4XQ6A

Crystal structure of dihydroorotate dehydrogense from mycobacterium tuberculosis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
317
Chain Sequence
VAPVRRLLRRLLGPTDPVLASTVFGVRFPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPLFRLADDRALLNRMGFNNHGARALAIRLARHRPEIPIGVNIGKTKKTPAGDAVNDYRASARMVGPLASYLVVNVSSPNTPGLRDLQAVESLRPILSAVRAETSTPVLVKIAPDLSDSDLDDIADLAVELDLAGIVATNTTVSRDGLTTPGVDRLGPGGISGPPLAQRAVQVLRRLYDRVGDRLALISVGGIETADDAWERITAGASLLQGYTGFIYGGERWAKDIHEGIARRLHDGGFGSLHEAVGSARR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Dihydroorotate Dehydrogenase form Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase (quinone)
total genus 105
structure length 317
sequence length 323
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4xq6A00
3O1NA 1DL3A 4LS0A 2EGZA 1TQJA 2ZTKA 1F73A 1QO2A 4MFDA 3C56A 5DN1A 2E1DA 5FEZA 4UFHA 1TCDA 1TRIA 4IX2A 3SIZA 1WBHA 3PB2A 1EEPA 3QC3A 1YPIA 1LLZA 3O07A 4E2BA 2V8ZA 1EP2A 5G4WA 2XN0A 1IGSA 2Y6ZA 3S1WA 1HL2A 3W9ZA 1DQWA 1P1XA 3W2NA 4YL2A 3W1MA 5K3VA 1I2QA 4DO4A 1J2WA 1ZFJA 4TIMA 3MI2A 2H3BA 2ZA1A 1EWEA 2EKCA 1KM1A 3MP3A 1QAPA 4I7VA 3BLFA 4RCXA 2WOQA 3W2MA 3F4WA 4BI5A 3HMJG 3IIXA 3CIWA 4S2CA 4NJGA 3LX9A 3EX3A 2CLHA 1SPQA 3PVFA 2W79A 3G0UA 3KVKA 2XFWA 2HMCA 1R47A 5HJLA 3SZ8A 1GPWA 3LHWA 3MHUA 4RKAA 5D09A 2J6XA 3KRUA 3PBVA 2YGYA 3EX1A 1TQXA 3JS3A 2YW4A 3CC1A 3P62A 2CLFA 1F7BA 4GBUA 4PL2A 3IIOA 3B06A 3KX6A 3FOKA 2AGKA 2QJIA 1H7RA 3I7RA 1G67A 2E68A 3NQEA 1SO6A 3HIJA 1ZJIA 1R30A 3C2OA 4JY9A 3P8IA 2WNZA 3ZWSA 3GDTA 1AK5A 3ATZA 3EWZA 1W3IA 3W1UA 3N19B 1F05A 4FX6M 3W7JA 1SSGA 4GRSA 1CI1A 4MY8A 3QMRA 4MLRA 3V75A 5K9CA 3PB0A 1Z41A 3N9SA 4N6FA 2E6YA 2ZCGA 2QAFA 1VRDA 4DF2A 5AB3A 1IIHA 4O53A 3WK3A 2WO5A 2V2HA 1UCWA 4JDYA 4IXXA 3FFSA 3MWAA 5EY5A 4N9CA 4O1DA 5LGZA 3PUOA 1ME9A 4ALDA 2C18A 1KM6A 3E02A 1T8XA 3NZRA 3KHJA 1O60A 6TIMA 4O1CA 4IGHA 3I65A 5FESA 1V5XA 2OJPA 3L2IA 4WY0B 1UASA 5D2WA 4LVFA 3N2XA 1I2PA 1X1ZA 1W54A 3IV3A 1W8SA 1W3NA 3CU2A 2Y89A 1GG0A 5T26A 3TE9A 5I3JA 1GYNA 3M0ZA 3TW6A 2A21A 1W5NA 1GOXA 2TYSA 4PCFA 3B03A 2V81A 1VPXA 1YXDA 4GUIA 2B7PA 2NUYA 1X7FA 4Z0JA 4FNTA 1GEQA 2NWSA 1OFEA 3NAVA 2CU0A 1VH7A 1GZGA 1JQXA 4BWLA 4Z1AA 5KINA 3PF3A 4IMFA 2Z6JA 3TSBA 4L4MA 3MI3A 4K36A 2ATSA 3S0CA 1DV7A 4H3DA 4L4LA 3ZWTA 3W83A 3TAKA 5D2TA 5IM51 1LROA 1EP1A 3QSTA 1IXNA 4RXGA 4PODA 1YTDA 1C29A 3WK0A 3CEPA 3A5FA 1VYSX 2C14A 4FB7A 1F2JA 5AHNA 2E77A 3FKKA 3TC7A 1IXPA 3G1HA 4MY1A 4NZJA 1EPXA 3STFA 3L5MA 4MOZA 2ISSA 3MBDA 4XKYA 1T99A 4DO6A 3LTPA 1H7PA 3LBCA 4CCEA 3E96A 4JXCA 2GVJA 4LVGA 4O19A 2RDTA 3NOEA 3W2JA 4MZYA 1TB3A 3BW2A 3PBYA 5EMUA 3HG4A 2Y85A 3LTSA 3IGSA 1FY6A 4XZ9A 2CZDA 1KM0A 3O16A 2J9ZA 2P0OA 4YXGA 5U7SA 3TKFA 1THFD 1W5QA 2JGQA 1S5TA 3G1XA 3N3MA 3QH2A 2GQ8A 2Y88A 2ALDA 4CCCA 2G97A 1AW2A 4HKPA 4LUJA 3UWYA 1Q6LA 3H54A 3I7QA 4EIVA 3KOFA 2ISWA 4FNPA 1KFBA 4DPQA 2FB2A 5CPOA 3U2OA 1DJQA 1Y0EA 2NWRA 4AHPA 1IXOA 4JX4A 4Z08A 1PL9A 2UV8G 1OVDA 4RZ6A 3DI0A 5AHFA 4LS1A 3B4UA 3MHGA 1TO3A 1KTCA 1ME8A 2A7RA 3S5ZA 5D2XA 1R2RA 2JK2A 3PSWA 3PM6A 4ZQMA 4AWUA 3NQ8A 1I45A 2FPYA 5AFDA 4JYDA 4LRTA 1NFBA 1QMLA 3W7MA 3LXBA 3W7HA 1FBAA 2C13A 2P1FA 4Y96A 5AC7A 1KFKA 4ORIA 1L6SA 3T55A 3TXZA 1KTNA 2E5BA 3B05A 4ZQNA 3LERA 1VYRA 4NU7A 4CCDA 4D2JA 1OABA 5G1YA 2ZRZA 5AHMA 3BGGA 4WQ6A 5ABTA 1YTKA 3TW7A 4UTHA 5D04C 3O6CA 1LDCA 5HINA 3QPYA 5BMXA 3RNDA 3S1XA 1Q6OA 3ZS4A 3TMQA 3KRSA 5LSMA 2PE4A 3DXIA 5TIMA 3O05A 3W1XA 4FF7A 2FPVA 4MKNA 4AXKA 4OV4A 2CZ5A 5D03A 1OK6A 1SW0A 4AF0B 2YCEA 2G96A 4O11A 2OT0A 5CPLA 3DHFA 3VFLA 2Y63A 3O6YX 3D0CA 1SUXA 3OVQA 3Q2DA 2DJXA 2FLIA 3STGA 3NQ6A 4KFOA 2RHGA 4JTUA 2NX3A 2OX1A 2ZRUA 3W6YA 4CQ8A 3OIXA 3BO9A 2V5BA 1F6PA 4GJ1A 4HSNA 2A85A 3GNNA 5EL1A 1FX6A 2DZSA 1WAUA 3TAOA 4WXYA 1G6CA 2DZXA 5J5RA 3G3DA 2ZZ3A 4EOUA 1Z44A 2WJZA 1VLWA 3HJZA 4M6QA 1GVFA 2VEKA 4E38A 4XKYB 1H63A 1XBVA 3KVLA 1TREA 2ZZ2A 3BARA 2PURA 2TSYA 5LNRA 2V5LA 4O50A 3W7NA 3TMLA 2WNNA 3SFKA 3TJLA 3NNTA 2BWGA 4S2BA 1HFBA 1WOAA 3BW3A 1SFJA 2CLKA 4RXFA 2WSYA 1DORA 4MLJA 4ZQOA 1OFAA 3NG3A 3W85A 4JTTA 4ICNA 2Z0IA 2A5HA 4NT0A 3L0NA 3GIYA 1UJPA 3HG2A 3BVJA 2OMAA 3LCFA 2CW6A 3L0GA 4TMBA 4LV4A 2G5WA 4BWLC 1GVOA 2Q3OA 4QAIA 4FX7A 1S5VA 5C6MA 3CTLA 4PH6A 3QZEA 4N4PA 3G1DA 2VFHA 2NV1A 4K37A 4ADUA 3W23A 1K8XA 1JCJA 2X1RA 5FF4A 3NXFA 3GX9A 2ZYFA 6ALDA 4LTSA 2W0UA 3A21A 4GFSA 4LC8A 5F2LA 3C2FA 5CZ0A 2NUXA 3NPVA 3WK2A 1AG1O 4UR7A 3HOJA 4DO5A 1RVGA 1P0KA 2CLIA 4ORMA 3GXTA 5LHFA 1GWJA 1NF0A 5MHBA 3MYPA 4XQ6A 1DHPA 2X1UA 1D3HA 1MEIA 2ZQ0A 3LOTA 1RV8A 5HQEA 1OK4A 3SSJA 4BFAA 1XI3A 4UFLA 3QSRA 1SR9A 4WXZA 4JTIA 1ZCOA 2GJLA 4JGDA 4O1BA 3S5OA 1EB3A 3HGOA 4JD4A 3W72A 1SO3A 1KFJA 1GQNA 1SO4A 4O8RA 4HSOA 3C2EA 4UFMA 4TX9A 4QISA 1LOQA 1TPEA 2NXIA 2VENA 5HR6A 1OHLA 1MZHA 3W7LA 3W1AA 5HR7A 1VYPX 4UNKA 1XBZA 3MW7A 4QIUA 2JGYA 3NA8A 4LS2A 2CLEA 4K6AA 4Z1DA 3M41A 5FEXA 1ICPA 1TV5A 5EKYA 1TRDA 3A22A 3W1LA 3W88A 4UTTA 3P7YA 5DY2A 5I3FA 4OV9A 2TRSA 3QJAA 5E93A 5D30A 4H4IA 4QM1A 3CHVA 1I4NA 4LT9A 3KFTA 3IVTA 4BR1A 1VLIA 3S9YA 2NV2A 1OX5A 2YW3A 3O8AA 3OG3A 3GR8A 2QUVA 3U8GA 1AL8A 1WV2A 2Y7GA 3TSMA 4NNBA 1EX5A 1SU5A 3F1QA 3VKJA 5F4WA 4EF9A 5CPNA 1SW7A 2DZTA 3B04A 1R2TA 4MPQA 1SO5A 3EX2A 3KRZA 4JTLA 5AN7A 1H62A 3P84A 4O0KA 2QCCA 4ML9A 1KM5A 2QCFA 2QDHA 1XUUA 4UMBA 5F1UA 1J5TA 1TV7A 2WV8A 1L9WA 3WFAA 3P61A 3NQCA 3MYOA 1FCVA 3PAJA 5F1VA 3BK0A 2E5DA 3DI1A 3CM4A 2HTMA 4GWEA 3SECA 5A5WA 1QR7A 3R12A 3PBUA 1OFOA 2VEMA 3LV5A 4JYFA 3M5ZA 3W84A 5KZDA 1T0OA 2H90A 3L9CA 1SZGA 3VCRA 3W22A 1OYAA 4AB4A 1OFBA 3NPWA 4CNOA 4IPIA 2ZZ6A 3FS2A 1Z48A 3GVGA 1G4TA 4HNUA 3IVSA 3PS7A 3NM3A 3STCA 3USBA 4A22A 3G0XA 3TK7A 2AQWA 4UTUA 1SW3A 2H8ZA 4AVFA 1QPNA 4FNSA 1HO4A 1OFDA 3GDLA 1DBTA 4K8HA 1A5BA 3C4UA 4Z1CA 3W7OA 2C19A 2A7PA 1BTMA 1H7WA 5HWNA 4RR4A 1KTBA 3E12A 1KA9F 1SZFA 4ZVJA 1L6YA 4Y8FA 4PA8A 4UTMA 5LZLA 1BEUA 2VEIA 3BGJA 4U28A 4IPJA 1JUEA 3FJLA 1QPRA 1ZY9A 2ATMA 3ABRA 4GNJA 3PSVA 1GVSA 3G8RA 3NQFA 1K03A 1GJPA 2WPBA 1MO0A 4UCGA 4FXSA 2VFEA 1VS1A 3LTYA 4NX5A 4CNPA 1LRTA 4DF0A 4X22A 4WD0A 4AMAA 4AEOA 1W5MA 1TPB1 2PCQA 4XBKA 5U4NA 5C2XA 4ZL1A 4JR5A 2QCEA 1G4EA 3C3NA 1P5BA 4DXVA 4JX5A 4WOQA 4AAJA 3U6WA 1H7NA 5AHIA 1MXSA 1OFQA 3S42A 5J5DA 2GQAA 1WXJA 5KZEA 5TQLA 4P2VA 1TYGA 1HO1A 5LGXA 1VCFA 1W31A 3RLVA 4EWND 3HG3A 4JN6A 2A0NA 1JR1A 3CQ0A 1DOSA 2Q3RA 2E5CA 1Q6QA 4LV9A 3WJYA 2A6LA 1OG0A 3EWXA 3BG3A 1H7OA 3B8DA 2D73A 3BLIA 1QPQA 2CLOA 1XC4A 5FF2A 1XCFA 4NNAA 1DQXA 2VKZG 3M47A 3G24A 4NXKA 2DZPA 3IIPA 4NNCA 4YWIA 4HHPA 3S1VA 5I3GA 1RQBA 4R53A 4HT3A 2CLLA 1O5KA 3F03K 1K02A 4A3UA 3KVMA 1G7VA 4IQLA 4MJZA 5CSSA 5G2WA 3KAOA 2EF9A 4OWGA 2EPHA 2GJNA 1VJIA 1Q45A 2GPTA 3TV8A 2YR1A 2TPSA 3PWAA 4K7YA 5CZSA 1TPH1 3Q58A 3W07A 1F6KA 3HGRA 1QPOA 3SGUA 1GG1A 4FNUA 1PVNA 3GYEA 1QO5A 3C8FA 3LI0A 1FXQA 4NQ1A 3B0VC 5AYZA 4UR8A 1A5CA 3UPWA 1KFCA 1ICSA 4ADTA 3TNOA 1DVJA 5CKSA 2DORA 2QCDB 3HPXA 4O16A 4CQ9A 3LV6A 4DBDA 4IMDA 1QDSA 2WSRA 1JRBA 1A50A 1B3OA 3LRMA 3DFQA 3T44A 3EB2A 3DENA 2JBMA 1K3UA 3IIVA 4X2RA 5DCEA 4O28A 4MYAA 1JCNA 1N8FA 4JTEA 4JICA 1TMHA 1XM3A 2B4GA 2X2GA 3R13A 3WJZA 5GVJA 2GQ9A 3EKLA 3SGZA 1K8ZA 1ZALA 2F84A 2DJLA 4I7WA 3I7SA 1WOBA 2E6AA 1VC4A 3EWWA 1BWKA 1O95A 4RLIA 1ME7A 2Y70A 4NJHA 1I2RA 1I2OA 4TMCA 2R94A 4JTGA 3P80A 4PC8A 3NL5A 1O5XA 3TQVA 4LY8A 4UTIA 3TSDA 4UUIA 5FF0A 2C0AA 5E0KA 2YXGA 4OBTA 3RF9A 1AL7A 5E1QA 5AYXA 4JX6A 4UTTC 3LCGA 4HPXA 4E2DA 2BZNA 5BW6A 5HNRA 3DFPA 3HBLA 3P5YA 2V0TA 3IIZA 3P81A 1F74A 4LRSA 1J4EA 3TA6A 5DELA 2C15A 4KFNA 3W7IA 3THQA 1YLVA 4Z1BA 3TIMA 4DPPA 4M7TA 3RU6A 3UXAA 1AW5A 3LXAA 2BLEA 1R2SA 4M7SA 4UFKA 3SY5A 5EBUA 2B7OA 3TC6A 1S5WA 3FLUA 5I3HA 1M6JA 3PUEA 3GB6A 4UIOA 3UWZA 3W7GA 5K9DA 3W2UA 1FDJA 1K7FA 3GKFA 2AAMA 3LDVA 4MY9A 3UWQA 3GDKA 4R7JA 2WQPA 1W5OA 4BI6A 2I14A 1JCXA 2YFNA 5HUOA 3NEVA 4UTWC 3LI1A 1KFLA 3MP4A 1GTEA 4WUIA 3L21A 1M7OA 4X3ZA 3P5ZA 5G2IA 2NZLA 3DFOA 3FEMA 1EA0A 4N9EA 4QSHA 2NX9A 1IIGA 1OYCA 3M44A 1KV8A 5D02A 5I3IA 3WJSA 4NZFA 4TU1A 1B4EA 2I1OA 1I8JA 2BSLA 3L65A 3NQDA 1OYBA 2V30A 4JTFA 3M7WA 1FXPA 1X6UA 4W9TA 1H5YA 3NR0A 2J27A 3A9IA 4AWTA 2Q8LA 2NLIA 4AWSA 3SI9A 1PCKA 2Y7EA 5D37A 3A24A 1YPFA 3EWUA 4KWWA 2XN2A 3SR7A 3O15A 2GOUA 1LBLA 3VI2A 5KTLA 4Z0SA 4OU1A 3DAQA 4A29A 3DFNA 2QCDA 4XTIA 1LORA 1SZEA 2VOMA 4FEZA 1QOQA 2Y61A 1WQ5A 3QRHA 4Q33A 2A4AA 4OGZA 2ZDRA 3T4CA 3CWNA 1R46A 2F7FA 2FIQA 2QAPA 3N73A 3ABQA 1Q3NA 2GVLA 3N9RA 2DP3A 2C6QA 4NVTA 1EIXA 4YCPA 1LOSA 2V9DA 5K9XA 1YXCA 3NM1A 4AHQA 1GTHA 3P67A 3MO7A 2YX0A 1XBXA 3HGJA 2QCGA 3F4NA 3CB8A 4O13A 4OHQA 1X8FA 5K4ZA 2WKJA 1FWWA 4K7VA 4M6PA 3LHVA 4IMEA 4Y6GA 5F2GA 1L6WA 1W1ZA 3QYQA 1QWGA 1BWLA 4IWWA 3H55A 3QMSA 3QEZA 3P74A 3P8JA 1HTIA 1RD5A 1A5SA 4IOTA 4TO8A 4G1KA 1D3GA 3EWBX 2ZZ4A 3HPSA 3L0KA 4IMCA 4WZHA 1JJKA 1LLWA 4Q4KA 3T40A 3ABOA 3PY2A 2R91A 3PBWA 1H60A 1JCMP 1JUBA 3GXNA 2J9XA 1UUMA 3O63A 4PFMA 3GXPA 3MUXA 2YFOA 4QJ1A 2Z2UA 5KSWA 4H6KA 5CZTA 2V82A 1VQTA 1KM2A 1P4CA 7TIMA 3LBMA 2X30A 2QDGA 3LRKA 1N55A 3RLUA 3R2GA 5BMWA 3JR2A 1A53A 1CX9A 1UB3A 5FEPA 4NXSA 3IGUA 1SZNA 1XDLA 2I9EA 3DFTA 2JKAA 3IRDA 4ADSA 4UTLA 3N2MA 4OE7A 1ML1A 3NQAA 4MZ8A 1D9EA 3IEBA 2A6NA 5AC6A 3CT7A 4UC5A 4QQ3A 5FEWA 4NJJA 5BRBA 1LBMA 5LHEA 3BG9A 1WYIA 3M5YA 1TJPA 2E6DA 3YPIA 5LNVA 1RQEA 2C1HA 1P0NA 2YYUA 2O7QA 3C6CA 2J88A 4JIPA 5G2HA 5H2ZA 5HULA 1KV5A 2PRLA 3CPRA 4HNVA 1YADA 4P61A 1QNVA 2J24A 3G22A 1JULA 5D05A 3STEA 3UNDA 4I9AA 5SWUA 1ZHAA 5AHEA 3NPUA 1LM1A 4I7UA 1C8VA 5DCBA 3M5VA 4WY0A 2XN1A 4JTSA 1LRQA 1RQHA 4JTKA 2ZA2A 1RPXA 4M5PA 3W7RA 3NQ7A 2Y7DA 3AJXA 2BX7A 2V2CA 5AC8A 1BKSA 1E51A 3UWUA 3IVUA 3G18A 2GVGA 3I68A 4TR9A 5AHLA 3LM7A 3E0IA 2YSWA 4XWUA 1GT8A 2X1SA 4POCA 1M5WA 2EAWA 3W7EA 3Q94A 1ICQA 2VFIA 1NSJA 2ZFAA 3UZ5A 3QPZA 4IUOA 2QF7A 4Y9AA 1QOPA 1W37A 5LNUA 3O06A 4RK8A 1PIIA 4FO4A 1JCYA 1KM4A 1OX6A 4DF1A 4O12A 3EXSA 4HNNA 4UTWA 4XUGA 2C3ZA 3LCHA 3W1TA 1OFPA 1TSIA 3NL6A 4M19A 2X16A 4N9DA 3G1VA 3ANYA 4NUWA 4B5NA 2ZZ5A 4DELA 4ZQCA 1TIMA 3B0PA 1JUKA 3HO8A 3QQ1A 1W0MA 1PHWA 2CZEA 1KW1A 1TTJA 2ZRVA 1F76A 2DZWA 1FWRA 3LHTA 1HUVA 2FFCA 4YLWA 3JRKA 5A8GA 3TQ0A 5CZJA 1LRNA 4C1KA 1TPDA 3T7VA 4MYXA 4FNQA 1U5JA 1FDZA 3FYOA 3R5EA 3EEGA 3L66A 2ZA3A 5DBUA 2EHHA 1PHQA 3W2LA 1RZMA 2IQTA 4GC4A 2PRHA 4DQWA 3CEUA 1XXXA 3G1YA 3ELFA 4FNRA 1TPFA 1XDMA 1IF2A 4QITA 1K7XA 3LLFA 3IGXA 3W1PA 1EP3A 1H61A 1H50A 4MFEA 3I6RA 3OA3A 3TUUA 3MP5A 1XFBA 2YDAA 4QNWA 3QQ0A 1S3HA 1YYAA 2YPIA 3OHIA 1G69A 1VHCA 3W7QA 4NJKA 3P82A 1FCQA 1UUOA 2LLEA 3TFXA 2DZVA 2VC6A 3W7PA 4YMZA 4OQVA 4GUFA 2QUTA 3LCIA 3W3OA 2FJKA 3NQVA 1G7UA 2FDSA 5AOUA 1VZWA 4LWWA 5F2MA 1JCLA 1LYXA 3LHZA 1MEWA 1JQVA 1OF6A 4NJIA 3WK1A 3FKRA 4ZQRA 2DZUA 2JKPA 3M16A 1OX4A 3CLMA 3BPWA 2J9YA 4MVAA 3ZFHA 4O18A 3NL2A 3M9YA 2Q8ZA 2NUWA 1NVMA 1U83A 2B0MA 3DH7A 4PL1A 5G5IA 3W74A 4A21A 5F2IA 5EA9A 5CSRA 3QW3A 4K8EA 2CWNA 3MBFA 1C9DA 2H3DA 3UZJA 3HQ1A 3H53A 3LRLA 5IBXC 4UTKA 1GVQA 3KXQA 4HPJA 4O17A 1O4UA 3R89A 3GAKA 1FWSA 2R14A 3W76A 4WX2A 1H7XA 2NXGA 1LP6A 4FX8A 3TFCA 3TROA 3ATYA 4N4QA 4NX0A 1I2NA 3TCEA 4MUZA 4FXRA 3DFSA 3OEXA 5HWMA 3UYCA 5L9FA 2VFDA 1KLZA 3CIXA 3LHYA 2A1YA 4IMGA 1G4PA 4K39A 3FA5A 3RK8A 3PG8A 4Y90A 1EWDA 3AO0A 4JTHA 1AMKA 2ZRXA 5CGQA 1LBFA 1KLYA 1WBJA 2VELA 3LLDA 5EPDA 1KBJA 2DU2A 2OZ0A 2Z1BA 3N14A 4BK9A 3BLEA 2RFGA 4KKXA 3W1QA 4MJMA 3TJXA 4M6VA 3PG9A 1VCGA 4O54A 1FUYA 5KMYA 3GLCA 5KITA 3PC0A 1DJNA 3GNDA 4O0ZA 3OVRA 5F4SA 4N6EA 1YDNA 3OBKA 1PV8A 2PC4A 1K8YA 3BW4A 2ZBTA 4LVAA 3W7KA 3GR7A 4EVZA 5C54A 4JEQA 5LNSA 1FCBA 4UFJA 4RV8A 3W87A 1WDWA 5FI8A 1QFEA 2C16A 3S8HA 4RJEA 1H1YA 1O94A 1Z42A 1YDVA 5BNKA 1YDOA 1CW2A 5CPMA 3UXDA 3EX6A 3GKAA 1H1ZA 4J9JA 4ZZ9A 3GK0A 5FF3A 5IBXA 1YTEA 4DBEA 1KM3A 2CZFA 3HF3A 3LCLA 5LKYA 3A5VA 3EXRA 3G3MA 3KVJA 2H6RA 4LUIA 3R8RA 1F5ZA 5D2VA 1TPWA 4PTNA 4O1AA 3RMJA 3PR2A 3UD6A 3EWYA 2FQIA 5LNWA 3NQGA 3TDFA 3W71A 2B7NA 1FQ0A 2RDUA 1MSSA 1ZNNA 4XTDA 5DBTA 2BTMA 1FCUA 3A23A 1N7KA 1DKWA 1OFRA 3G1SA 3TX9A 1TPC1 1LOLA 5D32A 2WSQA 1TTQA 5K4XA 4XBSA 4MZ1A 1K7EA 2E09A 3G1AA 3UPBA 5DCDA 2Y62A 3W7CA 3C2RA 5K7JA 1RR2A 3DGRA 5CG7A 1A5AA 3C2VA 1OX4B 3MMTA 1JRCA 2A7NA 2HSAA 3BV4A 5L6UA 3NO5A 1W56A 4LC6A 3C52A 3NQ2A 2ISVA 4A2RA 3WJXA 4R34A 3UWVA 4IXHA 3W86A 2VEPA 1B9BA 4UFIA 3NPXA 5C5YA 3NQMA 4ONVA 2B7QA 2TMDA 3C0JA 4FIRA 2ABBA 3EKZA 4O10A 2HS6A 2Z6IA 2VXNA 3DZ1A 3M1ZA 1TV8A 1VR6A 3NZ1A 4WJEA 1LTDA 3FYPA 4LNYA 3S5NA 3B0UX 1MEHA 4FHAA 2VFGA 1GYLA 3DKJA 1ZENA 2W6RA 4QNEA 3TR2A 3TU9A 4RZ5A 3GDMA 2WNQA 1L2UA 2R8WA 3PULA 1HG3A 3P60A 4IX0A 4AF0A 2OT1A 1TPUA 4JIQA 1WA3A 2P10A 3HG5A 1AW1A 2VFFA 4WOZA 4UMAA 3L5LA 3UY7A 4N02A 4JYEA 3L68A 2E6FA 1M7PA 3NL3A 1FWTA 1PS9A 1B4KA 1QCWA 2FPTA 3HB9A 3K30A 4GE8A 4O14A 5D2YA 1VCVA 1ALDA 1KBIA 3W1NA 5DY3A 3QFEA 2CFFA 4R33A 4JTJA 2ABAA 2KZHA 3M6YA 3UWWA 3M5XA 3TXVA 4HNTA 5TBOA 2V2DA 1YXYA 2HS8A 4CQAA 3OVPA 3DKLA 2QKFA 1UBSA 2OCZA 3T78A 4WY0F 1ZAHA 3DU0A 4JY8A 3S5YA 3NDOA 1TPVA 5DLCA 3HPZA 1W5PA 3LCXA 4MIMA 1LZOA 1TJRA 1ADOA 4JNMA 1B57A 4UXDA 3DBPA 3NVTA 4X9SA 2GUUA 3PUDA 3RFAA 1NEYA 2PRMA 4E0CA 4CLMA 4LW7A 4AHOA 3ABSA 1W3TA 5K2ZA 3L67A 2QCHA 5HMSA 4ZMGA 2G95A 4KFPA 4GXMA 5FF7A 3E49A 5F4XA 1WX0A 3C61A 4LU0A 1SSDA 4O57A 1PCWA 3SW6A 2RKXA 1H51A 3Q37A 1V7YA 1XL9A 1IXQA 5EYWA 3TH6A 4RZ4A 3L5AA 3MHFA 2O7SA 1NF7A 1ZAIA 2QCMA 4JDBA 2RDWA 4DEFA 4A2SA 4FIQA 8TIMA 4C1LA 1OF8A 3CWOX 3LB0A 2Y7FA 3DHDA 3VE7A 2QCLA 3W7DA 4BI7A 4CNNA 3GDRA 3HGSA 1KFEA 3S1UA 1GVRA 4O4VA 5D33A 2YZRA 1G4SA 3INPA 3LXCA 4RX0A 2A2IA 2ZRYA 5BOOA 4ZQPA 1X1OA 3GZ3A 3FIGA 4UMCA 4IJBA 3UY8A 5G4EA 2QJGA 1FWNA 2FTPA 3W2KA 4UNLA 3G8EA 4HN4A 3QW4B 4AH7A 2X1TA 2QEZA 5AYYA 3V1PA 4HIBA 3GAYA 1ONRA 3NYZA 3WJWA 1EUAA 5HWJA 2RH9A 2CLMA 3VE9A 4S1FA 1FDYA 3EXTA 4K38A 3LCWA 4PEKA 1OJXA 3O6DA 2QCNA 2ZZ7A 1TTPA 3W70A 1VHNA 1JVNA 3EX4A 4YCOA 4U4MA 4BF9A 1SFLA 4KWVA 2YYTA 3BG5A 4O15A 3W73A 3N34A 1XBYA 2BXVA 4LVDA 1XKYA 1EUNA 4JS3A 3G1FA 4UTJA 3W75A 3E9AA 4GUJA 3VNDA 1ZAJA 3SJ3A 1NAL1 1VGAA 2QR6A 3QF0A 5G1TA 5I3KA 3UQNA 3W1RA 1XUZA 5DXXA 4O52A 4LOCA 3QMTA 4GUHA 2ZRWA 3S6DA 2ZTJA 1LCOA 3MI6A 1TTIA 3THAA 2QJHA 3LGEA 3ZR4A 5KZMA 4OT7A 3M43A 2FB3A 4EF8A 1T96A 1PE1A 1SQ7A 3FJ6A 2H8XA 4N2YA 2QUUA 2ZZ1A 4N9BA 3MJYA 1Q6RA 4Q32A 3TQKA 3LHUA 5H91A 5C55A 4O4WA 3NGJA 4LVBA 2JKEA 4GUGA 5DXYA 2NXHA 5D38A 3G0SA 2NX1A 5HUPA 3QM3A
chains in the Genus database with same CATH superfamily
1KO0A 1TQJA 2ZTKA 1CGTA 1I1XA 4MFDA 3WLIA 1BYCA 5AYBA 3FDGA 4IX2A 4XO7A 3UCDA 3S83A 1EEPA 1E1CA 1XGDA 3QC3A 1LLZA 3ALGA 2WW5A 3IARA 3R4IA 1IGSA 1HL2A 3W1MA 3T9PA 4DO4A 4DUOA 4TIMA 3MI2A 1KM1A 1QAPA 2I56A 4F0LA 4I7VA 3BLFA 2WOQA 2OG9A 4EPBC 4BI5A 3HMJG 1HGYA 1XH0A 3EAUA 2WZEA 3VNMA 1EHNA 4J2MA 2XFWA 3FJNA 5HJLA 4RKAA 1KGUA 3KRUA 3PBVA 4D6CA 2YGYA 1TQXA 2CLFA 4GBUA 3B40A 3IIOA 1GUVA 3B06A 4ERAA 4F9DA 1XSKA 2V69A 4AYGA 4B3ZA 1NM9A 3IACA 1CENA 1G67A 4J7RA 3FSUA 3HIJA 1PPIA 1R30A 4JY9A 1TJ1A 2FZMA 3ZWSA 1IR2A 1A0DA 4JL2A 3GH4A 4FX6M 3VK5A 3QYSA 1C3FA 3KHDA 2E6YA 4MJ2A 3UGRA 3R0KA 1XPGA 3VUSA 1W1YA 4IPLA 5DMMA 4DF2A 5AB3A 3FSTA 1IIHA 3MUY1 2WO5A 1UCWA 2FZBA 1JF6A 4L1WA 3QV6A 5EY5A 4O1DA 3PUOA 4H9UA 4ALDA 2OEJA 4GBDA 4YPJA 2E40A 5ABHA 2J7HA 1R9ZA 4KCTA 1TWIA 3E02A 1T8XA 3NZRA 4Q4QA 5DANA 3WQEA 4BZYA 2VM8A 4QJ3B 1W1PA 4O1CA 3V1HA 2VI0A 3VYLA 4RNFA 1V5XA 3L2IA 5I7GA 1N8WA 5D2WA 3MV01 4LVFA 3N2XA 1VJZA 3CU2A 5D9PA 3M0IA 4XAZA 2YCKX 1J0KA 3PZIA 4LUYA 2WSPA 3TE9A 1CXEA 2VR2A 1PZ1A 4L5ZA 3F5KA 2A21A 2CXGA 1YXDA 1LWIA 4Z0JA 4FNTA 4C6DA 2CU0A 3A4JA 4NZCA 1V93A 4W88A 2ACSA 3B9AA 3MPGA 2DIKA 4KIEA 1OGGA 1XYCA 2Z6JA 1VIWA 5ECVA 3PFMA 4H3DA 2PBOA 3W83A 1PWMA 1EP1A 2J8GA 1IWPA 4RXGA 1MFUA 1YTDA 4PMQA 4GGHA 5IDZA 3CEPA 6TAAA 3KBWA 4A8LA 1IXPA 3G1HA 5FKYA 1TWZA 1Y5VA 4MY1A 4U5KA 3STFA 2E8YA 1ISYA 2Z4GA 4XKYA 1SJBA 1AJ0A 3LBCA 4JXCA 2GVJA 1B2YA 1TZZA 2EPNA 2BVDA 2YL9A 2A3AA 2PDPA 4PUWA 2I7GA 3RLGA 3PBYA 4GZEA 5REQB 1UOZA 1I0BA 3B8UA 3LTSA 1QNQA 3T07A 2EBNA 2AL2A 2GGHA 1XWYA 3RO6A 2HVNA 3TKFA 3WD0A 4DUVA 3N3MA 2PU1A 2ALDA 4AISA 1SJCA 4HKPA 3D6NA 3WQCA 3KOFA 1UR9A 2D2JA 4FNPA 3UCCA 4DJFC 1XIBA 3CMFA 1Y0EA 4AHPA 3VNZA 2UV8G 1W1TA 3ZMRA 3RLHA 2D1ZA 3MHGA 3GW0A 1KTCA 2NQ5A 3A3HA 2A7RA 1E6QM 1R2RA 3AIQA 3PSWA 3PM6A 3NQ8A 1I45A 2FPYA 4JYDA 2HXTA 1K70A 1VBGA 1EO7A 4M3PA 3W7HA 1VBUA 2J77A 1W1B1 1DHKA 4MF4A 1XIHA 4XIAA 2DV0A 4PUKA 2I16A 1X6LA 3TXZA 2UY4A 1L6GA 1MNZA 1KTNA 1QNSA 2CBIA 3B05A 3FAXA 1GOWA 3FYYA 4CCDA 1OABA 5G1YA 5AHMA 1UD6A 4WQ6A 4UTHA 5D04C 4YS1A 3EOOA 2CLPA 3LMYA 2OELA 3VDBA 4K3ZA 3W00A 3GH7A 2XIIA 3TZFA 3QPYA 3MKCA 3K2GA 3TOYA 4HMNA 3KRSA 1UWIA 4XD6A 3L4TA 5LSMA 2VVSA 1XLBA 3ARSA 4MSSA 1ZRQA 4PUEA 2O4QA 4A8IA 1LWJA 3PZ9A 3H6OA 4S3JA 4AXKA 4S3AA 2WMJA 4H6EA 3IANA 1YRRA 2G0WA 4DAFA 4I6KA 3V0SA 2G96A 3EWDA 4O11A 1FH7A 3KEHA 3AHZA 2Y63A 1KBKA 4MNJA 4Z2IA 2YJQA 2NQZA 3HA1A 4X0NA 3AMCA 1EL3A 1VRXA 4GJ1A 3RPMA 3T2OA 3GNNA 1FX6A 5EMLA 3G3DA 1XCXA 2ZZ3A 2E7FA 3V35A 4KH2A 3GW3A 1Q6DA 2OU4A 2ONEA 4XKYB 3NXLA 4LYPA 1WE5A 1XBVA 2PS2A 2TSYA 1XH2A 4R9XA 1BVNP 3NSNA 3TMLA 4XZIA 4L61A 2BWGA 4S2BA 5LA0A 3DESA 1SYTA 1J8VA 3MCNA 4TV6A 3NG3A 3CAQA 2A5HA 4NT0A 1UJPA 3HG2A 3F7JA 3TYZA 4J27A 2VYOA 2CW6A 4LV4A 3S2CA 2V67A 5GNZA 4F48A 1GVOA 5C6MA 4NAEB 4N4PA 3G1DA 2XSAA 2DW7A 3S2LA 5A94A 4AIEA 3AI0A 5FF4A 1TR9A 3GX9A 3OJGA 2X7WA 4GFSA 4LC8A 3WBEA 3AHXA 3BAIA 3C2FA 3E2RA 3QQWA 5CSYA 1D8CA 3FK4A 4UR7A 3WDRA 1RVGA 4YVPA 1IR1A 2CLIA 3GXTA 5LHFA 3ONBA 1GWJA 3MY9A 3MYPA 2NLYA 1DXFA 1LQAA 3PBGA 1M7JA 2CWXA 3W26A 3SSJA 4BFAA 3QSRA 4WXZA 4F79A 3V0UA 3GH5A 4CVUA 1UG6A 4NIRA 4GI8A 1DPMA 4PZVA 3LSCA 3FA4A 2F38A 4ZSUA 3PPFA 3VFCA 2VENA 1ECEA 4Q4MA 6REQB 2VX4A 1MZRA 4QLKA 3GC5A 3V5OA 3ZO9A 3VD3A 4XX6A 1XLCA 1EC8A 4XG1A 4CUCA 3GTFA 1TVNA 3WLKX 1S5NA 3I4KA 1PDYA 3W28A 4UTTA 5E93A 5D30A 5REQA 2QLYA 4QM1A 2J62A 2OWWA 1UR1A 3IGHX 2AL2B 4H9MA 2YW3A 3OG3A 4DBUA 3WDJA 4DYKA 3GR8A 3CV7A 3N04A 1C9WA 1WV2A 3OODA 2GVYA 1RP8A 3IJLA 1V8EA 3ARUA 1M03A 5CPNA 2DZTA 3UYIA 3B04A 2VUYA 3G2GA 4JTLA 5AN7A 1UH2A 1KM5A 4H41A 2INFA 1E4NA 1XUUA 1DXIA 1L9WA 3P61A 3NQCA 5GJPA 1J10A 5F1VA 4JN7A 1G5AA 2OGYA 2VQTA 1EZWA 1XF0A 1P1MA 1QR7A 4AVNA 3PBUA 4AWEA 2VEMA 3LV5A 3LD5A 4WDXA 5HDRA 4HYWA 5KZDA 2H90A 4AB4A 1OYAA 4F2TA 2BHYA 2WC3A 4CNOA 4C6NA 1EC9A 4WVXA 4PB3A 1RJQA 3WL1A 1IGWA 4ZENA 3HJEA 3CUZA 2QVHA 3NM3A 3USBA 3SUUA 2QIIA 4PMVA 2AQWA 1QPNA 9CGTA 4FNSA 4TUFA 2O9RA 3GDLA 1DBTA 4K8HA 3T08A 3S2NA 4WSJA 4Z1CA 3W7OA 1UKOA 3VNLA 3OLDA 4RR4A 1KTBA 1R3YA 3E12A 4ZVJA 2WPGA 4EK7A 1UR0A 3OQEA 2OLAA 4LXFA 1BEUA 3BGJA 5A8MA 1CLVA 1JUEA 1V0MA 1X97A 3UZWA 1ZY9A 4FXFA 2ATMA 5A8OA 4XZLX 2J7CA 3L4XA 4ZXLA 1K03A 4L64A 3WMBA 4UCGA 3T0BA 4AZCA 3NWRA 2NQJA 1K9DA 2UWFA 1QI2A 3LTYA 4MTVA 4NX5A 3KZPA 4CNPA 1UQZA 5EMKA 1LRTA 2IW0A 1W5MA 3N25A 3RR1A 4XBKA 4KWSA 1I1WA 5C2XA 1KR0A 5F7UA 1G4EA 1XLGA 3H24A 1QK2A 3N4EA 4JX5A 4WOQA 1V08A 5DFAA 4AAJA 5AC4A 1ZJBA 2VRQA 4AEFA 2GQAA 4RE0A 4P2VA 1TYGA 1HO1A 2ASHA 1W31A 3RLVA 4JN6A 2F2KA 3QN3A 4CEXC 3RDKA 4LV9A 2XVNA 3AZRA 5T9BG 2QPXA 5FJIA 2QUNA 2WHMA 4F0RA 1KR1A 1EXBA 3RUBL 1ZUAX 3B8DA 2D73A 1QPQA 1TV3A 5I3DA 4NNCA 1W3KA 2GK1B 3Q67A 1BSIA 4JTAA 1K02A 5CSSA 1JAEA 2ZXQA 2EPHA 3E5BA 4RDWA 1VJIA 3VOHA 2P3ZA 2GJXB 5C7HA 1J11A 1UWSA 5D8WA 3SCRA 1GG1A 3C8FA 1XIGA 1A5CA 3CH9A 4C7GA 5IXEA 1KFCA 1V3IA 1KGXA 3H22A 3CYJA 5CKSA 4DXXA 2DORA 5G1MA 3WQOA 4Q8NA 3LV6A 4DBDA 3H7VA 1JRBA 2YL5A 5DCEA 3MANA 3ARYA 1N8FA 5DRIA 3SUVA 3RPTA 4E4FA 3DECA 3EKLA 1ZALA 2F84A 1X8CA 1XIMA 3EOSA 1O95A 2Y70A 4NJHA 2R94A 3GQYA 3NL5A 3VINA 1EBGA 4UTIA 4B5SA 2WJEA 3ECQA 4P7QA 4UUIA 2J7FA 5AYXA 4UTTC 2D0FA 4GQGA 3KTCA 5BW6A 3EGJA 3T0CA 4ACZA 3IIZA 3P81A 3V4BA 3TA6A 4KFNA 2DEPA 3IUIA 3VIFA 3W7IA 1YLVA 4Z1BA 2UY3A 3EPMA 4DJFD 1OT1A 3UNTA 3MUAA 3QHMA 2BLEA 4EE9A 1UJQA 5EBUA 3UFYA 5I3HA 3CWHA 1PDZA 1MXDA 2FJUB 2EG7A 3W2UA 3RX2A 1R85A 3LDVA 4MY9A 1EH9A 1PKNA 1ITQA 3IAQA 3SN0A 4R7JA 1W5OA 1W3JA 4HU8A 2J8TA 4BY3A 3SRHA 2X0SA 1NP2A 3CUHA 9XIMA 5G4HC 3MP4A 4S3KA 1M7OA 3WQ6A 4ZOBA 3DFOA 3M7SA 2UZ9A 4N9EA 1R9XA 4ZO6A 2VX7A 1KRAC 3UP8A 1IIGA 2WZMA 4B2DD 5C2GA 1IYXA 1B4EA 4GZ7A 3ZR6A 3OYZA 2J47A 2V30A 3B8WA 3L4WA 3AIBA 2WVVB 4W9TA 3MO4A 3A9BA 4MNKA 3SN4A 1F4HA 1OY0A 1Q8AA 4AWTA 3N18A 4QLJA 4OJYA 4DZIA 1PXGA 1ZBCA 4U5IA 4KWWA 1L0PA 2NQHA 3NOYA 3TTEA 3O15A 4WIWA 3VI2A 4C60A 3POCA 4HD5A 4Z0SA 4G1NA 3K5XA 2AAAA 1JZ7A 3DFNA 1XW8A 4AIBA 3QRHA 2HE8A 4OGZA 3MZNA 3NSMA 3AXKA 1JYXA 2ZDRA 5CPSA 3WDPP 1X96A 4QROA 3CWNA 3RCNA 2QAPA 3VKBA 2FZ8A 4D8ZA 2Y4SA 4ZB0A 1JPKA 2D0HA 1XLIA 2ZADA 4Q6XA 4YCPA 1EZ2A 4A4AA 3BMVA 3BQ6A 3FVMA 1W17A 4LSBA 4G9PA 1EPVA 3HM7A 2I17A 3R1ZA 3HFTA 3CB8A 4Y9OA 1FWGC 5K4ZA 4MKSA 3ARVA 5LYRA 3WLOA 4K7VA 4M6PA 5F2GA 2XH7A 1CIUA 1QWGA 5H8UA 2INEA 5EU9A 1UA7A 5JBEA 1JGIA 3P74A 2WVTA 1RD5A 3LNMA 2HWGA 4IOTA 1K4HA 3NUKA 4WK9A 1CGWA 2GLKA 3MWCA 3KWXA 2VX5A 1VF8A 3LPPA 3PBWA 1H60A 3VIHA 3TA9A 4PFMA 2YFOA 2OYMA 4AY1A 4UWMA 5KSWA 2G3MA 4M56A 4H6KA 3TVAA 3K1DA 7TIMA 4KEVA 5HBFA 2F6XA 3R2GA 5BMWA 1A53A 4MDPA 2BOGX 1UH3A 1JXJA 2HJPA 4N7QA 3IGUA 1SZNA 2JKAA 1CBGA 3N2MA 4FI4A 1V02E 1VENA 1HXJA 2W5FA 1HJXA 4QTGA 1H0GA 4UC5A 3VO0A 1EF3A 4NJJA 5B7YA 5BRBA 4K2SA 3IJ8A 1NP0A 3VC6A 3EBVA 5BOFA 2C1HA 2YYUA 3DN5A 4JHMA 3AJ7A 3PFRA 2Z1XA 2J88A 3WD4A 3FJ4A 5H2ZA 3O9NA 5CGMA 2YCIX 3CPRA 1YADA 4P61A 4DWSB 1QNVA 1E9IA 2FMNA 4IZGA 4QX4A 1FHLA 3WNLA 4HMEA 3LS9A 4NZ4A 3WF3A 1C8VA 5BXTA 4WY0A 2XN1A 2VZOA 4JTKA 4UB9A 4W89A 4I8DA 5BXSA 3GE7A 3TCSA 4D6IA 6PTDA 5FCZA 3NQ7A 1BYAA 4TV5A 5AC8A 2GGJA 3TW9A 3WLTA 2J13A 5AHLA 3LM7A 3E0IA 4XWUA 2YSWA 3BCFA 1ODZA 4POCA 1CGXA 2EAWA 3Q94A 3RITA 1ICQA 2VFIA 1NSJA 2ZFAA 2ZX9A 3UZ5A 3N6QA 2Q8XA 4HP5A 2QF7A 5BWAA 4DJEC 3WMLA 1W37A 5LNUA 4ERGA 2Z24A 1FFRA 3VZZA 3O2LA 2HZGA 4GISA 2C1GA 4M19A 2BFGA 3GG1A 3WLLA 2X16A 4N9DA 3G1VA 4DELA 4DHGA 3PZVA 1TIMA 2Z26A 3A47A 3IWPA 3QQ1A 2IXUA 4W5ZA 2CZEA 2ZRVA 2DZWA 1J79A 3LHTA 2X0YA 3TQ0A 1XICA 2VO5A 2QNEA 2ACRA 3TR9A 1MI3A 4FNQA 5J8LA 3R5EA 1KCKA 3EEGA 3L66A 2ZA3A 4ML4A 4R27A 3RX4A 5A6TC 5I23A 1ONEA 2PRHA 1Y5WA 3OO2A 3ZVHB 4WDUA 3UG8A 2PDBA 4FNRA 3THDA 2WHJA 1BXBA 1LL4A 2Z29A 1BGAA 2WK2A 2XFYA 1K7XA 2JEQA 3HQPA 3IGXA 3DCPA 1H61A 1H50A 2WKGA 2V3FA 3MP5A 3GTHA 4FOUA 3VNJA 4FR1A 1R6WA 5CC3A 2OX4A 2P53A 3KTXA 4CN4A 1US3A 1XFCA 1G69A 3W7QA 2VT0A 1DIDA 1FCQA 1UUOA 1KXVA 1Q6EA 2WLYA 3KBVA 2DZVA 1FP9A 1VPQA 3WFLA 4C5ZA 3TWBA 3W3OA 3BJSA 3ZT5A 1ADDA 2D2OA 1G7UA 2FDSA 1NELA 5AOUA 3EWCA 5F2MA 3LHZA 1JQVA 1OF6A 3GNPA 1BXNA 4H8HA 2I5QA 5LIKX 4B15A 2DZUA 3O7UA 3CLMA 3BPWA 1UMLA 4H9ZA 3RPDA 4HHMA 3F2BA 2DSUA 1VB9A 4PL1A 3THCA 1AD1A 5CSRA 1X1NA 2EJ1A 4TX8A 1ITCA 4BQ4A 2AL1A 1C9DA 1DJGA 1S2CA 3KXQA 3BZJA 4HPJA 3GAKA 4RE4A 2JFEX 3USZA 1EOKA 1H7XA 3WFZA 3NFUA 1LP6A 4G6CA 3UCQA 1R9YA 1VFTA 3TROA 2DZAA 3F4VA 3OEXA 2EPMX 3SSZA 3ITTA 1AQMA 5L9FA 2FGLA 1KC7A 4FK9A 3ARWA 4INFA 4PMNA 3R0UA 4IMGA 2BHUA 3CUIA 3FA5A 2GYIA 1S39A 3SFWA 3AO0A 3OZMA 1WDRA 1XYMA 1EKOA 3V18A 2IS7A 1Y8BA 2Z1BA 3N14A 3WH8A 3R11A 1WAWA 2QVNA 4YYCA 5CJNA 3TJXA 4WKAA 4M6VA 4WJ8A 3PG9A 1VCGA 4O54A 1F3WA 5KMYA 2FFIA 3GLCA 4QEHA 4JHZA 2GUYA 5F4SA 5FAJA 4N6EA 3V36A 2PC4A 1Y65A 1DJXA 2VEGA 5AKQA 3MUCA 4DWDA 3GNOA 4L1GA 2YA1A 4JEQA 4RV8A 3E38A 1WDWA 3S8HA 3C2YA 1O94A 4MKVA 1OCBA 4NKCA 1PJ9A 4D6JA 2YDRA 4J1OA 5CPMA 4LUSA 3GKAA 1EJXC 1H1ZA 1A47A 1GVEA 5GJMA 3MUIA 5IBXA 4Q3MA 3A5VA 3EXRA 4GXPA 3KVJA 2H6RA 4LUIA 2A3EA 1F5ZA 5D2VA 3T0TA 3H70A 3PR2A 3CZJA 3CV1A 2FQIA 2PGWA 5LNWA 3NQGA 1OC5A 2QJJA 4DJEA 2WBGA 1KXTA 2W67A 5DBTA 3E2QA 2OQHA 3OLIA 3VTRA 1OFRA 3CK5A 3TX9A 4NASA 3VOJA 2V3GA 1LOLA 3VD9A 4XBSA 5C7VA 1K7EA 3G1AA 2QS8A 1W3HA 2Y62A 3W7CA 3C2RA 3VOFA 1W1A1 1A5AA 2P76A 3N2OA 1JRCA 4MDOA 1R5YA 3A3WA 2HSAA 1A5UA 2XWEA 4Q8VA 4MWAD 1XYBA 4XAPA 2P5NA 2XIMA 3NQ2A 2ISVA 5IFTA 4A2RA 1CDGA 1QTWA 4H01A 3ZXWA 3W86A 2GSEA 2WQDA 4UFIA 1KRCC 1JYWA 4DLFA 4D72A 2ABBA 2CHOA 4X63A 3BURA 2Z6IA 3DZ1A 2PTZA 3M1ZA 5E0FA 1VR6A 3NZ1A 5I09A 1GPFA 1R3VA 1MEHA 3L23A 1GYLA 1ZENA 4QNEA 1VFUA 3TR2A 2VUNA 3GDMA 4DVOA 3PULA 1GOKA 3P60A 4AF0A 2OT1A 4JIQA 1WA3A 4OZOA 2P10A 1AW1A 1XLJA 2VFFA 3ZJKA 2XWDA 4WSHA 2E6FA 5CG0A 3RG6A 2E25A 4GE8A 1GJWA 1VCVA 2DW6A 2A3CA 5DY3A 4WKHA 1XSIA 4GGBA 2ABAA 4WRHA 3TXVA 4U3CA 3NEHA 3DKLA 2QT3A 3WBAA 4F0KA 3T78A 5C9ZA 4JY8A 4JAWA 1HF6A 1ZP3A 1EJSC 3LCXA 5M2FX 1LUCA 4MIMA 2QIWA 1B57A 3DBPA 3AMGA 2PZNA 3PUDA 2WLZA 2Q02A 3II1A 2PRMA 2YB1A 5DQPA 4E2OA 5HMSA 4ZMGA 1GVYA 4GXMA 3E49A 4GY0A 2KAUC 1FWIC 3MQTA 4GX8A 4O57A 1PCWA 2NQ9A 1B5TA 1H51A 1V7YA 1XL9A 1IXQA 2IKJA 1EYEA 3GXFA 3WLRA 2GZXA 4JDBA 2QULA 3CWOX 1YBQB 3W7DA 2R1MA 3GDRA 3HGSA 4YN5A 2R82A 5T91A 1G4SA 3BH4A 4RX0A 2A2IA 5BOOA 1ISVA 2QGHA 4L6DA 1ITUA 2Y8UA 3LLXA 1P6WA 3DG7A 4HPHA 3P6LA 1X1OA 3FIGA 4FS9A 3VKDA 3OG2A 3UY8A 5G4EA 1FWNA 4IJCA 4LQ1A 1LG2A 4HN4A 1WKDA 4L7ZA 2QEZA 3LY0A 2GGEA 4DX3A 1EUAA 4FLRA 5HWJA 2RH9A 4IICA 2CLMA 3WLNA 1JF5A 1P0EA 2QDEA 2X8RA 1GOIA 1Z8AA 1VHNA 1XLMA 4F0SA 4U4MA 4KWVA 3FDKA 1XBYA 1XKYA 4JS3A 4Q7BA 4UTJA 3W75A 3R43A 1HJQA 1S2AA 2YZ5A 1JPHA 1MFVA 2OGJA 3HQOA 1VGAA 2QR6A 5I3KA 3OVGA 3BXWA 2IUZA 3W1RA 1PKMA 1XUZA 4HTYA 4O52A 4GQQA 3SCWA 4B5XA 4AZIA 2ZX5A 5KZMA 4PBFA 4EF8A 3T09A 3L2MA 2XFFA 3N11A 1T96A 1A3HA 1SQ7A 3FJ6A 5BYWA 4ASTA 1C7SA 4LB4A 4ERIA 1K6WA 2WNWA 4O4WA 2JKEA 2NXHA 3G0SA 1TG7A 4H7CA 1RBAA 5DN1A 3GU9A 5FEZA 4UFHA 1TCDA 1TRIA 4XAYA 2XSXA 2P3EA 4LX4A 3UZYA 3OGVA 9RUBA 4IIGA 1WBHA 2J74A 2V5KA 3WMCA 2V8ZA 5FA5A 3WNOA 4HZ6A 5G4WA 2XN0A 4GH1A 3WEOA 3VDGA 3W9ZA 3RAOA 1P1XA 1PIFA 3W2NA 2WYSA 3UR8A 1IE7C 1N82A 3PZNA 3B8VA 2ZA1A 3WCZA 1EWEA 2EKCA 2HRWA 3F4WA 4WEVX 4MB1A 1U1HA 3EX3A 3P14A 2VD9A 2BY2A 3KVKA 2FDMA 4IQJA 1O5RA 1DJIA 1R47A 2ZWYA 3SY1A 1GPWA 1EF2A 3LHWA 3MHUA 2OR2A 3AIUA 3EX1A 3WSUA 1OG6A 3CC1A 3P62A 4G7FA 1IZCA 4PL2A 3C5QA 1RD6A 4L56A 1O5QA 1XC6A 4J5NA 1HGWA 3FOKA 1JIBA 2AGKA 2QJIA 4AUBA 1H7RA 2B31A 5BXPA 1SO6A 4J3SA 4IT1A 4ZSTA 3S9IA 1ZJIA 1AUSL 1CXIA 1GOOA 1E9LA 4PCPA 5AC5A 3TTYA 3U2EA 1F05A 3QY6A 1IQ8A 1PZ3A 5K9CA 4GVHA 2G3IA 3N9SA 2OKTA 3BAYA 6ENLA 1L6FA 4H83A 3VNIA 5HMEA 4FP1A 1VRDA 3GS6A 3WK3A 4O53A 1AQHA 1G01A 2IPFA 3FFSA 3MWAA 4N9CA 5LGZA 1ME9A 1US0A 4JKMA 3VUPA 1T7LA 1P6BA 3SM0A 1PAMA 3UJFA 3TN3A 2DVUA 1A3WA 4MWAB 4JFVA 2VURA 4WY0B 3A4WA 3CQIA 1CPUA 5B7ZA 5M17A 4PRTA 1W54A 3IV3A 3IPWA 4MB3A 5FIPA 2OYLA 3IAPA 4RV3A 4ZOCA 3PZOA 3B8TA 3PPCA 2VD8A 3PZTA 3B4YA 1ZBKA 2Y24A 3PJWA 1TZ7A 1W5NA 2TYSA 3B03A 4UOQA 3UG5A 1VPXA 4GUIA 2OLSA 3SRKA 1X7FA 3ARQA 4F0MA 4YJ5A 1FWBC 2NWSA 3QLDA 2NSOA 4LJ3A 4ZGYA 1GZGA 2J4GA 4Z1AA 3BAKA 3PF3A 3TSBA 7TAAA 4K36A 4DWSD 4JQ4A 2ATSA 3S0CA 4CQDA 1CT5A 1LROA 5T9CE 2AMGA 1IXNA 1CGVA 1A4LA 1JDEA 3NJ3A 4PODA 3WLHA 3QV7A 3A5FA 1VYSX 2C14A 5AHNA 1V6TA 3BUVA 3TC7A 4DYEA 4TTUA 2VR5A 4LH8A 1EPXA 2PI6A 4DM1A 1E6XM 3L5MA 3QTPA 4MOZA 2ISSA 3LTPA 1H7PA 1R3TA 1EA9C 4LVGA 4XB3A 5C9XA 3W01A 4LYKA 2RDTA 1I9CB 4MZYA 3BW2A 8XIMA 1UPMB 3SIMA 2Y85A 1DIEA 4MB4A 1RA0A 1JI1A 1KM0A 1HJWA 3VDHA 3CPUA 4YXGA 5C9UA 1TELA 3OQ8A 4YVVA 3EDDA 1S5TA 1OC7A 4Z2JA 5CGTA 2GQ8A 2Y88A 4XVEA 5EB8A 3UXKA 5D9MA 4DPQA 2FB2A 3ZM8A 3T2PA 2XU2A 5CPOA 4UQDA 3UG3A 3U2OA 3P3BA 1YHTA 4Z08A 1BLIA 1PL9A 3TNBA 4RZ6A 5DMLA 4BHYA 1NFGA 5D2XA 3WUEA 1ZJAA 2OWXA 4AWUA 3QKZA 2J75A 2AMXA 5AFDA 1QMLA 3W7MA 1S38A 3LXBA 4H8VA 4AZGA 4P7OA 4J3TA 5AC7A 4C6CA 5EFFA 3FVDA 1R8LA 3QZ6A 4KPLA 3MVTA 1UP2A 2P88A 4ZQNA 1NH6A 5A2AA 1GZJA 5ECUA 3VNYA 1M53A 1EXPA 3CL8A 3KRBA 3GXIA 2DIEA 1OWQA 4J3VA 2ACUA 3S1XA 4HNCA 3ZS4A 4KWOA 3TMQA 1HKVA 4HB7A 3DXIA 5TIMA 3O05A 3W1XA 2WAGA 5CJ5A 3QHOA 1TUFA 4EXBA 1JDAA 1W9VA 3BWWA 2IPWA 4Q22A 1ODUA 5M03A 3H2MA 2YCEA 1QHPA 4AMCA 1UR8A 2L5HA 3OVQA 2VZVA 1LWHA 2VCBA 3STGA 3WQ4A 1OZMA 2RHGA 3FHQA 2ESCA 4OUIA 4CQ8A 1F6PA 1IT0A 1Z69A 4WXYA 4Y7EA 2DZXA 5J5RA 4D1JA 1CWYA 1PX8A 1VLWA 1GEHA 1XLEA 1X7IA 2J6VA 3HTWA 1TREA 4IP4A 3BLDA 4LCQA 4X61A 3KLKA 3JW7A 4AZBA 4KMQA 4H7ZA 2VZSA 2Y8VA 4GYPC 2A3BA 3BW3A 1SFJA 2CLKA 2BVYA 4RW5A 4FPSA 4UQCA 1V0NA 4XKMA 2DPEA 1OFAA 3PP7A 1IT7A 4JTTA 5LA2A 2HROA 3L0NA 3BVJA 4KETA 3LCFA 4IISA 1DE6A 3L0GA 3O0KA 4JEJA 1B31A 2ICSA 2QV5A 4O8AA 3BSGA 4PH6A 3QZEA 4U2YA 3V16A 2NV1A 4HK7A 2VDGA 3K8LA 1K8XA 2X1RA 2ZYFA 4AVOA 3A21A 3KBNA 3R8GA 1TX2A 3TLLA 1J12A 4W7UA 1UIPA 2WWDA 3HQNA 3U9IA 4ORMA 1NF0A 1RPKA 1IWAA 1JFXA 4A8RA 1EJVC 1D3HA 1VPYA 1MEIA 3WH6A 2ZX6A 3LEPA 2C7FA 4EWJA 1FWCC 4JGDA 2E3ZA 4O1BA 4AZ5A 3S5OA 4M81A 1E0VA 2ZUSA 1KFJA 1SO4A 3BAJA 8XIAA 3C2EA 3QXBA 4UFMA 1LOQA 1TPEA 2ZXBA 3LENA 3W7LA 5HR7A 4OBRA 2DVTA 1VYPX 2PDUA 1XBZA 3MW7A 4QIUA 3VDAA 3LQGA 4QDPA 3U57A 5FEXA 5HNNA 1TV5A 4GXWA 5EKYA 3E0VA 3KZSA 1UP3A 3A22A 3W88A 2DFAA 3P7YA 1WDDA 5I3FA 4OV9A 2VGGA 3S3GA 2G37A 3SURA 4H4IA 4DJDC 4HOXA 2BP1A 4BR1A 1VLIA 4LY4A 4GHRA 3TN5A 2QUVA 4CCZA 3U8GA 3URQA 1AL8A 4Q4OA 2YXXA 1R3QA 3SADA 4HA4A 1XDJA 5F4WA 1SW7A 3AHVA 3EMCA 3VOGA 1SO5A 3EX2A 4LPCA 4GJIA 4BEQA 2QCFA 2HPMA 1TV7A 3WFAA 1VBRA 3VXGA 3N12A 4RNJA 3GU1A 3GIPA 4REQB 3CM4A 2W66A 4ZODA 4XD4A 3GIQA 3P2VA 1B30A 2CYGA 1GNXA 3HURA 2R1LA 1V3LA 3BAWA 3MSRA 1Q5MA 3L9CA 5D9OA 3W22A 3BOLA 3NPWA 2P50A 4QR6A 3G1RA 1Z48A 3PS7A 1ZGDA 4A22A 2CHNA 3GVRA 4L6HA 2H8ZA 5I77A 1OFDA 1QNOA 1A5BA 1NIUA 1OADA 3R6IA 5HWNA 4XUYA 1KA9F 3LPOA 3WELA 3MTWA 3CHDA 1FOBA 1HX0A 4AY7A 4L9XA 5LZLA 2GUBA 3V0TA 2VEIA 4PRWA 3MKKA 1PTAA 4QGCA 4U28A 4A3YA 4IPJA 3H26A 2IQ0A 1O1ZA 3GM8A 2QMKA 4D6DA 4GNJA 2VGFA 1FWDC 3NQFA 1GJPA 1MO0A 3ITYA 4C6BA 1HN1A 3ES7A 4M6UA 1EGZA 3G77A 5CC6A 1M3UA 4F3HA 1TPB1 5E6YA 5U4NA 4ZEPA 4ZL1A 3TYEA 2QCEA 4BS0A 2C79A 3G6MA 2NT0A 4DXVA 4S3EA 4PEEA 3CZKA 4AYSA 1MXSA 1WXJA 4ZOEA 1J96A 3PANA 1MQQA 4K1WA 3W24A 1BYBA 2Q3RA 2E5CA 1Q6QA 3WJYA 3BCDA 2YA0A 3B9NA 3EWXA 3MDWA 3KP0A 4C7DA 2CLOA 1XC4A 5CH9A 4NXKA 3IIPA 4JQ1A 1KD0A 5EMYA 4YWIA 3S1VA 1XIEA 1ZP4A 3ZVHA 5I3GA 2HE5A 3F03K 4RE3A 1KNWA 4A3UA 5FJRA 3KVMA 4JNYA 3KAOA 4ZFCA 3LGGA 4GNVA 2CBJA 2GPTA 4Y2WA 3TV8A 2TPSA 3LNPA 3QGKC 4K7YA 3CL7A 3HGRA 1QPOA 4Z42C 3TJIA 1QO5A 3VIMA 3W4RA 3LI0A 4H6QA 1FXQA 4NQ1A 3WY1A 3B0VC 2QPUA 5AYZA 2UY5A 4UR8A 5D8ZA 3T4WA 3UPWA 4ADTA 2QCDB 4H1ZA 1OC6A 4O16A 4CQ9A 3T8QA 4S3CA 1QDSA 2DSKA 5JH1A 3DG3A 1FWEC 3DFQA 3EB2A 3QLLA 5H6HA 2WXDM 1QBBA 1WNOA 3PTMA 5CEWA 1E55A 4PULA 3GWQA 4O28A 1JCNA 4JICA 2X2GA 4LBRA 4HGXA 4W86A 3WQ5A 1K8ZA 4GABA 2DIJA 2REQA 1B0IA 4RLIA 5TAOA 4TMCA 1I2OA 2Z1WA 3C3UA 3P80A 3S5SA 1O5XA 4LY8A 1Z6KA 2DSWA 3ABZA 2C0AA 1J0HA 2YXGA 4JOMA 2WCSA 1AL7A 1E56A 3KBJA 5GPRA 1X6NA 4YTTA 2GJXA 3LCGA 2BZNA 5EGRA 1NOUA 5HNRA 2CCRA 4DJDA 3HBLA 1PX3A 4XISA 1R7OA 4LRSA 1J4EA 3EDFA 5CBBA 4WF7A 1REQA 3B9EA 3THQA 4M7TA 1AW5A 3LXAA 4WGXA 1R2SA 5H8PA 3POHA 1HL8A 2B7OA 4ZB5A 3S47A 1M6JA 4V15A 1QPKA 3GB6A 3FN9A 3CHEA 3W7GA 2PDJA 5K9DA 1FDJA 1E6PA 2AAMA 1OCNA 1P7TA 3FGCA 3QV9A 4GIYA 3RN6A 4KGJA 2WQPA 3N4AA 2I14A 1YNQA 5I02A 2YFNA 3NEVA 4YHGA 2XINA 3BJTA 1KFLA 2OO6A 2Q01A 1FH8A 4GLEA 7ENLA 1Q63A 2E0PA 1UKTA 3JUGA 4QQUA 3FEMA 4LANA 1EA0A 5CQ1A 4JFUA 4G5DA 4AD3A 2NX9A 1UP0A 4C6OA 3THUA 4J4KA 1PX4A 4S23A 2F9RA 4REQA 4EXQA 4ACZB 1GW1A 1I8JA 3L65A 2GGGA 3NQDA 2XFRA 1OYBA 3M7WA 1AH4A 1X6UA 2DGAA 1BSLA 3NR0A 1S2VA 4AZ6A 4H9VA 3AUOA 3LUTA 4B3LA 1WCGA 1PCKA 1HNYA 1NOFA 3FXGA 3N17A 3OPSA 1BPLB 4HHLA 3EWUA 2ZUTA 1GK8A 3WDIA 3JZEA 3RJXA 2CNCA 2PWUA 4ZXOA 3A4XA 4Y8EA 3VDCA 2QCDA 1Q65A 1LORA 3WQVA 3LBOA 2Y61A 2O0TA 4Q33A 3WBXA 3XISA 2XM1A 3T4CA 4R9OA 1Q3NA 2BDQA 4QJ4B 4NVTA 1EIXA 1IHIA 1LOSA 2V9DA 4E5TA 1LF1A 3WENA 3KL3A 3TQPA 3LSBA 3NM1A 4AHQA 4ATDA 1GTHA 3NZQA 3R79A 2WVVA 4GO9A 1NY1A 1UD3A 4IIBA 3C0LA 2QCGA 3AXIA 4RPPA 2WKJA 3UA3A 1ZLPA 3LHVA 1GONA 2Y0FA 1W1ZA 3W81A 4IWWA 4MJ4A 3H55A 1FWFC 3QMSA 1HTIA 4TO8A 1GQIA 2ZZ4A 3L0KA 1JJKA 4Q4KA 3T40A 3ABOA 4ZB2A 3PY2A 1EDTA 4GIAA 3VMNA 3MUXA 3PNUA 3WKZA 2Z2UA 3E74A 3HV9A 5CZTA 1NTHA 4HHHA 3EOUA 2G4JA 1N55A 1QOXA 4C6MA 2E9LA 2RDXA 3KP1A 1CX9A 4NXSA 2PDYA 1CGUA 1EDQA 2I9EA 3GTNA 4GQ0A 1GORA 1YIXA 4DLMA 4OE7A 1R3WA 4LYQA 4YHEA 3PJUA 1KRBC 4KEZA 3GC4A 3CT7A 3R10A 4IIEA 3FNDA 4QQ3A 5A6SA 2YLAA 4PTWA 3ARPA 3BG9A 1Y5XA 1WYIA 3M5YA 1TJPA 5I2UA 1RQEA 1P0NA 3C6CA 2O7QA 3PWIA 1QU4A 3N1AA 1VFLA 1K77A 1IEQA 4ILSA 2DT2A 3U7VA 1QW9A 4KT2A 2F2HA 1JULA 1UZDA 4I9AA 1LLOA 5I78A 2BS9A 3QGVA 3NPUA 2E4TA 4IL0A 5DCBA 4IGSA 3M5VA 1LRQA 3A64A 3R7MA 3ME3A 2REQB 1RPXA 3W7RA 4HMDA 3DERA 2Y7DA 4UQAA 3AJXA 3GTIA 2BX7A 4PTMA 1SZRA 1FHVA 1C93A 3G18A 1T5AA 3E2SA 4X2PA 1YPXA 4TR9A 3WQDA 1KRMA 1R0MA 2XHYA 4FLSA 1IEVA 3KM8A 3WYZA 2X1SA 3CHFA 5FJPA 1A0EA 4JNZA 3QPZA 4BF7A 5I5RA 4M1RA 1QOPA 3O06A 3W38A 1J6OA 4GY7A 1PIIA 1RCOB 3IRSA 3M0HA 3CV2A 1FWJC 4GQBA 4M29A 3VMPA 1NU5A 4UTWA 1LJYA 2C3ZA 3LCHA 1H41A 3NL6A 3NO3A 2PDIA 1PEZA 1DWJM 4B5NA 4ZQCA 3AXMA 1CB7B 2EG8A 4I9JA 2OTDA 3CUFA 1X98A 5DRCA 3JRKA 2HK1A 5A8GA 3HFYA 1F61A 1O12A 4MYXA 1KXHA 4XSLA 3RIKA 6XIMA 1MWOA 3VGEA 3ALFA 1JG9A 1RZMA 2IQTA 4IUGA 2Z1SA 3HZ3A 4DQWA 1XXXA 3SCVA 1FA2A 1IF2A 4C6EA 3W1PA 4MFEA 3VM5A 4EPDC 2HDJA 5CCZA 1NDYA 2QV4A 2PP1A 3WN6A 5HANA 3QQ0A 1QK0A 4XZNX 3UR7A 4UOZA 2C0HA 4J40A 4YMZA 1KWKA 4GUFA 1CGYA 1PYMA 2QUTA 4XD3A 1ISWA 1RH9A 2FJKA 1FWHC 3BSMA 3ITCA 1VZWA 3BCJA 4LWWA 2IKGA 4RDVA 3FKRA 4TXEA 2JKPA 3QC0A 2HV5A 2J9YA 3U48A 4Z2KA 1YQ2A 4MG4A 1MXGA 4YWSA 4LB3A 1KQYA 3LPFA 5E6ZA 4A21A 3KDNA 2CWNA 4UQBA 1H0IA 1V6UA 1ESWA 3MT1A 2OWCA 3F4CA 3UZJA 3HQ1A 1V6YA 3H53A 3LRLA 4YTRA 1GVQA 1YMYA 1E1EA 4HVXA 3R89A 1AMYA 2BB0A 4D1IA 1BF2A 1FWSA 3AIVA 4FX8A 3TCEA 3S9ZA 4AEEA 5LIUX 1J9YA 4CU7A 4HCDA 4HJWA 4US6A 5A69A 1KLZA 2IMRA 3UR5A 1G4PA 4ROQA 1J0YA 3TONA 3PG8A 4Y90A 1AMKA 2ZRXA 3N4FA 5CGQA 1V03A 2NW0A 1KLYA 2VELA 4IMAA 2PWVA 4O1EA 4WHBA 2O9PA 5EFDA 4BK9A 4QS6A 1E4IA 1U1JA 4IQEA 3LK6A 1XP3A 3T0DA 3SUSA 2GDUA 1MMFA 3AROA 2EJAA 5KITA 3GNDA 1M1BA 2P0IA 3OBKA 1PV8A 3D3AA 1K8YA 1W91A 2ZBTA 1IT8A 4LVAA 4ZO8A 2ZIDA 2WZIA 5LNSA 4P7NA 4UFJA 1SR0A 5XIAA 4RJEA 3VIIA 4MWAC 1H1YA 4UOJA 2QGYA 2JF6A 1Z42A 1YDVA 2F6UA 3N15A 5BNKA 2EPLX 4OOUA 4AZHA 5CBJA 1E1FA 3AHYA 5E9AA 3UXDA 1JZ4A 4J9JA 3W29A 1W9BM 1O7AA 3U2CA 4DBEA 1QXLA 1CYGA 1WKYA 3WF2A 2CZFA 5HNTA 5LKYA 5FL1A 3M0MA 2BG5A 1SGJA 4HU4A 2YCLA 3UD6A 4U31A 4TX6A 3OA5A 5E9XA 4LNCA 3K8KA 3ITLA 1BQGA 2RDUA 1TIWA 3NYDA 1ZNNA 1FCUA 3IJDA 3A23A 3UXIA 3CJPA 2WMIA 2O55A 1WUFA 4QG9A 1FWAC 1ADSA 2XSBA 1ISZA 3CB3A 1V51A 3WEMA 3C2VA 1JZ8A 2D0GA 4YIWA 2IKHA 2I9UA 5L6UA 1CXFA 1W56A 5MF5A 1W2VA 3C52A 4DI8A 4YNGA 4R88A 2VZTA 3WJXA 2TAAA 5HAOA 1R7AA 2OEKA 5GNYA 1B9BA 4ONVA 2B7QA 2TMDA 3JZUA 1XLLA 4TVCA 1XLHA 3G5EA 5HPOA 1XD0A 1LTDA 4LAMA 3S5NA 3B0UX 1ITXA 1PTGA 2GOKA 2VFGA 4FHAA 4U2ZA 1HT6A 3TU9A 4RZ5A 1L2UA 2R8WA 1J0JA 3ENLA 4U3AA 4CQCA 2DQWA 4JIEA 4UMAA 2PDLA 4NYYA 3E2VA 1M7PA 4V27A 2FPTA 2PF8A 3W6MA 5E70A 3KOYA 3W1NA 4KCWA 4JTJA 2KZHA 1UKQA 3NO1A 3AS3A 1YXYA 4CQAA 4IGNA 2PFHA 1UBSA 3GO2A 2OCZA 3REQA 4WY0F 1XIJA 1ZAHA 3DU0A 3S5YA 5A3HA 1CXKA 4PMDA 3BLPX 2W61A 3MKVA 3BTNA 4J35A 1TJRA 3BJFA 4BQ5A 4JNMA 3GHTA 2GUUA 3DYPA 3E3HA 3GHUA 5M5DA 3KLLA 4CLMA 1UD8A 1LQ2A 1W3TA 3L67A 2Y5JA 4KFPA 3GDBA 5F4XA 2G3JA 1QRQA 1XJBA 1MDLA 1VP5A 2W91A 2WJDA 1Z7AA 1WKEA 2PWDA 3SUTA 9XIAA 3L5AA 2O7SA 1NF7A 1AVAA 4GNKB 4WSKA 2XM2A 1O66A 3LB0A 2Y7FA 3DHDA 4CNNA 1MW1A 1KFEA 3H2OA 1TR1A 1W32A 4O4VA 1D7KA 3LXCA 3UZXA 1JZ2A 4EXAA 2Q09A 1FKXA 4GMEA 1P7TB 3KS5A 2WC7A 3U2ZA 3MC5A 4IJBA 1UC5A 2FTPA 1LUCB 4UNLA 2WMGA 3BOFA 1E40A 4AH7A 3AS2A 3OW1A 1DTNA 3V1PA 3GAYA 1ONRA 3NYZA 4UQ9A 3EDJA 4BQ3A 1FDYA 4RL3A 1OJXA 3AMDA 2CBUA 2ZZ7A 2DT1A 3WLSA 1JVNA 3MMDA 5J04A 4YCOA 2PUZA 3H2NA 4BF9A 3WQFA 2HVMA 4O15A 4LVDA 4V28A 1OZQA 4GUJA 3VNDA 3SJ3A 4DAIA 2YBUA 3QF0A 3UQNA 1XR2A 3GFXA 2FZDA 5I24A 4LOCA 2FVLA 3QMTA 2ZRWA 1LCOA 2R6OA 1TTIA 1HL9A 2QJHA 4AXNA 1A5LC 3M43A 2WWCA 1BG4A 3WNNA 4QHRA 4PTDA 1PE1A 3SDOA 4GFIA 5JXQA 3TQKA 3LHUA 5H91A 2VRJA 5C55A 2YXOA 4GUGA 5JMUA 3EOEA 5HUPA 3O1NA 1S1RA 5C9RA 2EGZA 1QO2A 1M04A 4UZSA 2ZC1A 4PMJA 3SIZA 1Q4NX 2VZUA 1VIZA 2PWHA 2W4XA 4PUJA 3F5LA 3O07A 4E2BA 2OB3A 2BV9A 3AS1A 1OT2A 5K3VA 1I2QA 2HXUA 2J7DA 4JIIX 2XGIA 2OZ8A 4QBXA 4S2CA 1WB0A 4NJGA 1VKFA 4IM4A 2CLHA 1SPQA 3PVFA 2W79A 3G0UA 3SCNA 3C0SA 3SZ8A 1WKFA 1F9CA 3VU2A 4P8VA 3JS3A 1QW7A 6A3HA 3APYA 1F7BA 1NARA 2Y5SA 1AODA 3QTGA 3M0JA 3VKKA 1V77A 4J3UA 2ZUUA 3SN1A 2AKZA 4GI9A 3P8IA 4XV0A 2OZTA 4KF1A 3VD7A 1K4GA 3GDTA 3EWZA 2IQDA 1W3IA 4GVGA 4XD5A 2DSZA 3F4DA 2V5JA 4RUBA 4IH3A 3W7JA 4GRSA 1CI1A 3V75A 4CU8A 1Z41A 1A5OC 4N6FA 1B9ZA 2ZCGA 4BCEA 1XX1A 2QAFA 2D22A 3BMXA 4B5UA 2V2HA 4IXXA 1R3RA 4JFSA 3GD6A 3RCYA 3IUDA 2C18A 2XVGA 2CESA 3KHJA 1O60A 6TIMA 1O1HA 3H2CA 1TUXA 2OO0A 4GYJA 5FESA 2OJPA 2PTYA 1UASA 3TP4A 3LZ5A 2WHLA 1X1ZA 1DWHM 2CKSA 2WSKA 1Q85A 2Y89A 3VKAA 1IEXA 4PCNA 1H11A 2XVLA 3EMQA 4G7EA 4AW7A 3AS0A 3VIGA 3PJTA 5E0CA 1EHAA 3M0ZA 2WB5A 3VIJA 2OSYA 3TW6A 4PCFA 3FCPA 2OSWA 3QZAA 3H7RA 1ZCCA 5CAKA 4DYJA 1H4PA 1JQXA 4ZBCA 5KINA 4IMFA 4XK2A 2O9OA 4C6JA 5CSUA 4MPKA 3OBEA 3WD2A 4G56A 5LXEA 3WLQA 1B3YA 4CD4A 4L4LA 2VGBA 1KWGA 5D2TA 3QSTA 3WLJA 3WK0A 4FB7A 1KBBA 1NDWA 4AIUA 4LYRA 3FKKA 1UPPA 2PTDA 4BJHA 4QE1A 4NZJA 5KZ6A 4I5RA 4JQ3A 3DHUA 4DO6A 1A5KC 3B8IA 3IJ9A 3NQBA 4JQ2A 4CCEA 3E96A 2R1NA 1HQTA 1XQLA 3TN6A 4YTUA 1UOKA 1NQ6A 1TB3A 4A6GA 5EMUA 2ALRA 4Z2GA 1H1NA 4NAFB 3ARZA 1XLAA 4XZ9A 1GQJA 1VFHA 2J9ZA 2P0OA 2V38A 1THFD 2Y8KA 1DJZA 4Y9MA 3U0HA 4CCCA 2G97A 4LUJA 3UWYA 3I7QA 3FAWA 4EIVA 2BOFX 3LA4A 4C1NA 1DJQA 2NWRA 1I75A 5BOEA 4GY1A 3B4UA 4PUDA 1QWKA 3DEQA 1F3TA 5H8MA 4ZQMA 4QCEA 1NDVA 1NDZA 3Q45A 2C13A 1KFKA 2YOCA 4DZAA 2W3ZA 4ORIA 4W85A 3LMZA 1L6SA 3T55A 3URNA 1KFWA 4FLQA 2E5BA 4MWAE 3LERA 5FSDC 1JZ6A 2ZRZA 3I6EA 2RGMA 1YTKA 1MVYA 1Q6GA 3AUJA 4GCXA 4WJXA 3MDUA 3O6CA 3UBPC 4C6PA 5BMXA 1B3XA 1DXEA 1W1VA 2OFJA 3U5YA 4IFKB 4FXJA 2PE4A 2D3NA 4URIA 1V0LA 1M7XA 3AYTA 3OHMB 3AXHA 3PTQA 4HQVA 3UG4A 4OBSA 4OV4A 1QI3A 4XO6A 1OK6A 1SW0A 1REQB 3MJMA 4AF0B 3QBUA 1EDGA 4R5EA 2OT0A 3GFYA 3ZLFA 5AYIA 5CPLA 1V6XA 1AH3A 3WLMA 3O6YX 3D0CA 1SUXA 4NP7A 3CASA 4DJFA 2BASA 1YE6A 4KFOA 3T81A 4JTUA 3BO9A 5CC5A 1FHDA 4AX6A 3V7PA 4HSNA 2A85A 1I60A 3UZZA 1OD8A 2VX6A 2DZSA 1WAUA 1G6CA 2OODA 3ICJA 4EOUA 2CEQA 2WJZA 4W7WA 2CZVA 4H7VA 2PSNA 3HJZA 1GVFA 2VEKA 4E38A 2EEXA 1H63A 3KVLA 3BARA 2ISFA 2ZUWA 2V5LA 1YNYA 1MYRA 5D9NA 4FOKA 2EKGA 2W92A 3SFKA 3TJLA 3NNTA 4HU0A 4ICCX 4ZOAA 3W53A 1WOAA 3SUWA 3B9OA 4Q4RA 5CXPA 3WUBA 4Q8QA 2WSYA 2YKKA 4F2BA 3ZR5A 1DORA 4MLJA 5A6LA 3E1F1 8RUCA 3W85A 4ICNA 2Z0IA 2PGRA 1KCLA 4ZA0A 3GIYA 2OMAA 2ZOXA 3GBDA 4L4OA 4EPKA 4GYKA 2XIOA 4TMBA 2RUSA 1CTNA 2Q3OA 4QAIA 3GVVA 1K1DA 4S3BA 1UR4A 1TWSA 1EX1A 1TA3B 2PPGA 3LZ3A 4C1NB 3BICA 3CAWA 2ZE0A 2WMFA 1LL6A 4DWSC 1XRVA 4HJFA 1OB0A 4HPGA 1ZL1A 3NXFA 6ALDA 4LTSA 5KEZA 2PTWA 3CQKA 1YKWA 5CZ0A 2NUXA 3WDHA 1AG1O 3LU2A 3I3BA 3HOJA 5LIYX 1P0KA 4DBWA 4W7VA 5MHBA 2VJXA 4XQ6A 1DHPA 2X1UA 3BE7A 5CLWA 3LOTA 5HQEA 2VQUA 3WEZA 4QFUA 2J7GA 4QAWA 4LEFA 1SR9A 4JTIA 1EGVA 5BRQA 4JD4A 3W72A 2X1IA 3WQ8A 3KBMA 4XZMX 1GQNA 3CPGA 4O8RA 4HSOA 5ABFB 4TX9A 1NQKA 3FGCB 1UZ4A 4QISA 2QHAA 2NXIA 5C70A 5JIWA 1UD2A 4UNKA 3NA8A 4LS2A 3IV8A 1UR2A 3AIWA 1R87A 2PLKA 4K6AA 4JZ5A 3BMWA 4Z1DA 1C8YA 2WANA 1ICPA 4NAEA 3W1LA 3EPNA 5DY2A 4DJED 1QHOA 1ENUA 1PKLA 3SGGA 3KFTA 3EDEA 4H00A 4B92A 3S9YA 2F61A 3ANUA 4ZO7A 1OX5A 3O8AA 3CBWA 1VEOA 5DT7A 2Y7GA 1CZ1A 1SU5A 4QJ5B 3SB0A 2YBTA 3VKJA 4EF9A 4Q7NA 4HTBA 1R2TA 4MPQA 3KRZA 1H62A 2QCCA 1AA1B 3FV9A 2QDHA 5BZAA 4AZCB 1BWVA 5F1UA 3CHCA 1VBJA 2WV8A 2NSXA 3GYCA 1GZ1A 3BK0A 3DI1A 2FGZA 4GWEA 2HTMA 3SECA 4E8DA 5A5WA 3R12A 1V4YA 1OFOA 5CLTA 2DUZA 4JYFA 3QV8A 3M5ZA 3W84A 3ITXA 1OFBA 1HKMA 4RW3A 4IPIA 1E15A 3GVGA 3PZUA 2XH4A 4CGTA 5B80A 2C8NA 4S3DA 3IVSA 3STCA 2P8CA 5AZ1A 3WH7A 4B16A 3TK7A 1GKRA 4UTUA 1SW3A 2Z1VA 1QBAA 3OZOA 1XLKA 1HO4A 4H9XA 3ZVIA 5JH2A 4LBUA 2XUCA 4UBPC 3W25A 3CIVA 1JD9A 1DWFM 1SZFA 2F8QA 5A95A 1CEOA 3NIYA 4HZ8A 1L6YA 1F3EA 2PAJA 4PA8A 1MQPA 1RSCA 3BC9A 1Y7VA 1G0CA 4B9ZA 3UESA 3IK2A 1V7AA 4IGMA 3NGFA 1QPRA 3OIHA 4LAOA 4GIEA 2V6AA 3ABRA 2XJ7A 4HPNA 5I79A 2ZKMX 1GVSA 3G8RA 4L80A 4ES4A 2WPBA 1WZAA 2BBFA 3SBFA 3CUJA 5CPTA 4CN6A 2VFEA 1VS1A 4US5A 3GFZA 4P7LA 1HP4A 1U2YA 5EMMA 7ODCA 1XPYA 4AMAA 4AEOA 4TTGA 1TV4A 1UC4A 4CD8A 3MSGA 1BVZA 1PWLA 4C91A 3LG3A 1RUSA 4LCRA 4E8GA 1W3LA 4PTXA 3TTQA 4CU6A 3U6WA 1WUEA 1DP0A 1H7NA 3W82A 1XCWA 3S42A 1XGZA 1U5HA 4HNLA 3H8AA 2BXZA 4EWND 3HG3A 3JU2A 1IEIA 2A0NA 1JR1A 3CQ0A 4M82A 4A8NA 3CLWA 3KS6A 1SFTA 1OG0A 2A6LA 1U22A 2XGZA 3IUHA 4NI3A 4D6HA 3I4EA 1A5NC 2VKZG 1KQZA 3M47A 2XPKA 2DZPA 2D2HA 2RGLA 1XLFA 4H2CA 4R53A 3CZ8A 4HT3A 1O5KA 2AQOA 3P0WA 3IK4A 2PDWA 1G7VA 4IQLA 4MJZA 5G2WA 2EF9A 4I8YA 3GNXA 4HA0A 3TWAA 1BGGA 1XIDA 1TPH1 3Q58A 3W07A 3GSMA 3S1GA 2CITA 3SGUA 3Q4DA 4HOZA 1OEPA 4FNUA 4AD1A 1PVNA 3GYEA 3OBAA 1UYQA 2D20A 1PTDA 5I06A 5A8PA 1ICSA 4OKDA 3TNOA 1DVJA 4XBJA 3VX1A 4JPGA 1RY8A 1YE4A 4ROPA 2J66A 2YL8A 1A50A 4QDMA 1B3OA 3VX0A 3LRMA 1KCZA 2PCEA 3GZAA 3DENA 1K3UA 6XIAA 4X2RA 2FTWA 1AD4A 3QOMA 2E67A 3EA2A 2B4GA 3SAZA 5GJNA 1VBHA 2W63A 5JVLA 3EA3A 2GQ9A 7PTDA 2DJLA 4Q8WA 3TN4A 1CNVA 4EAYA 4PB5A 1WOBA 2E6AA 1VC4A 4RNIA 3EWWA 1BWKA 1ME7A 1RBOB 4JTGA 3VOIA 1BVWA 4PC8A 2INZA 3TSDA 2HPIA 5FF0A 5E09A 3IJ6A 4OBTA 3AICA 2W9MA 1DJWA 1QJWA 1OM0A 3CS2A 2WKLA 4HPXA 4E2DA 4UTFA 4X9YA 4HA1A 3P5YA 2V0TA 1F74A 3AZTA 4QE5A 3HPAA 2OKOA 4E6MA 1FFQA 2G8ZA 3TIMA 4DPPA 3RU6A 2VDHA 4CD7A 1OCQA 3U5UA 1P0DA 3AXXA 4M7SA 3QR1A 2ZX7A 3TC6A 4F0HA 3FLUA