2IW0A

Structure of the chitin deacetylase from the fungal pathogen colletotrichum lindemuthianum
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
226
structure length
226
Chain Sequence
VPVGTPILQCTQPGLVALTYDDGPFTFTPQLLDILKQNDVRATFFVNGNNWANIEAGSNPDTIRRMRADGHLVGSHTYAHPDLNTLSSADRISQMRQLEEATRRIDGFAPKYMRAPYLSCDAGCQGDLGGLGYHIIDTNLDTKDYENNKPETTHLSAEKFNNELSADVGANSYIVLSHDVHEQTVVSLTQKLIDTLKSKGYRAVTVGECLGDAPENWYKAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITIN DEACETYLASE
publication title Structure and Mechanism of Chitin Deacetylase from the Fungal Pathogen Colletotrichum Lindemuthianum.
pubmed doi rcsb
source organism Colletotrichum lindemuthianum
molecule tags Hydrolase
total genus 89
structure length 226
sequence length 226
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2iw0A01
2CC0A 5JMUA 4HD5A 2IW0A 1W1A1 3CL7A 3HFTA 2DFAA 1XW8A 4NY2A 1W1B1 1NY1A 2C79A 2E67A 4OUIA 2QV5A 4F9JA 2C71A 2I5IA 2C1IA 1V6TA 2XU2A 4NZ3A 3RXZA 4M1BA 1W17A 4NZ4A 2Y8UA 3CL6A 4U10A 3VUSA 3QBUA 1Z7AA 3CL8A 4NZ5A 2J13A 4WCJA 5BU6A 4LY4A 4NYYA 4V33A 2VYOA 4NYUA 2C1GA 3S6OA 4L1GA 4NZ1A 3WX7A 2NLYA 4F9DA 2W3ZA
chains in the Genus database with same CATH superfamily
3TQ0A 2OWXA 5DLCA 3TW6A 3PUGA 4PTDA 3SY8A 4MHBA 3BOFA 3W7PA 2ADAA 3RO6A 2XGZA 2NX3A 3UXIA 1QWKA 1VS1A 1H62A 4MIMA 4F2TA 1QPNA 4J5NA 5ABEA 3VDGA 1XH0A 3HTWA 4XZIA 4XZBA 2QCHA 2C1GA 4GC4A 1A5CA 3E96A 1YTKA 3GVQA 2VD8A 2V9DA 4GZJA 2VC6A 2F2HA 1NSJA 4K8GA 3WLPA 3M44A 3C86A 5BCAA 3TMLA 3OGVA 3URQA 3UZJA 2VZSA 1GZ1A 1E3ZA 2PBGA 4LNCA 3PBUA 1FWGC 2HDJA 4GC3A 4QSFA 1GQLA 4Q7NA 1W9XA 2R24A 4BEQA 5I3DA 1OFDA 2Q6ZA 2PDMA 3AIUA 3MKKA 1TZ9A 2PDLA 2VFHA 1MDRA 5CG7A 5FEZA 3D5HA 5DX7A 2OO6A 5LXEA 1GZJA 5ECVA 2Z4GA 5C9ZA 5BWAA 3W27A 3VIKA 2ZVRA 3OJGA 3PTKA 1KXHA 1TMHA 5HR6A 3OZPA 1UZ1A 1BVNP 3CL8A 3T9PA 1GT8A 4L56A 3A9BA 3AAMA 3PBYA 1J6OA 2GVYA 3RHGA 4UQCA 1UR1A 3TYZA 3W7HA 1GTEA 4JQAA 3MO7A 2YIHA 4A3RA 1M7XA 1MQQA 3P74A 2ZBTA 1UR9A 5EGRA 3P7YA 1RA0A 5G1YA 1N7KA 3FX4A 5AVNA 3GNRA 4XO6A 1CI1A 3KTXA 1G0CA 2C1HA 2OFJA 1HO1A 1T8QA 3LRKA 3B8WA 3S2MA 1KV8A 1VBHA 3SQMA 4E2DA 3SEPA 3EPOA 3W22A 2YYUA 1UMYA 1TX2A 3GKAA 1PBGA 3H2MA 5TBOA 1YNPA 4QJ3B 3CT7A 2VFEA 1P4CA 1VAHA 4O53A 4MMWA 2OX4A 4ZQOA 4C6LA 2POTA 1UZDA 4XZNX 3S8HA 4IG2A 4H9ZA 5CLWA 4ZBCA 4KCWA 1A53A 2J7BA 2PWGA 4AB4A 2V5LA 3QZ6A 4JTLA 5CSUA 2H3DA 1GTHA 3HPXA 3O6AA 3QGAC 3CHFA 1OYAA 3OA3A 3W2UA 3EB3A 1ESWA 4Y9OA 2W66A 1EC9A 3AYRA 4Q4QA 1E4MM 2W5FA 1UP3A 3TCEA 3ZQ9A 3UG3A 4GO8A 1K8ZA 1XRVA 4LS0A 3SCPA 4GXWA 2INFA 4YCOA 1TV5A 4BS0A 4U28A 1OD0A 2EAWA 3CXOA 4GRSA 5MKGB 4R7WA 1H0IA 4CQ9A 3TR2A 3CAKA 1EO7A 2VC9A 3A24A 1PHQA 3MQTA 2GQAA 4M51A 2V82A 1JXJA 4BZYA 4AWEA 3NR0A 3VOFA 2VUNA 2D73A 1F3XA 4GISA 1QUMA 5FCZA 1Z48A 4L4OA 3W7RA 3LA4A 4AZBA 4F0SA 3EX6A 1NTHA 2J25A 3NQVA 5G1TA 5BMWA 1CXKA 4JTAA 3IIZA 4PMZA 5AOUA 1EPXA 2J74A 3TA6A 3N13A 2E5CA 2OSXA 4GUFA 3UESA 1IQ8A 3UF9A 3WEOA 3H70A 4EP8C 3NQGA 3FV9A 3W86A 4BI7A 2Z1VA 4UZUA 4HJWA 3HG5A 2NWRA 1FCQA 1HKKA 3BGAA 3EX2A 5BMXA 4FLQA 4JTDA 1D9EA 3LLDA 3XIMA 2D3NA 3ZS4A 1OK6A 3UG5A 4L7ZA 4H8NA 3UW6A 3NL6A 2V5KA 3WH8A 4TU1A 1TUXA 3SAZA 1HP4A 4MWAE 2BV9A 5A8MA 1VFMA 2C13A 2VCCA 2ZXQA 9RUBA 1WXJA 3GVGA 1XYBA 5G4HC 2O7QA 1M7OA 1AW2A 5F1VA 3EX1A 3N34A 4GCAA 3FCPA 1V51A 3HM7A 2OLAA 4CNNA 3W2LA 4PCTA 5D9NA 3ARXA 4HA0A 4XO7A 1RP9A 3MBFA 3VNYA 3F5JA 1VIWA 1V3IA 1DWAM 3VNIA 3VK5A 1UROA 3FJ4A 2YX0A 3GXMA 3WUEA 5IDZA 2HROA 2QYGA 3TN4A 2P0IA 1XINA 3PUEA 2X09A 4D9PA 2CC0A 3FK4A 2D3LA 2DW7A 3B0UX 2GJXB 5SWUA 2AL1A 4W7UA 3ZLHA 1FWCC 1QNSA 1QHOA 2ZDSA 4M0XA 1S2TA 1V77A 2X16A 2X0HA 3G22A 4HNTA 4RNFA 3QV9A 3L7RA 2E7FA 4A2RA 3VNJA 3KBMA 4JHZA 2DZPA 2CZFA 3B0YA 3WUGA 3RILA 1L6SA 1C8YA 4MB5A 3USZA 1KM6A 3U9IA 4Z2IA 5XIMA 4M1RA 4HNNA 2I17A 1TB3A 2Y24A 4B15A 2FDMA 2HXTA 1WV2A 1JDAA 4AYSA 2QMJA 3P6LA 4NRRA 1F61A 5CH9A 3APGA 4IL0A 4MM1A 1XYAA 3RU8X 2OYMA 3W53A 1Y8BA 4AZ7A 4S3FA 1KFCA 4Z0JA 1M5WA 4PTVA 5HOSA 4ZOAA 3VD9A 1VIZA 4BWLA 4NYUA 3NYDA 4LJ3A 1EFZA 4N42A 1C7TA 1XLBA 1TCDA 3CIWA 2XFRA 4HVXA 1P6WA 1FP8A 2DZVA 2BGQA 2BMBA 3VIMA 3ES7A 3TXZA 4M5PA 3R12A 4F48A 2V5CA 4Q8OA 2P5NA 3WDRA 4PB4A 1XIGA 4I8DA 3UERA 1F07A 4IH3A 3TJXA 3K8MA 4C90A 4KRTA 5HA7A 2GL5A 4TMBA 1WO2A 1LP6A 5AC6A 4FXFA 1PYFA 3G2GA 1J2BA 1HUVA 2VEFA 4R88A 4MKNA 4NI8A 2BX7A 1LRQA 2VURA 2NXIA 3RMJA 1I1WA 1MW0A 2W92A 2BS9A 3O6YX 3Q37A 4IHCA 3NEVA 4LUJA 4IGSA 1E6PA 2OZ8A 1A4LA 5HMSA 1D3HA 1W1VA 1BHGA 3VDAA 5H8UA 2J6XA 4KWOA 2RDWA 1A5AA 1GJPA 3KW3A 1A0CA 1MW1A 1OX5A 4PL2A 3VOIA 3QF0A 4EPKA 2WNZA 1VENA 1HX0A 4ZE5A 4WZHA 4BY3A 2J75A 3WK3A 2ISFA 4AX6A 2R1NA 1DJQA 2ZXAA 4NKCA 2CBIA 3EWCA 1ZAHA 5HPCA 3FSUA 4PTMA 3BAKA 4IFOA 3STGA 1Y7VA 6REQB 4I6KA 1JPKA 4YIWA 1E6SM 1JCNA 1LBMA 4LUIA 4YVXA 2HSAA 5JIPA 2P3ZA 4KWUA 3A3HA 5JU6A 4JIIX 1Q45A 3DYOA 5KZMA 2WCGA 2OPJA 3GXIA 3WEMA 4C6OA 1PKMA 3QW3A 3GIYA 1TWIA 4R3UA 5EU9A 4AZCA 5CPNA 1AW5A 1MVYA 3W7CA 2QCDA 4DBSA 4MY8A 2PDXA 1A0DA 1JNEA 1MRQA 1KLYA 3HPZA 4PMUA 4E3VA 2DUZA 3A21A 3N6QA 5HANA 2GVEA 4NUWA 2CZEA 5E1QA 4CD8A 2I14A 1W5PA 4NF7A 3JW7A 3PTQA 4P7NA 1U83A 2HBVA 1WB0A 1TIMA 4Q22A 1I2OA 2OMAA 3NXFA 1DL3A 4UQAA 4J2MA 3TKFA 2PU1A 1P7TB 1EH9A 3TYBA 1XQKA 5I23A 3QTGA 2OQLA 3AHTA 1V3HA 5EBUA 3LOTA 4L80A 2VVNA 5DANA 3A13A 3WKZA 2PGFA 4S23A 1TE6A 3VE9A 3CWOX 1TA3B 4CEUC 2CLPA 3EX3A 4B92A 1NU5A 3VKAA 1LL4A 4S3EA 1I9CB 3ALGA 5RUBA 2VENA 4WDTA 7TAAA 2DZTA 2A3HA 1I75A 2O92A 4HJFA 4MLRA 3VGFA 7PTDA 4ACZB 5CZSA 4H2HA 4CN1A 3VGGA 3IEBA 4OOZA 2CLLA 2YFOA 1CXIA 3LHWA 1RK5A 3M47A 2C71A 3QC0A 5JBEA 3WMSA 1R87A 1EXPA 3SUUA 3WH5A 3BC9A 5CBJA 5DXXA 2FLIA 3IJQA 1R8LA 2FHBA 4JGDA 1SW3A 2YSWA 1MQPA 1EP2A 4YS1A 4RNJA 4K6AA 3WELA 1RY8A 1XV8A 3O05A 2FQIA 4H2CA 4JNZA 4IOTA 4LANA 1HO4A 2FGBA 4WY0F 1JXKA 3W83A 5T91A 3V1PA 1DJXA 3QYSA 1PL9A 4AC1X 2WVVB 4J35A 3AXIA 1SSGA 2CCRA 4LVDA 5DBUA 1FTXA 1R3WA 1SJDA 1UBPC 4OFCA 1ZRQA 4IL2A 4E6MA 2QDGA 1XCXA 1DTUA 1K7XA 2NT0A 1YLVA 1YTDA 4NP7A 1NM9A 1Z32X 1E1CA 5FJRA 4UQEA 3TONA 1S1PA 5I3GA 1G67A 4L61A 2PEVA 2OGYA 3JZUA 1QW7A 1YDVA 3CUGA 1YNQA 1TV2A 3LSCA 4B3LA 5D03A 3SURA 1YQ2A 1ISYA 3IVTA 2PZ0A 2YCJA 4Z08A 4IP5A 2EKCA 2W63A 2YOCA 2J7FA 4DJFC 3K4AA 1V02E 4GIEA 1U5JA 3HJEA 1M9HA 1FKWA 3SRDA 3WSUA 5G2HA 5TF0A 1DWJM 4JQ1A 1IXOA 4IIGA 5BOEA 1HF6A 4YXGA 5CPLA 1ICPA 1EOMA 3KCOA 4O18A 3QLLA 1HG3A 1SW7A 4PUMA 3VM5A 3WLIA 4GFSA 1TMQA 4N9BA 3G6LA 3PJXA 2OT0A 4KEUA 1OSEA 1SO4A 2VEMA 2Z2AA 3EDJA 4HOWA 3TFXA 1MUMA 1A5OC 3R8HA 3MT1A 1CGTA 3CQHA 1FHUA 3MVTA 5E5CA 2OB3A 5B7ZA 1OC5A 5AC7A 4LVGA 4PMQA 1TPUA 1WDQA 2DORA 3CMFA 2CU0A 3SQSA 3VX1A 1KTCA 2IPWA 4BWLC 3N2XA 2QMKA 2QV5A 3DYPA 4TV5A 2WCAA 4AZ6A 3CQIA 1JI2A 4YTQA 4DJED 3AZSA 1YHTA 3SJ3A 3ZT6A 3E38A 3S46A 4JCMA 3GTNA 1E6QM 2VGIA 2W6RA 4CUCA 3D3FA 4Y6GA 2HNEA 3I3BA 5KETA 4DF2A 1HGWA 3GRIA 3RYSA 3THQA 2PWUA 3G0SA 4RPQA 3VM7A 4OIFA 2Z7KA 4HCDA 5AHNA 2J77A 3RX2A 2BSLA 3A4WA 4OHQA 2EGZA 3GLCA 3IGXA 4DUWA 2OKOA 2OO0A 1Z6KA 1QNQA 3G24A 1UD2A 3HU7A 4MY9A 3QMSA 3SN1A 2VRKA 1HQTA 1RD6A 1W0MA 4C5YA 2GWGA 3DYMA 3PR2A 1LBFA 1Z42A 1W9DM 3R1ZA 3CLWA 1W54A 3QHNA 3LYEA 2P76A 1E6XM 1UR2A 1Q8AA 4AIUA 3DHFA 4NJGA 2Y5EA 1A5LC 1K8YA 3EGJA 1F2JA 1KWKA 3LCHA 4YU1A 4HK7A 5E70A 3MHUA 3RUBL 3S47A 1GCYA 4Q8QA 2D0HA 4Q8VA 3AI0A 3NQBA 1FH7A 4ZTXA 2R14A 3R10A 1I60A 2AMXA 1M04A 3GBDA 1IWPA 5DEZA 2NQJA 3LCXA 1B54A 3HGSA 2J9YA 2HQAA 2V67A 4F79A 2CLIA 2P3EA 4RZBA 1C93A 1TWSA 3VC5A 3CB3A 3EOSA 1GZGA 4LEQA 5CPQA 1GJUA 4GQGA 3L4TA 3KS6A 1WAUA 4PUDA 4DUVA 1E5NA 1Q13A 4DXKA 4LRTA 1YE4A 1CLVA 1TWDA 4CU7A 3EXRA 2XH4A 3AXMA 3DBNA 1C8XA 2G50A 3HPAA 3BXWA 2XZ7A 2WOQA 3KHDA 3OIXA 4A22A 2QKFA 1BD0A 3AIVA 3GG8A 4D6IA 5EPDA 3LN3A 4MWAC 1UWQA 2GQ8A 2VQTA 3G1VA 1E1FA 2NWSA 4QTGA 3HOJA 2YL6A 5F2GA 2ZRWA 5C9WA 4XVEA 3F4DA 4UQ9A 4LU0A 1J11A 3T0DA 2IQDA 1W5MA 4US5D 3UVAA 2RAGA 1U1UA 4LOCA 5GQBA 3BAIA 3WQGA 3G3DA 3GB6A 1F3WA 1A0EA 3GHRA 2DUAA 4TTUA 1TO3A 3R43A 4RV8A 2XINA 3MZ2A 4GQRA 4MZYA 1OFOA 3TYCA 2ACUA 2VRQA 3H7RA 2RDUA 1OC6A 1MDLA 3GBEA 3PANA 3LV6A 3G1RA 4ZSUA 4GUJA 3W7GA 1E4NA 3S5OA 3A4JA 3VC6A 1E9YB 4HNVA 3QSRA 3UWZA 1E0TA 4TVDA 2MUCA 1O66A 2FB2A 3HV8A 5HWJA 3WQFA 1U30A 2EG6A 1ZENA 3R0UA 1CIUA 2BY2A 4M3PA 2GOUA 1DQUA 2V3DA 5LA0A 2X05A 2RHGA 1W31A 4YJ5A 2DZUA 1ZNNA 3L67A 1EGMA 4C65A 3VCRA 1K1DA 3IVSA 1W8GA 5D2YA 1E72M 2X1UA 5LA2A 1XYZA 4MFEA 3BSHA 2MNRA 5C2GA 1VHCA 1FP9A 3NYZA 4ATDA 4BHYA 2PLMA 5E0CA 1MUCA 1X38A 1AD1A 1YBQB 3U8GA 1QI3A 2A3LA 2G96A 4X60A 2NX1A 4KWSA 1XWYA 1E6ZA 1H60A 1KM5A 1VF8A 1IGWA 2DJLA 3TZFA 3UY8A 4QNWA 3VPLA 2JQXA 2WVUA 3L2LA 5LXXA 3LZ5A 3MP5A 3DFPA 2EXOA 3CO4A 1T7LA 1XFCA 3RXZA 3POHA 1N82A 3IVUA 4UTWC 2C91A 4FA3A 4B2DD 4LNYA 4ZQPA 3STCA 4Y8FA 3ZJ8A 3TYDA 2DPEA 4DBWA 1XD0A 4IP7A 3F2DA 4PMYA 4MYXA 5JH2A 3TZNA 4OV4A 2JALA 3M0IA 3AOFA 4H9UA 4ES4A 5FKYA 3N15A 3GNXA 4DIAA 2HMCA 4M7SA 4XKYA 4ORMA 4LGXA 3ENLA 1BF6A 1LWHA 3WQPA 1SZEA 2JEQA 3LTYA 1MI3A 2ZX5A 4O8AA 2BB0A 1SMDA 3W7JA 3LHTA 3AISA 3URBA 1H4PA 1MNSA 5M03A 1Q3NA 4ZFMA 2G97A 4M80A 4R53A 4M81A 3CUHA 1YNYA 3QN3A 4PMOA 3OLEA 4GYPA 5B80A 1V6YA 2XYLA 3LRMA 4PTWA 4K1GA 2B7QA 1OQFA 3WDPP 1G4PA 5A6BA 3WUBA 3LQGA 1R5YA 5C7VA 3T4CA 3GE7A 4HK6A 4QFUA 3BAWA 2V5DA 4C7FA 4XK2A 3BVJA 5I06A 1H51A 1HP5A 1KCZA 2E28A 3PF3A 3INPA 2VX6A 2R91A 5HNTA 1J0JA 5FSEC 3HO8A 3TIMA 4XZWA 3OB8A 3QV8A 2WHKA 4KCVA 4OT7A 3VI2A 1R38A 5BXPA 1JZ8A 2QULA 4DBUA 2QCCA 3NQ7A 2CESA 5BOFA 1G7UA 3NM3A 1QBBA 3AZTA 2G4FA 4QG9A 4PC8A 4JYDA 1HJWA 3GZAA 1F4AA 3TW9A 3KCLA 1H7RA 4K8HA 1B0IA 1W1A1 3LCGA 3GR4A 3OVQA 4XAFA 3IK2A 5U7SA 3ABOA 3PBVA 2B7NA 3QFEA 1OT1A 2Z26A 3E74A 4L4MA 4QJ1A 5T9BG 2UV8G 2BHYA 2E77A 3P80A 1V08A 5T9CE 2ZUNA 1E6NA 4AXKA 3EWZA 1CB2A 4IQDA 3TUUA 2Q8XA 5BROA 3NWRA 4WDWA 1R3VA 1OCNA 3E0FA 1W17A 2A4AA 2H8ZA 3EEGA 3GDBA 1UOKA 1J10A 3Q67A 3Q65A 2RDXA 3BARA 4HQVA 1F3EA 3YPIA 3LSBA 4A3YA 4ZZ9A 1UA3A 3PB2A 3ZVIA 3W6MA 1S2WA 1SGJA 1JYVA 4JTKA 3M6YA 4IMCA 5HAOA 4QJ5B 2ZC8A 1TZZA 4IQLA 3FIGA 4PSPA 5M2FX 3RCMA 1H7XA 4W86A 3OQ8A 1NDYA 2YCLA 1ML1A 4MNLA 5DO8A 1I4NA 4S2BA 3LCFA 5AFDA 1AJZA 3DN5A 1IWBA 2GVLA 3HQOA 4IX0A 4V27A 4LYPA 1KM2A 1LOLA 3TQKA 2TAAA 4GKTA 3LBCA 1NP0A 1QT1A 4NNAA 4O17A 3R8GA 1FXPA 3DG3A 2HS8A 1GKPA 4J28A 2W0UA 4JICA 1UBSA 3VILA 2QUVA 5JXQA 4W8LA 3ARWA 1T40A 1BXNA 1K8XA 4QS5A 4O13A 1UYQA 3E0LA 2P1FA 3OBKA 4DWSB 3AMLA 1RJQA 3FKRA 3GR7A 3LRLA 5FIPA 3CHCA 4KETA 1TPVA 2FH6A 1U1JA 2DZSA 4OQVA 2ZCGA 1WZMA 1CXEA 2FYMA 4UBPC 1VRDA 4RDVA 1L6WA 1B4EA 1BRLA 1IEVA 4B9ZA 3S9ZA 5REQA 1FFQA 1KCLA 2J8TA 3SGUA 3M6DA 2FKPA 4RX0A 3CYJA 3ZJKA 2B7OA 3QHMA 5FOOA 4Q7BA 3UR7A 1J8VA 2YL5A 4NZFA 2WMIA 2NZLA 3I6TA 2D2HA 2BTMA 4IGHA 4ML4A 3PNZA 4MZ1A 4WOZA 4XD5A 1N8FA 2B7PA 1L6FA 5LIYX 2OZTA 4GYFA 3COTA 2WQPA 5AYZA 2BVDA 2NW0A 3VD5A 1DWHM 1EJUC 4Q8UA 2PD5A 4LVBA 3WBXA 3KBSA 3WLKX 4BKNA 3WF3A 2V68A 4B5UA 3GIQA 3KRBA 3T2QA 2ZUWA 2YBUA 2I16A 3M9YA 4F9DA 4HSHA 3OOQA 4W84A 1PZ2A 2P88A 3VKJA 3GYEA 1HJSA 1LLWA 2QCDB 5CXPA 3R2GA 2WZIA 1M41A 4I9JA 4XBJA 2EHHA 4B5WA 1TKKA 2DUXA 1R0MA 2P8BA 3VIOA 4HN4A 4C1LA 4D6DA 2IW0A 4IPPA 2QQ6A 5A2CA 1C9DA 1NY1A 2OCZA 4GQQA 3TC3A 1Q7ZA 3Q45A 4IWWA 2ZUMA 3RM4A 4L1WA 2GK1A 2XWDA 3UCDA 2BBFA 2DSUA 2Y1HA 3N14A 1PX8A 4S3KA 3TN6A 1F9CA 4E4UA 3CB8A 2J7EA 2O9RA 5C9RA 4PCPA 4X2PA 3LV5A 4GUIA 1BSIA 2WNWA 3WLJA 3OA5A 3GZ3A 4AD2A 5EMLA 1W37A 1A47A 5IXEA 3FHAA 3WJSA 1CB7B 4IIDA 4HB7A 1Q6OA 1P0DA 4DJDA 2PLCA 3IANA 1UZHA 1JCTA 1EX5A 1ECQA 3DI1A 3SJNA 1LBLA 5F4XA 1KBLA 2Y63A 4GQBA 5CAHA 3VOHA 4TIMA 4HU4A 3HJZA 3WL1A 1US0A 2WJDA 4D6FA 2ACQA 3BW4A 3CL7A 3LHYA 1L8NA 3K8KA 3OODA 2WPGA 3ARSA 4GIAA 3VZYA 3GC5A 4J3XA 4ICCX 2Y61A 3CZEA 3PN8A 5A6MA 4QX4A 2XIQA 4N9CA 3VIJA 3H7UA 1OYBA 2V2CA 4GYPC 2YJQA 3MI6A 3U7VA 3PSWA 1KM0A 3N73A 3N4AA 3WO8A 3BG5A 3CUJA 3IV8A 5TAOA 2EBNA 3VGHA 3FJNA 1CZ1A 3DI0A 1OFBA 3ANYA 2ZZ2A 4L9ZA 4Q6JA 2VYOA 1UR8A 3NVDA 1QK0A 2XIIA 4UTKA 3JRKA 4P7OA 2INZA 1E6RA 5A8PA 1HVXA 5A1AA 4IMFA 4XD3A 3IUDA 4M6UA 1XUUA 4V28A 1GOXA 3CZGA 4HPHA 2QF8A 4XSMA 2CPUA 1OCQA 4HZ7A 3DXIA 1UKSA 4YTSA 1RXOB 2XFWA 4ZL1A 1EHNA 2PDCA 3UR5A 3WD1A 1QI2A 3LGDA 1G01A 3KBVA 3BOLA 3NQEA 2WSQA 3QPZA 4JX6A 2VOMA 4YHEA 5ECUA 3NDZA 3WMBA 1VJIA 1ZBCA 4Z42C 1K3UA 3KFTA 3OIHA 3C0QA 3S6OA 1FXQA 1E9IA 3KTCA 2DU2A 2VWTA 2V5JA 3O0KA 4M24A 1ZP3A 4AAJA 2GZXA 3E5BA 3SN0A 2WWCA 2NUWA 3RITA 3NA8A 1TPC1 4QDWA 4Y8EA 1ZJAA 3KXQA 4AEFA 2DSZA 1EPVA 1RCQA 1TMLA 2NLYA 4DYEA 4DB7A 1W6TA 4NY2A 3W7NA 4PB5A 4A35A 4XTDA 3H54A 4WSKA 4MAVA 1QK2A 3NSMA 4MG4A 3G1YA 3BICA 4NXKA 1QW9A 1HKVA 4CD5A 4LTSA 4Z1DA 1KQZA 2OQHA 1RALA 9XIAA 1W1B1 5KTLA 1V93A 2Z1XA 4GGHA 3SSZA 2D2GA 3QLDA 1GGOA 3ARRA 3AU2A 1XLFA 1L0PA 1GQKA 3BLFA 3MUAA 4GX9A 4AIEA 1GORA 3C2YA 3L2IA 1EUNA 3Q94A 2GDUA 2ZX7A 3NQMA 1S5VA 3SCNA 4NX5A 3EB4A 3G0UA 4AY7A 2XVLA 2XU2A 3THCA 1C90A 1A3WA 2BY1A 1D3GA 5KSWA 2OEKA 1GOKA 2X42A 2PDQA 1OM0A 2AGTA 1ADSA 4ZFCA 2E40A 2XTKA 2O0TA 4C1NA 3O6DA 3L4UA 4AH7A 1O5RA 1V3LA 1PTDA 2D2JA 3I7SA 4NG3A 4PH6A 1WDPA 3LLFA 2D20A 3BV4A 2V2DA 4HA3A 1U33A 1QPRA 5HBFA 4A3UA 4WXYA 1RAKA 1FWBC 3S83A 3T07A 4ZSTA 3WBYA 3SCWA 4LAZA 3GU2A 2R1MA 1YW1A 3PK7A 2X30A 4RW5A 3W71A 3ISIX 1UKPA 4MZ8A 1U5VA 1PTGA 4EVZA 4IPNB 2A3AA 1OINA 4JDBA 3R8RA 4K38A 3QKEA 1ZBKA 3VKCA 5GNXA 3IGSA 1HW6A 2Z1BA 4GVGA 1RQBA 5I03A 2ZVIA 5CAKA 5E93A 2OZ3A 3EX4A 2E8YA 3L4WA 4C6NA 3B9NA 3GVVA 1L6GA 1DE6A 1P43A 4TMCA 3WG6A 3CBWA 5A2AA 1RPKA 4M56A 5LSMA 3TDFA 3ABQA 4UB9A 1B1YA 4FNUA 3W7QA 3W26A 1REQB 3BWWA 2Y5SA 2WYSA 2KAUC 4KPLA 2P0OA 4EACA 1YYAA 4UWMA 1KRCC 4A29A 2ON3A 1DV7A 3PB0A 1DTNA 1K7FA 4IP4A 3R94A 3IARA 3W1MA 1JPMA 1KCKA 3WFZA 3RX3A 3S2LA 1AJ0A 3CM4A 3AIWA 3QQWA 1J0IA 3G1XA 3OU8A 3EMZA 2UY5A 2V3EA 2Y7DA 3BG3A 3TTQA 3SCQA 1Q2RA 5AC8A 3ABRA 3W7KA 2FFCA 1TWWA 3BW2A 1XH1A 4BCEA 1JF5A 4DY1A 3C56A 3LPFA 4ICMA 2NV2A 2VC7A 5L6UA 3P2VA 3UA3A 4P8VA 1E9LA 3EZ4A 3ECQA 3EWXA 3B0XA 8TIMA 2IQ0A 1W1ZA 4LYKA 3GVWA 5GNYA 5FL1A 3M16A 3TC6A 3MPGA 3U0HA 1HFBA 5A6SA 1UZ4A 4A8NA 4DI8A 5MKGA 3BLKA 1CPUA 3GY1A 1FWRA 5A8OA 4LC8A 2W91A 4B4HA 1U1HA 1W8SA 1HGYA 1HKJA 4QE1A 4J40A 3V0SA 3VO0A 3MUXA 1XLGA 1WXZA 3ME3A 1PB0A 1BYBA 1X8FA 2GLKA 3MKVA 3G0XA 1EJTC 2CNCA 3L66A 4LUTB 1BAGA 2J9ZA 3RLGA 4HNLA 2I9EA 1LT7A 1QNVA 5LYRA 1VYPX 1RUSA 3AS2A 3N2BA 4ERGA 3TFCA 1JGIA 3WLNA 1GKRA 4J3TA 3W82A 3M0XA 2OYLA 4QROA 3UD6A 3BLIA 1SZNA 1T6MA 3V5FA 2D2OA 4FIRA 1UWIA 3GSMA 5DRCA 1EWEA 1MSSA 1EIBA 2OZ0A 2XVPA 4S3CA 3W7DA 1TV7A 4JOMA 2FH8A 3MSDA 2VJXA 3AYVA 4WDXA 2BASA 4PMNA 4HU8A 1VFHA 3BGGA 3MS8A 4LT9A 1VP5A 3VZXA 4GI9A 3D47A 2NV1A 4E4PA 3VVGA 3MZNA 1KCXA 4RL3A 3H53A 1L6YA 5EYWA 1RPXA 4PULA 2WLYA 5DRIA 5LNRA 5K9DA 3CU2A 4GZ7A 5DMMA 2WQDA 3FS2A 3S1WA 1PZ0A 1DVJA 1WCGA 2Y62A 1CYGA 1OIFA 3MCMA 2OGJA 1UR4A 1XRSA 1RK6A 1XC4A 4KWWA 4UTHA 5GNZA 1POJA 3PY2A 3M7WA 3BK0A 4KFPA 1J0KA 1H7WA 4L9XA 2HTMA 4O10A 1JNDA 1XGEA 3STEA 2ZE0A 2VL4A 3VGEA 1WX0A 3AJXA 1D7FA 1WDSA 3LENA 4CCEA 4UOQA 4UTTA 2GJXA 1AK5A 2Z2BA 1EGVA 3IJ6A 4OWGA 1DWGM 4ROQA 4N2YA 1X6NA 2R94A 3CV2A 1Q6EA 4IMEA 4ROPA 2O9TA 4DYKA 2JGYA 2VO5A 1Z69A 3CUIA 1UH2A 1IEQA 1QASA 1DJHA 2J78A 1S2CA 1PIFA 1B3YA 4PUWA 4XAYA 3H12A 3QFWA 4EE9A 1XLJA 1UHVA 1CGYA 4ZODA 5CZKA 4BF7A 3PG8A 5ABGA 3NDYA 1UB3A 3AIQA 4R5EA 4H41A 3WLMA 1QI0A 3MANA 3WLOA 1UC5A 2WAGA 3UXDA 4CCDA 4M82A 1G4EA 1DE5A 4S3BA 5HQMA 2HPIA 4MADA 4FNRA 2QUUA 1EZWA 1CGXA 2PAJA 1HNYA 1D8CA 3PZOA 1F74A 1DQWA 3OLIA 1KD0A 4W93A 1M3UA 3W29A 1X6LA 1LCOA 1P6CA 4DO5A 3R7MA 3TROA 1OG0A 3IJ8A 4GQ0A 4RZ5A 3H2OA 2PZNA 3UGVA 4QQUA 3NZPA 2CEQA 1TQJA 3N2OA 1E0WA 4JZ5A 5EMMA 3BJFA 2ZZ5A 2ZICA 2R82A 5LGXA 3NO1A 1DJIA 1YXYA 2E9BA 3VA8A 1YADA 5FI8A 1V4YA 3IK4A 3UEQA 3W02A 4D6GA 1PAMA 3KP0A 3CWNA 3HGJA 4YTTA 5IHSA 3W85A 2PCEA 3AXHA 2V81A 3BMVA 1ISZA 5LNVA 5HNUA 1OWQA 1OZMA 1Y5VA 4BQ3A 3K1DA 4DPPA 5LNUA 3W7MA 5BU6A 4JKMA 2Z1SA 2D22A 5IRPA 2PGWA 3TNBA 4XUGA 1H49A 3BJTA 2F8QA 3AIEA 1OHLA 3DFHA 3GXNA 5I24A 3K1GA 1VZWA 2I56A 1KR0A 1K6AA 1BQGA 1JAKA 4GY1A 1A5KC 3KVLA 3V16A 1RVKA 1VBJA 4R27A 1B3OA 1GHSA 4DBDA 3GU9A 1MUWA 3LBOA 4K39A 1A5NC 5HUPA 3UZWA 1NOWA 4EWND 3ATZA 1WDDA 3KRSA 4AWTA 3B05A 4WDUA 4W9TA 1QPOA 3IAPA 1JZ6A 3CAQA 1XIJA 4WX2A 4TTGA 4DN1A 3VMOA 3PZVA 3WH7A 4PTXA 3C2RA 1QJWA 4D1IA 7ENLA 6REQA 3ITGA 3LGEA 2OWCA 1IWAA 1ZJBA 4GUGA 1XGDA 4FOJA 1WQ5A 1HN1A 3ATYA 1US3A 5HNNA 2FZ8A 4HN8A 3I3EA 4PEEA 3AYTA 3VE7A 3L68A 3UCCA 4DX3A 1WNOA 4UR9A 4OECA 2YL8A 3LGGA 4ZB5A 1VC4A 3TWAA 1ZAJA 2YCLB 4NZJA 1YRRA 3W70A 3PS7A 3BCFA 1BQCA 3MBDA 2G3JA 2VELA 4GVIA 3OG3A 1PO9A 3KTSA 5J04A 3A64A 4I7VA 4HD5A 4P8XA 5EMUA 3RPMA 3U5YA 1DJYA 4XG1A 2DH3A 3E2QA 1UD8A 4GVFA 5U4NA 5K2ZA 1JYNA 1P7TA 1PYMA 1SJAA 5FF4A 1FUYA 1J9YA 1EOKA 1GUVA 1RLCL 5D38A 1SFJA 1VJSA 3WZ0E 4GFIA 2VC5A 1NWSA 5I3HA 4L6HA 1V0NA 1LL6A 3STPA 2BNJA 4UNLA 5E9XA 1XLDA 3FYOA 1TA3A 3W73A 1QOXA 2HPMA 4NAEA 5JVLA 3CT2A 5XIAA 1VLWA 4S38A 3G18A 1KGUA 3GG1A 3C0JA 3UA4A 4TV6A 2QIWA 5TQLA 1BRLB 4B5XA 2OR2A 4C6EA 3TA9A 4Q7IA 1FCUA 3ZSSA 3OVRA 4ACZA 1JL8A 1J6PA 3PVFA 1A5UA 5HDRA 4HMCA 5D33A 4Z1YA 4QS6A 2ZZ3A 1UUOA 2TPSA 2DY3A 3T2PA 3LI0A 2JKEA 3DGBA 5DCEA 4JN7A 4Q32A 4UR8A 3C2EA 1J12A 3RK8A 2QJMA 3U7BA 4RLIA 3NQ8A 4I8YA 2IMRA 3W1LA 1G4TA 4D6HA 4AIBA 2FTWA 5BZAA 3CV7A 2IQTA 5HXMA 3OQEA 2OODA 4UUIA 4TQTA 3ZLFA 5I7GA 4WGXA 2VM8A 3TVAA 3KE0A 4WKAA 1L2QA 1EB3A 4N4QA 1PVNA 3F5KA 3W1NA 1ITXA 1XKYA 2DEPA 2Z0IA 2G0WA 3HGOA 4JEJA 4GOAA 3R11A 1I45A 4RE3A 1Q4WA 3VOJA 5DY2A 1J5SA 3EPMA 2ZE3A 4JTQA 2W61A 1O5XA 4P7RA 1F3TA 3QY8A 1TUFA 5A6BD 1KTBA 1GVSA 4EAMA 5LZLA 4J4KA 4BFAA 4CKQA 5I3JA 3B8IA 4AZIA 3GC4A 3EOLA 1P0BA 2GDVA 2F2KA 4S3JA 3T55A 4Z2LA 3IWPA 3OLGA 2E6DA 4ZQNA 2ZA1A 2XSXA 3BQ6A 3GUGA 2Y7GA 2WO5A 1XBVA 4XD4A 3VOCA 1B9ZA 3P0XA 5HMFA 4HPNA 2PC4A 1XLAA 1UW9A 3M0HA 1TJ1A 2W67A 3HQNA 2V8ZA 1JDFA 4RKAA 4U33A 4MDOA 3DH7A 3WQ8A 1Q6DA 2CHOA 2C7FA 4DVOA 5CJNA 3VNKA 4C6KA 4EX4A 1SJCA 3VIPA 5M5DA 2VEKA 3MSGA 2ZX8A 4JN8A 4R34A 3W7LA 4YCPA 1VFUA 3N4FA 1J4EA 4JFWA 2PBOA 1GK8A 2QDEA 4W7WA 3WBAA 3RM9A 4B91A 2PDUA 3MY9A 3I6RA 5HWNA 3CIVA 3N17A 4LS2A 4O1CA 4UMCA 1EO5A 3RO8A 4J7RA 4JQ3A 4W8BA 2CWXA 2X2YA 1GEHA 1WP6A 4AF0A 4E0CA 3CNYA 5A94A 4GZEA 5IM51 1WXYA 4HYRA 1GWJA 1C29A 2FVKA 3DFTA 3SCSA 5D37A 3WLRA 2Q09A 3GDTA 3WD3A 3WD4A 2NVAA 3GK0A 3KOWA 1SO3A 1R3RA 2DV0A 1CXFA 3LPGA 3ITLA 3C5QA 3UWEA 4XBKA 1JCLA 1K8CA 1KFEA 3CQJA 4D6EA 1ITUA 2G95A 1RCOB 2Y8UA 3GIPA 3WLSA 4WCJA 2Z1KA 2JEPA 1SJBA 4U3AA 1Y0EA 1CXLA 5EFDA 2V3GA 4FAMA 2H3BA 4BEUA 2EF9A 1FH9A 4AMAA 1S3HA 2KX9A 4JFUA 2V3FA 3LHVA 2AGKA 1ONWA 3APYA 4NZ5A 3DX5A 4X3ZA 4GNKB 1ZALA 1ODZA 3WUFA 4LAMA 2OLSA 1E0VA 2J88A 3LPPA 2F61A 4QE4A 1SPQA 2P53A 3ITOA 5MHBA 1C8QA 1LUCB 1C91A 4KEVA 3RPDA 1KRBC 2XFFA 2ZTJA 1E15A 4MKVA 1XYFA 1IR1A 2G41A 3WENA 4RE2A 4DWDA 3WD0A 4NJIA 4R7OA 4IIHA 1S46A 3TMQA 3CH0A 1VPXA 1CGVA 4ZB0A 1IXPA 2B81A 2TRSA 1EXBA 3ARPA 3DFOA 4LUYA 1O1ZA 4GZIA 3QYQA 1TE1A 5D9OA 3UJ2A 1C8VA 4FI4A 3S42A 1TPEA 3G3MA 1ZLPA 5FJTA 4G5DA 1QHPA 1TPWA 3BLLA 3V5OA 2NX9A 3PZIA 3B8VA 3BO9A 1GVRA 3HGRA 3S1GA 3SUTA 4G1KA 4GMEA 1XIEA 4LEFA 5DY3A 1AL8A 3R58A 1AFSA 1YPIA 3B4YA 3WEZA 1S2VA 3QJAA 1ENUA 3T09A 5KEZA 2Y7EA 4DJEC 5DT5A 1J5TA 2FB3A 4BA0A 3FEQA 1YDYA 1EP3A 3KOFA 4CVWA 4WD0A 3KZSA 5I02A 1H7PA 3KVMA 1QFEA 2C16A 3F5LA 4E8GA 4PRTA 4HHLA 3NL5A 4MNMA 3W07A 4HBKA 2D1ZA 2O55A 4C6QA 1OEPA 4IMAA 1ZUAX 5FF3A 4ZMGA 1YKWA 1L8PA 1UJPA 3MDWA 3OZYA 3ERPA 4FHAA 3MI3A 2F6UA 3VGBA 1OZQA 5HJYA 3G1FA 5FF2A 6ENLA 3KBWA 4JIEA 3W2KA 3QOMA 1R7AA 4Z17A 4C1NB 2A5HA 2QS8A 1A4MA 2QCFA 4JNYA 4J3ZA 4XIMA 3A4XA 4IX2A 1J0HA 3M1ZA 1DP0A 3SRHA 4UFHA 5ENLA 1OFQA 4XV0A 4UC5A 1KLZA 1OVDA 4V15A 3MMTA 1XIIA 3IUHA 4FF5A 2VZVA 2INEA 1SZFA 1GQNA 3OVGA 1SM9A 4CLMA 3ONBA 5BU9A 3O15A 1K9TA 4Q4RA 4ATLA 5H2ZA 5CGTA 5M1TA 1CGWA 4GBDA 4W85A 1M68A 4D6JA 3WCZA 3CZ8A 1GG1A 1SYTA 5LIWX 5CPOA 1C9WA 4LV9A 1KBJA 4U3CA 2WKLA 1K4GA 3B06A 4AXNA 3GNDA 4S3DA 2WHJA 3WQ4A 5CC6A 4DJDD 4OOUA 1ZAIA 4D1JA 3DFSA 1XIFA 3VFLA 2V63A 3H2EA 4AZHA 1T5AA 3VIIA 2OSWA 6XIAA 4XAZA 1SU5A 5D2TA 1AQMA 4A8IA 4DELA 2PU0A 3W75A 2ANUA 3UPWA 1OADA 1VPYA 1FRBA 5AYXA 4LFYA 3JVAA 1LQ2A 8RUCA 4B90A 4DF1A 4GK8A 1NP2A 3AS3A 3SCVA 4WKFA 3T1GA 3UXKA 1YBQA 4QIUA 4ZB2A 4H6KA 3F2CA 3KL3A 4PL1A 1R9XA 1KM1A 1NOFA 2HNHA 3W7EA 1S3TC 2ZA3A 3NXLA 4KGLA 2A7PA 3AHYA 3RPTA 4BQ2A 2E68A 4JFTA 2PB1A 4H7ZA 3SM0A 5DQPA 7ODCA 3GH5A 1EJXC 1R3SA 5KZEA 1DOSA 3M46A 3TU9A 1BGGA 1GYLA 2IKHA 3HMJG 4K8EA 1IF2A 1HZYA 1VGAA 4OJYA 2RDTA 1OC7A 4PUUA 2YXGA 2IXUA 3WLTA 4J3VA 4JFSA 2YBVA 3K4WA 3DDMA 4UTJA 1VFFA 3KOXA 1ME7A 2VDGA 4V1YA 1K6WA 4DUXA 2WW5A 4JPGA 2ZDRA 2IKIA 3MI2A 1X1ZA 1E9ZB 4DZHA 1OBAA 2Q71A 4L64A 1EJ7L 5IBXA 4LRSA 2BLEA 3NO3A 1BKHA 2QCNA 2XN1A 4NYYA 2WM0A 1ZBVA 4D2JA 3V4BA 1RQEA 5PTDA 3NL2A 4H9MA 3ZOAA 1OK4A 1TR1A 1AQ0A 1DEDA 4NZCA 4LC6A 1WBJA 3EAUA 2AL2B 3FXGA 1SZRA 2BHZA 2C1IA 2PRMA 1A5SA 2X0YA 5C70A 1QW8A 2EG7A 4O19A 2ZX9A 3JU2A 4GX8A 1K77A 5HQEA 2HJPA 1HL8A 2VHLA 1X8CA 2WSYA 2GYIA 3E02A 1B3VA 4MOZA 1PV8A 5JBDA 1PKYA 3LBMA 3WYZA 5A6AA 1R2TA 5LNSA 1KXVA 4E8CA 2FPYA 3N12A 1IV8A 4DO4A 1V6UA 1TREA 3N1AA 1W3JA 1T0OA 2EPLX 3L0GA 1FWIC 3PFRA 1XSIA 1U5HA 2ALRA 1UH4A 1JUKA 4A2SA 2Z6JA 2FZNA 5F2IA 1QOQA 3AU6A 3NZ1A 1P48A 3W4RA 3CUXA 3H2FA 5ABFB 2ZQ0A 3M4HA 3N29A 1DHKA 1AVAA 3JR2A 3OW1A 4MGGA 1LYXA 2CLHA 4WQ6A 3CZJA 2IPJA 4M7TA 1IZKA 3W7IA 4BQ4A 4MNKA 4KWVA 1XIBA 3LPOA 4X0NA 5AVHA 3O3RA 1US2A 1Q5MA 4UOZA 3AIRA 1Y5WA 3VD7A 1UG6A 3UWYA 5FJPA 3TP4A 3C0LA 3O0FA 3G1DA 4X22A 2FGLA 3B04A 4ENLA 4AZGA 1Q6LA 3S1VA 4K3ZA 1PZ3A 1JZ3A 3OEXA 2CYGA 7TIMA 1Q6FA 1T99A 3P14A 4EAYA 1KFBA 5G5IA 1MFVA 2TMDA 1UIOA 5CLTA 1W1IE 4NVTA 2BOEX 3PAJA 2J6VA 4YHGA 1XH2A 5D2WA 4JY8A 3SUWA 1R47A 4JTUA 1ZJHA 2QAPA 4QM1A 3CEPA 1GW9A 1WDWA 5FJIA 9XIMA 1G4SA 3OVPA 4DZIA 1LQ0A 2CLEA 1RY0A 2XH0A 1OFEA 3NFUA 3QSTA 4P5UA 4JYEA 5D09A 3WDIA 1ISXA 1RHCA 3DG7A 1UA7A 6TIMA 4LB4A 1O94A 1AH0A 1Q6CA 3MP4A 1GQJA 1XRTA 3L65A 4Q4OA 4XZ9A 3KS5A 3IJ7A 4N02A 3FYPA 1XISA 1Z3NA 2OEMA 1H50A 1M7JA 7CGTA 1JCMP 1R7OA 4D8ZA 1NF0A 3RJXA 5G2WA 2BDQA 2ZZ7A 4C6CA 4RDZA 2ZRYA 4IQJA 1S38A 2NQZA 4B5NA 1P1MA 3RFAA 1V79A 1RJPA 1XIHA 4C60A 1ZBWA 2X1TA 3BW3A 2H90A 3SRFA 2A3CA 3UETA 1E73M 1VEMA 1OX4B 2ZA2A 2TYSA 1A80A 4W7VA 3VNMA 3GC2A 1XLLA 4CNOA 2A6NA 4A3HA 2DT2A 1XC6A 1UD6A 4ALDA 1E4LA 4KESA 5MF5A 1E71M 3S0CA 1C92A 3WQCA 1ONRA 4IIFA 3C8NA 1NEYA 4G6CA 3SY5A 1K02A 3BSMA 4PFMA 2PWVA 3AUOA 4LBUA 1TVNA 3N9KA 4D6CA 3RF9A 2XUCA 4D71A 5CGMA 1H1ZA 4LVAA 4DWSA 3R79A 1WPCA 1PX4A 1QXLA 2VDHA 4QDPA 4RK8A 2E3ZA 1W5QA 1JYWA 4LB3A 1TRIA 3H21A 2CITA 3EOOA 2BY0A 1ZU8A 2HE8A 1DXEA 2X0SA 2JGQA 3NPWA 3LU2A 3PPHA 2GJNA 3A12A 4EIVA 2GQ9A 2FDSA 1R86A 2XIJA 1NFGA 3RLUA 3S5NA 3WMLA 3U5UA 2OYKA 1WUFA 3QH2A 5EMYA 3VOGA 1H61A 4RE4A 1HXJA 2QF7A 1EJRC 2V2HA 3N6JA 3WNLA 3TYAA 3SFWA 1IIGA 3PULA 3E2RA 4QDMA 3BAYA 2TSYA 2A7NA 4C6MA 1QATA 2ZZ4A 5A6TC 4AG0A 4J9JA 4DRSA 1IEXA 4KIRA 2BXVA 3GHUA 3ES8A 1YDNA 5F1UA 4WXZA 5A8GA 2WJFA 1ONEA 4TX6A 3U57A 4KERA 2E25A 1BWKA 2WC3A 1GOWA 1P0EA 4PA8A 3AJ7A 3VIGA 3WL0A 3NTYA 4C1KA 4GBUA 1O60A 5D8ZA 3D0CA 3WF4A 1TPH1 3S6TA 4B3ZA 3L5MA 3MYOA 2XG9A 4DI9A 4JTFA 3HQPA 2AKMA 1H3GA 1E70M 3ZT7A 3QOKA 1QNRA 4L4LA 1GG0A 1XLIA 3T0AA 5FAJA 4AWSA 1X98A 1GVQA 1H41A 2PWFA 3MW7A 4FZIA 3B8UA 3LD5A 1VBRA 3SO7A 1ZP4A 2V38A 1MW2A 3PM6A 4IJCA 4KRUA 3QZEA 3CTTA 1GOQA 3AMKA 5FAGA 1XX1A 4UTLA 2GSEA 4F3HA 1FH8A 4NAEB 1UWAA 2D24A 1E1EA 3H7VA 3PZTA 1H5YA 4Q4KA 3TSDA 3VMPA 2ATMA 2CZDA 4HYVA 3H55A 5FL0A 3OPSA 5K9CA 4QP0A 5I6SA 2HXUA 5A8NA 2DQWA 4UIOA 3G1SA 5IBXC 2QR6A 1JJKA 5T26A 3W6YA 5HWMA 4JYFA 2VCBA 2I5IA 1BWVA 4UOJA 1W3KA 4ZVJA 1KB3A 2NXHA 2GDQA 1UWRA 4HZ8A 4QHRA 4L1GA 1W3LA 4Z0SA 3QKZA 3LHUA 2Z27A 1H11A 1TJ0A 1ZCCA 1FBAA 3N3TA 1PDZA 3DHPA 4QBXA 3VIFA 1V0LA 2PD9A 4FALA 2F38A 1H1NA 5CSYA 3V5CA 3DESA 2DDXA 1QO2A 1V0KA 2PCQA 1HL2A 3K30A 3H4GA 2D0FA 3OZOA 3NM1A 1QPQA 1JDEA 1OF8A 2DGAA 2BGNE 3GWQA 4DUOA 2E0PA 3QW4B 3NEHA 3O16A 1M65A 2OELA 1GVYA 3QM3A 5A5WA 1QMLA 4IZGA 1U22A 3SY1A 2PDPA 3W81A 3L0KA 4O15A 2XH2A 3GVRA 2PDWA 2E67A 2VX7A 1TJPA 3QGKC 1NDZA 2HS6A 2DW6A 3UY7A 1Y5XA 3LX9A 2QDDA 4WKHA 5AZ0A 1I2PA 1R46A 3GU1A 3II1A 1RSCA 3KX6A 4NXSA 5DMLA 1V03A 1NOUA 1FHVA 4U2YA 3THDA 3PSVA 3AYSA 1UD3A 3NPXA 3EXTA 1X39A 1TYGA 3KEHA 1MYRA 2ICSA 2GGEA 4WVXA 1M03A 1N8IA 2PTXA 3ITVA 4GUHA 5HPOA 3QR0A 3PWGA 3S2CA 2IKJA 4AVNA 3FGCB 3P5ZA 4AVFA 2PP3A 4HPGA 3R6IA 2AAMA 2WSPA 4Q4SA 4PBFA 3AFBA 3DEQA 4I3GA 2VQUA 4KKXA 5I0DA 2PDNA 3LXAA 3G6MA 5E0FA 4F4RA 3CO8A 2PE4A 2ALDA 4FX6M 1R30A 2G37A 3FKKA 5G1MA 2BGSA 5GJMA 2FTPA 4W89A 1VCVA 3EEZA 1SR9A 1RLDA 1I6NA 4E8DA 3RCNA 1QPKA 4GKLA 4AF0B 1Q65A 1GNXA 4PMRA 3CGTA 3A5VA 1IYXA 1RD5A 2Z29A 4E4FA 3UFYA 3GO2A 2C15A 3F03K 5HINA 3EB2A 4MNJA 1CXHA 4ZQRA 6ALDA 3KOYA 3I10A 2A21A 1R85A 3SIMA 3PTMA 3BAJA 1KGXA 4Q8WA 3V0UA 4G7EB 3ITXA 1F05A 3GG0A 1JFHA 1EF3A 4OKDA 3QQ0A 3PUOA 4H6RA 4MJ2A 2G8ZA 1B4KA 1IEWA 5C7HA 4OTKA 4B9YA 4XIAA 1O5KA 1R9YA 1FWFC 1DJZA 1IEIA 1XXXA 2X8RA 1KFKA 3IIOA 2IXVA 4UMBA 2X2GA 4MTVA 2Y89A 4EPDC 1LZOA 1PSCA 5C6MA 3G77A 2YW4A 4WK9A 2B4GA 5FESA 2CBVA 4L4PA 3ABXA 2PFHA 5IFTA 2YXXA 2QJIA 4LWWA 3DFQA 5GVJA 1XF0A 1N55A 1TFVA 4CCZA 3TN3A 3W1UA 3VDBA 5DELA 3AALA 4B16A 2F84A 3WK1A 2BVTA 3H8AA 1JRBA 1W3IA 3P3BA 6PTDA 1RV8A 3MHGA 4I5XA 1LT8A 1PIGA 2QHAA 1EEXA 2XN2A 2PS2A 4UCFA 2CERA 5TD4A 1FWAC 1TVPA 2XSAA 1RVGA 3CUZA 3I3DA 4FX8A 4U31A 3F4NA 4C6JA 5EY5A 4H00A 3QR3A 3ZM8A 3EOEA 1WKFA 1TV3A 3G8RA 4MDPA 1GVEA 1F6KA 3C8FA 1AODA 1WYIA 2GUUA 3DECA 1REQA 1LF1A 1VEOA 5DN1A 3PWAA 1SR0A 3HF3A 1UPPA 2JBMA 4W88A 2Q3RA 3B97A 3CZKA 3TR9A 4AISA 1GYMA 2OLHA 3PUDA 4NJJA 1AH4A 2E9MA 3NSXA 2ZWYA 2HVNA 1JCXA 4XUYA 1F6YA 3NGFA 1XM3A 1PKNA 5F4WA 3WBWA 3F4WA 3DKLA 4J3UA 3W6LA 1LLZA 4OV9A 1W9PA 2OT1A 2UY2A 1ZQ5A 3NGJA 4J3WA 1JF6A 1UJQA 2XIMA 4U2ZA 3N6HA 2A79A 3ZZ1A 4FK9A 4OGZA 4MSSA 3TC7A 1EZ2A 3WK0A 3P84A 3LMYA 3GW0A 5LKYA 2G3MA 4CD7A 2VKZG 4G56A 5IOBA 3Q58A 2E8ZA 2P50A 3S2JA 5LGZA 3BANA 1Q7QA 4ZO6A 4QG8A 1KGWA 4Q8PA 4JIHA 1V8EA 2JIEA 4LUTA 4AY8A 5FJOA 1ECEA 2W27A 1EKOA 2ZTKA 1XLEA 2PGEA 4HPXA 2X1RA 1TVLA 3U3HA 2BY3A 1KRMA 2ZUVA 4N0RA 3WQOA 4UZSA 5F7UA 5I79A 3PZNA 2GWNA 1BTMA 4IUOA 2ZRUA 3W87A 4GD0A 3T44A 2PWDA 4K7VA 1HT6A 1LROA 1YDOA 3MCNA 1JGMA 4XTIA 1ITCA 4PTNA 3THAA 2CLFA 2VXNA 3ANVA 3P82A 1ODUA 2J66A 3CASA 1NWTA 1JPIA 3SCRA 4AHPA 1JFXA 4LY4A 3OZMA 1TTIA 1B31A 4AQLA 3N18A 5HULA 4QRNA 4GIRA 4DNMA 4YVVA 1XUZA 3CIXA 2ISSA 5A95A 3TAKA 1UD4A 4S3AA 1XFBA 3BH4A 4IFKB 1JIBA 5FJUA 3B3DA 1SFSA 1K9FA 4NX0A 3O06A 3AUJA 1ADDA 4K68A 5H8PA 3BLEA 3EWYA 1BKSA 3QXBA 1RP8A 2HEJA 4LBSA 4LSBA 2PP1A 5A6KA 2DVXA 4GE8A 1P0KA 4JX5A 3V18A 3QMTA 3GAYA 4DEFA 4PRWA 2QV4A 3OYZA 4DZ5A 1FDZA 3EWWA 2EO7A 1UCWA 1O12A 3TQVA 2IKGA 1EEPA 1TCMA 3E3HA 2HBXA 4OUIA 3JZEA 2VOTA 1P0NA 4LUSB 4N9DA 4U10A 3NUKA 1TTQA 1ZSXA 2I5GA 2NQLA 4NNCA 4C91A 5KINA 3SI9A 1I8JA 1MZHA 3ITCA 2WMFA 4A8RA 4CQ8A 2B31A 2CLKA 3SB0A 2R1LA 3A3WA 4EKJA 5FEPA 2ISWA 1W9BM 3EPNA 3IPWA 3SGZA 4Q3MA 2P8CA 3W74A 1AW1A 1CGUA 1FDJA 3FN9A 3PHAA 4YN5A 4P2VA 1LDCA 3DFYA 1ZCOA 3S4TA 2BXYA 2WANA 5EMJA 4P7QA 5I2UA 1IHIA 1E43A 3CPUA 1ONXA 5FF7A 4GH3A 3WIJA 1F4HA 4HHHA 3F7JA 3GX9A 4W4QA 1S5MA 1PZ1A 1AH3A 4HA1A 5EB8A 1WBHA 2WVSA 4ZQMA 3J7HA 1CNVA 2ZC1A 5CPSA 1UC4A 1GEQA 3AHZA 5AC5A 2JK2A 4XAGA 2VTFA 2JKAA 4MPKA 1QCWA 1LOSA 1VBUA 3E49A 1XBZA 1PIIA 1JUBA 4EPEC 5K9XA 2V0TA 2HVMA 1YX1A 1OD8A 1TG7A 4HCLA 1J0YA 4UTMA 4A05A 5C54A 5K3VA 3K2GA 1W2PA 3O07A 1A5BA 3CL6A 4YNGA 3CV6A 4EXBA 3Q4DA 3UJEA 2G4JA 5I78A 4WGHA 2DT1A 4C7DA 1O7AA 4CEXC 4F66A 2BFGA 2O4MA 2E09A 1YXCA 2F9RA 1JDCA 1EWDA 1SSDA 3PAOA 5JBFA 3OBAA 2Z28A 3QBUA 4GWEA 3SGGA 1XG3A 1Q66A 3ABZA 3KHJA 1Q6RA 2JF6A 3WY1A 4INFA 4JL2A 3N11A 2O4QA 4FMVA 3FLUA 7REQB 3UZXA 3CTLA 1OYCA 3PC0A 1N8WA 5CJMA 4EK7A 3CHDA 2CZVA 4O4VA 3A5FA 3DAQA 4PMXA 3VAVA 4JFVA 4AD1A 2PP0A 3AZRA 1PJ9A 4CN4A 3OLDA 2RH9A 1AD4A 1GVOA 2ZZ6A 2QGYA 3W1PA 1TPFA 2V69A 4A21A 4WOQA 2YDQA 1RJRA 4UFMA 2H8XA 3EMQA 4FOKA 2A6LA 3WLLA 2Y88A 5CSSA 4JHOA 3AMCA 1NFPA 2VFFA 1XYCA 1Z44A 5T8GA 3BLOA 3L0NA 5C0QA 4W8AA 4L6DA 1HJQA 4O8RA 2CHRA 4AZ5A 4JTSA 3UZYA 4Y9PA 3URNA 4WHBA 4G7FA 3FXYA 1UUQA 1ZHAA 3T0BA 4U4MA 3GNNA 3NURA 3SR7A 3SECA 1KTNA 4WJEA 4F40A 3IJ9A 2PGRA 4K7YA 4LF1A 1OY0A 3UP8A 3BOXA 1LWJA 3NVTA 4UTIA 1YPFA 1F7BA 4UNKA 3V1HA 4MB1A 4I7WA 4LY8A 4N6EA 4NZ4A 4TX8A 3S2NA 2Z25A 3VUPA 1YXDA 4ZCWA 5I3IA 3GH4A 3LDVA 3M07A 1GOMA 5CZTA 4H7VA 2XM2A 3CLMA 1JYXA 4AD3A 4ADTA 3ONCA 1VPQA 4GYJA 3MC5A 2R1KA 1VQTA 1XCFA 3GAKA 1KKRA 4HPJA 3IRDA 4WSJA 3W25A 4H19A 3C6CA 2VGBA 4FR6A 1GVFA 4QQ3A 5EA9A 1MXGA 1GONA 2I57A 3F4CA 4W5UA 4DJFA 3NCOA 1S39A 4LALA 1S2AA 4E3TA 2WNNA 4ERIA 2PF0A 4G2DA 1FWJC 5I07A 3HURA 4FNSA 4TXEA 4HYWA 1OG6A 1WZAA 2YFNA 5G4EA 2CLOA 3SRKA 3PFMA 3FA4A 1J96A 4NIRA 1UR3M 1QNPA 2YL9A 1OX6A 3B40A 3TK7A 2REQA 1MEHA 2X7VA 4F0LA 1CT5A 1W56A 3W2MA 3EMCA 3AWNA 2CW6A 3EOUA 1K9DA 1RBLA 3NO5A 3RR4A 1BGAA 2LLEA 2H9AA 2XVGA 3KAOA 3M5ZA 1V6XA 6XIMA 4Y96A 1VFSA 1XDMA 1UOZA 1BFNA 1S5NA 3E2SA 4M19A 3G1HA 2QPXA 3BURA 3MV11 4N6FA 1WZKA 1EDQA 3S9IA 4KBXA 2VCAA 1W9UA 3SQLA 4H9YA 2G3IA 1T41A 3FVDA 1VLIA 3JUGA 2XZ9A 5C9UA 2WHMA 2ZIDA 4DNHA 3HIJA 2R9RA 4YWSA 4HZ6A 3WNOA 2VFDA 1TZ7A 4H9VA 4B5SA 3EKZA 4IFRA 3ARQA 4HHPA 3BAXA 1JR1A 4O14A 1AA1B 3U6WA 4JQ2A 4NZ3A 4FPSA 1ELSA 3GW3A 2EG8A 4FS9A 3B8DA 3T0TA 3RLHA 5AECA 2ZWZA 4YTUA 4IGNA 4MFDA 2FVMA 3PJUA 4R9OA 5I00A 4JCLA 4N7QA 1IZJA 5L9FA 5KZDA 3I68A 1J2WA 4TVCA 1B3ZA 3B9AA 3JS3A 3DC8A 2PMQA 2E1WA 2QZRA 3GNPA 4ONVA 3VNZA 1KRAC 2IUZA 1NIUA 2CXGA 1NWUA 3M0JA 5JIWA 3C52A 2WB5A 5E0KA 2FHCA 4XQ6A 1F73A 3DERA 4KCUA 3I4EA 4GY7A 2FPTA 5IHRA 4Y9MA 4E2OA 3N4EA 2CFFA 5BWFA 2XFYA 4PCNA 1B9BA 2YLAA 3WF0A 3EDDA 3UWQA 1PE1A 4DHGA 3ARYA 3HG3A 1X7IA 1CDGA 4JTEA 3WJWA 1CWYA 1YMYA 2Y2WA 4WY0B 1W1PA 3RN6A 1M1BA 3FEMA 1ZJIA 3UQNA 1DIDA 4ZOBA 4O1FA 2EJAA 3BCDA 4OU1A 3LMZA 5H91A 4IPLA 1S2UA 1ALDA 1UWSA 4TO8A 1Z41A 3ORWA 4RNIA 1GPFA 3BSGA 1BLIA 4XKMA 5A6JA 2DJXA 3L2MA 2FVLA 1G94A 1DJWA 3TEVA 4P8UA 3B9DA 3E9AA 4OBRA 3R89A 5CQ1A 3UG4A 3BTNA 4MWAA 1GPWA 3ARTA 1C7SA 1WDRA 4Z2KA 2VUYA 2BOGX 4KS0A 1DORA 1JQVA 3C2OA 4U5KA 1QDSA 4GXPA 1AMYA 3I6EA 4F0HA 1V3KA 3DUGA 2XHYA 3IIXA 2YCKX 2VEGA 4WJ8A 3CHEA 4O12A 1KW1A 1DIOA 4NAFB 1DQXA 2Z1WA 4XZMX 3O63A 4WSHA 1J01A 3I4KA 3GFXA 3W37A 2WBGA 4KCTA 2FIQA 2HISA 3NDOA 3O6CA 5AYYA 1LUCA 3VTRA 5AHEA 4KGJA 2QLYA 3MP3A 2GVJA 4UFLA 2GSJA 4I7UA 3VU2A 3GDLA 1Q4NX 3WNMA 1PWMA 3GHSA 8XIMA 9CGTA 4GCXA 3IGHX 3L5LA 4BJHA 3MU7A 4AC7C 5DCDA 4DWSD 3TOPA 4G8TA 4C6DA 3W1QA 4XISA 4EXAA 1WAWA 3T6CA 1LJYA 2PTYA 4Q4MA 2C19A 4O1EA 1E0XA 1UR0A 4LCSA 1Q85A 2O56A 5D32A 2ZUUA 2BODX 1V6VA 3EDKA 3FY1A 5D2VA 3B8SA 5KMYA 1EC8A 4OBTA 2GFTA 5C2XA 3ZWTA 3KDNA 4Z1AA 4UQBA 4FSAA 1SO5A 3FVMA 4UNIA 2RJHA 4QLJA 3ZVHA 3CMGA 3H2CA 3ALFA 2G3FA 4GY0A 2XM1A 3W72A 4ZR8A 3S9YA 1F76A 3KUMA 1EBHA 1KXTA 5HR7A 1EYWA 2EKGA 1KFWA 3GXTA 4IF2A 2OJPA 3P0WA 1R3TA 4NL1A 3RRXA 3T2OA 2VGGA 2Y8VA 4KRZA 2WZTA 1AQHA 3IJDA 3K13A 4ERAA 1M7PA 3CJPA 1TPB1 2OX1A 4UTWA 4LH8A 1K03A 1GKQA 1EUAA 2DZAA 1EQCA 3U4FA 3T42A 2C14A 4FIQA 1XRFA 4CNTA 3SZ8A 1S5WA 3GD6A 4TR9A 3LI1A 2WM1A 3OHIA 4QEEA 5DFAA 3WQDA 2YGYA 3EWBX 4HMNA 4KQNA 2V6AA 3VABA 4AMCA 1IXQA 3TJIA 2BOFX 4PRRA 5JQ9A 2WZEA 2WLZA 3TTSA 4Z2JA 3NIYA 3CH9A 2QNEA 1DXFA 1QTWA 4BI5A 3I65A 1CTNA 1C3FA 1NFBA 4IMGA 4EF8A 1SQ7A 5J5RA 3C2VA 1PEZA 3KL0A 3TTYA 3KVKA 4TVUA 3MUCA 3DKJA 3WDHA 4RUBA 4O1AA 4UQDA 1A5MC 3DHDA 2PC8A 2PDGA 3VMNA 4PMVA 1GJWA 4BR1A 1BEUA 1IT8A 1XDLA 2YYTA 3G5EA 4NNBA 3WLHA 1W3TA 2Z2UA 4EWJA 1OGSA 3U2ZA 2CWNA 3UJFA 2NVCA 1LM1A 1V7YA 2YB1A 4GVHA 1XS2A 4DAIA 4CVUA 3W88A 3AQUA 4AUBA 1PHWA 4GGBA 4O0QA 1D8WA 4QXIA 1EDTA 3UJRA 2PTZA 1EBGA 3TW7A 2OTDA 3MUZ1 1KBBA 3W00A 2Y8KA 4DZAA 1W3HA 3VXGA 5EFFA 3A22A 2WBKA 1Q63A 4HGXA 2GVGA 3V36A 1LQAA 5AC4A 3KDOA 4RXFA 1OJXA 1TJRA 2WKJA 3ZSTA 3ITYA 2DZXA 5EBAA 1MZRA 3M64A 4DM2A 1WOAA 3B0PA 3URAA 1QU4A 5DF0A 3W01A 4CD4A 2Y4SA 2FGZA 1V3JA 4LXFA 4C6PA 3VGDA 1CX9A 1X97A 2FFIA 4GINA 3ANUA 1NWRA 1JCJA 2VNCA 4ML9A 2VI0A 5XINA 4ZXLA 2NQ9A 2HVOA 4GIYA 4RJEA 3NOEA 3WF1A 2CBJA 5HNRA 4I90A 4MB4A 5G4WA 1W5OA 3SCUA 1PXGA 3HV9A 3NL3A 2EPNA 3NZQA 4ZEPA 3WNNA 1GOIA 2QW5A 1OABA 2DSVA 4C5ZA 4JBRA 4HMEA 3K8LA 4NJHA 1F5ZA 1TR9A 2ZXDA 3L4YA 2UY4A 1LWIA 4IXHA 1MW3A 1H0GA 5FEXA 3TTEA 3UXLA 4XZLX 3A47A 3POCA 3GM8A 3KP1A 2J79A 2QCLA 2Z7GA 4DJDC 2NLIA 4ADSA 2CBUA 1DYSA 3P93A 1WKYA 3PG9A 4E5TA 2DZWA 2WZHA 3C4UA 4Q4PA 4H4IA 2AL2A 4NT0A 3K46A 5CCZA 2J9XA 4FLRA 1EC7A 1XR2A 2UBPC 2WMJA 4WJXA 3REQB 4AWUA 4YYFA 2QCGA 2RGMA 2WSRA 2QAFA 4CQBA 4IJBA 3BMWA 2RJGA 3UWVA 4FNQA 2J7HA 4YPJA 1OCBA 3CEUA 3SIZA 5AKQA 1Z9AA 2GGJA 1O95A 4H83A 3NQ6A 4W5ZA 1NJJA 2J7GA 3N19B 4ECLA 1WE5A 1FA2A 4G1NA 1JD9A 3BG9A 3KCJA 3PBMA 3CUFA 2NT1A 4DO6A 3RLVA 1TELA 3GDKA 1A50A 3NZGA 1ME9A 2VDIA 1TX0A 5EL1A 1KM3A 5ABFA 1P6BA 4CNSA 1EA0A 4WF7A 3NZRA 2EPOA 3AS0A 1LG2A 1OIMA 3T81A 4S2CA 4RV3A 1OFAA 2JF7A 4RZ4A 5FD0A 1XKJA 3W28A 2OU4A 5F2MA 3IJIA 1UP2A 3M0LA 1VKFA 2Y85A 3UBPC 3RM8A 5CC7A 2ZRZA 5FA5A 2ZADA 2Q8ZA 1E0UA 2DH2A 3F2BA 3UNTA 1SVDA 1V7AA 2G5WA 4MUPA 3VIHA 4I6VA 1QHZA 4Y2WA 3TJLA 1V02A 2E6YA 2XVKA 2Z24A 3WNPA 3W7OA 1OGGA 1IE7C 3H24A 3H2NA 1IIHA 1E56A 4HCHA 1KO0A 3T8QA 4GNJA 1RR2A 1LRNA 2OQYA 3N2MA 5GPRA 4OE7A 2QGHA 2GUYA 1EP1A 2EPHA 4IMDA 3IRSA 4O0KA 5EKYA 3NG3A 3H2AA 3VNLA 2Y70A 2Q8LA 1NF7A 3QPYA 3TH6A 4O0ZA 1FY6A 4PR4A 2ZX6A 3NAVA 3E0WA 3VX0A 3QPEA 4JTTA 3BE7A 1Z8AA 3ARVA 1U2YA 4Q6XA 1QWGA 1W1YA 3MVIA 2DIKA 1DHPA 8XIAA 1TTJA 1AMKA 3ZMRA 4UFIA 4IG2B 1UMLA 1XDJA 3WJXA 1EX1A 2BZNA 1OX4A 4GHRA 2WJEA 3U4AA 2PLKA 4JL1A 4BK9A 3AROA 3MJMA 3N2CA 3WBEA 5D9MA 2A3BA 4MAZA 1I2NA 1X6UA 4QCEA 4D8LA 2NUXA 4MPQA 5DBTA 1RCXB 1M6JA 3E2VA 2ODOA 3E6EA 3HB9A 2RFGA 3M0ZA 3NJ3A 1UKTA 5B7YA 4GA8A 2QXWA 1XJBA 3ZIZA 4PN2A 4UFKA 4F0RA 5A69A 2WZMA 4GG9A 1SFTA 1LRTA 1VEPA 3M7SA 1KFLA 2NQ5A 1QI4A 3TLLA 1FHLA 2WNQA 4QEHA 1MWOA 3OGSA 1G1YA 4PEKA 1JVNA 2EPMX 2F6XA 1DWIM 5GJPA 5A6LA 3HPFA 4FB7A 1POKA 2BVYA 3OTRA 4KH2A 2ABBA 2WWDA 3TOYA 2QCEA 1QI5A 4IM4A 4O28A 4KIEA 4R33A 3SADA 3S1UA 2C18A 3ZO9A 4A6GA 4CCCA 3RNDA 1KXQA 2PLJA 3QR1A 1KQYA 5BW6A 1RBOB 5F2LA 2CZ5A 4NRSA 1HVQA 1WUEA 4HNUA 3D46A 3L4VA 2DFAA 4H8VA 3O1NA 3GYCA 1HTIA 3NPUA 3TSBA 5LIXX 3PZ9A 1EJSC 4XVDA 1D7KA 2R6OA 3L5AA 2P10A 3FDGA 2WMGA 5C5YA 1MXSA 1UD5A 4JTCA 4AHQA 3MMWA 4IGMA 5LHEA 3FJLA 3LM7A 3LQLA 3OHMB 5H8MA 1R3YA 3H4WA 3D6NA 1MFUA 4JTIA 4JAWA 2PDYA 3GTHA 1UUMA 3HFYA 4P61A 4REQA 3T40A 2YDSA 3RMEA 4MF4A 3T8LA 2BWGA 4CQAA 2X1SA 4A4AA 2PUZA 3KRUA 4DM1A 4LAKA 3K4DA 4KF1A 2ISVA 4QISA 1ZB5A 4F8XA 3FA5A 2VEIA 2A3EA 2ACRA 1XLKA 4FP1A 3LCLA 3MWAA 1PCKA 2VFIA 3BLPX 3KOZA 3UZZA 1EJWC 3KWSA 3UR8A 2A0NA 1EL3A 3GFZA 3LTSA 3WQWA 2UY3A 3C3UA 1BPLB 4LAOA 1XI3A 2VRJA 1XQLA 3V3WA 3MJYA 2EEXA 1IZCA 5JH1A 4FX7A 2JKPA 4DLMA 3C0SA 2GGIA 3P5YA 2J8GA 4JHMA 4ZGYA 3MYPA 1EGZA 4NJKA 4GI4A 1BG4A 1LTDA 3KBJA 1TJ2A 3KZPA 2C0HA 3RG6A 3CQKA 1H2JA 2REQB 3A6OA 4ZOEA 4AY1A 5BXSA 3E12A 4IT1A 3LEPA 1RZMA 1B5TA 1PCWA 4V1XA 4O1BA 3VDHA 4AVOA 4FNPA 3IIVA 1QR7A 5IDIA 3T4WA 3BZJA 3VCNA 4JKKA 4LVFA 1X96A 2H9AB 4B5VA 4R85A 2VFGA 3KVJA 1I1XA 2E5BA 4QNEA 2YDAA 4RR4A 5CBIA 5HMEA 1TV8A 4YTRA 2JIWA 2W79A 4LBRA 2E5DA 2CLMA 1DIEA 2AQWA 1NELA 2QUMA 5D8WA 1A3XA 3QVQA 2PDHA 1B3WA 1XW8A 2WMKA 3QY6A 4BF5A 3AC0A 4FO4A 1BXBA 4A3QA 2GJLA 3W3OA 1SMAA 1AJ2A 3OO2A 1IT0A 3NSNA 3U2OA 3BMXA 2HRWA 3W1RA 2CETA 1S1RA 3KLLA 1UKQA 4Z2GA 4MJZA 5BRPA 3ABSA 3P60A 2RKXA 4S3GA 1N2VA 2IPGA 1R2RA 4KT2A 3ZJ6A 3ELFA 1RBAA 5E9AA 4UTUA 3EWDA 2YZ5A 2DVTA 2YBTA 3UPMA 2WJZA 2ISDA 3MKCA 3GXFA 5BXRA 5D2XA 4P7LA 4PBGA 3RIKA 2CIPA 4ICNA 3G8EA 4HNOA 4DF0A 3B9EA 3ZFHA 4QGCA 4QJ4B 1JDDA 4W87A 4WRHA 3E5PA 2OVLA 4UTTC 4Z2HA 5M17A 2X7WA 3UXAA 6A3HA 2Z00A 3VINA 4DXXA 3FGCA 1R3QA 4M8UA 3DFNA 1FOBA 3UYCA 4J27A 2ZYFA 4AEEA 5E6YA 3FHQA 3LB0A 2J7DA 4JIQA 1O1HA 3GNOA 8CGTA 3OGRA 2OXNA 3W9ZA 3LERA 2E4TA 2H6RA 3NQ2A 2PWHA 4AX7A 3QGVA 3KLKA 3FSTA 1TSIA 2YR1A 1XD1A 4Q33A 3AO0A 3MUIA 3SFKA 5HATA 1Q8JA 5HK4A 1LOQA 1QO5A 3V0TA 3PWIA 3LUTA 2E1DA 4MB3A 1RH9A 3K5XA 4AZCB 4ZO8A 2GQ3A 2QJHA 1M53A 3FJ6A 4PE8A 1CBGA 1K7EA 2PDJA 1CEOA 3EKLA 3AXXA 2CKRA 4MWAB 1R6WA 1FQ0A 3R5EA 4E38A 4XSLA 1T8XA 5TNVA 3RAOA 4G7EA 2FTYA 2PURA 1HIZA 4QAWA 3CZLA 1GQIA 1HKWA 1KC7A 1XBXA 3UG8A 1W1TA 4CN6A 4Q8TA 1HJXA 1X1OA 2RUSA 3FOKA 4AU0A 1B90A 5IFPA 3EKGA 3ITTA 1E40A 3KWXA 3MO4A 3ZWSA 5C9XA 2UWFA 3MSRA 4MJ4A 2XGBA 3HG4A 4HNCA 1QVBA 4F0KA 3LCIA 4O11A 1O4UA 4M6QA 3QV6A 3DC0A 3SN4A 1P5BA 4DJFD 2ZKMX 4JDYA 2BVWA 4GH1A 4JNMA 5DMYA 2YCIX 4CU8A 3UGRA 3KBNA 3PZUA 4CNPA 4OVXA 1UPMB 1E5JA 4FXJA 4QSHA 4AHOA 4NHVA 1BXCA 1H09A 1WOBA 2PDIA 4GI8A 1F8IA 1H5VA 1JZ2A 4AD0A 4DQWA 4M1BA 1MQRA 2B0MA 4H8UA 4UMAA 3BZGA 4EPBC 2C8NA 3H23A 3LZ3A 3IAQA 3SUVA 1V0MA 3E1F1 4GJIA 4L6OA 3W38A 1UWTA 1J0ZA 3TE9A 2BP1A 2YLLA 5LIUX 3NPVA 4FXSA 3ZVHB 4LS1A 3C2FA 2ATSA 3DU0A 2EPKX 5E09A 1PKLA 4HHMA 4IUGA 4H01A 4WLCA 3AXKA 1EQPA 4PUJA 3S1XA 2PF8A 2XJ7A 3S3GA 1TIWA 1BVZA 1VFOA 2Y0FA 5BNKA 1BYDA 1O5QA 5FF0A 1DBTA 1KA9F 3TV8A 1D2KA 1CCWB 3VKKA 1XCWA 2VP8A 1XP3A 5DXYA 5AYIA 3EA3A 3TN5A 1UASA 1E1CB 1R9ZA 1NDVA 3TTOA 2BXZA 2J7CA 1BF2A 1YE6A 4XBSA 3TJ4A 4CQCA 3AHXA 4NASA 1DXIA 2AMGA 2WC4A 5KITA 3GTFA 4GPNA 4JD4A 2PRLA 4N4PA 3ZR4A 3B4UA 3DBPA 2O7SA 2W3ZA 2XIBA 2ZFAA 2WHLA 2ZZ1A 4GABA 3DOPA 4LQ1A 4MLJA 3PBWA 3UWUA 2I5QA 5CPTA 3BPWA 3AMDA 3OG2A 4JXCA 3M41A 1RQHA 4ZOCA 1CLXA 4WUIA 2PRHA 3R4IA 1UQZA 1JZ7A 2DT0A 1B57A 1ZTVA 4XB3A 3WD2A 1XHGA 3WN6A 2BHUA 4I5UA 5CBBA 4X9SA 3MB9A 3DHUA 3W1TA 5CGQA 4YWIA 4K2SA 1UIPA 1CW2A 5CZJA 5E6ZA 3VNDA 3VCCA 1FCBA 4IQEA 1ZPTA 1I2RA 3LG3A 4IIBA 4HA4A 2AQVA 1NDWA 3VZZA 1FWNA 4I5RA 5HJXA 1M01A 5A2BA 4MKSA 2YCEA 3U48A 2QVHA 3TX9A 5FJJA 2I9UA 5K4ZA 4KFNA 2HCVA 5BOOA 3DZ1A 5CC3A 2VX4A 4A8LA 3GG7A 1JZ5A 4AFYA 2QUTA 3SUSA 1KBKA 2W62A 6TAAA 5J8LA 4ZA0A 4K36A 4R7JA 3MTWA 3CAWA 3L4XA 5AHFA 1EIXA 1MXDA 4POCA 2PSNA 5BYWA 2VD9A 1R2SA 2NVDA 1AQFA 1Q6GA 4PFHA 3OBEA 1TWZA 3ZYZA 4NSBA 1UQYA 4YYCA 3L12A 3TYEA 4IFKA 2WPBA 3PJTA 3HFTA 1J93A 1PUDA 4FF7A 1SUXA 2WCSA 3GR8A 4BI6A 1KR1A 3MA8A 3CC1A 3WLQA 2GGHA 4GJJA 5A8QA 3IGUA 2YB4A 2I7GA 1XL9A 3ARUA 1W91A 4MWAD 1WKEA 3I7QA 4HMDA 4U5IA 3PPFA 3O9NA 4MUZA 3P81A 2C6QA 1NH6A 4BF9A 4PUNA 4Q8NA 1I0BA 1KNWA 2X40A 4YLWA 4LCQA 4C6FA 4QITA 3EA1A 5ABTA 2Q3OA 2VWSA 1PTAA 3F1QA 3LS9A 1FWDC 3H26A 1G7VA 1OB0A 2WMHA 2R1PA 4LUSA 3LM3A 4IXXA 5AHIA 3IUIA 3MUY1 1JULA 4E2BA 5FSDC 1JPHA 3FW6A 2C79A 3MSYA 3PZGA 2AAAA 2VGFA 5AY7A 1SFLA 4OUEA 5I77A 2D23A 2PDFA 4KMQA 1K70A 1JZ4A 1EA9C 3M0VA 4EF9A 3GTXA 3AMGA 1XG4A 3TQPA 2TODA 3BV7A 5F4SA 2QIIA 3S6DA 3EA2A 3VFCA 2DIEA 3NQCA 3M5VA 3QHOA 4IIEA 4ZO9A 4JTJA 1CECA 3PBGA 2O9PA 3LXBA 5TIMA 4R9XA 4PYSA 2A1YA 2NQHA 3EDEA 4AYGA 3WK2A 2GUBA 3QRHA 1A3HA 3GFYA 2J4GA 3HZ3A 3EBVA 4HOXA 4S1FA 2OKTA 3LNMA 1V6WA 3UPBA 1JD7A 5C55A 4HP5A 2A2IA 2D0GA 2VZTA 4JR5A 1VD6A 3WH6A 4L5ZA 1VHNA 1V5XA 2YZRA 8A3HA 5CKSA 3GKFA 2DQXA 4FOUA 4PUKA 1JUEA 3V35A 3PZQA 2DIJA 2YDRA 2E6FA 3D3AA 3A3XA 2ZRVA 3V7PA 3LXCA 3HQ1A 2JE8A 3A23A 3BL3A 2NSXA 4QE5A 2A7RA 3ARZA 2VT0A 7REQA 3CMJA 3RU6A 1TTPA 1ME8A 1G9HA 1XPGA 1DPMA 5K7JA 2YKKA 1IGSA 2VMFA 1FFRA 1XPYA 4MY1A 3FA3A 2E9LA 1I2QA 4IISA 2EJ1A 4JTRA 5HUOA 1T96A 3MMDA 3M5XA 2WK2A 4JTHA 2PODA 3N25A 1BVWA 1BYCA 3GXDA 1FWWA 1H1YA 4TX9A 4WIWA 3W1XA 3SCOA 2OG9A 3P8JA 4V33A 3C61A 3KL5A 2WSKA 3UU0A 1FWEC 4N9EA 2FMNA 2KZHA 2HZGA 2ZUTA 4HSNA 1GW1A 1XIDA 4KEMA 3R0KA 4HK5A 3RCYA 3TYUA 3DENA 3MV01 4RNHA 4NU7A 4L9YA 1AZ1A 4M6PA 4FEZA 3T78A 3CPGA 3VKDA 2POZA 1IXNA 2XGIA 1PX3A 5HJLA 2QT3A 4I9TA 3L9CA 3NQDA 5D04C 4DXVA 3LK6A 1RA5A 1OCJA 2IPFA 1DWFM 3THUA 3N04A 3R0DA 4KW2A 4Z1CA 3CHVA 4ASTA 3M43A 1NAL1 5A3HA 4O4WA 3RX4A 1JI1A 3XISA 1ZFJA 3A4AA 3HN3A 3QTPA 3W0KA 2J62A 3GDRA 5FACA 5JMUA 1PWLA 1FKXA 2PTDA 4HU3A 2UZ9A 3ZJ7A 2DZBA 4O1DA 4ZO7A 3UT0A 2FMOA 3OP2A 7XIMA 1YPXA 3OYXA 2ZRXA 1HKIA 3E0IA 3W23A 1KKOA 2J24A 2OOFA 5M3WA 1KWGA 5C71A 1Y65A 2V30A 3V75A 2CKSA 3B9OA 2ACSA 1BSLA 1WKDA 3M0KA 7A3HA 1IT7A 2ZOXA 4O16A 2XDFA 1NQ6A 4EXQA 4UXDA 3M5YA 4YL2A 4GXMA 1Z7AA 1QRQA 2Q02A 3LTPA 4QCFA 3FAWA 5EMKA 4TUFA 2R8WA 2PI6A 4GJ1A 1YTEA 4X0VA 2EQDA 1EYEA 3NQFA 4B5TA 3S5SA 5K4XA 1EF2A 1HKMA 1K9EA 1VYRA 2Z6IA 5DCBA 1LORA 3ZT5A 2YA2A 2G3NA 4FLSA 4QG6A 4H7CA 1JCYA 4XKYB 1I0DA 3U2EA 1NARA 1XIMA 3NNTA 1YIXA 3P62A 1VH7A 1HJVA 4DAFA 5CZ0A 2WC7A 4AD4A 2W9MA 4M6VA 2PTWA 5AHMA 1CENA 4Z1BA 3T08A 1G69A 3PNUA 2FZMA 2HE5A 3PPCA 3LCWA 2DP3A 4WEVX 1BYAA 4YMZA 4IPIA 3TWBA 4E2VA 4LAUA 4GO9A 4FNTA 4UCGA 5LNWA 3GXPA 1QBAA 3VD4A 1VBGA 4LYQA 2OSYA 5CSRA 3TNOA 4O50A 1B30A 1ZY9A 4CU6A 4GNVA 5HMDA 4PCSA 4F9JA 5DMNA 3AWOA 1E51A 2GPTA 1ZL1A 5D4YA 4NI3A 4Y9AA 1FWTA 2HK1A 3M0YA 1VJZA 5LA1A 2HWGA 4ADUA 5CEWA 5I3FA 3B0VC 3N3MA 3NQAA 4G9PA 1AL7A 3IIPA 3APTA 3AS1A 3WFAA 1GOOA 3CV1A 1W5NA 2VVSA 4EOUA 1WZLA 3EDFA 4REQB 1A49A 3TSMA 1Z89A 3QY7A 2J27A 3H6OA 3W2JA 3HA1A 1TRDA 2GJPA 4MJMA 2XH7A 3AICA 3B8TA 1MO0A 2C0AA 4X63A 4DBEA 4ZENA 3WDJA 3SSJA 1GYNA 4GLEA 3W24A 1ADOA 1BG9A 2ONEA 3WH9A 1THFD 1V6TA 1J18A 1OFRA 3P61A 3TCSA 1KBIA 5I5RA 1XLCA 2WV8A 4F2BA 2GJRA 4L1XA 3EYPA 5AB3A 3WQ5A 4J2PA 3P67A 1MNZA 2J8FA 2YA1A 2E6AA 5H1WA 4WR3A 3SW6A 4NQ1A 5I09A 4ACYA 3MDUA 2FZDA 1XYLA 1FVPA 4JIPA 5ABHA 2GSHA 1PS9A 3TXVA 3UR2A 3S5ZA 1QOPA 3FDKA 3T7VA 2DVUA 3GTIA 3PPGA 1EHAA 3HBLA 1D3CA 4LPCA 4HT3A 3PJWA 1EDGA 4H6QA 2DSKA 3WQEA 5D05A