3NSNA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with tmg-chitotriomycin
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylglucosaminidase
publication title Structural Determinants of an Insect {beta}-N-Acetyl-D-hexosaminidase Specialized as a Chitinolytic Enzyme
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase
total genus 191
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nsnA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3nsnA01
3PZNA 3AMLA 2CKRA 2GDUA 2WXDM 4W5ZA 2YDQA 2CITA 3AMKA 3EDDA 2G8ZA 3DYPA 3A4XA 3VD5A 1JF5A 3OA5A 1AVAA 3F5LA 2WBKA 1SR0A 2ZUUA 1VAHA 4JZ5A 2X0YA 1E71M 2E9BA 4M24A 5JBEA 4ATWA 3PBGA 3L4XA 1JL8A 2CHOA 4HMCA 3A6OA 5IXEA 1Q4NX 1E56A 1W1YA 1VRXA 1W9VA 1CXHA 3UESA 1LLOA 2ZXQA 1MQPA 2YLAA 2ZUNA 2VX7A 1FOBA 2BVTA 4AZCB 2EBNA 1CEOA 3SCWA 2WVSA 1MFVA 2GFTA 5C70A 2OSWA 4UQEA 1HF6A 2VRJA 4PMUA 4IISA 3VILA 1KCLA 1EGZA 3T0AA 3EDFA 3N1AA 1VBUA 1E5JA 4AZ5A 3CUGA 4JKKA 1QI0A 2CBIA 3VDAA 1V6XA 1PX8A 4C91A 1R7OA 3VVGA 2W67A 2W91A 3AIRA 4HZ6A 3E1F1 1J11A 1R8LA 3BAWA 1E6ZA 1GJWA 4Q7NA 3CHCA 2NT1A 5D9MA 1HT6A 4EE9A 3VIGA 2VZOA 2ZWZA 1XH0A 2WWDA 4HZ7A 4IUGA 1PAMA 5AYBA 1MW2A 1Q6FA 1UKTA 2Y5EA 4RE3A 4HMEA 5GPRA 3RJYA 2VC9A 4UNIA 3VNZA 2E9MA 1CIUA 4W85A 1BGAA 4JFUA 5I78A 1J0IA 5DO8A 1VENA 3IANA 2VVSA 1XGZA 3PZTA 3AIWA 1PZ3A 1GQJA 2XSBA 4D1IA 3VX1A 1L0PA 1V03A 1EIBA 1DWHM 2BV9A 2PF0A 3WQ4A 1V0LA 4H41A 3OLDA 3UG4A 1UQYA 1B9ZA 3RM4A 2XVNA 3I3DA 2OYMA 4QAWA 2WCSA 4LYRA 4WKHA 2FHFA 3SCVA 3CLWA 1GJUA 3VUPA 3W26A 4WIWA 1UA7A 1E4NA 2JIWA 4CN1A 1MWOA 3VDHA 4F66A 1JNEA 3RMEA 2W92A 4LYPA 4S3JA 3EMZA 2QHAA 5I5RA 1L8NA 2QPUA 3KWXA 1CECA 2CHNA 2W63A 2J7EA 1TVPA 3ZSTA 1GOMA 2EO7A 2VCAA 1BTCA 2W4XA 3PZQA 4N0RA 5A8OA 1XHGA 1NWUA 2XVLA 1DWIM 3UR8A 2YL6A 2WBGA 4PMQA 3ZJKA 1WDPA 2W66A 1UD5A 1C93A 1GOKA 3KL5A 1CXEA 3AS3A 2CETA 2WVUA 4JFSA 3RILA 5ECUA 5E6ZA 1CGUA 2QPSA 1B2YA 2CKSA 5GNYA 4V2XA 1CGVA 4UQAA 4ATDA 3NSNA 2GK1A 3W28A 4UFJA 4UQDA 1OT2A 4MB1A 4CU8A 1BQCA 4E8DA 5I79A 4J27A 1BG4A 4MDOA 1HX0A 3II1A 1JIBA 3N15A 5TD4A 4DWSC 1MFUA 1VJZA 2J25A 3VM5A 1XYFA 2D0FA 4ZFMA 7TAAA 1UWIA 2TAAA 1EDQA 1QW8A 1OBAA 4PMXA 2D20A 2Y8VA 3FHAA 4HMDA 2NW0A 3K1DA 3GXMA 4WF7A 4R5EA 4MPKA 1JFHA 3OGVA 4XUYA 1BAGA 2WMIA 2C0HA 3NSMA 3VGHA 4DWSA 4BQ5A 4NSBA 1JFXA 1EO5A 4JKMA 1H0GA 4XZBA 4M1RA 4FK9A 4OOZA 3CHFA 3W6MA 4UOZA 5FL1A 4PUEA 3BXWA 1KBKA 3ARXA 3L4TA 3VIHA 4Q22A 5IHSA 4W8AA 3AIQA 4X9YA 1C92A 4DUVA 1BYAA 1BG9A 5D9NA 2WB5A 1FH9A 4S3KA 2ZXAA 4ZE4A 3PZ9A 2J7BA 4KGLA 1UR0A 2XSAA 2BS9A 3LPOA 3F5JA 5A8QA 5ABFA 2DDXA 2WVVB 4MNMA 2DQXA 3OLIA 4UFLA 2YA2A 4TX6A 4TX8A 3AFBA 5BXSA 3EDJA 3WEOA 1US2A 2XVPA 4B9ZA 3SUTA 3WD2A 4J3VA 4BS0A 1W32A 3I3BA 4ZE5A 1WDSA 4PMDA 3VIFA 1OGGA 1WCGA 3GNOA 2WKLA 4ZXOA 4MADA 4FLRA 4AZGA 3BAJA 5BXPA 3T2PA 2WWCA 1D7FA 1Q6CA 2GJXA 2DT3A 2VCCA 2NSXA 1M53A 1OIMA 1CXIA 5CSYA 1WP6A 3PZMA 2BVDA 3N04A 1HNYA 3FAXA 3WNNA 4W8BA 2J79A 4JHZA 5JIWA 1JYWA 1WKYA 1RPKA 1E1EA 1LQ0A 3U5UA 1QNSA 4F9DA 5D8ZA 2EJ1A 1ZL1A 5A95A 1GORA 1C3FA 1UUQA 1CXLA 4ZXLA 2W5FA 4IM4A 1BF2A 4ML4A 4PTWA 4H2CA 1CGYA 2MANA 4JCLA 4PMZA 2WC7A 3W53A 3CZGA 1TA3A 2VR5A 4OJYA 5FIPA 1EA9C 4PBGA 4GINA 3AIVA 1B30A 3U5YA 3HJEA 4HA1A 2FH6A 4AD4A 2WHLA 1ECEA 2WCGA 3JUGA 3S6TA 4E4PA 5DF0A 3VD7A 4AXNA 1IT0A 1H41A 2PBGA 3B9AA 1LWHA 4CUCA 4W8LA 1W9PA 2DEPA 1O6IA 3M6DA 3WL1A 4XX6A 3M46A 2D22A 2CIPA 2EPMX 2VX5A 4W87A 3W38A 4BQ3A 1C7SA 1FH8A 3ARZA 2ZX5A 2VT0A 3BGAA 4HZ8A 1HL8A 3VGBA 3ZMRA 1HKJA 2YLLA 1NOUA 3AHVA 1HXJA 4GKLA 1GCYA 4DUWA 1F4HA 1TFVA 1ESWA 3IJ9A 2D0HA 1E6SM 1V0MA 2XYLA 1FFRA 4PUDA 1BVNP 2WMIB 5M03A 4BQ2A 1KGUA 3WD0A 4DWSB 4UR9A 2ZX8A 4LXFA 3WH5A 1M7XA 2WCAA 3MMUA 1MQRA 2E4TA 2YA0A 3A4WA 1XH2A 4HOZA 3PZIA 1QI4A 1E43A 2AMGA 3NUKA 1J0HA 1K9FA 2XTKA 3UG3A 1B31A 1KQYA 3VGDA 5ABGA 1DWFM 3WH7A 3GTNA 4AD0A 1WAWA 1OM0A 1XH1A 4MB4A 3BH4A 2DGAA 5GNXA 4W89A 5IFPA 1G9HA 3WNKA 4JL2A 1MVYA 5A6BD 2C7FA 1NOWA 1VEPA 2JEPA 5D9OA 3WBEA 5LYRA 1A47A 1EO7A 3WH8A 1LG1A 1HVXA 1OINA 3AHXA 5CXPA 4B15A 2WK2A 3PZGA 1CENA 1M01A 3IJ7A 2Z1SA 2WMJA 1U33A 1J9YA 2BHZA 2F61A 2ZE0A 8A3HA 3FW6A 5I6SA 2YL9A 4HTYA 3ZR5A 3NCOA 1E3XA 4CCCA 4JFVA 3WEZA 1OD0A 1US3A 1V0NA 1PEZA 1EDGA 1HN1A 3AHZA 1GZJA 1WNOA 4PYSA 3QOMA 4XB3A 4D6FA 3AIBA 2WLZA 4PCTA 1G0CA 4PMNA 2EQDA 4BQ4A 4HOWA 4CVUA 3W25A 5A6AA 3SUVA 1UH2A 1QBBA 3LPFA 3S2CA 3K4DA 1HVQA 1TE1A 5C8BB 1QHOA 2GVYA 4UFHA 5CZKA 1UH3A 5CPTA 1K9TA 4PN2A 3RJXA 4MAVA 3DHUA 5HPCA 3ZJ7A 1WDQA 3AJ7A 4GIAA 2V38A 5GQBA 4ATLA 3M07A 1E6QM 2DT2A 2BXYA 3SUSA 4RE4A 1E3ZA 2O9RA 1DP0A 1ZBCA 3UCQA 1NP0A 1JZ5A 5I23A 3NSXA 3W27A 1J0YA 1TZ7A 1IV8A 4ZENA 3L4VA 3CTTA 1W2PA 2WSPA 3B9EA 1JYXA 2FDMA 2VMFA 3VMOA 1ISYA 4V28A 1VFOA 1KGXA 3AS1A 1D2KA 3L2MA 1JZ4A 2XIIA 4EK7A 1MW0A 2ZX9A 1Z32X 2PB1A 3MANA 3SURA 3AMDA 1UZ1A 1JDDA 1E5NA 1UA3A 4W93A 1WE5A 2BHYA 1GONA 3ZIZA 1CWYA 4CD5A 3BCDA 2UY5A 3SEPA 5E0CA 1NWSA 2BHUA 3ARYA 4EKJA 3MUIA 1AQMA 5AC5A 2E3ZA 1UR4A 2PBOA 2ZUTA 4D72A 4H7VA 3WF1A 1WZLA 1E55A 3AIUA 1IZJA 1I1XA 5I2UA 4AZHA 3W37A 4UZSA 2CXGA 2O9TA 3T08A 1C7TA 2C8NA 4CGTA 2DSWA 2WHJA 4J3SA 4MTVA 2O9OA 2PWEA 3RCNA 2HVMA 1JD9A 1KBBA 3MO4A 4CU7A 3QR3A 1PPIA 3MV11 1W91A 3N9KA 2J47A 1FHLA 3WNPA 3MKKA 3BAIA 5BRQA 4AIUA 1WZKA 3F5KA 3WQVA 2YL8A 4NI3A 5IDIA 1OGSA 1V0KA 4IPNB 4LGXA 1B0IA 2G4FA 1KWKA 1V6WA 3FXYA 2WVVA 4M8UA 3QGVA 2BY3A 2WW5A 4GZIA 1ITCA 3K4AA 1SYTA 3GNRA 4CD6A 2WKGA 4AIOA 1F4AA 1LJYA 4JKLA 4YHGA 2GUYA 5E9AA 1TCMA 2D23A 3D3AA 1KXVA 2BFGA 5LA1A 3WKZA 3MMDA 3IAQA 2DT0A 2Y4SA 5EFFA 1E40A 1JI1A 1E70M 4X0VA 3GBEA 1ZBWA 1CXKA 3AXIA 1BVZA 3SIMA 5DT5A 2E40A 3AI0A 1GHRA 1CDGA 1KFWA 1PBGA 2VRQA 4QLLA 4U2YA 2WMHA 4WKFA 3MUAA 1W1VA 3RO8A 2UY2A 3WQWA 1V08A 3T2OA 2O9PA 3VIJA 1EHAA 3WDRA 4AD3A 5LA0A 4CD8A 4HA3A 3WF4A 5CSUA 3AYRA 1RP8A 1EOMA 4AZBA 2GJRA 2J75A 3WUGA 1AQ0A 1ZJAA 4D6DA 1NP2A 1V6UA 3QHMA 1P6WA 3VD3A 4AEEA 4OUEA 1VFMA 4AIEA 5A6MA 3O2LA 2YL5A 4MB5A 5HXMA 2JIEA 3SCTA 4Z2KA 4M29A 1BLIA 4PSRA 1XC6A 1ISVA 2G3IA 3O6AA 1DEDA 1WB0A 4OKDA 2VCBA 5E70A 1CGWA 1W9BM 3OZOA 2D0GA 3VIKA 1UKOA 3KEHA 3PN8A 3WF3A 5HNNA 2V5DA 5A8MA 1CGXA 4PTVA 5C71A 2DSKA 3MSGA 3OLGA 2JF6A 9CGTA 1VEOA 4QLJA 1OT1A 3VGFA 3ARRA 3W81A 1XD1A 4Z2HA 4J7RA 1R7AA 2FGZA 3VD4A 1GHSA 2QMJA 4PRWA 2D3LA 2ZUWA 2XG9A 1XSKA 4PMRA 2GJPA 1C91A 2VURA 5M3WA 5FL0A 3WFZA 2XGBA 5BXRA 1KGWA 3WFLA 1C90A 4F79A 2FH8A 4J28A 5A94A 2OWWA 3SUUA 4CU6A 2CBUA 1I75A 1Q6DA 1UWUA 2BY1A 4JFTA 3WDPP 2XGIA 3AHTA 5FOOA 4D6EA 3WENA 4UQBA 2VZVA 1UYQA 2E0PA 3WN6A 1C8YA 4M80A 1FA2A 1TUXA 2WLYA 4GQRA 2F8QA 4E2OA 2J7DA 2ZUMA 3NYDA 4KGJA 1GVIA 1QHZA 4AD2A 3IK2A 4AW7A 1GOOA 3ZR6A 3CUIA 5E6YA 2A3CA 4FLOA 1VJSA 1HJXA 1QNRA 2YKKA 3GH4A 1NOFA 5A6LA 1JG9A 4L4OA 1CTNA 1R85A 4URIA 2XWDA 3M7SA 1J01A 5BRPA 4WSKA 2V3EA 3ZJ6A 4PEEA 1UR9A 3VIPA 4OZOA 3SCUA 1KB3A 2DSZA 2ZUVA 3CZLA 3A47A 2W62A 3DHPA 4GO8A 1G94A 1XSIA 2VOTA 5CPQA 1C8XA 5BROA 3UEQA 2WZEA 3CZEA 3LPPA 4MDPA 4LQ1A 3WF2A 3ALFA 5CLWA 1H4PA 2V5CA 1QBAA 2XFYA 3ARPA 1J0JA 2CPUA 2PWDA 3SCPA 1XRVA 3AYSA 3OGSA 1C8QA 2J74A 2QLYA 5DMYA 4NF7A 1NWTA 3OB8A 1UWQA 1X6NA 2PI6A 5KEZA 1JZ3A 1Q6EA 2J78A 1YQ2A 3ARQA 4GZEA 2WNWA 3AZTA 1WPCA 3WF0A 1B90A 3TA9A 1B3XA 1QPKA 1EH9A 1PZ2A 2PWGA 4FLSA 1FFQA 2WC4A 1V6VA 1V6YA 2BY2A 4KH2A 3VU2A 2XM2A 3ARSA 4U33A 3SCSA 5M17A 1FHDA 2YDRA 1JI2A 2WMGA 1TR1A 1H1NA 4UZUA 3EYPA 4D6IA 1J18A 2WVTA 4W7UA 1UR1A 4P8VA 5BYWA 2XPKA 5CJ5A 4TUFA 4DWSD 3DC0A 4PTXA 5EFDA 2V3GA 4TVCA 4HA4A 3N11A 3MU7A 1ODZA 2QF8A 3TTSA 2ZUSA 3IJ8A 3AQUA 3W4RA 2Z1KA 4QFUA 2EXOA 4AEFA 1UKPA 4EAMA 3FNDA 3VIMA 4QLKA 5A1AA 2CCRA 4OIFA 2DIJA 4P7LA 3RM9A 4P7QA 1MYRA 4AY1A 4A4AA 2B31A 4J3UA 1UWSA 3ALGA 4X0NA 5F7UA 2XJ7A 4RE2A 1SMAA 1PX3A 2X2YA 5I3DA 1VEMA 1EQPA 2EPOA 2ZICA 1MQQA 2HISA 5A8NA 1UOKA 4Z2GA 2CEQA 4V27A 3BLPX 4CKQA 4QCEA 3TTQA 2RGMA 3VPLA 4BF7A 3EMQA 4AC1X 4WKAA 2VL4A 4PSPA 3T0BA 3J7HA 1E4IA 2DSUA 1OD8A 1GNXA 4OBRA 5HOSA 3OLEA 3A3HA 2UWFA 4W5UA 3CIVA 1VB9A 1EOKA 4XZWA 2V3DA 4TXEA 2VR4A 3AICA 2J7HA 4P8UA 1W9XA 2JALA 3ZQ9A 1V3JA 1FP9A 1H0IA 5LA2A 4Z2IA 3GM8A 2VO5A 3RIKA 2VTFA 1W1TA 3TTYA 2BNJA 5E09A 3RPMA 2XFFA 1JD7A 4B3LA 4KRUA 4B3KA 4DUXA 3ZJ8A 1W3KA 1GQLA 3K8KA 3U7BA 1EXPA 4QP0A 2UY3A 2XVKA 1W9UA 3ARWA 5FD0A 1GPFA 1RH9A 1GQIA 4JAWA 3ZSSA 3VGEA 2YBUA 1HKKA 1MXGA 5A69A 2OWCA 4C7GA 3RM8A 3VO0A 3WNOA 2J8GA 1V3IA 8CGTA 2YBTA 3AS0A 4GO9A 5CGTA 2RGLA 1EDTA 2DIEA 2G3NA 3AZSA 4BCEA 1ZU8A 4UQCA 1JZ2A 1JXJA 2WZHA 3HN3A 4HPGA 4D6CA 4ACZB 2FHCA 2EPNA 4HU8A 1E6NA 1DHKA 4L4PA 3FN9A 3AROA 3NJ3A 5AYIA 1UG6A 1ZB5A 3QOKA 1R87A 3BCFA 2CESA 2WM0A 3WUFA 1EHNA 3SCNA 3GNPA 5A3HA 2VVNA 3RDKA 1XV8A 4NRSA 1MXDA 1YHTA 4A3YA 4WLCA 5FCZA 3AIEA 1N82A 5M5DA 2YA1A 3FHQA 1CNVA 2ZWYA 3PTQA 5CPSA 5CG0A 2X1IA 2GDVA 4P8XA 4CN6A 1GUVA 1NH6A 3GDBA 1VFFA 3BAYA 4YPJA 2PWHA 1HJUA 3N12A 1UD6A 2VUYA 4BA0A 3K46A 2OLHA 4AD1A 4M56A 3KL0A 2XHYA 1W3HA 4D6GA 4AMCA 1QNQA 3GH5A 4UFIA 1E6RA 3WSUA 1W2VA 2JE8A 1LF1A 4U3CA 4M81A 1UD8A 3L4ZA 3DECA 3WDHA 2X05A 4P7OA 5A2AA 3IAPA 4FMVA 2CBVA 1I1WA 4GI8A 1E73M 1U30A 3SUWA 3W24A 5ABEA 1J0ZA 2CYGA 1FP8A 2VX4A 1VFUA 1LL6A 2IXUA 1B3WA 1E0XA 3BSGA 2QV4A 1R86A 5DEZA 4J3TA 5D8WA 1KR0A 2CNCA 4EANA 2XVGA 1KXHA 1JF6A 1WDRA 4HOXA 1HJVA 2E8YA 5D9PA 2E8ZA 4YN5A 3VDCA 5EBAA 3WDJA 2G3MA 4WJXA 4GI9A 4KMQA 1DWJM 1H11A 3BMVA 1XCXA 3T2QA 3WY1A 1D3CA 4F9JA 4KRTA 4Z2LA 1H09A 4J3WA 3CMJA 4QDMA 3EDEA 1CLVA 3U7VA 3UERA 3GBDA 3L4UA 2ESCA 3GXFA 4XV0A 4W7WA 3MS8A 1HKIA 1UR2A 5GNZA 5IFTA 1QI2A 1PIFA 2OSXA 1W1PA 4GZJA 5AY7A 3VX0A 2PWFA 3WUBA 1JXKA 4W7VA 7CGTA 2DH3A 3WH6A 3QHOA 3VKKA 3ZM8A 2A3EA 1UKQA 3O9NA 3CMGA 3AISA 1X1NA 3ZT6A 3CZKA 1V3KA 2O92A 4CCEA 1W3JA 4NZCA 2NT0A 1HL9A 3SCOA 1RP9A 2WMKA 1BGGA 4UOQA 4N42A 4MNLA 1KXTA 4D1JA 1NWRA 3WMCA 3D5HA 1V02A 2WHMA 3VTRA 1V3MA 1JYVA 1QW9A 1TVNA 1DWAM 2OYKA 3SCQA 3SCRA 3PTMA 1XYZA 4TTGA 3L2LA 3F4VA 3N18A 2YIHA 1PJ9A 3CO4A 1ISWA 1QVBA 5D4YA 4H8UA 5A6SA 3OGRA 4A3HA 3TONA 3WNLA 3WELA 2IXVA 4DM2A 3WQ6A 3WDQA 1G5AA 1ZS2A 2F2HA 3PZVA 4BZYA 5I77A 1LL7A 3W29A 1G1YA 1UWTA 5KZ6A 2DH2A 1H5VA 3BSHA 3T0DA 4WK9A 3WMSA 1VF8A 1B1YA 3W6LA 1HJSA 1BYDA 1QI3A 3OBAA 3CPUA 1AQHA 3AZRA 3AS2A 1KQZA 3VIIA 3CH9A 2DT1A 2V3FA 2J7CA 3MMWA 4MNKA 4JL1A 4UQ9A 4HPHA 1Y7VA 1M03A 2VI0A 2VNCA 4F8XA 1OSEA 1JAKA 2VRKA 2VZSA 3ZT7A 1XSJA 4FF5A 3LMYA 1NQ6A 3CBWA 3VIOA 1GQKA 3VDBA 3ARTA 6TAAA 1J0KA 1GOIA 3BLKA 1TMQA 1NARA 1LG2A 1V3HA 2ZXDA 3EDKA 5HBFA 1UD3A 3MV01 2ZIDA 4UTFA 3G6MA 4AZ6A 2D2OA 4Y7EA 1BFNA 1H2JA 1GW1A 3VOCA 1UHVA 4LYQA 2ZXBA 5A6KA 1K6AA 1HKMA 1M04A 3NDZA 2VZUA 1K9EA 5A6JA 4C90A 2A3AA 1DTUA 2XFRA 1G01A 2WZIA 1JAEA 1LWJA 5BXTA 1W9DM 4D6HA 5I0DA 3BMWA 1VIWA 4CD4A 3EMCA 2WPGA 4C7DA 1QHPA 3CUJA 4OOUA 2A3HA 1B3ZA 1LL4A 4AYSA 1E0VA 1RD6A 2AOSA 4K68A 1KCKA 3HU7A 3CZJA 4U5KA 1J10A 3AOFA 3APGA 4UOJA 1OB0A 1ISXA 2YJQA 1W3LA 4P8WA 1E0WA 3OIHA 2VJXA 1SFSA 4OBSA 2D24A 1E4LA 3WQ5A 2YDSA 3VD9A 1DWGM 1JNDA 1O7AA 2ZOXA 3WNMA 3TTOA 1X6LA 3CUHA 1ITXA 2AAAA 5JUVA 1CLXA 3MUY1 2WYSA 2WMFA 1V02E 4J3XA 4H8HA 5IHRA 2BY0A 3L4YA 1J12A 3GH7A 1IZKA 3BC9A 3PZUA 4TVUA 4D71A 4P7NA 2OYLA 1GVYA 1SMDA 2J77A 4JIEA 1JZ8A 3PZOA 1JYNA 3AMGA 1XCWA 1K9DA 3VNYA 4ACZA 1OIFA 4W88A 3W82A 4JCMA 4AD5A 3EBVA 3N17A 3CHDA 2Y2WA 4TTUA 4YHEA 5E0FA 4JFWA 3TOPA 3GXIA 5I24A 4AWEA 4CVWA 2WHKA 3N13A 5A2BA 2E9LA 3NIYA 4PTMA 1H3GA 3FY1A 4GQQA 3PTKA 1UKSA 2FGLA 4NRRA 4U3AA 1TG7A 3WD1A 4CD7A 6CGTA 1E15A 5HPOA 4UFKA 4GPNA 1CGTA 2ZX7A 1MW1A 1E72M 3WEMA 5A6BA 1JDCA 4MJ4A 3POHA 2X0HA 1PIGA 4H04A 3ARUA 3UG5A 3WD3A 3VM7A 1CXFA 1PX4A 1ZJBA 1QNOA 3VGGA 4PCSA 1B3YA 4M82A 3WUEA 3TP4A 4HU0A 1BHGA 4U5IA 1WZAA 3VINA 2VX6A 2J7FA 3CZ8A 1HJQA 5CGMA 4PMOA 1ZBVA 2IUZA 5ABHA 2YOCA 5A2CA 4CCDA 1GOQA 2BVYA 2OWXA 1WZMA 4E8CA 2JF7A 2EPKX 7A3HA 1VBRA 2EPLX 4UCFA 3UETA 3LPGA 3DYMA 3A4AA 2WANA 1UR8A 2Y8KA 2UY4A 2GK1B 2A3BA 2VQTA 3WMBA 4CN4A 2Y24A 4B16A 5JBDA 3L4WA 1QNPA 1XD0A 1HP4A 4HP5A 1V3LA 3AMCA 2VZTA 3WQ8A 3K8LA 3WL0A 4C7FA 3B8SA 3DYOA 1BSIA 5CLTA 4MB3A 1HP5A 4AZCA 4KWUA 1FH7A 4MAZA 3GXDA 5HDRA 1OGBA 1KWGA 4JHOA 3BAKA 4P7RA 4LX4A 3UR7A 3AHYA 3GZAA 1CPUA 4Z2JA 3AXXA 1JZ7A 3CHEA 4AZ7A 4D6JA 3AXHA 1U2YA 1E6XM 4QCFA 2WAGA 4GI6A 3MUZ1 6A3HA 4RL3A 2FHBA 2OSYA 4H8VA 3W0KA 2XIBA 4PMVA 2EEXA 3MSDA 2VQUA 5EB8A 4ZEPA 5AC4A 5BWFA 2D1ZA 1S46A 4GXPA 2J8FA 4TOQA 1CYGA 3OG2A 1OWQA 1OCQA 2CERA 3K8MA 1AMYA 1JZ6A 4W86A 3WIJA 3G6LA 1ZBKA 1E1FA 1KXQA 3THCA 3I3EA 3ECQA 1HIZA 2D3NA 2JEQA 1A3HA 4R27A 5ABFB 4AISA 1BYBA 2BXZA 3ZOAA 5JBFA 3U57A 4MNJA 3KZSA 2GSJA 3CUFA 3PHAA 3GYCA 3WH9A 1UD2A 3B9DA 4DM1A 4FLQA 1E9LA 5DFAA 3FAWA 4W84A 3KL3A 2ZX6A 3KE0A 4U31A 3WD4A 5A8PA 1BPLB 4ACYA 2CBJA 1HJWA 1EQCA 3ZT5A 1CBGA 1UH4A 3BAXA 4WSJA 1UWRA 2JFEX 1MW3A 2J7GA 1BYCA 2GJXB 3ARVA 4PMYA 3VMNA 1NM9A 2Q8XA 2XWEA 2QMKA 1UQZA 1CZ1A 3WDIA 2W61A 2G3JA 2WSKA 1E4MM 3T09A 4UFMA 5CQ1A 1KR1A 2X09A 3VMPA 1ISZA 2PC8A 2XUCA 4U2ZA 4AZIA 3ZO9A 3NDYA 4LPCA 4IPLA 3HMCA 5DT7A 4B9YA 1H49A 1B3VA 1UD4A 2J62A 1QOXA 4TVDA 1WO2A 1ODUA 5JIPA 5FKYA 2X8RA 1JDAA 1Q6GA 2G41A 1GOWA 3OZPA 3QHNA 1JGIA 5BCAA 1UZ4A 4MJ2A 5EMYA 1E6PA 1QI5A 2DSVA 3CGTA 3WBAA 2XM1A 2DPEA 2J4GA 3THDA 1TA3B 2WC3A 3POCA
chains in the Genus database with same CATH superfamily
3LHVA 5CJMA 2GDUA 4DBEA 1FHVA 5MF5A 1PCKA 1NSJA 2POZA 4X63A 1AJ2A 3PB2A 3OA5A 1CB7B 2DORA 5AVNA 2WBKA 3RN6A 2Q8ZA 4RXGA 1EYEA 4BEUA 5FI8A 3GUWA 2E9BA 5XINA 4ATWA 3PBGA 4GK8A 3L4XA 3BGGA 5HJLA 3VXGA 1IEVA 1W1YA 2O55A 4WRHA 3PK7A 4Q7IA 1LLOA 5B7YA 1C9DA 2ZUNA 1W5PA 4NJKA 3WLSA 2HMCA 2AQVA 3CU2A 3H2EA 2OQLA 1CEOA 2W27A 4LUIA 2WVSA 2DUXA 4J2PA 4PFHA 2OSWA 2IQ0A 4UQEA 3T1GA 4IISA 3PPGA 1KCLA 2WNZA 3EDFA 3WK2A 4BEQA 4WOZA 3EXRA 3EPNA 1FWJC 3CUGA 4JIIX 2JBMA 3BV4A 4KWSA 1A3WA 4FO4A 1V6XA 3TR2A 2G3FA 2W67A 2W91A 1PO9A 1GTHA 1E6ZA 2WQPA 3GZ3A 2NT1A 1DQXA 4GA8A 3TSDA 4M6VA 4WXZA 2F9RA 5AYXA 1LYXA 4HZ7A 4JGDA 2YW4A 4NUWA 5AYBA 4O11A 2I7GA 4RW3A 2E9MA 3P60A 1ONRA 3IANA 1W3NA 2VVSA 3AIWA 1PZ3A 4K39A 1RCQA 3PY2A 3VX1A 1EWDA 1EIBA 2BV9A 2ISDA 1V0LA 3UNDA 3OLDA 1B9ZA 2YXXA 1XYCA 3BANA 3CJPA 3VUPA 5KITA 5LGXA 3W6YA 3IJDA 3LCFA 1HGYA 3BV7A 2CZFA 4S3JA 2H9AA 2KAUC 3NXLA 5I5RA 2J7EA 1TVPA 2QUUA 2VOMA 4NNBA 2W4XA 2DY3A 4N0RA 1XHGA 1KM2A 1DIKA 4WJ8A 4C65A 1K03A 5CBJA 4NAFA 2WBGA 3LZ3A 4TU1A 1TV5A 2W66A 4IIHA 3GXTA 3HO8A 1CXEA 2FFCA 3UXLA 4JFSA 5ECUA 3STPA 2P0OA 1F6PA 3N9SA 1AK5A 3IIOA 1CGVA 4UQAA 4G1KA 1YDNA 3M0KA 4CU8A 3GDTA 4KFNA 4L4MA 3EWDA 1ML1A 2PP1A 4YJ5A 5LIXX 1EDQA 1OBAA 4IQEA 2D20A 3APYA 3E2RA 3W1LA 4HMDA 3L5MA 3WJSA 1K6WA 2J8TA 5HWJA 1FDZA 2PODA 4NSBA 1JFXA 2VFHA 4FK9A 4E6MA 1RY0A 4UOZA 4ILSA 1K7XA 4Q22A 4B5SA 4X9YA 2A6NA 4DUVA 2WB5A 2OG9A 2QCDA 1FH9A 4S3KA 4R3UA 3MHFA 4KGLA 2XSAA 4ZQOA 3CIWA 4UXDA 3LCLA 1LROA 4FI4A 1XLKA 2YYUA 4W4QA 3SUTA 3AXKA 4Y9NA 4HHHA 4BS0A 3B97A 3I3BA 1WDSA 2H3DA 4IGNA 3PSWA 2OT0A 3FA3A 4ZB5A 4CQ8A 4ZXOA 1MZRA 4KKXA 4MADA 1Q2SA 2VDIA 4RNJA 1IIGA 1KRBC 1UJPA 5BXPA 1FY6A 3MCOA 4TV6A 1XLIA 2FKPA 1NDYA 1XGDA 3B0XA 1ZPTA 4KS0A 2BVDA 3N04A 3B9NA 4MKVA 2B7OA 1U22A 1OX4A 4IWWA 1UUMA 1E1EA 3DKLA 3U5UA 3N29A 1QNSA 3NZQA 3GRIA 1FWRA 3ZLGA 1GORA 2H9AB 4PRTA 3SQSA 5HA7A 1CXLA 4QEEA 3QZEA 3R25A 1ZJHA 1IT7A 3DENA 4UTTC 4ORMA 4AUBA 3QMSA 3MI2A 3OQ8A 5AHLA 3K4WA 3I4EA 1MI3A 1GEQA 1PB0A 4OJYA 4PBGA 4GINA 1B30A 3OTRA 3U5YA 3HJEA 4AD4A 2WHLA 2Y89A 3JUGA 3B06A 4NAFB 1IT0A 1H41A 2R6OA 1R9ZA 5BWAA 4N02A 1LWHA 4UC5A 4XSMA 4HZMA 2DEPA 3KLLA 4NP7A 1YKWA 3NPXA 4D2JA 3HQNA 3RX2A 4W87A 4M51A 3W38A 1UC4A 3NQMA 4DNMA 2GOUA 3KP1A 1XYLA 1R3VA 5HMFA 2V9DA 4HZ8A 4LB4A 4S3EA 1HL8A 1ZGDA 4S3BA 3ZMRA 1NOUA 2C6QA 3RG6A 4GKLA 4J40A 3AXMA 4CCZA 1ESWA 3CK5A 4KPLA 2QF7A 4LAZA 4E38A 2A7PA 4KCUA 3G22A 5G4EA 4UR9A 5GVJA 4LBSA 2ZX8A 1S3TC 2WCAA 3MMUA 2E4TA 4AFYA 2EHHA 3LLFA 4D8LA 3VC5A 1TPFA 4KRZA 3KTXA 4CNTA 3PZIA 3PJTA 1J0HA 2XTKA 3UG3A 2VEPA 3VGDA 3KS6A 4D8AA 2V5JA 4RV8A 1WAWA 3XINA 3KFTA 5C2CA 1AA1B 3BARA 3QH2A 1FBAA 1SJBA 1XBVA 5HJYA 2NX1A 3L66A 5GNXA 2Z27A 3L7RA 1T8QA 4HHLA 2J66A 1G9HA 1S5MA 3D0CA 3VKJA 4JL2A 4DXXA 4QE5A 5A6BD 1NOWA 2YPIA 1ONWA 2ZC8A 4O15A 4Z1DA 1EXBA 2WK2A 3PZGA 1KM4A 4LWWA 8A3HA 3PJXA 1K7EA 1UBPC 3W1XA 4CCCA 2BZNA 1OD0A 1LCOA 1V0NA 1PEZA 4L1XA 1PZ1A 4ZSUA 4M19A 3VCNA 4XB3A 4HPNA 2NXHA 2IS7A 4I6VA 4BQ4A 4CVUA 5A6AA 3LPFA 3W83A 1OX4B 3PSVA 2WQDA 1RD5A 5C8BB 1K8ZA 3V18A 1XIHA 4PN2A 2QVHA 2GQ9A 5HPCA 3KVLA 1XIDA 1WDQA 1VQTA 2G96A 4O50A 3OIXA 4NYUA 1OC5A 4O4VA 2UZ9A 4ATLA 4FNUA 4KFPA 2DT2A 3OVRA 1Q85A 3EPOA 4FIQA 1J0YA 5D02A 4ZENA 2WSPA 3V35A 1JYXA 2DZAA 3M0YA 2FDMA 5D05A 3FX4A 3GIPA 2OZ8A 4QBXA 5DXXA 3KDNA 2XIOA 3M5YA 3C3NA 4FX7A 1D2KA 1VYPX 2QJIA 2XIIA 5T8GA 3W84A 1Z32X 2PB1A 1JCTA 2DZXA 1LWIA 3NQGA 2P1FA 1UA3A 4CD5A 3BCDA 3SEPA 1MUMA 2BHUA 3S5NA 3UWYA 2ZUTA 3R7MA 3MSRA 1W37A 4F0KA 4EIVA 4N9DA 4CGTA 2WHJA 2O9OA 2PWEA 3RCNA 1JD9A 2A3LA 3QR3A 5AZ1A 3RLGA 3LHUA 3WNPA 4ICMA 3MKKA 4A8RA 3H2CA 3VKDA 4JTEA 3S2MA 2ALRA 3WQVA 2HK1A 4NI3A 4LGXA 4IPNB 1GG0A 3NO5A 5BRBA 3DN5A 2PFHA 3NVDA 1RCXB 2BY3A 3UD6A 2WW5A 4GZIA 1SYTA 2HQAA 2WKGA 4XD3A 4HYWA 4UR8A 3R1ZA 2VWTA 1KXVA 2BFGA 5LA1A 4N9EA 5EFFA 4W9TA 3GVRA 3BJFA 1E70M 2V81A 1S39A 3AXIA 3SIMA 3AI0A 4HJWA 3EB4A 3EXTA 1KM1A 3RO8A 2UY2A 3WQWA 3HJZA 4DUOA 3VIJA 1FDJA 3B0YA 3M0VA 4AD3A 3WLLA 1EEXA 3DC8A 5LA0A 3WF4A 3UXKA 2GPTA 3AYRA 4CLMA 5CSUA 4AZBA 3GKFA 1F9CA 2INFA 1VCFA 1V6UA 5EIYB 1P6WA 3EKGA 4OUEA 3MYOA 5HXMA 2JIEA 5FF4A 4PRRA 4FX6M 3LS9A 3ZWSA 1ISVA 1OABA 4JN8A 3SI9A 2G3IA 1WB0A 4K2SA 1ZALA 5LNUA 3TC7A 2CWXA 2BBFA 1GVQA 2Y7GA 3SBFA 1W9BM 3FSUA 5LHEA 4DAFA 1PKYA 4WY0A 3OZOA 2XN1A 3VDGA 1XBZA 1UKOA 3KEHA 3PN8A 1VRDA 3WF3A 2DZWA 1SQ7A 3OO2A 2V5DA 3U9IA 5A8MA 3KTCA 1CGXA 4FXRA 4S3FA 1SZNA 3GTHA 4DQWA 3COTA 9CGTA 1VEOA 3W81A 3T55A 4Z2HA 4LOCA 4AWUA 2GUBA 1MRQA 3CEUA 1OYAA 2D3LA 5AHNA 4PMRA 5FJRA 5M3WA 2FIQA 3NEHA 5AB3A 1JRCA 1FWCC 4B2DA 1XLAA 5TF0A 4F79A 2FH8A 3DEQA 3SUUA 3FJLA 4HGXA 2BY1A 5I3KA 3UR2A 4YTTA 5K7JA 3OBEA 4O1EA 3ABQA 3WENA 3HZ3A 4UQBA 1UYQA 4UNKA 4QSFA 1V7AA 2CLHA 3ONBA 3H7RA 4M80A 1W31A 2J6VA 4GQRA 2F8QA 1Y65A 4GIRA 1TUFA 1GVIA 2VFFA 4GKTA 3LRLA 3S2NA 3WYZA 4AD2A 1O5RA 3U2OA 1UP2A 2O7QA 1GOOA 3ZR6A 3W9ZA 1X8FA 1PZ0A 1XRFA 1JGMA 4GISA 3QV6A 1A4MA 4DJEA 1O1HA 3GH4A 1YTKA 1JG9A 3M7SA 1J01A 3BCJA 4NY2A 4V15A 5CC3A 3GC5A 2HTMA 5E5CA 4H9YA 3WLIA 5D2YA 1FKXA 3FYYA 4OZOA 3SCUA 5I07A 4JTFA 4I9TA 4NZ5A 2Z25A 3DI0A 1R46A 3W88A 3P3BA 4NX0A 1PYFA 3HGSA 3EWWA 5DX7A 3WF2A 4EXBA 5FJIA 1NF7A 3WBXA 2QXWA 1QBAA 3UA3A 1SZGA 5DBUA 1NDWA 1TWDA 2WSQA 3N9RA 1C8QA 3GU2A 1KFJA 4JICA 2X0SA 4C6KA 3OB8A 1UWQA 1X6NA 3T0TA 2J78A 2QR6A 4PH6A 3E0IA 2HNEA 5HAOA 2HS6A 3AZTA 1YX1A 1I0DA 2B7PA 5CSSA 5IBXC 1B3XA 4JY8A 1FFQA 2TRSA 1V6YA 4QGCA 2BY2A 4KH2A 3VU2A 5I3FA 1LT7A 3UT0A 2P76A 3C0SA 3A5FA 4JYEA 1TE6A 1H1NA 4UZUA 4X2RA 2WVTA 4CQAA 4RJEA 4P8VA 4A6GA 5BYWA 1TPWA 3N2MA 4TUFA 4PTXA 2DVTA 2PDQA 2PRHA 1T8XA 3G3DA 5FEXA 4MKNA 2V3GA 2Z00A 4TVCA 4HA4A 1ODZA 2ZUSA 2CU0A 3UWVA 3AQUA 3W4RA 5LXEA 4HPJA 2EXOA 2PMQA 4AEFA 3NA8A 1UKPA 2QEZA 3VIMA 2CCRA 4XZMX 4LAOA 1MXSA 4P7QA 3WG6A 1PVNA 2B31A 3UPWA 3ALGA 5F7UA 1ADDA 2XJ7A 1M6JA 2I17A 2X2YA 3RCYA 1EQPA 2EPOA 1CW2A 3EX6A 3PWAA 3OZMA 2Q8LA 3TTQA 2RGMA 3CPRA 4DJFC 4BF7A 3PTDA 4I6KA 4NILA 1JCMP 3S1XA 1E4IA 4BWLC 2ISFA 3VOHA 3WQOA 3TLLA 2BP1A 4Q8MA 1YPFA 3PP7A 4QS5A 4TXEA 4GG9A 5G1MA 3AICA 5D04C 2KX9A 1CT5A 4HTBA 4A05A 2JKAA 5DRCA 1W9XA 4BF9A 3CQHA 1ZUAX 1VBHA 1K70A 4MZ8A 2ACQA 3QW3A 5CZJA 4AH7A 3RIKA 4J4KA 5CKSA 4GY7A 3ABSA 1FWBC 4QNEA 1BKHA 1W3KA 1GQLA 3XISA 4H2HA 3U7BA 1YLVA 4PUJA 5JQ9A 3JVAA 3ARWA 5FD0A 1GPFA 2GSHA 4KCTA 1XQLA 2YBUA 3TX9A 3EGJA 2VC7A 2EGZA 4BI7A 3C86A 3NNTA 4PTDA 8CGTA 1F07A 2A7RA 3ZS4A 3NQ6A 4DEFA 3CB8A 2HNHA 4YNGA 1JZ2A 3W23A 4UTLA 1GYNA 4NAEA 3G77A 3GLCA 1RSCA 4L4PA 3AROA 1IHIA 5HQMA 1R87A 3AWNA 4WGHA 4WD0A 3HTWA 3SCNA 3MKCA 3PPHA 1GYMA 2VVNA 3MI6A 1XV8A 4NRSA 1RALA 2IKHA 2WKJA 4WLCA 4UTUA 3AIEA 3O05A 3EA1A 3CO8A 3HPFA 3FHQA 3KLKA 2ZWYA 1FWEC 3Q67A 2Y5SA 4KEVA 4J2MA 5F2LA 1DJIA 3GDBA 1IXNA 3OPSA 4Z1AA 3IACA 1KV8A 3PNUA 1IWBA 4YPJA 1HJUA 4AVFA 3G3MA 3KBJA 4GH3A 1UD6A 3MZNA 2VUYA 4BA0A 1RBOB 3R2GA 4JY9A 5K9XA 5J5RA 1H63A 4AD1A 1K1DA 2Y8UA 3MP4A 4O1FA 2MNRA 3GH5A 4AMCA 2WO5A 3EWCA 3BTNA 3SM0A 3KCOA 2Q71A 2JE8A 3W74A 1GYLA 1Q8JA 1P0BA 1LF1A 1Z6KA 3CT2A 3AYVA 4B4FA 4WCJA 1IE7C 1I0BA 3DECA 4XAYA 3JZUA 4FMVA 2FZDA 1U30A 5REQA 2C0AA 4S2CA 3S9ZA 1X39A 1VFUA 1Q65A 1LL6A 1E0XA 3AU6A 1XDJA 2O4MA 3IRSA 3PM6A 3WLPA 1VH7A 1WDWA 1ZQ5A 1HJVA 1UB3A 4IGHA 2E8ZA 3LCHA 1R3WA 4LV4A 4JDYA 1XLHA 2G3MA 2JKPA 3T2QA 4ZOEA 1D3CA 4RDVA 4Z2LA 4HPXA 4Z0JA 4X3ZA 5DXYA 4AC7C 2YCIX 3GBDA 4AXKA 3L4UA 2ESCA 1KM5A 4IIGA 4R7OA 3CL7A 1TJ0A 1DOSA 6PTDA 5GNZA 5IFTA 1N8IA 1QI2A 2OSXA 1W1PA 4GZJA 5AY7A 4GVIA 7CGTA 3WH6A 3QHOA 2VFGA 4DO7A 3FCPA 5G4WA 3T9PA 1Q8AA 4WDTA 1IZCA 3O0KA 3ZVHA 2TSYA 3VNKA 2R1PA 1FCVA 1W3JA 4NZCA 4JN6A 5KETA 5CC6A 1HL9A 1H5YA 4E5TA 4GUFA 1PXGA 1AW5A 1VPYA 4IPJA 1QMLA 4N42A 4D1JA 3TW7A 2WHMA 4IMCA 3LX9A 1JYVA 1QW9A 1XFBA 1JPMA 4RXFA 4CNSA 1Q6LA 4PZVA 3F4VA 2YIHA 1YMYA 4NAEB 3T4CA 4AHQA 1OFDA 5D4YA 5A6SA 4MIMA 3FK4A 2J9YA 1BXBA 3F4CA 1QWGA 5F4WA 5BNKA 4DM2A 4JYFA 3WDQA 3AWOA 1ZENA 5I03A 3PZVA 5HNTA 1NEYA 1QK2A 1K02A 4ES4A 1WXZA 4FS9A 1G1YA 5KZ6A 3BK0A 1AW2A 3P62A 3BLEA 3T0DA 2E1DA 3W6LA 1B1YA 2PWVA 5A5WA 1SPQA 1HJSA 4HNOA 1VC4A 3OBAA 1NIUA 3BL3A 4MFDA 1QPRA 1WAUA 3VIIA 1TZ9A 4MWAC 1PV8A 4MY9A 3QKZA 1XL9A 3CL8A 3T07A 1JR1A 1I2PA 1JAKA 2VZSA 3ZT7A 5CSRA 1XSJA 3NG3A 3W7LA 1L6FA 3LMYA 3CBWA 3VIOA 4RLIA 1GQKA 1EPXA 3U2CA 3IWPA 1GOIA 3BLKA 2OO6A 4IUOA 1W1IE 1DIEA 1NARA 3EDKA 1UD3A 3MV01 2ZIDA 3FJ4A 3W1QA 4UTJA 3CL6A 1BFNA 2VENA 4V1XA 5AHMA 4LYQA 5A6KA 1RQEA 1K6AA 3NDZA 1ME7A 2RFGA 1OC6A 4ZO9A 2HRWA 2A3AA 1G01A 3N3MA 4IZGA 2WZIA 3EEZA 3NQ8A 3GQYA 5BXTA 3W2NA 3ABOA 4IJBA 4CD4A 2VUNA 2XINA 1FTXA 4FB7A 2A3HA 3TSMA 1G4PA 2TPSA 4CNNA 3CAQA 2YCLA 2VEKA 3VFLA 1DIDA 3TXZA 1W3LA 4O8RA 4B5TA 1E0WA 5I3JA 5EY5A 2BOGX 4IIBA 1AUSL 7XIMA 3VD9A 1W3TA 3H4WA 2Y63A 2ZRUA 3TTOA 1CLXA 4J3XA 3EEGA 3L4YA 2OFJA 3BC9A 2E09A 2IPWA 2DVUA 4WY0F 3F4WA 4S23A 3AMGA 3LNMA 2I9UA 1K9DA 4OQVA 3TMLA 1VZWA 3I68A 4FXSA 1F3TA 3ZVIA 1J2BA 5EJZB 1SZEA 1C29A 3N17A 4TTUA 2YZ5A 4GIEA 4QHRA 5E9XA 5D03A 4RNFA 2VDGA 3TOPA 3UCCA 2D2HA 3W07A 3N34A 4HKPA 3VZXA 3OEXA 3QC0A 3A9BA 3QVQA 1PL9A 4GQQA 1VGAA 4ERGA 1MEWA 3P8IA 1HG3A 1TG7A 6CGTA 3HQOA 4GXMA 2JGYA 2X7VA 5TQLA 2ZX7A 1MW1A 3TQKA 2QIWA 5EMUA 2NUYA 4JTAA 1WKEA 4H04A 3H2MA 1X7IA 4QSHA 3WD3A 4EF8A 1PX4A 1QNOA 3OJGA 4JTQA 3TC3A 4LUJA 4IMEA 5C54A 2XN2A 3TP4A 2BMBA 4WEVX 3NPUA 4K8HA 3IUDA 3CZ8A 1HJQA 3U8GA 3EWXA 3DUGA 2XN0A 1EJXC 4DJED 3WZ0E 4N7QA 1Q5MA 2OWXA 4E8CA 3C0JA 1OCJA 4ZQMA 1UJQA 2Q02A 2TMDA 1WKFA 1VBRA 3E02A 3MPGA 3LPGA 3C4UA 1E51A 1UR8A 2ZRWA 3WMBA 4I7WA 1HKWA 3CV2A 4TV5A 1SO3A 1QNPA 5DCEA 1XBXA 1XD0A 1MO0A 2EG8A 4HP5A 5D2VA 3T42A 2VZTA 2PTXA 3B8SA 3OP2A 3D47A 4LU0A 1QASA 5CLTA 1HP5A 4AZCA 3Q45A 1FH7A 3B9OA 2OEJA 1G67A 5HDRA 3IJQA 1OGBA 3BAKA 4LX4A 3UR7A 4Z2JA 4HT3A 1JCJA 4AZ7A 4FA3A 1XIEA 2Y7DA 1U2YA 1R2TA 3BDKA 2RDXA 4MUPA 6A3HA 3MUZ1 1AJ0A 2NQLA 2C19A 3BLIA 2EEXA 2VQUA 1KO0A 3QYSA 5AYZA 4C6QA 1FXPA 5G2IA 2PPGA 3TYDA 3P5YA 1IXPA 3IPWA 1OCQA 3FOKA 1RA5A 1UUOA 3V5OA 3K30A 3WIJA 4V33A 1E1FA 3TU9A 3DXIA 3S9IA 3IVSA 2D3NA 2ABAA 3B8IA 3R58A 3ZOAA 5JBFA 4MSSA 2TYSA 3N73A 4R7JA 4Y6GA 3B9DA 4DM1A 3GSMA 5F2GA 4US6A 3HPAA 3RU6A 1OK4A 3TE9A 2NSOA 2ZX6A 4U31A 1GTEA 5A8PA 2D69A 4BFAA 5C5YA 4Q4MA 3QTGA 4HK7A 5FEWA 1UWAA 1R47A 1TWWA 3ZT5A 1XDMA 1CBGA 3EKLA 1Z9AA 4FALA 4LVBA 3UA4A 2GJXB 1R3YA 1KTCA 2IMRA 1J5TA 1CZ1A 3EB2A 2EKGA 5KTLA 3TUUA 1ZJIA 3T09A 1Q3NA 2X09A 4P61A 4U2ZA 4IIDA 3PBVA 4AZIA 4LPCA 4IPLA 5JXQA 3HMCA 1GOXA 5I3GA 1B3VA 1UD4A 4TVDA 3IUHA 4YWIA 1JDAA 1Q6GA 2G41A 3QHNA 1XLDA 5DMNA 5BCAA 3GK0A 1M41A 2RDWA 4XZLX 3PUDA 4MJ2A 5EMYA 1QI5A 3BQ5A 3W2UA 1EJSC 2DPEA 1H7OA 3NQEA 3GWQA 3MMTA 3G1DA 3POCA 4K37A 3AMLA 3LXCA 2CKRA 1G7UA 1OHLA 2WXDM 4W5ZA 2YDQA 3LBCA 3W7RA 4NI8A 1A5BA 2CFFA 3TN4A 3NOEA 1PUDA 2G8ZA 3A4XA 2ON3A 4MLRA 1AVAA 4GCXA 3DGBA 4ASTA 3T78A 2X0YA 4M7SA 1XLCA 3FVMA 3M1ZA 2F7FA 3UBPC 1JL8A 2DUZA 3FDKA 3A6OA 4H6EA 4S3CA 2QDEA 2VKZG 1W9VA 3IV3A 3MP5A 3S0CA 4AF0A 2OJPA 4QTGA 4MGGA 2ZXQA 2Z1WA 1MQPA 2VX7A 2BVTA 2C15A 3N2CA 4Q33A 4AZCB 3W2LA 2G97A 1AL8A 4DIAA 1R30A 9XIAA 3V3WA 3HM7A 4ZOAA 2ZTJA 2P5NA 2EKCA 3BGJA 3YPIA 4JBRA 1X1OA 1EGZA 3NQCA 1KFLA 4HCLA 1E5JA 3FGCA 4AZ5A 1YE6A 2VYOA 1XS2A 1GGOA 3KAOA 1J6PA 4DLMA 3VVGA 3PPFA 4HZ6A 1J11A 3W7GA 3CHCA 4ADSA 3NL5A 3R6IA 5H8PA 4C6FA 4XVDA 2FTPA 2XIMA 1GVFA 3KVKA 3W7OA 1RHCA 1TPDA 2Z2UA 3H4GA 3GHTA 1MW2A 1Q6FA 2QKFA 3GHSA 4RE3A 4XUGA 3QRHA 3W1NA 4UNIA 3RX4A 4W85A 4Y90A 4GX9A 1TMHA 3SDOA 3KVMA 3KDOA 3W1RA 5DO8A 1KFEA 3CM4A 3LHYA 1GQJA 2XSBA 4D1IA 3FEMA 3WLHA 2I5QA 3SQLA 1DWHM 3P74A 4IX0A 4IMGA 2JQXA 2OLSA 2GGGA 4ZA0A 4L6DA 4QAWA 1NU5A 2OQHA 4WKHA 4PMJA 2FHFA 3GNNA 1VLIA 3CAKA 4DI8A 2WJZA 2E28A 1E4NA 3HGJA 4NU7A 4CN1A 4FNTA 3TNBA 3C8NA 3R43A 2HE5A 3WLOA 3B03A 4E2VA 4K8EA 2QHAA 4HHPA 2B7NA 3PWIA 1ZNNA 1L8NA 1CECA 3ZSTA 1I6NA 2VCAA 2GVGA 2XSXA 3MTWA 4UTWA 1S1RA 2XVLA 1DWIM 3LTSA 1ZFJA 3UR8A 4FOKA 2H6RA 1XPGA 1WDPA 5G1TA 3Q2DA 4YTRA 1C93A 1GOKA 1NVMA 3KL5A 3CS2A 3M4HA 1S2TA 4GUGA 2CETA 4JIQA 4AY8A 5GNYA 1SZFA 4AAJA 4ATDA 3Q94A 1X8CA 3NSNA 4OT7A 5EBUA 4HA0A 4UQDA 4IMFA 4IQJA 1BQCA 1A5NC 2BTMA 1ENUA 4MVAA 3RXZA 1IEQA 3C2FA 1LM1A 3II1A 1MFUA 1VJZA 1XPYA 2J25A 1OX5A 2YB4A 4MMWA 2D0FA 3PC0A 4JTJA 2ZZ5A 4OFCA 3H53A 2Y70A 2HBVA 4AF0B 1XXXA 2Y8VA 3RITA 2NW0A 2PDWA 1JFHA 3CQIA 4HCHA 4J3ZA 4KEUA 4DJDA 1KRCC 1EO5A 4JKMA 3KBWA 2I9EA 1O5KA 5FF7A 3T6CA 3NQVA 3CHFA 4J1OA 4PUEA 2YR1A 3BXWA 1X7FA 1KBKA 4AY7A 5EU9A 4W8AA 3AIQA 2VEMA 4H6QA 4MJZA 1BG9A 5D9NA 2NVCA 3C2OA 1SW3A 4H9ZA 1GG1A 4ZE4A 2PC4A 3WQEA 3UZYA 1TSIA 1KNWA 2GWNA 3F5JA 1H62A 1EPVA 2VD8A 3P14A 3LK6A 4O12A 3OLIA 4UFLA 4K3ZA 4O8AA 3BSMA 3ITTA 3FXGA 1DE6A 3EDJA 2YXOA 1GZGA 1US2A 3TIMA 4B9ZA 2NQZA 1TWSA 1YPIA 3RR1A 4J3VA 4N4PA 3LENA 2REQA 1B54A 1W32A 3OA3A 3TJXA 2VD9A 1X1ZA 3IVUA 3GNOA 2ASHA 1EP3A 1BWLA 3BAJA 1DQUA 4BY3A 1V51A 3WLQA 4DBWA 2DT3A 4F0RA 3Q4DA 4GFSA 2XDFA 4PUWA 3QZ6A 1OIMA 3LLXA 5CSYA 1RJQA 1WP6A 1S5WA 3LGDA 3PZMA 3VI2A 3WNNA 4JYDA 2J13A 3WLRA 3NDOA 2XFWA 1Q13A 3M43A 3W1UA 2PLCA 4C5YA 4GGBA 1WKYA 4ZCWA 3GS6A 2DV0A 4F9DA 5D8ZA 2EJ1A 1QK0A 1KCZA 4LCSA 3VA8A 4JTCA 1HKVA 1UUQA 6XIAA 1KFCA 1EWEA 3LM7A 4H9UA 4IM4A 4TMBA 3LB0A 1T96A 4H2CA 2C91A 1CGYA 4JCLA 1VKFA 2WC7A 4PMZA 5FIPA 2YBVA 1GPWA 3IUIA 5EMLA 4AXNA 3IJ6A 5G5IA 5F1UA 4DWDA 5DBTA 3NR0A 3TYCA 1J79A 1W9PA 3E2SA 1W0MA 5AOUA 3WL1A 2BG5A 4FF7A 2PTDA 4XX6A 2YB1A 3M46A 4C5ZA 4M6UA 1E1CA 4BQ3A 1C7SA 4CQCA 1FH8A 2ZX5A 2X40A 4ZZ9A 1BF6A 1BQGA 2ABBA 2P8CA 2WJDA 4N6FA 2CW6A 2FMOA 1HKJA 2YLLA 4S3AA 2NXGA 1U5VA 5KMYA 2DW6A 5A6TC 2WZTA 1TFVA 1A5MC 5DCBA 1SO4A 2Z2AA 1TJ2A 4YXGA 1R3SA 4I9MA 4DZIA 4LAMA 1KGUA 4H6KA 3MKVA 4IH3A 1DXEA 4LXFA 3UVAA 4FIRA 3LNPA 1MQRA 4XKYA 3A4WA 1XH2A 5D09A 5KZEA 1OFPA 1G4TA 1BRLB 3LZ5A 4UR7A 3NUKA 1K9FA 1B31A 1KQYA 3KZPA 1TTQA 3FLUA 3WH7A 4JQ1A 1LBMA 3GX9A 3K1GA 4AD0A 3G2GA 3NO1A 1XQKA 1FX6A 4FHAA 4PCPA 3BH4A 3FDGA 4Q8VA 2VC5A 3WNKA 1E9IA 4N9BA 4L1GA 2C7FA 4G5DA 2JEPA 5LYRA 4GNKB 3WH8A 1OFEA 1NELA 1OINA 5TNVA 3OU8A 4B15A 2Z1SA 4ZGYA 3GNXA 3PG8A 3FW6A 5I6SA 5K9DA 4JIPA 3ZR5A 1EKOA 2CLEA 1U1HA 1H61A 4JFVA 1LOLA 3AHZA 3EX1A 1EJTC 1GWJA 3ID7A 3W25A 3K4DA 1HVQA 1T7LA 3GU9A 1UH3A 4B90A 5CPTA 1K9TA 3UGRA 4MAVA 1K4GA 3H22A 1XKJA 3ZJ7A 2QJJA 4A3RA 4YS1A 4Z17A 2OGYA 5C7VA 4GI4A 4WVXA 1F73A 2D73A 3M07A 4P02B 4H3DA 1E3ZA 2JK2A 1NP0A 1YBQB 3NSXA 1W2PA 1GQNA 4QITA 4OWGA 3BZGA 3NM1A 2I57A 3URAA 1ISYA 4FOJA 5DMLA 4B3ZA 4H9MA 5HATA 1JZ4A 2IQDA 3E74A 1EF2A 4EK7A 1ECQA 2ZX9A 1BTMA 1SR9A 2QDHA 3GTXA 3MANA 2QDDA 1U1UA 3RLVA 3GIQA 1UZ1A 5D32A 4W93A 1WE5A 3K5XA 3ZIZA 3H26A 1TKKA 2DP3A 3SY8A 5E0CA 2Z29A 4EKJA 3MUIA 5AC5A 4KERA 2PBOA 3WF1A 1X6UA 2QCMA 3AIUA 3LGEA 5I2UA 4AZHA 4NT0A 3CUXA 2Q3OA 4ROPA 1WQ5A 3LCGA 2Y0FA 1TWIA 4EVZA 2Y7FA 1F3WA 3HQPA 1QTWA 2GGJA 3MO4A 2QV5A 2Z1BA 3QR1A 4IQDA 2CLFA 1ITQA 3PWGA 3R94A 2VHLA 1AW1A 1FHLA 3RO6A 3S46A 2P8BA 3BAIA 5BRQA 3MCNA 1WZKA 3F5KA 4NKCA 4YIWA 2HXTA 3M5XA 4LUTA 5C9WA 3GIYA 4H9XA 1POJA 1V6WA 3FXYA 4JN7A 2WVVA 4M8UA 3N2BA 4FEZA 4TX9A 1P1MA 1LRNA 1QXLA 2ZTKA 3CHVA 1IYXA 1ELSA 1Q6QA 4DHGA 2BWGA 4LFYA 2PLKA 2PRLA 4DB7A 3M9YA 2FVMA 3MHGA 5E9AA 1OQFA 2D23A 4I9AA 5FACA 4LRSA 1PE1A 3WKZA 3IAQA 2Y4SA 2FQIA 3U0HA 1JI1A 3GBEA 3VABA 2E6AA 3WQGA 5DT5A 3ATYA 4AG0A 1PBGA 1JEZA 1RZMA 3REQB 1MSSA 4ZMGA 1JCNA 3G18A 1V08A 1ZAHA 3T2OA 1D8WA 2O9PA 3OG3A 1P0DA 1EHAA 3WDRA 3WLNA 1EF3A 1O1ZA 1RP8A 3APTA 4B5WA 1IR1A 1KFBA 2O0TA 4REQB 3W7JA 3VD3A 4AEEA 4AIEA 4YL2A 3QBUA 2LLEA 2YL5A 4MB5A 3TN5A 3O06A 5DANA 3ABZA 4UWMA 1W5OA 3QLLA 4Z2KA 4L64A 1BLIA 4I8DA 4PCNA 1MUWA 4IHCA 3SZ8A 3VOIA 3W86A 1SZRA 3O6AA 1DEDA 3BOFA 1V6TA 2OELA 5E70A 1KTBA 4DLFA 3B8WA 3MYPA 1XI3A 2D0GA 4RZ6A 3RNDA 2YYTA 3H12A 3O15A 3NZPA 3MSGA 4A8NA 3IGHX 2A6LA 2BSLA 3TQVA 4QLJA 3ARRA 1XD1A 3CUZA 3M5ZA 4LBRA 4J7RA 4WUIA 2QDGA 3MQTA 4PRWA 4D9PA 2XG9A 3IVTA 3W7DA 5FL0A 4WZHA 1SO5A 3SGZA 4LC6A 5C2GA 4J28A 1XINA 2B7QA 2OWWA 1OG6A 4CU6A 1Z48A 3TCSA 3WDPP 2PDMA 5FOOA 4LVFA 5EYWA 3W3OA 3UW6A 2OU4A 4F2UA 1VFLA 2VZVA 1TJRA 3RPTA 1X38A 4DJEC 1R3RA 4E2OA 4F0LA 1I2QA 1FCUA 3SSZA 3NYDA 1ICSA 2PU0A 5CZTA 1JQVA 1KRMA 4EAYA 1HJXA 1A3XA 1OFQA 3DCPA 1XG3A 3ANVA 3OYXA 4L4OA 1V79A 2XWDA 5IOBA 3LQGA 4DZ5A 3QM3A 1OFBA 4WSKA 5LIWX 2DJLA 1JJKA 2WZMA 4JOMA 3VIPA 4ZQRA 5GJNA 4N4QA 3WLMA 2DSZA 2ZUVA 5TIMA 4GO8A 4RDZA 1LORA 1XCFA 4Z1CA 5AFDA 1C8XA 2WZEA 4MDPA 3N2OA 1OCBA 4HD5A 1SVDA 4RPPA 4OUIA 3RX3A 1SFTA 2F84A 5CLWA 4XISA 1D8CA 3I6TA 4F2BA 5K2ZA 3W00A 2NQ5A 1J0JA 2FPVA 2CZDA 3B3DA 3TYZA 4UTIA 4AWTA 2PI6A 3BW2A 2Z1XA 3F7JA 3O07A 3NVTA 1OF8A 4E0CA 1WPCA 1H7XA 3TA9A 1QPKA 1EH9A 1PZ2A 3QLDA 2PWGA 3WQCA 1GVSA 1V6VA 3MW7A 3JW7A 2RDTA 3T44A 4O1AA 4ZFCA 2PLJA 2XM2A 3UZXA 4U33A 3V4BA 2Y7EA 4O57A 1FHDA 1TR1A 2CZEA 4EWJA 4W7UA 2HV5A 2HS8A 1QW7A 1XICA 3UJEA 1ME8A 4JEJA 3VYLA 3LCWA 3GTIA 5EFDA 3O6DA 3C56A 2C1GA 5PTDA 3P80A 4OTKA 3MU7A 2WOQA 1REQA 2E6DA 2ZADA 4QFUA 5C9UA 1V5XA 4E4UA 5A1AA 4QLKA 2UBPC 2DIJA 3MVIA 4P7LA 1Z42A 4A4AA 4MWAB 3GG8A 5K9CA 4RE2A 1TMLA 4GYJA 1LOSA 1UR3M 1JVNA 2QS8A 2WSRA 1LQ2A 1MQQA 2HISA 4B5NA 4IFRA 2CEQA 4V27A 1RJRA 4CKQA 3BW4A 4U28A 4QCEA 2Z2BA 3LY0A 5HJXA 3UJ2A 1YNPA 4ORIA 4WKAA 2PP3A 4PSPA 4G7EA 4MYXA 2DSUA 1OD8A 5HOSA 4GFIA 3PBUA 4W5UA 4AX6A 4AHPA 2BXVA 1PYMA 4MZ1A 5H1WA 2V3DA 2FGBA 1W5MA 1OF6A 5LGZA 3TDFA 4P8UA 1QOPA 1IT8A 1G69A 2ISSA 4QAIA 1EUNA 5CPNA 1Q4WA 1PS9A 3W01A 5RUBA 2VTFA 2AQOA 4LVDA 3EXSA 3F1QA 4KRUA 3ZJ8A 4ZB0A 4X61A 4GNVA 2ZBTA 1HKKA 1SJDA 2I1OA 4YYCA 3WNOA 3PB0A 1KBJA 1T6MA 3KXQA 2G3NA 1EZ2A 3AZSA 2DZTA 4D6CA 4LF1A 1CLKA 4ACZB 1ZP4A 2F38A 1SFLA 3IV8A 3WLKX 1J2WA 3QV7A 4HHMA 4AMAA 3UY8A 2A79A 3QOKA 3V7PA 1A5AA 1RY8A 3VNDA 3PPCA 3RDKA 2W3ZA 4KEMA 2HPIA 3L0KA 5FCZA 1N82A 2ANUA 5M5DA 5J5DA 4MUZA 1PTGA 3MC5A 5CPSA 3MT1A 2GDVA 3IRDA 4P8XA 4NJGA 4CN6A 4O14A 4RNIA 1A80A 2ADAA 3R0UA 5EKYA 3BAYA 5CJNA 4DO6A 2BGQA 4GYPA 3BLLA 4ALDA 2OLHA 5FSEC 3RLHA 4BJHA 1QUMA 4HQVA 5M2FX 4LUSB 1O5QA 4UFIA 1TPC1 3SN4A 3I65A 4DJFD 1SUXA 2I14A 4K1GA 4IJRA 4XZHA 1HW6A 4U3CA 1AH3A 3H70A 4NG3A 3EZ4A 4E4FA 1B9BA 4P7OA 3IAPA 3I6RA 4GI8A 3SUWA 3LA4A 1FP8A 4S3DA 2IXUA 1H50A 2QV4A 3GTFA 3NXFA 1R86A 3U4FA 2C3ZA 3HGRA 3HB9A 4G2DA 1X96A 4EANA 1DVJA 1WDRA 3VNLA 2E8YA 4Q4QA 1Y5VA 3G5EA 3VDCA 3WDJA 4ADTA 3BMVA 3WY1A 4GLEA 1H09A 4J3WA 4Q4KA 3GW3A 3CMJA 2ZRYA 1CLVA 3UERA 1Z69A 4W7WA 5DELA 3MS8A 3PANA 3N19B 1RQHA 5L6UA 1JXKA 4W7VA 4L1WA 4A22A 3VKKA 3VKAA 1TZZA 2VWSA 3BMXA 3LU2A 4PE8A 3S83A 1X1NA 1JDFA 3CZKA 1US0A 2O92A 1A5KC 1M65A 6ENLA 1WA3A 4C6BA 2AMXA 5CPMA 5F4SA 3G1AA 3L0GA 3GR8A 4UOQA 1T5AA 3USZA 1DYSA 2PDGA 1V02A 5AECA 2SFPA 5TBOA 3SCRA 1X98A 3PTMA 3O0FA 4QS6A 3L2LA 3TQPA 3N18A 1PJ9A 4LNYA 3E5PA 1M7OA 3OGRA 3EOSA 3TONA 4A3HA 3NQFA 3NYZA 2IXVA 3QY8A 4H9VA 4JTTA 3WQ6A 5D2WA 1G5AA 1IXOA 3IARA 1UWTA 3SJ3A 2AL2A 3FJ6A 2Z26A 3C2VA 3WMSA 1IEWA 3C2RA 5CAKA 3Q65A 1VF8A 1ONXA 3W72A 3UXIA 1QDSA 4K7VA 3HURA 4DF1A 4ZBCA 3WJXA 3TQ0A 1H7RA 3CPUA 1RCOB 1PSCA 1QAPA 4QJ4B 1BXNA 3CH9A 3IIZA 2NUXA 3I10A 2J7CA 3G1RA 1OX6A 1Q7QA 4DY1A 1UZDA 3N3TA 1ME9A 4MNKA 2W79A 1PHQA 1Y7VA 3P7YA 2VI0A 2VNCA 2VRKA 4PTNA 5FJPA 3H54A 3VDBA 3T4WA 1UPPA 3ARTA 3TAKA 2V67A 1V3HA 5HBFA 3NFUA 5JMUA 5XIAA 1VYRA 4AZ6A 2D2OA 1Q6RA 4GY0A 1UHVA 2ZXBA 1UIPA 1SSGA 2VZUA 4HCDA 1DTUA 5FJOA 1HZYA 2V6AA 3URBA 1THFD 1LLZA 4QE4A 2NXIA 2B0MA 2P53A 3ITLA 4Y9OA 1YXCA 3QQWA 1VIWA 3EMCA 1VFHA 1YTDA 2ZA1A 3GR4A 1TELA 1LL4A 4B4HA 3EX4A 1E0VA 1ZTVA 3N6JA 1RD6A 4K68A 3NL3A 5HANA 1LRTA 3HU7A 1X97A 1N55A 1A5CA 1J10A 3UF9A 3AOFA 3APGA 4UOJA 1OB0A 5IRPA 2YJQA 1S2VA 3QSRA 1IWAA 4P8WA 4GJIA 4ZTXA 3P67A 3OIHA 1P7TA 1VPXA 2QT3A 3EWYA 3E3HA 2YDSA 3LMZA 1DWGM 1ZSXA 4RE0A 4XZIA 1SM9A 4MJMA 3CUHA 3QW4B 3MUY1 2BB0A 1D9EA 3HG5A 2VDHA 3R11A 4IICA 4TVUA 1IZKA 3GYEA 4D71A 4S39A 2ZDSA 3NGJA 1SMDA 2FTYA 3U2ZA 4JIEA 3CC1A 1JYNA 3C0LA 3TYAA 2IKIA 3L2IA 2OO0A 3C52A 4W88A 2QJHA 4JCMA 3M44A 3CHDA 5C2XA 2E1WA 3INPA 5I24A 2AKMA 3P2VA 4CVWA 2WHKA 3N13A 4MY1A 1OC7A 5A2BA 4MWAD 1EX1A 3GAYA 3W2JA 4PTMA 1S2UA 3NQ2A 4EOUA 1UKSA 3DBPA 2FGLA 1BKSA 4IL2A 4NRRA 4U3AA 4ZOBA 1E15A 2WPBA 4O17A 4UFKA 4GPNA 5HPOA 9XIMA 4I3GA 1E72M 1JDCA 2X0HA 4HSHA 2RKXA 3W73A 4RW5A 4BI5A 3O7UA 1M9HA 1PDYA 4K8GA 4GD0A 1A5SA 4U5IA 3FJNA 3FSTA 4O16A 5D38A 1EA0A 2HZGA 1KD0A 2X16A 4HIBA 3ERPA 2QCNA 1M5WA 2E5CA 1OYBA 1WZMA 4GNJA 5DQPA 1QO2A 2JF7A 3TYUA 4M3PA 3PBMA 4RCXA 4O4WA 4ERAA 4TQTA 2X42A 2Y8KA 2A3BA 3H23A 4CN4A 5JBDA 4ZR8A 2HROA 1G4SA 1WV2A 1V3LA 3EOLA 1L6SA 2ICSA 2DZSA 3WQ8A 3WFAA 1PKMA 3WL0A 4G6CA 3VNIA 3ELFA 4HNLA 3DYOA 3JR2A 4PC8A 4F3HA 4JPGA 3RMJA 5CC7A 3HV8A 1F8IA 3GZAA 3CHEA 3AXHA 3LHZA 3M0XA 1W1B1 4H4IA 4QCFA 4BWLA 4GI6A 1VCVA 2FHBA 4H8VA 3W0KA 2PDKA 3MSDA 5EB8A 5AC4A 5K4ZA 4TOQA 1JPHA 1CYGA 1P7TB 4ZOCA 3OG2A 1OWQA 1XLGA 5BOFA 3S2LA 1AMYA 5CZSA 1F6YA 2QCDB 1XP3A 3MUXA 3GUGA 2FDSA 1WX0A 3JS3A 1ZBKA 3MDUA 3THCA 4L7ZA 4WXYA 4ONVA 3I3EA 3ECQA 4R27A 2BXZA 3ZYZA 4H01A 3U57A 3PS7A 3CPGA 1B5TA 2GSJA 3CUFA 3GYCA 2EJAA 5I02A 1XFCA 4OECA 1JQXA 4TO8A 1E9LA 5DFAA 3W85A 1P1XA 2C16A 5C9ZA 3UFYA 4Q6JA 2PD5A 4K7YA 1L6YA 2BX7A 3NPWA 2JFEX 2FLIA 1BYCA 4GJ1A 4UTMA 2Q8XA 2ZZ1A 1DJYA 5CZ0A 2CXEA 3PR2A 1RK5A 3WDIA 2W61A 3B40A 3M41A 7TIMA 3KHDA 4C6PA 3DERA 2XUCA 3N2XA 3ZO9A 3NDYA 1AZ2A 3UWEA 2Q6ZA 2XISA 1XIJA 1QOXA 1WO2A 1ODUA 4O10A 5JIPA 1F3XA 4LVGA 5FKYA 2D2JA 1ZY9A 1Q6OA 2V69A 5HNUA 1UZ4A 1AFSA 3U6WA 2DSVA 3CGTA 4F0HA 2ZRVA 5BMXA 4IFOA 2E25A 2J4GA 1I8JA 2WC3A 1Q66A 3SADA 2QUVA 4MHBA 3PZNA 3KRUA 5KINA 3LSBA 3MCMA 1YIXA 3LD5A 4MG4A 1GT8A 4JTRA 4CQ9A 1I45A 3QJAA 3CAWA 3F5LA 4KESA 4A8LA 2FPYA 3LBOA 2ZUUA 2QZRA 3IGXA 1E71M 1W56A 2ACUA 4DZHA 1K8XA 4DBDA 4G9PA 4S1FA 2CHOA 4JTHA 3LXBA 3P84A 1A53A 1OZQA 3DFYA 1CXHA 1GKQA 3W22A 1TO3A 2YLAA 4A2RA 2HJPA 1FOBA 1LRQA 3HG3A 1W6TA 2JKEA 6ALDA 3ITGA 4DNHA 5DN1A 1W1A1 5C70A 3HF3A 5LNWA 1FWFC 1HF6A 2VRJA 4PMUA 1YNYA 2H8XA 3V36A 4KETA 3N1AA 1FWAC 3QZAA 3EA2A 1Z7AA 4JKKA 4M6QA 2CLLA 3F2DA 3VOGA 1PX8A 1A4LA 1R7OA 1RLDA 4A3UA 5MKGA 3QPEA 3AIRA 5IM51 1J96A 1RQBA 3E1F1 1HT6A 4L5ZA 1TTIA 2VZOA 3VNJA 1XH0A 3HMJG 2WWDA 3WCZA 2Z4GA 4AVNA 1UP3A 1PAMA 1S5NA 1NDZA 4QQ3A 3S5YA 3H6OA 4TR9A 1BGAA 4JFUA 5I78A 1J0IA 4ZODA 3C0QA 4LRTA 1XGZA 3PZTA 5CCZA 3VZYA 2DIKA 3PUEA 2QAFA 1L0PA 3V5FA 2PF0A 3BJTA 1UQYA 3BPWA 3RM4A 3USBA 3I3DA 2OYMA 2WCSA 3DG3A 3LTPA 1PWMA 3SCVA 1GJUA 3G1FA 3W26A 1CB2A 5GJMA 3GDMA 4L61A 4L9YA 4UTWC 1J4EA 1K4HA 1MWOA 1ZP3A 1JNEA 2ZA3A 3LGGA 4LYPA 3EMZA 3TJLA 2CHNA 3NZ1A 2W63A 3EX3A 1OFOA 1GOMA 1BTCA 1MEIA 1GJPA 3PZQA 4O13A 4IF2A 1NWUA 2X1UA 3MDWA 3KOXA 3W7QA 4PMQA 2YCEA 3QEZA 4MKSA 1AD4A 1UD5A 4QDPA 2QUTA 1TPUA 3BLFA 3R13A 1D7KA 5E6ZA 1HO1A 5HWNA 2QPSA 2CKSA 2WNQA 4V2XA 4YTSA 4A29A 3UYCA 3TFXA 2EG7A 1TTJA 2GK1A 4UFJA 3RU8X 1V93A 4MB1A 1RLCL 3OHMB 4E8DA 4ICCX 5I79A 4N6EA 3N15A 3UWQA 4DJDC 5TD4A 4AYGA 5D30A 4ZFMA 4GZ7A 4JXCA 4XBSA 1J5SA 3FHAA 3K1DA 4GVGA 3UG8A 3GXMA 4WF7A 4Q4PA 4LNCA 4R5EA 4MPKA 3OGVA 3UZJA 1BAGA 2WMIA 4LC8A 2C0HA 2X2GA 3NSMA 3VGHA 4DWSA 3KOZA 4GQ0A 1H0GA 1BD0A 3O6YX 3FA4A 4M1RA 1SJCA 1JUEA 3W6MA 4DO4A 3NQ7A 5FL1A 2PDIA 3N6QA 3VIHA 3GD6A 3AUJA 2ZA2A 3L5AA 2HSAA 1G7VA 5IHSA 1EGVA 4LYKA 3P8JA 4FZIA 2DVXA 1HO4A 4C1NA 4K36A 4YCPA 5D2XA 3LOTA 1AODA 3T81A 2J7BA 1WKDA 1Q2RA 3W7MA 2C13A 2PLMA 5ABFA 2DDXA 4MNMA 3RFAA 2DQXA 3H55A 2YA2A 4TX8A 3AFBA 3H4XA 4L65A 2NLYA 3WEOA 2XVPA 1V8EA 2P88A 2YZRA 4Q8NA 1JULA 1QCWA 4PODA 3CTLA 4ZE5A 4EP8C 4PMDA 4DZAA 3VIFA 3LQLA 1OGGA 1AG1O 3G1SA 3HG4A 4FLRA 4AZGA 4QR6A 4GGHA 3UZWA 1D7FA 1Q6CA 2PDHA 1HTIA 2NWSA 4O53A 5AKQA 2VCCA 1M53A 3VE7A 3FAXA 2XH2A 3H21A 3RUBL 4JTKA 1JYWA 4IGMA 5FSDC 1RPKA 1O66A 1FWDC 4Z0SA 1LQ0A 4Y8FA 3RK8A 1ZL1A 5A95A 4LVAA 4DXVA 2PD9A 4NQ1A 1TPH1 4O18A 2OODA 4A21A 4ZXLA 3RGTA 3W1PA 4ML4A 4PTWA 3QKEA 2MANA 4ZVJA 3CZGA 4EXQA 1TA3A 2VR5A 3KOYA 5GJPA 5FF3A 2G5WA 4DO5A 2WCGA 3S6TA 1FWHC 4E4PA 3TVAA 4WY0B 1L6WA 1B57A 2PCQA 2PBGA 4A2SA 3B9AA 3CLMA 1O6IA 2QCHA 3M6DA 3B0UX 4C1LA 1EJVC 1TVLA 1QFEA 5JVLA 2CIPA 2EPMX 1NF0A 3DFHA 1IR2A 2Y5JA 3BGAA 1CI1A 4HU3A 3ITYA 3VGBA 3AHVA 4Q8PA 4L4LA 3AUOA 4H7ZA 1Q7ZA 2CZVA 3W1TA 2B4GA 4DUWA 5U7SA 1F4HA 4P00B 2D0HA 1E6SM 1V0MA 2WMIB 5M03A 4BQ2A 1LDCA 4DWSB 4XIMA 3LI0A 3IGUA 1M7XA 3N4FA 4R9XA 5HR6A 2ZZ4A 1QI4A 1E43A 2AMGA 5LIUX 4I5XA 3LTYA 4H8NA 4MM1A 1OM0A 4C1NB 1A0EA 1XH1A 4MB4A 5DRIA 2OZ0A 2DGAA 1F61A 5IFPA 1OVDA 1RK6A 1MVYA 1DJXA 3C5QA 2R24A 3QXBA 5D9OA 1A47A 1NQKA 1EO7A 3BG9A 1LG1A 5DCDA 1HVXA 1QOQA 3M64A 3AHXA 5CXPA 5LIYX 1M01A 3OVQA 2PP0A 2WMJA 1J9YA 3RHGA 3QY6A 1VR6A 2PGRA 2BHZA 2F61A 2ZE0A 2YL9A 4HTYA 3HG2A 3NCOA 1E3XA 3QMTA 3QQ1A 1PTAA 1O4UA 3WEZA 3UCDA 2PDFA 4FP1A 4QG9A 2W9MA 2OX4A 1EDGA 1HN1A 1OFAA 1GZJA 1WNOA 2R94A 3GE7A 3QOMA 1B4EA 4D6FA 3AIBA 2VXNA 3T7VA 4PCTA 4HOWA 4PMNA 3SUVA 1UH2A 2FJKA 1TE1A 2FPTA 2OKOA 4XTIA 3LYEA 2GVYA 5CZKA 1DKWA 4Q8OA 4Q3MA 3NQBA 3RJXA 4KIEA 3DHUA 5G1YA 4EPDC 1NAL1 4H19A 4XD6A 3AJ7A 2V2HA 4GIAA 5GQBA 5T26A 4R88A 1FRBA 1H7PA 3W2MA 1KM0A 2BXYA 3V75A 3W76A 4RE4A 4LV9A 1ZBCA 3THAA 5I23A 3W27A 1OEPA 2V5LA 1XLBA 3L4VA 3CTTA 4ADUA 2OQYA 3VMOA 3B8DA 4V28A 4CNPA 3AS1A 4GC3A 3LXAA 5FAJA 5FEPA 4MZYA 3DFSA 1NJJA 2PURA 4HNUA 3FYOA 1DXFA 3LRKA 2XIQA 1UCWA 1E5NA 1GONA 1CWYA 2UY5A 2AAMA 2QIIA 1EJUC 4H6RA 3ARYA 5KSWA 4KFOA 3QPZA 4NJIA 2OPJA 2EAWA 1ZCOA 3R89A 3EWUA 6REQA 1QATA 4D72A 4H7VA 3KX6A 1WZLA 1F8MA 4FNRA 4QM1A 1E55A 1HFBA 1I1XA 3W37A 4XZNX 4D8ZA 4JTDA 4EPEC 2VM8A 3EOEA 2XH7A 3T08A 2C8NA 4MTVA 3BG3A 2V2CA 4NIRA 3B4YA 2ISVA 2OLAA 1KBBA 1TWZA 1HQTA 1PPIA 3N9KA 5T9CE 2DZVA 4ICNA 2L5HA 4AIUA 3E0WA 2YL8A 3TN3A 4I5UA 1B0IA 5CAHA 2G4FA 1KWKA 3CXOA 3LG3A 1EGMA 3M0IA 1M7JA 4CD6A 1BVWA 4AIOA 1F4AA 1LJYA 3IIVA 2Z1VA 4OV9A 4JKLA 1P6CA 1P6BA 5SWUA 3B8UA 3RPDA 4Q8WA 3D3AA 3ANUA 3MMDA 4JX5A 4X0VA 1ZBWA 1TIMA 1BVZA 1MDLA 2QW5A 2E40A 2BGNE 3TEVA 1CDGA 4U2YA 4JTGA 2WMHA 1TCDA 2CLIA 2ZQ0A 3BVJA 5CPLA 4XZ9A 1AJZA 2HEJA 3UXAA 3WK3A 3RCMA 3FV9A 1ZAJA 4XD5A 4GBUA 4CD8A 4XKMA 1EOMA 3M16A 2J75A 1AQ0A 4LH8A 5DY3A 1NP2A 4DF2A 3CH0A 2QJMA 3SCTA 3OOQA 2E77A 4F40A 4PSRA 1EJ7L 4B5UA 4XBJA 2NV9A 4LCRA 3LLDA 3E2VA 3LDVA 4OKDA 2VCBA 3GDRA 3MUCA 2ODOA 1CGWA 4MPQA 1A0DA 4Q8TA 4CEUC 4LCQA 4JTLA 2E6FA 2WJFA 5C71A 1LP6A 2DSKA 2H8ZA 4GMEA 3VGFA 4AHOA 1JPDX 1DORA 1GHSA 1P4CA 1XRSA 2VEFA 1XSKA 2VURA 3T40A 4E2DA 3F03K 1KC7A 2XGBA 1KGWA 1JPIA 3WFLA 1PHWA 5REQB 4EX4A 1Q6DA 1UWUA 3W1AA 4QJ1A 4JFTA 4H1ZA 1AH4A 2FFIA 2XGIA 1T41A 5LSMA 4D6EA 6REQB 3NQAA 5HULA 1R2RA 2VGFA 3GAKA 2E0PA 1FA2A 2WLYA 1P5BA 4YYFA 3EKZA 3ZWTA 4Q4SA 3OHIA 2ZUMA 3KRZA 2I56A 4KGJA 1QHZA 2FYMA 1YXYA 1VBJA 4LB3A 3NM3A 4HSOA 5E6YA 1E0UA 4FLOA 5H8UA 3VUSA 1QNRA 2R1NA 4JD4A 4F4RA 2YKKA 1GW9A 3NZGA 3DI1A 5A6LA 4FPSA 1R85A 3CEPA 1A5UA 3QFEA 3EX2A 5EL1A 4JQ4A 4DBSA 2C79A 3RLUA 2HPMA 3ZJ6A 2OEMA 1JUBA 3W7KA 1UR9A 5LNVA 1DL3A 1DJZA 1GKPA 3ENLA 3VCCA 4Q7BA 1KB3A 1KKOA 4YCOA 3GG0A 3CZLA 3A47A 1G4EA 3ZVHB 1XSIA 3STEA 5CPQA 5BROA 3FVDA 3ITOA 3LPPA 3TAOA 4GCAA 2V63A 1IEIA 3IIXA 5HNRA 4LQ1A 4HN4A 2GWGA 2V5CA 2OZTA 3ARPA 1PWLA 3OGSA 2QLYA 2OVLA 5DMYA 4NF7A 2OOFA 2C14A 4B91A 1O95A 2PGFA 3DOPA 1PKNA 1JZ3A 3KBMA 1Q6EA 1RXOB 4UMCA 3UR5A 2GQAA 3WF0A 4Q4RA 3CV6A 4WOQA 3DFNA 3G1XA 3F2CA 4U4MA 1FKWA 3GO2A 5H2ZA 3LUTA 2VELA 2ZKMX 5G2WA 1R9YA 3ARSA 1FHUA 3LM3A 4U10A 4B2DD 1GVOA 3SCSA 3IGSA 4OVXA 2E6YA 2X30A 4ML9A 5M17A 2YDRA 1JI2A 2WMGA 4D6IA 3R12A 1UR1A 2BVWA 4DWSD 1VCGA 3ZXWA 3MVTA 3B8VA 4LAKA 2B81A 3A22A 3V0UA 3WK1A 5FJUA 2GOKA 3N11A 2MUCA 3E0FA 4IJCA 4MWAE 4OHQA 3O8AA 1XIIA 1MYRA 4AY1A 5DY2A 3GNDA 1UWSA 2ZZ2A 1PIIA 5FAGA 3I7SA 3TNOA 1SMAA 1UMYA 4NZJA 1VEMA 3O6CA 2ZICA 4K1WA 1UOKA 5A8NA 4E8GA 2PDJA 3BLPX 4B5XA 3LHWA 1QNVA 3VKCA 3K2GA 4AC1X 2YCKX 3T0BA 3J7HA 3GXPA 2P3EA 4OBRA 3OLEA 2UWFA 4NNCA 3S3GA 4KBXA 3CIVA 1Q63A 1IF2A 1OFRA 1VB9A 1XISA 4C6EA 4RUBA 3ZLHA 2VR4A 3VAVA 1SW0A