4XQ6A

Crystal structure of dihydroorotate dehydrogense from mycobacterium tuberculosis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
317
Chain Sequence
VAPVRRLLRRLLGPTDPVLASTVFGVRFPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPLFRLADDRALLNRMGFNNHGARALAIRLARHRPEIPIGVNIGKTKKTPAGDAVNDYRASARMVGPLASYLVVNVSSPNTPGLRDLQAVESLRPILSAVRAETSTPVLVKIAPDLSDSDLDDIADLAVELDLAGIVATNTTVSRDGLTTPGVDRLGPGGISGPPLAQRAVQVLRRLYDRVGDRLALISVGGIETADDAWERITAGASLLQGYTGFIYGGERWAKDIHEGIARRLHDGGFGSLHEAVGSARR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase (quinone)
publication title Crystal structure of Dihydroorotate Dehydrogenase form Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis h37ra
total genus 105
structure length 317
sequence length 323
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xq6A00
1A5CA 2GVLA 3DFSA 5C54A 3EX6A 5SWUA 1EP2A 4LV4A 3PY2A 3M47A 3B4UA 4O17A 3BPWA 5EKYA 1SR9A 3R8RA 4UTMA 1Q45A 2ZZ5A 3N2MA 4N9CA 1K7FA 3LHWA 4HPXA 5CSRA 2QCMA 2GQ9A 5K9CA 1H50A 2NUYA 4ALDA 3GDRA 5AHFA 1XBYA 5FF4A 1QPQA 2J88A 2Y89A 1GWJA 3CU2A 5F2MA 1X7FA 3QC3A 4JIPA 3L21A 1VYPX 1SQ7A 1OF8A 1JR1A 2VFHA 5CZ0A 4GUHA 1LOSA 3W74A 4HNVA 4LY8A 1T8XA 1RV8A 3LHYA 3HGSA 1JCNA 1KLZA 1KM2A 3QSRA 3S1XA 2G97A 1QPOA 4WQ6A 3TSMA 4FB7A 2AGKA 4UFHA 4LVBA 3UWQA 3CC1A 3W6YA 1PVNA 5CZSA 4CQ9A 2QJIA 1PS9A 5EMUA 1UASA 1S3HA 5BOOA 4N6FA 3W1RA 1GG0A 3EX1A 2GJLA 4X9SA 1TPWA 1S5WA 1ME7A 1TPVA 3MHFA 1TPDA 4OV9A 2ZRXA 4TX9A 3G1XA 2C16A 1BKSA 4HHPA 2ZZ2A 4ZMGA 2YFOA 3TROA 4IGHA 2ZTJA 3NPUA 1KBIA 3A21A 1AL8A 1Q3NA 1O5KA 4WUIA 4ADUA 1OFRA 3C3NA 3GLCA 5IM51 1V7YA 2YXGA 4ZVJA 1M6JA 1QNVA 3DXIA 1CW2A 1R30A 2YR1A 5A8GA 2NX1A 4OV4A 4O1CA 4R33A 5G5IA 2HSAA 1ADOA 4LTSA 4PC8A 3UWYA 1PIIA 5HR7A 1R2RA 1GZGA 1PCWA 5DCDA 3JS3A 3BG5A 4JTGA 2Q8ZA 3OVPA 3STFA 4U4MA 1SW0A 1F5ZA 2CLMA 3O63A 1FQ0A 3TW6A 3G18A 3A22A 2VEMA 4LVDA 3U6WA 3IVUA 4O11A 3MUXA 4Y90A 1KFEA 5KZMA 3TK7A 1KV5A 2WNNA 2P1FA 2H6RA 2QF7A 4PH6A 1XBZA 2Z6JA 3W2KA 4JICA 3H54A 2PURA 2X1TA 4A22A 3W7JA 3S5ZA 1OFQA 2QJGA 3EB2A 3T40A 2YYUA 1O95A 4O10A 1P5BA 3P84A 3H55A 1WBJA 1W5OA 1WAUA 4O4VA 3GX9A 4O4WA 3W1XA 2C19A 3LRMA 4DBDA 5F4WA 1OG0A 1LROA 2GVJA 1MZHA 3CIXA 1UUMA 2E6FA 4O52A 2CZEA 2CZDA 4XBSA 1GJPA 2Z2UA 2J27A 4N02A 4M19A 5LNUA 5D38A 3W22A 4PFMA 4NT0A 2QCGA 4JYEA 2JKAA 1TPFA 2TYSA 5CPNA 4POCA 4LC6A 3LHVA 1H62A 3PR2A 1A5BA 2C3ZA 2TRSA 5AHEA 2X1RA 3W07A 4WXZA 4ZL1A 3M43A 3STCA 3M5XA 3WJYA 4TMCA 3W7IA 2NUXA 2GQ8A 1WOAA 2HMCA 2CZ5A 1FDZA 4K7VA 3W7HA 3UWUA 4DXVA 2Y85A 1W31A 1FCVA 1XM3A 2E09A 3B0PA 3N14A 3N9RA 3DGRA 4LRSA 1LP6A 4AHPA 4JX4A 2CWNA 2DZVA 3TV8A 1OYAA 1GYNA 1KBJA 2V9DA 3NQVA 2VEIA 4IXHA 2JBMA 4NUWA 2QAPA 1CI1A 2RKXA 4MZYA 2Y6ZA 1QOQA 1Q6QA 2WKJA 3HGRA 3HGJA 1KFBA 3HIJA 3CT7A 3Q58A 1JQXA 4FX8A 3UNDA 4IMEA 2Y7FA 4MY9A 3FYOA 4OHQA 4Q33A 5L6UA 3NL3A 1TMHA 1WV2A 2EPHA 2VC6A 1XCFA 2YW4A 3VE9A 1SZGA 1OX4A 4H3DA 4QAIA 2Y70A 5K7JA 2NZLA 3WK3A 2ZZ4A 3GKFA 1K3UA 1U83A 4DF0A 3B03A 2YW3A 2ZZ7A 3SZ8A 3WJSA 3W83A 1UCWA 3NQDA 3GDTA 2XFWA 5I3FA 5AHIA 4MY8A 5TBOA 1VQTA 3TFXA 3LHZA 1M7OA 3P74A 5CPOA 2WPBA 3PULA 3QPZA 5FEWA 2ZCGA 3KRSA 3IRDA 1G7UA 3NDOA 1GVOA 3LI1A 5D2WA 5GVJA 2PRHA 3W7KA 4MLRA 2YSWA 2BZNA 3K30A 4FIQA 1UJPA 1MO0A 2Z0IA 4UTHA 4JTEA 3NG3A 1JRBA 3C2RA 5CKSA 4XBKA 3OHIA 1TJRA 6ALDA 3LOTA 1G69A 3CEPA 1F7BA 2GJNA 2OJPA 1B3OA 2EAWA 2KZHA 4S1FA 5FESA 1W5QA 1I45A 2C13A 2V5LA 3EX2A 3NQGA 3L68A 5E1QA 3S9YA 2RDUA 1VCFA 2Y62A 4FNQA 3KAOA 3OA3A 5DY3A 3O16A 3UWWA 3LXBA 4MFEA 1J5TA 2VEPA 3SW6A 2BX7A 3N9SA 4ML9A 3UZ5A 2NX3A 1LZOA 2VFFA 4UTTA 1I8JA 2RH9A 5FF2A 4CNOA 4DO5A 3W84A 1VYSX 1MEHA 2CU0A 4NZJA 3DHFA 1VZWA 5KSWA 3L0KA 4DELA 2ZRUA 3BGGA 4IMCA 4M7TA 5AC7A 3NPVA 4IOTA 2Q8LA 1OX5A 2B7QA 1SU5A 3IGUA 5FEZA 3LHTA 5D33A 1HFBA 4DPPA 1KM4A 3E02A 5E0KA 4M6VA 4Q4KA 3C2VA 2HTMA 1EUAA 3GVGA 3BLEA 1QFEA 4O14A 4WX2A 3RLVA 5F4SA 4GUIA 3DHDA 4OQVA 3S8HA 4FO4A 3PUOA 4GFSA 4ORMA 4B5NA 1TV7A 1H7WA 3EXTA 4WY0B 1IIGA 3LM7A 4IPIA 3W7DA 4JTSA 1LBLA 1VLIA 3KVLA 2RFGA 5I3IA 1NEYA 2I1OA 2ISWA 3OEXA 1SO4A 1OVDA 4QIUA 5K4ZA 3M41A 2H8ZA 3ATYA 1EWDA 2ZQ0A 1B4EA 4PTNA 4X22A 3B05A 3LB0A 5CPMA 1I2NA 3T78A 1VCVA 3NQCA 4UFJA 4UTUA 4H6KA 4FF7A 1H5YA 1KM3A 3UWVA 3G1SA 3W2MA 1LCOA 1PL9A 4CNNA 4QNEA 3L66A 5LGXA 1JULA 1EIXA 3CTLA 4MFDA 2CLOA 3N2XA 5G4WA 4K37A 5D2XA 3MP5A 3NA8A 1RR2A 1W3NA 2VFGA 4UMBA 5G2HA 4UC5A 2VOMA 1JUKA 3NQ6A 1L6WA 4K39A 3ABRA 1EB3A 2R91A 2C15A 1B9BA 5TIMA 1W1ZA 3WJWA 4N6EA 3G8EA 2B0MA 3QQ0A 4JTHA 2P0OA 4JYDA 4XQ6A 4XUGA 3F4WA 3W7OA 3TQKA 5D2TA 3O06A 2OZ0A 1H7OA 4GC4A 3GXTA 2QCFA 4FNRA 2E5BA 1KW1A 3W23A 1OJXA 1KM1A 2NLIA 4DPQA 4LW7A 4UNLA 1IXQA 3HOJA 2OT1A 1A5SA 1A5AA 4AMAA 3DZ1A 4QQ3A 4WJEA 1W3TA 3TC6A 5BMWA 3N73A 1ML1A 1G4TA 2B4GA 5AHLA 2H90A 2ZZ1A 3QEZA 3T44A 2XN0A 1H7RA 3QW3A 3MO7A 1FCUA 5J5RA 1A50A 1LRQA 5I3KA 5I3JA 4BFAA 3P62A 3PUEA 2V0TA 1QPNA 4AWSA 5H91A 1FWWA 3QFEA 1RZMA 1HL2A 2CLLA 4RR4A 3SFKA 2QCCA 1SFLA 4ZZ9A 4PL1A 1XBVA 3W70A 3DKLA 3MBFA 4AXKA 1EP1A 3PM6A 1GG1A 3Q94A 1M7PA 2B7OA 4LV9A 4AF0A 3L5LA 4XKYB 3LRLA 2VKZG 2Y7EA 1X1OA 3A9IA 1YDNA 3LTSA 4ZQMA 3FEMA 3LCWA 2JKPA 4CCDA 3HG4A 3L67A 4EF8A 3EWXA 2ZRZA 4YXGA 1Q6OA 1PV8A 4M6QA 1QWGA 2ZBTA 4JY9A 1FY6A 4NJHA 1VYRA 3IIPA 5LNSA 5HULA 4RXFA 4FNTA 4K38A 1RPXA 2NUWA 4DEFA 4O18A 8TIMA 3LI0A 2NXHA 3MBDA 4ADTA 4JTJA 1P0NA 4A21A 2EF9A 4O16A 5CPLA 3S42A 2EGZA 4Z1CA 3G24A 3USBA 3M1ZA 1IIHA 1P0KA 3O07A 2Y7GA 2OCZA 4KWVA 3T4CA 3TW7A 1HTIA 1H1YA 2HS6A 3G1FA 3TUUA 1WYIA 1KFLA 3GIYA 2YX0A 4XKYA 5D32A 3S1VA 4UR7A 4OU1A 1VHNA 1KTBA 3W3OA 1NAL1 2ABBA 3SJ3A 3PBWA 2YYTA 4M7SA 1DKWA 2YGYA 1KV8A 2NXIA 2FPYA 3PS7A 4FXSA 2AAMA 4NNCA 2PCQA 4MKNA 3NL6A 3SI9A 4ICNA 5K2ZA 3FIGA 1G7VA 2YDAA 3NM3A 3G8RA 1KM5A 3TQ0A 4X2RA 3RMJA 3TXVA 1FWRA 3NM1A 3HJZA 4IMFA 3C6CA 3GAKA 5EBUA 1QR7A 3A5VA 3WK2A 3G0SA 4DBEA 1KLYA 3CM4A 3LCFA 3W1UA 3W7PA 2FDSA 1EEPA 1HUVA 3NZRA 3TMQA 4UFLA 3P5YA 3VI2A 4GNJA 1TTIA 4E0CA 1DJQA 4RJEA 3S5OA 3TAKA 1GOXA 3L0GA 4JS3A 1W3IA 1K7EA 4IJBA 2GUUA 1KTCA 4K8EA 2ZFAA 1OFPA 1SSGA 5AHNA 1W56A 5U7SA 2ZRVA 4GWEA 2V2DA 5DLCA 5C5YA 4JX6A 3W1MA 1CX9A 1AW1A 1K02A 2B7NA 2YFNA 3I7SA 1NF0A 3UPWA 3W7NA 2G5WA 3TJXA 4KFNA 1SPQA 2A7RA 2DZTA 4YLWA 2I14A 3O6DA 2QCHA 1OX6A 3BW4A 3HBLA 3NGJA 4YMZA 5AC6A 1LBMA 2J9ZA 5EL1A 2XN2A 1H61A 1VCGA 1MSSA 2E6DA 4BR1A 4GBUA 4RK8A 5AYXA 1SZFA 1LRTA 1T0OA 4NJIA 4QITA 4ZQRA 5BRBA 4U28A 1FDJA 4N4QA 1EWEA 2ATMA 1H7NA 3BW2A 1EX5A 3BLFA 4UIOA 3ZWTA 5HR6A 4GUJA 3LXAA 1VPXA 2XN1A 4ZQNA 1OYBA 3EKZA 2ZRYA 1YLVA 1PCKA 5DCBA 5C55A 3TA6A 5F2LA 3MP3A 3BLIA 1OK6A 3FOKA 5HWJA 1K03A 3C8FA 5CZTA 4FNPA 3NEVA 4UFIA 1OFAA 3HO8A 2ZDRA 2Q3RA 2BTMA 3IGXA 3RLUA 5G4EA 3BV4A 4O54A 4QM1A 4CQAA 1TV5A 4LRTA 3P7YA 4A29A 1ZFJA 2ZA1A 2TSYA 1MEIA 2FJKA 2ZTKA 2X1SA 1B4KA 1A53A 1X1ZA 5ABTA 3MI2A 1OABA 1YXCA 4PEKA 2C6QA 4RCXA 1OX4B 2ATSA 1G67A 3NQFA 4RV8A 1P4CA 3M6YA 1O5XA 3BO9A 1GTHA 1PHQA 3ZR4A 4JTUA 1XL9A 3GDMA 5LKYA 1G4EA 3E0IA 4R34A 1ONRA 3O1NA 5LGZA 1W5NA 3W7CA 3HPSA 2Q3OA 3QF0A 4MIMA 7TIMA 1AW2A 1VC4A 4O1BA 5DBUA 3TXZA 3VNDA 3DI0A 4MLJA 3UXDA 4OBTA 3QZEA 4UMCA 4FHAA 2QKFA 3FFSA 3FJ6A 1DL3A 3TCEA 4A2RA 2QEZA 2A7NA 1UUOA 4OGZA 5KITA 4JIQA 3UY7A 3NL5A 4MVAA 1Z44A 3W7GA 3M9YA 1O4UA 2QDGA 2NWSA 2ISSA 1BWKA 3LRKA 3ATZA 4FNSA 2X16A 5EY5A 4JTKA 2O7QA 1QCWA 2DU2A 4IX0A 5BMXA 2QCEA 1SZEA 1ICSA 1I2QA 3SGZA 2WNQA 2OX1A 3G3DA 1YXYA 3IV3A 5IBXA 2E6AA 5HWNA 4CQ8A 3ELFA 4CCEA 1ZJIA 3R12A 5F2IA 3I7QA 2X30A 5CSSA 1K8XA 2V81A 4JDBA 3VCRA 3STGA 3C52A 2A5HA 2RDWA 3C56A 5CZJA 1H1ZA 1F05A 1PHWA 1R46A 3NAVA 4M5PA 3V1PA 3ANYA 4S2BA 4N9DA 5D30A 1ZENA 3U2OA 3LBMA 1ZAJA 3RF9A 1SUXA 3CQ0A 4WOZA 3UD6A 4UTTC 1DV7A 5D05A 1EPXA 3NPWA 3VFLA 4NJGA 4YCOA 2IQTA 4K6AA 1QMLA 3IIZA 4WD0A 1ICQA 3EWYA 1KFKA 2CLEA 2E68A 3NYZA 3PBUA 4PL2A 3E49A 1LTDA 3LTYA 1AK5A 4JYFA 2V82A 4Z1AA 1O94A 2W0UA 3PB0A 3WJZA 1GEQA 4PODA 2DP3A 3M5YA 1AMKA 4TIMA 3QPYA 5TQLA 3N34A 3THAA 4MY1A 1EP3A 6TIMA 3PUDA 4FEZA 2DZPA 3YPIA 2Y7DA 2DJLA 3HGOA 2QUVA 3MHGA 4L4MA 3C61A 5D03A 1Z48A 3GAYA 3BG3A 3LTPA 1X6UA 1NVMA 1YDVA 1U5JA 3C0JA 4UNKA 4OT7A 3F4NA 3I68A 4IUOA 2C1HA 1XFBA 4X3ZA 1OF6A 3QQ1A 1F74A 3PC0A 3LGEA 1R2SA 3M44A 3G1HA 2Y88A 4J9JA 2QCNA 4TMBA 2V2HA 4S2CA 1F76A 4HKPA 4O1DA 4IX2A 1UBSA 2P10A 4YCPA 2O7SA 1LYXA 3LDVA 1K7XA 3KVJA 4MOZA 4HNTA 3PB2A 1AG1O 3IIOA 3GNDA 4NX5A 1TSIA 1VS1A 4LUJA 5LZLA 4RX0A 4GUGA 4CLMA 1TYGA 3TFCA 3M16A 2A2IA 1Z41A 3IIXA 4Z0JA 3TSDA 2WV8A 4JTFA 2E77A 3S6DA 4UTLA 3SECA 1LOLA 4AB4A 1WBHA 4UR8A 3F03K 3W7LA 3CLMA 1XUZA 4JN6A 4UFMA 3EWBX 4DO6A 4C1KA 3Q37A 3UYCA 4LS2A 1L9WA 3AO0A 2B7PA 5AC8A 3QJAA 1FCBA 1L6YA 3FLUA 1JCMP 2PRMA 4WXYA 5D2VA 1J4EA 2CFFA 3CB8A 3EX4A 1JRCA 3PG8A 4Y6GA 3DENA 5BW6A 5F1UA 3DFTA 5EYWA 2GOUA 1VH7A 2PC4A 4M6PA 3EWWA 2WSRA 2ZA3A 1FXPA 3G1VA 5G2WA 3BG9A 1VR6A 4L4LA 1ZAHA 4IMGA 3PSWA 5HINA 4WY0F 4HPJA 4BWLA 4I7UA 4UFKA 1IGSA 1QO2A 4Z0SA 4Q32A 5H2ZA 3C2EA 1DQXA 3CHVA 3GYEA 2C0AA 4MZ1A 1EUNA 4MUZA 4NXKA 5LSMA 1PE1A 3TNOA 3W7QA 1C29A 1ZY9A 2Z6IA 2FB3A 2WOQA 4W9TA 1FWNA 3FYPA 1XXXA 3GZ3A 3U8GA 4AF0B 3F1QA 4ADSA 3NQ2A 3WJXA 3NZ1A 1FX6A 3C2OA 3TDFA 1VJIA 1R2TA 3W73A 3O8AA 2J9YA 1HG3A 2Y61A 3KRZA 4GUFA 4XTDA 2CW6A 4GJ1A 4EIVA 3MJYA 1RD5A 4WZHA 1TPC1 3MMTA 3NPXA 4E2BA 4TU1A 4KFPA 1QO5A 2E6YA 3S5YA 2Z1BA 2C14A 1QOPA 5AN7A 3KHJA 2LLEA 3MW7A 1N7KA 1TQJA 3W1NA 1P1XA 1KFJA 1JUBA 3G1YA 5K4XA 3FKKA 5K9XA 2DZWA 4KKXA 3PG9A 3QMTA 4LUIA 1VHCA 1GVQA 3GR8A 3LX9A 1TRDA 3QW4B 1W8SA 4I7VA 2X2GA 3HQ1A 1GT8A 3LCGA 1R47A 1YDOA 3HF3A 4XTIA 5I3HA 3OVQA 1I2RA 1OFBA 3ZWSA 1NFBA 3UXAA 4O53A 5HUOA 3TSBA 5HJLA 3GXPA 3SSJA 1IF2A 3L0NA 4JXCA 3G3MA 4A2SA 1MXSA 2E5DA 1JUEA 3W1AA 5AB3A 1MEWA 2NV2A 3A5FA 4HN4A 5A5WA 3INPA 1SO6A 4GRSA 2A85A 4MYXA 4RLIA 3DAQA 3IIVA 1JCYA 2WJZA 4UTWA 3S1WA 4IPJA 4NU7A 1WX0A 3G22A 3R5EA 3TU9A 2QCDB 2VFDA 4QNWA 4E38A 3TE9A 2J6XA 2JGYA 2ZYFA 4MJMA 5EPDA 1UB3A 1TJPA 4DQWA 3OVRA 2C18A 1FBAA 4YL2A 2GVGA 3QM3A 3PSVA 3TX9A 2HS8A 3NQMA 3FS2A 2TMDA 2ABAA 4LWWA 2QCLA 1SZNA 1YTDA 5FF7A 1G6CA 1QDSA 3G0XA 1F2JA 2VEKA 4JTTA 1WQ5A 2JGQA 1TPUA 4K7YA 1TB3A 4Y8FA 1TO3A 3L2IA 4NXSA 3M5ZA 3PAJA 1AW5A 4LT9A 4JTIA 4N9BA 4LVFA 4R53A 2R94A 3VE7A 1NF7A 5F2GA 2OT0A 2DJXA 2QCDA 4BI6A 1TQXA 2A4AA 5DN1A 3B06A 4H4IA 5HUPA 4TR9A 3ZFHA 3KFTA 1TPH1 1DHPA 1E51A 4P2VA 4UTKA 2FFCA 1YPFA 3JR2A 1GYLA 1EA0A 3O05A 1SW3A 4CNPA 1DVJA 2YZRA 4ZQCA 5FF0A 1LM1A 5I3GA 1TCDA 2QR6A 3W88A 1SSDA 3NNTA 4I7WA 2VENA 3CIWA 4ZQOA 1FCQA 5C2XA 3W9ZA 1WXJA 4HSOA 4UMAA 1I2PA 3GDLA 3NQAA 1W0MA 4I9AA 3HPXA 1FDYA 1ME9A 4EVZA 2JK2A 3W87A 4GXMA 3KRUA 3MYPA 3PWAA 1KFCA 1IXOA 1ZAIA 2H3DA 5AFDA 1IXNA 2FIQA 4Z1BA 5LHFA 1Q6LA 1H63A 4O12A 4XZ9A 4HNNA 2FPVA 4BI5A 4O1AA 1HO4A 3W72A 4K8HA 1FWTA 1OFDA 4JTLA 4MYAA 4BK9A 1O60A 1H7XA 2F84A 2A0NA 5FI8A 4JDYA 1T96A 1LORA 3MI3A 2H3BA 1OK4A 1RQEA 4JEQA 5HMSA 2J9XA 3WK1A 2WQPA 3GKAA 3NQ7A 4NJKA 4R7JA 3UY8A 3QSTA 3HMJG 4LVAA 3T55A 1XI3A 3HPZA 1TPEA 5KMYA 4AWUA 3NXFA 3QMSA 5K3VA 3GR7A 1SFJA 4EWND 3ABSA 3KVMA 1HO1A 3R89A 5DXXA 4KWWA 3IEBA 1KM6A 1KA9F 1ZNNA 3P60A 1TPB1 3D0CA 3B0VC 3OG3A 1F73A 2WO5A 1ZCOA 2NV1A 4GE8A 3WFAA 3B04A 5AOUA 1TIMA 4Z1DA 3TJLA 1L6SA 3P61A 1LLZA 2DZXA 1OFOA 2CZFA 2JKEA 3MI6A 4HT3A 3EWUA 1XUUA 3LCXA 5DELA 1DJNA 4FNUA 2CLHA 3BGJA 3SGUA 3W2UA 2V5BA 4XWUA 2G95A 1XKYA 1TTQA 3EXRA 3IVSA 5G1YA 1VRDA 3EWZA 5IBXC 3B8DA 4BI7A 3W2JA 1VLWA 5KINA 1JVNA 2ZA2A 3DH7A 3P67A 4DF1A 5HWMA 3W7MA 1D3GA 2FLIA 2ZRWA 3T7VA 1DOSA 3EX3A 2RHGA 3E12A 2QJHA 2NWRA 2V8ZA 1W54A 3UZJA 1B57A 3CPRA 4JGDA 3RNDA 1VGAA 3C2FA 4MJZA 4C1LA 3P8JA 1SW7A 4HNUA 2PE4A 4LS1A 5DCEA 1L2UA 1BEUA 1YPIA 2CLIA 1YTKA 2BSLA 3KX6A 2H8XA 3EKLA 4AH7A 3L9CA 3KVKA 3EEGA 5D02A 4O0KA 3ABOA 4LU0A 1WA3A 2F7FA 3E9AA 4O50A 5FEPA 4KFOA 2BLEA 3O15A 1I4NA 5LHEA 4RZ4A 3DU0A 1F6KA 3W1QA 4P61A 3W71A 2YCEA 2QUUA 5D04C 1LDCA 4AAJA 3P5ZA 2VFEA 3FJLA 3TC7A 2FB2A 1ZALA 1ICPA 5LNVA 2GPTA 3L5AA 1Z42A 2YPIA 2G96A 4TO8A 2W6RA 4O13A 5U4NA 1LLWA 3Q2DA 5J5DA 1SO3A 3L65A 4EOUA 3LCHA 3MYOA 4AVFA 2I9EA 3LLDA 4PA8A 3I65A 1DORA 3PBVA 3KXQA 4ORIA 4NVTA 5K9DA 5BNKA 1XDLA 3CWOX 3PBYA 3GK0A 3RU6A 1YXDA 2QDHA 3W1TA 3OIXA 4NX0A 3RFAA 3RK8A 4N9EA 4DO4A 3NL2A 3NO5A 2A21A 4ZQPA 2CLKA 4WOQA 3P80A 4Y96A 1JQVA 2VFIA 3N19B 1Q6RA 3NQEA 4RKAA 3AJXA 3QRHA 3GDKA 4AEOA 3LBCA 3LXCA 1ME8A 4RXGA 1H7PA 1V5XA 1GTEA 4O15A 3QMRA 4HSNA 1BTMA 3TIMA 3O6CA 2NXGA 1LOQA 4UUIA 4A3UA 1YTEA 4EF9A 4QJ1A 1S5TA 2BWGA 5LNRA 1FUYA 3DFPA 2WSQA 3E96A 3S0CA 3I7RA 3LERA 3NQ8A 4IWWA 2V30A 4JR5A 2ISVA 1GVSA 1ZHAA 2WNZA 3KOFA 2AQWA 1C9DA 1JJKA 3LHUA 3G1AA 3M0ZA 1WOBA 4UTIA 5KZEA 3M5VA 5KZDA 3W85A 3BARA 3BK0A 2QUTA 4NQ1A 3W76A 1M5WA 1LRNA 1K8YA 2E5CA 4IMDA 2A7PA 3W2NA 3W75A 3THQA 3LV6A 4NNBA 4AWTA 3BW3A 3VKJA 1GQNA 3FKRA 3DFNA 4G1KA 3I6RA 1DBTA 4O28A 4RZ6A 3C4UA 2EKCA 1T99A 4QSHA 2ALDA 4JNMA 5HNRA 5CGQA 3DFQA 3P82A 4NNAA 5CG7A 4JY8A 1RQBA 4BWLC 1W5MA 4FXRA 4LS0A 1N55A 1THFD 1YYAA 3SR7A 1K8ZA 2E1DA 3W86A 3W1PA 3QYQA 2ZZ3A 3GXNA 3IVTA 4MPQA 4O0ZA 1BWLA 3G1DA 4LVGA 3UQNA 3TMLA 2TPSA 1G4PA 4YWIA 4AHOA 1OHLA 2BXVA 1S5VA 1AL7A 1OYCA 3MP4A 5LNWA 3MWAA 1JCLA 5AYYA 3P8IA 1G4SA 3G0UA 3JRKA 2RDTA 1I2OA 4N2YA 2NX9A 5D2YA 1JCXA 3WK0A 2GQAA 1W37A 4FX7A 1RVGA 2DZUA 3HG5A 3TAOA 4HIBA 1H60A 3BVJA 1XBXA 3N3MA 4O19A 1DQWA 5T26A 1TTJA 3LLFA 2UV8G 4LC8A 3TR2A 5DXYA 4D2JA 1LBFA 2X1UA 3NR0A 5L9FA 4K36A 5F4XA 4LOCA 4JD4A 3B0UX 2A1YA 5G1TA 1X8FA 5D09A 3LV5A 1KM0A 4LNYA 3FA5A 4FX6M 3V75A 4WY0A 1KTNA 3OBKA 2DORA 1JCJA 2VXNA 4O8RA 1Y0EA 4JX5A 5E93A 3W7RA 1N8FA 4DF2A 4NZFA 1GVRA 1TTPA 1QAPA 2R14A 5AHMA 5MHBA 3A23A 2VELA 1TREA 1YADA 3ABQA 3HG2A 3W2LA 3S5NA 2W79A 3DBPA 3DFOA 4QISA 1J2WA 4MZ8A 1W5PA 3HB9A 3LCIA 3TH6A 1OFEA 3PF3A 5HQEA 3IGSA 3MHUA 5DBTA 1QPRA 2PRLA 5FF3A 1F6PA 3TQVA 2OMAA 1GPWA 1RQHA 4UTJA 3EXSA 1XDMA 3SIZA 1WDWA 5EA9A 3R2GA 3O6YX 1GVFA 4UXDA 1XC4A 4RZ5A 4Y9AA 4OE7A 3GB6A 4UCGA 2EHHA 3W1LA 4FIRA 3STEA 3HG3A 3GNNA 3CEUA 3SY5A 3ZS4A 4UTWC 4ONVA 2R8WA 2J24A 4NJJA 3TKFA 4O57A 3PVFA 3M7WA 3R13A 3P81A 5AYZA 2CLFA 5C6MA 5D37A 2A6LA 2D73A 1D3HA 3DI1A 3NVTA 1C8VA 1TRIA 1NSJA 3H53A 3NOEA 4BF9A 5F1VA 3UPBA 4N4PA 4AHQA 3DKJA 1SO5A 5G2IA 4OWGA 5KTLA 2V2CA 5DY2A 1FXQA 3QH2A 2Y63A 3S1UA 2ZZ6A 3A24A 2FQIA 4PCFA 4IQLA 4CCCA 1IXPA 1ALDA 2DZSA 2QAFA 5FEXA 1FWSA 3CWNA 3UWZA 3W7EA 3L5MA 3LCLA 1D9EA 2FTPA 2WSYA 4Z08A 1H51A 4IXXA 2A6NA 1TV8A 4E2DA 2FPTA
chains in the Genus database with same CATH superfamily
3WD2A 4Q3MA 5SWUA 5E0CA 1GOIA 3GHTA 3M47A 1BF6A 3IARA 3B4UA 5G1MA 4D6IA 3MZ2A 1SR9A 4UTMA 3WNNA 3KOXA 1O68A 3KBNA 4HPXA 5K9CA 3MA8A 4L1GA 4M82A 1XBYA 3AYSA 3KP0A 5FF4A 2Y89A 4OBRA 4RNJA 4JKMA 4YHGA 4WKAA 1U33A 2PDGA 4JIPA 1XP3A 4GBDA 1OF8A 1VBGA 1L0PA 3D3FA 4IIBA 3W74A 4HNVA 4LY8A 1T8XA 3TTSA 1RV8A 3HGSA 3SADA 1KLZA 3OP2A 3S1XA 4AD1A 5H6HA 4B5SA 2O9RA 1W9PA 3ANVA 3RHGA 2AGKA 3TYDA 3W6YA 4C7DA 1V0LA 2VWSA 1PS9A 4R9OA 2QIIA 3W53A 1S3HA 4N6FA 4M8UA 3EX1A 3CUIA 1ME7A 3I3EA 4TX9A 4A3QA 4MB3A 4HHPA 5M2FX 4HGXA 3TROA 3H7RA 4J3ZA 3UG3A 3TP4A 4BQ3A 2BV9A 4F0MA 5CXPA 4WUIA 4PUMA 3TYUA 2XG9A 1V7YA 3SN0A 1M6JA 3SCSA 3RN6A 1GOKA 2HSAA 1ADOA 4CCZA 4LTSA 4DYJA 4GOAA 5HR7A 1R2RA 1GZGA 1PCWA 3AS3A 3WNMA 3OVPA 3STFA 2BASA 1BGGA 4A8LA 2CLMA 1NM9A 4A8NA 3BQ6A 1FQ0A 2ZXAA 2WMGA 1MQQA 3U6WA 2XM2A 3IVUA 4Y90A 2AL1A 1OD8A 1QT1A 2H6RA 2QF7A 3L4YA 3TLQA 2PDCA 2EPNA 3ZJ6A 3GTHA 2Z1KA 1FHVA 3BL3A 3S5ZA 3RX3A 3TTEA 3CV2A 3LPPA 1TKKA 1P5BA 3P84A 1OWQA 3H55A 4S3FA 3VA8A 2HV5A 3KM8A 4GZJA 3RJXA 1WAUA 3K4WA 3GX9A 4O4WA 3LRMA 4DBDA 1YX1A 3UCCA 1MDRA 4R5EA 2GVJA 5ABGA 3CIXA 1XRTA 1UUMA 3UXLA 1V8EA 2QULA 3CL6A 5A6BD 2Z2AA 2J27A 4GXWA 5D38A 3IJQA 4J1OA 3W22A 3LZ5A 1XX1A 4PFMA 4NT0A 3M6DA 2QCGA 2Z26A 2YL5A 4QX4A 2ZIDA 2CYGA 4IICA 2TYSA 2VDGA 3PJTA 4JHMA 4XAGA 4LH8A 5CJNA 3PR2A 2WSKA 3GHUA 2TRSA 7PTDA 4P7LA 2VUNA 4NZ5A 4TMCA 3WD4A 1JDDA 1HJQA 2GQ8A 3VKDA 1WOAA 2P3EA 3NUKA 4JZ5A 3U7VA 1S2CA 4DXVA 1QNSA 3AYTA 1W31A 1FCVA 2E09A 3N14A 1AMYA 2YCLB 1CXLA 4UR9A 2CWNA 2DZVA 1OYAA 2ZXBA 3WQ6A 4Q4PA 3R0DA 1Q6QA 2WKJA 2DV0A 5DF0A 4JFTA 5HXMA 3CTTA 4FX8A 3UNDA 3A47A 3PK7A 2Y7FA 3H7UA 3URQA 1KCZA 2PDHA 5CC6A 4XVDA 1BYAA 5FJOA 2EPHA 1XCFA 2ZVRA 3VE9A 4QAIA 1JL8A 1OX4A 3FW6A 2NZLA 2GVEA 3WK3A 1DJYA 4XBJA 4UOJA 4HOZA 2NQ9A 1W1YA 3SZ8A 1JNEA 1PYFA 3WJSA 3W83A 2XFWA 4JTQA 2EXOA 3ABXA 3N3TA 2Z24A 4PZVA 1QHOA 4GIYA 4E5TA 3IJ8A 1OSEA 3PULA 1OGSA 2XVNA 5A8MA 2DW7A 5D2WA 3T08A 3W7KA 2V5JA 1NWUA 1Q6DA 5IOBA 4NL1A 1NWSA 1AVAA 1MO0A 3UZYA 3M0IA 4K3ZA 1GQJA 1H0GA 2DIKA 1HZYA 3OHIA 1QBAA 3B9OA 1EO7A 1G69A 3PZNA 1UPPA 4J3TA 2OJPA 2EAWA 4MJ4A 1QI5A 1I45A 3L68A 4HMNA 3WBEA 2Y62A 3KAOA 2WCGA 4TTUA 3OA3A 5EU9A 4JTAA 1IZJA 4QDWA 3UWWA 2W27A 4MFEA 3MMDA 1J5TA 1HJUA 2VEPA 4JKKA 3FA3A 3NEHA 3TNBA 3UZ5A 1RY8A 1E9ZB 1XLEA 2ESCA 4UTTA 4CNOA 4ZTYA 4DO5A 3HPAA 3W84A 1KQZA 3MO4A 3NZQA 4NZJA 3DHFA 4I9MA 4WSKA 3L0KA 4IMCA 4IQDA 2Q8LA 4DI8A 3WLMA 1XIEA 3B0XA 1OX5A 3MCNA 3DCPA 1M7XA 2DT3A 4URIA 1P7TA 3MUCA 1E6RA 4W8AA 1TWWA 1BF2A 1UPMB 1DEDA 5HMEA 4FO4A 5I07A 1I1WA 5CZKA 3W7DA 4JTSA 1B3ZA 1MUWA 2QV5A 3MSYA 4S3AA 4B5XA 3WYZA 1NEYA 4AIUA 4KBXA 2ZC8A 3OEXA 3LPFA 4HNLA 1OVDA 3BMVA 4ECLA 3ATYA 4X22A 3B05A 5CPMA 1I2NA 4RE4A 3T78A 2NQHA 1E9LA 4Z2HA 2E40A 2X0YA 5A6BA 4JNYA 3UWVA 2CBJA 2PDLA 4IP7A 2FKPA 3W2MA 3WF3A 2WJDA 4FAMA 1OZQA 2VZSA 1JULA 4AIBA 2E9MA 4HN8A 1CECA 3I4KA 2VC9A 3N2XA 4HNCA 3MP5A 3E5BA 1UOZA 1W3NA 4LSBA 3E1F1 1RVKA 4Q4QA 4I6KA 4UMBA 1A3HA 4A8IA 1L6WA 1JPIA 3C0SA 1NWTA 3HQNA 5JMUA 2VQTA 3G8EA 4JTHA 5HNTA 4PMVA 4UQEA 3TQKA 1H7OA 1J6OA 1KW1A 4MB4A 1IR1A 1KM1A 3TLLA 2NLIA 4LUTA 4HOXA 3FJ4A 1IXQA 1JPMA 3HOJA 2VVNA 3OLGA 3SRKA 2WMKA 1NOWA 4QQ3A 1W1B1 1XLLA 3P14A 5BMWA 3N1AA 1W1A1 2XU2A 1J2BA 4PMJA 2B4GA 2GGHA 3PTQA 2H90A 2HEJA 3T44A 1ZLPA 4X0NA 1XIDA 4E4PA 5J5RA 4H9UA 2GDVA 1XG4A 4F66A 4BFAA 1MUCA 2GSEA 1FWWA 3QFEA 4Q6XA 5C2CA 4PMDA 2IKIA 1XBVA 2ADAA 3AICA 4V15A 3MBFA 3SUWA 4PMQA 1M7PA 1TE1A 1XW8A 1JAKA 4LV9A 4AVOA 5FSDC 1J01A 4PB5A 1QVBA 4W5ZA 1WE5A 4L7ZA 5IHSA 4AD0A 1Z7AA 1EGMA 1X1OA 3A9IA 1I75A 1L6FA 3LCWA 5E09A 3K8KA 5HDRA 1GVYA 3MWCA 3KS6A 2GFTA 2JKPA 1E6PA 3ITOA 3L67A 3EWXA 4YXGA 2VGGA 1QWGA 4FA3A 5LNSA 3AMDA 2OX4A 4FNTA 1EEXA 3P2VA 1XIGA 8TIMA 2NXHA 1ONEA 1OT2A 1R7OA 3KWXA 4QS5A 4Z1CA 4C6CA 2NVCA 1F6YA 3R0UA 2PU1A 3T42A 1OQFA 5J04A 3VAVA 4UCFA 4KS0A 1ONXA 3U0HA 1B3VA 1WYIA 1EQCA 3S1VA 3GU9A 1UP2A 2ABBA 3SJ3A 3PBWA 4DJFD 4IT1A 1KV8A 1NP2A 2NXIA 4JIIX 1OEPA 1HL9A 1XJBA 1XIFA 3NSNA 5AC5A 1PUDA 2C8NA 2IMRA 4MKNA 3FIGA 4X2RA 3G6MA 2WBKA 3QN3A 3AIBA 3NM1A 2X0SA 4IMFA 1QR7A 1BSLA 4FP1A 5FJIA 4HOWA 3W1UA 3RX2A 2FDSA 1HL8A 4RPQA 3TMQA 2YIHA 4GNJA 3S5OA 1FWDC 3A64A 3ZT5A 4ZFCA 4DIAA 3DC8A 4JS3A 1W3IA 4XG1A 4IJBA 3GFXA 2ZFAA 1DJIA 2GSHA 3IUIA 3LY0A 3N25A 3WDHA 2ZRVA 5C5YA 2V2DA 1S38A 4E8GA 1AW1A 4QLJA 4BQ4A 3DYMA 2VGIA 4QJ4B 4KFNA 5GJPA 3ZM8A 3SIMA 2I14A 4J40A 1WB0A 3O6DA 3BW4A 1OX6A 3FGCA 1KXQA 1RA5A 1W9VA 3N17A 3PZOA 1GKRA 2QJMA 4H8VA 4IIEA 5EL1A 2XN2A 1CXEA 2WC7A 3KBJA 2UY2A 3B8SA 2E6DA 5AZ0A 3UR2A 1UWTA 1TWZA 4GBUA 1SZFA 2GWNA 2OO0A 1QOXA 1W9UA 4NJIA 1VEMA 2CBVA 3K1DA 1LT8A 4N4QA 1EX5A 3BLFA 2OVLA 3ZWTA 4BEUA 5HR6A 4ZQNA 3FN9A 2EJ1A 3EKZA 2CIPA 3R11A 1PCKA 5EFDA 5EGRA 3MP3A 3BLIA 3FOKA 5H8MA 5HNUA 4OTKA 3CL8A 1VKFA 1JYVA 4WIWA 3IGHX 4B5TA 3NEVA 2ZDRA 1VFFA 4MUPA 4FS9A 1N8WA 4QM1A 1TV5A 4LRTA 1ZPTA 3P7YA 1ZFJA 4LGXA 4BF7A 2E7FA 2ZTKA 4DLFA 3R7MA 2IS7A 5ABTA 3SFWA 4RCXA 3BE7A 2DSUA 4Q8VA 1OX4B 3QKZA 1G67A 3FHAA 4C5YA 2XH0A 3UJEA 3BO9A 4XK2A 1GTHA 2Y24A 3ZR4A 3GDMA 5LKYA 2FZ9A 4HZ8A 3F2CA 2OOGA 5XINA 4WEVX 2C79A 5LGZA 1JD7A 3G2GA 2VCCA 3HPSA 2Q3OA 1PB0A 4KGJA 1CPUA 4NZCA 2PGRA 1CBGA 1CGVA 3B8IA 1QHZA 2A3AA 2F2KA 3NSXA 4YTUA 1LJYA 2XISA 3FFSA 3FJ6A 3D6NA 4EPEC 4A2RA 3F4CA 5KITA 2VX4A 3UY7A 3NL5A 1VFMA 1UKSA 4DYKA 1ZJAA 1R3TA 4XD4A 1O4UA 3TN5A 3ATZA 3SBFA 1QCWA 1A3WA 2JF7A 3C0LA 5DMNA 2WNQA 1YXYA 3IV3A 9XIAA 1JDEA 3KOWA 1E1FA 1XISA 2E6AA 2X7VA 4IMAA 3WSUA 3T2QA 1R3YA 3GW0A 3STGA 4HVXA 2X8RA 4AISA 1F05A 3N13A 1XYLA 3L2MA 2DZBA 4DJFA 4M5PA 4H7CA 1J0HA 2WKLA 2PDJA 3B3DA 4D6HA 1EPXA 3F5JA 4BCEA 5CJ5A 1J5SA 3LYEA 2IQTA 4Q4OA 4K6AA 2VRQA 1QMLA 2WMHA 3N6JA 1XIHA 3EWYA 2E68A 1PDYA 1X6NA 3LTYA 2FVLA 1AK5A 4JYFA 1TWSA 4PODA 2DP3A 4ZOBA 1AMKA 3QPYA 3OU8A 2OEJA 4WHBA 5GQBA 2Z7KA 3PUDA 2O92A 3GC4A 2QUVA 2OEMA 3MHGA 3C61A 4ZCWA 5D03A 1Z48A 3PPCA 3M7SA 1NU5A 1NVMA 2HVMA 1UHVA 2D23A 1OBAA 4WDTA 1XFBA 1MVYA 2XIMA 1NTHA 3LGEA 3KOZA 5C9UA 4G7EA 3EA1A 3SCTA 4HKPA 4GA8A 4HB7A 3CNYA 2O7SA 1LYXA 3BURA 3H12A 3KOYA 3MY9A 2GJRA 4Q6JA 4PR4A 1UROA 1VS1A 5LZLA 3AI0A 1TYGA 4JL2A 1OCQA 3TSDA 4CVWA 3A4XA 3OZOA 1H1NA 4FXFA 5FL0A 1XLCA 2A3HA 1RH9A 3W7LA 2DUZA 3CLMA 4MPKA 1HXJA 4D6FA 4BQ5A 4LS2A 1L9WA 3AO0A 4TVUA 1QNPA 2WLZA 4O1EA 3WZ0E 1FCBA 7ENLA 4IPPA 2HK1A 4A4AA 3EX4A 3QHMA 4XV0A 2PTDA 1HKJA 2IXVA 1HKIA 7A3HA 1W3JA 1VFHA 5AC4A 3BOLA 2EPMX 4V1YA 3TC3A 2PCEA 1VR6A 5FSEC 3W27A 2Q09A 3PSWA 1WP6A 4BWLA 1IGSA 4NYYA 4HU8A 4CD4A 3W29A 4MUZA 5LSMA 1C29A 5MF5A 5HMDA 1FWNA 4S38A 4AWEA 3GZ3A 1RLDA 3MKKA 1XCXA 1VENA 1CIUA 3F1QA 3CV1A 4HA3A 4ADSA 2BBFA 4U3CA 4MTVA 3O8AA 2OSXA 1AZ2A 2F6KA 4GJ1A 4EIVA 4ZO9A 1HKKA 3CO4A 3KHDA 3OOQA 3VC6A 2BP1A 4QS6A 1QO5A 2E6YA 2C14A 2E4TA 3SCWA 4D71A 4B5VA 2QLYA 4PTVA 4ZGYA 4QE1A 5K4XA 3QQWA 1E55A 5K9XA 2DZWA 1AJ0A 3PG9A 4LUIA 4LXFA 5ABFA 3H2NA 3MVIA 1FWEC 3GR8A 3PPGA 3QW4B 1W8SA 3QR3A 3QV8A 2X2GA 3H2MA 1TA3B 1P6BA 1GT8A 2BOGX 4XTIA 1I2RA 1OFBA 3NCOA 3GNXA 1NFBA 1OD0A 3UXAA 5HUOA 2V63A 4JXCA 1REQB 3G3MA 5BU9A 4ZB0A 1JUEA 1MEWA 3A5FA 3HFTA 3LGGA 1US0A 1SO6A 3M0HA 1TX2A 4E8CA 1KBKA 1UWSA 1K70A 4GINA 3LM3A 4RLIA 3DAQA 3EMQA 4BQ2A 3AJ7A 2WJZA 4IG2A 2PS2A 3S1WA 1FP8A 3WF2A 2DVTA 4MADA 1TUFA 3WH5A 1XC6A 1KBLA 4HK7A 5IFTA 3G22A 4I90A 2BVWA 1TE6A 4KEVA 4E38A 4MWAC 3SQLA 1J79A 2J6XA 3QYSA 2NVAA 4DQWA 4QXIA 1GQIA 4YL2A 1NDWA 4L9ZA 1WZKA 3QM3A 3PSVA 3TX9A 2FZNA 2TMDA 3CGTA 4JIHA 2QCLA 1J0IA 3O0FA 1UZHA 2HQAA 1F2JA 4JTTA 2I17A 1TPUA 1TB3A 2DUAA 1EX1A 3I3DA 5FKYA 2VHLA 4E6MA 1E9YB 2A3EA 5CJMA 2O56A 2R94A 1NF7A 3GY1A 5F2GA 4H01A 3EOOA 1MFUA 1TQXA 1WKDA 3EMZA 1K6AA 3VNZA 1QW8A 3MUIA 4OBSA 3OZYA 1HIZA 2X40A 2WZHA 3H26A 2OELA 3MV01 6XIMA 4HZ6A 3T0DA 3JUGA 1EA0A 2VM8A 4R7OA 3T8QA 4UOQA 3LSCA 4QGCA 4ZQCA 5A2BA 1JDFA 2JEPA 4QE5A 4LBUA 2RJHA 2VENA 3CIWA 1V6VA 3W9ZA 4HSOA 4UMAA 3GDLA 1UKTA 2VURA 3VO0A 2QNEA 4GZEA 1ME9A 3NWRA 3GXIA 1EXPA 2Z4GA 1EHNA 4UQAA 4PEEA 3H4GA 3MYPA 1IXOA 1ISWA 3PZMA 2H3DA 4Z1BA 1Q6LA 1S1PA 1AD1A 1H63A 4HNNA 4LAOA 5FJUA 3W72A 4QEHA 5CG0A 3DECA 1PTGA 4B4FA 1FWTA 1OFDA 4MWAE 4F0SA 4JOMA 4MYAA 1EDTA 2F84A 3VKAA 1E5JA 5FI8A 2OZTA 1ITUA 4JDYA 1P6WA 4MKVA 2H3BA 1RQEA 3EDEA 4Q8QA 4GISA 3ZR5A 4EPDC 1J0ZA 1QI4A 1PWLA 4NJKA 3AZTA 3T0BA 4CN6A 1QRQA 4OJYA 4GVGA 4XD3A 3HMJG 1XI3A 3HPZA 1TPEA 1BAGA 1MUMA 2J79A 5KMYA 3FDGA 3NXFA 3QMSA 4FLOA 3TTQA 4DJDC 2GGJA 1XD1A 4DB7A 3H21A 2WC4A 3R89A 5DXXA 4KWWA 1EDQA 1ZNNA 3P60A 1C9WA 3D0CA 4L4PA 4HMCA 5A2CA 1FA2A 4HMEA 1TIMA 3T8LA 4Z1DA 3VNLA 4UQ9A 1ZUAX 4KRUA 3WNOA 1LLZA 1OFOA 4HT3A 3T81A 3H24A 3MSDA 5TD4A 4FNUA 2VUYA 2G95A 5IBXC 1Q7QA 1XYZA 3ALFA 3AU2A 1JNDA 5HWMA 1AJZA 3RR4A 4AY8A 3UVIA 4DXKA 3SRDA 1W1VA 4JGDA 3RNDA 2ZE3A 3PWIA 1EO5A 5I6SA 3B9NA 1BEUA 5JVLA 1WPCA 1YTKA 2H8XA 3EKLA 4AC7C 3EEGA 5D02A 1OC7A 1WA3A 2F7FA 4O50A 4RDVA 1WZAA 1UMLA 3N29A 5CGTA 1FWGC 1UR8A 2ON3A 1C8YA 4BKNA 4P61A 2OQHA 2FJUB 4W84A 2YCEA 4H83A 3M4HA 2WMIB 2VFEA 3CQJA 3ITVA 1ZALA 2PDPA 1WZMA 2PDBA 3IV8A 4QJ5B 1PSCA 1BVZA 3R8HA 3WLRA 1J96A 3Q2DA 4NILA 5J5DA 3LCHA 4AVFA 4LAKA 1IEVA 2Y5JA 4W7UA 3ARUA 1DORA 3BGAA 3KXQA 5BNKA 3AZSA 3GK0A 3RU6A 1YXDA 3E0VA 2QDHA 3UW6A 2FZBA 1AD4A 2WAGA 3VDBA 1WUEA 4N9EA 4JTCA 1VF8A 1W91A 2AAAA 4PMXA 1B9ZA 4QR6A 5ENLA 4WOQA 5CBJA 4QE4A 3PN8A 4ZB2A 4H2CA 3LBCA 4ERAA 5EMLA 3LXCA 4K8GA 5I79A 1ME8A 4TV6A 2CCRA 1GTEA 4L6DA 4ML4A 3TIMA 1TMQA 3EB4A 4A3UA 1YTEA 1S5TA 2VP8A 2PWDA 1FUYA 2A79A 3DFPA 2WSQA 3E96A 4KH2A 4GZIA 3D46A 1ITQA 4JR5A 3VUSA 3R4IA 4YYFA 2HNEA 3RPDA 3LHUA 3CZLA 4HHMA 4QG6A 5KZEA 3W85A 3BARA 3BK0A 2BXYA 5A6TC 6REQB 1LRNA 1EC8A 4LX4A 1FH8A 1O1HA 3WELA 2BY0A 5BU6A 4AWTA 3VKJA 4NY2A 3FKRA 3WQDA 3LZ3A 3B97A 4G1KA 4PMNA 4O28A 2ALDA 2FFIA 5HNRA 4GG9A 4NNAA 3L4WA 1EOMA 4JY8A 3ME3A 1RQBA 3VIJA 3DX5A 4LS0A 1THFD 1YYAA 3CH0A 4LYKA 3SR7A 4Q8MA 3W86A 1V6TA 4QSFA 3W1PA 5TF0A 3I3BA 1J8VA 1BWLA 1WDRA 3G1DA 1UD2A 3WDPP 4EXBA 3KL5A 4MKSA 1A0EA 3KCLA 3WEZA 4K1WA 1G4SA 1XLDA 1QW7A 3EPOA 1I2OA 2E28A 4N2YA 1K77A 1WKEA 1W37A 1S1RA 1TR9A 3HG5A 1XBXA 1DQWA 1TTJA 2YKKA 2UV8G 3TR2A 1DIDA 3TYAA 1LBFA 3VD4A 3NR0A 4LOCA 5LA2A 3NXLA 4EAMA 3AUJA 2A1YA 1V6YA 5G1TA 5D09A 3N2CA 1C8QA 4W85A 1KTNA 2ZDSA 4ATWA 2E3ZA 3OBKA 4O8RA 4JX5A 5E93A 1N8FA 1QNRA 1LL6A 1AH4A 2R14A 3BLOA 1RXOB 1UZ4A 2ZUMA 5MHBA 1T41A 1AA1B 1TREA 3HG2A 4LUSA 4G9PA 5JUVA 3S5NA 4D1JA 1V6WA 4LF2A 1W5PA 3GM8A 3AROA 2GVYA 3LCIA 1OCBA 1RALA 2PBOA 4AVNA 1V0KA 1K8CA 3ARQA 2OMAA 3TQVA 1CLKA 3WQCA 1HF6A 1S5MA 2PDYA 3S2MA 4CGTA 1LG2A 3SIZA 1R3VA 3ICJA 3E0LA 1XC4A 4X2PA 4UCGA 4XSMA 1HN1A 3OYZA 3L4UA 3STEA 4TUFA 3CEUA 3ZS4A 4ONVA 2R8WA 3UJ2A 1JZ8A 3KBWA 4CNUA 2PLJA 4W93A 3W01A 3R13A 4C6BA 3P81A 4WJ8A 2A6LA 1TRIA 1NSJA 1JDCA 1AH3A 3NOEA 3M0MA 1EQPA 3DKJA 1CTNA 4B15A 3QH2A 3RRXA 3WD3A 1E1EA 3BCJA 1UZ1A 4LAMA 2ZZ6A 3A24A 4H9ZA 3TJIA 3BSMA 4PCFA 4IQLA 4CCCA 3GG0A 1FWSA 2EG6A 3UWZA 4IP4A 2WSYA 1E0VA 1A47A 4IXXA 1TV8A 2QT3A 3ZT6A 1XCWA 3ARXA 1VEPA 3DYPA 2Q71A 3ZO9A 2XVPA 4Y9NA 4C6IA 2GVLA 3DFSA 5C54A 2EPKX 4UZSA 2AKZA 1K6WA 2ZZ5A 4N9CA 3CZGA 4A8RA 2QCMA 2GQ9A 1FWIC 1OGBA 1RJRA 4V27A 3GVVA 3O0KA 1SFTA 4A3RA 1JPHA 2BY1A 5A6LA 4FPSA 2UWFA 2FH8A 1BGAA 3QC3A 1VYPX 2VFHA 1JR1A 2FZMA 4ATLA 1K9DA 4JKLA 3WQEA 1HX0A 4B2DD 4HYRA 1B5TA 2POTA 3QSRA 5A94A 3B40A 1UH3A 1E4LA 3IUHA 4ACZB 3GUWA 3S3GA 5IFPA 4LF1A 3VX1A 3UWQA 4LVBA 5H1WA 1PVNA 4CQ9A 2QJIA 2JQXA 1YE4A 4YS1A 1GG0A 3M07A 3KBSA 3MHFA 3T0AA 3ZYZA 3RJYA 3WH9A 2PTXA 1R85A 3FDKA 1ODUA 2HXTA 4IGHA 3NPUA 5PTDA 3CB3A 1KBIA 4CNSA 3A21A 2OOFA 1U2YA 1V08A 1RAKA 1O5KA 4ADUA 4PUNA 2GQ3A 4C6PA 3C3NA 3GLCA 5IM51 3SCNA 5C0QA 2YDRA 1CW2A 5A8GA 2YR1A 3F5KA 4O1CA 4R33A 1WXYA 3UF9A 2ZOXA 2BGQA 1O66A 1UKOA 1YE6A 3BG5A 4GO9A 2Q8ZA 3O2LA 2Y8VA 3O63A 4H8UA 3SUVA 3KE0A 4X0VA 5KZ6A 1B0IA 1DWIM 3QLLA 2IPFA 5KZMA 1KV5A 2WNNA 2A3CA 4PH6A 4EWJA 1XBZA 2GUBA 4C1NB 1M53A 4RDWA 3W7JA 5BZAA 1E6QM 3W28A 3BSHA 5JQ9A 2JFEX 2R1NA 3LMZA 1WBJA 2WKGA 1W5OA 2AGTA 5BOEA 4O4VA 2VR4A 1V02E 2C19A 3PUGA 4AIOA 5F4WA 1OG0A 3LUTA 1R3QA 5HJYA 1GHRA 4O52A 4GI4A 1GJPA 3RIKA 1NFPA 3VZZA 5DO8A 4GVHA 2PC8A 3NIYA 1P0DA 4JYEA 4LJ3A 3GFZA 3RPTA 3EYPA 2FMOA 4UWMA 5LA1A 3H70A 1MYRA 1NFGA 4ZL1A 3M64A 2ALRA 4K1GA 3ITLA 4FLRA 3STCA 1R8LA 5DANA 3TYEA 4B3KA 4X61A 4REQA 2VVSA 2Y4SA 5A8PA 2V5KA 2Y85A 4IQJA 1XM3A 4HA4A 2YDSA 2FHCA 2E67A 3N9RA 4LRSA 1LP6A 1P43A 1XLFA 4G8TA 2G41A 3GUGA 1XPYA 3OLIA 4OOZA 3RM8A 4DUVA 4AFYA 2BODX 4HU0A 4IXHA 2CC0A 4QDPA 1YQ2A 4JCLA 4NUWA 2QAPA 2RKXA 1AQ0A 3SDOA 4U10A 3HGRA 1KFBA 3RCMA 1JQXA 3M46A 4GMEA 3B0YA 4M24A 1HGWA 4Q33A 3AC0A 2O4MA 1XH1A 2VC6A 4NP7A 3SJNA 1SZGA 4H3DA 4DZAA 3VCNA 4DBSA 2ZZ4A 1X8CA 2XH4A 4PB4A 4LYPA 3N6HA 6ENLA 5I3FA 4MY8A 5TBOA 1FWAC 8RUCA 1VQTA 1M7OA 3P74A 2BHYA 3AU6A 5CPOA 2WPBA 3QPZA 5FEWA 1N82A 3KRSA 1P6CA 3DOPA 4GX9A 1GVOA 3LI1A 4B2DA 5GVJA 2PRHA 4MLRA 2BZNA 1K9FA 1BD0A 1VBRA 2GGEA 2G3FA 2A3BA 4UTHA 3N04A 4DX3A 2D24A 1JRBA 3R58A 1MWOA 3BV7A 1V6XA 5I23A 3REQA 3RITA 1TJRA 1O7AA 1C7TA 2GJNA 2POZA 4ILSA 2KZHA 1UQZA 4QTGA 2C13A 2J7EA 3EX2A 3NQGA 2OODA 4E4FA 3UXIA 4IQEA 5DY3A 3O16A 4XVEA 4GK8A 5AKQA 2BX7A 5EMKA 1ISVA 3N9SA 1ZSXA 2NX3A 3AAMA 1MMFA 1O5QA 4PCTA 1FOBA 1GQLA 2ACRA 1O6IA 4DELA 3R0KA 5AC7A 2WZEA 4DO7A 4IOTA 4LYQA 4JNZA 3OLEA 1SU5A 1CNVA 5FEZA 2XWEA 3UWEA 3R43A 1WDPA 2AQOA 1XHGA 4DPPA 2F6XA 5E0KA 3QVQA 2TODA 1FKXA 4Q4KA 3C2VA 3AIUA 3WUEA 3T1GA 1QFEA 3RLVA 3WLQA 4GUIA 3DHDA 1EH9A 4B5NA 2G37A 3EXTA 4FR1A 1IIGA 1J93A 3LM7A 4FXJA 3SN4A 3SGGA 3ZR6A 1KWKA 1LBLA 1VLIA 3W25A 6TAAA 2RFGA 2I1OA 2ISWA 1SO4A 2WM1A 2G3NA 4GNVA 2DT2A 3KBVA 4CEUC 2H8ZA 2ZQ0A 1B4EA 3WMLA 2YCKX 4R9XA 3PJUA 5C9ZA 4PUKA 5M3WA 1DJXA 3NQCA 3QY8A 4UTUA 2J7DA 4ZO7A 5DRIA 2JIEA 4QRNA 5A6SA 3VX0A 1NP0A 4QNEA 3L66A 1XGDA 1DYSA 4HP5A 3V5FA 4KPLA 2BVYA 1E9IA 1TJ0A 3CTLA 1OCJA 1BXCA 3VIKA 7ODCA 1JYXA 4KEZA 1CXIA 1ZBCA 4UC5A 2I5GA 2VOMA 3LNPA 1BKHA 3CASA 5FACA 2WBGA 4K39A 1R86A 2XIIA 1QNQA 4NI8A 1EB3A 1B9BA 3RX4A 1ZZMA 3WJWA 4N6EA 3WMCA 2B0MA 3DEQA 2P0OA 2J75A 3GNOA 4XUGA 3F4WA 5H8UA 4F9DA 3O06A 3GXTA 1PZ3A 1GONA 4KRZA 2QCFA 4FNRA 2E5BA 3W23A 1UG6A 2J66A 3WNKA 5HJXA 1A5AA 4AMAA 1DQUA 3B9DA 3AIWA 3CMGA 2WMFA 3N73A 1JXKA 1FVPA 1G4TA 5AHLA 1BLIA 2F61A 3MO7A 4J2PA 1A50A 3CZ8A 1LRQA 2WVVA 2PODA 1QPNA 4AWSA 3OZPA 1SFLA 3GQYA 4NI3A 2AMXA 1S2WA 3PM6A 3Q94A 4QCEA 2B7OA 4QROA 4AF0A 2X41A 3L5LA 4XKYB 4D6DA 3OBEA 3MC5A 4NZ1A 4HPGA 1V3IA 4GKLA 3TCSA 2Z25A 3KL3A 5FCZA 3GSMA 3VKBA 3GH7A 1EJUC 1KCXA 3IANA 2Z1WA 2QMJA 3GFYA 4D1IA 4EF8A 2ZRZA 4HHHA 1Q6OA 1LWJA 4PTMA 1PV8A 1KR0A 1Y5WA 5MKGA 4Z17A 4RXFA 3S9IA 4K38A 3LI0A 4DJEC 3MBDA 4ADTA 2OTDA 3OYXA 3ZLGA 3M1ZA 3UPMA 2Y7GA 5AECA 4KWVA 1X96A 3GZAA 1EFZA 1D8WA 2HS6A 1FWBC 1KXTA 3E38A 1L8PA 3TUUA 4UR7A 5JIPA 1KTBA 1UWUA 3GO2A 1FWHC 1E1CA 4M7SA 1B30A 2YGYA 3QOKA 4D6GA 2ZUSA 1P0BA 2FPYA 3FY1A 2AAMA 4NNCA 4CU8A 2PCQA 1NJJA 3V0TA 3NL6A 3UGRA 4EAYA 1YHTA 3TQ0A 4NKCA 4O8AA 3TXVA 3U3HA 4TTGA 1YNQA 3C6CA 4LCSA 3MUZ1 1IHIA 1FH9A 5A6JA 8XIAA 3WEMA 1WKFA 4BHYA 3VILA 3G0SA 4DBEA 4JBRA 3JU2A 3S5SA 3LCFA 1V51A 2QF8A 3BAWA 1EEPA 3VYLA 3CUZA 3VI2A 1GJWA 2X05A 1TTIA 4HBKA 3RDKA 1GOXA 3ZVIA 1S39A 5B7ZA 1K7EA 4AIEA 1XYFA 3H23A 1SSGA 2X09A 3GBEA 4GWEA 1VFUA 2D2OA 3W1MA 2B7NA 2YFNA 1NF0A 3UPWA 3EDKA 1Q2SA 1SPQA 4YLWA 3S83A 2QCHA 2H9AB 5I0DA 3HBLA 4YMZA 4OUIA 5AC6A 1LBMA 1PX4A 3IJ9A 3K2GA 1E70M 1VCGA 1VJSA 3SSZA 2XIOA 4BR1A 1AJ2A 4RK8A 2BDQA 2BVTA 1LRTA 1T0OA 2Y2WA 1KGUA 2HISA 1EWEA 2ATMA 4UIOA 4AZBA 3BCFA 2W63A 1OIMA 4GHRA 1EHAA 2CKSA 4TX8A 3CYVA 1YLVA 3CL7A 3TA6A 5EMJA 3WMSA 3MS8A 3H2FA 1PKYA 4WDUA 4GYJA 4PB3A 3WF0A 1TX0A 3C8FA 3WLLA 4ERIA 1YMYA 2R9RA 1WNOA 4O54A 2IPGA 2REQB 1G5AA 1XIIA 3AMLA 4IISA 2ZA1A 3CAVA 2EJAA 4ATDA 3A4JA 4L80A 1A53A 1X1ZA 2P53A 4I5UA 2C6QA 3NDYA 4GY1A 4H9YA 3KEHA 3SCUA 2ATSA 8XIMA 1JGMA 1P4CA 3M6YA 9XIMA 1O5XA 3EDDA 2BFGA 1XL9A 3TYBA 3E0IA 4R34A 3ITXA 4WSHA 5DRCA 3T2OA 3IACA 3O1NA 1Y5VA 3CV6A 4X60A 4MIMA 3MCMA 4GVFA 2HVOA 4WGXA 4KEUA 4ZB5A 5DBUA 3DI0A 3WFZA 3A3XA 1NDVA 4OBTA 3QZEA 4UMCA 4LANA 4FHAA 1GZJA 2QKFA 5BWAA 3T2PA 1QUMA 1DL3A 3N2OA 3TCEA 4G1NA 4JIQA 4MVAA 2JF6A 1Z44A 3W7GA 1DXEA 1U5VA 1XSKA 1A4MA 3LRKA 2X16A 3REQB 2GJXA 5EY5A 5IHRA 2O7QA 2OU4A 5BMXA 3ZVHB 3FSTA 4Q7BA 2R82A 1Q7ZA 1O12A 4LBSA 1V3KA 1XYCA 3ELFA 4CCEA 1ZRQA 3WBXA 4WJXA 3I7QA 4GYKA 4IPLA 3QLDA 4JDBA 3VCRA 2DUXA 2RDWA 2OYLA 2ZUVA 4GQGA 2FHBA 2WK2A 4RNIA 1PHWA 1R46A 2PDWA 4IFRA 4S2BA 4N9DA 5D30A 3LBMA 1ZAJA 3T0TA 1RJPA 1DIOA 3CQ0A 3GVRA 3UD6A 1ELSA 2OFJA 4UTTC 2V67A 3MMUA 3MQTA 1M65A 5D05A 1AQHA 4PMRA 4NJGA 4YCOA 1PKNA 1I0BA 2OQYA 1ICQA 3KBMA 2CLEA 3NYZA 3MB9A 1KB3A 3E49A 4GY7A 2UBPC 2V82A 4Z1AA 2W0UA 5A69A 4TIMA 3IK4A 5TQLA 4WGHA 2ZX7A 1XLKA 2DZPA 2JE8A 1H4PA 1AQMA 2OYMA 4EK7A 2XYLA 3E6EA 3GAYA 3LTPA 1R3SA 2BGNE 4YVPA 1NQKA 4MF4A 3RRAA 1YDVA 3AXIA 3C0JA 3F4NA 4Q8NA 4ASTA 2C1HA 4X3ZA 1F74A 3BCDA 3VIMA 4I6VA 4YWSA 1WDDA 2J7FA 4JQ4A 6CGTA 5A8NA 2KX9A 2QCNA 3QGAC 2V2HA 1F76A 4MWAD 2ZUTA 1K7XA 3P0WA 4HNTA 1WCGA 3PB2A 2R6OA 4C6NA 2JEQA 3IIXA 2IQDA 4JTFA 2ANUA 1V4YA 1YKWA 1Q2RA 3VOJA 1QASA 3H2AA 4UR8A 3UCQA 4DO6A 5TNVA 3VFCA 4C1KA 1XYAA 3WQGA 2B7PA 3OODA 5AC8A 2DT1A 1XGZA 1QJWA 2PRMA 2PWUA 2CFFA 1GPFA 2O4QA 4Y6GA 3G77A 5F1UA 3DFTA 3WLJA 1B54A 2ZA3A 1FXPA 5G2WA 4FLSA 4W86A 1IT0A 3BG9A 1ZQ5A 5HANA 3ZSSA 4IMGA 1C93A 1W2VA 4JTRA 3GW3A 4HPJA 4I7UA 2WVVB 3C2EA 3CHVA 1PYMA 1EUNA 3OW1A 4NXKA 2GK1A 3TNOA 3RLHA 1NIUA 3S2CA 3FYYA 4JN7A 1ZY9A 2Z6IA 4M56A 3RM9A 2FVMA 2FB3A 3EAUA 4W9TA 1XXXA 2XIJA 3PFMA 4OKDA 4XAYA 1TZ7A 4AF0B 1DWAM 1VJIA 4ROPA 3W73A 2J9YA 1HG3A 4QJ3B 1BFNA 4GUFA 3MJYA 4WZHA 1UR3M 3BWWA 3ES7A 1WDQA 3B8WA 4XIMA 3NPXA 3QV7A 4KFPA 1FWCC 4A05A 4DWSD 2GWGA 3KHJA 2LLEA 3MW7A 2P8BA 3CBWA 3APTA 3G1YA 1US2A 1CB2A 3FKKA 4Y9OA 1RLCL 2EEXA 3WIJA 2IKHA 2VI0A 1TRDA 5IDIA 1XYBA 4XUYA 4ZODA 4Y8EA 3AWOA 1IT7A 2Z00A 3LCGA 4BA0A 3NOYA 5I3HA 4TOQA 3OVQA 4JFUA 4ZR8A 4O53A 1XLGA 3TSBA 1E1CB 1IR2A 4AZIA 2FTYA 4DUXA 3C5QA 1Y65A 3L0NA 2Z27A 3U5YA 2VR5A 1MXSA 4L5ZA 3W1AA 2NV2A 5A5WA 4AX7A 1A5NC 4M29A 4MYXA 4TVCA 3ZXWA 1CWYA 2WQDA 1CLVA 3DG7A 1MZRA 4IPJA 4NU7A 5CPSA 4BJHA 4RNFA 3S6TA 3TU9A 1XIMA 2QCDB 4GJJA 1Z6KA 2C1GA 3CHFA 3TE9A 4PBGA 2JGYA 2ZYFA 4MJMA 5EPDA 2EKGA 2WCSA 2C18A 4OVXA 2GVGA 1EDGA 4S3BA 3E0FA 5FJJA 2Q6ZA 3NQMA 2ABAA 4MSSA 2BY2A 2RGMA 1SZNA 1VIZA 3W38A 1YRRA 1YTDA 3L23A 1Q65A 1G6CA 1QDSA 4U2ZA 3TN4A 2VEKA 3WLOA 2PD5A 2JGQA 3HQOA 4E2VA 4NSBA 4NXSA 1S2TA 2GDQA 4DAIA 1AW5A 4MWAA 1CZ1A 4U3AA 5KETA 3R94A 3OJGA 1E71M 2DJXA 1TV2A 2A4AA 3M0YA 2WHKA 3IRSA 3B06A 1NARA 5E0FA 3TW9A 3GS6A 4JQ2A 4L9XA 1E51A 4YHEA 2E9BA 1B2YA 4UTKA 3JR2A 1V0NA 1RPKA 1SW3A 4CNPA 1H09A 5FF0A 5JBEA 5I3GA 1J0JA 3WQOA 2J77A 1ZP4A 3RAOA 1UA3A 2AL2B 2J47A 1FCQA 2XTKA 3LMYA 3NQAA 4I9AA 1TJ1A 3HPXA 4EVZA 2UY5A 1LQ2A 1IT8A 3NO1A 3W87A 4GXMA 3ZJKA 4ERGA 3EMCA 3SB0A 1CGTA 2XHYA 1T8QA 2ACUA 1OT1A 1W6TA 4O12A 4XZ9A 4O1AA 1HO4A 4G5DA 4P5UA 1M9HA 3SM0A 1AZ1A 3GH4A 1TELA 2X42A 7REQB 2XSAA 5EMMA 3AIRA 4NAEA 1LORA 1Q85A 1V3LA 4J3SA 1Y5XA 3NQ7A 1DIKA 5HATA 3RO6A 4IFKA 4AZ5A 2GJPA 2D20A 2P50A 3C2YA 3F7JA 1GNXA 4LVAA 3OQ8A 2XINA 4AWUA 3UZXA 1EKOA 4FOJA 4DWSA 1UR2A 1KGXA 1XLIA 3ABSA 3GYCA 3IEBA 1KA9F 1UD6A 3WBAA 3VD3A 1GOOA 4C6KA 1E73M 3OG3A 3A3WA 1ZCOA 4GE8A 3SCVA 5AOUA 3DHPA 3O3RA 3TJLA 2CZFA 2WM0A 1XINA 3EWUA 4XB3A 5DELA 4FI4A 1EJWC 2CLHA 3SGUA 3W2UA 2V5BA 4PRRA 3BZJA 3EXRA 1CXKA 1X98A 2XZ7A 5BXPA 1VLWA 2PI6A 3ANUA 4DF1A 4AEEA 4DZHA 3GVQA 1BG9A 3W7MA 2FLIA 4KCVA 3T7VA 1KXVA 1DOSA 3A9BA 2RHGA 4LEQA 1JEZA 4Y9MA 1B57A 3CPRA 1VGAA 4MJZA 1JF6A 4DJFC 1PWMA 5LXEA 1NELA 1SW7A 3WF1A 1J11A 5XIMA 1G01A 2CLIA 3DERA 2E9LA 1A5MC 3KVKA 4PSPA 3AIEA 4ZEPA 1Q66A 1FFQA 3AMKA 1F3EA 3HV8A 2BLEA 3CLWA 3O15A 5LHEA 4RZ4A 1EBGA 4PCSA 1LDCA 3P5ZA 4EP8C 2BNJA 4D8ZA 2FB2A 1BSIA 4WVXA 5LNVA 3THDA 4PUJA 4TO8A 3VDCA 1JI2A 3V18A 2I9EA 4PA8A 1H41A 1U1HA 4ORIA 4IL0A 4NVTA 1XDLA 5I00A 4TV5A 3AYVA 2PUZA 1RK5A 2QGYA 3RK8A 3R1ZA 2RGLA 3SO7A 2PPGA 3KZPA 3P80A 1JQVA 2IUZA 4RKAA 3GDKA 2Z28A 2NSOA 4ZSTA 3THCA 1TR1A 1B90A 4OZOA 1UD8A 1BPLB 5CBBA 1DJZA 2WC3A 2OPJA 2BWGA 1TZZA 3S0CA 3I7RA 1F8IA 3ORWA 4Z2GA 2PB1A 3JW7A 3VIIA 4B92A 2V30A 2WNZA 5HPCA 1C9DA 4RDZA 3G1AA 2BOEX 3M5VA 5KZDA 4Z2IA 1M5WA 4PTWA 1K8YA 2E5CA 2ZX6A 4W7VA 1UC5A 3LV6A 3QV9A 1F4AA 1GQNA 4P8VA 3DFNA 4I9TA 1DP0A 2IW0A 2PWHA 1DBTA 4RZ6A 3C4UA 1A3XA 1DWJM 4FLQA 1R5YA 3JZUA 2FHFA 5CGQA 1YBQA 1BWVA 3DFQA 3P82A 2DSVA 2Y8KA 1UR9A 4ZBCA 4BWLC 1N55A 4DYEA 1K8ZA 3QYQA 2ZZ3A 3PTKA 3GXNA 1WAWA 4MPQA 4O0ZA 4MB5A 5DMLA 3TMLA 3BSGA 4YWIA 4AHOA 1OHLA 1BVNP 1QTWA 5CBIA 4JHZA 5LNWA 3G0UA 3WLNA 1EJ7L 3JRKA 2RDTA 1GORA 2NX9A 3VDAA 5E9AA 1C92A 2HK0A 4FX7A 1RVGA 4MAZA 1FWFC 1H60A 1LL7A 2CXGA 3BVJA 3N3MA 1UH2A 1H3GA 4IZGA 5DXYA 1B31A 3UESA 3BAYA 1BRLB 1CB7B 4JD4A 2WPGA 3BJSA 3B0UX 3URNA 1XRVA 4LNYA 1R9XA 4FX6M 4WY0A 5G4HC 1F4HA 4J35A 3AALA 1LWHA 2DORA 1JCJA 4KF1A 5D9MA 3W7RA 1KRBC 2DQWA 4RW5A 1QAPA 5HA7A 1UW9A 2ISFA 3VIGA 3A23A 1A5UA 3PZ9A 2MANA 3GH5A 5DEZA 9RUBA 3IJ6A 4J5NA 1CYGA 3PF3A 5HQEA 3NGFA 3IGSA 1VB9A 2ACQA 4GZ7A 4LNCA 1XGEA 2PRLA 5FF3A 4TVDA 2IPJA 3A4WA 1X1NA 4QHRA 1MW3A 3EXSA 1RHCA 3EB3A 5EA9A 1SMDA 4Y7EA 2FTWA 4H41A 4RZ5A 2FGBA 2XFFA 4OE7A 2EHHA 1JCTA 1T5AA 4C6LA 7XIMA 3SY5A 2J24A 3AMCA 3QY6A 4NJJA 1Q63A 3PVFA 3E2QA 1GOMA 2V69A 2WMJA 5AYZA 2CLFA 3DI1A 3H53A 5JU6A 5F1VA 2J7BA 3WQWA 4N4PA 5G2IA 3IUDA 2VWTA 5DY2A 4OIFA 1FXQA 2WHJA 3UG4A 3R79A 1PIFA 1C3FA 4GABA 1SJAA 2FQIA 1IXPA 2DZSA 2QAFA 3CWNA 4DRSA 4DUOA 4DZIA 4HU4A 3LCLA 3FX4A 4DBWA 1F3WA 3VNJA 2FPTA 4V2XA 3WLPA 1XD0A 1QNOA 3ARWA 3EX6A 3ONCA 1LF1A 4WCJA 4HYVA 3SY8A 2I7GA 3WH6A 2NLYA 2Y5EA 3N18A 3T09A 3WN6A 2WHLA 1K7FA 3LHWA 5CSRA 4NYUA 4GYPA 3KW3A 3GDRA 5AHFA 2YZ5A 4PBFA 2PGFA 5M1TA 1W1PA 5F2MA 2P0IA 2WJEA 3WQ4A 1ISZA 1SQ7A 1Z9AA 2PWVA 3ES8A 5CZ0A 4C6EA 3N11A 1UJQA 1KM2A 2G97A 3BTNA 1QPOA 4WQ6A 4GYFA 3ARRA 4UFHA 4EACA 4RZBA 5CZSA 2OSWA 5EMUA 3GTFA 2C1IA 4LAZA 3WY1A 1R0MA 1V02A 1IWBA 2GJLA 1BYCA 1QK0A 1FHDA 2J74A 1S5WA 1TPDA 4OV9A 2ZRXA 4J27A 4WLCA 4KETA 3G1XA 2FGLA 1UWQA 3V35A 2ZZ2A 3T9PA 4ZMGA 4L9YA 4YTSA 2ZTJA 2X1IA 4UTFA 1Q3NA 3OGSA 5E6ZA 3UETA 4GFIA 1OFRA 3AUOA 1ZJHA 4KRTA 3AIVA 2YXGA 1KR1A 4ZVJA 3TVAA 5JIWA 3PTMA 3CIVA 3RM4A 4JN8A 2NX1A 4OV4A 3K5XA 3RR1A 3VINA 4PC8A 3UWYA 1PIIA 3RU8X 1XS2A 3K46A 4JTGA 4IH3A 4KIRA 4DWSB 1B3WA 1W3LA 2X7WA 4U4MA 3VNMA 3TW6A 3G18A 4LVDA 3TK7A 1NQ6A 1MRQA 3DC0A 3W6MA 5JH1A 3BAJA 3KTXA 4PMOA 1V0MA 4OFCA 3W2KA 4JICA 5CCZA 2PURA 2X1TA 1OFQA 3EB2A 3WDIA 3T40A 4HNOA 1F9CA 3PZVA 5AZ1A 3ABZA 3W1XA 1LROA 1K4GA 1MZHA 2PF0A 1EZ2A 3VCCA 2Y0FA 3VKCA 2CZEA 3C86A 4XBSA 3IS4A 1UUQA 2Z2UA 1CENA 2OWWA 4PTXA 4KT2A 1EF2A 2VDIA 1NOUA 3PHAA 2XJ7A 3VVGA 2JKAA 3CK5A 1TPFA 5GPRA 1HKWA 1L6GA 3LHVA 3SCOA 3ZJ8A 2ZC1A 5AHEA 4F0KA 1QK2A 3COTA 2YA1A 3M43A 3AOFA 3BLKA 3M5XA 4DLMA 3RG6A 4JCMA 4KW2A 4B9ZA 1FDZA 2O9OA 2ZXDA 4K7VA 3ZLFA 3W7HA 5BRPA 4Z1YA 4S3KA 3DGRA 3GIQA 4JX4A 4L1XA 1KBJA 2ICSA 1BYDA 4W8BA 3K1GA 1CI1A 4MZYA 4OUEA 3MKCA 3L4VA 3HIJA 2VNCA 3CT7A 3Q58A 4H2HA 2GLKA 4YU1A 4IMEA 4Y9PA 4W89A 3WLSA 4RE3A 4OHQA 1DXFA 1EIBA 4FZIA 3ZSTA 1C91A 1FH7A 2DGAA 3WNPA 1WV2A 2YW4A 1F8MA 3GNRA 4FF5A 1K3UA 1U83A 3NQBA 3JZEA 2INEA 4DF0A 5T9BG 3B03A 2ZZ7A 1R38A 3NQDA 3GDTA 4CU6A 3AS2A 3RGTA 5AHIA 3TONA 4JEJA 3LHZA 2YCLA 3VPLA 5A8OA 3LLXA 3BICA 3IRDA 3NDOA 4YVXA 3WKZA 4DM1A 5AYBA 1T40A 2MUCA 5J8LA 3EZ4A 3A13A 3K30A 2Z0IA 4HPHA 1MDLA 3NG3A 5D4YA 3WH7A 3C2RA 5CKSA 3VIOA 1XLHA 4E3TA 5TAOA 1RUSA 4JQ3A 4NRRA 1P7TB 4U31A 5BOFA 2IXUA 3FXYA 4S1FA 4P7QA 1Q13A 2CWXA 5FESA 1W5QA 2V5LA 5E1QA 2RDUA 4FNQA 1H2JA 3V7PA 4XZIA 2ODOA 2OYKA 4FR6A 1Q6FA 1UIOA 3VGDA 2PGWA 1I8JA 2RH9A 3PANA 1MEHA 4GQRA 1OADA 4LYRA 2G3IA 5KSWA 2ZRUA 3BGGA 4M7TA 5E9XA 2OZ3A 2NSXA 2CLPA 3DDMA 3LHTA 1V7AA 4DJED 4AYGA 1E0TA 1XKJA 2B81A 3E02A 4MDPA 3NSMA 4JL1A 4M6VA 4YTQA 5A1AA 4UBPC 4Q4MA 3GVGA 2NT0A 1PTDA 4O14A 4WX2A 2VGBA 4XISA 2YL6A 4C6FA 4HD5A 3FAXA 3T4WA 3PUOA 4ORMA 4XZNX 1TV7A 1UR1A 4WY0B 1J18A 2PAJA 1W3HA 4IPIA 3RYSA 1R3RA 2OKTA 4DNMA 4GCAA 5M5DA 2GGGA 5LYRA 3RILA 5C2GA 3GTXA 1QXLA 2PLMA 1ZL1A 4S3EA 1OIFA 3VZYA 4QIUA 4S3GA 1JZ4A 3QY7A 3LB0A 2VGFA 1TV4A 3UZWA 1CCWB 4GCXA 4UFJA 3ZOAA 5I24A 3I6TA 1JD9A 4X63A 4FF7A 1KM3A 3G1SA 1PL9A 4LUTB 2YOCA 3K8MA 1V3HA 5EMYA 4W87A 1EIXA 3GBDA 2CHNA 2CLOA 2RUSA 5G4WA 4K37A 3U57A 2PMQA 1HJXA 3NA8A 1RR2A 2VFGA 4XD6A 5ECUA 1JIBA 1QI2A 2D0HA 3ARVA 4GY0A 3GE7A 1I1XA 5C8BB 5FA5A 3VMPA 1CT5A 2C15A 1RCOB 5TIMA 1GJUA 4L56A 4CD5A 4GIAA 1T6MA 4KCUA 3W7OA 3HZ3A 3LU2A 5D2TA 1IZCA 2PZNA 3ITYA 2ZXQA 4ZE4A 4PUUA 1VBHA 4CN4A 4DPQA 4UNLA 3VOIA 2I57A 1BG4A 3DZ1A 4FSAA 1W3TA 1IEXA 4WRHA 2PTZA 1E3ZA 1ML1A 4S23A 4V28A 3UA4A 2XZ9A 1H7RA 3QW3A 4BF5A 3H6OA 5I3KA 5I3JA 3VUPA 1W1TA 3E74A 2QDEA 1J10A 2PFHA 2ASHA 1D8CA 2CLLA 3OVGA 4RR4A 3SFKA 3UJRA 1K4HA 4ZZ9A 1A5LC 4PL1A 4YTTA 2PDMA 1FP9A 3W70A 3EPNA 2J7GA 1Q7MA 1EP1A 2V3DA 1GG1A 1RD6A 1FTXA 2BHUA 3S2JA 2W3ZA 2I56A 4YVVA 4RNHA 2Y7EA 4B5WA 1E72M 1YDNA 3LTSA 5LIUX 2YBVA 3H4XA 3WDQA 4M3PA 3HG4A 4M6QA 2ZBTA 4JY9A 4INFA 1VYRA 1WUFA 4M0XA 2G3MA 5HULA 1RPXA 6XIAA 2NUWA 4DEFA 1RSCA 3BDKA 1P0NA 4D9PA 1HVXA 2EF9A 4O16A 5CPLA 1S5NA 1P0KA 3BLDA 3O07A 4ZE5A 1H1YA 1FKWA 2VO5A 3KUMA 5CLTA 1VHNA 1NAL1 3V5OA 2YYTA 1DKWA 1TJ2A 1M41A 5E70A 1GOWA 3IJIA 1HQTA 1TWDA 4DJEA 2YDAA 3NM3A 1KM5A 1XRSA 3RMJA 4G7FA 3FGCB 4C6OA 3GAKA 3DIPA 4UQDA 5EBUA 2PD9A 2P76A 3A5VA 3WK2A 3BJTA 1KLYA 3UG8A 3SRFA 1H49A 3W7PA 4JIRA 1HUVA 1TWIA 3NZRA 5DQPA 4UFLA 2CZVA 4GGHA 1DJQA 4RJEA 2DVXA 4W7WA 3TAKA 4H6EA 3L0GA 3MUY1 1KTCA 3TOYA 4IHCA 3PP7A 4D6CA 1X6LA 4QFUA 5AHNA 1W56A 1UWRA 3AQUA 3HMCA 1UWAA 1BTCA 3TN6A 3VKKA 1IYXA 4JX6A 1CX9A 1K02A 3H2EA 3TZNA 2VC5A 1EGVA 2D22A 2G5WA 2W92A 4CUCA 2DZTA 2A7RA 3NDZA 4KWSA 3VM7A 3WUBA 1HJWA 4HK6A 3NGJA 3M0LA 3WMBA 3VOHA 1L2QA 3GR4A 1MSSA 3NVDA 1KGWA 2WZMA 1DE5A 2J7HA 2ZWZA 1EF3A 1V6UA 4QITA 3ITTA 3RPMA 1FDJA 1H7NA 3UP8A 2XPKA 5BWFA 4AX6A 3U5UA 2VCBA 5DCBA 5C55A 5F2LA 3OPSA 1ITXA 1XFCA 1K03A 5CZTA 4FNPA 2YLAA 3FAWA 4UFIA 4XIAA 4EPKA 1L8NA 3RLUA 3SEPA 1MW0A 2UY4A 4CQAA 1PZ1A 2W67A 5C71A 1PAMA 3M0JA 4W88A 4A29A 2TSYA 2FJKA 4QCFA 4F0LA 2X1SA 2NQJA 1B4KA 1GZ1A 3MI2A 1OABA 1YXCA 2VC7A 4QP0A 2JIWA 5A8QA 3URBA 4RV8A 1IV8A 4BZYA 2VDHA 1G4EA 1V93A 5HQLA 1POJA 4DZ5A 3W7CA 2FZDA 7TIMA 1VC4A 4O1BA 1WDSA 4XSLA 3TXZA 3VNDA 3UXDA 2G50A 5I2UA 1UUOA 2OQLA 2XWDA 4P7OA 3HPFA 2HWGA 2NWSA 3ARSA 2ISSA 4FNSA 2J4GA 4QBXA 2YDQA 2QCEA 1X38A 1I2QA 2P88A 3SGZA 2Z1VA 2OX1A 1TMLA 3SCQA 2QPUA 2W4XA 1ZJIA 5CSSA 1K8XA 3S2LA 5IRPA 1BHGA 4YJ5A 3C52A 2A5HA 1A0DA 1W9XA 5CZJA 1V77A 3NAVA 4UNIA 2PLKA 1SUXA 4L61A 3WQFA 4CD7A 5FOOA 1XH2A 3F4VA 4GO8A 3NPWA 3VNYA 2D3NA 4F0HA 2J7CA 4PCPA 5BCAA 4K2SA 3KP1A 3IIZA 4G7EB 4WD0A 1KFKA 3PBUA 4DUWA 4PL2A 2PSNA 1LTDA 4GD0A 3PB0A 3WJZA 3RCNA 1GEQA 4F9JA 4PFHA 3M5YA 1K1DA 1VRXA 3N34A 1P48A 1MW2A 3E2SA 4MY1A 1X97A 6TIMA 4FEZA 1BVWA 1FHLA