4XO6A

Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human 3 alpha-hydroxysteroid dehydrogenase type 3: structural clues of 5 alpha-DHT reverse binding and enzyme down-regulation decreasing MCF7 cell growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
total genus 116
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xo6A00
2AGTA 3LEPA 4F40A 1MZRA 3RX2A 1Q13A 1PZ1A 3BCJA 4NKCA 1JEZA 3M64A 2PDXA 4ASTA 4MHBA 4LBSA 3R8GA 3QKZA 2IS7A 3WBXA 2FZ9A 2VDGA 3N2TA 2BGSA 4XZLX 4H8NA 4I5XA 1VBJA 2HV5A 2IQDA 2ACSA 3COTA 2PDNA 2PD9A 2INZA 3F7JA 3Q65A 1M9HA 1J96A 3LN3A 2IPGA 4WDTA 4ICCX 5JH1A 4JIIX 4XAPA 2WZMA 3RX4A 4PMJA 4WDWA 3V0TA 1R38A 4IJCA 4LB4A 1UR3M 4JQAA 5HNTA 2I16A 3LUTA 1AZ2A 2FZ8A 1HW6A 4LAUA 3ONBA 2FZBA 3LNMA 1QRQA 1PZ0A 4PUUA 3B3DA 5AZ1A 3VXGA 3G1RA 3CV7A 1VP5A 2R24A 1S1PA 4Q7BA 2PZNA 3V35A 3M4HA 5HA7A 3M0IA 2PDLA 1AZ1A 4FAMA 3LD5A 3UG8A 3CAVA 4XVEA 1IEIA 4Q3MA 4YU1A 1GVEA 5HNUA 3BV7A 4GA8A 4RPQA 3D3FA 4JTAA 2FGBA 1IHIA 4XZMX 1LWIA 1X97A 1A80A 1RALA 4PR4A 2PDPA 4PRTA 2PDGA 4GACA 4GIEA 5KETA 3R6IA 5LIUX 2HDJA 2ISFA 4EXAA 3WBYA 2PDIA 3R7MA 4ZFCA 1C9WA 4GQGA 2C91A 3UWEA 2PDHA 4AUBA 2HVNA 3R43A 4WDUA 4JTQA 1OG6A 2IKJA 4FALA 3WBWA 3ERPA 4L1WA 3CMFA 3UZZA 4LAZA 3MC5A 1K8CA 2CLPA 3WG6A 2J8TA 4QBXA 2F38A 3MB9A 4H7CA 2IKHA 4IGSA 1EF3A 3P2VA 4WGHA 1AH3A 2PDCA 1T41A 4YVXA 5LIKX 4JQ3A 2IKGA 1LQAA 1Q5MA 4XZIA 2IPFA 1MRQA 5AZ0A 2HEJA 3R94A 3Q67A 3CAQA 2PDBA 2ALRA 2PD5A 1PYFA 2IKIA 3WCZA 4XK2A 4XVDA 3UZWA 1ZUAX 3U2CA 3H7UA 3BURA 1YE6A 4YVPA 2DUXA 4JIHA 1RY8A 3O3RA 4DBUA 1SM9A 1S1RA 3UZYA 3NTYA 2PDFA 2A79A 1RY0A 3LZ5A 1XF0A 3V36A 1ADSA 3BUVA 2PDYA 3CASA 1QWKA 4DZ5A 3GHRA 4JTRA 4IJRA 3EB3A 5DANA 3T42A 1S2CA 4XZNX 2INEA 2QXWA 3R58A 3LZ3A 2PDMA 3LQGA 4QXIA 3C3UA 3LQLA 5JH2A 2F2KA 3GUGA 4FA3A 3DN5A 3UZXA 1AH4A 4GQ0A 4PRRA 2ACUA 1EL3A 2WZTA 4YS1A 3GHTA 5C7HA 4DBSA 5LIWX 4L1XA 2PFHA 4GABA 4OTKA 4QR6A 1ZSXA 2ACRA 1XJBA 3GHUA 4YVVA 4XO7A 3H7RA 4FZIA 3LENA 3R8HA 2ACQA 3LBOA 2PDJA 2PDQA 2HE5A 4GCAA 3DOPA 3FJNA 2HVOA 1US0A 3KRBA 2FVLA 4HBKA 4JQ1A 3V0UA 1PWMA 4XZHA 3N6QA 3UP8A 3H4GA 1ZGDA 1X96A 3UFYA 1FRBA 2PDWA 2DV0A 4HMNA 1PWLA 4QX4A 4XO6A 2PDKA 5LIYX 3S3GA 1EXBA 5M2FX 4DBWA 1YNQA 1AFSA 2I17A 4JQ2A 4LB3A 1Z8AA 3O0KA 4JTCA 3RX3A 4WRHA 3ONCA 3V0SA 2DUZA 1EKOA 4PUWA 2P5NA 4G5DA 2PF8A 3GHSA 1XGDA 4WEVX 1Z3NA 1Z89A 3G5EA 4JQ4A 3FX4A 1YNPA 4JTDA 3UYIA 1Z9AA 4JIRA 1X98A 4LBRA 1YE4A 2BGQA 2PDUA 5LIXX 1T40A 1AH0A 2NVDA 2R9RA 1S2AA 3EAUA 1MI3A 2IPJA 3CV6A 2IQ0A 4WDXA 4R9OA 4EXBA 1HQTA 1ZQ5A 3EB4A 2IPWA 3UGRA 2HE8A 2BP1A 2NVCA 2FZDA 2PEVA
chains in the Genus database with same CATH superfamily
3L67A 3SRHA 4DUXA 4IIBA 3MYPA 3LEPA 2Z24A 3EOOA 2E9MA 4L9XA 3IARA 4RDVA 1H41A 4GBUA 1I2NA 2WSYA 1OYBA 1UW9A 2WVVA 1H4PA 1R0MA 3H55A 1F8IA 4RZ6A 4AVNA 1MYRA 4FNQA 1VBJA 2GQ8A 2J7GA 1KLYA 3GVWA 4ECLA 3P67A 3W75A 3CT2A 4F0RA 3CPGA 1KM5A 3GDKA 1NELA 1K4HA 1XINA 1OF6A 3EX4A 1R8LA 1E9IA 1R38A 1RLDA 1L6FA 2V3GA 5FF3A 2HISA 3F5JA 3AU6A 2XIBA 1K8YA 2AMXA 4C5YA 1MEWA 1POJA 3O07A 3QH2A 3T0CA 4JHOA 1YTDA 2C13A 3VXGA 3WD4A 3BQ6A 2E09A 5EMUA 1VFHA 1NVMA 3O63A 1GVFA 4A8NA 4ENLA 4IT1A 3LTYA 1PCWA 1NM9A 5CCZA 1SGJA 3MWCA 1YW1A 4LS1A 1S3HA 4DBDA 1TCDA 4K68A 5TIMA 5E5CA 4AWUA 1T7LA 2PE4A 4MKVA 2ZA2A 4P7LA 3UT0A 2NWRA 4Q4SA 1NDVA 2YBVA 1AG1O 4CEUC 2ZRZA 3UQNA 3BO9A 3PB2A 2HPIA 4XZBA 3L5AA 1NOUA 1QMLA 1W3HA 4HD5A 1D3CA 1QOQA 2OZ0A 3GG8A 2J7DA 5PTDA 3VVGA 1A80A 4TX8A 4PTXA 1XLGA 3QR3A 4Q4MA 4MTVA 4FXRA 1AW1A 3A3HA 1TYGA 5JMUA 4IZGA 1VEPA 3BLOA 4GIEA 1S2TA 1F61A 1J6OA 1XHGA 3POCA 4DJDA 3U2OA 2XZ9A 3TXZA 4E4PA 1ZS2A 2XH2A 3B8UA 3W82A 1W31A 2CBIA 1S2VA 5A8PA 2PDHA 4GX8A 1W6TA 1AMYA 2BVWA 4Y9MA 1EJSC 4FALA 3CHVA 3B9EA 2HNEA 1QI2A 3ERPA 1B90A 3H6OA 4G9PA 1HXJA 1NU5A 3MS8A 3UR2A 2RDWA 1X6NA 3MB9A 1BYBA 1VFUA 1L2QA 2YZRA 1AJ2A 5H91A 1IIHA 2XU2A 2FYMA 4S2BA 2UZ9A 1FVPA 4TXEA 2ZCGA 4HA3A 1VFMA 5KEZA 3MDUA 4MJZA 3A22A 5AZ0A 1PAMA 4JDYA 3ITLA 3WUGA 5T26A 3FYOA 1VENA 3S5OA 1RQHA 3BGAA 1MDRA 3N04A 4GQQA 4U3CA 4UTIA 4AD3A 3PZVA 1RCXB 3GR4A 3KTSA 3VIPA 2E5DA 4HU4A 4JIHA 4ICMA 4XISA 4TV6A 4DBUA 1MW2A 3O05A 4GWEA 4RE3A 4NI3A 4FOKA 1TPDA 2GZXA 4E2VA 1XIEA 3CT7A 4ROQA 1DWGM 3VDGA 1GYMA 1YDNA 4JFVA 1R86A 1ICQA 4DI9A 4CNTA 1K02A 2AL2A 4K3ZA 3VKCA 1ISYA 1V02A 4JTRA 1GOOA 1S2CA 4XZNX 5EB8A 4TQTA 5I3HA 4OJYA 1NIUA 2WZEA 3WK3A 1H1YA 1CYGA 4H6EA 4NAEA 2ZXDA 3GUGA 1UH4A 3GHTA 2VFIA 2B7OA 3L65A 1FHUA 2GVJA 3U5YA 2XM2A 1HL2A 3H26A 1NEYA 2F7FA 2W91A 4CD6A 4XAYA 3IJIA 1XJBA 1H62A 4X60A 3EEZA 3RGTA 3I6RA 3KAOA 3UNTA 1DTUA 4UMBA 3SGUA 4U2YA 1TWIA 5J5RA 1VB9A 5M03A 1UKPA 2PDQA 3N9RA 4QSHA 4BI6A 1TA3A 2J7CA 1WXZA 3O06A 3HOJA 5A6JA 3NXLA 2ZKMX 5TF0A 4JYFA 1BYAA 1OT1A 4KEVA 1OABA 2CZVA 1S5WA 2HWGA 4DAFA 1OC7A 1HNYA 1O1HA 4MJMA 1W3NA 4GRSA 3C2VA 4XO6A 3PF3A 3CO8A 4ZXOA 3JZUA 3M44A 3W2NA 2EHHA 1XSJA 3MCNA 3KCJA 2QS8A 2A3EA 3STCA 1ECEA 3EBVA 4GJ1A 1A5CA 4I9MA 1JI2A 3G77A 2DZTA 2V5CA 2NVAA 1Z8AA 2FPYA 4P61A 3C52A 1L6YA 1NDYA 3LHYA 4CNUA 4O19A 3G8RA 3RX3A 4WRHA 3HV8A 1YTKA 3S47A 3FNDA 4MB1A 1EJWC 2BGNE 4C7DA 2XWEA 3NCOA 2D0FA 4QLJA 3FX4A 4DELA 2HS6A 3WZ0E 3SY8A 3GE7A 3AHVA 2X2GA 2YL6A 1X1OA 2OTDA 3B9OA 1H1NA 1OM0A 1MQQA 1SMDA 1S46A 4U4MA 3REQB 3IUHA 1QOXA 5CZSA 4RDWA 4ZQCA 3Q37A 5LXEA 2H8XA 3M0JA 5I7GA 3W76A 2DT3A 1IWAA 2IUZA 5DEZA 2UY4A 1TPWA 3FW6A 4NNBA 3TC7A 3VKBA 4RNFA 1UZ4A 3SSJA 2VX7A 3M0MA 2WJFA 2X09A 1TO3A 3L2LA 4IPPA 2J75A 1EYWA 1G94A 4GI4A 1YBQB 1LYXA 1PVNA 1XBXA 4FLSA 4RK8A 3W1RA 3W1MA 1UA3A 4PUEA 3ZS4A 1ZALA 4AY1A 3H21A 3QFWA 1XD1A 1M7PA 2WMHA 4UWMA 3FAXA 1P0KA 1G69A 3GVQA 1ZLPA 3KOFA 2P3EA 2QIWA 1RQBA 4JEQA 2DVXA 1XV8A 5C2CA 2ZE3A 5GJPA 4JX5A 1QI3A 4DXVA 3RX4A 4IG2A 4NNAA 3TN6A 5KSWA 2W66A 4XUGA 1BYCA 3SQLA 5C2GA 1W1ZA 2X2YA 4XKMA 3H23A 3IAPA 1RA5A 2E6YA 1XLFA 4Q4QA 4ORMA 3M16A 3CV7A 2ZDSA 2UY5A 1TJ0A 3NFUA 4LCQA 4LY4A 4DPQA 3E2RA 4G56A 3MMTA 3SY5A 2PDLA 3MBDA 5KZDA 3HFYA 2V3EA 4NZ4A 2H9AB 4UQAA 7TIMA 5JIPA 3BOLA 3LI1A 3AIEA 4JTHA 4MLJA 1W3LA 4CQAA 5FSEC 2ONEA 1FWAC 4QGCA 1XLLA 5ECVA 1PO9A 3CV1A 3BE7A 2ZUWA 4IWWA 2IXUA 3PPFA 2RDXA 3A5FA 3DHUA 3W83A 3R4IA 1AQMA 2OWCA 2J66A 3P61A 3ITOA 5GQBA 5KETA 5FACA 3KP1A 1XRTA 2ISFA 1DV7A 3G1XA 3UWEA 3BG9A 1OY0A 1C7SA 1RD5A 1YQ2A 3EA3A 5DF0A 1ZU8A 3WBWA 4L1WA 3CMFA 4W8LA 3UZZA 4LUTA 1REQA 1XG4A 3BJFA 3UESA 4PB5A 4I7UA 3OYXA 3TR9A 1UP3A 1NAL1 2OGYA 1GVSA 3NQGA 4GUFA 2CWNA 4QG8A 2D2HA 5F1UA 1UHVA 3ZIZA 3IJ6A 4ZVJA 4AF0B 1A5AA 2WHKA 5E1QA 1JRBA 4W88A 5E0FA 3VIFA 2G97A 3QC0A 5CPOA 1KNWA 3BC9A 4UZUA 1E0XA 3ORWA 3AZTA 2HEJA 3C86A 4Y8FA 3VGBA 4NAEB 3BAJA 4Q8VA 4GQBA 1W5PA 1RD6A 3D46A 1CNVA 4EOUA 1E70M 2OELA 3BDKA 5E6ZA 1R3QA 3L4WA 3WNNA 2OO6A 1PYMA 4UXDA 3HFTA 2VCAA 3L5LA 2GGGA 3S42A 4IPNB 1YE6A 4OUIA 1KBIA 1GHRA 3OGRA 4ZTXA 4JPGA 1DXIA 3EPOA 3VD5A 1LCOA 3OBEA 1HJVA 2OJPA 1RY0A 3AJXA 1DKWA 4PRWA 4NAFA 4LPCA 4MWAB 5LA2A 1BVWA 1AQ0A 1JDFA 5I2UA 3KP0A 1XLMA 2EG6A 5JBEA 3VDBA 3NXFA 3TYAA 4UR9A 3THUA 2GK1B 4PYSA 4TVDA 4ICNA 4L4MA 1IR2A 2WBKA 2J78A 3N4FA 3PZ9A 3QXBA 5FJIA 3MYOA 1EOMA 1DQUA 4FA3A 1DJIA 1LROA 3RAOA 4HYWA 3OVGA 4QRNA 3G8EA 2CLEA 3W28A 4DJEC 3EPNA 4WLCA 1C9DA 3IANA 4R88A 1JCTA 3HPSA 2HZGA 2OKOA 4UFJA 3NQMA 1PZ3A 2I1OA 1F3EA 4Y9AA 3VNYA 1HP4A 3TN3A 2FPVA 2CBUA 2XVPA 3HURA 3LENA 3WL0A 1YDYA 1QATA 2V3FA 3LBOA 3W71A 1W1PA 3EDKA 4MZYA 1TPC1 2CWXA 3VILA 1CBGA 5FCZA 3MVTA 2BDQA 2FH6A 3TU9A 3WLNA 3IGUA 4AY7A 1X96A 4YL2A 4JFUA 4QJ1A 3UVIA 2NXIA 2QCLA 2ZDRA 5K7JA 5MKGA 4IPLA 4Q8MA 3M0YA 4QAWA 4ZGYA 3G1DA 1DPMA 1PKYA 4S3GA 3CPUA 5F2GA 4R3UA 2CETA 2BFGA 3PTQA 3O0FA 4NJJA 2YDRA 2OEJA 4W4QA 4Q32A 1CPUA 4CVWA 1PE1A 3LOTA 4IUOA 3MI2A 1EC7A 1L8PA 1VIWA 3V5CA 2PU1A 4UCFA 5FI8A 3MUZ1 3T8LA 1TPB1 3IJLA 1J79A 3MQTA 3H2AA 3SUWA 2P5NA 1JYWA 3OPSA 3SZ8A 1LWHA 2HQAA 2W0UA 2GK1A 3ZLFA 3WLMA 1TX0A 3V1HA 3K4DA 4FPSA 1AUSL 1ODUA 3AS3A 4NYYA 1XCWA 4A3UA 2G0WA 1KFWA 3M9YA 4P7NA 2GGEA 2I56A 5C6MA 3MP5A 1FH7A 3LCLA 2ZVIA 3I10A 1HGYA 2P0OA 4HSNA 3QQ0A 4GGBA 4QEHA 4ZO8A 1OCJA 1EFZA 4MDOA 4IXHA 3VE9A 5LA0A 1PZ1A 3VDAA 5GNYA 4HCDA 3NL5A 5AFDA 3S5YA 1G6CA 4UNKA 1TZ9A 3N2TA 4H8NA 4Q8PA 2PCQA 2VWTA 3W72A 3HIJA 5JIWA 4LYPA 4KCUA 1B5TA 4PMYA 5CQ1A 3AS0A 3U4FA 2I5IA 2PPGA 3LDVA 1XKJA 2CIPA 3GTXA 4PUDA 3CIXA 3RN6A 3CZKA 2DZBA 3MSYA 1B54A 3Q4DA 3Q45A 1TSIA 5CLWA 1IXOA 3K8KA 1JZ3A 3UETA 2ZYFA 3EWUA 3ONBA 4C91A 1HUVA 4LQ1A 3ALFA 1VF8A 3LNMA 3GD6A 4PUUA 4YMZA 4DEFA 2WCSA 2JKAA 3IIXA 1XISA 5FF2A 7REQB 4A3HA 3FCPA 4ZSUA 5HA7A 2ATSA 3DHDA 3W7QA 4AAJA 1CT5A 2X1UA 5CZJA 4Z1BA 3IK2A 4L6OA 2QF7A 5T91A 3A4WA 1FKXA 3A3XA 1EWDA 3U9IA 6TIMA 4WCJA 1E0UA 2C1HA 1FCVA 1B3VA 1JCLA 4L64A 2Q02A 3WSUA 4UUIA 3ID7A 3D3FA 1IEXA 1WZLA 1FXPA 4FX6M 3NEHA 3WH5A 4HZMA 4PCFA 1TUFA 3K2GA 3I3BA 2NW0A 4XG1A 3A13A 4KWUA 2PDPA 3B06A 4OT7A 3EX6A 1XC6A 1B9ZA 1OSEA 2FHCA 4RNHA 1TQXA 3TDFA 2WMGA 4AW7A 1QBBA 1ZY9A 3CIVA 2V82A 1BLIA 1I6NA 1GOQA 1QU4A 3H2CA 3R7MA 3OHIA 4J3UA 6REQB 3KW3A 4JHMA 2E9LA 1ONEA 2VR5A 3GTIA 2HVNA 4XSLA 3R43A 2CEQA 4G1KA 4GG9A 1OG6A 3BTNA 3QRHA 4I7VA 4HPHA 4ZEPA 4M0XA 5AYZA 4AZBA 1ADOA 1A3HA 2I9EA 3LMZA 5BW6A 5K2ZA 2OOFA 3PBMA 2BTMA 4QP0A 1SR9A 3DC8A 2Z4GA 2GGIA 4MY1A 3I7QA 1X6UA 3PNUA 2DSZA 3E1F1 1M6JA 3O6CA 3NQ2A 4LF2A 3VNIA 2CHRA 1Y5WA 1JDAA 5IDIA 4ZMGA 5C71A 1EJVC 3FGCA 4URIA 4XZIA 1QUMA 2IPFA 1WKYA 1A5OC 3R1ZA 3TAOA 1OINA 3L66A 4BFAA 1JCMP 4CLMA 4EF9A 4DNMA 3IUDA 5FJUA 3GXNA 4OQVA 4C1NB 4IIHA 1JDEA 3GU1A 4DYJA 4J3ZA 1ZUAX 3T0DA 4NUWA 1XLCA 1OB0A 4JOMA 2Y2WA 4DZHA 4MZ8A 1KV5A 3WENA 1TPUA 1ISXA 2NQ5A 3NIYA 2VZOA 2V5LA 1W8SA 1FWEC 4FNRA 3LZ5A 1PX8A 4L6HA 4AX7A 4PA8A 1UJQA 3EGJA 3VNZA 1Q6DA 2E25A 4MF4A 3GH5A 4HYVA 3IEBA 1T0OA 4QAIA 1Q2RA 3TQVA 1UPMB 1TWZA 3L0NA 3VIJA 4DWDA 2GJRA 1R3TA 4DXKA 4YYFA 4ZB5A 2PAJA 4HU3A 3WQPA 3LQGA 1F76A 4QXIA 1R9YA 4LS2A 3ZO9A 5K4XA 1A0EA 5JH2A 2Y7GA 5E70A 3WBEA 5FAJA 3K13A 1GTEA 1AH4A 4K8EA 2A6NA 5CSYA 5DFAA 2OWWA 2JE8A 4LAMA 4YS1A 3W2MA 1FWNA 5C7HA 4KCWA 4PH6A 2X0SA 1AQFA 2ACRA 2DSWA 4LW7A 4HU0A 4IHCA 3QFEA 3QPZA 5CLTA 3VD4A 1TMLA 1U1UA 4B4FA 3NO1A 1V93A 1MZHA 3N2BA 4C6IA 5HK4A 4NI8A 3ZQ9A 3KRBA 5F1VA 3DBPA 4HBKA 3SB0A 1KCXA 1GKQA 5A6AA 4HN8A 3QLDA 3N4AA 3W1UA 3G6MA 3D6NA 4GYFA 4L9ZA 1L8NA 4HMNA 4K1WA 4NXKA 3ZT6A 4CCEA 2X1RA 4C1NA 5AVHA 3PNZA 2VEFA 4REQA 4GI9A 3DHFA 5CG0A 4JZ5A 1G67A 2WOQA 4UTWC 2A4AA 1VKFA 2G4JA 1OBAA 2XIMA 4HJWA 4N6EA 2XTKA 2JKEA 5BRBA 2NX1A 1EX1A 2NX9A 4UFMA 1Z6KA 2NXHA 1V3HA 5DBUA 3W7DA 1BWVA 4GKLA 4RUBA 4I8YA 1XFCA 1VYSX 1Z89A 3ANYA 3CUFA 3ZT7A 1VH7A 1UA7A 2W27A 4WSHA 5DT5A 4LC6A 2QEZA 1XKYA 3LGEA 4L4PA 3ZJ8A 2WANA 4Z0JA 4XIMA 1H0GA 1W9UA 1E15A 3ZR5A 1F2JA 2D73A 3LCGA 3EB4A 2IPWA 1D8CA 2PTDA 2W63A 4DUVA 3P8IA 4QEEA 5A8MA 2ZFAA 1M04A 1UWIA 2Y63A 3WEZA 1WKEA 1PB0A 5A6TC 3W24A 3W0KA 3WLTA 1HG3A 1TX2A 1TTPA 2PA6A 3WD2A 4MB5A 3T08A 2ZUNA 5TNVA 5HMSA 4H41A 1Q13A 2RJGA 4IP4A 4B3LA 4H8HA 3NZPA 1F3XA 1LQ2A 5T8GA 1UP2A 1S38A 2QULA 1LBLA 4AD1A 1W1TA 3O6YX 4XZWA 1EYEA 1KA9F 1QNOA 4XZLX 4KIRA 4ZQNA 3NPUA 5D30A 2JEPA 2W5FA 2WJEA 1JIBA 3QV7A 1ZFJA 3AHXA 3GC5A 2CLHA 4Q8WA 4RW5A 4AYSA 2IPGA 3ZWSA 3W53A 4ICCX 4JFSA 3ZFHA 1LJYA 1XIJA 2X1SA 2YKKA 4JNMA 2ZA1A 1XIMA 3LXBA 4L5ZA 3LUTA 1E9ZB 5H8UA 3WLRA 5CAHA 3YPIA 2VQUA 1I75A 4PB4A 5IDZA 3KZSA 3FV9A 1V7YA 4UIOA 4AEFA 1WDPA 4X22A 2O9PA 1VP5A 1JR1A 2ZZ6A 2XIOA 4YTTA 1F7BA 1J0IA 3NZGA 4KWWA 2Y85A 4R85A 4UTUA 1Y8BA 1KM2A 1LL6A 1K1DA 4FAMA 4NZCA 3GBDA 4Q3MA 4FNSA 1XLBA 1BQGA 3DFYA 3DUGA 2ZRVA 1MXDA 2QPSA 3T0BA 1YX1A 3TA6A 1XBYA 2ZC1A 4CQBA 3ATYA 4C65A 2VZSA 4N4PA 1XI3A 1D9EA 3ABXA 3GR8A 3WD1A 4HHHA 4PR4A 3OODA 3TAKA 4Z2KA 1NOFA 3THDA 2PC4A 1E73M 1JUBA 3B9NA 1ZJIA 3BMVA 3VIOA 3APTA 4BY3A 3AIBA 2VRJA 1PXGA 4LV9A 4RE2A 2ZQ0A 3ARZA 3WJYA 4CCDA 4HQVA 4M1BA 3UR5A 3LHUA 4NZ1A 4PMZA 4BS0A 1V6XA 3S2JA 4EXAA 2PDIA 2XSBA 3S5ZA 3W7IA 3B8SA 4H9ZA 4M81A 3SIZA 4O1DA 1EO5A 3I7SA 3D0CA 3UWZA 4A4AA 3BLLA 3Q2DA 1FWGC 3S46A 4UTKA 1XIFA 1AA1B 4AZCB 4LF1A 3ZLHA 1K8CA 1XICA 3IGHX 4AX6A 3WG6A 4I9AA 3LLFA 3WD0A 3EOEA 1ZBWA 4ZQMA 3FSUA 4GE8A 3DFPA 3GBEA 2QCFA 2QQ6A 1RHCA 4B5NA 3LSBA 1HO1A 3C2RA 1SSDA 3RMEA 3G24A 2XFYA 2GQ3A 2FDMA 1E6PA 4YVXA 1S5NA 4XTIA 3UG5A 4CCZA 4LCSA 3WH9A 3U0HA 5REQA 1QDSA 4MJ2A 4QDWA 3R12A 2HPMA 4IGNA 2YX0A 3TV8A 1Z48A 2YXOA 4Z08A 1EEPA 4YYCA 1EUAA 4JTJA 2B4GA 2H90A 4O13A 1VYPX 1I45A 4IPIA 4NP7A 1RH9A 3CJPA 4QQ3A 1F74A 1Q6FA 3GXTA 4MAZA 5EMLA 4HTBA 2E7FA 3ZJ7A 2C1GA 1GT8A 3DZ1A 4EANA 3H7UA 2VZTA 2C8NA 4YVPA 2PGWA 4US5A 4DVOA 4WK9A 4KEUA 3ANVA 1E9LA 2OYKA 1JXKA 1DJWA 1V3JA 1VJSA 2FZMA 4HNCA 1RP9A 1KCLA 3TTYA 1XF0A 1FWJC 3A4JA 4WOQA 3UVAA 1X8FA 1RJPA 2JFEX 1I0DA 4Q8QA 5DQPA 3IAQA 4O57A 4ZE4A 3ENLA 1RJRA 5K9XA 2OODA 1L0PA 1OYCA 2V8ZA 3AXKA 4IISA 1R2SA 4PCPA 5AC6A 2BNJA 4B5VA 2GGJA 5CPLA 3B9DA 1K03A 3DN5A 4GQ0A 1LQ0A 2FJUB 4HVXA 3W7GA 4PE8A 4L1XA 3VKAA 3RPTA 3N29A 4B9YA 2L5HA 3W7NA 1YDVA 1J93A 4JY8A 3OVPA 3TR2A 4DIAA 2PLKA 5HBFA 2FMNA 1HT6A 1GK8A 5GPRA 5M3WA 5HPCA 4HZ8A 4GZIA 1L2UA 4UTTC 2C19A 1K7EA 2PDJA 2HE5A 5IFPA 1UYQA 2BVTA 3LBMA 3W1NA 1R2RA 4M3PA 4DO4A 1Q8JA 2FTPA 5A2BA 1UD4A 4JQ1A 2G50A 4OE7A 3UP8A 1XDJA 1CEOA 1JF6A 4O1EA 2VXNA 3WEOA 4S3BA 2AAAA 3G3DA 3A4XA 4YTRA 4TMBA 1N55A 4U5IA 3GVRA 5BXTA 2ZVRA 3DFOA 3QTPA 1DIKA 1R7AA 5TQLA 1EH9A 4NJGA 2QAFA 2WC4A 3TC3A 3VD3A 1Y5XA 3LLXA 1XLJA 4CD5A 5AKQA 5C2XA 3WQ4A 1J2BA 3O15A 5CGQA 5HUOA 3PBUA 2ZOXA 2WW5A 4C6JA 2ZX6A 4GY1A 3UNDA 2J7BA 2FGLA 3OLGA 1W32A 4QS5A 3RFAA 3GDLA 3CUXA 4FXSA 2DZUA 3W87A 1G01A 3CWHA 4RLIA 1VPQA 4XBSA 3RG6A 1XXXA 1G4EA 2VUYA 4UZSA 1V3LA 3TTSA 3DBNA 5EMJA 2BWGA 4ZCWA 2VEKA 4PL1A 1AH0A 3B8VA 5ABGA 3ABZA 4RR4A 3W88A 3N1AA 1FHLA 3W27A 1IZCA 4ZQRA 5A8NA 1JVNA 1W1IE 3DIPA 1DOSA 1HL9A 3WNPA 4IICA 5B7ZA 4KFPA 3EMQA 3CO4A 3WQ5A 3CWOX 4F40A 4E3VA 5K4ZA 4M8UA 4DWSD 1UG6A 3HJEA 1YPXA 1H3GA 2F6UA 2UV8G 1CGWA 1C8YA 3JW7A 1O94A 3M5YA 3MCOA 2BS9A 3E9AA 4QCEA 3VA8A 4HMEA 3M7SA 3GH7A 3S5NA 3ZSTA 4NF7A 4IFKA 2VR4A 3RR4A 3R13A 4YTQA 1EZ2A 3PUOA 3TOYA 2PDNA 5XIMA 1XR2A 3F2DA 1I2PA 2HCVA 4ATWA 2A3LA 3PJXA 3GVGA 1GPFA 4JCMA 3WQWA 1KV8A 2E3ZA 1KGWA 3H4XA 3PB0A 4JIIX 3WK1A 1FWSA 3T2PA 5FF7A 1TE1A 3LNPA 1BXBA 3DEQA 3UU0A 3N2XA 3E74A 1KLZA 4LRSA 3P7YA 4AD2A 2IXVA 3OZYA 5LGXA 3OU8A 2PBGA 4J2PA 2WBGA 4MWAD 3N15A 4CQCA 3VGEA 4QIUA 4P8VA 4AHPA 4IQJA 2TSYA 3F4CA 4P2VA 1VQTA 3N19B 3SIMA 2PP0A 5K3VA 2BLEA 4Q7BA 1I4NA 1NTHA 5LSMA 1XYBA 5K9DA 1OC6A 1MMFA 4HA4A 1VBUA 3DG3A 4LALA 2F6XA 2P50A 4HPNA 5RUBA 1Z32X 3M0ZA 1ONXA 1RPXA 2CFFA 4UNIA 5D9PA 5AC5A 4NHVA 2BB0A 4AZ7A 1Q8AA 1HKJA 1NP2A 3RCYA 1HN1A 1QFEA 2W9MA 2WZIA 3NQ6A 5G1TA 4S3FA 3ABSA 3MTWA 3A9BA 4ZB2A 2RAGA 1N82A 4XD4A 3RU8X 3RHGA 4QE5A 4Q4OA 3F4VA 3NM3A 4A3QA 4O18A 1P1MA 1KM6A 3NAVA 3VFCA 1WX0A 5BCAA 1KTNA 3QJAA 1G4SA 1R2TA 2XN2A 3QW4B 1KM3A 3UJFA 3NVTA 5C54A 3PZIA 1PIIA 4EPDC 1E40A 1IWBA 5ENLA 1VRXA 3NQDA 5ABEA 1W3TA 4AB4A 1UBPC 3M41A 5IM51 1B57A 5H2ZA 4FNUA 2WKLA 1TV2A 4Z1DA 2OYLA 1D7KA 1MRQA 3IJ7A 5A5WA 3IIZA 3OB8A 4O1FA 4XQ6A 4OV9A 4MM1A 5DCDA 3VCCA 1UD3A 1PYFA 1ALDA 3WCZA 3LSCA 2DW7A 2GJNA 4XVDA 1C93A 3DU0A 4GINA 4RZ4A 4PCTA 4O16A 3UZWA 4WSKA 1G4PA 4UOZA 3SFKA 2EJ1A 3SGZA 1V0NA 4C1KA 2Y5SA 5I02A 3T81A 1HKMA 3SCUA 1BEUA 2OQYA 4FR6A 2NXGA 4YTSA 2WVUA 3PJTA 1E1CB 5M5DA 4ILSA 2Y61A 2DSKA 3UXAA 3GU9A 3KOYA 2FDSA 3GNXA 5I07A 3K46A 1TG7A 4IJRA 2ISSA 5DANA 2GDVA 2NQHA 3PPCA 3W25A 1BVZA 2D2GA 2OG9A 1Z42A 1JPIA 4R9XA 2FMOA 1XQLA 1BD0A 1SPQA 2DU2A 2DY3A 2CLKA 3CUZA 5AECA 1MDLA 3PUEA 1CXLA 1J6PA 3VOGA 4OBTA 4TU1A 1GOWA 1XH0A 5F2IA 4GFIA 5LIWX 1G0CA 3GK0A 1ICPA 1V3MA 4TVCA 1XP3A 3LTSA 4BK9A 3WBAA 4B15A 3ZOAA 2YCLA 4LGXA 3FFSA 3NWRA 4PCNA 2VC9A 3BCDA 3C4UA 3QKEA 2VD8A 4IJBA 3GZAA 3L21A 1K4GA 4NAFB 1HF6A 1QASA 3FJNA 2HVOA 1DIOA 4JKLA 3QMRA 1JZ7A 3H4GA 6PTDA 5F4XA 2FHFA 1ZGDA 3TYEA 2Q3OA 1W3KA 4QJ5B 4JCLA 1UR9A 4MY8A 1KTBA 3LCIA 1VYRA 3NQEA 3TSMA 1UZ1A 1J5TA 4PUNA 3UJSA 5AHNA 4U3AA 5D04C 1OFPA 1TWWA 2X7VA 3EZ4A 1RP8A 3GSMA 1J0YA 2DZPA 3WLLA 4DJED 1JQXA 1RA0A 2QYGA 3ABRA 1PEZA 4BQ3A 2Y7FA 1TE6A 4N9EA 5TAOA 3PBWA 2CZEA 3BOXA 4EAYA 1V3IA 3FSTA 4JTCA 3BCFA 1V6VA 1X8CA 5D37A 2XN0A 4CCCA 1EKOA 5AYIA 1PDYA 4DPPA 2YFNA 1OF8A 3NOEA 4DXXA 2VJXA 4MYXA 1EP1A 1NDWA 1XRSA 4JNZA 1JUKA 1T6MA 2P76A 3CZ8A 2RH9A 2PRHA 2PSNA 5MKGB 5D09A 3R89A 3ZXWA 1ODZA 2J25A 3OZPA 1UR4A 4EACA 2QPXA 3TXVA 4AXNA 2DDXA 1C7TA 1E3ZA 1UC5A 4QSFA 1WNOA 1MFVA 3RDKA 3I65A 4JTSA 2WQDA 3LLDA 4NZ5A 5FJRA 3SCWA 3T1GA 1KC7A 1GZGA 3S2LA 4HKPA 1MVYA 1IV8A 4HU8A 3SUSA 4UFIA 5CPQA 4OKDA 2BGSA 1XLAA 3GLCA 4I5XA 5AB3A 4V2XA 4P5UA 2ASHA 2G4FA 3U4AA 2PD9A 3AXIA 1NQKA 5DELA 2INZA 3NM1A 1FWIC 3LN3A 2WM0A 2RKXA 3EB2A 4QG6A 1JPMA 1YADA 2E40A 4ACZB 3N11A 4WDWA 4AVOA 4GK8A 1A53A 1XLIA 4KH2A 1EDTA 1VCVA 1ISZA 3CS2A 1AZ2A 2A7RA 4PMVA 4LAUA 3SADA 3VGFA 1W17A 2OFJA 1CWYA 3CU2A 3E49A 6TAAA 3ZT5A 1XLKA 2QR6A 1E6SM 3WLPA 1TA3B 1SFTA 1IT0A 1N7KA 5G1MA 1BF2A 1MUMA 4EPEC 3FKKA 3ZYZA 2VURA 3QY8A 1V4YA 4GVFA 4C6FA 4HPJA 2XIQA 3FHQA 4US6A 2NT1A 2JK2A 3MMDA 2WC3A 2V67A 2QVNA 3NO5A 1FDYA 3CAWA 3CQIA 1KBKA 4WOZA 4CD8A 4DJDD 4JDBA 1W9PA 1V6TA 5HOSA 3VM7A 4KESA 4F3HA 4S3JA 3EXTA 3DXIA 1UWQA 3PR2A 2JKPA 4I3GA 4PMNA 3L4UA 4X63A 1IIGA 1XRVA 4GUHA 4MIMA 4JTUA 3A23A 4GI8A 5I79A 2ISWA 2WB5A 2REQB 4EAMA 2PF0A 4KMQA 3WLJA 1V3KA 3V18A 2FH8A 1TTQA 4ZXLA 4QJ4B 3ARRA 3W26A 4WDUA 4JTQA 5HWNA 1JDCA 4HZ6A 3CQ0A 3GXPA 4F9JA 1F3TA 4AEOA 4C7FA 4V1XA 4YXGA 3KBVA 3LXCA 2FPTA 2Q71A 2PGRA 3URBA 4FLRA 3HQ1A 2ABBA 1UIPA 2F38A 4DHGA 2J7EA 1FP9A 5EL1A 3KUMA 3SQSA 2NZLA 4K36A 4JTLA 3FYYA 1B4EA 4FOUA 1ZBKA 4AQLA 3JRKA 2GGHA 1WYIA 2DPEA 4MB3A 2Q01A 3UGVA 3EKLA 4IXXA 3JZEA 4J5NA 3WH6A 1US2A 4R27A 3BJTA 2BVYA 3ARXA 2C1IA 5CKSA 4WKFA 1HGWA 3CHFA 4ZTYA 1E51A 2J4GA 3GH4A 5FF0A 5MF5A 3DECA 2BOEX 3KDNA 3AOFA 2XN1A 1R3WA 4JFTA 3BZJA 4FS9A 3T0TA 1MQPA 3O3RA 1LOQA 2R94A 2QUVA 4AYGA 1VFFA 3NTYA 3DG6A 3TCEA 3RMJA 3RR1A 4AISA 4K6AA 4K7VA 3WQ8A 7CGTA 4AHQA 3E0VA 4DQWA 4HA0A 4FI4A 2QIIA 1QAPA 3PP7A 5LHEA 4WIWA 3BPWA 1ITQA 1KFJA 4G7EA 5J04A 4RZ5A 3TUUA 1XBZA 4XAGA 3W2JA 3FGCB 2QGYA 3L2MA 4HCHA 3G2GA 3SN4A 1HVXA 3T0AA 2W62A 2F2KA 4W7UA 4M19A 3WMBA 5BOEA 2DUAA 4E8GA 4QFUA 3N34A 3UZXA 2V5KA 4TOQA 2YB1A 3UCDA 1R30A 1ZHAA 4RJEA 1K6WA 4WQ6A 2OX4A 3UBPC 3OGSA 4E6MA 2J47A 4GUIA 1SZNA 5CJMA 2O92A 3MUY1 2HXUA 1SQ7A 4L4OA 4H6RA 3GFXA 5BU9A 2ACQA 1DHPA 3EA2A 4LVBA 2Y8VA 1JGIA 2J24A 5G2WA 4MNKA 4A3YA 5CZTA 4DO5A 2ABAA 1LOSA 3LPGA 3ZJKA 1I1WA 3C0JA 3LPOA 3THCA 3HGSA 1TUXA 3AUJA 4RE0A 2O0TA 1DTNA 5FIPA 4UQ9A 3LCWA 3WQOA 2J74A 4IL0A 3AS1A 1FY6A 3GYEA 4GXMA 3ANUA 2WYSA 1ITXA 2V6AA 4US5D 4MZ1A 1PX4A 1H63A 1LBMA 3H2MA 3NYZA 1R3RA 3C8NA 4IM4A 1I1XA 3RIKA 1YNQA 1V03A 3M6DA 3PSVA 2D3NA 1E72M 4N02A 3CZGA 3P8JA 1TPEA 1W54A 1LLOA 1GJUA 1M53A 2QPUA 4K37A 5ABFB 4UOQA 3EWXA 3CH9A 3P5YA 3ONCA 2Y1HA 5LYRA 3OBAA 1W1A1 3LTPA 2WK2A 1UD5A 1J11A 4E4FA 4JS3A 2C3ZA 4PZVA 1CGUA 1Z3NA 4D9PA 4EPKA 1ADDA 1YNPA 1LM1A 2F8QA 3UY7A 3KHDA 2GSJA 2PDUA 2KAUC 2WZHA 3CZEA 1JUEA 4AEEA 1K9EA 1XRFA 3WDJA 2RDTA 3TROA 2EQDA 2TPSA 3NSNA 4CNPA 4R9OA 1ESWA 3MP3A 3S1UA 4A35A 2BODX 3WX7A 2NQZA 3BH4A 3OA3A 1XM3A 1NQ6A 4KEMA 4O10A 4U10A 3CBWA 3A5VA 3LA4A 2PLCA 3GTHA 3CTLA 3TW6A 3PZTA 1E4IA 1ME8A 1SFLA 4OOZA 4AWTA 4DYKA 1JEZA 2EKGA 5FF4A 4JFWA 3QHNA 1JYNA 1QTWA 3CB3A 3M7WA 2IS7A 2PWFA 2VDGA 3ARSA 1JD7A 2Z25A 2DZVA 2VWSA 3W7KA 3ZLGA 4H6KA 3PSWA 1DVJA 3DI0A 1QI5A 5CXPA 1Q6QA 4D72A 3B0UX 3PANA 1J9YA 2HK0A 2QV5A 1O95A 1DWHM 3V7PA 1WUEA 3PJUA 1BRLB 3DKLA 2WHLA 3U2EA 3V0TA 4ALDA 4ORIA 2OO0A 1V0LA 1G1YA 3GAKA 2I5QA 4HK7A 1F6YA 3HA1A 2XUCA 2ANUA 4FK9A 2CBJA 2FVMA 2C79A 3M5ZA 3WQCA 1FWBC 4KBXA 4LFYA 5E9XA 4K2SA 1KXHA 4WXYA 2X41A 2XISA 4DYEA 1HJQA 2EF9A 1XD0A 3USBA 4ONVA 4H6QA 3A12A 2ZIDA 4CD4A 3VC6A 2D2JA 1PSCA 3A64A 3W7RA 3WNOA 4B5SA 1IEIA 1P43A 4O0KA 4IMEA 2F6KA 3IPWA 3QPEA 2W4XA 4HNVA 4GYPC 5IRPA 4PUJA 8CGTA 5DRIA 3DH7A 5EFFA 3H7VA 3L23A 2OEKA 1GCYA 1OQFA 3W70A 4BWLA 4RDZA 3WK0A 4JTEA 1EA0A 5F2LA 1BWKA 2GDUA 4DRSA 3W9ZA 1W0MA 1R9ZA 2VGBA 1R5YA 3GC4A 4GNJA 3FA4A 3PG9A 4E2BA 4EIVA 3KHJA 3BXWA 1FTXA 1MO0A 4ZL1A 3L4TA 1SW0A 4C6NA 1PS9A 3QYQA 3C2YA 4E38A 3F4WA 3GXFA 3L7RA 2WNZA 1JQVA 1OIFA 2XGZA 2OR2A 5I23A 4KFOA 1NJJA 2YBTA 4U2ZA 1Q7ZA 3E0FA 4PL2A 1V8EA 3TX9A 1WDQA 3AFBA 4M51A 3MO4A 3VFLA 4W84A 3VX1A 1GWJA 4EF8A 4F2UA 1T41A 5H8MA 3AXMA 5T9BG 2VEIA 1NP0A 3F4DA 1QNVA 1LQAA 5LA1A 9CGTA 4TR9A 3M1ZA 1M03A 2GVEA 4FLOA 1DORA 3T44A 3AUOA 1IXNA 1VHCA 4HB7A 2DZSA 7REQA 3TWAA 3WDHA 2VC5A 4XK2A 4OHQA 5FEPA 4CKQA 2TMDA 1V79A 5FJOA 3ME3A 4XIAA 4PBEA 3VE7A 1BVNP 2Z28A 2BOFX 1RLCL 2CBVA 3WD3A 2Y70A 2PDFA 2XVGA 2A79A 4BF5A 1DJXA 3OZOA 3CL8A 1ADSA 2Z7KA 2VTFA 3KZPA 2AGKA 5D38A 2VZVA 3QVQA 4IMGA 4F8XA 1DJNA 1HVQA 4O50A 3F5LA 2O7SA 2GUBA 4QS6A 3W2UA 4L4LA 5HXMA 2GOUA 5IBXA 3OEXA 1RSCA 2B7PA 4I8DA 1BXNA 4MOZA 3W2LA 3P60A 2PMQA 4UTLA 3DG7A 3P62A 3W74A 2CHOA 3OGVA 3VGHA 4PUKA 4DM2A 1KRCC 2A7NA 2XINA 1MNZA 1S39A 1A3XA 3NR0A 1B3OA 2AL2B 2Z2UA 4KQNA 5JUVA 3WH7A 3ZZ1A 1O1ZA 1XIGA 3UR8A 3VUPA 3APGA 2ACUA 2D2OA 3OQEA 1JD9A 1OD8A 4UR8A 2VX4A 3E2SA 2ZTJA 3PM6A 2AL1A 4WZHA 4CQ8A 3MHUA 3THQA 3CYVA 3I6EA 1JL8A 5HR7A 2RJHA 4IG2B 2ZUVA 4WY0F 3WMLA 1X7FA 3SFWA 3I68A 4YN5A 3P82A 4D8ZA 2Q6ZA 3UJEA 4GVGA 4O15A 4N4QA 1KB3A 1E56A 3N13A 3AYVA 1TIWA 4O0ZA 3N6QA 5C9ZA 4DJFD 4GUJA 4NL1A 1F6PA 1F4AA 4LU0A 4BI7A 3RYSA 3GNNA 3LRKA 2PU0A 2Y7DA 1UWSA 4KEZA 4LVFA 5LHFA 5GVJA 1X39A 1D7FA 1CGVA 3E5PA 2P10A 1JZ2A 5IOBA 5BXPA 3N25A 1SUXA 2YPIA 4O53A 1J10A 3OYZA 2BY3A 2Z1XA 3UJRA 3SCTA 2ISVA 2ZRWA 3TQKA 2OOGA 3H24A 1ITCA 3BANA 4FMVA 2GYIA 2VI0A 1UIOA 3M0HA 1GOMA 1OFAA 1GQJA 4LUIA 3W7OA 4G1NA 1NWRA 1B31A 3HPZA 1XYFA 4ATLA 1F3WA 1QI0A 2XZ7A 8RUCA 1WZKA 4JQ4A 2BHZA 1PL9A 4JIRA 3BICA 7PTDA 1UWRA 2XH0A 1T40A 1EQPA 3D5HA 3B04A 4MMWA 1A5MC 1W5MA 4WDXA 5I77A 1ITUA 3SCNA 3W7CA 1GKPA 2WMFA 1HQTA 5CH9A 2G3JA 2BXVA 2CPUA 1EOKA 2PTWA 4DJFC 4WHBA 1SFJA 3LHWA 3TZFA 2NVCA 3T40A 1ICSA 3LHZA 5HJXA 3HU7A 3W3OA 1QK0A 4JAWA 1EIXA 5E09A 1RK6A 4FP1A 4DN1A 4ADTA 2Z27A 3ABQA 3JR2A 4I9TA 3A6OA 5CPSA 4S38A 1V7AA 4FLQA 3WF2A 3WJXA 1TKKA 1CCWB 1ELSA 5GJMA 2ZA3A 4YTUA 1EBHA 1WV2A 4FOJA 3R79A 3WNLA 4L61A 2WLYA 3TW7A 3TYUA 1OG0A 5DY3A 4RCXA 4JKMA 1U2YA 2DFAA 3WJZA 4N42A 3GB6A 1IEQA 3TNBA 3T9PA 4LS0A 6XIAA 3GRIA 1YYAA 2YDSA 1GQLA 4WY0B 3VMPA 1E0TA 4MFDA 1C8XA 5CBJA 1CGTA 2DJXA 1PZ0A 3EEGA 3MHFA 3A24A 1DIEA 1JFXA 2G3FA 3FXYA 1CDGA 2GWGA 3AMLA 3CLMA 3DFHA 3MY9A 3OLEA 4GC3A 3QYSA 2R8WA 2R82A 2B81A 2ZICA 5DT7A 4XVEA 2V30A 3VNKA 3BMWA 2QW5A 3M5XA 2V69A 4GLEA 1Q7MA 1LLWA 5DCEA 1I0BA 1EC8A 3SCPA 4OOUA 3N9SA 4JTAA 4DUWA 2BMBA 3PBVA 4UOJA 4DZIA 5DO8A 1ZTVA 4C6DA 3L0KA 4K38A 4O54A 3N3MA 3QTGA 3FKRA 1H7PA 3DFQA 2ZX5A 1A5NC 1UBSA 3MKKA 4G2DA 4C5ZA 3URQA 4Y2WA 1WKDA 2D20A 2OSWA 4EK7A 1UQYA 3L0GA 4MNJA 3L5MA 1W5QA 1SO3A 1UOKA 1AODA 3SCQA 1WE5A 3W7HA 4CUCA 5DXYA 1C90A 1J0KA 2GVGA 2BXZA 4RE4A 2QJIA 4GQRA 3BAYA 2ZWYA 4KWVA 1XIIA 3WLOA 4C6KA 2OWXA 4ZFMA 1TZ7A 1XFBA 2XIIA 3SRFA 1HTIA 3RM9A 2GPTA 2IKGA 3VKKA 1YHTA 3UJ2A 4ACZA 1REQB 1ZB5A 5BROA 3AJ7A 1YBQA 3FOKA 1PDZA 4IIEA 1E1EA 4FR1A 3MWAA 3L2IA 3TYCA 5KZMA 1HJWA 3Q67A 2PDBA 5H6HA 3JVAA 5AHIA 3S0CA 4H4IA 3PS7A 1WBHA 1JZ8A 2D0GA 3UW6A 4Y96A 1RUSA 2YCLB 3SQMA 5DN1A 1Z41A 2Y5EA 4AU0A 1XW8A 2DQXA 4INFA 3PULA 1SSGA 5G5IA 1KM1A 4PGLA 3MVIA 4PMDA 1W91A 1N8WA 4DBEA 1QWKA 3TSDA 4XUYA 1R46A 3KRZA 2VDHA 5DCBA 3R58A 1RXOB 2EKCA 2WCAA 4AIBA 2VENA 5BOOA 2PDMA 1GG1A 4AZIA 4J40A 1UKSA 2VP8A 4Z1CA 3QGVA 4I7WA 5D2WA 5CAKA 4R7JA 3OOQA 3UEQA 3VINA 4GPNA 4X2PA 4XAFA 5HJLA 3S8HA 3WQEA 2ALDA 4MJ4A 2XVNA 4GGHA 2E68A 1PIGA 5D9OA 1LTDA 3FDKA 4EWND 1ZSXA 4UQEA 1RPKA 3N2CA 3EA1A 4FNTA 3GNOA 2DP3A 2PGEA 3KBJA 3VIGA 1FFRA 4F2BA 4NNCA 5AN7A 4TX9A 4F0LA 5D33A 1XPGA 5FEWA 1WZAA 1OZQA 1BG4A 3PZGA 2A21A 3QY6A 4PUMA 2ZXBA 1DQWA 4NJIA 4P8UA 4U31A 3ITTA 4HNLA 2O7QA 1OFBA 3S1VA 1PTAA 1XYCA 2WQPA 1SO4A 2DV0A 4PTNA 5DMMA 3W6LA 2J7HA 4G8TA 1EGVA 3M0XA 2FIQA 1U5HA 1QO2A 2DVUA 3QV6A 5U4NA 3G3MA 1U1JA 1W9BM 4CEXC 3VNMA 3B8IA 4ES4A 3PZMA 4X0NA 2D1ZA 3AXXA 1AFSA 1TTIA 1EB3A 3HO8A 4AD4A 1QNSA 1H49A 1U83A 1JRCA 4GOAA 3Q94A 1DWIM 2QCCA 1DE6A 1TJRA 3UWYA 3AIQA 2X1IA 4F0SA 3CZLA 1VIZA 2Z26A 1P48A 4LJ3A 3HBLA 7ENLA 1Y65A 2BBFA 1PZ2A 3GTNA 4JYDA 3QQWA 3QLLA 2YB4A 4IPJA 2KZHA 2WNQA 1OFQA 2YYUA 5A8OA 1W2VA 4HHPA 3E12A 4JTDA 1IGSA 3FYPA 4Y7EA 3MUCA 3T4CA 3KVKA 5D9NA 4DF0A 1IEVA 3ISIX 5DMNA 1W9XA 3TQPA 2OQLA 4L7ZA 1Y5VA 1YEYA 2IQ0A 2F61A 3W01A 3GIQA 1FCBA 1ZQ5A 2QCEA 2NUWA 3JUGA 1EP3A 1GUVA 4HPGA 1A0DA 1MSSA 1JPKA 4MWAA 1ZP3A 8TIMA 1OD0A 4YJ5A 5KTLA 4H2CA 1LG2A 3RXZA 2VUNA 3UWQA 1J0ZA 2Q8XA 5A6BD 2BXYA 1UMYA 2V81A 3QGAC 4ACYA 5CSRA 1FWTA 1ZJBA 1A5BA 3LS9A 1N8FA 3CLWA 2PDXA 5C9XA 4PFMA 4MHBA 2ZXAA 1ZAJA 2TODA 3RRXA 2E1WA 4ZO6A 4A2RA 3IIOA 2YA0A 2IQDA 1VHNA 3XIMA 4K8HA 2H3DA 4B91A 1P6BA 3PN8A 1VD6A 3AICA 1M9HA 4RW3A 1TPFA 1FCUA 1F6KA 5G2HA 4XAPA 2WZMA 1WKFA 4M7TA 1CB7B 2QT3A 2O55A 2QJHA 3GWQA 2YL5A 1RCQA 4U33A 1AW2A 2J9ZA 2PLJA 1DJGA 4O28A 2NT0A 4W93A 3HMCA 1QHOA 1R9XA 5AZ1A 2YOCA 2QV4A 1LDCA 2E4TA 2VRKA 3G1RA 3II1A 4FNPA 2X1TA 1U5JA 3BAIA 3IVUA 3RCMA 1G7VA 3I3EA 2NUYA 2R24A 3V1PA 4CVUA 1J4EA 4XBJA 3CAKA 2OGJA 2VO5A 3SSZA 4KERA 4NJKA 2E5BA 1JCJA 3UG8A 4H7VA 4AC7C 1E6RA 4UMCA 4IP5A 3SCOA 1KRAC 2BY2A 3PFRA 3IS4A 4Z2IA 3NOYA 3UXDA 4DJEA 3UD6A 1DXEA 2QHAA 2NQLA 3F4NA 4RPQA 4AZ5A 3S9IA 3BZGA 3HQOA 1KW1A 4DO7A 5D2XA 4GO9A 1RALA 1EQCA 3LM7A 4ADUA 4AZCA 1ZJAA 5XIAA 4Z1YA 3T78A 1A0CA 1BSIA 4KRTA 1KRBC 1CGXA 3G0UA 3WBYA 3M0VA 3TWBA 4JYEA 4QE1A 2GVLA 1W2PA 1XIHA 3N9KA 3SI9A 3OLIA 4HOXA 4UQBA 4HCLA 5LNVA 1DJHA 1DJYA 3EDJA 3V4BA 1C8VA 3UPWA 2WAGA 2UY2A 4LWWA 2VYOA 3WO8A 1A5UA 1UKTA 1UASA 1BAGA 4EVZA 2XJ7A 4IMDA 3EOSA 2J9YA 4HK6A 3E0IA 3H70A 1JCNA 5EU9A 6REQA 3CMJA 3V5FA 3VABA 3RPMA 3P2VA 2EG8A 1TR9A 2C7FA 1WAWA 3NGFA 5LIKX 4LCRA 1LOLA 5A94A 3TQ0A 2R1KA 3IV3A 1UJPA 4D6IA 4NSBA 9XIMA 4WF7A 1I9CB 2VFDA 2YW4A 4JIPA 4WJXA 1CXFA 1XGEA 2OU4A 2WXDM 4ZOBA 4JKKA 1XH2A 3TKFA 1TV4A 3UXLA 1DQXA 4X3ZA 4LYKA 2WKJA 1HJSA 4R7OA 1GW9A 1EIBA 2G5WA 4AMCA 1PKMA 1PKLA 3W6MA 3BURA 3REQA 4BEUA 4D6CA 4QJ3B 4E2OA 5HMFA 3HGJA 1P1XA 3MSGA 5KZ6A 2VOTA 3QGKC 1GQKA 2QF8A 2QCNA 1KXQA 1SMAA 3ZWTA 3GUWA 1NH6A 2GQAA 3VGGA 2GJXA 2XFRA 1THFD 3CASA 3KE0A 1M68A 1YIXA 1UC4A 4UTFA 4C90A 3GVVA 1TV5A 1XGZA 4D1IA 4HOWA 4IOTA 3WF4A 2X0HA 4M6QA 3EOLA 3H22A 1Z7AA 3ECQA 3ITXA 2Y88A 2X0YA 4GVIA 1JI1A 3SEPA 4PRRA 3PZNA 1EL3A 5CC7A 3KLKA 3EWCA 4IFOA 1I8JA 3OIXA 3MI3A 1KFKA 3WY1A 4M82A 4O12A 2OZTA 3IRDA 1JPDX 1R6WA 1ZENA 2DQWA 4DY1A 2C71A 1F73A 3H7RA 4UNLA 1TTJA 3SN0A 2FKPA 4B3ZA 2WMIB 2X40A 3W84A 3VOCA 1GYNA 1EHNA 4ZQPA 4A6GA 3V0UA 3AIVA 3KVJA 4GKTA 1VJZA 3LI0A 3KDOA 3HG2A 4JN8A 3QF0A 4HP5A 1WBJA 3NPXA 3QSTA 1YDOA 4GX9A 1W37A 5BMXA 1JCYA 3AS2A 1PHWA 1SZGA 3ZSSA 2OT0A 2VL4A 5HQMA 4KIEA 4C6QA 5LIYX 4M6UA 3AAMA 3S3GA 2DT2A 1H5YA 2OQHA 3PAOA 4QTGA 1D3HA 2VT0A 4W5UA 4ADSA 3PBGA 5F4SA 4E2DA 1IGWA 2GUUA 3IIPA 2Z1WA 5I3FA 2Y8KA 4LVAA 2WPBA 3BLFA 4JTIA 4WXZA 1W9VA 3R0KA 2DT0A 3KOWA 1H7RA 5I3DA 1GVRA 1S3TC 2QCGA 1WXJA 1VZWA 1XGDA 1Y0EA 1CIUA 3WN6A 4LX4A 2DIEA 1FUYA 3P0WA 3T55A 1X98A 8XIMA 1O5XA 4PTDA 5BNKA 4LUSB 4M6PA 2G95A 3EAUA 3FK4A 3WQFA 5MHBA 2HSAA 2ZE0A 3W4RA 1VBHA 4R33A 1SJDA 1FWCC 4PN2A 4V1YA 3TA9A 4KS0A 4ATDA 1EJUC 3ARTA 2W67A 3RM8A 4NJHA 1KD0A 4H8VA 3EWWA 4D6HA 4LV4A 4NKCA 2Q3RA 2WSKA 1WDSA 1IZJA 3A47A 1KFEA 1KKRA 1O60A 4GBDA 4JICA 3VKJA 4GYKA 4R7WA 1Q6EA 3UG4A 5G4WA 2PC8A 1TV3A 1F05A 2GQ9A 3S5SA 3NJ3A 4M7SA 3COTA 2AKZA 2JALA 1EC9A 2DSVA 3Q65A 3NL2A 2WO5A 4BF7A 3NYDA 2VRQA 2F2HA 2NV9A 3G0SA 2YCIX 4NRSA 3UY8A 4B4HA 1UR3M 4JQAA 2QJNA 1A4LA 4M56A 1P7TA 4PMXA 2WWDA 3FA5A 4LRTA 4NASA 4YCPA 3C6CA 1O4UA 3R25A 4LOCA 1X1NA 1SO5A 4MKNA 2HVMA 3VZZA 1K6AA 5K9CA 2QKFA 3QZEA 3HG4A 1GQNA 3HN3A 4NILA 1EGZA 2ZUUA 1U1HA 3C0LA 3ARVA 2V68A 3ZMRA 5HANA 4NX0A 3LD5A 2ISDA 3S1GA 4LXFA 2O9TA 4JN6A 1UWAA 3W85A 2HRWA 3ICJA 1QI4A 2QUUA 2CERA 2OX1A 2DEPA 4H1ZA 1NDZA 4HA1A 4E4UA 1K70A 2BHYA 4D6EA 3W73A 4FEZA 3KCOA 3N4EA 4HMDA 3F5KA 1X97A 3F2BA 2W79A 3VKDA 4Y9OA 1V51A 3W1TA 4PRTA 3AXHA 2JF7A 4UTJA 3WL1A 4B2DA 2X8RA 3R6IA 3WH8A 4DAIA 4F4RA 4RV3A 1CECA 1R3VA 2J13A 2NLIA 1SO6A 2C91A 4Z2HA 5BWAA 4A8RA 4LVDA 3LERA 5FKYA 1MW1A 1OT2A 4NXSA 1KR0A 3E2QA 3E96A 1OIMA 2JBMA 3MC5A 3L4YA 1EDQA 3MO7A 1DP0A 4JL2A 1UD6A 1EF3A 1ZCOA 3HPFA 1FQ0A 4JN7A 4Y9PA 1LRQA 3B0XA 4O8RA 4O1AA 1VBRA 4QE4A 1MW0A 3CEPA 5I24A 2A7PA 1VPYA 2ADAA 5CJNA 3B03A 1D8WA 4NVTA 3WUBA 3LX9A 5REQB 1QNPA 3U2CA 4GH3A 2DUXA 1KCZA 3AHTA 4LTSA 2RFGA 2FLIA 2YJQA 3SURA 1GZ1A 3OVRA 3LY0A 4J9JA 1PKNA 3BUVA 4PTMA 4H9MA 1FKWA 4MUPA 1O6IA 4S1FA 3P0XA 5E93A 3QPYA 4XWUA 4TX6A 3I6TA 3IJQA 3XISA 2INEA 4RX0A 1E1FA 1RBLA 3W23A 4KT2A 2UWFA 3VMNA 2YDAA 3RO6A 1Q6RA 3KVMA 3QEZA 1A3WA 3NEVA 1H5VA 3DCPA 1BQCA 2WPGA 2Y6ZA 5KZEA 3S9ZA 3UF9A 3N2OA 4GNVA 1CENA 1PBGA 1BFNA 9XIAA 4XB3A 3M46A 4GABA 3ELFA 3VMOA 4IMCA 3VDCA 2A0NA 2HMCA 2HTMA 1WPCA 4BZYA 1KWGA 4UBPC 1B30A 1KGUA 3N73A 5AY7A 2ODOA 3PJWA 1R3YA 1OFOA 1P0DA 3IACA 2QCDB 4GFSA 3TONA 3HZ3A 1WDWA 3WFZA 1NFPA 4UTHA 3R0DA 1V08A 4G7FA 6CGTA 5H1WA 4H00A 2E67A 3W86A 2CITA 4XZHA 2BV9A 4PMQA 1JGMA 2FTYA 3PUDA 1O12A 4W7VA 4J2MA 4Z42C 3UFYA 4BQ4A 3AYTA 4BEQA 1BKSA 1OHLA 5HNRA 1P0EA 4J3WA 1HJUA 3EX1A 5I3IA 1IF2A 1JAEA 3QMSA 1ZP4A 1YXYA 4O52A 2C6QA 1KFCA 3R2GA 4M80A 2GDQA 4LBUA 1L6SA 3ATZA 3GG1A 4XX6A 2JGQA 3AIWA 3KBNA 4LNYA 1XBVA 3DYPA 4YWIA 4GY7A 4ZBCA 2H6RA 3AIRA 2G3NA 4EXQA 5LNRA 1HKKA 3V75A 3S2MA 3PZUA 2CC0A 4ZOAA 2PODA 4TO8A 4PMRA 3GHSA 2AKMA 4J27A 3R5EA 1CZ1A 3TN4A 1VR6A 4WEVX 3ABOA 4A3RA 5A2CA 2DGAA 3B05A 3W7MA 3CC1A 2R1MA 4LBRA 2FQIA 5LIXX 1SZRA 1TPH1 1S2AA 1MI3A 4WY0A 4M6VA 4D6JA 1E5JA 5CSUA 3VNDA 4O1CA 4GJIA 4A29A 3TLQA 1AK5A 4GMEA 4MYAA 3UGRA 2V5BA 2HE8A 1X1ZA 1HFBA 1NARA 5A1AA 4V33A 3W7EA 4AMAA 4BJHA 3FDGA 4JY9A 2F84A 1MZRA 1XSKA 4Z2LA 1XYZA 3P6LA 2WLZA 3BCJA 3BW3A 3TYDA 1HKIA 4C6PA 3N18A 2JGYA 1EUNA 3EX3A 2CW6A 2ZX9A 2X16A 5LKYA 3QC3A 1UD8A 5F4WA 2WVSA 4W8BA 5GNXA 1P0BA 2HV5A 3FXGA 2Y4SA 5EYWA 3NZ1A 2C0AA 2E77A 2XHYA 4W7WA 2GJLA 3F7JA 1LBFA 2OZ8A 4LVGA 2P8CA 2EPLX 1ECQA 4Q22A 4OFCA 1IEWA 3LPFA 4O8AA 1R7OA 4QCFA 4POCA 1XSIA 5A6MA 3EKZA 4DX3A 2YXXA 3SECA 1IWPA 3NQFA 1HL8A 3BAXA 2CYGA 3GR7A 3BLPX 3SY1A 1QOPA 3K4WA 2DT1A 1ME9A 1EO7A 1RBOB 1UB3A 1H7XA 2PWDA 4PEEA 2VGIA 3JS3A 1NFGA 4JNYA 3SRDA 4DI8A 4D6FA 3M0LA 4AXKA 3OJGA 2ZUSA 3CAVA 3DENA 3BSMA 4W85A 4YU1A 2REQA 2P3ZA 1YPIA 3N14A 4G6CA 1AMKA 3E6EA 1E0WA 2V2CA 1GHSA 3GDRA 2CHNA 3BV7A 3AIUA 2W3ZA 5C9RA 2J8FA 2CKSA 1W8GA 3S83A 1IHIA 5LGZA 5SWUA 3S9YA 2D24A 4JTKA 3ES7A 3UR7A 1FDJA 1B3XA 4V28A 2P53A 2PDGA 3WLKX 1DJZA 3CWNA 4GNKB 1TV8A 3D47A 4JD4A 1NWSA 2V38A 5DMLA 2ICSA 1R87A 3IV8A 4IIFA 3NQ7A 1LG1A 4DF2A 3FHAA 4MKSA 1XDLA 4D8LA 3VDHA 1XX1A 5FOOA 3UXKA 2VHLA 4YNGA 3MMWA 3PG8A 5M1TA 3O9NA 1TVNA 3KOXA 2P0IA 3G1HA 4OUEA 4PEKA 2IKHA 3FVMA 1MUCA 4C6CA 2TAAA 4LYRA 3TSBA 1LT7A 3SRKA 4O1BA 2OB3A 2OT1A 4GO8A 4AD0A 4NIRA 5EPDA 4K39A 3AHYA 4QROA 1PIFA 4A05A 4J3SA 3QY7A 4CQ9A 3QBUA 1SVDA 3BG5A 4IFKB 5A2AA 3LGGA 3RF9A 2PD5A 1E4MM 3DYOA 3EWYA 2GUYA 3DKJA 2BG5A 5C9UA 4NX5A 3O8AA 5FJJA 4HIBA 1C92A 5A6KA 4O11A 5I00A 2QGHA 5LNSA 2VDIA 3LK6A 3S2NA 1UKOA 3CTTA 5ECUA 1TR1A 1YMYA 4IFRA 1UKQA 1OCNA 4C60A 2J79A 2G3IA 3L12A 2XH7A 3FAWA 3GHRA 3CQHA 5DLCA 4LUSA 4Q33A 2PLMA 1FP8A 1E5NA 1KTCA 3AZRA 1E4NA 3L68A 3UPMA 1G7UA 3O16A 4WD0A 3BG3A 4WKHA 5JVLA 3BWWA 5IBXC 2OVLA 2YCEA 3URNA 1C3FA 1O68A 5CC5A 2YBUA 3W81A 1FH9A 1S5MA 5FD0A 3VAVA 4DBSA 1N2VA 4TTGA 1GVOA 4W8AA 3B8DA 4OTKA 3RLHA 4ML4A 3DGRA 1H09A 3DFNA 2GSHA 1Q3NA 2YW3A 1GONA 2J6XA 2Z6IA 2Z6JA 1XCXA 4QLKA 3DERA 3E0LA 4GH1A 3K8LA 3FA3A 2G3MA 2WV8A 3MJYA 4X61A 1O5QA 1WQ5A 3PC0A 4ZB0A 3S1WA 1DBTA 1BYDA 3W38A 3SJ3A 1QW8A 5I78A 3PWAA 1A50A 1W9DM 2A2IA 1M5WA 3AALA 4JTFA 1XIBA 4FX7A 4XSMA 5A6SA 3W1AA 1GVQA 3KLLA 3OTRA 4C7GA 4GZEA 2AQWA 5A8GA 4WKAA 1FOBA 3WF0A 1OADA 3P14A 1F4HA 3C0QA 3TEVA 1XYMA 3SCVA 3WMCA 1EXBA 3TJIA 4Y90A 2BX7A 4DBWA 4A22A 3VZYA 4E5TA 1FFQA 4LH8A 3KL5A 4I9JA 4JQ2A 2OLAA 3FY1A 3VC5A 2HBXA 3RO8A 2VMFA 4A2SA 2E6DA 4LB3A 3STPA 2A6LA 1NWUA 1GYLA 1UUOA 3MP4A 2BY0A 2QJJA 3VI2A 1NOWA 1DXFA 2VVNA 3QV8A 3U8GA 4Q8NA 3KS5A 4B5WA 3AMDA 4IF2A 3S4TA 2Z0IA 2EXOA 3UYIA 1LUCA 3S6TA 1BWLA 3QV9A 2AOSA 3NSMA 2WSPA 5HPOA 3GKAA 1QNQA 2GVYA 1OGBA 1TB3A 3CV2A 4MSSA 1G4TA 2W6RA 4GUGA 5AYBA 3UA3A 1QW7A 2PP3A 3TCSA 1PTGA 3ZR6A 3CYJA 3VYLA 2YDQA 5D2VA 5B7YA 2Z00A 3T7VA 3LRLA 4X0VA 4B9ZA 4H01A 4PTWA 4WJEA 1V0MA 4YWSA 4LAKA 3U5UA 3BSGA 3MPGA 1UH3A 2PWGA 3MCMA 1AD1A 1X6LA 4QISA 4S3AA 3UYCA 1BRLA 4FX8A 3HB9A 3POHA 4XKYA 4I6VA 1PV8A 1VFOA 1M1BA 2Z1BA 4ZE5A 5GNZA 3W07A 4NG3A 3AI0A 2CCRA 4ROPA 4RXFA 4M24A 3TLLA 4N9BA 4J3TA 3AHZA 3E38A 2Q8ZA 4KWOA 4QG9A 4UMAA 4AY8A 4KW2A 4XD5A 1KFBA 1E6XM 4W9TA 4JTGA 4K8GA 5XINA 4LEQA 3WJWA 4Y6GA 1IYXA 3M47A 1H1ZA 3PPGA 1FWRA 2WVVB 1B3ZA 2P1FA 3C2FA 5CG7A 5LNUA 5BRQA 4QDPA 1Q63A 2YL9A 5AOUA 3CNYA 2VOMA 1V0KA 3VU2A 3C8FA 3DX5A 1NFBA 1LLZA 1GVYA 1J5SA 4O17A 1C8QA 1O7AA 1JXJA 2ZZ2A 2MANA 1KRMA 2DJLA 3XINA 3MI6A 1XL9A 1A4MA 3O6AA 4AC1X 4C6EA 1JPHA 1TCMA 3GX9A 4WGXA 1E55A 4BF9A 2Y24A 4HJFA 1BPLB 1SU5A 1M7XA 5CGTA 2FTWA 3U7BA 3T2OA 4S3CA 1O5KA 3ITVA 3KRSA 4GA8A 1ME7A 3CUGA 2VCBA 4R5EA 4RXGA 1YTEA 7ODCA 1CLVA 4DWSC 4LUJA 3SUVA 3GIPA 3CMGA 5AYYA 1BGAA 1S5TA 1K7XA 1UR2A 2YGYA 1UROA 3D3AA 4F0KA 3W6YA 2PRLA 4ZQOA 2PWVA 5L9FA 1XQKA 2VVSA 2HNHA 5LIUX 3CB8A 3MHGA 1W1B1 5KINA 5BYWA 3MJMA 2D22A 1C9WA 1EJTC 1GJPA 3CL6A 1E71M 1ISWA 1KBJA 1J0JA 1ENUA 1QNRA 2JEQA 1EJRC 2WNNA 4A8LA 2IW0A 1TPVA 3VOIA 2YLAA 3BVJA 1GPWA 1P6CA 3T4WA 4K1GA 4QBXA 2INFA 3NL3A 4MWAC 4NRRA 1UR0A 3U6WA 1JJKA 4M29A 3K30A 3GAYA 3NSXA 5L6UA 4UQCA 3PTKA 5CEWA 3RK8A 2PI6A 1V77A 3OVQA 3UWVA 2C18A 4DZAA 3PZOA 2WSRA 3R94A 3TNOA 4D71A 3PUGA 4H9TA 3BW4A 2X42A 2ESCA 4UQDA 4KGJA 3RM4A 1I2RA 4Q4RA 1LRTA 3P80A 3QW3A 2YXGA 2PWUA 3WJSA 3I4EA 1QVBA 1MXGA 2WM1A 5HATA 4O4WA 2WJZA 1LRNA 1S1RA 1NF7A 1VRDA 4EX4A 1XLDA 3WFAA 1AJ0A 2P88A 1EA9C 5HMEA 2OZ3A 1W56A 1H2JA 3TFCA 1WXYA 1GVIA 3EB3A 3K1DA 4NQ1A 3T2QA 4LT9A 2E0PA 4L65A 2QXWA 2PRMA 2QMJA 4ERAA 1T96A 1UP0A 3QOKA 2WHMA 5HNNA 9RUBA 2QDHA 4C6BA 3H12A 1IE7C 3CUJA 3NQAA 2H9AA 4I6KA 1O66A 3RNDA 2XVKA 1J2WA 2DH3A 2YZ5A 5D8ZA 4MGGA 1VFLA 1E43A 5AVNA 2PFHA 4GIAA 4UTMA 1UZDA 2V5DA 1FCQA 4C6LA 2EPNA 4UC5A 3UZJA 2AQVA 4HNNA 4YVVA 2CLIA 4P8XA 3OW1A 4XO7A 2V5JA 1SJBA 1B3YA 4RDYA 4AVFA 4R53A 1WOBA 2F9RA 4CN4A 1DE5A 4W89A 4MVAA 3UPBA 2FVLA 4PODA 2XGIA 2CLLA 4DJDC 3W1QA 3B40A 5HMDA 1WB0A 3QHOA 1QO5A 3U57A 1H7WA 4N9CA 5C70A 2Y0FA 4PBFA 1UOZA 4YPJA 2ZRUA 4FSAA 4KPLA 1TREA 1FRBA 3U7VA 1SZEA 3B4UA 4QX4A 2WHJA 1KBBA 1LWJA 4IP7A 4Q6JA 3BW2A 3VTRA 4RNIA 3P81A 2RHGA 1RQEA 3GC2A 3TYZA 4WUIA 3QZ6A 3NDYA 3RLGA 2J88A 4XD6A 1VBGA 4MNMA 3P93A 2ZX8A 1A5KC 1PJ9A 3ITYA 2WVTA 5EA9A 1GZJA 1OZMA 1A5LC 4XKYB 2ZZ4A 4H3DA 4H8UA 2VX5A 4F9DA 1TJPA 3JU2A 4LUYA 4S23A 5B80A 1K8ZA 3GYCA 5A69A 5CGMA 4OZOA 3WNKA 4OWGA 3GXDA 1B9BA 3S6OA 2VD9A 7A3HA 5HDRA 3GXIA 3WUEA 4HK5A 1YE4A 2BGQA 2XPKA 2NVDA 1EP2A 2V0TA 2IPJA 3NO3A 3CV6A 2TYSA 3J7HA 3W1LA 1P7TB 4S3DA 4HPXA 5DY2A 4QITA 3AQUA 5BMWA 1RVGA 2BP1A 2FZDA 1OWQA 5ABTA 2YA1A 2A3CA 1YNYA 4EP8C 5EMKA 2XH4A 4KCVA 5A95A 1H0IA 3ITGA 3RX2A 3LV5A 2A85A 4V15A 1CLXA 3TN5A 4O14A 4Q7NA 4FIRA 3STFA 1VLIA 3EWZA 4IH3A 4ASTA 3W29A 3BOFA 2FB2A 3B9AA 2QCDA 2QCHA 1KXVA 3PTDA 3FEQA 2XM1A 1OK6A 3HPAA 2HXTA 3CQKA 4N6FA 4LC8A 2ACSA 4XZ9A 4ERIA 4MLRA 5JU6A 1E6ZA 2NX3A 2CXEA 4J3XA 3PWIA 2ZZ7A 4QNEA 4YHEA 4CNOA 3GY1A 4ZOEA 5AYXA 4DM1A 5A3HA 4ERGA 1RVKA 3EWDA 2ZRYA 3PTMA 3GTFA 5DBTA 3TVAA 4NZFA 2KX9A 2XGBA 5E0KA 1IXQA 2Z2AA 5HNTA 1QK2A 2I16A 4CN6A 3UA4A 2WJDA 5E9AA 2R1LA 3E0WA 2FFIA 4KCTA 5A6LA 1QRQA 2GLKA 1O5RA 3B3DA 4QLLA 5G2IA 3RLUA 5A6BA 2ZZ5A 3UWWA 4Z17A 3PVFA 5D4YA 1RR2A 5CBIA 3V35A 3M4HA 3HG5A 1JNEA 1CXIA 2GJPA 3B0YA 4D8AA 2UBPC 5CBBA 3OBKA 3USZA 2J77A 5AHFA 4X9YA 3W1PA 2CZ5A 3EYPA 4ZENA 1GVEA 1OFRA 5D02A 3GIYA 4CNSA 4HN4A 4E0CA 1LORA 2P8BA 1SZFA 5BXRA 3ZVHB 3RUBL 3HQNA 2XWDA 3AROA 1L6GA 3VGDA 2H3BA 4XZMX 1LP6A 4OBRA 1BKHA 1IQ8A 4AWEA 5LXXA 4YLWA 1GGOA 1R85A 2XFFA 1GEQA 5CSSA 2ZX7A 3SCRA 1WOAA 3CHEA 2Z1SA 3MUXA 3P84A 3RCNA 5DX7A 4Q8UA 1WP6A 4AUBA 2LLEA 2I5GA 4WR3A 1BF6A 1PTDA 2O9RA 3SO7A 1E0VA 4X2RA 1T8QA 3HGOA 4LAZA 4FB7A 2CNCA 2CLPA 2J8TA 1HZYA 4GIYA 4OECA 2HK1A 3H2EA 2NWSA 1QXLA 3T8QA 1YRRA 2O56A 4F79A 3EPMA 4WGHA 3KFTA 1M41A 1LZOA 4J35A 4D1JA 4QQUA 3S1XA 3NQBA 1OX5A 3KBMA 4JQ3A 4JHZA 1Q5MA 1JCXA 4W86A 1K9DA 2QUMA 2E9BA 2G8ZA 1VFTA 5CZKA 8A3HA 3GDTA 1UQZA 3TC6A 2I9UA 3THAA 3N2MA 2ON3A 4DJFA 3AISA 2AAMA 1V6UA 3DYMA 1SJCA 4IX2A 1OK4A 4ZO7A 4FO4A 2OYMA 1ZBCA 1U5VA 3IWPA 3DGBA 4F2TA 4GD0A 3ARYA 4Q8TA 4TUFA 3E5BA 4I5RA 3WF1A 4FIQA 3G6LA 2QCMA 4CGTA 3CPRA 4W87A 3E3HA 2QDGA 1E4LA 4HSOA 2H8ZA 1OFEA 2ZRXA 3BSHA 1HO4A 1JYXA 1W3IA 3W00A 1CX9A 3TJXA 2CLOA 1TELA 1H51A 3W22A 3PWGA 3PY2A 3UXIA 3O2LA 2OPJA 2YIHA 4UFKA 5D32A 5D2TA 1Q45A 2E8YA 3CUIA 5D2YA 3C3UA 1YLVA 3TW9A 4H04A 3KWXA 3EMZA 2VR2A 1F5ZA 4B5UA 5KITA 5FJPA 1T99A 1TWSA 1XWYA 3TJ4A 3LHVA 1KKOA 4L6DA 3DI1A 3IGSA 3BK0A 5H8PA 4Y9NA 3EXSA 4V27A 4XBKA 5HJYA 2DIKA 1ZPTA 4MPKA 3DOPA 1XUUA 1IZKA 1QCWA 1S2UA 4REQB 1FHDA 3B97A 3B0PA 5IFTA 1EJ7L 1OVDA 1POKA 2R91A 1BTCA 3G1VA 5C7VA 3SGGA 3PK7A 3HG3A 2PCEA 5DMYA 2DZXA 4RNJA 3OHMB 1UUMA 3SJNA 3KCLA 3WQDA 7TAAA 2PDKA 5AHEA 1VAHA 3OO2A 5C9WA 1QHPA 4JL1A 4ZSTA 3UCQA 5CJ5A 3TK7A 4W5ZA 1OX4A 3DESA 2W92A 3QOMA 2RUSA 2ZXQA 4GC4A 5FA5A 3LG3A 4AIUA 3S6DA 4Z1AA 1KQZA 1ZBVA 1LT8A 5G1YA 4JX6A 4XV0A 3HJZA 3V0SA 4LSBA 1NWTA 3N17A 3Q58A 2HROA 3P3BA 1TQJA 1P4CA 3TE9A 4HNOA 2JF6A 3V5OA 1QPOA 2FJKA 4KF1A 3TMQA 3QHMA 6XIMA 2VKZG 5BOFA 2EO7A 1E3XA 2J6VA 3CXOA 1VEMA 2R9RA 1ML1A 1A47A 1GJWA 1HKVA 1ONWA 4ZODA 3AO0A 2NSOA 3LCFA 4FF5A 4HNUA 1Q6CA 1EEXA 4CQDA 1WO2A 1Y7VA 4C1LA 3UCCA 3LCHA 3RPDA 3OG3A 1K7FA 3WDQA 4BR1A 2PEVA 2GFTA 3WQVA 3MU7A 2AGTA 3NUKA 3AZSA 4PTVA 2ATMA 4Q4PA 4PB3A 4N0RA 1YXDA 3LB0A 1LF1A 1C91A 4AH7A 4DO6A 4GCXA 1ZAHA 5BU6A 3TTEA 2NUXA 3IRSA 1WAUA 1DJQA 5CPTA 4ML9A 4Q7IA 3GS6A 1FWWA 1FWHC 3SM0A 3STEA 4CD7A 3C61A 3GW3A 5I09A 3VNJA 1QPNA 2DVTA 5HULA 4FXFA 4TIMA 3AYRA 1FDZA 3E02A 2PWHA 1UPPA 5JH1A 4HT3A 4GISA 5I6SA 3AWOA 4IGHA 2RGMA 2NQ9A 1KBLA 2ZUTA 2YSWA 1HP5A 2VC6A 1OYAA 1WCGA 3LU2A 1E6QM 5AHLA 1P0NA 4JX4A 1EHAA 2EPHA 1VJIA 1XLEA 2FZBA 1I2QA 2A3HA 4WSJA 3HF3A 3HPXA 2YL8A 4BCEA 1S1PA 1JZ6A 1JDDA 1B4KA 1TIMA 1K77A 1L9WA 3I7RA 2XG9A 2FHBA 3BLKA 3SCSA 1AZ1A 2VCCA 1KM0A 2B7NA 5TBOA 1VEOA 5CPNA 3BLIA 5T9CE 3CHDA 3FN9A 5EMMA 3VD9A 3R0UA 1CTNA 2CZFA 3MBFA 1NY1A 3LPPA 3MV11 4Z2GA 4DB7A 3GFZA 2XDFA 3GDMA 2TRSA 3KX6A 2QAPA 3EKGA 3LBCA 1SFSA 3M6YA 1Q6LA 5IXEA 1Z44A 1TVPA 1VC4A 3WUFA 1CB2A 4U5KA 4GACA 1MNSA 1XG3A 3BV4A 3W7LA 3GU2A 4JXCA 3CIWA 4PSPA 4XAZA 5F7UA 3RRAA 3B0VC 4OGZA 3WIJA 1RBAA 3OLDA 1PX3A 1Q4NX 2GOKA 3INPA 3NQ8A 5JBFA 2QDDA 1BG9A 4JIQA 3EMCA 2NSXA 3H53A 4JIEA 3LHTA 1UMLA 5G4EA 4JBRA 1RAKA 4IGSA 1BGGA 3FLUA 3VOJA 3AYSA 5HWJA 5ABFA 3QQ1A 2OCZA 3C2OA 3WELA 3LYEA 5JXQA 2VGFA 2ZUMA 5EKYA 5JQ9A 3HMJG 1K9TA 2Z7GA 4QHRA 3BL3A 4GXWA 5G4HC 5I03A 5E0CA 1E1CA 1SJAA 1Q6GA 4O0QA 2OSYA 5C8BB 1F07A 1KQYA 2GJXB 4J7RA 3WNMA 3NZQA 1TRIA 2VX6A 1TFVA 4C6MA 3TZNA 1FBAA 2E1DA 3RJYA 3KBWA 3FJ4A 2C15A 2ZWZA 3C0SA 2XVLA 2VFGA 3NQCA 1DWJM 1KXTA 5DXXA 3F2CA 1CI1A 4R34A 2WNWA 2XSXA 5FSDC 3OP2A 4CN1A 4GIRA 4NU7A 4NZ3A 1ONRA 3V36A 3GO2A 2O4QA 1TZZA 4EPBC 3H4WA 4GZJA 1GOKA 2MUCA 1ZRQA 4HHLA 1JZ5A 1MW3A 3K8MA 4LAOA 4OIFA 3CHCA 3G1YA 3T42A 1FX6A 3GKFA 2OXNA 2Z1VA 3BAKA 3WDIA 3KTCA 4BHYA 2Z1KA 1RZMA 1DWFM 2QNEA 2B31A 2ZADA 1PHQA 1AVAA 2EJAA 1FA2A 1VPXA 2ZTKA 2EG7A 3FJLA 1US3A 3EWBX 3BGJA 1MQRA 2WZTA 4AIOA 1R47A 5CC6A 2Y7EA 1AQHA 1GW1A 1VLWA 3QN3A 2OLSA 1KR1A 2DSUA 4AD5A 1VCFA 1XUZA 3I4KA 3C56A 1QPKA 1OFDA 3NVDA 4S3KA 1G9HA 4MNLA 2YLLA 4CU8A 1DWAM 4RL3A 1M65A 3HM7A 4GY0A 5FEXA 1WUFA 3OQ8A 3R8HA 4PC8A 2VGGA 4F48A 4YHGA 1LUCB 3P5ZA 2EEXA 3MDWA 4IQLA 3MUIA 3PPHA 2QVHA 1PWMA 1WA3A 1XLHA 1W5OA 1RCOB 2J8GA 5AC8A 1EX5A 3KWSA 1TMHA 1H60A 4L56A 4IL2A 3WKZA 2PDWA 1UCWA 1PWLA 4MADA 1G5AA 1QPRA 3RJXA 3NPWA 2OEMA 3S2CA 2WC7A 3TJLA 1SW3A 1WDDA 3VIIA 4B5XA 1W1VA 3V16A 3NZRA 1CXEA 3LXAA 1EGMA 4HGXA 2AQOA 5BRPA 2I17A 3GXMA 1UWTA 1QBAA 4PULA 2DZAA 3CH0A 2Y62A 3O0KA 3DFTA 1W3JA 3SAZA 1Q85A 1MWOA 1H61A 4DLFA 5C0QA 1EJXC 1XCFA 4M5PA 5F2MA 3R11A 2GL5A 4OV4A 2C16A 2G37A 3BMXA 1FHVA 3G5EA 4J4KA 4A21A 3AMKA 1KGXA 1JNDA 2PTZA 2A3AA 4IMAA 3SDOA 3VCNA 5HINA 4PCSA 3NURA 1M7JA 1OGSA 4AFYA 3N6JA 1B3WA 1P6WA 3URAA 2XFWA 3W02A 1AW5A 4HOZA 5BZAA 1UR1A 2HBVA 2PWEA 3T05A 3SW6A 1JZ4A 2PB1A 2RGLA 3T07A 4EKJA 3KS6A 5FJTA 2EPOA 2BOGX 3ARWA 1EWEA 1OC5A 4YIWA 3A21A 4GJJA 4N9DA 2D69A 5EGRA 1Q6OA 1MRAA 3R8RA 1DEDA 2DH2A 4HZ7A 4DLMA 2OSXA 3DAQA 3H2NA 1H11A 1JYVA 1OJXA 3O7UA 4D2JA 2Y89A 4NT0A 5HQLA 3NL6A 3L4XA 3R8GA 4TVUA 2CLMA