4XO6A

Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3 alpha-hydroxysteroid dehydrogenase type 3: structural clues of 5 alpha-DHT reverse binding and enzyme down-regulation decreasing MCF7 cell growth.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xo6A00
3S3GA 4XVEA 3R94A 1MRQA 2PZNA 2PDNA 4FAMA 3WCZA 3GHTA 2IQDA 4WDTA 1EL3A 1X98A 3ONCA 2FZDA 5DANA 3R8GA 4DZ5A 3CAQA 3V0UA 4L1WA 3RX2A 4XVDA 2NVDA 3DOPA 4H7CA 3VXGA 2HV5A 4HBKA 2PDHA 4GCAA 3UZZA 4JTQA 1IHIA 2IKGA 4QR6A 3CASA 1LWIA 2R24A 4WEVX 5JH1A 3FX4A 1IEIA 1X96A 1Z9AA 1EKOA 1AH4A 1XGDA 4PMJA 5KETA 3V0SA 3EAUA 2IS7A 4ZFCA 1AH0A 3LNMA 2FVLA 2PDPA 3R6IA 2I16A 3H7UA 4FALA 5C7HA 3WBWA 1EXBA 1C9WA 1OG6A 4EXAA 3LZ5A 4LAUA 1PZ0A 3GHRA 4GABA 4GACA 2F2KA 2PDLA 4XK2A 2IKHA 4JQ3A 3RX3A 1T41A 4L1XA 3LBOA 1PYFA 4RPQA 2PDKA 2PD9A 3NTYA 4PRRA 5LIUX 3CV7A 4XZLX 3ERPA 4JTRA 1Z89A 4F40A 3MC5A 4WDWA 2PDBA 3UZXA 2HE5A 4ASTA 2PDWA 3O0KA 2P5NA 2AGTA 1YE4A 1Z8AA 3UG8A 1AFSA 3LEPA 1ZQ5A 2NVCA 3UFYA 3UYIA 5HNUA 1Q13A 3H7RA 4LB4A 4GIEA 1HQTA 3CV6A 4GQ0A 3UGRA 2R9RA 4YVVA 2C91A 2QXWA 2ACQA 3N2TA 4JTDA 2IPWA 2ACRA 2J8TA 1XJBA 2VDGA 2PDXA 2INEA 1LQAA 1S1PA 3LN3A 1ZUAX 4PUWA 2PEVA 2FZ8A 3UZWA 1MI3A 2BGSA 5AZ1A 4XAPA 1A80A 3U2CA 4FA3A 3D3FA 3COTA 4JQ4A 3N6QA 4GA8A 3R8HA 2HVNA 2PF8A 2HEJA 3Q67A 5HA7A 3DN5A 4AUBA 1R38A 1S1RA 4XZNX 3FJNA 3BCJA 3R7MA 5LIWX 4IJRA 4LAZA 1EF3A 3EB3A 4QXIA 3G1RA 4PRTA 1K8CA 4YVXA 3V0TA 3R43A 3BV7A 2FZ9A 3M4HA 4LBRA 1M9HA 3GHUA 4DBSA 5LIYX 1MZRA 2PDMA 4IJCA 1X97A 4GQGA 4Q7BA 1YNPA 2IPGA 2IKJA 3LQGA 1RY8A 1GVEA 3ONBA 3BURA 3LD5A 1RY0A 2A79A 3UP8A 4YS1A 1UR3M 4YVPA 2INZA 2WZTA 4WGHA 1Q5MA 1JEZA 1S2AA 2PDFA 2CLPA 3LQLA 4DBUA 2PFHA 3G5EA 1SM9A 4WRHA 1AZ2A 4LB3A 3LENA 4I5XA 4QX4A 2ACSA 3MB9A 2WZMA 4OTKA 4DBWA 2DUZA 4HMNA 1YE6A 1ZGDA 1VP5A 1XF0A 1VBJA 3LZ3A 1PZ1A 4PR4A 4JIIX 2ALRA 5M2FX 3BUVA 2IQ0A 1T40A 3CMFA 2BGQA 3R58A 1ZSXA 4WDUA 4NKCA 3WBYA 4JTAA 4YU1A 2DUXA 5HNTA 3KRBA 2I17A 2FGBA 4XZHA 1PWMA 4PUUA 1AZ1A 2FZBA 4MHBA 2IPJA 1AH3A 3WBXA 4G5DA 5LIXX 4Q3MA 2PDCA 2ACUA 3C3UA 4EXBA 4LBSA 3RX4A 3Q65A 3P2VA 2PDUA 3H4GA 5JH2A 4QBXA 2PD5A 2F38A 3UZYA 3B3DA 2PDQA 4XO6A 1RALA 5LIKX 4R9OA 3V35A 2PDGA 2PDJA 2HE8A 4JTCA 3M0IA 4H8NA 1YNQA 4JIRA 1QRQA 2PDIA 2ISFA 4ICCX 4IGSA 3GUGA 1US0A 3EB4A 2BP1A 3T42A 1QWKA 4JQ1A 1J96A 3QKZA 1PWLA 3WG6A 3F7JA 2DV0A 3GHSA 1FRBA 1Z3NA 5AZ0A 3O3RA 4JIHA 2PDYA 4FZIA 2HVOA 4JQ2A 3V36A 1S2CA 4XZMX 4XO7A 3M64A 2HDJA 1ADSA 4JQAA 2IKIA 3LUTA 4XZIA 1HW6A 2IPFA 3UWEA 3CAVA 4WDXA
chains in the Genus database with same CATH superfamily
1UP2A 2E25A 3VOHA 3MVIA 3PUGA 2AQOA 4LVAA 3L4ZA 2PLKA 3AXIA 3ELFA 1SO3A 4GZJA 4JN8A 1WDDA 2ZX6A 4Y90A 4C6FA 1W8SA 4IP5A 3VIHA 1KBKA 5CJNA 5GJMA 1ZS2A 4C6KA 2WBKA 3GXFA 2GGGA 4UWMA 4WY0A 1YHTA 3ORWA 1CWYA 1KM0A 2RJGA 2YR1A 3PBGA 1JDCA 3QFEA 1X96A 1O5XA 4W84A 1ONXA 3C8FA 4M0XA 1H7NA 1CXIA 4FLQA 4KESA 3IJQA 4TMBA 4L9YA 3RYSA 4XSMA 2OGYA 2VXNA 1IR2A 4ROPA 4Y9AA 3AS0A 2GFTA 2I16A 4NILA 1DJNA 1EGMA 3SI9A 4ZQMA 1HO4A 1O68A 1XRVA 1TPUA 1HX0A 2HISA 4M7TA 4M7SA 3ARVA 4F48A 1CGXA 1ZAIA 5H1WA 5F4SA 4FXSA 3N18A 5HR7A 5LNVA 2OLAA 3CH0A 3HJEA 4N2YA 3FFSA 5A3HA 2F7FA 1WKYA 3TN6A 1SSDA 3CWNA 2ANUA 3FNDA 2QEZA 1F6KA 1EBGA 4H1ZA 2XINA 1OY0A 2V81A 1EQCA 5LNWA 3BLLA 1Z8AA 3MBDA 2DZVA 4DPQA 2WJDA 4JTJA 2Z2BA 4C91A 1XIEA 3UWYA 5FF2A 4YHGA 2DQWA 3OQ8A 2QVNA 1RUSA 3QV8A 1YDNA 3V5FA 3LA4A 1M7XA 3W1TA 1B3WA 5D02A 3NR0A 2GUBA 4LOCA 4ZZ9A 3MDUA 4HK6A 1XYFA 3TUUA 2PEVA 3GYCA 4EPEC 1C3FA 4IISA 5EMYA 5C54A 1A80A 4LVFA 2WYSA 3KP1A 2QULA 3B04A 1QATA 4GA8A 1E9ZB 1PVNA 3DAQA 4MG4A 4NQ1A 1WOBA 3W73A 3SCTA 2D73A 3QZAA 4AUBA 1EDGA 2GGHA 5FI8A 1BWLA 1E9LA 3IJ7A 6REQA 1PEZA 4PTDA 2ZUSA 3W1NA 3E0WA 5GQBA 1FWHC 1ZALA 3G1RA 2PCQA 4QQUA 4UOJA 1E0TA 2V30A 2C1IA 1W3HA 1XDLA 5BRPA 5LIYX 6TAAA 4NX5A 5DLCA 5LKYA 1AG1O 4Y7EA 2JEQA 4OBSA 1GOQA 3KOFA 2XIIA 3LGEA 4AVOA 1BHGA 1E6SM 5AHNA 1TPWA 3ARWA 3B9AA 2JALA 3VIFA 2AOSA 4LUSB 1RY0A 3GC2A 8XIAA 1GPFA 2OO6A 3PTQA 4CNPA 3PZMA 3H4XA 1XH1A 1V77A 2GSHA 2XSXA 2PDFA 3XIMA 3SCVA 3CQHA 1Q6GA 4DXVA 1TIWA 5FJOA 3SJNA 2P3EA 3IJ8A 3E2QA 3RMJA 4HNUA 4AZ7A 3A5VA 4H9ZA 3STFA 4R34A 3W75A 3WH8A 3I6EA 5I3HA 3G1HA 4WX2A 3BSMA 2MUCA 3HPZA 2ZUWA 4RUBA 3NQ7A 4QIUA 1RBLA 2Y0FA 1VP5A 3F4WA 3TSDA 3INPA 1MQRA 5KSWA 1PZ1A 3VKJA 4H41A 1OSEA 3S6DA 2OLHA 5HOSA 3MSDA 4EAYA 4M6PA 4DO7A 3IUDA 1W5PA 4BQ2A 3CMFA 4YTUA 2TAAA 1A4LA 3IUHA 1OADA 1LUCA 1RLCL 3B8TA 3ABOA 1MEHA 1NAL1 4XAFA 3CMGA 2OJPA 2ASHA 2ZUTA 4CQ8A 1VJIA 3CUJA 1AH3A 3SIZA 4G5DA 4AZBA 2OEMA 2WMJA 5E9AA 1WKFA 3GZAA 2V68A 3WLSA 3VMPA 4RNFA 3KTSA 2NQ9A 3LLXA 1LRNA 1GVFA 1UA7A 3GBEA 3KOWA 3P2VA 3SRKA 2G4FA 2PDUA 3GLCA 1QHPA 4I90A 1HFBA 3SCQA 4UTTA 1TZZA 1XL9A 4JY8A 3CYVA 4XO6A 4B5XA 1UASA 4INFA 1U1JA 1JZ7A 4GXMA 4NXSA 1XLDA 2E5BA 3T0CA 3V35A 4S1FA 1VAHA 3WY1A 3DC8A 2VGIA 1MNZA 1XBXA 3W22A 1FOBA 1DXFA 4YYFA 1MXDA 2WLZA 1C93A 5MKGB 4G1NA 2PDIA 3GUGA 3TJXA 3QPZA 1J96A 4O28A 3KBJA 1FA2A 2V5LA 2VEKA 1F3EA 3WG6A 5AB3A 1S46A 2Q8LA 1J4EA 1MQPA 4B5NA 1YNYA 4AD0A 3CBWA 1NDYA 2F61A 5CG7A 6PTDA 5HQLA 3RHGA 1FWTA 4C1KA 3SUSA 4CQAA 3VM5A 3E9AA 4IPNB 3VAVA 4JIHA 4ZR8A 4W93A 2P0OA 4AIBA 4JQ2A 3OIXA 3UXLA 1S2CA 3T78A 4DHGA 5JXQA 1ADOA 1B54A 1LP6A 3URNA 3FKRA 4CQ9A 3LUTA 3W7MA 2CHNA 1KGXA 3BC9A 1W9PA 3VU2A 1IIHA 1S5TA 3DFYA 4QG6A 4BK9A 2AQVA 3GG8A 4EE9A 3H23A 3UQNA 2XVPA 3KHJA 1RQBA 4HU4A 1UOZA 4NVTA 4JTSA 1EP1A 4IZGA 3C52A 3BAWA 3RCMA 4GE8A 3W02A 2J6XA 4GQRA 5BYWA 6ALDA 2YDSA 1QASA 1KBJA 2BOEX 1IE7C 4GYPC 3PWIA 3HQOA 4KRUA 3CASA 1OK6A 2OEJA 4IGMA 3WDRA 1X8CA 2G37A 3AHXA 5CZJA 3H55A 3U3HA 3WF1A 3M0JA 3SQLA 1AH4A 3F4CA 3OPSA 5D05A 3BLFA 3BTNA 3WNLA 1AH0A 3VZYA 1JCTA 3AHVA 3EPOA 1XM3A 1M6JA 1DQXA 4XB3A 4Y8EA 5BU9A 5KZ6A 3FYPA 5AC5A 7ODCA 4OOZA 4HQVA 8TIMA 4WOZA 4GACA 1DWFM 4DLMA 3CK5A 4PTNA 1QNSA 1OINA 2WNZA 3TOPA 3OGVA 2Y89A 3ANYA 4L6OA 2BB0A 4PB3A 1XYCA 3WEMA 1DL3A 3UGVA 4MZ8A 1OF6A 5C5YA 2VWTA 2E9LA 3W27A 1P6WA 3KTCA 5B7ZA 1SJBA 2V2CA 3NTYA 5A94A 3CQIA 3PJWA 1UC5A 4GJIA 5A6TC 3WD3A 1VBUA 4Q4SA 3VUSA 5A8GA 5EL1A 4L61A 3OTRA 1O95A 4TV6A 2DT0A 2I5IA 4CNNA 3W29A 2J7BA 5U7SA 3O63A 1TE1A 1CXLA 2J7EA 2CWNA 3S5OA 1JPKA 3MUCA 2J25A 2Z28A 2ZVRA 7TAAA 3NPUA 1H63A 3H8AA 3VC6A 5I7GA 2VHLA 1AJ2A 2CXGA 4AMAA 4GQ0A 4LUIA 1YBQB 3U5YA 3NG3A 1Z6KA 3HGJA 5TIMA 6XIAA 4JTDA 2VD8A 4I5UA 5I3FA 4OT7A 3WL0A 3B8UA 3G6MA 3LM7A 1E5JA 2G3IA 2VDHA 1OT2A 3T2OA 4O15A 4XAPA 3L9CA 3D3FA 3W1AA 3ITXA 4GNKB 2HVNA 1XPGA 1WCGA 5HA7A 5HNNA 3E02A 5AECA 4DI9A 3MWAA 4E8GA 1Z7AA 1UQZA 1MWOA 3FLUA 1KKRA 1TWIA 4I7VA 1QDSA 5I78A 3UG3A 3UCCA 1PB0A 2E67A 3BCJA 4TVUA 4FMVA 4Q4RA 4GUHA 1QUMA 4ZXOA 2C7FA 2QGYA 2ZA3A 4FLRA 1GQIA 5BNKA 2V69A 3PG8A 4IMEA 1WA3A 1NELA 2X7WA 3M4HA 3G1XA 1FP8A 4XUYA 3R0KA 4NYYA 1EH9A 1NWRA 4KEZA 3PZOA 1ZB5A 1E6QM 5A69A 3ITVA 1UKTA 4M80A 1RLDA 5E1QA 1P1MA 2Y24A 5JBFA 1EUAA 3EWYA 3E6EA 4O16A 1L6GA 1LCOA 3MHFA 1WV2A 2DT3A 4R5EA 4AC1X 4UTWA 1LRTA 1QOXA 4NAEB 4DBUA 2WKLA 1ZRQA 3I6TA 2WCGA 3LCLA 2A3BA 4XBKA 1HJVA 5D9PA 5HWJA 4HSOA 1UJQA 4DZAA 2YL5A 4QRNA 3WLOA 4GPNA 4YL2A 2BSLA 3WNPA 1PS9A 3WNMA 1CTNA 2X16A 1YE6A 4QLJA 1XHGA 4GH3A 2CZDA 2CZVA 5CPSA 4HOZA 3OG3A 4UFJA 2O9OA 2HBXA 1XLAA 3XISA 4ONVA 2WHLA 3LZ3A 4J3UA 4MDPA 1IXPA 3B97A 2VQUA 2W67A 3WFLA 3DH7A 1JDFA 3V1HA 1EC9A 3SN1A 2QCLA 4NNBA 1T40A 2RAGA 2BGQA 2PWFA 4V28A 2RGLA 3TQKA 2GVEA 3OODA 1A3HA 1UB3A 3IIZA 3WLIA 4HOXA 1FWEC 4IG2B 1JF5A 3P82A 2R91A 3H12A 3VGDA 2EAWA 1E40A 2Y1HA 1FY6A 3LHYA 1XICA 3VNDA 4X9SA 3G8RA 4Q4KA 4LF1A 5EKYA 1L6YA 5HQMA 2R1NA 1OC7A 3BMVA 5F4XA 3TR2A 4ICNA 2DEPA 4PBGA 1JPIA 4RE0A 1XYZA 1VLIA 3MW7A 2VEMA 1DHPA 3BJTA 1WAUA 2XIBA 2NX9A 1QK0A 2V82A 3HV8A 5AHMA 5LIKX 3WLMA 4E0CA 4DJDD 1MDLA 1L2QA 1EYEA 4OZOA 2ZC8A 4JTCA 1X1OA 4R7WA 3CO4A 1SMAA 1E0VA 4FXRA 3E5PA 1M7JA 1S5MA 4OV9A 3M07A 4C7GA 1TV2A 3RF9A 3GS6A 3KXQA 1W0MA 5BXPA 3ES7A 2O9RA 5C8BB 2YCJA 1WZAA 1G6CA 5AOUA 3GAKA 1M3UA 1PWLA 5XINA 4ERAA 2VWSA 3T1GA 1GVOA 4G7EA 3ZJKA 1ME9A 5LHEA 3PZUA 5AZ0A 3WQ8A 2XUCA 1G5AA 1OVDA 1AD1A 4HA0A 4C5YA 3NL6A 3QW4B 1JFHA 3TC6A 1FWWA 3OJGA 4JFUA 1W9BM 1R47A 2CEQA 1K4HA 4TX9A 2BLEA 2YCLB 1JUKA 1ONRA 2DUAA 5EFDA 2GQ3A 3DU0A 2NZLA 2WSYA 4FIQA 2TSYA 2YLLA 5C6MA 5C9XA 3GVVA 4GINA 3POCA 1P0BA 3VA8A 1V51A 3WDPP 4O19A 1EOMA 4LVBA 2IQDA 4KERA 1X98A 4DUXA 1UW9A 4OQVA 1U5HA 4L1WA 3TYBA 4UUIA 1V6UA 2WJFA 3AHTA 1L6WA 1LDCA 2F6UA 1YPXA 4MKSA 4K36A 1HXJA 4CNUA 4ML9A 4WY0F 5ABFB 1QWGA 1BGGA 3L4TA 4MYAA 1PKYA 3SCUA 2E68A 3JZEA 3CMJA 3A3HA 2QAFA 1CGTA 1VCGA 2UWFA 2DZXA 4UTLA 1F4AA 3WQCA 1GWJA 1GW9A 3KWSA 1ZENA 4GVIA 1DE6A 4PMXA 3PF3A 4PCNA 4JX5A 3T2PA 8XIMA 3PPFA 3HPFA 5DFAA 5HXMA 3F1QA 1E56A 3P60A 4GUJA 3CUXA 4OBRA 3LZ5A 4GJJA 4AAJA 3IGSA 3GR4A 5EA9A 5HUOA 1J6PA 1OFDA 3IIXA 1LYXA 1P5BA 1B30A 2PI6A 5KZMA 3M47A 5A2BA 2J6VA 3S42A 5LYRA 1HJSA 4MLJA 3C0SA 1E15A 3WQVA 2UZ9A 5DMYA 1YQ2A 3STGA 4J9JA 3R5EA 3VMOA 1X6UA 2WMFA 2FPYA 3KX6A 3ANVA 3QR0A 4GQQA 4JXCA 5MF5A 4JR5A 4G2DA 2XWEA 3ZFHA 2FVMA 4R3UA 3BAJA 2AGTA 1R3TA 2NV2A 2XFRA 3W01A 1OHLA 2TYSA 5FEWA 4NP7A 2A7RA 3H7RA 3BPWA 1UG6A 5CSSA 4TV5A 5D09A 3UYCA 2C91A 2E7FA 2ZUMA 5CJMA 1M04A 3I7SA 3OHMB 3LOTA 4IGHA 5G4EA 1IXNA 4NAEA 4CU8A 3V5CA 3UZWA 3HO8A 4IM4A 4IPLA 1WZMA 1H7PA 1FCBA 3TR9A 4UQDA 1XIHA 4JTFA 2P8BA 3VNKA 1SZGA 1M41A 4KW2A 3OU8A 4XBSA 2D0HA 4I5RA 1Q6QA 3LLDA 2Z7KA 1F73A 5XIAA 2FMOA 1MW1A 2X0SA 1SR0A 1PCKA 2NQZA 5HMFA 2FFCA 3R7MA 2GQ8A 1OQFA 4HJWA 3IS4A 3VKBA 2BBFA 4Y8FA 1W5NA 5DT7A 1JZ3A 4IG2A 4KF1A 3B0VC 1X97A 1FTXA 4GQGA 4UFHA 3WMCA 4ORMA 1KFCA 3EDJA 1VFLA 1MEWA 3IK2A 1UR8A 1WXYA 3HGOA 2QZRA 1F6PA 1ONEA 2O0TA 3UP8A 4MGGA 4IIEA 3QHNA 4HSHA 3OB8A 3LQLA 1KC7A 1MO0A 1CNVA 2PFHA 3QMRA 3QH2A 2Z1BA 4OWGA 4JDBA 3LTSA 2J7GA 3HBLA 3UWVA 5CPOA 2VR5A 1JL8A 1V3HA 4ICMA 4U5IA 4KIEA 4HMNA 2J7CA 2C0AA 2ZADA 1XLJA 2C3ZA 4WF7A 3G0UA 1TQXA 4DO4A 1G67A 3QV6A 2FJUB 1Q3NA 2E4TA 2NLYA 4LT9A 1A3XA 4PUNA 4HP5A 2VCCA 3A22A 1QPQA 2Q02A 4C60A 1HP5A 3WJSA 3APTA 3EDEA 3Q58A 3O15A 5HPCA 1UR4A 5HNTA 4AFYA 1DJWA 1OYAA 3C0LA 1AZ1A 1HKKA 3OA3A 3VINA 1UKSA 1FBAA 4REQA 4W8AA 3W2UA 4MHBA 2YCLA 3CO8A 3R25A 3W7GA 2VFDA 3T44A 1UZDA 3E2VA 1NP2A 4S2CA 1XBZA 3VZXA 4C65A 4L4MA 1QNVA 3BG5A 4UNIA 2YB1A 3VK5A 4RK8A 3K8LA 3R2GA 4M51A 3IACA 2WOQA 3HQNA 4MWAC 1XYBA 3O07A 4UFKA 3T0BA 4AWEA 4DZHA 1TSIA 1V6YA 4NZFA 1JRCA 4HKPA 4K1GA 4IXHA 3V3WA 1VFHA 3W72A 3L2LA 2CBJA 2W66A 1TTJA 3HU7A 3SIMA 1HGWA 4JX6A 3W7OA 4ADTA 4KS0A 3TZNA 2NSXA 4CNSA 4PL1A 4AXKA 1A3WA 2Y8VA 3S9ZA 2FHFA 5ABFA 4J28A 4LW7A 4UCFA 3RPTA 2I9EA 3CTTA 4LYPA 3RK8A 1OFPA 3S1XA 3O6DA 1PYMA 4F66A 2NT1A 2Y62A 4Q4PA 3TYDA 4KQNA 1RA0A 4I9AA 3OIHA 1RJRA 1HP4A 4AX7A 5E0CA 5AVNA 1HN1A 3WEOA 1EDTA 3HZ3A 1KM2A 3L5MA 4EXQA 5FJUA 3V36A 2ZA1A 3W26A 2D24A 4DLFA 1Z48A 1ZZMA 1AVAA 5H8MA 4H2CA 1L0PA 3EDDA 2YCKX 2IQTA 3MKVA 4GISA 4ROQA 1K9EA 2XVKA 1YDVA 3N4AA 2WCAA 1F3TA 1H11A 1NFBA 2OZTA 4GVHA 3GBDA 3QVQA 1QI4A 3NQCA 1YXYA 1S39A 1JCXA 1LWJA 1ZY9A 6CGTA 2J27A 1QPKA 1PDYA 3OZOA 1B57A 2XZ9A 1TJ1A 4MNJA 5HJLA 1QHZA 2D2GA 4UOQA 3NCOA 1TUFA 1ISVA 3GAYA 2JF6A 3I4EA 1TPEA 3NDYA 4XZBA 3W1MA 2D69A 4WXZA 2B31A 2XFFA 5F2GA 3TA6A 2GWNA 2PWGA 2HNEA 1UWIA 3DHDA 4QP0A 5CXPA 1FVPA 3WMBA 3UZ5A 5JH1A 4K2SA 3PAJA 3DKJA 3L4UA 1J01A 2LLEA 3JW7A 1C8VA 4GGBA 1UD5A 3SURA 5A8OA 1YRRA 3VGBA 3TAOA 4XV0A 2GDVA 4B16A 4DI8A 3MVTA 1XFBA 2PDPA 4GH1A 3L5LA 3B9EA 4IGNA 4HZ6A 4FALA 3QR3A 2V2DA 3H2CA 5EY5A 3KDNA 1LORA 2FMNA 3FSUA 1A0EA 4X61A 4JTKA 3W9ZA 4XK2A 1IV8A 5HANA 1JCYA 3SSZA 1JZ6A 1KB3A 4H83A 4OFCA 1GVSA 1MYRA 1B4EA 3PVFA 5K7JA 3S9IA 4H19A 3MI3A 2NUWA 3DFQA 5D2XA 3ZJ6A 4IH3A 3UA3A 4AU0A 2GGIA 4JEQA 1EB3A 2SFPA 3ERPA 2EHHA 9CGTA 1D7FA 2AL2A 3AAMA 4KCVA 3Q45A 1EA0A 3C8NA 3K5XA 1K02A 4CQCA 1OB0A 1PPIA 3UJ2A 3WUGA 5AC4A 4E4FA 2RUSA 1H7OA 1W1B1 4QNWA 2MANA 4K38A 3U48A 1OK4A 1OT1A 4GWEA 4AD4A 3C86A 4WJEA 2VGBA 4LF2A 5BRBA 3W83A 3W1UA 4N6EA 2A4AA 1F61A 1GPWA 1UD4A 2ZZ3A 4LEFA 4Z2GA 3IVUA 3VPLA 3SQMA 4DAIA 4P8WA 3CM4A 1KWKA 1RK6A 2PRMA 2PF8A 1PJ9A 4OOUA 3A4AA 4ACZA 3HMJG 1DPMA 2QDDA 6A3HA 1GJPA 2XGBA 3W07A 2D23A 3NM3A 3WFAA 1OFBA 3M43A 3WUFA 1KKOA 1I4NA 1DEDA 4C1LA 3PWAA 2OKTA 1VZWA 2YOCA 1KXQA 2WHMA 2W3ZA 1VPYA 2EPHA 1F07A 5FA5A 3ZLFA 3FN9A 4TQTA 3A3XA 1TPH1 3CHCA 1M7OA 4PMQA 5CAKA 1ICQA 3KBVA 3O8AA 3W7EA 4Z0JA 5C70A 2FZ9A 5C9RA 4LBRA 3VIOA 3CHEA 1DJZA 4ZGYA 1OBAA 1VFOA 2E0PA 5G4HC 2XWDA 4HPJA 1UR0A 2OELA 1JNEA 4I9TA 1C7SA 3DBPA 2QIWA 4GYJA 3BOXA 1FWGC 1XR2A 2AKZA 4ZOCA 2INZA 3CQ0A 4AY7A 3B8SA 4O1CA 2WZTA 4EWJA 4WR3A 1NOWA 2C1GA 3SSJA 4L9ZA 3UG4A 1PKNA 1OD8A 3H2EA 3QRHA 1V6TA 3MB9A 4J40A 3DYPA 2A3LA 4QAIA 3MYOA 4JCLA 4GXWA 5ABGA 1TR1A 2CYGA 1OCJA 4C6EA 3NSNA 3ZT5A 3EMZA 3G1VA 4N9EA 2AMXA 4DAFA 2WCSA 1BKSA 2ZX8A 1VBJA 2OQLA 2BOFX 2YCIX 1REQB 2Z2AA 4PR4A 3SBFA 4W88A 3PPGA 1U2YA 1IZJA 1BKHA 3WQ6A 1O1ZA 4MNKA 4R7OA 1GKQA 4Q8WA 3PTKA 1NQ6A 3B06A 2F2HA 2E77A 2W79A 5T26A 4XZ9A 3M0VA 1VFMA 4IMFA 3LHUA 2OYKA 3AJXA 2Y8UA 7REQA 5DCEA 2WVVA 4UFMA 4M1RA 4K8EA 2BS9A 4KWUA 4UTMA 1JXKA 5DQPA 3ARTA 3H4GA 3PZ9A 3ZVHB 1VJSA 2E8ZA 3RM9A 4LX4A 4MJ2A 4EF9A 1HKIA 2DIJA 2CZFA 4NF7A 3USBA 4UNKA 4S2BA 1K03A 3SRDA 2BV9A 2VC6A 1US0A 3NDZA 4YTRA 1ITCA 2X2GA 4DYKA 3CZEA 3T42A 4C5ZA 3F03K 4LNCA 4Q8NA 1XYLA 3L0GA 3B0YA 3THAA 4XD4A 4LC6A 2V3EA 5AKQA 2H3DA 1QR7A 1GQKA 2DZWA 1RP9A 4EPDC 5D2YA 4FNSA 1E6ZA 1QPRA 1OGBA 3VZZA 2WC7A 2D3NA 2AGKA 4JBRA 3KOYA 2PP3A 1QPNA 2OXNA 3N73A 1CBGA 2ZIDA 4GVFA 5TQLA 1WNOA 3A4WA 3KVLA 3HJZA 1GJWA 3GH7A 3BVJA 1A47A 4XZIA 3C2YA 1AD4A 1TTPA 2QNEA 4I7WA 2BY1A 3KBWA 1SQ7A 3THDA 4IWWA 2PGRA 4PGLA 3PZGA 3ONCA 3WEZA 4F4RA 3ISIX 3EA2A 3VILA 3G1YA 3UEQA 4D8ZA 2PLCA 4E2BA 4MZ1A 3KWXA 3UY7A 2FDSA 3F2CA 2NVDA 3WK2A 5HDRA 5I3KA 1HVXA 1HKWA 1RV8A 2PPGA 2YDQA 5FJRA 3HG3A 4X63A 2XH7A 1G4PA 5CC3A 3AIQA 5EMLA 3LI0A 1KA9F 5CEWA 3QTPA 1BYDA 5K4XA 2RHGA 3OVGA 3AZSA 2OEKA 1Z69A 4XIMA 5C0QA 3MSYA 1EEPA 3R89A 5CGMA 4CEXC 1MSSA 4HMEA 1CW2A 4LYKA 3A3WA 1K77A 4G6CA 4S3FA 2Y7GA 4H8VA 2Z1XA 3LM3A 1J79A 1V7AA 4LAUA 4B5WA 5T8GA 5A2AA 2Q01A 4UBPC 4YNGA 2PDLA 2IKHA 1HG3A 1KRBC 3URQA 3UCQA 2CESA 3FVDA 1PIGA 4B9YA 4Q8PA 1AL7A 2BY2A 2CWXA 3F5LA 4PB5A 1Q7ZA 1GG0A 4QAWA 4LTSA 3HG2A 2Z1SA 1XQKA 4MIMA 4MSSA 1Y8BA 4U3CA 5DN1A 3OGSA 4Y6GA 3GNPA 4JTRA 1GOXA 1FXQA 1E0XA 2FTYA 4JOMA 3RM8A 1Z89A 3AHYA 3MC5A 1KFWA 2XZ7A 4NG3A 2X30A 4LVGA 1GGOA 4ASTA 2CLIA 4LALA 2ISVA 4RLIA 3WUBA 4WOQA 3BG9A 3GG7A 3D3AA 1QI0A 3L67A 3AOFA 4HCDA 2BNJA 4E3TA 2Z27A 2HMCA 2QXWA 1CCWB 4AD5A 3FJLA 3VD5A 3BMWA 1LBMA 2VTFA 1CGVA 6TIMA 1ALDA 2XHYA 1SJDA 3IEBA 1H41A 2JIWA 4FEZA 1BVNP 1SFJA 2PTZA 3O16A 4AWUA 1RJPA 3DHPA 5EMMA 1XLHA 4NT0A 1TJ2A 3GTNA 3DN5A 3TWBA 2JKAA 3GXNA 4OVXA 3N6HA 2QJGA 3FAXA 4PRWA 1REQA 4YXGA 3FJNA 4ZMGA 1WBJA 4B3KA 4A3UA 3ABZA 4HZ7A 3ZOAA 1V6VA 1PIFA 3AROA 3MKCA 4O17A 2RDWA 1MZRA 4PMDA 3RMEA 4B2DD 4IFRA 3BG3A 5I02A 2C8NA 3FAWA 3R13A 2PP0A 3WIJA 4J2PA 4C6QA 3L4WA 5IFTA 2EJAA 4PN2A 3FEMA 3NZRA 2V67A 2XIMA 3VIJA 4FLSA 2IKJA 1RY8A 1OEPA 4RPPA 4MB1A 1B90A 2I5GA 2W92A 4CU7A 1ZPTA 4QE5A 3NL3A 2B7PA 3ZVHA 4F0SA 4LV4A 4N7QA 1OJXA 1EHNA 3HFTA 3GDMA 3O6YX 4C6LA 4PMRA 3PZQA 3S5ZA 2WK2A 1PHQA 1LBFA 4CN6A 4NZCA 3T0AA 4KWOA 3RPMA 3BDKA 1VC4A 4HTBA 1KFBA 4PUEA 2DU2A 1C8YA 2ZZ6A 2DSZA 3C56A 4YMZA 2E1DA 4OV4A 4PB4A 4BA0A 4FI4A 1EIBA 1DIOA 5I6SA 3GR7A 1XF0A 3JR2A 2QPSA 1Q65A 4MB3A 4CD7A 2BY3A 3C0JA 3VNZA 3CIVA 2PURA 5IDIA 4IOTA 4NZJA 2WMGA 3IK4A 2FQIA 1NOUA 5IBXC 2CHRA 3NM1A 3HN3A 3MHUA 4UMAA 1Q6EA 1FHLA 3RM4A 1DYSA 2ZE3A 1CLVA 4UR7A 1E1FA 5G1MA 4NAFB 3GDLA 1CT5A 1H5YA 3AIBA 3CHVA 2ZRZA 3K1DA 2HSAA 3W7CA 3W23A 2PDCA 4OIFA 4XKYA 4H8HA 3PR2A 4E6MA 3SRFA 1SYTA 1GYLA 2F38A 3OYZA 4LAOA 1R5YA 4BKNA 4J35A 1FUYA 1MFUA 3B8DA 1R9ZA 2FIQA 4MJMA 3ANUA 1H0IA 3BLDA 2EJ1A 2G8ZA 3TP4A 3OLDA 3WLTA 4FX6M 1TREA 4H8NA 3KP0A 2CU0A 1H62A 5CG0A 1W1TA 2IUZA 3ITYA 4Q6XA 1I1XA 1WQ5A 4WVXA 1MXGA 3GH4A 4PFMA 3L66A 2ISFA 3LY0A 4ICCX 5BRQA 5A2CA 2GJXA 1RBAA 2ZOXA 2B7QA 1TCMA 4OJYA 4L4PA 3BCFA 3FDGA 3GHSA 3W1RA 2PCEA 3A64A 2ZZ5A 2EG7A 4L6DA 3WF4A 4AD3A 3T8QA 2CETA 2CLEA 4O57A 3WLQA 3MDWA 2VMFA 1UC4A 3VNLA 3AMGA 1B2YA 2X40A 2XIOA 4LV9A 3L7RA 4GO9A 4N4QA 4W5ZA 3VOCA 3CXOA 3GKAA 4D8LA 5TD4A 1ZBCA 1L9WA 5A8MA 1N8IA 3GKFA 1LG1A 1VPXA 2PF0A 2IKIA 2ZRVA 5AVHA 4TVCA 2IXVA 4U33A 1O7AA 1NQKA 4OKDA 4DRSA 2YYTA 1QMLA 2P76A 4DJDC 2OOFA 2IW0A 3WJYA 3RUBL 4LY4A 2PGFA 1R3WA 3TTQA 1HF6A 2G5WA 7PTDA 3ARQA 3VTRA 2VFFA 3LCIA 4MFDA 3N2BA 4PE8A 1S2WA 1BTCA 4GCAA 1IHIA 3MUZ1 4GFSA 2BHUA 1Q85A 3GZ3A 1PKMA 1IEIA 4DUOA 1E71M 4E8DA 3AISA 4PMJA 4GVGA 4PSPA 2YZRA 3G0SA 2ZUUA 3V0SA 3M5ZA 1E3ZA 1KV8A 1PZ2A 4Q4MA 1BG9A 3VKAA 1L6SA 2CKSA 3VX0A 3R6IA 1N2VA 2BG5A 1QNPA 5T9CE 1QU4A 3ZT7A 3N2CA 3A13A 4DM2A 4D6EA 1W2VA 4S39A 3QMTA 4XAGA 4NI8A 2ZBTA 1T5AA 1BWKA 1I75A 5FOOA 5IRPA 1QXLA 5CC5A 1UZHA 1A5UA 4UR8A 4NJGA 1PZ3A 1DJXA 5IXEA 4JD4A 5DBTA 3BJFA 1PYFA 4ZB5A 3VI2A 3CU2A 1XLCA 1HZYA 5D8ZA 4C90A 2QJJA 3GYEA 3THUA 1GVYA 2ZFAA 1LLWA 2E6AA 3GQYA 5L6UA 1TB3A 3H2MA 4DJFA 1E4NA 3WLRA 3SY8A 4GBDA 4J7RA 1ZBKA 1LZOA 2PLMA 5G2IA 5FL0A 5E9XA 5CCZA 1XI3A 2PDBA 4O1DA 1FWNA 1S2TA 3IANA 3HQPA 1YLVA 1DIDA 3ZLHA 2VFHA 5FF4A 1AFSA 5ABHA 1ZQ5A 1JJKA 3MS8A 4ZQCA 3WK1A 3BW4A 3MO4A 2WSPA 3UGRA 4Z2LA 1LL4A 4Q8UA 2YJQA 3QZEA 3GXTA 4GUGA 3OLEA 2FFIA 3HG5A 2ATMA 4HHHA 1W5QA 1XX1A 1O4UA 4HPHA 3NZQA 2BTMA 1PAMA 2Z00A 3GNRA 1MRAA 4AZHA 1FH9A 1ODUA 3AWOA 3TZFA 1IWBA 4H9VA 1FDYA 4CEUC 4AYSA 3P7YA 1WZLA 3RRAA 4TTUA 4WZHA 2C0HA 4RXGA 5CGQA 2PTWA 4BHYA 3T81A 4HHMA 2ZRXA 4XZNX 1VHNA 3HFYA 3B0PA 3DGBA 4E8CA 5CSYA 2ISWA 3VDCA 3ARUA 3M46A 4Y9MA 1KM1A 1XIIA 2Y5JA 4W7UA 1JR1A 4ZOBA 2WO5A 2XIQA 2YGYA 2DJLA 4NAFA 1KCKA 1TUXA 4X60A 2ZQ0A 3D5HA 5DY3A 1PO9A 5D32A 4UXDA 3M0KA 3MY9A 3DFPA 2C15A 4BCEA 3EWCA 4C6PA 1UJPA 3T55A 1JULA 1O5QA 2ZRWA 2VJXA 3OZYA 4C1NB 4U31A 3SCRA 3MMTA 4WJ8A 2CLPA 3J7HA 2A6NA 2NQ5A 4LS0A 3G5EA 4KETA 3MP5A 4PCSA 5LSMA 3P8IA 4Z08A 4NI3A 3U5UA 2JEPA 5KZEA 2D2HA 3HA1A 4RE3A 4P61A 5DEZA 5ECVA 3W1PA 3W74A 4O18A 3AS1A 3VOJA 4PBEA 4DJEC 5B80A 2DZBA 2DFAA 1E55A 1PHWA 3LPGA 2GLKA 3VIMA 3GDTA 4BWLC 2GUYA 2WSKA 3ME3A 4HB7A 1O6IA 2FPVA 1LT7A 4FPSA 4B5TA 2PP1A 3BJSA 4ILSA 1NDWA 1OZMA 1NF0A 3C2EA 3PAOA 1CYGA 1PWMA 2ABBA 3MCMA 4DY1A 3KBSA 1PX3A 3L0NA 2PC8A 2RH9A 4UQBA 2ACUA 2CLHA 2A3CA 4IT1A 2VELA 3RX4A 4JFTA 3NYZA 3QGAC 3B8VA 5EPDA 4JIEA 4V33A 4KCWA 5E5CA 4U5KA 2CXEA 3FK4A 2FHCA 4LYRA 3QY7A 2PDJA 4PBFA 3NO5A 3GSMA 1PSCA 3IGUA 3AALA 4DELA 2ZWZA 4V27A 4KT2A 1P0DA 2VX6A 3CIXA 3U7BA 1O94A 3WLJA 3DI1A 3VGFA 1TWDA 3AQUA 2E9MA 2HCVA 2WKJA 3GIPA 2HWGA 4XQ6A 1ONWA 1XRSA 2ZA2A 3SCPA 1M65A 3W2LA 2W63A 3CB3A 3KTXA 4QTGA 1VS1A 3SR7A 4BEQA 3PWGA 1FRBA 3W00A 2GJLA 3AZTA 4H6RA 4IXXA 4TMCA 3FJ6A 2Y85A 3A9IA 4DN1A 3T09A 5AYXA 3L12A 3GNOA 1KR1A 3KBNA 4NY2A 2O92A 3EA1A 3AMCA 1VENA 1EX5A 2RDUA 1JF6A 1H7RA 5JQ9A 1BVWA 3FXYA 3UXAA 1KTCA 2CNCA 1RD6A 3N1AA 3WL1A 4IFKA 4Q8VA 1GORA 3B4YA 3B9NA 1SZRA 4XVEA 3SCWA 4AVNA 4K8GA 2V63A 4IUOA 3WCZA 4IIHA 2Y63A 5DANA 4DNHA 1BFNA 2Z29A 4DZ5A 3G8EA 5I3JA 3T40A 3GFXA 2XVLA 9XIAA 4PUJA 3CTLA 2V8ZA 4L6HA 1T6MA 5J04A 3LCGA 3DOPA 3TN4A 1FDJA 3D47A 1JDEA 5A8NA 2W62A 3EOUA 2G3NA 3MCOA 2JE8A 5JBDA 3BQ6A 3NQBA 3FV9A 1R87A 3E1F1 5E6YA 1XLGA 4BF5A 2KZHA 3R8RA 5E93A 3EWDA 3KRSA 5AFDA 4Q22A 4S3KA 3K8MA 4JN7A 3BSGA 3TQPA 2QMKA 4QROA 3H2NA 1PTGA 1G4EA 2EXOA 4O1FA 4DPPA 2Z6JA 4A6GA 1U5VA 4IIGA 4HNOA 3WLKX 1C9WA 1OG6A 2X09A 4IF2A 4M3PA 3C2VA 3S1GA 1K9FA 3LB0A 3E49A 3VNJA 4GABA 3CWHA 4DXKA 3UR5A 4F79A 2J62A 5BZAA 4PODA 3TXZA 4YHEA 3WX7A 3RX3A 3GTFA 4XD3A 2D0FA 2GVGA 5FJTA 4HSNA 4DF2A 1XG3A 3MMDA 2QJHA 2ZUNA 4XG1A 3ZVIA 5FSDC 2XU2A 4XAZA 3UA4A 4ZO6A 4PMNA 4K39A 2WWDA 4TUFA 4LS2A 1W5OA 1S3HA 3KVKA 4IP7A 4K68A 5K9CA 2PDWA 3O0KA 2QW5A 3UG8A 1PTDA 1WX0A 3JUGA 4HPXA 1TRDA 4X22A 4B5UA 1N55A 5A6AA 1O5KA 3LU2A 3M44A 1LOLA 1HKVA 4C1NA 4FP1A 5D4YA 2OWWA 5CSUA 5A6JA 3QPEA 1K4GA 1D7KA 4L65A 1RZMA 2XG9A 1VYSX 5AY7A 3SGUA 2KX9A 2PMQA 3QV9A 4TTGA 4EIVA 5LA1A 5IFPA 1OD0A 1QW9A 4WLCA 1ML1A 5AHEA 1MUWA 4IL0A 5J5DA 5FACA 5CJ5A 1ENUA 3EOLA 4A4AA 2GJRA 1THFD 2VYOA 3WF2A 3WMLA 2OQHA 1Q4NX 4IMCA 4LUYA 3RFAA 4H2HA 4LRSA 2DZAA 4IMGA 2WPGA 4IJRA 4C6MA 4DWSC 2KAUC 3P8JA 1BQGA 9RUBA 5LXXA 1GTEA 1BAGA 3V0TA 5M03A 3K46A 2QPXA 4KRZA 1M9HA 4P7NA 3XINA 3OVQA 1WO2A 2NLIA 1QAPA 3EKZA 1VCVA 4YWSA 3ENLA 3WQWA 3AIVA 3NXFA 3D6NA 1C8XA 3RGTA 4DYEA 1NWUA 1S2UA 3LQGA 1XDMA 1UA3A 2ZVIA 1SZFA 1PX8A 2WM1A 3N9SA 4GUIA 2Y5EA 3QQ0A 4RW5A 1XFCA 3DERA 3S8HA 4GZ7A 1Q5MA 4I3GA 2X1IA 2INFA 3W37A 1U22A 4QG9A 1PKLA 3TMQA 4JZ5A 5IHSA 2V5JA 4WRHA 3S2NA 3CLWA 1KQZA 1R9YA 3WQ4A 3NEVA 3KAOA 3TNBA 3W7JA 3V7PA 1VJZA 1ZNNA 4KFOA 5KITA 3BW3A 2NUXA 1WXZA 1EGZA 4MLRA 1W37A 2J47A 3L4YA 3BARA 1TA3B 2WXDM 2F6XA 6XIMA 3KOXA 3R58A 1Z32X 3W1LA 1FFQA 1UR1A 4JEJA 3SAZA 3CYJA 3A12A 3E2RA 2J4GA 3QOKA 3VIGA 5CZSA 2C1HA 2YFNA 1C29A 1TG7A 4PUUA 1US3A 3K1GA 4R7JA 3N04A 4ZA0A 5F1VA 2PODA 3WBXA 2X1SA 3VX1A 3NO3A 4BJHA 3W7IA 3KEHA 2VM8A 4Z2KA 2I56A 4GNVA 4LCSA 3W7DA 3WDHA 1IR1A 3II1A 3TLLA 3UR2A 1V0MA 2TODA 2NSOA 1RALA 1XBVA 1T96A 3NQEA 1ICPA 4GUFA 5D30A 1BD0A 3TYCA 4AEFA 1B1YA 4DO5A 4L80A 2PZ0A 4XZWA 2VO5A 4TVDA 1DQUA 2OWXA 2FPTA 4IFOA 1OF8A 2VCAA 1AQHA 4LH8A 2X42A 2J8FA 4P2VA 2VVSA 3KL5A 3EXTA 2XH4A 1T8QA 3W25A 1W9VA 4H7ZA 3O6AA 2O7QA 3TU9A 1QWKA 4NHVA 7ENLA 3ZWSA 3PTDA 5BMWA 1KRMA 5D2WA 3W76A 1M5WA 2B81A 4DVOA 3OBEA 2H8XA 3KLKA 1B3VA 1HNYA 4FZIA 2WM0A 4F9JA 2HVOA 3ITLA 1TV7A 2E3ZA 3S5NA 1ODZA 2Q8XA 3GC5A 2DIEA 1ESWA 2R6OA 4DX3A 1HW6A 3UJEA 1ECEA 2OO0A 1NSJA 1GOMA 5K9XA 1CXFA 1YX1A 4GX8A 1U1HA 3EOSA 3TQ0A 4JYEA 3M0MA 3NVTA 3GDKA 4MB4A 3C0QA 1W8GA 1BXBA 4QS6A 2Z2UA 5FAGA 4UFIA 2VEGA 4UC5A 3CT2A 3EA3A 4RV3A 4LAMA 2HZGA 4FOKA 2AL1A 3RDKA 2PDHA 1TJRA 3G24A 1KM3A 2YBVA 1XDJA 3OA5A 4HNLA 4PMVA 1GK8A 1ZJHA 1V93A 3ITCA 3Q37A 3UXDA 2R1MA 5AYYA 2GDUA 4MYXA 3H6OA 4HK7A 3QYSA 2J13A 3TW7A 1JUBA 3BAXA 4A3HA 3JU2A 4N6FA 4RR4A 2IS7A 3LNMA 4MB5A 1JZ4A 2W6RA 3K13A 4QDPA 1VYPX 3PHAA 4HMCA 4EAMA 5A6MA 2E9BA 2QUMA 5C7HA 3IVSA 3VCCA 3WBWA 5FJIA 1V3KA 3ZLGA 3VVGA 1ZAJA 1F05A 2V5CA 3G6LA 1T0OA 1UUQA 3RO6A 4KH2A 2JGQA 3RJXA 2YL9A 3VIIA 2QUUA 4UR9A 4L1XA 1VFSA 5GVJA 4Q4OA 1JXJA 4G9PA 4OECA 2HRWA 3MQTA 1BWVA 4B15A 8CGTA 4PRRA 5H8UA 3O7UA 3BCDA 5HK4A 5AC8A 5LIUX 2NXHA 1Y5XA 1UMLA 2YXGA 3QC0A 1EGVA 3THQA 3S2CA 2OCZA 1ISZA 3QGVA 4WSJA 1AW2A 4HNCA 3TC3A 3PFRA 3LK6A 3WH9A 4LNYA 2OYLA 4E2DA 4GIYA 3RLVA 2XH0A 4J1OA 3FW6A 5EGRA 1WXJA 2DIKA 2VRQA 4LY8A 3POHA 3M9YA 3LPOA 4UQ9A 3W53A 3ABSA 2G96A 4YVVA 1EO5A 3N2TA 4LC8A 4CCEA 3PANA 1V3LA 4ATLA 2C13A 1R9XA 1E51A 3RJYA 3NOYA 3WF3A 1QFEA 4EACA 1QJWA 4YTQA 4UOZA 4HU3A 3VDAA 2BGSA 3NJ3A 4FA3A 1H50A 4RE2A 1K7EA 2YA0A 2C16A 1HT6A 1EA9C 5AHFA 3H2AA 3NZPA 1HJQA 4AD2A 2OT0A 3VC5A 3PB0A 1GZGA 1BGAA 3S5YA 2OODA 3GNDA 3VMNA 4NJIA 3AS2A 3IGHX 4JIPA 4WUIA 1TA3A 3CS2A 1X8FA 1O1HA 5DMLA 4R53A 1JPDX 4QXIA 2V3DA 4Y9OA 4NSBA 3GM8A 3BLPX 2ZYFA 5DT5A 3RLGA 3KS6A 4QLKA 5I23A 3RR4A 1RR2A 1GYNA 3B05A 4D6CA 3WN6A 1UZ1A 3GHUA 3VGHA 2YXXA 3PSVA 1FH8A 3FY1A 4WQ6A 3VFLA 2OMAA 1UWUA 3GG0A 3DENA 5KMYA 3C2OA 1B9ZA 1XCWA 3PC0A 4LXFA 3VOFA 3F2BA 2EF9A 4RZ4A 3WO8A 3ONBA 3BURA 3LD5A 1AQMA 2FGZA 2Y61A 2OT1A 3D0CA 4YS1A 1EP3A 1TMHA 2G3FA 4KGLA 1BLIA 3UWUA 1AQFA 3VKKA 4H00A 3HQ1A 1A50A 2VC7A 4GG9A 2ZX7A 3TYEA 4ERIA 1PV8A 1P7TA 5HWNA 4GQBA 4AWSA 1D8WA 3WNKA 3LGGA 4Q32A 1B4KA 1NWTA 4I5XA 3O6CA 3TK7A 2Y8KA 3G1AA 4O0KA 3V18A 4RX0A 3CNYA 4AW7A 1E9IA 4S3JA 2HPMA 1F6YA 4DBWA 2DUZA 1RSCA 1F8IA 3HGRA 2EKGA 2OZ8A 2RGMA 4NIRA 1OX6A 4Q7IA 1ZGDA 4R9XA 3EMQA 3GVRA 2QCHA 4AMCA 3LV6A 1CX9A 3V16A 3VO0A 5HINA 2X0HA 3I3EA 4LUTA 4EP8C 2ALRA 2Q6ZA 2EKCA 2WB5A 1I0BA 4PCFA 2B4GA 1MVYA 3DIPA 1XC6A 4JTIA 1I6NA 2PWEA 3MU7A 2IMRA 4IQJA 2I17A 3LBMA 2XDFA 4JL2A 3BWWA 1JCJA 1DXIA 5TNVA 4W85A 1FCVA 5DCDA 3ZIZA 2BX7A 1I45A 4UTUA 1TPC1 3TWAA 2GZXA 2WSQA 3NFUA 3TTOA 3M0XA 4PA8A 5HMDA 3N9RA 5H8PA 1JAKA 2DH2A 3QSRA 1XCFA 2BMBA 4P7RA 3OVRA 4CD8A 1RXOB 3C5QA 2DZTA 3GU2A 1E3XA 3T05A 5G4WA 4MKVA 3WQEA 4DO6A 3TOYA 4G7EB 3RU8X 4JHMA 4LVDA 3SN4A 3WBEA 1I1WA 4DJFD 1UD2A 1F3XA 5GNXA 1XIBA 2Y88A 1DWIM 2WVUA 3MUAA 3I10A 1BG4A 3TJLA 4O11A 2YBUA 3IJIA 3DECA 2FTWA 2BXZA 1JUEA 1MNSA 2VURA 3UPBA 4QQ3A 5I07A 5CAHA 3S2JA 1KM6A 2VFGA 3ZR5A 3AMDA 4ZB2A 4DF0A 4H3DA 2PWDA 1XLFA 5CLTA 3UJRA 2HDJA 2GOKA 4JQAA 1CIUA 3JRKA 3TEVA 3LHTA 1GOWA 3CAVA 3W7QA 1EZWA 1Q8AA 4CN4A 3IJ6A 4LUJA 3DHFA 2HVMA 3S1WA 5BOFA 2ZRUA 1GT8A 1I2NA 1DJGA 2WNWA 4IQLA 1TMQA 4ZXLA 4D71A 4J4KA 3RITA 3CZJA 3UJSA 3VXGA 1K6WA 3HPSA 3JS3A 3UZZA 5LNRA 3Q4DA 2NT0A 4MAZA 3UJFA 4G56A 1H60A 5C9WA 2QYGA 1EXPA 2J9YA 3DCPA 1TMLA 4K1WA 3Q94A 3V75A 2D2OA 1WE5A 3HV9A 4ORIA 3UNTA 3W7HA 5A95A 5F4WA 3CZ8A 4O14A 4EWND 4GI9A 3GDBA 1GOIA 5HATA 3TTEA 1RCXB 3CPGA 4RKAA 1VB9A 1A5BA 1KM5A 4LS1A 4PTXA 5CGTA 1XLKA 3MI6A 4HYVA 1DJHA 1RCQA 2XN0A 3WD0A 4A29A 3SEPA 1UYQA 3BAKA 3EWZA 3IPWA 1WDWA 2UV8G 2PAJA 5G5IA 3A4XA 3GHRA 3WD2A 3QEZA 1UWQA 2F2KA 1QNOA 1TPVA 5I2UA 4D6GA 5HAOA 3SCNA 3BICA 4WSKA 1VEPA 2YFOA 3N3MA 1JVNA 3E0LA 4NL1A 4GZEA 3VDHA 1XXXA 4RPQA 3W24A 5IBXA 2AAAA 1JD9A 1GW1A 1E73M 2A2IA 4LU0A 4ES4A 2EEXA 4CD5A 1DXEA 3M0ZA 3YPIA 3UNDA 3TKFA 3MUY1 1VRXA 1SU5A 1HUVA 4B92A 1KTBA 2ZTKA 4QM1A 2YB4A 1Q63A 3UZXA 3I7QA 4L9XA 3VDGA 4UMBA 3ZM8A 3GVGA 5CC7A 3T4CA 2REQB 1PIIA 1OX5A 3DG6A 2XVNA 2DH3A 1RA5A 3LNPA 4BI6A 4O0QA 3B9OA 4JDYA 1WKEA 2IPWA 1TVNA 3PN8A 1XJBA 2AKMA 2VDGA 2J66A 1J5TA 1I2PA 1N8FA 2INEA 3AWNA 1VBHA 1S1PA 1E6XM 4F2BA 1NDZA 1UPMB 3DHUA 3W7KA 2ZZ7A 3UXKA 3BAIA 1A5CA 3B9DA 2QHAA 3DFHA 4F9DA 3CZLA 3EWXA 1HGYA 4B91A 2PBGA 1A5MC 1KNWA 3PPCA 3NA8A 3PBMA 3LCWA 1W3KA 1R38A 1UOKA 2VKZG 3MTWA 1YTEA 3M6DA 4O0ZA 3AU2A 3BXWA 2VOTA 2ZXQA 3CUHA 4QEHA 1VQTA 3B8WA 1O66A 4BR1A 4PRTA 3NQDA 4AY8A 4O1EA 3OO2A 4IICA 1XS2A 2VRKA 4CLMA 2YSWA 4O52A 1XUZA 1WPCA 1RQEA 1KFKA 4ZVJA 1US2A 2Z1KA 2R94A 1AODA 5HPOA 5C7VA 4JNYA 1GCYA 5HBFA 3WLLA 1VBRA 2WC3A 5L9FA 1TWWA 1XINA 1ZP4A 4HT3A 1NOFA 4RZBA 4UFLA 4N9CA 1TV5A 1KLZA 2A79A 3GY1A 1MUCA 1MMFA 4O1AA 3TYZA 5A6BD 3TMLA 2WMIA 3CV1A 4QLLA 1E0UA 4B2DA 2EPNA 5D9MA 1HJUA 1XLEA 3K4WA 3QGKC 5GNYA 4Z0SA 4S3CA 2GK1A 3VD9A 3K4DA 4RXFA 1J11A 5B7YA 3FYOA 3IARA 1X38A 4PMYA 4Z1CA 4PL2A 4IMDA 4FXJA 3TNOA 3TYAA 4C6CA 5DRCA 4D2JA 3HIJA 3FJ4A 4QG8A 4REQB 2ZCGA 3CUFA 5HR6A 2YDRA 5KTLA 3NPWA 3PTMA 3T0DA 4JIIX 5TF0A 2ZZ4A 1JFXA 3VCRA 3GG1A 4Z2IA 2DVUA 1SR9A 5M2FX 5SWUA 5CH9A 4XTIA 1W1PA 5C55A 4FNPA 3FKKA 3L65A 1P1XA 1LOSA 1GZJA 1MXSA 2HK1A 2PUZA 2PGEA 1QVBA 1EX1A 3S46A 3GXPA 2HQAA 1CGYA 3V4BA 4LPCA 4FS9A 4W8LA 1NIUA 4C6DA 1HL2A 3PY2A 1J5SA 2DZSA 1E4LA 4AB4A 3I65A 5CPTA 4LSBA 3FGCB 1K1DA 1V7YA 1OFEA 4D9PA 4MOZA 4C6BA 2J7DA 2QUNA 4W9TA 1HL8A 2PLJA 3Q65A 2OYMA 2W5FA 5M5DA 5EB8A 4QBXA 2DSUA 3F4DA 1YEYA 3B3DA 1EUNA 1UUMA 4ACYA 4L5ZA 5ABEA 3WF0A 5I00A 1R86A 1DWJM 2C19A 2WVTA 2QV4A 3R0DA 4NZ1A 3W87A 1WKDA 1OIFA 1M68A 2X0YA 5JIPA 4JIRA 2BDQA 2Y6ZA 2DVXA 2XM2A 1HJWA 1EQPA 5GJNA 3EB4A 3T4WA 4YYCA 1M53A 2L5HA 3STPA 1UWRA 4JQ1A 1E6NA 2W91A 3QKZA 2BGNE 2P1FA 2Z4GA 3M6YA 3L0KA 1H7XA 3BV4A 4MKNA 1HL9A 4GGHA 4PC8A 4ZENA 4S3GA 3NUKA 4J3VA 3W6MA 4JX4A 4QISA 3WFZA 4RDVA 3W1QA 3A9BA 4XZMX 3AXMA 1YKWA 3LTPA 3DX5A 3BAYA 3Q2DA 3U2OA 3AYSA 3U4FA 3ZR6A 4ENLA 4HYWA 1LM1A 4GFIA 4NX0A 1Q6CA 3LXCA 4JFVA 2DQXA 3QBUA 4WDXA 2XFWA 1XP3A 3W2MA 1MRQA 1NU5A 3JZUA 5HQEA 1E9YB 3PM6A 3HB9A 3UG5A 5HJYA 4C7FA 1R46A 3G1SA 2QJIA 5TBOA 3EKLA 2IXUA 2HNHA 4EPBC 4Q8MA 4B9ZA 1FCQA 3S47A 2V6AA 4XBJA 2REQA 3KVMA 3O1NA 3WK3A 1JRBA 1FKWA 1JZ8A 2RJHA 3P84A 3VGEA 3NWRA 1R2RA 1IT0A 1EKOA 3EXRA 3MP4A 2WNQA 1CEOA 1B31A 3EAUA 4XSLA 3ES8A 1FWFC 2Z1VA 3BLIA 3EX3A 4AZ5A 3NL2A 1TPDA 5LA2A 3N2XA 1T8XA 1BRLA 2J24A 2J7FA 3GXDA 2EGZA 2Q09A 3IWPA 3FA5A 1NEYA 3TV8A 2AL2B 3HM7A 4DJEA 4AY1A 3M0HA 3UW6A 3SFKA 2QJMA 4Y96A 2Z6IA 1R85A 2EG8A 4ECLA 3HF3A 4GOAA 5G2HA 3L4VA 4HMDA 1BXNA 1V0KA 4Z42C 4W89A 1BSLA 3R12A 2GOUA 3M7SA 2JIEA 3UBPC 1DTUA 4PFHA 5CQ1A 3BO9A 5BROA 1O60A 3BOFA 2VX5A 1R3SA 4Q8TA 2ZXDA 3GK0A 4XAYA 4GMEA 2NVCA 3UFYA 4A3YA 1TZ7A 1H2JA 4ACZB 4AH7A 3LGDA 4GI6A 3GD6A 3M7WA 4J5NA 3V5OA 2TRSA 3TW9A 4JYFA 4JS3A 3MZ2A 4GJ1A 3EX4A 3LN3A 5AHIA 5HUPA 1E1EA 3NQ2A 1EC7A 3KRUA 1SFSA 4LYQA 4AC7C 2G0WA 4QJ3B 1L6FA 3GO2A 2AMGA 2X1TA 4L7ZA 2HEJA 1AA1B 1IF2A 4HPGA 4H6EA 3LI1A 1PBGA 2D22A 1SMDA 5FD0A 3PUOA 2RKXA 3VIKA 4ZO9A 1U1UA 1U33A 4ERGA 4NJJA 3AU6A 2EPLX 4O1BA 2V5DA 5LIWX 4LAZA 4GNJA 4KEUA 4GXPA 2ZE0A 1EF3A 4MY1A 3TC7A 3EEZA 1W9DM 2J88A 2BVYA 4L64A 1RD5A 1P43A 3QHMA 3OQEA 4FOJA 3RAOA 1K8CA 3GU1A 3BV7A 4RZ5A 3ZSSA 1UCWA 1G1YA 3ECQA 3CUIA 1P0KA 4JL1A 1JCLA 2O7SA 3GW0A 3E0VA 1DBTA 4X2RA 3FGCA 3SO7A 1L8PA 4PTMA 4XX6A 1L2UA 3BGGA 1GHSA 1PX4A 3UF9A 1V4YA 1K6AA 7CGTA 3EZ4A 4TX6A 3SY1A 4XWUA 4YCPA 3NVDA 3GB6A 1TV8A 4Y9PA 3LRKA 3OZMA 3TYUA 3T0TA 1JG9A 2JKEA 3GIYA 3TCSA 1TRIA 3CHDA 5LGXA 1JQXA 1EPVA 3VNYA 1E1CB 4HZ8A 2A21A 1SM9A 1J0HA 2QLYA 5CBBA 2DP3A 4QX4A 1EIXA 1R3VA 2QCFA 3NO1A 2C71A 4POCA 2D0GA 5LXEA 2PU0A 4JKLA 4HGXA 3N12A 1ZHAA 1Q45A 4LJ3A 3H7VA 4F3HA 3NNTA 7REQB 4XD5A 3VFCA 2WVVB 1HO1A 3L5AA 2W27A 3PBVA 5EMJA 1J2BA 1RQHA 3RN6A 2XJ7A 1UZ4A 4J3WA 4NKCA 2CW6A 2VVNA 1H09A 3C4UA 3OG2A 4R27A 3KRBA 2A7NA 3NSXA 5CKSA 5A8QA 3IJDA 4FNUA 3NQAA 1Q6FA 1RK5A 4EOUA 1IXQA 2WHJA 4XD6A 1QI5A 3MP3A 3B03A 1AK5A 1LLZA 3ARYA 2OR2A 1IT7A 3UPMA 3RCNA 3TVAA 1YXDA 4UTKA 3UZYA 2POZA 1J0YA 4B5VA 2DDXA 1QOQA 2CITA 2V3GA 2YKKA 1GEHA 1K9DA 3GVQA 2VFIA 4W87A 4CNTA 1KFEA 3UPWA 2PRHA 2DGAA 4X0VA 1PCWA 4Z17A 2JFEX 2O4MA 1IYXA 3M0IA 1BF2A 2DZPA 3TH6A 3S2LA 5GJPA 3IJ9A 3THCA 2NQHA 3CEPA 4MWAE 4Q6JA 4QFUA 1HVQA 2QDHA 3MWCA 2E5CA 2OZ0A 3LCXA 1S3TC 5FEZA 5LGZA 3IV8A 3SGGA 2R1PA 4I6KA 1VIZA 2Y7FA 4MMWA 3PFMA 3USZA 2ZDSA 2P0IA 2GJNA 2OG9A 5I3GA 2RDXA 5I09A 1KBBA 4LCQA 1CGUA 3KCOA 3OBAA 2WHKA 3NGFA 3TN5A 3P62A 1CGWA 4ZB0A 2YBTA 3DUGA 3MPGA 2DSKA 3PG9A 3NQVA 1IQ8A 4AF0A 1IWPA 2IPFA 4PTVA 3RXZA 4HU0A 1SFTA 1TYGA 4S3AA 4BQ3A 4DWSA 3N14A 4AZ6A 4TR9A 3EX2A 2FZDA 2Q8ZA 3BMXA 4L4LA 3R8GA 5DRIA 3HG4A 4E2VA 4ZL1A 3AMKA 3DFNA 4D6DA 1VBGA 1UIOA 4B4FA 1AL8A 4J3TA 2HV5A 2RDTA 1I2OA 1RH9A 5D04C 3EGJA 3ZT6A 1UD6A 1P0NA 3FXGA 4FX7A 2POTA 3N9KA 2BXYA 3MZNA 3GX9A 4N9BA 4WEVX 3P81A 5JMUA 3S6TA 1ISYA 2QJNA 1Z42A 3GU9A 4Q7NA 3M5XA 1TQJA 2GYIA 4M29A 1MUMA 2FVLA 3UWQA 5I5RA 1LROA 4GIRA 3WK0A 1NVMA 5K4ZA 1X7IA 4JGDA 4RDWA 1D3CA 4IX0A 2G41A 4KFPA 2ZZ2A 3IIVA 4H8UA 4E4PA 2VC5A 2DPEA 3UVAA 4AZIA 3OGRA 3N3TA 4ZE4A 5FAJA 3PNZA 4LWWA 3MA8A 1AW5A 2HTMA 2VI0A 1KXVA 2VCBA 4BZYA 1EBHA 1DKWA 1QK2A 3DFSA 4W5UA 3N29A 1VLWA 2I9UA 2FLIA 2CZ5A 4S3BA 1S38A 2CFFA 4UZUA 2QQ6A 1ZJAA 4K3ZA 1LL6A 3BANA 4QITA 4YIWA 1DE5A 5C9ZA 5A6LA 3SN0A 2GQAA 1R2SA 4XZLX 1X7FA 1UIPA 2GQ9A 3TAKA 4PYSA 2FDMA 3RLUA 5FL1A 1CENA 4ATDA 4GCXA 4O50A 1VCFA 1R6WA 4DZIA 1BQCA 3UR8A 3ITGA 1SZEA 1QT1A 2G97A 4LB4A 2GSEA 4GIEA 3KUMA 1A0DA 2VENA 1V79A 1V8EA 2ACQA 3R4IA 4ADSA 2J8TA 2VEIA 1NF7A 1Q6OA 1EC8A 4GD0A 1E1CA 2WPBA 5AYZA 1WB0A 2DT1A 3U2CA 4DQWA 3N6QA 3CQKA 1GHRA 4XTDA 3KDOA 1NH6A 4HA1A 5CLWA 1TPB1 2G3MA 5D33A 2ZWYA 2PTYA 1TTIA 1SSGA 1RPXA 1MW0A 4FB7A 1GOOA 3G2GA 4IPJA 1ITXA 1X1ZA 2W0UA 3UESA 5ENLA 4AWTA 4JHZA 4D1JA 1Q6RA 1DJIA 4DBEA 3WELA 1U5JA 1JCMP 1XIMA 3W70A 3TLQA 1KW1A 4MFEA 4K7VA 1V5XA 5XIMA 1JD7A 3LPFA 2Q3RA 2H8ZA 3EWWA 2JBMA 3FEQA 2BOGX 3GTIA 5AC6A 3VNMA 3SUVA 4C6OA 5E0KA 1S2VA 2GPTA 3GVWA 3HOJA 3E0IA 1JNDA 1XWYA 3AYRA 2OX4A 3GUWA 2QAPA 3W85A 2J79A 2XH2A 4HPNA 1F76A 1GVRA 3KHDA 1RHCA 3T9PA 1I2RA 1IGSA 3TDFA 4CCCA 4QJ1A 5D38A 1S2AA 2A3AA 6ENLA 2OZ3A 4QEEA 1XLIA 4JICA 5M1TA 2NX1A 4B5SA 5PTDA 2YIHA 4P8VA 1E72M 4ZQNA 1EO7A 2I1OA 4WIWA 4FNRA 4DWDA 3TSBA 3NL5A 2WBGA 4MPKA 2WQDA 5BXRA 4HNVA 3GFZA 2BHYA 4LUSA 2ADAA 4WJXA 1RCOB 2PWVA 1UH3A 2VEPA 4LGXA 3RNDA 5F1UA 3QM3A 4AEEA 5BU6A 4A35A 1POJA 4GKTA 4XKYB 1A5NC 4AZCB 2YDAA 3NURA 2Z25A 3NYDA 1EP2A 1QCWA 2IQ0A 3PS7A 2DJXA 3AO0A 1D8CA 3QLLA 3WBYA 3GE7A 1TV3A 4J2MA 3IRDA 4AX6A 3EWUA 3LCFA 3WD4A 4F0MA 1GJUA 3QFWA 1NY1A 2R1LA 1ISXA 2CC0A 2IPJA 4UTIA 4KPLA 3W2JA 3BK0A 1V3JA 1IEWA 3V1PA 3KOZA 3AIEA 1LF1A 1SGJA 2CLLA 1UKQA 1R30A 2PS2A 1FHVA 5AYIA 4HZMA 3BH4A 1UMYA 1YADA 1HJXA 4Q33A 2GJXB 4DF1A 5JH2A 2UY2A 4JFWA 4MPQA 3WQFA 1T7LA 4KIRA 4N0RA 1UR9A 3QN3A 3PBWA 1ZBVA 3MUXA 4KCUA 1V0LA 1SW7A 3O05A 1X39A 1XRTA 2BVDA 1FWCC 4WGXA 3UY8A 5FF3A 4JY9A 1GG1A 1ZU8A 4AG0A 4F0HA 1ECQA 3VNIA 1C90A 2YW4A 2ISDA 4C6NA 1B0IA 3PZNA 3CWOX 2GSJA 1EJXC 1OFRA 2BHZA 4AYGA 4PH6A 3CAKA 4GLEA 2YLAA 5J8LA 4GHRA 1KCZA 1DOSA 1H1YA 4Z2JA 4C7DA 3LXAA 1HKMA 2Y70A 1XSIA 2CIPA 1GQNA 5MKGA 4DM1A 3M5YA 1HTIA 3QHOA 3DEQA 3R79A 2V3FA 3FA4A 3AYTA 2HJPA 3R1ZA 4PZVA 3S3GA 2W61A 3ZWTA 4YTTA 4BF9A 1TX2A 4FAMA 4HA4A 3W71A 3GHTA 3I7RA 4WDTA 4ZTXA 4A22A 3RCYA 1ITUA 4MNLA 2QCDB 1KR0A 3HMCA 4DJFC 1XD1A 4LBUA 1EWEA 1KTNA 3RX2A 4C6IA 2R8WA 1Z41A 2QCMA 4F0RA 4JHOA 1K3UA 1QPOA 4HA3A 3S83A 5CPQA 3MMWA 4MUZA 1Q2SA 1UD3A 3E3HA 3H70A 3ATZA 4JTQA 1AJ0A 3ALFA 1YMYA 1V03A 1FDZA 3SRHA 2R24A 2UY3A 2NQJA 1DORA 1L8NA 4D8AA 1ME8A 1XGDA 1JQVA 4CN1A 5KETA 4OGZA 3G3MA 4ZFCA 4JTHA 1YYAA 3E74A 3CL8A 4HHLA 1AJZA 3FHAA 1UBSA 4M8UA 3VD3A 3GH5A 4WXYA 3DYMA 2I57A 1V02A 4HYRA 1EXBA 3VOIA 3ZR4A 4H9MA 5HJXA 5HNRA 2XFYA 1BVZA 1TJ0A 1O5RA 4ZEPA 1G0CA 2J74A 3KE0A 1U30A 1EJSC 3DESA 2X1RA 3TCEA 3EX1A 1F7BA 1NJJA 3LSBA 3WKZA 4N9DA 1OCBA 2CERA 1C8QA 1CLXA 3MJMA 2E8YA 2PDKA 4GYKA 2VD9A 2PD9A 2XN1A 3WLHA 2CLMA 3M0YA 3I3DA 1P0EA 4JTGA 1VH7A 5CZTA 1PTAA 5I3DA 4Q4QA 1CXKA 3OHIA 2GVYA 4WKHA 3NZ1A 3G1DA 1UH4A 5I79A 2C6QA 3RU6A 3DG3A 2VZTA 4GYPA 1QBBA 1UKOA 1Q7MA 4HNNA 2ON3A 5HNUA 5E0FA 3DFTA 5EMKA 4HHPA 2E09A 4F8XA 2R9RA 3B40A 3TXVA 4DB7A 1Q4WA 1J0JA 2HXUA 1XYAA 2C18A 2ACRA 3UCDA 1P4CA 1IEQA 2DW6A 3VIPA 1A0CA 5EBUA 1XH0A 2HBVA 2VR4A 4E2OA 5JU6A 3I6RA 1LT8A 3U7VA 3BQ5A 4CNOA 1UWAA 1KLYA 4UB9A 5G1YA 1R3RA 4J27A 3WNNA 1H61A 1LBLA 1UHVA 1KXTA 2QV5A 4I7UA 4M6QA 5A6SA 3N4EA 4MJZA 4JFSA 1GUVA 1TR9A 1YBQA 5H2ZA 1SO6A 4EF8A 3MO7A 3NZGA 3IIOA 2V5BA 4M81A 4AZCA 1WP6A 3LYEA 4ZO7A 2FHBA 1AQ0A 3S5SA 1GOKA 2J7HA 1KM4A 4NNAA 1WBHA 4HN8A 3GDRA 4QS5A 4UZSA 3RR1A 2ZC1A 2WV8A 4M1BA 4R85A 4U2ZA 1QNQA 4CVUA 3N2MA 5A5WA 4DBSA 2WMHA 2FKPA 4QSFA 3KL0A 4P7QA 3CC1A 1SJAA 1CXHA 3G18A 4FR1A 2W4XA 1KFJA 4G8TA 2GUUA 4GK8A 2QCNA 4FX8A 3NGJA 4YVPA 5BMXA 1NM9A 1AUSL 4WGHA 3QPYA 2E6YA 3P74A 1YPFA 5C2XA 3MBFA 4LQ1A 3EBVA 2I7GA 1RVGA 3W84A 2W9MA 2OWCA 3RILA 3LENA 3GRIA 2GVJA 3LMYA 2BWGA 1Q8JA 1TELA 3TW6A 3W7LA 4NU7A 3TONA 4JTUA 1U83A 1A49A 2ZX5A 2PC4A 2PTXA 3N4FA 1EEXA 3UT0A 3CUZA 4W7WA 3WDIA 3HPXA 4A3QA 1XCXA 1XSKA 3S1UA 5GPRA 4KEMA 2WW5A 3BZJA 3QY6A 4ZQRA 5JVLA 4Z1BA 3FVMA 5FF0A 3BW2A 3PUEA 2VGGA 3DI0A 2HROA 1EDQA 4JTAA 3MI2A 2OLSA 3B0UX 4LFYA 1VRDA 2YX0A 3N19B 1EJWC 3PNUA 4A2RA 3PJTA 3QSTA 2CBVA 2Z24A 2VUYA 2JK2A 2FB3A 2DSVA 2WVSA 5IDZA 5LIXX 4NYUA 4U2YA 5H91A 1XBYA 3T6CA 2QGHA 2E6FA 3AI0A 3LDVA 2DVTA 4M19A 4U28A 1K7XA 3EDFA 4K8HA 2PD5A 4DJED 3EPMA 1IEXA 2WC4A 2QCDA 4IHCA 1HIZA 4R9OA 3BGAA 2PGWA 3ABQA 3AXXA 4YJ5A 4ALDA 2XISA 1SO5A 2VZUA 2G4JA 2F9RA 2OU4A 4V1YA 4DEFA 1YNQA 5CPLA 4B3LA 4R33A 4AISA 1AMKA 3OP2A 3VKDA 4KCTA 1QRQA 3ZYZA 1XRFA 1F8MA 4ATWA 1FH7A 3WJZA 1QO5A 1RP8A 3PZTA 2CZEA 3CAWA 3W1XA 2F6KA 3GTHA 3PZVA 3AUOA 3F7JA 4JKKA 4IFKB 4Y2WA 1S5NA 3LRLA 3UWWA 1FP9A 3P0WA 3R0UA 2NW0A 4Z1DA 2YL8A 1FWJC 3L2IA 3TFCA 3FYYA 1Q6DA 5F2IA 3APGA 1MW3A 1WDRA 1UPPA 3VYLA 4ZCWA 3E0FA 4B3ZA 1XGEA 2J9XA 5D9NA 2XTKA 1KBLA 4H4IA 2G50A 3EOOA 1QW7A 1H5VA 4HVXA 2FYMA 1R3QA 3CL6A 4HK5A 2ESCA 1ISWA 4J3XA 1FQ0A 2CBUA 4UNLA 1E4IA 1XIDA 2VNCA 1G7VA 1EL3A 3SUTA 3GNXA 2ZUVA 4UMCA 1D2KA 4RV8A 1XSJA 1GZ1A 3U2EA 3EOEA 3G3DA 1DIEA 2XGZA 3HURA 4GZIA 1G94A 5AHLA 3WQDA 1H1ZA 5DO8A 1UWSA 2QVHA 4X9YA 3ZO9A 5T9BG 2HK0A 2NXIA 1XQLA 4CKQA 4A8LA 1VD6A 4B90A 4IIFA 1VGAA 1LWIA 1JI1A 2FZMA 2PBOA 1P6CA 1A4MA 1RVKA 5HWMA 4M56A 4AVFA 1JI2A 3FOKA 3KZPA 4HD5A 1EJVC 3WH5A 3C2RA 1NFGA 2XSAA 3EPNA 1I9CB 3VKCA 3WENA 3L68A 2FGLA 1GYMA 3W7PA 3ZJ7A 1QBAA 2RFGA 3H7UA 5FF7A 3RO8A 3RIKA 2B7NA 4P8UA 3ITOA 3N6JA 3A47A 2WSRA 3VD7A 1FHUA 4UTHA 3SM0A 3GIQA 4RCXA 3EYPA 1E0WA 3ATYA 4JQ3A 2H90A 3LCHA 1Y0EA 3ZSTA 3LBOA 1IT8A 1X1NA 2R1KA 1MEIA 3KBMA 1OC5A 3SECA 4JTTA 3CL7A 2ZZ1A 4ZBCA 4MWAB 4RDZA 1RPKA 5BOOA 4I9MA 4BQ4A 4KEVA 3MMUA 3W28A 3AYVA 2OB3A 3TA9A 3AZRA 1GQJA 4F40A 3QYQA 4NRRA 2P3ZA 3O06A 4H9TA 4F2TA 3P14A 1A5SA 2P5NA 2R14A 4GIAA 1SW0A 3K8KA 4M6VA 2CLOA 2WMKA 1AMYA 1ZJBA 1A53A 4JTLA 4GKLA 1UUOA 3NDOA 1M01A 3DYOA 4H7VA 2VOMA 1LRQA 3CHFA 1T99A 1OX4B 3WQGA 2J9ZA 3F2DA 2QCCA 2PDXA 2VFEA 2UY4A 1ZUAX 4A05A 3FIGA 4PUWA 3K2GA 2FH8A 1KBIA 4AZGA 1TTQA 5AYBA 1K7FA 2F8QA 1OYBA 4N02A 5FEPA 3H2OA 4GX9A 2X2YA 3ARZA 4FHAA 4UIOA 5HMEA 1DWHM 1ITQA 5ABTA 3OEXA 1JCNA 2R82A 4GY0A 1S1RA 1UR2A 4WKAA 2VEFA 3F5KA 3IVTA 3STEA 4BFAA 2CLKA 3AXHA 3EMCA 1BXCA 1R7OA 3HGSA 1KCLA 3PBYA 1BEUA 2WZIA 4W7VA 3SDOA 5C9UA 3R43A 3FCPA 4IQDA 3BLKA 3A23A 3N25A 4WHBA 2ZTJA 4RJEA 2EO7A 2VC9A 2QUVA 4AHPA 3R11A 2ICSA 4QHRA 7A3HA 1W9UA 2VRJA 3QKEA 4Q7BA 5JIWA 4S3EA 4AQLA 4IPIA 3ARRA 1TIMA 5DX7A 3T2QA 1IXOA 1DJYA 4GY7A 5REQB 4QCFA 1V3MA 4MTVA 3ZZ1A 1UWTA 5D2VA 4PCTA 3E96A 1W1YA 3OBKA 3ABRA 4DWSD 2FB2A 1E5NA 4P8XA 5AN7A 4PMZA 4JYDA 3LMZA 2WANA 2ACSA 1TFVA 4W86A 1OZQA 1XIFA 3AC0A 5M3WA 1QI3A 4YLWA 1UQYA 3WH7A 3LG3A 4CUCA 1ELSA 2WQPA 1EZ2A 5I03A 2BVTA 1XIJA 2Y4SA 1ZCCA 2NV9A 1QOPA 3ZJ8A 4FF7A 5A6BA 1NP0A 1JIBA 3LLFA 4AD1A 1LQ2A 1N82A 1PUDA 3H24A 4HU8A 3BUVA 4O12A 2FH6A 2VP8A 1CLKA 3N2OA 2PU1A 1I8JA 1XLMA 1UBPC 3R10A 2VGFA 1H3GA 4XUGA 4MNMA 2YXOA 2QDGA 4OHQA 1MQQA 1R0MA 3KVJA 1IGWA 2D2JA 3CGTA 4Q3MA 3WQ5A 3MJYA 3SUUA 2Y7DA 2PTDA 2VR2A 3SUWA 4EXBA 1X6LA 1Y65A 1TPFA 3ZXWA 4LBSA 1OABA 3TJ4A 2Z7GA 3UZJA 1OG0A 1GEQA 3PULA 2PDQA 2OVLA 5LNUA 4EX4A 1QTWA 1K8YA 1XLBA 3SQSA 2AAMA 2HS8A 1UD8A 3EX6A 3IGXA 2ZDRA 1OC6A 2CPUA 1B5TA 3PZIA 1YIXA 3IJLA 1JDDA 1KFLA 4BQ5A 3OLGA 1DQWA 2TPSA 3W81A 2ZXBA 2A3EA 2BP1A 1G4TA 4O54A 3B4UA 4KRTA 3M1ZA 3PPHA 2A3HA 4E4UA 2QCEA 1SW3A 3O9NA 3U0HA 1XKYA 4MM1A 3WZ0E 1W3TA 4JKMA 5DELA 3EWBX 1B3ZA 1KRAC 1Q2RA 3I3BA 1KGWA 3F4NA 4IL2A 4G1KA 1V6WA 2NV1A 4US5A 4PCPA 2BFGA 1A5KC 3VD4A 2EQDA 3BE7A 2QPUA 2XN2A 2YPIA 4MY8A 5K2ZA 4PUMA 4MWAA 2A7PA 3NAVA 5EYWA 2DSWA 3N34A 1WOAA 5DMNA 3V0UA 1Z44A 1X6NA 3TE9A 1J8VA 4E3VA 4K7YA 3M41A 1UP3A 1W9XA 1RBOB 5G2WA 3LHWA 3N13A 4H7CA 2VZOA 2DT2A 4X2PA 4KGJA 1Y7VA 4WSHA 5EFFA 3KS5A 4EVZA 5C71A 2IKGA 1JYWA 1VPQA 2E28A 5I77A 2ABAA 1NDVA 3QW3A 3URBA 3GFYA 4O4VA 2V2HA 4NRSA 4J3ZA 1OX4A 1XIGA 3G77A 3PP7A 2OQYA 2TMDA 3MANA 3RLHA 2VX4A 4A21A 9XIMA 1DIKA 5H6HA 3L4XA 3CZGA 2OFJA 5G1TA 2QF7A 3WMSA 5CZKA 2UBPC 1GVIA 1O12A 2ZXAA 4FIRA 1XYMA 3ZQ9A 2OPJA 4FR6A 4H9XA 3G22A 4DBDA 4ZSTA 2O55A 1YXCA 2VZVA 1JZ5A 2BZNA 5T91A 3SCOA 1CB2A 3H53A 1FWIC 3F5JA 3P5YA 4A8RA 2ZKMX 4A2SA 4UTTC 3AS3A 3A6OA 1UH2A 4MY9A 3VM7A 1K8XA 2JQXA 1GTHA 2YL6A 4S3DA 2Y2WA 5FIPA 2NWSA 4K37A 4A8NA 5C2CA 1XC4A 2OTDA 4JPGA 1MDRA 4H6QA 4WDWA 3ZMRA 3B8IA 2HE5A 3E5BA 2A0NA 1XH2A 1YE4A 2XPKA 4US6A 3TN3A 4N4PA 4H9YA 3A21A 4ZQOA 3UYIA 4HIBA 4BF7A 1LJYA 3EEGA 3QF0A 1JGMA 1UKPA 2J75A 3CIWA 1YTDA 4W8BA 2QS8A 2P88A 2ZRYA 5REQA 3EB2A 1SFLA 4S23A 4F0LA 4FLOA 4FNTA 2XYLA 3AIWA 1E4MM 5AZ1A 4YWIA 4PUKA 4CQDA 4F0KA 5M17A 3TX9A 1A5LC 3R8HA 4NJKA 3Q67A 4JTEA 7TIMA 2A1YA 4YCOA 4FXFA 2OSYA 4JCMA 1H7WA 4UTJA 1EF2A 1FHDA 2VDIA 1DV7A 4N42A 3WD1A 3LXBA 1R3YA 1PXGA 4RNHA 3H4WA 4Q8OA 1F3WA 2PWUA 3M5VA 1LQ0A 1E43A 1TO3A 3VDBA 3BZGA 3DZ1A 3APYA 4FF5A 1PE1A 1RAKA 3KM8A 4IUGA 2WZHA 1P7TB 3VCNA 8RUCA 4GC4A 3LERA 3QC3A 4X0NA 1YW1A 1EJUC 1W56A 1SZNA 4O4WA 1YPIA 5DCBA 1MFVA 1E70M 1M03A 4FSAA 3CB8A 1E6PA 3OOQA 1FFRA 1KQYA 1EPXA 2IPGA 1AW1A 3REQB 3TJIA 1NFPA 1P48A 1TVPA 5E70A 1CI1A 1UR3M 3CEUA 3OVPA 2WAGA 3MV01 3EKGA 4NJHA 1QO2A 2GDQA 2E40A 4LUTB 4RNIA 1LL7A 4PEEA 3WDJA 4IIDA 4BS0A 4QDWA 2Q71A 1NTHA 1B3YA 3TFXA 4NNCA 2D20A 3IUIA 4I6VA 2J77A 5GNZA 4IJBA 4LANA 1W5MA 2VX7A 2B0MA 3AXKA 1J9YA 3E12A 1OFOA 1TJPA 1J18A 1IZCA 3WQPA 2DUXA 2P53A 2G95A 3RRXA 2YW3A 3N17A 3VUPA 3QMSA 1C9DA 1GQLA 3TROA 4RL3A 1Q66A 3KRZA 3UERA 2X1UA 3KL3A 1XW8A 2I5QA 2P10A 4KBXA 5D9OA 2BY0A 2DY3A 3DKLA 1F9CA 1S5VA 3W6YA 3RG6A 5DMMA 4CQBA 3LPPA 4DXXA 4R88A 3DDMA 1ICSA 1VFFA 3SJ3A 2OX1A 2PDGA 3QR1A 1FWSA 3BOLA 1B9BA 3WQOA 4URIA 4I8YA 3NQFA 3U9IA 1DHKA 1WAWA 4WD0A 4H01A 2WJZA 1BTMA 3OZPA 3CJPA 3KZSA 4HOWA 3FA3A 1YDYA 4AHOA 4IGSA 2Q3OA 1OGSA 4D6JA 3LBCA 4NZ3A 4UQCA 2ALDA 3CPUA 3LTYA 3D46A 2Z0IA 4KWWA 3ALGA 4CCDA 5D2TA 2DV0A 4IP4A 5LNSA 1OFAA 3C2FA 1OWQA 3O3RA 4PMUA 1TZ9A 1BPLB 1KRCC 2WJEA 1JYVA 4XO7A 3HPAA 1KO0A 5IHRA 4XIAA 1ADSA 2FZNA 3MV11 3K4AA 3NQ8A 3QV7A 1BYAA 1WYIA 4CD6A 5FKYA 5CZ0A 2JKPA 5CSRA 1XISA 1WUFA 3SY5A 3NQMA 3A5FA 3R94A 2PZNA 4MDOA 3T7VA 4DIAA 3N15A 4MADA 3VE7A 4U10A 3WJWA 5BWAA 4ZE5A 5CBIA 1WZKA 4UTWC 3CAQA 4M6UA 4RZ6A 2A6LA 5BXTA