RK5A 2FZ8A 5A6BD 1CYGA 4MUZA 1FTXA 2PRLA 5LHFA 4DPQA 1UOZA 2P0OA 4R3UA 2VR2A 5BXRA 1QFEA 2GQ9A 2VFHA 3GIYA 4MLJA 4M6UA 3CIVA 1MZHA 1AL8A 3RCYA 1Q2RA 1XRTA 1Q6CA 3W0KA 1ITUA 3MUAA 2Y24A 4HTBA 5EGRA 1PZ0A 2WHMA 2D0HA 2WJEA 4AZ7A 4IFKB 2OOFA 4L65A 4HNVA 1JPMA 2X2GA 2QIIA 1XGEA 2PDIA 1PYMA 5CZKA 1CNVA 1JAKA 4JTTA 3OP2A 4O10A 5HNTA 3COTA 5DELA 3FA3A 3C86A 3HFTA 4MNMA 3VVGA 2XZ9A 5AKQA 2G4FA 3VIGA 1JAEA 1US2A 4HMNA 3TFCA 2A2IA 3M47A 1J93A 1WDWA 2G41A 4A3RA 3BC9A 3TNBA 1OB0A 2ZFAA 3GDKA 1TTQA 4NAEB 3SGUA 2DV0A 4NJHA 4TUFA 3BG9A 3QC0A 4MNKA 4JKLA 4ZQNA 4DAFA 1M03A 5CC7A 1P1XA 2YXOA 3W2MA 2PLJA 5I24A 2E77A 1HX0A 4Q32A 2Z1SA 5F1VA 3HJZA 2NXHA 1FHLA 2PS2A 4I5UA 1MEWA 1W6TA 4MM1A 4PMJA 1ZAJA 4O15A 2J24A 4XZLX 4Z0JA 4MF4A 1JRCA 2XVGA 4XAFA 5KMYA 4PCFA 3WH8A 2W5FA 2W61A 3G1XA 1K9TA 4HP5A 4U2YA 3N9KA 3VYLA 2HZGA 1CLKA 2ZA1A 4AIBA 2I56A 3Q37A 3IV3A 3N2OA 2ATMA 2Q71A 4UCGA 3MWCA 4LPCA 3UWUA 4MWAC 4DX3A 1HZYA 2QVHA 2XFRA 4RW5A 3OTRA 1KFJA 3F4CA 1SJAA 4WLCA 4PTVA 4R5EA 1ZQ5A 2FJKA 1P48A 4BI5A 3MSDA 4HTYA 2ZTKA 2FIQA 4DXKA 1DEDA 3HV9A 3HURA 3N3TA 2VEFA 3W1QA 3ZT7A 1E0XA 1FHVA 1H4PA 1XICA 4GXWA 3SCWA 3GH4A 2R9RA 1A0CA 1UZDA 5JH2A 3RLGA 4KQNA 1DTUA 4Z2KA 4FR1A 3KOWA 1SFLA 1CT5A 4XD3A 3SN1A 2E6YA 2HRWA 1JDAA 2A5HA 1ZRQA 2OZTA 1DE6A 3OG2A 2EGZA 5EBUA 3S9ZA 1HXJA 3P82A 3AO0A 2BASA 2XWDA 4W8LA 1WXJA 2BBFA 4N9DA 5M3WA 1XCFA 2QQ6A 3U7VA 3V0TA 2VDIA 2CZEA 2E3ZA 4FHAA 3P93A 5A1AA 5ABEA 4JL2A 1JPIA 3OLEA 3T2QA 2F38A 1EL3A 3W38A 2VMFA 3VM7A 3CHDA 2YXGA 4UTFA 4QDMA 4HZMA 2XUCA 1JPDX 4ZQCA 5D9NA 4NYUA 3IS4A 2DSZA 3HMCA 3DYPA 5IDZA 4M7TA 1E6XM 1EWEA 3O05A 4RV8A 4JHOA 1R9XA 2VZVA 4ORIA 4U5KA 1QI5A 2W9MA 3CJPA 1K4HA 2OPJA 1EGMA 3GXDA 4XIAA 1MQRA 4X9YA 4DBSA 4P2VA 3S2LA 2P3EA 1HO1A 4C1KA 1QPNA 4PUDA 2GK1A 1FP9A 1V0NA 4WKAA 3CMFA 2OXNA 3IGUA 2O9PA 1TJPA 1LBFA 2CESA 1UQZA 3QLDA 2X8RA 1WE5A 3N18A 8RUCA 3T0DA 3AZSA 2V69A 3NTYA 3AWNA 3NDOA 1UR9A 4L56A 1CI1A 5BW6A 1KBBA 3DFOA 3CUXA 3SQSA 4JQAA 4FNQA 1T7LA 3PM6A 5K9CA 5LGZA 3ZLGA 3WEZA 3E3HA 2OLSA 1CGVA 2G3MA 3EWXA 4V33A 1EQCA 4E8GA 4HA4A 4MYXA 3DENA 3ITGA 2WMGA 3H2OA 4IQLA 4E4UA 3BE7A 1V08A 3IK4A 2YR1A 2HEJA 4D6DA 3DXIA 1XCXA 4QAWA 1XBYA 2CLLA 3DHUA 5DX7A 4ICCX 1Q6OA 3B9DA 4TV5A 4XAYA 3IANA 5J5RA 1TWSA 3GUWA 3PF3A 4PE8A 5AYYA 3T4WA 3FW6A 3EAUA 1X1OA 3UGVA 3TNOA 4GVGA 1GHSA 3V5FA 4L64A 3PZ9A 4W7UA 3T08A 2BHZA 4IIEA 4J7RA 3BGAA 3EX2A 4DUVA 2O55A 4WOZA 1UR8A 1TTPA 3WQFA 3ZO9A 1FA2A 5D04C 5M1TA 4MOZA 4NXKA 4A8IA 1QWGA 3F4WA 5HQLA 1P6CA 5IBXC 3JZEA 4O54A 3KXQA 3WEMA 1T96A 1RV8A 1UH3A 2VKZG 4OUIA 3RAOA 5HUOA 2WC3A 3CL7A 3CUHA 5F4WA 2W27A 3W76A 2QAFA 3N29A 1GONA 3H55A 2WZHA 4GGBA 2PWFA 3VGHA 3UWZA 2CNCA 3THDA 3IARA 3LZ5A 5E5CA 4HVXA 4JS3A 3UYIA 4AMCA 4K7YA 4YYCA 3UG3A 4XBJA 3BJSA 4K38A 3DIPA 3DU0A 4PMNA 2GWGA 1UKQA 4EXBA 1ZCCA 1H7WA 2B7NA 3A3XA 3T0AA 4L61A 3THQA 1HO4A 5T9BG 4UTKA 1VYSX 4A29A 5FJOA 3EWDA 2CBVA 1XFBA 2ZYFA 4GVHA 2J25A 2WZTA 4G7EB 3U2CA 3QOMA 3NJ3A 4QX4A 1XD0A 4M19A 3EDFA 3DFQA 2QXWA 4LVBA 4UFLA 1EA9C 2F7FA 1JF5A 3I7QA 2V3FA 2GGGA 2JEPA 3M5ZA 3VIIA 1DQXA 3IGSA 1FWIC 2HISA 2XFYA 1BTMA 3PZMA 4DJFD 1U1HA 1GVIA 1V93A 3GZAA 3LNPA 4JFTA 3B0XA 3VZYA 4RZBA 3M6DA 1EDTA 1W8SA 3L5LA 3CEUA 1PWMA 1XR2A 3RDKA 4IPLA 3KFTA 2PUZA 3S46A 4YL2A 1OGSA 4CQBA 3ZZ1A 1IEVA 5CKSA 1L6YA 2X7WA 2FDSA 1L0PA 2DP3A 4D8ZA 3L0NA 1IZKA 3A4AA 1OYBA 3KM8A 4F9JA 1MNZA 1NWUA 2WLZA 2J7CA 3WKZA 3UZYA 1UWAA 1Y8BA 5B80A 1W9UA 1RK6A 3W70A 4M80A 3NPUA 2OQYA 5D2VA 2KX9A 1SO6A 1JG9A 4HD5A 1NSJA 3N4EA 4JTQA 1A5UA 1G4TA 3NPXA 3G18A 4YYFA 1UA3A 4PA8A 2OLHA 2PC4A 4N9BA 1BWKA 4FNTA 2F84A 4QJ5B 3B05A 3NQVA 4FXSA 4QJ1A 3MMDA 3C56A 1UP3A 3BV4A 1C3FA 1ZJBA 3RJXA 1IEXA 4ATDA 3VOIA 2YCIX 2QDHA 2B4GA 1QW9A 1DWHM 2CU0A 4NIRA 5HJYA 3FY1A 3HG3A 2XPKA 3M0VA 4GNJA 1XIMA 2Y8KA 4LF2A 3P0WA 3VI2A 4H9XA 4ZB5A 4Q8UA 1XIDA 1XLKA 1EX1A 1FCVA 3A13A 2F8QA 1ISVA 4UR7A 2G97A 3BJFA 3T2PA 5FAGA 3F7JA 2PZ0A 2I9EA 3QYQA 4ZQMA 3EB4A 3AUOA 3UNDA 1XSIA 1O1HA 3W6YA 3WEOA 1ML1A 2V81A 3NGFA 2CLKA 1NIUA 2OT1A 1KGXA 3ISIX 2CLOA 4LRSA 1XDLA 3LRKA 4AX6A 5D8ZA 2FVMA 5KITA 3NXFA 1F6YA 1KLZA 3CYJA 5A6MA 1UKPA 4W7VA 4PMUA 3THCA 2J8GA 4B9YA 2CEQA 4Y7EA 2O9RA 3AUJA 4NZ3A 5LA0A 1TVNA 1BEUA 3UPBA 3W02A 3VD3A 1S39A 5SWUA 3IVSA 4Q4RA 1MUCA 3G1DA 4LUIA 1DJWA 4UTWC 2DZWA 3A23A 1RR2A 3BMVA 3AHVA 1Z42A 3KLKA 3WQCA 3L66A 4W4QA 3HO8A 4Q8QA 3MUXA 4M1BA 3ZM8A 2I9UA 3GTIA 1H11A 1CXKA 3NQDA 4IMCA 3RUBL 5HR6A 1LTDA 1E0VA 4ZO7A 3WENA 2PODA 5DT5A 1LT8A 3WG6A 1W31A 4JKMA 2WNZA 3HPXA 3UEQA 4OBTA 1B4KA 1QT1A 2GGEA 5I03A 3KHJA 1X1ZA 1SSDA 1Z7AA 3U5YA 4WVXA 3MZNA 4PN2A 1FHUA 3LZ3A 3EYPA 2OKOA 2CXGA 3GR7A 4JQ1A 3ZVHB 5LHEA 4I90A 3VPLA 4LTSA 3QKEA 3S1UA 1QRQA 2Q8LA 3TUUA 2UY4A 1EUAA 5F4XA 4UZUA 2IPFA 3FN9A 1GOQA 3SJNA 4PBEA 1PIGA 2E8ZA 4LYRA 2ZX5A 3PZIA 4HBKA 2BHUA 1XHGA 1UG6A 1R5YA 3GFZA 3BSGA 2D69A 1RPXA 3STEA 3W2NA 4IPJA 4BKNA 3DECA 3APGA 3TJXA 3ITXA 2ZZ2A 1NQKA 4BI7A 1A0DA 2BZNA 1W1PA 4D6HA 3TN3A 1J0IA 4HU4A 3HIJA 1CDGA 4FXJA 4G5DA 4IXHA 2VXNA 4KESA 4HNUA 3ENLA 1ZP4A 2B0MA 4F0SA 4XO7A 1NP0A 4GA8A 6TIMA 2OFJA 5DMYA 1H5VA 4UCFA 3S42A 1FDJA 5ECUA 3RF9A 2P3ZA 1E6QM 3HG2A 4RR4A 2ZUWA 4Z17A 5HWMA 4X2RA 1A5OC 1QOXA 4CCZA 1FBAA 3OYXA 4XZIA 3SURA 1F05A 1ZTVA 3WZ0E 1TPDA 1S3HA 1W3IA 3NM1A 1OX4A 4LF1A 3B0PA 5FJTA 4IFOA 1DIOA 2PTDA 3G1VA 5HATA 1CXFA 1AMYA 4RPQA 3FX4A 3W87A 4HPHA 2Q09A 4UC5A 1Z32X 3N73A 3SQMA 3DX5A 2YBVA 7ENLA 5FOOA 3SECA 2CIPA 4ZOBA 1P4CA 4CQ8A 2BS9A 4DO4A 1EPVA 1MUWA 1FWRA 3B8UA 5TNVA 4N9CA 3IVTA 1GZ1A 4L9ZA 2PWUA 3AYSA 3TYZA 2XGIA 3AS0A 2FDMA 1EQPA 1KXQA 1S5WA 2ZUNA 3C0SA 3H2CA 4Q4SA 4D6FA 2YKKA 3QW4B 4IP5A 3UW6A 1VEMA 4KPLA 3UETA 4Q22A 1I60A 1LOSA 5CPOA 3LRMA 4RE3A 6PTDA 1KBKA 2V3EA 2HROA 2P5NA 1AJZA 2ZQ0A 2YDQA 4UQAA 2JGQA 1KV5A 1ZLPA 3LSCA 1BYDA 3KVKA 5XINA 1RBOB 1D9EA 1T6MA 2CHOA 3BAKA 5D2YA 1E9ZB 2VR4A 2OQLA 1PWLA 4H2HA 4IUGA 4WKHA 4ZTYA 3AS1A 3A47A 2BX7A 1WKYA 5FEZA 5DEZA 1FWSA 1JQVA 3TSMA 3P3BA 5DLCA 4Y9MA 4QBXA 3R6IA 3VIOA 3GIQA 4GRSA 4JOMA 1BHGA 1KFKA 1KQYA 4YVPA 3RITA 4MG4A 2WMKA 2DZVA 3S1XA 3GO2A 1X6LA 2NV9A 4TR9A 3M0LA 4Q4PA 5D03A 1UJPA 3K4AA 3QKZA 3GXTA 3TR9A 2NV1A 1IIGA 3KP0A 4EPEC 4GFIA 5HULA 4QXIA 3QFWA 5I09A 5K4XA 3BOXA 3ITVA 3WNLA 5F4SA 3QMRA 3U8GA 3GY1A 4EAMA 4YPJA 4KETA 1JXKA 1L9WA 5CGQA 3MUZ1 2PDLA 1O1ZA 4NXSA 4AD1A 1R3WA 1NJJA 3IJLA 3L4VA 2V3DA 3RO8A 3T09A 4HMEA 3ALFA 3VINA 4XB3A 4I3GA 4CQCA 2VTFA 1CX9A 3FXGA 3F2BA 3O9NA 4JTHA 1U2YA 3EOUA 4AH7A 3TE9A 5DFAA 5CSSA 4ZA0A 4DUOA 2I5QA 2YA0A 1A5NC 4LUSA 3C2FA 4PMXA 4FOKA 1UKOA 1U83A 4CVUA 1B3OA 3QVQA 4J3XA 1P6BA 1HVXA 4C6JA 2RJHA 4UMCA 4R33A 4O8AA 4JR5A 1AH0A 4OFCA 3VMNA 3B04A 1M53A 1KKRA 1BVWA 2JK2A 3TH6A 2EQDA 3E5BA 4IGSA 1IWBA 5TD4A 7PTDA 1KNWA 4IX2A 3TTYA 4GVIA 4TVCA 3AYRA 2GDUA 1V5XA 1QHOA 2PWGA 3BMXA 3EXSA 5I23A 4G6CA 1QW7A 1H51A 1UWTA 1EXPA 1K02A 3TMLA 2E7FA 3DOPA 2RJGA 3TN4A 2W0UA 3QV8A 4J9JA 5HQEA 4OIFA 5BXTA 4XAPA 1R8LA 4FO4A 3FEQA 1KGWA 3N12A 3TYCA 3TW6A 3GNOA 4X61A 4KEMA 1E73M 2QUUA 3AMGA 2QCLA 2VJXA 4PB5A 1EJSC 1FH9A 2FJUB 4WOQA 3R94A 1AFSA 3MCNA 1RY0A 3GSMA 3NZPA 3LBCA 1WBJA 4P7OA 4YCPA 4O0ZA 3VKCA 4EIVA 4I7VA 2QJMA 1FWAC 1F9CA 2CWXA 4M0XA 1VIZA 3PULA 1LT7A 4KRUA 3GNPA 2BDQA 1Z89A 1J10A 3BLPX 2C8NA 4YWIA 1KCZA 1JDEA 3BLDA 3R7MA 2G96A 4JAWA 5BXSA 1KCXA 2YDSA 5AC5A 4AEOA 4CQAA 3QW3A 2ZXQA 3WQVA 1WXZA 2ZKMX 4KCUA 2WXDM 3SRDA 3TXZA 3VD7A 3L0KA 4MGGA 3C2EA 3QR0A 3EEGA 1UH4A 2V38A 2YB4A 3ZQ9A 4EXAA 2P50A 1RH9A 4Z42C 4DWSD 1NH6A 1QI0A 4F3HA 3EOOA 3BAYA 5REQB 4NJJA 5E9AA 3LGGA 4AAJA 4FOJA 1KRBC 1ITCA 4CN1A 4QGCA 4MDPA 3Q2DA 3N4FA 1OG0A 4TVDA 2NT1A 3N1AA 1UR0A 4J27A 3DC8A 3W7CA 3AJ7A 4K8HA 4Q7NA 4U10A 1ELSA 4CGTA 3TR2A 5KETA 4IXXA 3R8RA 1BGGA 1DJYA 3VGBA 3BAWA 3RO6A 4AD5A 3BLOA 3RCMA 1I2RA 3EDEA 3PS7A 1S46A 4C1LA 4V27A 4C6PA 1W9XA 3MV11 3EA1A 2QKFA 2FHFA 3G8EA 3RPTA 2C0HA 1GYLA 2NXIA 3IWPA 3BTNA 3RCNA 3KVLA 2ZBTA 3PC0A 3KDOA 3W4RA 3GG8A 5B7YA 1RBLA 3O06A 1NDWA 2E09A 3CGTA 4POCA 2Z24A 4JN6A 2CXEA 2WW5A 4MMWA 2WSKA 3KL5A 1UWIA 4OBRA 1EO5A 2B7QA 3FJ6A 3SW6A 4AZCA 1CGUA 4HZ6A 3NQ2A 2Y7EA 2GJXB 2BVYA 1Q4NX 2G3IA 4REQA 3FJ4A 3M0ZA 5DT7A 3GUGA 1LLOA 2CYGA 2Z2UA 2QMKA 4JTFA 5C9UA 1M65A 2HXTA 2BXZA 4B4FA 3SZ8A 2E68A 1FDYA 5A2BA 3MKCA 4GH3A 4WSKA 3W83A 1W1YA 4GIAA 4HJWA 2YZRA 4K37A 1KM1A 4X63A 4J3ZA 3L5MA 4O4WA 4ZODA 3B9AA 1TTIA 3S8HA 4JX4A 6REQA 4O57A 1TWDA 4A6GA 1VC4A 4IJRA 5D05A 1W17A 4RZ4A 1KQZA 3HG4A 1B31A 3ME3A 4CQ9A 1U1JA 4A3YA 1KFBA 1S2UA 1XLBA 1OD0A 4N4QA 4AF0A 1Q85A 4TV6A 4G1KA 1TV7A 4BWLA 3TSDA 2Y1HA 2PDQA 4BF5A 1EA0A 2GYIA 1GOKA 1W5QA 1J18A 3BLLA 4ZVJA 3UXDA 1O6IA 4KEVA 3H6OA 1EB3A 4AHOA 3UD6A 1DJXA 2FZDA 2GVYA 1WOBA 3W7DA 4KW2A 4JCMA 2WB5A 2TPSA 1FKWA 1H1NA 1EGVA 3CZLA 1LL4A 3E0IA 1GW9A 4JDYA 3UPWA 3R0UA 3TONA 2D73A 5K2ZA 1G94A 1UD5A 2QF7A 2YJQA 4UOJA 3EDKA 2DUAA 3CAVA 3VE7A 3IACA 3W00A 4KS0A 4ZGYA 8CGTA 1TWZA 1CPUA 3T8QA 3TW9A 1VB9A 1VZWA 3GE7A 4J3SA 1OC5A 2AL1A 1JVNA 4M56A 3LI1A 1IHIA 3CWNA 1UOKA 2YCLA 1NFGA 1OF6A 1J0KA 1EFZA 3MKVA 4OOZA 2DVTA 1VPQA 3UA4A 3HQPA 1NQ6A 1AW1A 2GOKA 4RDVA 3GC2A 3FJNA 2B31A 2A79A 4JNYA 4MUPA 2C71A 5EKYA 3KTCA 5FESA 1EGZA 3VK5A 4O18A 1OCBA 3U3HA 3SCNA 1S1PA 1MW0A 1HIZA 2X1UA 4FA3A 2WNNA 3ZS4A 5BROA 3R2GA 2NSOA 1KFEA 3AFBA 4AZHA 3ARQA 5C54A 4L6OA 5KZMA 3FNDA 3M0YA 5DQPA 3ZIZA 1BPLB 1RBAA 4AY7A 1PKLA 4AMAA 3Q45A 2Y61A 2ZICA 1QPQA 5C2CA 1LM1A 3W6LA 1W1ZA 1WB0A 4R53A 2DORA 3HGJA 4OKDA 2PWDA 2J7BA 1IZJA 1BTCA 1DE5A 1SZGA 1PZ1A 3I3DA 4B92A 1A3WA 4A05A 1QI2A 3TX9A 4M82A 3AC0A 3PWAA 4B3KA 3HPFA 3KBJA 5JIPA 5FEXA 2Y5SA 3DBPA 1VEPA 3M6YA 2A3AA 4AZBA 1UC4A 3LCXA 1XYMA 1GVSA 4WR3A 3WNKA 2ISVA 4QQ3A 3UZWA 3ES8A 2L5HA 4MPKA 5I2UA 4Y9PA 2V67A 5HAOA 4L1XA 2WPBA 4HU3A 4S2CA 4ZOCA 1ZUAX 3RPDA 3M07A 1X96A 3Q67A 6CGTA 2G50A 3VD5A 4DJDA 3F5JA 4ADUA 3G1AA 1DBTA 5U7SA 3W73A 1UB3A 1E72M 4O1DA 1P43A 4JTGA 5CZ0A 3N4AA 3LBOA 2WJDA 3U57A 5ECVA 1MWOA 2PGRA 4FR6A 1GVOA 4DO6A 1UC5A 4NX0A 2TAAA 1IQ8A 4KGJA 3K1GA 4LGXA 1KBJA 2PDWA 2W3ZA 2ZDSA 4U5IA 3NXLA 4NRRA 3ONBA 3P81A 3I6EA 3PPCA 2DSKA 2BNJA 1IXNA 4ZXOA 3V35A 1A5AA 3VNJA 2VL4A 2VO5A 4LS0A 4LVAA 4XKYA 1CGXA 1KM2A 2D24A 1A3HA 1DWJM 1QNVA 1VBJA 5I06A 3NQEA 1G7UA 4MY8A 1H41A 1W1B1 1OFQA 3VAVA 3SUVA 2OEMA 4GYPA 1US0A 1US3A 2DH3A 3M0MA 1LRQA 2W6RA 4L1GA 1XIGA 2ZCGA 3I10A 4KRTA 2PU0A 1MDRA 3LMZA 5I6SA 3QHOA 2DSVA 2P1FA 3N6QA 4DLMA 3KS5A 1TR9A 4DJFC 3DKJA 1SFSA 4L1WA 1CXEA 4H00A 1YHTA 4XX6A 3WIJA 2PZNA 1A5LC 1ZZMA 1BXCA 2CBIA 3PJWA 2XH7A 3EEZA 5CGTA 1JCMP 1J01A 2YYUA 3FOKA 5DO8A 5EMMA 4OT7A 3U5UA 3STGA 4WEVX 2VEIA 4LC8A 1OF8A 4M29A 1JULA 2PF8A 4YIWA 1GPWA 1IWPA 1MQQA 2VDHA 3CV1A 1KD0A 1JRBA 2PGEA 3BGJA 4WSJA 4DNMA 4J4KA 1TMLA 3NG3A 3PTDA 3N2BA 4Q33A 3JW7A 3V7PA 1D7KA 3IGXA 3OHMB 1D7FA 2JEQA 2FTYA 4ZSUA 3HGSA 4GBDA 1G9HA 3NSNA 3IJQA 4H9ZA 3W25A 4QJ3B 3M44A 4AWTA 3NOEA 1A49A 2WWCA 3LTYA 4HU8A 5E0FA 3NYZA 5XIMA 4RK8A 5A8MA 5I3IA 1EWDA 1Q65A 2ZZ3A 3VKBA 2RUSA 3IJ7A 2I17A 4JTEA 4P8XA 1ADSA 3BDKA 3N34A 2PTZA 1CECA 4L80A 1FCBA 1JJKA 3II1A 5BNKA 5HNRA 4YXGA 3MO4A 2NUWA 1TZ7A 3EX1A 2YW3A 3RN6A 3MCOA 2NX3A 2P76A 3FJLA 3S1WA 2Z29A 1E1CA 2HVMA 1E6PA 3QPEA 2RH9A 4TVUA 3B0YA 4DYJA 4H9UA 1W5OA 1JQXA 1JL8A 3PP7A 4B3LA 1K8CA 2UY3A 4L9XA 5CQ1A 1V3IA 2V30A 5CZJA 5LYRA 1JZ5A 4HHPA 1T41A 1RY8A 2PAJA 3UERA 5I3JA 1ZBVA 3C61A 3EXRA 4O28A 5GJNA 3EWCA 3LPPA 1LWIA 1V0KA 4J3UA 2VELA 4PMYA 2HJPA 3B8SA 2FYMA 2HK0A 5F2LA 1V6UA 1XUZA 5A3HA 4P8VA 2ZRYA 2RGLA 3W27A 1EJTC 5FD0A 3TC7A 3AOFA 4JX5A 1WDRA 4S1FA 1KWGA 4TMBA 1B90A 3G0UA 4IP4A 4HZ7A 4LANA 2B81A 1XX1A 3TAOA 2A3BA 4AG0A 2XH2A 4PUEA 3V5CA 3ITLA 1JEZA 1VFFA 2G95A 3JRKA 4URIA 2A6NA 3VOCA 3DKLA 3HTWA 1KBLA 3D46A 3WJXA 4JCLA 3PJTA 3PY2A 4MB5A 3OPSA 3H53A 1W3NA 1UW9A 3UWEA 4US5D 4LAMA 4MWAA 1R2SA 4RKAA 1HW6A 2OYMA 4WDTA 2HPIA 4JN7A 2E8YA 1B3YA 2GFTA 5BYWA 4FLQA 3AROA 4H9TA 3SIZA 4LVDA 4OBSA 4CNPA 3SN4A 4AZIA 2VFEA 4TIMA 3W22A 3CHEA 2J7FA 3E0WA 2D20A 3HM7A 4P5UA 5DCEA 3VIHA 1Y0EA 9XIAA 3WQDA 5AVNA 4PODA 3WDIA 3U4FA 3UU0A 2NSXA 4UWMA 1O94A 1NOFA 5AZ0A 3TTSA 3V18A 4Z0SA 1T8QA 1GQJA 1UPMB 2X05A 4ZO8A 3TCEA 3BWWA 2WOQA 3EPNA 5HPOA 1HKIA 5GJPA 2X0HA 4XUGA 3UWQA 5HMSA 2R1LA 4TQTA 1ITXA 3WQOA 4DBWA 3CNYA 3IJ8A 4E2DA 1SJBA 3T42A 1UASA 1X38A 1SFJA 1E6RA 1JR1A 3AHXA 3W7JA 3L4WA 1NFBA 3H24A 3W1AA 3SDOA 2O4QA 4IIHA 4LNCA 4M6VA 7XIMA 2Z1KA 1E40A 1QPOA 2EJ1A 3APYA 1JDFA 2W66A 2DT3A 2ACRA 4UBPC 2VZTA 1ODUA 3CZ8A 3G1RA 4I6VA 1UD2A 1AH4A 4GY7A 4UTIA 3CTTA 4EF9A 2DT2A 4LS1A 3ZLHA 3CT2A 2R1KA 1NM9A 2LLEA 3LNMA 3L4ZA 2HNHA 1VFLA 3CAKA 4NX5A 2VFDA 3H70A 4PMDA 3IEBA 3VIKA 2E6DA 4AW7A 1NWTA 2GQAA 2WHLA 6XIAA 4A3UA 2BFGA 1ICPA 1NP2A 4LCSA 4ATLA 2FPVA 4GI6A 1BXBA 1OZMA 5XIAA 4AF0B 5LIXX 1XLIA 2O9OA 1X8CA 3NFUA 3PUGA 3ZFHA 5LIWX 4N42A 4UIOA 1J9YA 4A3QA 1OK4A 1EX5A 3A3HA 3LHWA 2VI0A 3BVJA 3SRKA 1EDGA 4KIEA 3H7RA 4B5TA 2VX7A 2NZLA 3OVGA 4IMEA 2YL9A 2YDAA 2BY3A 3VKJA 3DAQA 1I2QA 5LNSA 2WSRA 3LM3A 4ZEPA 2FB3A 1FX6A 2WK2A 1W3KA 3PZUA 2XFFA 4ZCWA 1JCXA 1PL9A 2XIQA 3RX2A 1AQFA 2VZUA 4Z1CA 5EB8A 1J6OA 5H91A 3IAQA 2C1IA 3UG5A 3AAMA 4CU6A 1S2CA 1OABA 3WELA 3TDFA 2F61A 4PR4A 1HL9A 1SPQA 2YCLB 3ITTA 4ZR8A 3NDYA 2Q6ZA 3IUHA 6ENLA 5C2GA 4B2DA 3WLHA 2BV9A 3EOSA 4R27A 2VEKA 2F2HA 3W7MA 3QMSA 3CPUA 1DXFA 3T8LA 1RA5A 5G1TA 4C6DA 4JTRA 3WUBA 2JIWA 1SO4A 5TAOA 5I0DA 4QAIA 4LUTA 2GLKA 4AZ6A 1TRDA 4UFKA 1GJWA 1V6YA 3PG9A 1UYQA 1MEHA 4Q8MA 1M68A 4YTTA 4LBRA 1B3XA 1THFD 1K70A 5M5DA 1ZJHA 1ZAHA 2ZA3A 1U33A 1P0KA 4K36A 3UPMA 3LEPA 1VIWA 4RV3A 4ZFMA 2XGZA 5CSUA 4QROA 5IBXA 3OYZA 3THAA 4BA0A 2QVNA 2FKPA 3EOLA 2JKAA 4NAFB 4PULA 1A80A 3EKLA 2DVUA 1WV2A 5HWNA 4ZO6A 2RDTA 1QO5A 1SZFA 2QEZA 1DIKA 1UWSA 3POCA 4PMOA 1JGMA 1F3EA 5A8NA 3W7NA 2DH2A 5D38A 4C6OA 3UJFA 1C7TA 4BEQA 2YA2A 3M1ZA 1GKPA 1XPYA 5JQ9A 3P6LA 2QDGA 4GKLA 1F74A 3VIJA 3AMLA 2J27A 2Y4SA 5LNUA 1MW2A 4GO9A 3PJUA 3QTGA 3RMJA 3DH7A 4JNZA 1UWQA 2RDUA 4K1GA 4UOZA 4NI8A 3VIPA 1Q6DA 2BVDA 1DWFM 1D3CA 4PMRA 3V1PA 4F0LA 5LIKX 2FVLA 3F2CA 2X7VA 3HBLA 2QPXA 3ATZA 2J9XA 3GDRA 4HKPA 3O2LA 2OO0A 3UCCA 3A6OA 5HNUA 3VILA 1HGWA 3GXNA 1F5ZA 1PTAA 4RE2A 1R87A 2A3HA 2QDDA 2MNRA 2Z26A 1UH2A 2Y63A 3GU9A 1N55A 1TR1A 2CC0A 2PD9A 1YYAA 1LUCB 2J79A 3PBVA 3ZJ6A 4UUIA 5D09A 1VQTA 1WDPA 3ZWSA 4JHMA 3K1DA 3WMLA 1N2VA 5AC6A 1H0IA 1XYCA 4MWAE 3W86A 1ZBWA 3VX0A 1O12A 4AD4A 1JZ4A 3ZJ8A 3UFYA 2Y8VA 5FCZA 2GDVA 3OODA 4V1YA 4CUCA 5F2IA 1KM6A 1PS9A 3OLDA 1DJNA 4C65A 2O7SA 3G24A 1FDZA 1KRAC 4AZ5A 4UFHA 4HNLA 2C91A 3HGOA 4GX9A 3GVQA 5K4ZA 1PEZA 4AU0A 1DYSA 1G5AA 1TELA 2NUYA 3EX3A 1KA9F 1QMLA 2VUYA 2DT0A 3FAWA 2DSWA 2DJXA 3FGCA 4QS5A 3IV8A 3DFPA 3WD1A 3L9CA 4XQ6A 2VRQA 2TYSA 1EC9A 3NQGA 3VOJA 3QXBA 3BGGA 3SCPA 3UG4A 4Z2IA 1SW0A 4O0QA 3M9YA 2Z1XA 3F4NA 4L4MA 3NEVA 2HPMA 1W32A 3S6DA 4UTLA 3QSRA 2XU2A 5AY7A 1F76A 4QE1A 1QBBA 3AIEA 1MRQA 1A53A 1TPWA 2XWEA 4W9TA 4W84A 1LYXA 4OUEA 1E51A 4DWSC 3BQ6A 4RXGA 4UQCA 1TA3B 3VOGA 3BCDA 1EF3A 3TQ0A 4GYJA 3WFZA 2UWFA 3LXCA 4MZ1A 3A9IA 4JTIA 2C15A 1OFRA 3PZVA 3AU2A 4YLWA 4HHLA 2XSAA 4MZ8A 3CHCA 4Y8EA 4C6FA 1ECEA 1CXIA 4XBSA 3RIKA 1PDZA 2QF8A 3ZT5A 4IL2A 3GTNA 1VRDA 1K6WA 3RR1A 2XINA 4HYVA 2G3NA 1S5TA 1NWRA 1H0GA 3AHYA 1JI1A 1T99A 2GVLA 3WQ8A 4DLFA 4ZB0A 2YL5A 2OO6A 4LC6A 5CSRA 4NJKA 3WYZA 2J13A 1AA1B 4WY0A 4JD4A 3IJ9A 3KDNA 4EX4A 2GQ3A 3VOFA 1SZNA 1V3LA 4FALA 3CUIA 3IAPA 1EEPA 4HOXA 3RU8X 3B8DA 1BRLB 1J6PA 4XTIA 2F6XA 1PIIA 3L2LA 2X1RA 4QG6A 5G2WA 5D4YA 1M5WA 1FWWA 4CN6A 2YPIA 3GX9A 3SADA 1ISZA 3LHYA 1HL8A 1V7YA 4QR6A 4UTWA 3GW0A 1KKOA 2X16A 4DO5A 4C7FA 2H9AB 4OE7A 3B8WA 1OFDA 5FA5A 4LOCA 1PHQA 1XCWA 1YLVA 4GQRA 3E74A 4FF7A 1R0MA 2OSYA 3WH9A 2POZA 1L8NA 1YDNA 1TQJA 1ZSXA 2BGNE 1VR6A 1FWHC 1VFUA 3CAQA 2A4AA 3MMWA 4KCVA 3D6NA 1VJSA 3NAVA 1LWHA 3VDGA 1XH0A 4QQUA 3GVRA 4LWWA 3ARWA 1UD6A 3CO8A 4TX6A 3NPWA 3T05A 5HR7A 5FJJA 5A8GA 5BRPA 1KR1A 2VEGA 3UJRA 1TQXA 1W3TA 3AYVA 1UP2A 1PCKA 1TCMA 2FFCA 3QTPA 4H7CA 3MSRA 1CENA 4KWVA 2GGHA 3DYMA 3LI0A 4A8RA 2PDCA 3AIQA 3W7KA 2Y8UA 5H8PA 4MSSA 2D2GA 1XDJA 5A6SA 3CL6A 1TG7A 1HG3A 3VNYA 4GLEA 1A3XA 1LROA 4M81A 2GJLA 1H7RA 1TKKA 2E1WA 4PTWA 3UVIA 3CU2A 4XSMA 2ZX7A 3AXKA 3S6OA 1DHPA 3BOLA 2EBNA 2PP3A 2V2CA 2FGLA 3UJEA 3CB3A 5LIYX 3CMJA 3R79A 4FS9A 3FDKA 5CBIA 3VM5A 1Q6GA 3FLUA 1PTDA 1O68A 1EZWA 4B3ZA 2DIEA 1X8FA 2QJIA 1XIFA 3EXTA 1TMHA 3CH0A 1S2WA 2BXYA 4K8EA 4QLJA 1R3RA 1E71M 4RE4A 3WO8A 2QAPA 4WQ6A 3ERPA 1TWIA 4R88A 1QJWA 2R91A 3P62A 4W87A 4LAZA 4GO8A 4AWSA 3W1PA 1HUVA 1NU5A 1QDSA 5ABGA 4AZGA 1W8GA 4OTKA 4N7QA 2Z1BA 4S3FA 4ZE4A 5FSEC 1C93A 3CUZA 3PFRA 3GTHA 5KEZA 4MNLA 1R30A 2J7HA 5F2GA 3N6JA 1YKWA 4QEEA 2WC4A 2J6VA 1MZRA 1YX1A 1TPH1 1G0CA 3LTPA 2J8FA 3ECQA 3PBMA 1LCOA 2ADAA 3WLNA 1R7AA 4ML9A 5A69A 3AIWA 3L2IA 1SMDA 1KGUA 4GUGA 2WBKA 1XLFA 1NDZA 5LNRA 5AVHA 3MJMA 2EPKX 3PB2A 3UR5A 5IHSA 3NSMA 2VFFA 4NJGA 5AYIA 1SZEA 2J66A 4E5TA 2PP0A 4DBEA 3F03K 5I78A 2I5IA 1WAUA 1QOPA 5E9XA 4M8UA 5I7GA 1EC7A 2HS6A 3GFXA 1ZJIA 3S5YA 1UD3A 1CBGA 1D3HA 1PVNA 3VCNA 1W91A 1KC7A 4GI9A 4N2YA 3H22A 1V3JA 1V03A 1YNPA 4J1OA 2PLCA 2IKGA 2YW4A 3O8AA 4F48A 2ATSA 1XSJA 3WJSA 1P5BA 1DOSA 3H2MA 3L5AA 2VP8A 1UBPC 5FIPA 5DRIA 4LX4A 1MVYA 1XYAA 4HOZA 3TC3A 2HVOA 3UR2A 1E55A 4GACA 4HU0A 4FPSA 3O16A 5A6JA 4KMQA 4PTXA 4Y90A 4ZFCA 1M7PA 3CTLA 3MTWA 3O15A 4UQEA 3RG6A 4C5YA 2ZRVA 1LLWA 5L6UA 1JUEA 4Q8PA 4LUTB 4N0RA 2Y5JA 2BSLA 4P8UA 4AEFA 3N14A 3NIYA 2PDMA 1PE1A 3USBA 1F3TA 2TODA 4IQDA 3FFSA 1BG4A 2J78A 1ICQA 2BY1A 4TTUA 2J7DA 3UQNA 3V16A 1Q7MA 2YYTA 3GYEA 3BUVA 4QE5A 4LT9A 1CGYA 1JGIA 1K1DA 3H4GA 3G3MA 4MB4A 3K8MA 2QPUA 4H83A 2YGYA 3WL0A 3M46A 3S4TA 4NKCA 1EYWA 4DI8A 3W81A 3A4WA 1KM0A 3KL0A 4WDXA 1XBVA 3S5OA 5CC6A 4DM1A 3P7YA 3OZPA 4IGMA 1MFUA 5HOSA 1OC7A 4LH8A 2XSXA 1HKJA 1T40A 3A4JA 4HYWA 4ZBCA 3QEZA 1PZ3A 4DF0A 3A5FA 1XD1A 2QUNA 3WNOA 3ZVIA 4RX0A 5LXEA 3ABSA 3WQ5A 2FZBA 4ILSA 2BY2A 1TB3A 1NY1A 3ABXA 1KTNA 2OSXA 3DYOA 5E6ZA 5FI8A 3EPOA 3E0VA 3E2RA 2E5DA 4PCSA 4MJMA 5DF0A 3G0XA 4Z1DA 1E5NA 4H8NA 1P0BA 3L68A 5A6BA 2J62A 1KXHA 3G2GA 3RMEA 3EMQA 5LIUX 4Q4QA 1A0EA 1I1WA 4H8UA 5T26A 4IIDA 3W3OA 3KOYA 3CUGA 1TRIA 7A3HA 4ZMGA 4F0HA 2VGGA 1QOQA 3WD2A 1VFTA 3WDRA 4Q7IA 3B40A 2GUUA 5I3FA 1DWIM 3TMQA 4I9JA 1C29A 1ZS2A 1WBHA 2DSUA 3ONCA 5FKYA 2ABBA 4NNBA 3UR7A 1GQNA 4QG8A 1RD6A 3M41A 1MRAA 3KZPA 1HN1A 2GGJA 1C90A 2YB1A 2ZE3A 3CUFA 1NOWA 2P10A 1GOMA 2OEJA 3C3UA 1YTEA 5CPTA 2GWNA 3CV7A 4FXRA 3F4DA 3WFLA 4QDPA 1BYAA 1K8XA 1VLWA 1PB0A 1D2KA 1I2OA 1D8WA 3PSVA 3EKZA 4JTLA 4AVOA 3TSBA 3AXHA 5F1UA 1O5XA 3W1UA 4PTNA 3WLJA 1AW2A 4KBXA 4HYRA 4QHRA 2FZ9A 5D32A 2QV5A 2QT3A 4GE8A 2UV8G 3LHTA 3ZLFA 3NR0A 3PBGA 5EMJA 2MANA 3NZRA 4AY1A 1T8XA 4LYQA 5D2XA 3GBEA 4H6EA 1V6WA 2F6UA 3M0IA 3TTOA 3UXIA 2JFEX 4JL1A 1OFAA 2VOMA 2H3DA 2UZ9A 2C6QA 4E4PA 3FK4A 1DJGA 2IS7A 4FK9A 4Q8OA 4ZQPA 1OM0A 2Z2AA 3HGRA 3R12A 6XIMA 2YA1A 1V3HA 4MJ2A 1MNSA 3RNDA 4JYDA 2V82A 3A22A 4H6QA 4MTVA 4ZQRA 3P8JA 1ITQA 5C9ZA 1P1MA 4JPGA 4H01A 1E6SM 4LW7A 4CNOA 5D9MA 2OG9A 3PPFA 4WJEA 4EKJA 4K3ZA 2GDQA 8TIMA 4ES4A 1R2RA 3P67A 2G5WA 3E02A 4S3JA 2WANA 2OYLA 4ACZB 1GQLA 3WMBA 1IWAA 2ZVRA 2ZUTA 3K30A 1FCUA 3DFNA 5K9DA 2HV5A 6TAAA 1OGGA 7TAAA 3L67A 4N9EA 2NQJA 4L4PA 5C7VA 4XKMA 2OX1A 4FLSA 1QI4A 3CH9A 3GR4A 1LL7A 1YXCA 1R46A 2XN0A 2OB3A 5A6TC 1TE1A 3KCOA 4WY0B 3NCOA 2J77A 1V51A 1ONRA 1OFOA 3OBEA 3WNNA 2V5DA 5KSWA 2OSWA 2TRSA 1F07A 3PHAA 5A6KA 5K7JA 5RUBA 5G4HC 1X97A 4J5NA 3CYVA 4LALA 4C6KA 3OBAA 4MAZA 4NRSA 4KFOA 4DJEC 2ZX6A 3MV01 3USZA 1Q6RA 2PDXA 3ZSSA 1XP3A 4FIRA 5CBJA 3WN6A 2DIKA 5KINA 3WF0A 1RA0A 3VNKA 3AXIA 4IJBA 1OQFA 3LTSA 3SY8A 3M43A 1Z41A 1CB7B 1Y7VA 1P7TA 4S3DA 5I02A 5AN7A 3ABZA 1QCWA 2PTXA 4LU0A 5F7UA 1V7AA 3VNZA 5EA9A 3LCGA 3STFA 2PP1A 1LLZA 3HPSA 3W71A 1VLIA 3OBKA 1EOMA 3UXAA 1POKA 4ZSTA 3UNTA 4J2PA 2OODA 3E9AA 5JBFA 2EJAA 3HFYA 3BCFA 2B7OA 2NX1A 3GWQA 1E56A 4LS2A 1EJXC 4PEEA 3RLHA 4GUIA 2AL2A 2ZUSA 1OIMA 2WCAA 4K1WA 1TTJA 2CZFA 3TZFA 3JS3A 4GHRA 1DP0A 2PGFA 1KCKA 5CJNA 3B9NA 2OMAA 3KP1A 3KBWA 3GG1A 4B91A 2VVSA 1CWYA 1JCJA 3WQEA 3OB8A 1XPGA 1UKTA 4XV0A 1AQHA 1GWJA 3H8AA 2QZRA 2ZXAA 4DN1A 3L4XA 1AW5A 1TJRA 3LERA 3EWBX 2J6XA 1GOWA 2W91A 5LKYA 2NQ5A 3P80A 3W26A 4PH6A 1YE4A 4UFJA 2FTPA 2Y85A 4KFPA 1RVGA 1GOOA 3C8FA 1WNOA 3BLEA 5EYWA 4F8XA 1TMQA 1B3WA 4L5ZA 1UUQA 3SEPA 1RLCL 3TFXA 2PEVA 1NDVA 3B0VC 5J5DA 1J0JA 3BMWA 1J0ZA 4JIRA 3SRFA 3PJXA 5K9XA 1POJA 3RU6A 1EP1A 1I45A 1EUNA 1EJWC 4GZJA 1EJRC 2DZTA 4JX6A 3EPMA 4X9SA 3KX6A 4FOUA 1BKSA 3KWXA 5FAJA 1S2TA 2E5BA 3AMKA 3QGAC 3KWSA 1E4MM 1FWDC 1B9BA 2A6LA 4YTQA 2OKTA 2NQZA 3GVWA 5A2AA 3WUEA 2D2OA 2QV4A 2I16A 1VPYA 3F2DA 1H1ZA 3NA8A 4I6KA 4AHQA 1FXQA 5CC5A 2QNEA 1DXIA 3R0KA 3RPMA 5AECA 4R7JA 4WF7A 1V8EA 3VIMA 2VDGA 2ZUVA 1OINA 3P14A 1G7VA 3MVIA 3U0HA 2C13A 4WGHA 4A8LA 4YU1A 1J0HA 4PRWA 3PZTA 3B97A 1VHNA 4WSHA 1IIHA 4I7UA 4JEQA 1PKMA 2NQ9A 3FSUA 3WNPA 3NZ1A 2DDXA 3VCCA 1ME8A 4OU1A 4DBUA 3N2CA 3W82A 4DF1A 1E15A 1AH3A 2XTKA 4DYKA 3L4YA 2PBGA 4CKQA 1HTIA 2ZRXA 1UKSA 3TXVA 3C2VA 1BLIA 4JY9A 3EGJA 1GORA 2OU4A 3W7IA 3WX7A 5CZSA 4Q8VA 1JPHA 5KZEA 3SGGA 4AX7A 1XI3A 4IMDA 5EMYA 2W4XA 3C2RA 3DFTA 3KL3A 3AALA 3W88A 3SSJA 3ZR5A 3WK3A 4DY1A 4L4OA 4FNSA 2KZHA 1S2VA 3K8KA 3M0JA 4AC1X 3QRHA 1Q66A 3GW3A 1SR0A 1R38A 2ZWYA 4IGHA 4CCDA 4DJFA 3GR8A 3QR3A 2VRKA 4H19A 4O1CA 3UWWA 3T6CA 2WSQA 4GISA 4S3GA 3KOZA 3NYDA 2P0IA 5LXXA 5CCZA 1QPRA 4WX2A 1VJIA 1YE6A 4GOAA 4W8BA 3I6TA 4QLKA 1K3UA 4TTGA 2FFIA 3LK6A 1QK2A 4C91A 4C6LA 4JDBA 2GSHA 4HCHA 5JIWA 3WDJA 3TOPA 1HL2A 1RQBA 3W1LA 1ME7A 3KCLA 2PBOA 3N19B 1B0IA 3MC5A 4EE9A 3WLRA 2E9MA 3IIVA 1SO5A 2PU1A 1MXDA 2CLIA 3CWOX 3T7VA 2XIJA 4M5PA 5MHBA 5A8OA 4NAEA 3WF2A 4ZOEA 1W56A 3EWWA 3TJIA 1YDYA 5E0CA 2NV2A 3CMGA 4GUHA 1W5PA 2PGWA 3VMOA 2VNCA 1W9DM 3MO7A 3WUFA 4D2JA 4KERA 2I57A 3OQ8A 4IQJA 3T0BA 3VKKA 1HKVA 4NU7A 2ACUA 1DJIA 2WPGA 4N02A 3SM0A 2GJPA 4W89A 1Q6EA 3DEQA 1VCFA 5J8LA 2WMFA 3KE0A 5CPLA 4KH2A 4Y8FA 3QY8A 3S0CA 4YTUA 3QPYA 1J4EA 4CCEA 4PGLA 1C7SA 1Z8AA 3O6YX 3W6MA 2PMQA 1LBMA 1J0YA 3VD9A 1XYZA 4S3AA 1EHNA 3NDZA 4DO7A 3ZJ7A 5DBUA 2OT0A 1Q3NA 3AZRA 5EPDA 1JZ6A 4AFYA 3DFSA 3B8IA 3CQJA 5HBFA 2OOGA 4N6FA 2NLIA 5AC7A 1GYNA 1HNYA 3G3DA 4DNHA 1IGSA 2Y7DA 3IIOA 3PG8A 5HK4A 3T44A 1KM3A 3U48A 4E38A 3H7VA 2PDYA 1BQCA 2D23A 1LRTA 3GAKA 3IPWA 3VUPA 5DCDA 1XLHA 3GKFA 2FVKA 1K8ZA 4KWOA 4MKNA 1UUOA 4O8RA 3WJWA 4GD0A 1UQYA 2C18A 3KAOA 2DZSA 5E1QA 1Q7ZA 2XIBA 3W7RA 3UP8A 4FB7A 3HPAA 1LQAA 5GVJA 3MZ2A 3F1QA 5E93A 2R94A 4FLRA 4C7DA 2DZPA 3AIUA 1DL3A 3WDPP 1XC6A 3CZKA 3RFAA 2XIMA 1UCWA 2ZXBA 4AIUA 1Q6QA 1DJHA 3HG5A 1BWLA 1LL6A 1EXBA 1UIPA 3IRSA 2WHJA 2OCZA 1XIBA 3AJXA 3GBDA 2XN2A 5CZTA 3MSYA 1EF2A 2VC6A 4PSPA 4CLMA 2IPJA 3GH5A 2NT0A 1MW3A 5FEWA 1BAGA 3MBDA 3WMCA 5LA1A 3K46A 1XIHA 3MI3A 1FWGC 2QJNA 3ATYA 3WK0A 4XIMA 3N3MA 2F2KA 4NY2A 4DVOA 3ITYA 2E9LA 3L4TA 3GHRA 3MB9A 1RJQA 1HKMA 3V75A 3CT7A 1C9WA 1YTKA 4PUMA 4MNJA 3URQA 1J2WA 4R9OA 4X60A 3GNNA 1VF8A 4YWSA 5FJIA 2W63A 3THUA 4OVXA 1VFMA 3HF3A 3W84A 1KR0A 2WKLA 3IUIA 1XM3A 1K7FA 4PCTA 2QULA 1CGWA 3A4XA 2R1PA 1CXLA 4YNGA 1W3LA 4O52A 4UR8A 3GAYA 4N4PA 2YCEA 4K7VA 3N2TA 5FACA 4CNSA 2VC9A 4WDUA 3SUUA 2INFA 3WJYA 1E6ZA 2OWCA 3NZGA 1V6VA 4DI9A 1SQ7A 4AXNA 2VURA 3EKGA 3CQKA 2AGKA 2BXVA 3GIPA 3H7UA 4Q7BA 4LV9A 1LP6A 4GUFA 2FZNA 4J3VA 5C6MA 3HZ3A 2DZBA 4L6DA 1EP2A 4TX9A 3CL8A 4GQQA 4HMDA 1E1FA 1TPVA 2E1DA 3E49A 1UZ4A 3PZOA 4YN5A 2Q8XA 1JDDA 2VRJA 3SY1A 5AZ1A 1IEWA 3GVVA 2EHHA 3GG0A 4IJCA 4PEKA 4DZHA 3GD6A 3T78A 2R1NA 4NZFA 3QY7A 4GQGA 4NZJA 1AUSL 1ISYA 4RDWA 2DZAA 2F6KA 1MQPA 1V02A 1PX3A 3VGFA 4K39A 2ZXDA 4DIAA 3GC4A 2DT1A 5CJ5A 1BXNA 1Z69A 1UHVA 4LBSA 4JZ5A 3VGGA 2DEPA 4B4HA 4QISA 3FKRA 4IIBA 4R7OA 3R43A 3R8HA 3QBUA 1E3XA 1VS1A 3NZQA 4AXKA 2E6AA 1EPXA 2UY5A 2VGBA 4TX8A 3BW4A 4IP7A 8XIMA 5LNWA 2V8ZA 1U5HA 2DY3A 2I14A 4A3HA 1PCWA 2MUCA 1RXOB 5AHIA 2Y6ZA 1XXXA 1F7BA 1K9EA 2ZZ4A 1RCOB 4O19A 1IF2A 2OWXA 1JXJA 2X2YA 3LCWA 2RFGA 3W24A 4PMQA 3CZJA 1JYVA 2RKXA 1F6KA 3KW3A 3RILA 1EJVC 1XLAA 1E70M 1WZMA 3GZ3A 1B5TA 3CQ0A 4NSBA 3AXMA 2Z6JA 3REQA 2AL2B 1QAPA 3HQOA 4LB4A 2ONEA 5I3HA 2VC5A 3W7QA 3PPGA 3CBWA 3VZZA 2CHRA 2GK1B 3W2LA 5C55A 3FDGA 3FVDA 4HOWA 5BWAA 1GYMA 1ZPTA 4IPNB 3G5EA 3L23A 5CPQA 2X0YA 1QW8A 1ZJAA 3KTXA 4LEFA 1OEPA 1AZ1A 4AUBA 2ABAA 3FAXA 2Y0FA 2GUBA 4UOQA 2VX4A 3RK8A 2ODOA 4GJ1A 1REQA 3B4UA 4US6A 3IRDA 3KBSA 1X98A 1WP6A 1ADDA 1N8IA 3H4WA 4FF5A 4F9DA 2J47A 2WQDA 3IIPA 3H2EA 4LEQA 4ALDA 2R8WA 3NQ6A 4NT0A 2JE8A 3IJ6A 5H8MA 2NLYA 1XDMA 3QZEA 1YTDA 4ZTXA 3ZXWA 2X30A 3ZSTA 2PWEA 3A24A 1RVKA 1WXYA 3QQWA 1AL7A 3W7OA 2ZTJA 4I5RA 4W8AA 3CEPA 4C6BA 1PJ9A 3BARA 1DTNA 3DUGA 1CXHA 3ITCA 1WDDA 4HN8A 4WJ8A 2E25A 4MLRA 2DW7A 5BMWA 1B3ZA 1WPCA 3DESA 3VKAA 1QK0A 4RE0A 1UZHA 3CPGA 7ODCA 3TQPA 3SFKA 5IOBA 3WCZA 4GJJA 3BLIA 4IL0A 2XZ7A 3M7WA 3SN0A 3CLMA 1PV8A 2WM0A 3GDBA 3V0UA 1GVRA 1XWYA 2RDXA 4FAMA 1EHAA 5CPMA 2CWNA 5CLTA 3FYOA 4UTTC 1ZL1A 2IKHA 1XS2A 4IOTA 3BOFA 4G56A 5T91A 3MPGA 2YXXA 3STCA 1WKEA 3ABOA 4NJIA 4YCOA 1IEQA 3B9OA 3ORWA 1B3VA 4UFMA 2FMNA 2RAGA 5MF5A 1BG9A 3KVMA 1JNEA 2YX0A 4B9ZA 1A4MA 4CVWA 4GYFA 2XFWA 5FF3A 3AIVA 4HSHA 7TIMA 3U2EA 3D47A 3A5VA 4EF8A 3M7SA 2V2HA 1G4SA 4LVFA 3TAKA 3IIZA 3OA3A 3LXBA 4X2PA 5IRPA 3DG3A 4GIYA 4A2SA 3VCRA 1AJ2A 1GGOA 3RLUA 5A8QA 1GOXA 3MUY1 3VNLA 4GGHA 3R0DA 3I4KA 4UTJA 3VOHA 3RLVA 3TROA 5A2CA 4Y9AA 4BF9A 2QUMA 4WHBA 3SAZA 1J5SA 3BW2A 1XQLA 1MFVA 4S3EA 1C8QA 3DBNA 3CQHA 4G7FA 1OY0A 1QNOA 1UR4A 3N6HA 2CBUA 4JTSA 4GI4A 3WK2A 1MMFA 3RYSA 3C0JA 2WJZA 3L12A 2CCRA 3LGDA 1FY6A 4BY3A 3LV5A 4GY0A 1B54A 1D3GA 4Q6JA 1VBUA 4DXXA 1O95A 3IGHX 5TBOA 4DWSA 4AVNA 4B5NA 3MKKA 1VBGA 2NWRA 3IK2A 4HSOA 3M0HA 4LRTA 3WK1A 3TZNA 2AMXA 2PDUA 3V1HA 2UBPC 3TLLA 3NQBA 2GVEA 4F0MA 1WZLA 1L2QA 3DFHA 4DAIA 4EP8C 2Y62A 4NUWA 2W92A 2H8ZA 4B90A 4L9YA 1M7XA 3O07A 4BQ2A 4DM2A 4U3CA 3W9ZA 2P8CA 4E4FA 4IICA 5A94A 1JIBA 4HZ8A 5PTDA 1HJVA 4NZ1A 4Q4OA 3P0XA 1HJUA 5DXYA 1YRRA 3ZVHA 1V02E 3T0CA 2I7GA 3R58A 5BXPA 3UZJA 1DQUA 4XK2A 3POHA 2V68A 4Z1AA 3UBPC 4NQ1A 3WLKX 3WBXA 3W7EA 3K4WA 4PBFA 2J7EA 5B7ZA 2QPSA 2GVJA 4G9PA 2BTMA 4UZSA 2PD5A 2DW6A 3H54A 2IUZA 1I4NA 4GZEA 3TJ4A 4JIHA 4XD5A 4D6CA 1Q6LA 4FX6M 1YEYA 3D5HA 2J9YA 3SCUA 2GZXA 1A5KC 3DHDA 4KWWA 2WVUA 3Q4DA 9CGTA 4PMVA 5JUVA 3NQMA 3ALGA 4GXPA 1XIJA 1HJXA 1EIBA 1IT8A 1QNSA 4AY8A 1ZP3A 2WZIA 1HF6A 4UR9A 1SO3A 4OOUA 2ZE0A 2R6OA 2W79A 1E5JA 1TO3A 2WCGA 4OGZA 2ISDA 1GEQA 1F73A 1LBLA 4E8DA 3EWYA 2XN1A 1CLVA 3JUGA 2PE4A 5L9FA 3GDMA 2J75A 2ZA2A 4O12A 3CHFA 3N2MA 5D2TA 3WDHA 1IR2A 4IF2A 2O9TA 1R3YA 2CETA 4XZWA 4NI3A 4HMCA 4DBDA 1TX2A 4RNHA 3P8IA 1H09A 1JDCA 4QRNA 3E38A 2X0SA 5KZ6A 1XBZA 1E3ZA 5G1MA 5D02A 3EB2A 3PTKA 4CD5A 3ARRA 3E6EA 3MMTA 3MW7A 3P2VA 2V2DA 2Q3OA 4DWDA 4E8CA 3RM9A 1GVEA 1K9DA 2CLEA 1IYXA 1J96A 3LBMA 4C6CA 3GLCA 5G2HA 4XVEA 2EPHA 4GUJA 3PPHA 5G2IA 4F2UA 3FV9A 4UMBA 5EFFA 5FF7A 1WX0A 4DZ5A 1OFPA 3I7RA 1ADOA 1SW3A 3EWUA 1Q6FA 3N15A 2F9RA 2V5BA 1LWJA 1X7IA 3QZAA 3WY1A 4JTDA 3LQGA 3OLIA 1XYBA 1QASA 4FP1A 4GMEA 3QF0A 4LBUA 3BXWA 4MFDA 3HPZA 2REQA 1HKKA 2J9ZA 3RXZA 1ZALA 4GCXA 1XLMA 4IMGA 2QCMA 3S5ZA 4ECLA 4JFVA 3GC5A 4H7VA 1RQHA 5DMLA 4M6PA 5ABTA 5ABFA 3GK0A 1E4LA 3BK0A 1JCYA 3KZSA 4S23A 3C3NA 1GTEA 3VNMA 2ZX9A 4QFUA 5MKGA 2QGHA 3NO1A 3OA5A 2WMIA 3UJ2A 3MVTA 2OTDA 5KTLA 3AISA 1Z6KA 1FWFC 3R5EA 2VD9A 1L2UA 2VUNA 1P6WA 5CEWA 1UJQA 3OVQA 1DQWA 1W9VA 1NF0A 3CASA 2XVNA 1BSLA 4JICA 1RUSA 4HPJA 1OX4B 1JNDA 3B8VA 4BHYA 4PCNA 1CW2A 4YJ5A 4IHCA 3BSMA 3VE9A 1OG6A 2OYKA 1GG0A 2YZ5A 3TJLA 4G2DA 3R11A 3G1SA 5AYXA 1GPFA 3K4DA 5HWJA 3ITOA 3R13A 4GJIA 2VQTA 2P53A 3C0QA 3TWAA 1BVNP 1ECQA 3TQVA 4J40A 1TJ1A 1L6WA 1TZZA 1WZAA 3L7RA 1VKFA 4X0NA 4D8LA 5BMXA 5ABHA 4QNWA 3Q65A 2OVLA 3AIRA 2GQ8A 3QH2A 4AD2A 4QSFA 3V0SA 1KWKA 3CK5A 2JF6A 4O17A 5C71A 5C5YA 2YFNA 1IR1A 3KOFA 3WLQA 3EX6A 5ENLA 4Q8NA 4ZXLA 3OLGA 3TWBA 2YSWA 3DGBA 1PAMA 2YIHA 1E4IA 4MVAA 4FIQA 5JVLA 3ARXA 3N2XA 5CJMA 3MYPA 4H8VA 2CERA 4N6EA 3UYCA 3SCVA 1FFQA 3D3FA 3ZT6A 1A5CA 2INZA 3REQB 2ZX8A 3C6CA 2C79A 1AZ2A 5C9XA 1OJXA 3VU2A 2FH6A 1NAL1 3WQGA 2QLYA 1TPB1 2FGZA 3FS2A 3XISA 4JTAA 3WLLA 4GI8A 3V5OA 4C6MA 3UT0A 1AVAA 5AC8A 3NEHA 2R82A 1GJUA 1SJCA 2VX6A 4NHVA 2QCDA 5HMFA 3ARVA 1M04A 3ARZA 1SFTA 4K68A 1WDSA 3UWVA 1REQB 3QSTA 3PR2A 5BU6A 3RX3A 3E12A 3RGTA 1TE6A 2Z1WA 3HA1A 1OX6A 1OZQA 4AD3A 3XINA 4X0VA 4HB7A 1RSCA 2CKSA 5BCAA 5KZDA 3WL1A 3W1NA 4JHZA 4EWJA 4H9VA 3QFEA 3VDCA 2HNEA 1LORA 5F2MA 3BH4A 1F3WA 3AIBA 3PB0A 1V77A 4E2VA 4O13A 5HDRA 1IV8A 2X42A 3TA6A 3C5QA 3GM8A 3LN3A 4LYPA 1QR7A 3S5SA 4H9MA 3OQEA 3IVUA 2YL8A 4GX8A 3PZQA 4NASA 3M0XA 2WVSA 2VWTA 1Q8AA 2PF0A 3LPOA 3SO7A 1GNXA 2A21A 4PL2A 4M24A 4AISA 4LY8A 2ZRUA 2EG6A 4ERIA 3W72A 4QLLA 3URBA 1K7EA 4MDOA 3NURA 4DPPA 2YFOA</