2IW0A

Structure of the chitin deacetylase from the fungal pathogen colletotrichum lindemuthianum
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
226
structure length
226
Chain Sequence
b'VPVGTPILQCTQPGLVALTYDDGPFTFTPQLLDILKQNDVRATFFVNGNNWANIEAGSNPDTIRRMRADGHLVGSHTYAHPDLNTLSSADRISQMRQLEEATRRIDGFAPKYMRAPYLSCDAGCQGDLGGLGYHIIDTNLDTKDYENNKPETTHLSAEKFNNELSADVGANSYIVLSHDVHEQTVVSLTQKLIDTLKSKGYRAVTVGECLGDAPENWYKAHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITIN DEACETYLASE
publication title Structure and Mechanism of Chitin Deacetylase from the Fungal Pathogen Colletotrichum Lindemuthianum.
pubmed doi rcsb
source organism Colletotrichum lindemuthianum
molecule tags Hydrolase
total genus 89
structure length 226
sequence length 226
ec nomenclature ec 3.5.1.41: Chitin deacetylase.
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2iw0A01
2C79A 2NLYA 2Y8UA 4F9JA 2XU2A 4NZ1A 1XW8A 4OUIA 2W3ZA 2C71A 2VYOA 3WX7A 3HFTA 4NZ3A 4NZ5A 2C1IA 4U10A 2E67A 2I5IA 2QV5A 3CL6A 4M1BA 3VUSA 2J13A 4LY4A 4WCJA 5JMUA 4L1GA 3QBUA 4NYYA 3CL8A 4HD5A 2DFAA 4NYUA 2CC0A 2C1GA 5BU6A 1W1A1 4NZ4A 1W17A 2IW0A 4F9DA 3CL7A 3S6OA 4NY2A 3RXZA 1NY1A 4V33A 1Z7AA 1W1B1 1V6TA
chains in the Genus database with same CATH superfamily
3R0KA 3AROA 4QCEA 1A5CA 1MUMA 1NFPA 4WX2A 4W5UA 1SW0A 1TV5A 4O15A 2CHNA 3TX9A 1RV8A 4PH6A 3DENA 1UD2A 4J35A 4MVAA 3W00A 3WD2A 1JCTA 3S1GA 3H4XA 4GYKA 3FYPA 3AUOA 3EKZA 2V2HA 2BSLA 5DMMA 4S3DA 2QCLA 3WK1A 2QQ6A 3LZ3A 1Q13A 4DWDA 3RDKA 2OYMA 3MUAA 1KLYA 3DEQA 4NG3A 4OKDA 3QLDA 3BAWA 1FFQA 4AW7A 1VC4A 3IEBA 4XAPA 3WG6A 5A8GA 3WLNA 2D22A 1XL9A 3R13A 4AMCA 4GRSA 3W6LA 4CKQA 1QWKA 3MJMA 1I0DA 3UA4A 3O0FA 2WO5A 1OCNA 2BOFX 3LI0A 2R82A 4YPJA 2EO7A 2EPKX 3FAWA 4XQ6A 3FK4A 1HUVA 2C79A 3V4BA 3DBPA 1DQUA 2VKZG 1J0ZA 4FNQA 3A4AA 3T2PA 3QVQA 4MMWA 4CQ8A 3RMEA 4AWSA 3P67A 2CYGA 1KTBA 1XBYA 3ITVA 1B3OA 4IUGA 5AOUA 1ECEA 1DXEA 5AC4A 2QJIA 2YCEA 4EX4A 4IMDA 2I14A 3CUJA 6ENLA 2PDBA 4Z1BA 3G0SA 2CITA 5F4WA 4HCDA 1Y8BA 4QLJA 1PX4A 2P50A 3URQA 4MJ4A 4URIA 3KUMA 3WH5A 4N2YA 1X1ZA 5CSUA 2XSXA 3M0HA 3V5FA 5AKQA 2VFEA 3B04A 3UWUA 1G9HA 4Q32A 1Q66A 2JK2A 4NJGA 2Q01A 3MI6A 2E67A 1WXYA 3GXIA 1R7AA 4JTHA 1OCQA 3DZ1A 2I9UA 4NRRA 1UH4A 2W4XA 4CQBA 3PJTA 3VU2A 2ABAA 3DU0A 1FCBA 3W7OA 2RGLA 4CGTA 3ZS4A 1T8XA 1AVAA 1LQ2A 4S1FA 3TJLA 2WYSA 4YIWA 3L0GA 3FAXA 1JUEA 1X96A 2O7QA 1X8CA 2DV0A 1KFJA 2C91A 2FZ9A 3LHWA 5A8OA 3ARXA 3UJFA 3NVDA 2Z1SA 3WL1A 1ESWA 2ZOXA 1OGBA 3WFAA 1ZSXA 5HQMA 5DBUA 2V5JA 4GD0A 4M6PA 2GQAA 1X7IA 4GG9A 1QNRA 4NSBA 3SUVA 3UBPC 5DCBA 4GKTA 1R87A 4H19A 3W29A 2DZUA 2WXDM 3V1PA 3NGFA 1GTHA 3HJZA 5T8GA 3QMSA 3NL6A 2XUCA 2P0IA 1JPIA 1EJSC 1UYQA 3PZ9A 3L2MA 1TPVA 4AZ5A 3W6YA 3UY8A 3RU6A 4JPGA 1ONRA 3QZEA 1DE6A 2OWCA 1WO2A 2OR2A 1XIHA 1CENA 1VPQA 4QHRA 1Q63A 4HP5A 3CC1A 2G0WA 4MJMA 1ZENA 1CBGA 3TR9A 5D05A 4MY1A 3CUFA 4LF2A 4HKPA 2EXOA 1E4IA 3LQLA 4W4QA 4S3CA 3BE7A 2HROA 3W72A 4PBEA 1UP3A 1SR0A 1UD8A 1GJWA 3LN3A 2ZRUA 1GPFA 1SUXA 2XU2A 3T08A 4JTEA 1AODA 1BKSA 2FFIA 4AD4A 1BSIA 4XVEA 4MUZA 3AS3A 2X42A 3KTSA 2BVWA 3GHSA 1EOKA 2WV8A 5ABGA 4MADA 3GDMA 4GNJA 1MXDA 3VD5A 2XH4A 2CCRA 4QQUA 3TSDA 1OBAA 2V9DA 1BD0A 1EEXA 3S2MA 4IIGA 4DXXA 3GU9A 4EWJA 2BB0A 1EA0A 1PWLA 3A5FA 3WFZA 1OFDA 4OTKA 3POHA 7A3HA 3W6MA 1ZUAX 1XD0A 1U1HA 3DERA 4AHOA 4UUIA 2IQ0A 3CIXA 4M6QA 2PF8A 2J75A 3T81A 1W3JA 2REQB 6XIMA 4LUTB 1Q7QA 1XPYA 4US5A 4DRSA 3EMQA 3E0VA 3UPWA 3CHEA 4JKMA 5CPMA 5T9CE 3TYUA 4I7VA 4HSHA 3P5ZA 3BURA 5KZMA 3NUKA 1L8PA 4H6EA 3RRAA 3B9AA 4JQ1A 4L80A 3QKZA 6TIMA 1X6LA 3MZNA 1GJUA 1ZZMA 5J04A 1TG7A 2ZVRA 4GGHA 2Y7FA 4H9VA 4IP7A 4GMEA 1JZ3A 2VVSA 4GINA 4ICMA 3SUWA 3RX3A 4EK7A 1ZBVA 4HVXA 2XG9A 1E9YB 1WDDA 2XVKA 4JN7A 1L6SA 1KRAC 4ZO7A 4YLWA 1CECA 3PM6A 1DHPA 2DQXA 4UTIA 3UG5A 4GPNA 1VYRA 4YS1A 3CUGA 4DIAA 3O63A 5FA5A 3TSBA 4JY8A 4AY7A 1HKMA 2G3MA 2VGFA 3OLGA 3WJYA 4GUIA 1PCKA 3E96A 4HA0A 3QM3A 5C0QA 3U7VA 1VLIA 2BBFA 2FVLA 2NQJA 3RCNA 2XINA 1AW5A 1UUMA 4C6IA 3BAKA 1O5RA 2AQOA 4IIDA 4AD0A 1ITUA 4KCVA 2HVOA 2OSWA 3AXIA 1GW9A 3VIPA 4X2PA 2OZ3A 4O0QA 1VFUA 4QLLA 1ICPA 4DJEC 4C5YA 4Q8MA 4MWAD 2PLCA 4J9JA 3SN4A 1JPKA 1JI1A 4RUBA 3LGDA 3IJ8A 3VMNA 4BQ3A 5D32A 3P93A 1WDSA 4AH7A 2C3ZA 3DFTA 3UXKA 4PB4A 3NQ6A 4HOXA 2VX5A 2E6DA 2D0GA 4LYRA 1TJRA 4MB3A 1XLDA 5EYWA 1J5SA 4CEUC 4WVXA 3VX1A 1YADA 5D4YA 2G4FA 2WC7A 3EXTA 4NP7A 3W07A 2F8QA 3IANA 4D8ZA 1U5VA 3TH6A 2VGGA 1OFRA 1W1YA 1KD0A 1UD4A 1EGZA 3VILA 4XKMA 4Z2JA 3UT0A 1OSEA 4JX6A 3UWQA 3V35A 2PRMA 3CUXA 3AC0A 3EPMA 1TFVA 4DBDA 4CNUA 4DNHA 1H7PA 2DH2A 3VD4A 4LV4A 2XH2A 3MHFA 2YBUA 3PNUA 3RITA 4PMDA 1XIGA 3W2MA 4YYFA 2VEPA 4EPKA 4F2TA 1VR6A 1TPEA 1S2AA 2OT1A 3WNPA 3H24A 3N6QA 3GWQA 4PGLA 4K38A 3GFZA 1VJZA 3QSTA 3RK8A 2QMJA 1PZ0A 3ZJKA 1SGJA 4D6DA 4ATDA 1KBJA 4MFDA 3FFSA 4WXYA 2VZOA 2OGJA 2REQA 2X41A 3O0KA 4LFYA 1FOBA 1NARA 3N13A 4EXBA 4LUTA 5CSYA 2VC5A 3UD6A 1DQWA 5TBOA 3I6TA 3DESA 1TWIA 1R0MA 3VIKA 4YVVA 1VBHA 2GDQA 4HPXA 3UU0A 1DJQA 4U2ZA 3W25A 2DSUA 3JS3A 3R79A 2UV8G 2D0FA 2VC7A 3W1TA 2Z7KA 3GG7A 1C8QA 1XLMA 4Q7NA 3RXZA 2PWEA 3VXGA 2C6QA 4JTDA 1DYSA 2E6AA 4GUHA 3OLEA 1NDYA 2QHAA 3UCQA 1JXJA 3AYRA 2FQIA 1EEPA 3WK0A 2ZZ5A 1Q6OA 4QEEA 5BYWA 2CLMA 3T9PA 3W3OA 2I5QA 3G8RA 4Y8FA 2FVMA 4NZ4A 4LVGA 2WLYA 1XH0A 4C7FA 2XIJA 1CGWA 2D1ZA 4HK5A 1SFLA 3PUEA 2IKIA 3E0FA 3VIMA 3G1HA 1Z3NA 1R86A 2IKJA 2ZZ6A 3IGUA 5EGRA 1JPDX 2NX3A 1EGMA 1QHOA 1E6SM 3Q4DA 3LXAA 4MWAB 1NAL1 2J66A 5KZEA 3PBMA 3SIMA 2QDEA 4JEJA 3GK0A 5TNVA 1YHTA 3WBEA 3W87A 1JGMA 3L5AA 4YTRA 1GK8A 4M7SA 2EPOA 3F7JA 2WANA 2CXEA 3PR2A 1S1RA 5FF4A 2FIQA 3RPTA 2PC4A 3PAOA 3FXYA 4AD2A 3D6NA 3BGJA 4JIHA 3R58A 2W79A 4B4HA 2WJFA 1ZY9A 1XISA 1H51A 4S3KA 3STGA 2BASA 3A23A 1MW0A 1KBKA 4QFUA 2ZX9A 1FHDA 1IZJA 4GVHA 5HWJA 3WZ0E 3NEHA 4CCDA 3RU8X 2VXNA 1E3XA 4MPQA 3E2SA 2F2HA 2XZ9A 1BEUA 4XX6A 1LBMA 1EC9A 3LTSA 1OD0A 1DJXA 4HZ6A 1FHVA 1XHGA 1FDZA 3BUVA 1VBJA 4ZGYA 4QAWA 2V67A 2BMBA 1CB2A 4F4RA 2XHYA 4R34A 3TUUA 3PP7A 3CNYA 4H00A 2JF7A 1KBLA 1D2KA 1J96A 4CD6A 1D3CA 3OVPA 4YHEA 2FMNA 4QX4A 2PRHA 1GG1A 2FZMA 5DX7A 1SO3A 2ALRA 1RP8A 4AFYA 3GE7A 3UR7A 1BYCA 2PDLA 2GWNA 4FLQA 3IJIA 2INZA 3S6OA 2VC6A 1JDDA 1UWRA 1YTEA 2ZX7A 4O17A 4HPHA 4QJ3B 4OBRA 3O7UA 3I3BA 1EP2A 3W2UA 4F2UA 1EYEA 1P6WA 1GG0A 2BGSA 2VVNA 4KWUA 1XBXA 1HIZA 5LIUX 3CU2A 1SO4A 1EP3A 2PWGA 2ZRXA 3UERA 4N9DA 4BHYA 3CWOX 3GNXA 3H2CA 5HJYA 5HATA 3VGDA 1E0WA 3AIUA 3VTRA 3ABQA 4AG0A 1S2WA 2PDUA 3THCA 3APYA 1PKYA 1NIUA 4XTDA 3VMPA 4ZTYA 2F61A 4UTUA 2ON3A 2PDKA 3MDUA 4CVWA 1JF6A 4B5SA 4LX4A 3U5YA 1GONA 2J8FA 1DKWA 3QW4B 4TMCA 3MSDA 3UZJA 1RPXA 1OVDA 4LB4A 1I1XA 2YCJA 3GZAA 3W74A 3OOQA 2DZPA 1FWBC 1GCYA 3LMYA 3MUXA 3W86A 4HSNA 1NDVA 3PS7A 4MIMA 3VIIA 3H2NA 5D02A 3ARSA 1Q6FA 3A64A 3O8AA 2YXGA 3IPWA 2PGFA 5CPLA 4W5ZA 3OLIA 3TNBA 1KM1A 4DZIA 5C2CA 1WNOA 4IP5A 1ZP3A 3ZR5A 1FVPA 3EX6A 1XRFA 3H2OA 3PZGA 3HPXA 3G1YA 3A4WA 3ALGA 4H3DA 4FB7A 4UNKA 3FVDA 4D8LA 1TUFA 4MWAA 3LNPA 3TZNA 1NQKA 3HGRA 2NLYA 1EWEA 4ZB0A 1OT2A 5I3DA 3K8MA 3TSMA 3VNMA 3R0DA 4N4QA 2WSPA 1SQ7A 3NO5A 4KGLA 4TUFA 3C2FA 1K9FA 2OLAA 5KEZA 3SCWA 3KFTA 4MG4A 5CZKA 1S38A 1XG3A 1RVGA 4PUDA 4WDXA 5CGQA 4B91A 3ES7A 4H9YA 1CXHA 4I5RA 5D09A 3S83A 5C6MA 1LQAA 1E0XA 3TN3A 3HQ1A 2OLSA 3VUSA 1XLAA 3INPA 4UTMA 4XAFA 4JTFA 2EGZA 4IICA 2Z2BA 3HA1A 2W9MA 2FJUB 5I2UA 3CO4A 1YE6A 3ARUA 3PB0A 2D73A 1EUAA 4UQCA 3PUDA 2YJQA 4LNCA 2WVVB 4O50A 1MXGA 1FWWA 4IFRA 2Z0IA 4FF7A 2DDXA 3POCA 1BHGA 1OC7A 2H3BA 3E0WA 1HF6A 3PZNA 1L0PA 2ZC1A 1P1MA 3GM8A 2Q8LA 1MFUA 4P8VA 1J93A 1MEHA 2CU0A 1A5NC 3Q45A 1PKLA 1P43A 4GXWA 3M0MA 1J0YA 2XFFA 3A22A 4ENLA 4E5TA 1BGGA 2Z6IA 3EEZA 1M65A 4OBTA 3TJIA 3P60A 1MUWA 4E3TA 2B0MA 4B15A 3UXDA 1H11A 4AB4A 4RL3A 3KL5A 1DEDA 3TQPA 3BCJA 5D2TA 3IJLA 2HS8A 4N0RA 2X16A 1KV5A 3CAWA 5FJUA 3T05A 1IV8A 2I17A 2PSNA 4D71A 1W91A 4X61A 3M43A 2ZYFA 3IRSA 2PWUA 1T0OA 3GW0A 4Q8TA 1GUVA 1Z41A 5AY7A 1AA1B 2GVJA 1IF2A 5IBXA 3AIWA 1QHZA 3U48A 2O9RA 3C2EA 3E0LA 1J2BA 3WD0A 1C7SA 1PX3A 3WNKA 4MB1A 4F0HA 2JEQA 2FYMA 4N4PA 3MI3A 4K2SA 4FX8A 5BCAA 2VJXA 3D3FA 3WQCA 4NJIA 3U2ZA 1W5NA 1W1TA 1EBGA 5HQLA 4ICCX 4DF1A 1O5QA 4UTWC 4E2OA 2OQHA 1QW9A 2YZRA 4PCNA 1QNVA 1ZRQA 4QE5A 2ALDA 3MP5A 3CV1A 1V3JA 4MF4A 4C1KA 3M6DA 1LF1A 4YVXA 3MWAA 1CPUA 1JG9A 1HT6A 4KPLA 2AL1A 4IM4A 4M0XA 3OYZA 3S9ZA 3L67A 3EAUA 5F2GA 3W71A 3U8GA 4LH8A 3N12A 5A1AA 2PWHA 4EAYA 4ZBCA 1SW7A 1I2RA 2QNEA 2J79A 4XBSA 5E0FA 5HNTA 2OYKA 5DELA 3B9EA 1DIDA 4PFMA 1EJXC 3HPZA 3LYEA 4RZ5A 5C9RA 4B2DD 4JTTA 4KCTA 4PEKA 3CB3A 3S2NA 4U3CA 3W73A 3V3WA 3EB2A 4IF2A 4O8RA 1HGYA 1O12A 1UWTA 4HNOA 2YL6A 3N4FA 1RJQA 1FBAA 3FS2A 2PDYA 4O14A 2A4AA 3MMWA 2X1RA 3B05A 2BGQA 4PL2A 5LSMA 5M03A 4FP1A 4GJJA 3BAIA 3TMQA 2WVVA 4WIWA 4B5XA 3TFXA 1H7NA 3QMTA 3N2TA 4TU1A 4OOUA 4S3EA 1W6TA 1UWQA 1D3GA 2IQTA 1HVXA 2TMDA 4GQRA 4AAJA 5C71A 4HOWA 4UFJA 2R24A 1MVYA 3WX7A 2VZUA 3L7RA 1TWZA 1RJPA 4GBDA 4FLRA 3WDPP 2XPKA 1BVZA 4LAKA 2EG7A 3K1DA 2AAMA 3HPAA 3VGBA 4POCA 4WY0F 4G9PA 4FXSA 1NFGA 4GJIA 3CB8A 4M80A 3OVRA 4FNRA 1XI3A 2C1HA 3PG8A 3AIVA 4UTTC 1EJ7L 3WEOA 1DWGM 2G5WA 5IDIA 4C1NB 3F2CA 1DWIM 1JYVA 3PZVA 3QRHA 1M53A 1WZKA 4HPGA 4W8LA 3L66A 2DZAA 2ZFAA 3PZOA 4NNAA 4CD7A 4O52A 5E09A 1TMHA 5HDRA 4LWWA 4OT7A 5ABTA 3W24A 4IMEA 1LWIA 4CNNA 4PMVA 5FF3A 5H2ZA 1KGXA 3XIMA 3SN0A 2AMXA 4QGCA 3OEXA 1MNSA 4LALA 3I7RA 5KTLA 1K6WA 1O95A 3IVUA 4XG1A 5FKYA 4F48A 4LCQA 4DLFA 2OWXA 1VKFA 3VM7A 1S5MA 3WUFA 3QY7A 2P76A 2PAJA 4GUFA 1RY8A 4H8HA 1Y0EA 2QR6A 1OWQA 5H1WA 2SFPA 3SJNA 1LTDA 2GZXA 3R4IA 3CHFA 2YIHA 4NILA 1UR3M 3LLXA 1W2VA 3GNOA 1QNOA 1P0DA 4DAFA 1OK6A 1WXZA 3IUIA 2YOCA 5CQ1A 1TRDA 4X22A 1G4TA 4DJDD 1YQ2A 3GTHA 3HFTA 1C9DA 2QGHA 4TVDA 2DZTA 3VDHA 4JTUA 5IFTA 1TMLA 2FGBA 4G7EB 4JGDA 3ZLGA 3OG2A 3WNLA 3YPIA 1ZBCA 5DRIA 1W3NA 4UFLA 1E6QM 4E38A 4D1JA 5KSWA 2VZSA 4ACYA 2IXVA 2DUAA 2RJHA 3EYPA 4H7VA 5AB3A 3MSYA 1EIXA 3B97A 3L4VA 3OZOA 3AAMA 1OHLA 4C6JA 1NOUA 3HMCA 3KRBA 1IXQA 3W2LA 2GUUA 2POZA 4C6NA 3A21A 2ZXBA 3HU7A 2QIIA 1JDEA 4LY8A 1UBPC 3NQAA 2E9BA 4Q7IA 3HMJG 3R6IA 3CT7A 2RGMA 1CYGA 4XZIA 3L23A 1CGTA 3OQ8A 1GYNA 2R91A 4DUVA 2OKTA 3H53A 3OPSA 3N9SA 3DIPA 3MU7A 1JYWA 1J4EA 4XZLX 1MEIA 2ZUVA 3LCGA 4XSLA 5A6TC 4ACZB 3BLDA 3P61A 5BWAA 1C3FA 1QT1A 4U4MA 3TP4A 1XFBA 3FLUA 3JU2A 2V5CA 2G37A 1XGDA 2Z29A 1JI2A 3MO7A 1HJQA 3CQ0A 4GC4A 4Z42C 1W1ZA 1IIHA 4GYJA 2E4TA 2PDGA 4HZ7A 3NL3A 5BOFA 1A5LC 4FR1A 3FJNA 5ABEA 3BL3A 2DSWA 1A47A 2QT3A 5DT5A 4MKVA 1QI2A 4U31A 3V16A 3WIJA 4HU4A 4U2YA 3W1NA 2KZHA 3AWOA 3SSZA 3H2MA 2OSXA 3GFYA 1M6JA 1G69A 1UP0A 1XLBA 1EPXA 5GVJA 2CBJA 1G94A 3H23A 4OU1A 3UPMA 3W27A 4D8AA 4GZJA 2FTYA 4JFWA 1XLEA 2C71A 3EWZA 1X6NA 4ADSA 5BRPA 4GXMA 3NAVA 1F2JA 4GQGA 3P2VA 1EX5A 2O9TA 1R3VA 4GO8A 4E8DA 4F3HA 2OOGA 4NJKA 3GQYA 3H12A 4UQBA 1RLDA 2J7DA 4HJWA 1WPCA 3LOTA 3SCTA 3LCLA 1V03A 4C1NA 1GPWA 3IJ7A 3M0JA 2XIQA 3M64A 1P5BA 3BXWA 4PSPA 4B5UA 1O5XA 1LJYA 4RE4A 1TPUA 4Y9AA 1UWUA 3H7RA 1UASA 4JZ5A 3BAJA 3ITLA 4M7TA 4KKXA 2HV5A 3ANYA 2Z1BA 4NASA 2CBUA 3VOHA 3LPPA 2XJ7A 1SZNA 2OZTA 3WQFA 2A79A 3GR4A 4QDMA 2QV4A 3BJFA 3OB8A 3CTTA 1TZ7A 1OFEA 2GJNA 4PE8A 5I00A 2V30A 4IL2A 4LC6A 4KBXA 3I65A 3BARA 3SGGA 1WA3A 4NJHA 1K8ZA 4QP0A 1DWHM 3NDZA 5CEWA 4B3ZA 1J12A 4A3QA 4UOZA 1PWMA 3E2VA 4HGXA 5D04C 4DNMA 3IVTA 4H9TA 2YL9A 3IACA 3WO8A 4O1DA 2IS7A 1UZ1A 3ZR4A 2D24A 1AL8A 1W9UA 1ZCCA 5CJMA 1NP2A 4WSJA 3SFKA 3NQ8A 5CC3A 3KLKA 3OVGA 4AZ7A 4DUXA 4G7EA 4WGHA 3MV01 4PR4A 4ZQMA 3GVQA 1QPOA 3N9KA 3ZR6A 3SCPA 4ERIA 2R14A 4B90A 2A5HA 1SU5A 3IUHA 3FHQA 4Q7BA 3UVIA 4TOQA 1GVRA 3FOKA 3W2KA 2GSEA 2ZTJA 4ZL1A 4B2DA 3KL3A 4LV9A 3CPUA 5LIWX 1VRDA 4QROA 3RPDA 3GTXA 3R8GA 4PCPA 2V5DA 4IIFA 1H0IA 3DGBA 1VFSA 3U4FA 1W9XA 2QCHA 2RDXA 3EEGA 5C9UA 2PBOA 4ACZA 2GWGA 5FSEC 3QV7A 2VFHA 3WUEA 2JIEA 5AHIA 5K9XA 4ILSA 3T7VA 3K4WA 4TX9A 2OWWA 2E3ZA 1W5OA 1EHAA 4XZHA 1UJQA 3NQCA 1RBOB 3SAZA 3FYOA 1LDCA 4CD4A 4FNUA 3DFSA 5KZDA 3P8JA 2G8ZA 2PDIA 4D6EA 4UMAA 3V5CA 4NXKA 1R38A 2WHLA 3DYPA 4FR6A 4AIUA 4LS2A 3ABZA 2Z00A 3WFLA 1A0CA 5JQ9A 2W61A 4HYWA 3C2VA 3G6LA 4BQ2A 5K2ZA 3FJ6A 4O1CA 4H6QA 1W37A 4M8UA 1ADDA 1BVWA 6REQB 5LHEA 4YHGA 1BRLB 4S3BA 1FCVA 3AHTA 2Y8KA 1WKYA 2VM8A 3U2CA 1SPQA 3ENLA 1XGZA 3RCMA 5A3HA 4AZHA 4PCSA 2ZTKA 4RLIA 1WQ5A 5CLTA 4X0VA 3GXMA 1YEYA 3PHAA 1OZQA 4MWAE 1YE4A 1V79A 2BFGA 4H1ZA 5FJPA 3ZFHA 1PX8A 5REQB 2O56A 1W1PA 3EX2A 1KCXA 2DZXA 4Q4RA 1A0EA 1IEIA 3KBMA 5I06A 2R8WA 1RAKA 2QZRA 3GH7A 3QQ1A 3B8VA 5CCZA 2IUZA 4GIEA 2WWDA 4M5PA 5D2VA 3AQUA 3NZGA 3LBMA 4JL2A 3QR3A 1S3HA 5I3GA 4W9TA 3BG3A 3LENA 3IIPA 4L61A 1KRMA 3VGGA 2ZX5A 1I8JA 4GFSA 4DJDA 1WOAA 3MV11 4ORMA 1BGAA 1XW8A 4Q8QA 1V0MA 2BS9A 3DYMA 1SFSA 1GW1A 3N73A 1WDPA 3PBWA 3VIJA 1ZLPA 1XYZA 4LY4A 1C9WA 4WUIA 2X8RA 4A3RA 1JDFA 3QQ0A 2BGNE 4LB3A 4AX7A 4UNLA 2DJXA 1TZ9A 4KMQA 1W9VA 1A4MA 3E12A 3KVLA 3MC5A 1XQKA 3WLHA 1YRRA 4C5ZA 2YCIX 2D3NA 1TB3A 4IL0A 4GCXA 2GJXB 1QTWA 4YL2A 1MRQA 3N29A 4XAGA 2QUVA 4X0NA 1SJCA 4V2XA 2X7WA 3W2JA 1HO4A 2A2IA 4K8EA 5IBXC 4A4AA 4CUCA 4PTWA 3FA5A 4CNOA 3CPGA 2TYSA 4PTXA 3VM5A 4S2BA 2J7FA 4AZIA 3QGKC 5C9WA 1X8FA 4LVAA 4RK8A 4XO6A 2YYUA 2G50A 2WZTA 1DJNA 3QF0A 5EY5A 2NQHA 2O9PA 1LL4A 1XKYA 4ZO6A 3VIHA 4B4FA 3T2OA 2ISDA 2Y89A 2VOMA 3UYCA 1WZMA 3SQSA 1R3TA 3MMDA 2UY3A 1E4LA 2E25A 2YB1A 3VKCA 3FW6A 3KX6A 4F9JA 4BF9A 1ITXA 2NT1A 1FX6A 4Q4MA 3U5UA 4JQ2A 2BXYA 2FDSA 1HQTA 4NVTA 4NU7A 4IQJA 4NZJA 2ESCA 4DQWA 2QS8A 2D0HA 1NJJA 5XINA 1YPXA 1N55A 4JX5A 3S1VA 4HB7A 3W88A 1P0KA 3G1RA 5FD0A 3APTA 4O57A 2GQ9A 3BGGA 3AZRA 1NWRA 1FH9A 2J78A 1BLIA 6REQA 1QVBA 1ZAJA 3SQLA 4DJFD 1BRLA 4PMUA 4GACA 3BH4A 1EDTA 1X6UA 4P7OA 3UZWA 4FXJA 2YCKX 3HZ3A 4PCTA 1MSSA 3OGVA 2BHZA 5FJOA 3GXTA 3V0TA 1Z44A 5F1UA 3SCRA 4EPBC 1H62A 1RCXB 5MF5A 4EKJA 4QE4A 5REQA 2F6KA 4WY0B 4JQ4A 2Y62A 4W7VA 2AGTA 4EIVA 4QIUA 3C0JA 4PRTA 4BWLC 2CPUA 4RPPA 4WSKA 4UR8A 5EB8A 4TTGA 1EJVC 2P3ZA 2C13A 4IISA 3ARYA 1G7VA 4Z1DA 5FJJA 3EOUA 1BPLB 4DF0A 4ZZ9A 3AU2A 4L4MA 2CESA 1KXHA 1GKPA 4PBGA 1F8IA 1TVNA 4IH3A 3WJSA 1GKQA 3UPBA 3VZZA 2WHJA 4F0RA 3G8EA 3NOYA 3ZWSA 2WSKA 3D47A 3GNRA 3S0CA 2GDUA 4L1WA 3NZPA 4B5TA 3FKRA 3SURA 5CG0A 2WC3A 4Z0SA 3M7WA 4L1XA 3BMWA 2EG6A 2R6OA 3N17A 3W1AA 4H7CA 3E0IA 2WVTA 2YDAA 2BP1A 4W93A 1JF5A 1ADSA 4C60A 2J7CA 3NQVA 5G2WA 5CAKA 4L4OA 4ZE5A 1ITCA 1Z42A 4HZ8A 4JIIX 3D0CA 4WGXA 2E8YA 2QGYA 3R2GA 3GZ3A 3IAPA 4AWUA 3STFA 3ZJ6A 4YNGA 1NELA 1O66A 2DIKA 2GJXA 3LY0A 1UZ4A 4CU8A 5AYXA 1CXFA 1I6NA 3M46A 3L12A 4DBSA 4KEMA 2DFAA 1M7XA 3BTNA 4M3PA 4XTIA 3KW3A 1TMQA 1JYNA 2VGBA 3M5XA 4CN4A 1TVLA 3DFNA 1GVOA 4AY1A 5CBIA 1TSIA 1TJ1A 1Q3NA 1XLLA 1EF3A 1WKDA 4W89A 3LLFA 4BF7A 4ATWA 4BKNA 2OU4A 1XYFA 2QDDA 5FEWA 9RUBA 2DP3A 4FNTA 1WZAA 3GFXA 3VX0A 1JZ4A 1XG4A 3GNNA 3NQEA 1XF0A 1F74A 4ROPA 4XZWA 3O2LA 1VEMA 3IV8A 4HNTA 4IMAA 1F3TA 4JFUA 3I10A 4Q8UA 4P61A 1WKFA 5AHMA 4EF8A 2V3EA 1XXXA 4G6CA 4AUBA 1M1BA 3H54A 4HNUA 2EJAA 2V8ZA 2D2HA 4MNMA 2R1PA 1U22A 5HJXA 4KIEA 4MY8A 4QJ1A 2PU1A 2GVYA 1A5KC 3T0CA 4XISA 1HTIA 1H0GA 3CH9A 1TPWA 4MSSA 3SCNA 1XINA 2DUZA 1YNQA 3VVGA 4ZFCA 1OC6A 2Q09A 2CWNA 2GSHA 5BZAA 2VHLA 3N4AA 1EJWC 1K7EA 4QEHA 1K4GA 3EOEA 2WVUA 4HCHA 1E4NA 1FTXA 3MYPA 1G4PA 5EPDA 3P6LA 1PKMA 1GOXA 4UXDA 1KKRA 4E2BA 1B9ZA 3MCMA 3P7YA 1FP9A 4GA8A 5DCEA 2WW5A 4UFHA 2VC9A 1V3HA 2GL5A 2RKXA 3RF9A 1QFEA 3LHUA 3MCOA 2GK1B 2W3ZA 3DFOA 4ERAA 1K7XA 4I5UA 4IP4A 2CFFA 1VHNA 3STEA 1GYMA 4U5IA 1DXIA 3AIBA 3TTOA 3WENA 1W1IE 4QM1A 4H6RA 1XH1A 2FMOA 3BZGA 4UQ9A 1H49A 5H91A 3W1UA 1XQLA 2EAWA 4CCEA 1D7KA 2C15A 1EWDA 3WLLA 1UB3A 5F2MA 3O3RA 2V0TA 3AMDA 1RZMA 1L9WA 2VDHA 1UIPA 1J11A 4GQQA 1VD6A 3V18A 1ICQA 1V0LA 5HR7A 4A8LA 1AQMA 3SCUA 1QO5A 4DPPA 4GO9A 3UWEA 5LXEA 1PBGA 4ZXOA 2XIIA 2E7FA 3P5YA 2BWGA 4RJEA 1PL9A 4MKSA 2VP8A 3IK2A 2WJDA 3L4YA 5EMMA 5G2IA 2GGIA 1TR9A 3LM3A 3QC3A 3VKBA 4UFKA 3P0WA 1MNZA 3IARA 1WZLA 2Y63A 4UWMA 5HOSA 2E6FA 5K4XA 1T40A 2NUWA 4K7YA 3FGCB 3M7SA 2VD9A 1NDZA 4IJRA 3GSMA 3SB0A 2G3NA 4GY1A 5ECVA 3J7HA 1K9TA 3CXOA 4DEFA 3AS0A 2NV9A 3MS8A 3TYDA 4ES4A 3EB3A 1XYLA 3L2LA 3NG3A 1XJBA 3TN4A 3URNA 5FF7A 3UWVA 4H41A 3OU8A 5HULA 3WDIA 1QPQA 4YU1A 3M1ZA 3THAA 3R94A 3RFAA 1H7XA 2QVHA 3GDTA 1AW2A 5F2LA 2XN2A 1VLWA 3RYSA 3M0ZA 2J7HA 3MDWA 5IOBA 4YJ5A 4TV5A 1F5ZA 2AL2A 2Z1XA 3EX4A 5AYBA 2Y8UA 2DT1A 3C8FA 4Y96A 1DORA 1UWIA 3T1GA 2ASHA 1EDQA 3WUBA 4IMCA 4YCOA 5EKYA 5I3FA 3QHNA 3GAYA 2FLIA 1NWSA 2VD8A 2J9XA 1ZB5A 3WMLA 1BXBA 3EOSA 2A21A 4OV9A 1I1WA 1K6AA 2A7NA 2DVXA 1R2TA 3KBVA 1GHSA 3IV3A 1TQJA 3LUTA 1SMDA 2HPMA 3EWWA 1VFTA 1WDWA 1ZP4A 3C2OA 5D9NA 3RLVA 1UG6A 4KEZA 4ZQNA 3FJ4A 4ERGA 4GZEA 1XS2A 4L65A 2PCEA 2QVNA 4A8RA 4ALDA 3K46A 1VBRA 4PBFA 4P8UA 1V08A 4MNJA 4M81A 3RHGA 3MBFA 1CI1A 1KXTA 4CQCA 4DZHA 1DWFM 3PSVA 1JZ7A 5K9DA 3A47A 4Q8OA 2VWTA 5E70A 2CLHA 4AVNA 3PB2A 4LRTA 1XBZA 4BI7A 4AMAA 3A13A 5I7GA 3RCYA 4W8BA 1WCGA 3W7LA 1BQCA 3W01A 5I79A 3QLLA 5AHNA 1J0HA 2W66A 5EMYA 1B2YA 1P0EA 4MUPA 4HQVA 4XO7A 3P80A 3IRDA 3B0PA 1LOSA 1J0JA 4H8UA 3SCOA 3RILA 3V7PA 1DE5A 1KC7A 1OK4A 2X2YA 4ONVA 1CIUA 1OFAA 3GRIA 1YDVA 4GI4A 3SJ3A 3ISIX 1VZWA 3QC0A 4XAZA 1HN1A 4R33A 5EBAA 4AU0A 3AMGA 3ABRA 1OFQA 1GVYA 4PL1A 1Q5MA 3GKAA 2Q3OA 4GY0A 2CZEA 5M3WA 3SO7A 2PGEA 4IZGA 2WK2A 3NPUA 1TPH1 1R9ZA 2GJPA 4PMRA 1K3UA 2WLZA 2ZDRA 1XFCA 3W4RA 4MGGA 1GWJA 2PODA 2HVNA 4DWSD 3B8SA 3MUZ1 2C1GA 5M17A 1I75A 3CUZA 4C7DA 3P62A 4O1EA 2DW6A 2Y5SA 3FGCA 3NSXA 3P3BA 4H7ZA 4MNLA 2YB4A 2FHCA 3MP4A 1E56A 4PULA 3UYIA 4Q8VA 4YWSA 3LS9A 3KCOA 4KEUA 8XIAA 4P8XA 1UQYA 4AVFA 2VCCA 4HHHA 2I5GA 3IK4A 1OZMA 3B0UX 1JCXA 3AS2A 2D20A 3RGTA 4AC1X 1KCLA 3AS1A 4BEQA 4LRSA 2DGAA 2VEIA 5JIWA 3TW9A 1SYTA 2EQDA 2VENA 1HP5A 3VFLA 4GVIA 2WBKA 4P7RA 4DBUA 1DPMA 3PPCA 3K1GA 5C9ZA 5BROA 3PTDA 4LPCA 1AZ2A 3BMXA 5FACA 5DXYA 3PZUA 1ODUA 4TTUA 3BZJA 5DO8A 1B0IA 1E1FA 2XIOA 4QG6A 3WCZA 3NXLA 3FCPA 3GU1A 4R9XA 1UH2A 5LNSA 4B3KA 1QRQA 3QZ6A 1VFOA 4JHOA 1ZTVA 2BTMA 5KINA 1VJIA 1OABA 5FL1A 2JQXA 7ODCA 4TX6A 2BOGX 5K4ZA 3E49A 1PYMA 3M47A 4WSHA 3NZRA 2FJKA 3M9YA 3EBVA 3PVFA 3T2QA 4QS6A 1RLCL 2ODOA 2VUYA 3ARZA 4ZA0A 1FWAC 2WCSA 2YLAA 2KX9A 1REQB 3F4DA 1KR1A 1FUYA 3ZYZA 3UA3A 1V6XA 3SM0A 2E6YA 5FAJA 4HNCA 4DYJA 5A6LA 4JEQA 3R8HA 3HBLA 4L7ZA 4OVXA 4LUSB 2QJMA 3QR0A 1QCWA 1IEXA 2WPBA 1B3WA 5GJNA 4X2RA 5JBDA 3O06A 2R9RA 1QPRA 2I57A 5C7HA 1M04A 3I6RA 3OGRA 5HNUA 2NT0A 3SW6A 5K3VA 2UY2A 1PS9A 1LLZA 1AH4A 3KVJA 1UCWA 3OVQA 1HX0A 2EPLX 4BEUA 1U33A 5LXXA 4NXSA 1HKJA 1G5AA 3UZYA 3H70A 1WX0A 3V36A 5JH2A 3W81A 1ISWA 1AK5A 4FPSA 2HJPA 3LHZA 3AWNA 1CX9A 1KQZA 4GWEA 3JUGA 4QJ4B 5BXTA 2QXWA 3ITXA 1F6PA 3NDYA 2ANUA 3WBAA 5B80A 1UA7A 4A29A 4ZEPA 3JR2A 1PDZA 1OG0A 1KLZA 1OD8A 3VNLA 4OHQA 1PE1A 4E6MA 1WDRA 2P10A 4LVBA 4C1LA 3TAKA 2CWXA 1KFKA 3M0IA 4PB3A 1AJ2A 3H55A 3DX5A 2ZRVA 1JDCA 1QO2A 3SCSA 1I9CB 2Y6ZA 5LA2A 3TTYA 3A3WA 3LG3A 4N9BA 1YX1A 3HG2A 2EF9A 4DWSB 1Q6LA 2QAPA 1W5QA 5AYZA 3QFEA 3QOMA 3G0UA 4DZ5A 3AMLA 2RFGA 1V7AA 4WDWA 4PYSA 2FGLA 1KM3A 4CNTA 2QUMA 3CZLA 2RUSA 1LWHA 3MUY1 3W1QA 2WKJA 4XD6A 2WKLA 3PY2A 3WH9A 4ZMGA 2ACSA 4DN1A 2DSZA 1O1ZA 3P0XA 4JTQA 3EB4A 1TELA 1E6RA 4GIYA 4D6IA 4NAFA 1LRTA 4GI6A 3TK7A 5EFFA 2PGRA 1RBAA 2VCBA 3VO0A 5DCDA 4Y2WA 2HBXA 3W02A 2QDGA 2PTYA 3LRLA 7REQB 5HMFA 4M6VA 2WMJA 3DFPA 2PTXA 1L6YA 4B9YA 4HHMA 1EZ2A 3S5OA 1JXKA 1XLIA 1EB3A 2CHOA 3F5KA 5I78A 2HRWA 2PRLA 3U9IA 1TV7A 3CZ8A 2J77A 5AVHA 1C91A 3ERPA 1GGOA 3EPNA 5FL0A 3BJTA 4LF1A 1W54A 1D8WA 5T9BG 3O6DA 3S5NA 2PWFA 3NPVA 4KF1A 1RA5A 3VD3A 3QEZA 4R7WA 2F84A 2E0PA 2X0SA 2VDGA 4CQ9A 1TPDA 2X05A 4RV8A 3VA8A 4AD1A 3NA8A 4KCUA 4M6UA 5BMWA 3MTWA 1PCWA 1ONXA 4I6VA 4XBJA 3N9RA 2WM0A 2AGKA 1W2PA 2V82A 1PIFA 4QLKA 4C6EA 1DJGA 4TQTA 2A3LA 4ZR8A 2GGGA 3CEUA 1VHCA 2ZXAA 5HMDA 4PC8A 2BVTA 4K36A 2OFJA 2Y5JA 4Z17A 1XLKA 5F1VA 1REQA 2PDHA 2BHUA 3TN5A 4HHLA 3T4WA 1XIFA 2WSRA 3BC9A 5T91A 5PTDA 1E6NA 1L6GA 4QSHA 5FEXA 1ZHAA 2QMKA 4I9JA 4LUSA 1H09A 3EMCA 4MYXA 2ZE3A 3L21A 4C6BA 2R1LA 1B31A 3PK7A 1G67A 3VIFA 1CZ1A 4B3LA 4QTGA 3HTWA 3RG6A 2BG5A 2C0AA 1UUQA 3DI0A 4G1KA 1ZBKA 2H8XA 1QK0A 2PB1A 3A4JA 1FH7A 4XWUA 4ASTA 4S3JA 4JTIA 3PTKA 3UVAA 3CL6A 1IIGA 5FEPA 4L9YA 3QGAC 3SDOA 3W1RA 3QYSA 5AHEA 2W62A 5E0CA 2YKKA 3RRXA 2P0OA 1GVIA 1UQZA 3N6JA 2YL5A 4C91A 2TAAA 4MTVA 5ABFB 4ZE4A 3TLLA 1J6OA 4EF9A 1R9XA 1JEZA 1KNWA 3AJXA 2DZBA 1NVMA 1T7LA 3HQPA 4R3UA 2ZXDA 1W17A 2WMHA 4GK8A 5IFPA 4K7VA 4FLOA 3UG3A 4J2PA 1PZ1A 2VI0A 2GLKA 1VBGA 3R0UA 5ABHA 4LUJA 3NIYA 4F0MA 1X97A 4JD4A 1IZKA 1LCOA 4A2RA 4DWSA 5EMJA 5HUOA 1LUCB 1V3LA 1WAWA 3SFWA 2CC0A 3F2DA 1P1XA 1XYBA 2VEGA 4R88A 1CGVA 2GVEA 3ZJ7A 3U0HA 5AVNA 4LJ3A 3SI9A 1LBFA 3G1XA 4GY7A 2E9MA 3GBDA 2XM1A 3DHPA 4AF0B 4K39A 4ATLA 4RNFA 5I3HA 1PAMA 2VRJA 1F6KA 2NQZA 4BS0A 4WDTA 3VD7A 5D9PA 4G7FA 1IR1A 2Y70A 5GJPA 2XZ7A 4Q4SA 1FP8A 2J8GA 4Q22A 5G4WA 3G77A 5K7JA 1JULA 3OZYA 3GUWA 4P7QA 4LCSA 3HG3A 3W1LA 3VE9A 7REQA 1P7TB 3W7EA 3KBWA 2XSBA 3CBWA 1BF6A 3FX4A 1Q6EA 2QEZA 1QUMA 1UPMB 4EXAA 2VURA 3QY8A 4J3XA 4OBSA 2NVCA 4YTTA 2DY3A 4RE0A 1CXKA 4M56A 2E8ZA 1AD1A 1NM9A 3VUPA 1BG4A 3SY5A 3PJXA 1OCBA 3RLHA 4N6FA 3RM4A 1DP0A 3M5ZA 1ZJHA 2C18A 4LGXA 1J6PA 4WZHA 3QXBA 1C8XA 3TA9A 3WDHA 3HQOA 5LGXA 5C54A 3IJQA 2HDJA 4X3ZA 2Q02A 3LNMA 4CU6A 2PDXA 5JBFA 2RDWA 1PUDA 5MKGA 1IT0A 1TIMA 3FKKA 1SO6A 4E8CA 3NQDA 3R11A 1FWTA 1G6CA 3K13A 4ADTA 3NQ7A 2FHBA 4ZO9A 2Z1KA 2ONEA 1EGVA 3H2EA 3BG9A 4HMDA 4D6FA 2CBVA 3G1DA 3COTA 1CXIA 3WDJA 1YYAA 4OV4A 5F2IA 5F4XA 3QW3A 3W7PA 2BVDA 5HPCA 1DL3A 1VFFA 5CBJA 2C1IA 4IIBA 4C6FA 3PFMA 4LBUA 3MCNA 3LHVA 1S5NA 1V6YA 1C92A 1DTUA 1PO9A 3CMGA 1R7OA 1XP3A 1K9EA 2JGQA 1ISVA 3ZWTA 3O16A 3B9NA 1EFZA 3W7DA 2A3HA 4JCLA 4IPIA 3LTYA 1OF6A 1POJA 3C56A 1H41A 4HBKA 4TIMA 1ME7A 3WD1A 3RUBL 2AAAA 1RCOB 4C6MA 3CLWA 5ABFA 2EPMX 1KQYA 1XRSA 1RY0A 4IX2A 4PUMA 3EXSA 3FSTA 3GH4A 2WSYA 2OXNA 3DKLA 5C7VA 1DXFA 1VBUA 4L4PA 4HZMA 4DJFC 2QCNA 2AQVA 4BR1A 4O1AA 4X9YA 5CZJA 4A3YA 4W88A 4FOKA 4NZ1A 1E0UA 3FEQA 3W70A 2A6NA 3AMCA 3RR1A 1LUCA 2RAGA 3HB9A 5HWNA 1KM5A 3CT2A 3GXNA 4X9SA 1V8EA 1VYSX 1CW2A 1O1HA 1CLXA 4XIAA 2FDMA 2XIBA 4RXFA 3BW4A 1SM9A 4JN8A 1I60A 4AF0A 3OIXA 1XWYA 3VMOA 1KFCA 2ZE0A 3GY1A 4K8HA 4KWOA 2IPWA 1UZHA 1GEQA 1VB9A 3OBAA 4RDVA 2VOTA 2ZZ7A 2DT0A 2CHRA 3VYLA 3CYVA 4HA1A 1LBLA 4H01A 3B0YA 1P7TA 5E1QA 5K9CA 3VOIA 4DBWA 1SFTA 3FY1A 3UG8A 1QATA 2BXZA 3OZPA 1XH2A 2BY2A 2OZ8A 4A35A 3NSNA 1OGGA 1FRBA 1NH6A 1JZ6A 1F3EA 1TREA 2XN1A 3TLQA 3PAJA 1H4PA 4U10A 3H26A 5G4EA 1US2A 4KETA 2PDQA 3QH2A 2JGYA 4KERA 5A2AA 1EHNA 2HBVA 4DX3A 2VWSA 3NCOA 3MMTA 1UPPA 7ENLA 4GNVA 5FI8A 1AMYA 5A8MA 3AI0A 4AC7C 1A5AA 3BOFA 1VEOA 3GTFA 3KOWA 3TN6A 4GYPC 4RNHA 3HPFA 3PWGA 4ZCWA 1UC5A 1OQFA 5XIMA 3EWDA 1RSCA 4Y90A 4NI3A 1S5VA 2DVUA 4LCRA 4AZBA 1ZGDA 2UY5A 2YGYA 3QHMA 3F5LA 3WLTA 7TIMA 3RNDA 1GZJA 3UNDA 2Y7GA 3NPXA 4ZTXA 1VIZA 1OIMA 2QULA 3IWPA 5E5CA 3U4AA 4BZYA 5GNZA 3C5QA 3OYXA 4YXGA 4RDWA 5GJMA 3CK5A 2G97A 5A6BD 1TR1A 3G1AA 2NWRA 1GYLA 4RXGA 4RE2A 1JFXA 3NQMA 2E5CA 3BV7A 3EDKA 2F6XA 3PANA 1VH7A 4DY1A 3GLCA 3N1AA 2D2JA 2PPGA 2RDTA 1MMFA 3A6OA 4LOCA 4GISA 4ZQRA 1X98A 3UXLA 3VD9A 1FWSA 3LMZA 7PTDA 1CTNA 2Y7DA 1RUSA 1AD4A 1YNYA 3USBA 1E15A 3MANA 1I0BA 1QPKA 2Q8XA 3VGHA 4OWGA 2XH0A 1H50A 2AMGA 1E1CB 3EKGA 3GHTA 2F2KA 3WNOA 1F4HA 4Y9OA 3HG5A 4OIFA 3KBSA 4D6HA 3N19B 1PTAA 2ZWZA 1V0KA 3UY7A 1PZ3A 3R1ZA 2CERA 2GQ8A 2PLJA 1SR9A 3QTGA 3B4UA 3O6AA 4XZ9A 2C14A 1S46A 3TOPA 3M0LA 4A8NA 3KVKA 1XLFA 3ARWA 2QF8A 3BGAA 3KXQA 1MWOA 3T6CA 4UC5A 4QXIA 4E2DA 2YX0A 2OQLA 2VDIA 4GQ0A 1TJPA 3TAOA 4XB3A 3AISA 3AXHA 4MPKA 2G3JA 1IYXA 1I2NA 2YSWA 1UWAA 3S1XA 4LAMA 4H9ZA 3QSRA 1LRQA 1UOZA 2PTDA 1EDGA 4J3SA 2A3CA 4NAEB 5BRBA 2DJLA 2PTWA 5D03A 4FIQA 4DYKA 3WF2A 1DBTA 3LERA 3PN8A 1ISYA 4UMCA 1TPB1 1C8YA 4NX0A 1KM4A 2FTPA 4J3UA 4DM1A 3FXGA 3QFWA 4NRSA 1J8VA 5A2BA 4MLJA 2V38A 2J24A 2Y4SA 3GTNA 2VZVA 3CASA 3KOZA 1CGXA 4FOUA 1Q2SA 1YXDA 4C6QA 2CEQA 2EJ1A 5T26A 3GR8A 1VCFA 3CQKA 3RLGA 4D1IA 1RQHA 3A24A 3UFYA 3ORWA 1SFJA 5EU9A 1W31A 1HJWA 3HURA 1J01A 3RJXA 2R1NA 4I7WA 1TX2A 4O18A 4Z1YA 2Y1HA 3VZXA 3S2CA 3UCCA 1EO7A 4Y9PA 2V68A 1UR0A 3HF3A 1YTDA 1PHQA 2CZVA 4RPQA 1PJ9A 4LUIA 1OF8A 1YNPA 2WNWA 1RQBA 3URAA 4JY9A 5AYYA 3VDGA 5I5RA 4GYFA 1TQXA 2VELA 4ML4A 3SRHA 3ZM8A 1HNYA 3S2JA 2QLYA 2WC4A 3EWCA 3FEMA 4IGNA 3E3HA 2J9ZA 1U1UA 2OYLA 1NFBA 3TQKA 2G4JA 4NZFA 3WYZA 4LYKA 1EYWA 3LCFA 4IFKA 1ME9A 3WNNA 2PP0A 5HJLA 3TXVA 4NIRA 4PUUA 2A3BA 3KRUA 1RA0A 3OZMA 3HV8A 1RD6A 1UMYA 4IPNB 3L4XA 3QR1A 4Y9NA 1R2SA 3WEZA 4JTCA 3ZT5A 3KBNA 2ACQA 4HOZA 1E5JA 4UIOA 3BAYA 2IPJA 3WQDA 3EWYA 1PPIA 1SW3A 1B57A 1SZFA 1XSJA 4JDBA 3PTQA 3F4WA 4RKAA 3WH8A 4Q4PA 4CCZA 4RNIA 5H8PA 4QG8A 1J2WA 1O7AA 4B9ZA 3M5YA 3GTIA 1E1CA 2H90A 3OTRA 4O0KA 3N11A 2YA1A 1Y65A 2OPJA 4JDYA 1W3HA 4DJEA 3G5EA 3TXZA 1B4EA 1X7FA 4REQB 1FCQA 3T07A 3UESA 3W1MA 3WLOA 3NXFA 2XVPA 3E1F1 5TQLA 2FZNA 3DYOA 4EP8C 1CLVA 3WEMA 1ZBWA 3W38A 4XVDA 1LQ0A 4Q8NA 4IGSA 1XD1A 2ATMA 3D5HA 1Q45A 2QAFA 3W84A 3BCFA 1DIEA 4XUGA 2PP3A 3SIZA 2PF0A 2Y88A 3H21A 4IQEA 4Z1CA 3ELFA 3F03K 3LLDA 1VENA 1TE6A 4O28A 3U7BA 3RLUA 3SY1A 4ZOAA 5LIKX 1R5YA 3CTLA 2OB3A 4WQ6A 1UUOA 3ARTA 3WDRA 3CO8A 2B4GA 4NAEA 3OIHA 1KW1A 4U5KA 3NDOA 3S6DA 3HOJA 3N34A 1HZYA 3AHYA 3A9BA 4L6DA 4FAMA 5D2YA 3N2OA 2Q3RA 2NV2A 1XGEA 4UR7A 4H9XA 3UGRA 4DWSC 4M1RA 3B8DA 4LC8A 3FA4A 4KCWA 3NQBA 3VC6A 3CHDA 3UWZA 4RZ4A 4S2CA 4QG9A 4N6EA 5DRCA 3S9IA 3EX3A 4J28A 1ZFJA 5CZTA 2EKCA 2JE8A 5D9OA 2J88A 3WMBA 3PULA 4CLMA 1S2UA 3CIWA 3P84A 4MZ1A 3H7UA 3QMRA 1AW1A 3GNPA 4L56A 3QTPA 1KFBA 1Q4WA 3HJEA 1IR2A 3GX9A 4PRWA 3SR7A 3EGJA 4YYCA 2Y0FA 2ZWYA 1DWJM 2VX6A 2EBNA 3N4EA 4KRZA 4A21A 3PBVA 5A6BA 1DJWA 2J74A 3NGJA 1LOQA 3A4XA 3TYAA 4RDZA 1LT8A 4EANA 1OY0A 1M01A 1C93A 2GVLA 4C90A 5CC7A 3GIYA 1QDSA 3MHUA 1KFEA 3OJGA 1R3SA 1LG2A 1E71M 5CZ0A 4JIRA 1V77A 3T4CA 3PSWA 3IJDA 4GVGA 4DHGA 4ZOEA 4JTKA 3C2RA 5CBBA 2VGIA 1FCUA 5KETA 1R3WA 1WUEA 1FDYA 1ADOA 3REQB 4C6PA 5C70A 1B9BA 3GVGA 4UTJA 4OUEA 4BI5A 1JL8A 1JGIA 1UD3A 4I5XA 1RQEA 5BMXA 4XKYB 1YBQB 2MUCA 4IPJA 2ZVIA 2HK1A 1RPKA 3VIOA 1JVNA 4J27A 3S1UA 1M7JA 3GDRA 5D8WA 4EAMA 2ZX8A 3CWHA 3QY6A 1H7OA 1IHIA 1JQXA 1RXOB 4O54A 4CNSA 1TV2A 2HXTA 4XD4A 2B7QA 5AZ1A 3MI2A 4QSFA 3TOYA 4REQA 4ZXLA 1F76A 3C52A 4QITA 4RNJA 3NFUA 5H8MA 2INEA 1DVJA 4RW5A 4IJCA 3LDVA 4MYAA 3BW2A 3TROA 2YFOA 5A2CA 3OHIA 3APGA 2Q6ZA 4FLSA 3S1WA 4JTJA 3G2GA 4JYEA 3LPFA 3H2FA 5M1TA 4QCFA 1TUXA 1OINA 2ADAA 1K8XA 3DBNA 1U30A 1A5MC 4F0KA 3NR0A 2WKGA 3SEPA 3DI1A 1AG1O 5DT7A 4IPPA 1V6VA 1E5NA 3ITGA 3NM1A 1XLCA 3GXFA 1ZAHA 4LVDA 5RUBA 2JBMA 3WQ6A 1RK6A 4WKFA 1KM0A 3ZQ9A 1PIIA 3N3MA 5DLCA 4PRRA 2EHHA 4U28A 3D46A 2A1YA 3ABOA 2CLKA 5M5DA 3CH0A 4JNYA 3QBUA 2C7FA 3ME3A 1NF0A 4ZOCA 4RE3A 1KBIA 4F8XA 1YLVA 4WK9A 4FA3A 1US0A 2J62A 5MHBA 2IQDA 5F7UA 2FPTA 8A3HA 2VEFA 4LAOA 5CJNA 3GIPA 4E0CA 1JCYA 1R30A 1UZDA 4ZB5A 2VZTA 1M68A 1OFPA 2PDNA 1XIIA 3I3EA 1V6WA 1UOKA 1WB0A 1LZOA 2CBIA 5BWFA 4PFHA 3KWXA 1KB3A 2P88A 1GNXA 1N8FA 1KV8A 3E9AA 2J6VA 2NX1A 3DAQA 4EPEC 5CC5A 1W3TA 1A0DA 1F3XA 3L9CA 1KTNA 3HG4A 3AO0A 1M7PA 1V93A 3SUUA 4UCGA 1UR4A 2E1WA 4HYRA 1X38A 1JUBA 1F8MA 5FJRA 2VT0A 1S1PA 3EMZA 4AEFA 2HTMA 3DHUA 2JKEA 2E40A 1EH9A 3M0KA 4PMYA 2CXGA 3QPZA 3NVTA 1LG1A 2XWEA 4IPLA 3CUHA 2ZA3A 3H8AA 2Q71A 1XM3A 2EPHA 3SGUA 3REQA 4NT0A 4S23A 1NY1A 4PB5A 2Y5EA 2X30A 5EMLA 2CZ5A 4QDWA 2A3EA 2FTWA 4I9MA 2GYIA 3FJLA 4A3HA 1IWAA 5D33A 3S42A 2D2GA 1U83A 1VRXA 4O4WA 2I1OA 4XKYA 1YBQA 4C6DA 3SN1A 3HN3A 5HMSA 1A4LA 2CLIA 2WHKA 3ARPA 2YBVA 4BA0A 1X1OA 4MDPA 4RW3A 1BG9A 3BOXA 3TZFA 4DO5A 2HZGA 5A6AA 3W7JA 4TX8A 3WLSA 4PMOA 1R6WA 4GX8A 2YXOA 1RD5A 5HNNA 2JALA 2TODA 1TWDA 4PA8A 5BW6A 2PZNA 3KDNA 1MDLA 2EKGA 1C8VA 1O4UA 2Z27A 1ZNNA 1Q85A 3LQGA 4FF5A 3BPWA 6PTDA 3DOPA 1JPHA 3MP3A 4H8NA 5EA9A 5AC6A 4JKKA 4GI9A 4PZVA 1NU5A 3WLIA 4YVPA 1FWGC 1JYXA 5EFDA 2BX7A 3G24A 4F2BA 4XV0A 4LSBA 4NX5A 1EP1A 5G2HA 5U7SA 2XN0A 1E73M 3ANUA 1IGWA 2DU2A 3N2XA 2W67A 1I2QA 4Z2IA 3TJXA 3HV9A 3THDA 2OMAA 1PYFA 3MYOA 1B4KA 3SZ8A 2QUUA 1MEWA 3MVTA 1Z48A 1V02A 4OGZA 2WAGA 3VPLA 3V0SA 1JD7A 1TJ2A 4Y6GA 3ZO9A 4ZQOA 1B3VA 3LCIA 5HBFA 3N04A 3ONCA 5I77A 1JCJA 1NOFA 1H7RA 1GOQA 3R10A 4EE9A 3QV9A 1GJPA 4W8AA 4KESA 1H1YA 3UWYA 4ICNA 1I2OA 4UZSA 1P48A 2NV1A 2BNJA 1E72M 3N25A 1CDGA 1PDYA 3I7QA 4UR9A 4KWWA 1Z9AA 3EX1A 4XUYA 4M1BA 2HEJA 4DB7A 3WELA 5BNKA 3O05A 4GZ7A 4FX6M 3E2QA 3EOOA 2YA0A 4JTRA 1MDRA 2GPTA 2E5DA 4KRUA 3G18A 1F07A 1RR2A 4M19A 4LAZA 3W7QA 3WJWA 2F9RA 3HO8A 3C8NA 3WLRA 2YR1A 3I4EA 1CCWB 3TMLA 2ZIDA 3IIZA 1IQ8A 2I7GA 4FXFA 3O9NA 5CSRA 1GQJA 3T8LA 1H1NA 3WH7A 1YDNA 3OODA 5DN1A 3LPGA 1NSJA 3GHUA 4L9ZA 1UR9A 3W9ZA 3WNMA 5A6MA 3VK5A 4FALA 1CWYA 4UTWA 2QCCA 3OO2A 5A8NA 3UR5A 6TAAA 3WH6A 3NPWA 3IS4A 3TCSA 3FHAA 3GG0A 4MOZA 3AFBA 4MHBA 5DY3A 4XD5A 1FQ0A 3LHTA 3TWAA 2OQYA 5AC5A 3AXMA 3GDLA 2J47A 1C29A 2DZSA 3DFYA 2HPIA 4EPDC 2RDUA 4GFIA 1S5WA 5E9AA 1XRVA 2W92A 1FWRA 5CJ5A 3NNTA 1D3HA 1GZGA 1KR0A 2NZLA 3P8IA 1JIBA 4H8VA 1FXQA 1Q65A 2NUXA 4WCJA 3NTYA 4CD5A 1OX5A 3WK2A 4JFTA 2R94A 2OEKA 3R5EA 1FWJC 5AYIA 3GHRA 2VCAA 2PA6A 4Q8WA 4E3VA 3WQWA 3NYZA 1Z89A 3IVSA 5LIYX 4BQ5A 1Q6RA 3LU2A 2PBGA 3GH5A 4O12A 4K8GA 1HJVA 5DMLA 1PSCA 1FWCC 3U57A 1W3IA 2FH8A 1EOMA 2RJGA 3ABXA 2PTZA 3LGGA 4DBEA 4XAYA 5HPOA 1GVQA 1K8YA 3M0XA 3AIEA 2XGIA 4UQDA 3HPSA 1MQPA 1WDQA 1V3KA 3O15A 4O1BA 4BK9A 1HGWA 1DHKA 1PZ2A 1RVKA 4XZNX 3NJ3A 2Z7GA 3CIVA 1R3YA 2ZQ0A 1HKVA 4JFSA 3PZQA 4WDUA 1A5OC 2YA2A 5EMKA 3WN6A 4WKHA 1NDWA 5I03A 3O1NA 3OBEA 5C55A 4GVFA 3DXIA 1AQ0A 2ISSA 3VCRA 1V3MA 2A85A 2QYGA 3ES8A 5D9MA 5AC8A 5A6KA 5LGZA 3WBWA 1M7OA 1TTQA 4UOQA 1CT5A 4L4LA 4UTTA 1W32A 2A6LA 4NZ3A 4AYSA 1DIOA 2YPIA 3WMCA 3LBCA 4UOJA 1P4CA 1XV8A 2GUBA 1KGUA 1GQIA 4F0SA 3LV6A 4NY2A 4Y7EA 1JRBA 3AYTA 3I68A 5DY2A 2Z28A 3GXPA 1OCJA 1A5BA 3NZQA 1TA3B 1TIWA 5CPNA 3UXIA 4IOTA 1ZAIA 3AYSA 1E4MM 4R53A 3LRMA 4UCFA 2B81A 3EWBX 2YLLA 2DH3A 3DC0A 3PPHA 5J5DA 4I9TA 4Z2LA 3A9IA 3BQ5A 1LROA 1XYAA 3PBGA 3KZPA 4PMXA 3ID7A 2E09A 4F0LA 3G3DA 2QUTA 3H4WA 4B5WA 1U1JA 2FGZA 4MWAC 2PDPA 1HJUA 2WOQA 4LTSA 3A3XA 1XDLA 4S3AA 3WQVA 4YMZA 2I9EA 2V2CA 4OE7A 1YXCA 2RHGA 3V75A 2PDMA 1KWGA 4OQVA 4V33A 2F6UA 2FH6A 1LLWA 2ZRZA 1QI3A 1S39A 4AD5A 4BJHA 2O4QA 4DO7A 1OIFA 4UTLA 2XFRA 3H7VA 4PODA 1B30A 3QQWA 4HCLA 4W85A 4FOJA 1KKOA 2V69A 2QPSA 3FIGA 2X40A 1Z7AA 3KP0A 4FO4A 1IXOA 3BWWA 1F6YA 3SUTA 5D8ZA 1HVQA 1HKKA 4MNKA 3HGJA 2NQ9A 3OBKA 4YWIA 4R5EA 1W5PA 1SZGA 3VI2A 5JXQA 1T96A 3GAKA 1GZ1A 3BLEA 2BY1A 3CAVA 3AHVA 1XYMA 4H83A 2XVGA 4CVUA 5GPRA 2WMKA 3GDBA 1GVEA 3KTXA 1R3RA 4JN6A 2OKOA 3L4UA 5AN7A 3AALA 5AECA 2FB3A 1KXQA 5CPSA 4IMGA 1W0MA 1BFNA 5TF0A 2DQWA 1F05A 3W7GA 2HCVA 3EA3A 4HMNA 4TR9A 4UFMA 1XC6A 5J8LA 3UJEA 1VPYA 4JTAA 3GXDA 2WMIB 4IJBA 1IE7C 4AWEA 4JQ3A 1NWTA 3SRDA 2PGWA 1HL2A 4NYUA 2XYLA 4U3AA 1O94A 1UROA 1J0KA 1JCNA 3CL7A 1R85A 1FWFC 2VUNA 1S2TA 1ZL1A 5EMUA 4Q6XA 3LXBA 5L9FA 2GQ3A 5DFAA 1LP6A 5TAOA 4O1FA 3VDBA 1OADA 2X2GA 2HMCA 4F9DA 1SJAA 1HFBA 2PUZA 3UJRA 2P8BA 4WLCA 3GW3A 3WQ4A 4FNPA 3VOCA 5DF0A 3TA6A 2BHYA 3AOFA 2OCZA 3LRKA 2QJNA 1BYDA 1I2PA 1DIKA 3CQJA 1BWLA 5LHFA 2D3LA 3V0UA 3BQ6A 2CZDA 5HUPA 5AFDA 4DZAA 1TA3A 3A3HA 1IT8A 3DCPA 3PWAA 1ISXA 5DQPA 2PU0A 3KOXA 1JD9A 1V7YA 4KT2A 1E43A 3GVRA 1UR1A 4N9CA 5BXPA 3FDKA 3PNZA 4GZIA 1MZHA 1FWDC 3NL5A 2A7RA 1O6IA 1IXPA 4MJZA 4O19A 5DMYA 4H6KA 2ZZ3A 5D2WA 1Z6KA 4F79A 5I3JA 4H9MA 4XD3A 1OC5A 3W7HA 3TVAA 3GG1A 1RCQA 2QPXA 1NP0A 2ISWA 4C6KA 2VNCA 3L5LA 4UQEA 1VFLA 3S8HA 2PZ0A 3M41A 3M0VA 1QAPA 4GX9A 4A05A 3UXAA 1B5TA 4DUOA 5DBTA 1HKIA 2P5NA 2PD5A 3MJYA 1MFVA 1WV2A 2PLMA 1E3ZA 2YW3A 3CWNA 4ADUA 3KTCA 1CNVA 4QAIA 1GVSA 4KW2A 1JZ2A 5A69A 4HNNA 2OGYA 3QV8A 4EACA 1G4SA 3MBDA 1R46A 2XM2A 5E6YA 1B3XA 5F4SA 3AZSA 2WQDA 1KTCA 3ZT6A 1H5VA 4AQLA 2QJHA 3KDOA 5H8UA 3B0VC 3UETA 1AFSA 2ACRA 4D6CA 5I09A 2E28A 3B4YA 3U2OA 4Z08A 5AHFA 3CJPA 5IRPA 2CLLA 3CAQA 3RM9A 3CPRA 4G8TA 3UWWA 2YBTA 3RPMA 1KO0A 1P6BA 3E38A 1JZ5A 3PC0A 1JAKA 3HGSA 4IMFA 4BY3A 1W1VA 3LV5A 3CUIA 3N2BA 3HM7A 3VNZA 3PFRA 4LW7A 4S39A 2DIJA 4O10A 2QDHA 4HIBA 4HJFA 4AY8A 2XFWA 1H5YA 2WZHA 3CAKA 3IUDA 1KM2A 1HL8A 4JOMA 3OQEA 4FS9A 3KVMA 1KWKA 1UD6A 1GQNA 2X09A 3IIXA 4D6GA 1W3LA 2F7FA 1YDOA 4KGJA 1B3ZA 4EVZA 4PMNA 1M5WA 3M16A 4L64A 4UB9A 3RJYA 2Y7EA 2ZUWA 5FIPA 5D37A 5TIMA 2WMIA 1Q6QA 2EEXA 1FFRA 1HO1A 4B5NA 3B8UA 1B1YA 4JHZA 2OX4A 3FNDA 1AJ0A 1UP2A 3MKVA 1XLHA 5LIXX 3SUSA 5FJIA 2WSQA 4NKCA 3QV6A 3AXKA 2VQTA 1X1NA 1TE1A 3Q67A 4US6A 1MW1A 4HK7A 4HPJA 2OLHA 3THUA 4J7RA 3W26A 4O4VA 1F9CA 1MQRA 5A5WA 3KS5A 3VKAA 5B7YA 4KQNA 3CV6A 4R7OA 1K03A 2PWDA 4AEOA 5JBEA 5CLWA 4MJ2A 3ZVIA 1W8GA 2V2DA 5CXPA 1FHLA 1XR2A 3CLMA 2DIEA 4OUIA 1LYXA 4AHPA 3EDDA 1QI4A 1SVDA 3W37A 4GGBA 1HL9A 1E0TA 1QWGA 3K2GA 3T8QA 2AKMA 3KHDA 2UBPC 3PG9A 3MHGA 4JX4A 3W7IA 2X1SA 2AL2B 4DI9A 2ZZ2A 1D8CA 3R43A 1WOBA 1BWKA 1DJIA 3AYVA 1TVPA 4H2HA 4GUJA 5SWUA 2PMQA 1XUUA 2NSXA 4PTMA 3TONA 3TYCA 3LCHA 1GOWA 4EXQA 2HSAA 3NYDA 2EG8A 4AYGA 3ZT7A 1XICA 3GKFA 5HWMA 3DHDA 2V5KA 1M3UA 3PJWA 3O6YX 4WR3A 3F4NA 4QE1A 1P0NA 5HQEA 1E9LA 4AEEA 3AU6A 4W7UA 4WJEA 3L2IA 4Z1AA 3VNKA 2OX1A 4RV3A 2AKZA 1GHRA 3URBA 2ZC8A 1MRAA 3V5OA 2ZADA 1GEHA 2JIWA 4DLMA 3LCWA 2QV5A 5G1TA 2V63A 4DM2A 1N7KA 1V02E 2POTA 1IT7A 4KFPA 4NNBA 3T0DA 3LXCA 5KMYA 3BLKA 2XSAA 4LS1A 2DUXA 2ZICA 3W53A 4G1NA 2BV9A 4FX7A 4L9XA 1AH3A 1A3WA 3STPA 2X0YA 4AHQA 3P82A 1IGSA 2NXHA 2VL4A 3ONBA 3TW7A 2JFEX 5HANA 3ALFA 3ITOA 3W85A 1POKA 2HQAA 2KAUC 1VS1A 5I3IA 2I16A 2J7GA 2R1MA 1EPVA 4M24A 4Q4KA 3NQGA 4KWVA 3W82A 4Q3MA 4ECLA 2C19A 3CMFA 2Q8ZA 2YDSA 1PVNA 4RX0A 1BVNP 3UG4A 4BI6A 3TYZA 1I4NA 5ECUA 1G01A 4F40A 3UGVA 1TX0A 1IXNA 1UH3A 3CEPA 1T5AA 3FYYA 4U33A 3PPFA 1XUZA 5LNWA 5E0KA 2A3AA 4P2VA 5LA0A 4GXPA 2GGEA 2DZVA 3S2LA 2BY0A 1F7BA 4XZMX 1S3TC 2A0NA 2YYTA 3RM8A 4A2SA 1TJ0A 4O0ZA 5IHRA 2Z26A 4QJ5B 3WF4A 2G41A 2OELA 1ITQA 4R9OA 3DN5A 1BTMA 1FWHC 2GJRA 4FZIA 3VOFA 4CQDA 1RALA 3K8KA 2J27A 2IPGA 4KH2A 1UHVA 4Y9MA 1CGUA 4NUWA 4J5NA 1B3YA 1A49A 4HSOA 4GIRA 1G7UA 3NO3A 2F38A 7TAAA 4LANA 1EBHA 1OYBA 5A6SA 2DT2A 3CMJA 4FMVA 1UC4A 2CLFA 5CZSA 2VX4A 4Q6JA 3VNDA 1IEWA 3CHVA 3FV9A 1VCVA 3VCCA 2ATSA 1Z8AA 3M5VA 3C61A 4BWLA 3T0AA 3B06A 2C16A 2G96A 4JHMA 3VCNA 1PXGA 1YXYA 4JQAA 4PTDA 2CZFA 3UCDA 1E9IA 4PTNA 4FNSA 1E0VA 3B9OA 3RX4A 4HTYA 2PURA 4JIQA 4XZBA 1PKNA 1I45A 4C7GA 1LT7A 5G4HC 3QJAA 4YTSA 1QW7A 1XPGA 3GYEA 2I5IA 4UTFA 5E9XA 4X63A 3CL8A 3M4HA 4N9EA 4I90A 5J5RA 4R7JA 3MKKA 1Q8AA 1YTKA 2ISVA 3OGSA 3G22A 3RO8A 4NL1A 3U6WA 1OYCA 4LUYA 4PCFA 4HU3A 2DVTA 1DWAM 3W1PA 2V3DA 1GQLA 4I3GA 4LS0A 3AMKA 3VZYA 2WJEA 3UF9A 3DG3A 2CNCA 1BSLA 6A3HA 4B92A 3TEVA 1FH8A 3W23A 2NX9A 2OG9A 3NOEA 1Q7ZA 2WJZA 1R8LA 3VDAA 4D9PA 1F4AA 4ZENA 3C3UA 2MNRA 3MT1A 3VOJA 1Q6GA 3N2MA 2H8ZA 2V3GA 1V4YA 1LLOA 2XTKA 5JUVA 1J18A 1Q6DA 4IX0A 1F73A 3GR7A 1K02A 3GUGA 1ME8A 4P7NA 3UP8A 1G4EA 4ZQPA 2D69A 3R7MA 1BWVA 5B7ZA 4LYPA 3BJSA 4HHPA 2YW4A 3TIMA 4J3VA 1XCFA 1ALDA 3THQA 3KEHA 1DOSA 4GUGA 2DPEA 4UMBA 2WZIA 4LNYA 2CW6A 4N42A 4TVUA 2ICSA 3BVJA 3WY1A 4GHRA 1HXJA 4GLEA 3S3GA 4YCPA 4O13A 4I7UA 3SECA 3K30A 2V5BA 2ZUSA 3G1FA 4EWND 4CN1A 3VDCA 2TSYA 5GQBA 3UNTA 2Z1WA 5BU6A 5A6JA 1EJUC 1MXSA 4G5DA 1EO5A 4P7LA 4Q33A 4WHBA 3N2CA 4J3WA 4JYFA 1UW9A 3GS6A 4CEXC 1QOPA 4ZO8A 5CH9A 4LYQA 1HKWA 1TKKA 3E5BA 5A94A 4GH1A 2YDQA 3N3TA 4RR4A 4Z0JA 3T55A 2WM1A 2XFYA 3MPGA 1K9DA 3WMSA 5I24A 5E6ZA 1OB0A 4KS0A 4ZQCA 1PHWA 3JZUA 1XSIA 4NAFB 1UD5A 2OSYA 4HMEA 5AHLA 2H6RA 1S2CA 4GH3A 1Q7MA 3SSJA 1OJXA 4QNEA 8CGTA 5A95A 1OG6A 1VGAA 4NQ1A 4CCCA 5I6SA 1QPNA 2V81A 2W63A 1P0BA 3ATYA 1EF2A 4OJYA 1E6PA 3KAOA 2C8NA 3BLLA 1QOXA 2CKRA 2XGZA 1XLJA 2IXUA 1YPIA 4QR6A 4Z2KA 3L68A 2Y2WA 5JH1A 2QJJA 1U2YA 2OEMA 1YPFA 4P5UA 3WF1A 4DJDC 3II1A 1MYRA 4HMCA 4GOAA 3P14A 1GOIA 1WUFA 2NQLA 4WF7A 3LK6A 1CXEA 3MSGA 2TPSA 3TE9A 3AHZA 3DG7A 2AQWA 1G1YA 1SJBA 2EPNA 1XIEA 3OA5A 4AD3A 3BV4A 2Z4GA 3JW7A 4WKAA 8XIMA 3DH7A 3WQ8A 1J79A 1YMYA 3NSMA 3F4CA 1FWIC 1BXNA 4XIMA 3SRKA 2PDWA 3LA4A 4N02A 3UZZA 4C6OA 3H22A 2J8TA 3B0XA 3F2BA 3M0YA 3TU9A 3LZ5A 1XC4A 2A7PA 2HNHA 3ZSTA 1O5KA 2UY4A 2FPYA 3VFCA 3EDEA 3TV8A 2NLIA 4WJ8A 3F1QA 4ZFMA 1SMAA 5HINA 1KFLA 1VAHA 4DVOA 4GI8A 3WL0A 1C7TA 4AZCB 2PDFA 2G3IA 5C5YA 4AISA 3A12A 1NOWA 3I7SA 4I8YA 4DAIA 2HISA 3KOFA 5G5IA 4IGHA 4LQ1A 3GO2A 4HA4A 3QKEA 2WNZA 3KE0A 5XIAA 1KGWA 3PPGA 3T0BA 4FIRA 5HXMA 1Y5VA 1EJRC 3PTMA 4ZOBA 1J5TA 1LL7A 2WPGA 4IT1A 1B54A 3RMJA 5DXXA 1UKOA 3W2NA 2HK0A 3PBYA 3W7KA 4AX6A 4O11A 3UR2A 1XKJA 3DHFA 1RHCA 1ISZA 1EQCA 1FY6A 4HK6A 2QJGA 4E4UA 3BANA 5IDZA 5CG7A 3MB9A 1W9BM 4PEEA 1RP9A 4NZCA 4LBRA 2GOUA 1XIMA 4QS5A 3WLQA 4ML9A 2WBGA 1JQVA 4TMBA 5LA1A 3KM8A 2X1TA 1V51A 3IJ6A 1UJPA 2PEVA 4ZSUA 4IWWA 2RH9A 3VABA 1MW2A 3XISA 1Z32X 2Z2UA 2OT0A 1ZPTA 3TTSA 2ZRWA 4BCEA 4PSRA 2Y24A 4JTGA 5CC6A 2YXXA 1EA9C 3R8RA 4S3GA 1WBJA 2OOFA 4FEZA 4IIEA 3VIGA 4WEVX 2D23A 4BF5A 3CGTA 5FOOA 4PUJA 2UWFA 5IHSA 1JZ8A 3IAQA 1GORA 3R89A 2W6RA 3RIKA 1FDJA 2OJPA 1E51A 3I3DA 3ABSA 2FKPA 2HE8A 2VMFA 1F3WA 3WQ5A 3AICA 1JUKA 2E1DA 5GNYA 2CLPA 2QCGA 1KM6A 3DC8A 1VYPX 4NZ5A 2O92A 2V3FA 1QI5A 3VE7A 1FXPA 3HQNA 1ZCOA 4UTKA 5CPQA 4LAUA 4JS3A 4GE8A 3L4ZA 4DYEA 5D2XA 1AQFA 2HVMA 4JCMA 4QDPA 3P81A 2E68A 3BLFA 4K1GA 2DEPA 4PUNA 1JRCA 1DQXA 3G6MA 4E4FA 2XDFA 2GOKA 3K4AA 3VKDA 5JVLA 2P1FA 1ZS2A 3KRSA 2H3DA 1D7FA 2YFNA 3ZSSA 1LRNA 1H63A 3W75A 1K8CA 3M07A 3QN3A 1XRTA 3KHJA 5MKGB 1H2JA 2Y61A 3PZMA 1DV7A 3S5SA 3BICA 2IKGA 1JJKA 3H4GA 4Q8PA 2JKAA 3WJZA 2NVAA 2B7OA 1QNPA 1PEZA 2XWDA 1JCLA 1XIBA 4LT9A 3TR2A 1AMKA 1GTEA 1QK2A 1OFBA 4GIAA 1S5TA 3ECQA 3AXXA 1T99A 1Q6CA 2CLEA 4H04A 1NWUA 1KA9F 4PUKA 3KCJA 5LNUA 2ZKMX 2XH7A 4B5VA 4W87A 4MAVA 3VINA 4AZCA 5FJTA 4M51A 4HU0A 3OA3A 1VF8A 5JIPA 3C86A 3LBOA 4QRNA 3PWIA 1XDJA 2X1IA 1QXLA 3W22A 3NQ2A 1W9DM 3B8IA 3IIVA 4JFVA 3BDKA 3FVMA 1SZRA 4YN5A 5D38A 1GKRA 4MB4A 3L0NA 2OEJA 4MZ8A 1UA3A 3SBFA 3L4TA 7CGTA 5CSSA 2OO0A 2WB5A 1EL3A 4HTBA 3O6CA 1ECQA 3SQMA 4HT3A 3Q2DA 2V6AA 1QI0A 3EPOA 3DFHA 3LGEA 1QW8A 4IXXA 4PMZA 4K1WA 2WVSA 4V28A 5DMNA 4JR5A 5HR6A 1BKHA 2BDQA 1PIGA 4B16A 1TWSA 2FZBA 2J13A 3LB0A 2W0UA 3MMUA 4L1GA 3KWSA 3QHOA 1OEPA 3ZLHA 2BODX 2VR5A 4MB5A 3SRFA 3Q37A 4HN8A 4G56A 1QR7A 3GVWA 2ZX6A 3LPOA 1W1B1 3L5MA 4YTQA 1NQ6A 2OTDA 2B31A 1A50A 3JVAA 5FESA 1JFHA 4WXZA 4HA3A 5AZ0A 3UQNA 1YDYA 4HN4A 5BOEA 3NM3A 1PB0A 3TWBA 2QPUA 3QZAA 4ROQA 4MFEA 2QF7A 3TYBA 4Z2GA 3CHCA 2CKSA 1KBBA 3GBEA 4C6LA 4D72A 4MZYA 1L6FA 1XYCA 1UWSA 3B40A 3QPYA 4A8IA 3T40A 2X0HA 3ITTA 4O16A 2HE5A 2W5FA 4L6HA 2LLEA 1BYAA 1DJYA 4C65A 1TV3A 3OP2A 4KFOA 3VGFA 1Y5XA 3RO6A 2WMGA 4MAZA 2ZRYA 3AIRA 3KOYA 3FA3A 5CPOA 1L8NA 3CZEA 1XBVA 2E9LA 3RN6A 5EL1A 3SCVA 2VTFA 1ZJAA 1BF2A 3AIQA 2ZA1A 3PJUA 1NEYA 3R12A 4GNKB 3PZIA 7XIMA 2OVLA 3W0KA 2Z2AA 2WZEA 3RR4A 1MZRA 5CAHA 2DSVA 3VKKA 1FWNA 1WE5A 3WQPA 1TV8A 4DUWA 3VNJA 2J7EA 4PUWA 3AUJA 4RCXA 3K5XA 5FF0A 1EC8A 3MUIA 2PD9A 4OOZA 3K8LA 3N14A 1UKTA 5TD4A 3VNYA 1E6ZA 3PUOA 4L6OA 4GQBA 2VR4A 1OM0A 3AZTA 3H6OA 3B8TA 3ZJ8A 2P3EA 4HYVA 1YKWA 3ITYA 2B7NA 1U5HA 3TFCA 2FFCA 1YIXA 2HNEA 3NURA 3OW1A 1IZCA 4J2MA 3UEQA 1HJSA 3ATZA 3F4VA 5JU6A 2QCEA 4GC3A 4HNLA 2CIPA 2GUYA 2DORA 2NXIA 3GIQA 3OHMB 3VC5A 3BMVA 1EUNA 3NEVA 2NWSA 2ZUUA 2Z24A 4JNMA 3DUGA 3G1SA 1W1A1 2O4MA 3LSBA 1XDMA 2XISA 4N7QA 4E8GA 4QNWA 4UTHA 2WQPA 2VR2A 3IGSA 3HFYA 1MI3A 2PDJA 1W8SA 1KRBC 4TVCA 4A3UA 3C2YA 1ZJIA 3Q94A 3MO4A 1GQKA 3GU2A 6CGTA 5ENLA 4R85A 1C90A 4K6AA 5BXRA 5AC7A 4IXHA 1DJZA 2CETA 1FA2A 3C4UA 1TZZA 3WK3A 4KEVA 4H4IA 3PBUA 3JZEA 3KBJA 1VQTA 3LCXA 1VP5A 2FZ8A 4NHVA 5CPTA 2QCFA 2YDRA 1WKEA 1SSGA 3AJ7A 4AWTA 2VRKA 2AOSA 4EOUA 3L65A 2PLKA 1Z69A 1J9YA 3U3HA 5HMEA 4KRTA 1THFD 3GVVA 2FVKA 3W76A 3NQFA 4DJED 3LM7A 1A3XA 1W3KA 2HS6A 3HGOA 3L0KA 4K37A 5I0DA 1UKPA 1A3HA 4XSMA 2NXGA 3ZLFA 1WP6A 1FKWA 2BY3A 3MY9A 1HG3A 2WHMA 3GC4A 1W5MA 2GVGA 8RUCA 5IXEA 3UW6A 3W7NA 1A5UA 2WMFA 1OFOA 2VFGA 1V6TA 4INFA 4X60A 2HWGA 4PN2A 4UFIA 4NJJA 1KXVA 1MO0A 3E6EA 2OODA 2VEMA 3N15A 2ACUA 1ICSA 1OX4B 5HK4A 2J6XA 3B3DA 2QW5A 3M6YA 4WOQA 3MUCA 2IKHA 2O9OA 1VFHA 4LVFA 1PTDA 2C0HA 4FXRA 3P74A 5HAOA 3WD4A 3EKLA 4ZB2A 3N6HA 3WQGA 1IWPA 3T78A 1DJHA 4FSAA 1E40A 1JCMP 5GNXA 4IUOA 1QMLA 1QOQA 3WJXA 1E55A 3QYQA 1AH0A 3G3MA 3C3NA 2ZUNA 1ONEA 2NW0A 2O0TA 4C6CA 4DO4A 1FHUA 4CU7A 5H6HA 1BQGA 1R3QA 1T6MA 1QASA 3TQVA 3WQOA 2O55A 4DF2A 2PCQA 3CV2A 4M82A 4O8AA 5FEZA 4KIRA 4JAWA 1KFWA 1UR8A 3ANVA 4V1XA 3WF3A 2FB2A 4GKLA 2QUNA 5BXSA 4A6GA 3SCQA 4DXVA 4AIEA 2ZUTA 2GJLA 1GVFA 4TXEA 1L2QA 4WY0A 3TC6A 1VCGA 1BTCA 1XSKA 4YTUA 3ITCA 2XIMA 3C0SA 3U2EA 2WCGA 2E77A 4W86A 1J10A 1SO5A 4S38A 1AL7A 1N82A 3WSUA 2J7BA 1A53A 4IFKB 1EC7A 1EXPA 3MQTA 4DELA 3KL0A 3CV7A 1VFMA 1AZ1A 4MKNA 3S46A 2TRSA 4GJ1A 4CD8A 4K3ZA 3WLJA 2BOEX 3V1HA 3TC3A 1N2VA 4J3ZA 3TKFA 1VPXA 4LEFA 4W84A 1ODZA 2IMRA 2IPFA 5C2XA 4WRHA 5FF2A 4ZVJA 2W91A 3TW6A 4AZGA 3MVIA 2VFIA 2FHFA 3ZMRA 3TDFA 3CZGA 1IWBA 5CKSA 4O53A 3BO9A 3BW3A 1H61A 1W9PA 3JRKA 4H9UA 2GGJA 3M44A 3SADA 2INFA 4QISA 2P8CA 3DFQA 4HPNA 5LNVA 3A5VA 3BAXA 5U4NA 3E2RA 1TO3A 2VX7A 3LI1A 4ORIA 4MM1A 3KCLA 2UZ9A 1GOOA 4JNZA 1T8QA 4DO6A 3WD3A 3BLPX 1CXLA 3STCA 3GG8A 5G1YA 4Q4OA 3S5ZA 3TJ4A 3W7CA 1CLKA 2MANA 4E2VA 1ELSA 5A8PA 1M9HA 4CQAA 2VFFA 1WAUA 4IFOA 1G0CA 2VEKA 3LHYA 3W7RA 3ARRA 1GOKA 3DG6A 4JKLA 1K70A 3GNDA 2DSKA 2JEPA 1WXJA 3EOLA 2GFTA 4HNVA 1YW1A 1QHPA 1UKSA 1XIDA 4KFNA 2ABBA 4UBPC 5IM51 2PDCA 4RDYA 2G3FA 2VFDA 2VQUA 4CNPA 1QU4A 3ZOAA 1OX4A 2BXVA 2WCAA 1SJDA 4V27A 3MA8A 3GB6A