3NSNA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with tmg-chitotriomycin
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords N-acetylglucosaminidase
publication title Structural Determinants of an Insect {beta}-N-Acetyl-D-hexosaminidase Specialized as a Chitinolytic Enzyme
pubmed doi rcsb
source organism Ostrinia furnacalis
total genus 191
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nsnA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3nsnA01
1JAKA 3CUHA 1BTCA 1P6WA 3ZJ6A 7A3HA 2WMHA 2DEPA 2NT1A 4J28A 4TTGA 3F5LA 1K9EA 3KL3A 3PZVA 4M29A 1QW9A 4CKQA 3S2CA 4W7UA 1KB3A 3NUKA 3VMPA 1FP9A 1GJWA 1UD4A 1JDAA 3W28A 1GOWA 2DT3A 4V28A 3W0KA 5A3HA 1RP8A 3W27A 1QOXA 4HPHA 7CGTA 1O6IA 1ZBWA 2E4TA 3CMGA 1V02A 2YA0A 4HMCA 4PUDA 4P7RA 2CBVA 1OIFA 1PPIA 4R27A 2CERA 4UQAA 2QLYA 1A47A 3SEPA 2O92A 1RH9A 2J7GA 1LWJA 3WF1A 3L4VA 5FOOA 1FOBA 3WUEA 1TVPA 4B3KA 4U2ZA 1G01A 3WF2A 1TVNA 4QAWA 3AHXA 1G94A 1MFVA 3W82A 6TAAA 2OSYA 3MMDA 3GH7A 4MB4A 2X0HA 4BS0A 4AIOA 2BY1A 4B3LA 2C7FA 2V38A 1N82A 4M80A 4AEEA 1TMQA 3A6OA 1WZLA 5D9PA 5LYRA 2VMFA 2GDUA 5A6JA 3OLEA 4J3XA 2ZUUA 5HBFA 1NWRA 2XVNA 1HJUA 3N17A 4LYRA 4UFKA 1DWFM 3ECQA 3BAXA 2VJXA 3WQ6A 3WNOA 5CGMA 4BQ2A 2XSAA 4C7GA 4CD7A 5CSYA 4MJ4A 4UQDA 1J01A 1G0CA 4JHZA 3GBEA 1HVQA 4GO9A 4BCEA 1E56A 4GPNA 5LA1A 4UFLA 1CXEA 1MW1A 5E9AA 4PCTA 3TONA 4W84A 1VIWA 4BA0A 4H8HA 4GZIA 1XC6A 1MQQA 2YBUA 2HVMA 1J18A 4F9JA 2BY2A 1JYWA 2WVSA 1XGZA 3ZJKA 3SCSA 4AY1A 2CITA 4CD4A 1EDTA 4W85A 1QI2A 2D0HA 2BHUA 4H8UA 4XUYA 3UCQA 1ODUA 1QBAA 3S6TA 3WH6A 3O2LA 3MS8A 4WIWA 3NYDA 1LLOA 3AMKA 2EQDA 4KMQA 3ZT7A 1KGUA 4ZXLA 3SUTA 4AWEA 3DC0A 3QOMA 4PRWA 4A3YA 5C70A 3CLWA 1CGUA 4J3TA 1CZ1A 5CLWA 3CPUA 2EBNA 3TTYA 5AYIA 4JFWA 1JZ4A 3J7HA 2VZVA 2WHJA 1UWQA 2XM1A 2WM0A 3VMOA 2Q8XA 2YBTA 1OBAA 3T0AA 2B31A 1TFVA 1QNSA 2ZX7A 3NSNA 2WHMA 3VIFA 1R8LA 3WNPA 5BRQA 3WF4A 2NT0A 1V0MA 4FLRA 3EDEA 2BXZA 2WMKA 1EO7A 2CKRA 4CU6A 5C71A 3FN9A 1UZ1A 4AIUA 2FH6A 3PTQA 2E9LA 4AZCB 2J75A 4NSBA 4JL1A 3WUFA 1JD7A 4TOQA 2PWEA 1JGIA 1ITXA 3BAJA 3UG4A 4AD5A 2E40A 4UFJA 3K8MA 1XSKA 4OBRA 3DYPA 3WQVA 1NWSA 1QHPA 2J7FA 1KXQA 3WNMA 1LG2A 5HXMA 2XWEA 1V6XA 2YJQA 1IZJA 3B9AA 1B3VA 1H4PA 2YOCA 3GZAA 1HJXA 2VX6A 1M53A 4PMVA 1UWUA 3W29A 4BQ4A 3MV01 3PZ9A 5CPTA 2QMKA 3W38A 3U7BA 1GOIA 3UG3A 2UY5A 2WKGA 1AQ0A 1Y7VA 2DSUA 1CGYA 4UNIA 4CD6A 1VFMA 2X2YA 2AOSA 2CBJA 3EDDA 1BGAA 1BPLB 5C8BB 3NDYA 1UH4A 3CHDA 1GONA 4LYPA 3SCOA 4D6IA 1WDRA 3N04A 4UFMA 3WD1A 5EMYA 1QVBA 2Y5EA 2VCCA 3WD0A 1TG7A 3WD4A 3VNYA 2G3NA 2WHKA 3NSXA 2UY4A 1DP0A 1FFRA 3PZOA 1J0ZA 1UUQA 3AFBA 3VIHA 3ARYA 5D9NA 4CCDA 1JFHA 4TUFA 1UD8A 3AMDA 2WB5A 1VB9A 4JHOA 1W3JA 2O9OA 2ESCA 2ZX9A 2UY2A 1ISXA 2J8FA 1ZU8A 1US2A 3WF0A 2J7DA 1WNOA 1QBBA 3WMBA 1ZBCA 5M17A 5ABHA 1TZ7A 3LMYA 5BYWA 1GQIA 1UWRA 3N11A 1RPKA 2WZEA 3PBGA 4H04A 5LA2A 3ZO9A 3RJXA 1BG9A 1XD1A 3BMWA 6CGTA 3OA5A 1V02E 4B9YA 2WZHA 2PWGA 3WMCA 3VIKA 3CHFA 4RE4A 2FGLA 4TTUA 3HN3A 2X09A 3PZNA 4UOJA 3EBVA 1PEZA 2E8ZA 3RM9A 3VIIA 1VF8A 1E1FA 1EOMA 2VT0A 3AIEA 2CETA 3IJ7A 4HZ6A 2YL9A 4BZYA 2ZX8A 1VBRA 4HOXA 5I2UA 1UD5A 1HT6A 2JFEX 4M81A 3W4RA 4HP5A 4GIAA 1QNRA 1X6NA 1BVZA 4W8BA 4XV0A 2A3AA 2G4FA 2V3DA 2Y8KA 5DFAA 4W5UA 2JALA 2YDRA 3CUFA 1ZS2A 2OYLA 1PAMA 2J62A 5GQBA 3WDPP 2WC3A 1R85A 5I23A 2VUYA 5DO8A 2ZUVA 2DSWA 3ZT5A 1Q6DA 3EYPA 2BVDA 2EPLX 3GBDA 3CGTA 2EEXA 1B2YA 1MYRA 2BV9A 1V0LA 3VD7A 1W1YA 1QI0A 2J7HA 4AISA 3AZRA 1E72M 1HIZA 2GK1A 4PN2A 3GNOA 2PB1A 5M03A 5IFPA 2PBGA 3WQ8A 1FH8A 4AXNA 1JZ8A 1CNVA 3VOCA 2DH2A 3WDRA 5DMYA 3EDFA 4DM2A 2E9BA 4HA3A 4KGJA 4JIEA 1VENA 5F7UA 4D1JA 3AMCA 4PMQA 1WAWA 4Y7EA 4ACZB 1NOFA 4D6EA 1EXPA 3BGAA 4N42A 4W93A 1KWGA 2X8RA 1BYBA 4AZIA 2OSWA 1C91A 5D8WA 1E1EA 2BS9A 1ECEA 3IK2A 3T0DA 4ATWA 4HPGA 1GQLA 5M3WA 1W1VA 3U5YA 4ML4A 3L4UA 4EK7A 1QPKA 3POHA 3WEMA 1OGSA 4JKLA 1VJZA 1A3HA 1JF5A 3NDZA 4AEFA 2QV4A 2VL4A 2EJ1A 4PTMA 4UQEA 1XH1A 4BQ3A 1WO2A 3LPGA 1HP5A 3GTNA 4CD8A 4DM1A 2WVTA 2JIEA 3M7SA 1KCLA 5CPQA 3FNDA 4MNKA 5CJ5A 3I3BA 5LA0A 3CTTA 2E0PA 1VFFA 3K46A 1W9UA 4B9ZA 3I3EA 1HL9A 2O9PA 2OLHA 3BC9A 1UD6A 2WLYA 4PMZA 4HTYA 1XCWA 3SCRA 1E6XM 1GOQA 3O9NA 3ZM8A 4JCMA 2DSVA 1OT1A 3HJEA 2CEQA 4P7OA 5CQ1A 1HVXA 2CNCA 2OWWA 1J0KA 3CZGA 2F61A 4J3UA 4AD4A 3OG2A 4H8VA 4RE3A 2OYKA 2EXOA 2WAGA 3BAWA 2ZE0A 2W63A 5AC5A 3W6LA 1VJSA 4HZ7A 3W24A 2VRQA 3N15A 3VVGA 1XH0A 3AHTA 4IPNB 4FLQA 3VGGA 5A6BD 1J0YA 2EPNA 3PZIA 3VIPA 1DTUA 5A6LA 1ZBVA 4EKJA 4GI8A 1UQYA 4XZBA 4OUEA 3B9DA 1E43A 3CZLA 3VILA 4PTVA 1W9PA 2D22A 3D5HA 1CYGA 2A3CA 1UKTA 4HOZA 4W8LA 1FH7A 2VC9A 2ZWYA 8CGTA 3CBWA 3VX1A 4F9DA 2YA1A 3GNPA 4ZEPA 4PMNA 3VDAA 1V3IA 1UZ4A 2VQTA 1VEMA 2GJXA 2XIIA 1JIBA 2G3MA 1E4MM 3F5KA 2PC8A 3NJ3A 1EHAA 2A3HA 3OLIA 2VZTA 3UESA 4L4OA 1GJUA 4ZE4A 3SCTA 4JZ5A 3OZOA 2J7CA 1HJWA 3IAQA 4U3AA 1UH2A 3N18A 5ECUA 4ZE5A 1GPFA 1ZB5A 5CLTA 1B90A 2XGIA 4CUCA 1M01A 3DYOA 5I79A 1J0JA 1JDDA 1QW8A 3L2MA 1M04A 4YN5A 3TTSA 2ZUWA 4KRUA 3AI0A 1R7AA 5A6BA 3NSMA 1C8QA 3PZQA 3AIBA 1ISZA 2BY0A 1B3XA 1ZBKA 3BCFA 4HOWA 2XVLA 5E09A 4Z2IA 5I0DA 2WANA 1LWHA 4C90A 1OGGA 1GQKA 2JIWA 3AMLA 3D3AA 1J0HA 3ZJ8A 1BGGA 2JF7A 2WSPA 1W9BM 1OIMA 2E9MA 4OZOA 4W7VA 4RE2A 2DQXA 1EO5A 2EPKX 5FL1A 3AS0A 3OLGA 4MB5A 3SCNA 3WH7A 1E15A 4GQRA 1WZMA 3DHUA 5EFDA 3RCNA 1CLVA 1RD6A 1EH9A 3SCWA 4Z2JA 2J74A 3OBAA 3FXYA 1F4AA 4JAWA 4L4PA 2X1IA 3SUUA 3T08A 5JBFA 2YL8A 4IPLA 2XPKA 1VEPA 4PMOA 4WKAA 3TOPA 3DECA 5CSUA 5AYBA 3VINA 2AMGA 1LL6A 1NM9A 2GFTA 3CIVA 3WEOA 1CXFA 2WLZA 1CXHA 1CGVA 4GZEA 4NF7A 2EO7A 4DWSB 2VZOA 3VIMA 1WP6A 3L4TA 3AHZA 3B8SA 4QLLA 5FL0A 3AZTA 1UA3A 2HISA 1JNDA 4MNMA 5FIPA 4AZGA 4PYSA 3CHCA 3WNNA 1BYCA 4OBSA 2VI0A 2D3NA 1MQPA 1KR1A 2G41A 1JAEA 5EB8A 3VDCA 5I24A 4MNJA 1EQPA 1E0XA 1L8NA 1E5JA 1PBGA 4LQ1A 4P8WA 3GNRA 3T2QA 4QCFA 5GNZA 4NRSA 1V3MA 1NP0A 4TVUA 3ALFA 3EDJA 3VGBA 1XYFA 1ITCA 1D3CA 4PEEA 1GQJA 2XVPA 3GH4A 2W67A 3W25A 2MANA 1BQCA 3RJYA 4UZSA 5BWFA 4AC1X 1IV8A 1EHNA 3IJ9A 2VTFA 1GORA 4P7NA 4WSJA 4R5EA 1H3GA 4JFSA 1S46A 2D0FA 2FHCA 2WNWA 4QDMA 5D9OA 4AZ7A 1BYAA 1H2JA 1Q6EA 1CXLA 2J7EA 4GQQA 3OGRA 1CGTA 2YDQA 2JF6A 4J7RA 1C92A 3NIYA 3SCQA 1OT2A 2XFFA 5A8MA 2DIEA 5CXPA 1JXKA 2IXUA 1UR8A 4FLOA 2WBKA 3TP4A 1QHZA 1KWKA 4RL3A 4CN6A 2YA2A 2ZUTA 4AZCA 3W53A 1BFNA 3VM7A 1HF6A 4IISA 5CZKA 3ZR5A 2RGLA 5HDRA 1V3JA 1FFQA 4GI9A 1CGWA 5BXRA 1KXVA 1GVIA 3SUVA 3AYSA 3KZSA 4W5ZA 4ACYA 4C7FA 2DSZA 4D71A 4QCEA 3F5JA 4X0VA 3RO8A 4M56A 2XUCA 4OOUA 4PSPA 4JFTA 3AXHA 3MKKA 4D6FA 4AW7A 2J79A 1UQZA 3ARZA 3CZ8A 5BXSA 4P8VA 1UWSA 3OGVA 4Z2LA 1JZ2A 4CCEA 3SUWA 1MXDA 1TR1A 3WFZA 5IHSA 3POCA 1LG1A 2X0YA 1E4NA 1B30A 3TA9A 2XGBA 1MW0A 2ZICA 4D6JA 3L4ZA 4W7WA 2CBUA 5JIWA 3CMJA 1DHKA 2WC4A 1W3KA 2WCGA 1MFUA 2NW0A 1R7OA 2V5CA 3MSGA 1BF2A 1UA7A 3HU7A 4J3SA 2Y2WA 1KGWA 3MUAA 2YL5A 1OSEA 4ZFMA 3AJ7A 3F4VA 1QNPA 2PI6A 2WZIA 3II1A 1R86A 1GHRA 4V27A 2V3GA 3ZMRA 1H49A 2BY3A 4NRRA 1PIFA 1Z32X 3PZTA 1BSIA 4HU8A 4P8XA 2VCBA 1GOOA 2GVYA 1D7FA 1K9TA 1B0IA 1ODZA 2XVKA 3W6MA 4F79A 2JE8A 2QPSA 2WWDA 1W2PA 1AMYA 1ZL1A 2CKSA 3I3DA 3K1DA 3AYRA 2ZOXA 3PHAA 4HMDA 2CBIA 2WMIB 3G6LA 4YHGA 3WY1A 1WZKA 5GNXA 3ARUA 2EPMX 2DT1A 3UR7A 4TX6A 1SMAA 3VD4A 1C3FA 2XTKA 3CH9A 4PMYA 1EDGA 1JFXA 1FHLA 2D23A 2EPOA 4UQBA 4U31A 3WELA 1SFSA 1FH9A 1PIGA 3PZGA 4IUGA 2ZXAA 4QLKA 5ABFB 1H1NA 4QP0A 1DWHM 5ABGA 2XG9A 4AZ6A 3AQUA 4M1RA 1NQ6A 4KWUA 2WC7A 1UKPA 1JDCA 3GM8A 1J9YA 5BRPA 3CZJA 3PN8A 3G6MA 4ATLA 2WKLA 2VVNA 2JEPA 4AYSA 2FHFA 4BF7A 4K68A 1GOMA 3VD5A 3AMGA 2FDMA 2ZUMA 4WLCA 3VD9A 1G9HA 3A4AA 1GW1A 3AOFA 2W91A 3WD2A 1OCQA 1UHVA 3GH5A 4TVCA 1UD2A 4GI6A 2QF8A 3UG5A 5A8PA 1OWQA 1E6RA 1E40A 5JIPA 4PTWA 3WFLA 2BNJA 2PWDA 4YPJA 1HKJA 4UZUA 1HKMA 1O7AA 2OWXA 4H7VA 5ABFA 3ARXA 4NZCA 3ZIZA 3RDKA 4CGTA 3WN6A 3WUBA 3MO4A 4FF5A 3ZSTA 1EOKA 3EMCA 3LPOA 3TTOA 3ZOAA 5E6YA 1JYNA 2ZUNA 2D24A 1V6YA 2V3FA 3AIVA 4M24A 1E3XA 5A2BA 1Q6FA 2GJPA 3FHAA 5KZ6A 2WCSA 4C91A 2D20A 2BHZA 2DT0A 3PTMA 4D6CA 1PZ2A 1K9DA 1SR0A 2ZXDA 2WHLA 1EA9C 1NH6A 1XYZA 1BLIA 2DIJA 1VFUA 2CPUA 1J12A 1HNYA 2VR4A 4ACZA 5CG0A 2ZXQA 1NOWA 1QI4A 1FA2A 2E8YA 3ZSSA 1ESWA 2VURA 1U2YA 2WXDM 1QNOA 3QGVA 3OLDA 3W81A 3WKZA 4H41A 4JFVA 5D9MA 3VU2A 3FW6A 1C90A 1ISWA 2VRKA 1ZJAA 5BCAA 2DGAA 1W2VA 1E70M 1MW2A 2CHOA 4OKDA 1WPCA 2UY3A 4J3VA 1WDPA 2PF0A 4P8UA 4W87A 1D2KA 4CN1A 1BVNP 2VCAA 4Z2GA 2IUZA 3MSDA 1XCXA 1I1WA 2Z1SA 1J0IA 2VO5A 5EBAA 3ZQ9A 4D6HA 3B9EA 2F8QA 3WH5A 1JI2A 5DF0A 2XFRA 4D72A 1FP8A 3FAXA 4UCFA 4HA4A 2XSBA 4AIEA 1I75A 2V3EA 2RGMA 3SCUA 1B1YA 2DPEA 1KQZA 1X1NA 4Q22A 4KH2A 3SIMA 1DWAM 1HP4A 2X05A 2CXGA 2GJRA 4J3WA 1OM0A 4AD1A 1J11A 2O9RA 3VIGA 4JL2A 2XFYA 2C8NA 3CUIA 2ZWZA 2D0GA 3GXDA 4QLJA 1UOKA 1C7SA 2GDVA 3WL1A 1UKQA 1UR1A 1W91A 2XWDA 2W4XA 4AMCA 4CVUA 4CD5A 1DWIM 3AS3A 4NI3A 1CENA 4U33A 4CU7A 1UD3A 1VBUA 4WSKA 1G1YA 3EMQA 1MVYA 1JYVA 1NWUA 4WF7A 3VDHA 1IT0A 2VZUA 3VO0A 4OIFA 4E8DA 4F66A 1XRVA 3VGHA 5I3DA 2J47A 4KGLA 4P7QA 4W8AA 1JXJA 3ZT6A 4U5KA 3A47A 3E1F1 5A8NA 3OGSA 2NSXA 2WYSA 1Q6CA 2ZXBA 1HXJA 3L2LA 4DUXA 1JD9A 1PX8A 3VIJA 3WIJA 4TXEA 4MNLA 4PMDA 1WCGA 2WW5A 1KFWA 1OD8A 1H5VA 1US3A 1WDSA 1NOUA 5A2CA 5E70A 1AQHA 1C7TA 2WMFA 4Z2HA 1XD0A 2WMJA 3HMCA 2VR5A 4JFUA 4C7DA 1V3KA 2J77A 4GXPA 1EIBA 4FK9A 3MMWA 1KBKA 4BQ5A 4S3KA 1U33A 1W9VA 3WBEA 1W32A 1OGBA 1PX4A 3K4DA 5E6ZA 3VKKA 3CO4A 4LXFA 1VEOA 2C0HA 1X6LA 1B9ZA 2O9TA 3A4XA 4UFHA 3UR8A 1UKOA 4AD3A 4AD2A 3AISA 3VGDA 1QNQA 3WEZA 1TE1A 4DWSD 2CYGA 1LJYA 4LYQA 3VGEA 3BAKA 1G5AA 1JZ7A 3AIWA 4U3CA 2A3EA 3CHEA 3M07A 1H11A 1TUXA 4Q7NA 2VX4A 4URIA 4PCSA 4XZWA 4MTVA 3GDBA 3QR3A 1HJVA 3OB8A 4X0NA 5IHRA 5I6SA 2VVSA 2BVYA 1E55A 1JYXA 5GPRA 4E4PA 1JI1A 2J78A 3AHYA 2W61A 4KRTA 2D2OA 3VUPA 1ISYA 3W26A 5AC4A 4UR9A 4PMRA 4FLSA 1EGZA 1KR0A 1UYQA 1B3WA 3BCDA 5BROA 3K8KA 4HA1A 1C93A 5A8OA 3T2PA 4A3HA 3OZPA 3AS2A 1I1XA 3PZMA 2PWFA 2J4GA 1CEOA 1W9XA 3CZKA 3KWXA 1OINA 1J10A 2WWCA 3SCPA 2YLLA 4GZJA 3KL0A 1SYTA 3W37A 1W1TA 3WNLA 5A94A 2E3ZA 3BAYA 1LF1A 4WKHA 2J25A 3MUZ1 4ZXOA 4DWSA 2CCRA 3A4WA 3K4AA 3U7VA 3WH8A 1V0KA 3AHVA 2OWCA 3EMZA 5HOSA 7TAAA 3UEQA 3N1AA 1HX0A 3K8LA 2XM2A 5TD4A 1PX3A 3RIKA 2OYMA 5EFFA 3BLKA 1E3ZA 3QHOA 2VX5A 1CTNA 3ARRA 2Y24A 3GXMA 2Y4SA 4AZ5A 2WBGA 1AQMA 1CIUA 4MADA 5BXTA 1SMDA 5IXEA 1CPUA 1EDQA 1UH3A 3WQWA 1GZJA 1VRXA 3ARQA 2BXYA 3WQ4A 5DT7A 1UR2A 1V03A 3RM4A 3N13A 2FHBA 3KE0A 4UOQA 1CGXA 3SCVA 4GO8A 1QI5A 3BMVA 1ZJBA 4EAMA 5BXPA 2TAAA 1E71M 3U57A 4B15A 1GUVA 3THCA 4WJXA 4ATDA 1GNXA 4AD0A 2QHAA 3WDIA 2IXVA 1UR4A 3N9KA 1CXIA 1JL8A 1OB0A 5A8QA 5HPOA 2ZX6A 4X9YA 2W66A 3CUJA 4DUWA 3WDJA 1CLXA 3LPFA 1OD0A 1CDGA 3BSHA 4HU0A 1GCYA 4PMXA 4U5IA 4F8XA 1CBGA 3CZEA 2VX7A 4M8UA 4PMUA 3AS1A 2F2HA 2XJ7A 3RILA 5IFTA 1E6ZA 4YHEA 2ZIDA 1JF6A 2DDXA 1K6AA 2Z1KA 4UQCA 5FD0A 3MU7A 1R87A 2VZSA 2CIPA 5A1AA 2QPUA 3GXFA 4N0RA 1H09A 4FMVA 1BHGA 3M6DA 5ABEA 2WVUA 3AROA 3GYCA 2FGZA 1W1PA 4HMEA 3SUSA 1NWTA 2YKKA 3GXIA 6A3HA 4QFUA 5E0CA 5I5RA 1L0PA 3BSGA 1IZKA 5CPSA 1HL8A 2GUYA 3WL0A 5IDIA 3DHPA 3NCOA 4JCLA 1WDQA 2V5DA 4MAVA 2CHNA 1E0WA 2FH8A 3QHNA 3WQ5A 1V3HA 5FCZA 2XHYA 1PJ9A 4W86A 1E6PA 3VTRA 2DH3A 1E73M 1W3HA 9CGTA 2WSKA 1C8YA 3OIHA 4M82A 2WMGA 4MB3A 3ARWA 2G8ZA 2ZUSA 4CN4A 2YDSA 1KQYA 4JKMA 3FHQA 3MUIA 1NP2A 5DT5A 2GSJA 4LPCA 4MB1A 3ARTA 4EANA 3KEHA 1E6SM 2OSXA 1V6VA 2G3IA 1DEDA 4D6GA 1H41A 4CVWA 3KL5A 4U2YA 1XSJA 3WDQA 1UWTA 3AZSA 1H0GA 1HN1A 3MUY1 1W9DM 2AAAA 5I78A 4CCCA 3RPMA 1QI3A 3LPPA 5A2AA 1K9FA 3MANA 4PTXA 4GKLA 2GK1B 3IANA 4PSRA 3RM8A 4XB3A 3PZUA 5KEZA 3BLPX 4AZHA 3AIQA 1GVYA 3ZR6A 2UWFA 3VIOA 2XVGA 2XIBA 4IM4A 1F4HA 4Z2KA 3U5UA 3ZJ7A 4LX4A 1W3LA 1AVAA 1LQ0A 1BAGA 2BFGA 4JKKA 1C8XA 2YL6A 4LGXA 3AIUA 3WNKA 4MPKA 2WCAA 4OOZA 1UG6A 3WH9A 3WUGA 4MDPA 1FHDA 5E0FA 1Q6GA 1B3ZA 1KXHA 2G3JA 3BH4A 3WDHA 4DWSC 3VGFA 1EQCA 4V2XA 3WBAA 2WK2A 4S3JA 2WMIA 1UKSA 2CESA 2D1ZA 1DWGM 1XSIA 3UETA 3AIRA 1CWYA 1NARA 1E4IA 1MQRA 3RMEA 1WB0A 4WKFA 3L4WA 3EDKA 1WKYA 1XV8A 3FY1A 5JBDA 1VAHA 2W92A 5A6SA 2DSKA 1GHSA 3PTKA 3UERA 3FAWA 3IAPA 4OJYA 5DEZA 1RP9A 3VDBA 1KCKA 2W62A 4UFIA 1YQ2A 3WSUA 1JG9A 1M03A 5FKYA 5A69A 3AXIA 4B16A 1E6NA 2VOTA 1JZ6A 4UOZA 1H0IA 4GINA 1ISVA 3O6AA 3QHMA 3BXWA 2VNCA 3WENA 4H2CA 3QOKA 3VM5A 2DT2A 1GOKA 3WMSA 1JZ5A 1UWIA 5D8ZA 2J8GA 1E4LA 1JZ3A 1E0VA 4ZENA 3T0BA 1E5NA 4PUEA 4D6DA 4D1IA 4DUVA 2A3BA 3ARPA 2BHYA 2VRJA 5HNNA 4E2OA 2WPGA 1QHOA 1LL4A 3VPLA 4CU8A 5I77A 3VD3A 1E9LA 5CGTA 1JNEA 1M7XA 1UR9A 1PZ3A 3L4YA 3WF3A 5D4YA 4XX6A 4TX8A 1CXKA 4EE9A 1HKKA 3BAIA 3DYMA 1WE5A 4W88A 1TA3B 1KXTA 1V6UA 2BVTA 1E6QM 2XYLA 5GNYA 2PWHA 2J7BA 2QMJA 2WVVB 3AICA 1BYDA 2PBOA 4A4AA 5A6KA 4MAZA 4UTFA 1V6WA 3APGA 5AY7A 1V0NA 1KBBA 2Y8VA 4TVDA 4AZBA 3A3HA 4P7LA 4WK9A 5A6MA 1B31A 1HKIA 1HJQA 4PBGA 1WZAA 1Q4NX 3JUGA 8A3HA 1VFOA 1MW3A 4UQ9A 2JEQA 3VNZA 3VX0A 1BG4A 1TCMA 1LL7A 1V08A 2VQUA 3N12A 5JBEA 4MJ2A 2GJXB 3IJ8A 3T2OA 1XH2A 3ARSA 1MWOA 3CUGA 2D3LA 4J27A 3AXXA 1U30A 3L4XA 1KGXA 1UR0A 1YHTA 3T09A 5A95A 4MDOA 3THDA 2ZX5A 3SURA 5A6AA 1DWJM 1HJSA 3MMUA 1TA3A 5HPCA 3TTQA 4E8CA 1CECA 3M46A 3ARVA 3WD3A 4HZ8A 2WVVA 1V3LA 4W89A 1MXGA 3ALGA 3MV11 5JUVA 1XHGA 1B3YA 5M5DA 2YLAA 3VMNA 2YIHA 2W5FA
chains in the Genus database with same CATH superfamily
3H7RA 5M2FX 1P0BA 1K9EA 3PZVA 2HCVA 5KETA 1G67A 4AHPA 4Q8VA 1JJKA 1FP9A 1XLLA 5TNVA 3B0XA 1JDAA 1VCGA 1GOWA 1QFEA 4NXSA 2A5HA 2B0MA 4ZO7A 4LBSA 5A3HA 4WDXA 4JN8A 4HPHA 7CGTA 5LXEA 2FVKA 1TV3A 3EXTA 4G8TA 4PUDA 4HNNA 3REQA 4P7RA 5AHIA 1PPIA 5LNWA 3SEPA 2O92A 2X7WA 2J7GA 1RV8A 1GOXA 3KOFA 5H2ZA 3P3BA 3WF1A 3TV8A 1SSDA 2INZA 5FOOA 3EA3A 4JX6A 3WUEA 1TVPA 1DHPA 3TDFA 2Z7KA 4U2ZA 3NQMA 4PCNA 1TVNA 4QAWA 2FTPA 4G1KA 3UXIA 5D05A 4AIBA 4MB4A 1J5TA 4AIOA 1BXBA 2BY1A 1Y8BA 2HVOA 3A6OA 3UVAA 3M64A 3M16A 5A6JA 2NSOA 2XVNA 1PB0A 3M0YA 2DORA 3W02A 4LANA 4UFKA 1P5BA 4A3UA 3WQ6A 4BQ2A 3STEA 2Z29A 3RRAA 4MJ4A 1XKYA 3GR7A 1G0CA 3CH0A 5J5DA 5CC7A 1HVQA 1GVEA 4DEFA 2OVLA 1XLIA 4V33A 4XBKA 1ICQA 1YDVA 1CXEA 5E9AA 4BA0A 4H8HA 1XC6A 1MQQA 1V93A 2GVEA 4IJBA 1J18A 2BY2A 3C3NA 3H2AA 1V6TA 3T05A 2CITA 3R8HA 2B4GA 3VC6A 2BHUA 2CFFA 3MJMA 2DUXA 3MS8A 1NFBA 1YDYA 1LLOA 2WZTA 1H63A 2OZ3A 2AKZA 3SUTA 4ZXLA 3QOMA 3CLWA 1CZ1A 3TTYA 3N2MA 1REQA 4Z1DA 1FCVA 4WY0A 2Q8XA 2ZX7A 1QNSA 1LRQA 2PRMA 3NSNA 2C19A 2A7RA 3NQGA 1R8LA 3WNPA 4HTBA 5BRQA 3G1VA 4FLRA 2ZA3A 4QEHA 3FDKA 1DXFA 4IIGA 3BURA 2CKRA 4UTHA 4CU6A 1UZ1A 4AIUA 2Z1VA 1N55A 4AZCB 4RNJA 2PUZA 1JD7A 1ITXA 4KEMA 3UG4A 4JXCA 1XSKA 3WQVA 2FZDA 3S5ZA 3NQAA 3GW3A 3M0VA 3RLVA 2WNQA 1ME9A 3FV9A 2B81A 3IJIA 2HXTA 3T4WA 1NDWA 3GSMA 3UNTA 3MHUA 4FOKA 1M53A 1BXCA 1TX0A 1Q2SA 4NQ1A 5J5RA 1Q7ZA 4GOAA 1Q4WA 4DZAA 4LUTB 1EJRC 2YYUA 1AD4A 1AQ0A 4UNIA 1OY0A 4KKXA 2F6UA 4GVHA 4ZQMA 4UTMA 2D2JA 1OC5A 4PUMA 4DF1A 4AY7A 5C8BB 3NDYA 3CHDA 4D6IA 1NSJA 3MUCA 2HQAA 1AD1A 5BU6A 2VCCA 3FJ6A 4QQ3A 1A5AA 3VNYA 1GG1A 4DBUA 3MI3A 4TV6A 4OUIA 1EX5A 2UY4A 1DP0A 3PZOA 3QMTA 1J0ZA 2V30A 1ADDA 4IQDA 3ARYA 4XO7A 4TUFA 4UTUA 4JTIA 1ZENA 2IPGA 2DZPA 4M6PA 1GTEA 2VFEA 4OT7A 5L9FA 1RCOB 2J9ZA 2TSYA 3G1SA 4CNPA 1DORA 5AZ1A 4F2BA 1ZBCA 5ABHA 5BYWA 1MZRA 1VCFA 1UWRA 2OLAA 1E9YB 1W8GA 2WZEA 3PBGA 1EP2A 4GH3A 4G1NA 1XD1A 2SFPA 4ADTA 3BTNA 5LNSA 3CT7A 3OA5A 4EWND 4N9CA 2ZC1A 2PWGA 3FSTA 4A05A 1GJPA 3HGSA 4UOJA 1QASA 3EBVA 1VF8A 1E1FA 1DVJA 3AIEA 3SECA 2YL9A 2WO5A 1QMLA 3ZLGA 1HT6A 2JFEX 3W4RA 3VOGA 4W8BA 4XV0A 3I7RA 3R8RA 3P93A 4W5UA 3NO3A 3U4AA 3COTA 4ZB5A 3WK3A 3K4WA 3CUFA 3DFOA 3AAMA 4FR6A 1PAMA 3Q58A 2VUYA 3OEXA 3U4FA 4LFYA 2Z25A 4JYEA 5REQA 1BEUA 1Q6DA 4WOZA 2E6DA 4GUHA 1JPDX 2PTYA 3GBDA 4CQBA 3SBFA 1XBVA 2BV9A 4O0QA 1ZJIA 3VD7A 5C7HA 3CASA 1A0DA 1QI0A 1EJXC 3N25A 2V82A 2KX9A 3BMXA 1NVMA 1HIZA 5K4XA 3VA8A 3RLGA 3B0UX 1IQ8A 2PB1A 4IIDA 5M03A 3WQ8A 2HDJA 1ZP3A 3HQPA 5FSEC 1TB3A 4PC8A 3W7PA 1NTHA 1PUDA 1GVQA 4HA3A 3W7OA 2Y6ZA 4LSBA 3TYUA 2Y70A 3AMCA 4PMQA 4ACZB 3ELFA 4N42A 1KWGA 3GX9A 4WDTA 4H6EA 3C56A 1AQFA 1E1EA 2BS9A 1NAL1 3IK2A 3R12A 1N7KA 4EK7A 2PEVA 4I7UA 1OGSA 1EJSC 3KOWA 4AEFA 4GVGA 3UZYA 2VL4A 1JRBA 2EJ1A 3F2DA 3EA1A 1IT8A 1P1XA 4GYPA 4BQ3A 4A6GA 1WO2A 3BOFA 3ATYA 1HP5A 4CD8A 6REQB 4MYXA 5AHFA 1R3SA 4S38A 3DERA 4N7QA 3M7SA 1WKDA 2Y7FA 2YCIX 5CPQA 1TWIA 3BJTA 4JTGA 2E0PA 1HG3A 4GACA 4N9BA 4MUPA 4B9ZA 2RJGA 5LGXA 2OLHA 4JYFA 3O0KA 4HTYA 1UJPA 4OU1A 3UG8A 2Z2AA 4P7OA 4PUJA 5CQ1A 4AD4A 3MPGA 5FJOA 5C6MA 1P4CA 2OYKA 2P88A 1RAKA 2ZE0A 1FWCC 1Z41A 3W24A 4J2PA 3NQ2A 5G1MA 2VRQA 3KRZA 4N6EA 2ZE3A 4KEVA 3IK4A 3VGGA 5A6BD 4Z17A 2EPNA 4YMZA 1W3NA 3QPYA 4EKJA 4J3ZA 4GRSA 2Q01A 3TSDA 3QYSA 2QJHA 5CCZA 2NXHA 3D5HA 4ZA0A 1CYGA 1XWYA 3QY6A 2XFWA 1UKTA 4HOZA 1PS9A 4A8RA 4D8AA 2XN1A 2ACRA 3I7SA 3VX1A 4F9DA 2CLLA 1FWIC 3VDAA 3OTRA 1S39A 1UZ4A 3LY0A 3HQNA 5AB3A 2GJXA 4U4MA 2XIIA 3ZVHA 1JIBA 2PC8A 4G7FA 3GW0A 1UP0A 2PDPA 2GOKA 4WUIA 3QPZA 3UT0A 2A3HA 4GNKB 5F2GA 4L6OA 2RKXA 4L4OA 1YTEA 3SCTA 2J7CA 1UH2A 1EBHA 5ECUA 2CLKA 4ZE5A 4ERAA 2XGIA 3DYOA 4IPIA 1J0JA 4LT9A 3L2MA 3UR5A 1M04A 3LCXA 4KW2A 3CQKA 2BG5A 1R7AA 3DU0A 3DFSA 5A6BA 1DQUA 2IQTA 2Z28A 4H9TA 3QKEA 3QF0A 1XKJA 3BANA 4HOWA 1ZRQA 4L80A 2CWXA 2JIWA 3RYSA 2BMBA 3D3AA 5U7SA 1J0HA 3ZJ8A 5C55A 2FGBA 2YBVA 5AOUA 1BGGA 4AX7A 1NFGA 5FJUA 5C9RA 1DJGA 1OIMA 4LAKA 4W7VA 3GS6A 3IRSA 2EPKX 4FI4A 2DJLA 4J2MA 3AS0A 3U2ZA 4GC4A 3G1RA 3SCNA 3WH7A 4DO6A 1TVLA 5EFDA 3NXLA 1CLVA 3SCWA 1J96A 4O1BA 5I3IA 3FXYA 4JAWA 5JBFA 5FF4A 2YL8A 3G1DA 4K36A 2XPKA 4CNUA 2DVUA 4F3HA 1K6WA 1O5QA 5CBIA 1AW1A 5CSUA 3E0LA 3VINA 2AMGA 3JW7A 4S3DA 4HIBA 4MM1A 2FFCA 3CIVA 3EWCA 4R7JA 1GYLA 4GZEA 4H6QA 4DWSB 2PDXA 2VZOA 4ERIA 1WP6A 3KBJA 5FL0A 4JR5A 3TJIA 2HISA 4NT0A 3E02A 3UWWA 3CHCA 3NQDA 3WJYA 3TSMA 2VI0A 4CEXC 2P0OA 2GVGA 4XVEA 4HMNA 1Z42A 2VFHA 4D9PA 1IXNA 4KEUA 1BSLA 2C79A 2J66A 1FWHC 4WDUA 1PBGA 4H9UA 5IOBA 1PYFA 4LQ1A 1K02A 3C6CA 2BODX 3W1NA 3HURA 6XIMA 4NRSA 2V68A 5AYXA 3GH4A 4AG0A 3VXGA 4Q8MA 1BQCA 1W3TA 3G8RA 3W7LA 3NG3A 4DJEC 2QJJA 2I9UA 2JGYA 2C13A 4WSJA 1FCBA 4R5EA 1AUSL 4HNTA 2B7PA 1GT8A 1G4PA 1S46A 3QLDA 3UD6A 4JNYA 4AZ7A 4BJHA 2PZ0A 1Q6EA 1CXLA 4JTAA 1I2OA 3N6JA 1UOZA 3QMRA 2X41A 3T7VA 4FNRA 2DIEA 3AU2A 5CXPA 1FHUA 3OIXA 4BEQA 1XQKA 4H83A 3N4EA 3SFWA 4DZ5A 2QCGA 1X1OA 4NILA 1BFNA 1WBJA 1HF6A 1J4EA 1DJHA 1M1BA 4IISA 2FVLA 3LMZA 1PDZA 3NDOA 1FFQA 1KXVA 1RA5A 3KZSA 3UF9A 2HEJA 3N4FA 3TR9A 1FCUA 2EHHA 4X0VA 2XUCA 2Y1HA 3QZ6A 4OOUA 3CMFA 3O0FA 2WJDA 5BOEA 4US6A 2V0TA 3AXHA 3SM0A 2X42A 4D6FA 3KVLA 1S5VA 1BRLB 1UQZA 3UYIA 3CZ8A 4TO8A 4DNHA 1JZ2A 3ITYA 3IIVA 3QQWA 1MW0A 2G95A 5FJJA 2ZZ5A 1GEQA 3LS9A 1OG6A 1H50A 3GIQA 2PMQA 2HTMA 3KBWA 2WCGA 1MFUA 2ZKMX 3BLFA 1R7OA 3TUUA 1XYAA 3GTXA 4XD4A 4IGSA 1O95A 2CU0A 3VNIA 4BF5A 4OQVA 2J6XA 1GHRA 3DFQA 3ZMRA 4O16A 1JCXA 4HU8A 1OX5A 1B0IA 1ODZA 5FJTA 1KD0A 1UZDA 2JE8A 3AU6A 4HK7A 1W0MA 3TLQA 2J13A 3M7WA 1AMYA 1ZL1A 2CKSA 1L2UA 3AYRA 2ZOXA 2QEZA 4RDVA 1ZALA 4FNSA 1YTDA 4HYVA 3WY1A 1TKKA 3H8AA 2Y7DA 1I60A 2PGWA 3VD4A 4L64A 1C3FA 3O3RA 1IGWA 1P0EA 1JFXA 3RG6A 1FHLA 3P74A 1JCJA 3PWGA 4NASA 1RQHA 3CYJA 1I2NA 2OKOA 3PZGA 1A4MA 5ABGA 4AZ6A 3AQUA 2Y88A 4O13A 1RSCA 3W2LA 1JDCA 2Y8UA 2WKLA 2VVNA 2E5DA 2JEPA 1YW1A 2ATSA 4O1CA 3QR1A 4HCLA 5D03A 1O60A 4FNQA 1OYBA 3BG9A 2FDMA 1IF2A 1VZWA 2ZUMA 4WLCA 1G9HA 2ZRZA 4C1LA 4XD5A 3ITOA 3LHUA 1R3QA 3QY8A 3C2VA 4RZ4A 5JIPA 4IQJA 3WFLA 1SW3A 2BNJA 4XISA 1PV8A 1HKMA 4UZUA 3TJLA 1O7AA 2NQ9A 2WQPA 1WAUA 3M0LA 3T1GA 3ARXA 4NZCA 3RDKA 3R4IA 4CGTA 4WGHA 3CQ0A 3WN6A 4FF5A 1EOKA 4ZO9A 3TTOA 5E0KA 2PE4A 1V6YA 3AIVA 4B5SA 4M24A 1SO6A 2GJPA 1K03A 2BHZA 1X7IA 4D6CA 1GYMA 1SR0A 5DY2A 1EA9C 3VC5A 3B97A 1BLIA 4LNCA 3HQ1A 3PG9A 3IWPA 4DO7A 3H53A 1QI4A 2QPXA 4PMJA 1SM9A 3QW4B 1PTGA 1UP3A 2VURA 4ZOCA 1W5QA 2PCQA 2QCDA 1QNOA 3HJZA 2PP1A 3OLDA 3W81A 3FW6A 2X40A 1ZJAA 3PPGA 3VI2A 1Y65A 1TPDA 3TSBA 3NR0A 3TXZA 2CHOA 3FKRA 3WK1A 1WPCA 1IEIA 4P8UA 1D2KA 1FBAA 1BVNP 3W85A 3UQNA 1B54A 3OBEA 1I1WA 1XI3A 3BGJA 4EOUA 4GISA 3WH5A 3W1PA 2XFRA 4QJ5B 3FAXA 3EPMA 3PBUA 4LB3A 2RGMA 3SCUA 1PHWA 3URQA 1HGWA 2BXVA 2DPEA 1MUMA 1KQZA 1IE7C 2DIKA 4KH2A 4GIYA 3RR4A 1TPVA 1TPWA 4J3WA 1OM0A 2FB3A 3SDOA 1J11A 2O9RA 4E6MA 4JL2A 3HA1A 4NNAA 3TN6A 3CUIA 2D0GA 2XH4A 1C7SA 1TX2A 2OEMA 3RU6A 3NPXA 4JTJA 3PAOA 4AMCA 4YIWA 4L9ZA 1DWIM 4IFKB 3LI1A 4N4QA 3S1XA 4AU0A 4EWJA 1G1YA 4YNGA 1MVYA 1JYVA 1NWUA 1O66A 3VABA 4OIFA 3NL5A 3VGHA 3S5YA 1T5AA 2J47A 5I3DA 3TOYA 2I5QA 3WMLA 3C61A 1I0BA 4P7QA 1KFBA 4PTDA 2FZ9A 4W8AA 4U5KA 4GABA 3E1F1 2NSXA 5CC3A 1HXJA 1LTDA 3TMLA 1OFPA 3WIJA 4JHMA 1KFWA 1H5VA 3B8DA 1AG1O 1F73A 3N2OA 5HATA 2VDGA 2JQXA 4IJRA 4C7DA 4JBRA 1EIBA 4C6FA 2XZ9A 3WLKX 5CBJA 4HPJA 3MMWA 2P5NA 4BQ5A 3HPXA 4XSLA 1O12A 1U33A 3B05A 1OGBA 1AL8A 4DYKA 3K4DA 1XLEA 2OU4A 1VEOA 2C0HA 3S9YA 3A4XA 4IP7A 3IGUA 3IJLA 3WJXA 4AD2A 3AISA 1UC4A 3LTPA 2IPJA 2DV0A 3WLNA 1MO0A 1L6SA 4GYJA 4A2SA 3VKJA 4CNNA 1DIKA 3OU8A 1I4NA 3QC0A 2F7FA 4X2RA 3GKFA 1LBLA 3OB8A 2VVSA 4HKPA 1TWDA 2VGIA 1QAPA 1JYXA 2FMNA 4GYKA 5EMJA 1ISYA 3BV7A 1R2SA 4XVDA 3W26A 4PMRA 3N14A 1KR0A 3CC1A 1PHQA 3CV6A 2PTWA 3R1ZA 1C93A 3OZPA 1I1XA 3PZMA 1DJQA 1CEOA 1W9XA 3KWXA 3L5LA 1J10A 4Q4KA 2WWCA 3GAYA 3SCPA 2VELA 1HL2A 5B80A 4ZQRA 1SQ7A 2PGEA 3TQ0A 4EIVA 3BAYA 2FZNA 2OZ8A 1LF1A 4XAPA 5F1UA 3OZMA 3W73A 3D3FA 1EYWA 3MUZ1 3IPWA 2VEMA 7XIMA 1SU5A 2OWCA 3PS7A 7TAAA 3G18A 1HX0A 3CQIA 2BP1A 4R7OA 1B4KA 4MVAA 3GDKA 4ROQA 4NX5A 2VX5A 2VGGA 2Y24A 3ARRA 4RW5A 4LC6A 3QR0A 1ECQA 3W7IA 3M44A 5HQMA 4O53A 1UH3A 3WQWA 4O50A 1GZJA 3FGCA 5DT7A 1UR2A 1V03A 3B0PA 3N13A 3W7GA 3KE0A 4UOQA 4I9TA 1XLMA 3PK7A 3RU8X 5FF7A 5D2WA 1L6GA 1ZJBA 1PWLA 3CNYA 2A6LA 2TAAA 4B15A 3TH6A 1GUVA 1AZ1A 4B5TA 1MXSA 2QHAA 1GZ1A 4QISA 5D37A 3EB3A 4Y8EA 3B03A 3WDIA 1UR4A 1EEXA 2NXGA 1XDMA 2HMCA 5A8QA 2ZX6A 3CUJA 4DUWA 1NQKA 3LTYA 3KM8A 3T07A 4RE0A 3Q37A 1CBGA 4F8XA 5EMKA 2HS6A 2DVXA 3AS1A 2F2HA 4YHEA 4KCWA 2ZIDA 5F4XA 4UTTA 3MU7A 4MLRA 4GH1A 1ONRA 2NWRA 2CIPA 3BLLA 3S0CA 4O12A 1S2VA 2ZTKA 2ZA1A 1LROA 1W1PA 1NWTA 5E0CA 1L0PA 3NOYA 2GVJA 2FTYA 1FWDC 1IWBA 4PUUA 4KCTA 3WL0A 4PEKA 4Z1YA 2IQ0A 2FH8A 1VFSA 4J40A 4C6BA 2XHYA 5HUOA 1LOSA 3VTRA 2DH3A 3W7EA 3UZXA 4GCAA 1C8YA 3BICA 2BBFA 4M82A 4MB3A 3AO0A 2G8ZA 3FIGA 1KQYA 1ZCCA 2RJHA 3MUIA 1NP2A 3KXQA 2GSJA 4MB1A 3ARTA 3KEHA 1E6SM 1V6VA 1T41A 1QOQA 1DJXA 5DXYA 4UTWA 3C0JA 4Q8PA 4XBSA 1EWEA 1XPYA 1DQXA 1VC4A 3MUY1 3W74A 2PWVA 3RPMA 5AN7A 3U8GA 3MANA 1I2RA 1G7UA 3DG6A 2X16A 4PSRA 3LI0A 3RM8A 3JZEA 3AIQA 3TIMA 2XVGA 4IM4A 4RKAA 4AAJA 3RHGA 1WBHA 3CQHA 2GQAA 1AVAA 3SRDA 1BAGA 2BFGA 1Z48A 2C0AA 2YL6A 3BG3A 3N9RA 1W54A 2OT1A 3WNKA 2QNEA 4S3AA 4JTFA 5CAKA 1UG6A 2PTXA 5B7ZA 1RJQA 1UR3M 2WSQA 3KTSA 1NF0A 3XINA 4ZSTA 2HE5A 3U2OA 4DWSC 3VGFA 3B8IA 4TIMA 4IMAA 2WK2A 2X0SA 4MY1A 1X1ZA 2XIMA 4XIMA 4LF1A 1M7PA 3W22A 1NARA 4HQVA 3W00A 5I02A 1RBLA 3CT2A 3PWAA 1MEHA 3EDKA 3L65A 4O8AA 3MW7A 4UNLA 1I0DA 2W92A 5MF5A 1YX1A 2DSKA 3KHDA 1GHSA 1KBIA 3IGHX 3FAWA 2J24A 4FS9A 1U83A 4AY8A 3R0DA 2W62A 4KIRA 3WSUA 1TV5A 1A5NC 3W7MA 1EJTC 3V35A 1H0IA 2R94A 2AQWA 2E6FA 4HBKA 3M0ZA 3HFTA 3QHMA 3WENA 4H2CA 3SRFA 4C6QA 1T0OA 4M5PA 5D8ZA 4H00A 1VKFA 1E4LA 4GUIA 4NP7A 4KFPA 1E5NA 4PUEA 4XAGA 3KVKA 4D1IA 4DUVA 3H4GA 4AF0A 5HNNA 2E09A 3EWBX 5I77A 1WXZA 1M7XA 1UR9A 4NAEA 3PUGA 1ZFJA 3C4UA 3E96A 3W2MA 5D4YA 3MSYA 5GJPA 4JICA 1WKEA 4TX8A 5H8MA 1H1ZA 3BAIA 2VEKA 4JNMA 1CI1A 3EWZA 4GX9A 4DAFA 2J7BA 4RZ5A 1IHIA 2TRSA 2PBOA 3H2MA 4A4AA 4MAZA 1ENUA 1GQNA 1V6WA 5G1YA 1V0NA 4DLFA 1A3WA 4TVDA 1KM1A 1B31A 4PBGA 1ME7A 1O1ZA 2YB1A 3W72A 1XINA 1VFOA 3VX0A 1R47A 1BG4A 3N12A 5JBEA 2XIJA 5LHFA 5CBBA 1OX4B 1KM2A 1XYLA 2PGRA 3IJ8A 5A8GA 4Q4PA 1U30A 3KBSA 4IPPA 4R7WA 5LXXA 1UR0A 5A95A 4MDOA 1HJSA 5G1TA 3MMUA 1AJ0A 1U22A 5HPCA 3DXIA 3W84A 4AWTA 4E8CA 3M46A 3CL8A 3HF3A 4A8LA 3A3XA 3RF9A 4Q8UA 4J5NA 2CZVA 4ZMGA 1MXGA 2WJEA 3ALGA 3MV11 4RNIA 1LQ2A 2A4AA 1J2BA 1LWIA 3LQGA 3SSZA 1P6WA 7ODCA 1UMLA 2NT1A 3F5LA 4Q7BA 2EKCA 1QW9A 4AHOA 1YDOA 3S2CA 3O07A 2BOEX 3UZWA 4L65A 5LIUX 3NUKA 1XUZA 3VMPA 3GNNA 4H1ZA 5G2HA 4FX8A 5C2XA 1XLGA 1TJ0A 3ZWSA 2GPTA 5F2MA 1BKHA 5EKYA 4C6OA 2Z0IA 2HS8A 3C8FA 2DT3A 4LBUA 1W1ZA 1QOXA 2Z26A 1BF6A 1O6IA 5G5IA 1ZBWA 3CMGA 3GNDA 2VWSA 2BOGX 4DBEA 2CBVA 4R27A 1A47A 3PPFA 2XGZA 3TAOA 1LWJA 4FIQA 3EA2A 4ZODA 4JIRA 1FOBA 3C8NA 1JDFA 2YYTA 1A5OC 3N2BA 3W82A 1BQGA 6TAAA 4MFEA 3URAA 7PTDA 3U2EA 3B0VC 2FZMA 4B3LA 5LIWX 3KAOA 4AEEA 1TMQA 5D9PA 1LM1A 4GQBA 2VMFA 5FJRA 4J3XA 1TPH1 2ZUUA 5HBFA 1NWRA 2AL2A 3MYPA 4PGLA 5C9UA 3ECQA 1M3UA 4DELA 2OO6A 3BAXA 3NWRA 3DDMA 3WNOA 3TQKA 5CGMA 4CD7A 3HG3A 2R1MA 3DH7A 2CZDA 4UQDA 3W83A 1K8CA 3CYVA 4BCEA 3B4YA 1E56A 4P00B 2E28A 4QNEA 1REQB 4K7YA 1MW1A 4WY0B 4BHYA 1P0KA 4BWLC 2HVMA 4OE7A 4JX4A 4LS0A 4GYPC 3ZJKA 3URBA 3SCSA 3CIWA 3SGUA 1QR7A 3WQOA 2NQLA 3CPGA 4CD4A 4W85A 3UCQA 2D0HA 1W5NA 3DG7A 4REQA 3T8LA 4Q8WA 3SJ3A 1QBAA 3WH6A 5I06A 3O2LA 3I65A 5I09A 4N9EA 2VKZG 4DBWA 3USZA 2PDQA 4NNCA 2WV8A 1KGUA 3ZR4A 3UYCA 3GHUA 4A3YA 4PRWA 5C70A 1QRQA 1FQ0A 1OADA 3EB2A 2VEFA 4J3TA 3BOXA 5CLWA 2OX1A 2ZBTA 4NI8A 5AYIA 1UWQA 4IL0A 4LEFA 2RAGA 3VMOA 4M7SA 1PKYA 2O7SA 2X30A 4LNYA 5J8LA 3RX3A 2NT0A 3QRHA 2WOQA 4JTKA 3ONBA 5TIMA 3R6IA 3BLEA 3EDEA 2WMKA 4NVTA 1EO7A 2P3EA 4TV5A 3RMJA 3FN9A 3RX4A 2FH6A 1XCFA 5DXXA 1VH7A 2IKIA 2J75A 3OODA 2PWEA 2QVHA 4QEEA 5LGZA 1JGIA 3LENA 1L8PA 4NY2A 4JY8A 3R94A 4LCRA 3K8MA 2YR1A 5AC6A 1S1PA 1R3RA 1NWSA 4HSHA 1XIHA 1RHCA 1KXQA 2ZRVA 3I6EA 1LG2A 4DXXA 3H54A 2XWEA 1DJWA 3B9AA 2ZZ3A 1B3VA 3C2FA 3LG3A 3LHYA 3SY5A 3VNDA 1F8MA 4L4MA 3PM6A 1UW9A 2E77A 4PMVA 1MDRA 2J6VA 1UUOA 1UWUA 1DOSA 1VGAA 3A23A 2UY5A 2I14A 1XRFA 2BSLA 3NZQA 4CD6A 2QDDA 2ABAA 4QG8A 3WJZA 5HQEA 1WX0A 3A5FA 4EX4A 3TW9A 4UTIA 4HPNA 2ZRWA 4UWMA 1EBGA 1BPLB 4H9YA 4LVAA 3B0YA 2XH2A 5CPLA 1WDRA 3TXVA 3LM7A 4GCXA 2Y5EA 5HA7A 3NQCA 3WD4A 3WD0A 4DY1A 4LH8A 1MZHA 1RY0A 3OQEA 4BKNA 2YCLB 3NSXA 3EOEA 3IIPA 2YZRA 3BO9A 3AFBA 3VIHA 3CAWA 1XLJA 1JFHA 3GR4A 3AMDA 3Q65A 1VB9A 3PFRA 4LS1A 5CZ0A 4WOQA 2ZX9A 2UY2A 1ISXA 3UGRA 2PF8A 1SW7A 2PAJA 2J8FA 1ZU8A 4IXXA 3CQJA 4GJ1A 4ROPA 3WMBA 4Z0JA 4QE5A 4IGNA 1K8YA 3LMYA 1IXOA 2PDFA 4YTUA 1KM5A 1RPKA 3ENLA 4NYUA 3NXFA 3LTSA 5LA2A 1Y5WA 3RJXA 1BG9A 3NGFA 1LUCB 4YVXA 6CGTA 4IFOA 1F2JA 4C6KA 3WMCA 1XLHA 3CHFA 4RE4A 3NO1A 4JYDA 5BWAA 3ZXWA 2X09A 1FDZA 1XIFA 1R9YA 1PEZA 2E8ZA 2WNZA 3VCNA 4FALA 4HZ6A 3GTIA 4HHHA 4HP5A 4I8YA 1AJ2A 5RUBA 2A3AA 3IRDA 7ENLA 3UWVA 3CTLA 5DCDA 5ENLA 3KBVA 3OVQA 2OYLA 3PP7A 5GQBA 1R85A 5I23A 1JCYA 2Q02A 4EXBA 4ADSA 4RCXA 1OC7A 2E6YA 2ZUVA 2DSWA 2QW5A 1UPPA 4RDWA 2DFAA 2EPLX 2O0TA 2ICSA 1Q85A 5TF0A 3AUJA 4UCGA 3QXBA 1B2YA 1MYRA 2QDHA 1RK6A 4MSSA 1W1YA 3AZRA 3UZJA 1E72M 2GK1A 4PN2A 3DKJA 5IFPA 3XIMA 4GY7A 4YYCA 4JX5A 1V79A 4MHBA 4PODA 3LU2A 4XBJA 2JKAA 3GDRA 4PB3A 4JIEA 1I2PA 2PFHA 3S8HA 4D1JA 1G4EA 1VFTA 1S2AA 2BTMA 1F6KA 1S5TA 3LCWA 5I3KA 3BGAA 1W8SA 3BPWA 2B7NA 3GG7A 4IP5A 4X9SA 2RDUA 1C91A 4Q33A 4DJFD 1ECEA 5BRBA 1E1CB 1GQLA 1ZQ5A 1W1VA 7TIMA 3XISA 1WKFA 3NDZA 1JF5A 5JVLA 3FYYA 4EF9A 4PTMA 3SRHA 3QQ0A 4YCPA 5K4ZA 3SB0A 3LPGA 3G0UA 1W31A 4DJED 5C54A 2E5BA 2WVTA 3MP3A 1S2UA 3SN4A 5C2GA 1L6YA 5HUPA 5LKYA 1IXPA 3FNDA 1RJPA 4FR1A 1VFFA 2MUCA 2XDFA 1XC4A 5A6TC 4PMZA 1XCWA 1GOQA 3KS5A 1OT1A 3HJEA 2GUBA 1J0KA 1YPIA 2F61A 4J3UA 3IJDA 3EPNA 2DP3A 4RE3A 2RHGA 1FVPA 3F4NA 1F6PA 3BAWA 3CV1A 3OPSA 3QJAA 2E67A 1RPXA 4DJFA 3W6LA 5AC5A 4RUBA 2A79A 3C2YA 2VM8A 4JIIX 4YTRA 1N8WA 3N15A 1GTHA 4HT3A 4RK8A 4INFA 3CIXA 4IPNB 4FLQA 1J0YA 3PZIA 3VIPA 1OK6A 4FF7A 3URNA 1DTUA 4GI8A 1UQYA 3FA4A 2H9AA 3CEPA 4F0LA 3B9DA 3EWXA 4S3FA 3ABXA 3C2OA 1W9PA 3IVUA 3V0UA 2ZVIA 2A3CA 4DJEA 4F0MA 1FH7A 1KM4A 1YMYA 3FX4A 2UBPC 1HFBA 1ZP4A 2V81A 3TYBA 3S9IA 3A24A 3GNPA 4ZEPA 4PMNA 1VYSX 1ZSXA 3NEHA 4KETA 2V5JA 1TV7A 3JRKA 1XL9A 1EHAA 1X38A 1V7AA 3OLIA 1R3YA 1OF8A 3IAQA 4U3AA 3T44A 1ZB5A 3LB0A 1B90A 2ZZ2A 5I79A 1JDDA 2KAUC 2YXGA 2ZUWA 3AI0A 1OEPA 3STFA 3FXGA 1C8QA 4Y6GA 1FDJA 4AXKA 4JGDA 1LWHA 5K7JA 2HK0A 3R13A 3VKCA 1GQKA 3AMLA 4Q4MA 2H6RA 3G2GA 4TU1A 3H4XA 2JF7A 3C0QA 1W9BM 1A53A 4OZOA 4PL2A 1EO5A 1BTMA 1A50A 5FL1A 3EOSA 4MB5A 1ZAHA 2P1FA 3PNZA 1ZY9A 4A29A 4LV9A 2Z2UA 4EPBC 2PLMA 2J74A 3OBAA 4KQNA 3LN3A 1BXNA 1F4AA 4L4PA 3EX3A 3SUUA 3PSVA 4MKVA 3LLDA 1VEPA 5DMLA 1C8VA 5IBXA 3O7UA 1Q45A 1ELSA 2GFTA 5EJ1B 2QAFA 3WEOA 2WKJA 3B8WA 2G97A 1V77A 2WLZA 4LY8A 1CXHA 2GQ8A 2C6QA 2GZXA 2VFIA 5MKGB 3AZTA 1K7FA 4K7VA 3A4JA 3U48A 3LGEA 4PYSA 2PTZA 3WNNA 1MMFA 4QAIA 1XBZA 3TLLA 1B3OA 1KR1A 2G41A 4XIAA 5HR6A 5I24A 4MNJA 5I3JA 1L8NA 2V8ZA 3GNRA 3R10A 2PDNA 1PKLA 3W01A 2YXXA 1D3CA 1LBFA 4ZTYA 1GQJA 1MEIA 3U2CA 3BQ6A 4IMFA 2W67A 5ECVA 3WLMA 2MANA 3RJYA 2C1IA 4XWUA 1OG0A 3UJEA 5BWFA 2XN2A 1WQ5A 3IJ9A 4H9MA 3BUVA 1ZTVA 3MZ2A 1GORA 2UZ9A 3BARA 2FHCA 3KFTA 4P61A 3M0IA 3MP5A 1KO0A 1H2JA 2Y0FA 1T96A 3OGRA 3EOOA 2YDQA 1C92A 3NIYA 1GG0A 2HJPA 3O06A 2G50A 2ISDA 2ZRXA 4JTCA 4QSHA 2XFFA 3PB0A 5A8MA 3MYOA 2F38A 1UR8A 4FLOA 3W7HA 1VFLA 2WBKA 3TN4A 4PUWA 1OHLA 1QHZA 3V16A 2GUUA 4CN6A 2YA2A 4AZCA 4Z1BA 5I3HA 2GGJA 1ALDA 3NZGA 3P8JA 3ZR5A 1K70A 2VYOA 3BW3A 1JPHA 4JN6A 3I6RA 4HPXA 1D7KA 4JDBA 4A3QA 4B90A 3RITA 4W5ZA 4PULA 3T9PA 3NTYA 2HE8A 5KITA 3Q2DA 3I4EA 3LOTA 2Q09A 4L56A 3EXSA 3MKKA 1JULA 2CZEA 4QBXA 4C1NB 4JTLA 1XISA 4P8VA 3UJRA 4Z2LA 3WFZA 4OHQA 2X0YA 1E4NA 1W17A 4LUTA 2XGBA 3TQVA 4W7WA 2CBUA 1DHKA 5T8GA 2WC4A 2A1YA 1W3KA 1D8WA 4LTSA 4FOUA 3DN5A 2NW0A 3DKLA 4HJFA 4FA3A 1HKVA 4KT2A 5I00A 2Y2WA 1LLWA 3MUAA 2YL5A 4ZFMA 3AJ7A 1YYAA 1YE6A 1QNPA 2WZIA 2FPYA 3II1A 1R86A 4XTIA 2I57A 2BY3A 1Z32X 1BSIA 3QSTA 2VCBA 1GOOA 2GVYA 1KFEA 3W6MA 2E1DA 4HCHA 2WWDA 3WLTA 3IGSA 4C60A 1TPB1 1YIXA 4IH3A 1MSSA 3I3DA 2PD9A 3CWHA 4MKSA 3TYEA 4CNSA 3QM3A 1O4UA 1R3VA 4AEOA 2WMIB 3UWEA 5KMYA 3N34A 5GNXA 1FWWA 4CNTA 4O18A 2KZHA 4Z0SA 3GC5A 4EXAA 2XTKA 2QDGA 2V6AA 1DV7A 2BDQA 2QYGA 3WLSA 2EPOA 1XIJA 2C14A 4AVFA 1XG3A 3S5SA 1T7LA 1H51A 1PIGA 3D6NA 3NQEA 4ZO8A 4QP0A 4I5RA 4BK9A 1DWHM 1KW1A 2YPIA 2HVNA 4HCDA 1NQ6A 1PTDA 1EJUC 4S2CA 5FF3A 2J27A 3R2GA 2HXUA 5BRPA 4DBSA 3G6MA 2BZNA 3MKVA 1GKPA 3ABQA 1J6OA 3M5VA 3VD5A 3C0LA 3AMGA 4DZHA 4QNWA 3TW6A 1KTCA 3A4AA 1GW1A 4ORIA 5HNRA 3R58A 3AOFA 2W91A 2EKGA 4RDYA 1OK4A 1VR6A 3HZ3A 3L7RA 3UG5A 1BD0A 1E6RA 1E40A 2DVTA 4NZ4A 3HGOA 1WDDA 1Q6OA 2P76A 2GQ3A 3DEQA 4L6DA 5CKSA 4Y9PA 4QGCA 1BWVA 2OWXA 3EX6A 4KWWA 4QRNA 5ABFA 1OCBA 4Y96A 3ZSTA 3CAQA 3LPOA 3QVQA 3ZOAA 4R9OA 5AYYA 4A21A 3G3DA 1H60A 2DJXA 2V3FA 4DBDA 1Y5VA 1Q6FA 1Q7QA 3GHRA 3TTEA 5KZ6A 4CQAA 4E3TA 2WCSA 2D20A 4EVZA 4TQTA 1P7TB 2PDUA 3IJ6A 3PJUA 2OLSA 2VEPA 4DB7A 4LAMA 1O94A 1VFUA 1JUKA 2W27A 3DFTA 1J12A 1FKXA 1HNYA 2VR4A 3K30A 4ACZA 1L2QA 2I9EA 2ZXQA 3HTWA 2BX7A 4HNUA 1FA2A 4IMCA 3GXTA 1ESWA 4X3ZA 1R3TA 1U2YA 2WXDM 3H26A 4G6CA 1T8XA 2AQVA 2VRKA 4LUSB 5BCAA 2INEA 1W2VA 3LZ3A 1E70M 1L9WA 2WPBA 1WDPA 2DZXA 2PF0A 3PPHA 1M7JA 4AFYA 4MGGA 2IUZA 2WJFA 3U6WA 2VO5A 3ZQ9A 4D6HA 2WNNA 6REQA 4B4HA 2F8QA 4I9JA 4HHMA 3UWUA 4D72A 4S3CA 4JTUA 4IQEA 2XSBA 1UB3A 3EEGA 2P8CA 1VPXA 4OWGA 3CU2A 2CHRA 2QKFA 4LVDA 1X1NA 2CXEA 4ENLA 2Z27A 2Y5SA 5D32A 2FKPA 2Z6IA 1DWAM 4K38A 3VFCA 3QV7A 4AD1A 4AWSA 3T42A 1XLAA 4DIAA 1YDNA 1UOKA 4FPSA 2GDVA 1ONWA 4JQ2A 5F2IA 3VDGA 3OVPA 4QE1A 4PBEA 2LLEA 1W91A 2A7NA 1BVWA 2W4XA 1F8IA 3MVTA 3AS3A 4NJGA 1G4TA 3ES8A 1UD3A 3GD6A 2OZTA 1VBUA 3F03K 3EMQA 3UFYA 4UB9A 3F4CA 4WF7A 2VZUA 3VO0A 4KGLA 4JY9A 5HK4A 4IG2B 2IKHA 1SO3A 3HFYA 4R34A 3T55A 2AAMA 3BW4A 1JXJA 1NJJA 1RD5A 4FNPA 2WYSA 4DUXA 5CC6A 1XLCA 2OCZA 1JD9A 1PX8A 3VIJA 4TXEA 1OFBA 4GFSA 4PMDA 4GUGA 4H2HA 1WCGA 2WW5A 1OD8A 1US3A 4FB7A 5A2CA 5E70A 2WMFA 1CB2A 1LLZA 2WMJA 2VR5A 4JFUA 1V3KA 3RPDA 3C5QA 3S1WA 3R8GA 3V0SA 4JTRA 4FK9A 4LS2A 4NZFA 1DJYA 4C65A 3S42A 4S3KA 4XK2A 5HJLA 2ZCGA 2HPMA 1PX4A 2OMAA 3GQYA 3CO4A 2PC4A 2ON3A 4AMAA 2VUNA 5AVNA 3S5OA 2Q6ZA 1B9ZA 4UFHA 3WEZA 1US0A 4DWSD 2CYGA 3B9NA 3GY1A 1LJYA 4L1GA 2QIIA 3VGEA 3BAKA 3T0TA 1JZ7A 1XGEA 2EF9A 1PCKA 3NO5A 3M07A 1H11A 4ZFCA 1A5KC 3A5VA 4JIQA 2C71A 2Q3OA 5D2VA 1S1RA 1KRAC 3UWQA 1HJVA 4ILSA 1AK5A 1PL9A 2FZ8A 3W1UA 3GHTA 3T78A 4E4PA 3A3WA 3AHYA 1V4YA 3KWSA 3ZYZA 3PPCA 2ADAA 5GJMA 1KA9F 4AVNA 1GEHA 3O6CA 4Z42C 1B3WA 5BROA 2Y63A 4NNBA 3K8KA 3EPOA 4IIHA 4UR8A 3WQDA 5A8OA 3FGCB 4ERGA 5AHLA 5I3FA 3T40A 1LQAA 3CZKA 1JR1A 3S47A 3MHFA 4GZJA 2QCFA 4HN8A 3KL0A 1SYTA 3QGKC 3BSMA 3EAUA 4ADUA 3B8VA 2E3ZA 1AODA 4WKHA 5AYZA 4DWSA 2CCRA 5A5WA 3SY8A 4UUIA 1V0KA 3MO7A 2CLEA 3UEQA 4PCPA 4IGMA 4HB7A 3H2CA 1ZAJA 3RIKA 2P10A 4ASTA 4WSHA 1H7NA 4AH7A 4AZ5A 4N6FA 3TJ4A 1JCMP 2GWGA 4MLJA 3KOYA 5IXEA 1CPUA 4UTLA 1EDQA 4IQLA 4C6LA 1H7WA 1X97A 3CAKA 3U3HA 4RNFA 2FHBA 1CGXA 4LOCA 3BMVA 3L67A 4IGHA 1KCXA 3LCLA 3QMSA 1QWGA 3GVVA 5BXPA 3OVRA 4IT1A 5DCEA 5CJMA 3THCA 1RA0A 2ACQA 1GNXA 2OEJA 4JQ3A 4IOTA 4H4IA 3P62A 3W75A 3KDOA 1SGJA 3N9KA 1JL8A 1SJAA 1OB0A 2RDTA 4J1OA 4X9YA 4S3BA 2ACSA 4DO4A 3L9CA 1XLFA 3RR1A 3GKAA 1YRRA 3WYZA 4PMUA 2XJ7A 3RILA 5IFTA 1E6ZA 4H9XA 1JF6A 1K6AA 4UQCA 2ISFA 1K77A 3KCJA 2NX1A 2QXWA 3QEZA 1DE6A 1XPGA 1FXQA 1EP1A 1JCLA 1FWNA 1BHGA 1Z8AA 1MNSA 3M6DA 5ABEA 3SUSA 3GXIA 1X96A 2PZNA 3VOFA 3GVWA 3NQ6A 5LNRA 1TO3A 4QHRA 2YFNA 1D9EA 3DHPA 3R11A 1AH3A 3HV8A 2V5DA 3QHNA 3SSJA 2A85A 3WQ5A 1V3HA 1PJ9A 3K5XA 5CAHA 2DZBA 2F84A 2WSKA 1HZYA 4HNLA 2G0WA 2P8BA 1KKOA 4F2UA 4XQ6A 3GTFA 2WMGA 3KP1A 6ENLA 2YZ5A 1PE1A 1F7BA 1JUEA 4K1WA 3NGJA 3ABZA 4LEQA 3EWYA 3R89A 2G3IA 3N29A 3VZZA 4DLMA 1QOPA 1UWTA 3AZSA 3HBLA 1VFHA 1H0GA 3ZZ1A 1BWLA 1ICSA 2ALRA 1XIIA 2NQHA 1MRAA 3DFPA 1ITUA 3TW7A 2VGBA 3T8QA 5A2AA 1K9FA 4AUBA 2W0UA 4GKLA 1TJ1A 3PZUA 5KEZA 3BLPX 3CWNA 3QH2A 4AZHA 1EA0A 3MP4A 4XSMA 3VIOA 1KBJA 3EOUA 1F4HA 2Z00A 4LX4A 1B9BA 4K8GA 3KOXA 3N3TA 1C8XA 4A22A 3QGAC 4MPKA 4MWAD 4NZ1A 3WH9A 2R91A 1QATA 1VCVA 4HK5A 1Q6GA 2G3JA 3H23A 3VYLA 2NV9A 3MQTA 1AH4A 4Y8FA 4WD0A 3WLIA 4NHVA 3WBAA 2ISVA 4B2DD 3MJYA 3HG2A 2QJMA 4DZIA 1PWMA 1FWAC 3L21A 4GK8A 3AIRA 2C15A 2DZSA 1MQRA 1WB0A 5I7GA 4XAYA 3L4WA 3T4CA 4Q3MA 3HQOA 1XV8A 4NJKA 3GUWA 1VAHA 3PF3A 5CZSA 5A6SA 3PTKA 1RXOB 4OJYA 2GSHA 5HMFA 1KKRA 1KCKA 4NU7A 1QWKA 3O8AA 4UFIA 5I3GA 2OGJA 3U9IA 1M03A 4J4KA 5A69A 3OVGA 4O11A 4B16A 3BE7A 4LRTA 1JZ6A 2XSXA 1AW5A 4R53A 2D2HA 1ISVA 2VNCA 1T8QA 1ZNNA 3QOKA 1GOKA 3DBPA 3WMSA 3V4BA 4M6QA 4O1EA 2J8GA 1UPMB 4JN7A 1E0VA 3WK2A 1KRCC 1IZCA 2OFJA 1AL7A 4IFRA 2CWNA 4QXIA 3MZNA 3SI9A 3ARPA 2BHYA 4BWLA 1ICPA 1LL4A 3VPLA 4B2DA 1AMKA 3M0MA 1E9LA 4HU4A 4I7VA 1PZ3A 2IW0A 3UZ5A 1H7RA 1SVDA 3W7RA 1CXKA 3VNMA 2PDWA 5G2IA 4EE9A 1HKKA 3DYMA 3IIXA 4W88A 2A21A 4C6IA 1RALA 3CO8A 1H7OA 1XGDA 5HANA 2XYLA 1R5YA 4V1YA 4K39A 1IR1A 3MWAA 2BGNE 4RX0A 3APGA 5AY7A 5BMWA 1K1DA 1KBBA 3ID7A 3A3HA 4P7LA 1W1A1 5A6MA 5AC8A 2IMRA 1HKIA 1HJQA 1Q4NX 8A3HA 1MW3A 3VNZA 1S2CA 1TCMA 2V67A 4ECLA 4ZQNA 2AGTA 3EX1A 5F4WA 1YPXA 3V0TA 1RLDA 1UIPA 3MUXA 3ARSA 1XXXA 2D3LA 5HMSA 2PCEA 3AXXA 5JXQA 1H61A 3THDA 1W3IA 3SURA 2H8ZA 1DWJM 2Z24A 3QSRA 3LNPA 4DPQA 4WEVX 2R8WA 3APYA 3KBNA 3KCOA 2WVVA 1V3LA 3JS3A 4W89A 4A35A 5EMMA 4MY9A 2EG7A 5M5DA 3BJSA 4ZB2A 3N2TA 2YLAA 1BTCA 2WMHA 2DEPA 4J28A 1K4HA 3RCYA 4IX0A 4NUWA 3ITGA 3N73A 4W7UA 3K2GA 1TMHA 1KB3A 1XBYA 2NVAA 1TTPA 4TX9A 2REQB 2QDEA 4CQDA 1F05A 4MJMA 1A0CA 2OEKA 3W28A 4DF2A 2OGYA 1B4EA 3W0KA 1RP8A 1S5WA 2GLKA 5JU6A 4KCVA 2VC7A 4HMCA 5I07A 3A13A 1CLKA 3TFXA 4UQAA 3ICJA 1FWBC 3BV4A 2Q3RA 3W7QA 2VDIA 4X2PA 4B3ZA 1K8ZA 1G01A 3WF2A 3AHXA 4C6JA 3HG4A 1P6CA 3A9BA 3MMDA 3GH7A 2A0NA 3DAQA 2C7FA 2V38A 1N82A 4WHBA 1RR2A 2O56A 1WZLA 1A5UA 2GDUA 2G37A 3OLEA 4LRSA 4AX6A 2ZZ6A 3KUMA 2ZYFA 1W5PA 1DWFM 4HG6B 2ZZ1A 3DOPA 4YCOA 5CSYA 4O19A 5FESA 4I9AA 4JHZA 1EF2A 2TYSA 1HGYA 3MT1A 3O15A 3OYXA 2YXOA 5T26A 4W84A 1VIWA 2DY3A 1QTWA 4Q8OA 1QO2A 2A2IA 3NZPA 3E2VA 1JYWA 1IGSA 5HAOA 2WVSA 4AY1A 4L61A 1XIBA 3SO7A 5HWJA 2QUNA 4MMWA 1EDTA 3M0HA 1QI2A 4XUYA 3VAVA 2IPWA 3S6TA 1FUYA 1UUMA 4GKTA 4WIWA 4JEQA 3FYPA 2E1WA 1GGOA 4HD5A 4WZHA 3AMKA 4HA0A 5DANA 2V2DA 3ZT7A 1Z3NA 2XINA 1W1IE 2PLCA 3GFXA 2FPVA 1PSCA 5DN1A 2Z1BA 5D2YA 3SADA 4RDZA 3CPUA 3BZGA 3IARA 2PODA 3AWNA 4JFWA 2Z1WA 1XFBA 3J7HA 3TVAA 2WHJA 2P53A 1QXLA 3C2RA 2PS2A 2YBTA 4QDPA 1YXDA 4WXZA 2B31A 4Z08A 4B5NA 2XU2A 1Q65A 4YS1A 3S1UA 4XZNX 5IM51 4POCA 4US5D 2WHMA 3G3MA 1Z44A 3SAZA 5C5YA 4DJFC 3WF4A 4MWAE 1Q6LA 1F3EA 3IEBA 5T91A 4ZCWA 3DIPA 3NQ8A 1S2TA 4GFIA 4O0KA 2BXZA 2DZAA 1XS2A 5H91A 2CZ5A 3G1AA 1J8VA 1Q63A 1JUBA 4Q8QA 2E9LA 2OPJA 3KP0A 1NY1A 3WQEA 1TELA 3QZEA 2PRLA 2DW6A 1VJIA 2EG8A 2E40A 4UFJA 3R25A 3P0WA 1P0NA 1OQFA 4XKYB 3E2SA 1VPYA 4QJ1A 3WNMA 2NQ5A 2IKGA 1JPMA 1V6XA 2YJQA 2Y5JA 3L12A 1H4PA 3OBKA 2YOCA 3KZPA 4RV3A 3PBVA 1HJXA 2OR2A 1XRTA 3GAKA 1X8CA 1XG4A 3W29A 1FWGC 2NV2A 3PZ9A 1WUEA 2QMKA 3W38A 3U7BA 3UG3A 4US5A 4IIBA 2WKGA 1I45A 1Y7VA 1CGYA 4CQ8A 1VFMA 2NVDA 2QUUA 2X1TA 3EDDA 1KLZA 4F0HA 1BGAA 3PUDA 1UH4A 1GONA 4LYPA 1FXPA 1YBQB 2GWNA 3N04A 3TYCA 1SO4A 5EMYA 1KM3A 2VEIA 3GG1A 2G3NA 2WHKA 3W7JA 1EPVA 1DL3A 5D9NA 4LUJA 4CCDA 1UD8A 2PDYA 1SZNA 3ABOA 4JHOA 4I90A 2TODA 1G6CA 3VOJA 3MHGA 2QCHA 1US2A 3P80A 3WF0A 3PBYA 2J7DA 2V63A 2YX0A 5M17A 3I4KA 1TZ7A 4ZQCA 3AXKA 2VC6A 2VXNA 1XM3A 1VBGA 3TROA 3LCIA 5DBUA 4IMDA 4GY0A 3AWOA 1OFOA 3GLCA 4B9YA 4WJ8A 2WZHA 1R38A 3VIKA 4MZ8A 3A22A 5IBXC 3LCHA 3RM9A 3VIIA 2QUTA 2O55A 3TWAA 4LAOA 3WBXA 2VT0A 5XINA 2CETA 2F6XA 4ALDA 3IJ7A 4NZ5A 4BZYA 2ZX8A 3A21A 1UD5A 3UY7A 4M81A 1IEXA 4GIAA 3QPEA 3NQVA 1X6NA 3QFWA 2G4FA 4RR4A 5TBOA 2Y8KA 5DFAA 2P50A 2YDRA 2IS7A 4LU0A 4M6VA 5IDZA 3DGRA 2J62A 1BWKA 1ZAIA 1MUCA 1RBOB 5DO8A 3FA3A 2RFGA 3ZT5A 3EYPA 1CB7B 4NZJA 4WGXA 3CS2A 5BMXA 2QGHA 4X22A 1UIOA 3AYTA 1V0LA 2E68A 4QG9A 3MI2A 4EPDC 4AISA 3KRUA 1R3WA 4NAFB 2YCKX 3LSCA 2V5BA 3B8UA 2FJKA 3GNOA 1FH8A 1CW2A 1JZ8A 1XX1A 1CNVA 3EEZA 4I6VA 4MWAB 4E5TA 2DH2A 1FWRA 1R2TA 4DM2A 4H6KA 1WDWA 4MY8A 3UPMA 3I68A 1VENA 4DWDA 5F7UA 1OFDA 3FJLA 1QK0A 4Y7EA 4D6EA 4W93A 4FX6M 2WM1A 2OTDA 3O63A 1BYBA 4DVOA 3EX4A 4AZIA 4IJCA 2AQOA 1F6YA 3T0DA 4ATWA 4HPGA 3U5YA 3TN3A 3W3OA 3L4UA 3DFNA 1VJZA 1A3HA 3LHVA 1L6WA 2QV4A 3P82A 4CCZA 4L6HA 2C3ZA 8RUCA 4UQEA 1XH1A 4ZBCA 3W1RA 1L6FA 4NJIA 3LBCA 3GTNA 3N19B 4OV4A 4DM1A 4FAMA 5K2ZA 3CAVA 4KERA 1UBPC 3RNDA 2QAPA 4KFNA 3NQBA 3WLRA 4JQ4A 4DJDC 4ZQOA 1EKOA 3K46A 3UR2A 4HNOA 3KOZA 3I3EA 1HL9A 2RUSA 3BC9A 2WLYA 3M5ZA 3QBUA 3SCRA 4FX7A 3O9NA 4JCMA 2DSVA 2R9RA 1H1YA 5I03A 1HVXA 2CNCA 2OWWA 3CZGA 4MUZA 4B92A 1I8JA 2D2GA 1MUWA 3LXBA 3OG2A 4H8VA 3LD5A 5AECA 1VJSA 5AHMA 3TQPA 4I8DA 3UXKA 1F3XA 3VCRA 3PUOA 5CG7A 2NQZA 1ZBVA 4OUEA 4LBRA 2OZ0A 3VILA 3BCJA 4ICNA 3QV6A 4GIRA 3OG3A 3G0XA 5ABTA 1A5SA 4GXMA 2FJUB 2ZWYA 2FB2A 1SFJA 3W7DA 2NWSA 1VRDA 2AGKA 1OX4A 2VQTA 1Y0EA 1E4MM 3RUBL 2PPGA 4D8ZA 3W07A 3NJ3A 1J5SA 4B5UA 5FAJA 4PTNA 1OF6A 1WV2A 1SO5A 3UESA 1EYEA 3W2JA 4JZ5A 1HJWA 4JEJA 2FQIA 1UWAA 3W1MA 1TUFA 4NXKA 1M01A 3W70A 1JQXA 3RAOA 1PZ1A 1QW8A 2VD9A 1AFSA 1RQEA 2QF7A 5LHEA 3AIBA 3GR8A 1ISZA 3I7QA 2BY0A 3TC7A 4S2BA 3FK4A 1W37A 1B3XA 2FZBA 4QE4A 2C18A 2XVLA 5E09A 4Z2IA 2WANA 4C90A 3WQFA 1OGGA 4YVPA 2NUWA 3L68A 4WRHA 2CZFA 3DI0A 3FJ4A 3LV6A 3ES7A 3RLHA 4PA8A 1EGMA 1TRIA 4CNOA 3QY7A 2E9MA 4CQ9A 4RE2A 1N2VA 2DQXA 2Q71A 3R7MA 4L5ZA 4DPPA 3MC5A 4C5ZA 3N6HA 3L5AA 5EY5A 2F2KA 4GQRA 1WZMA 3DHUA 1TPUA 3RCNA 1EH9A 2GSEA 2YB4A 5EIYB 3S2MA 1NDVA 1TV2A 4XZ9A 3G8EA 1LT7A 3RO6A 4YWSA 4IPLA 1RY8A 1SZRA 2PLJA 3R79A 2CW6A 2DU2A 3EKGA 1LL6A 1YTKA 1NM9A 4OV9A 2P3ZA 1LT8A 1CGVA 1PKNA 1I9CB 4K6AA 3T0CA 1O5XA 4MIMA 5D02A 2HBVA 1QPOA 3L4TA 4JQAA 3AHZA 3B8SA 3W7CA 3IUHA 3S1VA 4S39A 3W9ZA 4JD4A 1GKRA 4PH6A 1JNDA 2RDXA 5DBTA 2PA6A 2FTWA 3STCA 1JCNA 1BYCA 4L9XA 4OFCA 2HBXA 3N3MA 3V7PA 4K8EA 3YPIA 2ZRYA 2D3NA 1TQJA 5DRIA 4ORMA 3MWCA 4WJEA 1JAEA 3H2NA 5EB8A 1Q13A 3VDCA 4Q8NA 4B4FA 4E3VA 1EQPA 4BI6A 3ANYA 3RGTA 1E5JA 2Y89A 3T2QA 3LBOA 4WVXA 7REQB 5GNZA 4TVUA 2E6AA 3EDJA 1YXYA 2POTA 1EPXA 2XVPA 5DX7A 1XP3A 4Z1CA 3W25A 5LZLA 3GYEA 4UZSA 4AC1X 1EHNA 2WQDA 4LV4A 3VZYA 4GY1A 4NJHA 4UC5A 4P7NA 4HYWA 1XYMA 1GVFA 1H3GA 3NVTA 3M1ZA 1QPNA 1AZ2A 1YE4A 2D0FA 5D9OA 3S2JA 1BYAA 4GQQA 1CGTA 3VK5A 3M5XA 2JF6A 1TJ2A 4OVXA 4J7RA 1PTAA 4K2SA 4FEZA 3RRXA 3M0JA 1WUFA 4HSNA 3VE9A 3LXAA 3T81A 4YJ5A 1OT2A 5CZTA 1MNZA 1EL3A 1JXKA 1RJRA 5FA5A 3WQPA 2IXUA 4GGBA 4C6EA 4O54A 1Z89A 2NLYA 4PRRA 3TP4A 3NL3A 1KWKA 4RL3A 4IIEA 1EX1A 1H5YA 2Y7EA 4O28A 5FI8A 5HDRA 3GNXA 3V1PA 1M41A 4C6NA 2ODOA 3SUVA 3AYSA 3TZFA 1XR2A 3G1YA 4ACYA 4C7FA 3KW3A 1OZMA 4D71A 1IIHA 3DX5A 1TZZA 1EC7A 1UC5A 2DZUA 1N8FA 2FYMA 4MJZA 4M56A 1S3TC 2XIQA 2Z6JA 4YTTA 1FWFC 4JFTA 3G1HA 2QS8A 3H7VA 3H2EA 3S46A 2J79A 3LLXA 3VZXA 4E2DA 1UWSA 3LM3A 1ZGDA 1QCWA 1GYNA 3GE7A 3SUWA 1MXDA 1TR1A 3LHWA 3POCA 1LG1A 4QSFA 5HNUA 1B30A 3M9YA 1LRTA 4K1GA 2ZICA 4PL1A 3L4ZA 4D6JA 1EFZA 1Q5MA 3MKCA 3CMJA 5EGRA 4ZO6A 4EF8A 1DBTA 1BF2A 1UA7A 2VENA 5DELA 4J3SA 1OSEA 3GXPA 1UCWA 5BNKA 3E0VA 4UMCA 3CUXA 1HUVA 3OOQA 3PZTA 1UASA 1FCQA 4AC7C 1M68A 3B04A 2Q8ZA 1D7FA 2YCLA 2XVKA 1RCQA 4F79A 1W2PA 4MZ1A 1KNWA 2HV5A 3JVAA 4WDWA 2R82A 3E2RA 3BLDA 1J93A 5BOFA 3PHAA 4HMDA 1AA1B 3FCPA 4Q4RA 3C86A 4MYAA 2PURA 1FRBA 2CLPA 1KRBC 4BI5A 2FLIA 2BWGA 4C6DA 1HQTA 3CH9A 4W4QA 1LUCA 1EDGA 1V5XA 2D23A 1TREA 1KC7A 4LYKA 4UQBA