1K7XA

Crystal structure of the beta-ser178pro mutant of tryptophan synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
254
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 95
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k7xA00
3R2GA 4MLRA 1SQ7A 2W0UA 1J5TA 5BMWA 4Z1BA 2VFDA 1GVOA 2R91A 1ME8A 2E6AA 1KM5A 4ZQPA 4O1BA 3PY2A 4Y90A 2YZRA 4O13A 5AOUA 1VC4A 3SR7A 2B7OA 3NG3A 3VKJA 1NF0A 3ELFA 2AQWA 1SO6A 5H91A 2NX9A 1BTMA 3W1QA 2A7NA 3MBDA 3PG8A 4LC6A 3F1QA 3NQ8A 5FEPA 4FNUA 1LOSA 3PVFA 4LTSA 2CZ5A 4P61A 4GRSA 2VKZG 3TW6A 2QJHA 3TQVA 1ICPA 1JCMP 5FEXA 3P74A 5LSMA 3TW7A 1H1ZA 5AC7A 4LVDA 1VH7A 2PURA 3DKLA 5FF2A 4RXFA 3L0KA 3NQ7A 3DH7A 1S5VA 1VCVA 4ZVJA 7TIMA 4GC4A 2PRLA 1TSIA 3RK8A 2OMAA 1TB3A 2Z0IA 3M6YA 4RZ5A 2YR1A 1GVQA 4JYFA 4KWVA 1O5XA 5HULA 3ATYA 1LROA 3DFPA 2ZTKA 3O16A 3LB0A 4U28A 1O95A 1B9BA 3PC0A 4DXVA 1EEPA 4MY8A 3M7WA 2WPBA 5AB3A 5F4XA 4JYDA 5E0KA 4UTKA 4O4WA 1KTCA 1S5WA 3KVKA 5KZEA 1SZGA 3G1FA 3M41A 2CZFA 4NQ1A 1O94A 3N34A 1B3OA 4DPQA 2H3BA 2X30A 4JTJA 3EEGA 4HNUA 1Q3NA 2JKEA 2X1SA 1KTNA 5LHFA 1WBHA 2RDTA 4X9SA 3LHZA 1SO5A 3W73A 3WJYA 4O19A 4A22A 4CCDA 3D0CA 4LVAA 3W2KA 3TAOA 1H7PA 1B4KA 1TRIA 1A5AA 1CI1A 3NPVA 3C61A 5D02A 3NXFA 5K9DA 1ONRA 1KFBA 4NNCA 1D9EA 5AYZA 3DHFA 4OQVA 1I45A 4N4QA 2OX1A 1DBTA 4H6KA 3E96A 3QFEA 4LS2A 3Q37A 5HINA 4IXHA 1VLWA 3MW7A 3STFA 2QCGA 3E0IA 2FPTA 3MYPA 5G4WA 5AFDA 4TO8A 3QC3A 3EXTA 2W79A 3U2OA 1F5ZA 2PCQA 3TV8A 3W86A 2CLIA 1ZALA 4O17A 1BKSA 1L6WA 2GJNA 1VQTA 2P1FA 3NDOA 3OG3A 5U4NA 4UFKA 3LXCA 1TREA 3W2NA 1HO4A 3DGRA 3HPZA 3S8HA 5MHBA 3BLEA 1I2OA 2DZSA 4EF9A 2G97A 1OVDA 3LHTA 3T44A 4E2DA 3IRDA 3GNNA 1ME9A 1VS1A 1OFPA 2QCDA 3GYEA 3W3OA 1OYCA 4EOUA 1JULA 5LNVA 4UMBA 2GJLA 4ADTA 2A21A 3W76A 4GFSA 3GIYA 2OZ0A 1M7PA 4WOZA 3W7MA 5HWNA 4JR5A 3ZWSA 2ZYFA 2WJZA 2C18A 3W75A 1P4CA 1L9WA 4UFLA 2ABBA 4XTDA 3W7PA 4AWUA 3TJXA 3LLFA 1ZCOA 1PIIA 1RVGA 2ZZ2A 1W0MA 2V2CA 5EPDA 4YWIA 2ZRXA 1A5BA 2V8ZA 4NJJA 2QUTA 3W7EA 2E5CA 5SWUA 4G1KA 3WJXA 3LLDA 3TAKA 3SY5A 3BW3A 3T40A 3H55A 4JTUA 4S2BA 4NUWA 4LUIA 4HPXA 1AL7A 2FJKA 2NWRA 4QJ1A 5DCEA 3VNDA 2DP3A 1K02A 2VEKA 4M7TA 2BSLA 2DU2A 1AK5A 5G2HA 1UASA 3SFKA 2JKAA 4UFMA 1O60A 4JTEA 5G4EA 3G18A 3L0NA 3B0VC 1WOBA 4A29A 2YXGA 1FXPA 4PEKA 5D03A 3QQ0A 1R2SA 5D33A 2GOUA 1M5WA 3RF9A 3W7NA 2ATMA 1DKWA 1OFQA 2Z2UA 3W71A 3I7QA 4RKAA 5HWJA 2FLIA 4L4LA 3HQ1A 3MI3A 4YL2A 1KLZA 3QPZA 3G3DA 3S9YA 4UTIA 2GQ8A 4RCXA 3P8IA 3G0XA 1BWKA 3OEXA 3TCEA 4HNVA 1LBMA 1QPQA 4O4VA 3TMLA 4OHQA 1LOQA 4N4PA 1E51A 3S6DA 4POCA 2V2HA 1KM6A 3BO9A 4BFAA 3UD6A 3P7YA 4MJMA 3HO8A 1V5XA 3B05A 4JX4A 4DO5A 4UTLA 1ME7A 3CLMA 1ZAIA 3RMJA 3KVJA 4JN6A 5CZ0A 3VE9A 1FQ0A 2V0TA 1NFBA 4NNAA 3SIZA 4K39A 1AL8A 4IOTA 3W7KA 4FX7A 4JXCA 3LCXA 5EBUA 3S1WA 1X6UA 4S2CA 4L4MA 4FHAA 3WK1A 2ZZ7A 1R47A 1ADOA 4NXKA 1MSSA 5KMYA 5FEWA 3E02A 4XBSA 3DU0A 1G4PA 1H7WA 3MUXA 4DF1A 4ORIA 4OV9A 4IX0A 2FPVA 1JJKA 1ALDA 4PH6A 3LTYA 3G1HA 2BLEA 4W9TA 1I2QA 3GK0A 2E1DA 2O7QA 1GG1A 3O8AA 4GUIA 4C1KA 4GUJA 4AHQA 3PF3A 4OV4A 1ICQA 1PCWA 1VPXA 1LORA 4O57A 4AB4A 1FDZA 4GE8A 5CPLA 4GUFA 1W1ZA 4KFPA 3LDVA 4AWSA 1K03A 1QPNA 5D2WA 1NEYA 4FX6M 4GWEA 3R8RA 5AC8A 1C29A 4M6VA 3EXSA 2H3DA 5D2YA 3N19B 4FF7A 3UZJA 4QAIA 3G22A 1XCFA 1PE1A 3PB2A 3FS2A 3LHWA 3L5AA 4ALDA 1WDWA 4FEZA 3G1DA 2NLIA 3MI2A 2NZLA 5LNWA 1IXNA 1UJPA 5HJLA 5EY5A 3KVMA 3U6WA 1TPFA 2ISSA 1H62A 1VYSX 2Y7DA 3ABRA 1LCOA 1XC4A 3USBA 2C0AA 3IVTA 4CCEA 1F76A 3C52A 2ABAA 2XN1A 3RU6A 3EKZA 1T8XA 4K36A 3TSBA 4IMFA 1KW1A 1L6YA 4JTGA 3H53A 3S5NA 3SGUA 3O63A 5F2IA 5KZMA 3EWYA 3I6RA 4IX2A 4NZFA 5DXXA 4U4MA 3TKFA 5K3VA 2OCZA 3DENA 3CC1A 3QMSA 2TPSA 1HFBA 3HPSA 1LYXA 1GTEA 1AW2A 3GKAA 3QZEA 2YFOA 5CZTA 4JDBA 4O16A 5IBXC 4QM1A 2VFGA 1WOAA 1OABA 4XKYA 3QF0A 1Z44A 4ML9A 2ZRWA 3A9IA 2CW6A 1KM2A 1G7UA 4M7SA 1TYGA 3CEUA 4RZ6A 5HNRA 3PS7A 2QCEA 3FYPA 3FJLA 2NXGA 2Z1BA 5D2XA 1FCUA 4CNNA 3TE9A 1JCLA 1IIHA 3QSTA 3UNDA 1A5CA 4Z08A 4BK9A 1H1YA 3FKRA 2WSQA 5D04C 4DQWA 3TR2A 2Y7EA 2PC4A 1XI3A 4NVTA 4UFHA 2ZDRA 4Q32A 1RD5A 1HG3A 4JTHA 1K8YA 5DBTA 2XFWA 4J9JA 3HG5A 1H50A 2FPYA 2ZRYA 3A5VA 3STCA 3LV6A 3LX9A 3W1TA 1EWDA 4TMBA 1TTPA 2V2DA 4M19A 5F1UA 3P67A 3NM3A 4HNNA 3NQ2A 1XUZA 3OA3A 2RH9A 4EF8A 3ANYA 3EX6A 1XKYA 2P0OA 3R89A 4DELA 3G1YA 3NQMA 4ZQCA 5DXYA 3KVLA 2WOQA 3W84A 1L2UA 4LU0A 4E0CA 1EPXA 3EWWA 3O6YX 2KZHA 3W7GA 2BTMA 1H51A 4MIMA 1QAPA 3CTLA 3W85A 3RLUA 3GR7A 3AO0A 2NWSA 4AWTA 1KM4A 3GXTA 2XN2A 3W7LA 4JTTA 4EVZA 4Z1DA 3JR2A 4PL2A 2I9EA 2CFFA 1H7OA 3EWZA 3SECA 3W22A 3L65A 3CB8A 3FKKA 1YXCA 1FXQA 2QEZA 3NQVA 1SW7A 2GQ9A 3PUEA 1J4EA 2E77A 3C0JA 3O07A 5BNKA 5K2ZA 1OX4B 3A23A 1Q6OA 2PRHA 4RXGA 1OFBA 2GVGA 4O1CA 4RLIA 3FYOA 1M7OA 5K4ZA 1RQBA 3LCLA 1AMKA 4O28A 2Y7GA 4Q4KA 4DBDA 4RK8A 3UPWA 1RPXA 5KSWA 4E2BA 1UCWA 3B03A 1XFBA 5LZLA 1SFLA 4LVBA 4JTKA 4YMZA 2DZWA 2QJIA 3EX3A 2O7SA 3C6CA 4IPJA 4NJIA 3WJZA 1TPDA 5DY3A 2RDWA 1FDJA 4LVFA 1QO2A 1LLWA 1H7XA 3GB6A 2Q3RA 2FFCA 1Z48A 3C4UA 4BI5A 3KRSA 3LCWA 1SO4A 4Z1CA 3Q58A 5TBOA 5A8GA 5IM51 1GPWA 2OJPA 4WD0A 3W7HA 2V5BA 4HPJA 2EHHA 3GAYA 3HGRA 4WZHA 1H7RA 1LRNA 3G8RA 3GXPA 4PODA 5HMSA 3EX4A 4N6FA 2FTPA 1YLVA 2WV8A 3MP5A 3PM6A 4BR1A 1JCJA 1FDYA 3TJLA 3UY8A 4I9AA 2J9ZA 5J5RA 1OFRA 3OHIA 5CPOA 2DZUA 3TC7A 4AHPA 2B4GA 2A7RA 3PBVA 4WJEA 1C9DA 5F4WA 3LOTA 1AW1A 4WY0B 1KFLA 3B8DA 3G1SA 2VXNA 3N73A 1RV8A 2B7QA 3IIXA 1ML1A 1CX9A 1KA9F 4N9DA 3P60A 1I8JA 4Q33A 4UTHA 2BX7A 4BI7A 2VOMA 2CU0A 4ORMA 3QRHA 3W07A 3W23A 5CPNA 2A6NA 4HIBA 3RNDA 3M16A 4MY1A 4CNOA 4MFDA 4HNTA 4XWUA 1SZEA 2FQIA 3W1LA 4MY9A 4O12A 2DORA 2Y61A 1MO0A 5HUOA 3QM3A 2ZZ6A 4LS1A 3LBMA 2CLHA 5C5YA 3A21A 2JGYA 3NQFA 5HUPA 1OK4A 3F03K 4N9EA 5G1TA 1F7BA 1DVJA 4UNLA 2EGZA 4MOZA 3PSWA 3JS3A 1IXPA 5BRBA 4QIUA 2TYSA 1Q6QA 5EL1A 4UTUA 1W31A 4QSHA 4CNPA 1FWSA 4RJEA 1GTHA 4JY8A 4DF2A 3O6DA 1MXSA 2X1UA 2WNZA 1O5KA 1YPFA 1KFKA 4IWWA 2QDGA 1I2RA 3A5FA 4UTMA 3NM1A 3L68A 4AF0B 4PC8A 1GJPA 4K38A 5F2MA 3LCIA 4AXKA 4JX6A 5AYYA 2OT1A 3DHDA 4PL1A 1GT8A 3HJZA 3EB2A 4ZQMA 3CWOX 3UWVA 4BI6A 5TQLA 3G24A 3VCRA 3HOJA 1WXJA 4UCGA 3MHFA 1FWNA 3IGUA 4O0ZA 4UTWC 4O1DA 2I1OA 3EWUA 3M0ZA 4WUIA 4KFNA 4DO6A 4HHPA 4MYAA 5DLCA 1F73A 4UC5A 2Z6IA 2VEMA 2ZZ3A 4D2JA 3RFAA 4IMEA 2I14A 3CU2A 3PSVA 4UMAA 2QR6A 3C8FA 2YPIA 3W1XA 1VHCA 2VENA 4NJGA 1OFOA 2A6LA 1K8XA 3NYZA 1P0KA 4OT7A 1GG0A 2RDUA 4ZQRA 2JBMA 3W9ZA 3A22A 3GDLA 4OU1A 4ADUA 1J2WA 3ZWTA 4Y8FA 2J9XA 3UWZA 1X7FA 4WX2A 3L9CA 1LDCA 4YLWA 3W72A 2WQPA 4KWWA 4I7UA 4N02A 2QCFA 1BWLA 4LOCA 1K7FA 1KV8A 3L5LA 1W5NA 5FF0A 3W7JA 3WJWA 3CHVA 5KINA 1SR9A 2Q8LA 4O1AA 2ZA1A 3SZ8A 2CWNA 3WJSA 3STEA 3KX6A 1T0OA 3G0SA 3NQEA 5A5WA 3BW4A 3EX1A 5KZDA 3T55A 4GBUA 3PG9A 5AHNA 1PHQA 2FB2A 2NV1A 1TPEA 3QYQA 4TU1A 1AG1O 5ABTA 4OBTA 4B5NA 1GVRA 4A21A 1KFJA 1HL2A 5I3JA 2C3ZA 1SSGA 1T99A 5CGQA 4JTSA 2G5WA 3DKJA 2C13A 5BOOA 2Y6ZA 4H3DA 2QUUA 2E5DA 3B06A 3TXVA 3HF3A 4HSNA 2BXVA 2CLFA 3CIXA 2ALDA 4I7VA 1P0NA 3TNOA 4JD4A 3UWYA 3O6CA 1XDLA 2YYUA 3QEZA 2YGYA 1W3NA 3W70A 3LCHA 2DJLA 3W7QA 3GZ3A 2V5LA 4JDYA 4YCOA 3LV5A 1V7YA 3FIGA 3GXNA 5I3HA 2ZZ5A 1H63A 4ZZ9A 5C55A 3LHVA 1EUNA 3NZ1A 1HO1A 3PAJA 1TPVA 3C2RA 3W88A 2QAFA 4JTFA 2TRSA 1N55A 1VYRA 3P5YA 4EIVA 1XUUA 5I3GA 2YDAA 3GLCA 1JQXA 3NPWA 2YW3A 2ZA3A 1O4UA 1S5TA 2F84A 4N2YA 3GR8A 2YFNA 2EKCA 2ZZ1A 4Y96A 1UUMA 2GVJA 3TC6A 4PA8A 1KFEA 5L6UA 3IIPA 4AMAA 5D37A 3OBKA 3AJXA 3DFOA 1P1XA 1RQHA 4QITA 4LC8A 1R2RA 4UTJA 1X1OA 3HMJG 1W5PA 3HIJA 1DV7A 1R2TA 2QCDB 5DBUA 1OX6A 2E6DA 5DELA 1DQXA 4ADSA 3HB9A 1UB3A 8TIMA 3B4UA 3JRKA 3M5XA 3ZS4A 4FNTA 5C54A 2VEIA 1QFEA 1G4EA 4I7WA 5F2LA 1OG0A 3DFTA 4ZQOA 2E09A 2JGQA 2R14A 2ZRVA 2B7NA 4N9BA 2E5BA 1Y0EA 4O53A 3GX9A 3BLFA 4XQ6A 3V75A 1YDVA 3OVRA 1OFDA 4OE7A 5D2VA 2VELA 3TXZA 3IV3A 5DY2A 3F4NA 1SPQA 4KFOA 2R8WA 5KITA 3IGXA 2LLEA 2ZQ0A 1SFJA 2CLEA 3EKLA 1W8SA 3LERA 4FX8A 4PTNA 1PVNA 3NNTA 2VFFA 4K7YA 3DFQA 1JRCA 2H6RA 5LNUA 5LHEA 1L6SA 1B57A 4Z0JA 3WK2A 4ZQNA 2A5HA 3S5OA 3TK7A 1G67A 4LV4A 3FJ6A 3K30A 2H90A 1VLIA 1WA3A 1HTIA 1VYPX 4JS3A 1NVMA 1B4EA 2HS8A 1X8FA 4M5PA 1QOPA 5CG7A 3QH2A 3CM4A 2H8XA 4TX9A 4LY8A 3BVJA 3N2MA 4AAJA 2R94A 3W7CA 4IXXA 3MI6A 4LT9A 1JUKA 1OYBA 1ZHAA 1U5JA 3NQGA 2RFGA 4BF9A 3BG5A 4IPIA 3L21A 1GYNA 1OYAA 3O06A 3W1RA 1TQJA 3BGJA 1A50A 3PUDA 3R12A 1KM1A 3P62A 5C2XA 4OGZA 1TJRA 4DPPA 1QDSA 1RZMA 2AAMA 3TU9A 2Z6JA 1DHPA 3NZRA 1VR6A 5C6MA 4K37A 1ZFJA 1XBYA 3UPBA 3W2JA 3QQ1A 2Y85A 1IXOA 4LNYA 4XTIA 3BLIA 5J5DA 2EPHA 3C2VA 3B0UX 1C8VA 3NL5A 3EX2A 3LM7A 1QWGA 3UXDA 2QUVA 3W1AA 1QR7A 4JX5A 4YXGA 4ZL1A 4NX0A 1SZNA 4NX5A 3TDFA 5HR6A 3M5YA 1I2NA 5HQEA 1JRBA 4MLJA 5LGXA 4WY0A 5DN1A 3N3MA 1KM0A 1TV5A 3CIWA 5E93A 3OIXA 2C6QA 4UFIA 1IXQA 3DBPA 1DORA 4GXMA 3NGJA 4R33A 1W5MA 1OFAA 5F4SA 1FUYA 4O54A 3OVPA 4CCCA 3R5EA 5G1YA 1GZGA 2Y88A 1TPC1 3UZ5A 1FCQA 1QO5A 1JR1A 2X1TA 3E12A 3S0CA 1LOLA 3THQA 1TIMA 2V9DA 2J88A 3VI2A 2A85A 3SI9A 2QF7A 1BEUA 3GAKA 4OWGA 1EUAA 1EIXA 1PS9A 5K9CA 3NPUA 1QPRA 2QKFA 4IMGA 3P5ZA 1UBSA 4NJHA 5D09A 1YXYA 3M44A 3INPA 3I7SA 4FNQA 2C19A 3STGA 3QMTA 5TIMA 3V1PA 1VZWA 5FEZA 3QPYA 5HWMA 4AHOA 3GVGA 1R46A 1Z42A 2ZRZA 4JTLA 3ZFHA 2QJGA 5CSRA 3S1VA 1YYAA 1LRTA 1YDNA 2WNNA 1D3GA 5L9FA 5I3FA 3NEVA 1A5SA 5T26A 4X2RA 1TV8A 1TTIA 4CQ8A 3BV4A 4H4IA 2OT0A 2CLKA 4RX0A 4NU7A 5K9XA 3PUOA 4AF0A 2J27A 5LKYA 1TTJA 2ZZ4A 2J24A 4HN4A 1LBFA 3E9AA 2WSRA 4IMCA 3LGEA 5AN7A 4FNRA 5EMUA 2WNQA 3BGGA 4XKYB 2HTMA 1FBAA 4UXDA 4LUJA 3E49A 3QSRA 2WO5A 3T78A 3BG9A 4O10A 3IIOA 1EP1A 5FF7A 3QW4B 1FCVA 3KOFA 4MZ8A 1IF2A 3CEPA 1XBXA 1ICSA 3IVUA 2NUXA 3DI0A 4TR9A 1K7XA 1K3UA 4PCFA 4TMCA 1FX6A 1VJIA 4UFJA 4WOQA 1XBVA 3EXRA 1I2PA 2J9YA 5FF4A 1H7NA 2QCMA 4X22A 3TSDA 3NL2A 3CWNA 2A2IA 3HG4A 3L2IA 3H54A 1GYLA 2DZTA 4JIPA 1I4NA 5FI8A 4DO4A 3W7DA 5EKYA 2B7PA 3UYCA 2G96A 5BW6A 5CZSA 1G7VA 3DFNA 2CLMA 1JCXA 3GNDA 1ZY9A 2ZBTA 3I68A 3PWAA 5FF3A 2V82A 3TQ0A 2VEPA 2QCLA 4N9CA 1OX5A 1ZENA 3N14A 1F6PA 5G5IA 1H61A 3W1UA 1HUVA 3TFXA 3G3MA 1JUBA 3L67A 5K7JA 3LTSA 3RLVA 1MEIA 3QJAA 1WQ5A 1FY6A 3ABOA 1VCGA 2X1RA 3HBLA 4ONVA 3W1NA 1QNVA 3NL3A 3P80A 5AHIA 2Y62A 3ABQA 2A1YA 2X16A 5D2TA 3S5ZA 1A53A 4JGDA 3W1PA 2EAWA 2WSYA 1JCYA 2VFHA 4JY9A 4O15A 4N6EA 1PV8A 1XM3A 1MEHA 4XUGA 1D3HA 1CW2A 3DAQA 5D38A 3HG3A 1JVNA 3C2EA 4M6QA 2NX3A 5AC6A 1IIGA 4NNBA 4CQAA 2JKPA 4YCPA 4TIMA 1ZAHA 3O05A 3S5YA 4K8HA 4BWLA 3MBFA 2IQTA 3NQDA 2P10A 3U8GA 2C14A 2DZVA 2QDHA 3NQ6A 3B04A 3LI0A 4FXRA 2UV8G 4O52A 5KTLA 3BG3A 1KFCA 2E68A 5D30A 4WY0F 4LV9A 5F1VA 3ATZA 1XXXA 1WX0A 1DL3A 2B0MA 4UMCA 2ISVA 1DJNA 1G69A 3LHYA 1WV2A 4WXZA 5BMXA 3M47A 1EB3A 1WBJA 4IUOA 1LTDA 1H5YA 3IEBA 3S42A 3TSMA 5K4XA 3IIZA 3G8EA 1SW0A 4NZJA 1F74A 1TV7A 2DZXA 5AYXA 1DOSA 1Q6LA 1W5QA 3G1AA 1TQXA 5IBXA 2QAPA 2A7PA 3C56A 3HGOA 4GJ1A 5D05A 2YSWA 3TH6A 5CZJA 1W5OA 3LI1A 5G2WA 3SW6A 4X3ZA 1OHLA 1TCDA 5LNSA 1OF6A 4Y9AA 3W2UA 3MJYA 1GQNA 3NA8A 1XL9A 3NR0A 4CQ9A 4O0KA 1OJXA 3T4CA 4DEFA 2TSYA 1F05A 5CKSA 4MJZA 4HKPA 2ZTJA 1TPH1 3MMTA 1Q6RA 3FFSA 5F2GA 2QCCA 3UXAA 5EA9A 3TX9A 3UY7A 3NQAA 1SZFA 1KBJA 3C2FA 3O15A 1T96A 1OFEA 3G0UA 1N8FA 4K6AA 4S1FA 1VGAA 1LLZA 2BWGA 1U83A 1FWTA 4JICA 4O14A 1VRDA 1GEQA 2CLOA 4QNEA 1GOXA 1RQEA 3HGSA 3W7IA 1QMLA 1QOQA 1NF7A 3MHGA 4Z0SA 1TTQA 2NUYA 3KRZA 3IVSA 3SJ3A 1GWJA 3W1MA 3QW3A 1YPIA 1F2JA 3HGJA 3NQCA 3MP4A 5HR7A 3MYOA 5CPMA 1TPUA 2DZPA 4UTTA 2V81A 1Z41A 3UQNA 3FEMA 1W3TA 3L5MA 4QNWA 2ZCGA 3YPIA 3DFSA 2FB3A 5I3KA 1NAL1 3GDRA 4RV8A 1TPWA 2PRMA 3THAA 4A2RA 4A2SA 4MZ1A 2GPTA 1G4TA 3NO5A 2C16A 5G2IA 4JTIA 3HPXA 4FIRA 3PULA 3P82A 4E38A 6ALDA 3PBWA 1XDMA 4IQLA 4JEQA 3W6YA 2Y89A 4JIQA 2QCNA 3S1UA 1N7KA 4WXYA 3GKFA 1THFD 3UWUA 4R53A 3I7RA 1ZNNA 4WQ6A 3P84A 4JNMA 4JYEA 3W2MA 1LRQA 4O8RA 4Z1AA 3TMQA 2NXIA 4MYXA 2D73A 2J6XA 5E1QA 4QISA 4O11A 4MVAA 1PHWA 1PCKA 1W54A 3KRUA 2GVLA 2YX0A 1WYIA 3MP3A 3KHJA 2Q3OA 2GUUA 3M43A 3VFLA 3G1VA 1OK6A 2H8ZA 4CLMA 4FB7A 2JK2A 3Q94A 3GDKA 1TJPA 4IGHA 1VCFA 3P61A 3TIMA 5LGZA 2YCEA 2NV2A 3L66A 5AHEA 4LS0A 2ATSA 3W87A 2GQAA 3Q2DA 4NT0A 1LM1A 1JCNA 4MKNA 3UWWA 1JUEA 3WK3A 2A0NA 3ABSA 3DI1A 3TUUA 4HT3A 1SSDA 3HG2A 1YDOA 4MPQA 2E6YA 4BWLC 4Y6GA 3UWQA 1EP2A 3WK0A 2HMCA 4PFMA 2V30A 2NUWA 3TROA 2ZFAA 4KKXA 3WFAA 4UIOA 1DQWA 2C1HA 3PR2A 3TQKA 2CLLA 1IGSA 3LBCA 4K7VA 2FDSA 3CT7A 4NXSA 2ISWA 3G1XA 2YYTA 5EYWA 4UUIA 3MHUA 5DCDA 3OVQA 1OX4A 4R34A 3M1ZA 1FWWA 2Y70A 1DJQA 3VE7A 1YTDA 3C2OA 4AH7A 2QCHA 3B0PA 4ZMGA 2AGKA 5DCBA 5FESA 4XBKA 4K8EA 1VHNA 3NOEA 1KTBA 1MZHA 2YW4A 1GVFA 5CSSA 2RKXA 1TPB1 5AHFA 4AVFA 1GVSA 4IJBA 1KBIA 4AEOA 3DZ1A 3F4WA 1EA0A 1FWRA 3TFCA 3CPRA 4P2VA 1TMHA 3M5ZA 3W74A 4LRSA 4IMDA 3IIVA 4O18A 5GVJA 3QMRA 3M5VA 2E6FA 1LP6A 3LCFA 1S3HA 3SSJA 1SUXA 4DF0A 3A24A 3LRLA 4HSOA 1JQVA 2F7FA 3W83A 3MO7A 4A3UA 2ZRUA 3DXIA 1Q45A 2PE4A 3NVTA 4RZ4A 3SGZA 1ZAJA 3BARA 1TRDA 3BK0A 3IGSA 3GDTA 4LRTA 1NSJA 4EWND 1FCBA 1WAUA 2TMDA 3LTPA 2C15A 4GNJA 5D32A 3T7VA 5H2ZA 4MZYA 3N9RA 2HSAA 2HS6A 3KAOA 3W7OA 1P5BA 3GDMA 3I65A 2ZA2A 3P81A 1KLYA 4RR4A 2XN0A 3M9YA 1SU5A 3O1NA 4FXSA 4DBEA 2A4AA 1LBLA 3LXAA 4XZ9A 1ZJIA 5U7SA 3CQ0A 2Y7FA 3NPXA 3LRMA 5AHMA 3KFTA 3FLUA 2RHGA 3KXQA 1EX5A 1R30A 2VFEA 3LCGA 4NJKA 1SO3A 1LZOA 1OF8A 1RR2A 3W2LA 4R7JA 3FA5A 4UTWA 4C1LA 2Q8ZA 1W37A 1W56A 1G6CA 3NAVA 3LHUA 4O50A 2CZEA 6TIMA 4FO4A 3BPWA 3MWAA 1MEWA 1YXDA 4UTTC 1EWEA 2NXHA 5AHLA 3NL6A 3P8JA 2DJXA 3TA6A 2FIQA 4MUZA 3S1XA 3PBUA 4ICNA 4FIQA 2EF9A 3C3NA 4LW7A 4LVGA 1SW3A 2VFIA 1PL9A 4FNPA 3PBYA 1X1ZA 1EP3A 1YADA 5I3IA 4UR7A 4GUGA 2WKJA 1YTKA 4M6PA 3ZR4A 1QPOA 2W6RA 1H60A 1G4SA 1W3IA 2Y63A 3LRKA 3N9SA 1K7EA 3EWBX 4LWWA 4MFEA 3PB0A 3N2XA 3L0GA 3LXBA 2CZDA 2X2GA 5LNRA 1UUOA 1TO3A 3W7RA 2NX1A 2G95A 1F6KA 3EWXA 1QCWA 1KV5A 1K8ZA 1XBZA 4FNSA 1YTEA 1AW5A 1M6JA 4UNKA 4GUHA 3FOKA 2BZNA 2VC6A 3BW2A 4QQ3A 4UR8A 3R13A 1KM3A
chains in the Genus database with same CATH superfamily
3R2GA 4NAEB 4CGTA 1PX4A 1JNEA 2W0UA 5A6JA 1J5TA 4HK7A 4Z1BA 4HJFA 2BB0A 2R91A 1ME8A 4M0XA 4O1BA 2R6OA 4MDOA 1SMAA 2BBFA 4R7OA 3RUBL 4M1BA 2AQWA 3NOYA 5F7UA 4LC6A 3PG8A 3WEOA 2VCAA 3F1QA 3NQ8A 5FEPA 1H4PA 4P61A 4GRSA 1FWAC 1ICPA 2WSKA 1GCYA 1TWIA 3P74A 3TW7A 3EA2A 3GTHA 4XD5A 3HV9A 5FF2A 3W38A 3MKVA 4RXFA 3THCA 1S5VA 4GC4A 3UG3A 2PRLA 5A8MA 3IWPA 2WLZA 3GTXA 2YR1A 3WUFA 1CIUA 3GNPA 1TZZA 3A12A 5HULA 3ZT6A 3ATYA 3KTCA 3VDHA 2B81A 1VAHA 2OLSA 1O95A 3W29A 5E0CA 3PC0A 4DXVA 1BG9A 3EDKA 5F4XA 2VNCA 4JYDA 5BOEA 2ADAA 4O4WA 3CL6A 3KVKA 5KZEA 3G1FA 2CZFA 3M07A 2INZA 4QDWA 1KBKA 2BODX 2H3BA 3A3WA 4JTJA 3WQWA 1UD6A 2X1SA 3GG0A 2XIOA 3PP7A 1SO5A 3ALFA 3W73A 3WJYA 4QAWA 4H9UA 4H7CA 3IARA 5DMMA 3T2PA 3S5SA 1B4KA 1GVEA 3C61A 5K9DA 4MMWA 4YVPA 2X05A 3AWNA 3H2OA 4PTXA 1YDYA 1DBTA 3O3RA 3AZRA 1IQ8A 4LS2A 4KGJA 4IXHA 1VLWA 2R1NA 4PMQA 3WH5A 2ZC1A 1E56A 1UWUA 4X61A 4ZTXA 3WKZA 2W79A 1GKQA 3U2OA 3TV8A 3W86A 1EQCA 4O17A 3NIYA 2VJXA 4L6DA 3TTOA 2GJNA 4DNMA 4UFKA 3LXCA 1TREA 3DGRA 1WDPA 1E72M 2DZSA 2PLCA 3TYZA 1OVDA 1BQGA 4C6PA 2VCBA 3VGGA 1BVNP 1ISVA 4TXEA 1FH7A 1VS1A 2QCDA 2WPGA 5JQ9A 1OYCA 1AD1A 4YIWA 1JULA 3MU7A 3VZXA 3IPWA 4ADTA 3A3HA 4QX4A 3AS0A 2BXYA 4GFSA 3W7MA 3W7PA 1P4CA 1SVDA 1F3EA 3GH5A 4LF1A 2CETA 4JIEA 3MMDA 1PIIA 3LMYA 4YWIA 2AL1A 1CXKA 2QUTA 1A80A 4W8LA 2ISDA 3WJXA 1ONXA 3OGSA 3LLDA 3TAKA 3DERA 3WBAA 3SCSA 3E38A 4LUIA 3G1RA 3VNDA 1Z9AA 3I3DA 1K02A 2VEKA 1U22A 2E25A 1KXVA 4J2PA 3U3HA 5G2HA 3SRDA 1BGAA 5G4EA 2DT1A 3R11A 1UMYA 3VIIA 3L0NA 4ICCX 1JXKA 4IIBA 5D03A 5HXMA 3SQLA 2WC4A 5TF0A 2VX6A 1DKWA 1XR2A 2FLIA 3HQ1A 4S3KA 3QPZA 3G3DA 4ERGA 4LBSA 3G0XA 3NO3A 2WCSA 4O4VA 2O92A 3TMLA 4KRTA 1CXFA 4POCA 1KM6A 3FCPA 4JFSA 3BO9A 3VOIA 3EDFA 4MJMA 3WLJA 1V5XA 2B31A 4JX4A 2W27A 4TVUA 3NFUA 3CLMA 1ZAIA 3ZJ6A 1XG3A 3KVJA 1UR1A 3R7MA 2FZDA 3WDJA 2X2YA 1FQ0A 1NFGA 1ZTVA 2ZWYA 2GQ3A 1FP9A 3OHMB 4MAVA 2OELA 2SFPA 3T09A 4IOTA 3W7KA 3S1WA 2P0IA 4S2CA 4L4MA 2ZZ7A 2ODOA 5FAGA 3APTA 1MSSA 5KMYA 3E02A 2P8BA 1XLBA 1H7WA 3MUXA 4D71A 1JGIA 2FPVA 3DBNA 4FOKA 1ALDA 3LTYA 1NFPA 4ZTYA 3AIRA 3AICA 4JIHA 1JF5A 1B5TA 3VCNA 2REQA 1LORA 3VKBA 4AB4A 3GWQA 3KBWA 4NZ1A 1JPDX 3LDVA 5BRQA 4FX6M 7A3HA 3LSBA 3DX5A 5BRPA 4F66A 4DUVA 2UWFA 4QAIA 2VC9A 4KS0A 3L5AA 4GQQA 4ALDA 1WDWA 3G1DA 3VD4A 4R88A 5HJLA 2ISSA 4UOJA 1H62A 3SUTA 1LQAA 3ABRA 1EDQA 1F76A 1OCNA 1PZ0A 1T8XA 2PGEA 5HOSA 4IMFA 3U9IA 3EOLA 1OC5A 4JTGA 5CC5A 6TAAA 2VM8A 1YNPA 2WQDA 3I6RA 4IX2A 3FHAA 2HVOA 4GVIA 3WUBA 4GA8A 4U4MA 5BXPA 3VOGA 2OCZA 2GZXA 2TPSA 4PRTA 4FXJA 4IL0A 4AW7A 1KO0A 3R1ZA 1AW2A 3GKAA 3DOPA 4O16A 4HN8A 4J28A 5CC3A 2CC0A 4AD2A 2CW6A 5CC6A 2J79A 3CEUA 4GQBA 5HNRA 4XIMA 1TV4A 2QCEA 2X0YA 1BHGA 4HZMA 1JFXA 5I0DA 1HZYA 1IIHA 4RDVA 2ZXBA 4BK9A 1VEOA 4MJ4A 5D04C 3VMPA 4L1XA 3N4FA 4HTYA 4NVTA 1VB9A 1QI4A 2J78A 1BXNA 1ITXA 4JBRA 1M03A 3B0XA 3STCA 4OTKA 5AZ0A 3UG5A 3LX9A 5G1MA 1I60A 2V2DA 4M19A 4C6JA 3UA4A 3D47A 4HOXA 4E4PA 1OIFA 3NQ2A 2PSNA 4EF8A 2OYMA 1UKTA 1XKYA 2P0OA 2INFA 3R89A 4DELA 1BXBA 3PZ9A 1PTDA 5DXYA 5BROA 2RJGA 5FACA 3GNXA 3BAYA 3VO0A 2OG9A 4K8GA 3ZOAA 3TVAA 2KZHA 4EKJA 1H51A 3T81A 3MC5A 1R5YA 1QNRA 3GR7A 3PJWA 3GXTA 4EVZA 4DRSA 5KETA 3WD4A 3EWZA 3SECA 3TN3A 3CB8A 1YXCA 2QEZA 2G3NA 4C6NA 3O07A 1R9XA 5BNKA 2QJJA 5K2ZA 4CQBA 2VRQA 2PRHA 4RXGA 3APYA 4O1CA 2AMXA 3FYOA 4JTQA 3I6TA 3H12A 5EMKA 4O28A 4FAMA 3JZEA 1O5RA 4RK8A 1P43A 3OLDA 4E2BA 3VXGA 1A0CA 2JEQA 3VD3A 3G6MA 4LQ1A 1UKPA 3F4VA 4JTKA 1FOBA 2DZWA 2O7SA 5A69A 4IPJA 2FZ9A 3WJZA 4Q4PA 4PTWA 1DE6A 1ISYA 3IJLA 4X60A 1QO2A 4A8LA 3CMJA 5GNXA 1MUCA 3DCPA 1NDZA 3UZZA 4PB4A 3CAWA 3G8RA 2WM1A 4FOUA 3RO8A 2HVNA 4N6FA 2WV8A 1JCJA 2UZ9A 2DDXA 3ZXWA 1FDYA 5IDZA 2J9ZA 5GPRA 1OFRA 1JF6A 5HNNA 2DZUA 3B9EA 4AHPA 1HKWA 5F4WA 3LOTA 3CO8A 1AW1A 4W87A 4ZE4A 3B8DA 1GQIA 3G1SA 3N73A 2B7QA 3IIXA 3SY8A 5IDIA 3CL7A 1EJRC 4Z1YA 1YX1A 1CX9A 2HPMA 2YCKX 1FHVA 1XH0A 4Q33A 3C0LA 2PDWA 4QQUA 3W23A 2W67A 5BYWA 4CNOA 2D22A 2DPEA 4HNTA 2A3LA 1NOWA 3EWCA 2ZX9A 4GKLA 2O4QA 5HUOA 2I5GA 2ZZ6A 1QHZA 2CLHA 1P48A 4Z2LA 5HUPA 2WHJA 3F03K 4N9EA 3HFTA 1N2VA 2OEJA 1EGZA 1CGWA 5EL1A 1YEYA 1CTNA 4UZSA 4RJEA 1GTHA 4DF2A 1JYVA 1OM0A 1O5KA 3ERPA 4IWWA 2QDGA 1I2RA 1UC4A 1QPKA 3UWEA 4ACYA 4DIAA 3K4DA 3CYJA 4AG0A 5F2MA 4IIEA 3DYMA 3DHDA 3XISA 1R9YA 3NXLA 4ZQMA 1QWKA 1UZDA 2Y8UA 3CAQA 5BZAA 4GVFA 1TMQA 2XINA 2PDFA 5ABEA 5CCZA 3I10A 4C6DA 2I1OA 1OIMA 3N6QA 5XIAA 5JH1A 1TG7A 3M0ZA 4WUIA 1MXDA 3QHNA 4KFNA 2OZ3A 2VCCA 4EPDC 4HHPA 5DLCA 1PTGA 2Q6ZA 3M46A 4UC5A 2Z6IA 2VEMA 4D2JA 4IMEA 3CU2A 2QR6A 3C8FA 1UQZA 4NJGA 4GGBA 1IEIA 4AISA 3BZJA 3FSUA 1UUQA 1KXTA 3VA8A 4RW3A 1JI1A 1NDVA 1QW9A 1UIPA 2RDUA 1YIXA 1H09A 1ZPTA 2JBMA 2DT3A 3GS6A 3GW0A 2GSHA 4ADUA 5FOOA 1A47A 4WX2A 5EMMA 3L9CA 4CEUC 1E0VA 1M1BA 4YLWA 7REQA 3W72A 5FJOA 4V2XA 1QW8A 1ESWA 4Q8NA 3EMZA 4H9ZA 5E9AA 3WJWA 5KINA 2Q8LA 1R8LA 2CHNA 2CWNA 3KX6A 4M29A 1T0OA 4NRRA 3NQEA 4F79A 1H0GA 1S1RA 4GBUA 3PG9A 5ABGA 4GZJA 3KCLA 4H9MA 2Y5JA 1A3XA 3N11A 1PDYA 3WLSA 1EJSC 4CVUA 2Y8VA 3DFYA 3ITVA 4A21A 2E4TA 5I3JA 5T91A 1AMYA 1T99A 4N0RA 1A3WA 1HT6A 2WYSA 2C13A 4J3XA 2VZVA 1UR2A 3LQGA 2POTA 3WLMA 3A4AA 4AY7A 3CIXA 3A13A 3WQGA 3UWYA 1XDLA 2YYUA 2YGYA 3SM0A 4IISA 3LCHA 2DJLA 3W7QA 3W00A 4NZ4A 5HPOA 2G3FA 2NT0A 4TV5A 3VIJA 4GXPA 4MB5A 2VQTA 2ZZ5A 4A4AA 1ADDA 1E4IA 4ZZ9A 1EUNA 4W85A 4FS9A 1HO1A 2JEPA 4GH1A 1ISZA 3CHEA 1H49A 2V6AA 4DWSA 1XUUA 2YDAA 1JQXA 4B5XA 1G0CA 2XVPA 3AQUA 3BGAA 4DO7A 4I5UA 1S1PA 3B97A 1R87A 4P7OA 2GVJA 1BWVA 2YA1A 2XG9A 3TC6A 1KXHA 5L6UA 4S23A 5D37A 3OBKA 1P1XA 1MVYA 4D9PA 1W1PA 4UTJA 4WDUA 1W5PA 5C70A 3CUIA 5DELA 4IP5A 4AIEA 1OGBA 3B4UA 3QY7A 4DM2A 5JBDA 3M5XA 4EK7A 3ZS4A 4FNTA 4N42A 2PTDA 1G4EA 3PPGA 1FTXA 4HBKA 1PB0A 1ZL1A 4N9BA 4XQ6A 4J3SA 3FDGA 4OE7A 4HU0A 3AIQA 3E1F1 1UR8A 3F4DA 4ZENA 4IIGA 1RP9A 3LU2A 5DY2A 1GNXA 4HYVA 3OJGA 3GO2A 1SPQA 2V3DA 4PUWA 2R8WA 4L1GA 5KITA 1XF0A 3DFHA 4EX4A 2ZQ0A 1XLJA 2YL6A 2WMIA 3S46A 1V6VA 1TE1A 1E0WA 1W8SA 3LERA 3VIKA 2H6RA 2PMQA 3BLLA 4C7DA 4L64A 1L6SA 4Z0JA 3WK2A 1E43A 3S5OA 4AX7A 1G67A 3NCOA 1QBBA 3AHTA 1HTIA 3EDEA 3QLDA 1NVMA 1B4EA 4M5PA 2FH6A 3E0WA 1EO5A 4H9XA 2XGZA 3N2MA 3TTYA 4ENLA 4AAJA 2W66A 4IXXA 3MI6A 1XQLA 1OYBA 4M1RA 1NWUA 2RFGA 1XRFA 4BF9A 1K6WA 3BG5A 1FKXA 5HK4A 3VOJA 4GNVA 3W1RA 1TQJA 3SCOA 3R12A 3UJ2A 2PGRA 2XDFA 3GC4A 2AAMA 2Z6JA 4QLLA 4C90A 5C6MA 1WKFA 1RA0A 1XS2A 3UPBA 3R94A 3ZM8A 4YYFA 2Y85A 2IQDA 4LNYA 3BLIA 3V36A 1F4AA 1YBQA 3KCOA 1GOIA 1UPPA 3TDFA 5HR6A 3KUMA 4JQ3A 5HQEA 4OBSA 1JRBA 1E55A 4MLJA 4XSMA 6REQA 3ANUA 3VDBA 1WXYA 3BE7A 4RE0A 4B5UA 5D4YA 1T40A 1W5MA 3QTGA 1OFAA 4OIFA 5F4SA 4O54A 3OVPA 4U5IA 2O9PA 3E5PA 3AS3A 1GZGA 1TPC1 3UZ5A 2VX7A 1FCQA 5T9CE 1JR1A 4G7FA 1CNVA 3E12A 1LOLA 3T0BA 1EX1A 1UJQA 3PPHA 2J88A 4GK8A 2X09A 2PP0A 1BEUA 1PS9A 5E6ZA 2WVUA 2QKFA 3QR3A 4KCVA 4REQA 4DYKA 2YCIX 3TZFA 3INPA 1F4HA 4DWSC 3I7SA 2FKPA 4B9ZA 5CPQA 3AISA 2WB5A 3V1PA 2NV9A 4AHOA 3GVGA 2DQWA 4QCFA 5CSRA 4DZIA 2WWCA 3ONBA 1VFTA 4DBWA 1TV8A 1TTIA 1XLHA 2VDIA 4P7NA 5A3HA 3DESA 3OW1A 4S3JA 3BV4A 3PUOA 4B5WA 1J96A 4WKAA 1TTJA 2J24A 3QGAC 3OZPA 3A9BA 3ARQA 2C1IA 2WSRA 3SRHA 3GNOA 1J0ZA 1BKHA 1H2JA 3QR1A 3MWCA 3GFXA 2WCAA 3IUDA 4O10A 1EDGA 3IIOA 4GNKB 5HMDA 1EP1A 5FF7A 2D1ZA 1ZLPA 3LQLA 1CDGA 1CYGA 1E5NA 5DQPA 2EEXA 4DM1A 1EEXA 4Y7EA 1S38A 1IF2A 1XBXA 2XSAA 3LA4A 4Q8TA 2XZ9A 1Y65A 1P7TA 1Q63A 2PZ0A 3SUWA 1VPYA 1UP0A 4WOQA 1CGTA 1T5AA 5FF4A 3AXIA 4XX6A 2VYOA 5H8UA 3CWNA 2GGIA 4Y9MA 3VMNA 2G96A 4DI9A 5CZSA 1HL9A 3DFNA 3GNDA 1JCXA 1ZY9A 2ZBTA 3VIFA 4XAYA 2ONEA 4JHZA 2JIEA 4TVCA 4KT2A 1EPVA 3TQ0A 1F8MA 2VEPA 4N9CA 1W2PA 3ME3A 4F0KA 3B9NA 3W1UA 4F0HA 4ERIA 2X0HA 2AAAA 5I3DA 3PTQA 3N4AA 5IRPA 1EBGA 2WZEA 4XZMX 3ABOA 1FY6A 1IHIA 3IJ8A 3NQBA 4ONVA 3OZMA 5C9RA 3W1NA 3P80A 1D8WA 3GC5A 5D2TA 2WVTA 3W1PA 3CMGA 2WSYA 3GHTA 1VIWA 2QVNA 3QLLA 3O0FA 1D3HA 1CW2A 5D38A 1JVNA 3P2VA 4S38A 1A4MA 5AVHA 2J47A 4TIMA 2E3ZA 3S5YA 4M3PA 4BWLA 2IQTA 3AC0A 2PDMA 2P10A 1SJDA 4I6VA 2EO7A 2XH7A 1DWAM 2OVLA 3IJ9A 1A5KC 4M56A 1JAEA 3H23A 3KS5A 1ADSA 3GG8A 3S6OA 1UWAA 2E68A 1KQYA 4IJCA 2ACUA 5F1VA 1DL3A 4UMCA 4ZOEA 2ZVRA 3UP8A 4B4HA 1BAGA 3QV7A 5BMXA 4LUTB 2W63A 4PMUA 3L4YA 3O6AA 2VDHA 1WBJA 1LTDA 5AKQA 3K13A 3S42A 1M9HA 3QZ6A 3S1GA 1ODZA 2VT0A 3WLPA 2ZVIA 1Q6EA 5TNVA 4U10A 1TUXA 1W5QA 2CIPA 5IBXA 2QT3A 3AOFA 2P3EA 2YSWA 1XCWA 5A2BA 1OHLA 3G77A 3KOYA 4Y9AA 3MJYA 1GQNA 4U2YA 3SCVA 4FA3A 2PWGA 8XIAA 4M82A 1Q4NX 1A5UA 3T4CA 4GCAA 1TUFA 4DEFA 2GJXA 1F05A 2ZDSA 2GYIA 3R79A 3KEHA 2EPMX 4HKPA 1CB7B 2ZTJA 4XD6A 1TPH1 3MMTA 2J62A 4AWEA 3WQ6A 3CTTA 4K6AA 4ATLA 2HWGA 1VGAA 1LLZA 2HROA 3N17A 5DT5A 3IAQA 2EXOA 5FJIA 1JI2A 4FK9A 1W3HA 1FWTA 4LF2A 1PKMA 3ARYA 1GEQA 1BQCA 1VIZA 2CLOA 4QNEA 4OFCA 4YTUA 4RPQA 3HGSA 3W7IA 3KL5A 1QOQA 1TTQA 1JDEA 5D9OA 1BYBA 2VURA 2ZE0A 3SJ3A 1VBHA 2PODA 3PZUA 4H83A 4NP7A 1LUCA 1YPIA 3W1MA 3MP4A 4YPJA 1Q8AA 4UTTA 4HA1A 5E0FA 3UQNA 4ZOBA 2J4GA 2V3GA 1WDDA 1Z8AA 5I3KA 4N7QA 3POCA 3W25A 5A6BA 3GDRA 1TPWA 5BXSA 3THAA 1CLVA 2UY2A 3IJ7A 3UZWA 3BICA 1V3KA 4L7ZA 3REQB 2PS2A 3B8UA 3PULA 4E38A 4XSLA 2Q09A 2PDUA 1V6WA 4JIQA 3WD3A 2X41A 1N7KA 3AYVA 1E73M 2QS8A 3KLLA 2HDJA 4HMEA 1EGMA 2VDGA 1TX2A 2IMRA 3WUEA 5E9XA 5FKYA 4IMAA 4IQJA 4O8RA 1TJ1A 3TMQA 2J66A 2NXIA 3UZXA 1TV2A 4QISA 4MVAA 1PCKA 2YZ5A 1O6IA 2YX0A 1WYIA 4XZIA 4A05A 4EWJA 3G1VA 1OK6A 4HA4A 2UY3A 1J2BA 1VCFA 3TIMA 4HMNA 5AHEA 4LS0A 3LPPA 3LLXA 4W84A 2XIQA 1PZ1A 3AIVA 2YBVA 3KBJA 3WK3A 3ABSA 4C6CA 3DI1A 1W1VA 4CKQA 1XPGA 3HG2A 1JZ7A 4RL3A 4BWLC 4B4FA 2FDMA 3WK0A 4XG1A 4PFMA 4WKFA 4G56A 2PU1A 3FHQA 3BC9A 3BQ6A 2R82A 3PR2A 3TQKA 2FVMA 2FDSA 4KBXA 4H1ZA 3VUSA 8XIMA 4NXSA 1J6PA 2ISWA 3G1XA 2YYTA 2GDQA 4FR1A 3VGDA 5DCDA 3QV6A 3WELA 2CCRA 1S2UA 3GXDA 4D8ZA 2Y70A 3WMCA 1RALA 3QN3A 1Y5XA 3B0PA 4Q3MA 5DCBA 4XBKA 3WDIA 3NOEA 3GXIA 5CSSA 3PAOA 2RKXA 5AY7A 4AVFA 3M0JA 1JYWA 1KBIA 3AWOA 3DZ1A 3F4WA 5CXPA 1FWRA 1DJZA 5A6TC 1N82A 4CCZA 4LRSA 4QLKA 3QVQA 3IIVA 5I6SA 3QMRA 3M5VA 5CLTA 3LCFA 1S3HA 4PBGA 1SUXA 3MCOA 1KWGA 3A24A 1QNOA 2WHMA 3LEPA 4QE5A 3R0DA 4X0VA 4IG2A 1WAUA 3LTPA 3VKAA 2Z25A 1Q6FA 4GNJA 4HMDA 3S4TA 1M68A 4UQDA 4ZB0A 3SN1A 2HSAA 2HS6A 1BXCA 2ZX6A 4GY0A 1A4LA 3W7OA 3RGTA 1M7JA 2J7DA 1KLYA 4RR4A 2XN0A 4CU7A 2ZWZA 3SGGA 1ZJIA 1E4MM 3CZGA 3L2LA 3CQ0A 5A2AA 5AHMA 3UCQA 1TE6A 2XVLA 3KFTA 2G3MA 3FLUA 3KXQA 2VFEA 1SO3A 4WGHA 1OF8A 2REQB 4PRRA 3EKGA 3KBVA 4B91A 1UG6A 4PCTA 1W37A 1HP5A 2PDPA 2VR4A 4G9PA 3V0UA 1CGVA 3BCJA 1KRAC 3PWGA 4BCEA 2DQXA 3BPWA 3KDNA 3MMWA 4HCHA 1MEWA 4V15A 1GJWA 4UTTC 2NXHA 5AHLA 2XHYA 4MUZA 3AIUA 5C0QA 1AD4A 3R4IA 4XZWA 2OX4A 4LVGA 1E6XM 3ARSA 4Q8MA 1EP3A 4GKTA 1YADA 3PTDA 1LF1A 2A3CA 4AFYA 3ZR4A 1H60A 1W3IA 3ID7A 3LRKA 1K7EA 3EWBX 4LWWA 4MFEA 3N2XA 2AL2A 3NO1A 3L0GA 3LXBA 1ONWA 5LNRA 4ZEPA 1UUOA 1JXJA 2E28A 1K8ZA 1XBZA 5C7HA 1YTEA 4UNKA 3FOKA 4DLFA 3GBDA 4NRSA 2ZX8A 2VR5A 1U5HA 2OODA 1UD2A 4RZBA 1PEZA 3R13A 2J6VA 4LBUA 1KM3A 3VTRA 4LCSA 2F6KA 1KKOA 2PWHA 2FZBA 2VP8A 3UR8A 1TVLA 1KM5A 3CB3A 4Y90A 2YZRA 4O13A 4JN8A 1KGWA 1VC4A 2OQHA 3NG3A 4H8VA 3VKJA 1NF0A 3ELFA 4RNHA 1SO6A 2NX9A 2HV5A 1VF8A 1BVZA 2A7NA 3PNUA 1LOSA 3PVFA 3GFZA 1CWYA 3GSMA 3WQFA 4TUFA 2FGZA 3QC0A 5AC7A 2VQUA 3BL3A 4S39A 3CASA 2QF8A 4GIYA 4NKCA 1C7SA 3SY1A 1B1YA 3AROA 3L0KA 3NQ7A 1E1CA 5TAOA 4ZVJA 3CV7A 1TSIA 3RK8A 5ECUA 4RZ5A 1OD8A 1C3FA 1GVQA 3K1DA 2FMNA 4DJFA 7TAAA 1VFOA 3V35A 3DFPA 5JIPA 3M0YA 3BTNA 3O16A 1EEPA 2CERA 3T0AA 4MY8A 3M7WA 2WPBA 1Q5MA 3CHDA 4YTTA 4E8DA 1E6SM 3PPFA 3AS1A 2WJDA 5E0KA 3S3GA 4UTKA 4RE2A 3WQOA 1XQKA 1PWMA 4NQ1A 1EGVA 4P8WA 2YA0A 4JL1A 2QULA 3EEGA 5CPSA 1Q3NA 3EA3A 2JKEA 3UW6A 3BSMA 1W32A 3OP2A 5GQBA 3SBFA 5LHFA 1WBHA 2I16A 2XYLA 4U5KA 1N8IA 1P0BA 4KMQA 1FFQA 3D0CA 1H7PA 1EJVC 4UQBA 1TRIA 3NPVA 5D02A 1KFBA 2YOCA 3MUAA 5AYZA 3L4TA 3DHFA 4EE9A 4OQVA 2QIWA 3S2JA 3FY1A 4H6KA 3QFEA 4J35A 1VBUA 3CPUA 2G3IA 3MW7A 5G4WA 5AFDA 1PZ2A 2RDXA 2PCQA 3QKZA 1BKSA 2P1FA 3EB4A 4W5ZA 4P7RA 4G7EA 5U4NA 4X63A 1EC8A 1DIEA 3WLLA 3HPZA 3KTSA 3S8HA 4CD8A 3F5JA 1M04A 1TWZA 3SAZA 3LHTA 1A0EA 2OPJA 3T44A 4E2DA 4OKDA 2VC5A 2A3HA 4J7RA 3E2RA 3H24A 2CPUA 1T41A 2BHUA 3TZNA 3L23A 4GX9A 5LNVA 1UH2A 2WW5A 4XAZA 1DJWA 5EB8A 2PD9A 2GLKA 2INEA 2OO0A 3THUA 4P7LA 2VO5A 3LMZA 2ZYFA 2WJZA 2C18A 3W75A 1L9WA 1JNDA 4NZ3A 3M0HA 3TJXA 3LLFA 4WSHA 4MWAE 2C71A 1RVGA 2ZZ2A 1W0MA 2ZRXA 2V8ZA 4S3AA 3W7EA 2E5CA 5SWUA 1R6WA 3CV1A 4FSAA 4L1WA 3BANA 2W5FA 1XRVA 3T40A 4B92A 3CWHA 1M53A 3K8MA 1NH6A 4S2BA 4AD3A 1EJUC 1S5MA 5DCEA 4HPXA 2FJKA 2VTFA 1TX0A 2DU2A 3E5BA 1F8IA 2WXDM 1O5QA 1KGXA 3A64A 1UASA 4UZUA 3KTXA 3QFWA 4UFMA 5MKGA 2YIHA 3G18A 1WOBA 3BAJA 1QK2A 4ZFCA 5RUBA 1CENA 3QV9A 5D33A 1K4GA 3UU0A 2R1PA 5C9XA 4GQGA 2Z2UA 3KLKA 4W8BA 3W71A 4ZA0A 4L4LA 5HQMA 1KLZA 4RCXA 1K9TA 1BWKA 2PP1A 4DY1A 3OEXA 4HNVA 5JUVA 1R7OA 2AOSA 2HE8A 4TQTA 2C1GA 3S6DA 2V2HA 5I09A 1AH4A 1QATA 4ZFMA 4BFAA 3P7YA 2FZ8A 3B05A 4LAOA 3DC8A 1ME7A 3RMJA 4I9TA 5CZ0A 2VGIA 4NZ5A 1EF2A 3CPGA 2D0GA 3DYPA 2PAJA 3XINA 4NNAA 1HKJA 4DJFC 1UH4A 4MB4A 1Q7MA 4Q4QA 3WQ5A 4JXCA 3LCXA 1JIBA 1X6UA 2HK0A 1IEQA 3SCTA 4NXKA 4IHCA 4HPNA 4AC7C 4DF1A 4IX0A 4PH6A 1CT5A 3G1HA 4W9TA 4MAZA 2PGWA 1NU5A 2O7QA 5C9UA 4U2ZA 3ZO9A 2PBOA 7REQB 3N18A 2Y1HA 3PF3A 4OV4A 1ICQA 3GU9A 1VPXA 1G1YA 1DJHA 3K4AA 4E8CA 4A8IA 4UQEA 1K77A 4AWSA 1K03A 4MKSA 4KEZA 3UGRA 3R8RA 2CESA 3CUGA 1V79A 5H8MA 1TWSA 3N19B 4FF7A 3UZJA 4PUDA 4Q8QA 4Q8VA 3MSDA 3HTWA 3PB2A 4AU0A 3UJSA 4FEZA 4H8HA 1XFCA 1BD0A 1G9HA 2NZLA 4ILSA 4GI9A 1IXNA 2OKOA 5EY5A 3KVMA 3U6WA 2Z7KA 2ZUUA 1VYSX 5FSEC 2Y7DA 1JDDA 3VOFA 3KZSA 4CCEA 2ABAA 3ZYZA 1KW1A 1L6YA 3H53A 3S5NA 4Y2WA 3SGUA 3O63A 2P3ZA 5F2IA 3FXGA 4X0NA 8RUCA 4NZFA 3S9ZA 3CL8A 1L2QA 3DENA 3VNMA 3DYOA 3AYSA 3R6IA 1HFBA 4S3DA 4F48A 2WC3A 3RM8A 3QZEA 2YFOA 4JDBA 1AQFA 4JTCA 4LUSB 4XKYA 4L65A 3QF0A 4ML9A 4B3KA 3PZNA 1XGDA 3S47A 1KM2A 4M7SA 3PS7A 3FJLA 1YPXA 1MRAA 1E4NA 1J12A 5D2XA 1FCUA 4CN4A 2EJAA 3PTKA 3QSTA 4WEVX 2VX4A 3UYIA 1I0DA 4Z08A 2WSQA 3K8LA 4A8RA 4XZNX 3TR2A 2PC4A 1XI3A 1O66A 3JZUA 3S2CA 4UFHA 4NL1A 2GGJA 5JBFA 1RD5A 3KOZA 3P6LA 4QS5A 5DBTA 2XFWA 4J9JA 1H50A 4EANA 4IZGA 2BVYA 4TMBA 4PMNA 5F1UA 3NM3A 3WLTA 1JDFA 1XUZA 3OA3A 2RH9A 3U7VA 4MNLA 3Q4DA 3ANYA 3EX6A 1SR0A 3LN3A 1MNSA 3W84A 1IEWA 1TWDA 4LU0A 5TD4A 3VNJA 1J10A 1W1TA 2OSWA 1QAPA 1V0LA 2WMIB 2XN2A 3C0QA 2CFFA 3IJQA 1H7OA 3TYBA 3WENA 1Z7AA 1NM9A 2V5KA 3AUJA 2GK1A 3W22A 5HBFA 1ITCA 3FKKA 5A6SA 2J7GA 2GQ9A 2E77A 2IXVA 3WQCA 3LNPA 1OX4B 1Q6OA 3N9KA 1Q7ZA 2GVGA 1PIGA 1AMKA 1RPXA 1REQB 2BVDA 1EIBA 2OSXA 3VDCA 4PRWA 1XFBA 5LZLA 1XCXA 2P50A 4YMZA 1YRRA 2QJIA 3R10A 1TVNA 5DY3A 1FDJA 1AJZA 3BAKA 4LVFA 5HNUA 1LLWA 1H7XA 2QMKA 1XH1A 4IIHA 4DBUA 3C4UA 4R7WA 1SO4A 1UZ4A 3WDQA 4LYKA 4V1XA 3UJRA 1GPWA 2YL8A 3W7HA 2V5BA 4HPJA 2EHHA 1FA2A 3HGRA 3WNMA 2DT2A 1L8PA 4IM4A 1XYMA 2NQHA 2UY4A 3EX4A 2PDGA 3WCZA 3CQJA 1CEOA 1ZCCA 2DVTA 1PDZA 1WZMA 3UY8A 3JUGA 5AYBA 5CPOA 1BG4A 2B4GA 5J8LA 3PBVA 2V3FA 1XSJA 3DG3A 2J7EA 1KFLA 2VXNA 3EMQA 6REQB 1SFTA 5M3WA 1ML1A 2PBGA 3FAWA 3K8KA 2EKGA 4N9DA 5JIWA 3SO7A 4GGHA 1I8JA 4H04A 4UTHA 2BX7A 4BI7A 4ORMA 3W07A 1V77A 1QNPA 2A6NA 1UA7A 2DSUA 1DWHM 5C9ZA 4MFDA 2IPWA 3URAA 1SZEA 1GQKA 4KIRA 4O12A 2DORA 2HISA 3GH4A 2Y61A 4REQB 3QM3A 4LS1A 3LBMA 1AODA 3A21A 4ASTA 2D3NA 2JIWA 5G1TA 1F7BA 4LYQA 1RUSA 1P0EA 3W24A 2EGZA 4GFIA 4DYJA 1IXPA 5BOFA 4IH3A 1DJXA 3NUKA 2R24A 2L5HA 4DAFA 1W31A 4ZOAA 4CNPA 2GSEA 3IJ6A 4F4RA 1FWSA 4LNCA 2EQDA 2HRWA 3UESA 3WBWA 2WNZA 1YPFA 2BMBA 1F6YA 3L68A 4BQ2A 1AH3A 4WF7A 3PZOA 3WNKA 4K38A 3WLNA 1OT1A 3AIWA 2XWEA 4AXKA 4JX6A 4EPBC 5AYYA 2OT1A 4PL1A 3MVTA 3HJZA 1GONA 1JFHA 4LYRA 1ZGDA 3G24A 3MUIA 1WCGA 1IT7A 3RHGA 1W9DM 3GUWA 4O0ZA 2G4FA 4UTWC 4Q4SA 3TC3A 2FTWA 4O1DA 4A3YA 1OADA 1FWEC 3KM8A 4DX3A 4DO6A 4Q7BA 4WSJA 1A3HA 4QROA 1F73A 1GEHA 1JZ6A 3WD2A 3WO8A 4JTRA 2XH2A 3GD6A 1P7TB 2YPIA 3TYEA 3PBMA 2D0HA 4EPEC 2WSPA 2R1MA 2PD5A 2ZXQA 4ZQRA 3W9ZA 3GDLA 1ISXA 4OU1A 1UQYA 1B30A 1RLCL 3NDZA 3CZKA 2IKJA 5FCZA 3EPNA 1BWLA 1K7FA 1XWYA 1KV8A 3L5LA 1E5JA 5FF0A 2DZBA 5BXTA 1XIHA 4O1AA 3SZ8A 1V51A 1I75A 2AKZA 3WLRA 4BA0A 6XIMA 3PZMA 2NW0A 3T55A 2FB2A 3FV9A 1TPEA 4DVOA 1AG1O 2D20A 3PBGA 5ABTA 1CGUA 2RGLA 3O2LA 3THDA 2AQVA 1KFJA 1J0JA 4AYGA 4V27A 4ACZA 3IS4A 4JTSA 2G5WA 2ZOXA 4H3DA 2QPUA 3B06A 3HF3A 4HSNA 2CLFA 2ALDA 1PYFA 1IEVA 3VDGA 4JD4A 1E9LA 3WDHA 3UVIA 3QEZA 2R1KA 4H8UA 3ICJA 7PTDA 2XISA 2V5LA 4JDYA 3SCQA 3LV5A 3RJYA 1V7YA 1RLDA 3R0KA 5HPCA 1H63A 3C86A 1X38A 3N04A 4I5XA 3NZ1A 1XKJA 1XV8A 4ZB5A 2J77A 2BVWA 2QNEA 4PE8A 2QAFA 1D2KA 1EA9C 1PBGA 3RILA 1IEXA 1C7TA 1VYRA 4EIVA 4AD0A 4Y9PA 1P6BA 2O9RA 2ZA3A 1V03A 3URBA 2YFNA 3H7VA 3VYLA 4Y96A 1UUMA 5KZ6A 3VGEA 3EDJA 3ABXA 3IIPA 2DW7A 2YA2A 1BRLA 3AJXA 4XVEA 4YHEA 1RQHA 4QITA 1R2RA 1DPMA 3ZSTA 3AZTA 4ES4A 1UKOA 1XLIA 4JZ5A 5BU9A 1S2VA 3HMJG 3WD1A 2DH3A 3HIJA 1V6TA 1DV7A 5DBUA 1BYDA 4ADSA 5AC4A 1UB3A 4AX6A 3WNNA 2PWEA 3N2TA 3BXWA 1EFZA 1QFEA 4FXFA 1OG0A 1AJ0A 3WLIA 2R14A 2B7NA 2E5BA 3L2MA 4DXKA 1ZJHA 2JQXA 3BLFA 2OWCA 4M8UA 3PZQA 4HB7A 2YDRA 3AHXA 5D2VA 2HBXA 2VELA 3T0DA 3IV3A 5C2GA 2DGAA 3F4NA 2PTYA 4KFOA 3I6EA 2LLEA 3A47A 4TOQA 2CLEA 1XLFA 4K7YA 3DFQA 2D23A 1JRCA 3FEQA 4OJYA 4JN7A 4AYSA 5LHEA 2A5HA 1R0MA 4AZCA 1NQ6A 4F0LA 3K30A 1KCKA 2H90A 1LUCB 4GYFA 1QOPA 5CG7A 5E70A 4NAEA 2Z1XA 4TX9A 4LY8A 4K3ZA 4U31A 1JUKA 1ZHAA 3NQGA 1EHAA 2PWVA 4IPIA 5IFPA 2PB1A 1J5SA 3BURA 1KM1A 1Q66A 1JYXA 4AZHA 1GZ1A 1TJRA 4DPPA 1VR6A 4KWOA 2XIBA 1YE6A 4K37A 2Z4GA 4J3UA 2JFEX 3OB8A 3W2JA 3AYTA 5J5DA 2EPHA 4FLQA 3SURA 3C2VA 4B16A 2IPJA 4QLJA 3W1AA 1QR7A 3U4AA 1PAMA 3NGFA 3PTMA 7ENLA 3M6DA 3LENA 2J75A 5DRIA 4LX4A 3CS2A 4WY0A 2G0WA 5DN1A 3N3MA 4WIWA 5E93A 3TW9A 5T9BG 4PB5A 2C6QA 2FJUB 1X1NA 3ZLFA 3DBPA 1QI0A 5KEZA 1FUYA 4CCCA 4D6JA 3GXMA 5G1YA 4OVXA 4GIAA 1E6QM 5I77A 3MPGA 3S0CA 5M5DA 4K1GA 1C93A 1E1EA 1TIMA 3VI2A 5CGTA 3W0KA 1XYFA 1EIXA 4NJHA 4GYKA 5D09A 1YXYA 2VVNA 2X8RA 1KWKA 3D46A 3QMTA 4Q4OA 5FEZA 3QZAA 3UR7A 5HWMA 3FJ4A 3WL1A 4JTLA 3ZFHA 5FIPA 2QJGA 3S1VA 2F2KA 1LRTA 1YDNA 1D3GA 5I3FA 1A5SA 1CXLA 3TN6A 4LANA 1CB2A 4XD4A 4IGNA 2OOFA 4CQ8A 1XICA 4H4IA 3ITLA 3UZYA 5LKYA 1YE4A 1LBFA 3BLOA 4L9YA 2C91A 4HNLA 4O1FA 2NSXA 3LGEA 1CLXA 4FNRA 1MMFA 5EMUA 1NDYA 1T6MA 4C6BA 3BGGA 3ITTA 1HL8A 4F9DA 4UXDA 4QEHA 4PMJA 4IG2B 4O8AA 1BF6A 1SJCA 2KX9A 1TFVA 3CEPA 4MGGA 4AZ6A 3A4XA 2CITA 1V08A 1BYCA 2PC8A 3BCDA 3B8SA 1K3UA 4GQ0A 4TMCA 2FFIA 1FX6A 4UFJA 1XBVA 2OLHA 3EXRA 5AC5A 3KRBA 3TN4A 2QCMA 2ZKMX 4HD5A 1I6NA 3NL2A 3SUSA 3L2IA 4DO4A 3W7DA 4GXWA 3CYVA 2WM0A 2B7PA 3IAPA 1PPIA 3MANA 3RX2A 3HFYA 1G7VA 2V82A 5FSDC 1VP5A 1JPMA 1V6YA 2G8ZA 4B5SA 1HVQA 3N14A 5G5IA 4L9XA 1VPQA 3OQEA 3FGCB 2E8YA 1CECA 3G3MA 5H6HA 3L67A 5K7JA 5DX7A 3VINA 3RITA 3QJAA 1K70A 1WB0A 3HBLA 3VNIA 2ZXDA 3S5ZA 1A5NC 1MDLA 4H19A 4QHRA 1QW7A 3U5UA 5REQB 1JCYA 4O15A 4IP7A 4F0MA 2PLJA 4N6EA 4X9YA 3H4XA 3QY6A 4PBFA 1L6GA 1XM3A 2DIJA 4XUGA 2FZMA 4I6KA 3HG3A 1O12A 3VCCA 2PTWA 4NNBA 4CQAA 4YCPA 1ZAHA 1AQ0A 2AKMA 3NQDA 5ABFA 1GK8A 3CMFA 5I23A 3MKCA 2C14A 2DZVA 1DEDA 4FXRA 4JQAA 2EPLX 3AU6A 3II1A 3URQA 4YTRA 1KFCA 2XJ7A 1KQZA 1OWQA 4WY0F 1XXXA 4UBPC 2ISVA 5C71A 1DJNA 1G69A 2QUNA 4AXNA 2Y24A 4QEEA 2Q8XA 4EAYA 4FPSA 3T8LA 3LZ5A 1EB3A 4C6FA 4LPCA 5DF0A 2ISFA 4IUOA 3WUGA 3ITOA 1HN1A 1NELA 3G8EA 1SW0A 2BOEX 3RCMA 3WMLA 1F74A 5AYXA 1TQXA 4J2MA 1V3LA 4L6HA 2A7PA 3C56A 2EPKX 3BLKA 3V4BA 2YB1A 4NAFB 5CZJA 1W1IE 1Q2RA 2OB3A 3CZEA 3LI1A 5LNSA 1TCDA 3K2GA 1JAKA 2OSYA 3VD7A 4IGSA 1X7IA 2CZVA 4GY7A 1Z6KA 1OJXA 1ZP4A 5C8BB 1NWRA 3ZVHB 1GPFA 5F2GA 2QCCA 4UB9A 4PEEA 4CD6A 1RJRA 5EA9A 3UY7A 1B31A 1KBJA 3O15A 4JKKA 1AH0A 1OFEA 3G0UA 4S1FA 3WZ0E 3RRAA 1Y8BA 4E3VA 2NVDA 2BWGA 3TYDA 2XM2A 3S2NA 4O14A 3KHDA 1HW6A 3KOWA 2P53A 3BLDA 2I9UA 3MHGA 4Z0SA 1JD7A 4J3ZA 2XH4A 3KRZA 1ENUA 3QW3A 4BQ5A 5DMNA 3NQCA 2KAUC 5HR7A 1TPUA 2DZPA 1IWBA 2ZIDA 3BOLA 4QNWA 3L5MA 2ZCGA 2BOGX 4HMCA 1SYTA 2CNCA 1NAL1 6XIAA 5GJNA 4A2RA 1R3VA 4MZ1A 3ZSSA 5I02A 1G4TA 3KS6A 4HU4A 3BAWA 5G2IA 4JTIA 1ECEA 3VIMA 3WN6A 5D9PA 4DWSD 4H2CA 4G7EB 1JPIA 1WZKA 2BXZA 3GW3A 3GKFA 3VGFA 3UWUA 3H4GA 4R53A 3I7RA 1ZNNA 4H9YA 2R1LA 3ZJKA 4BQ4A 1WUFA 1CXEA 4Z1AA 4MYXA 4W86A 3VIPA 2D73A 4O11A 3WFZA 1PHWA 3KRUA 3MP3A 2GUUA 2H8ZA 3V5OA 4CLMA 1XLCA 1XSIA 2JK2A 1EL3A 3GDKA 1TJPA 4IGHA 3SUVA 1UWIA 2HNHA 2NV2A 3EYPA 1XIBA 3L66A 3U7BA 1US2A 2X42A 1HXJA 3Q2DA 4NT0A 3RYSA 3WMBA 3B40A 4AQLA 1SSDA 2Z2AA 4MPQA 3MSYA 3TOYA 3UWQA 2HMCA 2V30A 2NUWA 1ZQ5A 2ZFAA 3TROA 3WIJA 2IQ0A 3BJTA 4KKXA 4UIOA 2C1HA 4OUEA 3ARPA 5CC7A 2RGMA 3ITCA 1NP0A 2GOKA 1QNSA 4LCRA 5MF5A 4PMDA 4FLOA 2EPOA 3OBEA 5EYWA 2Y5EA 3MHUA 4XVDA 3OVQA 1VKFA 2WKLA 3BWWA 1D7KA 1VD6A 4R34A 3UPMA 1FWWA 3C2OA 1ISWA 5T8GA 3MCMA 5FESA 2AGKA 4K8EA 1VHNA 1MZHA 5M17A 1GVFA 1TPB1 1XSKA 1V0KA 1GVSA 2FVKA 4CU6A 4FZIA 5A6MA 1PWLA 6A3HA 1EA0A 3TFCA 3CPRA 2QYGA 3RLGA 3VOHA 1BVWA 3M5ZA 3W74A 4IMDA 5GVJA 1CGXA 2PLMA 3AIEA 2XVGA 4HSOA 4L4PA 5XIMA 2F7FA 3W83A 2VVSA 4S3GA 3DXIA 2ACQA 2PE4A 4QS6A 3TNBA 4ZODA 3MJMA 3BUVA 2ICSA 3ZQ9A 1FCBA 4TX6A 2NQJA 2OZ8A 1FWHC 1FWCC 4X2PA 4IFKA 3N9RA 1RAKA 2YCJA 2EBNA 1R3WA 1RJQA 3M9YA 3GRIA 1KB3A 4DBEA 2D24A 2Y7FA 3WEMA 3LRMA 1XISA 4WDXA 3GTNA 3VMOA 3WNOA 3EB3A 4IJRA 5C7VA 4H00A 1J8VA 3S2MA 1LZOA 1EXBA 3GE7A 4ZXLA 2WZHA 5EGRA 4D6CA 4V1YA 3NAVA 4EPKA 3HPAA 1E6RA 2HE5A 3AXXA 3M0KA 1KRMA 3GIQA 4HJWA 4FO4A 3GHSA 4AZ5A 1WDSA 3W6LA 3NEHA 4ZSUA 3WG6A 3NL6A 3P8JA 2PDXA 1W6TA 3TA6A 1LWHA 3PBUA 2PDCA 1GKRA 4ICNA 3GVVA 4LW7A 1SW3A 1ZP3A 4IT1A 3MCNA 3QQWA 5BWFA 3R43A 4UR7A 4GUGA 4CD4A 1QPOA 2W6RA 1G4SA 4E6MA 2Y63A 3N9SA 2YDQA 2CZDA 1TO3A 2VGBA 3W7RA 2NX1A 3TCSA 2G95A 3VC5A 3EWXA 4DHGA 1QCWA 1KV5A 1CXHA 2BZNA 2PDIA 3VPLA 4UR8A 2E1WA 1E9YB 2NLYA 2FH8A 3F7JA 5M03A 4MLRA 3W27A 1SQ7A 5ABHA 2YLLA 1U1UA 2BV9A 3ARZA 5BMWA 2VFDA 4XUYA 3S9IA 4ZQPA 1EJTC 2DUZA 3PY2A 4DXXA 4TTGA 4HTBA 3OLEA 3GXFA 1BTMA 1E9IA 3AMLA 1ZJAA 1S2WA 4XAPA 3W1QA 3MBDA 2BGNE 1DWFM 1EYEA 4FNUA 4KRUA 4LTSA 5CAHA 2QJHA 4YS1A 4PFHA 4HHLA 5FEXA 3DHUA 5LSMA 4US5A 3GU1A 1WDQA 3NDYA 1VH7A 2PURA 2JF7A 4MADA 3RX3A 7TIMA 1VFMA 5GNZA 2DIEA 4J1OA 4GZIA 4GYPC 1O5XA 3TQPA 1QK0A 2XFFA 3MQTA 2IUZA 3BAXA 1LROA 2HK1A 2NVAA 1C91A 3VZZA 1GW9A 3LB0A 4U28A 3RM4A 1B9BA 4BKNA 1LL4A 3VZYA 4GJJA 1XW8A 4MWAB 4NY2A 4A6GA 4C7FA 4RUBA 2ZICA 4K68A 1KTCA 1WAWA 2CLPA 3M41A 3VFCA 1B3OA 1GHRA 5CJNA 2F38A 4AZIA 4J4KA 1IV8A 2CKRA 1S39A 4DJEA 1UC5A 1FVPA 4Q4MA 3PK7A 1KTNA 3AS2A 2RDTA 1DXFA 5B80A 1UH3A 1ZBWA 1NDWA 2VRJA 2IPFA 1GVIA 4O19A 1PUDA 3WQ8A 4A22A 3WY1A 3WLKX 4CCDA 2BP1A 3ARUA 1WZAA 1PTAA 1CI1A 3KZPA 3NXFA 2WMGA 3QPEA 4M81A 4NNCA 4HZ7A 1V8EA 4PZVA 2DUAA 1I45A 3ZJ8A 4YYCA 2EG7A 4S3EA 2XTKA 2YLAA 3E96A 2QV4A 3Q37A 3LK6A 4XO7A 4JIRA 3E2SA 2FZNA 5HJXA 3OQ8A 3E0IA 5A1AA 3MYPA 4TO8A 3QC3A 3QOKA 3LUTA 4WKHA 4EP8C 3TWAA 1L6WA 1VQTA 3W2NA 1XD0A 1HO4A 1D8CA 5MHBA 1JZ2A 3SDOA 1U2YA 4LFYA 4L80A 3IUHA 3KP0A 5G4HC 4W7UA 1EO7A 1MWOA 1FHUA 2G97A 3WL0A 1TKKA 1XGZA 3ARTA 4NILA 4M6UA 3VNZA 3GNNA 1ME9A 3LZ3A 3GYEA 2YB4A 3TR9A 1KBLA 4UMBA 3FVDA 2GJLA 2WZIA 4Z17A 2XSXA 2VZOA 2A21A 3W76A 2HZGA 1M7PA 1Z89A 3EPOA 3ZWSA 4AWUA 4UFLA 1ZJBA 2G4JA 3DGBA 4C6EA 1F3WA 1PZ3A 1A5BA 2CEQA 3MO4A 4J5NA 4C6OA 4G1KA 1HVXA 3SY5A 1XC6A 3BW3A 1J93A 4XISA 3MDUA 4JTUA 4IPPA 4QJ1A 1AL7A 1XLLA 3FNDA 3VK5A 1OZQA 3RPMA 1RCXB 3K5XA 2C7FA 1O60A 4JTEA 1Z32X 3T6CA 1DTUA 3VD5A 4D72A 4ZGYA 4GI6A 1EYWA 1UWRA 4C6MA 3V18A 4A29A 2YXGA 4EAMA 4PEKA 1DTNA 3QQ0A 3HZ3A 1QU4A 3DG7A 3MS8A 2GOUA 1M5WA 1DJIA 3DHPA 3I7QA 4LB4A 5HWJA 4ICMA 1VEPA 3MI3A 3P14A 4YL2A 5C2CA 3OTRA 2GQ8A 1LWIA 2HNEA 3UGVA 2F8QA 4OHQA 4N4PA 1E51A 4GJIA 4HZ6A 3TP4A 1D7FA 4L56A 3PHAA 4P7QA 3QXBA 3A4JA 3HO8A 5LXXA 4DO5A 4UTLA 4HU3A 5A6BD 3VE9A 3SQSA 4RNFA 2Y5SA 2V0TA 1NFBA 3PZTA 1A49A 3CAVA 3MV11 4K39A 4FX7A 5EBUA 2WAGA 2IS7A 3WK1A 1R47A 4C6KA 3RCYA 1NJJA 1ADOA 3ZZ1A 2OTDA 1HP4A 3TTSA 3WSUA 2HBVA 4ORIA 1TCMA 1JJKA 1CXIA 2BLEA 2EG8A 1I2QA 1OC7A 2WMHA 3ZMRA 1GG1A 1IZCA 4AIUA 2QGYA 3O8AA 3RDKA 3VC6A 4DJEC 1XIMA 2Z24A 4GUJA 4AHQA 2QMJA 1DIKA 5HQLA 4GMEA 2VD8A 4ZR8A 5CGMA 1PCWA 2Q01A 3VNYA 1FDZA 3KBMA 1BYAA 2OQLA 3LNMA 4BS0A 5D2WA 3V0SA 3GG7A 1NEYA 4ATDA 4GWEA 5AC8A 1C29A 1ONEA 4M6VA 4A3RA 5CJ5A 1BSIA 3EXSA 4WVXA 1R86A 3G22A 1PE1A 3FS2A 1ZS2A 1UWTA 4CNSA 3OIHA 5CZKA 4IFOA 3MI2A 1UJPA 3JU2A 4MUPA 1TPFA 1HGYA 2QVHA 4Q6JA 1XC4A 3IVTA 5B7ZA 1OGGA 3RLHA 4DBSA 3C52A 3RU6A 4K36A 3PWIA 1UOKA 4IL2A 3RMEA 2NQ9A 2G50A 4GZ7A 3EWYA 1ECQA 1XX1A 4QFUA 1Q8JA 3TKFA 3AMKA 3GNRA 1VBRA 4FLSA 1GTEA 3CNYA 2QZRA 4QM1A 5I03A 1WOAA 2CYGA 2Y4SA 4LBRA 3WD0A 1OABA 1Z44A 2ZRWA 2CBJA 1LG1A 1V6UA 1GQJA 4HU8A 1W2VA 4WJXA 3FYPA 1RD6A 4PUJA 2YJQA 3KWXA 2JF6A 2RUSA 2WKGA 2NXGA 5LYRA 1C9WA 1ZUAX 4J40A 4JQ2A 4RV3A 4R5EA 3UNDA 1A5CA 3K46A 1W9XA 1MUWA 1F3TA 1FWJC 2Y7EA 2X7WA 1J18A 1NP2A 2CWXA 3I3EA 1I1XA 5H8PA 1UA3A 1W9PA 1AJ2A 4RDWA 4JTHA 3T9PA 4P8UA 1K8YA 3LPFA 4C65A 3HG5A 1R3YA 2FPYA 3UA3A 2D69A 4KIEA 1EWDA 1ELSA 4EXQA 1V6XA 2YL5A 4HNNA 4I8YA 1JZ8A 5I2UA 4PUNA 3CIVA 1B3XA 3G1YA 2WOQA 4G8TA 4RNIA 1JPHA 1MRQA 3W7GA 4QJ4B 3T08A 2BTMA 2W4XA 1HQTA 1WNOA 3VX1A 1KM4A 1UIOA 1E70M 1X98A 3JR2A 4Z1DA 2I9EA 1FWFC 3VVGA 4J27A 3B9DA 3VNLA 1AQHA 3L65A 4GISA 3ZVIA 4OUIA 2ALRA 1FXQA 1KNWA 4PUEA 3PUEA 2HPIA 1J4EA 1QOXA 3GVQA 4AZCB 1M7XA 4QR6A 3A23A 1J6OA 3GTIA 4E4FA 3CH0A 1OFBA 3BLPX 2BG5A 2D2HA 1M7OA 2VZTA 3LCLA 4Q4KA 4DBDA 3UPWA 5KSWA 1UCWA 3B03A 2IW0A 1NY1A 4QXIA 1SFLA 1RSCA 4GINA 2PWUA 2AGTA 3EX3A 1PO9A 3C6CA 4I8DA 2WHLA 1TPDA 4PMOA 4BZYA 1ITQA 4LEFA 2FFCA 1Z48A 3KRSA 3LCWA 4Z1CA 3MT1A 5TBOA 5A8GA 2EJ1A 5BWAA 2OJPA 4WD0A 3GAYA 3GXPA 4PODA 3IANA 4A35A 3WX7A 2YBUA 5HMSA 4LUTA 3OZYA 4HA0A 5LA0A 1DWIM 3O0KA 1YLVA 3MP5A 1KBBA 1C8YA 3WBYA 1DJYA 3TJLA 4I9AA 2HXUA 5J5RA 3OHIA 1UPMB 2ZUNA 5CQ1A 2A7RA 4WJEA 5I00A 1C9DA 3FA3A 3RU8X 3GY1A 4GHRA 2CBUA 4WY0B 3IJIA 3E0LA 4KWUA 4R9OA 3V5CA 2DSWA 1KA9F 3KBSA 3P60A 1NWSA 1J0HA 3TJ4A 4JPGA 2CU0A 1V3IA 4DJFD 2A3EA 4NF7A 3RNDA 3M16A 2O0TA 4MY1A 4IUGA 1RY8A 3CGTA 4XWUA 3MZ2A 2FQIA 1JG9A 4NYUA 2CXEA 1MO0A 5C5YA 2JGYA 4PMYA 2YBTA 3NQFA 1OK4A 4UNLA 4MOZA 5BRBA 3FA4A 2P76A 3ARXA 1Q6QA 1V4YA 1EF3A 4DB7A 3B4YA 2ZC8A 4QSHA 1E9ZB 2VL4A 2JALA 3O6DA 1MXSA 2X1UA 1EJWC 4C60A 1NOUA 1KXQA 1KFKA 4PN2A 4UTMA 1YNQA 4PC8A 3W6MA 1BLIA 1GJPA 3EZ4A 3GU2A 3LCIA 1OBAA 1XLMA 1IR2A 4C1NB 3PJXA 1RBOB 2J8GA 3UWVA 4BI6A 1AQMA 3VCRA 5DMYA 5FD0A 4UCGA 3P0XA 2DH2A 1R9ZA 3Q45A 3REQA 4O0QA 1Q6CA 1QVBA 5CG0A 3WH8A 2PDQA 3DN5A 3KL0A 1ZBKA 3RIKA 2ZZ3A 4UOZA 5IHSA 4AY1A 3RFAA 3ZT7A 2ZE3A 4R85A 4B5VA 4UMAA 1RCOB 1HJXA 2HVMA 1VHCA 1LL7A 2DUXA 4LCQA 2VENA 1OFOA 1X6NA 2A6LA 1K8XA 3G5EA 3NYZA 2D2JA 2O55A 4L9ZA 1P0KA 3TN5A 3W82A 3EOSA 1PYMA 1J2WA 3ZWTA 4Y8FA 1X7FA 2V5CA 4OOUA 3E0VA 3WH7A 2WQPA 4S3CA 4N02A 2QCFA 4LOCA 1Q13A 2VEFA 3W7JA 3GDBA 4M51A 2ZA1A 3AXHA 3WJSA 3STEA 1K6AA 5A5WA 4V28A 4GCXA 1OSEA 4URIA 1G01A 5JBEA 3BW4A 4I3GA 5KZDA 1UWSA 1PHQA 2XU2A 1E0U