1K7XA

Crystal structure of the beta-ser178pro mutant of tryptophan synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
254
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k7xA00
3I68A 3NQMA 2GVGA 1ZAJA 4W9TA 1G7UA 3HG4A 3SJ3A 4LOCA 1V5XA 1FDZA 2QCFA 3ABOA 1FWTA 1AK5A 1TREA 2VC6A 3QPYA 1JCJA 4O4WA 5EY5A 3EX3A 4PH6A 3RLVA 1H60A 2ZDRA 2E6FA 1SSDA 3E9AA 4N02A 2AGKA 2E6YA 1A5SA 4UTUA 1ICSA 4GXMA 4JNMA 3GK0A 4JXCA 2QDHA 2CWNA 3DFQA 3GDKA 3GB6A 3WFAA 3ZS4A 2WJZA 5I3HA 5D02A 1SZFA 1QAPA 3C56A 1AL8A 4O1BA 2C14A 3MO7A 2GQ9A 3BVJA 4TR9A 3SIZA 3NM3A 4TU1A 1WDWA 4UTKA 1FDYA 4IMCA 1Q45A 3ATZA 1CW2A 1UB3A 2CFFA 2X1TA 4HNUA 3S42A 2Y70A 1KLYA 4RK8A 3M1ZA 1YTKA 3O6YX 2ZCGA 1KM6A 1KM0A 1W5OA 2RDWA 5DY2A 1GEQA 2Y89A 4RX0A 5G2IA 4IQLA 4A22A 2EHHA 1NVMA 2V9DA 5CPOA 5AHNA 3MYOA 4C1KA 1I2NA 1KBIA 1W5NA 4JTGA 3SR7A 3MWAA 4HPXA 3C2OA 3G1DA 4IGHA 3NL6A 3NQGA 3B05A 1ZNNA 4JR5A 4LRSA 4QNWA 3NL2A 2CLHA 3W1MA 4MOZA 3C2FA 5MHBA 1DV7A 5AYYA 4GFSA 3ABRA 2Q8ZA 4AH7A 4LS1A 3WJYA 2R14A 3P7YA 1HFBA 2J88A 1AW5A 1SZEA 3NR0A 3EWYA 1H1YA 1G4PA 3TUUA 3L0NA 1SO3A 4FEZA 1QO5A 3W1NA 2ZZ2A 3DGRA 1FWNA 2Y7EA 3W7LA 2VENA 4JTKA 2DZSA 3BLIA 3CB8A 3UY8A 2NX1A 3O6DA 2YYUA 2B0MA 5F4XA 3VCRA 4RR4A 3PBWA 3QYQA 5H91A 4M7TA 3PBUA 2FLIA 4KFOA 4JTSA 5DCBA 1T0OA 3NQDA 4FIQA 4CLMA 3L5LA 4NX5A 4E0CA 5H2ZA 1LP6A 3NPUA 3GVGA 4JTEA 1RQHA 3BGJA 2YXGA 4K38A 3W1RA 4LU0A 4FNRA 3W2LA 5IM51 2DZTA 1ME7A 2WNNA 4GBUA 4O10A 3USBA 2YGYA 2ZZ3A 1D3GA 4NJJA 4L4MA 3EXSA 5FI8A 2ZZ1A 2OMAA 5FF3A 1KV8A 3P60A 5CG7A 2QJIA 3KRZA 5D2TA 4OWGA 4UCGA 2WNZA 5AC6A 4HNVA 1H7WA 4IPIA 4LWWA 3P5ZA 1YYAA 4ZZ9A 1OFEA 1QOPA 3GR8A 5DBTA 1GVSA 1H63A 4D2JA 1TB3A 5DCEA 2CZEA 4RCXA 5F2MA 3M44A 1KM2A 1XBVA 1FXPA 3W7HA 3B8DA 2ZZ4A 1JCXA 3TXVA 2G95A 2X30A 3VE9A 1YXCA 1QPQA 3GIYA 1GT8A 3E96A 2PURA 3W2UA 4JIPA 4I7VA 3B06A 1SW7A 2A1YA 3GYEA 1VHNA 3G1AA 2X1SA 4J9JA 2W79A 1HL2A 3M5YA 4HNTA 2QUUA 4OQVA 2ZRUA 4LV9A 1JCYA 3LBCA 3VKJA 4N4QA 3LHVA 3TJXA 5K4XA 3BG3A 1AMKA 5L6UA 3G0UA 1O94A 4E2BA 4FX7A 1TPWA 3MUXA 4A2SA 3QC3A 2FJKA 3KXQA 3GKAA 5D33A 3MJYA 1MZHA 2H90A 4LC8A 2Y63A 2V82A 4Z1CA 3NXFA 1JUKA 1AW2A 3CU2A 3QFEA 4N4PA 5CZTA 1DL3A 4JTIA 2NZLA 1GYLA 3DKLA 5I3GA 1I8JA 4UTTA 3OBKA 4M19A 3KFTA 4UTTC 5D2XA 1GWJA 3C2VA 4CNNA 2ISVA 5F2GA 3RK8A 4R53A 3MMTA 1RD5A 1TRIA 5KZDA 4S2CA 1LTDA 4A3UA 1VS1A 4ZQNA 3HPSA 5D03A 3THAA 3UWUA 5CZ0A 3QSTA 3UWQA 4NXSA 2B7NA 1K3UA 4UTHA 1RQBA 4FNPA 3B0UX 3G1FA 4O50A 1VCVA 1SO6A 4O18A 5G1YA 4CQAA 1NF7A 1S5VA 1YXDA 2J9ZA 1AG1O 5I3KA 1VJIA 2RFGA 2C19A 3UNDA 1N7KA 2PC4A 3W1TA 1GQNA 3KAOA 4LY8A 1SO4A 4A2RA 5U4NA 2ZRXA 1OF6A 1Q6RA 3OVRA 1H7OA 2Z6JA 4OT7A 2E77A 1H7RA 4UC5A 3P82A 5AC8A 4HIBA 1PCKA 2I9EA 5DXXA 1H51A 3NQ6A 4MFDA 1S5TA 3CQ0A 1JCMP 4AF0B 3NL3A 4GUIA 1XBXA 1C9DA 3V1PA 1XXXA 4PC8A 4AHOA 4WJEA 5CPLA 1GG1A 3HGOA 1EPXA 1KM3A 2HS8A 3UWWA 2YW3A 1T96A 1WBJA 4U28A 3BG5A 4ONVA 2DZXA 2YFNA 5FF7A 3G1HA 5A5WA 5EA9A 5K3VA 5TQLA 1VYPX 3L5AA 3QPZA 3QRHA 4WY0B 1SQ7A 1O4UA 3HGJA 1OF8A 4UFLA 1L6YA 3L21A 3TMQA 3W07A 5EPDA 4FNUA 4DO5A 2PCQA 2TRSA 3BARA 2E6AA 2X1UA 5E0KA 5K2ZA 4JN6A 5DY3A 1OK6A 4WOZA 3P8IA 3W9ZA 2BLEA 2PRLA 4DF1A 4FNQA 2P0OA 4NNBA 3RU6A 1I2RA 2J6XA 2JKPA 3CWNA 2FTPA 3L9CA 3LCXA 3LI1A 3IIPA 4O17A 5F2LA 2NXHA 3QH2A 4O0ZA 4NJHA 1TV8A 1RQEA 1M7PA 4HKPA 2CLFA 3IIXA 3LBMA 1HTIA 3A5VA 4DXVA 4CCCA 2A6LA 2UV8G 1KM4A 1TJPA 3EXTA 3HG2A 3GXTA 1IXNA 1GVFA 2YDAA 2ZZ7A 5HUPA 4QSHA 3JS3A 2KZHA 4JD4A 1ZJIA 1TMHA 4XUGA 5CSRA 4JDBA 5HNRA 1JCLA 3BG9A 1OX5A 1JJKA 3MI3A 4JDYA 1LROA 3HB9A 4RV8A 4X2RA 4UR8A 4ZQCA 3KVMA 3L65A 1IGSA 3CEPA 4UXDA 5AHLA 2HTMA 1KV5A 3WK2A 1VPXA 4Y96A 1XUUA 2ZRVA 4MUZA 3U8GA 1QWGA 4M5PA 3WJXA 2NWRA 3W83A 1QDSA 3PM6A 2NV2A 4B5NA 5DCDA 2QCCA 3LV5A 3M5ZA 3LHTA 5DXYA 1ZCOA 1NAL1 3BPWA 3M41A 3L68A 3WJWA 4MZ8A 3P80A 1TV7A 1QCWA 1OYBA 2F84A 3EWXA 2DZUA 3PC0A 3W2MA 3HG5A 1W5MA 2CZFA 3BGGA 4PFMA 3S9YA 1FUYA 2TSYA 4BK9A 4RXGA 4M7SA 1A5BA 2YCEA 1K7EA 4EOUA 4YXGA 5C6MA 3HF3A 5AHIA 4PEKA 3TIMA 4XTDA 2FPYA 3LERA 1X6UA 2NUYA 3UXAA 3TE9A 3PS7A 4PL1A 3UWVA 3GDTA 4UTWA 4IMEA 5C2XA 4UTWC 4Y6GA 3F1QA 3B4UA 1A5AA 3SW6A 5G4WA 3A23A 3PB0A 2VFIA 1SFLA 3W7QA 2R8WA 3UXDA 3EB2A 3T44A 1XDMA 3RLUA 5CKSA 1VHCA 1W54A 1ZALA 1UCWA 3M43A 4DF2A 3C52A 1ICPA 3U2OA 1RPXA 3TDFA 4A29A 3DFOA 4AF0A 3BLFA 1Z41A 3LRKA 4JYDA 2A7RA 1FWRA 2LLEA 4X3ZA 3FEMA 1XL9A 2A5HA 3EX2A 3R8RA 5A8GA 5CZSA 4LVBA 4ORIA 1GVQA 3WK3A 3CT7A 2NWSA 4BFAA 2V30A 1KLZA 3G1VA 3LHYA 3TCEA 1O60A 2H8ZA 3LTSA 2X2GA 3W76A 5F4WA 3TQKA 3DH7A 1F76A 3CLMA 3NOEA 4WY0A 1KFLA 3SZ8A 3TQVA 1OYAA 3B03A 1LLWA 1F5ZA 2FPTA 3WJZA 4M6PA 4LUIA 5HUOA 4FXRA 2W6RA 1VCFA 2J24A 3FA5A 4DBDA 1VLIA 1JR1A 2QJHA 2V0TA 4N9BA 4ZQRA 1GPWA 3IGUA 2C13A 4Q33A 4XBSA 4CQ8A 4JTHA 4Z1BA 1FCVA 1JVNA 2C15A 4KKXA 4N6EA 1UUMA 1DVJA 2GOUA 3NM1A 1OVDA 2E09A 5DELA 1FCBA 2AQWA 3MP4A 3TH6A 1TPC1 3DAQA 2JBMA 4E2DA 3A5FA 1W0MA 3TX9A 3LCIA 4XQ6A 1B3OA 3FS2A 4FX6M 2E6DA 3S0CA 1PHWA 1HUVA 3CC1A 4NJIA 3TC7A 3EWBX 3DU0A 4RZ5A 1M5WA 1OFAA 4POCA 1OFBA 4QITA 5TBOA 3R5EA 3LGEA 3W1PA 4O52A 2IQTA 1VCGA 3S1WA 1F74A 4E38A 4NU7A 4TX9A 1EUAA 1I2PA 3L5MA 3GZ3A 2ATSA 2HMCA 4PCFA 2VEKA 3OVPA 1VRDA 3PG8A 5K4ZA 1EP2A 4Q4KA 2VEMA 3W70A 3HBLA 1TPUA 3KOFA 4BR1A 3TNOA 4GE8A 4JX5A 3G8EA 3GDMA 4R7JA 2H6RA 2J27A 1ME9A 4Z1DA 2YZRA 5HR7A 4LUJA 3M16A 1IXOA 1CX9A 2CLOA 1H5YA 3EX1A 2FQIA 4TMBA 2Q3RA 5F4SA 3NNTA 3E12A 3QMSA 1KFJA 3DI1A 2C16A 5D2VA 1B57A 1OFDA 1NFBA 2PE4A 1PHQA 1SSGA 2CU0A 2NXIA 3M7WA 1BTMA 5HWMA 4AMAA 3A21A 3EWWA 2OT1A 3FOKA 2VEPA 2QKFA 1EA0A 3QJAA 3C2EA 2ZQ0A 5FF4A 1I2OA 4KWWA 3GDLA 5KMYA 4RZ4A 3H54A 6TIMA 4MKNA 4DQWA 3FYPA 4ZMGA 1NSJA 3OVQA 3PSWA 2Z2UA 3OHIA 4MYXA 3T55A 3SSJA 3DENA 4ICNA 4MVAA 3DFTA 3NPWA 4ADTA 4K7VA 3SY5A 4ZQPA 1KTBA 3M0ZA 2VFDA 5AN7A 3G8RA 4CNOA 5K7JA 3CTLA 3L2IA 1ONRA 2DZVA 3NDOA 1LDCA 1W5PA 4JX4A 3GKFA 1PV8A 2E5CA 2ISSA 1MEIA 2RDUA 4GRSA 4O4VA 3NYZA 1X8FA 4ZQOA 4DPQA 3QMRA 4IMFA 2Y7GA 3B0PA 3HPXA 3NQVA 1GVRA 5LGXA 1WYIA 4LVGA 3QW4B 4I7WA 5FF0A 1YPFA 4FNTA 3WK0A 2O7QA 1SPQA 4I9AA 1QR7A 1G69A 4O14A 3P8JA 1J5TA 1LYXA 3W71A 2CLMA 3EX6A 4C1LA 5BRBA 4GUHA 5E1QA 4ADUA 2WQPA 3S8HA 1OFPA 1H7NA 1VQTA 3MBFA 3D0CA 4UFIA 4EIVA 1PL9A 2J9YA 2FIQA 3W72A 2QJGA 1BKSA 1ADOA 3G3MA 1IXPA 5D2WA 1YLVA 2JGQA 5K9CA 5HWNA 3PR2A 3QQ0A 3CM4A 3TROA 2OCZA 3UWYA 2ZA2A 1L6SA 4QIUA 3HJZA 1SR9A 3FKRA 1OX6A 2C0AA 3NQFA 4KFPA 1OK4A 3PBYA 4NNCA 1TQXA 3L0GA 2BZNA 3NG3A 2GJNA 4ZVJA 4OGZA 4QISA 1W31A 1X7FA 3BLEA 3QF0A 5FESA 7TIMA 2J9XA 1RV8A 1OABA 3NGJA 2A7NA 2WKJA 4IWWA 2ZRYA 1LRTA 3LLDA 3ELFA 1GG0A 4HT3A 4R34A 1JUEA 3DFNA 1SO5A 1FDJA 3IVSA 3MBDA 3NZRA 1BEUA 1VGAA 3IGSA 1TPDA 3ABQA 1KFCA 4HNNA 1I45A 4YWIA 1F2JA 3NQEA 4R33A 4Q32A 3RF9A 4O57A 4O1DA 5IBXA 2ABAA 3VE7A 1R2SA 3TA6A 5IBXC 1XM3A 2CW6A 1T8XA 1YPIA 3UY7A 4KFNA 4UNKA 1S5WA 5LNRA 2VOMA 1W8SA 2QCEA 3DKJA 2DJLA 2E5DA 2ABBA 1B4EA 3P67A 3THQA 3NL5A 3TKFA 3TV8A 2FB2A 4Z1AA 3QEZA 2GUUA 3QZEA 5FEPA 3W7NA 4ORMA 1B4KA 2OJPA 4JS3A 1R2TA 4UTJA 4M6QA 3L66A 3TMLA 1F73A 2QF7A 2RKXA 2D73A 4UIOA 1WX0A 1EEPA 3E02A 5AHEA 1J2WA 3LTYA 3LDVA 4O53A 4N2YA 5D32A 5LNWA 1F05A 1W37A 1M7OA 3T78A 1SW3A 4I7UA 3TQ0A 1OYCA 1D3HA 3ANYA 2TPSA 5DLCA 3STFA 1DHPA 5EBUA 1PE1A 4BI5A 1P0KA 2QCGA 4H4IA 1WV2A 3N34A 1KM5A 3B0VC 1YTDA 3W2JA 3A22A 3VNDA 1R30A 1XFBA 1PS9A 4RKAA 4MY9A 2QCDB 1XKYA 4LS0A 4UMAA 2QCLA 5U7SA 1MEWA 3O07A 4DO6A 3W74A 4CCDA 4YCOA 5CSSA 2A85A 1G4EA 4XWUA 3SI9A 1TJRA 3JR2A 1Y0EA 4IMDA 3UWZA 2CLIA 3NAVA 1OHLA 1IIGA 5L9FA 1XCFA 3W86A 3DXIA 4BI7A 1K8YA 3H53A 5DBUA 4IXHA 5LZLA 1GVOA 1Z44A 4PTNA 4K37A 4DBEA 3PULA 3NO5A 3R13A 3HOJA 3DHDA 3UD6A 3LHUA 1GTHA 3FFSA 4TMCA 2DU2A 2A6NA 1FY6A 5FF2A 4WXZA 1LBLA 3PSVA 3TAKA 4CCEA 5LNSA 1DOSA 3R89A 3SGUA 2Y7FA 2CZ5A 4JTTA 2WO5A 1DORA 5D2YA 4NJGA 4AHQA 4JY9A 4O13A 3EKZA 1VR6A 4O15A 4O1AA 3LCGA 3O8AA 1EWDA 1XUZA 1U5JA 1A5CA 1OFOA 1WOBA 1WAUA 3O6CA 4OV9A 2QUVA 3WJSA 2VFGA 4EF9A 5D30A 2DZPA 2OT0A 3W1AA 4BWLA 1QO2A 3RFAA 3NEVA 3R2GA 4BWLC 3F03K 1IF2A 1W3NA 4YLWA 3P84A 3P5YA 4UNLA 2ZZ6A 4KWVA 4O1CA 3G1SA 5KITA 1ML1A 4N9CA 5G2WA 5EYWA 1F6PA 4WY0F 1GZGA 2O7SA 4UUIA 4MY8A 4QJ1A 1THFD 2BXVA 2OX1A 3GAYA 3NQAA 4YMZA 4LT9A 5TIMA 2ZA1A 1ICQA 4UMBA 3INPA 3I7SA 2A21A 1UASA 3LRMA 2QCNA 1YADA 1AL7A 1L6WA 3W7OA 1TQJA 5AHMA 3IVTA 1XC4A 3EXRA 1A50A 1W5QA 2Y85A 1KFBA 3IIVA 3MW7A 5CPMA 2QDGA 4MLRA 3OA3A 3LXAA 3G0XA 3PWAA 2ZBTA 4O54A 3N14A 3HIJA 2JKEA 4AEOA 1P4CA 1TO3A 4YL2A 4UTMA 4X22A 2VFEA 3PAJA 3QM3A 2FPVA 3W7DA 2YX0A 1TPFA 4K8EA 4WX2A 3S1XA 2F7FA 4UMCA 1DQXA 2P1FA 1XDLA 3I6RA 3LOTA 4PA8A 4RLIA 3NQ8A 3TFCA 1K7XA 4QQ3A 3TSBA 3W22A 3PUDA 2R91A 4LV4A 1K8ZA 3LXBA 4Z08A 4O8RA 4OBTA 1GJPA 3TJLA 3GNNA 3KVLA 3TR2A 1U83A 3VFLA 2BTMA 1KA9F 1LOSA 4JTJA 3W7MA 1Q6QA 5HWJA 3GAKA 2C3ZA 1YDNA 2CLEA 4AXKA 1VZWA 4PODA 2X1RA 4WOQA 1PIIA 5KINA 1HO1A 3NA8A 1D9EA 2DZWA 3CIWA 1CI1A 3BW3A 3A24A 3MI6A 2E68A 3ABSA 3W7EA 2QCDA 2WNQA 1R47A 1YXYA 4MIMA 5CZJA 1TYGA 3GLCA 3MHFA 2B7PA 3HPZA 2ATMA 1WXJA 4LS2A 1KFEA 3T7VA 3TFXA 3SECA 1TV5A 1Q6LA 3NQCA 3P74A 2CLKA 2Y6ZA 3G0SA 4EVZA 1TPH1 4O0KA 3C3NA 3OEXA 2BWGA 1FXQA 1VC4A 3C2RA 5LNUA 2WSRA 4IPJA 1QFEA 5AOUA 2ALDA 2QCMA 4OV4A 3SFKA 4DEFA 1C8VA 4BF9A 3HQ1A 3O05A 2TYSA 2Y7DA 4DELA 1SZNA 3TC6A 4GWEA 1W3IA 3W7RA 4P61A 4UFJA 1DKWA 2G5WA 5D09A 1KTNA 3W88A 2XFWA 3LX9A 1MEHA 1FBAA 2OZ0A 1W56A 3QMTA 2XN0A 3EKLA 1I2QA 2FDSA 3N9SA 1P0NA 3LTPA 3W23A 4DF0A 2WPBA 2HS6A 1O95A 4RXFA 3CIXA 2VFFA 5SWUA 3IV3A 1QPNA 1XBYA 2W0UA 3BV4A 3TSDA 4N6FA 1QOQA 1LM1A 2H3DA 5K9XA 4LVAA 4NQ1A 4NZFA 3KRUA 1LCOA 3O06A 2R94A 4Y90A 4K7YA 4CQ9A 1SW0A 2H3BA 2YR1A 5LHEA 1FWSA 4NT0A 2B7OA 1LZOA 1Z42A 4WUIA 1H7XA 1F7BA 2WSYA 1JUBA 3I7RA 1QPRA 4AAJA 3E49A 3W6YA 2NX9A 3G24A 3BW2A 1WOAA 2Q3OA 3LCWA 4JICA 1SUXA 4JYEA 4NVTA 2VFHA 1RR2A 4QM1A 3GNDA 2VXNA 3IVUA 2ZFAA 3ZFHA 2V81A 5GVJA 4N9DA 5I3FA 2QEZA 4Z0SA 3MP3A 2WOQA 4GUFA 5BOOA 1G6CA 1FQ0A 2GVLA 4IUOA 1O5KA 1UJPA 3TW6A 1SZGA 2GQ8A 2PRMA 3P62A 3TXZA 1R46A 2EAWA 1AW1A 3G18A 1K7FA 4UFHA 4PL2A 1FCQA 1OX4B 1Z48A 3V75A 4OU1A 1LRNA 1X1ZA 1K02A 4GC4A 2DP3A 3W7IA 1PVNA 2V5BA 3W7PA 4A21A 1TTPA 3A9IA 5HULA 3FYOA 3LXCA 5LHFA 3LHZA 2NUXA 1WA3A 3L67A 2YW4A 4FIRA 5LNVA 1GOXA 1VYRA 2A0NA 1UBSA 4ML9A 4JGDA 5F1VA 1FCUA 3UZJA 3W2KA 1LRQA 2QCHA 3W7GA 3F4NA 4ADSA 5LSMA 5FEZA 2V5LA 4GNJA 4HN4A 2BX7A 4MJZA 2HSAA 4DO4A 2EGZA 5C54A 3GR7A 2EF9A 4IX0A 4MZ1A 2XN1A 4O16A 4UFKA 4X9SA 3S5OA 8TIMA 3NZ1A 4JTLA 4CNPA 3GX9A 1H62A 1SFJA 2DORA 5FEXA 2Q8LA 3ZWSA 2FB3A 3STGA 3LI0A 3U6WA 4MPQA 4ALDA 1JCNA 3IIOA 3NQ2A 1MSSA 2ZYFA 3W1LA 2V8ZA 4H3DA 3R12A 5HINA 1LBFA 1G67A 5G1TA 4MZYA 4LVFA 2ISWA 4RZ6A 3RMJA 2ZTJA 5K9DA 4XZ9A 5BW6A 3Q2DA 3C4UA 3PUEA 4O19A 3C61A 3LCHA 4HHPA 4HPJA 3HG3A 1MO0A 5KSWA 1YTEA 2Z0IA 1HG3A 2ZZ5A 3NVTA 1UUOA 3IEBA 1EX5A 2NXGA 1XBZA 2VEIA 1Q3NA 4EWND 5I3IA 2RDTA 3NPVA 3UQNA 5BMWA 3IGXA 2QUTA 4XBKA 1EIXA 3OIXA 4IOTA 5G5IA 1TPB1 5F1UA 1K8XA 1ZHAA 4WQ6A 3LB0A 4LRTA 3AJXA 3YPIA 5FEWA 3TSMA 4S1FA 5LKYA 5J5RA 3IIZA 1FX6A 5CGQA 4NXKA 3GDRA 1OG0A 1TCDA 3PBVA 3W2NA 3W87A 3CPRA 1RZMA 1VLWA 1H7PA 3STEA 3DFSA 3G3DA 5AYZA 3UPBA 4M6VA 5ABTA 3TAOA 1J4EA 1JQXA 4FB7A 3O15A 3N19B 3S1VA 4AHPA 1KBJA 4MYAA 2I1OA 1K03A 3M9YA 1NEYA 3L0KA 3LLFA 4NUWA 3W7KA 3K30A 4QAIA 5J5DA 5F2IA 3G22A 3FJ6A 3FIGA 4DPPA 1XI3A 4FF7A 4HSOA 3GXNA 1TIMA 2YYTA 2Z1BA 3FKKA 1OFQA 4JEQA 1ZAHA 2G96A 1Q6OA 3O63A 3O16A 1T99A 3G1YA 1YDOA 1TTIA 2Y88A 3MYPA 1EP1A 3S5NA 4K39A 1G4TA 3VI2A 3E0IA 1LLZA 3CEUA 5BNKA 2YPIA 2GPTA 5DN1A 1OX4A 3PUOA 3TW7A 4FO4A 2A4AA 4TIMA 3T40A 3CHVA 3WK1A 1H61A 4OHQA 4UTLA 3M6YA 3S5YA 3KVJA 3F4WA 5LGZA 3S5ZA 3UZ5A 2C6QA 1ME8A 1X1OA 1I4NA 5HJLA 1QMLA 1VH7A 2A7PA 2EPHA 5AB3A 3T4CA 1KFKA 1WQ5A 3MP5A 2X16A 1C29A 4JX6A 1OJXA 3EWUA 1W3TA 3G1XA 3C0JA 3EWZA 2JGYA 3M5XA 3NQ7A 1LORA 2B7QA 4IX2A 1W1ZA 3W1XA 1E51A 1GTEA 3TK7A 2GVJA 5D37A 3RNDA 2XN2A 3CWOX 1B9BA 1SU5A 4JY8A 2CZDA 5C55A 3DI0A 3LM7A 4FX8A 1LOLA 1HO4A 3NPXA 5D05A 5EMUA 1P5BA 1GYNA 3ATYA 1DQWA 4NNAA 3H55A 3FLUA 1RVGA 2G97A 3PVFA 2GQAA 5KZEA 1OFRA 4GUJA 1L2UA 4Z0JA 1FWWA 2QAFA 4FNSA 4WXYA 3BW4A 5KZMA 1TRDA 1JRBA 4UFMA 2AAMA 4AWTA 1N8FA 2E1DA 3KX6A 3GXPA 1ZENA 4K8HA 4UR7A 4XKYB 4Y8FA 3Q94A 1H1ZA 1DBTA 3S1UA 4WZHA 2NLIA 2YFOA 3DBPA 3BO9A 2H8XA 3OG3A 3W73A 1IXQA 1DJNA 1DJQA 1ZY9A 3DZ1A 1L9WA 4IMGA 2ZRWA 3O1NA 3C6CA 2YSWA 3KRSA 3LRLA 1S3HA 2ZA3A 5D04C 4LW7A 1KW1A 3LCLA 1NF0A 2P10A 2RHGA 1TTQA 5KTLA 1KM1A 5I3JA 5AFDA 3ZR4A 3MHUA 4OE7A 5AC7A 3PF3A 5HQEA 1P1XA 1BWLA 3W84A 2VKZG 3HGSA 4AB4A 2E5BA 1KTCA 4MFEA 4JIQA 1JQVA 4MLJA 2NV1A 2WSQA 3STCA 3MHGA 4S2BA 5EL1A 3N3MA 3BK0A 1VYSX 4BI6A 4ZL1A 4FHAA 5HR6A 2C1HA 2C18A 2ZTKA 4O28A 4RJEA 3W85A 4U4MA 2V2DA 3W75A 4FXSA 1TSIA 5BMXA 4H6KA 4GUGA 1TPEA 2ZRZA 2DJXA 3B04A 1R2RA 4P2VA 2WV8A 2A2IA 3IRDA 3W3OA 4IXXA 4AWSA 3HMJG 4EF8A 3PY2A 3Q58A 4LC6A 2TMDA 1QNVA 3PG9A 2BSLA 1BWKA 2PRHA 3HO8A 5AHFA 1JRCA 2JK2A 2Y61A 4LTSA 3S6DA 3W1QA 3P81A 2V2CA 1O5XA 2NX3A 1M6JA 5AYXA 4JYFA 2Z6IA 3DFPA 1H50A 4XTIA 3LCFA 1QPOA 1V7YA 3N9RA 5EKYA 1IIHA 1EB3A 3FJLA 1PCWA 2CLLA 4GJ1A 1TTJA 3Q37A 3ZWTA 3EEGA 3PB2A 3QQ1A 1JULA 1YDVA 4YCPA 1LBMA 1EWEA 3MI2A 4IJBA 1N55A 3SGZA 1EP3A 2QR6A 3LV6A 4LVDA 3DHFA 4AVFA 4QNEA 6ALDA 3I7QA 4MY1A 1WBHA 4TO8A 5G4EA 1G7VA 1ZFJA 4WD0A 5HMSA 4JTFA 3KHJA 3I65A 3N73A 4G1KA 4UTIA 2Y62A 1MXSA 5D38A 3TU9A 3N2XA 4NX0A 2I14A 3W7JA 2GJLA 4LNYA 4NZJA 2RH9A 4K36A 5E93A 2EKCA 3UPWA 3LHWA 3UYCA 4AWUA 4ZQMA 3QSRA 3QW3A 5G2HA 3JRKA 1G4SA 4HSNA 3KVKA 2B4GA 4MJMA 2QAPA 1TPVA 5CPNA 3P61A 4O12A 1A53A 2JKAA 5T26A 3EX4A 4N9EA 3N2MA 4Y9AA 3M47A 1F6KA 2VELA 1ZAIA 4JTUA 3AO0A 4K6AA 1LOQA 2NUWA 4O11A 2FFCA 3W7CA 1EUNA 2V2HA 3C8FA 4NJKA 4L4LA 3W1UA 3M5VA 3HGRA 4XKYA 5C5YA 1ALDA
chains in the Genus database with same CATH superfamily
3I68A 2GVGA 4WJXA 1Z7AA 1FDZA 2QCFA 4GKTA 3EB4A 3STPA 3WF3A 1FWTA 3BCFA 1AK5A 2GGEA 1EJ7L 1TREA 2VC6A 1JZ2A 1SYTA 4O4WA 5EMKA 1ECEA 3QZ6A 3W26A 2Z2BA 5FD0A 1K77A 3GXFA 2P50A 1VEOA 2VQTA 3MPGA 3GK0A 2XWDA 1ONXA 2Z1KA 2Z1XA 4GGBA 4XZNX 5A6SA 5I3HA 3C56A 2PDWA 4GZJA 2GQ9A 1GHRA 1U33A 2F6XA 3ARUA 4MB5A 1XP3A 4GX8A 4UTKA 1KBLA 3GR4A 4IIFA 3ARXA 4YTUA 1CW2A 1Q6GA 4HMEA 2CFFA 3ZM8A 1DWGM 4HNUA 5BU6A 3PZQA 4RK8A 3WH7A 1DJWA 4IPPA 3ZXWA 1WZAA 1KM6A 5IDIA 1G1YA 4JQ3A 4JL2A 3TYBA 4RX0A 4IQLA 2XIBA 4KWUA 4Q8NA 2V9DA 3MYOA 3GG8A 4HNCA 4GNKB 2QIWA 8CGTA 3V16A 3SR7A 3MWAA 4HPXA 3G1DA 1XQKA 3T8LA 3OLGA 2FVMA 3NL2A 3S2CA 3VZZA 3BSMA 3PJTA 4GFSA 3GG1A 3SM0A 3UF9A 5G4HC 4LS1A 2QPSA 3WJYA 5A6MA 2E8ZA 3P14A 3NR0A 3OLEA 4L6OA 1G4PA 4PN2A 5LIYX 1GQJA 4QBXA 3K8LA 1RD6A 2Y7EA 5A69A 3NUKA 4H7CA 3CB8A 1BTCA 5FJTA 1HJWA 3UZXA 2PLMA 3APYA 2B0MA 5LA0A 1BKHA 3PBUA 3CUZA 2FLIA 4KMQA 4KFOA 5HDRA 4ERIA 1NP0A 4UQEA 2PWEA 3L5LA 3U5YA 4NX5A 4CD6A 3N2CA 1LP6A 4NAFA 5XIAA 4D71A 3MWCA 1Q65A 1CPUA 3VGEA 1OINA 1R0MA 3TN3A 1YMYA 2WNNA 4GBUA 4O10A 3USBA 2YGYA 2ZZ3A 2AL2B 5I6SA 3CAQA 3IJDA 4HB7A 5FF3A 1W9VA 4AX6A 3B8IA 3MUZ1 3WQWA 5D2TA 1M65A 1DWIM 4XD5A 3A4AA 2O9PA 5AC6A 1EZ2A 1BSIA 2FMOA 4LUTB 3KCOA 4QCFA 5BU9A 4F4RA 1UG6A 3C5QA 7TAAA 3R0UA 1QOPA 4D2JA 4ZE4A 3JZUA 4W7WA 1KKRA 4PB3A 1KM2A 1JCXA 2QJNA 1YXCA 3M0YA 1RJPA 3ITTA 3H7UA 1SW7A 2A1YA 2J74A 3WQ8A 5JBFA 3OJGA 4J9JA 3M5YA 3FHQA 1PTAA 2D2OA 4RDYA 1UMLA 5G1MA 2PA6A 2JEPA 1I1XA 4A2SA 4L1XA 3KXQA 3GKAA 3M46A 5D33A 1R9ZA 3MJYA 3QOKA 2Y0FA 2H90A 3UVAA 3GXMA 4IHCA 3VILA 2Y63A 1S39A 2DZBA 2W67A 3MS8A 3NXFA 3CO4A 3CU2A 3QFEA 2GVEA 5CZTA 1H41A 1W1PA 2J77A 4HHLA 4UZSA 1J96A 4NL1A 4LY4A 3OBKA 4L5ZA 6PTDA 3KFTA 2XWEA 5D2XA 3C2VA 4FF5A 5F2GA 3RK8A 3Q65A 4J3WA 1XRVA 4E8DA 1TRIA 1YEYA 3VOJA 4S2CA 1PTGA 4HZ6A 4ZQNA 5D03A 1V0MA 2G37A 2XVKA 3MDWA 1J12A 2WJFA 1IT7A 3W25A 4XSMA 2ZX8A 4BEUA 2B7NA 4UWMA 2J7BA 2W62A 1EX1A 2PWGA 3REQB 2O9OA 1YNPA 2GDUA 4PUUA 1PUDA 1SO6A 2D3LA 1S5VA 2J9ZA 1YXDA 4OECA 3AXXA 4DIAA 4QR6A 4D6HA 4A4AA 1IZKA 1W91A 2Z6JA 3HQOA 1H7RA 5M1TA 5JU6A 1O1HA 1PCKA 2I9EA 3FCPA 4H7ZA 4H6RA 5DXXA 4AFYA 1S5TA 3CQ0A 3AYSA 1WZLA 1PAMA 4GUIA 1C9DA 3MCOA 4A8RA 4PC8A 1ZJBA 1E0TA 3HGOA 4DM2A 4JQAA 2HS8A 1WKFA 4EPDC 1UWAA 2YW3A 3UWWA 1WBJA 3A4XA 4U28A 1IV8A 3EPNA 3FAXA 4WEVX 4V33A 3V1HA 3BLPX 3QXBA 3G1HA 3CUJA 3BLOA 5TQLA 1VYPX 3AAMA 1XWYA 1XPGA 4WY0B 1RLDA 1E3ZA 3MV11 4FNUA 4B4HA 3UG5A 3A64A 3BARA 2TRSA 3OA5A 2X1UA 4E5TA 1F4AA 3W9ZA 2D69A 1WDSA 4DF1A 1TV2A 5HNUA 3ALFA 2DSZA 3VMOA 4Q7NA 1CLVA 5EMMA 3LCXA 3LI1A 2PWHA 2QULA 2NXHA 4IG2B 1EDTA 3SCSA 4GVHA 1HTIA 3AIEA 4CCCA 1QNQA 1R3YA 3FN9A 5T9CE 3EXTA 3HG2A 3GXTA 1GVFA 3H6OA 5HUPA 3D6NA 3MANA 4JQ2A 3JS3A 4GYPC 2VX6A 1ZJIA 5CSRA 3ALGA 5HNRA 1JPHA 4GG9A 1JCLA 1UQZA 8A3HA 3HB9A 3VD7A 1CGVA 4X2RA 4ZQCA 4CU8A 3KVMA 5BXTA 6ENLA 1IGSA 3BAYA 2A79A 2ZVIA 1Z6KA 1Q63A 4QQUA 1PIGA 2XIQA 5XINA 4RDVA 2OODA 1VPXA 3PPGA 3QGKC 4PBEA 5C0QA 1KQZA 2OPJA 3GO2A 1J10A 1XD0A 2NV2A 1TUFA 3M5ZA 3LHTA 1ZCOA 4LAOA 2OZ8A 3BQ5A 2W92A 4U10A 1OYBA 1R3RA 3PC0A 3W2MA 4V1XA 1W5MA 4C60A 3URAA 3BGGA 2TSYA 3IPWA 1UOKA 3EEZA 5BXRA 4RXGA 3FY1A 2WAGA 1K7EA 1TWIA 1TZ9A 1B9ZA 1FP9A 5AHIA 1E4LA 4XTDA 2FPYA 3W82A 4PL1A 4M1BA 1NDYA 3TW9A 1IHIA 1MRQA 5CBIA 3K4AA 3F1QA 3K46A 5G4WA 3A23A 2Z27A 2VFIA 3T9PA 4ERAA 1E0WA 3W7QA 1IT0A 3B9EA 3QHOA 3SJNA 1Q7MA 4GHRA 5CKSA 1M41A 2R82A 1ICPA 4A29A 1FWCC 1EYWA 1XRSA 3N6HA 4GQRA 4JYDA 3LRKA 2A7RA 1AJZA 4X3ZA 5HANA 1XL9A 3R8RA 3WD1A 5EMYA 5HNNA 4XVDA 1GVQA 3CT7A 2NWSA 3LHYA 4AXNA 3HQPA 3LTSA 1KKOA 5FJRA 3TQKA 3DH7A 1MW2A 1F76A 3CLMA 3SZ8A 3B03A 1LLWA 3VGBA 2ZUSA 3WF2A 3QKEA 3GTHA 3L2LA 5HUOA 4FXRA 4Z2IA 1Z69A 3UG4A 2REQB 3NDYA 2J24A 3VDGA 3FA5A 2FGZA 3LQGA 3LZ3A 3AXKA 2W61A 2Q02A 1VBJA 3FAWA 4ZQRA 3K2GA 2VD8A 1R9YA 3IGUA 4XBSA 4CQ8A 4JTHA 1FCVA 1TELA 4HOWA 1JVNA 1RSCA 2C15A 1DVJA 4ZGYA 4WGXA 5DMNA 4HU4A 5DELA 1FCBA 3ITGA 3ZJ8A 3UG8A 4GJIA 2WMIA 3A5FA 3TX9A 4ZENA 8XIMA 4P5UA 3FS2A 1U5HA 2E6DA 3BOXA 5I0DA 3L23A 2PMQA 1ZP4A 2V5DA 1KRAC 3GIPA 1REQA 3ARTA 4UQ9A 1OFAA 1Q5MA 4QITA 1HP4A 5C9UA 1PO9A 3R5EA 3W1PA 3RR4A 4F9JA 5DANA 4RDWA 2IQTA 1F74A 1UA7A 4NU7A 3ZJ7A 4CN4A 4B15A 5AC5A 3CAKA 3L5MA 2O9TA 3GZ3A 2HMCA 1NFPA 3TZNA 1EJWC 1F8IA 3OVPA 4BCEA 1ENUA 4Q4KA 5M03A 3W70A 1TPUA 1ZS2A 2DH2A 1X96A 4BR1A 2VL4A 3RX3A 4DXKA 2VC7A 3DCPA 3W53A 1F4HA 3BDKA 1SJDA 5HR7A 3M16A 5IOBA 3OZOA 1H5YA 3OGSA 2FQIA 5B80A 1DXEA 4AZ7A 1JFXA 5CLWA 4ES4A 1A5KC 4LCQA 2C16A 5D2VA 3S2NA 4HVXA 1OFDA 1NFBA 4HHMA 1PHQA 1SSGA 5TD4A 3H26A 2NXIA 3GVQA 2G3IA 1VBUA 3VDCA 2PDCA 1RBOB 2E9LA 3E0VA 2QKFA 1EA0A 1D7FA 2C8NA 2ZQ0A 1PKLA 5FF4A 1I2OA 4KWWA 4RNHA 1VF8A 5KMYA 2WHMA 3AXMA 2Z28A 1J6OA 2IPFA 4KW2A 3FYPA 4ZMGA 5I5RA 1LJYA 3USZA 3SSJA 1NIUA 4ICNA 1GORA 2BHUA 3LK6A 3SQMA 4ADTA 4K8GA 2R24A 3RDKA 4ZQPA 3MUY1 4ZO8A 2VFDA 2XFFA 3IANA 2WC3A 4CNOA 5E0FA 3F4DA 3CTLA 1Y8BA 4JX4A 4RNJA 2RDUA 1WO2A 3GNXA 4W8AA 4IMFA 3K1GA 2DSUA 4LVGA 3E5PA 4Q6JA 1DWJM 5FF0A 5HQLA 3K8KA 3WK0A 1LL6A 1NWUA 2O7QA 2OLSA 1QR7A 4O14A 3XISA 3P8JA 4FPSA 1J5TA 2G4JA 1FWEC 4AIOA 3FA3A 4MNLA 2HXTA 1G5AA 3THDA 3MBFA 3RR1A 5CLTA 3B0XA 1E1CB 2CXGA 3W72A 1OC5A 2QJGA 5A8QA 3QHNA 3G3MA 1XH2A 3NSMA 1FKXA 2JGQA 2OCZA 4ZTYA 4QIUA 1SR9A 2YDSA 2VWSA 5ABHA 4AZ6A 3VIOA 1IEVA 3FKRA 3N1AA 3NQFA 1O1ZA 1L6GA 2OB3A 1TQXA 2X40A 3L0GA 2PZNA 4QISA 1X7FA 3BLEA 1US3A 3SN1A 5FESA 1OABA 1C9WA 3CYVA 2GUYA 2A7NA 3ZT6A 1RCOB 4LB4A 2WKJA 1AQ0A 4IWWA 3ARRA 8XIAA 2ZRYA 4DZIA 1GG0A 4R34A 3ME3A 3MBDA 3NZRA 3F7JA 1BEUA 1HKJA 3IGSA 1V6UA 1EJRC 2Z25A 4HNNA 2XH7A 3WZ0E 1F2JA 4Q32A 3RF9A 5FCZA 5IBXA 2ABAA 1ADSA 3WFLA 4NIRA 1R2SA 4HYWA 1T8XA 2V63A 3VCNA 4XB3A 3UY7A 3ABZA 4UNKA 1R86A 2GLKA 1F8MA 4Q8PA 1N8IA 2DFAA 3L4YA 4E4PA 3SY1A 2VJXA 3TKFA 4LUSB 2QXWA 4Z1AA 1LUCA 3N2TA 2GUUA 3T81A 3FK4A 1VPQA 4C1NB 2D3NA 5C9WA 2NSXA 4E6MA 2RKXA 2D73A 1EEPA 3DECA 1UZ4A 3ABXA 3WSUA 2WZHA 3GRIA 1F05A 1BPLB 1HJSA 3Q4DA 4UB9A 1KXHA 1M7OA 1ZUAX 1CDGA 1RHCA 3WFZA 4DWSC 2BGSA 2QF8A 3ANYA 4RE4A 1A80A 1D2KA 3STFA 4EAYA 5JH2A 4BI5A 2WKLA 2GJXB 1KM5A 4HTYA 3W2JA 3A22A 1HF6A 1O6IA 1WDQA 1XFBA 2X2YA 4XZIA 4FALA 3W74A 4L61A 2Q71A 2DUAA 2Q09A 4PMRA 5CSSA 2A85A 3AZSA 3JR2A 3CQKA 1Y0EA 1XCWA 3NAVA 4UR9A 1J5SA 4DJFD 1XCFA 3KLLA 4E2VA 1KR1A 4V2XA 1MUMA 1N8WA 4AIBA 5LZLA 3UJ2A 4QG9A 3H8AA 3ZVIA 1EZWA 4QS5A 2I9UA 1KCXA 2ZUTA 2VZOA 5JUVA 5DMMA 2A6NA 3MVIA 4FXJA 1LBLA 3PSVA 4CCEA 2OXNA 1LQAA 2V3GA 1DORA 4ZFCA 1XGEA 3WDIA 5MKGB 4DUXA 4O13A 2O0TA 4GYPA 3A4JA 4O15A 5D4YA 1HVQA 3PHAA 4UQBA 2OQYA 1W1B1 1XUZA 1OFOA 1L8PA 1AQHA 1WAUA 1ISXA 3AQUA 3WJSA 3VIKA 5D30A 2DZPA 1CNVA 4TX6A 3RFAA 5RUBA 3VIGA 1L8NA 3R2GA 1TA3B 1JI1A 3P84A 4FR6A 3VGGA 2ZZ6A 4O1CA 4CQCA 3RAOA 4N9CA 4AG0A 5EYWA 1FTXA 1ODUA 1AUSL 1GZGA 4O8AA 4UUIA 1T6MA 3T42A 2PDBA 1E1EA 4J3ZA 4LT9A 5TIMA 4UMBA 1ICQA 3P6LA 1WDPA 1OIFA 2BY0A 2BB0A 1AL7A 3W7OA 1W3LA 4CD8A 1W5QA 3MW7A 1Q7QA 1I0DA 3JU2A 1SZRA 3G0XA 3HIJA 4AEOA 1P4CA 7A3HA 3MZ2A 3K1DA 4B5WA 2FPVA 3WBYA 3W6MA 4WX2A 3S1XA 2F7FA 4KCTA 2PD9A 4B92A 1DQXA 2P1FA 4PA8A 5BRQA 3NQ8A 3N4FA 1TV4A 3W22A 2NQZA 3B9OA 1JYWA 3PUDA 1CZ1A 1Q2SA 5ECVA 1AQFA 1VJZA 3OLDA 5CQ1A 1KA9F 3P2VA 5HWJA 2CLEA 4AXKA 4PODA 5E9AA 3U2ZA 3TLQA 1FWIC 2HV5A 4XK2A 1PIIA 1FWBC 5KINA 2P3ZA 1HO1A 1XC6A 1NWSA 1D9EA 1CI1A 1EQCA 3BW3A 2ZUMA 2QCDA 4MIMA 5AVHA 1TYGA 1BQGA 3MHFA 4PFHA 2ATMA 1JD9A 1KFEA 1IQ8A 1UD8A 1E5NA 1ZSXA 2WVUA 2YBTA 1W6TA 3WLIA 2BOGX 3ZLHA 2AKMA 1VC4A 5LNUA 4IPJA 4V27A 3PZIA 4QXIA 4OV4A 3TYCA 4DEFA 1JGIA 2A3LA 2ZX5A 3HQ1A 3O05A 1AVAA 3GU9A 4F0SA 1DJGA 1CT5A 3W7RA 1CGXA 1U2YA 5D09A 3OGRA 4J5NA 4L9ZA 4EPKA 1FBAA 3QMTA 4DF0A 5IFTA 3OIHA 2HS6A 4E4FA 1EJUC 3CMFA 2Q6ZA 1U1UA 4I90A 1VFTA 4N6FA 1E4MM 2H3DA 2PDUA 4JFTA 5K9XA 4LVAA 3E1F1 2NW0A 3KRUA 3GH5A 4H8NA 2DVUA 2Y8KA 4K7YA 3BCJA 1SW0A 2VT0A 1W9BM 3KL0A 1EC9A 3VGFA 4I8YA 4CEUC 3TTEA 1WUFA 1FFRA 3SQLA 3E49A 3W6YA 1QWKA 1DHKA 2NX9A 4REQB 1QW9A 3U4AA 1FFQA 3LCWA 4A3HA 1SUXA 4JYEA 2VC9A 1GPFA 2VFHA 3IJ7A 3V0UA 2HEJA 4DXXA 3AFBA 2F2HA 2ZFAA 1CLXA 1XHGA 4D6GA 1HKMA 5I3FA 3CS2A 2QEZA 2EG7A 4GUFA 3M0JA 1O5KA 3MMDA 5FACA 1UJPA 3TW6A 2PRMA 3P62A 5FL1A 3DN5A 3G18A 1UMYA 3I3DA 4UFHA 1OX4B 1Z48A 3V75A 1UIPA 2VCAA 3BE7A 5AYBA 4EAMA 1K02A 3GW3A 3W7IA 3AU2A 1QU4A 1TTPA 2PDJA 2PD5A 3FYOA 1V3MA 4I5XA 2NUXA 1GOXA 2CHNA 1JI2A 3W7GA 3F4NA 3HURA 1R85A 3G77A 4AZBA 2HSAA 1ESWA 2EGZA 5C54A 3CV2A 3GR7A 2WB5A 5I77A 2R6OA 2XN1A 4PBGA 5A3HA 1QPKA 4UFKA 2H9AA 4CNPA 3MQTA 4ZO7A 2DORA 2Q8LA 3ZWSA 2FB3A 1YE6A 3ARQA 3LI0A 4ALDA 1ZBCA 1BLIA 2ZYFA 1TKKA 3CZKA 5HINA 1X8CA 3VDHA 3OBEA 4J4KA 4AW7A 3R4IA 2ISWA 3UJRA 1S1PA 2D0FA 4HCHA 4EE9A 1ISYA 3PUEA 5I2UA 3KTSA 3FW6A 2X0YA 2HE8A 3A12A 4UBPC 3HG3A 3GG0A 5A1AA 3VD9A 1UUOA 1LF1A 3IEBA 2NXGA 2PBGA 1XBZA 4ZXLA 4E2OA 6TAAA 4EWND 5I3IA 3EWCA 3NPVA 3OP2A 3IGXA 1E73M 4JQ1A 1EIXA 1UZ1A 2PZ0A 4IQJA 1W9DM 5F1UA 4R88A 3D5HA 4JHMA 2DQWA 1JZ8A 3AJXA 2J7GA 1HKWA 1DQUA 5CC6A 5J5RA 2PCEA 4AY1A 5HOSA 1UR9A 4GACA 5A2BA 4LBRA 3W2NA 3CPRA 1RZMA 2VZVA 3STEA 1ZL1A 3G3DA 3QFWA 3IUHA 1FVPA 3N3TA 4M6VA 3DBNA 2YLLA 1VRXA 5AZ1A 2D1ZA 2OKTA 2AL1A 3M0HA 1FOBA 3O3RA 4QAIA 4MMWA 2PS2A 3EDDA 4FLRA 4FF7A 4HSOA 2IKGA 4C6FA 3GXNA 3RM9A 3T0TA 4JTAA 1ZAHA 3I4EA 4TV5A 2FHCA 4G8TA 4S3FA 2J75A 4LAZA 3MMUA 1EIBA 5F7UA 4Q8VA 3SCQA 3TW7A 3PUGA 1JZ4A 5C71A 1GEHA 3WK1A 4MWAC 4YN5A 1H61A 4OHQA 4UTLA 5I00A 4GXPA 3M6YA 3UZ5A 4C6OA 3NZQA 5BRPA 4OTKA 1W9PA 1QMLA 1VH7A 2EPHA 4PCPA 3T4CA 1A49A 2ZXAA 3VNLA 4PUKA 1OJXA 3AC0A 3C0JA 2QT3A 3QV7A 1K6AA 3W1XA 4FP1A 2GVJA 4QEEA 2GK1B 1JIBA 3RNDA 5FA5A 4FOUA 1HXJA 3BXWA 1NARA 4G7EA 1Q6CA 1V4YA 5REQB 5BROA 1S2VA 3QR1A 4LYQA 1IZCA 1P5BA 3U4FA 1VP5A 2I5IA 3AMGA 1DQWA 3AI0A 1RVGA 3PVFA 4GUJA 1FWWA 3WDQA 5KZMA 1TRDA 1JRBA 1ELSA 3GNPA 4UFMA 4A6GA 1C7SA 4UR7A 1FWAC 4YTTA 4WZHA 5HQMA 4FLSA 3BO9A 1F3XA 4DJED 1XJBA 3OG3A 2WVVA 3QC0A 3W73A 1CB2A 1Y65A 3O1NA 3QY6A 1P6WA 2F9RA 4LJ3A 3RX2A 5TF0A 2PDFA 3HFYA 2RHGA 4U3AA 3N11A 1SVDA 3R25A 2VDGA 2R1LA 5I3JA 3MCNA 1XYMA 4C5ZA 4OE7A 5AC7A 3HPAA 2VKZG 2VVNA 4H7VA 5LXXA 2VMFA 1K9EA 2V68A 1JQVA 3O6AA 2NV1A 2WSQA 3STCA 1A0CA 2CESA 3MHGA 4S2BA 4UZUA 2O55A 2CKRA 2FZDA 3CHDA 4FHAA 4PYSA 1GOQA 4W89A 4U4MA 3BJSA 3O7UA 3W75A 5FJJA 4GUGA 5A6BD 1JDCA 1OSEA 1GZ1A 3I3EA 3HMJG 1QOXA 3FHAA 3PFRA 2C1IA 3PG9A 4W84A 1ADDA 3OU8A 4D9PA 4AZGA 1JRCA 4LTSA 3W1QA 1KCKA 3P81A 3O0KA 1O5XA 2QUMA 1M6JA 5AYXA 4JYFA 3DFPA 1E56A 2ZKMX 4LAUA 2DT2A 3N9RA 5EKYA 1IIHA 1JPIA 3FJLA 2CLLA 1C3FA 1US0A 4Q4OA 1LBMA 2V5KA 1J0KA 3WUEA 1W3KA 3SGZA 1TVPA 3LV6A 4OJYA 1UWTA 3OVGA 2ICSA 3WQGA 6ALDA 4AMCA 4ICCX 2X8RA 1I1WA 4MY1A 5G4EA 1G7VA 3URBA 1UKSA 1J8VA 4GQQA 2WWDA 4G1KA 4UTIA 1RCXB 4C65A 1DTUA 3AMLA 1XICA 3WKZA 2EKCA 3LHWA 2JALA 4LALA 3IRSA 1XLBA 5I3DA 5CPTA 4CNTA 1TMQA 3JRKA 2XIJA 4MJMA 3P61A 1A53A 5A94A 5T26A 1A4MA 4US6A 3WH5A 2BVTA 3FVMA 4HU0A 2NUWA 1R3VA 1FRBA 2FFCA 4DHGA 3F5JA 2XVNA 4BHYA 1WKDA 3AUOA 3WUBA 4HZ8A 4HZMA 4C7DA 5C5YA 2YCLA 3LGDA 3NQMA 3TQPA 1ZAJA 3GNOA 2XIMA 1G7UA 3HG4A 3TP4A 1V5XA 4PCNA 2PGFA 3ARWA 4P8VA 1S3TC 5EY5A 1Q85A 2FVKA 5BWFA 4GI4A 2PLKA 4N02A 2AGKA 4TVDA 1ICSA 4D6IA 2BV9A 3N4AA 2CBIA 2CWNA 5H1WA 3WF0A 1SMDA 3UJFA 3WFAA 1SZFA 4JEJA 4UOJA 4O1BA 1S2CA 3MO7A 3LMZA 4KRTA 3SEPA 4TR9A 1IWBA 4TU1A 3W37A 1FH8A 2DGAA 3U2CA 1VFFA 3ATZA 1XYLA 1QNRA 1OWQA 1M68A 2Y70A 4CN1A 1KLYA 3M1ZA 2BNJA 1V93A 4W5UA 1WE5A 3TONA 1S5MA 3SRKA 2YCIX 1GEQA 2Y89A 1ONEA 3QTGA 1AH0A 3MSDA 1U22A 2ASHA 2E0PA 1PPIA 3QR0A 5I78A 4W7VA 4NG3A 4B4FA 1E1FA 2MANA 1KBIA 1EHAA 2QPUA 3UPMA 4JTGA 1LQ2A 3C2OA 4J40A 4IGHA 3BOLA 3B05A 1OGBA 4CEXC 4JR5A 3K13A 3N6JA 4LRSA 1UR0A 2CLHA 1JD7A 3MKCA 2YA0A 2QVHA 3P7YA 1HFBA 1XFCA 1TX0A 5JVLA 4LX4A 4DYEA 1H1YA 4HCLA 3TUUA 2HCVA 4FEZA 3SURA 2XZ7A 1U30A 1NOFA 5HBFA 3W7LA 2VENA 4JTKA 3VX1A 2DZSA 3P0WA 3BLIA 2NX1A 2YYUA 3CYJA 4IICA 5EFDA 4HOZA 1VFOA 3ZT5A 3VCRA 3PBWA 3VDBA 5H91A 5DCBA 2CYGA 4FIQA 4CLMA 2BY3A 3U48A 4IP5A 4E0CA 1LWIA 4LSBA 3OB8A 2FZ9A 3VNZA 3RPTA 2UBPC 2XIIA 2ZUVA 1OM0A 5AKQA 1CXKA 2YXGA 4K38A 3W1RA 5CC7A 4W8BA 5IM51 1ME7A 4KCWA 2YOCA 3KP1A 3CAWA 4GO9A 4WF7A 1SGJA 4NJJA 4L4MA 5AC4A 4C91A 2X7WA 4R7WA 3FXYA 1KV8A 1OCNA 3KRZA 4PUNA 4OWGA 3TOYA 3TWBA 4FA3A 4H2CA 2YB1A 2GWNA 4HPNA 4IPIA 2VDHA 3WMLA 1TR1A 4ZZ9A 1OFEA 1GVSA 2RDXA 4XD6A 4M24A 1P1MA 4AD1A 4Y9OA 3S2LA 4RCXA 4JAWA 5F2MA 3M44A 1AH3A 3W7HA 3UZZA 3I6EA 3O2LA 3KOZA 1EGMA 1QPQA 3GQYA 3RILA 1GT8A 2PURA 3W2UA 4L64A 3GYEA 2BMBA 3G1AA 2X1SA 2W79A 1HL2A 1T7LA 3SCUA 4MJ2A 5ABGA 1PX4A 4OQVA 4DB7A 1UHVA 1WZMA 3LBCA 1XLIA 4XZWA 2F6KA 5L6UA 2E28A 3VIIA 5C70A 4FX7A 1TPWA 3MUXA 3E2VA 2OKOA 1WDDA 3H12A 5HPCA 4WDTA 4J2MA 4K3ZA 3UXKA 3CPUA 4LANA 4LC8A 3RJYA 2BGNE 2V82A 3UJSA 4Z1CA 4AD4A 3ITCA 3KBWA 1Z8AA 3EA1A 2ZOXA 1GYLA 3DKLA 4MNJA 5I3GA 4Y9PA 4QDMA 4UTTA 1RCQA 3MMWA 2ZC1A 4CNNA 1XIIA 4DJFC 1RD5A 1LTDA 4A3UA 3R11A 1QI4A 4DAIA 4IPNB 2WYSA 3GNRA 1TV3A 3QSTA 4MWAA 4AEEA 4C6LA 1PKYA 5ABEA 4N7QA 5FJUA 3ARVA 2ANUA 4LYRA 4FNPA 4XISA 4NASA 4ZO6A 5LA1A 5G1YA 1NF7A 2RFGA 3H24A 2C19A 3WUGA 4JNYA 4LY8A 1SO4A 5U4NA 2NQLA 2PDYA 2ZRXA 3UGVA 4XZHA 3M0IA 4F66A 1A5MC 1GCYA 3CL7A 4NZ3A 1PDZA 3NQ6A 1C8QA 1UD5A 1BHGA 2HJPA 4IJCA 4G6CA 3VX0A 3SSZA 1MFVA 1KM3A 3LSCA 4DRSA 1QI2A 5HJYA 2XVLA 5EA9A 2EPOA 4DNHA 3VVGA 2G3MA 3L5AA 3QPZA 4A3RA 1O4UA 3GIQA 4UFLA 1L6YA 1GJWA 4A05A 3L4WA 3W07A 4YYFA 1OT2A 1TFVA 1V02A 1KXVA 2E6AA 2D2HA 3V5CA 6REQA 5C8BB 2PWUA 1OK6A 4MB1A 3P8IA 4GY7A 1PEZA 1W3JA 1FH9A 1I2RA 4C6KA 1LL7A 4BF5A 5F2LA 3NGFA 4C6CA 3QH2A 4L1WA 5AZ0A 1M7PA 3IIXA 2YBUA 1R6WA 5IDZA 3UEQA 3D47A 4KF1A 4QDWA 2D23A 3UG3A 2Q8XA 1H0GA 4QSHA 1HJQA 3SCOA 2WMIB 1A3WA 3I3BA 3ANUA 3BG9A 1KGWA 1YW1A 1GQIA 3POCA 3MI3A 1E6SM 4JDYA 1LROA 1EDQA 2HNHA 4YTSA 1S2AA 1FH7A 1UC4A 4K1WA 4OIFA 4PTWA 4UR8A 3CEPA 4UXDA 4AD5A 2HTMA 3BAWA 4Y96A 3POHA 2ZRVA 4MUZA 3KTXA 4WDXA 1QWGA 1CBGA 2QS8A 2OQLA 1DYSA 3W83A 1X7IA 3VIFA 4GFIA 5DCDA 2QCCA 3LV5A 3ARZA 3U5UA 4H83A 3L68A 4MZ8A 3VPLA 2F84A 4PMUA 5CH9A 2QQ6A 3KDOA 4BK9A 1JNDA 2VD9A 4M7SA 3ZYZA 2J8GA 3HV9A 1A5BA 1TG7A 1VB9A 1F07A 1VFLA 1UKTA 1X6UA 2C91A 3TE9A 3PS7A 4OBRA 5CG0A 3GDTA 5C2XA 4UTWC 1D3CA 3B4UA 3MO4A 2WC4A 2O4QA 1VBRA 4FXFA 2R8WA 5LIWX 3EB2A 4F40A 1J0HA 3T6CA 2Z7GA 1CEOA 1VHCA 1W54A 3M43A 1W9XA 1RPXA 4P8WA 3DFOA 4AF0A 2EG6A 3BLFA 2OTDA 2LLEA 5A8GA 4WKHA 1V8EA 5HA7A 4C6BA 4IIEA 1D7KA 3G1VA 3MV01 2X2GA 3W76A 4JFSA 2BHZA 3TQVA 3D3FA 1QW7A 3ERPA 3SRHA 5D9OA 2FPTA 2I56A 4LUIA 3GW0A 5CPQA 1VCFA 3KHDA 3V35A 2YZ5A 4LNCA 2CIPA 2QJHA 1M53A 3MSGA 3GHRA 2HROA 3SUTA 4NILA 4J3UA 4Q33A 4L9YA 5FSDC 3M0KA 1GOMA 4WSKA 1K9TA 1IR1A 1UUMA 2R1MA 1ZU8A 2X0SA 3NM1A 1OVDA 3H7VA 3FV9A 1QHZA 1OB0A 3LZ5A 2AQWA 2PTXA 4CUCA 1OEPA 1TPC1 3AIWA 1B0IA 2GDVA 2JBMA 1E40A 4E2DA 4MPKA 1W0MA 2WZEA 4XQ6A 5FJOA 1B3OA 4FX6M 3EMZA 5HMDA 4NJIA 3CUXA 1V3IA 3RCYA 4PRWA 2ZWYA 1RVKA 4QX4A 1KCLA 3CUHA 1OFBA 4O52A 3VXGA 4US5A 1VCGA 4E38A 4TX9A 4DJDD 1XS2A 1XSIA 5DFAA 2F2KA 3U7BA 1VRDA 3S2MA 3BOFA 4LFYA 3TNOA 3MSRA 4JX5A 3G8EA 1SJBA 1DIKA 4G56A 1LUCB 4I8DA 4Q4QA 4PZVA 2XM1A 1UKOA 2NT1A 1CX9A 2F61A 2HISA 4IIHA 3LS9A 5CAHA 4EWJA 1M04A 4QRNA 3E12A 3IUDA 1KFJA 1AJ2A 3H70A 4YWSA 4Y9NA 2WK2A 3A9BA 2PE4A 2CU0A 4GKLA 4JKMA 3PPCA 4LYKA 4PBFA 3UT0A 5HWMA 4LEFA 2VEPA 3N04A 3OPSA 4W87A 1Q8JA 2GDQA 1BQCA 2JE8A 3TOPA 2FZ8A 4DQWA 5H8UA 3WMBA 1NSJA 1IEQA 3DENA 3CWHA 5ECUA 3V5FA 3DFTA 2R1PA 1JCTA 1BYBA 5EB8A 3A6OA 1UD6A 3L2IA 1EH9A 3SB0A 4AY8A 4IF2A 3GKFA 2DEPA 4O4VA 2ISSA 3NYZA 4ZQOA 3QMRA 3B0PA 2XTKA 1V7AA 4WVXA 1GVRA 4GYJA 1JYNA 3QW4B 1AZ1A 4I7WA 1KWKA 4FNTA 1FA2A 1SPQA 1YPXA 5HPOA 4GUHA 1VQTA 1GVEA 4UFIA 4EIVA 5CJNA 2DVTA 2G8ZA 2FIQA 4A3QA 4GNVA 3OO2A 2B31A 1ADOA 4KIRA 1X39A 1FHVA 4AD2A 3PR2A 3TYUA 3FA4A 3BH4A 3CM4A 3TROA 3WN6A 3HJZA 3M4HA 1K4GA 2P8CA 5BZAA 3KOXA 4D1IA 2XVPA 2C0AA 3MUAA 1ONWA 3T8QA 2GJNA 1DTNA 1BWVA 1RV8A 2J9XA 3NGJA 4YNGA 3W6LA 2E25A 3SDOA 4HT3A 2X05A 4Z1YA 1JUEA 3R0DA 5GJNA 1FDJA 4XVEA 2WSPA 3T05A 1E6PA 4L9XA 3CB3A 1TPDA 3A3HA 5ABFB 3ABQA 2IPGA 2UY4A 3CJPA 4XZLX 2L5HA 3S3GA 4O57A 4YTQA 3WDJA 1ODZA 3TA6A 4ZB2A 1OQFA 1QI5A 1YPIA 2ZDSA 5LNRA 5T91A 4L7ZA 3THQA 3VD5A 3TV8A 2FB2A 3QEZA 3W7NA 1FWDC 2YJQA 2XZ9A 1C92A 4JZ5A 1RALA 4M6QA 4IISA 3UBPC 1OG6A 3TMLA 1F73A 1O68A 1MQPA 3EOUA 1JDEA 3E02A 4N2YA 5D32A 5C9ZA 2YL9A 4DJEC 1EF3A 2OWWA 3TQ0A 1VIZA 1H1NA 4PR4A 1D3HA 3WF4A 4LXFA 4R85A 1EGZA 1DHPA 5EBUA 1UWRA 3ARSA 2XYLA 1P0KA 1W2VA 3VNDA 4RKAA 2QCDB 1XKYA 4UMAA 1KBBA 2QCLA 5U7SA 3O07A 1XR2A 1VPYA 3RJXA 2E3ZA 3KZPA 4J28A 4LQ1A 2DIEA 3AIBA 4IMDA 1WB0A 1MDRA 2YXOA 1E6QM 1OHLA 1IIGA 3W86A 1S2TA 4BI7A 2Y5JA 1K8YA 3H53A 3LPFA 2VRQA 3GHSA 1JAEA 3BJTA 1CECA 1QXLA 2DY3A 1GVOA 2Z2AA 3MU7A 4K37A 2A3EA 4LUTA 1SFTA 1QI0A 3NO5A 3HOJA 3AISA 1XRFA 3DHDA 1HN1A 1NTHA 3MC5A 4YTRA 4H9UA 4ZXOA 4Q4RA 5LXEA 4JQ4A 5LNSA 1G94A 3R89A 3SGUA 2Y7FA 2PDIA 4XD4A 2PTYA 5H8PA 1FWGC 1VR6A 3KL5A 4Q4PA 4ZOBA 1XRTA 3LCGA 4S3JA 4UCFA 1U5JA 2HDJA 1QNSA 3VCCA 1WOBA 4Y8EA 4AVNA 4GC3A 2D22A 4UTFA 4Q6XA 4QEHA 4GZEA 3W1AA 2ZICA 1QO2A 4BWLC 4YLWA 5JBEA 1VIWA 1DJHA 4PGLA 2V5CA 3R7MA 1RA0A 4ZB5A 4WR3A 4IMAA 2YDQA 3SN0A 1B30A 1YNQA 2FZMA 4MY8A 2J7EA 4YVVA 1MI3A 3GAYA 4GCXA 2Y8VA 1UW9A 1VBHA 3INPA 2A21A 3LRMA 1Y5VA 1R3TA 3W27A 1BG4A 1L6WA 2DVXA 4QGCA 5AHMA 2P5NA 3IVTA 1XC4A 3IIVA 1QHPA 3LXAA 1ZLPA 3N14A 2JKEA 3RPDA 4M8UA 4X22A 2VFEA 2GQ3A 2FTYA 1V3HA 2YX0A 4K8EA 2UY3A 4L80A 3RLGA 3FSUA 3HU7A 3LOTA 4RLIA 4DNMA 4F0LA 3M6DA 4XG1A 4NSBA 3BLKA 3VNYA 5JQ9A 2QV5A 4O8RA 1GJPA 3TJLA 3GNNA 3KVLA 4ZTXA 2BG5A 3TR2A 1LG2A 2BTMA 2DIKA 4JTJA 1HL8A 3EAUA 2C3ZA 1GVYA 5DQPA 4B2DA 2WKGA 4I9TA 4ZE5A 4J7RA 2XSBA 3L4XA 2DUZA 1ISWA 1I9CB 3WNLA 3HQNA 3P3BA 2G50A 3A24A 1LQ0A 3W7EA 5CGTA 3T4WA 1ITQA 1IEXA 4XD3A 2B7PA 4KRZA 3T07A 3VKCA 4LS2A 2C0HA 4K68A 3CT2A 1TV5A 2J8FA 2ACUA 3GFXA 3GS6A 2JIEA 5BXPA 3P74A 5A6AA 3ZSSA 1TPH1 4O0KA 3HA1A 3QN3A 2BWGA 1QFEA 4U2ZA 3LY0A 3Q67A 3WMSA 1C8VA 2J66A 2Y7DA 1JPDX 4ZCWA 3KOYA 3TC6A 2XISA 2Y2WA 4P61A 4UFJA 5PTDA 4HNOA 1VJSA 4AY7A 3W88A 1JZ5A 1VENA 4DZHA 2OZ0A 2Z1WA 2FDSA 3PP7A 4A35A 4B90A 4CD7A 1BGAA 1A5UA 4D8LA 3OOQA 2WPBA 1O95A 3EB3A 3NCOA 4Q8MA 4BEQA 5GJMA 5SWUA 1XD1A 1XBYA 3WQDA 3TN4A 3BV4A 4JFWA 2POZA 3BURA 1QOQA 2HZGA 4B9YA 2PAJA 1EGVA 4PMDA 5CJ5A 4WHBA 2W9MA 4Y90A 3DYPA 2YR1A 1XLCA 1NY1A 1X1NA 4GK8A 7ODCA 3SGGA 1BXBA 1TJ2A 4NT0A 1XLKA 2B7OA 1LZOA 2BBFA 4M56A 3SUWA 5XIMA 1J0YA 1JUBA 3I7RA 1QPRA 4ENLA 4WKFA 3BW2A 2Q3OA 1Q4WA 4NVTA 2V81A 1XIJA 1KNWA 2FVLA 4N9DA 3MP3A 3PPFA 3MKVA 5BOOA 1FQ0A 4IUOA 1SZGA 5FKYA 1CGTA 2PDGA 2BGQA 1K7FA 3LPPA 4IGNA 4PL2A 4LBUA 3TEVA 5A6KA 3C86A 3WNPA 4GC4A 1EBGA 2BY2A 4U2YA 5HULA 4GGHA 2Y4SA 1WA3A 3L67A 2UY5A 1D8WA 3W24A 4P7OA 2A0NA 1UBSA 4PULA 4AX7A 5F1VA 1FCUA 4AD3A 4PSPA 1LRQA 5HJXA 1KCZA 4URIA 3D46A 4QLKA 4W86A 9CGTA 3VAVA 2BX7A 4GLEA 4G7EB 4IX0A 4MZ1A 1J9YA 4O16A 3DC8A 1JYXA 3UVIA 3S5OA 8TIMA 3WNKA 1H62A 1SFJA 5A8MA 2G41A 3STGA 1X98A 1DIEA 3VOGA 2OU4A 3IIOA 5E6YA 3NQ2A 5FL0A 1E43A 4H3DA 4GIYA 2VX4A 3R12A 4HK7A 1G67A 2WMJA 5G1TA 4MZYA 5HK4A 1IWPA 5K9DA 4XZ9A 4IT1A 2WZMA 3C4UA 3PFMA 5FSEC 2PTZA 3C61A 4GO8A 2WVVB 3SRFA 4G9PA 5KSWA 2QGYA 2Z0IA 3OQ8A 3NVTA 4KCVA 2CETA 4QS6A 1EX5A 1NFGA 2O9RA 2VEIA 2O4MA 4GQ0A 4FLQA 4I9MA 3G6LA 2QUTA 3GBDA 5I06A 3QTPA 3RLHA 1K8XA 4LRTA 3NFUA 2G3NA 5LKYA 3IIZA 3AZRA 4GJJA 5CGQA 4NXKA 4JFUA 3IJ9A 3NURA 3PWGA 3CNYA 1VLWA 3DFSA 3GSMA 1IEWA 4OKDA 5BCAA 4G2DA 4PMVA 3UPBA 5ABTA 5A95A 3TAOA 4XAZA 1JQXA 4FB7A 3S1VA 1KBJA 4MYAA 1K03A 3ECQA 3AHZA 1NEYA 3L0KA 3SCNA 3K30A 4CQBA 3G22A 3FIGA 3VOHA 1XI3A 4ZOEA 2OSWA 1TIMA 3W29A 3O0FA 3BLLA 4F2BA 4HD5A 4JEQA 1HIZA 3ZOAA 4ROQA 3O16A 1T99A 3G1YA 1YDOA 4PUEA 2Y88A 3MYPA 5CC3A 3E0IA 1LLZA 3CEUA 4FO4A 2A4AA 3L4VA 4F0MA 4TIMA 3CO8A 3CH0A 2OWCA 3S5ZA 3WD2A 5J8LA 2C6QA 3ITYA 4E3VA 1X1OA 1I4NA 1CWYA 2W66A 4Z42C 1KFKA 2W63A 1C29A 3LEPA 3H4GA 4TVCA 1Q13A 1IGWA 4MAVA 1W3TA 3TN6A 1HW6A 3EWZA 3PJUA 3NQ7A 1JFHA 3GFZA 3B3DA 4KGJA 4M6UA 4C5YA 3TK7A 2C71A 2HBVA 4IIDA 7PTDA 3UGRA 3AIQA 2E8YA 4W7UA 3QOMA 4GZIA 3QV9A 2CZDA 3DI0A 3PZTA 1V08A 3AUJA 4GX9A 3VM5A 5D05A 2WM0A 1Y5WA 3K5XA 3ARPA 3FDKA 4NNAA 2ADAA 1GKQA 2EBNA 2ONEA 1P7TA 4KEMA 4PRTA 2GQAA 1OFRA 2AKZA 4M3PA 2QAFA 4FNSA 2PEVA 5A8NA 3BW4A 3IWPA 3EOEA 3KX6A 3GXPA 2Z1VA 1ZENA 3ANVA 2YCLB 4Y8FA 4CKQA 1E1CA 1DBTA 4JNZA 4B5SA 3ZJ6A 3CMGA 3EKGA 3AMCA 2IS7A 4EXAA 4H9TA 2P53A 3OZMA 3DBPA 1XF0A 3WQ5A 3D3AA 5HXMA 3N17A 2GZXA 4PTMA 1DJNA 2E40A 2EEXA 3P93A 3KRSA 1R3SA 2NQJA 1S3HA 2ZUUA 1KW1A 1ECQA 2ACQA 2V69A 3RYSA 4JKLA 1QATA 1UROA 4CNSA 1E0XA 3MHUA 3PF3A 4NI3A 5LIUX 1MMFA 2E5BA 1TE6A 1OGGA 2WW5A 3BK0A 3N3MA 4ZL1A 2ZTKA 4O28A 3W85A 3ZMRA 2I57A 4FXSA 4J3XA 4H6KA 1TZ7A 2DJXA 4NZ5A 3B04A 2NLYA 3VUPA 2WZTA 1U5VA 3ZVHA 3IRDA 1H3GA 3UESA 3ITLA 3PJXA 3OYZA 1E15A 5LIKX 3LU2A 2BSLA 5AHFA 1PBGA 4GXWA 3S6DA 4LUSA 1XSJA 2V2CA 2BOFX 4TXEA 2NX3A 3FNDA 1UH4A 2XPKA 3LCFA 1LWHA 4C1NA 5CXPA 4OOUA 3TR9A 4XO7A 4PSRA 1PCWA 4ACYA 4MDOA 3ZWTA 3PB2A 3QQ1A 1YDVA 4M0XA 1TCMA 3OQEA 3MI2A 3FGCA 1GQKA 1EP3A 3KL3A 3L7RA 4LVDA 1E0UA 1BSLA 2PLCA 3CL8A 5JIWA 1OZQA 2Y8UA 3GUGA 4M29A 1ZFJA 2NVDA 1G0CA 2OOGA 4WD0A 3KHJA 3N73A 3S6TA 1OCJA 2D2GA 5D38A 1MXSA 4NX0A 2I14A 2GJLA 4AZCB 4AYGA 4NZJA 1CENA 3B0YA 2BHYA 2QDDA 5E93A 3UYCA 3WCZA 3WLKX 2YBVA 3N9KA 1A4LA 1G4SA 4BJHA 3WLJA 1HZYA 3CUGA 4N9EA 1UH3A 5T9BG 4Y9AA 1KRCC 1F6KA 1CGWA 2VELA 4HPGA 3AO0A 4K6AA 4BS0A 1OIMA 4QJ5B 2KAUC 4KT2A 4M82A 3EDFA 3CLWA 2V2HA 2FTWA 3WX7A 4Q7BA 4L4LA 4RW5A 3CQHA 3M5VA 5LIXX 2HBXA 3SJ3A 3H2CA 4QJ4B 4KEZA 1PZ0A 2QW5A 4Q8QA 4TTUA 4YIWA 3S9IA 1JCJA 3EGJA 4KRUA 4PH6A 3RLVA 1H60A 2ZDRA 5I02A 4BQ2A 1MFUA 1SSDA 2ODOA 4Z17A 4G7FA 1ZCCA 1XQLA 4OUIA 2VGGA 4UTUA 1HKIA 4GXMA 4JNMA 4JXCA 2QDHA 2RJHA 2E9BA 3K8MA 2J13A 4Z2GA 3LD5A 2IQDA 3GB6A 3ES8A 5D02A 3ZS4A 2WJZA 1TA3A 3BJFA 3L4ZA 4B5TA 3GY1A 4M1RA 1AL8A 3QV8A 3TYZA 3WLNA 1R3WA 4FZIA 1MUWA 4HSHA 1C93A 1BRLB 1YQ2A 3BVJA 5A8OA 1UZDA 3WEOA 4GI9A 4MF4A 1Q45A 3V0TA 1UB3A 2X1TA 4X2PA 2HWGA 5JIPA 5I23A 1V6YA 1VKFA 1XH1A 3O6YX 2ZCGA 2CC0A 2XUCA 1W5OA 5DY2A 2WBGA 4AZHA 4A22A 4OVXA 4D6EA 1NVMA 3ITVA 5AHNA 4C1KA 5M2FX 1W5NA 1GGOA 3NL6A 4ERGA 3AHVA 4JKKA 3PAOA 3UW6A 3WD0A 2FGLA 5T8GA 3W1MA 3C2FA 4F8XA 5MHBA 3QVQA 3OYXA 4NKCA 1YX1A 3GC5A 1E9ZB 4QAWA 3CUFA 2Q8ZA 4AH7A 4S3GA 2VUYA 1AW5A 5HMEA 1SZEA 1YHTA 3EWYA 4J3TA 4A8IA 4F0KA 1QO5A 1FWNA 1GW9A 3M0XA 2ZUWA 2BODX 1W1TA 3AWOA 3O6DA 2OEMA 4JCLA 1DXIA 1PZ1A 4QCEA 1V6XA 4M7TA 3J7HA 4JTSA 4MWAE 3E38A 5A6LA 3WL0A 1UBPC 2NSOA 5D9NA 3T0DA 3GVGA 2PP3A 4JTEA 2FZBA 1KXTA 3U0HA 3VOCA 2QYGA 4FNRA 2WXDM 4OOZA 1D3GA 3EXSA 2PB1A 2ZZ1A 3WNNA 3ARYA 2VR4A 2OMAA 5CG7A 3VMNA 2FH6A 6REQB 1J79A 2KX9A 2WNZA 6CGTA 4HNVA 2QDEA 1H7WA 4LWWA 1UP3A 4X60A 3SUUA 1H4PA 5DBTA 1H63A 1TB3A 2VRKA 1QRQA 2CZEA 1XBVA 1XSKA 2ZZ4A 1HQTA 3TXVA 5MF5A 2QMKA 2BASA 3GIYA 3E96A 3LMYA 3M0MA 4I7VA 1BYAA 1VHNA 4XO6A 1ZPTA 1V02E 2QUUA 2OLHA 4PEEA 4F9DA 1JCYA 2VR2A 3VKJA 1D8CA 3TJXA 1AMKA 1O94A 1C90A 4E2BA 3LSBA 3QC3A 3GHUA 3HZ3A 3RM8A 3DERA 4E8CA 2GSJA 3UR5A 4EX4A 1EDGA 1JUKA 2GSEA 1AW2A 4N4PA 2WJEA 3SADA 2PUZA 2INZA 1DL3A 3UCQA 2J8TA 2NZLA 2VI0A 5E09A 1I8JA 1JAKA 3SCRA 4XBJA 1NWTA 3L2MA 4P7QA 1C7TA 1GWJA 5C7HA 4K2SA 2ISVA 3CZJA 1JF5A 4R53A 4DYJA 4JHOA 1NELA 5KZDA 3GVVA 1X97A 3A3WA 3GXDA 1VS1A 3HPSA 3NDZA 1NU5A 3N2OA 4B5XA 3THAA 5D9PA 3TA9A 2EKGA 3UWQA 1PX3A 1K3UA 3ID7A 1FKWA 1B90A 4X61A 4O50A 1MUCA 3QYSA 5I3KA 1AG1O 2J47A 1VJIA 3WLMA 1N7KA 3NO1A 3DDMA 2PC4A 3VNKA 4YHGA 1GQNA 4A2RA 1JXKA 1OF6A 4XAYA 2E77A 4PMZA 5AC8A 1HGYA 4HIBA 3B97A 3CGTA 1PYFA 1H51A 4IL2A 4MFDA 2OG9A 3I4KA 4AF0B 3KRBA 3V1PA 2ISDA 4WJEA 5CPLA 1EPXA 3BG5A 2DZXA 2YFNA 5A5WA 1N2VA 3GYCA 2ALRA 4L1GA 3U57A 3ZZ1A 1SQ7A 3K4DA 3DHUA 4O0QA 3L21A 4S3EA 3E2QA 1R3QA 3W81A 5EPDA 1CXLA 1JPKA 3TJIA 2VQUA 5CAKA 1F3EA 4DO5A 3CL6A 5E0KA 2VDIA 3G5EA 4I6VA 4JN6A 5K2ZA 3NYDA 5DY3A 4WOZA 2PRLA 5JBDA 4I6KA 2P0OA 4NNBA 3RU6A 4NF7A 2J6XA 2JKPA 4WRHA 4GVGA 4S23A 2YDRA 3IIPA 4O0ZA 4NJHA 1RQEA 4NZ1A 2SFPA 4HBKA 2CLFA 3VC6A 1S46A 1E72M 3A5VA 3TZFA 4CCZA 4ECLA 1WDRA 2UV8G 1KM4A 2ON3A 3CZGA 5EBAA 1TJPA 1H49A 3FSTA 3VNIA 3SUVA 1IXNA 3KM8A 2YDAA 1V03A 2ZZ7A 4V28A 4F0RA 4JD4A 4JDBA 4IIBA 2WLYA 1OX5A 1JJKA 1MWOA 4RV8A 4D8ZA 3RU8X 1AODA 3WF1A 1YNYA 4AD0A 1ZTVA 3L65A 1L2QA 3GU2A 1VEMA 5AHLA 1V0NA 2OO0A 3WK2A 6XIAA 1XUUA 2UY2A 1QTWA 3BSHA 4M5PA 4GYFA 1UC5A 3WJXA 1ZQ5A 2NWRA 3ZLGA 1QDSA 2VX5A 1NWRA 4WCJA 2Z7KA 4B5NA 1E9YB 1XYFA 2HK0A 4XSLA 3T1GA 4B3KA 3M07A 5DXYA 3N4EA 3IJLA 2Y1HA 3EDKA 1BVNP 3M41A 4XZBA 1TV7A 1QCWA 1VBGA 4XUYA 1LWJA 3BICA 3N2BA 3HG5A 4XX6A 2CZFA 4L6DA 4PFMA 4ACZA 3S9YA 1FUYA 3GTIA 2BVYA 4C6EA 1XV8A 4GINA 4EOUA 2WQDA 5C6MA 3HF3A 4PEKA 1SFSA 3UXAA 4FOKA 4KGLA 4MNKA 3B8WA 4GH3A 4TUFA 3N12A 1E70M 3DFHA 4Y6GA 4F79A 3GM8A 3B4YA 1A5AA 3AS2A 5A2CA 2W4XA 3PB0A 2WHLA 3UXDA 1KXQA 2GK1A 1W1VA 3T44A 3RLUA 3WLHA 2IXUA 1ZALA 1UIOA 3MT1A 3C52A 2OGJA 2YLAA 3TDFA 3WQVA 4LF2A 1FWRA 5REQA 1RY0A 3FEMA 1DXFA 3EX2A 3ZJKA 4LVBA 4MB3A 2Z24A 1IR2A 1V77A 4ORIA 4EK7A 3VDAA 2XHYA 4BFAA 2V30A 1KLZA 3WLOA 1O60A 5F4WA 1KFLA 3G6MA 1OYAA 3R6IA 1ZGDA 1F5ZA 2FGBA 1WUEA 3LM3A 3WJZA 3EMCA 1J0ZA 4KEUA 1GHSA 3BAXA 4DO7A 2OR2A 5KETA 2PTDA 4M51A 5E0CA 1GONA 1GPWA 4J2PA 2C13A 2V3FA 3NSNA 1BFNA 2OZTA 4X63A 2YL6A 3LN3A 1MW3A 4HU8A 2E09A 3AMDA 4S3AA 3MP4A 4GIRA 1RP8A 3R1ZA 3WL1A 4DI8A 3DAQA 3KLKA 4MADA 1Q66A 3LCIA 4IP7A 4INFA 3H2AA 2IPWA 3RN6A 3W02A 3CMJA 5IRPA 2V3DA 3CC1A 4MB4A 3DU0A 4ZSTA 2NT0A 4ATLA 4POCA 3ZIZA 2ISFA 2PDQA 4IFKA 4GQBA 1W1YA 1I2PA 1NP2A 3AIVA 3DYOA 3GZAA 4UNIA 3F4CA 3ITXA 1JNEA 4ZB0A 3KBJA 3VD3A 2E9MA 1B2YA 1R7AA 3PG8A 3HBLA 1F3TA 4WSHA 2XVGA 3GDMA 1PJ9A 2VURA 2QZRA 2J27A 4RZBA 2VTFA 3UWEA 4LUJA 1PWMA 4KERA 1OBAA 4IZGA 2QVNA 4MTVA 3THUA 3DESA 5F4SA 1MYRA 2Q3RA 2CNCA 3NNTA 3AXHA 3QMSA 3DI1A 3KE0A 1GYMA 1V0LA 1H5VA 4YHEA 1FHDA 2J7FA 2PWVA 4XIMA 3M7WA 1BTMA 4AMAA 3A21A 3EWWA 3FOKA 1F61A 3C2EA 9XIMA 2IKJA 3S4TA 4MAZA 4RZ4A 1XCXA 3H54A 2JEQA 6TIMA 1C8XA 2B81A 3RITA 3OVQA 2Z2UA 3OHIA 4MYXA 3T55A 1JZ6A 3EZ4A 4MVAA 3NPWA 3IACA 3SY5A 1R5YA 3M0ZA 1B3YA 2WLZA 4HA3A 3APTA 4ZOCA 3F2BA 5K7JA 3CIVA 2PDNA 3PZNA 1ONRA 2DZVA 3NDOA 2WNWA 4AUBA 1W5PA 5I03A 5C9RA 1K9DA 2VYOA 4GRSA 1X8FA 2VZUA 1XDJA 4H9YA 4QG8A 2Y7GA 1ZRQA 3HPXA 5LGXA 1YPFA 3LG3A 1WKEA 2E7FA 4HA4A 3PWIA 1XIBA 4I9AA 2V38A 3L12A 1G69A 4A8LA 3W71A 3PTQA 4P7RA 1GVIA 5E1QA 4ADUA 3S8HA 1E6XM 1XGDA 1H7NA 2QPXA 1UOZA 1PL9A 4I3GA 2BDQA 3HJEA 2J9YA 2XFRA 1BKSA 3UR7A 2JF7A 5D2WA 3PZVA 1MRAA 2ZWZA 5K9CA 2IKHA 1ZBWA 2UZ9A 1YBQB 3QQ0A 2V67A 1MZRA 4ZA0A 1NDVA 3UWYA 3GC2A 1M1BA 3CZ8A 4KFPA 1OK4A 3PBYA 4NNCA 2GJRA 3T0CA 2BZNA 3IJQA 3BL3A 3IS4A 1EO5A 4OGZA 1K9FA 4ZVJA 3NZGA 2VX7A 2PF8A 3QF0A 7TIMA 3B8UA 2WHKA 3GG7A 5CJMA 4IGSA 3DFNA 1SO5A 1Z32X 3ES7A 2WPGA 3IVSA 3H2OA 2XINA 4JHZA 1I45A 4YWIA 5EMLA 3NQEA 2NVAA 2OGYA 4R33A 3UZYA 1K6WA 1QJWA 2QGHA 4XAPA 4O1DA 2OX4A 1RK5A 4NHVA