4XO6A

Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
325
structure length
325
Chain Sequence
b'SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3 alpha-hydroxysteroid dehydrogenase type 3: structural clues of 5 alpha-DHT reverse binding and enzyme down-regulation decreasing MCF7 cell growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 116
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xo6A00
4JQ1A 1C9WA 4JTDA 3WBWA 3R6IA 2PDLA 5AZ1A 2NVDA 2PDHA 2R9RA 4YU1A 4XZIA 2HE5A 4XAPA 5LIXX 1T41A 4DBUA 2FZ8A 4XZHA 2DUZA 2PDNA 4XZNX 4IJCA 3M64A 3UZXA 1ZUAX 2FZBA 1VBJA 1AZ1A 3V0UA 2F38A 3LD5A 4IJRA 1Q13A 5HA7A 3D3FA 1X97A 3R8HA 3Q65A 5KETA 2I17A 4WEVX 5LIYX 4DZ5A 4DBSA 3H7UA 1EL3A 4GQGA 1EF3A 1MZRA 1QWKA 3ONCA 3O3RA 2BP1A 5JH2A 2WZTA 4FALA 4WGHA 3MC5A 3R43A 1EXBA 2R24A 4GA8A 3GUGA 3G5EA 2IKHA 3CASA 4FZIA 2ALRA 3N2TA 3ERPA 3GHRA 3KRBA 4WDXA 3F7JA 2IPGA 3BUVA 2J8TA 3LEPA 1X96A 4G5DA 1MRQA 3WG6A 2HEJA 3VXGA 1QRQA 3RX4A 4GCAA 4RPQA 1S2CA 2PDJA 3CV7A 2IPWA 1T40A 4NKCA 4H7CA 4JTQA 3COTA 4LAZA 4JQ4A 2PDMA 3UP8A 4PRTA 2DUXA 4JIHA 1Z89A 5JH1A 3UZYA 3V35A 3EAUA 1Z8AA 3V0SA 2PZNA 3WBYA 3R8GA 1Q5MA 2BGQA 2P5NA 2FZDA 1RY8A 2PDPA 4Q7BA 4L1XA 4XZLX 2PDWA 5AZ0A 2IKJA 2PDBA 1AH3A 1UR3M 3R7MA 4F40A 1PZ0A 4PUUA 5LIUX 1ZGDA 4H8NA 4GABA 3UFYA 3UZZA 1XGDA 3MB9A 1HW6A 3WBXA 2VDGA 3GHUA 2PD5A 4L1WA 2PD9A 3B3DA 4JQ2A 2PDYA 3BCJA 3P2VA 2FZ9A 4PMJA 4XO7A 4XVEA 4DBWA 2ACUA 4JTCA 3BV7A 2PDXA 2PEVA 2ACRA 2IKGA 4GACA 1FRBA 3WCZA 3UYIA 3C3UA 4FA3A 5LIKX 1JEZA 4I5XA 2ISFA 1GVEA 4XZMX 2PDGA 3V0TA 3DOPA 4YVPA 3R94A 5C7HA 3UWEA 3LENA 1IEIA 1PYFA 5HNTA 2ACSA 4XO6A 1ZSXA 2IPJA 4QXIA 2IS7A 3V36A 3U2CA 3CV6A 2AGTA 3S3GA 2I16A 2F2KA 1M9HA 2PDKA 1J96A 1IHIA 4QX4A 4YVVA 2PDUA 3BURA 1ADSA 4JQ3A 1OG6A 2HV5A 5M2FX 1RALA 4LB4A 3CAVA 2HVOA 4Q3MA 3CAQA 3QKZA 4EXBA 1Z9AA 2NVCA 3CMFA 1AH4A 2CLPA 4AUBA 4JIRA 2PDCA 2HVNA 4JQAA 4WDUA 4PRRA 1S2AA 4QR6A 3RX3A 1S1PA 1LWIA 2HDJA 4YVXA 4MHBA 4FAMA 4GQ0A 2ACQA 2FVLA 3G1RA 1X98A 2IKIA 4PUWA 3GHSA 4LBSA 1AFSA 1PWMA 3LUTA 1YE6A 4LBRA 3LZ3A 1RY0A 2PDFA 2IQ0A 2PF8A 1US0A 1R38A 4JTAA 3EB4A 5LIWX 2INZA 3LN3A 1LQAA 1XJBA 1EKOA 2INEA 3H4GA 4YS1A 2PFHA 4ICCX 1HQTA 2DV0A 4JTRA 3RX2A 4LAUA 3H7RA 3UZWA 4ZFCA 5DANA 1YNPA 2C91A 3DN5A 2QXWA 3FX4A 1AH0A 1SM9A 1ZQ5A 1A80A 3O0KA 5HNUA 4HMNA 4WRHA 1XF0A 3LBOA 1YE4A 3M0IA 3UGRA 3LQGA 3LNMA 3Q67A 4OTKA 4HBKA 2A79A 4WDWA 2HE8A 2IQDA 1PWLA 1PZ1A 4LB3A 4PR4A 4XK2A 4EXAA 2IPFA 2PDIA 1MI3A 4IGSA 3LQLA 3LZ5A 3N6QA 1AZ2A 3FJNA 2FGBA 2PDQA 3NTYA 4R9OA 3M4HA 1YNQA 4QBXA 4JIIX 4XVDA 3GHTA 3ONBA 2WZMA 1VP5A 4GIEA 3T42A 2BGSA 3UG8A 3R58A 3EB3A 4ASTA 1S1RA 1Z3NA 1K8CA 4WDTA
chains in the Genus database with same CATH superfamily
1HJWA 1R7AA 4NL1A 2WNNA 4L56A 3WLLA 3PANA 5D9MA 1DYSA 3O2LA 3WFAA 2ZUNA 1QU4A 1BWLA 2EG6A 3I3EA 4XZNX 1BSIA 3LMYA 3W7CA 2HISA 2Z1KA 2OOFA 3WYZA 3SIMA 1F5ZA 4ROQA 5KETA 2CHOA 3ID7A 4AMCA 1KV5A 2BOFX 1Q8JA 4JL2A 9XIMA 3EOSA 1VBHA 4ZQRA 1MZRA 1HL9A 1NFGA 3PZTA 1CZ1A 4LYRA 4TTUA 5G1MA 2I57A 3OBEA 2J7EA 2E8ZA 1TPFA 2QF8A 4ZQOA 1O68A 1U5JA 1O5XA 4LTSA 1DL3A 1OK6A 3WLPA 3CQHA 3CIXA 2R24A 2ZRYA 2C79A 2JKPA 3G5EA 4DUWA 2YA2A 2FMOA 1GQJA 3QW3A 3OLDA 4NJHA 4ZBCA 3K1DA 2XU2A 3PSWA 1PHQA 4OUIA 3N4FA 2Q8LA 1XWYA 3BLOA 3RRAA 4QAIA 3BUVA 4TU1A 4JL1A 3UG3A 2F2HA 5EPDA 3WLKX 4GFIA 4I7UA 4V27A 2DIJA 2E9BA 3GTHA 4PB5A 5I6SA 4IL2A 4QG8A 1QRQA 1B4KA 4HSOA 2GVYA 3MY9A 2JE8A 2IPWA 1N8IA 4CUCA 1T40A 4RNJA 1WZMA 3MWAA 4JTQA 2NSXA 5ABHA 1T6MA 3SGGA 3KM8A 3SCWA 1C93A 1H61A 4W8BA 5CPMA 1IGSA 2CLEA 2BY0A 4B2DA 1NTHA 3B0PA 3K30A 3U6WA 2YOCA 3QPZA 4GGHA 3IRSA 1DXFA 4AEEA 4XISA 4UFLA 2QEZA 1XIIA 3THDA 1EQCA 4X0NA 1BVZA 1XIBA 1JYVA 4N9DA 4WJXA 3RNDA 1SO3A 3L0GA 2Q71A 1B5TA 3CAWA 4BY3A 3NQEA 1FWTA 1CWYA 4MFEA 5C2XA 4MZYA 2UY3A 1M3UA 3W74A 1W3NA 3UJRA 1B9ZA 1XISA 5M5DA 3IACA 2NV9A 6REQA 1UB3A 1W8GA 5LSMA 1T5AA 5FJIA 5DMNA 1A5NC 3F5JA 3NGJA 1XRTA 4Z2JA 1B3YA 7REQB 3L4UA 2YR1A 2O9TA 2Z6IA 2OOGA 3TW9A 4E2OA 4HHMA 1KLYA 4GG9A 5JUVA 3S2JA 1UJPA 1UKSA 2YZRA 2J7HA 4EPBC 3S46A 1HJQA 3M1ZA 4A29A 3BSMA 4KFPA 3G1SA 3GG8A 4DWSC 5I7GA 2YB4A 1Q8AA 1OYAA 5BXRA 2H8ZA 2C15A 3AXMA 3RCMA 3EWXA 1FOBA 2G3MA 4GMEA 1LZOA 1G4SA 1QWGA 3WQ4A 1UD6A 3S5NA 3TYZA 4NZ4A 1YPFA 2G50A 2PDKA 1O6IA 1KFKA 1TV4A 1EJUC 1VJSA 2F6XA 3DBNA 1FWBC 3SGUA 4FLQA 2FHBA 2XINA 4CNOA 1UD4A 3VKBA 3I6RA 3GNPA 3MMUA 1PKYA 4MWAD 2V3GA 1QNPA 3NL3A 3CMFA 4EAYA 2QPUA 1W0MA 4QS5A 4ML9A 2G8ZA 3U5UA 1EXPA 3R0KA 2NW0A 1J01A 2FFIA 5DRCA 4C6MA 2VX6A 4ZTYA 1SPQA 2HJPA 4UOJA 3XISA 2OLAA 1F3EA 1DOSA 5LA0A 3QH2A 4JNMA 4ZOEA 3WF1A 2YBTA 1FWHC 1W17A 1LOQA 1JZ5A 1POJA 4ML4A 4PUWA 2UZ9A 4N9BA 5GJMA 1B57A 1CXIA 1PWMA 1M5WA 4N0RA 1CI1A 1RPXA 4GXPA 3VK5A 4FXJA 3RN6A 5TF0A 4C1LA 1S3HA 4XKMA 3A64A 3BJFA 4DPPA 3LGGA 2ZVRA 4QJ3B 4HJWA 2QPXA 3VD5A 2O9PA 1EKOA 3SY1A 1NQ6A 4GK8A 3GU2A 1SZNA 2XM1A 1CGWA 3WFLA 1T96A 1NFPA 4KEUA 2WKJA 2QUMA 1BKHA 1VFOA 1REQA 1UWUA 4MADA 1X7IA 1BVWA 3AIEA 1NWSA 4B5XA 2ABAA 3VIPA 1KKOA 3LXBA 1OWQA 4PMQA 3G0XA 2XWDA 2GYIA 4LS1A 2D1ZA 2QAPA 3USZA 3ARPA 5HWJA 2WQPA 2X7VA 4A4AA 4FX8A 2YL5A 4H3DA 3VX0A 4O1EA 2G95A 1ZB5A 4IMDA 1EA0A 1D8CA 2EG7A 3LNMA 1QNSA 2X05A 2A85A 2H9AA 4WF7A 3CMGA 1GKRA 3MKVA 6CGTA 4TX8A 3LRLA 3POHA 3G22A 2DY3A 3BLDA 1KKRA 3HB9A 4AX7A 1JQXA 5JXQA 2Z2AA 5AYIA 5C7VA 1GKPA 2ZUMA 3QY6A 4LUYA 4LV9A 2HPMA 3W6LA 4RZ4A 4XVDA 1UBPC 1E56A 4K36A 3W2UA 3TN5A 2W66A 1QI2A 2A2IA 1FCVA 1FWGC 4P8WA 1U5VA 4S38A 4GZ7A 3WUEA 5CGMA 1A4MA 1HGYA 3DGRA 4O8AA 1XH0A 2VEKA 1EUNA 1JAEA 3L4WA 4QS6A 4BKNA 3AYTA 4XIMA 2I9UA 4F0LA 4Q8NA 4HNTA 4E3TA 2R9RA 3VOCA 1E70M 1H5VA 3VZZA 4YYFA 4L9XA 2FHCA 4QJ1A 1FKWA 2Y1HA 1J9YA 4P7QA 3R8RA 2X41A 3KAOA 3W37A 5CC7A 2GGGA 3SUTA 4ATLA 3IGUA 3U5YA 1EC7A 1Z41A 3G1XA 4GYJA 1I1XA 4US6A 1WBJA 5C70A 5E0CA 4L4MA 5HPOA 1UJQA 3WJWA 3CHEA 1XR2A 1UD2A 5AC6A 3JR2A 2E1DA 5BWAA 1A0DA 2BFGA 3H2EA 3G0UA 1I2OA 3FXGA 1TA3A 3IK4A 1TCMA 1EX1A 4IIDA 3ONCA 1I9CB 2BP1A 3MUAA 2PP3A 1EJ7L 3AHXA 1OIFA 1XPGA 2WO5A 2HVMA 2P50A 3GWQA 3Q58A 3ISIX 4TVDA 1L8PA 2QQ6A 1Q85A 2O56A 2AL2B 3DFPA 3PBWA 3N2TA 3WLHA 3QSRA 2AMGA 2YFOA 1W1PA 3C2OA 4DBDA 1WBHA 3U4AA 5HPCA 4ORMA 2CBJA 2O55A 2PTZA 1AQFA 3N9KA 2JEPA 4K8GA 5ABGA 4XD3A 4BS0A 4ERIA 7CGTA 1C7SA 3PAOA 2CYGA 2ZZ7A 1WKEA 2OGYA 1CXFA 3QM3A 1AJ2A 2DZUA 3FYPA 4RW5A 7PTDA 3VKCA 3UG4A 5M17A 3MWCA 2I5QA 2BGQA 2P5NA 3UWVA 4HNNA 4M8UA 3KFTA 2J62A 3JU2A 1Y5VA 2PDWA 2CNCA 2VX7A 1AL8A 6XIAA 1RLDA 4KWOA 2IKJA 3E2QA 3K46A 2X2GA 2Y6ZA 4M80A 1EPVA 4NIRA 1IR2A 4X61A 3EWWA 3TR9A 4IIBA 3UWYA 3S6TA 4A3YA 7A3HA 1X1ZA 3TW7A 4ADTA 2BV9A 2WC7A 4H41A 1PAMA 1TTJA 3NQCA 2Y7DA 2WWCA 3TCEA 2A1YA 5CBBA 1PSCA 4URIA 3NPWA 3QV9A 3TYEA 2C71A 4M19A 4DVOA 4L4PA 1JD7A 1W31A 2QJMA 4JTCA 2D0GA 5HJLA 5HQMA 3GK0A 1DBTA 1FWIC 4HNLA 1EH9A 4B4FA 1JGMA 1V7YA 1CBGA 1HKJA 1LYXA 4LRSA 5LGZA 1KCLA 3AIUA 3NPVA 4IFRA 1UIPA 1UKOA 3JRKA 3KBNA 2PDGA 3FA5A 2VXNA 3N2OA 4Q4SA 2WSQA 2O92A 4NJKA 1W5NA 3LSBA 3LXCA 4YHGA 3UJSA 1TUFA 3BAXA 2V5LA 1IEIA 2HTMA 1XI3A 1W9BM 3B8VA 3PTDA 3W25A 5DY3A 3T09A 1PTAA 2QR6A 3WJZA 4CD5A 1QPKA 1Q6EA 1SW3A 4FNQA 4HA1A 3TJXA 2E8YA 3FKKA 2CLKA 3WQ5A 2PDUA 1FH8A 1KFCA 3WN6A 1YDYA 1ALDA 4HNOA 5BMWA 3GG1A 3W7GA 4R53A 2NT1A 2PE4A 4GI9A 5E1QA 3H70A 3U4FA 1SU5A 1PX3A 1YXCA 2VOTA 3IUIA 2PDCA 1N55A 2YLAA 4W84A 2DGAA 4AF0B 2D2HA 3VM7A 3ZM8A 5EMUA 3W6YA 5BXPA 5IM51 1R30A 4PCSA 5LNWA 4MMWA 1X98A 3KDNA 2ISDA 4MKSA 1ZNNA 1TVPA 3EKLA 3P67A 4UFJA 4GXMA 3GIPA 1Z42A 3C2VA 1SZEA 3W01A 1HKKA 5HNRA 2J7GA 1IR1A 4DXVA 3VNLA 3B8IA 5KITA 3CHFA 3F4NA 2I5GA 4GUFA 3KCOA 3THAA 3M47A 3K4AA 2WB5A 4D71A 3KL3A 1AK5A 3N15A 2ASHA 3RRXA 1W5PA 3SUVA 1XG3A 4GKLA 1VKFA 3L7RA 1UC5A 2DVUA 4D6CA 1DWHM 2WNQA 1LLZA 3QQ0A 1SSGA 2A3LA 1NIUA 4J7RA 4DM2A 2OO6A 3EOLA 4EVZA 1YLVA 4DY1A 5D03A 4GD0A 3LPFA 2VR2A 3G77A 5CPTA 9RUBA 3CIVA 1BG9A 4O28A 2B7PA 4WDWA 3Q37A 4UFIA 5I09A 3WQVA 1KGXA 3OEXA 3PB2A 1K4HA 1PZ1A 3GNNA 4EXAA 2PUZA 5CG7A 4J3XA 1I2RA 4S3GA 2Z29A 4FR1A 3GDKA 1JXKA 4AXNA 1QR7A 3GQYA 3TTEA 3E02A 2O7QA 2BASA 4KCUA 2QCNA 1IEVA 1IWPA 5KZ6A 3AICA 4PGLA 4F0MA 3T42A 3W38A 5GQBA 3N29A 1ME7A 1DWGM 1R3TA 4ASTA 4GZIA 4DN1A 4Z0SA 1WZAA 1VS1A 4WDTA 5HQEA 1US2A 4JQ1A 3IS4A 4LUIA 3NM1A 5EMJA 4K37A 4UCFA 3LHUA 1TQXA 2PA6A 3K13A 4G2DA 4IGHA 3O6AA 1PV8A 1ZP3A 3GXIA 1US3A 3W7QA 1WXZA 2DW6A 3DDMA 2EG8A 4P8XA 3Q4DA 4V33A 5BW6A 1GUVA 3V0UA 2HWGA 4AHQA 1CXHA 3PF3A 1HZYA 3O05A 4DZAA 3B8DA 2NUYA 2X1UA 4AYGA 3ITXA 3TR2A 3KLKA 1B3WA 1LM1A 3DAQA 1PBGA 2H6RA 2NT0A 4O11A 1I6NA 3ECQA 2VYOA 4HD5A 3GKFA 4CN4A 1U22A 3G1HA 2DZXA 3M0JA 4BFAA 1EJWC 5C9UA 5HJYA 1QT1A 3WH9A 3P62A 1BQGA 1V3KA 1BAGA 3LX9A 3BDKA 3LLXA 1KXQA 4HK5A 4FO4A 1PZ2A 2DZVA 1TJPA 3JW7A 1YMYA 3BV4A 3KOYA 2ZCGA 4EX4A 2BTMA 4CQDA 2DP3A 2VGGA 3S1WA 3NZ1A 2D0FA 5CSYA 3QR3A 2WWDA 3DUGA 3SEPA 3NDOA 2R1KA 4KFOA 3MSGA 3DFYA 3BAJA 3PTKA 3UJEA 3W1UA 4S3FA 3EXTA 5GNZA 5J5RA 3LY0A 1LG2A 3TLQA 3QHNA 2ZKMX 4OE7A 2WANA 2J24A 3ZO9A 5I2UA 3URNA 4V15A 3QHOA 1JDCA 1HX0A 3RYSA 4ZCWA 1UD5A 4LUSA 3H4WA 1KR1A 4L64A 3AXXA 3CZJA 3UP8A 3I4KA 2QJJA 3WENA 4CQ8A 1KCZA 2OZ3A 4NZCA 3CYVA 4I6KA 4ADSA 3KCJA 5DX7A 4NZ5A 1PXGA 2ZA2A 1R86A 2ZX8A 5FD0A 4HTYA 1XYBA 3FA3A 3CB3A 2E40A 3B03A 1UR3M 1TPB1 3HJEA 3E12A 5IDIA 2VGIA 3H23A 2CETA 2E5BA 2NWRA 2OTDA 3OVGA 1LLWA 4ZOAA 2ZVIA 3UESA 3SQSA 1GW1A 2QCMA 1E4IA 4W88A 1XL9A 2VDGA 2PD5A 4UZUA 4JKLA 4F48A 2A3CA 1HNYA 1JD9A 2ZRUA 1P6BA 3QYSA 1QI3A 3CYJA 1MYRA 4F9JA 1QW9A 1VYPX 1IXOA 4PMJA 3PUDA 3W1MA 2J7FA 5C54A 2GQAA 2IKGA 1OT2A 1G67A 1H4PA 2YCIX 2CZDA 3MO7A 5ECUA 1WOAA 4U10A 1J0HA 3QFEA 2PGRA 1P43A 1PJ9A 4B91A 3U3HA 2WLYA 1OZMA 2EGZA 2B7OA 3FY1A 2V68A 3HOJA 2Z25A 3MVIA 4C6EA 2ISSA 5HNTA 4JTTA 3GU1A 2P0OA 4C6KA 4DO4A 3E2VA 1JPHA 2WMIB 3I6TA 4PTXA 4IPNB 3ZSSA 3OBKA 5FJTA 3MANA 3RLVA 4Q6XA 3W27A 5G4WA 2V81A 1DWAM 1E0WA 3DI1A 3RHGA 3O06A 3E9AA 1JJKA 4PB3A 4MSSA 4NSBA 1GOKA 2E6YA 3BK0A 1FP8A 3CAQA 1Z9AA 1ZU8A 2FB3A 3S5SA 1IT7A 4RNIA 2CLPA 1TX2A 2NV1A 2VZVA 3TW6A 3BCDA 1K8XA 2HROA 5G1TA 5CCZA 1LRQA 2ANUA 3P60A 4JD4A 5HK4A 1IEXA 1N7KA 1VBUA 2RDTA 2W63A 2INFA 3QLDA 2P0IA 4B5UA 2G97A 3K2GA 2GQ9A 3LPPA 4LRTA 5A2AA 5F2IA 1XIEA 4RNHA 3OHIA 1V6TA 3YPIA 3WDRA 1RCOB 1O94A 4NZFA 1RY0A 3BANA 4ICNA 2QCCA 3CQKA 4GZJA 3USBA 1LQAA 1NY1A 1XIGA 2PSNA 3BSHA 3STGA 3MV01 1LT8A 1Z48A 5CH9A 1ZALA 5D38A 3GDLA 3QOKA 3WF4A 1O12A 3TDFA 3AXKA 3NOEA 4LAUA 2DT0A 4ORIA 1RA5A 3UZWA 2Y7FA 4PCNA 4WJ8A 4LYPA 1XKYA 4NRRA 2WVUA 2PGFA 1JDDA 3DIPA 1ECQA 1OF8A 4MGGA 3WD2A 4HKPA 3TE9A 2AL1A 4JTSA 4ZENA 5I3JA 1EGVA 1Y0EA 1KBKA 4BZYA 5A8NA 1W3IA 2P88A 4JBRA 3LS9A 5BOOA 5AY7A 4LUTB 5I3HA 3WMBA 1PIIA 3WLOA 2YA1A 3NO3A 4KWWA 1JF5A 1ODUA 4ZMGA 1VCFA 4JXCA 3CWNA 4IGMA 3WBEA 1ZAJA 4W8AA 4E6MA 1NH6A 1XLKA 1YPXA 3H21A 5HAOA 1Q2SA 3F03K 1WXYA 2NX9A 3DFOA 3SJ3A 1HVQA 3WH5A 5KSWA 5H6HA 3NQMA 1DE6A 1EYWA 4YXGA 4W87A 4R9OA 3HV8A 3MBFA 4RE2A 3ONBA 4FOUA 1DQWA 1C3FA 3AIVA 4BI6A 2DT2A 3I7QA 3WMCA 3AI0A 1E51A 4Y90A 3TZFA 1EZ2A 2QPSA 2CLLA 1M7JA 3PZIA 2C7FA 2HSAA 3WLSA 3BG9A 3GRIA 4ZOCA 3HPSA 1BXNA 3EA3A 5CZJA 2CWXA 3HBLA 4C1NB 4L4OA 5CEWA 1YTDA 5IDZA 1A5KC 1AA1B 4LBUA 1CW2A 1MWOA 4YL2A 5A8OA 3H2FA 2J74A 4O10A 4WCJA 2RDWA 4M0XA 1F76A 2YIHA 4UFMA 5GNXA 3SN1A 4UCGA 5FJJA 3AISA 3WQOA 4B5NA 3MPGA 1TWWA 3L67A 3HG4A 4H7ZA 3I6EA 3GAKA 1HT6A 1TV5A 2DU2A 1V3MA 2C0AA 3BC9A 3CPRA 3REQB 3TYCA 3VNYA 3UY8A 3FLUA 2BVDA 2XYLA 3SFWA 3WMLA 4NY2A 3PJUA 3LTYA 3LM3A 3TONA 2XWEA 4UIOA 3VINA 2VEPA 3B4UA 3PZUA 3S2NA 2RGMA 4HZMA 1XIFA 4S1FA 5IXEA 4AIUA 1JCTA 1GHRA 2C8NA 3QR1A 2IPGA 3EKGA 3PC0A 4UTFA 4Q4OA 4H2HA 1X8FA 1LROA 1WDWA 2RJHA 3AHTA 3EDDA 4QM1A 3RX4A 4JGDA 2AOSA 4LYKA 1PIGA 4GCAA 1REQB 1UP2A 1ODZA 3CV7A 3RCYA 3WD4A 2BB0A 3IPWA 5EKYA 2A3EA 4AZ7A 2Z27A 5I79A 3RM4A 1DWJM 1V5XA 4JX5A 4TV6A 3P6LA 5CSSA 5EMKA 3W1RA 1FBAA 5DF0A 1FVPA 5JH1A 4P7NA 2Z28A 3R8GA 3T0BA 1G5AA 3W02A 1QDSA 1AJ0A 3GAYA 4OBRA 2D69A 4Z2LA 4HK6A 3EB2A 4FIRA 3ORWA 4UOQA 3VDHA 3UQNA 3WQCA 1AW1A 1GG1A 3LPOA 5EL1A 5CC3A 3DZ1A 3CUXA 3A6OA 3WDQA 4Q4QA 4AVFA 1E6XM 3N14A 1Q6QA 1MXGA 3HFYA 2LLEA 2VR4A 5HMFA 1XGDA 3PFMA 1J0JA 4GI4A 1HW6A 3GBDA 2NQZA 2PPGA 4KFNA 1TJ0A 1XFCA 1YBQA 4LNYA 4PBGA 3ARRA 2I14A 3W76A 4ILSA 3MW7A 4PE8A 4NNAA 2OX4A 4OZOA 4LYQA 4BI7A 3NGFA 1DHPA 3H7VA 1J5SA 1IIHA 5DQPA 1AJZA 2TAAA 4BJHA 5LXEA 3RU6A 2A6NA 3VKAA 5HANA 5BMXA 3FCPA 5TIMA 4A3RA 4GY0A 1SFLA 4YTQA 2FB2A 1OFEA 1JCLA 1G69A 4H4IA 3MUIA 3KBMA 3LGEA 4CQAA 5FAGA 1G6CA 4DXKA 1MUMA 3N3TA 2WVVA 4YN5A 1KR0A 3UWWA 5K9DA 4XD4A 2X0HA 3G1YA 3NQ2A 1YRRA 1JCJA 4CN1A 4YVVA 3VCRA 4F79A 3CO8A 4O1FA 4O0ZA 5M2FX 4FF7A 5C9RA 1YPIA 1KTNA 3LXAA 1NF0A 3WLTA 2YYTA 1JFXA 4LVFA 5T9CE 1CB2A 1UPPA 4AUBA 2DVTA 2XZ7A 1HUVA 1B4EA 3TLLA 1U30A 5A3HA 5A5WA 1ZHAA 1F3XA 4MJ4A 7TIMA 4PSRA 1W1YA 4Q8WA 3CT2A 3WNLA 4U5KA 1GCYA 1UR1A 2Z1XA 3ARSA 5EB8A 4JTJA 2WZHA 2ZX6A 2VZUA 5A94A 1G01A 1KRBC 3CEPA 1K7EA 4FF5A 4GYPA 3GC2A 2V2DA 4BK9A 5ABTA 5L6UA 3R0DA 1WQ5A 1RXOB 2C16A 3CZGA 2D3NA 2PC4A 1VAHA 2OYMA 3NCOA 2MUCA 1NELA 3TMLA 3W9ZA 1Q6OA 1K6WA 2INEA 3W7RA 1M65A 3CPGA 2DV0A 4A8NA 4XAFA 3VIMA 1E1CA 2PGWA 3HG3A 4PEEA 3B04A 3MYPA 3RU8X 1CB7B 1W56A 1QJWA 5LZLA 5AFDA 3CS2A 3DU0A 4UTKA 2J79A 5HXMA 1F61A 5JQ9A 5H91A 1FFQA 3PZGA 3VDAA 4JHMA 2PURA 3TSBA 4OJYA 1OD0A 2W27A 1NWRA 2OQHA 5LHEA 3GUWA 5A6LA 2F84A 4HN8A 4HYVA 3R0UA 1XSIA 2FGBA 1TPWA 1F3TA 2WM1A 1XHGA 1LQ0A 1RD5A 2JF7A 2ZZ5A 3DERA 4JDYA 3WSUA 1VH7A 1SVDA 1VP5A 4DJDA 2BY3A 3VFLA 4ERGA 4WXYA 1E5NA 1E43A 2BOEX 2E5CA 4UQAA 3M0HA 1DWFM 3A3HA 4GKTA 3LA4A 4QISA 1E0VA 3GVQA 4IQLA 4R7WA 4ATWA 2V5BA 2VC7A 1F6YA 5CPLA 4YTTA 5REQA 5IOBA 4JNZA 1ZBVA 4UQDA 1E1FA 1VEMA 3GVRA 4D8AA 1KLZA 1RPKA 4Y9AA 2QS8A 4Q6JA 3I7RA 4C6PA 4ZTXA 1R5YA 1E15A 4IFKA 4R5EA 1B30A 4WEVX 5IHSA 1WKYA 3XINA 2PCEA 1NJJA 2BMBA 4XAYA 4MF4A 1VFSA 4XZ9A 3EBVA 1HGWA 4OGZA 3B8UA 4FALA 4L65A 4CNTA 5A8PA 1XYFA 4E0CA 1EXBA 2XFWA 4LGXA 5DMLA 1NM9A 3B06A 4DUOA 1TPUA 4FZIA 2ZXAA 4PMYA 2ZIDA 2NX1A 3E0IA 3LG3A 5FF0A 3TOPA 2QLYA 4Q4MA 2VL4A 4Q8PA 8A3HA 3GSMA 2OODA 1Q7ZA 3CH9A 4XBSA 4I7VA 4HZ6A 3I10A 5A6TC 2HEJA 1HIZA 3MSDA 2VFHA 4N02A 4AH7A 1RZMA 3KZPA 1AD1A 3HQNA 3H12A 3GIQA 1G4EA 4FLRA 3RUBL 1S2CA 1XRFA 1YEYA 3HF3A 3TTQA 3AYVA 4D6EA 2L5HA 1OHLA 3LHWA 5AYZA 1VIWA 1IWBA 4DWSD 1EGZA 2VEFA 4PMZA 4GO8A 3GU9A 4PULA 1VLWA 3OG3A 3NZPA 3W2LA 2GJLA 3DX5A 4LF1A 3KEHA 3HG2A 2J6VA 2FZDA 1EOKA 3DFTA 1NOWA 2I56A 3KBSA 3B9OA 3OA5A 1QNRA 1XLMA 2C18A 1T8XA 1U83A 3NURA 5LIUX 2V67A 3S2MA 3KE0A 5LNUA 5JIPA 5JVLA 4PUEA 5I02A 3T0DA 1A3XA 1YDOA 3G0SA 2E3ZA 5F7UA 3ZVHB 3NO1A 2PRMA 3L21A 3QC3A 3UVIA 4O50A 2YL8A 3AXIA 5A1AA 3VMOA 2PD9A 4K39A 1J0ZA 2Z24A 3E38A 3II1A 2G96A 4GBDA 3MUY1 3ATZA 1EZWA 3MMDA 4GFSA 3AHZA 4M56A 1XYCA 1KQZA 2PDXA 3LERA 4HYWA 3RO6A 2WHMA 3PZQA 2D22A 3WK1A 4HNCA 1E0UA 2I5IA 4Q22A 1VPXA 2WPGA 2FPVA 1WXJA 5LIKX 2A4AA 3OLEA 2VTFA 5CZKA 4MWAA 3W7IA 3PJWA 2J27A 1OGGA 4TX9A 4P5UA 1RQBA 2CFFA 3HA1A 2BS9A 3Q45A 4Z2IA 3N2MA 4FXSA 5DT5A 2Q3RA 2BXZA 2PAJA 3LENA 4QHRA 1BPLB 1R87A 2O9RA 3LM7A 3P0WA 1ZSXA 5I03A 1XW8A 4MNJA 3U2CA 1L2QA 3S3GA 3TA6A 3UR7A 2F2KA 4NU7A 2C19A 2DH3A 4H83A 1YXYA 1G0CA 5KTLA 1GZJA 3G3MA 4JQ3A 3NDZA 1JCMP 4E4PA 4D6HA 1KNWA 1H50A 2QF7A 3S9ZA 2VEGA 3E0LA 1NAL1 2WKLA 1NOFA 2QDDA 4OVXA 2OT1A 4JQAA 4GHRA 4NNCA 3GNXA 4QG9A 3RO8A 2GGIA 2Q8XA 4WGXA 3SW6A 3WL0A 3PBUA 1UOKA 1UKPA 2YX0A 4N4PA 2VJXA 4AD3A 4UR9A 5HMDA 2FVLA 5AB3A 3GHSA 1UH4A 3ZQ9A 2WC4A 5A2BA 4B90A 3RK8A 4ACZB 2E0PA 1ML1A 1VR6A 2Z1SA 2BGNE 4LUSB 2R6OA 3CM4A 4LEQA 2PF8A 1US0A 3L4YA 4Y9NA 4JIQA 3SY5A 1XIDA 1JDEA 2WJEA 3OGVA 1ZP4A 3ABXA 3CWHA 1UR8A 3DBPA 3EYPA 2GGEA 3AO0A 1ZENA 4W93A 1UWQA 3QLLA 3BW2A 4ZR8A 4H9UA 4F2UA 5A95A 2BOGX 3TYDA 2FJUB 4YCPA 3VMNA 3KS6A 3G8EA 3VKJA 2RUSA 4HMNA 1UP0A 1U1HA 1XF0A 5B7ZA 4J40A 1TB3A 4AY8A 3IVTA 4B5SA 3A3WA 3UGRA 5D32A 2X30A 3GYEA 3N2CA 1W5MA 4AWEA 3DYMA 2YXGA 1LDCA 1XINA 1F73A 1XLDA 2HCVA 4GJ1A 2BWGA 1ECEA 3NQBA 4QSHA 1SO6A 1TTIA 5LA1A 3VDBA 1AZ2A 3MMWA 4YMZA 3DFSA 2H8XA 1QAPA 2E67A 1RVKA 1YNQA 4WKAA 4ZQPA 1XCWA 3R2GA 1ICQA 3HO8A 1K4GA 4DX3A 2R8WA 3FN9A 1B3OA 2X7WA 4MY8A 4DO6A 2XIMA 1E6QM 3EB3A 4OT7A 2OSWA 1L8NA 2AQOA 1O7AA 4BR1A 3GVWA 1C9WA 3AJXA 3WBWA 1A3HA 1R85A 4I5RA 3WJSA 1T0OA 4YU1A 3MDWA 1PX4A 2GDVA 4KCVA 3B8WA 5I24A 2QVNA 3V7PA 2QHAA 3F4DA 1XQLA 3VDCA 1V3LA 1C29A 3P0XA 3MKCA 2PDNA 5D9OA 3W84A 2VZSA 6TAAA 4IJCA 4OBSA 3M64A 4FX7A 4LC8A 2CBUA 4O12A 2GWNA 3WL1A 1OVDA 1GKQA 2UV8G 3L68A 1OFQA 2FVKA 3NG3A 1J93A 4JCLA 2AQWA 1IYXA 1ZPTA 3FJ6A 2QJNA 5LA2A 3V16A 3WQFA 1AL7A 1EL3A 4NAEB 3DKLA 3NZRA 3S1VA 3Q94A 1Q6FA 2V69A 2F61A 1NWUA 4MNKA 3O3RA 3KRZA 2QDGA 1E40A 1P0NA 3B9NA 1ADDA 3LCLA 2WZTA 4AIEA 3OQEA 4FS9A 4BF5A 1JRCA 4EXQA 4UXDA 9XIAA 1DHKA 1CENA 1W3JA 4E38A 1V0LA 1XYMA 3R13A 4V28A 2UY2A 2C0HA 3EX6A 4PA8A 4CVUA 4X2PA 3OO2A 2PLCA 2JKAA 3SADA 1R3YA 3MU7A 1XLAA 3M5XA 2Y8KA 3TP4A 3FW6A 1I2QA 5E0KA 4NYYA 1CPUA 4RE0A 4DAFA 1J18A 3AYSA 3T0TA 4ES4A 4NKCA 2VZTA 3FEMA 3ZLFA 3PFRA 4ZXOA 2GGJA 4GI8A 1TPVA 1E5JA 1W3LA 1WPCA 1EJTC 3S9YA 1Z8AA 1IT0A 2ZDRA 1SFTA 2QGHA 4WKFA 4EWND 3MP4A 3C8NA 3OQ8A 4JKMA 2HS8A 1TVNA 2PMQA 3V4BA 4D6IA 5LNSA 3UERA 1GQKA 4NP7A 2E6AA 3F5KA 3ZLGA 2OWWA 2FTPA 1FQ0A 3NJ3A 4JX6A 3SJNA 3STCA 3KTCA 1I1WA 2AKMA 3A4JA 5CLTA 5TD4A 3TH6A 4WSHA 2C1GA 1WE5A 3L5AA 3B3DA 4NHVA 3W7NA 2AL2A 3U8GA 2YDAA 4W85A 2QV5A 4LS2A 1XUZA 3IAPA 4CQCA 3AZSA 2GOUA 2ACRA 1EDTA 3MSRA 1Z44A 2DW7A 1CLXA 1N8WA 3DFHA 3LU2A 3O63A 4FA3A 1QXLA 1BVNP 1ONWA 4QEEA 3VMPA 5F2LA 1GVEA 4O4VA 4LNCA 4XZMX 5AHEA 3AZTA 1Q45A 4K1WA 2D3LA 5K4ZA 3AIQA 1ZJHA 1GQNA 3V0TA 1WKDA 3M5YA 5CBJA 2VGFA 3H24A 1H7XA 1MO0A 4LEFA 3VGEA 2XG9A 2QULA 1ADOA 4C5YA 3QZAA 4FI4A 1V6XA 2C14A 4G8TA 3CV6A 4CD6A 3F2BA 1M9HA 3P81A 4XX6A 1K9EA 4PUJA 3HG5A 3JZEA 1IHIA 4BA0A 3UGVA 1WV2A 2PRHA 4GQRA 3TYBA 2A3HA 2WMGA 1IZJA 1UZ1A 5J5DA 3GXPA 3P5ZA 2AAMA 3CAVA 3BAIA 4NQ1A 4AZHA 1DKWA 4O14A 4DJDC 4R33A 1C7TA 3SQMA 4X60A 3BCFA 3KTSA 3VKKA 4PRWA 1UR2A 2X2YA 1QMLA 4EPKA 4D1IA 4C6DA 3PG9A 4PN2A 3DECA 3E2RA 3IJ7A 2ZX9A 3A4WA 3QSTA 4TIMA 3RX3A 2QYGA 3VUSA 3TA9A 3O7UA 3IGHX 1IE7C 1CLVA 4HU8A 2WLZA 2CZEA 3UW6A 3AS2A 2IKIA 3TN4A 1WCGA 1AFSA 1ENUA 1TFVA 2QCLA 4X3ZA 5PTDA 2XN0A 4GQBA 2JFEX 3MI2A 3T0AA 4MJMA 3OLIA 3S8HA 1YDNA 3GW0A 3M0ZA 3VO0A 1GK8A 2CKRA 3OVRA 4LW7A 4Y7EA 4PTDA 1ITXA 4B2DD 4IIHA 2R94A 3PPFA 1E72M 3EB4A 3SCRA 1FHUA 1RH9A 2VC6A 5TQLA 1OFAA 3L4XA 4NUWA 2PWEA 2PS2A 2VHLA 3WBAA 3WLMA 4QAWA 4S2CA 4GGBA 1UWIA 1UH2A 2XH0A 2EPHA 4PTNA 3B8SA 3JS3A 4ZL1A 3VCNA 3LSCA 4AZCA 2D2GA 4FLSA 1GVFA 4IZGA 3N18A 4HMDA 4P61A 4AD0A 1EJRC 3CPUA 1IEQA 4OWGA 1ONXA 3MA8A 1C8VA 3LYEA 1D7FA 2JKEA 3VZXA 3MZNA 3LBOA 4MAVA 3PK7A 1FCQA 4MZ1A 1H0GA 1Q63A 3WEMA 4OTKA 2A79A 2RFGA 2ZZ1A 4AZ6A 3SCUA 2QCHA 4WUIA 4XAGA 3ZT6A 3N13A 1DJZA 1R6WA 3VI2A 3ZIZA 1H63A 4EP8C 2YBVA 4FK9A 1A4LA 3QR0A 5FCZA 5A6BA 3OW1A 1F6PA 3KVLA 3NEVA 4BQ2A 4UMBA 4UZSA 3AS1A 3LCIA 4QNEA 3VD4A 5AC7A 1BTMA 1XQKA 4B5WA 1MQQA 1EPXA 2A7RA 3FNDA 3GXDA 3CV1A 2PP1A 2QMKA 3A5FA 1XLJA 2PDHA 3RILA 3E5BA 3A4XA 2JK2A 3UU0A 3IJ6A 2CEQA 1H7OA 2OLHA 4HOXA 4KEMA 4HP5A 3IGSA 1FWAC 3IIZA 3UZXA 3GC4A 1PL9A 1XGEA 4IJRA 5D09A 2DZSA 3E0FA 4YLWA 5HA7A 8RUCA 3OGRA 1RD6A 4WLCA 1ZBCA 3EWBX 1EWEA 1I75A 2XHYA 2WMFA 1H60A 1NVMA 3KRSA 1W32A 3H54A 1MXDA 1VZWA 3EWDA 1ITUA 2VRJA 4WQ6A 5LIYX 1HJVA 4PMDA 4DBSA 3GVGA 1LL4A 4GQGA 1J79A 1EF3A 4QEHA 1SMAA 3IJ9A 1QWKA 2QJHA 3MI6A 1SSDA 3VE9A 3WK2A 2CLFA 2ZICA 3C86A 2TMDA 5AN7A 5TAOA 4Q8UA 1EJVC 3VIKA 3OIHA 4GO9A 1XCFA 3R43A 1H62A 1GJWA 4WSKA 4H6RA 1F3WA 1EC8A 2WVSA 4HB7A 1XRSA 3F4VA 5JIWA 3TXVA 5I5RA 5AYYA 2ZDSA 3TK7A 3M5ZA 3UXIA 3NUKA 4AY7A 1VPYA 5DMMA 4GUIA 2P8BA 1V6VA 3OTRA 3P61A 4AZGA 3NQ7A 2B81A 1O4UA 1EBGA 3AWOA 4MUZA 3NQ8A 3LEPA 5JBFA 3STPA 1KC7A 1E1CB 1UMYA 4C5ZA 4NNBA 2DT3A 3PNUA 3W1NA 1JUKA 1M7XA 2GL5A 3KRUA 1A0EA 2NVAA 2WJZA 2PDJA 1OC7A 3NM3A 2CBIA 4IP5A 4GUGA 1LCOA 3SCTA 4M5PA 4R85A 6A3HA 1QATA 3COTA 5FI8A 4QDMA 4S39A 4D6FA 1U1JA 3EOEA 4O1BA 2WJFA 1HKWA 2V5DA 1E9IA 3WBYA 3L23A 4KEVA 3IV8A 3WLNA 1R47A 3BICA 4OIFA 3MMTA 2BY1A 1BHGA 3VTRA 2OT0A 5RUBA 2OZ8A 3R7MA 1A50A 3H26A 4ZB5A 4I3GA 2VQUA 4F0RA 1S46A 2CU0A 2W91A 4DJEA 4GUHA 3V5OA 5FEPA 1EDQA 4RUBA 3OZMA 5EFDA 1P0DA 4NJJA 4Q8OA 3L12A 3TNBA 3BJTA 2W62A 4CVWA 3R25A 4ZQNA 1B1YA 1V08A 3BOFA 1H7NA 3S6DA 4DI8A 5HMEA 3D6NA 3CQIA 5L9FA 2BDQA 4RKAA 1BGAA 2GUUA 5F4WA 5CJ5A 3H6OA 2ISFA 4WY0F 1KM4A 5REQB 3K5XA 3DYPA 1UASA 1MDRA 4YTSA 2WCGA 1MUWA 2X0SA 4O1AA 4A05A 4WX2A 2V0TA 4DM1A 3TXZA 4DNMA 4QE5A 1GZGA 2EKGA 1VB9A 2FHFA 5HUPA 1HFBA 4BWLA 2XISA 2GZXA 3WDPP 5T8GA 1TRDA 3EEGA 4IFKB 4W5UA 1KBJA 1OY0A 1DQXA 2E68A 4PCTA 3TWBA 4AZ5A 4Q8TA 2GOKA 2R14A 5FF7A 5D2TA 3URQA 3WK0A 5BXTA 5HQLA 3DGBA 3TMQA 4WXZA 4C6NA 2I7GA 4LF2A 5I78A 1LOLA 2ZRVA 3F4CA 5IFTA 1LF1A 1YXDA 1LRNA 4H8VA 4E2BA 3L2IA 1ISYA 3CAKA 3KXQA 3W1QA 2NXGA 3SCQA 3LB0A 4GLEA 3BOXA 1JPMA 5CSUA 4IXXA 3TSMA 7ENLA 1NDZA 3O07A 4KT2A 4C6QA 1UC4A 2PLMA 3CC1A 4FEZA 1D3CA 3OU8A 2VX4A 1UMLA 5LGXA 1S38A 1XSJA 3G6MA 2CITA 3A23A 4N4QA 2BG5A 2VD9A 1R2SA 1FDJA 3DC0A 3FKRA 3LZ3A 1TWDA 4MZ8A 1Y65A 4AWTA 1C9DA 3TJLA 2BXYA 4XD6A 1VFTA 4MPQA 4J9JA 2PTWA 1WZKA 3T6CA 4DUVA 5C55A 1EP2A 1QW7A 2G3JA 3ZS4A 1UP3A 4H9TA 3GTNA 3LPGA 1EP1A 1H7RA 4FXFA 1OM0A 2J7CA 2WMIA 2OWCA 1AQ0A 5T26A 1DJYA 4ZVJA 2ICSA 4S3CA 1XYZA 3CV2A 4I6VA 4M6QA 3GG0A 1H7PA 1A80A 1TR9A 1S2TA 3O0KA 1K6AA 5BU6A 3EOUA 4JX4A 1ZCCA 3IIVA 4JFWA 1UBSA 1XBZA 3SDOA 3L66A 2YBUA 4KW2A 3G1AA 4EIVA 2BZNA 2HE8A 4MPKA 4O16A 1BYBA 2IQDA 4G7EA 1JZ3A 4PR4A 4RPPA 2Y61A 3DCPA 1VLIA 5DFAA 1A5BA 2WMKA 3T2OA 4AVNA 2FFCA 3GHTA 3WEZA 3LV6A 4MWAB 3SFKA 4CNNA 2VO5A 3NNTA 4IQDA 2WZMA 4NI8A 3WZ0E 4OOUA 1KM1A 3M0XA 1BXBA 3E5PA 2WNWA 4K38A 2XH2A 3S5YA 2E6FA 4BEUA 2BX7A 1QHOA 3TX9A 4PUMA 2BHUA 3MYOA 4ALDA 1Q6CA 2VT0A 4XSMA 4EK7A 1TKKA 1TPC1 1L6GA 3ANVA 4MLRA 3MHUA 1WDSA 2VP8A 3OJGA 2QZRA 5AC8A 3AMCA 3SCVA 3NSXA 1ZLPA 3AMGA 1TELA 1CYGA 2ZUTA 2DSUA 4HHPA 3QFWA 3BXWA 3PZNA 4R88A 3LHVA 1QBBA 4L6DA 1GQIA 1HL8A 3SR7A 3T4CA 3UF9A 1DIDA 4LUTA 5E6ZA 2V38A 3TCSA 2FZMA 2QV4A 2ISVA 1PVNA 4H9XA 3H2CA 1OCJA 4FNPA 3KS5A 4F4RA 2X1IA 2Q01A 4K7VA 1PEZA 3IIOA 1DIOA 2J7DA 1CGYA 2WAGA 3AALA 5I3KA 4U2ZA 3CLMA 4M51A 4IH3A 4MFDA 2NUWA 1SZGA 4LY8A 1ISVA 3M43A 5D2VA 1SR0A 1KWKA 1L0PA 3MBDA 3EPOA 3G3DA 3DHFA 4GPNA 2J8TA 3VFCA 2J9ZA 1JZ6A 1XLBA 1R9YA 2EKCA 3ZOAA 3QHMA 4C1NA 3EXRA 3ARWA 5IBXA 1GJUA 1PKNA 3KW3A 1RCQA 3GVVA 1J0IA 1B31A 3O6CA 3ZWSA 5FSDC 5A69A 4I7WA 4XWUA 4B16A 6ENLA 3STFA 4JNYA 3MT1A 2DUXA 3N12A 3C4UA 2XVKA 1J0YA 1K8ZA 1G9HA 4AAJA 2PZNA 1JIBA 1W2VA 1A5LC 5DT7A 1Q6GA 3ZLHA 1X38A 3TTYA 4EAMA 4UTJA 1R3SA 2PRLA 3IIPA 2BHYA 1NU5A 4IHCA 2YW3A 1Z69A 3MDUA 1GW9A 3BTNA 5FF4A 2WM0A 3REQA 3LRMA 1LOSA 3UFYA 1U33A 3QPEA 1KM2A 4S3AA 3NQAA 1E9LA 3VILA 3SSZA 5CGTA 4A6GA 3UZ5A 4W89A 4Y6GA 4FR6A 3OYZA 2F7FA 3VGHA 4CCZA 1KTCA 2RH9A 1U2YA 2XIBA 4REQA 2VVNA 2FZ9A 1EO7A 1RBAA 3AAMA 4QCFA 3WUFA 3PVFA 5AVHA 3TFCA 3U9IA 4PTWA 1AMYA 2PLKA 4TOQA 3CHDA 2X42A 1FRBA 4US5A 3P8IA 4KGJA 4HYRA 1E6SM 3NAVA 3WF0A 5H2ZA 1ME8A 5JBEA 2YPIA 5FKYA 2Z1VA 1ONRA 3PPCA 2KX9A 4W4QA 3VNDA 3W1AA 1TUXA 3BE7A 4DJFC 3V5CA 5C71A 1V79A 5HATA 1CXKA 4XTIA 5FAJA 1CGXA 3NQVA 1DORA 1TO3A 2E25A 2GDQA 4CNSA 4EACA 4D1JA 4XO6A 1T8QA 1XDJA 3FAWA 3B8TA 3C3NA 3ABQA 2I16A 3HGRA 2RDUA 3RR4A 4J28A 1PDZA 1CNVA 1EJXC 3EA1A 2JGQA 2PWFA 4GNVA 3OOQA 1OABA 3U7VA 1QHPA 1OK4A 3UR5A 4V2XA 1V6UA 1I0BA 1RALA 2WVTA 3ITGA 1SZFA 4I8YA 3ES8A 1GYNA 4DO5A 5CAHA 3EDKA 4I8DA 2H3DA 5GNYA 3G18A 1J10A 3C52A 2HVNA 4WDUA 3T05A 1EF2A 3LCXA 1V3IA 1LWIA 1NDWA 3RJXA 4MHBA 2RDXA 5LKYA 3TFXA 2OSYA 1J4EA 1L2UA 1TREA 1MRAA 2PGEA 4HOWA 2OZ0A 4ZO8A 1KCXA 3PNZA 4WOZA 3FFSA 1ZFJA 1LG1A 3OLGA 5ABFB 1XBVA 5H8UA 3UCDA 4E8GA 2WSPA 1GTEA 1NDVA 2HZGA 1XD0A 2VCBA 4P8UA 5EMLA 3OBAA 2VFFA 4MM1A 1F7BA 3LN3A 3PZMA 1XJBA 2TYSA 1OX4A 5AHFA 1W1IE 1J12A 1JZ8A 1DQUA 4GVFA 4A2SA 1T7LA 5BYWA 4L7ZA 2UWFA 3RX2A 1F9CA 2ZTJA 3CUIA 2WSRA 4O17A 5GVJA 4I9MA 2GUYA 3EWZA 2FPYA 5B80A 3SBFA 4RV3A 1SM9A 2W9MA 2WCSA 4R27A 2WMJA 3DH7A 3OZYA 5HNUA 1UG6A 2B0MA 1XXXA 3MTWA 2P3ZA 3M0IA 3UETA 4ACYA 3QV8A 3AMKA 1VPQA 1KO0A 1P0EA 4KETA 1NOUA 3N9RA 2C1HA 1D9EA 1K03A 4JN7A 3AYRA 5BOFA 1OGBA 2P10A 1D3HA 3SCPA 2UBPC 1XLIA 3H8AA 3MZ2A 1UYQA 1SJBA 3M0MA 1TYGA 1G94A 2J7BA 2ZBTA 4IP7A 1VCVA 3WLIA 4G1NA 4UNKA 1H11A 4O13A 3MQTA 2UY5A 2D23A 4NASA 4CLMA 2YB1A 2HBVA 3W81A 4UNIA 4EWJA 3MKKA 4ZO7A 5A8QA 3D3AA 1K8CA 1ZJIA 4ZSUA 1D7KA 4JTDA 1ELSA 4W8LA 4C6FA 4DYKA 1JCNA 4PSPA 3UT0A 2NUXA 4JYDA 4XZIA 4IX2A 1OEPA 4B5TA 4QGCA 5LIXX 5GJPA 2FYMA 4NT0A 3IRDA 4YNGA 1TWSA 4XZHA 1UA7A 2W67A 1S5MA 1GG0A 4EE9A 1U5HA 5A6SA 3HU7A 4EPDC 2CLMA 3LD5A 1U1UA 1AW2A 2J13A 4LVGA 2V2CA 1X97A 3NSNA 1P6CA 4AW7A 2FZNA 4HPGA 1VC4A 3EX3A 2GPTA 4XSLA 3T4WA 5D9NA 5C8BB 3ARYA 3QQ1A 3LBCA 5EMMA 3EPMA 1GPFA 2PWVA 2VUNA 3GFXA 4F2BA 3EEZA 1F74A 5EMYA 1CECA 1BYAA 3TAKA 3QY7A 3T40A 4AD1A 3QZEA 2ZC8A 4PMNA 2EPOA 3TSDA 3MCOA 3W86A 2OEKA 3CASA 4NX5A 4Q7NA 4DRSA 1XIMA 3DFQA 3ITOA 1J6PA 3VX1A 4NRSA 3ERPA 5MF5A 1GQLA 1V77A 3WUGA 3SRDA 3KCLA 3K8LA 3R5EA 3P74A 4KEZA 3ITLA 1MRQA 2GGHA 3E2SA 2WZIA 3TYUA 4KESA 2XH7A 2FJKA 2YYUA 4AZCB 4N6EA 3MHGA 4IIGA 1H51A 2PDMA 3GYCA 4U3AA 5BXSA 4KBXA 5HOSA 1MW3A 5DCEA 1VFMA 2XSAA 2YZ5A 3TTSA 2P8CA 1BGGA 1DWIM 1H5YA 3PBMA 4HMCA 2J47A 1CCWB 1YNYA 4YYCA 2A3BA 1KM0A 2X16A 3M0YA 4DO7A 2BVYA 1TSIA 1TRIA 1OZQA 4OFCA 1L9WA 4TV5A 1AH3A 5HJXA 2J6XA 3W72A 1GVSA 3QMRA 4MKNA 5CLWA 1WO2A 4FSAA 3VM5A 4N9CA 4H8NA 2EAWA 3QQWA 1FWFC 4O8RA 1O5KA 4RLIA 4JTFA 3VGFA 3WK3A 3CLWA 3SCNA 2VFGA 2PU1A 2WXDM 2NZLA 2KAUC 4JAWA 1LTDA 3M5VA 3VIHA 2PB1A 1ZAHA 1FWWA 4WVXA 4GC3A 3SAZA 4IMEA 2DZWA 4W86A 1FP9A 3DG3A 4V1XA 4M1BA 4XAZA 3RM8A 2HK1A 3N17A 1E0XA 4WIWA 4GIRA 3WCZA 4ADUA 3UY7A 5CC5A 4CEUC 3M6DA 3GC5A 5I77A 3SUUA 3WO8A 4PUKA 1LUCA 3RCNA 2ZOXA 2OXNA 2DIEA 3LNPA 4FNSA 2QCEA 1S3TC 4HPXA 3VYLA 2GSEA 4HU3A 4AIOA 4CQ9A 1AW5A 3ARVA 2XGZA 2ACSA 4LVDA 4QXIA 1UKTA 2AGTA 1Q6DA 4MYXA 3ANYA 1W37A 5FIPA 4MY1A 1F07A 5D9PA 3LK6A 2J78A 3HPXA 2ZQ0A 1YDVA 4IT1A 1ADSA 3PZ9A 5LXXA 1FFRA 3WIJA 2YCEA 2VENA 3T07A 3UA4A 3RDKA 3MUXA 3ZVHA 1Z7AA 1RVGA 3WD0A 1QNQA 1Q4NX 3VAVA 3JVAA 3POCA 4EXBA 2EBNA 1TPH1 3QRHA 1EHNA 1W91A 3HQ1A 3U57A 1H2JA 2ZRWA 4UTLA 2PWHA 2CKSA 1QASA 3UR2A 4QR6A 1S2AA 2PLJA 2DIKA 4G1KA 2R1PA 3NQDA 1BWKA 4GQ0A 3FHAA 4H1ZA 3ZZ1A 2R1LA 4DI9A 1OC5A 1TQJA 2Y89A 4GCXA 3F4WA 1ZL1A 2ABBA 1MEHA 4LBSA 4GC4A 1F4HA 1H3GA 1NEYA 3FOKA 1ONEA 2C13A 1JYWA 4HNUA 1E73M 2OKOA 2ZZ6A 5CJMA 3BSGA 1OCBA 3W7HA 5LIWX 2WYSA 1SUXA 4PL2A 1JDFA 4D6GA 2CLOA 4PMUA 1BSLA 3A5VA 3U2ZA 4ICCX 3U0HA 3CEUA 1HQTA 5CSRA 4M29A 5FJOA 4ZXLA 1CGUA 4R9XA 8XIAA 4YHEA 5JU6A 2NV2A 1PKLA 3PHAA 3H53A 3ZWTA 3I65A 1YQ2A 4NILA 4R7OA 4GBUA 4O15A 4ZSTA 2PP0A 3GBEA 4AC1X 3K8KA 5DEZA 4MG4A 4GE8A 3OZOA 3W7KA 3CL8A 4KRUA 1G7UA 4C6LA 4J3ZA 1K9TA 2VCAA 4JY8A 3WQEA 2QVHA 3F2DA 5I3GA 1VYRA 4H9ZA 4JCMA 3RIKA 3Q67A 1LORA 1UCWA 5FF2A 5T91A 5DMYA 4LFYA 3VA8A 2V8ZA 5MKGB 4LALA 4ZODA 4IPIA 1W6TA 3DFNA 2CCRA 1I2NA 3IEBA 1P7TB 3OVQA 2VURA 5IBXC 3LZ5A 2EXOA 5LNRA 1M03A 3FK4A 1POKA 3KOZA 3NTYA 1UOZA 2J75A 3CU2A 4RDZA 2XVPA 3M4HA 2DPEA 4UQ9A 4E8CA 3UPMA 4ACZA 4KCTA 3QGKC 3ZSTA 7ODCA 4OU1A 1BRLB 3RG6A 1M68A 4WJEA 4EF8A 1LL6A 4Q32A 3CTTA 2ZX5A 1KFWA 2DFAA 2XIOA 2NVDA 1QPOA 4WKHA 1FHVA 3BW4A 3KVKA 3NOYA 2OELA 1O5RA 1GZ1A 3UWZA 3GFYA 2YL9A 2ZC1A 2Y8VA 4M81A 3IUDA 4HJFA 2FGLA 1VFLA 4NF7A 4JFSA 3H4XA 2GVGA 1VBJA 2WV8A 3WLJA 3HURA 3PP7A 3CJPA 3R8HA 1HKMA 2Z4GA 3Q65A 4CKQA 3WQ8A 2I17A 1Q3NA 3NR0A 3KX6A 1LBLA 3A9IA 1VGAA 3B9AA 3HV9A 1W9DM 1E0TA 4F9DA 4C6CA 3QGAC 2J8FA 4O57A 1RCXB 4S23A 2A3AA 3L5MA 4LH8A 5AHIA 4KF1A 2WQDA 5BOEA 4QDPA 3ZYZA 1K02A 2QMJA 3QV7A 2G3FA 1FKXA 1CEOA 2P76A 4WGHA 1XBXA 3NIYA 4ZB0A 7XIMA 3BH4A 2JF6A 2QJGA 4JTLA 3G2GA 4KCWA 3VC5A 4C7DA 1SQ7A 3S6OA 4OKDA 3HN3A 4K8EA 2EPNA 3FA4A 2QUVA 3FS2A 1WKFA 1UZHA 3KRBA 1M53A 3QY8A 4A8LA 1GOIA 3KL0A 3GDRA 4MB4A 3T0CA 1GOMA 4G9PA 1OYCA 1C91A 3N6HA 1ME9A 1EYEA 3AU6A 4S3KA 2C3ZA 2B4GA 3UYCA 3C61A 3W2NA 3VNMA 3WG6A 1QCWA 3ZXWA 4G7FA 5GPRA 2BHZA 3UA3A 3CUJA 4IX0A 1WNOA 4A35A 5EY5A 4OV4A 4E5TA 5DBTA 1EBHA 1XBYA 4C90A 3FAXA 1RHCA 1Z89A 4UC5A 4MVAA 5J8LA 3W2MA 3V0SA 3WMSA 1VBGA 1XX1A 4J5NA 4RXFA 1HP4A 1K7XA 1K9FA 4GUJA 5I23A 1E6PA 1YHTA 1GT8A 4EF9A 2W4XA 4FHAA 5HWMA 2X0YA 2Q3OA 4RK8A 3W82A 4F40A 2GDUA 2TODA 3VNIA 4HMEA 4G7EB 3VIIA 3OIXA 3WF3A 4K7YA 4NAEA 3HPFA 4PUUA 3E3HA 4NZ3A 4M3PA 2HS6A 4DYEA 2J9XA 1OFPA 3GKAA 2R1NA 3IJQA 4GY7A 5D33A 2JBMA 4H9YA 4GABA 3IANA 5E9AA 4YWIA 4KS0A 1PX8A 3UPBA 2WNZA 3UZZA 3B0VC 3UBPC 4LT9A 4O54A 2V2HA 1IZKA 3N3MA 2G5WA 2XFYA 3C0QA 4DJDD 3K4WA 4D9PA 1Q65A 1G1YA 3BCJA 3VE7A 3ITTA 3A12A 1CX9A 1DJQA 4C6BA 4AMAA 2W3ZA 4BQ3A 2ACUA 4H00A 1KM3A 1K8YA 4QQ3A 3N6JA 5F2MA 3M7WA 5DXXA 2EQDA 2ZUWA 3QVQA 1E4LA 1JQVA 1PYMA 1JNEA 1MFUA 1V6WA 2FIQA 4QROA 1XYAA 4INFA 4JYFA 2FDSA 3UYIA 4LCSA 4A8IA 1OYBA 3QZ6A 3SN4A 3TYAA 3M9YA 4EOUA 4JFVA 2Y5SA 3WLRA 3ZJKA 1OCQA 3DOPA 1QK2A 5A8GA 3UXLA 4HZ8A 1Y7VA 1B9BA 3TTOA 1ZJAA 2CC0A 4LUJA 3B0UX 4MJ2A 1W3HA 2VKZG 4NJIA 4MB1A 2VRKA 1TZ7A 3EWYA 3TROA 2DH2A 3M46A 1UWTA 3LV5A 3GNDA 2WHKA 4A3HA 4DEFA 1BQCA 3MCNA 2ON3A 2QCDA 3GDBA 4LB4A 4W7WA 1BTCA 4A22A 1OCNA 1KV8A 1FWCC 1GPWA 1QUMA 2DJLA 4Z1BA 3M41A 3MUZ1 3EZ4A 4MYAA 3SURA 1XUUA 4GWEA 3PTQA 3HQOA 1K9DA 4PMRA 2WC3A 1KW1A 2VMFA 2B7QA 3J7HA 3SCOA 3W07A 3VDGA 2HRWA 1FCUA 4JYEA 3HMCA 4XIAA 4AD2A 1BWVA 1JZ4A 2G0WA 1X1NA 2HNEA 2ZXBA 1A5UA 2E1WA 3IJLA 3H22A 2DSZA 4CU7A 3NL2A 4HCLA 1UZ4A 1A5AA 3O9NA 1BF2A 1GEHA 2FVMA 1HL2A 3LGDA 1O1ZA 2BXVA 3GR4A 4AYSA 3TN6A 1R3VA 3M16A 3PM6A 3QXBA 2C6QA 3UNTA 3CUHA 1FA2A 4YJ5A 1QPNA 1X7FA 4PMVA 1YNPA 2NQ5A 1B90A 5JMUA 4C6JA 2OR2A 3SO7A 3ZR4A 1CXLA 1RP9A 1YYAA 4GNJA 4Z1CA 3T1GA 2J25A 1Q66A 2QIIA 3W6MA 3HFTA 4PCPA 3VC6A 2H90A 2CZFA 3IJIA 4HIBA 2GJPA 3RLGA 1W9PA 4O1CA 3UEQA 1GWJA 2BSLA 1B3ZA 4NZ1A 4REQB 4P8VA 2A7PA 3ZJ6A 3HQPA 1ISZA 1QI0A 4AU0A 3PN8A 2CPUA 4XK2A 2OG9A 3TJ4A 3EMZA 3SGZA 3VUPA 3W71A 4IGSA 3LQLA 3CQ0A 3EDFA 3ARTA 2WOQA 1KA9F 3WNNA 5I00A 4CU6A 1JZ7A 1P0BA 1KRCC 3LHTA 4DZHA 1M04A 1WA3A 3T08A 3SB0A 3SZ8A 1RLCL 1QOPA 1K1DA 4IQEA 4X0VA 1DJHA 2P3EA 1B54A 3B0XA 3H55A 2BGSA 4M6VA 4C7GA 4OUEA 3P7YA 1Z3NA 3VVGA 2REQB 2G3IA 2W79A 5AZ1A 3TEVA 2C1IA 3FGCB 4AD4A 5H8MA 1JAKA 1I8JA 4O19A 2YCLA 5DCBA 2D0HA 1DTUA 4POCA 1BYCA 1EO5A 3MV11 3BMXA 3RPDA 3GNRA 4UTHA 1P1MA 4C6IA 2HXUA 1K70A 1R9XA 2Y5EA 3CQJA 2XGBA 2UY4A 4JTUA 3MVTA 4LX4A 1HF6A 4IXHA 2F6KA 3RJYA 4I90A 4HZ7A 2EF9A 3HPZA 4QIUA 2ZRXA 2CESA 2WCAA 5BWFA 4GOAA 4V1YA 1XLFA 3ES7A 4RDYA 1J0KA 4H9VA 1PTGA 3P80A 1CGVA 4UFHA 4KH2A 3NPUA 3WDJA 1TMHA 1RK5A 2OGJA 1C8QA 2IQTA 3O6YX 1TE6A 3TQPA 3MC5A 3U48A 1IWAA 4AXKA 4UTIA 3V5FA 3VIJA 3GUGA 2IKHA 3D5HA 2PZ0A 1M41A 4A8RA 1RP8A 1H1YA 3W70A 1BXCA 3M7SA 1OX4B 4LY4A 2JIEA 1E6NA 1QHZA 2VWSA 5EBUA 1QO5A 1NWTA 3RLUA 1X96A 4L9YA 5F4SA 3VXGA 1H09A 1VBRA 4UFKA 1JFHA 3EDJA 1CDGA 1E4NA 4JTHA 1L6SA 4FXRA 1Z6KA 1FH9A 5D2WA 3ZMRA 5KMYA 4C60A 2A5HA 3WKZA 5HR6A 3VD9A 4W5ZA 4XV0A 4AHOA 4DYJA 3UWQA 4KMQA 1TE1A 4U2YA 3G8RA 2E9LA 4L1XA 3ANUA 2OEMA 4XZLX 1JPDX 3AWNA 1TJRA 4L9ZA 1JG9A 1V3JA 3VNZA 2GK1A 3EGJA 4DPQA 3S1XA 3O0FA 1UR9A 4HSNA 2ZXQA 4B4HA 2Z2BA 3ICJA 1JPIA 4U28A 3KVJA 4D6DA 2QW5A 4TXEA 4N9EA 4L1WA 4AZIA 4Z1AA 1V8EA 3NZQA 1TIMA 4DBEA 2DSVA 3TWAA 5A8MA 1QI4A 3A3XA 4A3QA 3QMTA 3OYXA 3BAWA 1D8WA 1PTDA 4DBWA 2X40A 4Y9OA 3WNKA 3DG6A 2DQXA 1TMLA 2PEVA 1MQRA 2FQIA 1OD8A 3SM0A 4TVUA 4M82A 5HUOA 4LQ1A 3Q2DA 4ZFMA 3LTPA 1L6WA 3U2EA 2FLIA 4L5ZA 4DAIA 5DELA 1IV8A 5FJRA 2XIJA 1E4MM 5AC5A 1TWZA 3MUCA 3HMJG 3C56A 4QDWA 2ZYFA 1DV7A 2JIWA 1S39A 1PYFA 4I5UA 3PAJA 3QKEA 3V36A 1XC6A 4RE3A 2VWTA 1ZS2A 1E9ZB 1JXJA 3QF0A 4FNUA 4UTMA 4BI5A 1UD3A 3TC3A 3N25A 1MDLA 1KFJA 5TNVA 2OVLA 3FVDA 3V1HA 4XUGA 4DIAA 4H8HA 1JULA 2D73A 4DWSB 1GORA 1J2WA 1OFRA 2W5FA 1JR1A 3UVAA 3SQLA 4AB4A 3PWGA 3AS0A 4MJZA 1H1NA 5D2YA 5AHNA 3FXYA 2YGYA 1PE1A 3CO4A 2YDQA 2CHNA 4YWSA 4FAMA 3M0KA 2YKKA 1ZY9A 2OPJA 4LV4A 4RZBA 2V3EA 3N73A 2HQAA 5BCAA 1WUFA 3E0VA 4I9AA 3BLKA 4B9ZA 1KGUA 1R9ZA 4Y9PA 3O6DA 4UUIA 3GDTA 4GYFA 3EOOA 2ATSA 3S42A 1PB0A 4KRTA 1A5OC 2IUZA 3AUJA 4GH3A 2DVXA 2OX1A 3LLDA 2INZA 2YXOA 4JTKA 3T9PA 1GYLA 3VU2A 3QEZA 1CTNA 4XTDA 1KBLA 4JN6A 4JTRA 4H9MA 4MY9A 2E7FA 2ZX7A 5G5IA 2GQ3A 1AODA 3JZUA 2FTWA 4AC7C 4QE4A 1HJUA 2NWSA 1S5WA 3SUWA 2HK0A 4WRHA 2YW4A 4ENLA 3P82A 3WDHA 1SR9A 5DN1A 4R7JA 3LQGA 3QBUA 3CWOX 3ALGA 4DNHA 2OCZA 1PWLA 4UWMA 1DE5A 4PZVA 3BAYA 3R1ZA 2PDIA 1H7WA 2VFEA 1AVAA 4RE4A 3W88A 5D05A 3WQGA 1LQ2A 2QUUA 4MOZA 5DO8A 3PJTA 1J6OA 2PDQA 4O53A 3F5LA 3QPYA 1TJ1A 4D72A 3G1DA 4C6OA 1LUCB 2SFPA 2YL6A 4Z2GA 3BG5A 3QJAA 3MJYA 4UNLA 1VJZA 3TKFA 3ATYA 4AEOA 1O66A 2CZ5A 2BLEA 1LL7A 1Y8BA 4CD4A 4FNTA 5CBIA 2NLYA 3N4AA 1LBMA 1LWJA 3UCQA 2PDLA 3GTIA 4O52A 3R10A 3GLCA 1FWJC 5KZEA 2V63A 4YCOA 1T41A 1BD0A 2FZ8A 5C2CA 2ZTKA 4PMOA 8TIMA 4RW3A 5M1TA 1S5VA 3APGA 3EA2A 3TN3A 3FVMA 5DBUA 1RV8A 3HZ3A 3NZGA 1UWAA 2V82A 2B31A 3AS3A 1A47A 1UROA 2ZFAA 5HULA 3MI3A 3LRKA 4NG3A 4F3HA 1A53A 4D2JA 4Y9MA 1KBIA 3IJDA 4GVGA 1O60A 1GVRA 4DZ5A 4J3WA 3NSMA 4WSJA 3P84A 1E3ZA 3KUMA 4IP4A 3CL6A 3RR1A 3B4YA 1SMDA 3VD3A 2RHGA 1SGJA 1KBBA 2BVTA 4E8DA 3WH6A 3VNJA 1S2VA 2HNHA 4GA8A 4QRNA 2Y4SA 4YTRA 2GJXB 5G4HC 4E2DA 1G4PA 1XDMA 1VJIA 1EA9C 2J77A 4LOCA 1O5QA 1N8FA 1TV7A 1GJPA 3CGTA 4W7VA 2OFJA 2Q09A 3GHRA 1XFBA 4MB5A 5D8WA 3P3BA 2PTDA 3F7JA 2AMXA 3W00A 5I06A 3ZR6A 3VOHA 3C0JA 4NVTA 3OP2A 3NXFA 3KBVA 1KFEA 5BRBA 3AIWA 3QMSA 4TTGA 5K2ZA 3W7DA 1V0KA 3BLLA 4J3VA 4GX9A 4ZQCA 3D47A 3KLLA 3AIRA 3IGXA 2WW5A 2DDXA 4PFMA 1XCXA 4K8HA 1S2WA 1AG1O 1HTIA 4LAZA 3PWAA 4RV8A 1QOXA 1QI5A 1WDDA 3KOWA 2J66A 4H19A 3EAUA 3E49A 4DJFD 3ZR5A 3PUOA 5FSEC 5BZAA 1P6WA 2WJDA 3P93A 2POZA 4FB7A 5AZ0A 4JIEA 3BGJA 2EPMX 1TZ9A 4Q33A 2WKGA 3N4EA 5MHBA 4TUFA 4JPGA 1KCKA 3SN0A 1J8VA 3CZ8A 4AEFA 4GXWA 1DIKA 5G2HA 4QP0A 5A6BD 3W1TA 2EPLX 1KFLA 1RJQA 4PEKA 1FHDA 3L4TA 3WBXA 3GHUA 4BQ5A 2Z00A 3S83A 4IJBA 2RAGA 4IUOA 5CG0A 1RBOB 3A21A 1TG7A 4IOTA 2VVSA 5K9CA 1JYXA 2P53A 4UQCA 1OFDA 3AU2A 1JDAA 4XO7A 4AWUA 3NQ6A 4J3SA 4RNFA 3BV7A 2CIPA 4WZHA 2OU4A 3VOFA 2Z1WA 3AQUA 1H1ZA 3CL7A 2OEJA 4LAOA 2YFNA 1AUSL 4MTVA 3G1FA 1GVYA 3VNKA 1EDGA 1ZAIA 4AQLA 4TVCA 3TAOA 1JEZA 2YCKX 3BPWA 4HK7A 1TV2A 4Z1DA 2GUBA 1FDZA 4GH1A 3CB8A 1W1ZA 3ITYA 5SWUA 4WD0A 2BODX 3A4AA 3UWEA 4XKYB 1V02A 1NP2A 5LHFA 3W2JA 2ZUUA 4HPNA 3L5LA 2DORA 4CNUA 1G4TA 2VM8A 4Z42C 3CTLA 1W3KA 1GHSA 4HT3A 3MCMA 3ZT7A 3V18A 1LJYA 4X22A 2VDHA 1I4NA 4QNWA 4IPPA 4P7LA 5U7SA 2HVOA 3TC7A 5AC4A 2E5DA 1LP6A 3BQ5A 4MNLA 1HO4A 5FJPA 3K4DA 3R89A 1GGOA 1TTPA 2ZA3A 3DG7A 4UTUA 1MNSA 3GG7A 1ICSA 4KPLA 2ZUSA 1A3WA 1JRBA 4HA0A 2YSWA 4EANA 1OJXA 4F0KA 1JCYA 2PF0A 3HPAA 4UBPC 2BNJA 5LYRA 1FWSA 4K2SA 3LCFA 2ZE3A 3LUTA 3ZJ7A 2NQHA 3IVUA 6ALDA 1BYDA 4RZ6A 2IQ0A 2PDFA 3NPXA 1R38A 2Y5JA 2R1MA 2DSWA 4E4FA 1R8LA 4KWSA 3OVPA 3O8AA 3W4RA 3G6LA 4DQWA 2B7NA 1MEWA 2X1RA 4K1GA 2Z0IA 2YLLA 4MKVA 1HJXA 4PODA 1UKQA 2Y0FA 3E0WA 3H7RA 4UTTA 4UTWA 1XLHA 4DJED 1OFBA 5D30A 1TJ2A 5CPSA 1XH1A 1THFD 4DXXA 4N6FA 4U31A 4HGXA 2E77A 4FIQA 4GQQA 3ME3A 5EA9A 4DHGA 1W3TA 2EHHA 3OODA 2Y62A 3TJIA 4LWWA 4QQUA 1W1TA 3LCWA 5CPQA 3W7PA 1GNXA 4X9YA 1VEPA 2I1OA 3GZ3A 3DHPA 4RDWA 2Y7GA 2IPFA 4UQBA 4IM4A 1SJAA 2IMRA 3T81A 3CHCA 1W9VA 5KEZA 1ICPA 4LPCA 3I7SA 1KGWA 3BAKA 3NVTA 3W7MA 2O7SA 4TO8A 5CZSA 4GIAA 4X63A 2AQVA 1DVJA 5ABFA 1H41A 2GJRA 1FXQA 3F2CA 4TMBA 4YIWA 2Q8ZA 1MW2A 3B9DA 3CMJA 3FEQA 3O15A 4U3CA 4FLOA 4Q4KA 2RGLA 2DZBA 3LMZA 3W3OA 4DUXA 1X1OA 1F2JA 4JY9A 1V93A 2NLIA 3APYA 3TUUA 3V3WA 3IWPA 3GH7A 1V51A 2V5JA 3VOJA 2QCDB 4R34A 3EKZA 2G4JA 4U5IA 3TIMA 2V30A 1M7PA 3RITA 3WNMA 1A5CA 2Y85A 1W5OA 4GYPC 3BZGA 1TVLA 2XM2A 1JGIA 2ZXDA 1W5QA 1V0MA 4IG2A 5CZ0A 1W2PA 1QTWA 1CGTA 4CGTA 1HJSA 4GI6A 1RA0A 3B9EA 3ABZA 3M0LA 4WOQA 3ITVA 1A5SA 3OGSA 1L6YA 3N2BA 1LLOA 1OG0A 4M7SA 3TU9A 1NSJA 1BFNA 4AVOA 4IGNA 2CWNA 3MP3A 5FACA 3GXMA 1OBAA 3UPWA 3IJ8A 1X6NA 3UXKA 1T99A 1H49A 6REQB 3HGSA 1UWSA 4G56A 2XTKA 4YPJA 3MHFA 4Y8EA 4WDXA 4XD5A 2VGBA 4H7VA 2PWDA 1PDYA 2OQLA 4GY1A 1I2PA 2GFTA 3UWUA 4JHOA 4P2VA 3GD6A 4DELA 4JS3A 5XIMA 1UWRA 4L61A 4GISA 1MNZA 1E9YB 4H6QA 4M1RA 3H2AA 3SIZA 4AY1A 4JQ4A 3URAA 4QLLA 4TQTA 1KM6A 3V35A 1DJIA 3OB8A 1M01A 3KZSA 1LT7A 4BF7A 2Z7KA 1RY8A 5XIAA 2XJ7A 4OOZA 2MNRA 1I45A 5C5YA 5AOUA 2VQTA 3S5OA 1MW1A 5IFPA 3BARA 4HVXA 1GVIA 4X9SA 1J2BA 4MUPA 3TQ0A 3QTPA 1ZGDA 3N2XA 4QSFA 2OSXA 3UJFA 4WY0A 3NWRA 4LXFA 3VD7A 3EX4A 3MB9A 2IW0A 2PI6A 1SW7A 4Z0JA 4Z08A 1EP3A 3H2MA 4LSBA 4UOZA 3L65A 1DIEA 4H01A 1QVBA 1FHLA 1OX6A 4BCEA 4GRSA 3FYOA 4OHQA 2X1SA 4UB9A 2VNCA 2PBOA 2PDYA 2GVJA 3CIWA 3P2VA 2YCJA 4XZWA 3NO5A 3RAOA 2Z1BA 1R3WA 4XUYA 4MLJA 2OYKA 4CCDA 3NL6A 4QLKA 3AMLA 3U2OA 4DWDA 1ITQA 3UR8A 5EU9A 2O4MA 2YCLB 5C6MA 3PUGA 2QIWA 3NXLA 3C3UA 2Z26A 3EWUA 3PUEA 4Q8MA 4S3DA 3MS8A 4W9TA 2V9DA 4I5XA 3DKJA 3L4ZA 4H2CA 3WJYA 1EUAA 1TPEA 4YVPA 3R94A 3ELFA 5HMSA 4Z1YA 4O0QA 1Y5XA 2PWUA 3V75A 1R3QA 3A22A 1ISWA 3SCSA 1SYTA 1EQPA 3NVDA 3CNYA 4C65A 3WF2A 1EHAA 2ZADA 4JZ5A 1Q6RA 4W7UA 1PCWA 2OMAA 3TQKA 3TV8A 3ABSA 3W0KA 2PODA 2WSKA 2V5KA 4QCEA 1XG4A 3ITCA 4NX0A 4CU8A 4HQVA 3BO9A 3LCGA 1OIMA 1P4CA 4F0HA 2HV5A 3UJ2A 3KWSA 4K68A 4GINA 3FSUA 2X09A 4PBEA 3T2QA 2OLSA 1KWGA 3FDKA 1KB3A 5CZTA 1JI2A 3NQFA 4PH6A 5C9XA 2DZAA 1FWRA 1GVQA 1KQYA 2ALDA 1EJSC 2H9AB 2Y8UA 1QPRA 3VOGA 4HOZA 3S0CA 4DLMA 3ARUA 3AZRA 4HCHA 1KFBA 4H6KA 2XSBA 4J2PA 4DZIA 1S1PA 2V5CA 5ABEA 5AKQA 4ZQMA 4NAFA 2ACQA 4R3UA 3BG3A 1AD4A 3EXSA 4HSHA 1MFVA 2GQ8A 1YE6A 4LBRA 5D37A 3N1AA 3EPNA 1N2VA 1PS9A 5E5CA 4BQ4A 4JTAA 4ZA0A 4J35A 3SUSA 4M7TA 3VZYA 2GLKA 2X1TA 2YDSA 2XPKA 1F8MA 3BGAA 3O16A 4AD5A 3EWCA 3FIGA 2VDIA 4LCQA 4M6UA 1WAWA 5C9WA 4J2MA 2RKXA 4LAMA 4N2YA 1ZCOA 2GK1B 4DF0A 3NYZA 1X6LA 3H2OA 3ARQA 4KIEA 1AH0A 5C9ZA 2XFFA 1KXHA 1OADA 4QTGA 1DJWA 2A6LA 3D46A 4MWAC 2NXIA 2F8QA 1RBLA 2WK2A 3DESA 1RJPA 4IF2A 4CD8A 2FGZA 4BHYA 3PWIA 1UHVA 1YE4A 3B40A 2D20A 1TIWA 2ESCA 2ZZ3A 5DCDA 2J4GA 4FNRA 2NX3A 5BRPA 3SY8A 4ONVA 1TA3B 4UMAA 1QNOA 1F8IA 3A13A 1S5TA 1MI3A 4IISA 1W1B1 4EPEC 1EWDA 1VF8A 3N6QA 4US5D 5F4XA 1PUDA 1JL8A 3FJNA 2BY2A 2I9EA 2PU0A 1EGMA 1XSKA 1HKIA 4GJJA 3HGOA 4IMFA 1OFOA 2XFRA 3DC8A 1J5TA 1UQYA 2VEIA 4KKXA 3W7JA 1WX0A 3KL5A 3LDVA 2QDHA 4RCXA 1A5MC 3KHJA 1S2UA 5H1WA 3WEOA 3PULA 3KWXA 2QAFA 4RJEA 1PZ3A 2G4FA 5CAKA 1B0IA 3WQWA 2QGYA 3W1LA 1C8YA 3CK5A 4UR7A 1I60A 3E74A 3VGBA 2W92A 5BRQA 1R2TA 1R7OA 1AZ1A 1K7FA 3KBWA 4BEQA 1MUCA 4D8LA 3INPA 2CXEA 3I3BA 2XDFA 3UCCA 1M7OA 3T78A 3MO4A 3A9BA 5CKSA 3T8QA 1ZJBA 2GVEA 3CZKA 3GDMA 2FPTA 3KTXA 1W8SA 2D2JA 3H7UA 4WR3A 3LBMA 3EMQA 4IMGA 5MKGA 2GSJA 1FUYA 3P14A 3LHZA 1P7TA 2Z7GA 2VUYA 5D04C 3ZJ8A 1Q2RA 1FCBA 2PBGA 2ADAA 1SJCA 4KERA 4XG1A 5G2IA 1Q4WA 1QPQA 4X2RA 4GVIA 5I3IA 3T55A 4B92A 3URBA 3M6YA 2OB3A 2Y7EA 3CHVA 1HN1A 2V3DA 4P7RA 4EKJA 1BRLA 1SZRA 3QW4B 4OV9A 1EIBA 3UG5A 2VFIA 4LVAA 4HTBA 2XIQA 1XGZA 5KZDA 3DENA 1Q6LA 4FMVA 2Y70A 2XN1A 5KINA 5BROA 4IIEA 2G37A 1WAUA 1B3VA 4Q8VA 3DI0A 1A0CA 1LWHA 2TPSA 5ECVA 1BKSA 4QFUA 3BZJA 3EX1A 8CGTA 4IWWA 1X6UA 2CW6A 2CZVA 1SW0A 3KDOA 5CJNA 4JIHA 1UR4A 4F66A 3F1QA 1NQKA 4DF1A 3VCCA 3GFZA 1OC6A 3GS6A 5J04A 1FY6A 5AYXA 1VFHA 2VC5A 4Q7BA 3PPHA 2P1FA 2JGYA 2E4TA 1Q7QA 3C2RA 4CN6A 3AJ7A 1JNDA 3QTGA 4JTGA 1L6FA 3WQDA 1PZ0A 1W9XA 3GZAA 4S3JA 5AVNA 5IRPA 1G7VA 3AHYA 1FWDC 1R0MA 1QBAA 2GVLA 4LU0A 5E0FA 3DHDA 1UH3A 2W61A 2HBXA 3JUGA 2QUTA 3BGGA 1YW1A 2XIIA 4L6HA 2VFDA 5EFFA 3PR2A 5I3DA 4O4WA 4JQ2A 3EMCA 2HXTA 3PBVA 1ESWA 1QK0A 1JUEA 2PWGA 2TRSA 5GJNA 4H6EA 1WOBA 4UQEA 4UTTC 4UTWC 2AKZA 3S47A 3W7EA 1BF6A 1OF6A 3N19B 4LANA 2Q6ZA 3W26A 3S2LA 5F1VA 2XSXA 5E09A 1KTBA 3ABOA 2VRQA 2WHLA 3HIJA 1D2KA 1TMQA 2WPBA 4B3LA 4GX8A 3EDEA 2ODOA 2XN2A 3T44A 4CCEA 1AQHA 4ROPA 4HU0A 1BEUA 2CLIA 3TC6A 2OWXA 1YKWA 1D3GA 4XB3A 3C2EA 1DJNA 4QX4A 4ECLA 1KD0A 4PTVA 1VFUA 3L2LA 4MIMA 4ICMA 1IF2A 1XDLA 3W7OA 1NFBA 4Q3MA 3VIFA 3BLEA 3FDGA 3QKZA 2NVCA 2BBFA 1JI1A 5EBAA 6TIMA 1N82A 5AHMA 3GR7A 2Q02A 4JFTA 4IUGA 2E09A 4LS0A 4IIFA 4QITA 5K3VA 3OG2A 1DJGA 5A2CA 3FV9A 1UUMA 4IL0A 5FEWA 1Y5WA 3R12A 1P5BA 5G4EA 1VYSX 2VC9A 3A24A 3CZLA 2J8GA 1MVYA 1B3XA 2QJIA 1XRVA 4NYUA 4KWUA 3PPGA 3S9IA 2YDRA 2AGKA 1PKMA 1DJXA 1TPDA 3R79A 1PPIA 1QOQA 4GIYA 3W23A 4RR4A 4L80A 3O1NA 1QW8A 3TQVA 1JVNA 4AIBA 4DB7A 4J1OA 1MQPA 2JQXA 1RJRA 1XS2A 4G6CA 3PS7A 1W1VA 2VEMA 1KRMA 3BOLA 1QNVA 3KP1A 3H4GA 4HPJA 2J88A 3DYOA 4YS1A 1UUQA 3CH0A 4ZFCA 2PTYA 3PZOA 2C91A 2Y63A 3W28A 1AQMA 1P0KA 1W54A 3RPTA 1XP3A 2WSYA 5K4XA 1V7AA 5FJUA 1TX0A 3BLPX 4JFUA 1XD1A 4KGLA 2E28A 3IV3A 3I3DA 1E55A 3W85A 5FF3A 4J27A 1E6ZA 4HBKA 1JUBA 1RK6A 4MNMA 1NF7A 3UZJA 3GTXA 2WBGA 3NFUA 1UQZA 4ZE4A 2DEPA 4GJIA 3M07A 1GVOA 4ZO9A 4B5VA 2QCFA 4FX6M 4AZBA 4HN4A 3C2FA 4OBTA 3C2YA 1TCDA 1CT5A 3N34A 3IIXA 1VIZA 4K6AA 1YX1A 4IMCA 1K3UA 1YTEA 2OJPA 1C8XA 2JEQA 2XVLA 3THCA 4GYKA 4JKKA 4IFOA 1SFJA