1K7XA

Crystal structure of the beta-ser178pro mutant of tryptophan synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
254
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 95
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k7xA00
4YL2A 1VZWA 2GVLA 4Z0JA 1AK5A 3P8JA 2QDHA 4ADSA 3ZR4A 1AW1A 3M5YA 3B0VC 5I3GA 4IUOA 3EB2A 3I6RA 3TR2A 1Z48A 1PV8A 3QW3A 5HJLA 1L6SA 1G69A 5I3JA 3UWQA 3KXQA 4B5NA 2EPHA 1GYNA 4MJMA 3W2JA 3QQ0A 2EAWA 2FFCA 2JKAA 3GVGA 4XQ6A 3QPZA 1LLZA 3AJXA 5HMSA 3OHIA 3HPSA 5K2ZA 1AL7A 2PRHA 1J4EA 1QFEA 1UUMA 3ZWSA 2J27A 2QAPA 3MP5A 1TTQA 2A1YA 3W1PA 1Z41A 3G24A 1HTIA 4L4LA 3PSVA 1DVJA 2PRMA 2C1HA 2QF7A 3LHYA 2W0UA 1QOPA 1KM2A 2NXGA 2E77A 7TIMA 4DF2A 3CQ0A 1PVNA 4KKXA 4AHOA 4RXFA 5D2XA 3S1XA 1ZENA 4GUFA 4UFJA 3C2FA 2VFDA 1I2RA 3NZ1A 4PTNA 3EWXA 2YGYA 3S6DA 2GQ8A 2HSAA 1R2RA 1VPXA 5G4WA 1OABA 1HO4A 5SWUA 2J88A 4GWEA 1T8XA 3LLDA 1RQHA 4OT7A 3GK0A 3C6CA 3NYZA 1PHQA 4GNJA 3G1FA 3G0SA 5C55A 3QMTA 3TXZA 4NJHA 3IVTA 3W2MA 2ISVA 1FCBA 2AQWA 4FEZA 3NL6A 3NM3A 2GPTA 3ATYA 4LV9A 4OV9A 5FEPA 3USBA 3KVJA 4M6PA 4DO6A 4HHPA 4Y96A 3PSWA 4YXGA 1XM3A 3CU2A 1EB3A 3G22A 5AYZA 3QW4B 1TTJA 1C29A 2WNQA 3FYOA 1F73A 3T78A 5CGQA 5C54A 3GX9A 4IWWA 1HO1A 1P5BA 1OX4A 2A21A 1XUUA 2FTPA 3DHFA 4O10A 2VFFA 3A22A 3F4NA 4KWWA 1DL3A 3M41A 3MW7A 3I7QA 5HUPA 4AB4A 3W83A 2CU0A 2Z6JA 2Y63A 1NEYA 4EF8A 2BZNA 1KV5A 5DLCA 4LW7A 1QO5A 4IXXA 1BKSA 1G7UA 1XKYA 5I3FA 4JTTA 3U2OA 4L4MA 1YDOA 5T26A 3NZRA 4QIUA 4LOCA 3G1VA 5CZJA 1YTDA 4K38A 3STGA 3C56A 3M7WA 2DJXA 2RKXA 2YX0A 2CLEA 4QISA 5C5YA 2TRSA 3PG8A 1JUEA 3STCA 1OF8A 3SIZA 4O12A 3FS2A 3QZEA 5KSWA 4LUIA 2A6NA 3MHUA 2F84A 1DJNA 4LC6A 4WXZA 2ZZ1A 1LRNA 3IGXA 1P0NA 1TCDA 2CZ5A 1CI1A 1TTIA 3M43A 5MHBA 1NSJA 1DHPA 2Z2UA 1EWEA 5L9FA 1GT8A 1SZNA 2Y70A 3INPA 3MI6A 1OK4A 1RPXA 1K03A 5IM51 2ZDRA 5IBXA 1FWNA 4LVDA 1N7KA 4MY9A 3SSJA 3HGRA 3UYCA 3DGRA 1GVSA 2QR6A 4EIVA 1DQXA 3S1WA 4CCCA 3NA8A 3W7HA 1W31A 2G5WA 4JNMA 1OFEA 4N9CA 1O5XA 1BWKA 1FDYA 3G8RA 1H1ZA 4LVAA 3FLUA 1SFLA 3W22A 2NXHA 2QJIA 3VI2A 4D2JA 1FCQA 3FFSA 1W1ZA 4KFPA 3F03K 1X1ZA 1M6JA 4DF0A 2HMCA 1H61A 4A2RA 3W71A 2ZTJA 2CFFA 1DOSA 5HR6A 2CZFA 3HGOA 1KW1A 4MOZA 4UR8A 3W74A 1RQBA 3MP3A 5G2WA 4UTJA 1OVDA 1ZAIA 1QDSA 3W1TA 3NR0A 3PM6A 4FNPA 2Z1BA 2ZA1A 3HGJA 3OVPA 1TB3A 5AHIA 3W07A 1J5TA 1AG1O 1L9WA 2ZRUA 2ALDA 3FOKA 6TIMA 3UXAA 1PE1A 2E6FA 3TU9A 1LRQA 4M6VA 2RFGA 2VEPA 1KTCA 3EEGA 4LS2A 1M5WA 3HMJG 3SGZA 4FX6M 4N4QA 3E9AA 3STFA 4OBTA 4E0CA 1JCMP 1KM3A 4MY8A 4E2BA 2ISSA 5F1VA 3STEA 2GOUA 1LBMA 4PL1A 3NQ6A 4OHQA 1HG3A 3EWZA 1OFQA 1R47A 4JGDA 2VENA 2X1RA 3RFAA 1KM5A 4UMAA 1QPNA 3UQNA 3TAKA 2YDAA 5BMWA 3PUDA 5I3KA 3DHDA 3CTLA 2FB3A 3MBDA 1G67A 1HL2A 3SECA 4O16A 3PB2A 3MJYA 1ME8A 1ZCOA 2NZLA 3G3MA 3UNDA 5KITA 4JXCA 5KZMA 3G1DA 2NXIA 4M5PA 1EIXA 3UXDA 3DAQA 5FF0A 5D05A 5HR7A 4UNKA 2FIQA 3A21A 5A5WA 3N14A 3S0CA 4KFOA 1JUBA 1JUKA 3RNDA 1DBTA 4MPQA 1V7YA 3PC0A 5C6MA 3RMJA 2CLIA 3OG3A 5L6UA 1NF7A 3BGJA 3TA6A 3SW6A 2Y85A 4QITA 2P10A 4UTWA 2Y89A 3LGEA 4LWWA 4Y6GA 3ABRA 3C8FA 1A5SA 1FWWA 1S5TA 5AHLA 2H3DA 2V2CA 5AYXA 3HO8A 3R8RA 5F2GA 5F4XA 4O4WA 1ML1A 3LHTA 4N9EA 1GQNA 2EKCA 3B8DA 3BVJA 3TQKA 3Q2DA 5HUOA 2Y61A 3NQVA 3NQDA 1TQJA 3B4UA 4IMFA 3V1PA 3MUXA 1XFBA 2C18A 3F1QA 2RH9A 4O0ZA 1VHNA 3R13A 4CCDA 4AWSA 4ML9A 3BW2A 1D9EA 4FXSA 3TSBA 3M6YA 3TW7A 3O05A 5TBOA 1U5JA 4PA8A 4R53A 1D3HA 3CB8A 4C1KA 1MSSA 1SW7A 5LZLA 1Q6QA 3BGGA 4M6QA 2PCQA 4A21A 2EHHA 3DI0A 4NNCA 4NJKA 2QCEA 3NQGA 1B3OA 3P62A 1FBAA 3L0KA 4TU1A 5J5DA 5EA9A 2NLIA 4LS1A 3NM1A 3P8IA 4A29A 1HFBA 4ZQOA 3NOEA 5HINA 1E51A 3QEZA 1TV8A 1PL9A 4N6EA 1LOQA 1OFAA 3TAOA 2E6YA 4IMDA 4LY8A 1GVOA 1JJKA 3B05A 1F7BA 4E38A 4FNQA 1QPQA 4O1BA 3QH2A 3GXTA 1WBHA 5F2IA 1RZMA 1RQEA 5LHFA 4JTIA 4N4PA 3W6YA 3NPWA 4JY8A 4UFIA 4CLMA 1I2OA 2Z0IA 2WNNA 1OFRA 4AXKA 4OGZA 5EMUA 4BI5A 2QJGA 4K8EA 4MZ1A 2X2GA 4AEOA 1LCOA 4YCPA 1TRDA 2PE4A 3W2KA 2WSYA 3TX9A 3PUOA 1ICPA 2OT1A 3GKFA 5ABTA 1H50A 4ICNA 3BLEA 3W86A 4JTLA 1JCYA 3C3NA 5BMXA 5CPLA 3G1SA 1I2NA 3L67A 1H7NA 4HIBA 4JIPA 3W7IA 5DELA 4S2BA 4GUJA 4NU7A 4KWVA 2BX7A 4LT9A 3UPBA 3LCLA 5DXXA 3IVSA 3MP4A 1F6PA 2YZRA 1WQ5A 3D0CA 1QO2A 1ME9A 3LDVA 2BTMA 4ZMGA 3U6WA 2GVGA 4MY1A 5AN7A 4IGHA 4N9DA 1SZGA 1GZGA 1I2PA 2H3BA 1I8JA 2OX1A 3NQCA 2J6XA 4BF9A 4FIQA 2QEZA 4AMAA 4UTLA 4MZYA 3HBLA 1ZNNA 4FX8A 2E1DA 3HIJA 3SGUA 1VGAA 4UMBA 1JCXA 4WJEA 4ZVJA 3ZWTA 3CHVA 3LB0A 2ZTKA 3DI1A 4XKYB 3S1VA 1H1YA 2FPTA 4NXSA 1T96A 1X7FA 1EA0A 1NFBA 3LCXA 4FHAA 4GBUA 4LNYA 5HNRA 5HWJA 4I7UA 3G18A 1KBJA 1SSGA 4JN6A 2H8XA 1FDJA 3GDLA 4O1DA 2ZA3A 2JGYA 2JK2A 3DH7A 1VC4A 3KOFA 3GAKA 4O11A 3L0GA 1CW2A 3E49A 2X1TA 1LP6A 4FF7A 6ALDA 2WSRA 2WV8A 1WX0A 3IGUA 3PBVA 5DXYA 3EWUA 4MFEA 3W7MA 3DFPA 1C9DA 2DORA 4JIQA 3QSRA 2AAMA 1TPWA 4LV4A 2I14A 3W1NA 1SUXA 3ATZA 1GG1A 2C3ZA 4MYXA 1OJXA 4GUIA 3W7NA 3W87A 2QKFA 4ORIA 2I1OA 1MEIA 4ALDA 2WOQA 2ZRVA 3C2RA 1SU5A 1UBSA 3WK2A 2JKEA 3JR2A 3S8HA 5AC6A 3ABOA 1OFDA 3DKJA 2R91A 3EWYA 4Z1BA 1JCLA 3TC6A 4GRSA 2X1SA 1TQXA 2VC6A 3HB9A 1GG0A 4NJJA 3DFOA 1H7WA 3G1XA 2A0NA 1OF6A 1LOSA 3C2VA 3OA3A 1PIIA 3O16A 1S5VA 2V5BA 4NJGA 4ZZ9A 3TSDA 4PCFA 3PWAA 4CQAA 5EY5A 1LZOA 1XBXA 2RDWA 3O8AA 1IGSA 3WJYA 2Y7DA 3E02A 3DU0A 2QCDB 3LLFA 3S5NA 5KZEA 3OEXA 4HSNA 4J9JA 3L5LA 4JDYA 1X8FA 3MWAA 5LKYA 3IIZA 5D03A 1CX9A 3G1AA 3HJZA 3QSTA 1W5OA 1S3HA 5FEZA 2OZ0A 3LCWA 1SO4A 2J9XA 4MZ8A 4ONVA 4K37A 4O52A 5K9CA 1O60A 1XC4A 4K8HA 2YFNA 2E6DA 3HF3A 3KFTA 4MLRA 3VE9A 5AOUA 5H91A 1YXYA 4ZQCA 2C15A 1LBLA 3TW6A 1QNVA 1QR7A 1GTHA 5CPOA 1YADA 3N2MA 4UTMA 3LHZA 2NWRA 2QUTA 3NG3A 3QQ1A 3N73A 3PBYA 1H51A 3W7CA 4BI6A 3NNTA 4OQVA 3GXPA 3H53A 3NQ2A 3OVRA 4JY9A 1FUYA 3W7JA 4O1CA 4UXDA 1EUAA 1TREA 2R14A 3ABSA 1BTMA 1C8VA 3M5ZA 5A8GA 4CNOA 5G2IA 1TO3A 2A7PA 1S5WA 3PULA 4WD0A 3LOTA 4O4VA 2A4AA 1AW5A 1FCUA 5LNVA 2ZFAA 3P7YA 3PAJA 8TIMA 1VLIA 3C61A 1H62A 2B7NA 1ZAJA 3TQ0A 2FLIA 3TMQA 1TPVA 3EXRA 4JTSA 1QAPA 1BWLA 3LBCA 3R12A 1UB3A 4PC8A 3GB6A 5G2HA 3TQVA 1T0OA 4UTTA 1LM1A 4PEKA 3PY2A 3W2LA 3NPUA 1ADOA 1FQ0A 2YPIA 1TSIA 1SFJA 2ZZ6A 4A2SA 5C2XA 2Y6ZA 4NT0A 1YPIA 3DXIA 2AGKA 3HG5A 1YTKA 4IPIA 1VH7A 3L21A 4UTTC 1IXNA 1OX4B 2DP3A 1FXPA 4JTJA 2X16A 3R2GA 5LNUA 3S5YA 4N6FA 2ZA2A 3QJAA 1TPFA 4FB7A 1W5NA 5K9XA 1OG0A 3L65A 3N34A 3GYEA 2E5CA 3TCEA 3C52A 2V82A 3LV5A 3CLMA 5K3VA 3T7VA 4AHPA 1IXOA 3GKAA 3P82A 3WK0A 3L5MA 1H7RA 1A53A 1KLYA 4TR9A 4AAJA 1N55A 2FJKA 4FIRA 3S5OA 3ZS4A 4R34A 4UTIA 5U4NA 2E6AA 1EP1A 3NQAA 3P84A 2DZXA 4RV8A 4Z1CA 5FI8A 1OHLA 4CQ8A 1VYSX 1JQXA 2TYSA 4EF9A 3QFEA 4IX2A 3S42A 3MO7A 1KFCA 1VCVA 5F2LA 2TPSA 1MZHA 1EP3A 5D33A 4MJZA 2B7OA 1D3GA 3UY8A 1EUNA 3W1RA 4MVAA 1TPEA 1LOLA 3C2OA 3GNDA 1JCNA 3NDOA 2GJLA 5DN1A 1MXSA 3GLCA 3W7EA 2YW4A 3CIWA 4UFLA 1YLVA 1YXCA 4EOUA 1GPWA 1JULA 4UTWC 3LCHA 1F74A 1OX5A 1F5ZA 5LNWA 5LGZA 1KA9F 5K4ZA 1W3IA 4QNWA 4WOZA 3AO0A 1UJPA 2Q8ZA 1JRBA 4YCOA 2WKJA 4WY0F 3GXNA 1LYXA 3RLVA 1T99A 1NVMA 3DFNA 3NO5A 4A22A 4JX4A 2GUUA 2JBMA 4UUIA 4IOTA 5F4WA 3BLFA 3T40A 1H7PA 1SQ7A 1GOXA 3P61A 5LNRA 2QDGA 5CPNA 3KX6A 1W3TA 2B7PA 4JTKA 3LTSA 2QCFA 4NNBA 1RD5A 3EXTA 3C2EA 5D37A 5LHEA 1XBYA 1SSDA 1FDZA 3L5AA 5D38A 1WV2A 3LRMA 1H7OA 3BPWA 2E68A 4Y9AA 5I3HA 3KRUA 3RLUA 1EWDA 2NUXA 2E09A 2GJNA 2P1FA 4HPXA 2RDUA 4XTDA 1WXJA 1XBVA 2HTMA 3FJ6A 5FESA 1PCWA 3NPXA 2RDTA 5BOOA 5KZDA 2QCLA 3TV8A 1K7XA 4M19A 2O7QA 2BLEA 1N8FA 1EPXA 5D32A 2QCNA 3NVTA 4MFDA 1G4TA 3O6YX 3GDTA 5GVJA 3NEVA 2C0AA 4TMCA 5AHNA 3GDRA 3BLIA 3KRSA 1FCVA 5FEXA 3CIXA 3LI0A 1F2JA 4NXKA 3UWVA 4DQWA 3PR2A 1OK6A 1OYAA 3W7KA 3O15A 4O14A 1V5XA 3SJ3A 4R7JA 5D2WA 5DBUA 2DZWA 5D30A 4MLJA 1M7PA 3EX3A 3S5ZA 1FY6A 4FNUA 4NZJA 1SO3A 2W6RA 3W76A 2IQTA 3S1UA 3W75A 3N9RA 5HULA 5EBUA 4DXVA 2A85A 4K7VA 1O94A 3JS3A 1VYPX 1UCWA 3KVMA 4ZL1A 3WJXA 4WXYA 1MEWA 3L0NA 1GVQA 3LXBA 1TRIA 3A9IA 3W1QA 2QAFA 4LRTA 4Z1DA 4JX6A 3MHFA 1K8XA 1LLWA 2BXVA 2H6RA 3GZ3A 2D73A 3T44A 5CZTA 3KVKA 4YWIA 2G97A 3QRHA 4TX9A 4WX2A 1G6CA 3WJWA 4U28A 4OWGA 2VKZG 5LNSA 3CC1A 1THFD 4JS3A 3NL2A 2DJLA 3LBMA 3UWUA 1KV8A 4UFHA 3QF0A 3TXVA 1LBFA 4P61A 4LC8A 3TDFA 1QCWA 5AC7A 4C1LA 1B4KA 4O28A 3N2XA 5BRBA 5LSMA 3B0UX 1VRDA 3W7QA 4X3ZA 4AWUA 2ATSA 4POCA 4FX7A 3TK7A 2VELA 3EWWA 3U8GA 1XI3A 2ZRZA 3PBWA 4FNSA 1VYRA 2QUVA 5CPMA 3IIXA 4O54A 3OBKA 1BEUA 2YYTA 3TFCA 3H54A 4DBDA 1QPRA 4WY0A 4KFNA 3O1NA 2YFOA 3LV6A 3BV4A 4WUIA 4HNVA 1TPUA 1VHCA 2CW6A 2C6QA 2PC4A 3N19B 1QMLA 2VXNA 3NL5A 3M5XA 2X1UA 3GR8A 4R33A 4RZ5A 1Z42A 3HG3A 4RX0A 4UFKA 4I9AA 3NAVA 1TMHA 3LXCA 3EX1A 3ANYA 3BK0A 4JTUA 1VCGA 1XXXA 2VEKA 4TO8A 4MYAA 1H63A 1KM0A 2YSWA 2O7SA 1YDVA 3W7GA 1R2SA 5G5IA 3GNNA 1FX6A 1FWTA 2V8ZA 1L6WA 2V5LA 3IGSA 3W7OA 1I2QA 2ZRXA 3LHVA 2PURA 3LHUA 3G8EA 2DZTA 4N9BA 4HNTA 3PG9A 3CWOX 2J24A 2ZYFA 3ELFA 2WO5A 2CLKA 3TIMA 1WOBA 3G1HA 4BR1A 3GIYA 3E96A 2YXGA 2V81A 4JTEA 3R89A 1EP2A 2ZZ5A 4Z1AA 1R30A 4XZ9A 3GR7A 1SPQA 3W73A 3DFSA 1F6KA 1WA3A 4IPJA 4PH6A 3UZJA 3W1AA 1B4EA 2CZEA 3MI3A 3GDKA 3SY5A 5BW6A 3HOJA 5EL1A 4XUGA 4GUGA 2QCCA 3TKFA 1VR6A 3FYPA 3NGJA 4M7SA 3FA5A 3V75A 4GFSA 3VKJA 1EX5A 4IX0A 5AB3A 1WDWA 3MBFA 5CKSA 3LX9A 4ORMA 1IIHA 4E2DA 4TMBA 2NWSA 4WOQA 4NQ1A 2Y62A 4WQ6A 3SZ8A 4ZQRA 3TROA 3IV3A 1DV7A 1OFOA 2ZQ0A 4H6KA 2Y88A 4AF0A 4Y90A 1LRTA 3HQ1A 3TH6A 4O53A 4O57A 4O13A 2NUWA 3DENA 3LRKA 4X9SA 1UUOA 2ZZ2A 3CEUA 3M9YA 4O0KA 4BK9A 3QMSA 3W7PA 1P4CA 2CLMA 1TV5A 2BWGA 1ZFJA 4UIOA 1SZFA 4GJ1A 1GEQA 4CNNA 4HSOA 2E5BA 5FF7A 4HNUA 2V9DA 4LVGA 1IXQA 4GXMA 3G1YA 4TIMA 5D2YA 1YYAA 4JX5A 5E0KA 3BW4A 4IMCA 3W1LA 1ALDA 1XDLA 2C19A 3W2UA 2GVJA 1IF2A 2VOMA 3DFTA 3MI2A 1H5YA 1GJPA 2XN0A 1QWGA 1GYLA 2XN2A 4UTKA 4MKNA 4ZQPA 4BWLA 3EX4A 1R2TA 2J9YA 3SFKA 5HWMA 2YYUA 3QC3A 5D09A 4AH7A 3LHWA 1UASA 4CCEA 3G0XA 1VS1A 3GDMA 3I65A 1KLZA 2EF9A 4QJ1A 4RZ6A 2NV2A 1DORA 1A5BA 1JR1A 3O07A 3PF3A 5DY2A 4DEFA 4NJIA 2FPVA 3IIVA 2WNZA 1KM6A 1WOAA 4GE8A 3PBUA 3T4CA 1PS9A 3NL3A 3DKLA 3G3DA 1I4NA 4QQ3A 2BSLA 1ICSA 1U83A 4XBSA 4Z0SA 3W88A 4U4MA 2V0TA 3WK3A 2W79A 3IIPA 3UWYA 3MYPA 2CLFA 3PVFA 1PHWA 4JD4A 4HPJA 1DJQA 4JICA 4O15A 5FEWA 3BO9A 4CQ9A 3BG5A 2ZCGA 1Q3NA 3WJZA 2B4GA 2CLLA 4RK8A 4O17A 3W23A 1YTEA 3P81A 1B57A 4DO5A 2QCMA 2NX1A 2C14A 3IRDA 4X22A 1I45A 5TQLA 3TNOA 1W5MA 3TE9A 3OIXA 1IIGA 1TV7A 2ZBTA 1W5QA 2Q3OA 1KFEA 4Y8FA 1XL9A 5EYWA 3LTPA 3L68A 1ONRA 3NPVA 5G4EA 3ZFHA 4JTFA 5BNKA 2WQPA 2QCGA 4QNEA 3W2NA 3FIGA 3EWBX 1W37A 3A23A 4AWTA 3LI1A 3NQFA 1W3NA 4JTGA 1MO0A 1XCFA 2JKPA 1TPDA 3RF9A 4DPQA 1JVNA 3JRKA 5FF4A 4YLWA 5KMYA 1P1XA 5I3IA 3HPZA 3LCFA 5DCDA 4NZFA 4ADUA 3BG9A 3EXSA 3KRZA 2QUUA 3PB0A 5D2VA 1P0KA 2G95A 2V2HA 3A5VA 3Q94A 4ZQMA 1RV8A 1G4EA 1WAUA 2JGQA 2V30A 4NVTA 1L2UA 3BW3A 4OU1A 2A2IA 4DELA 4UCGA 1LDCA 4OV4A 4I7WA 3TFXA 2VFHA 4I7VA 4JDBA 3P5YA 3C4UA 1TIMA 1VQTA 2A7NA 4RCXA 3VFLA 5TIMA 2Y7GA 1DQWA 5KTLA 1Q6OA 4QSHA 1K02A 1K7EA 2CLOA 3P80A 5CZSA 3W7DA 3MYOA 5CSRA 3M44A 2ISWA 4LUJA 3EKZA 2OCZA 4GUHA 4XKYA 4IQLA 3TMLA 3QM3A 5KINA 5F4SA 3VE7A 3LTYA 3KHJA 3IIOA 5F1UA 2ABAA 2CZDA 1FXQA 1OFBA 1F76A 2A7RA 1R46A 2WJZA 3T55A 2RHGA 2KZHA 3K30A 1VLWA 2NX9A 1SZEA 3DBPA 4Q33A 3PS7A 1FWSA 1ZY9A 3M16A 1WBJA 1Z44A 2X30A 2TSYA 4FO4A 3KAOA 3GAYA 3P74A 1W54A 4XWUA 3UWWA 2NV1A 4LU0A 2HS8A 1KFKA 3R5EA 4H4IA 3O6DA 2R94A 4ZQNA 1ME7A 4K7YA 3RK8A 3EX6A 3BG3A 4RR4A 1TTPA 2P0OA 4UR7A 5IBXC 4H3DA 3L9CA 1JCJA 1YXDA 2DZSA 3UPWA 4NNAA 3HGSA 5LGXA 2VFEA 1KM1A 3CEPA 4RLIA 1KFBA 1X1OA 4EWND 4YMZA 1WYIA 4JTHA 4WY0B 1Q6RA 1XUZA 1K8YA 2PRLA 4Q32A 3M0ZA 4JYDA 3W70A 4GC4A 3SI9A 3KVLA 2EGZA 1W5PA 4O19A 4UTUA 3THAA 4M7TA 1KFJA 1AL8A 1O5KA 3TC7A 4UNLA 1Q6LA 2ABBA 4FNTA 4Q4KA 3LM7A 3O06A 3NQEA 5D2TA 4UTHA 4DF1A 4O18A 3LCGA 2VEIA 5AYYA 1MEHA 4O8RA 2CLHA 3OVQA 5EPDA 4IMGA 4X2RA 4LVBA 3NQ8A 3L66A 3W1MA 5DY3A 2WPBA 4RZ4A 5DCBA 1OFPA 4QAIA 2ATMA 3UZ5A 1W0MA 4HKPA 3F4WA 5CG7A 4K36A 4DPPA 3W1XA 4QM1A 4JR5A 3EKLA 2VFIA 1G7VA 2VFGA 3ABQA 2OT0A 4AHQA 2OMAA 3LCIA 1TJPA 2YW3A 4MUZA 3UD6A 3LRLA 2XFWA 4HT3A 1Y0EA 1GTEA 1KM4A 5HQEA 1M7OA 5U7SA 5CSSA 5K7JA 1SW3A 5FF2A 1FWRA 3B04A 2C16A 3PUEA 2G96A 2ZZ3A 4HNNA 5D02A 2OJPA 5F2MA 1H7XA 3I68A 2A6LA 2DU2A 4UMCA 1O4UA 3B03A 4PFMA 3YPIA 4K6AA 4NUWA 2GQAA 4XBKA 2GQ9A 3NQMA 4RXGA 5G1TA 4CNPA 5J5RA 4Z08A 3MHGA 5DCEA 3WK1A 2B0MA 3TJLA 3P5ZA 1YPFA 4LRSA 5CZ0A 5AC8A 3THQA 4BWLC 3S9YA 3IVUA 3BARA 1VJIA 1J2WA 3EX2A 3B0PA 3E0IA 4LTSA 4G1KA 1A5CA 3RU6A 4O1AA 3W85A 3E12A 3W3OA 2V2DA 1DKWA 3TSMA 1NAL1 3HG4A 3W84A 1RVGA 2R8WA 1GVRA 1SR9A 1KTBA 4JEQA 1EEPA 4UFMA 1LTDA 2DZUA 1TPC1 1JRCA 1TPH1 1HUVA 3M47A 3UY7A 1O95A 2FQIA 4FNRA 1OYBA 1KBIA 4ADTA 2TMDA 1G4PA 4FXRA 2NX3A 1ZJIA 3A24A 2QJHA 1GVFA 4RKAA 5HWNA 1L6YA 2LLEA 1TYGA 4O50A 5FF3A 1JQVA 3W7RA 3W1UA 4N2YA 1Q45A 5DBTA 2A5HA 2WSQA 3P60A 3CM4A 3I7SA 1AW2A 1TPB1 1KTNA 3SR7A 1K8ZA 1LORA 3MMTA 3LXAA 4JYFA 3HG2A 3UWZA 1G4SA 1NF0A 1AMKA 3CT7A 3G0UA 1K7FA 4DO4A 3QPYA 2J9ZA 4S1FA 2YR1A 4IJBA 3O63A 3WFAA 2Q3RA 2FDSA 4PODA 1W56A 3O6CA 2NUYA 3FKRA 2H90A 2YCEA 3TJXA 5AFDA 1ZHAA 1XBZA 1XDMA 3NQ7A 5K4XA 3QYQA 4RJEA 3FJLA 4JYEA 1TJRA 1OX6A 3TUUA 4AF0B 3LERA 4IMEA 2QCHA 3CPRA 3WJSA 2Z6IA 5AHFA 2ZZ7A 1GWJA 3HPXA 1SO6A 3FEMA 4UC5A 3M1ZA 4NX5A 2HS6A 2F7FA 3Q37A 1VCFA 3W9ZA 1H60A 4W9TA 3M5VA 1W8SA 2I9EA 5E93A 2ZZ4A 3FKKA 1QOQA 1OYCA 2QCDA 1KFLA 1K3UA 2VEMA 1ZALA 5H2ZA 4IXHA 3CWNA 1RR2A 2DZVA 3I7RA 2E5DA 2CWNA 4NX0A 2XN1A 2ZRYA 4N02A 3QMRA 2FPYA 4EVZA 3DZ1A 1LROA 5AHEA 1YDNA 5AHMA 2B7QA 4OE7A 1ZAHA 1PCKA 4K39A 4AVFA 1A5AA 3N9SA 4XTIA 4WZHA 3NXFA 3H55A 3W7LA 3VNDA 1X6UA 2Y7FA 1A50A 3B06A 2H8ZA 5E1QA 1QPOA 2DZPA 4BI7A 1ICQA 4LS0A 4LVFA 3Q58A 5G1YA 2Y7EA 4HN4A 1IXPA 4S2CA 5K9DA 3VCRA 2FB2A 2ZRWA 3DFQA 4BFAA 4PL2A 2Q8LA 3IEBA 2C13A 1SW0A 1SO5A 4MIMA 5EKYA 4A3UA 3P67A 3N3MA 1F05A 3L2IA 1B9BA 3W72A 3A5FA 3C0JA 2UV8G 4P2VA 5D04C 4DBEA
chains in the Genus database with same CATH superfamily
4YL2A 3P8JA 3WLOA 2WVVA 4L6DA 4PUMA 3TR2A 1Z48A 3VGFA 1PV8A 2NQ5A 1G69A 2A79A 4GD0A 2EPHA 1GYNA 3W2JA 2EAWA 1R9YA 2YLLA 4PCPA 6XIAA 3REQA 3ZWSA 1Z41A 1FP9A 2OWXA 1BG9A 2OOGA 4MWAB 4L4LA 3PSVA 2PRMA 5CAHA 3DG3A 2C1HA 4B5SA 3M0YA 4ZXLA 2ACUA 4DJEC 4IT1A 1PZ3A 2E77A 1PEZA 2GGGA 5EGRA 1PVNA 3QXBA 3S1XA 1TWIA 5D4YA 1ZENA 3WL1A 3C2FA 5GNYA 2VFDA 2ODOA 3GNPA 1R9ZA 2GQ8A 1V03A 4R85A 1OABA 4LY4A 2VCAA 2Z1KA 3GK0A 3C6CA 5C55A 4NJHA 3IVTA 4C6CA 2IUZA 2AQWA 5HAOA 4K1WA 4J2PA 4AZ7A 3N6JA 1AUSL 2GPTA 4JFWA 2EPKX 4OV9A 5FEPA 3CPUA 4HQVA 3KLLA 3VGDA 2POZA 4HHPA 4Y96A 2YZ5A 4YXGA 3GXFA 1XM3A 3CU2A 5AYZA 3T78A 3S4TA 5LXXA 3GM8A 2I56A 2YB4A 3F4NA 3W26A 3M41A 4D6IA 2I17A 4R7WA 3SADA 2Y63A 4DN1A 4LW7A 3P2VA 1BKSA 1XKYA 5T26A 4Q22A 3AROA 3NZRA 1BYBA 4K38A 2XIQA 3THCA 1FHVA 2RKXA 2VGGA 2YX0A 1VFLA 3K4DA 3QR1A 5C7HA 2TRSA 3PG8A 4Z2GA 4O12A 3FS2A 1S2UA 1H1NA 1X6NA 1DJZA 1AJZA 1BYAA 5A6SA 3GVWA 3IGXA 1SJAA 1FWFC 3ZVHB 5MHBA 4TQTA 1DHPA 4H9MA 4JN7A 4GFIA 3GTXA 4TXEA 2Y70A 3INPA 3MI6A 1TELA 3RJYA 2ZDRA 5IBXA 2AL2B 4MY9A 1E1FA 3HGRA 3UYCA 4EIVA 1GVSA 1CNVA 3RLHA 1W31A 1OFEA 1BWKA 4LBUA 2HVOA 5XIAA 2QJIA 3FFSA 1X1ZA 4GISA 4A2RA 2XWDA 5HR6A 2J62A 2I9UA 1SJDA 3W74A 4V2XA 5G2WA 4IJCA 3WMLA 4I9MA 1OVDA 4UTJA 4NI8A 3O6AA 1OC6A 3N4EA 3PM6A 4IL0A 1AODA 4OTKA 2SFPA 1TB3A 1X96A 1L9WA 5FOOA 6TIMA 4B92A 2E6FA 2BASA 5CSYA 3ZT6A 3R25A 1QI5A 4M6VA 5FSEC 1KTCA 4RNHA 3EEGA 2ZUNA 4O0QA 2P53A 3WL0A 4E2BA 3STEA 1LBMA 2PWFA 4PL1A 4ZSTA 3MCMA 4YTQA 3AWOA 1XV8A 3PP7A 3T2QA 1KM5A 1QPNA 4Y2WA 2MANA 3TAKA 2YDAA 5BMWA 1CPUA 3CTLA 1TVPA 3QGKC 1F3TA 1HL2A 3IV8A 3PB2A 1ME8A 3G3MA 5IDIA 4Q4OA 1O5RA 1E3XA 3D6NA 3BSGA 1ZSXA 4KETA 1W9XA 3LNMA 4E4UA 4PUEA 2FIQA 3IK2A 3N14A 5LYRA 1JZ4A 4AISA 2NQHA 4H8NA 1UQZA 1BGGA 1V3MA 3B9EA 1YHTA 5L6UA 1NF7A 7ODCA 4US6A 2Y85A 4P8UA 3HN3A 3PZNA 1PPIA 4LWWA 3KLKA 1DIDA 4GBDA 3B8SA 1R0MA 1HP4A 3KZPA 2WKGA 1XLEA 5C7VA 5F4XA 3VIHA 1ML1A 1XR2A 3TQKA 2Y61A 3NQVA 3WF0A 1TA3A 4YWSA 1XFBA 2C18A 2RH9A 1CEOA 1V6UA 4YN5A 1V0MA 1SFSA 3NIYA 1EZ2A 4CCDA 4LF2A 1KB3A 4NASA 2OFJA 2QUMA 2WNWA 4QLJA 3OGSA 1U5JA 4R53A 3U7VA 3N2CA 3QGVA 5LZLA 4M6QA 3DI0A 3OZMA 5D9PA 2QCEA 4OBRA 3V3WA 1FBAA 2Z26A 3L0KA 1ZLPA 4LS1A 1P7TA 1W9VA 3CUFA 1XX1A 3KCJA 3SCNA 4ZQOA 5HINA 3USZA 1E51A 5BYWA 4X61A 2D69A 3QEZA 4N6EA 1LOQA 1FWBC 3EOEA 2VO5A 4HU8A 5CCZA 4A3RA 4LY8A 4C6EA 1JJKA 3CZLA 3O7UA 1R85A 1QPQA 1LQ0A 1D8CA 4KS0A 3KP1A 4N4PA 2BGNE 4DUVA 3NPWA 4UFIA 3W02A 2V69A 2Z7GA 4CLMA 2Y2WA 1QU4A 2QJGA 2DVXA 4GJIA 3IS4A 1QNRA 4UZSA 2OT1A 1RP8A 2DW7A 4P8XA 3BLEA 4K3ZA 3C3NA 5H8MA 1HJWA 3G1SA 5BU6A 4YTTA 1Q6EA 3W7IA 1NWRA 5DELA 3NYDA 4S2BA 4GZ7A 4ENLA 4L65A 5I6SA 1EHAA 4AX7A 4DYKA 2GQ3A 4KIEA 3UPBA 1GQKA 3FVMA 3IVSA 3ZJKA 2PLMA 3LDVA 2BTMA 1B5TA 3TTSA 1D3CA 4XVEA 5BXRA 1J9YA 4MAZA 4AWEA 2H3BA 3AAMA 1UD5A 5M17A 3TZNA 5CJ5A 3QN3A 4AVOA 3E0WA 1ZNNA 3HIJA 2H9AB 4REQB 4WJEA 1HZYA 4BEUA 3TJ4A 3CHVA 3SRKA 2ZTKA 4NRRA 2WSKA 3S1VA 1E15A 1H1YA 3N15A 1S5MA 1Y7VA 1X7FA 3MT1A 1EA0A 1UKQA 3TN3A 3LS9A 4LNYA 3SDOA 2QMKA 3G18A 2J6VA 4JN6A 4YPJA 3G1RA 3B8VA 3F4VA 3GDLA 4XO7A 1R86A 3AHTA 4ZR8A 1E4IA 3WLNA 1L8PA 4FR1A 4CNSA 3L0GA 2FGLA 1B3YA 1CW2A 2MNRA 4F66A 4HPGA 5HNUA 6ALDA 5CXPA 2WV8A 5DXYA 2W62A 1C9DA 5BROA 3PZOA 4J3UA 4PUNA 4IPPA 2IKGA 1XLCA 3T8LA 4LAUA 1BVZA 2ACRA 4FALA 4MYXA 4GUIA 3F5JA 3GBDA 4D8ZA 2QKFA 4ORIA 4ZXOA 1YX1A 2UBPC 4FLOA 1V0KA 4QDPA 1UBSA 4AU0A 4BQ2A 4HHMA 2JKEA 3S8HA 3DKJA 4W87A 3WG6A 1GZ1A 3M0IA 4JQ1A 4L5ZA 2X1SA 3CQJA 2VC6A 4C6LA 2G3FA 3DFOA 3GFYA 1TR1A 4S38A 1LOSA 3ECQA 1PKYA 1JZ3A 2W27A 1S5VA 4PCFA 1LZOA 3O8AA 2XFYA 4XZHA 1LQ2A 5E9AA 1JI1A 2Y7DA 3L4VA 2OLHA 2DIJA 1MW2A 4JTDA 3OEXA 4HSNA 1IEQA 1E9YB 3WNKA 3PTMA 3HJZA 4GABA 1S3HA 1D8WA 1E9IA 3LCWA 4W7UA 5C9ZA 3PWGA 1KXTA 1XC4A 2YFNA 3G6LA 4MLRA 1PWLA 3VOGA 4ZQCA 3TCSA 2GWGA 2WMIB 2AQVA 4E3VA 3QOMA 4F0KA 1YADA 4OOUA 3DHUA 3NZPA 3VGBA 3ONBA 3TYDA 3D5HA 2XIOA 1PZ0A 4EAYA 3KL0A 3Q45A 3NQ2A 4LH8A 2VI0A 4O1CA 1DP0A 4PB3A 4J7RA 3AALA 4H8UA 1TO3A 5FJJA 5A1AA 4O4VA 5LNVA 3PAJA 1CB7B 1VLIA 3BAKA 1IGWA 2L5HA 3NOYA 5CC3A 2YCLA 3MB9A 1XYBA 4XIAA 3GH4A 3R12A 4QXIA 3RO6A 3N9KA 1XC6A 3GB6A 2CERA 4PB5A 3KOXA 3N25A 4HJWA 4Q8PA 3CIVA 2DT1A 3NPUA 3WDIA 5JBEA 1UOZA 3HTWA 1P1MA 2OEMA 1TSIA 1SFJA 3TC3A 2ZZ6A 5C2XA 2Y6ZA 2A3BA 3V0TA 4AUBA 2GVEA 1S2AA 4IPIA 2OO6A 4XZLX 6REQB 3L21A 4UTTC 1IXNA 4UZUA 4G7EB 4H19A 4B15A 4LYKA 4JTJA 2X16A 3R2GA 1R38A 2IKHA 1RBAA 3F5LA 1EQPA 5K9XA 3N34A 3LV5A 3CLMA 5K3VA 2J7BA 4GKLA 4AHPA 3BLDA 1IXOA 3P82A 2GDVA 4LUSB 1FHLA 1PYFA 2JQXA 1DJGA 1KLYA 4KWSA 1OIFA 5CGTA 4H2CA 3ZS4A 1XYLA 3R8HA 5FAJA 2E6AA 4F79A 3RJXA 1VD6A 4CQ8A 1VYSX 1JQXA 2TYSA 1XLAA 4XD3A 4IX2A 3MO7A 1VCVA 1V08A 5I09A 1BAGA 3B9AA 4YVXA 4MJZA 2B7OA 1D3GA 3W1RA 1IEWA 3ARPA 1LOLA 3NDOA 2HEJA 4XVDA 2D2GA 3N6QA 3GLCA 5ABFB 2YW4A 3CIWA 1F74A 1F5ZA 5LNWA 3KOWA 5DT7A 4Q4SA 4PSPA 4IIHA 3GH5A 4WSHA 1JRBA 1OINA 3LM3A 1X38A 2WKJA 3RN6A 3RLVA 1T99A 2WZMA 1NVMA 3NZQA 4H7CA 3VKCA 4YVVA 5A6KA 1QPKA 3CQHA 5KETA 2GJPA 3P61A 2J7FA 2O4QA 4TUFA 2WMGA 3LPOA 1QK0A 4JTKA 2WZTA 3CYJA 1RD5A 4J1OA 1SSDA 5D38A 3R8GA 1WV2A 1XISA 2E68A 1JEZA 1S1PA 5I3HA 4PYSA 1TG7A 1IWPA 3VNIA 1E0WA 1XWYA 4PTMA 4QE1A 3A47A 4HPXA 2RDUA 3KRBA 1P7TB 4DUOA 4DM2A 2XSAA 2QCLA 1ZZMA 2BLEA 4RZBA 3VIGA 2O0TA 5B80A 1G4TA 3S2JA 4X0VA 3RAOA 5GVJA 3NEVA 2C0AA 1GQLA 1RY8A 3KRSA 4IH3A 3WLTA 1FCVA 5FEXA 1NTHA 3RCMA 1OYAA 3W7KA 3O15A 3WUEA 3VILA 2V68A 2DZWA 1J0HA 1MW1A 5HBFA 2WYSA 4DXXA 3NO3A 4IISA 4NZJA 3W01A 2W6RA 1RALA 2IQTA 2IKJA 1QHOA 1TKKA 3GH7A 1JCTA 4Z2LA 4DXVA 1BD0A 1CLKA 1XH0A 1A0EA 1O94A 1XIMA 2ZUUA 4FS9A 1IYXA 1UCWA 1EEXA 4L56A 4V1XA 2PD5A 1HVXA 1BPLB 1NWTA 3LXBA 3AHXA 1TRIA 3UESA 1BLIA 5ECUA 3TTOA 1KC7A 3K8KA 1LLWA 2BP1A 4IFKA 3KVKA 4YWIA 2G4FA 5DO8A 2OYKA 1G6CA 4MWAC 3BAYA 4JS3A 4CNUA 5BZAA 2X0YA 1NU5A 2ZUMA 1PKNA 1KV8A 4UFHA 3TXVA 4LC8A 3WDPP 5KZ6A 1PTAA 1FWEC 1QCWA 4C1LA 4GO9A 3N2XA 2Z29A 1VRDA 4B3LA 4X3ZA 5E70A 2QW5A 2VZVA 2ATSA 1XG3A 4FX7A 3V36A 3EWWA 3PBWA 5DMNA 2QUVA 2XIIA 3N18A 1X98A 5BXSA 1G9HA 3H54A 4LBRA 1TR9A 3EPOA 1HJXA 1T40A 3DG7A 1B3WA 4GI4A 4KFNA 3C86A 4DBUA 1TPUA 2C6QA 1QTWA 3L4YA 2VXNA 3M5XA 3GR8A 4RZ5A 2QDEA 3S2LA 3ITCA 4RX0A 1J12A 4I9AA 3NAVA 3LXCA 3LEPA 3CZKA 3EX1A 3BJSA 1XXXA 2PLCA 2VEKA 5FL1A 1KM0A 3ZLHA 3EDFA 1MUWA 3QY6A 4AX6A 3GVVA 4GIAA 1FWTA 4ZB0A 2V5LA 3W7OA 2J7GA 1HNYA 3QLDA 3T42A 3CQKA 2QPUA 3ELFA 3K13A 2HBXA 3B8UA 3E96A 4JIIX 2ZZ5A 1UP2A 2ANUA 4XZ9A 4FMVA 1WA3A 2GGIA 2YDQA 7XIMA 4R5EA 3UGVA 3SN0A 3UZJA 3OZYA 2UY2A 5D9NA 3VABA 3OW1A 1K77A 1GJWA 4CU6A 5BXPA 3FYPA 3A4XA 5AB3A 1WDWA 8RUCA 3AQUA 3NSXA 3SCSA 3CO4A 4TMBA 4XUYA 2WKLA 4WQ6A 5I03A 4B2DA 2J25A 2P8BA 4PUDA 3P0XA 2QJNA 5FSDC 3AC0A 2ZQ0A 4Y90A 1LRTA 3HQ1A 4HCDA 2NUWA 4OKDA 4HOZA 3HJEA 5BRQA 3DENA 3WDJA 1RBOB 1LL4A 2JIEA 4X9SA 4S3EA 2J4GA 2OSXA 1MXGA 2VMFA 4BK9A 3QMSA 3GW0A 2CLMA 4UIOA 2BWGA 2DFAA 7CGTA 5FACA 3AYVA 4GJ1A 5ABFA 4CNNA 4HNUA 1AMYA 4LVGA 4KT2A 3W1LA 4GO8A 1ALDA 1XDLA 4D8LA 5C2CA 3AZRA 4LAZA 3VCNA 1XLJA 1OG6A 1O12A 1ISVA 2NQJA 3UZZA 3A64A 2WAGA 1U5HA 4ZQPA 2F61A 4XZNX 3EX4A 3HURA 2YYUA 3VK5A 1WE5A 1JYWA 4AEFA 3FXGA 4EWJA 1KLZA 2EF9A 4QJ1A 1B90A 1A5BA 4QLLA 3QTPA 4DB7A 3IIVA 5A69A 4FP1A 1Q4WA 2X1IA 1CWYA 3KBMA 1MDRA 3T4CA 5FCZA 2QS8A 3MTWA 1Y5WA 3QPEA 2ALRA 1E3ZA 3G3DA 1V77A 3VDGA 5D9MA 2AMXA 3ES7A 3QV8A 3W88A 2QPSA 4U4MA 4ZENA 4A8LA 3ZMRA 4Z2IA 3KE0A 3LUTA 3M4HA 1OWQA 4CD5A 3GS6A 1PHWA 3I6EA 1DJQA 2CYGA 3VKDA 5FEWA 1KGUA 4PUUA 3BZJA 2P50A 1VBUA 1Q3NA 2YBUA 2GLKA 3ZLFA 3SUUA 4ACZB 1OEPA 3P81A 2NX1A 2XH4A 1I45A 2FMOA 3V35A 3TE9A 2W91A 4BQ3A 4KEUA 3GXIA 4W84A 3TA9A 4XD4A 4GIEA 1KFEA 1NM9A 1ZBKA 1XL9A 5EFFA 1P6BA 3FSTA 4P7OA 3WO8A 1XSIA 3H2CA 1J11A 3EWBX 2P3ZA 2HJPA 3GXDA 4Q8WA 3KWXA 3CUGA 3NQFA 1ADSA 2TODA 3IWPA 1FHDA 4RDVA 4J3SA 5KMYA 1JD7A 3SM0A 1QHZA 4A6GA 3ORWA 3NSMA 3EXSA 3URQA 4Q8MA 1BSIA 3LY0A 4HA3A 1JDCA 4A3YA 3KBVA 1P0KA 4Y8EA 5A2BA 1E1CA 4ZQMA 1RV8A 2J7CA 2JGQA 4NVTA 4AZIA 5B7YA 2PP0A 4Q4PA 4I7VA 3W24A 4OZOA 4EPDC 3P5YA 4GIYA 2IQDA 5AECA 4JFUA 1FWHC 4H41A 3JZEA 1DQWA 3E1F1 3H4GA 5IFTA 2HZGA 3EDJA 1Z7AA 4N7QA 1UYQA 4PMRA 3NDZA 4WR3A 3RCYA 3GU1A 5F1UA 3TLLA 2ABAA 2CZDA 1TCMA 1EJRC 2A7RA 2JE8A 3UEQA 3MJMA 1R9XA 2RHGA 1K70A 3K30A 4V15A 1VLWA 1KBKA 2NX9A 1ZY9A 4L4PA 1OT1A 1SJCA 4JN8A 1LG1A 2X30A 4EE9A 2XM1A 3WF3A 5EMYA 4XG1A 1F3WA 3UWWA 4LU0A 3HA1A 2ACQA 4H4IA 3CAQA 3O6DA 3HFYA 1ME7A 3RK8A 3AWNA 3VD4A 4XD6A 2DH3A 2BOFX 3HGSA 1A49A 2VFEA 2YL5A 3CEPA 4QCEA 4PZVA 3PN8A 4YMZA 2ZOXA 1WYIA 1Q6RA 1J0JA 1ITUA 1K8YA 4UR9A 3M0ZA 4GC4A 2EPOA 3QY7A 4MNJA 3KVLA 2EGZA 3QR0A 2FZ9A 4Z2JA 1AL8A 2BB0A 4UNLA 1Q6LA 1UR0A 2QYGA 3VMNA 1W3HA 3ZVHA 5HATA 3LM7A 3GQYA 3O06A 4WSJA 1XP3A 4KRUA 4UTHA 1NQ6A 2WHJA 3FJNA 2P8CA 2VEIA 2CLHA 1H2JA 1E6SM 1IEVA 1V6YA 4KMQA 5EPDA 3IJIA 4MB4A 4X2RA 4I8YA 5DEZA 1X8CA 5DCBA 1TFVA 4CQCA 4QAIA 2D0HA 1M3UA 4S3GA 4HKPA 5CG7A 2HXTA 1EJSC 1IEXA 3GSMA 3K2GA 4K36A 4QM1A 3R0KA 3WFZA 1JDDA 3H7UA 4Z1YA 4AHQA 1JNDA 1ZPTA 2DT0A 3TEVA 3LCIA 1TJPA 2PGFA 1CXFA 5CBIA 4MUZA 1ENUA 2XFWA 2WWCA 3CV6A 1GTEA 1X1NA 3TTYA 1EYWA 1LL7A 4GCXA 1U5VA 2C16A 2WCAA 1XYAA 2ZZ3A 4HNNA 2WC7A 3I68A 5M3WA 2DU2A 4UMCA 1O4UA 2FGZA 3YPIA 4K6AA 3A3XA 4GH1A 3SCWA 4XBKA 5G1MA 2GQ9A 4GVIA 3WBAA 1BQCA 4AD1A 2D1ZA 1NJJA 1WCGA 1OD8A 1OB0A 4B5XA 3AMDA 5CZ0A 4XX6A 3G5EA 4B90A 1E70M 3IVUA 4IF2A 3BARA 3RU6A 3E12A 4BY3A 2BG5A 3HG4A 3W84A 1W9PA 4LNCA 1R8LA 4JEQA 1K8CA 1TE1A 1TZ7A 1HUVA 3CLWA 3UY7A 1O95A 2FQIA 4CN4A 5EMJA 1H4PA 1OYBA 2Z1SA 1KBIA 4ADTA 2TMDA 3S9ZA 4YVPA 1BF6A 2QGHA 1MW0A 3CJPA 2NX3A 3A24A 2R1PA 4H8VA 2BXZA 4RKAA 1RJPA 4FLSA 1JYVA 4HGXA 3AFBA 3EKGA 4QX4A 1ZB5A 3TW9A 2WSQA 4ERAA 4MNLA 3FA4A 1TPB1 3R0UA 1K8ZA 2OZ3A 3MMTA 3PAOA 1A3HA 3EA3A 3WCZA 2PZ0A 4ACZA 2VGIA 3GC5A 2OB3A 3HG2A 1BG4A 3H2NA 3G0UA 2VZSA 4INFA 2ONEA 2IPFA 4DO4A 2YJQA 2J9ZA 2HVNA 4C6NA 4M80A 3WD2A 4IJBA 1NP0A 1CYGA 2XHYA 4UWMA 2VEGA 2ZKMX 3B9DA 3ME3A 4GQGA 2A3HA 1YDYA 1XCWA 2H90A 4AC7C 4TVUA 1OX6A 4AIUA 4BEQA 4NAEB 2Z6IA 4HHHA 4MWAD 3EBVA 2ZZ7A 1GWJA 3T6CA 4ZOCA 4NX5A 1H3GA 3Q37A 3OQEA 3UR7A 1VCFA 4PCTA 1K6AA 3POHA 2FZ8A 1QOQA 1OYCA 1KFLA 2FZBA 2VEMA 2GL5A 1ZALA 4IXHA 3GRIA 4DJDC 2DZVA 2E5DA 3T4WA 4IJRA 2J77A 1VKFA 3N6HA 4NX0A 4E4FA 1JI2A 3FHQA 3FDGA 2FPYA 2J79A 2C79A 5AHMA 1ZAHA 3N29A 1LWJA 3A4AA 5GNXA 4AVFA 1A5AA 3NXFA 3H55A 4MNMA 1X6UA 4JCLA 1RA5A 4HP5A 4GI8A 3AYTA 2DZPA 3MSRA 3FAWA 4LS0A 2J7EA 4HN4A 1IXPA 1JFXA 1S46A 1EDTA 4IPLA 2FB2A 2VYOA 1KBLA 1B9ZA 1U1UA 4DJED 3CL8A 4DNHA 2XINA 1UH2A 2C13A 2Z7KA 2NVAA 1F05A 1KGXA 4KGJA 2VR5A 3A5FA 2UV8G 4LUTA 4BF7A 5I3GA 4IUOA 4BKNA 2IPJA 2VUYA 3LPPA 5J04A 1HKMA 2PU1A 4JFVA 3QW3A 3F2DA 5I3JA 3KXQA 2WZHA 4H01A 4B5NA 3CHFA 5M5DA 2FFCA 3AJXA 2PWHA 5EMKA 4B5WA 7REQA 2DW6A 1H11A 3FYYA 1J4EA 3G24A 1EXBA 2QF7A 4ZOBA 1AQFA 3LHYA 1SGJA 3ITYA 5C0QA 3WY1A 7TIMA 2ASHA 4KKXA 1EBGA 2E67A 4UFJA 3LSCA 3RPTA 1I2RA 3NZ1A 3WQDA 2WZIA 2G3IA 3S6DA 1FFRA 1DWIM 5C9WA 2C0HA 1VPXA 2XVLA 5G4WA 4EKJA 1XG4A 1HO4A 1UD8A 5SWUA 3LLDA 2F38A 3VAVA 3NYZA 1PHQA 2J8FA 3G1FA 3G0SA 2FTYA 1GVIA 3PZQA 3FK4A 1FCBA 3AJ7A 3NM3A 4UQEA 4G56A 3PSWA 3BJFA 1E5NA 4RNIA 3TONA 2WNQA 5CGQA 3GX9A 3OGVA 4JNYA 1P5BA 5A6BA 1ITXA 3SSZA 4B5VA 4O10A 2FTPA 2VFFA 3A22A 2PDLA 5E09A 5HNNA 1DL3A 3THUA 2OGYA 3AMLA 2DDXA 3W83A 2CU0A 1NEYA 2PWGA 1KV5A 1S5NA 1CGYA 3WQOA 1UWQA 2CBIA 1QO5A 2D24A 5I02A 1YDOA 2VQTA 1TX0A 1YTDA 1OD0A 3C56A 1MYRA 3ARTA 1EGMA 2CLEA 3AIEA 1J93A 4E6MA 2FVKA 3STCA 1OF8A 3VXGA 3AIUA 5KSWA 5BCAA 3MKKA 4IIGA 2JFEX 2V5CA 2VZOA 3MHUA 1DJNA 4WXZA 2ZZ1A 1LRNA 2WBGA 4PMDA 1TCDA 2CZ5A 5CC5A 1TTIA 4Q4QA 3MY9A 4XAGA 1VIWA 1M9HA 1F4HA 1GT8A 4WDWA 4AC1X 1K03A 5IM51 1FFQA 3SSJA 4DAFA 4LYRA 4CCCA 4N9CA 2G5WA 4JNMA 2YL9A 1O5XA 4GA8A 1FDYA 5I00A 3G8RA 4IUGA 1SFLA 2PDGA 3W22A 4DJFD 4D2JA 3T05A 9RUBA 2Q09A 1FCQA 2V5KA 3PFMA 4KFPA 2YDRA 1M6JA 4DF0A 2VR4A 1EDGA 5JBFA 4MSSA 1HL9A 2ZTJA 2CFFA 4UR8A 1RQBA 2JF6A 4FLQA 1QDSA 2RGMA 3W1TA 4S3KA 5JBDA 4FNPA 4PTVA 4AFYA 1YIXA 3HGJA 1Z3NA 4GNVA 1AG1O 2ZRUA 3A6OA 4TTGA 3EWDA 1Z32X 1M01A 5BU9A 4AZBA 3DYOA 2C1IA 2VEPA 1A3XA 2UZ9A 3CUJA 3SGZA 3STFA 4N4QA 3KBWA 3MSYA 3WUGA 4B5UA 4GZJA 4OBTA 4E0CA 2Z27A 3CH9A 1L6FA 4F2TA 1XGEA 4OHQA 1F3XA 4P8WA 2J8GA 3EWZA 1OFQA 3R43A 4U5KA 4HA0A 5LIWX 3U5UA 3GNXA 1Q66A 3MU7A 3RFAA 4W5ZA 3UQNA 1DQUA 3PUDA 3VD3A 3L4XA 3JW7A 1G67A 3ZJ8A 7ENLA 3H23A 2QJMA 1A0DA 3VZYA 3UNDA 4JXCA 5KZMA 3G1DA 1NY1A 2NXIA 4M5PA 3BCFA 4EAMA 2OR2A 3KBJA 1XHGA 3MCOA 3A13A 1CBGA 3PC0A 1PZ2A 2YB1A 1UR4A 4CN6A 3BGJA 3TA6A 2A3CA 2IMRA 1XPYA 4HZMA 4LANA 3JUGA 3UJSA 4PRTA 3LGEA 4PE8A 2ZXDA 4C6KA 1FH7A 2WW5A 5AHLA 1RCOB 4W4QA 2V2CA 2WVUA 3R8RA 1UP0A 1KXHA 1W1A1 3LHTA 4N9EA 3ENLA 3GNOA 5AY7A 1FKWA 2AKZA 2VWSA 3WBWA 4O1FA 1TQJA 4BS0A 3B4UA 3V1PA 4M51A 4J3XA 5HPOA 3F1QA 4RDYA 4O0ZA 1VHNA 3EB3A 4AWSA 2F9RA 3VOIA 1JZ5A 3TSBA 3O05A 3ZQ9A 5TBOA 1H0GA 3B0YA 3CB8A 4C1KA 4D9PA 1Q6QA 1XIJA 3P93A 4LF1A 1HKWA 4A21A 1FHUA 2EHHA 4NNCA 5DMLA 2YCJA 3GUGA 5J5DA 5EA9A 2X09A 2UWFA 4B2DD 3NM1A 2VGBA 2FKPA 4IG2A 3CV7A 3EDDA 3NOEA 2V3GA 3KTSA 4ZO6A 5AVHA 4C5ZA 1PL9A 5XINA 3TAOA 4IMDA 4KEZA 4YHEA 2QT3A 3BAJA 1GVOA 3ISIX 3FGCB 5A6AA 2PCEA 3H70A 5EFDA 1MVYA 4J5NA 4WJXA 4O1BA 5D8ZA 1WBHA 3REQB 5F2IA 3RRAA 3TVAA 4RW3A 1RQEA 2ADAA 3W6YA 1QI2A 1I2OA 2WNNA 4NAEA 4AXKA 4OGZA 5EMUA 4BI5A 2WLYA 1EDQA 4MZ1A 4YCPA 1ONXA 2D2OA 3FNDA 1L8NA 3PUOA 2GDQA 3B8IA 5H8PA 1D7FA 1H50A 4ICNA 3GHSA 4JTLA 4QE4A 2BHUA 1IQ8A 4F0HA 1I2NA 1J0KA 4O1EA 3PZ9A 4GUJA 4NU7A 4KWVA 1KO0A 4LT9A 3SUSA 4R27A 1G1YA 4ATWA 2PWVA 2BXYA 8CGTA 5FJRA 1RSCA 2DT2A 3H2MA 3MP4A 4E4PA 2IPWA 1K6WA 1WQ5A 2YZRA 1QO2A 3SUWA 4HK7A 1JGIA 3H26A 1E0VA 4U2ZA 4ZMGA 3U6WA 3CUIA 3JZUA 4V28A 2GUBA 4MY1A 1ZP4A 2G41A 4N9DA 1SZGA 1I2PA 3KEHA 1JPIA 3JVAA 4ZE5A 2VM8A 4A05A 1V79A 4FIQA 1Q63A 2QEZA 4OUEA 4QAWA 4AMAA 3ZT5A 4DWDA 4G7FA 4FX8A 3RILA 3SGUA 1VGAA 4UMBA 3SCRA 3ZWTA 1EO5A 1M65A 6XIMA 2DQXA 3DI1A 2GYIA 3BANA 2JEQA 1IWAA 1T96A 4MAVA 3TLQA 3KBNA 1NFBA 3LCXA 4FHAA 4GBUA 5HWJA 3LMYA 1KBJA 1SSGA 2NT0A 4J3ZA 3KW3A 3CUZA 3CT2A 4O1DA 1F6YA 2ZA3A 2JGYA 1RY0A 3DH7A 1VC4A 1PO9A 2AGTA 4MWAE 1BVNP 1EXPA 1FWIC 3EWUA 2XWEA 1S1RA 2Z2BA 3W7MA 2DORA 4JIQA 1OGBA 3IARA 4LV4A 4OECA 4HD5A 5I7GA 1UH4A 3W1NA 1SUXA 1OGSA 3ATZA 1GG1A 3KP0A 4WHBA 1OJXA 1V7AA 2YA0A 2XFFA 4QG6A 1XLIA 2ZRVA 3GVQA 1SU5A 3GG1A 1RXOB 3ABOA 2R91A 4Z1BA 1XLLA 3CZGA 1JCLA 2O4MA 1NWSA 1GG0A 1VAHA 1H7WA 1R3TA 3GVRA 3OA3A 3S2NA 3RM8A 4JL2A 2I16A 1K9DA 2NW0A 3RX3A 3WF4A 3AU6A 1RAKA 1XGDA 3O2LA 4KRTA 1UWTA 4XZBA 3E02A 3DU0A 3S5NA 1S2VA 4H9VA 5FAGA 3SCOA 1NOUA 1J0YA 1Q7ZA 2VUNA 3MWAA 5LKYA 5D03A 3RR1A 1W17A 3QGAC 5FEZA 2XJ7A 3EB4A 1EC7A 4ONVA 4O52A 5K9CA 1O60A 1ISZA 5REQA 2AAAA 3VE9A 4HCLA 3ZM8A 1GYMA 1YXYA 1XRVA 4XO6A 1XH1A 2C15A 1LBLA 1VFMA 5HPCA 4KRZA 3BSHA 2YCKX 2YBVA 3TTEA 3UNTA 3N2MA 5EMLA 3LHZA 1KKRA 3VOFA 3SGGA 2EQDA 4W8BA 1QBAA 2X41A 3N73A 4RV3A 4F0SA 3GU9A 1H51A 4BI6A 3ITOA 2ZICA 4DZ5A 3NNTA 4OQVA 3SBFA 3AIWA 2PTZA 4AQLA 1FUYA 1E4MM 1VFTA 3QV7A 1R3YA 2R14A 1BTMA 1C8VA 2NQZA 5A8GA 3EOOA 1Q65A 4CNOA 3SCQA 4GGHA 4PULA 1A5MC 2QPXA 2A7PA 1FCUA 2WMKA 1HVQA 2Z24A 3WQWA 2ZFAA 3P7YA 1LUCB 2BY2A 1H62A 3TQ0A 4ROQA 3V5OA 1TPVA 9CGTA 1QAPA 3VZXA 3MZ2A 1V0NA 4WKFA 2B31A 3UJEA 4FOKA 3LBCA 1XSJA 4PC8A 3TQVA 1T0OA 4UTTA 1LM1A 3W2LA 2XZ9A 4NZ5A 3O0FA 3SB0A 3B40A 1UZ4A 3EDKA 3SN4A 1SM9A 4A2SA 4HMCA 3L7RA 3RDKA 3OLDA 2XVPA 3DXIA 3OBAA 2AGKA 3N2BA 5E0FA 1YTKA 7TAAA 1VH7A 1OX4B 2DP3A 4EPEC 4HK6A 3LG3A 2FZNA 3S5YA 2ZA2A 2YBTA 1PTGA 1EX1A 4X0NA 1Q6DA 4LUYA 2XSXA 3BXWA 3URAA 2XGZA 1OG0A 4J40A 3L65A 3U9IA 1Y8BA 1FH8A 4D6JA 3DIPA 4U3CA 3WK0A 1PIFA 1A53A 3U5YA 4L61A 6PTDA 2FJKA 1UD6A 1REQB 3S5OA 4UTIA 4LB4A 1YMYA 4YJ5A 4CVWA 2DZXA 4HOXA 5LIKX 2NQLA 5A6LA 1OHLA 4AY8A 1C7TA 1RCXB 1LLOA 4I3GA 5FJUA 4EF9A 3M0XA 1XIIA 3S42A 4H6EA 2RUSA 3H4WA 2XSBA 3RU8X 1MZHA 2DPEA 4F2BA 1EUNA 4JNZA 1TPEA 5TF0A 2BVWA 3TTQA 2GJLA 3TYUA 2GK1A 3VD9A 2AKMA 1AVAA 1W1PA 4UFLA 1YLVA 3ZIZA 1GPWA 1JULA 2PS2A 4KEMA 4KH2A 3BLPX 1MNZA 5LGZA 1V3HA 4PMYA 4QNWA 2I5IA 3LQLA 4G6CA 4YCOA 1I6NA 1LYXA 2OQYA 3GXNA 5D9OA 3EAUA 4PTXA 4ZCWA 4DAIA 2J13A 2JBMA 1RVKA 4UUIA 5CLWA 4BHYA 4WGHA 3I4KA 3BLFA 1MW3A 3T40A 4UQDA 1GOXA 2QDGA 4NYYA 5CPNA 3KX6A 2B7PA 4ZB2A 1WKDA 3W00A 3MMWA 1KGWA 5D37A 1OY0A 1XBYA 3L5AA 2GDUA 3KOYA 3LRMA 1H7OA 1PJ9A 3BMVA 4Y9AA 3MMUA 3KRUA 3RLUA 3W38A 4ZFMA 3VD7A 3SCUA 2E09A 2GJNA 3G2GA 2G0WA 3WEZA 4XTDA 1XBVA 2HTMA 3WQGA 3FJ6A 1UKOA 1PCWA 3V0UA 1B31A 3NPXA 5FESA 5FKYA 4E2OA 3TV8A 2CEQA 2C71A 4M19A 2DUZA 2X0HA 4B4HA 4F9JA 1WP6A 3R10A 5HMEA 3O6YX 4L7ZA 4L9YA 3WSUA 4TMCA 4AD3A 1G0CA 2WJEA 3GDRA 5AKQA 1H49A 1YE4A 3QHMA 4DQWA 1PAMA 1OK6A 2VT0A 4O14A 3OVGA 4PBEA 5DBUA 3VDAA 5D30A 1F3EA 5A2AA 3GTFA 3EX3A 3PBGA 3AXHA 3BUVA 3PTKA 4MGGA 2R82A 3W75A 3N9RA 1FKXA 4UB9A 3TYEA 1T5AA 4R88A 3SRDA 2QIIA 1NP2A 3CMGA 2XM2A 3KVMA 4DBWA 3WJXA 2FYMA 4JOMA 4DVOA 3L0NA 3H2FA 1QATA 3KOZA 3MHFA 1K8XA 3GZ3A 4C1NB 2ZE0A 2Z28A 3M0HA 1R3RA 3EYPA 1K1DA 2PTDA 3E6EA 3WJWA 1JZ8A 1C3FA 1J6PA 2VKZG 3CC1A 3NL2A 2DJLA 1HW6A 3B9NA 4GVFA 1KCKA 3LBMA 3UWUA 3OBEA 4HTBA 3QF0A 1LBFA 4P61A 3TDFA 4NRSA 1BWVA 4IFOA 3SJNA 3URBA 1I75A 1JFHA 4POCA 4OBSA 2VZTA 3TK7A 2G8ZA 3ABZA 3T1GA 4JBRA 4JTCA 1J18A 3U8GA 1W1YA 1VYRA 2DZAA 4AEEA 1PBGA 3IIXA 4O54A 1HQTA 1ZU8A 1BEUA 1XQLA 4L1WA 3TFCA 5T91A 1QPRA 1OGGA 1CXKA 5LIYX 4Q8TA 3O1NA 4QP0A 3LV6A 4WUIA 4L9ZA 1F8MA 1PDYA 2G3NA 2X1UA 4UFKA 2GSJA 3WLRA 5DMMA 4JTUA 1VCGA 2FZDA 4MYAA 1B0IA 2VWTA 1HP5A 1E1EA 1YDVA 3W7GA 1M04A 2WSPA 5G5IA 1T7LA 4CEUC 2WB5A 3GNNA 1FX6A 2J66A 3PBMA 3PJTA 3H7RA 4AY1A 1JZ6A 3G8EA 2DZTA 4HNTA 1DE6A 4DLFA 1R6WA 2ZYFA 2WO5A 3LZ5A 4UNIA 3G1HA 4D1IA 2O92A 4PMQA 4Q7BA 4JTEA 3R89A 1EP2A 3WMSA 1JPHA 4DZAA 3DFSA 1F6KA 4PB4A 4IPJA 4QQUA 2ZVRA 2D3LA 1GUVA 3UJFA 1B4EA 2VRQA 3GDKA 3SY5A 5BW6A 1UQYA 3SY1A 4FXFA 4LAOA 2YCLB 1R7AA 4GFSA 3VKJA 4IX0A 3WELA 5H8UA 3MBFA 3B8WA 3LU2A 5CKSA 1IIHA 2V3EA 3GU2A 2V38A 9XIAA 2FFIA 4LEFA 3CAKA 5LXEA 1QK2A 3SZ8A 3M7SA 2C91A 3BMXA 2Z25A 4HYVA 1TX2A 3AMKA 1DV7A 1OFOA 4H6KA 3MKVA 1F9CA 4Q6XA 1VPQA 3T0TA 2CETA 5C9XA 2ZWZA 4O13A 2FH8A 4UOZA 4US5D 2QHAA 4A8RA 1UUOA 2VVNA 4OIFA 3CEUA 3M9YA 1A4LA 2XVGA 4P5UA 2XGIA 3W7PA 4GY0A 4M0XA 4HSOA 4H9UA 2E5BA 1EO7A 3HV8A 1W3KA 3S9IA 4DWSA 4GYPA 2DSZA 4JX5A 3WQ5A 5E0KA 4IMCA 1GOWA 1PX3A 5LA0A 3RIKA 2GVJA 1EC8A 1GEHA 1IF2A 3DFTA 2PA6A 1H5YA 3P14A 1GYLA 3WDQA 1DIOA 4CUCA 1PKLA 1RJRA 3UCQA 1E9LA 3QC3A 4AH7A 2OPJA 4Q7IA 1FRBA 3D47A 3G0XA 3GDMA 2H9AA 1WUFA 4WDXA 3VIPA 2NV2A 4DHGA 1JR1A 3ANVA 1ZUAX 4I5UA 2X42A 5HMFA 1YEYA 2FPVA 2AQOA 2WNZA 1HF6A 2BY3A 1TZ9A 1A5KC 3KBSA 4W7WA 2ZX7A 4MKSA 3PBUA 3VOHA 3WEMA 3FX4A 1CECA 1I4NA 1QUMA 2BSLA 3CL7A 1VP5A 1U83A 4WDUA 4Z0SA 5E5CA 1X39A 4ASTA 2V0TA 3WK3A 3WNLA 4H00A 4GLEA 3FGCA 3MYPA 2CLFA 3PVFA 1CXIA 4JD4A 4JICA 4EP8C 3AIBA 2G3MA 5CEWA 3VGGA 5JH1A 3WJZA 4MB3A 4RK8A 2CLLA 3VNZA 4O17A 1YTEA 2HXUA 3FXYA 4DO5A 3ZOAA 1NFGA 2I5GA 4LYQA 4X22A 5TQLA 3TNOA 2X7VA 1VIZA 3OIXA 2E25A 1OCBA 1WDPA 1KR1A 1W5QA 4GMEA 4Y8FA 1YQ2A 3LTPA 3L68A 4KPLA 1E6XM 5G4EA 4JTFA 2JEPA 2WQPA 3W2NA 3KS6A 3QV9A 2GGJA 2O9TA 1B3ZA 1W37A 2E7FA 2G50A 2JKPA 3VIIA 3TR9A 2PDMA 3JRKA 5FF4A 4V1YA 3EGJA 3HPZA 3LCFA 3KRZA 2QUUA 3PB0A 3RGTA 3T08A 1DJHA 3UU0A 2D20A 2V30A 3BW3A 2R1MA 3UW6A 1LDCA 4OV4A 2VFHA 4JDBA 4QLKA 4Z2KA 1VQTA 1UUQA 3T9PA 4HSHA 5TIMA 2ZADA 3SCTA 2OELA 2Z1WA 3DX5A 4CQDA 4QSHA 1K02A 2CLOA 3W7DA 3MYOA 1RA0A 3M44A 4JTAA 1I0DA 3UVIA 3EKZA 2OCZA 1SFTA 4XKYA 1R3WA 5KINA 4OFCA 1QHPA 5F4SA 3BQ5A 1EA9C 5G4HC 4EXQA 2UY5A 3SRHA 3DC8A 1JIBA 1OZQA 4ILSA 3UG8A 3A9BA 2E40A 1R46A 4G9PA 3B3DA 2KZHA 4X9YA 1W32A 1ITCA 2X05A 4DJFA 1SZEA 4Q33A 2PSNA 2XIJA 4DBSA 4NAFA 4FO4A 2ZVIA 2VC9A 3GAYA 2F6KA 5JVLA 2NV1A 5BXTA 3EOLA 3A3HA 3W81A 3KTXA 4CEXC 3R5EA 2HQAA 4K7YA 2VOTA 3EX6A 3UXIA 4DI8A 3JU2A 1TTPA 1AD1A 5I2UA 2P5NA 1WKYA 3L9CA 5GPRA 3MO4A 4WK9A 1O6IA 4GQ0A 2BY1A 2FMNA 5LGXA 4UBPC 3MUAA 4RLIA 1KFBA 4EWND 4JTHA 3U2CA 1DEDA 1UJQA 4Q32A 1MMFA 4JYDA 3PJXA 3SI9A 2QNEA 3MUY1 4O19A 3L12A 3N4AA 3SRFA 4DZIA 3TC7A 3DBNA 4RE0A 2R24A 1JF6A 1WB0A 3CO8A 2CITA 2HRWA 3MSGA 1MEHA 4HOWA 1U30A 2W61A 3NVDA 1O7AA 4NZCA 1C7SA 2O55A 3PUGA 3L66A 5JIWA 5DY3A 2WPBA 4RZ4A 1OFPA 2Y4SA 3DGBA 3N4FA 3UZ5A 3CASA 3F4WA 4GPNA 2ISFA 2PFHA 4ERIA 1XD0A 3ABQA 2VFGA 3WNPA 3M0MA 3F2CA 1F8IA 2OMAA 3KL3A 1V93A 3S2MA 1KM4A 4GACA 5HQEA 4JTRA 5REQB 5LIXX 5K7JA 4M29A 1ONWA 3QLLA 5FF2A 5C9UA 3ABXA 3NXLA 3PUEA 2ISDA 3BURA 5D02A 3GY1A 2DY3A 3CL6A 2CNCA 4PFMA 1C8QA 4NUWA 2GQAA 4WKHA 3PWIA 1VF8A 1R87A 4RXGA 4CNPA 2VP8A 4Z08A 5DCEA 2B0MA 2HPMA 1YPFA 1I1XA 2Y8VA 1EC9A 3TQPA 3EX2A 1H0IA 2NLYA 3B0PA 4LTSA 3N3TA 4C6QA 1FWJC 3W85A 2DUAA 1RK5A 3W3OA 3WMBA 1EGVA 4HYRA 1FOBA 3HQPA 1DKWA 1NAL1 2PDFA 3GWQA 3WBYA 2BOEX 2FDMA 1KTBA 1EEPA 1WDRA 1V6VA 3R7MA 2DZUA 1TPH1 2PWEA 1T41A 4NYUA 3M47A 2XH2A 3AIVA 4TX6A 1Z89A 1G4PA 4PRWA 4Y9PA 1NDWA 3KDNA 2QJHA 1UOKA 5HWNA 5LA1A 3I6TA 1TV4A 2LLEA 3MQTA 4DYEA 3AYSA 3CBWA 4NI3A 3CM4A 4TOQA 3I7SA 3SR7A 1BVWA 4QHRA 3II1A 1GHRA 1JPKA 3P3BA 3LXAA 4AIBA 4JYFA 4DM1A 1J79A 3UA3A 1NF0A 4B3ZA 4TX8A 2HDJA 4D72A 1EQCA 1K7FA 4S1FA 1XLHA 4E8CA 4MJ2A 4REQA 4JIHA 4PCSA 3VMOA 3O6CA 5DT5A 3FKRA 2YCEA 1ZHAA 6A3HA 5K4XA 4XKMA 3QR3A 2OYLA 3TUUA 3WLHA 4D6HA 3LERA 4FK9A 2QCHA 4MB1A 6TAAA 1PXGA 3V7PA 1QVBA 3MZNA 1IZCA 3LSBA 3HPXA 3FEMA 1R3SA 3VYLA 1YNYA 2F7FA 2R1NA 3S83A 1KKOA 5CPTA 1XQKA 3W9ZA 3MSDA 3M5VA 2I9EA 2ZZ4A 1UKTA 2INEA 4C6JA 3UGRA 3LZ3A 3FKKA 2QCDA 1K3UA 5E0CA 4LUSA 4PUJA 5H2ZA 3PZIA 5A6MA 5E9XA 1DJIA 3ONCA 7REQB 4HMDA 1ZBWA 1HGYA 4GYPC 1TV3A 4EVZA 4QS5A 4URIA 1YDNA 3AMGA 3WZ0E 4K39A 4XTIA 4WZHA 4M3PA 2Y7FA 3OB8A 3B06A 2H8ZA 3C5QA 1UZHA 1ICQA 2GGEA 3KUMA 2BNJA 4LVFA 2Y7EA 5K9DA 2KX9A 4S2CA 3W37A 3K4AA 1ZBVA 1V3LA 4BFAA 4PL2A 1XLFA 2VNCA 1AJ2A 3VTRA 3MMDA 3IEBA 4MIMA 1SO5A 2HCVA 4XAZA 4R3UA 5EKYA 1X97A 3VX0A 2WJDA 3WNOA 4K68A 3P67A 1CB2A 3OJGA 4IL2A 2DVUA 1ZGDA 1A5OC 3AIRA 3ZLGA 2X2YA 1VZWA 2GVLA 3B9OA 4Z0JA 2IQ0A 2QDHA 3ZR4A 3EB2A 3I6RA 4AG0A 2HK1A 1Z9AA 5HJLA 4NKCA 3UWQA 1EF2A 3QQ0A 2JKAA 3KZSA 1LLZA 3QPZA 4IP5A 4PMUA 5HMSA 3OHIA 3P0WA 3MS8A 2PRHA 4QRNA 1UUMA 2VDHA 5I78A 2QAPA 3MP5A 1TTQA 1TVNA 2VD9A 3OIHA 3FV9A 1DVJA 1TA3B 3K46A 5HQLA 3OG2A 1W91A 1KM2A 2NXGA 3WH7A 3VIFA 1E56A 3CQ0A 1Z6KA 3R11A 4AHOA 3E2VA 4RXFA 1VENA 4Q4MA 3OTRA 4GUFA 1ODUA 2GWNA 3IUDA 4ATLA 5DX7A 3TWAA 1E6ZA 2ZX8A 4PBFA 4PTNA 3EWXA 2YGYA 2QGYA 1R2RA 3AHYA 3TYZA 4DJEA 4C1NA 3FSUA 4GWEA 1T8XA 1RQHA 1XINA 5JH2A 4GNJA 5GJPA 1EPVA 3QMTA 4WCJA 3W2MA 2ISVA 4A3HA 3TOPA 3K1DA 3C0SA 1BSLA 3NL6A 3ATYA 5JQ9A 1B30A 3KVJA 4M6PA 4DO6A 3R1ZA 1XYMA 3ITGA 2XZ7A 4DIAA 4O8AA 1EB3A 3G22A 1Q7QA 3QW4B 1TTJA 1C29A 4ZSUA 1F73A 3HFTA 1AZ2A 1FP8A 4RNJA 3IJ8A 1UMYA 3WF2A 4C6BA 3U3HA 3WLQA 3DHFA 4WF7A 3MW7A 4CD8A 5HUPA 4AB4A 3UXLA 4EF8A 2BZNA 4WSKA 5DLCA 4RL3A 1ISWA 1VB9A 1G7UA 4JTTA 5BOEA 4QIUA 4LOCA 3STGA 3M7WA 2DJXA 3LYEA 4Y7EA 5C5YA 3SO7A 3COTA 3RPDA 3SIZA 4C6MA 2EJ1A 5AYBA 4LUIA 1O1ZA 2F84A 1P0NA 2BVDA 1FWGC 1NSJA 3OU8A 2Z2UA 3V5CA 1VJSA 2PPGA 5L9FA 2E9LA 3IPWA 1N7KA 2QR6A 4C6IA 3S1WA 3NA8A 4XSMA 3W7HA 3CZJA 3RX4A 1H1ZA 4L4OA 4L1XA 2Y1HA 2BHZA 5HDRA 5JU6A 3U4AA 2NXHA 3VI2A 3GE7A 2AL2A 2OO0A 3F03K 2ACSA 4D71A 2HMCA 3PZMA 2VZUA 1KR0A 1H61A 5TNVA 3W71A 1DOSA 3LD5A 3QVQA 1R7OA 3K8LA 1KW1A 4MOZA 1VBRA 3AYRA 2CHRA 4MNKA 1ZAIA 4Z2HA 3NR0A 2Z1BA 3OVPA 3AS3A 1J5TA 2D2HA 2ALDA 4WRHA 3GYCA 4AYGA 3WLPA 4TVCA 1XFCA 2HNEA 3D3FA 2CBJA 2PEVA 3TU9A 1JD9A 3OODA 1PUDA 2PD9A 2FHBA 2NV9A 1M5WA 1XRFA 3ARRA 3E9AA 1JCMP 1KM3A 1XRSA 4MY8A 5F1VA 4RNFA 1ECQA 1GJUA 1HG3A 2ZC1A 4IQJA 3GG7A 4JGDA 4RE3A 5BOFA 4F48A 4E2VA 1QXLA 2GVYA 2X1RA 4UMAA 4UCFA 1UWIA 3M0LA 3GFZA 2FB3A 2PDCA 3MJYA 1ZCOA 3B8TA 3E2SA 1V51A 4UQAA 3UXDA 5B7ZA 3GTIA 5FF0A 4CNTA 5D05A 5HR7A 5A95A 1J10A 4S3FA 2OWCA 3S0CA 1JUKA 4K2SA 3AZSA 1V7YA 1VRXA 2OLAA 1JZ7A 3RMJA 3OG3A 3BC9A 5A8NA 2E4TA 4QITA 3CS2A 4H1ZA 5DRCA 4L6OA 2VCBA 2ZDSA 4Y6GA 2IKIA 2OX4A 3E0VA 5CLTA 3C8FA 4S39A 1A5SA 1MI3A 1XIDA 5AYXA 1X6LA 5F2GA 1DIEA 3AHZA 4O4WA 1Q6CA 1GQNA 3B8DA 3BVJA 3Q2DA 5HUOA 4M6UA 3CUHA 4IMFA 1W8GA 1Z69A 3MUXA 2G3JA 2OGJA 1Y65A 3R13A 3L23A 4KCUA 3WYZA 2DSKA 3PTQA 4FXSA 3M6YA 3W6LA 2VX5A 4PA8A 1E4LA 1MSSA 1SW7A 2PUZA 4GYJA 1NDYA 3SUVA 3H6OA 3NQGA 2BS9A 3BWWA 3P62A 5FA5A 2BMBA 2XISA 3S5SA 2DH2A 4NF7A 1A3WA 3P8IA 3QC0A 2VVSA 5H1WA 3P6LA 3CXOA 2FH6A 1TV8A 2XGBA 1OFAA 3F4DA 3BTNA 4HNLA 4HU4A 3B05A 1F7BA 1GOQA 4BZYA 4FNQA 3HM7A 2BDQA 5LIUX 1RZMA 2Q71A 2CLPA 5LHFA 4JTIA 2V5JA 3TZFA 2Z0IA 1OFRA 1FWAC 4YTUA 4K8EA 2X2GA 4AEOA 1TRDA 3W2KA 3TX9A 2HVMA 1M1BA 1C90A 5ABTA 2XFRA 3W86A 5A8OA 6REQA 4H9YA 4HIBA 4JIPA 4LPCA 5PTDA 5AYIA 1E5JA 2BX7A 4TV5A 2OSWA 1MRAA 2PBGA 3V0SA 1OT2A 1L6GA 2WM1A 1R3QA 1LUCA 1TJ2A 5I06A 3CV1A 3D0CA 1ME9A 3IRSA 1WDSA 3CHEA 3L4WA 4IGMA 2PDHA 1BFNA 4F0LA 1JPDX 2PB1A 5AN7A 4IGHA 1ZBCA 2HE5A 4H9ZA 1GZGA 6CGTA 3WF1A 1UW9A 4FZIA 3WLJA 1I8JA 4GX9A 2OX1A 1OADA 3NQCA 3ITVA 2J6XA 4QROA 3VD5A 4BF5A 4BF9A 1CENA 3T2OA 1EJTC 1JGMA 3GNRA 4MZYA 3HBLA 1JCXA 3FVDA 4ZOEA 3LB0A 5C70A 4ZBCA 4H83A 3LENA 5HNRA 4J35A 5JUVA 1TZZA 4B16A 2H8XA 4D8AA 1FDJA 1ITQA 4MKVA 2JK2A 3GAKA 3O0KA 1MXDA 3E49A 1UD3A 2X1TA 5EMMA 2WSRA 1EJVC 1WX0A 1DWHM 1MNSA 3DFPA 1QT1A 3QSRA 1EOKA 4L9XA 3C8NA 1TPWA 2GZXA 4HZ7A 2I14A 1OQFA 4YHGA 2C3ZA 1M03A 1E0UA 3W87A 3W7NA 3U2ZA 3UR8A 1MEIA 4ALDA 2WOQA 3C2RA 2BGQA 1US3A 4Q4RA 4E5TA 2CHOA 3JR2A 1GNXA 4PMOA 2FJUB 2XIBA 3KHDA 3EWYA 4Y9NA 2PODA 2OSYA 3TC6A 4GRSA 1TQXA 3WDRA 1F07A 1UKSA 3C2VA 5A8MA 1KBBA 3RXZA 5I23A 1VFSA 2OQHA 3O16A 4XB3A 4DI9A 4NJGA 3TSDA 3PWAA 2F2KA 5EY5A 2RDWA 1IGSA 1P0BA 2UY3A 4ZTXA 2D0GA 5AZ0A 5KZEA 3ICJA 4ACYA 4M81A 4J9JA 1X8FA 2EPLX 5T9CE 4F0RA 3IIZA 4KERA 1W3JA 3QSTA 4MDOA 4N0RA 2IXVA 1SO4A 2GSEA 1M7JA 1UMLA 3MUIA 1XIGA 3EOUA 2E6DA 3AUJA 3KFTA 3ITTA 5LA2A 5AOUA 5H91A 4UTFA 4L6HA 5E6ZA 5AVNA 2XG9A 3TNBA 4DWSC 1DYSA 5CPOA 2PI6A 3PZGA 3OOQA 4MG4A 1A5UA 2NWRA 3NG3A 2DQWA 3PBYA 5EB8A 4IGNA 1T6MA 4HJFA 1HKJA 2HPIA 3OVRA 4FOJA 1KD0A 3PPGA 4JY9A 3M46A 1GVYA 4UXDA 5CJNA 2OEJA 1EUAA 1TREA 4WLCA 3RHGA 5CSUA 4AD0A 5G2IA 4GG9A 1U1HA 4KF1A 4JPGA 3PZTA 1S5WA 3PULA 3LOTA 3GC2A 1D7KA 2A4AA 1AW5A 5F7UA 8TIMA 1AH4A 3C61A 2B7NA 1ZAJA 2FLIA 1KCLA 3EXRA 1VFFA 3K8MA 4JTSA 4PUWA 1XRTA 2I7GA 1AA1B 3SEPA 2Z2AA 1UB3A 2PLJA 1A0CA 1TJ1A 3VA8A 3OPSA 1ZCCA 3PY2A 5FJTA 1FQ0A 3VU2A 3DHPA 4NT0A 3AS2A 1YPIA 3IAQA 3AS0A 1TIWA 4P8VA 4QFUA 3EWCA 2PDPA 2NSOA 1WKFA 2CBVA 1AQHA 1FXPA 1A4MA 3AI0A 5LNUA 1W2PA 4ZO9A 3K5XA 3QJAA 1TPFA 1ZS2A 4FB7A 2E5CA 1K9TA 3BICA 4J2MA 3TCEA 3AXKA 1B1YA 5M1TA 3T7VA 2PF8A 3L5MA 2QIWA 5A6TC 4AAJA 1N55A 2RAGA 3BCJA 1IZKA 5U4NA 2BVYA 4D6DA 1RCQA 2OWWA 3GXMA 1KXVA 3P84A 4GINA 5FI8A 4IIEA 2D3NA 2Q02A 3NCOA 1CGUA 1NIUA 2E8YA 3QFEA 1FVPA 1KFCA 5FD0A 3GNDA 5DN1A 4AZCB 3PNZA 3ITXA 2MUCA 1GW9A 1UC4A 1YXCA 4EOUA 3QZAA 2PWDA 1EIBA 1KA9F 1W3IA