4XO6A

Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3 alpha-hydroxysteroid dehydrogenase type 3: structural clues of 5 alpha-DHT reverse binding and enzyme down-regulation decreasing MCF7 cell growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 116
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xo6A00
4JQ3A 2I16A 3UGRA 3F7JA 2FZ8A 3LZ5A 1PZ0A 3QKZA 3CV7A 4EXAA 4IJCA 4QBXA 4F40A 3CASA 3U2CA 4ICCX 5JH1A 3R94A 2PDKA 3RX4A 1AH4A 4XZIA 4H7CA 3R7MA 2NVDA 1X98A 3T42A 2DUXA 4JIHA 4JQ4A 2R9RA 1S1RA 4XO7A 4LBRA 3N6QA 3LNMA 4L1XA 2INZA 3BCJA 4GABA 5LIYX 2PDBA 2PDCA 4GQ0A 1S1PA 4JQAA 3CAVA 4WDWA 4R9OA 3V0UA 1JEZA 2HEJA 3LQLA 4FAMA 5AZ0A 3LBOA 1FRBA 1QWKA 4PRRA 2PDJA 2NVCA 3GHTA 2I17A 2IKIA 4HMNA 3M0IA 3UZXA 3WCZA 3UZZA 3ONCA 3C3UA 4GQGA 2ISFA 3M4HA 1Z9AA 3CMFA 3WBWA 2FGBA 3WG6A 3RX2A 3LQGA 1M9HA 2BGSA 4AUBA 1RY8A 2HE5A 1Z3NA 3V0SA 1VP5A 3GHSA 3G1RA 5LIKX 2FZBA 4EXBA 4XO6A 2PF8A 4JQ2A 3BUVA 1K8CA 1VBJA 4PMJA 2PDMA 3COTA 4QR6A 4ZFCA 4WDXA 3UFYA 1PWMA 2PDXA 2PEVA 1YNQA 2PDPA 1ZUAX 4JIRA 2IPJA 5HNUA 3LN3A 4QX4A 2PZNA 2C91A 3FJNA 3N2TA 3NTYA 3EB4A 1MI3A 2PD9A 4L1WA 4WRHA 3UZYA 3LENA 2AGTA 3R58A 2HVOA 4FZIA 2VDGA 2IPGA 1EKOA 1MRQA 2DUZA 4G5DA 2HE8A 3WBXA 1RALA 3CV6A 3O0KA 4HBKA 3H7UA 1X97A 4FALA 3EAUA 4DBSA 2WZMA 2DV0A 1ZSXA 3BURA 3M64A 3ONBA 4XAPA 4IGSA 4GA8A 5LIXX 1GVEA 1LQAA 1T41A 1ADSA 1YE6A 2PDUA 2IQ0A 3V35A 4XVEA 4LBSA 4ASTA 2J8TA 3R8GA 3LZ3A 1IEIA 3R8HA 3Q67A 1HQTA 2IPFA 4GIEA 1EF3A 4Q7BA 4PRTA 3H7RA 1Q5MA 3Q65A 5C7HA 1EL3A 3EB3A 1A80A 2IS7A 4RPQA 2PDHA 3UYIA 3RX3A 1SM9A 1LWIA 4LAZA 1YNPA 2ACQA 5HA7A 4Q3MA 2ALRA 2PDQA 3MC5A 3O3RA 4LB3A 3LD5A 4QXIA 2PDGA 2HV5A 1Q13A 5HNTA 2P5NA 3DOPA 4YU1A 1AH3A 5AZ1A 1ZQ5A 4JQ1A 1OG6A 4WEVX 3ERPA 2WZTA 2IKGA 4YS1A 1EXBA 2A79A 1QRQA 1XF0A 4WGHA 2FZDA 5LIWX 2ACRA 3WBYA 4XZHA 2IQDA 5M2FX 3DN5A 4WDTA 1S2AA 1Z89A 3UWEA 1X96A 1R38A 1Z8AA 1XJBA 2PDNA 4H8NA 2CLPA 4XZMX 1HW6A 2F2KA 4WDUA 2HVNA 3CAQA 5JH2A 1J96A 3KRBA 2IPWA 2PFHA 3FX4A 5LIUX 3S3GA 3LUTA 2BP1A 4PR4A 2IKHA 4JTAA 1PYFA 3UZWA 4MHBA 2FZ9A 3VXGA 4JIIX 4JTDA 3UG8A 2BGQA 3MB9A 3B3DA 3GHRA 4YVXA 1YE4A 2PDIA 3P2VA 4OTKA 4DBWA 2F38A 4DZ5A 1ZGDA 4JTCA 4NKCA 2PD5A 4PUUA 1UR3M 2PDFA 2IKJA 3D3FA 4DBUA 3H4GA 1T40A 3V0TA 5KETA 4LAUA 1AZ2A 1XGDA 3GUGA 3BV7A 2PDLA 1C9WA 1US0A 1AH0A 3G5EA 2PDWA 2PDYA 3R43A 2ACUA 4GACA 1IHIA 2HDJA 1PZ1A 4I5XA 1PWLA 2R24A 4YVPA 4XZLX 1AFSA 3R6IA 4XVDA 5DANA 4GCAA 1AZ1A 3UP8A 4FA3A 1MZRA 4XZNX 1RY0A 4PUWA 4JTQA 2QXWA 2FVLA 4LB4A 2INEA 4JTRA 4IJRA 4XK2A 3GHUA 4YVVA 3V36A 2ACSA 3LEPA 1S2CA
chains in the Genus database with same CATH superfamily
4B90A 2Y8KA 3F4DA 3RM9A 1KBIA 3L66A 5FJRA 2H8XA 3RLUA 1JXJA 3JZUA 3W76A 2RDTA 1FHUA 1PZ0A 4F0RA 2JGYA 2YL8A 3QH2A 3TTSA 3WD1A 4DJDD 2VC7A 1AH4A 3AIWA 1JCMP 3GUWA 2Z1XA 3WDHA 2GJXB 4LFYA 3BC9A 4NZ1A 3PZGA 1U1UA 3PAJA 4MY1A 1P6WA 5IM51 4JQ4A 1S1RA 1GQKA 3LLXA 4PTMA 3I10A 3VOGA 5HPOA 4O0KA 3L5MA 3TV8A 1QW8A 3U8GA 3W22A 1I2RA 1IE7C 2QCMA 4WVXA 1FWTA 1UMLA 5B80A 2D0GA 1W1TA 5KTLA 1W6TA 1CBGA 2OSXA 5EMUA 1VRXA 2CERA 5CSYA 4E2DA 3E5PA 1IYXA 5DMYA 4QQ3A 4A4AA 3MWAA 5HWMA 3VZZA 1E9YB 4U4MA 2NQHA 1ZP3A 3TTEA 4J7RA 2XU2A 3GXIA 5F1VA 3UJFA 3UZZA 5EMYA 2FHFA 2V63A 1VCGA 3W82A 4WY0A 2ZC8A 1BGAA 1SSGA 4DO4A 4OUIA 3W1QA 3CH9A 3QV8A 1KM4A 1EJRC 3CHEA 1KXHA 4R5EA 3GTIA 2Y5JA 4H2CA 1G7VA 4AC1X 1JCNA 1UKQA 3CPUA 3OVGA 4HOWA 3ARUA 1H61A 4JHZA 3T2OA 5D04C 4WK9A 4NZJA 1UZDA 3ATZA 4O17A 5G1MA 4D8ZA 3A12A 3A23A 5CLTA 2XH7A 2J77A 3ZJ7A 3T2QA 4DRSA 3GWQA 2BXYA 5AVNA 1H3GA 4PMJA 2XGZA 1UOKA 1W1VA 4A3RA 4D72A 4N9DA 1AL8A 4QR6A 4WDXA 1TA3A 3W70A 3AU6A 4O8AA 4IMCA 4ZOCA 5C70A 7ENLA 3QR1A 3LU2A 3P7YA 4AW7A 1XFCA 3TN3A 1NU5A 1JYXA 1AK5A 1Y65A 3BK0A 3DIPA 3EB4A 4YTSA 4GWEA 3WJYA 4QGCA 3M6DA 3MZ2A 1HVXA 2Z1KA 3EWXA 4Q7NA 1V77A 3AXIA 4ZOEA 3EWZA 1MRQA 1X6LA 4YNGA 3FKRA 3CV6A 2YA2A 4JTKA 2BWGA 3KL5A 2Y5SA 1N55A 5MF5A 1K7FA 2WZMA 1QHZA 1UROA 4Z2LA 3UJRA 4GVFA 1NF0A 5IRPA 4H9ZA 1QI2A 4FI4A 4I9TA 2YDSA 5L9FA 1XYZA 4B5VA 5BOFA 1KO0A 1B3XA 4P7OA 4GIYA 3V35A 1TJ2A 2W9MA 3AHVA 1EPXA 1JI1A 3OZYA 2I9EA 2PBGA 5G4WA 4D1IA 2J9XA 4O11A 3EB3A 1VEPA 4HK7A 1Q6GA 3GIQA 4IIEA 2VX6A 4DJDA 2ZADA 1E6NA 4R85A 1G7UA 3V18A 4JY8A 3TNBA 3LERA 2E77A 2Y7EA 1Q63A 1SJCA 4UBPC 5AYYA 2ZA1A 3W7GA 1M53A 3AQUA 3BDKA 3V5OA 3M0YA 4JCMA 4CN6A 2YYTA 3BV4A 1X8FA 1LM1A 2X1RA 3SCNA 4JFVA 5FEWA 1OINA 5TAOA 1I6NA 3UWQA 1U1JA 4UQEA 4GQQA 4XBSA 3WQWA 5K9DA 5CG0A 3F5LA 3WUGA 1M7PA 1UR0A 3GIPA 2C19A 3EKZA 4LSBA 2W6RA 1K9DA 5A2AA 5GNZA 1V7AA 2QV5A 4NL1A 3I3EA 3I7RA 4MSSA 3GNDA 4Q6JA 4LV4A 3IJDA 3TJLA 2CCRA 1H41A 3WEOA 4W84A 1MEIA 3SCVA 4KBXA 4P8XA 9XIAA 4H2HA 4L9XA 1HG3A 3TDFA 4LWWA 3P5YA 4DO5A 5EYWA 1OK4A 3UCCA 2CLIA 4LCSA 1HP4A 1F6PA 3W1XA 3GNNA 4EIVA 3TYDA 1SUXA 2OGJA 5A6KA 2F38A 4X22A 1POJA 2WW5A 2XIBA 3C0LA 1SSDA 4NI3A 4H04A 5I02A 4AD5A 3TSDA 1O66A 1EXPA 1XRVA 1XUUA 1NFBA 1TYGA 4FHAA 5I03A 1V0LA 4QE4A 1NH6A 3E3HA 2WSKA 3FA3A 3NQ6A 3AIVA 2YCLB 4IG2B 5E6YA 2CYGA 1OIMA 3EKLA 4W5ZA 2GSHA 4RCXA 3CZLA 2VKZG 3NO1A 4HA4A 3OGVA 3UERA 4GHRA 3CEUA 2BHYA 1H0IA 2FZNA 1FTXA 1PWLA 4ZE4A 4LBUA 3W9ZA 5GQBA 2EG8A 4DYEA 4H3DA 4DJED 3R6IA 5A6AA 1K4GA 4CUCA 1EC9A 4Z08A 3T4WA 3D46A 1KFKA 4FXSA 2X1TA 2BXVA 1NP0A 4PTXA 2WHJA 3W23A 4LS0A 2VURA 4KEMA 4FLSA 1QPOA 3H53A 1KV8A 4LNYA 1EFZA 1HKIA 3QYQA 3MW7A 1XXXA 5I78A 4L7ZA 4QIUA 1QPKA 3S1WA 1U5HA 4J9JA 2DU2A 2CWNA 4CNNA 2WHLA 4CEUC 1HL2A 1PX3A 3L4UA 4DWSB 3L5LA 4IT1A 3P67A 1QK0A 1XINA 1VGAA 2FPTA 1NWUA 3W29A 2PP0A 3P93A 4TV5A 2P50A 2NXHA 3TXVA 5CZ0A 3NYZA 4ZBCA 2GK1A 5G5IA 4F2BA 2UY2A 3I4KA 2ZX6A 2AMXA 3OIHA 3W1UA 4P8UA 1B3YA 3OZMA 3RHGA 1TWIA 4C6OA 1VCFA 1AD4A 3BGGA 2W0UA 3O6CA 2JKAA 5D09A 3PVFA 5BRPA 3MZNA 4MZ8A 4S3DA 1NDWA 4FAMA 1REQA 5FCZA 2RJGA 1GVOA 3M0KA 1K02A 1EYWA 1FRBA 3DDMA 1IEWA 4S3EA 2VWSA 4UQAA 2NVCA 1BXNA 1XH1A 1TIWA 3E0WA 4MWAB 3VKDA 3BL3A 4FLRA 1KM5A 3ABSA 3W4RA 1G4SA 1A5CA 2X1UA 3WNMA 4UZUA 1I2OA 2PWHA 4IP5A 1ZHAA 1OYAA 3VC6A 2X0HA 3EDEA 1BRLB 3AS1A 4HSHA 4W8BA 4P7RA 1JL8A 4FR6A 3VX1A 1AJZA 4DAFA 3ABRA 5CPNA 1NTHA 5HJLA 4JYFA 3AZRA 3M5ZA 2R1LA 3KVJA 3GRIA 4HGXA 4C6IA 1K8CA 3URAA 3C2FA 2ZE0A 1UWUA 1EH9A 2YCKX 4AVOA 3WJZA 4XAGA 2DZPA 3EA2A 3FN9A 4QS6A 4DXVA 1K6AA 1L9WA 2PDPA 2YL6A 3S1VA 1FWNA 1OCNA 4H6RA 2NV9A 4CVUA 2XZ7A 2O4MA 2CWXA 2RDXA 1MNZA 2Y0FA 3QHMA 3RJYA 1P7TB 3NTYA 3Q4DA 3CWHA 2Y63A 1FWSA 2J7FA 2IMRA 3KP0A 1ZLPA 2VDGA 1CLXA 3N9SA 4CKQA 3SM0A 4WUIA 3QC3A 4DJEA 3V3WA 3O0KA 4P61A 8RUCA 2YDRA 4TU1A 3VE9A 3NQVA 1KBLA 1WXZA 2QCLA 3M64A 1YXYA 1DKWA 3EWUA 2ALDA 4IP7A 1MEHA 5CJNA 1B5TA 3BQ5A 5AHIA 4D71A 4HZ8A 4GVGA 3N1AA 4CU8A 3OJGA 1KKRA 1LT8A 2G3MA 2PRHA 3BOFA 3FHQA 3SCRA 4WSKA 3VNDA 1HQTA 3HFYA 3VIFA 4HPJA 1GHSA 1UP0A 1ZALA 3TYAA 1KBKA 5C7VA 1DTUA 1QMLA 1DWHM 4ORMA 1QTWA 2IS7A 2OX4A 5CZTA 4PSRA 4RDYA 3AIQA 4HU0A 4JKMA 1CENA 3SUWA 1J10A 4LAZA 4ZO7A 4EPEC 5G2HA 1E1CA 1UWRA 3CWNA 3WLQA 4CCEA 4EPDC 4GI9A 1ADDA 1R85A 5KZ6A 1UD5A 1TRDA 1YQ2A 3TR2A 4AF0B 1XLJA 5I3KA 3WMLA 2VWTA 3CPRA 3W38A 4JL1A 3MT1A 3THDA 4JQ1A 1GG1A 4W85A 2ZUUA 4WSHA 3AMDA 1GEHA 4RZ4A 4B5UA 3MKVA 5F2MA 3QR0A 3H2CA 2O92A 3TQPA 1CTNA 2RDWA 1K9EA 4KCWA 4YS1A 4ZA0A 2GUYA 1LOLA 4CD7A 1QRQA 3T9PA 1S38A 3ES8A 4ZO9A 1TE1A 4WGHA 4QHRA 1ZENA 1X1ZA 3AXHA 3EEGA 4GY7A 2GGJA 4KETA 4LAOA 1TV3A 3Q94A 1A5UA 3L0GA 1PX8A 3A4JA 1F3TA 4WDUA 3AS3A 3WF2A 1DJIA 1RR2A 5A2BA 3RYSA 3FKKA 2HMCA 4DI8A 4E2OA 3L4ZA 4BKNA 1SPQA 3IJLA 5AC6A 2ZXBA 2XFWA 1YDOA 5F4XA 3CUIA 1VBRA 3H2MA 5D9NA 1OD8A 4JX4A 3VXGA 1MQPA 2V2DA 1PL9A 3WQPA 3IK2A 2E28A 1IIHA 4ADUA 1MWOA 4CU6A 4WY0F 3AMGA 4QNWA 1J0IA 1MFVA 1XGZA 4J35A 2NSOA 2TMDA 1YPFA 4MAZA 2C1IA 4JAWA 1FKXA 5FKYA 3NQ2A 3EX6A 4Y6GA 5CC3A 3Q58A 2BOFX 1UR3M 5C54A 3TMQA 2ZRWA 2WQPA 1OD0A 1CT5A 2R82A 4WJEA 1HL9A 5K4XA 1RXOB 4AHOA 1RSCA 5E5CA 3P74A 1FWHC 3AWOA 4WXZA 5CC7A 1XIHA 4Q7IA 5C9RA 4HZ6A 3KRZA 2FKPA 3TROA 6ENLA 1TVPA 4AMAA 3MI2A 4GYJA 3VABA 4KIRA 2CLMA 4KEZA 4BCEA 4C6QA 2FGZA 3HPAA 3SSZA 2Q09A 3P8JA 4WJXA 1VPXA 5LA2A 6ALDA 2E4TA 2X40A 3DFHA 3R25A 3IIPA 1QNVA 1PIGA 1UKPA 2V8ZA 1BSIA 4M29A 4AD2A 2QUMA 3SUTA 3SIMA 1S2CA 2JFEX 4JQ3A 2OZ8A 3HJZA 4GBDA 4Q4QA 3QPYA 4PUDA 4XUGA 1XDLA 1Z32X 4PBEA 3ABQA 1TVNA 4AHPA 1K8XA 2ABBA 1UH4A 3HF3A 3N2OA 1XLAA 3AALA 1A5MC 1TPFA 1DBTA 3Q45A 3L67A 2NUYA 3BLDA 1QPNA 2TRSA 2Z25A 3A5FA 3VGGA 3C0JA 3JS3A 1J5TA 1M7JA 1XD1A 2DW7A 2VFEA 1IT8A 4A21A 4P7QA 4PCFA 3KVMA 3VO0A 2OEMA 4XZBA 2ZZ5A 1DE6A 3T0TA 1RBLA 5I3FA 2VI0A 1WB0A 3ZLHA 2DZAA 3CHCA 1B0IA 1Y0EA 1HGYA 2WHMA 2FTPA 1VKFA 3GC4A 2FQIA 3KOFA 2YLLA 3GXDA 4W88A 4BQ2A 5LYRA 2R91A 1UD8A 3VGFA 1OX4B 1EJTC 1Q2SA 2YXGA 4UFKA 1TQXA 3DI1A 4GJIA 2WJZA 2OR2A 1F2JA 4UFJA 3NPUA 1DTNA 2X16A 2VGIA 3AYVA 3ONCA 4CQDA 3W1RA 2ZQ0A 2FTWA 3FA5A 2ZZ4A 3PZUA 4TXEA 5CZSA 2C16A 3NPWA 4O4VA 3FYPA 5DX7A 3GXPA 4HCHA 2EPMX 3WG6A 4H6QA 3QQ0A 2O0TA 3N18A 3ABOA 4Y9PA 3TXZA 1SMAA 3KWXA 2WPBA 2I57A 2DT1A 2PF8A 3SY1A 3G1HA 1UWQA 2I5IA 1P6CA 4JTLA 3WQEA 3RDKA 1I2NA 1TRIA 1RCXB 2ZX9A 3G3MA 4S3CA 2A3BA 3R0DA 1F8IA 5HR6A 1RJRA 5A8MA 2QJIA 3PF3A 3IVUA 3SN4A 3CZEA 3LHYA 3EXRA 5I5RA 3LBCA 2BTMA 4ZEPA 3S4TA 4OOUA 1O4UA 1Q7QA 2BVWA 5DN1A 1L6SA 3W7JA 1J6PA 4OOZA 6REQA 2E3ZA 2C91A 4HSOA 4NAFB 4C6NA 2HROA 1ZCCA 5GJPA 5EBUA 2DZXA 1TJ1A 3ZXWA 3W2NA 1ZAIA 3EAUA 1O94A 4XAFA 4YYFA 1XIBA 1D9EA 3BH4A 4Z1BA 2ADAA 4XAPA 2FHCA 3LPOA 4HOZA 5LIXX 3GNPA 3NO3A 3WD0A 1YTDA 4Z2IA 3LLFA 1D3GA 4A22A 4QJ4B 5AYIA 3W1NA 3THAA 3HFTA 2A3EA 3N12A 4S39A 1GOKA 2TAAA 1MVYA 4UZSA 4F4RA 2D2HA 2GLKA 5AHMA 2OVLA 5IHRA 3G0UA 4IJBA 3Q65A 3OQEA 4MFDA 4Q4RA 4C1NA 3MCNA 4RPQA 4OBTA 1WKYA 3SN0A 1DHKA 4ATLA 2BNJA 2G3JA 3VOFA 1ZB5A 4CQBA 4LV9A 3QOKA 5B7YA 3DYMA 1QFEA 3IIVA 1JQVA 3VAVA 1ZTVA 2H90A 2Z00A 4RLIA 1QBBA 2HV5A 5I07A 1EDTA 2HWGA 1K7EA 2OEKA 5GVJA 1GZGA 2EQDA 3E2RA 1FCQA 4LAKA 3EPMA 3W74A 4HNUA 1OFQA 4WKFA 4PL1A 3EX3A 3FVMA 3KL3A 1OFPA 3KBWA 4AWSA 4PUKA 2H9AB 1DXFA 4XWUA 2F6UA 1RAKA 3TN6A 4I9AA 3M0ZA 1XLMA 4URIA 4G8TA 2NZLA 3SQLA 2VEIA 2VRKA 1FP9A 3DKJA 1Z8AA 3VOHA 1TTIA 3JZEA 5EPDA 3CHVA 4MNJA 2XWEA 4X0NA 4MB4A 2BMBA 3PZQA 2WNZA 2OX1A 1EPVA 1WAWA 4BR1A 3EDJA 3FX4A 3WH8A 4EF8A 2BP1A 1TR1A 4QJ5B 4LY8A 1K6WA 2GGGA 3UNTA 2J62A 3WUEA 1F61A 3IGHX 3WQDA 1T0OA 1H0GA 4K37A 2XN2A 3GZAA 3WLSA 3W81A 3P2VA 3Q37A 1VFTA 1F73A 2BGNE 1UPMB 4DZ5A 1TZ9A 5HR7A 4DAIA 4D6HA 4MM1A 4HCLA 1LZOA 2YFOA 2DT2A 2YBUA 5DT5A 1QOXA 1RVKA 1M01A 2BODX 1PKMA 1V51A 1K4HA 2ZUMA 3WNLA 3WBEA 1I8JA 4BI5A 1IEXA 1QPQA 1TTJA 3LHUA 2A3AA 2V5DA 4JL2A 4A6GA 1EOKA 4LUSB 2WVTA 2HS6A 1Q6QA 1LRNA 1W9VA 3KZSA 4L4LA 3ZIZA 4J3VA 4KGJA 3VYLA 3N04A 3AYSA 1PHWA 4AY7A 1SFJA 4A2RA 1ELSA 3TA6A 4XZLX 1H1NA 5FF0A 1F8MA 1TV7A 4XZNX 4YCOA 4HN4A 2BASA 2CETA 3HPFA 1Q4WA 3P60A 2QXWA 3F2BA 4QAIA 3TIMA 2QUTA 3OLGA 4GJJA 1XIIA 4E4UA 3OA3A 1Z69A 4FXFA 1E4MM 1XI3A 4XKYA 3DAQA 1EIXA 4ONVA 4NJGA 1Q4NX 2X05A 2WKLA 2EEXA 4AWUA 1GEQA 3IJ6A 1OADA 1XR2A 1MRAA 3RLVA 4S3AA 5CEWA 1RQHA 3LTPA 3UXDA 2IUZA 1XICA 3AJ7A 4CEXC 1SR9A 2VT0A 4H7CA 3CUHA 2NVDA 3GXFA 3S1GA 3QQ1A 1K8ZA 2QYGA 1V0KA 1CYGA 3N2MA 4V2XA 3AIUA 4M56A 1XPGA 4U2YA 3ZVHA 3DERA 4UQ9A 4AYSA 2BY1A 2VFIA 1I60A 4OFCA 1PBGA 4LBRA 3ZSTA 4YTRA 5C0QA 3W1LA 3FY1A 1LBLA 4ZSUA 3FJ4A 3DG7A 2PCQA 4GMEA 1XIJA 3QM3A 1UZ4A 2ZZ1A 1JFHA 2P3ZA 3THCA 1OC6A 1ESWA 4FIRA 1WUEA 4ML4A 1S5WA 3A5VA 3LI1A 1KM0A 3O8AA 3W7LA 4C6LA 2HEJA 4K8GA 1F6KA 4R33A 1E56A 4Z1YA 3G2GA 3H21A 1OF6A 3VKAA 3HPSA 4FOUA 3LBOA 1F74A 1UQYA 3NXLA 1MW1A 5F4SA 1PHQA 2OYLA 1H7XA 1XRFA 4RE3A 2O56A 4HMNA 1E4NA 3MP5A 2E0PA 1VYRA 3CEPA 3WQ6A 4DUVA 1E70M 2E5DA 3MHGA 1Q66A 5I77A 2ISFA 3B06A 1YDNA 1WQ5A 4HSNA 4JD4A 1GOXA 1LUCB 3H2OA 1M9HA 2WZHA 3QN3A 2BVTA 5FEZA 3WF1A 4S3FA 5AYBA 4O18A 4LEQA 4WD0A 1FWRA 2QCDA 1L8NA 5CBBA 1N7KA 3S0CA 3PTKA 1JZ7A 4HHHA 3BG9A 4XD6A 5G1TA 2QF7A 5AOUA 5BCAA 4JPGA 1NQKA 1YIXA 4MFEA 2MUCA 1O5KA 1OCBA 4N0RA 1K9TA 1CGYA 2W67A 3SQMA 1U30A 3N4FA 2GVYA 3MHFA 4XD4A 3DZ1A 2Q71A 3RPTA 3DFOA 2YB4A 2PCEA 3BJTA 3DECA 3VD4A 1XIEA 1FWIC 3FNDA 2FPVA 1XM3A 4M7SA 1BXBA 1XYLA 2OZTA 3B8SA 1KA9F 1D7FA 4GQBA 1LORA 3ITOA 5FEXA 5HXMA 4C6MA 2PBOA 3NSNA 3W2LA 4HBKA 3H7UA 4XV0A 1QO2A 3DYPA 3DFNA 2A6NA 3L5AA 4GVHA 1W3TA 3SCWA 2TYSA 1WUFA 1DHPA 4REQA 1G5AA 1KM1A 1M1BA 1V7YA 1P0DA 2WCGA 1ZY9A 4UFMA 1S3HA 4Y2WA 3A4WA 1XYFA 3VIHA 1H1YA 4IPNB 2I9UA 4LYRA 2P53A 4NILA 1XQKA 1GWJA 3Q67A 3H6OA 3W7RA 3N29A 4GIRA 3LA4A 1WBJA 3BICA 3HPXA 2VQTA 4R7WA 4FB7A 3HM7A 3M5VA 4FXJA 1WOBA 3NDOA 3NQCA 3SAZA 1W0MA 3O9NA 2XIJA 3DENA 1EGZA 2IW0A 5EGRA 1AL7A 2V2CA 3AU2A 4RV8A 3DH7A 3FHAA 2PDQA 1Z7AA 4GYPA 3LCFA 2NX9A 2PDGA 1VHNA 3KX6A 3L4TA 2HISA 4E38A 2F6KA 1UCWA 5E09A 5TF0A 4WOQA 1OG6A 1VBUA 4NYUA 4UB9A 5LXEA 3N11A 5AHFA 3IEBA 1BTCA 3CH0A 2E09A 5T26A 1EXBA 1SO4A 2TPSA 3VDHA 4N7QA 1OY0A 1OYBA 2FZDA 1L6GA 3FGCA 2Y89A 3U6WA 4DI9A 4LT9A 1TPB1 1Z89A 4O28A 3UWEA 1US3A 4R7OA 3IJ8A 4QM1A 4ZQOA 2CHRA 1QO5A 2REQB 2X2YA 4F0LA 3ID7A 2Z0IA 1QNPA 1F6YA 3CAQA 3UR8A 5AFDA 2IPWA 4F66A 4BF7A 2DSKA 3NSXA 1KCXA 4GE8A 5BXPA 3UESA 1PYFA 2XPKA 3LPFA 3E2QA 3UXIA 2EKGA 3AHZA 4DF1A 3BSMA 4H6KA 3GR4A 4AISA 3GH5A 4YVXA 3AHTA 4DBWA 4WGXA 3NVDA 3ZR6A 4U5KA 3CV2A 2PD5A 2QZRA 5CLWA 2RGLA 3CO8A 3RIKA 1UWSA 3LPPA 3BGJA 1TIMA 3VE7A 2QJMA 3GXTA 2Y85A 4LAUA 4PUMA 4G7EB 4LVDA 4L1GA 4K6AA 4TUFA 1KRBC 5I3GA 1C7SA 4LC8A 2JK2A 1R3RA 3BAKA 2FH6A 4IPJA 1VR6A 3VIKA 2PLMA 1CI1A 4AY1A 1VJZA 1EDGA 1XSJA 4LPCA 1OFDA 3VMNA 3CB8A 4HD5A 3U48A 4EP8C 1LL4A 4GCAA 5CZKA 4X0VA 4PMDA 1R47A 1RY0A 4UCGA 4JTQA 1VIZA 5I00A 1C8XA 3ARXA 4WZHA 1TV8A 4NYYA 1KFWA 2YGYA 3LSBA 5M3WA 1J8VA 1OCQA 4PBGA 1E6RA 2WJFA 4CCCA 2WJDA 2P0IA 5DMLA 2AAMA 3PPHA 1J5SA 1OC5A 3O1NA 4IMGA 1PVNA 3HBLA 2QVNA 3F03K 1QI3A 1H09A 2PLCA 2FH8A 4K7YA 3R94A 3URBA 3NZQA 1XKJA 4QG6A 3WQ4A 5AECA 4Q8MA 4YLWA 5HATA 2E5BA 3VFLA 3T42A 2VEGA 1BAGA 3UWZA 3GTNA 3WQGA 1RV8A 1RP8A 4R9XA 2V3GA 3WYZA 3PM6A 4CQCA 1UJQA 1DOSA 5LNSA 1ZBVA 3NQBA 1Q6DA 4F0SA 3GW3A 1GYLA 4PB4A 1XSKA 1V0NA 4BQ4A 2VRQA 3PUOA 3FDGA 1BTMA 1JZ5A 2JQXA 3QGAC 3FVDA 1UR4A 2G0WA 2J8FA 4WCJA 1A4MA 5CSRA 1C93A 3SFWA 1JUBA 1UYQA 1OK6A 1M6JA 4E3TA 2R14A 3AMCA 2OELA 4IXHA 1SMDA 3VCCA 1A5KC 3QMRA 4IFOA 3D3AA 1JEZA 3QSRA 2V2HA 3FA4A 2ZUNA 4BS0A 3SCPA 3L4WA 3W2UA 2WO5A 4Q6XA 1CLVA 4D6DA 1SU5A 2OCZA 4IF2A 3GYCA 2WOQA 1Z48A 4MKNA 3NOYA 3WLHA 4ZXOA 5LHFA 5AY7A 1VQTA 2WSQA 2GJXA 4FS9A 3ZLFA 3LCLA 1H7PA 1LL6A 1MQQA 4Y9OA 4RDZA 4M6QA 3NQAA 4MG4A 3R8RA 1QR7A 2GGEA 4LEFA 3PBMA 4JXCA 3UG5A 1NFGA 3CV1A 3A4AA 2GQAA 3TKFA 4DN1A 2BGSA 2ZX7A 2CW6A 1OB0A 4LNCA 2Y4SA 4BZYA 3OLIA 3SZ8A 5IDZA 3AO0A 5C5YA 1CPUA 3EZ4A 1XKYA 3VTRA 1H5VA 5FJUA 4CD5A 1OVDA 4JQ2A 5LHEA 1OX6A 1OC7A 2QCCA 5EMJA 4B5NA 2VL4A 3PPCA 1A0EA 4EKJA 4NZFA 2J27A 4FNTA 4XTIA 4QDMA 4DF0A 1ICQA 1HNYA 4M82A 4ALDA 3NM3A 3B8DA 4DZAA 4KWOA 1ZAJA 1JYVA 3S2CA 1KR0A 2D22A 3A64A 4J3XA 5E0FA 2EPLX 1XLDA 2JKPA 5HNUA 1LQ0A 1I9CB 1LTDA 3E38A 3NXFA 4LCRA 3M7SA 4OHQA 3WIJA 1P5BA 1R9YA 4FX8A 5HMSA 2G97A 1GVFA 3UZJA 4MNMA 4C6KA 4U5IA 3TW9A 3M07A 3WQVA 4B3ZA 1P43A 3H26A 3W84A 3NNTA 4LY4A 3O6AA 3ABZA 3NGFA 1VFMA 4FF7A 3ITVA 3DFQA 3R89A 2VZSA 3BURA 1O12A 3CIVA 3CIXA 3WSUA 3S5YA 3ARSA 4UFIA 2Z7GA 4RK8A 2OG9A 4TR9A 4RE0A 1ADSA 1JF5A 2BX7A 2YL5A 1CXFA 3NZPA 1BVNP 4H7ZA 3P62A 1UD3A 1B31A 4XVEA 1G6CA 2NQLA 3T44A 6A3HA 3LZ3A 1IEIA 3I6TA 5FOOA 4PMOA 1UH2A 1V79A 1Q5MA 5C7HA 2PU1A 5M17A 1A80A 1JGIA 3NL6A 4MKSA 2I14A 5C2GA 3W7DA 1X7FA 3VNLA 3DFPA 1I1WA 2OWCA 4S38A 2CKRA 2P76A 1O5XA 4S1FA 3MCOA 5D9MA 1IIGA 1Q13A 1AH3A 3EMCA 4OUEA 2V0TA 4B3LA 2BVDA 3TONA 5D9OA 2BSLA 5AC8A 3TP4A 4M51A 1FHVA 3M0XA 4HQVA 2FJUB 3CWOX 3WMSA 1EQCA 4OV4A 3M5YA 1TWWA 3LV6A 3OG2A 4DWSD 1IT0A 4H9TA 3U2EA 4P5UA 2I1OA 3EWCA 3VDCA 1W56A 4CGTA 3WELA 4ENLA 1VYSX 5JBFA 4H8NA 4NIRA 1Y7VA 3FDKA 2B0MA 1ZFJA 4JR5A 1KV5A 2FPYA 4HIBA 3RLGA 1J96A 1O60A 1Q8AA 4QCFA 1JG9A 1OX5A 4Q8VA 3FEQA 4L6OA 5GJNA 3FEMA 3NJ3A 1I0DA 4JTDA 3DHUA 2WSRA 1T5AA 2ICSA 4QJ1A 2DJLA 3B3DA 4U3AA 3MMUA 4NJJA 4XB3A 3K4DA 2DVTA 3JU2A 1GONA 4BA0A 2QW5A 2WC3A 4JNMA 4L4MA 5T9CE 3T55A 3BGAA 1FH9A 5CPMA 3D3FA 2CZEA 3ZO9A 1GOOA 2D1ZA 2V5LA 3VILA 4HNVA 3V0TA 4HPXA 2QAFA 3B4UA 4O10A 1OFEA 4H83A 4C6JA 1GVRA 1B54A 2QNEA 4S3BA 3NQMA 2R1PA 1H62A 2FFIA 2NX3A 3NDYA 2HDJA 2XFFA 3ARPA 3MA8A 3FSUA 5KMYA 4AZIA 4AIOA 4J28A 4I5XA 3N4AA 3EDFA 3CHFA 2DH2A 4GQRA 1PKLA 4UWMA 5DT7A 1UBPC 3C2RA 2XSBA 4O16A 1S2TA 1DJZA 2WAGA 2PWFA 1CIUA 1XBVA 3N2CA 5A1AA 4IJRA 2BS9A 4HYVA 4M7TA 4XAZA 1FHLA 2I16A 2O7QA 3UGRA 2XM2A 1BYCA 3KRSA 4M6PA 1F76A 3T8QA 5SWUA 4QBXA 1W31A 2P8CA 4R53A 1Y8BA 4GRSA 2PDKA 2HNEA 2YCLA 4XZIA 4IG2A 1H7NA 2YCEA 1KFCA 1QI0A 2Z6JA 2W79A 1E0WA 1OGBA 2R1MA 3GR7A 1VBHA 4DZIA 4GBUA 1XP3A 4GGBA 3PBGA 4DUWA 1IF2A 2Y7GA 2GWNA 4NNBA 3BARA 3V1HA 3WK1A 2QF8A 1TMHA 3PS7A 4UFLA 1SO3A 2OOGA 4GUHA 1X1OA 3WY1A 3MMWA 1O5RA 3PN8A 3MO4A 3PBYA 2OSYA 3APGA 1EX1A 1A5NC 1J9YA 3DI0A 2GDVA 2AGKA 4A3UA 4NP7A 4C6EA 2XDFA 1SZNA 4IPPA 3S83A 3ANUA 4YCPA 1HO1A 1MUCA 3P8IA 5D2VA 1EYEA 3CHDA 1ISXA 1IR1A 1AQFA 4R27A 1RQEA 3ARZA 4GC4A 3RK8A 5KSWA 4KRZA 4EX4A 1LCOA 4DWSA 3K13A 2AAAA 1XBZA 1A47A 4OZOA 4GQGA 3BW4A 5BU6A 3U4AA 1FY6A 2QJGA 4IX0A 4JIEA 2FGBA 3RX2A 1RH9A 2DORA 1QCWA 4L61A 1TKKA 1RY8A 5AYZA 4OBSA 3C2OA 5FJIA 3P80A 3OLEA 3BLOA 2QDGA 4IPLA 2BVYA 3ALGA 3JUGA 3T8LA 4PMRA 4B15A 2GVLA 1LLWA 1UA7A 2PU0A 4L9YA 2AOSA 2VRJA 2CXEA 2HBXA 4F8XA 1W3HA 1J79A 3BJFA 2QEZA 5EMMA 4K36A 4HT3A 4KH2A 1DEDA 3KTSA 1A3HA 4NX5A 4GH1A 3QFEA 1R9ZA 3AUJA 3HG4A 1UHVA 1ZJIA 5BXSA 1WDQA 2PEVA 4QE5A 4RL3A 3N3MA 2ISVA 4F2TA 2EF9A 2FDMA 4G7FA 1TUXA 1QNSA 2A6LA 1H7OA 4PCPA 1ICPA 4XUYA 1TZZA 4MWAA 1X39A 4M1BA 3SR7A 1J2WA 5FF7A 2CIPA 1BRLA 4US5D 3JVAA 1AD1A 5CCZA 1BGGA 2F2HA 2YYUA 3OVQA 4US6A 2C0AA 4QP0A 4DBSA 3C6CA 3K1DA 1JZ4A 9CGTA 3OZOA 4O53A 2PC8A 4ZTYA 1W3KA 3M0VA 1DXIA 1YPIA 2G96A 3KZPA 1E6PA 1OZQA 2QJHA 1PB0A 1TQJA 2GFTA 1XBXA 1UJPA 3D47A 2DW6A 1AQ0A 3MYOA 2WHKA 1W1B1 3MMTA 4QITA 2GQ9A 3NZGA 4HCDA 4NASA 3WDQA 2QJJA 5KINA 2F61A 4JKKA 1V08A 1W17A 2G95A 5AHNA 4RUBA 2A7PA 4CU7A 4PRTA 4ZFMA 1Q45A 1J4EA 4KCTA 1EL3A 1EIBA 2OB3A 1GNXA 8CGTA 4Z2JA 1LWIA 1IXQA 4PCTA 4X2RA 1EZ2A 1P7TA 3EOOA 3OYZA 1QXLA 3BZJA 3OBEA 2PP3A 3S1XA 3O3RA 3EX1A 4PSPA 5JQ9A 3ATYA 5U7SA 1XGEA 4H19A 1YYAA 4KWSA 1V6VA 1UP3A 1B4EA 4Y90A 3KCJA 3C0QA 2OZ3A 4C5ZA 2E6YA 2AL2B 1R87A 2QKFA 3PUEA 3LS9A 2PSNA 4NJKA 1JRCA 1BWVA 3PBUA 1XF0A 1PSCA 3EB2A 2E9MA 3VNIA 2QCNA 1G4EA 4J2MA 4ZCWA 4WDTA 1HKWA 3WQOA 1GJWA 1E4IA 1RBOB 4PRWA 4C1KA 3THQA 1GGOA 3B4YA 5EBAA 1W9PA 5DXYA 3LYEA 4GKTA 4AZCB 1SFTA 2XVLA 2WMKA 3IIZA 5ABTA 3GFZA 3ANYA 4PR4A 1EHAA 2EGZA 4DF2A 4G2DA 5DBTA 4C6CA 1BWLA 3G1YA 3MUCA 4AF0A 5E6ZA 3BOXA 3TNOA 2GJLA 4PGLA 4X63A 3EPOA 1G9HA 4UTUA 5I2UA 1ONWA 1Q6CA 5D2WA 3D0CA 4QJ3B 4QQUA 2RUSA 2NV2A 4QDWA 4A8IA 2IKJA 3L2LA 3H4GA 4N42A 5HAOA 1UB3A 3IGSA 4PFMA 4IMAA 3ARTA 2J9ZA 1FFRA 2ZYFA 1E9LA 4IX2A 4X9SA 4EF9A 3PJWA 4JBRA 3CJPA 4L6HA 5BW6A 2PDYA 1UC4A 6CGTA 3PG8A 1EA9C 4O52A 1A5BA 2PLJA 2YA1A 1W5OA 3GYEA 3W83A 1RD5A 4DB7A 4DJFC 3N34A 3F5KA 5AB3A 2YBVA 1HT6A 3VMPA 1OABA 2VUYA 1KFEA 1NWSA 1WOAA 2PTXA 3ZSSA 1MZRA 1S2UA 4DM1A 3MJYA 4LB4A 5H6HA 4UR8A 5XIAA 1R9XA 2VZUA 1FWJC 2O4QA 3GXMA 2WJEA 4XD5A 1UD2A 2BLEA 2ZIDA 3AUOA 4ROPA 5BRQA 1A49A 3R13A 1HJXA 2GWGA 5F7UA 3IGXA 1J01A 1GOIA 3ITGA 4F40A 3U2CA 3OHIA 3PY2A 1P6BA 3P6LA 1I4NA 3O6YX 4B9ZA 4UR7A 4HPHA 1RPXA 4AY8A 3UCDA 4GVIA 3CK5A 4AX7A 1KBJA 2GYIA 4AIEA 1Q6EA 5FL1A 2R9RA 4AD0A 4EWJA 4QLLA 5C6MA 1O1HA 1A5AA 4IISA 1OEPA 4JTEA 2OSWA 4V15A 1X1NA 2INZA 1V6YA 1VFOA 3PJXA 4F2UA 4TVDA 1XCFA 3HZ3A 4JZ5A 4EK7A 4OT7A 2CBIA 2GVJA 2VEKA 3MVIA 2QQ6A 4L80A 4HPNA 4A3HA 4QNEA 3FXYA 1E5NA 1I1XA 1HGWA 1GKPA 2A4AA 1EP1A 4JIQA 4E8DA 3I7SA 4LS2A 3BLEA 1DJHA 4PA8A 3KAOA 3EOEA 3SCQA 3WH5A 4W93A 3LCGA 3WEZA 2E8ZA 2VENA 1M7OA 2B31A 3BLFA 5XIMA 1JR1A 3GB6A 2UBPC 4GZIA 4A2SA 3IJ9A 4OVXA 1Z42A 4MB5A 2DT3A 2E1DA 4UUIA 3GG0A 4PRRA 2NV1A 4Y9NA 5K2ZA 2DSVA 3TX9A 3MANA 2OT1A 5DELA 1CXHA 5HWJA 2YIHA 4P7LA 3VVGA 3U7VA 3UG4A 3PP7A 4PMZA 3HURA 2GK1B 4Z0SA 2QPUA 3W28A 3NG3A 4HU4A 1GJUA 4JN7A 4UC5A 3TFXA 3VA8A 5EFDA 1QWGA 3O0FA 2ZTJA 1KC7A 1BHGA 1Z9AA 3AZTA 4MTVA 3CUFA 5G4HC 4M5PA 1VH7A 2VCAA 3KVKA 4WLCA 3T7VA 1C7TA 2P88A 2WMJA 1EDQA 3VK5A 1SFSA 1TTQA 4J3UA 6PTDA 1VF8A 3IRSA 4QEEA 5RUBA 5T9BG 4EXBA 3WZ0E 3A4XA 1Q3NA 3T40A 4LW7A 3RUBL 4LTSA 4MOZA 3BUVA 1R86A 1B3ZA 3NR0A 3E6EA 2C6QA 1OX4A 3R11A 3NQFA 4ZFCA 5K9CA 1UKSA 3LMYA 3K5XA 3CT2A 1RK6A 3EXSA 3GBDA 3BLPX 3QVQA 1ZUAX 1XSIA 3W7IA 1MFUA 4QX4A 3PZNA 2XYLA 5CGMA 4JDYA 4FNUA 3LRLA 2WMIB 2PGWA 1Q8JA 4KFNA 2O55A 5H8PA 2EO7A 1ODZA 1IGSA 3R58A 2HVOA 2GUBA 5DQPA 3EDDA 2Y7FA 3C8NA 2KAUC 4JIPA 2X42A 3R0UA 1HL8A 1LL7A 2X0YA 1UWIA 1M03A 1PYMA 3HG5A 3LNPA 1FX6A 3UEQA 4J40A 4IGSA 1WP6A 4P8VA 1ADOA 4MDPA 1LQAA 3BAIA 3I6RA 1YE6A 4QRNA 2CXGA 4LUJA 4Y96A 1FH7A 1BXCA 4UXDA 2JGQA 1Q65A 4PN2A 3WLTA 3WDRA 4NSBA 4I5RA 2F7FA 4IIDA 2Y6ZA 3LHZA 4AZGA 3NQ7A 2ESCA 3IUDA 3PB2A 1XCWA 5A3HA 4LX4A 5JXQA 1KQZA 3GVGA 1MSSA 1ISWA 5C9ZA 1EEPA 1JF6A 1PKYA 3QTGA 4WHBA 1SGJA 3MPGA 3LMZA 1RA5A 4NAFA 1BVZA 1BQGA 3V5FA 1T8XA 1TX2A 1L6WA 3E0LA 5ENLA 1IWBA 1RA0A 3B40A 4MADA 3AC0A 2XIOA 3MBDA 3MKKA 1QOQA 1TZ7A 1KTCA 4CN1A 1JFXA 3K4AA 1LP6A 3C86A 1E40A 4MPQA 3G1AA 3VOCA 4C7DA 2A79A 1FWGC 3WNKA 3GDRA 1A0DA 4MWAE 5EY5A 3IVTA 2Z29A 4GUFA 3G6MA 8XIMA 1JZ8A 2NQJA 2YCJA 1WV2A 1UC5A 3HOJA 4KRUA 4O1CA 4K1GA 1CB2A 4Z1CA 3CNYA 3OLDA 1SYTA 1K70A 3H2AA 1XJBA 1TWDA 2ZWYA 4XKMA 4ZL1A 2CLPA 3PULA 1V03A 4XZMX 1PXGA 3W75A 1KXVA 1J12A 2ANUA 1LDCA 2WKJA 4YIWA 2PFHA 4JTHA 4NNCA 1UQZA 1JAKA 1T96A 4LYQA 3AS2A 5CH9A 1PV8A 4DO6A 2DDXA 1WYIA 3AROA 4QE1A 1ECEA 5CGQA 2KZHA 4YTQA 1ZGDA 4BQ3A 4RNJA 3I3BA 4PH6A 4LC6A 4NNAA 5XINA 2J4GA 3IJIA 3ZOAA 2H9AA 3H55A 3CIWA 1E43A 3GDMA 3II1A 4HHMA 3ZVIA 3W1MA 1S39A 4G56A 4LYKA 3G6LA 3IIOA 4W8LA 1P1XA 3BSHA 2VFGA 1US0A 4RXGA 4M3PA 1C8YA 2PDWA 3RU8X 2QV4A 4GACA 1V3KA 3R4IA 1OFRA 3T6CA 5JIWA 3N9KA 2CFFA 3U2OA 4WOZA 4WIWA 4WF7A 3LM3A 3MV11 4UTIA 5TIMA 5J5RA 5C9UA 2WLZA 2I5GA 3MMDA 3KL0A 3LCWA 1NJJA 5G4EA 2E8YA 3UY7A 2V3DA 1RLCL 3S42A 4NZ3A 3L4XA 2VXNA 4O54A 1G69A 4AQLA 2G4JA 3NWRA 1B3OA 1X8CA 4FK9A 3F7JA 1J18A 1YXCA 1AG1O 4CNUA 2FZ8A 3UWUA 1U33A 5A6JA 4TVUA 3UQNA 1L8PA 3LZ5A 4HYWA 2CZ5A 5TNVA 4C90A 4EXAA 4IJCA 3T09A 3LTYA 2E5CA 1MDLA 4QG8A 2VC6A 3AHYA 4ICCX 2Y1HA 3L9CA 3E74A 4C6DA 3GG7A 4PMQA 1CW2A 3IK4A 3W07A 3AIRA 2Y8VA 2ZUVA 2TSYA 1X98A 4AEFA 4IFKB 1GT8A 4XAYA 4B5TA 4LUSA 3Q2DA 3G1DA 1TX0A 4QSFA 2DUXA 4XTDA 2QR6A 1H63A 2WZIA 4ZSTA 1LOSA 2VX7A 3TTYA 4CNOA 4XO7A 3CL6A 2DGAA 3ITXA 1TV4A 2QGHA 2J7EA 2VC5A 1O7AA 3S5SA 3LK6A 1NELA 2GQ3A 1NSJA 1XLIA 1SJAA 1S5VA 1G0CA 2ZRVA 4KQNA 2EHHA 2C71A 1C3FA 2QULA 2V3EA 4GI6A 3SGZA 1DIOA 4HMEA 1W54A 3ZWTA 4EE9A 1X38A 1E55A 2Q01A 1EO7A 3GZ3A 1YADA 2ZZ6A 1G67A 1ZL1A 4KFOA 4HNOA 1CECA 3IS4A 3QV6A 3G18A 4H8VA 1CXKA 1EJWC 1XLLA 2GGIA 3LCIA 2WV8A 4BF9A 2VP8A 3EKGA 2IKIA 4HNLA 4KMQA 4BWLA 4RR4A 4ERAA 3UZXA 4XIMA 4IMEA 2I7GA 3KLKA 2Z1SA 3I4EA 3QLLA 2Z6IA 2DSZA 3H8AA 3OU8A 2RKXA 3AIEA 1SZFA 1MXDA 3H7VA 3M0HA 1GUVA 1ZPTA 1XFBA 3UWVA 3F4VA 4XZ9A 4AUBA 4DPQA 4OJYA 5CXPA 3TCSA 2BBFA 1I75A 3A9IA 5DRCA 3QY6A 3G1VA 3L2IA 1V4YA 5M5DA 2JKEA 4ZOAA 1P4CA 1CZ1A 3A6OA 1EWEA 3CZGA 1CNVA 1SQ7A 3MHUA 4A29A 1KFJA 2D0FA 4DJDC 5HMFA 3A21A 3CMJA 2CZDA 3H12A 2CNCA 4IP4A 1TUFA 3O7UA 1PWMA 4E2BA 3DESA 4XX6A 4LJ3A 3REQB 2PPGA 1R3VA 3UZ5A 2PWDA 2D2JA 2C3ZA 2YDAA 4MJMA 1P0EA 2V69A 4ZENA 2RFGA 2UY3A 1BEUA 1ITXA 1VEMA 4A8LA 3SBFA 2WNWA 4GXPA 4PTWA 3UZYA 1AW1A 2V81A 2V82A 2V9DA 1LUCA 1C8QA 3TJIA 1A5OC 1RP9A 2DFAA 4PTDA 3EX2A 3S2LA 4J5NA 5LNRA 3SRHA 5DY2A 4HA0A 3ME3A 1ZSXA 4B92A 5C55A 2D2GA 3CQ0A 1L6FA 4JTUA 5LXXA 1W1A1 1W2PA 1BYDA 1PIFA 3SGUA 2YFNA 1WDDA 2Z1BA 1KCLA 2J79A 4B9YA 5F2LA 2OPJA 3GR8A 4ASTA 3PZMA 2WSPA 4GY1A 4GIEA 3B8UA 3VD7A 1W1PA 3MBFA 3QV7A 4LS1A 3H7RA 1PAMA 3LTSA 4CN4A 3C2YA 3AWNA 4RDVA 1POKA 7XIMA 2ZX5A 4NAEB 1L2UA 3UYIA 1EGVA 2GSJA 5C2XA 3SY5A 3L68A 5ABGA 1YRRA 5I3HA 2Q8ZA 1JZ2A 6XIMA 3GVRA 2P8BA 4PYSA 2ACQA 3TFCA 3G8EA 3M5XA 3GDLA 4FR1A 3AIBA 3MC5A 5BZAA 4RX0A 2P5NA 1XLBA 1UKTA 3GNOA 2PE4A 2O9RA 5D8WA 2ABAA 2NT1A 4WEVX 3S8HA 3TCEA 1F3WA 2OEJA 2NQ5A 2Q02A 1W91A 1PZ3A 3FAXA 2R94A 1B3VA 3NPXA 3WEMA 3FV9A 3A3XA 4OECA 3VC5A 1ISVA 1Y5XA 4UNLA 2C13A 4Q4PA 3E0FA 2DIKA 3G1FA 2XVKA 3W7PA 3S2NA 1AMKA 5IFPA 5HMEA 4A8NA 5KZMA 4DZHA 3THUA 4AB4A 4IMFA 3WUBA 1PTDA 3IVSA 4HZ7A 3KRBA 5HQMA 1EHNA 1XS2A 3GQYA 1JDAA 4NG3A 3S2JA 5HK4A 1A5SA 2IKHA 3JRKA 4BK9A 3TQKA 3ANVA 1ISYA 2YA0A 3CO4A 3DFSA 4AXKA 4MB3A 3E96A 3MB9A 1R3SA 1LT7A 5EA9A 3RAOA 4OTKA 2ATMA 3VM7A 1GVYA 1NQ6A 3SUVA 2VCBA 2QHAA 3SGGA 1UR8A 2I56A 2X2GA 3NM1A 3VIPA 4WQ6A 1T40A 4JDBA 4P8WA 3GXNA 3TYUA 2WNNA 5KETA 5U4NA 3USZA 3CAWA 4HA3A 3NA8A 4OGZA 2F84A 3M9YA 3OBKA 3G5EA 4BQ5A 3GAKA 3NIYA 3R5EA 2H6RA 4GXMA 4HN8A 2REQA 4FX6M 3STGA 3L65A 1C29A 4KIEA 3O6DA 2Y8UA 1PCKA 3O06A 3CAKA 3G3DA 5C9XA 1XYBA 4XVDA 3TVAA 2QDDA 2VVNA 1TVLA 3ARYA 1LLOA 2W5FA 4EXQA 1GJPA 2E1WA 1WAUA 1V0MA 3AS0A 3BJSA 3ISIX 3L23A 5CSSA 3GHUA 2J6XA 1EUNA 2NLIA 2VUNA 3L0NA 2GVGA 2J25A 1J2BA 2D0HA 2J13A 4PCNA 5G2WA 2XTKA 1NARA 3CQJA 3LLDA 3QKZA 1JJKA 4IICA 4RKAA 3H54A 3CASA 4GLEA 2DEPA 3BO9A 1NOWA 2H3BA 3R12A 5IOBA 1KM3A 4IWWA 3LGDA 3ITTA 4Q8OA 3PZ9A 2VR4A 2OTDA 2QDEA 4HB7A 1W1YA 1QNOA 5IBXA 4AU0A 4Z42C 4CCZA 3F2CA 4PTVA 7TIMA 2VZVA 3HGSA 3WLIA 1SVDA 2QMJA 3G0SA 3L7RA 3SJNA 2FMOA 2ZUWA 1OF8A 5I7GA 1AODA 2E68A 3GSMA 1JUEA 2G4FA 2OLHA 4HU3A 4O1BA 2YOCA 3VIIA 4O13A 1OZMA 4WDWA 1S5MA 4HZMA 1OM0A 1XRTA 3G77A 2XINA 5I6SA 3QW3A 3BMXA 3W7MA 3ICJA 5BWFA 2OOFA 3CTLA 2V67A 5EMLA 3H22A 2QJNA 1BF6A 1H5YA 2WNQA 3WK2A 3GTXA 4DJEC 1XIGA 1H7RA 3VINA 3PPFA 4BI7A 1B4KA 3UPWA 4JTIA 1QAPA 4JX6A 1DJQA 4TO8A 4NXKA 1KWKA 1SO6A 3GE7A 5HDRA 4DEFA 5TD4A 1FH8A 4E4PA 3RN6A 3GS6A 4Q4OA 1XDJA 3POHA 5I23A 1DL3A 2CLLA 4V27A 1YLVA 2YSWA 3KW3A 3VZXA 1VFFA 2XH0A 4ZMGA 1R2TA 5FJOA 4LF1A 3MUIA 2WMFA 2YZRA 2Y24A 4TX6A 4YXGA 1VBJA 3OHMB 3P0WA 4MJ2A 1TPWA 1FCVA 1V6TA 1FWFC 3K2GA 2OYKA 3EOUA 1R3QA 3DHDA 4HPGA 4JFWA 4JYDA 5F2IA 2PZ0A 3QC0A 3TH6A 2XH4A 1XL9A 3VGHA 3MQTA 1D2KA 1YNQA 2QCEA 2XIQA 3B9OA 4HVXA 3OVRA 5JUVA 3QBUA 4XBKA 4GX8A 3B8IA 5E0KA 1KWGA 5K3VA 1VIWA 3DC0A 5DMNA 3C3NA 3IJ7A 4PCSA 4WRHA 4PUJA 4KEUA 3ES7A 3AYRA 4KS0A 1KCZA 2FMNA 4XZWA 3NPVA 4HTYA 1PCWA 2W3ZA 4OE7A 3MSRA 1ZNNA 4AZ7A 4CQ9A 1RPKA 3FW6A 5TBOA 2FGLA 4DELA 3EXTA 3PANA 1JGMA 3ONBA 1VLIA 3PHAA 1JDDA 4WX2A 4L5ZA 1ENUA 3B8WA 4CNTA 2IXUA 3MI6A 1CB7B 1YBQB 4ACYA 1UH3A 3GC5A 2AKMA 2EKCA 2HQAA 4J4KA 2A7NA 4LCQA 1XH2A 3FSTA 3TYBA 5DF0A 1H60A 5EL1A 1JZ6A 3MUZ1 4YWIA 2NUXA 5PTDA 4HJWA 5GPRA 3GM8A 1VRDA 4LB3A 2J7BA 4QXIA 3VDBA 1E0XA 1VFSA 4AZ6A 5HNTA 1M65A 2G3FA 1NOFA 4AYGA 3KE0A 3DGRA 5IDIA 4ICMA 5BU9A 2VZTA 3K8LA 5E9AA 1ZJHA 3TU9A 3VUSA 1EB3A 5CJ5A 5I24A 1DP0A 1FUYA 1J6OA 1F05A 3DN5A 2A5HA 4GPNA 3EOSA 3WK0A 2PMQA 1N82A 2F9RA 2PDNA 2Z2AA 4DX3A 3W3OA 1QNQA 3PWGA 1ZZMA 1WZKA 1VB9A 3B0PA 3BW3A 1JAEA 3VM5A 3LOTA 1WBHA 4A3YA 2BY0A 2VFFA 3CTTA 3S6OA 3T07A 4IH3A 1YEYA 3WLNA 1Y5WA 2CHOA 1TCDA 1FWEC 1TPC1 4GXWA 1Z6KA 5E93A 1HZYA 1FOBA 3KOZA 1CDGA 2E67A 2VJXA 2Z2UA 1UR1A 3RITA 1JCLA 2JF6A 2RGMA 2QDHA 5T91A 3MYPA 1NF7A 3L4VA 3IJQA 1OGGA 1UP2A 1WPCA 5C2CA 2XGIA 4ZQPA 4UOJA 3W6LA 3P5ZA 2OLAA 3KBSA 3N19B 4UTWA 3R43A 4QCEA 4D6IA 1IV8A 3JR2A 1E5JA 4NRSA 2DSUA 1XISA 1F4AA 4UTTA 2R24A 2FB3A 1HKMA 2J7CA 3DFTA 3DYOA 2IQTA 2V5KA 3UP8A 3MU7A 1U2YA 2VZOA 4PUWA 1UZ1A 4I5UA 4FO4A 2WBKA 1OIFA 1PKNA 3OGSA 1CXEA 1O95A 4GNKB 5MKGB 3VMOA 1HX0A 1W32A 4MY8A 3CT7A 1FDJA 4DLFA 4ILSA 3S9ZA 2XHYA 1H49A 3QSTA 1HTIA 4IQLA 2FIQA 3ARRA 1MNSA 2HXUA 1K7XA 1XYCA 5KZDA 3RX4A 1CEOA 3V1PA 4E4FA 1EOMA 3LCXA 4PODA 3GH7A 5FL0A 2ZDRA 2QPSA 3A9BA 1J93A 4MIMA 3LPGA 1DVJA 2FJKA 2GUUA 1SR0A 4EAYA 3VOJA 1YTKA 1V6UA 1EC7A 4L1XA 4F0HA 4MDOA 2JE8A 3RILA 2XN1A 6XIAA 3BCJA 1Z41A 3B0YA 4GABA 3BPWA 4X61A 4JS3A 1QPRA 4S2CA 1DV7A 1A0CA 1CXIA 1LWJA 2OO6A 2C15A 3UR2A 1OJXA 3ZS4A 2DUAA 3QRHA 4W5UA 1E3ZA 5D4YA 4L4PA 1FWAC 3S6TA 1I2QA 3EWYA 4FSAA 3ZMRA 1XD0A 1H1ZA 5I3DA 2OO0A 5ABHA 2H8ZA 2J7DA 2JEPA 3BXWA 2FTYA 4E2VA 4UFHA 3EX4A 4IUOA 2PDJA 1W2VA 1MW2A 1E72M 1E6ZA 2I17A 4G6CA 3J7HA 3PTDA 1WCGA 2VDHA 3TTQA 3O2LA 5D05A 4GCXA 3HG3A 2OFJA 3UNDA 1DIEA 3A22A 2ZA3A 3B0VC 3RM8A 3OPSA 3WH7A 4KEVA 4I7UA 3OEXA 3M0JA 4M6UA 2J78A 2OKOA 3AHXA 4U2ZA 1QW7A 5D03A 4BEUA 3KHJA 1R30A 1E3XA 1R6WA 4AEEA 4YTUA 1AJ0A 5E70A 3GX9A 2YW3A 4BFAA 3BCFA 1GQJA 2C18A 3MV01 2G41A 3SCTA 3WBAA 2BV9A 4H41A 4S3KA 4EOUA 4ZO6A 1UUOA 1VS1A 5JU6A 3GC2A 4ORIA 3RU6A 3RR1A 3WDJA 5IXEA 3CXOA 5EKYA 1JRBA 4OU1A 3HN3A 3DBNA 3OW1A 3G8RA 1D7KA 2DJXA 1KXTA 1P0KA 1KM6A 3NDZA 2IPJA 3RMEA 1T8QA 2PZNA 3EMQA 1OFAA 3E02A 4B3KA 1TSIA 3QW4B 1W3IA 2OU4A 2WPGA 3QHNA 2ZDSA 2IXVA 2HBVA 2BY2A 3W2JA 3TMLA 3WJXA 3NQDA 4D6CA 1KTBA 1D8WA 4L9ZA 2DUZA 1RALA 3WX7A 3LHWA 3S1UA 3W7NA 1GPFA 2B7QA 5ECUA 1DIKA 5A94A 1K9FA 1GOWA 3WLPA 3WDIA 4MYXA 4J3ZA 4YYCA 3M1ZA 4AXNA 2PGRA 5DRIA 4C7FA 1ONXA 3HO8A 5C9WA 1B30A 5LA0A 1GZJA 1J0HA 2V5BA 3SIZA 1CGVA 2XZ9A 2FFCA 3R0KA 1E1EA 1RK5A 3TTOA 3WMCA 3UR7A 2PTZA 5ABFB 2PDHA 3WLOA 2NT0A 4HKPA 3H4XA 4PZVA 1IWAA 2Z7KA 1V3HA 1FHDA 3N6JA 3DU0A 4LVBA 3RGTA 3VDAA 3VIOA 1DQWA 4QEHA 5FA5A 4AFYA 3CGTA 4I3GA 5M03A 2ZX8A 2VX5A 4UTJA 2A3CA 1BF2A 3RXZA 2DZUA 2R8WA 1TWZA 4NVTA 5D37A 4FLOA 1R3TA 1EWDA 5LGXA 1CXLA 3VCNA 3CUXA 2PA6A 4GINA 2IQDA 1NWTA 3CUJA 4MNKA 1WKFA 3TE9A 3WQ5A 4LUTB 1PUDA 1IXNA 1MYRA 1FP8A 3RCMA 1B2YA 1BYBA 1DQUA 1VCVA 5A8PA 2BOEX 2PRMA 2F2KA 3N4EA 3W37A 5H8UA 3LRMA 1B9ZA 3MVTA 5D33A 5LIUX 1GPWA 2E9LA 3CUZA 3UG8A 2BGQA 2J47A 4GOAA 3UPBA 3GVVA 4W89A 2PGFA 1TJRA 5D38A 4C7GA 1ITQA 4GO9A 2J88A 4MNLA 2AL2A 4Q32A 1DWAM 5FAJA 4NKCA 4J27A 2DT0A 2WANA 1UD6A 1JPIA 2FVKA 1E6QM 2ZBTA 1QOPA 1VHCA 3VX0A 3HTWA 3I7QA 4IGHA 5BXRA 3B9NA 1V6WA 3BV7A 2RHGA 4ZB0A 3UG3A 1V3MA 4JNZA 2XIIA 4IIFA 4KWVA 1IHIA 3TC6A 2UY4A 1A3XA 4UQCA 2Q8XA 3QPZA 4ZXLA 4FP1A 4AZCA 3HPZA 3F4NA 3TYZA 3MO7A 1Z44A 5BRBA 3BTNA 3MUY1 4TV6A 3PZOA 2NXIA 2ZRZA 4LVFA 1EO5A 2MANA 1EQPA 2JIWA 1MZHA 1TFVA 1BSLA 2WVVB 1LROA 4EPKA 1BD0A 1JZ3A 1QHOA 3KHDA 3W00A 1V02A 1E71M 2EAWA 3AAMA 2W27A 4D8AA 3TLLA 3FK4A 3OOQA 4B5SA 3GNRA 4E3VA 3QLDA 3E0VA 5BWAA 3KWSA 3MSDA 1HXJA 3PWIA 5IHSA 4UQDA 1LWHA 2LLEA 3OBAA 1U5JA 3GDBA 3NYDA 3P3BA 3ZR5A 1OT2A 3F2DA 3C2EA 4F48A 1HIZA 4HMDA 4HNCA 4Z2KA 2DZTA 3RRXA 3W6MA 3NAVA 4N4PA 2VEMA 1DJXA 2HTMA 1T6MA 4EACA 1HKVA 4ZE5A 3WLMA 4RJEA 5KITA 1D8CA 1KCKA 4M8UA 1RHCA 3ECQA 3LNMA 2CBVA 3TSMA 3PNZA 2D3LA 3C61A 3I65A 2QCHA 4IQEA 1Q6RA 1XV8A 4DVOA 5JBDA 6TAAA 3CUGA 1MMFA 3UWYA 2PTWA 2CHNA 4EPBC 2OWXA 3WMBA 2OQLA 3RO8A 1QATA 1UIOA 3K30A 4GG9A 4R9OA 2X0SA 4DM2A 1SJBA 4LGXA 1WNOA 5AZ0A 3IV3A 3TWBA 4ACZA 3RPDA 1QWKA 1DJNA 2E40A 3DG3A 5AHLA 1YXDA 5D2XA 4D6JA 3WO8A 4AEOA 1OG0A 1SZRA 3OA5A 4KCVA 1E51A 3KVLA 1GZ1A 3WH6A 3U3HA 5E9XA 2QIIA 2XISA 4H00A 2D3NA 1KTNA 3GU9A 4HHLA 3UETA 1DJGA 2EBNA 4FNRA 1ITCA 2Y61A 4V1YA 2YW4A 2G8ZA 3CMFA 4Z0JA 3PAOA 3ZWSA 3V7PA 3U9IA 2CPUA 2Z1VA 5DXXA 3BAWA 1L2QA 3L12A 3P14A 3P81A 1XG3A 4NRRA 4ADTA 1IR2A 2HE5A 1W9UA 3PTMA 4CCDA 2OWWA 1B57A 3OYXA 1IZKA 4V1XA 3PZIA 3GHSA 4AZBA 3PBVA 3RFAA 3QV9A 4UOQA 3PC0A 3WF4A 1C9DA 4IIBA 4O0ZA 1BKSA 1BG9A 4AD1A 1ONEA 4O1AA 4FXRA 4AC7C 4JFSA 2QPXA 4Z2HA 4M1RA 3W7QA 1FXPA 3COTA 2VC9A 1C90A 4Q8NA 4GYPC 4Q22A 1ML1A 2V30A 3OVPA 4E8GA 1HUVA 2V5CA 3KBJA 3ZZ1A 3MP3A 1GW9A 4YN5A 2X7WA 1UMYA 1W9XA 4GK8A 3G1SA 1J0JA 2PI6A 3NL5A 4YPJA 3L2MA 3EMZA 2IPGA 3VNYA 1EKOA 2ZRUA 4TQTA 4OWGA 3HV8A 1FWBC 2PWEA 3SCOA 3E12A 4G5DA 1W9BM 1XWYA 5DCEA 1X97A 1R2RA 2XSAA 4FALA 1VAHA 2W62A 2PRLA 3P84A 1JULA 1K3UA 2ZZ3A 3B8VA 1CWYA 1RVGA 2AMGA 2DIJA 2Y88A 2J6VA 4LUYA 3BQ6A 5DO8A 3CLMA 5HMDA 4PTNA 1A50A 3DCPA 4LBSA 5CC6A 1JD7A 1SW0A 2GGHA 1GQIA 3CZ8A 1WKDA 3KDNA 1HP5A 2XSXA 3KP1A 3QZ6A 3WLKX 3GDTA 3OIXA 3E49A 5LA1A 1JPDX 4XG1A 1XX1A 3RJXA 3FJLA 4GGHA 4O50A 3N13A 2WMIA 3UWWA 2VGGA 4QROA 5HA7A 3NSMA 4KW2A 4XSMA 3ZT6A 4Q3MA 1PO9A 2UY5A 1W5PA 1LF1A 1L0PA 3BOLA 3HMJG 3FAWA 4B4FA 3LD5A 1UPPA 3VGDA 1Q7MA 1UIPA 1M04A 5A6BD 2JEQA 2ZWZA 3SCSA 4ZQMA 1W8SA 3F4WA 3IACA 1EJVC 2IKGA 2RJHA 1Y5VA 7TAAA 4IZGA 1AW5A 3K1GA 3M7WA 4Q4MA 1ISZA 2GJRA 4CQ8A 4PULA 3ITYA 3S5ZA 5FAGA 3ALFA 1AA1B 1TB3A 4HU8A 2XWDA 4UOZA 4BF5A 3V5CA 1TELA 4I9MA 4UNKA 2VR2A 4RPPA 1ZJBA 3N6HA 1VFLA 4GUJA 2ZVRA 4YL2A 4J3WA 4B16A 2Y62A 1E0VA 4EAMA 3W2MA 4ERGA 1ZU8A 2PWVA 4KCUA 3WLJA 1C91A 2VYOA 2W63A 2TODA 3S5OA 1YHTA 5HNRA 4UMAA 1G01A 5CGTA 4JTCA 2ZZ2A 4E5TA 1M68A 3H24A 1XLHA 4FIQA 3TW7A 2OLSA 1UKOA 4QAWA 3ENLA 1AZ2A 4ROQA 2YCIX 2PWUA 2PDLA 5AC5A 1C9WA 3M0MA 9RUBA 1LG2A 3B03A 3DKLA 7REQB 3TAOA 1WX0A 2EPHA 4R88A 1R5YA 1PZ1A 3SN1A 2Q3OA 4DY1A 1E9ZB 2G3IA 3ZLGA 3CYVA 1H2JA 1X7IA 4LRSA 1UR2A 3U57A 2AQOA 2P3EA 4TIMA 1AZ1A 5FJTA 1TPH1 3W53A 1OT1A 1W5MA 3STCA 3K8KA 2VGBA 4U28A 3ITCA 4J2PA 1XLEA 4AZHA 4RNFA 4XK2A 1OYCA 3APTA 3MSYA 3LEPA 2Z27A 5CZJA 3DG6A 3HMCA 2E6AA 5REQB 3UJEA 1G4PA 2V38A 3S5NA 2FVMA 3DBPA 4NI8A 2J8GA 3TOPA 3CV7A 1VYPX 1BVWA 3AMKA 4NZCA 4DUXA 1GQLA 1EX5A 3LSCA 2DSWA 3GO2A 4U3CA 3IRDA 4MZ1A 3FYOA 4NZ5A 3TR9A 1F07A 4RZBA 5AC7A 3M41A 4K3ZA 4GUGA 1X6UA 1XC4A 3WDPP 3CL8A 3GTHA 3N25A 3MJMA 1JVNA 3IPWA 1R2SA 3RNDA 4HNNA 5HANA 5LIYX 1S2WA 2W92A 1B1YA 4L6DA 3NFUA 2HXTA 4LXFA 2YDQA 4YTTA 4I6VA 1CX9A 2QCFA 4RW5A 4L64A 1E73M 1S46A 3PTQA 4NHVA 1TV2A 5A6BA 3W7CA 1VFHA 2NWRA 1LOQA 3UVIA 2Z4GA 2V3FA 3LX9A 2C14A 3HJEA 4D1JA 3O16A 4ZQCA 1JDFA 1EJSC 4IFKA 3HGJA 4GO8A 3WCZA 1VPQA 1LBMA 1GOMA 1ME8A 2AQWA 4JY9A 3BAXA 4JOMA 4FMVA 3PSVA 3E1F1 4QS5A 5DY3A 2ZXAA 1V02E 2G37A 3TYEA 3BMVA 3UVAA 1M5WA 5CPQA 2J75A 4BI6A 4INFA 1N8WA 2WMHA 1CGXA 3OZPA 1ZBWA 3LGGA 4IL2A 2B7OA 2FZBA 3G24A 4W7WA 2DQWA 3WF3A 3KM8A 2AL1A 7PTDA 5CJMA 2WLYA 1XW8A 1IQ8A 2HS8A 4N9CA 3BMWA 3CBWA 3DHFA 1C8VA 4LALA 2EPOA 1EBGA 3EWWA 2PDXA 1LLZA 3D6NA 1BWKA 2QVHA 4JIRA 3EOLA 3E0IA 3QR3A 1G4TA 3N3TA 3QF0A 3C4UA 4JX5A 2FYMA 2CLEA 3CL7A 5DLCA 3EYPA 4DYKA 3L21A 3W6YA 4JN6A 2BHUA 3B9DA 4DWDA 1S3TC 3ORWA 2AGTA 3USBA 3KCOA 4UTFA 3CQKA 2JIEA 1UG6A 4H1ZA 4RE4A 5E1QA 5FSDC 1GOQA 3UPMA 2BG5A 5FI8A 3ZJ8A 3SW6A 3DX5A 4CD6A 3XINA 2F6XA 2DV0A 4KFPA 3H23A 3A3WA 3ARQA 3CS2A 1XRSA 2XFYA 3WENA 1GVEA 3LDVA 1T41A 1DPMA 2CLFA 1E9IA 4PUNA 1AUSL 3BAJA 2ZRXA 3WK3A 3RPMA 3ZQ9A 1MXSA 4Q7BA 5CPLA 4MWAD 2C79A 3MSGA 3REQA 1XYMA 4OQVA 1LJYA 3GKAA 1LBFA 1U22A 1PJ9A 1YNPA 4Z1DA 4NQ1A 4NJIA 1KLZA 4M80A 2WCAA 2HCVA 2EJAA 5LZLA 2ZOXA 1Q7ZA 3TN5A 2QUNA 1KXQA 4QG9A 5AZ1A 2QS8A 5A6SA 3M44A 3AOFA 1NVMA 4JTJA 4H9XA 1TV5A 1LYXA 2WZTA 1GVQA 4Q4SA 1QUMA 2OQYA 2CBUA 2P10A 2YLAA 1W8GA 4K39A 3SRKA 1GTHA 3W25A 3UU0A 5LIWX 3TEVA 4GD0A 3W26A 1F3XA 3S9IA 3O07A 1FKWA 2EG6A 3OQ8A 2FB2A 4OKDA 4F0MA 4FOKA 4O0QA 3BAYA 5D8ZA 1AJ2A 2ZXDA 3E9AA 1HF6A 4GC3A 4NAEA 5FF2A 1U83A 1R7AA 1JPKA 1ZAHA 2WKGA 2YB1A 3CB3A 4PMXA 2PF0A 2C0HA 1RZMA 3P82A 4M24A 2GVEA 3U5YA 2AKZA 3VU2A 4ICNA 1AVAA 5CPSA 3IGUA 3UCQA 4Z1AA 4FNQA 3PK7A 3QJAA 4ES4A 1GK8A 1XC6A 4PBFA 1ZP4A 3OODA 2VX4A 5KEZA 4O14A 4IL0A 4LUIA 1FWCC 2UV8G 4JTSA 4PMVA 1QVBA 2QLYA 4NU7A 2VELA 1H11A 1MW0A 3WFAA 3GUGA 5CPOA 3KDOA 4P7NA 5HQLA 3SURA 5B7ZA 2WM1A 3GY1A 4L65A 4C91A 3B97A 3VIMA 3FCPA 5I79A 1FWDC 3MI3A 4GFSA 1DYSA 3W24A 3WNPA 1HJVA 1YX1A 2PTYA 3S47A 2VR5A 2ZCGA 4JGDA 1AFSA 3SEPA 3H2EA 3WF0A 4NJHA 3VD3A 4C60A 3EDKA 9XIMA 5IFTA 3NGJA 3PFMA 1DIDA 5DCBA 3H4WA 4JTRA 2GL5A 4I6KA 5FIPA 4UMBA 3O05A 3SFKA 1KGWA 1XQLA 2JF7A 1ZBKA 1FQ0A 4IGMA 1RCQA 4NUWA 1H50A 1JDCA 4IIGA 2D20A 2POZA 4DWSC 4LVGA 1GQNA 3QY8A 4CNSA 2VFHA 4X60A 4IGNA 4A05A 4ZTXA 4AH7A 4LU0A 1N8FA 5FSEC 1GTEA 5JMUA 2OKTA 4UTLA 4DXKA 2VMFA 4H6EA 1ME9A 3TZNA 3IUHA 2DZBA 3CU2A 2GZXA 5CQ1A 1DQXA 3W7HA 5FF4A 5HJXA 3BW2A 3PG9A 3W87A 1LRTA 2GDQA 2ZVIA 4C1LA 3VGBA 3QMTA 4IQDA 3GD6A 1HN1A 4WY0B 4IMDA 3W86A 4Q33A 2OYMA 4O19A 3B05A 2WYSA 2PP1A 3N9RA 4F9JA 2E9BA 5HPCA 1CCWB 2EPNA 2OMAA 1GKQA 5HULA 3FIGA 3U0HA 4O1EA 4DO7A 4CD4A 3T0DA 3W1AA 2PDCA 3INPA 2W66A 2VOTA 3LXCA 4PMUA 4U31A 3QEZA 3T81A 4GQ0A 2WC4A 2A7RA 4M6VA 2WBGA 5BNKA 2ZXQA 4MWAC 3LQLA 4DXXA 4DNHA 4MLJA 4I8YA 1PE1A 1R3YA 4GX9A 2BHZA 1TA3B 4Q4KA 4W7UA 4S2BA 1OQFA 3G1XA 2WC7A 3QPEA 3GHTA 3M0IA 3VDGA 2JALA 2ON3A 5LNUA 2ZKMX 1WA3A 4NZ4A 1QK2A 4LH8A 4YHGA 5JIPA 1VPYA 4R34A 2WM0A 2VD9A 3G0XA 5F4WA 1ICSA 4PL2A 2Y70A 4HK5A 4GZ7A 5DFAA 5G2IA 1KRCC 3A24A 1NDZA 3WUFA 2XN0A 3WH9A 3M0LA 1R8LA 2KX9A 4CQAA 2OXNA 4FF5A 4XO6A 2Y5EA 2NQ9A 4XIAA 3EPNA 1GKRA 3NQ8A 5HINA 5CBIA 2XG9A 4ZVJA 4LRTA 3E2VA 3ABXA 3GLCA 2ZRYA 1V3LA 3U7BA 1SZGA 1NOUA 1WKEA 1DE5A 3UD6A 4RE2A 1F3EA 1RCOB 3OB8A 5M1TA 1VLWA 3B9AA 1Q2RA 4ATWA 1T7LA 1GCYA 1NAL1 2EPKX 7ODCA 4KPLA 1EGMA 2G3NA 1FVPA 1MUMA 5H2ZA 2BFGA 1WDRA 3FJNA 3N2TA 4BHYA 3O15A 5CBJA 3W2KA 3N2BA 3LENA 4LAMA 1N8IA 4IFRA 5A5WA 3GVWA 5T8GA 3TAKA 4B91A 1S5TA 2HE8A 4FNSA 3WN6A 1PIIA 3RMJA 3MTWA 1BKHA 4LYPA 5BXTA 4ADSA 3RLHA 3SB0A 5FACA 1WO2A 5K7JA 5F2GA 4W9TA 3WQFA 4ZR8A 1PS9A 2D73A 1HJUA 3LHVA 5D2YA 2Y7DA 3HQOA 1YNYA 4HHPA 2HJPA 2NLYA 3R8GA 4N02A 2DY3A 2ZZ7A 2DH3A 1YW1A 4G1KA 3M6YA 1KGUA 1TPDA 4ZOBA 1OCJA 7CGTA 3ZJ6A 3B8TA 3URQA 1WXJA 1E6SM 2H3DA 5G1YA 4ML9A 2VD8A 1W5NA 2QT3A 4O1DA 4YMZA 2A0NA 1G1YA 3HB9A 3LV5A 3SECA 3WD2A 5J8LA 1MW3A 1XLCA 4UCFA 4FLQA 1TPVA 5BROA 1UW9A 4WKAA 2W61A 2VNCA 1GYMA 1EF2A 2GJPA 1GVSA 5D30A 4E0CA 1E4LA 3ERPA 1IZCA 1W37A 2A1YA 3PZTA 5FEPA 5GJMA 1FDZA 2FZMA 2V6AA 3WD4A 3WQCA 2ACRA 3DC8A 3HA1A 4TTGA 1O5QA 4XZHA 2PURA 1YBQA 1RJPA 4AD3A 4IIHA 3PJUA 2GDUA 2GOUA 1GVIA 1EZWA 3QZAA 5K4ZA 3SRDA 3BG5A 3QYSA 3QXBA 4MYAA 4H9MA 2CLKA 5HNNA 3VFCA 1JYNA 4H9UA 3PR2A 4I8DA 4LF2A 3BLLA 2A21A 1GW1A 5A8GA 5TQLA 1WZLA 4M19A 2B7PA 2WK2A 4JTAA 3CYJA 3HU7A 3O63A 4JIIX 4HK6A 3W88A 1JI2A 2QAPA 4D2JA 4O12A 5A8NA 3PZVA 3VI2A 1QBAA 1W9DM 3WJWA 1UUQA 2YX0A 5MHBA 3CQHA 1KD0A 3SY8A 2OZ0A 4LANA 1ITUA 1LRQA 2DQXA 4OIFA 4IUGA 3DHPA 2ZFAA 4ZO8A 5A2CA 2I5QA 1ONRA 2WCSA 1YKWA 4JYEA 2NW0A 1FCBA 1MDRA 1VJIA 2ACUA 1XUZA 5F1UA 3BZGA 4MMWA 2YL9A 1XIFA 3IANA 3N15A 4MY9A 4I90A 1UUMA 4B4HA 4TOQA 2V68A 3POCA 2D2OA 3M43A 3OTRA 4G9PA 3SCUA 3KS5A 3WKZA 1A4LA 2FVLA 1XIMA 3W7OA 1MUWA 1UA3A 3TLQA 3HQPA 3CMGA 3KOYA 5LKYA 2X1IA 4AIBA 1E1FA 1TPEA 3BLKA 4B5WA 5ECVA 3I3DA 1REQB 2QGYA 1EC8A 2WB5A 1J11A 4A8RA 4NY2A 4I7WA 4QDPA 4DIAA 1WDWA 2INFA 2NXGA 3T78A 3K46A 1V6XA 3R7MA 4R3UA 4ZZ9A 1FFQA 1FCUA 3AI0A 4NX0A 4ERIA 4MKVA 4POCA 4H01A 1R7OA 1L6YA 3GVQA 3KUMA 3N6QA 4TX9A 3TOYA 1BYAA 5CAHA 4HYRA 2XJ7A 5AVHA 2BXZA 3LXAA 4GYKA 2DPEA 4D8LA 1O68A 1XG4A 1NDYA 4HTBA 4UQBA 2HPIA 1JD9A 1V8EA 1S1PA 5MKGA 3EA1A 3T1GA 5K9XA 4JQAA 2A3LA 4U10A 1JNEA 2E6DA 4XQ6A 4TMBA 3V0UA 2Z28A 1RJQA 4B2DD 1W3LA 2SFPA 2Z26A 4N9EA 1NFPA 3R10A 3VPLA 3NURA 1AW2A 4H9VA 5EU9A 3RRAA 4C6BA 3QGKC 2PTDA 3EGJA 1H7WA 1S2VA 4WR3A 1SO5A 4MUPA 4FPSA 3BVJA 4W86A 1QI4A 1PDYA 2R6OA 2XIMA 2VOMA 2XUCA 4AIUA 3UF9A 3T4CA 3NZ1A 1XCXA 3P0XA 3TWAA 1VD6A 2BB0A 1VP5A 1GHRA 3G1RA 3GU2A 4J3SA 2G5WA 3I6EA 3QY7A 1WXYA 4AD4A 4M81A 1B9BA 3KLLA 2L5HA 3S46A 3VNKA 2ISSA 4H7VA 2Z2BA 2A85A 2J7GA 2Z24A 2FLIA 3TN4A 2NUWA 2MNRA 1FWWA 4G1NA 3S2MA 4UTMA 3AXMA 3QMSA 3VKCA 3ZFHA 2WVUA 5BOEA 2OQHA 1NEYA 1GYNA 1B3WA 1WE5A 2PAJA 2WSYA 1DWFM 1OFBA 3SDOA 4XSLA 5AKQA 4Y9MA 4GZJA 4Q8PA 3UW6A 1E1CB 4H8UA 1MI3A 5BOOA 4L1WA 1JDEA 3QFWA 4MVAA 5KZEA 3S9YA 1ALDA 1WDSA 3W02A 5I06A 3F4CA 1CGUA 1WZAA 1SW7A 1AQMA 1NY1A 5HUPA 2BDQA 1D3CA 2D23A 3QTPA 3C5QA 3TZFA 1R3WA 1XLFA 3GKFA 1TTPA 2FHBA 4GA8A 5A6TC 4N6EA 5LSMA 3B04A 2ZUSA 4JHOA 3FYYA 2PDUA 1EJUC 1P48A 2J8TA 4I9JA 2IPFA 2VDIA 2VQUA 3PB0A 3W27A 4D6FA 3BE7A 4J3TA 3UR5A 4WJ8A 8A3HA 1VC4A 3UJ2A 3IUIA 3MDWA 3DXIA 4IHCA 4M0XA 4HMCA 4TTUA 1HFBA 3FLUA 3VD9A 1TO3A 3QKEA 4KWWA 5EMKA 1KM2A 2C8NA 1A5LC 1IWPA 4AVNA 1KFLA 3ARWA 1XDMA 4GI8A 4YHEA 1XLGA 4YU1A 1JPHA 1TG7A 5DCDA 2XVNA 1W3NA 4FEZA 4WSJA 1GG0A 3KBNA 1EEXA 5FJPA 1KRAC 2ZICA 4XD3A 2HPMA 1XHGA 4ZGYA 1RBAA 3QOMA 1NWRA 3IAPA 4B2DA 1JXKA 1X96A 4KF1A 4DUOA 4MUZA 5D32A 3TQVA 2WQDA 1ZBCA 3AJXA 1HW6A 5ABFA 1E0UA 1GORA 5JH2A 3TW6A 4U33A 4C65A 5AHEA 3CQIA 2D69A 2NQZA 3TYCA 2VM8A 1YTEA 3GH4A 3QZEA 1M41A 4KKXA 3UZWA 1OFOA 5CPTA 2GQ8A 2OGYA 4FOJA 1TCMA 4KRTA 4PFHA 3GHRA 3FFSA 1YE4A 3L4YA 2PDIA 3GFXA 1JCTA 4MPKA 1KNWA 3DGBA 3NZRA 3VKKA 3VZYA 4AZ5A 4PUUA 4IQJA 2Q8LA 1N2VA 4BY3A 2VO5A 1TE6A 1VEOA 5LGZA 4PC8A 1HJWA 3W0KA 1CGWA 3SSJA 5GNXA 5I0DA 1XLKA 1E15A 4K38A 4QTGA 2O9TA 4LUTA 2VGFA 3T05A 1ODUA 4O8RA 3XIMA 2HVMA 4OV9A 5D02A 4K68A 1EA0A 4HP5A 2RDUA 8XIAA 2ISDA 3NL3A 3RCNA 4Y8FA 2QUVA 3PWAA 4O1FA 1JYWA 1ECQA 2J7HA 3BWWA 5DANA 3PPGA 1V93A 3UT0A 2J66A 2G50A 2DVXA 1B90A 1DORA 3KCLA 4GIAA 3WJSA 3VD5A 3BSGA 3S6DA 4BWLC 1W5QA 1TMQA 1BFNA 3GTFA 3R1ZA 3LG3A 2WWDA 3UYCA 1EJ7L 4RW3A 2DZVA 3MKCA 3MCMA 4JTGA 3PNUA 3KFTA 1PPIA 2B81A 2BY3A 3HG2A 1Q6FA 3OP2A 1HVQA 1RUSA 5EB8A 4LQ1A 1YDVA 4N4QA 4O15A 4PMNA 4AX6A 5C8BB 3BG3A 2ISWA