4XO6A

Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3 alpha-hydroxysteroid dehydrogenase type 3: structural clues of 5 alpha-DHT reverse binding and enzyme down-regulation decreasing MCF7 cell growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 116
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xo6A00
2CLPA 1AH4A 3V0UA 1M9HA 3O0KA 4G5DA 3LENA 2DV0A 3ERPA 4JTDA 3H7RA 4XZNX 3GHSA 2ALRA 3UFYA 2ACUA 4FALA 5JH1A 4L1XA 2FZ8A 2IKHA 4YU1A 1Q13A 3FJNA 4FA3A 1ZGDA 1US0A 3MC5A 2BGSA 1PZ1A 4H8NA 4XVDA 3WBYA 2BGQA 2IS7A 3COTA 1RALA 4GQGA 1VP5A 1X97A 2A79A 4WDUA 4EXBA 3EAUA 3RX4A 3LZ3A 1ZSXA 1XF0A 3S3GA 4R9OA 2IPJA 5LIKX 1ZUAX 4JTCA 2IQDA 4QR6A 1HQTA 2FGBA 1X98A 5C7HA 3NTYA 1YE6A 3GHRA 2FVLA 3DN5A 1QWKA 4FZIA 2PDYA 1ADSA 1RY0A 1JEZA 1MZRA 1EL3A 3M64A 3RX3A 3MB9A 3B3DA 1J96A 3UWEA 2IKGA 1EF3A 4PUWA 3EB4A 4GCAA 2PEVA 4XZMX 3UG8A 2DUXA 4JTRA 3O3RA 4GIEA 3CV7A 2F2KA 5AZ1A 2PDKA 1SM9A 1YNQA 4YVVA 4LAUA 3U2CA 1MI3A 1Q5MA 2ACRA 4MHBA 4LAZA 2WZMA 4I5XA 1HW6A 2QXWA 2INZA 3R6IA 4JQ4A 2HVNA 4ASTA 2AGTA 4JQAA 1AZ1A 2PF8A 4JIRA 2PDNA 1AH0A 1IEIA 1A80A 4EXAA 1S1RA 3R94A 4DBWA 4L1WA 3LQGA 3LNMA 1FRBA 1Z9AA 3LBOA 2PDFA 4XO6A 4IJCA 2PDHA 3H4GA 1S2CA 1PWLA 2C91A 3M0IA 1T40A 3V36A 4JIIX 4ZFCA 2ISFA 3LZ5A 3GUGA 4Q3MA 4QXIA 3UP8A 4JQ1A 2FZBA 4JQ3A 3WBWA 3UZZA 2NVCA 3EB3A 4XZHA 3BCJA 1IHIA 5LIYX 4DBUA 4HMNA 4LBSA 4YVXA 4WDTA 4XAPA 1PWMA 1YE4A 4IGSA 4WGHA 3CMFA 2HDJA 2IKIA 2IKJA 2IPWA 1LQAA 3Q65A 5DANA 2R24A 3BUVA 2I17A 2PDXA 2PDWA 1GVEA 3UZYA 3BURA 5LIWX 2F38A 3CV6A 3N6QA 4YS1A 3UYIA 3VXGA 3V0SA 2PDGA 4GACA 5KETA 2FZDA 4Q7BA 4DBSA 1X96A 3UGRA 3Q67A 3F7JA 2PD5A 3BV7A 3V35A 2PDIA 2PDLA 1Z8AA 4XO7A 4H7CA 1ZQ5A 3CAVA 4GA8A 2IPFA 4WRHA 4F40A 3RX2A 3CAQA 4FAMA 3QKZA 1PYFA 4PUUA 4WDWA 3UZXA 3WBXA 4QBXA 5JH2A 4JTAA 4JTQA 4DZ5A 2ACQA 3R58A 4JQ2A 3LUTA 4XK2A 3G5EA 4WEVX 2IPGA 1K8CA 4PMJA 4LB3A 3FX4A 3H7UA 2IQ0A 4GQ0A 2PDMA 3LEPA 4OTKA 4QX4A 4XZIA 4GABA 3R43A 1VBJA 2HE5A 2P5NA 2PD9A 2FZ9A 4YVPA 3CASA 3GHTA 3GHUA 4XZLX 3G1RA 2PDUA 3P2VA 4XVEA 4HBKA 4ICCX 2PDQA 2DUZA 1Z89A 4IJRA 1OG6A 1XGDA 1AH3A 2PDPA 4JIHA 4NKCA 1QRQA 1RY8A 2PZNA 5AZ0A 5HA7A 2PDBA 2VDGA 4AUBA 2HVOA 2PFHA 2HV5A 3WG6A 3D3FA 1S1PA 3ONBA 4LB4A 5LIXX 1EKOA 4WDXA 3ONCA 2ACSA 5LIUX 2WZTA 4PRTA 3V0TA 3KRBA 2NVDA 4LBRA 3C3UA 2INEA 1T41A 1PZ0A 5HNTA 2R9RA 1XJBA 1S2AA 5M2FX 3R8GA 5HNUA 3LN3A 3DOPA 3LQLA 1EXBA 1C9WA 2PDJA 3LD5A 4PRRA 1LWIA 4PR4A 3M4HA 2PDCA 1MRQA 2HEJA 1Z3NA 3UZWA 1AFSA 2HE8A 1YNPA 3WCZA 3N2TA 2J8TA 1UR3M 2BP1A 3R7MA 4RPQA 1R38A 2I16A 3R8HA 3T42A 1AZ2A
chains in the Genus database with same CATH superfamily
4WUIA 2DVXA 2YDAA 1DWIM 3P0XA 4DX3A 5FL1A 2OTDA 1WCGA 4TTUA 2CFFA 4WKAA 3ZR4A 1ZP4A 1C8YA 5AVNA 4HNUA 5T26A 4DJDA 1VRXA 4QITA 3GO2A 3ZWSA 2PP3A 4E8DA 2GUBA 5I3DA 4O16A 3FJNA 5BZAA 2CLIA 2BDQA 3COTA 6XIMA 3MUZ1 3TLLA 2DSVA 3L2MA 4RKAA 4FIRA 2A79A 1EC7A 4XQ6A 1ICQA 1JG9A 2IXVA 3URQA 1H41A 3GXTA 4UR8A 2QJHA 3P62A 1UD4A 5DQPA 2Y5JA 1I0BA 5C7HA 1UD8A 4AXKA 4RXGA 2CBVA 3TAKA 5HATA 1PXGA 3HGJA 3VGGA 5D9PA 1S2VA 1QFEA 3WDIA 4WD0A 2AKZA 3RO6A 3VOIA 1JD9A 3CB3A 3MW7A 3AU6A 4W87A 3CH0A 4PL2A 4E2VA 3U7BA 4YJ5A 3AXXA 1HO4A 4MJ4A 4PUJA 3SO7A 2IKGA 3E2SA 2FYMA 1QWGA 2E68A 1GONA 5G5IA 1I45A 1R6WA 4Q4SA 4W7UA 4NI8A 1UP0A 1M03A 3FOKA 3WQVA 2UZ9A 3UPMA 1LF1A 2XTKA 3GFZA 4QG9A 2PAJA 4FR1A 1IXOA 4GIEA 2CNCA 3G8EA 4FNQA 4TQTA 5I23A 2OJPA 3A5FA 1OCNA 4P7OA 1EJWC 1NF0A 3FSTA 4NZCA 4JQ4A 2BHZA 2PGRA 3UJ2A 4HCDA 3ZM8A 4UTWA 1BSIA 3IANA 2YFOA 1RA0A 5EU9A 1JNEA 1S5NA 3S6DA 4H9XA 5IBXC 3M5YA 3TP4A 2G4JA 2VD9A 3GAKA 4LYPA 4K7VA 1RK6A 1IF2A 4AD2A 5LNVA 1OT1A 4RXFA 3FK4A 1B1YA 3UXDA 5CH9A 1H11A 4PMRA 3NEVA 2OOGA 1XDMA 2VRQA 1S2CA 3ITOA 3D5HA 1XIMA 3IJ7A 1AK5A 5C9UA 4LU0A 2Q3OA 3C0SA 4GISA 3AU2A 1FWTA 4GXPA 3C3NA 1MEWA 3RPMA 3LU2A 4LVBA 2JF7A 3BLKA 3T09A 3LPOA 3DFYA 3HURA 3PB2A 1DTUA 3DHDA 2EG6A 3W1LA 4US5A 2V5JA 3L66A 3DFPA 2Y7GA 2D23A 3REQB 1LOLA 2BB0A 2XZ7A 3MY9A 1IIGA 3BOXA 3G8RA 4HTBA 4IMAA 4AD4A 1GQNA 3ISIX 1DXFA 3WQEA 1WOAA 4U10A 1DWFM 1XX1A 2I17A 1XLBA 4K68A 2PDWA 1UUQA 2BHYA 1I2OA 3VABA 3LBMA 3W23A 5HR7A 3WNPA 3DKJA 4LV4A 3ARVA 4JY8A 1Y8BA 3W7JA 1XUZA 2XIBA 3S5YA 1CXIA 3N14A 1GEHA 3OVQA 4K36A 1M04A 3EOLA 4H8VA 4JKMA 2YPIA 5LSMA 3CZJA 2Y7DA 3FS2A 1VJIA 3OBAA 5A1AA 4DEFA 5M1TA 4JCLA 1JAEA 1DBTA 1J4EA 3H2EA 2CITA 1UP2A 1TR9A 1W1B1 1Z42A 2X7WA 2XH4A 5I5RA 4QEEA 3T78A 4NP7A 1D7KA 3GH5A 3SY8A 2XN0A 5CAHA 3HQNA 2PLKA 5CPMA 3PTDA 3C8FA 3GDBA 5FIPA 4KCTA 1KGUA 3LY0A 3IUDA 4L65A 1JCYA 3TW6A 3SECA 1GOKA 3AS3A 1UC5A 2GJNA 3BW4A 3R43A 1FKWA 2ZBTA 4KIRA 3WSUA 4I6KA 4DF0A 1RAKA 1A5MC 4FXRA 4EPKA 4BQ4A 2P3ZA 4GBUA 2KAUC 4IJRA 1U83A 2FZNA 2RHGA 5HUOA 2X7VA 1O1ZA 4GKLA 4AAJA 4MNLA 2J7BA 3TFXA 3U2OA 3GW3A 1E51A 4O1DA 3TQVA 2ACSA 4L5ZA 1O5RA 3GIYA 4A4AA 4GQRA 3VNYA 4MNMA 1V4YA 4H6RA 4HNLA 3IJLA 4KW2A 3ZVHA 4LBUA 1RP9A 4BQ5A 1AODA 4I5RA 4CKQA 1NEYA 3GNNA 3L5LA 4MB5A 2GK1A 1KB3A 4PTMA 4QDPA 1OM0A 3EOSA 3OZMA 2OVLA 4PRRA 1LWIA 3WH8A 1UUMA 2PA6A 3H12A 2VYOA 2G3NA 4GY0A 3W7RA 4GCXA 3CO8A 5HJYA 3CZLA 1RUSA 4O1BA 4O1EA 1VS1A 3ALGA 1TPUA 2I1OA 1UYQA 3WUFA 4UWMA 4P7QA 3BLPX 1A4MA 3QTPA 2R94A 5EMJA 1N82A 1XKJA 1OK6A 3CPUA 2NUXA 2WZEA 4CQ9A 1QUMA 2A0NA 3GHSA 1OEPA 2W79A 2E3ZA 3W4RA 4HSNA 1G94A 1L6SA 4J3XA 1YTEA 3P67A 5HJLA 3P80A 4DAIA 4ML9A 4Z08A 5A6MA 1XH2A 4X2RA 5CXPA 4LUJA 1PL9A 4LAOA 1P1XA 3QF0A 3DEQA 1W37A 1A3WA 3AJXA 4BK9A 4UFHA 4A3UA 3FEMA 1TCMA 4IPPA 3H7VA 2WVVB 1CXLA 3N17A 3W2NA 3SRFA 3AS0A 3ZR5A 4GI9A 2HZGA 2QJMA 3WD2A 3AZSA 3EX2A 4A05A 1TR1A 9RUBA 3SAZA 4FF7A 5GJPA 4JTSA 1XBZA 3R5EA 5LNRA 3WQ5A 3N2CA 3RXZA 5I3HA 2VCCA 4GNKB 1GOMA 3WLJA 4LV9A 3NR0A 2ICSA 3VZYA 1AG1O 2A3EA 3VIHA 1EF3A 4UTKA 3G0UA 3G77A 3PC0A 3B8VA 2PEVA 1WUEA 1UUOA 3ABQA 1I8JA 1TQJA 3IAQA 3QY6A 2P8CA 4KCVA 5I3JA 5HR6A 2OYLA 3MP3A 5AZ1A 2WKJA 1MWOA 1JDEA 4HVXA 4G7EA 4LAUA 2OYKA 4C91A 3O6DA 1Q5MA 4QG8A 4Q8NA 4AZBA 2CETA 3EEZA 3CT7A 3EKLA 5A8PA 4HOWA 2VDHA 5FACA 1UKTA 3NGJA 1W91A 5DY2A 3NPWA 2J8GA 4K1GA 2VZTA 5CCZA 2XWEA 2GUYA 2JE8A 3CQKA 4JTJA 4RDVA 1ZAHA 1J5TA 2XFWA 4GYPC 1L2UA 3N3MA 2XVGA 1QPKA 4KRZA 4MSSA 3PY2A 5EA9A 3UJRA 4EPDC 1EOKA 3TW7A 1XIEA 1H0IA 3TE9A 1PV8A 3TQKA 5GQBA 2QCFA 4HB7A 3MKVA 1MW0A 5LNSA 5A6KA 4B5NA 2QEZA 4WGXA 4O15A 3GUGA 2WAGA 1O68A 2QT3A 2FZBA 2AGKA 3BE7A 3UJEA 5BU6A 2DU2A 3MYOA 3NQ6A 4GZJA 1VH7A 2Y62A 1XP3A 5DX7A 2D2GA 3K8KA 3G1YA 4WDTA 4NJKA 3UZJA 1J0ZA 1E0VA 3P8IA 2WVTA 1DQWA 3TYAA 1P7TB 4E4PA 1VBUA 3ANYA 1P5BA 1RVGA 1A47A 2VRKA 4LRSA 1XRSA 2GDQA 4NZ1A 4O53A 5LGZA 2XH0A 3IGXA 3TWBA 2G0WA 3W1MA 1C29A 1QBBA 3P6LA 1NWTA 4RW5A 3TFCA 1H51A 2FFCA 2E25A 4H1ZA 1Z48A 2PDGA 3GNXA 3R1ZA 4DB7A 3KRSA 4OU1A 3URNA 4KFOA 1KWKA 1VHCA 3P61A 1U33A 1GJWA 4DJDD 5H91A 2IUZA 2QDEA 1YTDA 3EWCA 3LA4A 4XO7A 3UG5A 1S3TC 2A3AA 4G7FA 3CAVA 5CZ0A 3ITLA 5C9ZA 3A64A 2FJUB 3BSGA 2F7FA 3NOEA 3KBJA 1XCFA 1PCWA 1TPDA 1ELSA 4ZBCA 2ZXQA 2HCVA 4ATDA 1AQFA 1NOUA 1TJ0A 3GVVA 1W17A 2J79A 3P74A 4D6CA 4IUOA 1K1DA 3WNNA 2NX1A 1XINA 2VC7A 3KM8A 1OFAA 1ZENA 4A22A 4ROQA 2R1NA 1TVLA 2REQB 3MDWA 2TODA 3O06A 4F2BA 4NY2A 4AF0A 2CLOA 3QGVA 3TTOA 1QJWA 2VURA 4FLOA 5IHSA 4N9EA 5EMMA 4ATLA 3V16A 2JKPA 1MFUA 1XLAA 3WQ8A 4OGZA 1SSGA 3N6JA 4FLSA 3VDGA 1FUYA 1PJ9A 3BWWA 2EKCA 4LCQA 4DWSB 2V3EA 1CDGA 2PDBA 3N18A 4M6UA 2OQLA 3BQ5A 2XH2A 1Q6QA 1UH4A 4D8ZA 3PTQA 4LXFA 1JIBA 3WH6A 4TTGA 3E0FA 3SQSA 2WW5A 3D3FA 4BS0A 4WY0B 4JNZA 3WLHA 2YL6A 2UY2A 2VR5A 2NVDA 1IE7C 4PMUA 3ALFA 2DZTA 1S5TA 4J28A 4HMDA 3CQIA 4YTUA 3N6HA 5GVJA 1PZ3A 2DZXA 4GC3A 3WH7A 1LLOA 4KCWA 1XJBA 4O57A 2C1HA 3ATZA 3LQLA 3NQCA 3VINA 2X05A 1R3WA 1QPQA 3PBYA 1C9WA 3BMVA 2WK2A 4GNVA 4LC6A 3FA4A 3WN6A 2HE8A 3OZPA 2GDVA 1B3YA 1PKNA 4EVZA 1VFUA 4MDOA 1KM0A 4W93A 4KF1A 5HQEA 3WYZA 1B3ZA 4B91A 4H04A 3ZZ1A 5E09A 1F76A 4ZO6A 4ZR8A 4AQLA 2CERA 1WNOA 5FJOA 4IQDA 2WZIA 4ES4A 3DG6A 3AXHA 2J13A 1XYLA 1V3HA 1DIKA 1KFJA 4OHQA 2UY5A 3LLFA 1OC5A 1SZEA 1W1VA 1WDPA 4H8UA 3TSBA 1W32A 3GW0A 4JFWA 2PWVA 1W1TA 4H8NA 4US5D 3SY5A 3M5ZA 3BAIA 1JULA 2PP0A 2PI6A 4H9ZA 3VIIA 1V93A 2D2HA 1F2JA 3MYPA 4LPCA 5LNWA 3RDKA 1K70A 8XIMA 5CGTA 2PWFA 1VQTA 4J3WA 3VDAA 1X1ZA 1EP3A 1EGMA 4C6QA 3SJ3A 2X1UA 5EKYA 2E77A 3ITYA 2QW5A 5MHBA 2OWCA 1EWDA 3GHRA 3PP7A 3KL3A 2NWRA 3IJIA 1SJAA 3PN8A 1JF5A 3LRMA 3W2LA 4C6CA 2L5HA 2YCLA 4CU8A 4PSRA 1DWAM 5I0DA 4RE4A 4Q4KA 3SN0A 1ISWA 3RO8A 4ZGYA 4GI4A 3BC9A 1OINA 3BGJA 4DJFD 1A5AA 3PJWA 3UY8A 3SCPA 1NDVA 3K4DA 4D6JA 1QI5A 4OBSA 3G0SA 1B57A 1RQEA 2O9TA 3GH7A 4ATWA 4U2ZA 1E6NA 2FMNA 1QR7A 3J7HA 3AC0A 5CPQA 3KL5A 4IT1A 6CGTA 5CEWA 3W38A 2NZLA 1J0YA 3PPHA 1H49A 3F03K 1XM3A 4NZFA 5H8MA 3HU7A 2DIJA 3QGKC 1FWDC 4PULA 5K3VA 3WIJA 1V6VA 4ASTA 4HYRA 4JQAA 2V5BA 1TIMA 4GINA 1EEXA 5BNKA 4N9DA 3UG3A 1YDVA 4BWLC 2XFFA 1PX4A 3WBEA 1CEOA 3R94A 1VLIA 1TTPA 1FCBA 2GVJA 1UWAA 1DEDA 4JZ5A 3UWUA 1J0IA 3IVTA 4DHGA 3B0YA 3TQ0A 1JF6A 3LOTA 1UBPC 2AAAA 3LM3A 5ABFB 3C5QA 3WEZA 5FA5A 3RRXA 1RR2A 1F3XA 3SFKA 2QVNA 3EBVA 1SJCA 3W1QA 3MHFA 1VB9A 4R33A 4XZHA 2WLZA 3DBPA 2NQ5A 3WD3A 3KBNA 3MO7A 3WLPA 4MFDA 4KFNA 3CMFA 4O10A 4TO8A 4H6KA 3OB8A 1QCWA 2IKIA 3GXFA 4CQCA 2ZUUA 3OOQA 3SB0A 1HKWA 2P76A 3ARZA 3UZYA 2Y5EA 3W84A 5HK4A 5DBUA 1SZGA 3TKFA 1V5XA 2ZDSA 4PTWA 3Q67A 3NQEA 3IRDA 1FHLA 4F9JA 2WM1A 1EJ7L 1JYVA 5K9CA 2GGJA 2NV1A 1FDJA 3KW3A 3WQ6A 5TBOA 2F84A 4NL1A 1EIBA 3EOOA 4CD5A 4BHYA 3T2PA 3KP0A 1UD5A 1FHVA 1IXNA 4AIEA 4ERIA 1IV8A 3GIQA 4B9ZA 3WJZA 3ZQ9A 3GDLA 4M5PA 3MT1A 4XAFA 4CNOA 1OIMA 4HSOA 1V0NA 5C70A 9XIAA 2OPJA 4KCUA 3H2MA 4UQ9A 3G24A 2Y0FA 3VFLA 3RAOA 3QGAC 2O4MA 4I8DA 2OZ8A 3NDOA 2IQ0A 3WDQA 4MLRA 3T55A 1RQBA 1XLGA 4MWAB 2XM2A 3GS6A 4GNJA 1OYCA 2W66A 1O1HA 3R89A 1E1CA 1J8VA 3AXMA 2B7QA 2PDUA 3UQNA 4Q32A 4BKNA 2EKGA 2HS6A 3QZEA 3N11A 3NYDA 4MMWA 3FN9A 1E6ZA 2PLCA 1XYMA 3HPXA 3ARWA 2WMIB 3L12A 4M7TA 2GJXB 4OV4A 3C8NA 1OC7A 2G3MA 1EP1A 3QLLA 5FSDC 1DE5A 3OPSA 2DZBA 3NFUA 2NUWA 1P0KA 2X42A 5C6MA 1C3FA 1W9UA 4UMBA 3BH4A 1Q8AA 4KRUA 3CUFA 4MGGA 1IGWA 4S3EA 2B0MA 2INEA 3CXOA 4BQ3A 1DXEA 4NILA 4QQUA 4QISA 4GY1A 1TQXA 2UV8G 2QDHA 1EC9A 2HPIA 4KGJA 3UETA 1POKA 2JEPA 4Q8VA 2VX6A 1E4LA 3O63A 1LL7A 3EWUA 2WJDA 2R1KA 4AG0A 3WLOA 3ZXWA 4GGBA 1ZTVA 3AHYA 2Y8KA 2X30A 4Q33A 1VZWA 3HPFA 3H6OA 3PZ9A 2J7CA 4ERAA 3T2QA 1OADA 4QRNA 4N4PA 3K8LA 4LAMA 2W5FA 1KM5A 3R8HA 3K4AA 3WENA 3H4WA 2BS9A 5I7GA 5A95A 4ALDA 3O0KA 3SSZA 2LLEA 3S2CA 1OD8A 2NW0A 2X1TA 3H7RA 2EF9A 4RE3A 3PUGA 3UFYA 3PS7A 3V1PA 2A6NA 3TK7A 4MF4A 1ZCCA 1NSJA 1BYAA 2QUTA 2IS7A 2D22A 4E3TA 4GQGA 3CHCA 1OFPA 1TMQA 3LGDA 4O0KA 4ZB2A 2YBVA 4DYEA 2VZOA 1F3WA 4L7ZA 2BVTA 2QUVA 3EA1A 4MKSA 1Q6OA 1WKEA 1KRBC 4HA0A 1BXCA 2VGFA 1AJ2A 1EOMA 1KLYA 3CGTA 1Q4WA 4LTSA 3U9IA 4FB7A 5LIKX 4FNRA 4MZ8A 4GJ1A 1HF6A 1HQTA 2OB3A 3NZ1A 4ORMA 2XYLA 1YE6A 1EQCA 3AXKA 3W22A 1EXPA 1ALDA 3GVWA 3W6YA 4JIPA 3M1ZA 3W6MA 1ZPTA 3W28A 1PCKA 4DZHA 4UTFA 2DJLA 3JVAA 2EJAA 1ONXA 4TVCA 4RNIA 5IDZA 1LUCA 4M24A 1ITUA 3S2JA 1JCNA 1E6XM 5ABHA 3B3DA 2GJRA 6ENLA 2DSKA 2FLIA 1T99A 3WF2A 3QQ1A 4BF7A 2QGHA 3VDBA 4PMXA 2C1IA 5EGRA 1OF8A 4B5WA 2PRMA 4JN6A 2RDUA 2PZ0A 4RDWA 4D1JA 3WF4A 1R85A 2P0IA 5JMUA 4GFIA 4IQJA 1AQHA 2R82A 4I9JA 1TVPA 2F2KA 3BSHA 3CWHA 4WSKA 3KHJA 2VENA 3W26A 3PZIA 5AC8A 1W3KA 1JDCA 4FK9A 3UR5A 1L6GA 1W8SA 1VFTA 1HW6A 1GVQA 1ZJIA 3THDA 2I7GA 1JCJA 2INZA 4IPJA 4W88A 3WQFA 3VFCA 5I02A 5C7VA 4JHMA 1MW1A 4AD3A 3SUVA 3PPGA 4A3YA 3RCNA 4XBKA 4C1NB 1VCVA 3C61A 4LCRA 2HQAA 2EEXA 4QAWA 3TZNA 1XGZA 1CYGA 4G9PA 3L67A 3KRUA 5RUBA 1EZ2A 2G41A 3H53A 5GNZA 4GQQA 4RZ4A 3MI3A 4DQWA 3ABXA 2W27A 1E0UA 1SO4A 3NM1A 4S1FA 4U2YA 1A0EA 2FMOA 4UQCA 4FF5A 3VKKA 3LSBA 4NT0A 1V6UA 3CYJA 5AYXA 3SCVA 3AWOA 4FLQA 5A6TC 2YCJA 3P5ZA 4J3VA 3M6DA 2RAGA 4O17A 2QCCA 4TX6A 1JR1A 3C2FA 3G6MA 5FL0A 1W3NA 3N2OA 4JICA 3OIXA 3FKRA 3UVAA 2A21A 3BUVA 4M0XA 4DVOA 3NM3A 2WSRA 1SFJA 1V08A 2WPBA 3M7SA 1XI3A 3PBVA 1UWQA 4P8XA 1GG0A 4CD7A 1BF6A 1R87A 5H2ZA 3WF3A 1LM1A 4PL1A 1XIGA 4CUCA 3VD4A 2FFIA 3CO4A 2H3BA 1GOQA 1HJVA 4FOKA 4ZQPA 1F3TA 4UQBA 3TC7A 4RE2A 5LHEA 3SGGA 4E4FA 3V5CA 2IPFA 4IICA 4Z1AA 1KGXA 3OHIA 4WDWA 5A6JA 3BK0A 4LF1A 1QW7A 4MWAD 4KQNA 3TV8A 3ZO9A 1A5OC 5HMFA 3S9IA 5JH2A 3VD3A 3GFYA 4HA4A 1HVXA 3ITXA 2V5LA 4TV6A 1B31A 2J77A 3E2QA 2NLYA 5BMWA 1HT6A 2ZIDA 3RLHA 1XQLA 4NQ1A 2D20A 5KZEA 1TJPA 4CCCA 4ZSUA 1PEZA 3CASA 3I3DA 4PBGA 1YADA 4C1LA 3VIMA 1E56A 3P82A 1O66A 3IAPA 2R1MA 3TLQA 3QEZA 3W27A 4DYKA 3W02A 4E8GA 5EFFA 1TE1A 3S5NA 1CNVA 1RY8A 2ONEA 1FX6A 4LNCA 1EX1A 4KMQA 2QJNA 4WXYA 3BARA 2XUCA 4OFCA 3R4IA 2ZUVA 3NPVA 3DC8A 3LMYA 3E5PA 1A3HA 2I5QA 3M16A 3A4JA 2DPEA 2QPXA 2A6LA 4FOUA 4UC5A 3C3UA 3P93A 1UA3A 1T41A 1B3VA 1UQYA 2C16A 4Z42C 2AQOA 2X2YA 2GSHA 4H6EA 4GX9A 2DT0A 2ADAA 4Y9MA 4JDYA 2D73A 3GU1A 5AFDA 4J3UA 1EC8A 5FKYA 3LD5A 1GPFA 3ANVA 4PR4A 1TX2A 3E0IA 3VNDA 1T8XA 3C4UA 3GR4A 4UCFA 4ADTA 4DBEA 4DJEA 1UR3M 2BP1A 1G0CA 1G6CA 1NIUA 1I2RA 4Y9OA 5J8LA 1R38A 1TPVA 4GO8A 2FB2A 2DT1A 2VFIA 2WCSA 4YCOA 1OYBA 3EXTA 3OG2A 4GH3A 2WMHA 3LHZA 5CJMA 1W2VA 1H61A 1WPCA 1SUXA 1XYAA 4C6MA 4V2XA 4REQA 1XICA 2VDIA 2ACUA 3MQTA 3H2CA 3MS8A 1BGAA 1OBAA 3ES7A 3AWNA 2BY0A 4XZWA 4MVAA 4NZ4A 3FW6A 3GY1A 3VE7A 3MC5A 3R2GA 2XSAA 1UP3A 2EHHA 1E43A 1RALA 3LHWA 2B7OA 3L4YA 4P61A 4F2TA 2IW0A 4B5UA 4AVNA 3HN3A 5KZMA 2WVSA 1IEWA 3UERA 2CHRA 1R3YA 3V1HA 3N2BA 2B81A 4UBPC 2FB3A 2P8BA 3NEHA 1HKMA 4RW3A 3N04A 1EO7A 4QDMA 2IQDA 3L4WA 4J9JA 3U5UA 3WNKA 2UY4A 4OQVA 4EKJA 3HG3A 4BI6A 1F8MA 3OGRA 3U5YA 4GXMA 1JDFA 3NAVA 5AHEA 1BPLB 3KHDA 3VOFA 4CEUC 3T08A 2D2JA 1UKOA 1GEQA 1HJSA 1JCLA 2PDYA 1CGTA 4A3RA 1RY0A 5FF4A 1W0MA 3L0NA 4AZIA 5D03A 4UTTA 2C15A 2YZ5A 1UWRA 5E0CA 5HAOA 4HYWA 3GM8A 1OFQA 3OZOA 4JAWA 1ECQA 1V0LA 3TN4A 2PBOA 4PTVA 1SYTA 4UUIA 3HG4A 4LQ1A 4O13A 2C6QA 4GJIA 3RLUA 4JD4A 1KFWA 5F7UA 3CJPA 1W1ZA 1TKKA 3DDMA 5DMLA 5D04C 5CKSA 4BEUA 3DIPA 5HWJA 1LLZA 3WUEA 1XC4A 1O12A 3BSMA 3ARRA 1Z44A 1LRTA 4F9DA 1I0DA 2PF8A 1M68A 3GYCA 2Z1KA 3V3WA 3CZKA 5F2IA 1NQKA 2Z6IA 4YPJA 1DE6A 2GVLA 2QPUA 4DBWA 2WNQA 1WDQA 3AICA 4S39A 4L1WA 3LQGA 4ZB0A 3W87A 1GJUA 4MUZA 1EJXC 3LBOA 4GLEA 1A0CA 4GIAA 3PSWA 2HROA 3S2MA 1VJSA 1V6TA 3T44A 3SM0A 4DM2A 2G95A 4AMAA 3B97A 3H4XA 3UWQA 1O4UA 3C2VA 4QXIA 2ZUWA 1R30A 5CGQA 1GK8A 3WNMA 4Q4RA 4IP4A 3GU2A 1C7SA 3EOUA 2CWXA 4F0SA 1BYCA 1H3GA 3W7QA 3N3TA 2E5DA 1XLJA 1SO5A 3NSNA 1QPRA 2CLMA 4EE9A 8A3HA 4CN4A 3U3HA 5CPSA 3WKZA 1XLCA 3KWXA 1D9EA 1CGVA 5HQMA 4I8YA 2HDJA 2OSWA 3GZ3A 3LDVA 4MWAE 2IPWA 3N9SA 2QNEA 3GFXA 2QPSA 3ZSTA 4FNUA 2RJHA 3U2EA 5DANA 2GLKA 1BRLA 1I6NA 1WOBA 3GU9A 2OO6A 1KBKA 3VCNA 1OX4B 4FX6M 5D05A 4A29A 5A3HA 5KETA 3MV11 2QULA 1OWQA 1R3TA 3ZIZA 4IF2A 3WJXA 1WZAA 3WJYA 3DESA 1R7AA 3S9YA 2J9ZA 1SGJA 5GNXA 1IQ8A 5HBFA 4UB9A 1FY6A 1PE1A 3NO5A 3ARSA 1BTCA 2GQAA 1RBAA 4ILSA 2XHYA 4D6IA 1HNYA 1OFBA 2BY3A 3VKAA 3ZJ6A 3C56A 2V2CA 3M9YA 3NGFA 1ZLPA 1HKVA 1M01A 2QV4A 3R58A 2WBGA 2YLLA 4WHBA 3BQ6A 4DLMA 3DI0A 1OYAA 5F2MA 4J3SA 3VE9A 4O14A 1VEOA 3RCMA 1UR9A 1XC6A 4WKHA 4UMAA 3H24A 3ME3A 4U3CA 3LEPA 4LS1A 3THAA 4XZIA 4WJ8A 3EX6A 3UVIA 2PD9A 3VYLA 3T7VA 2V0TA 3SCWA 2WSKA 1G9HA 3GHTA 5FSEC 4CU7A 3M46A 1G67A 4I7VA 4UZUA 2PRHA 2PDQA 2O56A 1W1YA 3IPWA 4MPKA 2BVYA 1QNPA 3DECA 4C6OA 4Y8FA 4O18A 2GJXA 1UKQA 1XYZA 2WHLA 3N73A 3OVRA 2ZDRA 2VDGA 2CLKA 3W73A 2X0HA 4AMCA 3C0JA 3AMKA 1J10A 1MW2A 1JPHA 4S3FA 5KMYA 2H8ZA 4H6QA 1CXFA 2PMQA 4O19A 1OABA 4LB4A 4S3BA 1E6RA 1XBYA 2GGHA 1TELA 1PZ0A 3OYXA 3K30A 9CGTA 3GC5A 5CBBA 1YYAA 3UWVA 4JTHA 4ACZA 5REQA 3VC6A 2BHUA 1CENA 1K7FA 4BI5A 1BLIA 1OJXA 1IT0A 1PS9A 5D30A 1S5WA 4JFVA 1X8CA 3O6YX 1R9XA 1U30A 4MNJA 4LT9A 5HQLA 3LYEA 1TE6A 1B54A 4DZIA 5XINA 1Q65A 2EPKX 4OIFA 4C7DA 3I3EA 4LUTB 2Q3RA 1XFCA 2RDXA 2OCZA 4YIWA 1KRAC 1ZFJA 4GJJA 2BWGA 3WLNA 3L23A 3VC5A 4C6NA 3U57A 5HPCA 3ZJ7A 4NAFA 3TXVA 1LRQA 2WNWA 4J2MA 3FGCA 2ALDA 2XIQA 4LX4A 1CB7B 1FVPA 3NL3A 1DXIA 4DWSC 3TTEA 3WNLA 4IZGA 1XISA 4OBRA 1W56A 4G1NA 4IX0A 3AHVA 4A2RA 1BWVA 3FA5A 3KE0A 4YCPA 3SEPA 4WDUA 1LYXA 3KOFA 5C2XA 3TC3A 5FESA 4K8GA 1H60A 2RGMA 3HQOA 4MB3A 1ITQA 3PWGA 5AC7A 4UFMA 4HK6A 1KRMA 3VI2A 4MPQA 5F4WA 3AHTA 2ZRUA 3URAA 2QQ6A 2TPSA 4ADSA 4D6EA 5CGMA 1Q85A 3IGUA 1H7WA 3JZEA 1VPYA 1UMLA 5LA2A 3BW2A 2Y5SA 1SJBA 4FZIA 4ADUA 4UFLA 1A0DA 4XWUA 2EG7A 1VBHA 4A6GA 2Y4SA 3VMNA 2NQZA 1K8ZA 4UTMA 3TYUA 4AIUA 4IFKB 2Z7KA 1ZBVA 1A5NC 3TW9A 3EA2A 1LBLA 3DFSA 2CBJA 3GXPA 4GBDA 3UD6A 2OO0A 1XGEA 2OZ0A 3EDFA 2VUYA 8RUCA 2W61A 2VL4A 4MFEA 4FX7A 1H5YA 1T96A 4XZMX 3VKBA 4PEKA 1B5TA 4B3LA 3UG8A 4DNHA 4K39A 3FFSA 3RN6A 4IP5A 3TTQA 2Z1WA 3R13A 4LOCA 3KZSA 4XSLA 3THCA 3S5SA 4JN8A 1W3IA 3Q58A 3EWDA 2Z1BA 5DXXA 4ERGA 1BQGA 4AXNA 1ME7A 2WHMA 2QR6A 4Y9PA 3MUCA 2QLYA 3H8AA 5ENLA 2Q8ZA 2PTYA 3ABRA 1QXLA 3ZS4A 5CG7A 1BFNA 3ZMRA 1JJKA 1XCWA 4WIWA 2XFRA 5K9XA 1A5BA 2ZZ2A 1R9YA 2DVTA 1AH0A 2Z7GA 2UBPC 1P0DA 1TV5A 3LTYA 1TA3B 3Q4DA 2PDFA 4XO6A 3H4GA 4Q4PA 3CQ0A 1W9PA 1TWSA 4CQ8A 4Y90A 3CV2A 3UZ5A 4HJFA 4FOJA 5DLCA 4B3KA 3FIGA 3STEA 3NL2A 3PUEA 1MXSA 1UR0A 1KD0A 4AW7A 1NQ6A 3W0KA 2WO5A 3IGSA 3JU2A 1JZ8A 1KR1A 2HNHA 4AC7C 3BCJA 4UNIA 1AW1A 3EPOA 4W5UA 3QY8A 2DQWA 3E2RA 4UTTC 4DBUA 1C9DA 3UNTA 4W7WA 4RV3A 2BGNE 1YBQA 4Q4QA 2FHFA 1JYXA 1YLVA 1CIUA 3WK2A 1OC6A 3MI6A 4AC1X 4IP7A 1S39A 4BZYA 4DAFA 4AIBA 4DJED 3CIWA 1LQAA 8TIMA 4GZ7A 3PTKA 2AMXA 4B5TA 4ZQOA 1NFGA 1EEPA 1B9BA 4LUSA 1VHNA 1WAWA 5AECA 5BYWA 1XL9A 4HU8A 2PLJA 3LGGA 3DU0A 4EAMA 1AL7A 2C7FA 2VT0A 3F7JA 1WDSA 3VM7A 1JL8A 3UEQA 1UH3A 4X9YA 1VPQA 4OECA 2PDIA 1KR0A 1Z8AA 2PP1A 5K4ZA 2VM8A 2WHJA 1XPGA 1EUNA 4H9YA 3SGUA 1JZ7A 2FKPA 3TNBA 4WZHA 2OWXA 4A8LA 3MANA 3OZYA 4EF8A 3G1FA 1KA9F 1BWKA 4AZ5A 4DZ5A 4OOUA 5C2CA 4WK9A 3QMSA 3NQMA 4C5ZA 3LUTA 2I9UA 3U2ZA 3ZVIA 3SQLA 3R25A 2GUUA 2W63A 1YKWA 1K8CA 4W8BA 6TIMA 5BMXA 1ISYA 4JX4A 1YDYA 1B2YA 3FCPA 2A3BA 1J12A 2EAWA 2JIEA 1JUBA 3W1PA 5IBXA 4WR3A 3SCQA 1LJYA 5B7ZA 5I77A 4TMCA 1LP6A 1AQMA 3BG5A 8XIAA 4U31A 1GKRA 2PRLA 1W5PA 4A35A 3M5XA 4PUDA 5AZ0A 2JGYA 1Q6FA 2Z28A 3B9DA 4DUXA 4HU4A 2R1PA 2PFHA 5DRIA 2EG8A 4IPLA 3UU0A 1H4PA 3E74A 2DFAA 4EANA 2IXUA 1EKOA 3LS9A 6REQB 3AZRA 2QGYA 2ATMA 1A5LC 2ZRXA 4DYJA 1OVDA 1G01A 3ZOAA 3Q94A 1P0NA 2E09A 2H6RA 4JFUA 4B5VA 3CQHA 2BOEX 3B04A 3WLLA 2MNRA 5BXRA 5DO8A 4G1KA 5IRPA 4I5UA 4ZA0A 1PYMA 3MMUA 8CGTA 3UYCA 1AQ0A 3SUUA 4B4HA 3M6YA 3CEUA 3IJ8A 3OQEA 4WQ6A 2R14A 2OGYA 1PBGA 4AD5A 1PX8A 2E28A 3R0DA 1JD7A 3R7MA 1IR2A 1DL3A 2VFFA 2GOKA 4CQBA 2OLAA 1FFQA 3B8WA 3CBWA 4GVHA 1T8QA 3GG7A 2GSJA 2JALA 2NXHA 3ARPA 2YL5A 4DO7A 5BWAA 3NL5A 4YN5A 4UXDA 2V69A 2BNJA 1CB2A 5A6SA 5CLTA 3W53A 1EH9A 2E1DA 3W25A 2J7FA 2V5CA 3AAMA 3NQFA 3TVAA 2V67A 3TR2A 2AL1A 3PZNA 1MO0A 4FA3A 1S46A 4NNAA 3B8DA 4XVDA 3SCSA 4F2UA 3B8IA 1DQUA 3LG3A 1VEPA 3EPMA 3AIVA 1LOQA 4W8LA 3II1A 3RX4A 1BTMA 4AZCA 3W76A 3HTWA 3OTRA 5I3KA 2FJKA 3W7NA 4UNKA 2OGJA 3W6LA 2XIIA 4PZVA 1IIHA 1Q6EA 3RITA 3MHGA 4Q8OA 2RJGA 3ZYZA 2VFGA 4JYFA 1R47A 4LALA 3W2JA 1XD0A 3NL6A 3KTSA 4ACYA 3QV8A 2VEIA 4S3JA 4XAGA 4NIRA 4YHEA 4EOUA 1YXYA 1Q6LA 2PBGA 5PTDA 4M19A 4QCFA 1KM3A 3IIOA 5FJJA 4ROPA 3ARTA 4HPXA 1IT7A 1B3OA 4JBRA 3W24A 1ADDA 3STGA 3KVLA 3UG4A 4Z2HA 4PB3A 3BPWA 2PODA 4PYSA 1ZJHA 3EB4A 4HD5A 5G1TA 4I9AA 3HPAA 4JTTA 3QHNA 4C6PA 4O28A 4K7YA 1QW8A 4ZOEA 1GVIA 1YNQA 1EB3A 5JBFA 5DELA 2NT0A 5FAJA 3TNOA 3MWAA 2VC9A 3M0YA 4LAZA 1OF6A 2TAAA 4B92A 2ZWYA 1TO3A 1CGXA 1QU4A 3CB8A 3NQGA 4AB4A 3PG8A 3KS6A 1TTIA 3QPZA 5K9DA 4IFOA 4JCMA 2QCLA 1R3QA 7REQB 3M0VA 2A5HA 3OU8A 2X41A 4WXZA 5M5DA 1JDAA 1DJGA 3YPIA 1LQ0A 1KTBA 2J24A 4MJMA 3AFBA 4GUFA 1XFBA 3MHUA 2KZHA 4HZ7A 3F1QA 2FPTA 5DCDA 4IUGA 4DBDA 4DNMA 2PF0A 1F5ZA 4V1YA 4OUIA 4UIOA 5T9BG 5DBTA 1PX3A 1O7AA 2YXXA 5CJNA 1L9WA 1PDYA 1QO2A 3T0AA 3WUBA 1GGOA 3QKEA 3C2EA 3C86A 5JBEA 1GCYA 1BKSA 1P6WA 1G4EA 2QHAA 4L9YA 1RJQA 3VZZA 4PE8A 4LS2A 4MZ1A 2AL2A 2BY2A 3NPUA 3C6CA 4J5NA 3SN4A 1LT7A 2XVNA 2F8QA 3KOZA 4H2CA 3T6CA 2Z1XA 1WKFA 1TV7A 3THUA 3CS2A 1YTKA 1XLLA 1VYSX 3AIWA 3BZJA 2JBMA 3WK0A 1B3XA 3S9ZA 3MJMA 1RP8A 2F38A 3VXGA 4HCHA 4MKVA 1ZNNA 3E9AA 1NM9A 1ZAJA 3GTFA 2JIWA 5FJRA 2MANA 4F79A 3UJFA 2DZSA 1P6CA 2ZXDA 2WNNA 4H7CA 1ZQ5A 3E96A 4AH7A 2OMAA 1JYWA 4BI7A 1MUWA 3T0BA 1XLMA 4DIAA 1ZBCA 5BOFA 5T91A 4RNHA 3WH9A 4LC8A 5HMDA 1BXBA 2J9YA 4L6DA 1NP2A 5C9RA 1RV8A 2WPGA 3RHGA 3GG1A 1NVMA 3GXMA 4ZENA 3SR7A 1GKPA 5GNYA 5TD4A 2IPGA 3WEOA 3F4WA 3FJ4A 2POZA 2ZX6A 4LB3A 3TJ4A 2P88A 1C8VA 2OKTA 1O6IA 4PBFA 5A2BA 3KVJA 2ZTKA 4YVPA 4DUOA 1O5QA 2PCEA 1QNQA 2QCHA 3GHUA 1E1EA 3WQCA 3W71A 3GXNA 1DWGM 4XKYA 1W6TA 1JZ5A 4GYPA 1BSLA 1XGDA 4I9MA 3OYZA 3W7KA 5IFTA 4V15A 2VTFA 2W6RA 4AUBA 2ZRYA 1HG3A 2OT1A 2J4GA 1WUFA 3M0LA 2YBTA 2CZVA 3EEGA 3F5LA 2I5IA 1GOWA 4RJEA 1TZ7A 3PBGA 4D6GA 5CC7A 2XU2A 2WLYA 4JGDA 3MO4A 2EBNA 3S5ZA 3TCSA 4DO5A 1MUCA 1EYEA 2EO7A 3FLUA 3UPBA 3L65A 1GORA 6XIAA 1UJQA 4CLMA 2VC5A 3VKJA 1E9IA 3LI1A 3HMJG 4Z17A 2BXYA 4XTIA 2INFA 4JTEA 4AISA 1Q6DA 3UBPC 3AZTA 4Q4MA 4CNUA 4AY1A 4DI9A 1K9EA 3U7VA 4XBJA 4P7LA 5AOUA 4YWSA 3R11A 2VQTA 2PPGA 2PWHA 3LPGA 5HNRA 2XWDA 4DLFA 3SSJA 1CGUA 2VZSA 2UY3A 4YYCA 3LRLA 4S3KA 1PIFA 4NSBA 4NZ5A 1AH4A 1OFDA 3GDRA 3CH9A 3CT2A 4G5DA 2C3ZA 1WYIA 1FWNA 1K3UA 2O0TA 4O52A 4NNBA 3IS4A 1NDWA 3H2NA 3E2VA 4MUPA 2PB1A 1P1MA 2J6XA 4ONVA 2VR2A 4NRRA 1JCMP 4PFHA 3MU7A 1ZGDA 2BGSA 3LCLA 2DY3A 3CPRA 2C1GA 3HG5A 4GE8A 3QV6A 1JCTA 4GIRA 3UT0A 3L2LA 2XM1A 2TMDA 3A5VA 1B9ZA 1KFKA 3DGRA 2NQLA 3PUOA 4NZ3A 1ODZA 4EIVA 3JS3A 2VEFA 5ECUA 3L0KA 2WBKA 1RPXA 1DJIA 4LYQA 1JPMA 3GWQA 5CSYA 3GVGA 1NAL1 4FNTA 1KM1A 1TUFA 1F6YA 4UTHA 2W3ZA 5K7JA 3PF3A 4PRWA 4GMEA 1KBLA 4J35A 2FVLA 3EPNA 3FYOA 3KRZA 1AMYA 4JTKA 2XG9A 2H9AB 1AD4A 2CHOA 5C2GA 4XTDA 4LY4A 1DP0A 4AX6A 1K02A 1TUXA 4GVIA 4GY7A 3RMJA 3VGDA 1J79A 4GG9A 3GSMA 1US3A 3I7QA 2PWUA 2ZXBA 3CM4A 3TYZA 4ZZ9A 1EGVA 1XUUA 4GCAA 3APTA 4F0RA 1TB3A 4BF5A 1GZ1A 5FF7A 3DFQA 1ZJAA 5HMSA 1U5VA 2R8WA 1SM9A 4YVVA 1K4HA 2YJQA 3S42A 1KBJA 3U2CA 5A8GA 2D3LA 3P14A 4UTIA 1MI3A 5TNVA 2YLAA 4ECLA 1FWHC 4CNTA 2OEJA 1XD1A 1GVYA 3UWZA 1UR1A 3NZGA 4CCZA 2AGTA 2ZXAA 3MVTA 3PVFA 3OVGA 1FTXA 2DZAA 3IARA 2PDNA 1Q6CA 3F4NA 3W1TA 4FPSA 1IEVA 1W5OA 1E9YB 4QNWA 3TJLA 3BGAA 1SZFA 4RZ6A 4FI4A 2VQUA 4IIDA 1XRVA 3PZVA 5EMUA 3WJWA 2PGWA 1UR2A 1XH0A 4K8EA 5C8BB 4NAEA 4R7JA 1V0KA 5D2TA 1GQJA 3MP5A 4TMBA 1A49A 2Q8XA 3R79A 1KM6A 3IK2A 4V1XA 5CJ5A 4E0CA 1TCDA 4ZL1A 1K4GA 4JTLA 4FLRA 4LCSA 4P8UA 3Q2DA 1PIIA 3RU6A 1JGMA 1ONRA 3BL3A 2IMRA 3FDKA 3SCTA 3ECQA 1PHWA 2C13A 3PNUA 3OEXA 1QHZA 4WGHA 5LNUA 3HFYA 2C8NA 3KTXA 1JFHA 4Q8PA 4Y6GA 2J66A 4GZIA 3FYPA 5J5RA 3GXDA 3K1GA 1UZ1A 3UJSA 4K3ZA 4B2DA 1IWAA 1I75A 2DSWA 1IEXA 3XINA 4YMZA 5CBJA 1WBHA 4LRTA 2P53A 4N2YA 3HJEA 4E4UA 5FJTA 3N6QA 1MEHA 2BZNA 2ZA3A 3CQJA 3WQWA 2WJZA 3EKGA 3E02A 4FXFA 1WZMA 1A5CA 4Q22A 1RBOB 3VK5A 2J74A 3I65A 2ZZ1A 4H9MA 3N4AA 3VPLA 4GA8A 1W2PA 3MCOA 3WF1A 5HUPA 4HOZA 3RX2A 3ITGA 1PYFA 2FTYA 2WQPA 2G3IA 3H2OA 4NNCA 5EB8A 5I79A 3PUDA 4XIAA 3KDNA 4QE5A 4FNSA 2XZ9A 4TX8A 1JZ2A 3N25A 4JQ2A 4WCJA 1DWHM 4YNGA 4WEVX 3KCOA 1VPXA 1POJA 3ITVA 4GO9A 3ZT5A 4JY9A 3R0KA 1A50A 1XLDA 3BW3A 1W3LA 1UCWA 1KKOA 1CW2A 3AS2A 3B06A 1KFCA 3N2MA 1GOOA 1L0PA 5DCBA 4XZLX 4TX9A 3G1RA 2HBVA 3P2VA 4MNKA 2Q8LA 2ZTJA 2J75A 3KL0A 1QVBA 1EPVA 2Q01A 4L6OA 4BWLA 5AHIA 1Y7VA 4WF7A 2FIQA 3VOCA 4QS5A 1JGIA 1ZU8A 2WOQA 3DUGA 1D2KA 4UR9A 1KM4A 1TWWA 3OW1A 4M8UA 2G3FA 1B90A 1OY0A 5GPRA 3WG6A 4UFKA 4GHRA 3MUY1 5LIUX 3BAWA 2VX5A 1X6UA 4BFAA 5CC5A 3G0XA 4WY0F 3WO8A 3GTHA 3TJIA 4HGXA 3RF9A 2DUAA 4O4VA 1H7XA 3QC3A 3RYSA 1OCJA 2QIWA 1M65A 3W7LA 2DT3A 2V82A 3H22A 1KTCA 3R8GA 3T4WA 3GBEA 1X7FA 3PBWA 1V02E 4INFA 3LB0A 4NX5A 1R0MA 3GUWA 3O05A 1F8IA 4ZVJA 3ENLA 1XKYA 3CHDA 4LUIA 3S6TA 1XIFA 2NXGA 1XLHA 4BR1A 2GVYA 4ENLA 1C92A 1W1PA 1ZB5A 4O8RA 2I16A 1UJPA 2X2GA 3BICA 2V8ZA 3QV7A 4QP0A 1KRCC 5JU6A 1A5SA 5M3WA 1ZZMA 4JL1A 1ODUA 4ZEPA 1CGYA 4E3VA 2YSWA 3QQ0A 3BV4A 2J6VA 1GHSA 4A3QA 2Z2AA 1FQ0A 2XGIA 3B8TA 3V5FA 2GQ9A 1IXQA 4FR6A 3TU9A 3HQ1A 3GTIA 3C2RA 1DWJM 3LTPA 3N13A 3STPA 3QPYA 4ICNA 1GTEA 3T81A 4HCLA 2J7DA 1H7NA 4FXSA 2I9EA 1K9FA 3BCFA 5CC3A 1WO2A 2GYIA 3LZ3A 3B0UX 1PDZA 3WBAA 1B4KA 1W5QA 3XIMA 3S3GA 4CVWA 4G56A 4N9CA 2OYMA 3GAYA 3IIZA 4GPNA 3FV9A 2YIHA 3PNZA 1TV8A 4I9TA 4GI6A 3TYEA 2FHBA 4QR6A 1H7PA 2CKSA 4PN2A 1FWBC 4M1RA 3B9NA 3ZT6A 4BY3A 5A8QA 5ABGA 2WCAA 1MVYA 3FXGA 1EHAA 2I14A 2BSLA 3SADA 1K03A 3KXQA 4HKPA 4UOZA 1IT8A 3OLGA 3BMXA 4AEEA 1SJDA 4FO4A 1GYLA 1Z6KA 3ZVHB 4L1GA 3KDOA 4KEZA 1ME8A 1E6PA 5BXPA 1J0HA 4LFYA 2X1SA 4POCA 3PJTA 4KEVA 1EDQA 3UWEA 2OSYA 2GK1B 1TWZA 3VD7A 4HNOA 2FHCA 4PH6A 1E71M 1TYGA 4HN4A 4P7NA 3OGVA 4ZQMA 3DHFA 2PE4A 2QUUA 4RV8A 1QOQA 4CGTA 1PTGA 1QBAA 2VEMA 3CV7A 1NFBA 4DPQA 4U4MA 2PDKA 1W8GA 2WKGA 1YPIA 1DJZA 2WYSA 4HP5A 1JVNA 3TROA 3WQPA 4I5XA 4AWSA 5JBDA 3IEBA 3FYYA 1R2RA 5MKGA 1PTAA 5A2CA 4HNVA 1KC7A 2W0UA 2HXUA 2G96A 4IIBA 2TYSA 1ESWA 1UKSA 5D2WA 3KUMA 2GWNA 3PBMA 4W5ZA 3UCQA 3WD1A 2X0SA 7REQA 3UF9A 1UWTA 2ZC1A 4CD6A 4H7ZA 3EGJA 1JQVA 3C0QA 4NJGA 4RR4A 5D8WA 5C55A 2VGBA 5AYIA 3K13A 4MADA 2YL9A 3LNMA 3MMWA 3M41A 2JK2A 3S46A 4IG2A 2CLEA 3QC0A 1BYBA 3EDKA 4FEZA 1GOXA 5E5CA 2PLMA 1T6MA 1YEYA 1ITXA 1DJNA 1DIEA 2G3JA 1KGWA 3MKKA 4LAKA 4DELA 3UZZA 1UB3A 3V7PA 1XHGA 2PGFA 2YCEA 2OZ3A 4AZ6A 3PZUA 2Y7EA 1R3RA 3BJTA 3F4CA 1IXPA 4LBSA 3WL0A 1GWJA 4YVXA 3N1AA 3QW3A 2X8RA 3TR9A 1RCQA 4XAPA 4E2OA 5CZJA 1VYRA 3FVMA 4G6CA 3OQ8A 3NQ8A 1DOSA 4PA8A 3GH4A 4L56A 2OODA 3NQVA 5JQ9A 1PHQA 1G5AA 2CZEA 4H7VA 2EPMX 4LVAA 2H3DA 4JNYA 3SRHA 4OBTA 4TR9A 1E0XA 3WDJA 3MSRA 2FZDA 3V75A 1NDZA 3E3HA 4PCPA 2PD5A 1NP0A 2ZZ6A 2VHLA 3RIKA 1IR1A 4PUMA 3W70A 4H4IA 5KSWA 3AI0A 3QLDA 3MMTA 1REQA 4RX0A 4AHOA 1W9XA 1OQFA 1RXOB 4H8HA 3QM3A 3B40A 4G7EB 4X22A 2Z0IA 4AU0A 2CU0A 3QKZA 2C71A 1T7LA 3CUGA 1N55A 3K8MA 1YNYA 3G6LA 1HJXA 1DJHA 4PTXA 3PZQA 4D6HA 4IIEA 4JTQA 4JYEA 1FWIC 1HN1A 4CD8A 1FKXA 3SIMA 3JW7A 2NQ9A 2V9DA 1J11A 4AWTA 1LDCA 1HX0A 4UOQA 1V0MA 1I2QA 1E70M 1MUMA 1NH6A 1WB0A 1Q45A 3N2XA 4TUFA 3D3AA 4BCEA 4PTNA 2HE5A 1E6QM 3RCYA 1XIHA 2E5BA 3AIQA 2EPOA 2BFGA 3C52A 5BWFA 2ZUMA 5FJUA 2NUYA 4HBKA 5F2GA 4IXHA 2GQ3A 3LERA 3CEPA 3EWXA 4NXKA 1OG6A 4IJBA 1WXYA 4D6FA 4KRTA 2ZWZA 4NKCA 4XKMA 1RD5A 1DTNA 5HA7A 4XIMA 1G69A 3L21A 3O16A 4ZQRA 1GYNA 2EJ1A 1CLKA 4IX2A 3DKLA 1XCXA 2WZTA 3EWZA 3V0TA 2CZFA 2J62A 1DQXA 2V63A 5D33A 3GNDA 4L64A 2GZXA 4GIYA 3MI2A 3IJ6A 3VUSA 1LBFA 1BXNA 4GVGA 3RJYA 1XR2A 4X61A 3RNDA 1OG0A 4HHMA 5HWMA 1UWIA 2AKMA 3LN3A 3CV1A 3MV01 3EB2A 4L80A 1HGWA 3W82A 3IACA 2CC0A 4C65A 3MSYA 4OOZA 3MZNA 4L4LA 1JUEA 3RLVA 4ZQNA 2PWEA 1Q6RA 5D09A 3WCZA 1KXQA 2FDSA 3N4EA 1YPXA 1OD0A 2WMFA 2ZX5A 2IQTA 4GWEA 1DVJA 2P3EA 4U3AA 4B5SA 4CQDA 3TONA 1AZ2A 3FHAA 3VO0A 3CUJA 1C7TA 3TX9A 2R6OA 3CHVA 1S5VA 1IWBA 3T9PA 2VFDA 4Q8TA 3QN3A 6A3HA 3KVMA 1DJQA 3I4EA 3HA1A 5A5WA 4M1BA 3BVJA 3VNLA 3LNPA 4HQVA 1UG6A 1GTHA 1K9DA 1OFEA 2ZVRA 3W1RA 3TJXA 3GK0A 3B0VC 2C0HA 5EYWA 5H6HA 3N4FA 2DT2A 4JPGA 3T40A 4QQ3A 5HXMA 4AYGA 3WBYA 4AF0B 1JXJA 1KBBA 1VP5A 4TVDA 3H26A 3EAUA 5CZKA 4GUGA 4M7SA 3S4TA 3FNDA 3LM7A 1D3HA 3HPSA 2PS2A 3M43A 3GD6A 1RCXB 4DUVA 4B2DD 5LXEA 3TOYA 1E0TA 5I78A 2GQ8A 1FH9A 4LWWA 3A47A 4WX2A 1I60A 2E6AA 4ML4A 4NG3A 1BD0A 2ZKMX 4IIHA 3VDHA 2ZQ0A 2OU4A 1GKQA 3REQA 2EXOA 3GVQA 3LI0A 1AW2A 4I90A 1K77A 2X1RA 1CXEA 3HM7A 3TTYA 1TZ9A 1UR4A 1JZ6A 4LF2A 3H2AA 5E70A 1JEZA 1MZRA 1F6KA 3B03A 4E5TA 3M64A 4J4KA 4O0ZA 4BEQA 2NVAA 2JQXA 1KV5A 5DMMA 2YA1A 2WXDM 4JX6A 3EXRA 1VBGA 4Z0JA 7TAAA 4XZ9A 4ZQCA 1GJPA 3GC4A 2C14A 1LOSA 2YR1A 2DUXA 3O07A 2BASA 4N6EA 1E73M 2VJXA 1RD6A 5JXQA 1WAUA 3RUBL 1ISZA 3BMWA 4QROA 2D2OA 5K2ZA 2WZMA 4Q8UA 3QOKA 2YX0A 1VRDA 5CC6A 2XIMA 3E5BA 5A8MA 1FCUA 5F4XA 2QXWA 3UR8A 1JRBA 1O5XA 1JPKA 4X63A 2EQDA 3LCFA 1EJSC 3T05A 1QDSA 4D1IA 3E49A 3DI1A 5KTLA 1HL8A 4XSMA 3A9IA 1UOZA 4R85A 1A80A 3FAXA 2R1LA 5AKQA 3ATYA 1QNVA 1TVNA 3I10A 4XBSA 1U5JA 2WC3A 3E38A 2DEPA 3S1UA 4GH1A 1H1NA 2PTWA 1W3HA 3OODA 1K7XA 3IJQA 2J78A 4LSBA 3V36A 4Y8EA 3W9ZA 1JZ4A 4C7GA 3VOGA 3VDCA 4Q3MA 2O4QA 7TIMA 3WLTA 1D3CA 1EYWA 1KXTA 1V3JA 5AHNA 2BTMA 4YTSA 1UPPA 3WUGA 3W1XA 4DO6A 4HU3A 2YDRA 3AYTA 1SW7A 3ZSSA 5I3GA 1RQHA 2ZUSA 4IGSA 2XDFA 4Q7NA 5ABTA 2WMGA 1HP4A 1KM2A 2AAMA 1HL2A 3W81A 2RDWA 4WJXA 2NQJA 2WANA 2IKJA 2V3FA 3RILA 4DXXA 1F3EA 3KEHA 3WDPP 1J0JA 2YCLB 1CCWB 3AMLA 2QJGA 2E0PA 2FPYA 2ZA1A 1UPMB 4E2DA 3BCDA 3CV6A 3TYBA 4DPPA 5BRBA 2QMJA 1V3IA 2G97A 3FXYA 3L5AA 1QT1A 3OHMB 2A3CA 3V35A 2A3LA 4F0LA 2O7QA 1JUKA 3WDHA 5CG0A 4IHCA 1YW1A 2HMCA 3GC2A 2VR4A 3TAOA 5F1UA 4CNNA 3GVRA 3SDOA 1IZKA 3B9OA 4AZGA 4KPLA 3SUSA 1VCGA 1AW5A 4NYYA 3SUWA 4QBXA 2ZCGA 2CXEA 3LCIA 1U2YA 2FGZA 5CSRA 1E4MM 1KCLA 1FA2A 2HJPA 2NSOA 1MMFA 1P6BA 2YYTA 1TMHA 4KEMA 1JCXA 1KWGA 5CZTA 5DMYA 4AWUA 4DY1A 1SO6A 2ZA2A 1VCFA 4QX4A 5FCZA 2E9BA 4QJ4B 1E6SM 2BG5A 2YA0A 1MQQA 3HIJA 1J9YA 2OR2A 1H0GA 2OXNA 3D47A 4L4MA 1KCXA 2E5CA 1W54A 1AMKA 2WVVA 4CCEA 4NZJA 3VCRA 3NYZA 4L9ZA 4AEOA 4NJJA 4P8WA 1XXXA 2WC7A 1XG3A 4CEXC 1SMDA 2QMKA 2BLEA 3IIVA 4S2CA 2I56A 1E5NA 4PMNA 4ZO8A 2HV5A 2QAPA 1EP2A 2FQIA 4Z2IA 6TAAA 1PVNA 3ONCA 3G1XA 3OJGA 3TN5A 4ZTXA 3USZA 1PPIA 1BVWA 1SO3A 4HT3A 1TPFA 4N6FA 2B7NA 3M47A 2AQVA 3GR8A 1JZ3A 1SFSA 2JKEA 1ZBKA 2DQXA 3AYVA 4BA0A 2R9RA 7PTDA 1MRAA 3RPDA 3S0CA 2HISA 2Y7FA 3PJUA 4KFPA 3QW4B 3WQDA 1GYMA 3O0FA 3KLKA 1N8IA 3G3DA 5FJPA 1KV8A 1Y5WA 3QR0A 4HIBA 1MW3A 4UCGA 3M4HA 3GRIA 4BQ2A 3NPXA 4N0RA 1BG9A 2ZFAA 1AFSA 2XH7A 2ISDA 1NTHA 3H54A 4QJ5B 3HGOA 4IIGA 4HMEA 3PJXA 3EDEA 3MSDA 4RPQA 1EWEA 4H19A 4HYVA 1TRDA 3PANA 3W29A 4EAYA 2W91A 5HMEA 1GHRA 1H1YA 5AC6A 3KZPA 4DJFA 3EWWA 2XPKA 5E6ZA 1F74A 1B30A 4O8AA 3H2FA 3M0HA 2CXGA 1A3XA 1ZP3A 1DHKA 3SGZA 4XAYA 5A94A 1QW9A 1FCQA 2A85A 4R34A 4F0KA 4CU6A 3APYA 1EDTA 3O6CA 3L7RA 4TXEA 3CZ8A 3L9CA 4KH2A 3EWYA 1H62A 2KX9A 4QNEA 3LXBA 4O11A 2BMBA 4JOMA 4EXQA 2ANUA 5E9AA 1XH1A 3EMZA 1YRRA 1E1CB 4ZOAA 2QCGA 4KEUA 1BAGA 3ICJA 3WNOA 3R8RA 3ARQA 5IM51 4H9TA 1XYFA 1J18A 4NHVA 3NG3A 1R7OA 4I3GA 3VKDA 1CLVA 1VFFA 3IV3A 1TZZA 3VGFA 3N19B 3BZGA 3JR2A 1S2UA 4JTFA 3E1F1 1H7OA 4PMQA 1P7TA 4N4QA 2Z1VA 2XN1A 4MAZA 3WDRA 2QDGA 1JPIA 1EL3A 4J27A 3VU2A 2NLIA 3KCLA 4PEEA 3TMLA 2DP3A 4P2VA 5LXXA 1BG4A 1LBMA 4M29A 3A3XA 5TIMA 1E4NA 3NZPA 3CUHA 2C18A 2Q6ZA 2VOTA 3S6OA 2VNCA 3WQGA 4K6AA 3MUAA 4QSFA 5FEXA 4Q4OA 1JI2A 2CYGA 3TN6A 2E8ZA 2F9RA 3RR4A 1VYPX 1RBLA 4L61A 4UZSA 4MJ2A 1H5VA 1UZHA 3W1UA 5LYRA 3S1XA 2J47A 4J2PA 3ORWA 4AZHA 1OCBA 3EWBX 1SW0A 1WXJA 1QK0A 3TTSA 5ABEA 2Z1SA 4HPJA 2VUNA 1O94A 1TIWA 2J7GA 4XISA 1JQXA 1TV4A 1KKRA 3BAXA 3IIXA 1ONWA 1FCVA 3DFTA 1HVQA 2E8YA 3G1AA 1MQRA 3NWRA 3FJLA 5B80A 2GGEA 1VFSA 3CNYA 4JR5A 1OX5A 5I03A 2VC6A 2REQA 3B4YA 3DYOA 1ICPA 4JN7A 1VEMA 3CAKA 2YXOA 1BEUA 3GG0A 5TAOA 1E15A 2HPMA 4KESA 2C91A 3M0IA 3N34A 1DJXA 3VTRA 2F6KA 4JIIX 1EZWA 3CMGA 2GVEA 1Q7ZA 1RHCA 2BVDA 3EX3A 4DWSA 1ZHAA 4IM4A 3OIHA 3S83A 1YDNA 2NVCA 2AOSA 1ENUA 2PUZA 4W7VA 1UZ4A 3S5OA 1RJRA 3T8QA 3CIXA 4JHZA 2XSBA 2OWWA 4A21A 4WY0A 3RR1A 4EK7A 1HUVA 1HKKA 4IH3A 1ZCOA 3POHA 2HTMA 3VX1A 2Y24A 1LUCB 3TSDA 2PDXA 1GOIA 4L4OA 3F5KA 4FNPA 3F4VA 3GE7A 4UQDA 4MIMA 1E3XA 3ABSA 4YTRA 4X3ZA 3PAJA 2ZZ5A 1Z32X 3FJ6A 3LPPA 3VIJA 1UHVA 4PODA 3N29A 4N7QA 5H8UA 4JL2A 4DJDC 2VZUA 2QF7A 1FDYA 2QCNA 5IXEA 2RKXA 5DF0A 3AIRA 3W2KA 1Q63A 1M3UA 2W67A 3FKKA 2J27A 1YPFA 2ZADA 4N9BA 1H63A 3SN1A 3LV5A 3IUHA 1H50A 4JTAA 1E0WA 2ACQA 4KBXA 2DZWA 3GXIA 3PZMA 4C6EA 3NDYA 3SQMA 1MYRA 4TV5A 1G4TA 3KBVA 4R9XA 1VKFA 4I6VA 4MB4A 4ZE5A 1GNXA 3MUXA 3GR7A 1V3MA 1KW1A 2VCBA 5D2XA 3RLGA 1JNDA 1JPDX 4O50A 1XBVA 4O1CA 4OTKA 4N02A 1CXHA 4ZXOA 1Z7AA 2O9OA 2FZ9A 3I68A 4LVGA 5D2VA 1OSEA 5HULA 2A4AA 4WVXA 1N2VA 4L6HA 1LG2A 1P0BA 3W72A 2DJXA 3NXFA 1QRQA 2CHNA 3POCA 4LUYA 3L4ZA 3ID7A 3CL6A 2V6AA 2Z2UA 1V79A 3TWAA 1ZBWA 5D9OA 4PCFA 5KINA 1O5KA 1DHPA 4LGXA 2J25A 2WMKA 2J7EA 5EY5A 5TF0A 4ZCWA 1TPC1 5C5YA 3FEQA 2F61A 1W9VA 3HGSA 4R7WA 3P0WA 4QLKA 3M0ZA 2FPVA 4PGLA 2DDXA 3T0DA 4J40A 1T5AA 3ZLGA 3DOPA 4S3DA 2QJIA 1TPB1 1RJPA 1HIZA 3OO2A 2VEGA 5D9NA 4FSAA 1G4PA 3UZWA 3UWWA 4IMDA 1R2SA 4UTWC 3G18A 3IVSA 3NQ2A 2VEKA 3WLRA 1TJ1A 5F1VA 4AVFA 3RM9A 3UR7A 2VP8A 3SUTA 2P10A 1HJQA 3IVUA 3SFWA 5I3IA 4TOQA 3NO1A 5SWUA 2ISVA 1Y5XA 4K2SA 5D37A 3S1WA 4KWVA 4RL3A 4NI3A 3WFZA 1XS2A 1S38A 2HRWA 3ERPA 1MEIA 5IOBA 1H1ZA 1YHTA 1R3SA 3W7CA 3GKAA 5DFAA 4O1FA 2FH8A 2RGLA 2GGGA 3NJ3A 3NXLA 1OHLA 3W07A 1I2NA 3CC1A 2O9RA 4YU1A 1Q13A 2BOFX 1WX0A 4PSPA 5BOEA 1US0A 3BG9A 1RPKA 1UOKA 3CYVA 4N42A 1X97A 4QLJA 4MAVA 3LLDA 1ONEA 3BOLA 4KS0A 4UR7A 4RZBA 1SVDA 1UH2A 1IYXA 5ABFA 3JRKA 1NELA 4WSJA 3QFWA 1GVOA 3K2GA 2FZMA 2VELA 3F2CA 3WMLA 4MY1A 4C6DA 2P0OA 4CNSA 2HS8A 1L2QA 3NTYA 3CUXA 1N7KA 4UNLA 3I6TA 2DSUA 1Q3NA 3W86A 1Y65A 4FHAA 2ATSA 1M7JA 4V27A 5U7SA 1AA1B 5LHFA 1RSCA 4JFSA 1VIWA 2PCQA 3W75A 1U1UA 1H7RA 1ZS2A 1UBSA 4GK8A 5BRQA 3AMCA 1X38A 1X8FA 4EX4A 1GVSA 1DV7A 1JDDA 3BJFA 1TJ2A 4B90A 4IGNA 4DJFC 1X7IA 3DFOA 4C6LA 3O3RA 3O1NA 1QATA 3A13A 2YA2A 4H00A 1E1FA 1XRFA 2QCDB 1VENA 3MDUA 3VOJA 1CBGA 3AQUA 1BVNP 1O60A 4Z1DA 2YL8A 1NARA 1L6FA 3T07A 4QE4A 5LGXA 2HVNA 2Q71A 1EGZA 4REQB 3UXIA 5A8OA 3W7MA 4MB1A 5FEPA 4C60A 4R27A 3WH5A 2OFJA 2PURA 2FTWA 3EMQA 1GVRA 1KQZA 1Q6GA 1Q7QA 1FWGC 1TX0A 4MWAA 3WZ0E 3CWOX 3AXIA 4S3GA 1EX5A 2VZVA 1MNZA 2A7RA 3KBMA 1W5MA 5T9CE 3ARYA 3P3BA 3MA8A 3AMGA 3B0PA 3WJSA 4IJCA 3W1NA 1PWLA 3RMEA 3PTMA 3AS1A 4Q8QA 4ZFCA 4P7RA 4EPEC 1OGGA 1RZMA 4DZAA 1UZDA 3UP8A 2NX3A 2Z26A 3BAKA 5G4HC 4KWSA 3EXSA 2WMIA 3WBWA 3IV8A 5FF2A 3NCOA 1NJJA 3M07A 4NX0A 4OZOA 1FWCC 4JNMA 3LTSA 4ZODA 2OQYA 3G22A 4HMNA 3TCEA 1P4CA 5I09A 2XFYA 1CECA 3QPEA 1C8QA 2ZZ3A 1PWMA 3V5OA 2FDMA 3HGRA 2P50A 1EIXA 1G7UA 3M7WA 2PC8A 2XSXA 1J0KA 4NXSA 3DFNA 3W7IA 3CZGA 1LCOA 1I1WA 3O8AA 3OGSA 5FI8A 3VMPA 3AIEA 3PBUA 3IJ9A 3M0KA 3CAWA 2BV9A 4KWUA 3MSGA 5J04A 1UA7A 3AIBA 1SR9A 3WQOA 2CLFA 2BBFA 1JRCA 4J7RA 2DVUA 3THQA 2VVNA 1YIXA 4C6FA 3WX7A 3M0MA 3SBFA 3W83A 3L68A 5A69A 3LHYA 2Y8UA 4XUYA 2VX7A 1VFHA 4HZMA 3WLSA 4Z2LA 4HNTA 2YDQA 4D72A 2ZUTA 3ARUA 1RK5A 2CWNA 5KZDA 1W9BM 4BF9A 3UCDA 5I00A 4J3TA 1GQIA 1F07A 3KBSA 1ISVA 1P43A 3DYMA 1ZALA 3JZUA 4F3HA 2Y2WA 3TEVA 5DMNA 1FP8A 3G5EA 2VMFA 3DG3A 5EMYA 1RVKA 7CGTA 3FX4A 2BX7A 3NDZA 4GQ0A 1UIOA 4HMCA 3PPCA 3AHXA 2P5NA 4IISA 1G1YA 3OA5A 4PMYA 4PCNA 2GPTA 1GZGA 3GNOA 3S8HA 3WF0A 1NOFA 2NXIA 1DORA 3KOXA 1B0IA 1WKDA 2O7SA 1THFD 4O0QA 2WB5A 5XIAA 5H1WA 2ODOA 4OJYA 2RH9A 1FOBA 4GUIA 4F48A 3NZRA 3CHFA 3A3WA 5FF3A 1EFZA 2E67A 1WV2A 4NRSA 1DIDA 2QAFA 4PRTA 4JX5A 4C7FA 3WFLA 4LBRA 3PM6A 1SR0A 2EPLX 3LBCA 3T0CA 4JEJA 2HNEA 2WJEA 4O4WA 4UQAA 1MSSA 1BRLB 5HDRA 3T4CA 1U22A 3CL8A 3EKZA 1XWYA 4KGLA 4KKXA 2PDJA 1WDRA 1BKHA 5D8ZA 4C6IA 3L4UA 1YNPA 4PMZA 3N2TA 4GYFA 2J8TA 3D46A 2YCKX 3EZ4A 3WY1A 3ZT7A 1W1A1 2CLLA 3LPFA 3OLIA 2ABBA 2HWGA 2CLPA 1TWIA 2OKOA 3M0JA 4KWWA 4IQEA 1M9HA 3CPGA 3FSUA 3LENA 3L2IA 1DIOA 4JTDA 3UXLA 1GW1A 1FP9A 1XIIA 4S2BA 4LEQA 2O92A 2B7PA 2WJFA 3A9BA 4FALA 1GQKA 2W9MA 4L1XA 1QNSA 4RE0A 4DWSD 3PAOA 3VIKA 4HPNA 3R0UA 5EPDA 4C1NA 1PTDA 4IMCA 4QEHA 2GFTA 2QYGA 2W4XA 1WP6A 2Y1HA 3NQBA 3PG9A 3ZLFA 3KCJA 4FIQA 3VAVA 1D8CA 1QTWA 3VUPA 3IWPA 1GQLA 2B4GA 5I07A 4R9OA 1EBGA 4AVOA 5HANA 2IPJA 4MG4A 3O2LA 5AC5A 5E9XA 4MY9A 4YL2A 5I24A 5CPNA 3TYCA 5A8NA 1LWJA 3LCHA 1UD6A 1EA0A 1US2A 4QHRA 5I2UA 1X39A 3W2MA 4JYDA 2ISWA 2VO5A 4H41A 1I9CB 4H01A 1ISXA 3DN5A 2DSZA 1LORA 5M17A 1Q7MA 3L4XA 3QHMA 4UFIA 3NNTA 4HTYA 2OX4A 3VNIA 3BTNA 1LG1A 1QHOA 1I4NA 1XRTA 5D02A 3U4FA 1SMAA 1XSJA 4ACZB 3KS5A 5REQB 4JFTA 3FHQA 2OT0A 3SIZA 4Z2KA 4PUWA 2Y89A 1ZY9A 4E38A 1XIJA 3CHEA 5BXTA 1V7AA 3UY7A 1XLFA 2J8FA 3GB6A 3L4TA 4EWND 4WKFA 3TIMA 5KEZA 2QZRA 4GRSA 1VGAA 2XGBA 5AHLA 4QCEA 1SU5A 3W3OA 4A3HA 4QIUA 2WSPA 1IEQA 1V77A 4WSHA 4U33A 3AMDA 1X6NA 2HBXA 3TOPA 3VD9A 2F6UA 2X16A 5DT5A 3R6IA 3ARXA 3MBFA 4CNPA 2QJJA 4HOXA 3B9AA 4NAFB 3FGCB 5DRCA 4Q7IA 1AZ1A 3A3HA 1LROA 2Y88A 4ZO7A 5FJIA 3MMDA 3V4BA 3BOFA 3S1GA 3ZJKA 1SQ7A 3GX9A 3ZR6A 4NJHA 2XVPA 1OT2A 1RLDA 3LK6A 4X0VA 4Q8WA 4P5UA 3M44A 1U1JA 3N9RA 1Z9AA 3H55A 1XSIA 5A6BA 2V2DA 1CTNA 2OEMA 1ICSA 2WM0A 4V33A 3TN3A 4HPHA 3LZ5A 3MZ2A 1HZYA 4RDYA 3WMSA 3I4KA 2GWGA 3R10A 1LTDA 4US6A 2XVKA 4R5EA 4QM1A 1KFBA 4U28A 4JQ3A 5F4SA 1FWFC 3UA4A 1M5WA 3E12A 4XD3A 4PB5A 1UKPA 3WLQA 3DC0A 3F5JA 3CZEA 2Z4GA 2W92A 2OLHA 2QDDA 2BVWA 2ZUNA 1QMLA 5EBAA 1PKLA 5DN1A 3WMCA 2OLSA 1GUVA 3VIGA 4GX8A 1V7YA 3WD0A 3UWYA 4Z1YA 4W89A 2R24A 1C91A 5F2LA 4PUKA 2GOUA 2OEKA 4AHPA 4G2DA 1N8WA 3W7GA 3WQ4A 1CX9A 1MDRA 3BURA 3OVPA 4XZBA 4YS1A 1FHDA 5HNNA 1OGSA 2A3HA 2CKRA 3A4AA 4GACA 3I7RA 4Q7BA 1HKIA 5DXYA 1R8LA 3UGRA 4PMDA 4DRSA 1QNRA 3P5YA 1TV3A 1NWUA 3KX6A 1Y5VA 4YXGA 2YW3A 3G3MA 3M0XA 3A4WA 5A6AA 1QNOA 3TQPA 3VKCA 1E9ZB 3PB0A 4HHPA 5JVLA 3H23A 3B8SA 4GZEA 4Y7EA 2ABAA 4EP8C 4MWAC 4PTDA 3BANA 4M80A 4I7UA 2WNZA 4W85A 3CLWA 4D2JA 3VGEA 1ME9A 1CXKA 3B05A 4AIOA 1BGGA 3LSCA 5CBIA 1XLKA 2V81A 3V18A 4PMJA 3H7UA 4W84A 4CCDA 3O6AA 4IIFA 1A4LA 4YTTA 4A8IA 3L5MA 4K8HA 4AX7A 4LVDA 3SCRA 3QH2A 3ANUA 2WSYA 3LHTA 3MPGA 3B4UA 1PZ2A 2H90A 1Q66A 5AYYA 3FY1A 4XVEA 5DCEA 1B3WA 3E0VA 4OUEA 3GIPA 1E72M 4RDZA 1XYCA 2WHKA 3U8GA 1J93A 1NDYA 3TSMA 3DG7A 1EBHA 1KFLA 4JIHA 1AJZA 2WVUA 5CPLA 2VGGA 3A24A 4F66A 2NX9A 1OCQA 3LHVA 1P0EA 1UASA 5G2HA 2NQHA 3PWIA 3CIVA 1PKMA 3LRKA 1RH9A 5KITA 2G37A 3LXAA 4MM1A 4LH8A 4M3PA 1YBQB 1I2PA 3N15A 3VCCA 1G4SA 2C79A 2YXGA 1AL8A 4H2HA 3TXZA 3OA3A 2HSAA 1TPH1 1CGWA 1S2TA 3QQWA 1W5NA 2ZYFA 2PTDA 4C90A 1AD1A 1F7BA 4FXJA 4K1WA 1FWEC 3BXWA 3ITTA 4LUSB 2ZVIA 1T0OA 3UR2A 1OX6A 4H83A 4H3DA 1JYNA 2Z29A 1EXBA 1OIFA 1F05A 1KQYA 2G8ZA 4ICMA 1YXCA 5B7YA 2HEJA 4LNYA 3XISA 1UW9A 1ML1A 1MXGA 3TUUA 2YW4A 4NYUA 2XJ7A 2E7FA 4LJ3A 3DGBA 3QVQA 3AISA 1F61A 4CD4A 4D6DA 3MBDA 2DZPA 4JTUA 2A2IA 3T42A 1EA9C 1MQPA 1FWRA 1BHGA 3KVKA 2DGAA 2VGIA 3RM8A 3GZAA 4FS9A 4E2BA 2ALRA 1TRIA 4JKLA 4Y9AA 4MJZA 5HWNA 5JH1A 4NU7A 3QSRA 2FZ8A 4HHLA 4JHOA 3R12A 4F8XA 2DORA 2IKHA 1VC4A 5BRPA 1D8WA 5C71A 3LX9A 1NY1A 2PC4A 3WLIA 3RK8A 5L6UA 3W01A 4Z2GA 3UW6A 4M6VA 3HMCA 1MFVA 3BLLA 1GVFA 4PUNA 2QUMA 4EXBA 2OQHA 3S1VA 1PB0A 2YB4A 1H2JA 3MUIA 4QSHA 3IUIA 1KO0A 4WLCA 2FVKA 3F2DA 1Q2RA 3UCCA 4GVFA 2Z00A 5CLWA 4IL2A 4PMVA 1XG4A 2G50A 4F4RA 1ZAIA 3KLLA 2YZRA 5AY7A 2C0AA 3B8UA 1G7VA 1J01A 2FGBA 3BLDA 2QCMA 3PR2A 5C9XA 4Y96A 5MF5A 2VFHA 2GGIA 3URBA 3KP1A 3G1DA 2GJLA 1BVZA 3HQPA 2VOMA 1VFMA 2OOFA 9XIMA 2ZE3A 4M6QA 4W86A 2HK1A 2J7HA 2D0GA 3MJYA 3RGTA 3BLEA 3DCPA 3QXBA 1QI0A 2OSXA 4XD5A 2DZVA 4M51A 1NWRA 1NWSA 3GKFA 4IL0A 5G2WA 1TREA 3DYPA 3PULA 3MB9A 3WLMA 2GJPA 1OX4A 3WMBA 4K37A 5E1QA 3RRAA 3NQ7A 3VGHA 2ZX8A 2E6DA 5EMLA 3QMRA 2PSNA 4QJ1A 2BXZA 1HXJA 4KIEA 3VILA 4DXKA 3VNMA 7XIMA 4UTUA 1Z41A 4DI8A 1TTJA 2QCDA 3RG6A 4YYFA 4OKDA 2WZHA 2ZRWA 2E6YA 3AALA 1GZJA 3LXCA 4KT2A 1XBXA 3NSXA 5KZ6A 4W9TA 3ZLHA 4HSHA 2A1YA 3W7PA 1QOXA 1KFEA 3NIYA 2YCIX 4LVFA 2V68A 2DH3A 2P1FA 2ZRZA 5DY3A 1VF8A 4JEQA 1IEIA 2G5WA 4DO4A 1RLCL 3WK3A 2ZC8A 3CTLA 4S3CA 2B31A 2PU1A 1TTQA 1XW8A 1FRBA 5D32A 1YDOA 2PDHA 1FFRA 3PFRA 4AEFA 4AZCB 1LL6A 1T40A 2Y8VA 1HP5A 2RDTA 5FEZA 1UMYA 3CLMA 5CZSA 4GOAA 5CQ1A 2X09A 4HJWA 4JQ1A 3W00A 5LZLA 1OGBA 4YLWA 4B15A 2DIEA 4L9XA 1YMYA 4B16A 1M7PA 2ZE0A 3ZJ8A 3SCOA 1O95A 1EQPA 3PZGA 1OFOA 2JGQA 1BF2A 5EBUA 3G1SA 1CI1A 1YE4A 1DYSA 2E1WA 5GJNA 1VFLA 3PZTA 3H21A 1LWHA 4P8VA 3AYRA 1M41A 3OLDA 2ASHA 5LA1A 1R3VA 4C6KA 4G8TA 3VA8A 4HZ6A 3UA3A 3GDKA 5AHFA 5IFPA 4JTIA 4HNNA 2V38A 3UYIA 1X6LA 2OZTA 3NA8A 2XISA 4GGHA 4ZMGA 1X96A 4JKKA 1FHUA 1LZOA 5CPOA 2VVSA 3B0XA 4PCTA 3LMZA 2HK0A 4BJHA 1ZRQA 5HOSA 2V5DA 5LA0A 1HO1A 3SW6A 3CU2A 3ABOA 2AMGA 4LYRA 1TG7A 5HJXA 3TZFA 4AD0A 4C5YA 1Q2SA 4LUTA 5JIPA 2Y61A 4WOQA 3UZXA 2X0YA 3WBXA 4KERA 4A8NA 3E0LA 4UTLA 3O15A 1A53A 5ECVA 2ZZ7A 2VEPA 2UWFA 1QK2A 3ZWTA 1FBAA 1TV2A 1VFOA 3G1HA 3EMCA 3BDKA 1WA3A 3QZ6A 3HZ3A 4QGCA 1R86A 3A21A 5CPTA 3BG3A 4IXXA 4OVXA 1TPEA 4AFYA 3KAOA 4Z1CA 3DENA 2CBUA 3ELFA 3VNJA 3SJNA 3NUKA 3UGVA 4NASA 3RPTA 4ORIA 1HJUA 2E40A 1PIGA 4DWDA 3KTCA 2BOGX 5TQLA 2VFEA 2WC4A 1UROA 2QCEA 1PO9A 3QR3A 4GYJA 3SZ8A 4RPPA 4AY7A 1GT8A 2DUZA 4X60A 4AYSA 5IHRA 3SCNA 1RCOB 1IZJA 4IQLA 3E6EA 3K46A 1F4HA 1FWJC 4RLIA 3TDFA 5FEWA 2Z27A 1JI1A 3SRKA 4KETA 1OB0A 3Q45A 2VI0A 3VD5A 3IGHX 1S2WA 2AL2B 3F2BA 3STFA 4NUWA 1W1IE 4WDXA 3BO9A 4ZTYA 4XUGA 1P48A 4M56A 1KCKA 4PB4A 5BXSA 2DH2A 1WE5A 1UWUA 4S3AA 3VNZA 3MVIA 2Z6JA 5HNTA 4IFKA 3ZFHA 1Q8JA 4GC4A 1W31A 3TMQA 5AYBA 1S2AA 5M2FX 1EUAA 4KWOA 4OV9A 1BYDA 1QI2A 4GYKA 3DERA 3OG3A 3STCA 3FVDA 5IDIA 4NF7A 2PDCA 1MRQA 1Z3NA 4GKTA 4MDPA 4EWJA 1IZCA 4C1KA 4NVTA 1FH7A 4O12A 1NFPA 3UNDA 2HXTA 4DUWA 3PFMA 4MY8A 3SRDA 4JTGA 3PK7A 2JFEX 1SFTA 4J3ZA 4QE1A 5A6BD 1KXHA 3BAJA 4R7OA 3EX4A 3PHAA 5GJMA 4CN6A 4O1AA 2PWDA 2XIOA 3QYQA 4UQEA 4LEFA 1J2WA 4DF1A 3LV6A 1F6PA 3WEMA 5CSUA 3TA9A 1A5UA 3HF3A 2I5GA 3B9EA 2DIKA 2A7PA 1RA5A 4ZO9A 2AQWA 2NV9A 3S2NA 2CESA 1PZ1A 1WXZA 3O9NA 2BGQA