1K7XA

Crystal structure of the beta-ser178pro mutant of tryptophan synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
254
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k7xA00
2AAMA 1P0NA 3UWVA 1WXJA 4UNKA 3TQKA 1KFJA 1Z42A 3M44A 1XI3A 3STGA 4GUGA 2G5WA 2QJIA 2BZNA 2GJNA 5A5WA 4QAIA 3GYEA 5IBXC 3R2GA 3LCLA 1XDMA 3VCRA 1VRDA 3W7MA 3W2MA 3WJZA 4RK8A 1K8XA 3W7DA 1SW7A 5CG7A 1TO3A 2E6YA 2X1SA 3TAKA 1AW1A 3HGJA 3MW7A 5CSRA 3TIMA 1WA3A 1XL9A 3QZEA 4PFMA 4LRTA 2VEIA 3BPWA 2C14A 4LWWA 4WZHA 3CTLA 2CZ5A 2Y70A 3HG3A 4UMBA 1VHNA 2NUYA 4N4PA 4YLWA 2B7QA 1SO4A 4WXYA 1XBXA 3NZRA 1DORA 1DBTA 1VYRA 5F1VA 2NX1A 2EGZA 1KA9F 1THFD 2GQ8A 3WK0A 1SSDA 2XFWA 4I9AA 1RPXA 1KFLA 1W56A 1WOBA 4UTTA 3P81A 5GVJA 4NZFA 3PM6A 3QH2A 2E5DA 2FB2A 3W7IA 3BLEA 4FHAA 3KVJA 4LC6A 4EOUA 2Q8LA 3W75A 3W7NA 1W31A 3CWNA 3W7QA 1U5JA 3W1UA 2ZTJA 1ALDA 2CZDA 3ZWSA 4X9SA 3MYPA 3NDOA 3DZ1A 1F5ZA 3EWYA 2ISVA 3FS2A 4CNPA 5HNRA 3W7PA 3HG2A 1E51A 4Q4KA 1C9DA 1YPFA 3PBYA 5CZTA 4UTWC 1OG0A 1D9EA 1Q45A 3HMJG 1JCXA 4LVDA 3UPWA 4TMCA 3A23A 3PG9A 3G1YA 3EX2A 1XM3A 2YFOA 2B7PA 3UZJA 3I6RA 3M5YA 4IMFA 2J6XA 3QRHA 2E1DA 1OX5A 5SWUA 4RXFA 1IXOA 3B0VC 1AMKA 3B0PA 3NAVA 5AHFA 1XFBA 4C1KA 4AH7A 1JULA 1EUNA 2B0MA 4Q32A 1LBMA 3HO8A 4Z1CA 3EWBX 4LVAA 4FNTA 5FI8A 5AC8A 3LTPA 1OF8A 5C2XA 2J9XA 3C61A 4UTJA 5LZLA 2XN2A 1DJQA 3W9ZA 2A6NA 1XCFA 1UJPA 3UXDA 4Y9AA 2KZHA 3USBA 4IGHA 4QNWA 1GG0A 3N3MA 1FWRA 5F2LA 2VFDA 3PSWA 5I3JA 2QCEA 1IF2A 1CX9A 3FKRA 3ABRA 1A5BA 1OF6A 4OT7A 4JTKA 2Y89A 4M6VA 3HGOA 1VLWA 1IXQA 5AHIA 3MBDA 4QITA 4HN4A 3PBVA 3TUUA 2H6RA 1OJXA 4MKNA 4PCFA 3L21A 2NUWA 3MHUA 2R91A 1ZY9A 5F2MA 4PEKA 2GVGA 1ICSA 4R34A 4DELA 1H1ZA 2PCQA 4RCXA 3M1ZA 3QSRA 3MWAA 4BI6A 1ZALA 4JIPA 3S9YA 4LVGA 4MOZA 3B03A 4R7JA 1VLIA 3BG3A 3CT7A 3HQ1A 1RQBA 3QF0A 1Q6LA 1OK4A 4JX6A 4FNQA 1YLVA 2F84A 1PE1A 3MHFA 1TMHA 3QQ1A 3G1DA 3G8RA 3GDTA 1GZGA 4P61A 2CLEA 5LNWA 4WY0A 2GQ9A 3S5YA 3GZ3A 4DF2A 2VOMA 4FNRA 4RZ6A 4E2DA 3WK2A 3GIYA 2DZSA 1TPFA 3IIOA 2FPYA 1IIGA 3W22A 3KVKA 3O16A 3PC0A 3SFKA 1F6KA 3CQ0A 4IX2A 3FEMA 1EP3A 5F1UA 1S3HA 3S5NA 4WOZA 1B4KA 3NPUA 3QPZA 1YTKA 5CZSA 3C3NA 4UFHA 2H8ZA 4NVTA 4TIMA 5K9CA 4N6FA 3F1QA 3NGJA 3LX9A 4CCEA 1QOPA 2A4AA 1P0KA 3LHYA 3NM3A 3WFAA 1TPH1 2EHHA 3NL3A 3W76A 3W7CA 2Q3OA 3IIZA 4AVFA 2WJZA 3PBWA 2ABBA 3NNTA 1EA0A 5AC7A 1QPNA 3ABOA 2CLFA 2QAFA 4PODA 2ALDA 4UTTC 2QCMA 1OX4A 5H91A 3Q37A 2VENA 3H53A 3QW3A 1GVSA 4JTIA 1N7KA 4IPIA 2B4GA 4E0CA 3L67A 3R13A 4FXRA 2XN0A 2VFFA 3FJ6A 1FCQA 4A3UA 1WOAA 4W9TA 1GPWA 1FUYA 3SW6A 3T4CA 1G69A 3ELFA 4GUHA 4RZ4A 4A2SA 4S2BA 1F74A 1MXSA 1UBSA 2VKZG 5HQEA 5AHNA 5DY3A 3RFAA 4OGZA 1YPIA 3S5ZA 1MZHA 1EEPA 4K8EA 5DXYA 2QUTA 3LTYA 3MHGA 4JY8A 2DZPA 2VEKA 1RD5A 4IUOA 3UQNA 4KFPA 2Z6JA 2CZFA 1NF7A 2Z2UA 5DXXA 3W7RA 3TJLA 1NFBA 4IMGA 1A5AA 1FXPA 5J5RA 3LCGA 4AWTA 3O1NA 3ABQA 3N14A 4M6QA 3VFLA 2C6QA 4KKXA 3IIXA 3TFCA 3EXSA 5EPDA 4LU0A 1O94A 2UV8G 4NX5A 2X1UA 2C13A 4DF1A 4FF7A 5AYXA 4XZ9A 1HTIA 3IGSA 3NXFA 1TPWA 1ICPA 2J88A 4OE7A 4GWEA 3KRSA 3LV6A 4KWWA 1LRTA 1CW2A 2ZZ3A 1PL9A 3EX6A 1EWDA 3GR8A 4JX5A 4B5NA 1D3HA 1PCWA 2Z0IA 2VELA 1ZAHA 1RV8A 4LT9A 4UTKA 3ZS4A 4LV4A 2ZZ7A 3OHIA 1JUEA 1OFRA 4LW7A 4O57A 1QPQA 4ICNA 2E6FA 2Y7EA 4FX6M 4PC8A 1TTPA 5DN1A 1QCWA 1X7FA 3E9AA 4FEZA 1RZMA 3KXQA 3LCXA 1L6YA 4GRSA 3GVGA 4DBDA 3E02A 1XKYA 4FX7A 3W7HA 3IEBA 5EMUA 2VEMA 2ZTKA 2E68A 2V5LA 3TSMA 3L9CA 2E09A 1K7XA 2Y61A 2ZYFA 3UWUA 3RU6A 3C0JA 4HIBA 5I3KA 3LCIA 3G3DA 3W1TA 2NV1A 1ZHAA 2CW6A 3DHFA 2V81A 3LRMA 4LTSA 3W2UA 3N9RA 1LCOA 2ZRXA 3RLUA 2WSYA 2G96A 3A24A 1G4PA 2X1TA 3PB0A 3FYOA 3B04A 5EBUA 4DPQA 3TXVA 1FDZA 4UCGA 2FLIA 5CZ0A 3P67A 2A7RA 4CQAA 2ZBTA 1A5CA 4AXKA 1TV5A 5CKSA 3WJSA 4O50A 1T96A 1SO3A 5KZMA 1EP2A 1VPXA 1OYCA 4LS0A 1K8ZA 2A6LA 3W1PA 3C52A 3STEA 5AB3A 2V5BA 4O18A 1AG1O 1IXNA 4QISA 5L6UA 4RXGA 4O1BA 1B4EA 1FCUA 4JR5A 3IIPA 5LHEA 2DZXA 2PURA 3GXPA 4NJKA 5AFDA 1RQEA 5G4EA 3U2OA 4DPPA 3PULA 1JCMP 1Y0EA 4FXSA 4N9BA 2ZZ4A 1LM1A 2WNZA 4A29A 4CLMA 3MBFA 2ZCGA 4O10A 2QKFA 3W07A 3DI1A 4UC5A 3QC3A 4PA8A 4NNAA 4M19A 4KFNA 3LBCA 1I2NA 1R47A 1OFAA 2ZRYA 2WO5A 1TPB1 2R14A 3EEGA 4JD4A 3PAJA 5IM51 3W7KA 1NVMA 3K30A 3M5VA 3R5EA 2JGQA 3L68A 3O63A 5BMWA 3MP4A 4M5PA 2RFGA 4XKYB 5D2WA 5HWMA 4MPQA 3G1HA 5BOOA 4K6AA 3E96A 4JTGA 4RJEA 3O05A 2ZDRA 1TIMA 5TQLA 3TSBA 3G1SA 5EYWA 5LSMA 3V75A 4C1LA 1WQ5A 4K7YA 1AW5A 3LERA 3I7SA 1JUKA 5F4XA 2X16A 4BK9A 3Q2DA 2A7PA 2E77A 1Z41A 4UR7A 3ZR4A 2NLIA 1PVNA 3IVTA 2QJGA 1W5OA 3EXTA 2YGYA 1H7RA 1HUVA 4OV4A 3OVQA 3GDRA 3G1XA 1J4EA 3HBLA 3BK0A 2GUUA 4MY1A 3HGRA 1QAPA 4HSOA 4JTTA 2O7QA 2TRSA 3P7YA 1GVFA 5CPMA 1JJKA 1JRCA 3CM4A 5LKYA 4UNLA 4PTNA 1M7OA 3EX3A 3FOKA 2RHGA 2BWGA 3W1LA 3LDVA 2OJPA 1OX6A 3GDKA 1W5QA 2HS8A 5FF3A 2B7OA 1KTNA 5EY5A 1LTDA 3PVFA 5T26A 5CGQA 3FJLA 4MJMA 5K4ZA 1AK5A 1QO5A 5AHLA 3DH7A 4AHQA 4PL2A 5D2TA 4FB7A 5HWNA 5TIMA 3I65A 1EPXA 5AHMA 1LBFA 5AYYA 5LHFA 3P82A 1KW1A 2JKEA 3JRKA 1GG1A 4IMEA 2QCDA 3QEZA 1TTJA 3DFTA 3O8AA 1W8SA 4AMAA 4RZ5A 1FWSA 2A7NA 3G1AA 3EX1A 1PHWA 4BI7A 3G8EA 1W3TA 5C55A 1SSGA 3EWUA 1TJRA 1KM3A 2WKJA 1HFBA 3MUXA 3T44A 3C2FA 1N55A 3PY2A 3QMRA 1OFEA 5D2VA 4UR8A 3HGSA 4H3DA 4ADSA 3UXAA 3TC7A 1R46A 3P8JA 3W7OA 1FCVA 5AYZA 1RQHA 3HOJA 3S1VA 5FEZA 4LS2A 1FBAA 5DBUA 2DZWA 1K7FA 3EKZA 4O4WA 4M6PA 4G1KA 3W7JA 3MI6A 3THAA 1SO6A 1OABA 3TKFA 1XBYA 3TE9A 1ONRA 1JCJA 4FIRA 3R89A 4JN6A 5D38A 2DORA 4AEOA 1KM2A 3LM7A 1ML1A 1H7NA 2FDSA 1ME8A 3THQA 2VEPA 1SZEA 1TQJA 3LRLA 3HG5A 4ORMA 2WSQA 3FA5A 1SZFA 3IRDA 2YSWA 3LCHA 4JTEA 4M7TA 4MVAA 3E0IA 3NQCA 3SY5A 4GNJA 1WV2A 2NUXA 4EWND 3GXTA 4NX0A 5TBOA 4POCA 2Q8ZA 3UNDA 1TRDA 3U6WA 2DU2A 1F7BA 1GJPA 1G6CA 4O0KA 2ZQ0A 3T7VA 4TX9A 1Q6QA 3G0XA 5BMXA 1VS1A 3M5ZA 3BW4A 1H50A 4HNTA 1ME9A 4AHOA 2NXHA 3CHVA 2I14A 1BWLA 4WOQA 3OVPA 2CLLA 1O95A 1PHQA 1QFEA 3DFSA 4I7VA 2ZRWA 2GPTA 3DFPA 4UTLA 1K7EA 3NQFA 4LVFA 2YYTA 4NQ1A 1FDYA 4UIOA 2P0OA 5AC6A 1QNVA 4IXHA 1DVJA 2F7FA 4MJZA 3FIGA 3CPRA 3UD6A 4O12A 3IIVA 2WNQA 3NQMA 1ZNNA 1W54A 4EF8A 3GLCA 3GKFA 3I7RA 3KHJA 3NQ8A 2ZA1A 3RLVA 3SJ3A 3M47A 4QSHA 2EPHA 1FDJA 4RV8A 4NNBA 3F4NA 3UWYA 1J5TA 4GE8A 4QQ3A 5I3IA 4NNCA 3DXIA 3LBMA 2C15A 4GUIA 3W74A 4TMBA 4MLJA 3P61A 2TSYA 3UY7A 3NQDA 3QW4B 1JCYA 1EUAA 2FQIA 2OT0A 3PG8A 4LV9A 4AHPA 2V2CA 2NX9A 2J24A 4ONVA 4DQWA 4IXXA 1Z44A 3UPBA 1TPEA 3BW3A 1TPDA 3G0SA 4ZZ9A 3MP3A 1MEIA 2TYSA 3EKLA 2CZEA 2FB3A 1ZFJA 1VH7A 5KMYA 1MSSA 1VZWA 3W83A 4LNYA 2GQAA 4OQVA 2G97A 1KM0A 1QPOA 4CNNA 1W3IA 2NXIA 3LHZA 3B0UX 3OVRA 5K9XA 1LOSA 2JK2A 2NV2A 2QDHA 3S1UA 3VE9A 1GTHA 2DZVA 4K8HA 1K8YA 3QM3A 5HWJA 1ADOA 4GBUA 2ATMA 3M16A 2EAWA 3L5AA 1FY6A 3M43A 4JTFA 1AL7A 1KTBA 3DFQA 4FNUA 2J9YA 5D37A 1WX0A 1TSIA 4HPJA 3GR7A 1TB3A 2JBMA 3LXAA 1KFEA 3BLIA 4XTDA 3A5VA 1I2QA 2X1RA 4LRSA 1OFDA 7TIMA 5HULA 4IMDA 4NJGA 1YTDA 4AF0B 1G7UA 2YYUA 3E12A 3FLUA 4FO4A 1HL2A 4NXKA 1M6JA 1GEQA 5F2IA 4ZQNA 3EX4A 3W2JA 1NEYA 4X2RA 3KRZA 5FESA 1OYAA 1A53A 1R2SA 3N73A 4JYEA 4UUIA 1W5PA 1G4SA 4D2JA 1DKWA 1O5XA 4NU7A 2E5CA 3HB9A 1KLYA 3HG4A 5D04C 4A21A 3DHDA 1SZNA 3ABSA 5KSWA 3LI0A 4CCCA 4UFKA 3QMSA 2PE4A 5MHBA 1FWTA 4NJIA 2XN1A 4O54A 2FJKA 3C6CA 3PF3A 1DV7A 1BEUA 3FFSA 4JGDA 3JS3A 5KINA 2GVLA 3DGRA 3PUEA 3L0NA 3SECA 1I4NA 3NEVA 5H2ZA 3GKAA 4UMAA 3BLFA 3N2XA 4LUJA 1F05A 4JNMA 3T40A 2CLMA 3P84A 1G4EA 4QJ1A 1KM6A 1NSJA 3C4UA 3NVTA 2YW3A 4IOTA 2J9ZA 2YR1A 5A8GA 2AQWA 4DF0A 4ADTA 3KRUA 4MY8A 5E1QA 2ATSA 1MEWA 1GT8A 3E49A 5BRBA 2ZFAA 4FIQA 5C6MA 3CB8A 3HPXA 3HPZA 2V30A 2BLEA 1W1ZA 1X8FA 3T78A 2DJXA 2H3DA 3UY8A 2A0NA 2R94A 3CC1A 5D30A 1JCLA 3VE7A 1DL3A 4LVBA 4BFAA 2ISWA 3LLDA 3VNDA 2HMCA 4JX4A 4JIQA 4JTSA 2GJLA 1SW0A 1K3UA 2NXGA 3IGXA 1RR2A 2X2GA 4L4MA 4UXDA 2E6DA 4AB4A 2Y7DA 4O28A 3QJAA 1JVNA 1EIXA 1DQWA 1KFCA 2NWSA 1VJIA 3NO5A 4WD0A 1VCVA 1OFPA 1A5SA 1LDCA 4KWVA 4Y6GA 2VXNA 3KVMA 1QWGA 1A50A 1QMLA 4DBEA 1IGSA 1F76A 3EWWA 4OHQA 5J5DA 1C8VA 2A21A 4BF9A 2FIQA 1PIIA 5DCBA 2DZUA 3SGZA 1GTEA 4A22A 4JDYA 4ZQOA 1GQNA 5FF2A 5LNVA 4N02A 1CI1A 2HTMA 5G5IA 5K2ZA 2J27A 5K3VA 1QR7A 1SU5A 2WPBA 3M41A 1F73A 5FEXA 3STFA 2GVJA 4CCDA 3TNOA 3N2MA 5D33A 2Z6IA 3OIXA 1TCDA 1LOLA 5K4XA 4IQLA 3MI2A 3RF9A 1P4CA 4JEQA 1OK6A 3W2NA 1YDVA 2CLHA 2BSLA 3KVLA 1F6PA 2C3ZA 5I3GA 4O52A 3IV3A 1O4UA 1H51A 1M5WA 3OEXA 5LGZA 2VFIA 4JTLA 2X30A 3GAKA 5BNKA 2WNNA 3BW2A 4XQ6A 4H6KA 3S8HA 4Y96A 3NPVA 4LY8A 3M6YA 4E38A 3B06A 4JXCA 3KOFA 1H1YA 2FTPA 4H4IA 1LBLA 3W87A 3W7LA 2JKAA 3G18A 1SFJA 1I2RA 1SUXA 4UTUA 3LI1A 2QCNA 3PWAA 4NT0A 5ABTA 1C29A 3H55A 3SGUA 1TTIA 2FPTA 5I3HA 3EWXA 2P10A 1D3GA 2YXGA 4Q33A 4JTUA 3DENA 2YCEA 3L2IA 2WSRA 1KTCA 1EP1A 1L6SA 2CWNA 3PB2A 1YDNA 4MY9A 1LP6A 1LLZA 3EWZA 2PRHA 3LOTA 4RX0A 1WBJA 3W73A 3LHUA 3TQ0A 1UUOA 3TV8A 4RLIA 1L6WA 4HHPA 3UZ5A 1H7PA 2QUUA 3CWOX 3G22A 2ZA3A 3RNDA 3M5XA 3SSJA 1JRBA 1FWNA 3BO9A 2V9DA 3CU2A 4OBTA 1G4TA 4DO4A 3QFEA 3CLMA 4X3ZA 1J2WA 3W1MA 3ATYA 4QIUA 5FF0A 3S1WA 1O60A 3W70A 1HO4A 3R8RA 2QEZA 4EIVA 4YCPA 3MYOA 2OX1A 3NL6A 5K9DA 3O07A 3W7GA 4MZYA 4WY0B 1QOQA 3LHWA 3TDFA 4XWUA 2PRLA 1LYXA 4ZQMA 3S6DA 4HNNA 1W0MA 1Q6RA 2WQPA 2NWRA 1FXQA 3O6DA 2H3BA 2QR6A 5C5YA 1EX5A 1LOQA 3WK3A 5F2GA 2YX0A 4MFEA 1VCGA 3S42A 3G0UA 3GNNA 4NJHA 1H61A 1K02A 3P5YA 4BWLA 2VC6A 4GC4A 5G4WA 2RDUA 4IMCA 4Z1DA 3CEPA 4I7WA 1TV8A 1QPRA 2V2DA 3DU0A 3P62A 3UWWA 2Y62A 2P1FA 1WDWA 2CLKA 3W86A 1H7WA 1TJPA 4K7VA 3A21A 2W0UA 3TROA 1XXXA 5KITA 1NAL1 1KM5A 3D0CA 1ZAIA 2JKPA 3HF3A 3YPIA 3I68A 3MP5A 1LRNA 2PC4A 3Q58A 5FF7A 3LTSA 1OX4B 5HR6A 1KV5A 1L2UA 1OFBA 1H60A 2ABAA 4O53A 3NR0A 4AAJA 1OVDA 1P1XA 1UCWA 1F2JA 1DJNA 1PCKA 3W7EA 4Y8FA 4JS3A 3LV5A 1ME7A 5G2WA 2B7NA 5CPLA 1XC4A 5DCEA 3NQAA 4CNOA 4O4VA 2QCFA 4UFIA 2H8XA 4WJEA 3PUOA 4K36A 3W23A 3M0ZA 1SZGA 4LOCA 3DFNA 3NOEA 2BXVA 2W6RA 2C0AA 3O15A 4RR4A 4QM1A 1TRIA 3LCFA 4EF9A 3LHTA 5G1TA 1TQXA 4UFJA 3NA8A 3TAOA 4GJ1A 3MJYA 3GDLA 1FCBA 3W1AA 1TPUA 4OV9A 4AWSA 5HUPA 1DQXA 4AWUA 4UTMA 5HR7A 4Z1AA 2EKCA 3FKKA 3I7QA 1XUZA 1VCFA 3NQ2A 3OA3A 2CU0A 3P8IA 4WUIA 3TJXA 1IXPA 1PS9A 3ZFHA 3PUDA 5HMSA 2BTMA 1JQVA 5U7SA 5EA9A 2QJHA 3C2OA 1YXCA 4XBKA 1SO5A 4A2RA 1Z48A 4MZ8A 4XUGA 1LORA 4JTHA 4ZVJA 1EWEA 3HPSA 4ALDA 3KX6A 3W1NA 3W1XA 4K38A 4ADUA 2VFEA 1X6UA 4YXGA 1OFOA 4IJBA 3B4UA 1Q3NA 4IPJA 3A5FA 4Z0SA 3NZ1A 5F4WA 5D2XA 5CPOA 3TMQA 2CLIA 2RH9A 3BV4A 2H90A 3TCEA 4IX0A 3TW6A 3TFXA 1WAUA 3OG3A 5G2IA 3F03K 3W2KA 2R8WA 4NZJA 3NM1A 3WK1A 4WX2A 4WQ6A 1EB3A 3EB2A 4O17A 5K7JA 3JR2A 3QQ0A 1W37A 1OFQA 1X1OA 1I8JA 1VYSX 5FEWA 4O16A 2OZ0A 6TIMA 1ZENA 1PV8A 4YCOA 1M7PA 4XKYA 3BG9A 1W5MA 1YTEA 2DZTA 3O6CA 4N9DA 3DI0A 3LGEA 3MO7A 2ZZ1A 1H7XA 1SFLA 2PRMA 4MLRA 3EXRA 2DP3A 4N6EA 2QAPA 4UTHA 1AW2A 3QSTA 3NYZA 4S2CA 3H54A 4EVZA 3TU9A 3INPA 3L0KA 4WXZA 3L5LA 4X22A 1G7VA 1KFKA 2Y88A 3NQ7A 3OBKA 5LNRA 4L4LA 2NX3A 5I3FA 1KV8A 3NQVA 3C8FA 1YADA 3Q94A 3G1FA 2TPSA 3L5MA 1H62A 1B9BA 3W88A 4MYXA 2ZRZA 1VR6A 5HJLA 4N9CA 4XBSA 2WOQA 5KTLA 3G1VA 4GFSA 4BWLC 1DOSA 2ZRVA 4HNVA 3A9IA 3BGJA 3UWQA 3PSVA 1T0OA 4O1DA 4CQ8A 5D09A 3ZWTA 1KLZA 1DHPA 3W3OA 4ZL1A 3GXNA 4HSNA 4UTIA 1SQ7A 5F4SA 3IGUA 1B3OA 5LNSA 2CLOA 1T8XA 1UB3A 4FX8A 4U4MA 3N9SA 2O7SA 3HIJA 1KFBA 1GVOA 4O0ZA 2ISSA 1MEHA 3F4WA 5BW6A 3TH6A 1H5YA 4R53A 5LGXA 3DKLA 3W1QA 3SZ8A 1VQTA 5EKYA 3C2VA 1SPQA 5D03A 3NQEA 1HG3A 3MMTA 1B57A 4PL1A 1I2PA 4HT3A 3M9YA 1TYGA 4O13A 1TTQA 4DO5A 3IVSA 1HO1A 1V5XA 3TQVA 3NQ6A 1LRQA 3LXBA 4WY0F 3RK8A 2A2IA 5G1YA 5LNUA 3S5OA 2RKXA 1ICQA 1WBHA 1NF0A 3GDMA 4NJJA 2OT1A 3AJXA 2A85A 3UYCA 5CPNA 2Q3RA 4YWIA 2Y7GA 4MIMA 3BGGA 4Z1BA 1P5BA 3UWZA 3ATZA 1FWWA 3S0CA 4JY9A 2OCZA 2QCCA 3SR7A 1V7YA 5KZDA 3TA6A 1KBJA 2I9EA 4JYFA 4MUZA 2GOUA 2ZZ2A 3CEUA 3VI2A 2NZLA 3QYQA 4LUIA 3O6YX 1VHCA 2Y63A 3PR2A 3L66A 5AHEA 2YW4A 1MO0A 2V2HA 4FNPA 4O8RA 2CFFA 3NG3A 4UMCA 4U28A 3NPWA 3W1RA 5AN7A 3LHVA 3W71A 1ZAJA 4KFOA 4TR9A 5DCDA 4O15A 1GYNA 3RMJA 2RDWA 2QF7A 4GXMA 3BARA 1H7OA 3SI9A 3HJZA 5CSSA 4IWWA 3BVJA 1LLWA 4ZQPA 5IBXA 3VKJA 3N34A 1XBVA 4YL2A 2QCLA 3P74A 5DBTA 1JUBA 1VGAA 3QMTA 4J9JA 1S5WA 1O5KA 1X1ZA 4QNEA 4FNSA 4JTJA 1OHLA 4BR1A 2QCDB 2A5HA 2OMAA 2RDTA 2FFCA 1SR9A 1YYAA 1WYIA 2I1OA 5C54A 1I2OA 1TREA 3P60A 1KM1A 2VFGA 2E6AA 5D2YA 2V8ZA 4S1FA 1ZJIA 3LRKA 3P80A 1SW3A 4ZQRA 4N2YA 4DEFA 1G67A 4MYAA 2ZZ6A 2JGYA 4BI5A 4E2BA 1RVGA 2FPVA 4OU1A 4ORIA 2C16A 2QUVA 3LB0A 2QCGA 1TV7A 2C1HA 5DELA 5DLCA 3IVUA 3W85A 4Y90A 4ML9A 3C2EA 3KAOA 2VFHA 1GYLA 3AO0A 5HINA 3SIZA 2YFNA 4O14A 3NPXA 5EL1A 2G95A 1YXDA 3B8DA 1JQXA 3ANYA 3GX9A 3LCWA 5D05A 4LC8A 3DFOA 2ZRUA 4UTWA 3N19B 3B05A 1GOXA 1ZCOA 3DAQA 3WJWA 3NL2A 1QDSA 2YDAA 1TPC1 3FYPA 3TX9A 1W3NA 3BG5A 3S1XA 2ZA2A 5E93A 3L0GA 2QDGA 1FX6A 2Y7FA 4N9EA 4O1CA 4RKAA 1YXYA 2A1YA 3C2RA 4R33A 1R2RA 4TO8A 1UUMA 3O06A 2V82A 3LXCA 6ALDA 4K37A 4O1AA 1BTMA 3R12A 5KZEA 3LLFA 3GNDA 1LZOA 4UFMA 4PH6A 1K03A 1FQ0A 5L9FA 1VYPX 3U8GA 1UASA 1XUUA 3NL5A 5D32A 3C56A 4LS1A 5DY2A 2HSAA 1S5TA 1I45A 5E0KA 3TMLA 4Z0JA 4I7UA 1JR1A 3WJYA 2DJLA 3CIWA 3T55A 1S5VA 1QO2A 3WJXA 1Q6OA 1GWJA 3CIXA 4YMZA 2V0TA 1LROA 3W6YA 1GVRA 1L9WA 3PBUA 2LLEA 1U83A 3M7WA 2AGKA 2TMDA 2Z1BA 1T99A 2C18A 1AL8A 2WV8A 1N8FA 4ZQCA 2D73A 3P5ZA 3TSDA 5FEPA 3GK0A 8TIMA 4OWGA 1KBIA 1BKSA 3TK7A 2C19A 4O19A 4ZMGA 3MI3A 4GUFA 5U4NA 2BX7A 3PS7A 3TC6A 3W84A 2ZZ5A 3DBPA 4MZ1A 2W79A 1IIHA 3KFTA 4GUJA 5G2HA 3STCA 1OYBA 2YPIA 4HKPA 1JCNA 5D02A 3W2LA 1XDLA 1R30A 4N4QA 4DXVA 4CQ9A 3DKJA 4JDBA 3W72A 1W5NA 3G3MA 3GAYA 1YDOA 4M7SA 1GVQA 4AF0A 1H63A 2Y85A 4JICA 3G24A 4HPXA 5CZJA 3A22A 4DO6A 2EF9A 1R2TA 3TW7A 4NXSA 5AOUA 2Y6ZA 4HNUA 4UFLA 4K39A 4Z08A 1VC4A 2QCHA 5FF4A 5HUOA 3TR2A 1XBZA 2IQTA 3L65A 3NQGA 4TU1A 4MFDA 1BWKA 4O11A 4NUWA 2HS6A 3TXZA 3V1PA 4JYDA 4P2VA 2YZRA 3GB6A 3QPYA 1KM4A 1TPVA 2E5BA 4XTIA
chains in the Genus database with same CATH superfamily
4NILA 3GM8A 1FRBA 1XI3A 3O0FA 4XZIA 1VBHA 3VGDA 3STGA 4GUGA 5LIUX 2FTWA 5C0QA 5A5WA 3W7MA 3LCLA 1XDMA 2E9LA 1K8XA 3KBVA 5LIXX 1FFRA 3UG4A 3MUCA 2QV5A 3HGJA 3MW7A 1MW1A 4NI8A 3WEMA 5M1TA 5CEWA 3JUGA 4LRTA 1XYAA 5C71A 3KE0A 2Y70A 1R3QA 1V6WA 2V5DA 3HG3A 2NUYA 4G5DA 4YLWA 4UTFA 4J27A 1SO4A 3AMDA 5F1VA 3WQ8A 3KHDA 2EGZA 1W56A 1WOBA 1JZ2A 4NZFA 3PM6A 3UR2A 2GQ3A 2XWDA 1HXJA 1EJVC 3BLEA 4H19A 3KVJA 1M68A 1P6BA 2Q8LA 3LY0A 3W7NA 1OIMA 1TJ2A 2XIJA 3CWNA 3W1UA 2HK0A 3ZSTA 1DJGA 2CZDA 3M4HA 3DZ1A 1F5ZA 3KZSA 4GO9A 1CEOA 2IKJA 1D8CA 4RDYA 2DPEA 1C9DA 5CZTA 1OG0A 2QHAA 1D9EA 1Q45A 3HA1A 1FWHC 4A3YA 4NRRA 5A6JA 3T08A 5AYBA 5CG0A 3G1YA 2J77A 3CHDA 2YFOA 2B7PA 3UZJA 1OC6A 3GU1A 3VA8A 2OFJA 4HCHA 3QRHA 1UKOA 5SWUA 1IXOA 3B0VC 3B0PA 5AHFA 5CPQA 1XFBA 1A0CA 2B0MA 1LBMA 3HO8A 4Z1CA 3EWBX 4FR6A 3QV8A 4BHYA 4DAIA 5AC8A 4US6A 4FF5A 2J9XA 2QJJA 4XD3A 3DUGA 1TELA 1VFUA 4D6JA 4QDMA 3H2MA 4GI6A 1AODA 1GG0A 1XP3A 3GUWA 3AS3A 3B3DA 4AW7A 2QCEA 3U5UA 1IF2A 3FKRA 4NZ3A 3GQYA 4OT7A 1KBBA 2ZE3A 2Y89A 1FH8A 4GYPC 5AVNA 3HGOA 4EACA 4P8WA 3MBDA 4HN4A 2CYGA 1MRQA 4MKNA 3L21A 1QRQA 2FVKA 4R34A 4PTDA 4DELA 1H1ZA 2AGTA 2FVLA 3I3DA 3K8MA 4RCXA 4BI6A 4JIPA 5AC5A 4GIAA 4MOZA 4HA1A 3HQ1A 1RQBA 4HK6A 2YDSA 1ISWA 2A3LA 3F2DA 4PULA 1POJA 3NIYA 2F84A 3B8VA 1W2PA 3MHFA 3QQ1A 4PMXA 1BWVA 2XM1A 6A3HA 4G8TA 1TUXA 3WLRA 3SRFA 5H8UA 4WY0A 2GQ9A 4FNRA 3CAKA 3KL0A 3OP2A 1LJYA 2FPYA 1IIGA 1Q13A 4Y9PA 4CNTA 3PC0A 3SFKA 1I75A 3GWQA 1TV3A 4Q8PA 4WOZA 4BQ5A 3GBDA 2AL2A 3NPUA 4H9MA 3QPZA 1U5VA 3MZ2A 3UZWA 4NVTA 5HK4A 4I90A 4BF7A 4GBDA 1T5AA 2WJZA 1J6PA 2B31A 4Q4PA 2CLFA 4KPLA 3AALA 5BXSA 2VX6A 1CCWB 2ALDA 2QCMA 1PWLA 3ZYZA 5H91A 2PDHA 2XIIA 3H53A 4JTIA 5JVLA 4C6NA 2E9BA 6PTDA 3XINA 4IPIA 1YEYA 4E0CA 5D9OA 1YIXA 3D6NA 2QF8A 1NM9A 1XSKA 2ZOXA 4W9TA 1GPWA 1G69A 1KGWA 4RZ4A 2WAGA 4JKMA 3TJ4A 1YPIA 1G9HA 1EEPA 4K8EA 4OOZA 1H2JA 5DXYA 2QUTA 1V0MA 2FGBA 2VQTA 3OZOA 4ZO8A 3VO0A 1RD5A 4Q8TA 3ME3A 1D7FA 2QULA 4MDPA 3GXFA 1GHSA 3GG8A 4Q4RA 5DXXA 5I78A 1UWIA 4IMGA 3EDJA 1CWYA 5TD4A 3M0KA 3N15A 2IPGA 4W85A 3N14A 2QUMA 2FKPA 5D9PA 2C6QA 3BAIA 4KKXA 1BXBA 3L4XA 4M1BA 5EPDA 4LU0A 1ECEA 2UV8G 4KEVA 1N8IA 5C2GA 3F4VA 2C13A 3VC5A 3WNKA 5AYXA 3GC2A 1HTIA 4F0MA 1TPWA 4OE7A 4GWEA 3SN0A 4KWWA 3GH4A 1A80A 1J11A 1CW2A 3OA5A 2PD9A 5EBAA 3FX4A 3GR8A 4I9MA 1FWIC 2Z0IA 1ZAHA 4UTKA 3FEQA 1JZ4A 4LV4A 4HMNA 3OHIA 1CYGA 4LW7A 3EA1A 3SGGA 4FX6M 4NSBA 4IJRA 3TTYA 4HNLA 3E9AA 3W37A 4FEZA 3LCXA 1HVXA 3SIMA 5GNZA 1VENA 4NZ4A 4DBDA 3UU0A 1XKYA 3IEBA 5EMUA 2VEMA 1VF8A 4N42A 1NH6A 2V5LA 2PMQA 2GDUA 1P6CA 4D72A 4KS0A 4INFA 3UWUA 1CLXA 3E5BA 3G3DA 1JPMA 1ZHAA 3OYXA 5M03A 1S39A 2EXOA 4LTSA 5PTDA 1RXOB 1E73M 1GOIA 3WH8A 2ONEA 3S83A 4R3UA 2XHYA 3OBAA 4PYSA 1QI4A 1FDZA 4G7FA 4O1EA 3UG8A 1EHAA 2JQXA 4HPNA 4JN8A 4A05A 2AMGA 1PWMA 1A5CA 3DIPA 3MPGA 1CLKA 1EGZA 4CN1A 5KZMA 3CAVA 1VPXA 1OYCA 1K8ZA 4B9YA 1BVNP 3MSRA 5JIWA 2XPKA 4RXGA 1R3RA 3AZTA 2WSPA 1V8EA 3AUJA 3IIPA 1JYVA 4JTAA 4CVUA 4OUEA 2ZXBA 5G1MA 4DPPA 3LYEA 3EDEA 4CLMA 3CHCA 2QKFA 4RPQA 3DI1A 4J3VA 3WQWA 5JQ9A 2OX4A 1JZ3A 1R6WA 3BLKA 3ZT6A 1R5YA 3M5VA 3L68A 3O63A 4DNHA 4G2DA 4L9XA 2BY1A 3G1HA 4DWDA 1SFTA 4YHGA 2VC9A 3MKCA 3VM5A 4K68A 3WNLA 3E96A 1GK8A 4S38A 4JTGA 4H9UA 5BYWA 3N1AA 3WD3A 1EBGA 1XKJA 3G1SA 1F61A 1WQ5A 4K7YA 1AW5A 3LERA 3QC0A 2EPOA 4ZOAA 4HVXA 5F4XA 2PTDA 4XB3A 4L5ZA 4BK9A 5B7ZA 3EWCA 4RW3A 2V6AA 1AJZA 1Z41A 3AHTA 1PVNA 3IVTA 2YGYA 3FY1A 1HUVA 3GDRA 3ZM8A 1CXFA 2GUUA 1EDTA 4MDOA 3A47A 2E40A 3M0JA 4LB4A 5C9UA 1WKEA 1JJKA 2Z25A 1J10A 2J47A 3W6MA 2RHGA 2BWGA 2X42A 1FWAC 3T8LA 4I6VA 2C0HA 3EMCA 3QKZA 3H7UA 3FJLA 1WE5A 3JZUA 5CC7A 5D2TA 4FB7A 1TMLA 1L2QA 1UD5A 2VZSA 3S2LA 3S47A 1PO9A 1TR9A 5BOFA 5AHMA 1LBFA 5LHFA 3JRKA 4M8UA 1TTJA 3U3HA 3DFTA 3O8AA 1FWSA 2A7NA 5FJUA 3P14A 2NT1A 2HJPA 4V27A 2DV0A 2J4GA 1TJRA 3MUXA 4X63A 3T44A 4CGTA 3CLWA 5D2VA 1OFEA 4WRHA 4H3DA 4ADSA 2XSAA 3UXAA 1R46A 2PF8A 1N8WA 3S1VA 5KETA 3ITCA 5DBUA 2RGMA 3PZQA 4CVWA 4FI4A 5ECVA 4IG2A 1LLOA 3CV1A 1XPYA 4XUYA 1CGYA 4JL2A 4XO7A 4OZOA 1XGZA 2REQA 1ENUA 4D8AA 2E8YA 3BOLA 2NQ5A 4AQLA 1XPGA 2EPNA 4OKDA 3R89A 1FP8A 3B8TA 1R7AA 3PZMA 4W88A 2WNWA 3VIMA 1J0JA 4V15A 1ME8A 2HXUA 2D24A 2VWTA 1R3VA 5EMMA 1EEXA 4XAFA 1SZEA 4GK8A 3HG5A 4ORMA 3LCHA 4IISA 3E0IA 2X8RA 4Z2LA 3AROA 3GXTA 3AIVA 2Q8ZA 1MFUA 1V6UA 4PB3A 1GJPA 4O0KA 4YTSA 1AA1B 4E4PA 2VUNA 4HU8A 1VS1A 3BW4A 3RX2A 1UWSA 3WBWA 2QT3A 3U4AA 3GHSA 1HGWA 2VX7A 2VI0A 2WCAA 4QAWA 1XYFA 2Z4GA 4I7VA 5T91A 2FH8A 3WLQA 2PU1A 3LZ5A 2YYTA 4PMVA 4BEQA 1QNVA 1DVJA 3FA4A 1UD4A 1NDVA 1XS2A 3FIGA 4JQAA 1CXHA 3UD6A 4O12A 5REQA 3IIVA 1XF0A 2VD9A 1ZNNA 3RCMA 3G77A 4EF8A 3W01A 3W27A 3WL0A 3NQ8A 2ZA1A 3VZZA 3SJ3A 2EPHA 1GKRA 1X6LA 4DJDA 1G01A 4GE8A 3KBNA 5HATA 3AI0A 2VRQA 1UR1A 1W1YA 2ZICA 2C15A 4HU4A 4TMBA 4MLJA 3L4VA 3IK4A 1KB3A 1G5AA 3NQDA 3QW4B 1EUAA 2FQIA 2Y24A 2V38A 3E74A 3M07A 4JTCA 3KL5A 1Z44A 1TPEA 1TPDA 1UMYA 5GPRA 3G0SA 4JQ2A 3F7JA 4P5UA 1MEIA 3HJEA 5FKYA 3L4UA 2G97A 1KM0A 2NXIA 4UB9A 2JK2A 3KOXA 5DMYA 4DLMA 1K8YA 2FZBA 2PDWA 2IW0A 5HWJA 3TN5A 3AXHA 1JI2A 1FY6A 3M43A 3H21A 3PWGA 5D37A 4H6QA 4GACA 4HPJA 4Q8QA 2Y5JA 2YZ5A 1KFEA 1QI3A 5ECUA 5CJ5A 2E0PA 2X1RA 4MGGA 3ITYA 4C6IA 4P7QA 4HOZA 1Q2SA 1UWTA 5DRIA 4MJ4A 4AF0B 1G7UA 1R85A 4AUBA 3B4YA 4KEZA 4ICMA 4NXKA 5HDRA 2YLAA 1P43A 2XINA 5HMEA 4WVXA 3GU9A 3VX1A 1J0YA 2GYIA 3U0HA 4UUIA 4AEFA 1W5PA 1G4SA 4GPNA 1CT5A 3MKVA 4CEXC 1O5XA 3ARZA 3V0UA 2BOEX 3QMSA 5MHBA 3VKCA 1K8CA 2WMFA 3AOFA 1BLIA 2FJKA 3PF3A 1JZ5A 4TVDA 3SECA 4WK9A 2PTZA 2OGJA 3KBMA 1EJ7L 5DT7A 3N2XA 4JNMA 1HW6A 1NSJA 1GOOA 4IOTA 4UQDA 3I3EA 3ORWA 2ICSA 1KR1A 4Y9MA 1A5MC 1AH3A 1GT8A 1DIDA 2OXNA 4IIGA 1OEPA 3O3RA 3N6HA 3LZ3A 3CB8A 4JCLA 2ZIDA 3VGFA 2BLEA 5IFTA 1VFFA 2Y5EA 2DJXA 3EA3A 1JYNA 3VE7A 1JCLA 1DL3A 4LVBA 4BFAA 2PB1A 2A3EA 3U7BA 4PR4A 3VNDA 1TMQA 5FAGA 2XSBA 2BY2A 3R79A 3U2EA 1ITCA 1SW0A 1K3UA 3IGXA 1TFVA 4L4MA 2PDJA 4YPJA 3WSUA 3WQVA 3ALGA 5A2AA 3QJAA 2AL1A 2E8ZA 3EOOA 4AD2A 1J0IA 4PRTA 5E6YA 3VKDA 1EIXA 4IP5A 1PTDA 3NO5A 1VCVA 1OFPA 4PTXA 3DFYA 1A5SA 2J79A 4KWVA 6XIAA 1H11A 4Z2GA 5A6AA 1L8PA 4DJDC 2PDBA 4JFWA 1YE4A 3KCOA 3OB8A 2JALA 2GL5A 1EA9C 2A21A 2YIHA 4QBXA 4AY8A 4Z1YA 1GTEA 5C2CA 4ZQOA 4XAYA 3MC5A 4N02A 4MB3A 4KMQA 1K1DA 2VDGA 3DBNA 2XUCA 4DJFA 2QQ6A 5K2ZA 3FYYA 5K3VA 1SU5A 2WPBA 3STFA 2GVJA 3OIXA 4QJ5B 3DHPA 1LOLA 1WB0A 3TQPA 3VK5A 1OK6A 1WAWA 4AZGA 3CGTA 2BSLA 3WBXA 2UY4A 2EQDA 4O52A 3ARWA 1M5WA 3QOKA 2IMRA 1OT1A 4H8VA 3GAKA 1GGOA 4H6KA 3S8HA 3BLDA 4WGHA 1AQMA 1TG7A 3SFWA 2HEJA 3VIHA 3KOFA 1KRCC 2JKAA 3G18A 5I7GA 4FLOA 3DERA 5ABTA 1ODZA 2PDFA 1UWQA 4QS5A 5AYIA 5I3HA 2P10A 1D3GA 4XTIA 4Q33A 3DENA 1PUDA 3ITLA 4TX8A 2AOSA 1EJTC 2CWNA 1JF6A 1UQZA 3CJPA 4MY9A 3K4AA 1WBJA 1V02A 3LHUA 2FHCA 4DBWA 3TQ0A 3TV8A 2OZ8A 4JZ5A 1H7PA 3SQSA 3M5XA 3SSJA 1FWNA 3NJ3A 1EO5A 2V9DA 3AIUA 3HU7A 2CETA 3WUFA 4OBTA 1G4TA 1XLGA 2VRKA 3W1MA 4MG4A 2PDYA 4REQB 4ZXLA 3R8RA 2QEZA 5JBDA 1EYWA 1C9WA 3VUPA 3KTSA 3MO4A 4PMYA 1GEHA 3W7GA 2BHUA 3LHWA 1HVQA 3HV8A 2PRLA 3R7MA 2BY3A 1K9DA 3GTHA 1W3JA 1W0MA 1Y7VA 4RNFA 3O6DA 4CCZA 1EZWA 3HFTA 1EX5A 4WSJA 1K77A 5DRCA 3SADA 2ZXDA 3M0LA 4MFEA 3S42A 3GNNA 4NJHA 1H61A 1K02A 3AU2A 3P5YA 4GC4A 2D2GA 2RDUA 1CB7B 2WCGA 4H04A 2Y62A 2P1FA 3W86A 1FWEC 3CPUA 3EOLA 3TROA 5GJPA 3U2CA 1XXXA 3TLLA 1NAL1 3BCJA 3CQIA 1S2AA 1ZAIA 2JKPA 3HF3A 1GQKA 3LG3A 3T2PA 3B9NA 3TC3A 3MP5A 1EJWC 3AXMA 3Q58A 3KOZA 3UVAA 3WQ6A 3NR0A 1UKQA 2JF7A 1DE6A 3T0CA 4S3BA 2GVEA 1DJNA 1PCKA 2O55A 5G2WA 5GQBA 1V79A 3TP4A 2B7NA 1XC4A 3CH9A 1PXGA 2QCFA 4M56A 4WJEA 3W23A 1KWGA 1PKMA 2ON3A 1A5LC 4LOCA 3T2OA 4UWMA 3DFNA 4JQ4A 4I5RA 3PTDA 2GSEA 4GZIA 3NXLA 2PODA 2XM2A 3QHNA 2DH2A 2XFYA 3O15A 4RR4A 3PZNA 1CXLA 4UFJA 4ZEPA 4JAWA 3GC4A 3GDLA 1B3XA 1JIBA 3GS6A 2GSHA 1UYQA 4OV9A 1UZ4A 5DEZA 4AWSA 5A6KA 1RBAA 4PTWA 1NARA 2ASHA 1JCTA 2WCSA 1A4MA 3VFCA 1IXPA 1PS9A 2QMKA 3ZFHA 1JQVA 3NZQA 3TN4A 4PUUA 2FZNA 3UCCA 2EPLX 4H9VA 3AHZA 1SO5A 1Z48A 1LORA 4HZMA 3UR5A 3PZ9A 3WLJA 3DEQA 3TN6A 4MPKA 4WLCA 8RUCA 3I6EA 2QV4A 3WLSA 1OZQA 4Z0SA 1UPPA 5XIAA 3MKKA 5F4WA 5D2XA 3TMQA 3IK2A 4HD5A 2WZHA 2D2OA 3F03K 3E0WA 3OW1A 1I60A 4O17A 1ELSA 1JG9A 1JDEA 1BXNA 4KGLA 3AISA 3URAA 1EC9A 2FFIA 2OZ0A 2PF0A 1XGEA 3S3GA 4GIRA 4YCOA 3CUJA 3O6CA 3PP7A 1NQKA 4PUEA 2Q01A 4AZCB 1O7AA 2D22A 2XZ7A 3EXRA 1V3JA 4UTHA 2POZA 3QSTA 3NYZA 1YDYA 4S2CA 4QHRA 4EVZA 4KIEA 3TU9A 1QXLA 3RM9A 1JZ7A 3RRXA 2ISDA 3MV11 4E5TA 1TV4A 4TQTA 2XVPA 4AD5A 2G3MA 1U33A 3NQVA 2ACQA 1YADA 2YLLA 3JW7A 1CGUA 3L5MA 2ZRZA 4XBSA 2WOQA 3WLLA 2P8CA 2WZIA 4HYRA 5JXQA 2J7EA 4HNVA 3A9IA 3BGJA 4UQAA 4B5XA 3ZWTA 4M80A 3M46A 1B3OA 3FJNA 1RCOB 1W9UA 4IPLA 4FX8A 3N9SA 2O7SA 3WLPA 4YTRA 4JPGA 5LIYX 4RZBA 4RV3A 2ISSA 3F4WA 3R25A 1E6SM 3TH6A 5LGXA 4J2MA 2PWVA 5EKYA 2W27A 1SPQA 2WVSA 2VZOA 1D7KA 1HG3A 1ISZA 3MDWA 4HT3A 5CJMA 1GKPA 3M64A 1HO1A 1V5XA 3K4WA 4QR6A 4U2ZA 4DWSB 2XIMA 2A2IA 5LNUA 3S5OA 2F6KA 7TAAA 1NF0A 4W7VA 4NJJA 4MB1A 3AJXA 3QTGA 4B92A 1PKYA 4HBKA 4JL1A 1J01A 2Q3RA 2Y7GA 4MIMA 4ZFMA 1XSIA 2DIEA 3UWZA 4GNKB 3H7VA 2NQZA 5C9RA 2BB0A 3WF1A 4C1NA 3SR7A 4QG6A 4DBSA 3II1A 4D6HA 2I9EA 2HXTA 3UNTA 3S2JA 3URNA 2ZZ2A 2PFHA 3VMPA 1VHCA 1VIWA 4PB5A 1FHLA 2CFFA 3A6OA 3NPWA 1Y5VA 1RH9A 4KFOA 3W71A 5DCDA 4GI4A 4BS0A 2GWNA 2RDWA 2OODA 4IWWA 1OC7A 1O1HA 1VB9A 4LAZA 4ZQPA 5IBXA 4YL2A 3HZ3A 9CGTA 1ADSA 3ERPA 5DBTA 1WUFA 3NWRA 3A4XA 1O5KA 4QNEA 3LSBA 4FNSA 3PPFA 4BR1A 4HK7A 4JCMA 2WWCA 2DZAA 2FFCA 2O4MA 1AD1A 1YMYA 4O1FA 1US2A 1TR1A 2VO5A 4GX8A 1X38A 5D2YA 3N17A 4Q6JA 3LRKA 1SZRA 4ZQRA 4DEFA 1QNSA 2GGIA 4A3HA 3BL3A 2JGYA 1V93A 1U5HA 4W8BA 1XRFA 3K1DA 3BDKA 2W61A 3TVAA 3VC6A 5FCZA 4ZXOA 5A8NA 3W85A 4CU7A 2NVAA 1B30A 2E9MA 4ML9A 4IT1A 3VDAA 1M1BA 4QLLA 1C91A 5EL1A 2G95A 2DSZA 2Z1WA 3H2CA 4LBRA 4C6JA 1W91A 3RM4A 3LCWA 1UC5A 3DFOA 5HPOA 1K6WA 3N19B 1CLVA 3T4WA 1QNPA 2VWSA 3NL2A 1QDSA 4L80A 4F2BA 5HMFA 4MKSA 3PJTA 4B3ZA 4EE9A 2D1ZA 1W3NA 3T0BA 5E5CA 3VNIA 5JMUA 5E93A 3AS0A 2ZX7A 2QDGA 1FX6A 2Y7FA 1EGMA 3EAUA 1YXYA 4R33A 1R2RA 5LA2A 4F48A 6ALDA 1Q63A 4K37A 3PZGA 1JAEA 4C7FA 2Y2WA 1LZOA 3TA9A 1OB0A 1C8XA 3FSUA 3NL5A 5D32A 3C56A 3ONBA 1I45A 3TMLA 4Z0JA 4I7UA 4JHZA 4J35A 4IHCA 2PBOA 3CIXA 3NSNA 1UHVA 2V0TA 1JZ8A 1L9WA 4WGXA 3M7WA 7REQA 3WMCA 1T99A 4O0QA 3VKAA 2PWHA 3TSDA 3QY8A 4I9TA 1W3HA 1KBIA 2I5QA 4LCQA 3R0KA 3DBPA 4HSHA 7ENLA 4J3UA 4YTQA 5G2HA 3UZZA 3P0XA 3W2LA 5AY7A 3R0DA 3NOYA 4FA3A 2ZX6A 4N4QA 1NDYA 1OT2A 2Q71A 3W72A 3T05A 1XC6A 1YDOA 1DIEA 4AF0A 3E0FA 2CIPA 1E4NA 3TEVA 4R27A 5EB8A 3A22A 3F4CA 3TW7A 2Y6ZA 4UFLA 4K39A 5C7VA 4WCJA 1FKWA 1VC4A 5FF4A 1EHNA 1JXJA 3WQOA 2OQLA 4MFDA 3TXZA 4P2VA 4Q3MA 1HL9A 1EKOA 2E5BA 3EA2A 2GUBA 3ITTA 1KFJA 4IMAA 2BOGX 4DB7A 2G5WA 3O7UA 2QJIA 5IBXC 3W2MA 1SW7A 1HKJA 2Q09A 1LWIA 3G6LA 3V1HA 5CSRA 1EXBA 1EJRC 1XL9A 4PFMA 1MW3A 3R4IA 4L61A 4XAPA 3BPWA 4LWWA 2CZ5A 3CZLA 4LYPA 3UCQA 4UMBA 4FK9A 1VHNA 4FALA 3S9ZA 1MMFA 5IHRA 3FA3A 4WXYA 2CLPA 3NZRA 2YXXA 1DBTA 3OVGA 3NEHA 4GA8A 1F07A 2DT2A 3WK0A 2OLHA 2PDLA 1D3CA 1W9DM 5GVJA 3T42A 4FR1A 1PDZA 5JBEA 2FB2A 2J6VA 4FHAA 5HANA 9XIMA 4M1RA 3W75A 3W7QA 3VINA 1QK0A 1LT7A 1V3HA 1B3VA 3ZWSA 1XYLA 3AXXA 2OLSA 3MYPA 3WH7A 4PSPA 5HNRA 1FWBC 3ZJ8A 2FGLA 3QN3A 4Q4KA 1IT8A 4KW2A 4B15A 1YPFA 3PFMA 3F5KA 4B5SA 1B90A 2Z26A 4DI9A 1XM3A 3HV9A 4LBUA 3I6RA 1RUSA 3M0VA 2E1DA 1KR0A 2TODA 1R86A 2ZDSA 1KCKA 2VVNA 2NSXA 4AH7A 5I00A 1R9ZA 3GVQA 1KQZA 4HMDA 3UJRA 4LVAA 4FNTA 5C2XA 3WD1A 3VCNA 4UTJA 2OWWA 2XN2A 3W9ZA 3IV8A 2A6NA 1GVYA 1PBGA 3U9IA 1ZS2A 1XCFA 4Y9AA 8A3HA 2VR5A 4WKFA 4YWSA 2KZHA 2JEQA 2P0IA 4J3XA 1ISXA 4KEUA 1YPXA 2GSJA 4MWAB 1X7IA 4LEFA 3VIJA 3ABRA 3ZJ7A 2YBTA 1JEZA 2PTWA 1VLWA 2YCJA 3PBGA 2XH4A 1CGVA 3VIOA 2O9OA 3MCOA 3TUUA 2H6RA 4WEVX 4CD4A 2D2JA 1OJXA 1GJWA 4PCFA 3TWAA 2EPKX 4ATLA 3MHUA 3C5QA 4RNJA 1ZY9A 5F2MA 1MXGA 2GVGA 4AZIA 1OC5A 2DIJA 1PJ9A 3M1ZA 3QSRA 3N2CA 3UF9A 3MWAA 1RK5A 4C6PA 1ZALA 3S9YA 2BVWA 3VVGA 3EB4A 2PDKA 3BG3A 2I5GA 2O9PA 2IXVA 2F38A 3GVVA 5A6SA 4AVNA 1OK4A 2O56A 4FNQA 4PMDA 1P7TA 4AY7A 3U57A 2OO6A 4REQA 1TMHA 3NCOA 1BHGA 3MV01 5M3WA 3G8RA 3GDTA 4L56A 1BF2A 1MVYA 2R6OA 4QROA 5HQLA 4E2DA 3WK2A 3GIYA 3FAWA 4Y7EA 3WUEA 1WKFA 4WDXA 1TPFA 4X9YA 3IIOA 3AYVA 3O16A 1F6KA 3CQ0A 3S2NA 3BSMA 2DSUA 1B4KA 1GOWA 1DTNA 1YTKA 3WDIA 1V08A 4N6FA 3NGJA 2OQYA 3LX9A 1IWBA 3B9DA 4AWEA 3ECQA 2R1PA 1AZ2A 3CZGA 2Q3OA 4AVFA 3RLHA 3PBWA 2ABBA 2XYLA 2DT1A 2GVYA 3ZQ9A 4I5XA 1RJQA 2QAFA 5DT5A 4M0XA 2ISFA 3QPEA 2G4FA 1W3LA 5C7HA 3QW3A 6ENLA 3SCPA 5FSEC 1S2CA 1N7KA 2B4GA 3TYEA 2VFFA 3S2MA 2VL4A 3FJ6A 5CPSA 4A3UA 1SMAA 1FUYA 3SW6A 3ELFA 3RCYA 3NVDA 1WKDA 2ZE0A 4S3EA 4CD5A 3C0QA 4A2SA 4S2BA 3GC5A 1M7JA 2VKZG 5DY3A 3RFAA 4EKJA 1PZ1A 8XIAA 4U3CA 3B0XA 5BZAA 5FJJA 3UYIA 5EGRA 3QV9A 3LTYA 3L4YA 4GVFA 4JY8A 4R9OA 3N6QA 3RU8X 3UJ2A 3BWWA 1WDSA 3HTWA 3BOFA 4KFPA 3GTXA 3UA3A 2GZXA 1NF7A 3CASA 3MVTA 4ZBCA 1GW1A 1A5AA 2ZADA 3LQLA 5DF0A 4AWTA 3O1NA 5LA1A 1MDLA 2UY5A 3R8GA 3IIXA 2PGEA 2FZDA 3EXSA 1O94A 4IIEA 2VTFA 2VZUA 1FVPA 2CWXA 4FF7A 4C60A 4LAUA 4ZOEA 3NXFA 1ZQ5A 4PN2A 3WD4A 2VVSA 4C5YA 3LV6A 4TVUA 1DWIM 2ZZ3A 3EX6A 4DN1A 2WKLA 1AVAA 1RLCL 3P2VA 2VELA 2QJNA 1QPKA 3MUY1 3CZKA 1JUEA 5LA0A 2BVYA 1C92A 3IUDA 3WUGA 4PC8A 4BZYA 5IOBA 1C3FA 1X7FA 4RDZA 4I3GA 3IPWA 2IKIA 1LQAA 4PUWA 1RZMA 4X61A 2WZTA 1FA2A 4D71A 3D3FA 3K46A 1EDGA 2Y8KA 3W7HA 4B5VA 2ZTKA 2E68A 2VGBA 3NTYA 1TWSA 2D69A 2CCRA 1K7XA 1E0TA 2WQDA 1BF6A 3C0JA 4PCNA 2BGSA 2VZVA 3W1TA 2CW6A 4PEEA 2V81A 3SRDA 1LCOA 1BXCA 3RLUA 2AKZA 3A24A 2MUCA 3FYOA 3TTQA 3I4EA 5RUBA 4PE8A 3QV6A 1MXDA 3BE7A 4HCLA 4UQ9A 3P67A 3G6MA 2A7RA 2H9AB 1E4LA 1DWJM 3WJSA 4O50A 1SO3A 3ITXA 1E5NA 4LS0A 2A6LA 3WLMA 1S2UA 3WDPP 2IS7A 3STEA 5AB3A 1CGWA 4O18A 1AG1O 1IXNA 4Z42C 1O6IA 3P93A 1B4EA 2VDIA 3OGRA 1XINA 2DGAA 2DZXA 2QGHA 3KDOA 4C5ZA 5AFDA 2G41A 2OZTA 4LPCA 2ZZ4A 1VJZA 3SUVA 2Z2AA 1QBBA 3GVWA 3GIQA 3QC3A 1ESWA 1WDRA 5B80A 4KFNA 3LBCA 1R47A 1OFAA 3B8UA 2WO5A 3LNMA 3PAJA 5IM51 1NVMA 2HZGA 2JGQA 3EDKA 5D2WA 4XKYB 5HWMA 2HK1A 3W0KA 4YNGA 1QOXA 4Q8VA 1T41A 4R5EA 4RJEA 1QASA 4DWSA 5TQLA 2QUNA 3EMZA 3V75A 5J8LA 1JUKA 2R1MA 4TV5A 1Z6KA 3R8HA 3EYPA 1Y5WA 3H23A 2YCLB 4IIFA 3S5SA 1JD9A 3ZR4A 4XZWA 2NLIA 1RA5A 3FV9A 2WVVB 4GYKA 1J4EA 3WO8A 3ZT5A 2WMJA 4JTTA 2V3GA 2BODX 1JRCA 1UWAA 3CM4A 5LKYA 5I24A 2BNJA 4NL1A 4PTNA 2FDMA 3W1LA 1S2TA 2HVOA 4JFSA 4XBJA 3PTQA 2J74A 2HS8A 4NI3A 4XZNX 3IAQA 1NWSA 1LTDA 3PVFA 3B8IA 4GCAA 5K4ZA 3VILA 3GR4A 4PL2A 4L6HA 4PRWA 3W25A 3FDKA 4S3JA 3L4ZA 3I65A 4W5UA 4H41A 1DWHM 1PZ2A 3K1GA 3ARXA 2EEXA 2V5KA 4NYUA 5AYYA 3P82A 3QEZA 2WVUA 4HPGA 4ZCWA 3ICJA 2WHKA 4AMAA 4L65A 2PDIA 3UWEA 3NZPA 3G1AA 4Z2JA 1XFCA 2AKMA 4LXFA 2BBFA 3G8EA 1W3TA 3EWUA 1BVWA 1KM3A 2VCBA 3L12A 3QMRA 3PY2A 1VFMA 4AZ7A 1ZLPA 3W7OA 3VTRA 3HOJA 1K6AA 1M65A 1MQQA 3EKZA 4O4WA 2OB3A 3COTA 4M6PA 3BAWA 4G1KA 2F6XA 4NZ5A 3MI6A 3VPLA 2PP3A 1PAMA 2QS8A 5GNYA 4ATDA 2VGGA 1E9LA 1JDDA 1RY8A 2X0HA 2ZUVA 2ZXQA 4L4OA 2VURA 1KM2A 3LM7A 4GZ7A 1ML1A 3NO1A 1H7NA 2FDSA 4YHEA 1DWFM 2PGFA 2VEPA 4MMWA 3FA5A 1J0HA 3FGCB 1MI3A 1WV2A 4JNYA 4POCA 3UNDA 3IJ6A 1AD4A 2IPWA 1TRDA 5FD0A 3EZ4A 3AHYA 2DU2A 1F7BA 1UD8A 3DYPA 3G0XA 3M5ZA 4AC1X 2G3JA 2J66A 2NXHA 2I14A 1BYBA 3TTEA 3OVPA 5I3DA 4S3AA 3AWNA 4DM2A 3GW3A 1QFEA 3DFSA 2VEFA 5DMMA 1S38A 1F8IA 4UTLA 1IEQA 1T40A 2XFRA 4RNIA 1B3ZA 4QEEA 2OEJA 2J7FA 2VMFA 3MU7A 5BXTA 4Y9NA 4CN6A 4LUTB 4A4AA 4IXHA 2F7FA 4IQDA 3LLXA 4MJZA 2RJGA 4J3WA 3VNYA 3ARVA 3CPRA 4QCFA 4A3QA 4JEJA 4N7QA 1W54A 3GLCA 4H8HA 4KEMA 4JHMA 3WUBA 4XSLA 2BV9A 4Q7BA 2HDJA 3IJ7A 3RLVA 3M47A 2OSXA 4QSHA 3W4RA 3PANA 3GH5A 4XAGA 1J5TA 3FHAA 3AMGA 3ZVHA 4NNCA 2XZ9A 2EG6A 2MNRA 3LBMA 1B54A 4JOMA 3W74A 1K9EA 2C1GA 3PG8A 1W1PA 4WSKA 2J24A 4DQWA 3UPBA 4D8LA 3CL6A 3MP3A 5E9AA 1M3UA 2TYSA 3EKLA 4B90A 5KMYA 2QZRA 4MWAE 3P0WA 2QNEA 2DDXA 4W84A 3RYSA 2DIKA 5E9XA 4OQVA 1KNWA 1O66A 2FGZA 1LOSA 5AVHA 3TZNA 3C86A 3VE9A 3BJFA 3QM3A 2GJPA 1ADOA 3WKZA 2ATMA 3VXGA 1FFQA 3ZR5A 5FAJA 2VX5A 4F4RA 3PNZA 4OUIA 1WX0A 2F8QA 4LNCA 1CXEA 3UW6A 2OSWA 1HX0A 3A5VA 1BD0A 4H2CA 2O92A 3BJTA 2ZVRA 3WG6A 1EGVA 4IMDA 1H4PA 2CKSA 3IJDA 3E12A 2J7BA 4FO4A 3NSXA 1M6JA 3M0HA 1GEQA 1WO2A 3EX4A 3W2JA 1FWJC 2GJRA 1R2SA 3N73A 4JYEA 4LFYA 3TWBA 4D2JA 2C1IA 1DKWA 1HKMA 3BAJA 1CTNA 4UZUA 1KLYA 5CAHA 1QW8A 1SZNA 3ABSA 1M7XA 3TYDA 2BG5A 2J7DA 1J12A 4UFKA 4AD4A 2XN1A 1TZ9A 3C6CA 3CWHA 1DV7A 2GVLA 3PUEA 4OFCA 4NF7A 5H2ZA 3GKAA 2ACRA 4UMAA 4FP1A 3ZZ1A 3QGKC 1F05A 3T40A 3V3WA 1G4EA 3BH4A 3CHFA 3C4UA 1DEDA 2J9ZA 2XH2A 3GE7A 5A8GA 2AQVA 2AQWA 7CGTA 2I16A 5A6MA 5E1QA 1Q6GA 4ZE4A 2ATSA 3SB0A 2WXDM 4ZR8A 3E49A 2Z2BA 1NOFA 2D3LA 3TONA 4YU1A 2Y5SA 1VEMA 1W1ZA 1X8FA 4DM1A 4KT2A 2H3DA 2R94A 3CC1A 5AZ1A 1RVKA 3MSYA 1ZL1A 4ZO6A 4RE0A 2PDCA 4CU8A 3VDGA 3WBYA 2GJLA 3BANA 2NXGA 4XISA 2WK2A 1F4HA 4XVEA 3C0LA 4AB4A 2Y7DA 5I2UA 5I03A 2XIQA 2EJ1A 4XG1A 1J8VA 3UR7A 4WD0A 4JHOA 1LDCA 2VXNA 2WWDA 4FLSA 1XH1A 1A50A 5J04A 1QMLA 1OQFA 1S5NA 1IGSA 1F76A 3EWWA 5DO8A 1C8VA 1PIIA 1V4YA 5DCBA 3SGZA 5IXEA 5FF2A 2ZUUA 2HTMA 2X0SA 3GG0A 1QR7A 4W86A 4EXQA 3UCDA 1F73A 3N04A 3TNOA 3N2MA 2Z6IA 1TCDA 4F8XA 4GVHA 4IQLA 7XIMA 4JEQA 3H2OA 3AS2A 3WCZA 3W2NA 1YDVA 1F6PA 1LUCA 2C3ZA 4LAKA 3IV3A 1BPLB 1O4UA 5MKGB 1Q65A 1MW2A 2WNNA 3PZUA 3KTXA 4DJFD 5BRQA 3PAOA 4HCDA 1XIMA 4LY8A 1UR9A 4E38A 3B06A 5KEZA 4JXCA 1JDCA 1LBLA 2EPMX 1SUXA 3IJIA 3LI1A 2QCNA 4NT0A 2C79A 5LIWX 1CGXA 2J25A 2YXGA 1RLDA 4G56A 3L2IA 1KTCA 1EP1A 1KCZA 5AZ0A 3EDDA 1J79A 1TWWA 3W73A 1UUOA 4GJJA 4BEUA 4F3HA 1JPHA 1JRBA 2XIOA 1S46A 3BO9A 1XIGA 5E70A 3GTNA 1EJUC 3ARYA 4DO4A 3QFEA 4X3ZA 3RPMA 1BRLA 4Q7NA 2V67A 4W7WA 1J2WA 3TYZA 3ARTA 4U33A 5FF0A 2Q6ZA 3S1WA 4GXPA 3A13A 3W70A 1ZB5A 4PFHA 1W1VA 2A3AA 5K9DA 1ITXA 3O07A 2R1LA 3AIBA 4ZO9A 3TDFA 4C90A 4S23A 2WMIB 2PLKA 1JPIA 3S6DA 5FIPA 2GLKA 2E1WA 4HNNA 1GOKA 1Q8AA 3WQPA 3OPSA 1FXQA 4GI9A 4KETA 5D9NA 2QR6A 1SJDA 2PGWA 3GH7A 1XYBA 3VGGA 5A8QA 5F2GA 1PPIA 2Z28A 1DJHA 1KXTA 1UZHA 5BU6A 4FMVA 3WMLA 4E3VA 4B4HA 3CL8A 3VD4A 4JNZA 3UZXA 4I7WA 3DU0A 1QPRA 2VZTA 3P62A 2PWFA 2J7HA 1KGUA 3RCNA 4DZHA 2CLKA 1AQFA 4GGHA 4IFKA 4K7VA 3A21A 4DAFA 1BG9A 3BURA 1GNXA 1ONWA 4KWUA 3DHUA 3YPIA 3I68A 1LRNA 2PC4A 1QU4A 1DXIA 5FF7A 1L2UA 1OFBA 2ABAA 4HNOA 3IJ9A 1OVDA 2ZUTA 1P1XA 5LIKX 3W7EA 4Y8FA 3LV5A 1F3EA 3T6CA 1IT0A 4O4VA 1JYWA 1JGIA 4UFIA 2H8XA 3WQEA 1ODUA 1VPQA 1SZGA 4CN4A 1XIEA 1RPKA 5LXXA 2BXVA 5HQMA 2GGGA 1MWOA 4V1XA 4ML4A 2RAGA 2HPIA 2XVLA 4BF5A 5I07A 1TQXA 3MJYA 1JF5A 5CGMA 2Z1KA 3VD7A 4NAFB 1FCBA 3U4FA 4MTVA 4DBUA 2UBPC 1ZBKA 2CITA 4Z1AA 1X39A 4GIYA 5DMLA 3CMGA 1IR2A 1PYMA 2YB4A 4AZ5A 5FOOA 5HMSA 1UH3A 3WEZA 4ZOBA 1V0NA 3FVMA 3C2OA 3F5LA 4F9JA 4JIRA 2WPGA 3SN1A 4GZEA 4ZVJA 1BVZA 4K38A 5FL0A 4DVOA 1UD3A 2VFEA 1SVDA 4G7EA 2FJUB 3B4UA 3EOUA 4NKCA 1UP2A 4ACYA 3BV4A 2H90A 3UESA 1JAKA 4Q4QA 3UZYA 3TW6A 3EBVA 3VOIA 2WM1A 2R8WA 3U2ZA 2CPUA 2XTKA 3NM1A 4C6LA 4WX2A 4IL2A 4RDVA 4J4KA 2OGYA 3AWOA 1JXKA 1W37A 4X60A 1OFQA 4Q7IA 1Y8BA 3MCMA 4O16A 6TIMA 1ZENA 2FMOA 4J2PA 4XKYA 3BG9A 3KW3A 2DZTA 3DI0A 2EG8A 2CC0A 4CD8A 2ZZ1A 2PRMA 4F2TA 2D0FA 3QOMA 2QAPA 1H1NA 2G0WA 2X7VA 3INPA 4CD6A 1DJZA 3L5LA 1G7VA 1KFKA 2Y88A 3NQ7A 6XIMA 1KV8A 1ZBWA 2POTA 3Q94A 2YCLA 2WMKA 1B9BA 1C7TA 4MYXA 2XVNA 5KTLA 3CYVA 4GFSA 4G1NA 2WANA 1DOSA 2BP1A 3PPHA 2OYLA 2C7FA 1NELA 4XK2A 4CQ8A 1KLZA 3W3OA 3RJXA 1OY0A 3CQHA 5BWAA 1EIBA 3GXNA 4HSNA 4UTIA 5LNSA 2X1IA 3K5XA 1T8XA 2XGBA 4U4MA 4P7RA 2MANA 1E6XM 1KFBA 1GVOA 3AXKA 4XX6A 2PI6A 2VHLA 3LS9A 3WF3A 3S9IA 3ES8A 4K1WA 3W1QA 3SZ8A 4Q8OA 4HMEA 3OJGA 5D03A 4IUGA 1NP2A 1I2PA 5GJMA 1TYGA 1TTQA 3O9NA 4XSMA 4DYEA 1XQKA 2GK1A 3LXBA 1YKWA 3CQJA 4J7RA 1ICQA 3NQBA 1EF2A 1CXKA 3V5OA 3UYCA 5CPNA 1Q4NX 3ITVA 2X40A 3AZRA 3BGGA 4LQ1A 4JIIX 3ATZA 2PS2A 4I8YA 5M2FX 1U30A 4QJ4B 2OCZA 3RGTA 2TAAA 2QCCA 3TA6A 3BLPX 4J40A 3WFLA 1KBJA 4JYFA 4YVPA 2CHNA 2NZLA 1KRAC 4YJ5A 1V3KA 3O6YX 2Y63A 3L66A 4LB3A 3A3WA 1U22A 2V2HA 3NG3A 3AXIA 5AN7A 3LHVA 1WZLA 1LL7A 4TR9A 1VBUA 2ZUMA 4O15A 1GYNA 3RMJA 3SCQA 4HMCA 5FACA 1DWGM 5B7YA 3BARA 5CJNA 5CLTA 1XGDA 4NP7A 3VKJA 3N34A 1XBVA 5D4YA 2QCLA 3DECA 1E6ZA 1S5WA 1GKQA 2J75A 4JTJA 4LF2A 3MSGA 4HTYA 1F6YA 5ENLA 1WYIA 3WH5A 1MYRA 3VYLA 2I1OA 1Z9AA 2I7GA 5C54A 3P60A 1EO7A 2VFGA 1NDZA 2E6AA 1ZJIA 3P80A 3N25A 3VD3A 4N2YA 1XLKA 2ZZ6A 1T7LA 4LUTA 1MNSA 4Q8NA 4OU1A 3LB0A 2QCGA 5DELA 1UROA 3WZ0E 2OPJA 3KAOA 2VFHA 3ZOAA 6TAAA 3SIZA 3N13A 4O14A 3CMJA 3NPXA 2YBVA 3CUFA 3ANYA 2RDXA 3GX9A 4GY1A 5D05A 3CIVA 5CBJA 4UTWA 2YDAA 5CAKA 3M0IA 3BMVA 4TXEA 2DVUA 1CZ1A 1PX8A 3E0LA 3THDA 1XLLA 5BWFA 4RKAA 4IIBA 1F3TA 3MMWA 1GZ1A 3GUGA 4LH8A 3EDFA 2V82A 3R12A 1W32A 3OU8A 2DW7A 1W8GA 4PH6A 5L9FA 1XUUA 2YL9A 4LS1A 5DY2A 1EC7A 2HSAA 4A8RA 5C8BB 5E0KA 2VC5A 1EQCA 2DJLA 3CIWA 3WJXA 1Q6OA 4PZVA 5E0FA 1LROA 4LY4A 2QVHA 1GVRA 2OOGA 2AGKA 2TMDA 2NT0A 5CPTA 5C70A 1XLBA 1AL8A 2WV8A 4ZQCA 2PDXA 2D73A 2Y0FA 3UXKA 8TIMA 3SM0A 2BS9A 5EMJA 4O19A 1OINA 4ZMGA 4GUFA 3PS7A 3UA4A 2W79A 1IIHA 4GUJA 1JD7A 1ZSXA 3RX4A 4K2SA 3R1ZA 3SY8A 2DVXA 2GGEA 1R30A 5XIMA 1H41A 3G3MA 4F0HA 1QNOA 2R82A 2ZWYA 4JICA 2WZEA 1GQIA 1DP0A 3OTRA 4GY7A 5AOUA 1GYMA 4GQRA 4DY1A 3OO2A 3DX5A 4Z08A 3UP8A 1V6TA 1FH7A 3WDQA 1XBZA 2IQTA 4LUSB 1NY1A 1ZCCA 5DMNA 4TU1A 1OZMA 4JYDA 1J0KA 3B0YA 1GQLA 2HQAA 1DIOA 4QP0A 1P0NA 1XICA 3UWVA 4TVCA 4Z17A 3TQKA 1JYXA 4WKHA 4NASA 6REQA 3BGAA 1K9FA 4B5UA 5CSYA 2BZNA 2GJNA 2P50A 3R2GA 5A95A 3WJZA 2O4QA 3FDGA 2E6YA 3REQB 1I1XA 1A47A 2XISA 1BKHA 1WA3A 3QZEA 1YBQB 1RA0A 3MJMA 2VEIA 2F6UA 2C14A 3CTLA 5CCZA 2ZC8A 2Y8VA 4HK5A 2BOFX 2JFEX 4N4PA 5GJNA 3IGHX 2HNEA 2B7QA 4L1WA 5IFPA 1VYRA 4EAMA 1MDRA 1PIFA 3SSZA 1X96A 1KA9F 1THFD 2GQ8A 1SSDA 2XFWA 1P1MA 2D23A 4I9AA 1KFLA 4UTTA 4G6CA 3IUHA 3H2AA 3N2BA 2Z00A 3QH2A 3DCPA 2E5DA 4LC6A 4EOUA 4UQCA 1UOKA 3P3BA 3SCNA 1W31A 4AYGA 2W9MA 3AIEA 3RM8A 2ZTJA 1NWUA 3WENA 3LD5A 1KBLA 2PA6A 1V6XA 3KBJA 3SJNA 1O1ZA 4R7OA 1BGAA 1TIWA 2O0TA 3EWYA 4CNPA 4B5WA 3E2QA 3HG2A 4RPPA 3W7PA 1E51A 3HQNA 1V3IA 3B97A 1NWTA 3PBYA 4UTWC 4WDUA 4UQEA 2VC7A 3BUVA 4LALA 3EPMA 4LVDA 1ISYA 3NYDA 2JEPA 2JE8A 3PG9A 1Q7ZA 3EX2A 5DFAA 1CDGA 1EC8A 5AKQA 2J6XA 3BLOA 3IS4A 2E28A 1OX5A 2VNCA 1HT6A 4RXFA 1GUVA 1ECQA 1N2VA 3VIFA 2GWGA 3CUGA 3VU2A 3WLNA 2V5CA 3SUWA 2PP1A 2VCCA 1EUNA 2ZUSA 4Q32A 9XIAA 4V1YA 5FI8A 3D3AA 4QEHA 3LTPA 3LPGA 5LZLA 4KRUA 1DJQA 1IZCA 4E3TA 2E25A 3N2OA 1RD6A 4QLKA 1UJPA 3DN5A 3F4DA 1CECA 4DUVA 4F2UA 4F0RA 1FWRA 5F2LA 3KCJA 3THCA 2PEVA 1VJSA 4LGXA 3UGVA 3QBUA 1FP9A 4L6OA 1A5BA 2EO7A 2WHLA 1BQGA 1PYFA 4HGXA 3MUZ1 4QITA 4AZHA 1S2VA 1AQHA 3FN9A 1AMYA 2NUWA 2P3ZA 1WP6A 3BQ5A 1ICSA 4QLJA 3UR8A 4D6FA 2O9TA 2PCQA 5C9WA 4CD7A 1ZBCA 4LVGA 4NHVA 3B03A 1VLIA 3N4AA 1Z8AA 3SQMA 4F79A 4JX6A 4HA0A 7A3HA 3VX0A 3QVQA 1EF3A 1E1CB 1PE1A 4GVGA 4HJFA 4P7LA 5CLWA 5IDIA 3G1DA 4MM1A 4BQ3A 4P7OA 2WLZA 3AQUA 1GZGA 3V18A 1DWAM 3S5YA 3GZ3A 4DF2A 2VOMA 2P76A 3UBPC 2Q8XA 4A3RA 1PKLA 4AFYA 2DSWA 4GHRA 3W22A 4H9ZA 2PTYA 1GZJA 3N18A 4IX2A 3FEMA 1M41A 1GW9A 1S3HA 3S5NA 1KO0A 1C8YA 1QT1A 3HQOA 4H00A 3OIHA 3C3NA 4HPHA 4GH1A 2Q02A 2IQ0A 4IICA 3MMUA 1PDYA 1QOPA 2A4AA 1P0KA 3LHYA 3NM3A 1I6NA 3WFAA 1TPH1 2EHHA 3W7CA 4ZFCA 3IUIA 2OWXA 3WEOA 1XYZA 2QIWA 3I3BA 5AC7A 1Q6CA 2D0HA 1QPNA 1XRTA 4CQDA 5I02A 4UTTC 3DYMA 1M01A 3L2LA 4E8DA 2VENA 3ZIZA 4IP4A 1UC4A 4FOUA 4GMEA 2WBKA 4IGNA 3R13A 1QVBA 2CHOA 1WOAA 3R10A 1UMLA 3T4CA 3CXOA 3WD0A 4AVOA 1PIGA 8XIMA 4LBSA 5AHNA 2C91A 3S5ZA 3M0XA 1MZHA 1GVIA 1TVPA 3LGGA 4LYRA 4PRRA 1V0KA 4QS6A 2DZPA 4H9YA 2VEKA 4E2VA 3THUA 3UQNA 2V3DA 3H24A 2DT0A 1JDAA 2Z2UA 4DJED 1FXPA 3LCGA 4X0VA 3ABQA 4DXKA 5CSUA 4NAEB 4B2DD 4M6QA 3VFLA 4QG9A 1ONEA 3ZO9A 5A8MA 3MSDA 1H3GA 1HKVA 3TFCA 2G50A 2WLYA 4Q8WA 4NX5A 4M81A 1Q6DA 3H2NA 4DF1A 2F2HA 1ZZMA 7ODCA 5I79A 4S39A 2ZWZA 3LENA 2WMGA 1ICPA 3LPPA 1FHVA 1AUSL 3KRSA 4S3FA 5A94A 1WNOA 1LRTA 3VGHA 3VNJA 3QHOA 4F0SA 1PL9A 1KGXA 3TZFA 4JX5A 3CV2A 2OG9A 4B5NA 1D3HA 3VNLA 4LT9A 1HQTA 1JNEA 2RGLA 2ZZ7A 3IARA 1OFRA 3LGDA 4GD0A 1QPQA 4KCUA 4AIUA 2Y7EA 1YRRA 4IG2B 2CZVA 1QCWA 1VFTA 5ABGA 2REQB 1W2VA 1WZMA 3KXQA 3B40A 1L6YA 3GVGA 4OECA 3KCLA 3E02A 4FX7A 1HKKA 4XZMX 1DIKA 3W53A 1TWDA 1Q4WA 2J8FA 4GINA 3TSMA 1R9XA 1R38A 5EMKA 2E09A 2Y61A 3BZJA 4W87A 4CKQA 5I3KA 1JPKA 3RX3A 3DHFA 1E43A 4GQGA 3W2UA 1OGSA 1F8MA 2G96A 5A6BD 1G4PA 4AYSA 3PB0A 3TXVA 1P0EA 4HZ6A 4L64A 2FLIA 4IFOA 4EPBC 5CZ0A 2NVDA 3O6AA 4CQAA 1YQ2A 5E6ZA 5CKSA 1TV5A 1T96A 1QTWA 1J93A 1EP2A 1Q66A 1MRAA 3VDHA 1RJPA 3W1PA 2V5BA 3GFYA 4QISA 5L6UA 4LCSA 1FCUA 2J13A 4JR5A 2IKHA 1UR2A 2PURA 4NJKA 1RQEA 1YNPA 4WJXA 5G4EA 3U2OA 1UOZA 1Y0EA 3CO4A 2XDFA 2C8NA 4FXSA 4M29A 1LM1A 2WNZA 4A29A 4UNIA 4LAMA 1DJXA 5DX7A 4O10A 1UQYA 3W07A 4UC5A 5REQB 1HN1A 5A6TC 1MQRA 4PA8A 1YW1A 4AIBA 4M19A 1I2NA 1AH4A 4AIEA 2ZRYA 1XIHA 1TPB1 4ERGA 3AICA 4JD4A 5EFDA 3HPAA 4TX6A 3W7KA 3K30A 1GHRA 3QYSA 2A3BA 5BMWA 3MP4A 2RFGA 4MPQA 1R8LA 5BOOA 5JUVA 4QDPA 3R6IA 4K6AA 2W92A 4N0RA 1KRMA 3MY9A 1QNRA 3N4EA 1SFSA 2ZDRA 1TX0A 1TIMA 3FAXA 3TSBA 5EYWA 5LSMA 2YJQA 3KLLA 1ONXA 1DE5A 1FKXA 2W3ZA 4HTBA 2QXWA 1CENA 1OD0A 2V5JA 3VIKA 2FVMA 4R88A 4PTVA 1XQLA 4GISA 1M53A 3GNRA 2A7PA 2E77A 3T1GA 4UR7A 3BZGA 1W5OA 1SM9A 3BSGA 4OV4A 4GKTA 3OVQA 5I23A 1KBKA 3HBLA 4DWSD 4DX3A 1U1UA 1Z89A 2TRSA 3P7YA 1GVFA 4ZA0A 3VGEA 4KCVA 3EX3A 4C6QA 5HJYA 3I4KA 3LDVA 2OJPA 1OX6A 1PEZA 1DJYA 3H12A 2OU4A 5T26A 3RXZA 4MJMA 1QO5A 5AHLA 2PZNA 5TIMA 2KAUC 3LNPA 2VYOA 3TN3A 3UG5A 1YNQA 3S2CA 4J28A 3RMEA 3E1F1 2XFFA 1KW1A 3OHMB 4IMEA 2HROA 2OVLA 4B9ZA 2BDQA 4HOXA 5CBIA 1PSCA 2PWUA 4IQEA 3EX1A 1PHWA 4LSBA 2O9RA 1MNZA 4GQ0A 4Y9OA 2INEA 4DNMA 4KGJA 5C55A 2PWDA 3E2SA 4PMQA 1V6VA 2WKJA 2QJMA 4PMJA 3EKGA 1N55A 3PBMA 1ZBVA 3WNOA 1C7SA 3TC7A 3P8JA 1FCVA 1HJSA 1RQHA 3CUZA 3DG3A 4BKNA 1US3A 1VFSA 4C7GA 1FBAA 1HJQA 1HF6A 4QX4A 2DZWA 1K7FA 5BOEA 4X2PA 1O5RA 3RLGA 1JL8A 4PMOA 5BROA 4IGSA 3TKFA 1E0UA 1CXIA 4DUWA 3TE9A 4ROQA 2VR2A 2QVNA 1NFPA 1ONRA 3VIGA 1E15A 1JCJA 2JF6A 4ROPA 4QGCA 4DJFC 3TYBA 4JN6A 1GVEA 3TOYA 3THQA 1IEWA 2VT0A 3ZLGA 4JTEA 2YSWA 1R0MA 3NQCA 3SY5A 4Q8MA 2NUXA 1VEPA 1EZ2A 4EWND 1EH9A 4RE4A 2PU0A 3T07A 2ZQ0A 1NOWA 3OQ8A 4TX9A 1Q6QA 3NGFA 5BMXA 1WCGA 3PTMA 4KIRA 4S3CA 3KTCA 1H50A 4MJ2A 1S2WA 4HNTA 2YL8A 1ME9A 2HNHA 3CHVA 1BWLA 2CBVA 3GHTA 5D9MA 2HV5A 2CLLA 1O95A 4HHMA 1JFHA 4DIAA 3M0MA 4GIEA 2GPTA 1QNQA 3PN8A 3NQFA 3FNDA 3QZAA 5HBFA 2BVDA 4PUNA 3FXGA 4WF7A 3AHXA 3PPGA 3DDMA 4JBRA 3W24A 3NQMA 3GY1A 2JIWA 1DPMA 4MADA 3AMCA 1R7OA 3A9BA 1B31A 4EX4A 3GKFA 4AXNA 3KHJA 2ZUNA 4AEEA 4QQUA 1P0BA 1FDJA 3F4NA 3UWYA 3RJYA 4WKAA 1TWZA 3DXIA 4V33A 5GNXA 3WF0A 2PAJA 2TSYA 3UY7A 1JCYA 1LWJA 4LV9A 3PJWA 1YE6A 2VUYA 4ONVA 4IXXA 3H7RA 3BW3A 4PUMA 3CNYA 3UXLA 1XHGA 4YIWA 4GLEA 2FB3A 4LUSA 3VMOA 2XU2A 3ENLA 1MSSA 1ZP3A 1BSIA 1ZRQA 3GFZA 2X05A 3CHEA 4CNNA 3OVRA 3ZVIA 2QDHA 2PDNA 4GC3A 4K8HA 3GXDA 3TLQA 1E40A 1QHOA 4GBUA 3AUOA 3URQA 3RAOA 3M16A 2YA0A 3ONCA 4TUFA 1AL7A 1TX2A 3B8WA 4DYJA