4XQ6A

Crystal structure of dihydroorotate dehydrogense from mycobacterium tuberculosis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
317
Chain Sequence
VAPVRRLLRRLLGPTDPVLASTVFGVRFPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPLFRLADDRALLNRMGFNNHGARALAIRLARHRPEIPIGVNIGKTKKTPAGDAVNDYRASARMVGPLASYLVVNVSSPNTPGLRDLQAVESLRPILSAVRAETSTPVLVKIAPDLSDSDLDDIADLAVELDLAGIVATNTTVSRDGLTTPGVDRLGPGGISGPPLAQRAVQVLRRLYDRVGDRLALISVGGIETADDAWERITAGASLLQGYTGFIYGGERWAKDIHEGIARRLHDGGFGSLHEAVGSARR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone)
publication title Crystal structure of Dihydroorotate Dehydrogenase form Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Oxidoreductase
total genus 105
structure length 317
sequence length 323
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xq6A00
3NNTA 1QOQA 4MJZA 4WXYA 3VI2A 4O17A 3TAKA 3QMSA 2Q3OA 3EXTA 5C5YA 2ZRZA 5FESA 4CCEA 1LYXA 1KV5A 3SSJA 3HG3A 1W3TA 4JY8A 1B3OA 3KFTA 1NF7A 4UFIA 5KSWA 5E0KA 4UR8A 3M16A 3W1MA 2QKFA 3HPXA 4IXXA 5A5WA 1TPFA 1TREA 2A7RA 5KMYA 1VJIA 3FKKA 3N73A 4UC5A 3G1XA 4WD0A 5FF3A 2CLLA 4IGHA 4WY0F 3SIZA 2I9EA 3QJAA 5CSRA 3I65A 3GAYA 1JCMP 4JYEA 3TQKA 1QOPA 2FLIA 1I2OA 3TQ0A 3B4UA 3BPWA 1OF6A 3IVUA 3N14A 3NXFA 4N6EA 3R89A 2OCZA 3P81A 3BW4A 3FKRA 1VPXA 3ABOA 5DLCA 3L5AA 2VKZG 2YDAA 1SZGA 3EXRA 3KAOA 2X1UA 1E51A 3EWYA 4LW7A 1KFLA 5D02A 2FJKA 1J2WA 3MW7A 4DPQA 4I7UA 4NJHA 4DF1A 2C19A 1OFOA 3O16A 1XXXA 4R34A 1JUEA 5KINA 4CNPA 2ZRXA 3M44A 5FEXA 1W1ZA 5D05A 1P4CA 5HWJA 5I3KA 1THFD 1FXQA 4Z1CA 5K9XA 1LLWA 3BVJA 1I45A 4A21A 1TSIA 3LXAA 2PRHA 3P67A 3EEGA 3N19B 1QMLA 1VHNA 4JTUA 2AGKA 5G2HA 5TQLA 2B7OA 1DVJA 4EF9A 3RF9A 3BGGA 3TH6A 4UFLA 1K8ZA 4YWIA 4O0ZA 3W76A 1WX0A 1O94A 2DZPA 3N2MA 4A2RA 2Y61A 3DFOA 2FPVA 1G6CA 4AWTA 4H4IA 4P61A 2H90A 1O4UA 4Z0SA 2XFWA 1LBMA 3S9YA 2A7PA 1ZALA 4JTGA 1W0MA 1RQHA 4O57A 1OFAA 5G4EA 2V9DA 5D30A 1VS1A 3NQMA 5U7SA 2ZRUA 3ABSA 4O4VA 3DI1A 1QFEA 3UY7A 4HHPA 1TPC1 2ZCGA 4E0CA 1W5PA 1KV8A 3TR2A 1Z48A 3SECA 5ABTA 4M6PA 1XFBA 1YTKA 3W7JA 1TPWA 5HUOA 2GQ9A 3MP5A 1QR7A 3PBYA 1PIIA 1DL3A 1PHWA 2A6LA 1Q6RA 5EKYA 3VE9A 4JTKA 3UY8A 2A1YA 1BEUA 1F5ZA 1YXDA 1GYLA 4X3ZA 1LRQA 3NO5A 2B4GA 4B5NA 2OMAA 5LZLA 1TJPA 4UMBA 1RR2A 1S5TA 4RK8A 4IUOA 4NJKA 1TPUA 2R14A 1ZFJA 3NQ2A 2DORA 4MJMA 2Y6ZA 1SZNA 4JTTA 3TXZA 5K9CA 3DFPA 4MOZA 3O05A 1TJRA 4NQ1A 2QCLA 2Z0IA 4O54A 3IVSA 3HJZA 4QSHA 3P8IA 5FEPA 3PS7A 3SI9A 4JTSA 5CZ0A 4ZQPA 1R2TA 4OE7A 3RFAA 1KTBA 4CCCA 3YPIA 1A53A 3CWNA 2DJXA 4ZQMA 1TTQA 5AYZA 3B0VC 3LHUA 3SGZA 2YYUA 4HNNA 3TXVA 5BOOA 2ISWA 3ATYA 3M5ZA 2GQAA 3CC1A 4Y90A 2ZTKA 3ABRA 4AMAA 4WUIA 2QUVA 1SO3A 3G22A 1KTNA 2C6QA 3B0PA 4FNTA 2YXGA 4WQ6A 3DHFA 4BI7A 3C6CA 5AC7A 1TMHA 2YW4A 4FXSA 2A5HA 3QPZA 1JQVA 3GK0A 4H6KA 1MXSA 3QQ1A 3HIJA 3P61A 3C2VA 3UQNA 4K7VA 4ZL1A 2UV8G 5EMUA 2TYSA 5FEWA 4I9AA 5G5IA 4O16A 1G4SA 1N7KA 3P62A 5AHNA 2RDTA 1OYAA 1QPRA 3A24A 1YYAA 1DORA 1JCJA 2V81A 4K39A 4N9EA 1VYPX 1L6YA 1FX6A 3UWVA 1A5SA 4WXZA 2NWRA 4AXKA 2CLOA 3QSRA 1A5BA 3FJ6A 3LXBA 2G5WA 4ML9A 2YZRA 1I2RA 2BXVA 1XL9A 2Z1BA 1IXOA 5HWNA 5D09A 1TPDA 2QCFA 1T0OA 3OVPA 4OT7A 3W7DA 4UTUA 5KITA 3HGJA 2CZEA 3AJXA 4YLWA 2Y63A 3R8RA 2BLEA 3MP4A 3MI2A 4BWLA 2H8XA 5HULA 1LRTA 3VE7A 4MPQA 4EF8A 3B03A 2WNQA 3W72A 3ZWTA 2GJLA 1SSGA 1GZGA 3TE9A 5T26A 5GVJA 1GTEA 4MZ1A 4QITA 1TB3A 3NQEA 1OX4B 2P1FA 4OGZA 4XZ9A 4K37A 4IMCA 3QRHA 4JR5A 3N9SA 3LI1A 4AHQA 4CQAA 3P5ZA 1KM5A 1TPEA 2CZDA 3KVMA 3BLFA 3T7VA 5FF2A 2C1HA 3KVKA 5DY3A 2E09A 4Y96A 1I8JA 1H1ZA 3E0IA 2F84A 4XTIA 4W9TA 1XI3A 2OT1A 4Q4KA 4FNUA 1XCFA 1AL7A 1YDVA 2NXIA 3OA3A 3NM1A 5DXXA 1SO4A 1I2QA 1TYGA 4QQ3A 3CM4A 3DENA 1Q6OA 2C13A 3GKAA 3NEVA 3NGJA 3FIGA 1M6JA 3SJ3A 1H5YA 5D2YA 4S2BA 2YSWA 4WZHA 3W7OA 4NNCA 3W88A 1PL9A 1WOBA 2GVJA 1K7XA 2FQIA 1DOSA 1K8YA 3PBVA 2VEKA 4Y6GA 2XN2A 1SO5A 4LY8A 3CT7A 1ZENA 3MWAA 5DY2A 2V8ZA 2NWSA 3JS3A 1O5KA 4HSNA 1P0NA 4DF0A 2CLMA 5F2IA 3W73A 1W3NA 2V5LA 3P60A 2ZA2A 5DCEA 4UTHA 3G1SA 4TO8A 1XC4A 1LM1A 1OX6A 4R53A 3BGJA 3DFNA 1ZY9A 2WQPA 4FEZA 1QPNA 4UTWA 1OABA 5K7JA 2NUYA 3LGEA 4DXVA 3I68A 3DZ1A 2KZHA 4N02A 4O15A 3W1QA 3TSDA 4QM1A 3NQ6A 1ZNNA 4JD4A 2Y70A 1I4NA 3WK1A 2X1RA 5TBOA 1VZWA 2A6NA 4JX6A 4O53A 1FWWA 3VKJA 3TDFA 1KBIA 3W74A 4FNPA 2O7QA 2WSRA 4FF7A 4U4MA 3PUEA 2AQWA 4NXKA 1QCWA 3TMLA 3W6YA 3A22A 2C15A 1XDMA 4JY9A 3N34A 3CWOX 3TCEA 1RPXA 2FPTA 2EHHA 4N9CA 3RK8A 3E9AA 1LZOA 1O60A 2QUUA 5EYWA 3G1YA 5DBUA 3DKLA 3CPRA 1EX5A 3L2IA 3W7IA 4MUZA 4WY0B 3L66A 2BTMA 1SW0A 3LCFA 3TA6A 4A2SA 1GJPA 4MLRA 4L4MA 4J9JA 1UCWA 1LOSA 3DI0A 4HPXA 4ORIA 1FDYA 2RDUA 5FF0A 2W6RA 3L0NA 1KFJA 1JRBA 3GX9A 1R2SA 3CEUA 4YCPA 5D2VA 4PTNA 4GWEA 1A5AA 3G1FA 1GT8A 3GKFA 4UMAA 3CB8A 3R2GA 1DKWA 3NQDA 4JIQA 3UYCA 4MKNA 3G18A 3R5EA 4IPJA 4PFMA 3LTYA 4UTTA 4YMZA 1GQNA 4O1DA 3ZFHA 1VLIA 1VRDA 4LRSA 1ME9A 3PBWA 4K8HA 1OYCA 2DU2A 1F6KA 4HSOA 4NJIA 4RZ5A 1LROA 1DBTA 2J9ZA 3IGUA 5G1YA 4OV4A 1KFBA 5CZJA 2AAMA 1WBJA 5LNWA 1VGAA 1FDJA 1YDOA 3C61A 3UD6A 3G0XA 4DBEA 1GG1A 3BG3A 1TV7A 3RMJA 5D04C 4K36A 3WK3A 1I2NA 3NR0A 3SY5A 1K8XA 1SR9A 3SW6A 3H53A 3LLDA 5HNRA 3C3NA 1H60A 3W7KA 3WJXA 4AHPA 1FCVA 1GWJA 4NJGA 3CHVA 1LORA 1IXNA 4UR7A 4HT3A 2ZDRA 4LV9A 4WX2A 3S5OA 3PG9A 3DXIA 4TR9A 3T78A 2E5DA 5K4ZA 2NXGA 3BG9A 5I3HA 3C56A 2QCDB 4LVBA 3T40A 1G69A 2RH9A 4HNVA 3P82A 3QMTA 4UMCA 3ANYA 3W1XA 1FWRA 1K03A 3E49A 2QJGA 4CQ8A 3W2KA 5DN1A 3P74A 3R13A 5I3JA 2ZZ1A 2BSLA 5J5RA 3GVGA 3O8AA 4BWLC 5IM51 2CLFA 2E6AA 4TX9A 5KZMA 2YR1A 1GTHA 1CX9A 4S1FA 4PODA 1EP1A 3KVJA 1GVOA 3V75A 1HTIA 5AYYA 2CWNA 3W7EA 1ONRA 4O19A 3L5MA 3MYOA 5D2XA 2CFFA 5K9DA 2ZZ7A 1SFJA 2VEIA 4ONVA 1H51A 3I6RA 2J27A 1A50A 3KRSA 3Q94A 3TSBA 3NOEA 3C2EA 2WPBA 3IIXA 1PVNA 3INPA 2QR6A 2VEPA 3CQ0A 3KVLA 3KHJA 3W1RA 3B0UX 1LBLA 3F4NA 3QF0A 2EF9A 4N4QA 4RV8A 1IGSA 2W0UA 4E2DA 1QAPA 1TPB1 1W31A 4MZYA 1EA0A 2P0OA 1JVNA 3T55A 2F7FA 4NX5A 3GZ3A 5G1TA 5K4XA 4UUIA 3HGOA 5CPLA 1OFQA 2NV2A 1TV8A 5EL1A 1AMKA 3S5ZA 4CQ9A 4FIQA 3A9IA 4HIBA 2J9XA 1IIHA 2PE4A 1WA3A 1OX4A 4O11A 2E6FA 3TQVA 1JUBA 1KM6A 4GUGA 3W7QA 2CLIA 5KZDA 5F4WA 4FX8A 2V2CA 1A5CA 4PL2A 1W5OA 3HG2A 5CKSA 1HG3A 4ZQNA 5DCDA 3O1NA 3WK2A 5CGQA 2ABBA 3W7HA 5I3FA 3E96A 1Z41A 2VENA 4ALDA 2Y7DA 4GJ1A 5C54A 1KM4A 3LRLA 4P2VA 1EB3A 2QDHA 4LT9A 1JQXA 2X2GA 3CLMA 3BG5A 4ZQRA 4O4WA 4RR4A 1OK6A 1QO5A 1QDSA 2DJLA 4LTSA 3B05A 2WSYA 2V0TA 4ZMGA 4Z1DA 1P0KA 3TIMA 2NV1A 3QPYA 2OJPA 3W3OA 3TW6A 4H3DA 1HFBA 1GVSA 2A0NA 3RNDA 4Z08A 3IIPA 3NYZA 3CU2A 5HMSA 1OVDA 1K7FA 2WKJA 3KOFA 4EOUA 2PURA 3PWAA 3FA5A 4Y9AA 3W7NA 3WJSA 3MHUA 3USBA 4M5PA 4PH6A 1SU5A 4UTWC 1DV7A 4LRTA 1EP3A 4PC8A 5CSSA 1K3UA 1Q3NA 3L0KA 4HNTA 4GUIA 5AB3A 1JCYA 4OU1A 2GUUA 1ZAJA 3H54A 1KM3A 1GVRA 1XUUA 2VFHA 2Y62A 4R7JA 1H63A 1YPIA 4ADTA 2E5CA 1SFLA 5CPMA 1TV5A 1YPFA 5F1UA 3UXAA 4X2RA 4AHOA 4FB7A 3DFTA 3IIZA 2R91A 2YW3A 1VYRA 3NG3A 1ML1A 3G1AA 2FDSA 5HR6A 2ISVA 3HG4A 1GVQA 5LKYA 1SW3A 1W5NA 1SQ7A 3GDTA 4CCDA 3L5LA 2I14A 1UJPA 3ATZA 4UNLA 4PCFA 1KM1A 3TX9A 4NXSA 2EGZA 3GDRA 3KRZA 1F73A 4O14A 1EUNA 3Q37A 3E12A 2J24A 3NQFA 1IXQA 3QM3A 2XN1A 1NFBA 4GE8A 4NZFA 4FX7A 5LNUA 3MHFA 2A2IA 5AHIA 2X30A 1R46A 1KLZA 4OBTA 1JCLA 1FQ0A 5AHLA 6TIMA 3DU0A 2X16A 4JYDA 4LS0A 3MBFA 3DH7A 1MSSA 3M47A 4RJEA 3WJZA 3B06A 2RDWA 1QNVA 4ADUA 1R47A 4RKAA 4XBSA 5H91A 1GOXA 3O06A 4DF2A 3GR8A 4BFAA 3G1DA 4RZ6A 5HR7A 4ORMA 4NUWA 4LU0A 3W7LA 1X8FA 3DFSA 4IMFA 1WBHA 2A21A 5KTLA 1CW2A 2QF7A 3P7YA 2QEZA 3U6WA 2QCEA 2NX9A 4UFMA 3NM3A 5BW6A 1S5VA 4RX0A 3THQA 2H6RA 1MEWA 5KZEA 4UTTC 1TRIA 4WY0A 4OV9A 1JJKA 1LRNA 3EKLA 1BTMA 3UZJA 3G3MA 3LB0A 1W54A 5BRBA 1M5WA 4FX6M 1B57A 4LVAA 3I7SA 3S1VA 1FBAA 3PC0A 3TUUA 3W7GA 3TC7A 3TW7A 4QISA 4BI5A 3LM7A 2JGQA 1PCKA 3ABQA 1V7YA 5AC6A 4A29A 5AFDA 3EX1A 3NZRA 5LGZA 3VCRA 4GBUA 1H7XA 1V5XA 3S1XA 3STGA 2E5BA 3Q58A 4N6FA 3S0CA 2VXNA 1ALDA 1G7VA 3LCIA 3GDLA 4C1LA 1KA9F 2YFNA 4Q32A 4OHQA 1HO1A 2YGYA 4JDBA 2QJHA 2C18A 3BW2A 1LOQA 3DBPA 2GVGA 4M6VA 4KWVA 2PRMA 1O95A 4JIPA 3W9ZA 3NPVA 4NVTA 3B04A 3B8DA 2FTPA 3SR7A 3W2UA 3G8RA 3M0ZA 1T99A 1WOAA 4FNQA 4HN4A 2PC4A 4IXHA 3P8JA 4KWWA 3P80A 3OEXA 3NZ1A 2E77A 1QO2A 2JKPA 5DXYA 4RZ4A 3A23A 5CZSA 2ZQ0A 3L68A 4GC4A 2VFDA 5A8GA 1X7FA 4IX2A 3IIVA 3FFSA 3MO7A 4UFKA 2CW6A 4X9SA 3LCLA 3NL3A 2HMCA 2Q8LA 2B7QA 1HO4A 2GVLA 4U28A 1JR1A 2VFEA 1VR6A 3C2OA 2DP3A 2HSAA 2B7PA 2P10A 5CPOA 1WYIA 3MI3A 3OG3A 3L65A 1TPH1 2QCDA 1ZCOA 3FS2A 3FLUA 4MFDA 1ICQA 2DZXA 2TSYA 4M7SA 5HJLA 1VYSX 1H62A 1UB3A 3TMQA 2O7SA 2QJIA 4K38A 2GJNA 3STFA 6ALDA 3NVTA 8TIMA 1OHLA 2V82A 1YTEA 4ICNA 2Y7GA 1KM2A 3TKFA 4PEKA 5LNVA 1K7EA 3G0SA 5L9FA 1D9EA 2ZZ6A 3TFCA 4RLIA 3QH2A 5F2GA 4FNRA 2RFGA 1OX5A 3OVQA 1S5WA 4LS1A 2Y7EA 1W5MA 1ZHAA 5EA9A 4UTJA 3W7PA 3NQGA 3WFAA 1G67A 2NLIA 3G1VA 4O12A 3W1AA 1ME8A 2YPIA 3M5XA 4DO6A 1SO6A 3O6DA 1GPWA 1LP6A 4JEQA 4JTEA 3S1WA 3GIYA 1FDZA 3SZ8A 3WJYA 1UUOA 3W85A 1LOLA 3VFLA 3QYQA 4Y8FA 1NEYA 3GNDA 2E68A 2WO5A 3STEA 3P5YA 1WV2A 1F6PA 3HB9A 4JTLA 5C2XA 1QPQA 3NQ8A 1WDWA 3TU9A 1D3GA 2NUWA 3C8FA 4BI6A 5LHFA 3WJWA 4PL1A 1VCVA 4QNEA 1FUYA 3MHGA 2ZRWA 3LXCA 4O13A 2ZTJA 3KRUA 3W1NA 3G3DA 1OFEA 5F2LA 1ZJIA 2E1DA 3HGSA 3PSWA 4LS2A 3W1PA 1RZMA 2NX1A 2B0MA 1MO0A 2V2HA 5D32A 1JULA 2JGYA 1NSJA 3JR2A 3UXDA 5I3IA 1AW1A 1KW1A 2EKCA 1K02A 3UPWA 1TQXA 3EWZA 5FI8A 1PHQA 3STCA 2ZZ5A 1UUMA 4UTIA 1PE1A 3W2LA 3N2XA 1OJXA 2Z6JA 3RU6A 2NZLA 2Y88A 4IPIA 3NDOA 2E6YA 1G7UA 5AHEA 3NL5A 3S6DA 3KX6A 2FFCA 3HO8A 3DAQA 4UTKA 1P5BA 5AYXA 1QPOA 3M1ZA 3LRKA 3W7MA 1RQBA 2R94A 3W23A 3W75A 5K2ZA 1TO3A 4ADSA 4ZVJA 1IIGA 3OHIA 4DQWA 4MYAA 2WNNA 1R2RA 5LNRA 2G95A 5IBXA 3P84A 4AH7A 5I3GA 3PULA 4LUJA 3UWZA 3LI0A 2PRLA 1JCXA 1S3HA 3PUDA 1GG0A 1CI1A 1SPQA 3LCXA 2ATMA 3QW4B 2C16A 1W56A 5J5DA 1HL2A 3IGSA 3LCGA 2BZNA 3N9RA 1EWDA 3W71A 2Y85A 4G1KA 4LUIA 4QNWA 2ABAA 2VFFA 1RV8A 3R12A 3IV3A 2I1OA 3EWUA 4LVDA 1I2PA 4MY1A 4XBKA 4AEOA 2CLKA 1J5TA 1JCNA 3TSMA 5F4SA 4N2YA 2RKXA 1LTDA 7TIMA 3LHYA 2C14A 2WV8A 3LHZA 2ZRVA 1JUKA 1D3HA 1F2JA 2H3BA 2JK2A 3NL2A 4UTMA 2TRSA 1F05A 1H7RA 4GUJA 3M43A 3HPSA 5DCBA 4POCA 1GVFA 2X1TA 3GNNA 4JGDA 3EB2A 4IX0A 4WOZA 4I7VA 4QIUA 3CEPA 4QJ1A 1FCQA 2EPHA 4FNSA 3W2MA 4K8EA 3TROA 3UWQA 3NA8A 1L9WA 4EIVA 3BW3A 3QQ0A 3E02A 5LGXA 4L4LA 4JYFA 1DHPA 1DJNA 1ME7A 1ZAHA 1LDCA 2VC6A 1W5QA 1WAUA 2DZTA 3GXNA 3TC6A 1YDNA 4O1AA 5AHMA 5HWMA 1BWKA 3TK7A 4HNUA 1XBYA 3LHTA 3JRKA 1XDLA 3BO9A 3IGXA 4MZ8A 4OQVA 2OX1A 2QDGA 3NPXA 1TCDA 1TTJA 2TPSA 2CZFA 4GRSA 1KLYA 2ZZ4A 3W86A 3W84A 1RVGA 2YFOA 3W7CA 4E2BA 4JTIA 4O1CA 2GOUA 4UFHA 5D33A 5FF7A 1PS9A 2BX7A 3W2JA 1VCFA 3W7RA 3M5VA 3LDVA 2JKEA 3LCHA 2ISSA 3GXTA 1EEPA 3Q2DA 1OFBA 2GPTA 1WXJA 3LTPA 2E6DA 3ELFA 4K6AA 1MEIA 3BLIA 4GNJA 5CZTA 3PB0A 4FO4A 5D38A 3MMTA 2JKAA 3TAOA 4O0KA 1J4EA 2FB2A 3HGRA 4WOQA 4TIMA 1PCWA 2NUXA 1BWLA 1FCUA 3HQ1A 4K7YA 3EWXA 3PBUA 3TFXA 4ZZ9A 1AK5A 5FEZA 3S42A 4JN6A 1W37A 3PR2A 2QCMA 1RD5A 1Q6LA 3LHWA 4LV4A 2FPYA 4M7TA 3KXQA 4NJJA 1M7PA 3G8EA 1AG1O 1OYBA 3O6YX 1RQEA 1IF2A 4JX4A 5EPDA 3W22A 3FYOA 4HPJA 4Z1AA 1N8FA 2NXHA 1SSDA 4XKYB 4JICA 3TV8A 5G2IA 3MYPA 1LCOA 2R8WA 1G4PA 1TRDA 2A7NA 2QCNA 3EX4A 4GUFA 3UPBA 1IXPA 1Z42A 2C3ZA 2G96A 3H55A 3MBDA 3TJLA 4YXGA 3FJLA 4DPPA 3W1LA 2YCEA 4JS3A 3OIXA 4E38A 1W8SA 3GLCA 3MP3A 3SFKA 1YXYA 3O15A 2ZYFA 1H7WA 2VELA 1UBSA 3MUXA 3HG5A 3PVFA 4PA8A 3MJYA 1H61A 4IMEA 4ZQCA 4QAIA 4LOCA 1VCGA 1QWGA 1T96A 3DKJA 4O28A 1F74A 4AF0B 4IMDA 1KFEA 1KFCA 3FOKA 4RXFA 4TU1A 3GDKA 3VNDA 2VFIA 3K30A 4XQ6A 1EIXA 4IJBA 1B4EA 2A4AA 5DELA 3NQAA 1ADOA 3BLEA 1F76A 3S1UA 3QMRA 2V30A 2EAWA 5AC8A 3EX2A 3LBMA 2HS6A 4YL2A 1C9DA 2ZBTA 3C0JA 4O52A 4FHAA 4JX5A 1Z44A 5D37A 1Y0EA 2XN0A 3THAA 2CLEA 3GXPA 3M7WA 3L0GA 1B4KA 4M6QA 1H7OA 3W70A 2G97A 1JRCA 3A5FA 5LNSA 3PY2A 2JBMA 3ZS4A 5TIMA 5BMXA 3S5YA 3HBLA 1VH7A 5BNKA 3FEMA 3EX3A 3W1TA 2YYTA 3A5VA 4HKPA 1TPVA 2RHGA 4BF9A 4LVGA 2ALDA 1FWNA 1L6SA 5E93A 4UNKA 3W1UA 1GEQA 3LX9A 1C29A 4C1KA 4XTDA 3SGUA 4GXMA 4EVZA 4AVFA 5D2TA 1X1ZA 3LV5A 4MIMA 1YADA 5C55A 1ZAIA 3EX6A 4Z1BA 3RLUA 5MHBA 1DQXA 4IWWA 4DBDA 3FYPA 5AN7A 3F03K 4IQLA 1N55A 4JTFA 1VLWA 3BK0A 4JNMA 1FWTA 3S8HA 4WJEA 2NX3A 4JTHA 2Y89A 4D2JA 3I7QA 2DZUA 3RLVA 3OVRA 1YXCA 3QEZA 4IOTA 3TJXA 3V1PA 3T4CA 3N3MA 3ZWSA 1FXPA 1F7BA 4KKXA 1MZHA 3NPWA 4XUGA 1VHCA 4NNAA 5IBXC 1AW2A 4N9BA 2J6XA 1P1XA 2TMDA 3GR7A 2YX0A 1OG0A 5L6UA 4UXDA 3EWBX 5K3VA 2D73A 4AB4A 4DEFA 2J88A 1H7PA 1EWEA 4R33A 4FXRA 4KFPA 4TMBA 3UWWA 3PM6A 1U83A 2H8ZA 3G24A 3O07A 4O18A 3CIXA 3NQVA 3M9YA 3S5NA 4A3UA 4N9DA 2QCGA 1TTIA 1HUVA 3EKZA 4BR1A 2Q8ZA 2ZFAA 5CG7A 4KFOA 5HUPA 1OK4A 2ZZ2A 1LBFA 3DGRA 2GQ8A 1OFPA 3UNDA 2V5BA 4Q33A 4A22A 3IIOA 1H7NA 1GYNA 1XUZA 3DHDA 2V2DA 2ZZ3A 1O5XA 5HINA 5E1QA 2QCCA 2OZ0A 5CPNA 2DZWA 1TQJA 2WNZA 1NVMA 4O50A 3HPZA 5F4XA 3W07A 3NPUA 3QSTA 4LWWA 1VC4A 3PF3A 5HQEA 4LC8A 3W87A 4AWUA 3PSVA 3BV4A 2Z6IA 4NU7A 4FIRA 3M5YA 3M41A 4NNBA 5BMWA 3W83A 4JTJA 3GYEA 4MLJA 1PV8A 5G4WA 1KTCA 1U5JA 3L21A 4I7WA 2VFGA 1M7OA 3LHVA 2CZ5A 1WQ5A 4BK9A 3QC3A 3LOTA 4DO5A 4UFJA 4O8RA 4CNNA 3O63A 2QUTA 2VEMA 3LERA 3LLFA 3MI6A 4KFNA 3G0UA 1MEHA 4X22A 3TNOA 3EWWA 2HTMA 5LHEA 5U4NA 4IMGA 4O1BA 1DJQA 5H2ZA 1H1YA 2W79A 3D0CA 1NAL1 1SZEA 2B7NA 1C8VA 3IVTA 3LCWA 3C2RA 4MY8A 4UIOA 2H3DA 3QZEA 3PAJA 2PCQA 3NQCA 1XM3A 3L9CA 4CNOA 2FIQA 4DO4A 1L6WA 2LLEA 4MFEA 1OFDA 2ZRYA 3PG8A 2VOMA 4EWND 3BARA 3DFQA 4S2CA 1YTDA 3PB2A 4NZJA 4DELA 4N4PA 1FWSA 4CLMA 1G4EA 3I7RA 5D03A 1OFRA 3AO0A 1EUAA 2OT0A 3PUOA 4GUHA 1FY6A 3UZ5A 4Z0JA 4UTLA 3U8GA 2QAPA 3NAVA 4MVAA 3T44A 3UWUA 1EPXA 3NQ7A 1BKSA 3L67A 3M6YA 3OBKA 4ZQOA 1NF0A 1AL8A 3IEBA 3WK0A 1X6UA 3W2NA 1ICSA 4LNYA 3LRMA 3IRDA 4OWGA 1T8XA 3GB6A 1KBJA 3GAKA 3HF3A 5DBTA 1XBVA 3EXSA 4NT0A 5AHFA 1H50A 3QW3A 1EP2A 1KM0A 2HS8A 2QCHA 2BWGA 1SUXA 3UWYA 1R30A 2FB3A 2WOQA 4O10A 4JXCA 5F2MA 3HMJG 3U2OA 4MYXA 3LTSA 4AWSA 3A21A 5EBUA 4YCOA 3G1HA 3F4WA 1B9BA 1X1OA 1SZFA 2IQTA 3QFEA 2WJZA 4RXGA 4NX0A 5D2WA 5SWUA 2J9YA 3ZR4A 1ICPA 2Q3RA 2ZA3A 5F1VA 4XKYA 4LVFA 1UASA 1W3IA 1TIMA 1Q6QA 4UCGA 1DQWA 2WSQA 3GDMA 5G2WA 1L2UA 3C52A 1TTPA 5AOUA 5LSMA 4JDYA 2CLHA 2A85A 1SW7A 2QAFA 3F1QA 5EY5A 1XKYA 3CIWA 3C4UA 3HOJA 4LC6A 1Q45A 1AW5A 1G4TA 2ZA1A 3LV6A 4M19A 2DZVA 5FF4A 1YLVA 4AAJA 4MY9A 3C2FA 1KFKA 4TMCA 4GFSA 1XBZA 2Z2UA 5C6MA 1VQTA 2DZSA 1FCBA 3LBCA 1XBXA 2CU0A 3O6CA 4AF0A 2C0AA 2X1SA 4RCXA 4XWUA 2ATSA 3CTLA 3NL6A 1OF8A 2Y7FA 1LLZA
chains in the Genus database with same CATH superfamily
2QJNA 3NNTA 4DNHA 2EBNA 1QOQA 4WXYA 5XIMA 2QT3A 2PWFA 3CMFA 3VO0A 2ZRZA 5FJIA 4CCEA 1LYXA 1UD2A 1KRAC 1B3OA 3KFTA 2DV0A 4UFIA 2VP8A 1BAGA 4IL0A 1UIOA 4GQGA 2VO5A 3W1MA 4R9OA 3WCZA 1M04A 1TREA 1KO0A 3DN5A 1FA2A 1X38A 4RE2A 3ITCA 4QJ5B 3WQ8A 3R0KA 4TVUA 4F66A 2ON3A 1ONEA 4S3BA 4WY0F 3UJSA 3L23A 1GW1A 4FA3A 4US5D 3I65A 3GAYA 2J8TA 1IR2A 1QOPA 1VJSA 3GU2A 4JOMA 2F2KA 2CETA 3OPSA 3R89A 3ARPA 3BW4A 4I90A 3ABOA 2WWCA 1EDQA 1IZKA 1ITXA 3EXRA 1XD0A 4TQTA 4AIBA 2PWUA 2PSNA 3AS2A 3PPHA 2WPGA 4YTRA 1J2WA 3MW7A 4C5ZA 2WHKA 4NJHA 1QUMA 1HP4A 1UR8A 2FZBA 2JIWA 3O16A 1XXXA 4BQ3A 3AICA 4LUSB 4BEUA 4MJ2A 2I16A 4RNFA 4CNPA 2BV9A 3GG8A 2BGSA 2X8RA 3NJ3A 5CBJA 3AMGA 4FOJA 1FXQA 5K9XA 3BVJA 1I45A 3WQPA 4A21A 4XAGA 3H2EA 1F8IA 3N19B 3S46A 4P8XA 1T5AA 4HPHA 3VKKA 4C6EA 2B7OA 3V5OA 1DVJA 1S1RA 4H9UA 1CXLA 3MMWA 4P7LA 3AS1A 2DZPA 4A2RA 2CHRA 3N2MA 2OYKA 1O4UA 1V8EA 1EEXA 1MW0A 3GC5A 4Z0SA 3PPGA 1ZL1A 1LBMA 4MWAD 1B3XA 2VL4A 3S9YA 5EMMA 4IG2B 4O57A 4NRSA 4DAFA 5D30A 3PZQA 1VS1A 4FZIA 1FWJC 4QQUA 5M3WA 1O68A 1K4GA 3RJXA 3N12A 3PJXA 3UY7A 3TR2A 2ZXBA 3ONBA 3SECA 5EMKA 4AD5A 5ABTA 1BQCA 3VINA 1UC5A 5A2BA 4OUEA 4XKMA 1FH7A 1PHWA 3ZM8A 4H6RA 4JTKA 1IEWA 3TYAA 3IJ9A 1V0NA 4X3ZA 1KCZA 4LB3A 2FTWA 5ABGA 3G5EA 3QR1A 4B5NA 3VGBA 5LZLA 3NUKA 7A3HA 1S5TA 4IUOA 4BQ5A 2R14A 4A8LA 4ATLA 2DORA 4MJMA 1F4HA 3TXZA 5K9CA 1TJRA 2XDFA 5LA2A 4JFTA 2CBJA 3WH9A 4QE5A 1CXIA 1HGYA 3P8IA 4LGXA 3PS7A 3BDKA 2RJGA 3SUSA 2CITA 4JTSA 4J4KA 5FJJA 4GH1A 4QGCA 3LHUA 4WDWA 5JIWA 3U2CA 2ISWA 3ATYA 4Y90A 1WO2A 1VRXA 1VPQA 2QUVA 2PUZA 3U2EA 3CXOA 1W8GA 2EXOA 3B0PA 4UBPC 1JZ4A 1PDZA 3WLHA 1OD8A 2A5HA 3U4AA 4WF7A 3V5FA 2Y5EA 4NHVA 1BYCA 3HIJA 4FOKA 3P61A 1OCQA 1CGVA 3SCPA 1DJXA 4Z2HA 1KQZA 5JUVA 1GK8A 4F0KA 1NOWA 1XRTA 1KCKA 2TYSA 3BOXA 4KRZA 5FEWA 1EF2A 4I9AA 1G4SA 3GNRA 4E8DA 1N7KA 2RDTA 1QPRA 3HPFA 3UWVA 4WXZA 3FV9A 4AXKA 2R1NA 3E2SA 3LXBA 4ML9A 2INEA 2BXVA 2Z1BA 1IXOA 4E4UA 4UZUA 5D8ZA 4UTUA 4PZVA 1BF6A 5KITA 3BCFA 5FJUA 1ODZA 3PZOA 1R0MA 2ZC8A 1FWHC 2BLEA 2BY2A 4EXBA 3BWWA 2DVTA 3T0AA 4HA3A 1R6WA 4B4FA 3AUOA 3THUA 3VE7A 2EG6A 4PUEA 2XH0A 4ECLA 3MKCA 3PNUA 4L56A 5C2CA 1SSGA 5C7HA 3TE9A 4CNTA 4MZ1A 3U57A 5FACA 2P1FA 2R6OA 4GI6A 2HCVA 4JR5A 3LI1A 3KVMA 3VIIA 4I6VA 1XFCA 4LCRA 3MMDA 5KZ6A 2J7FA 3GS6A 1F4AA 2PDMA 2OO0A 3WG6A 1CEOA 2F84A 3WQFA 2D1ZA 2B81A 1XI3A 4PUJA 3R94A 1DE6A 1XISA 4IPPA 1ONWA 3EGJA 3GTFA 4EXAA 1Q6OA 2OVLA 3GKAA 3ZYZA 3SJ3A 4B92A 4GYPC 4NNCA 3W88A 1TWZA 3AXIA 3PBVA 1J79A 1NDWA 2VEKA 8RUCA 3KZSA 2MUCA 4N42A 1ZPTA 5KEZA 4YNGA 1ZENA 3MWAA 3CIVA 4R88A 3B8UA 1RJQA 2ZOXA 3JS3A 2F2HA 4HSNA 2J25A 5F2IA 4L61A 1P0DA 3VAVA 2ANUA 3ITXA 2ZA2A 5DCEA 2QW5A 4UTHA 5HOSA 1V0MA 1EO5A 4HOZA 1S39A 5CSYA 2VWSA 5I03A 1H0IA 3P2VA 2WM1A 1FFQA 1OABA 3OBEA 5K7JA 3UXKA 4PR4A 4LUSA 3T9PA 4PMJA 2NQHA 4MB4A 2Y24A 4PMDA 2WQDA 4HK6A 4O15A 4U5IA 3TSDA 3VC6A 1TV3A 3NQ6A 3ARVA 5TBOA 2NVAA 3PFRA 3VFCA 3AWNA 5DMYA 2YKKA 2WCAA 1UZHA 2WYSA 4IP7A 1UKOA 2WSRA 4U3CA 4W88A 4HZMA 2XVPA 1QCWA 1WP6A 1LQAA 2GUBA 3C0LA 1GOMA 4JY9A 3TN4A 3N34A 3TCEA 2FPTA 2EHHA 2X05A 3M4HA 1JGIA 1RA0A 3RK8A 3APGA 5BU6A 1O60A 2G3NA 2ZKMX 4IG2A 4LYPA 3DKLA 2VX7A 3W7IA 4WY0B 3QFWA 4PBGA 3LCFA 3BUVA 4A2SA 1ZBKA 1J12A 1JDDA 1UCWA 1LOSA 3AXHA 2JF6A 4PTMA 4Y9PA 1FWGC 3ES7A 4HD5A 4ORIA 5A6BD 2W6RA 4RV3A 1UQYA 3OGSA 1JZ5A 5CSUA 1I60A 4Q7BA 4DJFA 3O7UA 2PTWA 1UH2A 3G1RA 1TV4A 2O56A 4GWEA 2XVGA 3BLDA 3G1FA 1W3HA 2Y8UA 3H21A 2C7FA 3T2OA 1DKWA 1RSCA 3UYCA 5JU6A 3I4KA 4B5WA 3ZFHA 1TR1A 3LZ3A 4M29A 7REQB 2Y8VA 2DU2A 2PBGA 4HSOA 4ZFMA 2VC5A 2BG5A 1OG6A 3KBMA 4H83A 4OV4A 4QLKA 3KOXA 3BAXA 3QN3A 3MJMA 1HF6A 5LNWA 1CXHA 3BG3A 4JIHA 4ZOBA 4IT1A 3WK3A 1I2NA 2WMHA 1K8XA 4AVOA 3SW6A 3A12A 3H53A 1GZ1A 3PN8A 4RPQA 3C3NA 2V38A 1H60A 3WJXA 1GOQA 2YA0A 4MKSA 1GWJA 4NJGA 1LORA 4UR7A 3SN4A 2WNWA 3UGRA 4CQBA 2ZDRA 4LV9A 2ISFA 2P50A 5I02A 5K4ZA 4D8ZA 1LQ0A 3VZXA 4LVBA 3W01A 3LNMA 1X7IA 4AZGA 2WMGA 3BCDA 4HNVA 3QMTA 1ZB5A 4O1FA 5EGRA 2C79A 4OKDA 3WLNA 1DHKA 5DN1A 1C90A 4C6LA 2XFFA 4LYRA 3UWEA 3VMPA 5DEZA 2PDPA 3UW6A 1HJSA 5IM51 3PJWA 2CLFA 1WDRA 2OLSA 4PODA 2ZWZA 1EP1A 1GVOA 3V75A 2PLKA 4OTKA 3O3RA 1ONRA 3EOLA 4O19A 3MYOA 5D2XA 1CDGA 2C1GA 1SFJA 4EXQA 3I6RA 3TSBA 1AQHA 1BYDA 3KW3A 1PVNA 4Q8VA 3N04A 4KETA 3KHJA 3QF0A 1HJWA 4CCZA 1IGSA 4E2DA 2CNCA 1QAPA 4QXIA 1DWAM 4MZYA 3VU2A 1XYCA 4D1IA 1JVNA 4Q8QA 3E1F1 1IT7A 4PUKA 4UUIA 3EPMA 3HGOA 4QJ4B 1MUMA 1HT6A 2IKJA 3QQWA 4OBSA 3QTPA 4FIQA 3BMWA 2HNHA 4BHYA 2PE4A 4IIBA 3CHCA 4HU8A 5JBFA 2CLIA 4GABA 4H6EA 2XH4A 2YBTA 4ZQNA 2ABBA 2DQWA 1J6OA 1EB3A 1D7FA 4H9VA 4Z2GA 3BG5A 5A6AA 2NQ5A 1P1MA 2WSYA 1RXOB 3UGVA 1P0KA 4CVWA 1P6BA 1E6ZA 2OJPA 2YL9A 2VCCA 2D20A 1HFBA 2A3BA 1HKJA 1T7LA 4MB5A 3SUVA 1X96A 3IIPA 5HMSA 1K7FA 3CPGA 4AD1A 1MDLA 2PURA 3FA5A 3PWAA 4Y9AA 4F0LA 1AQFA 4RDVA 1SU5A 3ES8A 1DV7A 4LRTA 1EP3A 5CSSA 1Q3NA 1QI5A 3OLDA 5AB3A 1CZ1A 2GUUA 1EHAA 2DZAA 3URBA 2VQUA 2HXUA 1JF6A 1NQ6A 4WKHA 5CPMA 3ZJKA 1TV5A 4X2RA 1EKOA 3PBGA 3DFTA 4FB7A 5HBFA 3PTDA 5A94A 2YW3A 2QZRA 3WQ4A 2FDSA 4F0MA 2ISVA 3WDHA 4R7OA 4Q8NA 5LKYA 2ZX6A 1GNXA 2ZUSA 2I14A 3ATZA 4B5VA 3BURA 3WUFA 4X63A 3AIEA 3GFZA 4AW7A 1NDVA 1UR1A 2OOFA 1ISVA 2FGBA 5AVHA 1LJYA 1HX0A 4IJRA 1S5MA 2X41A 3QM3A 1NFBA 3TC3A 5I00A 2YL8A 4FX7A 1HNYA 1P7TB 3EBVA 1JCLA 1FQ0A 1I9CB 5GNZA 1KWKA 3DU0A 1VPYA 4LS0A 3MBFA 1H4PA 1MSSA 4S3KA 3WJZA 1QNVA 1KXVA 1WCGA 4AFYA 4XBSA 5H91A 1GOXA 3S1GA 1OT1A 1ZLPA 2VX6A 2OODA 2VYOA 2NV9A 3W7LA 1WBHA 4ZO7A 3MSYA 1CW2A 2EO7A 4XSMA 2QCEA 2NX9A 1JZ7A 3U2ZA 4RX0A 1W3JA 4DIAA 4QEEA 4WY0A 4N7QA 1CECA 1J96A 4GGBA 1JJKA 1LRNA 3G3MA 3LB0A 1M5WA 5IRPA 4BS0A 3S1VA 3PC0A 2PB1A 3TUUA 4LH8A 2QXWA 4LEQA 3TW7A 4D6EA 1QU4A 4DJEA 1PCKA 3O9NA 1YKWA 3KEHA 3Q45A 4A29A 1OCNA 1GQIA 1NFGA 2YB1A 3FNDA 5EFFA 1V5XA 3S1XA 1WB0A 3RDKA 1G7VA 2GGGA 2VC7A 4EPBC 4UQCA 1HO1A 2YGYA 2Z7KA 4LF2A 1A80A 3BW2A 4Q4PA 1JEZA 4A8IA 5IHSA 2VM8A 1QHPA 3CASA 3AJ7A 2J47A 3AMLA 4NVTA 3B04A 4DZAA 4MPKA 4A3QA 3W2UA 1T99A 1WOAA 3L12A 3ALFA 2OLHA 4MG4A 1Q5MA 3V1HA 2YZ5A 3DYOA 3OEXA 3GFXA 3WNOA 2JKPA 1ZCCA 4FLRA 1XS2A 2D2JA 1X7FA 2TODA 1UZ4A 3FFSA 1VEPA 3MO7A 2CW6A 3DC0A 3IPWA 2VX4A 2B7QA 4D8LA 1V4YA 4Q7NA 1Z8AA 4KEUA 3EOUA 3AHTA 4AD0A 3F5LA 9RUBA 2VDHA 3BCJA 1SR0A 1VFOA 4JQ4A 1ZCOA 3FS2A 3FLUA 4H7ZA 3CZEA 4HU4A 3UT0A 2XINA 5EMYA 2YA2A 4PMRA 2O7SA 2QJIA 3J7HA 2E40A 4G2DA 3DERA 3MMUA 1SYTA 2IUZA 3VC5A 3RM8A 4PEKA 1VBJA 4J3XA 3WLPA 5IDZA 1HP5A 2XZ7A 4KT2A 4LY4A 1X98A 4GO9A 2ZZ6A 3TFCA 4RLIA 3QH2A 2NT1A 5F2GA 4FNRA 1S5WA 3GVRA 5FD0A 3KTXA 4W84A 1ZHAA 5GJPA 3G1VA 4RDYA 1Q2RA 1ME8A 4B9YA 2YPIA 3O6DA 1AH4A 2V63A 4JTEA 1KKRA 1DXEA 2DEPA 1W1B1 3SZ8A 3W85A 2VRKA 1UP2A 1D7KA 3ARRA 4Y8FA 1NEYA 2V3GA 3H26A 5C2XA 1QPQA 3NQ8A 1JGMA 9XIMA 1WDWA 3I4EA 3GVWA 1AJ0A 4PL1A 1DWJM 4X0NA 4QNEA 3THDA 2ZTJA 3W1NA 4AY8A 2XSXA 2PTZA 2E1DA 1JYXA 4LS2A 2XYLA 3AMKA 1MO0A 2V2HA 3ZT5A 5I3IA 4CN1A 4XAFA 4DYJA 1OZMA 3HQOA 2ZUWA 1NY1A 1PHQA 1JPIA 1UUMA 2VRQA 2NZLA 4INFA 2VHLA 1Q2SA 2E6YA 5AY7A 2VI0A 3CUIA 3HO8A 4R27A 3M1ZA 3LRKA 3W7MA 3SFWA 3W75A 3TLLA 3NIYA 3OHIA 4DQWA 4H7VA 3H6OA 5BXTA 4MUPA 2G95A 2XIQA 2G3MA 3UWZA 4IJCA 1QJWA 2PRLA 2IKHA 3GXDA 1SPQA 3FX4A 2C16A 1E0VA 1FHDA 1W56A 3GYCA 3WLRA 4PCPA 3IGSA 1JG9A 2OEMA 4I9JA 4QNWA 3RRXA 4XZMX 4GQRA 4XUYA 3EWUA 4GFIA 1OT2A 1ESWA 1ITCA 2WCSA 1EBGA 3W6LA 3QV8A 3UR5A 4N2YA 3LY0A 2RKXA 1LTDA 5HNTA 1WXYA 3LHZA 2ZRVA 3PZNA 4ACYA 4UTMA 1F2JA 3NL2A 1RBOB 1B31A 4POCA 2X1TA 3GNNA 3EB2A 4P5UA 4IX0A 4PCTA 4I7VA 1QBAA 4GJJA 2HBVA 2EPHA 4ZOCA 4FNSA 3TROA 1CYGA 5CZKA 3UWQA 1DJYA 2R82A 2NQJA 3WDJA 3QQ0A 4ROQA 4L4LA 1EC9A 3LA4A 1W1IE 3A3XA 1ME7A 4Y9MA 3POCA 3B8SA 4U10A 1W5QA 2DZTA 3GC4A 3TC6A 3EZ4A 2PDKA 2PDHA 4O1AA 5HWMA 3A13A 3ITOA 3CV1A 4HNUA 3GTNA 4YYCA 1XDLA 4MZ8A 2OX1A 5ABFA 3S9ZA 3I3BA 1Q6DA 3NPXA 3AU2A 4DWSC 5BROA 5J8LA 2YFOA 4MGGA 1GOKA 2GOUA 4LUTB 3R10A 4DM2A 4V15A 5FF7A 3R58A 3CZJA 3UVIA 1OADA 3W7RA 3RYSA 1C3FA 1M68A 3RIKA 3GXTA 1RUSA 1ZS2A 2XIJA 3Q2DA 4WCJA 3LTPA 2GL5A 4ZBCA 2Q8XA 3VGEA 2BGNE 4GNJA 5CZTA 5HK4A 1Q6GA 3TW9A 2FMNA 1J4EA 2FB2A 2WBKA 2HVOA 4K7YA 4ZZ9A 3T81A 1E15A 1L0PA 3RJYA 3RPTA 4GH3A 4W5UA 3PR2A 1UWAA 4H8UA 2WM0A 2P53A 1RQEA 2ASHA 3H2OA 3W22A 1VEMA 3FYOA 3NO3A 1PTAA 4HPJA 1N8FA 4J2PA 4JICA 3TV8A 2Z1XA 2IKIA 1W3LA 3EX4A 4Q7IA 2C3ZA 4B9ZA 4Y9OA 3WY1A 3FJLA 3W1LA 2XM2A 4HYWA 3OIXA 4E38A 1W8SA 3SFKA 3PJTA 1UQZA 3VMNA 4D71A 2X1IA 4X0VA 3OZYA 4DY1A 1W1PA 3M0XA 3MUIA 7CGTA 1QWGA 3EDFA 1H1NA 1KFCA 1GOOA 4NL1A 3K30A 4XQ6A 4OOUA 3NCOA 1HKWA 3HFTA 4IJBA 3VYLA 2CYGA 5DELA 3S1UA 3QMRA 2V30A 2EAWA 3EX2A 1VFMA 2BB0A 4O52A 3E6EA 4YU1A 5A6SA 1Y0EA 4H9TA 3EA3A 3NDZA 4HK7A 1DWFM 4HTBA 1PYFA 3THAA 3U3HA 3VDGA 1PBGA 4P7RA 4JNYA 5LNSA 4XIAA 3ZS4A 3S5YA 2OWWA 2PF8A 1SM9A 1VH7A 2PTXA 1RD6A 3VOJA 1PIGA 4F0HA 1TPVA 2RHGA 1RBLA 4LVGA 1FWNA 1E3ZA 1JCTA 4NSBA 1GEQA 1C29A 3VNJA 3UU0A 1PYMA 2PF0A 1WDDA 4XTDA 5IHRA 1WZAA 4KERA 5D2TA 3ARSA 1YADA 4UB9A 1OIMA 4LAMA 4U31A 2E4TA 1DQXA 3F03K 4DJFC 5DRCA 4G6CA 1I75A 1UA7A 1OCJA 4J35A 1C8XA 2L5HA 2G3IA 3NYDA 1V6WA 1OQFA 2DZUA 3OVRA 2DIEA 4QAWA 1DIDA 1VFUA 3TNBA 1SJCA 3QEZA 3TJXA 2J7GA 1GW9A 1CXFA 1FXPA 2CCRA 4XUGA 2QF8A 4NNAA 4N9BA 1AW2A 2YX0A 1H49A 1VIWA 2WVUA 4RW3A 1SVDA 1J0JA 3T6CA 4J3UA 2J88A 3QBUA 4IF2A 4R33A 2OQYA 2V5JA 3UWWA 2H8ZA 3M9YA 1V0KA 3BANA 3I3DA 4BR1A 1V02A 1QNRA 1UWSA 1J2BA 1OB0A 3DGRA 4ERIA 2BXYA 3UNDA 2X42A 1LWHA 4Q33A 4Q4MA 2R24A 2CWXA 2XM1A 4DJED 1EJSC 1RP9A 1BSLA 2V2DA 2ZZ3A 5M2FX 3WQ5A 5E1QA 4FI4A 5CPNA 1V03A 1S38A 4JZ5A 5C9RA 3BICA 2WNZA 3VD5A 4D6HA 3HPZA 2XISA 1BHGA 1S5NA 1VC4A 4W86A 1DYSA 4ZTYA 2PMQA 4JTJA 1PV8A 5G4WA 4I3GA 2NLYA 3L21A 3N25A 3ZVIA 3BOFA 3MUCA 4C6QA 4BK9A 1UD4A 1WQ5A 2CZ5A 1EF3A 2OWXA 2PAJA 3QC3A 1R87A 3RPDA 4DO5A 3TYDA 4O8RA 4CNNA 1S2UA 4MTVA 3LERA 3V35A 4KFNA 1Q7MA 4DX3A 3NFUA 4MAVA 5H2ZA 1QOXA 4Z2JA 4HU3A 1NAL1 1SZEA 2B7NA 3MANA 3LCWA 3C2RA 4MY8A 1K77A 1NH6A 4KS0A 1C7TA 1FHUA 3NQCA 1ZBVA 3PG8A 2VOMA 3BARA 3DFQA 1XIFA 3KCOA 3MCNA 4N4PA 1E4NA 3I7RA 3MUY1 2OQLA 3W37A 5D03A 3ARXA 4WSKA 3PUOA 5CG0A 2ALRA 3QGVA 1MW3A 4LUTA 3U8GA 1CTNA 3MDUA 1E6RA 3UWUA 4D8AA 2XH7A 1AQ0A 1BKSA 3L67A 3M6YA 4ZQOA 1NF0A 2WC7A 3WK0A 1ICSA 4LNYA 4XD3A 3U0HA 1SFSA 2YCIX 3CZKA 3WDRA 1X6NA 3GAKA 2O9TA 5DBTA 1XBVA 3EXSA 3GW0A 1O7AA 1WDQA 3QW3A 1J0KA 1KR1A 3D6NA 1KM0A 2BWGA 3UWYA 1R30A 2FB3A 2WOQA 1KBKA 1NP0A 4DUVA 3U2OA 1GVEA 2VWTA 3TONA 3LTSA 4AWSA 5E9AA 4AZ5A 2ZADA 1QBBA 3QHNA 4FPSA 3QFEA 4XVEA 5D2WA 2J4GA 3DHUA 1UZ1A 4XIMA 1F07A 3W25A 1BXCA 5LXXA 4MNKA 1UASA 3USZA 1TIMA 1Q6QA 1Q6CA 1IWAA 1UOKA 1C7SA 2PDIA 5AOUA 1V3HA 2QAFA 3CIWA 1AW5A 5FL0A 2ZA1A 3JW7A 3LV6A 5FF4A 3QOKA 4N0RA 2Y0FA 4MY9A 2DZSA 4GIAA 4A8RA 1EPVA 2CU0A 4PB5A 2C0AA 5E70A 2Z1KA 4JPGA 3RM9A 4XWUA 1FWBC 1LL4A 4W4QA 3CTLA 2AQVA 2AQOA 1OF8A 5AYIA 1W9VA 4MJZA 3VI2A 4O17A 2W66A 3QMSA 5FESA 3NSXA 1KV5A 1VB9A 1W3TA 1NF7A 2HISA 1ECEA 1OC7A 2OGYA 3UFYA 5E0KA 4H9MA 5AC5A 4UR8A 3WMSA 3M16A 3OW1A 5A5WA 3VNIA 3BH4A 2A7RA 1VJIA 1I0DA 3N73A 1GZJA 2NSXA 1XLCA 4J3SA 1DJZA 4K2SA 4WD0A 1VBHA 5FF3A 2CLLA 4IGHA 1L8PA 3GHSA 1I6NA 2I9EA 2D22A 3P0WA 3M0MA 3CUZA 1JCMP 4HJFA 2I5IA 3VOCA 3BPWA 2HEJA 3IVUA 3N14A 3NXFA 4N6EA 2OCZA 3P81A 3SRKA 3MC5A 4UNIA 3OGVA 1EGVA 2YDAA 3EMCA 3FVDA 3EWYA 2F61A 1KFLA 2FJKA 4TVCA 4DPQA 1Q65A 2C19A 4GACA 1OFOA 3WSUA 4R34A 3BOLA 5KINA 2VD9A 2VOTA 3ZOAA 2PA6A 5D05A 5HWJA 1HL9A 1OCBA 4Z1CA 5M1TA 3VTRA 3LXAA 3O6AA 3DFYA 2PDGA 1HKIA 1VHNA 4JTUA 3B8VA 5G2HA 4FK9A 4EF9A 3BGGA 4JL1A 3TH6A 4YWIA 3B9NA 4H7CA 1WX0A 3B40A 1O94A 2Y61A 4ZXLA 3DFOA 2XWDA 2OSYA 2JEPA 2UY2A 4KMQA 4LBSA 3R0DA 2SFPA 1SGJA 2VMFA 4WR3A 2HZGA 4IMAA 4M3PA 2NT0A 4DXXA 1MW2A 2YJQA 4JTGA 1W0MA 1RQHA 3LNPA 5G4EA 2V9DA 3V0TA 2O9PA 5I6SA 2OXNA 1OGSA 2ZRUA 3EDJA 3AIRA 4IZGA 1IR1A 2VTFA 3ANUA 4O4VA 3DI1A 2FHCA 3CYVA 4HNCA 1TPC1 3WDIA 2EEXA 1Z48A 3S2CA 1NP2A 1YTKA 2EG8A 3V5CA 2GQ9A 3ZR6A 2PEVA 3FJNA 3CAWA 2D0GA 3S4TA 4G56A 3QV6A 3KUMA 2VVNA 1Q6RA 2ZXDA 1US2A 4Q8WA 2A1YA 2VZUA 2WZIA 4CU7A 1YXDA 1J10A 5E5CA 1HXJA 4DXKA 4GG9A 3NO5A 5DF0A 3N6HA 2WK2A 5A8NA 5HDRA 3TWAA 5I5RA 1JAEA 3S6TA 3NQ2A 5E0CA 3OGRA 3OODA 5CAKA 2Y6ZA 1EJXC 4MDPA 4HHMA 4CNSA 1SZNA 4JTTA 4PE8A 3W26A 3KM8A 3DFPA 3V0SA 3KZPA 5HXMA 7ENLA 1XINA 3IVSA 3R7MA 3PHAA 2I5GA 3N11A 4H9XA 2J6VA 1UR3M 4LALA 1C92A 4AEEA 3RFAA 1KTBA 3CQJA 5IOBA 3CWNA 2DJXA 5AYZA 3SGZA 3NZPA 3LU2A 2Z29A 3H4WA 2GQAA 1JPMA 3KL0A 2ZTKA 4DBWA 4AMAA 4DUXA 4WUIA 5AZ1A 2C6QA 3DHFA 3C6CA 1TMHA 3S2JA 3QPZA 2XU2A 3ZVHB 3SM0A 2DSVA 4MNMA 1V02E 4NZ5A 4K7VA 2EPLX 4EACA 5EMUA 2J79A 1XGZA 3M64A 4O16A 2BVTA 2QPUA 3LGGA 2PTDA 2DT2A 3P62A 5AHNA 1PWLA 4BQ4A 3SN0A 1TZ9A 2BHZA 4DN1A 1VYPX 2NWRA 3UXLA 4PTDA 2CLOA 1A5BA 5I23A 2YZRA 5A1AA 1BPLB 5D09A 2QCFA 2V3DA 2DZBA 2RAGA 4OT7A 3HGJA 1BD0A 3K4AA 2Y63A 3S83A 3MSRA 3MI2A 4MWAB 2H8XA 5HULA 2BGQA 3GNOA 3GNXA 5DMNA 3VIJA 3B03A 2WNQA 3AI0A 1ISYA 4Q3MA 4BY3A 5I0DA 1JFHA 3T0CA 2G50A 5CH9A 1GTEA 4QITA 1TB3A 2CBUA 3NDYA 3NQEA 4JN8A 3SCRA 1GVYA 3QRHA 3P5ZA 3L2MA 3ZQ9A 1TPEA 2XHYA 4DWSD 1SJDA 5AC4A 3T7VA 3URAA 1MRAA 2C1HA 2VZOA 2E09A 4M80A 5ABEA 1I8JA 1H1ZA 4WDUA 5CBBA 2HPMA 2CPUA 1V08A 3VA8A 4UTFA 4W9TA 4Q4KA 2OT1A 5A8QA 1D2KA 3OB8A 5FIPA 3AIUA 3WLIA 1AL7A 1YDVA 5DXXA 2DW6A 4M8UA 4FLSA 1N8WA 2G0WA 3DENA 2C13A 5HA7A 4KF1A 3FIGA 5D2YA 1FKWA 5JQ9A 3MKKA 4S2BA 2FZ9A 3VOHA 4WZHA 3UESA 3W7OA 4QS6A 3GXFA 2GVJA 5DO8A 4GK8A 1K8YA 5I09A 3RX2A 1SO5A 4LY8A 3RO6A 1K1DA 3CT7A 3Q4DA 3KL3A 3LENA 4IIGA 5DY2A 5A8MA 1XPGA 1DJHA 3I6TA 1O5KA 1S2TA 3AXKA 2CLMA 1W3NA 2QYGA 3P60A 1IHIA 1XIEA 2CZVA 4LSBA 1LM1A 4W8AA 1W2PA 4QDMA 5KETA 3AXMA 2WQPA 4FEZA 1QPNA 3U5UA 3MWCA 3WO8A 4UTWA 3LGEA 2OKOA 3I68A 3V36A 3DZ1A 3SQLA 2KZHA 4WDXA 3W1QA 5BCAA 1ZNNA 4JD4A 1WKEA 2Y70A 1I4NA 2X1RA 1VZWA 3CV2A 1TR9A 3GNPA 4DYEA 5LIUX 3L4YA 1BQGA 4G7EB 4XX6A 4ILSA 2W67A 4S3CA 3RLGA 1UH4A 3TMLA 3A22A 2C15A 3H4GA 3AZSA 1RPXA 1VBUA 2OSXA 4W8LA 5I77A 1AQMA 1EQPA 5CJ5A 3E9AA 3ZJ6A 4IIDA 1NU5A 4BZYA 2QUUA 3QXBA 1OY0A 3CYJA 4WK9A 1PZ3A 3OBAA 4F9DA 1UPMB 3TA6A 2J74A 4MLRA 4L4MA 4J9JA 1IZCA 1ZJAA 4XAPA 1C93A 4IP4A 4U2ZA 1PKLA 4ZO6A 2E28A 1GJUA 2RDUA 5FF0A 4DB7A 1KFJA 3GX9A 3R8HA 2DSZA 3MVIA 1P6WA 1BRLB 4YCPA 4B5XA 1MNZA 5D2VA 4PTNA 1A5AA 2JEQA 3AZRA 3GKFA 3CB8A 1UOZA 3NQDA 3LTYA 5CC6A 4FR6A 1M1BA 3COTA 4O1DA 5T91A 4LRSA 3WF0A 3PBWA 4K8HA 3BC9A 4RZ5A 1LROA 1NIUA 1US3A 4C6MA 1CIUA 1UZDA 5BRPA 1KC7A 2QULA 1KFBA 3GH7A 5CZJA 2NQZA 1WBJA 3M0KA 4YS1A 1YDOA 4V1YA 2AMGA 5M5DA 3G0XA 4PGLA 1QI4A 1GG1A 4L1WA 2HDJA 3RMJA 3THCA 3SBFA 1UH3A 4LAUA 3SY5A 1JYWA 4HGXA 4ZO8A 2WB5A 3BAWA 3LLDA 4EKJA 1OD0A 3IACA 3W7KA 1FCVA 1Q8AA 4FAMA 2PGEA 4US5A 3R43A 2UY5A 3PG9A 4UOQA 3F7JA 2E5DA 4ERAA 3BG9A 2QCDB 3T40A 1XSJA 3LM3A 3P82A 4PEEA 4FLQA 3ANYA 3ZVHA 1FWRA 1K03A 4MSSA 1E43A 2Q02A 3N6JA 5CPTA 3GXIA 3K13A 3W2KA 2IPJA 3M0YA 1KB3A 3H8AA 3R13A 2GJPA 3A3HA 3F5JA 3UBPC 4AUBA 3KCLA 2D3NA 3PZMA 2BSLA 5J5RA 2O0TA 1HL8A 4BWLC 1XD1A 1HJQA 3AIVA 3S47A 1EXPA 3F4VA 1GTHA 1CX9A 1QNSA 4ZGYA 4S1FA 3SCTA 3HQNA 6ENLA 2R1MA 4PBFA 3W7EA 1Y5VA 1V3MA 3ARZA 4ZB0A 2VEIA 1IEVA 2J27A 3IK4A 3KRSA 3Q94A 3SUTA 4QEHA 4UOJA 3C2EA 5I7GA 2FH8A 2WPBA 1XLHA 3IIXA 1NWRA 2BY1A 3W1RA 2F9RA 3KTSA 1LBLA 4RV8A 4Q22A 1CXKA 1W31A 5D4YA 5A8PA 3VIHA 1EA0A 5I2UA 2P76A 1HVXA 2Z28A 4MWAA 1MDRA 4GD0A 5G1TA 4US6A 3SCNA 2IQ0A 1PTDA 1YDYA 1OFQA 2NV2A 2OZ8A 5EL1A 3S5ZA 4CQ9A 5FL1A 3A9IA 4CVUA 4OZOA 3W00A 4O11A 3LPPA 3TQVA 5FA5A 5ECUA 1BF2A 5F4WA 1W5OA 1ZUAX 1HG3A 3W7HA 3E96A 3T8LA 5C54A 1TWSA 4LT9A 2X2GA 1TE1A 4O4WA 2PGRA 1UHVA 2C0HA 3MS8A 1QDSA 4JHMA 3B05A 3QR3A 4PCNA 3TIMA 3H23A 4DBUA 3CH0A 1R8LA 3TW6A 2R1PA 3WEMA 1KCLA 3NYZA 3CU2A 1XV8A 1OVDA 3CL6A 2C1IA 4JTCA 4M24A 4XV0A 4WJ8A 2PTYA 3USBA 4M5PA 4PH6A 2XVLA 1J18A 3L0KA 3E3HA 1ZAJA 1SMDA 1XUUA 4L4OA 2VFHA 3M7SA 2Y62A 2D3LA 4CUCA 4ADTA 3LEPA 2E5CA 1SFLA 4IPNB 6PTDA 3GUWA 5F1UA 4C7DA 1ENUA 3DHPA 4AHOA 3LS9A 3IIZA 8A3HA 4DBSA 5HR6A 1B1YA 4LCQA 3HG4A 4OBRA 1GVQA 3L4UA 1XC6A 3N9KA 1YX1A 1UJPA 1CLVA 3CBWA 3CH9A 1KM1A 3TX9A 4AY1A 4NXSA 2PS2A 3TJIA 4GZ7A 3NTYA 3TP4A 2I17A 2V6AA 1IZJA 2EPOA 4L1GA 3HURA 2O4QA 2J24A 5A2CA 4AD3A 4G1NA 4NZFA 3GR4A 3UPMA 2A2IA 3CPUA 1R46A 4OBTA 5AHLA 4JKMA 3KLKA 2X16A 3U5YA 4JYDA 1U30A 3DH7A 3C2YA 4G7EA 3B06A 2Z2AA 4LAOA 5EB8A 4AIOA 3WQ6A 1Q66A 2INFA 2YLLA 4ZE5A 2FKPA 3G1DA 5C71A 4NYUA 4ORMA 1XIDA 3UG5A 4LU0A 1X8FA 3DFSA 3GFYA 4YPJA 2X09A 4LF1A 3GIPA 4MKVA 1AJ2A 2H6RA 1MEWA 5KZEA 2QJMA 4C6NA 4UTTC 4PUWA 7TAAA 3VNYA 3DEQA 1W54A 4FX6M 2JF7A 1FBAA 3W7GA 4QISA 3RCNA 3FVMA 3SCVA 4KCVA 1W1YA 3BJSA 2OR2A 1UR4A 1BRLA 1QRQA 1E4MM 1BGAA 3EX1A 4IUGA 4PUMA 1CLXA 5HJYA 3UERA 1EJUC 3BLOA 3OYXA 5MKGB 1ALDA 4DZIA 3LCIA 4CKQA 1W17A 3UXIA 1AA1B 3QTGA 4C1LA 4Q32A 4OHQA 2V68A 5JMUA 4BJHA 4M6VA 3C0SA 2PRMA 1MFUA 3B8DA 2GFTA 5A6MA 3G8RA 3M0ZA 1Q7QA 4JQ1A 4FNQA 4GVFA 4GXPA 1EL3A 4IFRA 1QPKA 1LF1A 4KWWA 4B15A 3P80A 1ZP4A 3TWBA 1US0A 1HKVA 4FALA 4RZ4A 1QW9A 3MDWA 2ZQ0A 1RCQA 1YE4A 3KOZA 4IX2A 3IIVA 3VX1A 1DTUA 2OG9A 1PIFA 4UFKA 2HMCA 1GKQA 1HO4A 4H6QA 6REQB 2GVLA 4A3RA 2PCEA 2BVYA 2J77A 4HB7A 4RE0A 2DP3A 4ACZB 4IFKB 3OG3A 3CMGA 3HJEA 1ZQ5A 2QCDA 5HATA 5D9NA 1R9YA 2DZXA 2IMRA 3AROA 4M7SA 5HJLA 3ZMRA 5BOFA 4I8DA 4TVDA 3DYMA 1BGGA 4K38A 6ALDA 4GI8A 3T0BA 3NVTA 4ICMA 1WE5A 3AISA 3VD7A 3ARYA 3EAUA 1YTEA 3HFYA 4K3ZA 4GY0A 5CAHA 1N8IA 3QR0A 4M51A 1IE7C 3VGFA 4DI8A 1OX5A 2DH2A 3VIKA 3AS3A 2Y7EA 3WFZA 2ZVIA 3NQGA 3WX7A 1MXGA 2NLIA 3TTQA 4O12A 3QVQA 1Q63A 1O5QA 1SO6A 1GPWA 1BWVA 1F8MA 2GDUA 1XLGA 2VDIA 5XINA 1JYNA 1XYBA 3VFLA 3QYQA 1G9HA 2WO5A 1JL8A 1F6PA 3HB9A 1C91A 1T8QA 1SFTA 1BLIA 1D3GA 2NUWA 4QS5A 4NRRA 2HQAA 2Z27A 3WJWA 1TVLA 1TJ0A 3MHGA 4HK5A 3U48A 3LXCA 1JDEA 3VXGA 4C6CA 2Q01A 1W91A 3PSWA 1LT7A 2B0MA 3TQPA 3VKAA 3QY7A 3UXDA 3JR2A 3MCMA 3SJNA 1K02A 3UPWA 3EWZA 4HCLA 1S2VA 1PE1A 3WZ0E 1OJXA 2Y88A 3GVVA 4PB3A 3NL5A 3ISIX 5CBIA 2DT0A 2BXZA 3V7PA 2R94A 4RE3A 1TO3A 1VBRA 4ZVJA 5TD4A 4KQNA 2XIIA 2WNNA 5IBXA 4LUJA 3LI0A 4D6DA 2O9RA 1M9HA 1S3HA 1GG0A 5BXSA 3LCXA 1UW9A 3QW4B 5J5DA 3BQ5A 2WHJA 4L6OA 3N9RA 1EWDA 2I57A 2FGZA 4G1KA 2D24A 3ZSSA 4LVDA 2EQDA 4QX4A 3TVAA 2X0SA 1JCNA 2ADAA 2D0FA 7TIMA 3GDBA 3TN5A 2WV8A 1TIWA 2H3BA 2TRSA 4B3LA 2VX5A 3CAKA 1H7RA 3M43A 4JGDA 4WOZA 3CEPA 3MPGA 4QE4A 1V3JA 2FJUB 3CGTA 3W2MA 4K8EA 1FH8A 4AD4A 3BW3A 5CJMA 1HJUA 4P7OA 4J3ZA 4XVDA 3KOWA 4DM1A 1DHPA 4JQAA 2P3ZA 4MWAE 3E74A 2VC6A 1WAUA 1PKMA 3QY8A 3GXNA 3ZO9A 3UETA 3RX4A 4B2DD 2W92A 1BWKA 2F6KA 3TK7A 2W5FA 4PMVA 3BO9A 2BVWA 1JNDA 2UY3A 2A3HA 1V0LA 2TPSA 3I6EA 3N2OA 1CGYA 3CT2A 3NGFA 2EG7A 3T0TA 4OJYA 3G6LA 3VGDA 2DGAA 4LNCA 4O1CA 3CQHA 4UFHA 3AFBA 3W2JA 4ZCWA 7PTDA 2XPKA 3LZ5A 3LDVA 2JKEA 2ISSA 2D2OA 4IGSA 2WZMA 1WXJA 4GZEA 2HBXA 1BVNP 4K6AA 2P0IA 1MEIA 5FAGA 3MMTA 2A3LA 4O0KA 5MKGA 1PCWA 2NUXA 1FCUA 1IWBA 2WW5A 3EWXA 3PBUA 3SCQA 5FEZA 4WHBA 2QCMA 1XCXA 4B4HA 4CNUA 4M7TA 1CGTA 3G8EA 1AG1O 2DDXA 3WMBA 2NXHA 1A4MA 1OIFA 4XKYB 2GZXA 2ZX8A 5G2IA 1LCOA 3TZNA 1TRDA 1E3XA 1IXPA 4J2MA 1Z42A 3BLKA 4FMVA 2F8QA 2WAGA 3MTWA 4AU0A 4YXGA 3JU2A 1W9XA 2YCEA 2Y4SA 3CV6A 3TCSA 3O15A 2ZYFA 4V27A 1UBSA 2J66A 3ZIZA 6REQA 4GVGA 3HG5A 3PVFA 5DT5A 3LQGA 2CC0A 1UG6A 1H61A 4QAIA 1E0WA 2QUNA 3IANA 4ACZA 4IFKA 4O28A 1F74A 4AF0B 4IMDA 3EA2A 3IS4A 1UWTA 1KFEA 4XZWA 3G77A 3VNLA 2F6UA 4H9YA 4RNHA 4C6PA 2J75A 5H8UA 1B4EA 3WNPA 1ADOA 1F76A 3PPFA 4HPNA 4OFCA 2HS6A 3D47A 2ZBTA 4MM1A 3K5XA 5CXPA 5BWFA 4JX5A 2WZTA 1XYAA 4FLOA 4UQ9A 4HA4A 2CLEA 3W29A 3AMDA 4M6QA 4NF7A 4IGMA 3PY2A 4C7GA 2JBMA 4K68A 5BMXA 4GKLA 1S2CA 5BNKA 1PPIA 1UJQA 3BSHA 3FEMA 3EX3A 1L8NA 2Z1VA 2Q6ZA 1MVYA 4F0RA 4J3WA 1NOFA 4CD5A 3LGDA 3RILA 4GXMA 4EVZA 1KWGA 4AVFA 3LV5A 5A3HA 5C55A 1ZAIA 1AD1A 3H2MA 4DBDA 4CU6A 5AN7A 1N55A 2Y5SA 2R1KA 3BK0A 3B4YA 4P8UA 1FWTA 4V2XA 1RJPA 3S8HA 2NX3A 4JTHA 3NQBA 4D2JA 3I7QA 1Y5WA 1FOBA 2GLKA 1YXCA 4IL2A 3SQMA 3V1PA 3N3MA 5XIAA 3G6MA 3KDNA 1F7BA 2FZNA 2DFAA 1EJWC 3GR7A 1NTHA 5L6UA 3EWBX 2DUAA 3TN3A 4AB4A 3N15A 1XYFA 3R25A 5BXRA 1EWEA 4HYVA 3SUUA 4UZSA 1ZJBA 3OLIA 2D23A 3G24A 2XGIA 3CIXA 3NQVA 2NVDA 3RRAA 4A3UA 2QCGA 4YTTA 1TVNA 3V3WA 5CC5A 3GSMA 3DBNA 3GY1A 2ZZ2A 4NY2A 3VZZA 3ONCA 1MUWA 5CJNA 3UR8A 4A22A 2VR4A 4E8GA 1H7NA 1S2AA 2KX9A 3SB0A 3DHDA 3AWOA 1XIHA 1P6CA 4Q8UA 1C8QA 2W27A 2QCCA 1W3KA 1GHRA 2DZWA 1NARA 5BXPA 5J04A 3TTEA 3SCUA 1NVMA 3ITGA 4PYSA 3W07A 3CAVA 3QSTA 1XJBA 1F3XA 1A3HA 2E9MA 2BOEX 4FIRA 3M5YA 4K1GA 1XH0A 4GCXA 4NNBA 1WZMA 1AH0A 4NAFB 3U7BA 1UR0A 4MLJA 1R3RA 4ZB2A 2YCKX 2VFGA 1RLCL 1M7OA 3LHVA 2A3AA 4EAYA 3LOTA 5TF0A 4F40A 4QG6A 3O63A 3QY6A 1NDYA 1AUSL 2WBGA 1TFVA 3WELA 5F7UA 3BJTA 3G0UA 1MEHA 4X22A 1AODA 2GSJA 3TNOA 1V7AA 3MUZ1 3WH6A 3B8IA 1E6QM 2ZDSA 1H1YA 4Q6JA 3VUPA 1MMFA 1P0BA 2XJ7A 3IVTA 4MWAC 1MQPA 3ITVA 3QZEA 2CBVA 4FXFA 4HHHA 3VOIA 4UCFA 4Z42C 3SADA 2DT3A 1XM3A 3L9CA 4DO4A 4MFEA 5ENLA 1PX4A 1OC6A 3PB2A 1TZZA 1FWSA 1VFTA 1EUAA 4MB1A 4A3YA 1LUCB 3MSGA 4YVVA 4E3TA 2BASA 2QAPA 2CLPA 3T44A 2GYIA 3H70A 3OBKA 4D6JA 1FWFC 1VEOA 5LA1A 4NZ4A 3W2NA 2PPGA 3LRMA 1TG7A 1VAHA 3GB6A 3VIFA 1XIMA 4A3HA 3HF3A 1A5LC 3ARWA 2YCLB 4C7FA 3VABA 2P88A 2EKGA 1XIJA 2CKSA 1XW8A 4MJ4A 1RALA 1OSEA 4ZA0A 4XB3A 3IARA 1MNSA 4O10A 3PBMA 5BU9A 1H0GA 3WLKX 3A21A 5EBUA 3G1HA 7XIMA 1SZFA 5MF5A 2IQTA 3WDPP 5SWUA 3K8LA 1IT0A 4KCTA 2Q3RA 4BQ2A 2ZA3A 2ZIDA 5F1VA 4XKYA 1HJXA 4HMDA 3A6OA 1VD6A 4KESA 1E0TA 2JFEX 3GDMA 1B3WA 3GE7A 3ITTA 1L2UA 1TTPA 1K6WA 4JDYA 1RH9A 3F4CA 3ARUA 1XKYA 3C4UA 1GQKA 5IFTA 3AHVA 2Z26A 1C9WA 1PJ9A 1OBAA 3GTIA 3C2FA 4TMCA 4GFSA 2Z2UA 3IWPA 1FCBA 4ZSTA 1KXHA 3LBCA 5A2AA 1XBXA 1E4IA 3GG0A 4AF0A 3PANA 3RX3A 1VFFA 2WZEA 4GVIA 4QG8A 4W87A 3HN3A 3W02A 1ZP3A 2QLYA 5DX7A 2GGJA 3E38A 1K9DA 3W53A 1E9LA 4ZXOA 1XF0A 4GVHA 3LQLA 3TAKA 1XYMA 5C5YA 2BP1A 3W0KA 2ZUTA 2HVMA 4JY8A 5TAOA 2VUYA 3KP0A 4XO6A 2NQ9A 3CLWA 4IXXA 5KMYA 4B3ZA 5JVLA 1H3GA 4QROA 1LG2A 4DHGA 4GC3A 3CTTA 3Q65A 1FKXA 3G1XA 3CQKA 3BJFA 4CU8A 3BLPX 2VRJA 3SIZA 2QV5A 1R3WA 3QJAA 4GPNA 5HJXA 3L4XA 1CWYA 4JYEA 2Y5JA 2FLIA 4EE9A 1I2OA 1UR9A 4CGTA 3B4UA 1OF6A 4DJDC 3FKRA 1VPXA 1A3XA 2G41A 3L5AA 2VKZG 2F38A 1KBLA 4CD8A 3RCMA 1E51A 4LW7A 4BCEA 4AWEA 3BTNA 4GYPA 4RNJA 4ZR8A 3ZJ8A 2QS8A 3EOEA 1JUEA 1QWKA 5ECVA 3VOFA 5FEXA 5B7YA 1P4CA 5I3KA 4W7WA 4IIHA 3MSDA 1UC4A 3N1AA 4DAIA 1TSIA 3SCWA 3H2FA 1WUFA 3EEGA 1QMLA 4H01A 2AGKA 3WD2A 3AZTA 5TQLA 3XINA 1CB2A 1X1NA 4UWMA 1QNQA 1K8ZA 4O0ZA 1UUQA 5EFDA 2FPVA 1G6CA 4AWTA 4QG9A 4L6HA 1XH1A 4AX7A 4C6JA 1ZALA 2PWGA 1UMYA 1OFAA 2WZHA 3HTWA 3NQMA 4HVXA 5U7SA 3ABSA 4GI9A 4JQ2A 1TJ2A 1BTCA 4ROPA 2ZCGA 4Z2IA 1KV8A 2ZWYA 3W7JA 1RP8A 1YEYA 2E67A 3WF1A 4E2VA 3WD4A 3OVGA 4J7RA 5DQPA 1TVPA 3MP5A 4NAFA 3C86A 1QR7A 3PBYA 2GJRA 2E0PA 2A6LA 5EKYA 3VE9A 4TOQA 4GISA 3CO4A 2J62A 4H2HA 2V5DA 2OMAA 3CNYA 1RR2A 3M0VA 3RPMA 2G37A 3CV7A 2CEQA 4RPPA 1TPUA 4TX8A 3NEHA 1YRRA 3B9AA 4QJ3B 2WSPA 3TOPA 2QCLA 3TZFA 2Z0IA 4O54A 4I5UA 4OIFA 2W61A 5FEPA 4IIEA 1XX1A 3VDHA 2DIKA 3BZJA 4RNIA 1TJ1A 4KCUA 4S38A 2FGLA 4GBDA 5FSDC 3JZUA 4G8TA 3EYPA 4OE7A 3WD0A 4P8VA 4CCCA 3YPIA 2WVTA 4ZQMA 1JAKA 3MQTA 1LUCA 2YYUA 1TUFA 2DPEA 3H7VA 4CEXC 1YE6A 4JIEA 1TWIA 3CC1A 3N29A 3ABRA 3VDCA 3SUWA 5D9OA 3OP2A 4YTQA 4BI7A 1RCOB 2E1WA 2PBOA 2YW4A 3AHZA 4FXSA 3HZ3A 3CAQA 1EDTA 3GK0A 2QVHA 3VNZA 3GHTA 2YCLA 2ZXAA 4W89A 3C2VA 4JHOA 5GPRA 3CZLA 1J0IA 4YJ5A 3PK7A 1E72M 3E2VA 3ZLHA 4H8VA 5LYRA 5T9CE 1OYAA 3A24A 3CUXA 3IJQA 4S39A 1DORA 1JCJA 5AZ0A 4K39A 1L6YA 5ABFB 3FAXA 3VMOA 1A5SA 5H8MA 3FHAA 2QDEA 1TX2A 3FJ6A 2Z7GA 2P3EA 1FP8A 1XL9A 4QCEA 1TPDA 1T0OA 3OVPA 1A0CA 3OU8A 2CZEA 1YBQA 3LD5A 4YLWA 1DJGA 1U22A 4E5TA 3RG6A 2ZE3A 4NYYA 4JKLA 4ZB5A 4MPQA 3W72A 5LIKX 2G3FA 3QZAA 1A3WA 1GZGA 3T4WA 4I9MA 5GVJA 1JXJA 2I56A 3H4XA 1NM9A 1OX4B 4PSPA 2J7CA 4DO7A 4K37A 1L2QA 3N9SA 4CQAA 4ZE4A 5HMDA 4KEMA 2V5KA 2CZDA 3T42A 1RBAA 1PZ2A 4FP1A 3BLFA 2OB3A 4GHRA 4BA0A 3T09A 2QMJA 3MKVA 1XGEA 2DUZA 5FF2A 3KVKA 5DY3A 2NSOA 3T05A 3E0IA 3LYEA 3NURA 3PAOA 1UMLA 4FNUA 4Z2LA 4C6KA 3F2BA 3NM1A 2P8CA 2QPXA 2GVYA 1V77A 1V6YA 2VJXA 3E0WA 2RGLA 3KDOA 4QQ3A 1PWMA 1QHOA 3NGJA 3SRHA 1AJZA 2XSBA 1PL9A 1K7XA 2XN2A 3DG3A 3MV11 1KR0A 4R5EA 3WUBA 3VPLA 3WH7A 2ODOA 4NAEB 3AIWA 2NWSA 4DF0A 3W73A 2V5LA 4AC7C 2HJPA 3GUGA 3B9EA 3BAYA 1QK0A 3IV8A 4TO8A 4V33A 5G4HC 5BYWA 1XC4A 1OX6A 5D9PA 4B91A 3DC8A 4QFUA 4R53A 3GW3A 5HQMA 1ZY9A 1XLLA 1UP3A 2FFIA 4AYSA 2ACQA 4LPCA 2NUYA 4HMEA 4C6OA 4HMNA 1HQTA 4XZBA 1QW8A 3P6LA 3UA3A 1FWWA 3VKJA 2W4XA 1H09A 3IAPA 4WDTA 3W74A 2O7QA 1UA3A 4F0SA 4UR9A 4D6FA 4FF7A 2AQWA 2PC8A 3D3FA 1Y8BA 2QDDA 2BS9A 3S5SA 3QGKC 4L4PA 1QT1A 1A5OC 5C9XA 3CWOX 2P5NA 3VIOA 7ODCA 2DSKA 5HAOA 1KRMA 1R7OA 4QR6A 3AYVA 1V51A 5A6JA 2Q71A 4WIWA 5EYWA 2RGMA 3EKGA 3L7RA 3B8TA 3CPRA 4YYFA 3F4DA 3L2IA 4WJXA 2VD8A 3L66A 4D9PA 1SW0A 3EB3A 1SJBA 3WNKA 1GJPA 2WC4A 4MAZA 1JRBA 1R2SA 2VGGA 2BMBA 2YIHA 1PO9A 3AS0A 4DUOA 1GT8A 2GSEA 3R2GA 4DWSB 4KGJA 1FWIC 4JIQA 4MKNA 4IPJA 2WKGA 2WANA 4PFMA 1LL6A 4YMZA 1CNVA 1VLIA 2E8ZA 6XIMA 4AVNA 3KOYA 2XH2A 1JI1A 5C7VA 2J9ZA 1EH9A 5G1YA 3U7VA 2CXEA 3UG3A 9XIAA 2BODX 2AAMA 1K4HA 1W2VA 1VGAA 5ABHA 4B16A 4IPLA 3C61A 1ODUA 4GY1A 3QZ6A 1ZBCA 1V6VA 5D04C 4K36A 3NR0A 2PU1A 1OGBA 5HPOA 4EX4A 5HNRA 1F3WA 4ZOEA 4S3DA 1EGZA 4OECA 4URIA 1IXNA 4HT3A 1JI2A 2AAAA 3G2GA 4H8NA 4WX2A 3DXIA 3TTOA 3T78A 1LL7A 4XZNX 2Z4GA 2HE5A 2BDQA 4RZBA 5I3DA 3WLOA 2PWDA 4PTVA 4IH3A 1PXGA 4UMCA 3W1XA 4GYKA 1EYWA 3EMZA 1XIIA 4CQ8A 4HA0A 1NWSA 3P74A 6XIAA 5I3JA 5A69A 3RUBL 5IXEA 3AU6A 4ATDA 4GQ0A 3MUAA 2E6AA 4TX9A 2VNCA 2DT1A 3PP7A 4IIFA 1DP0A 1HTIA 5AYYA 4LB4A 1QXLA 4JCLA 4AMCA 3WBAA 1W9UA 5K9DA 4ONVA 1H51A 3UYIA 3RAOA 1XWYA 3UJFA 1XP3A 3CWHA 2MANA 3NOEA 4PULA 2X7VA 3UZWA 3INPA 3UF9A 2QR6A 2VEPA 3CQ0A 2Y2WA 2GWNA 3B0UX 3DUGA 2EF9A 2HV5A 4N4QA 3BMXA 5HPCA 1TPB1 4RDWA 1NFPA 3KBSA 4L9ZA 2IQDA 3UG4A 3GU1A 3K8MA 2F7FA 3GZ3A 1PEZA 3SRFA 2FMOA 5CPLA 1CGWA 1KXQA 1AMKA 3RGTA 4L9YA 5AECA 1VENA 1G1YA 4HIBA 2J9XA 1IIHA 4YIWA 1OX4A 4AYGA 4WSHA 1JUBA 3QHOA 4Q4QA 3UZYA 2OWCA 5HMEA 3RCYA 2A79A 2ISDA 4FX8A 2V2CA 3WIJA 1A5CA 3C3UA 3QLLA 5CGQA 5I3FA 1A49A 1XHGA 1M7XA 2VENA 4ALDA 4GJ1A 4CN4A 3IAQA 3VD9A 2XZ9A 1VBGA 3LRLA 4P2VA 2QDHA 1JQXA 4ZQRA 3CLMA 4RR4A 1OK6A 2PWEA 4F9JA 1QO5A 1TCMA 2V0TA 1XLIA 1KGWA 3CO8A 4Z1DA 1PDYA 4GKTA 4HNLA 2XVKA 3QPYA 1RLDA 4X61A 3WMCA 1GVSA 2A0NA 4Z08A 4DLFA 4S3EA 2ESCA 3KOFA 1A5UA 4EOUA 4XAYA 3APYA 3ARTA 1EX1A 3AYSA 3PZVA 3W7NA 1BSIA 1UROA 3FSUA 3BL3A 3MHUA 4EAMA 1E9IA 3SRDA 4TTUA 4PC8A 1K3UA 2HWGA 4GUIA 1JCYA 1EBHA 1RA5A 2WKLA 3H54A 4W5ZA 1KM3A 1HZYA 2VT0A 1H63A 1BXBA 2R9RA 1YPIA 4NAEA 2YCJA 4PTXA 3R11A 1YPFA 3UXAA 1EXBA 1CCWB 3SQSA 3NG3A 3G1AA 1CB7B 4U5KA 1SW3A 3MB9A 3GBDA 1SQ7A 3GDTA 4P7NA 4G9PA 2DIJA 4RUBA 4CCDA 3L5LA 3L4ZA 1XLEA 4Q8MA 4HZ7A 3CS2A 1R85A 1EYEA 2EGZA 3GDRA 3KRZA 1ITQA 3F2CA 1F73A 4O14A 1EUNA 3H2CA 3UP8A 3POHA 3E12A 4U3AA 3SY8A 2QQ6A 2XN1A 1Z9AA 1TWDA 5LNUA 1YHTA 5AHIA 6TIMA 4RW5A 1S3TC 3WL1A 2XUCA 1W6TA