1SMAA

Crystal structure of a maltogenic amylase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
588
structure length
588
Chain Sequence
MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALTOGENIC AMYLASE
publication title Crystal structure of a maltogenic amylase provides insights into a catalytic versatility.
pubmed doi rcsb
molecule tags Hydrolase
total genus 156
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1smaA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1smaA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1smaA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1smaA03
2F53A 4MDOA 1WJ3A 3W6LA 4YGVA 1TFHA 1INDH 4L3EE 4DFHA 1IC7L 2B2XH 5TF1H 5I0ZA 1WITA 3MMEA 4WSJA 1H5VA 2HTKC 5EU6D 5HPOA 3DETC 1EAJA 1BOGB 1QLRB 1XGTB 5D7LA 4BK5A 4AD5A 3QJFB 1INDL 2DN7A 2JFEX 1E4XH 1I9IH 4WTWA 5EU6B 2X9YA 3OLIA 3IU3A 4NBZB 1UM4H 4HFWA 2H3NA 5E2UH 2J2ZA 4FQLL 1WK0A 2JF6A 2B0SH 3OX8A 1CE6B 1I9IL 4G6FD 4R7NA 2J47A 4KGLA 3OKOA 5E2UL 3G5VA 4MDIA 3VD9A 1WFOA 5ICZA 3MGOA 2CERA 1XCTB 2B0SL 1RZ7H 4ZYKB 4U6XA 4YPGB 4G6FB 5E7BA 5DFVC 4HKZA 4YJZL 1BPLB 1HL8A 1OB1B 1L9MA 3T08A 1U42A 2AJUH 5HY9B 1A6PA 2IH3B 5CIPH 3VGFA 1X5YA 1T7VA 4P2QD 2W0PA 3S6CA 1HWGB 2E9IA 4WV1A 1LEIB 3HE7B 3LN9A 5FO8B 4U3AA 1MFNA 4LAQH 2ENSA 1WT5C 2ZNXA 4LVHB 3P73B 4P2QB 4TUJA 5IW6A 1HKJA 2DIEA 5IBUG 2Q76B 5IJKA 2MHAB 2YZ8A 5DJXA 2BNRD 2E6PA 2JLLA 1YN7B 2AQ1A 2CYGA 5IB2A 4LCIL 4ZO9A 1FVEB 5D7JB 4W7VA 5KVGH 3IJHB 1M05A 2VXQH 4URTB 4JN2A 3V6FB 2BNRB 5CJQL 4HEPG 3F12A 3S5LB 5A16A 5I71C 3VD4A 1BGGA 2G3IA 1F42A 3AS2A 2ITCA 3DUSA 3RWHB 1N8ZB 2R0LL 1QW9A 3BX7C 1BYDA 3LXAA 3WSUA 2V5SA 1P1ZA 5CEXA 4MNQE 4M8QB 5H2BB 2V2XA 3GDBA 3VFOB 2X2IA 1EBPA 4I5BA 5FYJU 4RZCB 4UQ3A 3F7PC 2AJSH 1T1WB 4WRLA 1UM5H 4JKWA 1JBJA 4X83A 4IRSD 1MXDA 1SEQL 5I15H 2K3TA 3CSBA 4MX7B 4KHTH 2Q7NA 2NTFA 3H9SE 1P7KA 1NFDA 3NN8A 4X7TA 4Y89A 1I9JH 2XG9A 2AJSL 4IRSB 1UM5L 4HBQA 3LEYH 4YXLH 2HT4D 5I15L 2FJHB 3GSXB 3DSFH 1QLEL 1ZXQA 1DVFB 4WW1B 3AHYA 4AZIA 3MJ6A 4TVDA 1AC0A 4YXLL 2A0LC 2CIIA 4E8DA 4M8VA 5ICYA 5H35B 1XHGA 2FWOB 2X1WL 3DSFL 4Y5VB 1W3HA 3AHVA 3PZNA 1DSFH 5A8PA 1US3A 4E0RB 1KLUB 1UJ3C 4Z95L 3NCJH 3WEXB 3OGRA 2QADB 2H45A 4XBPB 4NO5A 3ZTJH 5D7KD 1JDCA 1C3FA 5D2LA 3EDJA 3I02B 5FF6A 3BPNB 3VSUA 1F6AA 2ZICA 3O9WD 3WF1A 1GC1H 4KY1H 1QP1A 1CFSB 1TVBA 4WFED 4BSWB 3EJUA 4UB0H 1OTSD 5JNYB 5L2KD 1NMAH 4ONOA 5SWSA 5F7EH 3TZVC 3O9WB 3BKMH 3UTSE 1GC1L 4HLJA 2ZSVA 1A6VL 4KY1L 5MHSE 3EBVA 3BUTA 2EECA 4PJIB 1G9NC 5L2KB 8CGTA 4DKEH 1UH2A 4F15C 3EDEA 4UB0L 1V7MH 1II4E 2V3GA 1NMAL 4WHYG 4JY5L 5F7EL 5IR1A 2B1HH 3MX0A 2NY6D 3DXAE 4FQHB 4L9LC 1OQOA 3BKML 1OD8A 4Y2DD 3DVNA 1TMCB 1P4BH 3WH8A 2PO6C 4GBXD 1V7ML 1CDIA 3W81A 1J9YA 2B1HL 4MD5A 4S11A 1AO7E 1GOIA 3SE4A 2M1KA 3TYGL 4Y2DB 3FQRB 1N5AA 1QW8A 4RMSA 1P4BL 2LAAA 4FQIH 3SGEH 1XF4A 2DJSA 1E28B 2RHEA 4LLQB 4QHNB 2AXGA 4MSWA 5DI8A 2P48B 1N64H 3LVEA 1WAAF 4HC1H 4BQCA 3QFDB 5E6IB 1MEXL 2J7HA 3VGGA 1QTYT 1QRNB 5LKNA 1FCGA 3BZ4B 2HJKB 3QCVH 4NFDA 4FQIL 4PRHA 2X4TA 4AL8L 5FKYA 3GNOA 2ZSWB 1D5XB 1N64L 3EDKA 4HC1L 4PJCE 5DO2D 2BERA 1JDDA 2WW8A 1IMHC 3O6AA 3IDUA 4Z7UE 4WJ5A 5FO9B 3CH9A 5HYQA 1QFWL 3MRGB 1OAKH 4XVUC 5EBWA 2GSIA 1KTDB 3X3FH 4JQXA 2CLRA 3MV8E 3OB0K 4PGJA 4BFIA 4X80L 3MV8A 4I0CC 2ADJB 3FZUC 1T5XB 3MJ8B 2QV2A 1FVCB 4L3CA 4MCYB 1WZMA 3IAPA 1EO8H 1OAKL 1A1NA 2EACA 1OGTA 3X3FL 5KSUB 4APQC 3AXHA 1ONQA 1UD4A 2AJZA 3U4EB 3W0WD 2QHRL 1QSFB 2W91A 4R26H 1PBGA 1I1WA 3LS4H 1TJIH 4NQVA 5JW3H 5DHVH 3NIDE 1EO8L 1S9WA 4L4VA 3BGFC 4MMXC 5C8JA 3W0WB 1K8IB 3CFCH 2MCG1 5BVPH 2FJGB 2GCYB 1AXSB 1MNUL 4BSJA 4LYQA 3EYUL 5E09A 5D8WA 2EABA 3WDIA 3VFWB 4PYHA 5JW3L 2G5BB 4NKMB 5FXCH 4DGYH 2V7HB 2QF8A 1MXGA 2G9HA 2YIHA 1JNJA 1CFNB 3LMYA 5BVPL 1RP8A 3FB7B 3MV7D 3H0TA 2FH6A 3QEGL 3VD3A 5AZEL 5I18H 4K8RH 5AG8A 4DGYL 4PGCB 2XKSA 4R0LA 4NM8L 4F9LA 5J89A 3I6LE 1CI5A 3OZPA 4AW7A 4MPKA 1T0MA 3FRPG 3IFOB 2VI0A 4CD7A 2ADGB 1F6LL 3FTGA 4RGOH 3UTTE 3WFCH 1BQUA 4NBYB 1MW2A 1B30A 1ISYA 4PJBB 4AEHH 1VBRA 1U58A 3J8F7 1JRHI 3J7HA 4XAWL 3TIDA 1B0GA 3WMBA 4U6HA 3IJYB 4POZD 4UT7H 3WFCL 3T3MF 3HCVB 4UQ9A 1PQZA 4MJ5A 2OL3H 4NZTH 4Z76A 1LL4A 1NAKL 1FAKT 1A2YA 4M1DH 5E70A 5FUCE 4IS6B 3GUTB 3II1A 5ILTH 1E73M 1ISZA 4N0RA 4UT7L 3ZE1E 3PQYA 4F8QA 4PLKC 5C0EB 5EFIB 2OL3L 4JAMA 1NCAH 3LKNA 3A5VA 1RPKA 1J1XL 3L3HA 3O41B 4M1DL 4UNTA 5DTFA 5ILTL 4JKLA 3AYRA 2G8ZA 4LASL 3SE3C 1XC6A 3CX5J 4AG4L 1FC1A 3KXFD 3PP4H 4N8VG 2OTUB 2FCBA 3X3GH 4QRTB 2Y5TB 3BIAX 1NGXB 3ZKMD 4AMKH 4UIKH 3AXIA 3WIJA 4HIEB 1OT1A 1JAEA 3KXFB 4QRPA 3OR6B 3BKJH 4AT6A 1T04B 2EYTB 1ZS2A 5F93C 4ZXOA 2W66A 3PP4L 4Y88A 4XWOD 1IKFH 5DT1H 3X3GL 1N0XH 4UIKL 3CHCA 5J12B 4MHHG 1YUHA 4JVUA 2DLFH 4L8DB 3S7GA 1RK1A 1JWSB 5DJYA 4GQRA 1GAFH 5JIHA 1INQA 5DT1L 3MUY1 4Q9BA 5IW1B 1KXVC 3ARED 4LLMB 3D25B 1K9TA 1OGBA 4XPGH 2F19H 4D9LH 1AGFA 2VABA 3TNNA 3CX2A 5EUOF 4QXWA 3RIFK 3AREB 2I5YH 2OI9B 4EBQH 12E8L 3MUHL 2NY4B 4F33B 3SKJH 3JVGC 4N0FB 4NQEE 3QP3A 1QI0A 1MAJA 1NOUA 1P84J 4Y4KD 4FNUA 1MCHA 2F19L 3RL2B 4X99A 3DUUB 3MQIA 1U92B 5D72H 1X4ZA 1Q6FA 1UFUA 4EBQL 3ARXA 3LY6A 1RI8A 1SJHA 2VDOH 2PTUA 3BH9B 5DMGD 3L1OH 4HAFA 4QRSB 4XXDA 2V5MA 1YPZE 2TAAA 1M04A 1H0IA 1YMHB 1UWIA 4KVNH 3KPOB 4UFKA 3BIKB 3V6OE 1JNDA 3MR9A 1ITXA 3VXQA 5DYOB 1AP2B 3ECBB 4I0PA 4X6CF 3SKNA 2J4WL 5E2JA 3SDDD 5C9JA 1AQDA 2HJLA 1QEWB 1XF3A 1A7BA 2XY1A 2RGSA 4ZO7A 1Q1JH 4EKJA 4LIQH 4G6AC 3N85H 4JFXA 2HT2D 3SDDB 1DWGM 3ROOA 4AZ6A 2HT3C 4N8CH 4RMTA 5TF0A 4KKBD 4Y4FB 1FCCA 3FOLA 2R1YA 2I27N 4Y19A 5KBNC 4JAWA 1Q1JL 3QULB 3ILPB 1FO0L 3N85L 1QA9B 3U0WL 4W87A 4Y1AA 1O0VA 4H20H 4N8CL 1SEBA 4HIHB 5K9QG 3NIYA 5A8MA 1NGYA 3B8SA 2J7DA 3MCLL 1UJTA 5J6HA 2CXKA 4DAGL 2XN1A 5JA9A 3H3PL 1XR8B 3NCYP 4OI9A 1FP9A 4CCDA 2A3HA 3FT3A 5L0QC 1X5GA 4PJAF 4D9RE 1E4KC 2HFTA 3W29A 2OP4L 3V0VA 4NGHH 5T3XE 3SOBL 3FONA 4LNVA 5BW7C 2NT1A 1NDGB 2P44B 3MRFA 3WBAA 2V17H 2H8PB 1FYTA 4D6EA 3I75B 3K74B 5HYSA 3ZDZF 2WCSA 5D7SH 1BZ9A 5I5RA 4OQTA 3KPLB 3KPQA 2NY5H 1WZLA 4PGDA 3VG0H 3VX0A 3RDTC 3CO4A 4HHAA 3HG5A 3DI2B 3L3JA 5HJ3B 4MAYC 4ENEC 2WMHA 4RFOL 2QBWA 2BNUA 3VG0L 3VFNB 1RZJH 5EUKB 3FQTA 1PVHA 1YDPB 1CZ8H 1MCNA 3E6FB 5GGTH 3QHMA 4E42B 4P7NA 3WE6B 3QFJD 3IDIA 1ESWA 2A6JA 3MFFA 3GSWA 5HGHA 5F7DB 1MQPA 2CSPA 1UQSB 4YXHH 1CZ8L 5IMKA 2YD7A 3GJFH 3QFJB 4URIA 3BLKA 1E27A 3BP4B 3RWEB 5I76B 3IDNA 5IEKA 5I1EH 4OV6F 4KK9D 1FV1B 1RZGB 3G9VA 2KKQA 4IDJH 5AUMA 1FNGB 1X5KA 2HMIC 4J27A 2C3HA 1J18A 3N06B 4GKSA 1QSVA 1JGIA 3LKQB 4LCWD 5E9DA 2FIRT 3CC5B 4IDJL 5HHPB 3DX7A 3FRUB 2G4FA 1KXHA 4LCWB 3L4YA 1JNLH 3MBED 1FNLA 3U82B 4ZFOA 4WI3A 4UUJA 1D6EB 1V0MA 1T3FA 1GZPA 5TDNB 1F4XH 5FGBA 5JHDA 4MD0B 3SUVA 3QIWA 3NMEA 1U95A 3INUL 1JNLL 1FYHB 2YD8A 4R4FH 1UQYA 5CZVH 1SYTA 1PKOA 1ZVHA 3LD8C 4JANB 1PG7W 3MA7A 2DRUA 1YNTA 5ITFA 1F4XL 3C8KA 4P9HC 4W93A 3RY5A 3ZKND 3OR7A 5EU6E 2E8YA 3QO1A 3FNDA 3MLRH 4A2MA 4E2OA 1AFVL 1BEYL 2DQJH 3KLHC 2PNDA 1RVFH 4J1UB 4X4XA 4GRWF 4BQ4A 5E8EB 7TAAA 3G5XA 4S3JA 3HPLA 4Q9QH 1JI1A 3TJEH 1A64A 2ESVD 3MLRL 1I1XA 3C6LC 3QUYC 1HSAA 3WHE1 1RVFL 4YDLB 4LCCA 1Q9OB 5KW9H 2CLVA 2CO6B 1HKLH 1MCPH 4HLZH 4U1IB 3TJEL 4Y5XB 1AGDA 3VVGA 3ARBD 1JPFB 5KW9L 5ACLA 2EDLA 1I7RB 3TO4C 1MCPL 4UI2A 2C3XA 4LRNL 4RL3A 3ROLA 5EORH 32C2A 3ARBB 3KR3H 3RWJB 1RZFL 4HS6B 4P2QE 5C08D 1IILE 4D2NA 1E5JA 4JPWH 4D6FA 4X6EB 1KENL 3M07A 4QNPF 3G9AB 3NCFB 4F7TB 1GH7A 4ODWA 5C08B 4ONFH 4OD2A 3KG5A 3AISA 3EYOA 4JPWL 3UG3A 1DBMH 2EXYD 5JPMB 2XQYK 3CPLB 3GFUA 1EEZA 2BNRE 2OM5A 4JPVH 3GSQA 4LLWB 4XNXL 1IRAY 2NZ9D 1P7QB 2MSPA 3GM8A 4YBLC 2R0ZH 1DP0A 3Q6GH 1NMBL 4JFEA 4N90D 3ZHKA 3HG1D 3ARSA 1NJ9B 4OCYL 3WO3B 4JPVL 2NW2A 3VJ6A 1CS6A 2XWTA 1D9KD 3OJ2C 3A6BH 4S2SA 1FL6A 5EBLB 3D3AA 3W53A 2OR7A 4QCIA 5JXED 2WW5A 2R0ZL 3HG1B 3Q6GL 1UYWH 2CRYA 3ZSSA 4EOWH 3ZE0E 1D9KB 4P8VA 3CXDH 4HDIB 1NGZB 3A6BL 3SKUD 3BLBA 1KB5H 4AYSA 4NT6B 5J3HD 4DZ8B 1TTGA 4NKDB 1UYWL 2ZNWA 4P3DA 2OCFD 3FQNB 4EOWL 1LE5B 2XQBL 5L88H 4PB9L 3WJLA 3WHE0 3KPSD 3OG6B 2AMGA 4IPNB 1CQYA 3CXDL 2CPCA 1NWSA 4JM2B 3RJXA 3FFDB 1S7RA 5DFWH 4PGBA 1HJQA 3KPSB 1E43A 3L5XH 1CFQA 1H3VA 1WPCA 3EBAA 4LQ1A 2QQKH 1W1TA 3VGDA 1MAMH 1CFBA 5C0IA 2C4FT 5CPQA 3L3KA 4RQQB 1JZ2A 3SEPA 3PZ9A 1A1OB 5BRPA 1UVQB 3U57A 2QQKL 5IHUH 5KSBB 1MCJA 1NAMB 3T0EB 2GTWA 3H7BB 5D9NA 4NRRA 5F7FA 1J0KA 5D7KE 3X14A 5AEAA 5INDA 2JIXB 3W38A 1H3GA 5C0CD 3DX4A 1BYCA 3ES6A 2WWMC 4FS0A 1CTNA 5D8JH 4WFEE 4HXBL 4PJIE 5L2KE 3BDYH 1H5BC 5E4EB 3ARRA 1YY8B 5C0CB 5CINH 3THML 4NZDA 4JL2A 2BOBA 3NPSB 2OYKA 3UESA 4D72A 2P5ED 2ZX8A 1O6IA 5DURD 3TVMD 2PBOA 5ESQA 4HK3J 1HILA 4YO0B 5GGRY 2O5YL 3LEVH 4HIXL 1F02I 2CBVA 4M6AA 2P5EB 5CINL 4XRCB 4GW5B 2B31A 5A6MA 5ALBL 3SGKA 5DURB 3TVMB 4P23D 3SJVA 4HMDA 2CXGA 1W2VA 3VFMB 4HJJH 1HINH 4GBXA 3RWGB 2CQVA 3LEVL 3T8XA 3V95A 3PGCA 4MJID 1OOAA 1D2KA 1QRNE 1ZJBA 4P23B 3NDYA 3WJJC 2VQTA 4KJQD 1J05B 2GSGB 4ZEPA 3GJEA 1F13A 4PJ8C 2Y36L 3VXSA 5L9DH 1BSIA 1FL3B 1QPXA 2XICA 4JRXD 4A4AA 4G42A 1CEOA 4WI6A 2QR0B 5FGSA 2HTKD 1FFQA 4ZOAA 4KZEL 5L9DL 3DETD 1WVZA 5I17B 4JRXB 2WKLA 4QT5A 4NKQB 5IDIA 1FNSH 3SO3C 2XN9B 5FOOA 2DL9A 2FYYB 3VX1A 1GJWA 4EDWH 3WKMH 4J12A 1UXWB 1S9KC 2YBTA 4PMDA 5TDOB 3TP4A 1UQZA 3DECA 3L95A 4AZ7A 5T5NF 1U41A 2DT3A 2XG4A 5KVFH 2X2HA 1L0QA 4EDWL 4K68A 1UWXH 4KHXH 4U1SB 4ZUSA 3VIKA 5A94A 3W0WE 1CL7I 3TNMB 2ATPA 1XGQA 2IAMC 1EDQA 5DFVD 5A8NA 4R4BA 5DMIH 5KVFL 1F6FB 4KHXL 1FE8L 2P8LA 3WELA 3EOTH 3RY6C 4M6NH 3T77A 1ULVA 2X5PA 4YHNB 3ESUF 1A02N 2EC9T 3PL6C 2CGRL 5M03A 1UGNA 3AM8A 5F9AC 2NNAA 4W8AA 1A0QH 5FYKH 2DGAA 2BVOA 4H0HB 4M6NL 3MV7A 5GGSA 4FNPA 3MLVL 3IFLL 4FQXC 2IG2H 1BAGA 1WBXB 4W4OA 5CIPA 1VEPA 3KYNA 2J7BA 1U36A 5CUSL 5A6BD 1U8QA 5FYJL 5DMKB 1A0QL 3KPNA 1WZ1H 4PJBE 4J3SA 5I1CH 1B0IA 4JFQA 3JV0A 1N5YH 3MNWA 1TXKA 5EO9A 1KPVA 3ZM8A 3IGAB 3FAWA 4K7PH 4RFEB 3RBSA 5FA4A 2PYFB 1W72L 1WZ1L 1LO3H 1RUKL 1VFAA 4TUOB 5IQ9A 4PJGB 5IFTA 1PYWA 3AY4C 1ETZA 4GRLC 5T5FH 5I71B 4N42A 1N5YL 1CXEA 3KPPB 3D69A 4JG1H 3PP3H 3GSOB 2F8OA 1LO3L 1CGTA 5H37H 4U0RB 3KL5A 4PRAB 1ZK9A 3V7AE 3W6MA 5T5FL 4G6KH 5LBSH 4ALAH 4PRDB 5HDRA 3TTYA 4JGUA 4YQXH 4PMYA 1W3KA 3WUWA 4UINL 3P9WB 1PKQB 2FH8A 2VISB 4JHAH 1TCMA 2AV7B 1S7SA 2NW0A 1A7PH 3NA4A 2X8RA 4G6KL 3BN9C 4Q0XH 3RM9A 1A14L 5TQ0H 4YQXL 1WBYA 5GGUB 1HL9A 2EH8H 4IIQC 4BQ3A 4NRYA 2CDFA 2ZPKH 4DK6A 4JHAL 2ZOKA 5FM4A 1N26A 1NCCL 4OCWH 3T1WA 3KXFE 2GJXA 1A7PL 1CENA 3MOBL 3HPJA 4M6MH 1TLKA 4CBPA 2DLEA 4JDZB 1NC2B 5HYSG 2A0LD 2OZ4H 1SYVB 1L7IL 7FABH 1UYQA 2ZPKL 1QSEB 1QFUL 3VIMA 3VIIA 4J23A 1OWQA 4MNMA 4M6ML 3H3BC 4U1NA 4Z2IA 4IMKC 2IANB 7FABL 3SDXA 3GSNL 5CEZH 3OXRA 1LWHA 4M4PA 2EEDA 3S37H 5KG9B 4L8SC 4TPRH 3B6SA 4XX1G 4OKVB 4TOYL 1HIZA 5FV2A 1KIQA 1KLGA 3TZVD 5B3JF 1HCFX 1I3UA 1JWUA 1ZVSB 1FH5H 1T2QL 1X44A 2E9BA 5CEZL 3CC1A 3WENA 3CLEH 1W9BM 4K3GA 4OZGB 1EEUA 1JPGB 4LARL 4OLEA 2AK1H 3GHEL 2QKIB 1FH5L 3GHBH 3VU2A 4Y4KA 3MUZ1 4UOJA 3Q48A 3OLDA 4G7VH 2PO6D 4GKNA 4ZTOH 1WWWX 4FQJH 4L9LB 3SCMC 4L8CB 1MHHB 3OHXA 4LMQE 5FM8A 5FKPA 2AK1L 5J1AB 2D0FA 3QDGD 2PO6B 3K1DA 1NCTA 4Q58C 5ELIA 3I84A 4FQ2H 4PN2A 4ZTOL 4QRQA 1NSNL 3FFCA 4DOHB 2FSEA 4QCEA 3QDGB 5F1KC 1D5IH 3RUGE 3RUGA 1KWGA 3OAUL 4NRZA 5HGBB 4QP0A 4MB5A 2I07A 3N12A 3U36B 3S4SB 2YA1A 1CK0L 4PTTA 1UR0A 1YECH 4M7KH 4HC1A 3MYJB 3MUAA 1P4LA 5EZOL 1EJ6A 2C26A 4PUBH 3GSRB 5A3IC 1CLYH 2EEBA 3FZUD 4QOKA 1EZVX 1KB9K 1S7VB 1A3HA 1YECL 3MOAH 4F79A 1JNEA 1QBBA 4EUPB 5BO1L 3CK0H 4APQD 5I23A 3MV9D 4ERSL 1WNOA 3KS0J 4P7QA 5DHXB 4HULB 4ODUA 2ATKB 1MOEA 3G6DH 1NMCB 3EOBA 4OZHF 3MV9B 3TN0C 4OUUB 2BCKA 4MNHB 4QLKA 1C08B 3QHZH 1RJYB 1CICA 5EFDA 1P6AB 3G6DL 3T65B 3BGFB 4JLRA 4F7MA 2A6DA 3MRLB 1K9FA 3E2HB 5EH1A 4H04A 4ONHB 1EEQA 4MAUH 4QTHA 5DHVA 4M81A 4U7MA 3QHZL 4AH2A 1OINA 5HGGS 3QHNA 4FLQA 4JY6A 4HZ8A 1FRGH 4DKDC 2EIEA 2J25A 1UR8A 4Y7EA 3DROA 5FYJD 1JK8B 1IEAA 4H1LB 1KN4H 2NLJB 3ARFC 1LK2B 2Q8AL 2BMKA 2V3DA 1FRGL 2WKGA 1WEJL 3T0BA 2EJ1A 2F7RA 2FR4A 4X6BB 3FQXB 3S5LG 1XF2B 1QI3A 1JV5A 4HKXB 4P46A 1KN4L 1XGRA 4HUWA 1W1VA 1GVIA 1XGYL 1ZHKA 4UAOC 1EQCA 3QFJE 4ACYA 2CIPA 5CSYA 3AC0A 3BMWA 3X11B 2D24A 5ICXA 4LCYB 1OP5K 4OF0A 5C0AD 2B8OT 1UH3A 3M8OH 2AEIT 4GW1B 5GRZA 1K8DB 4OV5A 4PLKD 2ZIDA 3SQOL 3KYMB 4B15A 2WINA 3LPOA 1BVLA 2XA8L 4H88H 3VXOA 2OL3A 3CDGB 1G0DA 1XMWA 3OKNB 3G6LA 1OCWH 5DK2B 4UOQA 3A3HA 4FZ8L 4NSBA 1QR1A 1M7IA 1Q0YL 1XD0A 3GSUB 2XFXB 1TZHA 4CVWA 4U1KB 3TTSA 4LCWE 5C6PB 4JZJA 3BHBA 4GW4A 3BPCA 2OWXA 1HQ4A 2CDEB 4N0UA 4M80A 3BXNA 3TH2T 4OLWH 2VZVA 2C7UB 3QG6A 5F21B 1AGEB 5JOPD 3MBEA 5D5ME 5HBBA 1OIMA 5D5MA 2ZCKH 4WO4C 4PTWA 2GYSA 3A67H 3FN3A 4LKCB 4X8JB 1BBJA 5DEFB 3MLUL 3KLAB 3ALGA 2VUOA 1YNLL 5JO5A 1Q9WB 3BKYH 4P9HL 5D71L 5C0GA 5IVXA 3E1F1 1B2WL 4CRPA 3LKRB 1U8HA 3A67L 1G9EA 4LPTA 2DIAA 3W11C 4Z7OF 2D03L 3U0PA 1ZLSH 2PR4H 4GLRH 3BFOA 4XNUL 3GSNB 4ZNCD 5SWZA 1U93B 4F8XA 3ZDYF 5CEZD 3ULVF 4MXWL 2YD5A 1CGVA 5F1IB 2ZXBA 1U8PB 4JFOA 1NBVH 3SCRA 3MLZH 1DUZB 2ESVE 2X4OB 4F8TA 2ESVA 1G0XA 1RJZA 4G8IB 1GZJA 4LGPB 1NBVL 4PLJC 1QI4A 2E9WA 5E9AA 5ID0A 5E2VL 1K3IA 5FOBB 2JEPA 2BY2A 3LZFL 4LHUD 4UQ2B 2CUIA 2YLLA 4CMMB 3JWDC 3HU7A 5C08E 2VCBA 5J56B 4G6AD 3T2NH 1FLTX 5GS0H 4LHUB 4WW2A 2H32B 2W59A 5FGCB 2HT3D 3U30C 2VKWA 3BP5B 1NBZA 4OIIL 3BCDA 1X9QA 1G1CA 3P11H 5AG9A 1PZ3A 3HZ3A 4NQCD 2R2CA 3ZKQD 3FQUA 1NQ6A 2HJFA 2DDXA 3RCNA 2YUXA 3REWA 5C70A 1FO0A 4WKHA 1XCQB 3GK8L 3WMCA 4N90E 4TRPH 3O6FA 4XCNA 4NQCB 5TE7H 1A7OL 4PG2C 1PX4A 3HG1E 2VITB 1C91A 1EX0A 4EDXA 1LE9B 1GHFL 2HFEA 4D0BA 5C7XH 5JXEA 4XCEB 2PWEA 3QUXC 1G7MA 5TE7L 1MELA 1MVUB 4JFFA 1G6RL 3HMCA 3DX9B 4Z7VF 3DO7B 1KACB 3VW3L 3WN5A 1C5DB 1M7XA 2VXUL 5C7XL 5L0QB 4MJ4A 1FLRH 3AZTA 4HH8A 3W25A 3KPSE 2FLBT 1JGVH 5HOSA 1XT5A 4NNYB 3HS0B 3OWEA 4MD4A 3H7LA 4HEME 1HEZB 1MAKA 4YHIA 4AMWA 1JZ6A 1FPTH 5FK9A 4X7EC 2UVEA 1JGVL 3CSPA 4KQ3H 1JZ4A 4MZ3A 4QO1A 2DBLL 1V08A 2OQJB 3RDTD 2BHYA 2DM4A 3CVHH 5KSBE 1IAOB 4OCSH 4KGJA 3WNKA 1CVRA 2DTML 4MAYD 1HQRB 1I8IA 4XMKH 3FOMA 5DD1H 1ED3B 4D0DA 2P5WB 1UB5B 4G8GB 3RDTB 2DKSA 1G7JA 2O5XH 5HHOB 4J28A 1CGUA 3CVHL 3GIVB 2Z92A 4MAYB 4Z0XB 3O4LB 4AIUA 5KSVB 1FSKC 3CSGA 4EK7A 5I1GH 1U8NB 3NA9H 5DD1L 2EDBA 2V2TA 5IKCA 5D1QC 2OLHA 2Q7YB 1OAYH 1LP9F 2BSRA 2Z31C 5BJTA 4OFIA 1KTLB 1ISXA 2O5XL 1E6RA 5C0CE 5FB8B 5IMLA 3QDJA 1MH5A 3VXMB 3BISA 2A9ML 2WVVB 3BWUC 3GMRA 1D5ZA 3U46B 5GGTA 3TTOA 4A6YB 1M71A 3GKWH 5F9OL 4YE4H 2P5EE 3LKSA 3NH7H 5BS0A 2DTSA 3V7AG 2HMID 5EZIH 3DDFA 3EMZA 1WDPA 4XB7A 1N6QL 2PBGA 2VLJD 3GJFA 3RIKA 1W3JA 3GKWL 1TETH 3C60A 4QF1B 5A2CA 5EZIL 4O4YL 2ADIB 5F89A 1BWMA 4X4YA 1FZOA 3KLLA 2VLJB 4U1LB 1S8DA 2W9DH 2R1XB 5L2JA 5DJAB 2MQ0A 4MJIE 2IBZY 2LABA 2VN4A 4OCMC 1TNMA 4MJIA 1TETL 4I3RL 2G2RB 5GGVY 3RX8A 2Z35B 4FZEL 2W9DL 4ZFFA 5KTEH 3LQAC 3IVKB 4M7JL 4YFLF 1VA9A 3TH4T 1A5FH 4JRXE 1RAMA 2VERN 1CGYA 1S9XA 4ZD3H 5C3TA 3T4YB 1MCQA 3GXFA 5D93B 5KTEL 5MEPA 5DWUH 1GGIL 3KLHD 4DJMA 1A5FL 2XJ7A 1C92A 4ZD3L 2O9TA 4M5ZL 2UVFA 1W8NA 4E41D 1VAHA 4N1HB 1XGZA 3T0DA 5DWUL 3C6LD 3QUYD 5IESH 5T1MA 3M7SA 2V2WB 4NI3A 3O0RL 1HHIB 2WYSA 1SJEB 4E41B 2R2HB 1QNQA 1MLBB 1VGKA 4O5LH 4D0CA 4B0MM 2VIRB 3R4DA 4RSVA 4BZ2L 4UT6L 2BVQA 5E94B 3C6LB 3QUYB 2AXFB 4Y16C 4P59H 3H53A 4QFUA 1RPQA 3ZSTA 5H8DA 2Z1SA 1E6PA 4U31A 1IC5H 2RGMA 1RULH 2AABH 4QHMB 4Y0GA 1T7YA 1RV6X 5IJVA 4O5LL 3TO4D 2C3VA 4O00A 3W2DL 1DCLA 2E4TA 1IL1B 2KQMA 4NNXB 4HWZB 4QGTA 4P59L 1OM0A 3CUFA 4DWSB 1YEEL 3SPVB 2DPEA 1RULL 3NACH 3T4AA 4PJ5A 1UD6A 4YNYA 1ES0B 1GZQA 5AWNL 3UC0H 1VB9A 3SCNA 2O93L 3SO5A 1OAUH 2ARJA 1FNEB 4AJ0A 1IGTB 3QUKB 4KV5E 1WDQA 4OLXL 3N15A 3I6KA 1AKJA 1E6OH 3OKKA 1T20B 1JXJA 1MFAL 5A6BA 3UC0L 1BVKB 4AD4A 3B9EA 1VADB 4M1CC 3OXSA 1OAUL 2WBJB 5D2NC 2W1NA 2ED7A 5CCKL 4PJGE 1XD1A 2PTTB 1M6OB 3QZWA 4HOZA 1DLFH 3D2UA 2FNBA 4OD3L 2AS5M 4XMPH 2YS4A 4YBLB 1I85C 2DH3A 2AXHA 1ZHLB 3WO4C 2OWCA 5A69A 1BFOB 5CQ1A 1D5MB 2I9LA 1J0ZA 1CCZA 1NFDF 3RPKA 2GI7A 3SKMB 4QXTB 1EAPA 1OP3H 4XMPL 5EUOB 1HVQA 1PKQE 4M7LL 3TO2A 5E1QA 3ARGB 4ORZC 3UYOD 4FLSA 1X6LA 2BRQA 3BZFA 4K3JH 1FH9A 4EQ3A 3WUEA 4D8PB 5EU3A 1G1YA 1N6UA 4PRBA 4YAQB 2OW6A 2J7GA 1MCRA 1OLZA 1IQDA 4Y4HA 5BRZB 2QMKA 1AGCA 1KB5A 2EYRA 1B4JH 2X05A 4J8RB 3LMJH 5D2LF 4HFUH 1PEWA 4PP2A 5ETUA 4X6CB 3AI0A 1XGPA 1B4JL 1XF5A 1YJDH 2WV3A 4O9HH 3GMQB 4FK9A 1CLZH 4K2UL 5JPNB 1G7LB 3QH3A 4WNQA 1F4WH 3BH4A 1UJ3A 2VL5B 4QYOA 1YJDL 4O9HL 5J9PB 2HRLA 5DUPH 3U0TB 1F4WL 4CU8A 4OFVA 2WWMD 4HUKB 4A3YA 3VXUD 4WEUD 5BWFA 4NSKB 1JF6A 1LDPL 2FL5A 5ACZA 3DX2A 3O8XC 5DUPL 4ZPTB 3TZVA 1BOYA 5IV2B 4HUXA 3MJ7B 4FXGB 1F11B 5IB5B 1HIMH 4IDLA 4NZUL 2DQFA 1H5BB 3H8NA 3UCRA 3C9NB 3EO1B 2NY0C 1KGUA 1ZWIA 1ZSDB 1PZ5B 5A2JH 3VWJB 2A6IB 3V5HB 2YPKA 2VLMD 3TBSA 4PJAB 3PTMA 2LU3A 4KRMB 2PW2B 4DOHE 2E6QA 3QDGE 1E72M 3LN4B 4MQXC 4X9HA 3U7WH 4ZFGH 5FKAB 9CGTA 1OGGA 4ODSH 4PJ8D 3DTXA 5F3HB 3ZOAA 1SYSB 5MEND 1V05A 3MRRA 3ALFA 5E03A 1FFPA 1OGSA 5HYJB 4IHOB 4PJ8B 1LEKA 4ODSL 1QVOB 3UBXA 1X5ZA 2VE6B 4ZFZB 3VFPB 3HMWL 4R96A 3ALXA 2GFTA 3D87B 4EJ1C 4F7EB 4EAMA 3OSKA 1QQDB 3ARDC 5F7MC 2PCPB 5T33L 3EYVB 1G9HA 5DZLA 3LV3A 3DRQB 4RMRA 1MI5D 4XCYB 4MA7H 1T22B 1JZ3A 2MFNA 3OJMB 5T1LA 2NXYC 2VLLA 3IDGA 4CVXB 2ID5A 4OB5L 2EIZA 2NY3C 3BEVA 2OLDA 3LRGA 3MV9E 1MI5B 3UETA 1LNUB 4APQA 4FXKA 2X09A 3SIMA 1IM9D 2IAMD 4GS7B 3UDWC 3BUDA 2F5AH 5FECA 4ODXA 1HKIA 3MCKB 4UTBH 1IKNC 1KUMA 1IM9B 1HYRC 4RWHA 2IAMB 2BY3A 4XVTH 3BSHA 3KL3A 3PL6D 2OJEA 2P8PA 1NEUA 3PDDA 1PZ2A 3AMLA 1HJVA 2XZCH 3KLKA 2A73A 2EDQA 4R3SA 1E1EA 2VT0A 5CJ5A 3AHZA 3PL6B 1PW3A 4FQXD 2PB1A 3OG2A 3K46A 2DWEA 1EHAA 2XZCL 5K9JH 3PF2A 5HGAA 2YD2A 5ABFA 4DZBA 1E4WH 1DQLL 3GMNB 5CD5C 3MNZA 3HI1B 3RPMA 4KMTH 5FYJE 4Z7NF 2ICEB 3QPQC 1PX3A 1JE6A 2C5DC 3N1AA 3TIEB 1N2RB 1I8MA 1Q94B 5K9JL 5GJSH 1JYVA 4CDHA 3CMJA 3WS3A 2F18A 1QNZH 3ZE1F 1VCAA 2PUQT 1V3MA 2VKXA 4KMTL 2JB5H 2GAZB 4GRLD 4HCRH 2X1PA 4TSCL 2J4GA 1W72A 3H9HB 3Q2CA 3QWOB 1OWRM 1FBIH 4XP9H 2C3GA 3QCUH 4GRLB 1QNZL 2JB5L 4GRWB 4XTRD 5CBEB 2E40A 1IGCH 5LA0A 2WIIA 5C0AA 3K4ZA 4XVJH 1MCLA 1CD1A 4WV1C 2K1MA 1FBIL 1T4KA 1ZA3A 2W92A 2DD8L 4KI1A 3QCUL 5LAXB 1ISVA 5JIWA 5C09B 2HTLC 4U6VL 3BN9D 3AROA 1NC4D 5GGRA 4XVJL 3CZNA 5SX5H 2VAAB 2CKNA 2KQNA 4LPYA 3SE3A 1X7QB 5IJKC 3DURB 3SKOA 4OOUA 4XNQA 43C9B 1NC4B 3MO1A 1UKOA 1H3XA 4M43H 4IIQB 1R3JB 2GJPA 1A6AA 1ZT7B 1TPXC 3QDHA 2OTWA 4M93B 5F6HI 4ZAKA 3GRWH 3RM4A 3BPOC 4OD1H 3VFVB 5JOPE 2PWHA 3OKDA 4K7PX 1EXUB 4WUKH 1UCTA 1GSMA 4PCTA 5IB4B 1Z9SA 4TVPL 4HH9A 3EZ8A 5LQBL 3VA2C 3GRWL 3PIQB 4HS3A 4OD1L 3VXRD 5I1HL 5D9OA 1AQ0A 2OZ4A 2QSCH 2Z8SA 1UZ6F 4S1RH 4LSUL 2VDRH 4J7RA 3BZDA 5F97E 1NGPH 4P4RA 3TA3B 2NX5D 4UMGA 1TTFA 2YSSA 1KXVA 1MHEB 3UR7A 3VXRB 4L8SB 4YGAB 2AJXH 3HC3H 2N4IA 2AJVL 2BVPA 2C1PB 4HQQH 6FABH 3X17A 5CEZE 2OSYA 1FQ9C 2VDRL 2NX5B 1NGPL 3JVGA 3RDKA 1I1YB 4ISVB 2XY2A 3HC3L 4RA0C 1R86A 1GQIA 3VI3F 2ZWZA 4TTUA 4HQQL 1CQKA 5CMAA 3SCMD 1XGTA 1MWOA 4JM4H 3VDBA 1S9VB 1KGWA 5C6TL 4LF3A 5J11C 1VFBB 5TH2A 3DWTA 3BSZH 1MUJB 3CJJA 1IEBA 4QLLA 3UJIL 5EC1A 3JWDL 2R1WA 1LLOA 5I78A 4RAVB 5FGCE 5K93A 1M4KA 1F3DJ 5JUEL 4TNWK 3RAJH 3DIFB 4IUGA 2FYVA 4XZBA 1BQHA 1HH6A 1UENA 1IGFL 1K9DA 4BF7A 5I2IA 3OF6A 2FE0A 3S37X 3WEOA 1AH1A 5D4YA 2MQCA 3RAJL 5DQ9A 4X5XA 2IADA 1PIFA 1R46A 2XTJC 4NNPH 5CSZA 5GS2H 4LHQB 4F37F 3QUMB 5A3ID 3QOKA 5E8PB 4NQCE 4DO6A 3F5WA 4N0YH 1YEDA 5E00A 5JA8B 2W0FB 4UQCA 1VESA 3O11A 4WGVB 4P2RA 3ISWA 4M7ZC 4LFHD 1B2YA 2WBGA 5DEGA 4MHHI 5CEYB 4ACPA 5EBMB 5CXPA 2FDBP 4JKKA 3TN0D 1NEZB 3A0OA 1OD0A 3C2AH 4PRPD 3CMOH 4ZS7H 2OK0H 3SDCA 2FHFA 3D48R 5JLZB 4W85A 4G8EA 5GS1A 4X9BA 3KPRB 5D6DA 2CHOA 2FZ3A 3RI5F 1QNSA 1H49A 4PRPB 5C0FB 5DJ8A 1R6VA 5CWSB 3GM0A 1OHQA 3C2AL 3CMOL 4ZS7L 1F45A 2WUBH 3M17A 1H3UA 2J88H 1UD8A 5BW7A 1Z5LB 1FFOB 1EFXA 2EYSA 4OGYH 2QMJA 2B20A 2G60H 1WAAE 5A6JA 1RJLB 2AQ2A 2J88L 2IXVA 4JQXC 3Q0HA 5ECJE 4LX4A 2P5WE 3ARFD 4G8GE 1HSBB 1S3KL 4OGYL 5HDBF 1FJ1A 2G60L 2BJMH 3PHQA 3O4LE 1U8OB 1VGEH 1XH3A 4QRUB 4Z2HA 3QDMB 2F58L 1QRKA 2Y9RT 1R3IL 4C7FA 1IAII 3RQ3A 4Z5RB 2X4UB 3SDYH 3VXME 3QZWG 4QWWC 3SHSA 1VGEL 4F7CA 5IOPA 1K4DB 3VRIB 3PWPA 1Z2KA 1ZVYA 3LXCA 5DDHA 4UAOB 4XNZB 3WL9A 4OUEA 5E1HB 4PG9B 3JWOC 3Q3GB 4H5SB 5EU4A 2NW3B 4OF8A 3UYRH 4NCDA 1M7DA 3I02A 4QTIH 5K59F 3SDAC 1PFCA 5D1XB 4WI4A 5EB8A 5GQBA 3IGUA 4KROB 3QWRD 1EBAA 4JB9H 4R0LC 4OFPA 4AEEA 2VLJE 4PJ7E 1F3RB 5BZDB 4PJ7A 4NHUB 1HXJA 2WSKA 4QAWA 1A4JA 1NDMA 3NFPA 4PJ9A 1AXTH 1SBSH 4HA4A 4BFGA 1A3QA 5C3LD 4DQOH 5CILH 4WU7A 1FZJB 1E6QM 5LWYH 1KXTB 2D7QA 1E0WA 3G5YA 1FVDA 4L4TD 1TQSA 4WO4D 3QT2A 5AAWA 4W8BA 2HA1A 1RUPH 3LQAL 1G6VK 1E4JA 1SBSL 4M9OA 5IMOA 5ADPL 2IWGA 4DQOL 3HAEH 2DMBA 4RDQG 4ODTL 4TVPD 3UTQB 1EFQA 4WO4B 4PY7B 2B4CC 5KOMC 3WLBB 4QXGH 4PR5A 1ORQB 4XWGH 5I1IH 1RUPL 4NXKA 1INEH 2YPVH 3W11D 1KWKA 4MNLA 3W9DA 1KCSH 4PPTA 3NUKA 3QJHA 2FBJL 2K7QA 5LCVH 3HNVH 4XWGL 3T3ME 2YBRB 1BIIB 3FB5B 2EO9A 1INEL 4MA8H 1DQDH 4E41E 5IMMB 3SCUA 1QG3A 1I1AA 4HPOH 1JD7A 5EOTA 4CN6A 1QUNA 5LCVL 4EUPH 5BXFA 2FLRT 4HPYH 3V4PL 2PXYC 5ESAA 4MA8L 4JFPB 1DQDL 4YIQA 4ODHH 5A6AA 1YQVH 2AV1A 3I6GA 4PLJD 1I75A 3EJQA 3OTTA 4QHLB 43CAB 5JTWA 4HPYL 4CNIB 1A7RL 3P40A 4HJGB 4B50A 2R4RL 1E6NA 3JTTA 4ODHL 1YQVL 3TO4A 4IOIA 2WC3A 5DQDL 1MLCA 3VDCA 2CLZA 4Q2ZB 4F7PA 4O02H 2Y6SC 3MC0A 4AEIH 1GGCH 4DVBA 3LRSA 5JW4M 5AZ2L 3I9GH 2F2HA 4CD6A 5JMRA 3WF3A 4O02L 1FZKA 4JCLA 1J0JA 1A3RH 3O3DB 3QUZB 1KIPB 2FECL 1CD9B 1GGCL 1HXYA 3U30B 1G7QA 2CRMA 5KAQG 4X5WA 4WTZA 1ZS8A 2OR9H 5DQJA 4H1LH 2WC4A 3OZOA 1H3PL 5D6CB 5DR5H 4HG4K 1CNVA 3RL1B 3GEWB 4X5LA 1ADQH 2F7OA 3WUFA 3ZE2F 2CH8A 2FX9H 3S8WA 3CVIH 2D9QB 1JPTH 2OR9L 2MJWA 2R39A 3TT1H 1AD9A 1G0CA 3SGJA 3WUZA 2P49B 5ABEA 3V2AR 3QUXD 5A2FA 4OM0L 3IJSA 1ADQL 3JSSA 1CG9B 3WL1A 1Y18A 5DLML 3BC9A 3D0VB 2DJUA 1JPTL 4D94A 1NGQL 2A83A 1JG9A 3TT1L 5D70H 3QUXB 1G6RA 5A2LH 2CITA 3RRQA 1OSPH 1EVTC 1CDUA 1NGWB 1J0YA 4U5KA 2R0KH 3ZTNL 3SCPA 5IIEB 5DUML 1F58H 2NTSP 3KLDA 5D70L 3MLYL 5IBUB 2QLYA 4ZPVA 5EU5A 1GCFA 4W7UA 3TEUA 4TNVK 2XN2A 4X6CE 3WIFB 5GGQH 5B38A 4MQTB 4DN3H 1GOKA 5EFIA 4X98B 3O3AA 4NP4H 5CBAB 3RWCA 3VFTA 2Q6WA 3FQWB 3FN9A 3KHOA 1BYBA 4GSDL 5EOCJ 3DRTA 2J12B 35C8H 4GXUN 5DRNB 1UCBH 2BHUA 4DN3L 2WAHA 1FDLL 5B8CA 4NP4L 2XVKA 3V8CA 5IM7B 4MWFA 1IM3B 1WE5A 4FFZH 4LPVA 4L5FL 35C8L 5D1QD 4J6RH 5E1AA 3CVHA 5I66A 1UCBL 1UG9A 2Z31D 5IG7A 1V6WA 4PTVA 1U8JA 4LPWA 2VDLH 2E27H 1D6VL 1FSKB 2APXA 3T2PA 3PP3K 4GI6A 3VXUE 2E7CA 4O2EB 3VXUA 5D1QB 1CWYA 3SBWA 3MRCA 2Z31B 4J6RL 1MQQA 4FTVB 4K3DH 2Z1KA 1OAQH 5DRWB 5SWQA 4XCFH 1QBLH 2VDLL 2E27L 4JGJA 5E7FA 1LO5A 3UZQA 3DX3A 4TQEH 1J0IA 2XKNA 5KANG 2X7LB 3B2UD 1I4FB 4K3DL 3IJ8A 4PJAE 1OAQL 3D25A 4OZHB 1KIRB 2Q87A 4UDUB 4PJFA 1J0HA 4RMQA 3JV4A 4OGAC 4WVRA 2ZX7A 4LVEA 4AMCA 1KEMH 3HLAA 1HYSC 3B5GA 2VLME 4G9FA 2VSCA 5HYEA 2ZCHH 4I2XB 3U9UA 1CPUA 5IFJA 2UY4A 3MRMB 1VACB 4IBLT 1Q9LB 4MB3A 4JFDA 4GKZB 3K8MA 4GKLA 3ZDZE 3C2SA 5DVMA 4KPHH 1JHTA 2YC1A 2EQDA 5DS8A 1ODUA 1MCKA 3TTQA 4MCZA 2ZCHL 5F3BB 4EEEA 4XNMB 3BAIA 5MENA 2WP3T 4KJYA 2W62A 4QRSA 4MNGA 4M00A 1MQRA 3ZT6A 4KPHL 1KCKA 1GQJA 5M94B 3GMLB 3QI9B 4YWGH 3BZEA 4Z0BH 3H42L 4B9ZA 3U7VA 3P3YA 3VCLA 1QKZL 3DUHA 3QIBC 4ORGB 3U9PL 5GRWA 1JHKH 2BK8A 1WWAX 4ZSOA 1VKXA 1KN2H 4U2ZA 4YWGL 2DQGL 1WAWA 3OKEB 4ZUVB 3AOFA 4U6YB 1A1MB 2VRKA 1MI5E 3WNMA 3DX6B 5J57B 1DN0B 4WI8A 2H9GB 1HXKA 1BECA 1JMZA 3MUGA 4B53A 4DGIH 1T1YB 1FH7A 3W27A 4Y16D 2ZOLA 4MVBC 1B0RB 4TULH 5JXAH 5JBDA 4JFTA 4V1DB 1H41A 3O2DH 2XGBA 1U33A 1UOKA 4Y16B 4KH2A 4DGIL 1X5XA 2H2SC 2VLRA 5DA4A 1FG2B 1FHLA 4DN4L 1R8LA 4ATLA 3QIWC 5JXAL 2FO4B 4AIZA 3RY6A 5EO0B 3PGFH 4FNQA 4MLIA 3UEQA 3QHOA 4ZE4A 1NLDH 4WUUD 2P42B 3GMPB 4WI9A 4WLCA 1JF1A 3W4RA 1IFHH 4LHUG 4OZ4A 3PGFL 1UM6H 2A3CA 4FQXA 1JWMB 1R3KA 1BQHG 3BW9B 4WUUB 5JORB 5AC4A 1ZLVK 1NLDL 3RO8A 4M1CD 2X40A 1BLNA 2QEJA 1IFHL 5IHLB 5ECUA 3EFDH 1UM6L 5J6GB 4C83B 3WBDA 4Q7DA 2IXUA 2ZG2A 5ABHA 4LCCC 5D2NB 3P4OB 5SV3A 5IVOA 1YN6A 1Z9OA 4ZNEE 4X7CC 4ONGH 4OJYA 1R5VB 2DQIH 3EFDL 3PZTA 3K2UH 5K9KA 4AZGA 5B22A 4JKMA 4GG6A 3P4MB 2PKDA 3PNWB 3WO4B 4HXAL 3Q6FA 4NO0A 1DQJA 5JW4Q 1YYLL 4X4MA 4ONGL 4PYGA 3WHXB 4PRIA 2NY1C 5LYRA 3DV4A 1IC4L 1MRCH 4HV8B 3FW6A 2A6KA 1A4KB 5EIIA 5GZOC 2PWDA 1L7TH 2BZDA 4QY8B 5EIQA 1MVYA 3HMXH 3PDOA 1PG7H 2SEBB 1LDSA 1NP2A 1MRCL 5DC0A 4YBQC 4XC1H 2BC4B 2HN7A 4JRWA 1L7TL 3QEQB 3BEWA 1ZGLA 3L3GB 3M6DA 3HMXL 2VURA 3CUIA 1CD0A 1NWUA 5IVZB 3H3KA 4EN3C 3FO2B 1IT9H 1R5WA 1A9EB 1F4HA 4XC1L 4JY4A 4NQXB 4PJXA 2XRAH 1TVHB 5D9PA 5I75B 1Z9LA 3HKFA 2AI0H 3BH8B 1T1ZA 2HRPH 4R4NC 4RIRB 1BJ8A 3RJDA 2D31A 1CL7H 1DDHA 3NSXA 1GOMA 1G0YR 2W63A 1KPUA 4ODVL 2DM3A 3VXRE 1DUYA 1TZIA 2OX5A 3L3DA 2X44D 1WP6A 2AI0L 1N3NB 4U49A 5I19L 1EV2E 1CL7L 2EDJA 2HFFA 4FNLH 2DQUH 3REVB 3SE8L 3WIHH 1LO2L 2NX5E 4ACZA 4NZJA 2A74A 2VB5A 3WJLC 2VVSA 4AZHA 4Z2KA 3A22A 2YXFA 2A77H 3VE0B 2NSXA 5E99H 4JANA 3O8XB 4W70A 4FNLL 4NFCA 2NY0D 2VZOA 1RZKH 3V5DB 4DW2H 3ZL4H 2V5DA 3ILQC 4C56D 3ZJ6A 1QD0A 2NY0B 4Z7VB 5E99L 3RUGF 3GIZL 2I9TB 4FG6D 2HISA 3LPGA 4LBEB 4DW2L 1B90A 1FHGA 3CFIC 3LKOA 5CJ8A 3BGMA 4C56B 4MQXD 1BHGA 1OVZA 3EYPA 3MSDA 3VIPA 4GFTB 4GXPA 5I1JH 2CDGB 3CFEB 3TCLB 5ESVA 1HDMA 1FGNH 4XBGA 3L3OA 3BVNA 3P4NA 3TBYA 3MZGB 2DB8A 5GNXA 5CP7A 5GRJH 3TV3H 1YEJH 1Q9KB 5CSBA 1TIUA 4L29A 2PF0A 3C08H 2QJDA 2XPGA 4HWBH 3VO0A 4JPIA 5DRXB 2UUDH 3ARDD 1BX2A 2OXHA 5I3DA 3PE9A 5IK3B 4D3CH 3TV3L 1R3HB 2XNAB 1YEJL 5K9OA 3IRZA 5E6YA 1QNPA 4TSAL 4ZUUA 2WMIB 5I1DA 1TITA 2OSLB 1M53A 4HWBL 1CECA 3TPUA 2NXYD 3EFFB 3B4NA 5GSRA 4EVNB 1UR1A 2XZZA 4P5KA 2V7NB 5KSAB 2NY3D 4DEPB 2AEQL 5CS7A 1LP9B 3FJTA 5J4MA 1O7AA 2NXYB 4NYLA 5TE6H 3HZKA 3PTQA 3P30L 1QI2A 1RHFA 1UR9A 1NL0H 5FL0A 2CKSA 4HA1A 4D6JA 3IKCB 1AMYA 3TN0A 1E5NA 4H25B 4PRPE 5JDSB 3G6AA 2X4SB 1U0QA 3F7YB 5TE6L 1TR1A 1KGCD 3RZCC 1KV3A 1D5BB 3MGTA 2WMKA 5ID1A 4JJ5A 4Q6IB 5DJ0B 1I8KA 2VR5A 4JDVB 2O61A 3PHAA 4R5EA 4U3XA 2F53B 4XMLL 4YGVB 5HGDA 5D7LD 5DHYA 4YHPA 1BAFH 2BVUA 3MMEB 5CD5D 5BZWA 4TXEA 3QXDA 3VWKA 5ACMA 4O51A 3QDME 5D7LB 4JM2A 2CR3A 5C2BH 2GT9A 2EXWC 2ZJSH 1TENA 3ARFA 3MV11 1GORA 1BAFL 3IU3B 4YHYC 4HFWB 2H3NB 2D4DA 3ZKXB 4HZAA 2APTA 3U6RA 1AQHA 3MLXL 3OX8B 1KEGL 1MPAH 4R7NB 3OKOB 4UNVA 5ABDE 3G5VB 4MDIB 5ICZB 3MGOB 4AENA 3DHUA 2CKBH 4RQQA 4U6XB 3ELAT 4R8WH 4HKZB 1U2YA 1MPAL 4JEGB 5DUBA 1JNHA 3HRZA 2PWFA 1KJ2H 2WAGA 3QQ4A 3CZKA 4MAVA 2C7FA 3AM8C 4XNYH 2HTLD 2IALA 3AFBA 1F3JA 4UQBA 2J8FA 2CKBL 3WFDH 1OF2A 4OCNC 4RE4A 4LP5A 1MRFL 4P4KA 3E8UH 4WV1B 4R8WL 3U5UA 2ERJC 5CD3A 3EGSA 3CFBA 1KJ2L 4W4OC 5D5MF 3S34H 3MSPA 3QWRA 4XNYL 2NY7H 3FT4A 4TUJB 1X5JA 5IW6B 3G5ZA 3E8UL 2E6JA 5ALCL 5I1KL 2DSVA 3ZR6A 1S7UB 1T21A 3RU8L 5DJXB 2AEPL 3S34L 1E4LA 5IVXF 4EXPX 4DM1A 4U4BA 5L8LB 2XWJA 1N82A 5IB2B 1U3ZA 3CUJA 2A9NL 4L4TE 3UZEA 1Y7VA 4LSQH 1M05B 2DOCA 3OAYK 4L4TA 4JN2B 1TPXB 4YHZH 3F12B 5A16B 4HKBA 1A8JH 5E2TL 1KQYA 5H94A 2YKLL 3BPOB 3MRHA 4OCXL 2B4CL 2WLYA 2ITCB 2GVYA 3DUSB 2JJWA 1QLFA 4TVPE 4I4WA 3SUTA 5KS9A 3PZIA 4LSQL 1P1ZB 4JCMA 5CEXB 3GRWA 4BH8A 4I18A 1FOBA 2V2XB 5DO8A 3D85A 4I5BB 1GIGH 3L3IA 4FN0A 3BT2L 4UQ3B 5GRXG 3GMOA 5FV1L 2X89A 1KELL 1JIBA 4P2OC 3N1QC 4LVNC 4AK1A 5HVFB 1LILA 3RWIA 4F66A 2H6PA 2I60H 1GIGL 1JZ8A 2L4OA 1C5BH 2NTFB 1P7KB 1NFDB 3NN8B 4X7TB 4LYRA 3ETBF 1QNOA 3SCQA 1GGUA 1LD9A 4CUCA 1BFTA 1DBAH 1AGBA 3SUUA 5C0ND 4WW2F 5IP4A 2VLKA 3D18A 1L6XA 5FL1A 3OKLA 4HWEH 5J11B 5LXGL 1RIHH 3MRPA 2CIIB 1DBAL 3CHFA 5ICYB 2QPUA 1A6ZA 3UYPA 5EZLB 3WNNA 2HVJA 3MLSL 2RBLA 4HWEL 2WM0A 1RIHL 4NO5B 5T1DH 4YEEA 5D2LB 4XBEH 1EEYA 4JQVA 1RZ8A 5FF6B 5SWSD 4FNTA 5F1NA 1F6AB 4POUB 3KWXA 3TBTA 5CPTA 2X4NA 1TVBB 2XTJD 2EPOA 2R9HD 5IWLA 4LLUA 5DJCA 5SWSB 4PB0L 2V6HA 4D6IA 2CUHA 2DQDH 4O2FA 1PGRB 2ZSVB 2XTJB 4LKXA 2BHZA 3D5OF 1WBZA 5JOFA 1T6WA 4XP5L 3EO9H 4LLYA 4PG2A 5IR1B 2C0HA 3QPXL 4DK3A 4LSRL 4PBGA 4BQ6A 3DXAB 1LEGA 1WISA 4ZE5A 3KYOA 4M7ZB 3DVNB 4JRYA 4LLVA 2CBIA 3RWFA 1I3VA 2VRAA 5DVNA 2H1PH 1UEMA 4HKJA 4MD5B 5I73C 3MS8A 1N5AB 1AE6H 3DVFA 1XF4B 4E4PA 1CR9L 5KN5A 2EKJA 2AXGB 4MSWB 5DI8B 4PRHD 3KJ6L 4OF6A 1GOQA 1YEHH 1S78D 3G6JE 1AE6L 3G6JA 2X1QA 3I3EA 4PRHB 1JGLL 2X4TB 5CLTA 3A6CL 4ZG1A 4KK8C 5HHNA 5GHWH 3CXHJ 5JBEA 1Q72L 3QEUA 1YEHL 4WJ5B 3EDDA 1UXSA 2P4AB 2VISA 1KYOK 3VGAB 5HYQB 5HVHB 2AV7A 5JZ7C 5IT2L 5EBWB 2GSIB 3WXWH 5GHWL 2YUWA 2CLRB 4BFIB 3MV8B 2WQRA 2VX6A 2GSJA 4UIMA 4X9GA 1B6UA 3G6MA 2UY3A 4L3CB 1A1NB 3WXWL 1FG9C 1OGTB 4L4VD 4QWWD 1ONQB 2BDNL 2AJZB 2Y4SA 4ETYA 1NCWH 1QHPA 2YDSA 1EHNA 3KS0H 5HHMD 3UG4A 4NQVB 5CSUA 1CICC 1KFAL 1S9WB 4L4VB 5C8JB 1OP3K 4UNIA 2BFVH 3GO1H 1ZT4A 4U2YA 1DLHA 2IANA 1U91A 3SDAD 2AOSA 2DSKA 4OZHE 1WIPA 2HKHH 3ARVA 2QTEA 3BGAA 4RGND 3K8LA 2G9HB 2BFVL 4OQTL 1E3XA 1YEIH 3STLA 4NXSA 3GO1L 4M3KB 4KJPC 8FABA 3RM8A 3WKZA 1R3LA 3H0TB 1WSST 2AXJA 3BESR 4HGMA 4I2XE 5B39A 2ZUNA 2HKHL 5E0QA 4LLDA 5MEQA 4R0LB 1YEIL 2IPUK 1ZL1A 1T0MB 2IPKA 1A7NL 1EGZA 2P47B 3EZJB 4LSVH 3IJ9A 4K8RC 3FTGB 3OBAA 2IPTL 2VR9A 1D7FA 1LWRA 4ZUTA 3GB7A 2ZWLT 1X4XA 4P46C 3ZLQC 4EI6A 4XVSH 1U58B 2XN0A 4BQ2A 3TIDB 1PY4A 2V9RA 1BG4A 1JGEA 4LSVL 4NDMA 3PZGA 1B0GB 4U6HB 1E6XM 2YL5A 3F65A 1PQZB 2ZCLH 4MJ5B 3PQYD 1R85A 2J8OA 5F9WC 2X70A 1A2YB 2Y07H 3STZA 4HUNB 1S5IH 1OPGL 4LXFA 3OGVA 2F54D 3HAEA 1YEFL 5D1ZB 3UTOA 3AXXA 1C16A 3PQYB 1NPUA 1BQCA 4XPHL 2ZCLL 4OBSA 4JAMB 3IXAA 4X7DC 3AIBA 3LKNB 3L3HB 1DWAM 1S5IL 4AYFA 4NN7C 5DTFB 1BFVL 4UBDC 2PXYD 2RFXA 4JZJC 2Z93A 2XIIA 1G84A 1HHGA 3DOSA 4HGWA 4ZFOL 4QRPD 1BMGA 1H09A 3KEHA 4DVRH 3LIZL 1YHTA 4MGXA 4FABH 4DGVL 4ZODA 3CBWA 1KNOA 4EUPA 4QRPB 4AT6B 5AYQA 4PBVC 3NFNA 5I74B 1GOOA 2R0WH 4UU9A 1MFUA 2Y6SD 2YD1A 1GPOL 3H9ZA 3DHJA 4WUUE 1YUHB 4LSTL 2QHAA 2BV9A 1RK1B 4MJ6A 1H15A 3VG9C 5DJYB 3F4VA 1INQB 2ZUUA 1RU9H 1C5CL 2R4SH 3NABH 4F9DA 3MRLA 5HVWA 4D71A 5CPSA 5D2NE 1AGFB 2VABB 3TNNB 1NQBA 4GAGH 3EJYC 1QFHA 2YR3A 2YEZA 4MYWB 2YJQA 3H2WA 5LVEA 4RCAA 5HYIA 4JR9H 4X99B 3T2OA 4UOW0 1ACZA 1HHKA 2HVKA 1R0AH 1MIEH 1SJHB 2BP3A 2BSED 1NP0A 2NLJA 4XXDB 4NZFA 2DAVA 4LFHG 1ADQA 4JR9L 1UG6A 2GEEA 1MCBA 2XUCA 2ZXDA 5A6SA 1R0AL 1FORH 1T03L 4Z2GA 1XF2A 3MR9B 3VXQB 2CNCA 3AAZA 4YZFF 4I0PB 3SKNB 1MJUL 3EYSH 1QBAA 1HI6A 3D0LA 4WW2C 4RWYH 5C9JB 2IQ9L 1AQDB 2HJLB 4RDQF 2KZWA 2LVCA 4I3SH 1FORL 1XF3B 3MODL 3U7AA 4GIAA 4GO6B 4L4PA 3F7RA 4Y19D 2NT0A 4JFXB 4X6DA 4S1QH 3ROOB 5EDXA 3RNKA 4RWYL 5KEZA 1ZB5A 4Y1AD 3L7FA 3FOLB 4NBXB 4I3SL 2R1YB 2UWEA 4Y19B 1JNNL 2CO7B 1K4CA 4W5UA 4KFZC 3O6FC 4NRXA 4Y1AB 1JXKA 4LMQI 5F9DC 2CHNA 1ZEAL 3IDXH 1IGIH 1P69B 1TJGH 1MIMH 2VH5H 1NGYB 2DQCH 5J6HB 3EHBC 4KQ4H 4UQDA 2DQEH 4FQCL 3SUWA 1CXHA 1IGIL 3WN5C 4K94H 1TJGL 1K2DA 4FFYH 3VXTA 1ODZA 2BY1A 1AY1L 3FT3B 2WCAA 3PHOA 2VH5L 4UDTA 2ZG3A 4KQ4L 4XH2A 2DQEL 1J5OH 2EH7H 5EWIH 1FYTD 4P57A 4FFYL 3V0VB 3WFBH 4XP4H 4YHML 4CW1A 3FONB 1IAKA 4Z7VE 3SCVA 3IFPA 1QFWI 2EH7L 5CG0A 3GI9H 4OGAD 5EWIL 5IHZA 1FYTB 2B39A 4K55A 4C56E 5BOPA 5HYSB 2XVLA 3EMQA 1HYSD 5HPCA 1FC2D 3WFBL 4ELMA 3K7UA 2DYPA 1BZ9B 2W07A 4MTVA 1KBKA 3KPQB 5B4MC 4PGDB 1DEDA 4EI5A 1I1CA 3GI9L 4IRZH 4PJEA 3AMCA 3E6HA 1ZANH 2OJZL 4HHAB 3L3JB 1W9PA 3QNXA 1MWAH 2YUZA 2AK4A 4G9DA 2NY5C 2UZXB 4OGXH 3BAWA 2BNUB 4ZTPL 1W0WA 1TVPA 2J1KA 1AJ7H 4K3HA 3ZYZA 4CCEA 4AYGA 2DWDA 3FQTB 4OF3A 1MFDH 1JD9A 1TQBC 1ZANL 2UZYB 1M03A 1RURH 4NRSA 3VNYA 1MWAL 5AYBA 5C0DA 4Y2OA 5I77A 3IDIB 1X6NA 2A6JB 3MFFB 3GSWB 5HGHB 1RZJC 1AJ7L 3QIBD 3RIAK 3GXPA 1RH9A 5EN2A 3MMDA 5IMKB 3O45A 3ARDA 5KVDL 1TVDA 4M7LT 1RURL 4OJFH 4LEXL 1U3YA 1E27B 2VXSL 3IDNB 3PXJA 3TPKA 5IEKB 1LP9E 1C1EL 5E9DD 1LK3L 3DX1A 2XYLA 5KZ6A 1UWGH 5AUMB 5MP6L 1FN4A 5T3ZH 5TQ2L 1JTTA 3C60C 4YXKL 2YHGA 5DGRA 4GKSB 3PWUA 3RY4A 4KK5C 1KCVL 4M56A 5E9DB 5CGTA 1RIVH 3O3UN 1UWGL 4PV9A 2ZUXA 3DX7B 4IRJC 3RP1A 3UDWA 1DL7H 1UACH 3OPZL 5T3ZL 3R8BB 2H2SD 3LRHA 2VMFA 3MRJA 5A2KH 5JHDD 3JV5A 3QIWD 3R0NA 2Q3AA 4X7SH 4ZFOB 5ADOH 4UUJB 1N4XH 2CUMA 1T3FB 2J5LC 3AU1A 2YBUA 1KGCE 1GZPB 1LE9A 3OZ9L 4AD0A 1LL7A 1UACL 5ENWA 5JHDB 4PJDE 3QIWB 1AQKH 1MFCH 1U95B 3O2DA 4PJDA 3IDJA 3NCCB 1MVUA 5ADOL 5BV7H 2XSBA 3MLTA 1N4XL 1DBKL 3MA7B 2OYPA 3N9GL 5ITFB 1YNTB 5D7LE 3C8KB 5EB9A 5CJOH 4LYPA 3BJLA 4KVCH 1AQKL 3OR7B 1MFCL 4CN4A 1G94A 5TF1L 1KPRA 2B2XL 1TFVA 3QO1B 4G43A 2WHLA 3PV7A 3NSNA 4X4XB 5E24E 4FOMA 1OQXA 3GXNA 2JIWA 3G5XB 1S7XA 4KVCL 3HPLB 5GNYA 1E4XL 3BPLC 4TTDC 1BLIA 1SFSA 1UM4L 1HSAB 4LCCB 1PJ9A 2CLVB 1W9XA 1T6VN 1EZVY 1H3WM 1AGDB 1KLFA 1HZHH 2NY1D 4TVCA 1QYGH 5DJZA 5HYFA 3WLWC 3RVUC 5HHOA 1RZ7L 2J8HA 5GZOD 2QSQA 2UY2A 4NFBA 3ROLB 4B16A 1BM3H 2NY1B 32C2B 3CSYA 3DV6A 4U7KA 2AJUL 2OBGA 2Q8BH 3WY1A 3SUSA 1PSKH 1GW1A 1HHJA 3LPPA 2VDNH 4YBQD 1OW0A 4PBWD 2BRRH 4ODWB 3GXIA 5CP3H 4LAQL 1V3JA 4OD2B 4JVPA 4K7FA 1CLXA 3EYOB 1KJVA 2P45B 4EN3D 4JFED 2VDNL 1EEZB 3HMXA 1WCBA 3GSQB 4JKPH 2WCGA 4C7GA 2BFGA 3P9LA 1JGDA 3BUIA 1P5UA 2R69H 4R4ND 4JFEB 3CH1A 2DLIA 5KVGL 3VJ6B 2NW2B 2VXQL 4H26A 4OZIA 2XWTB 1PS3A 4S2SB 2LE9A 1GGTA 1FL6B 5F1OB 4QCIB 3GMMA 4HK0A 2R69L 2VDPH 4MS8C 3OGCA 4BS0A 5D7IA 5FYKU 4P5TA 1T0NA 4WHYH 2HH0H 2WWKO 4K07A 4S0SD 3HG3A 4KUZH 2Z9TA 3B9DA 4P3DB 4Y4HC 1NFDE 4MADA 2FX7H 1UWTA 1VDGA 5C07D 1PG7X 3EMCA 4ZUWA 4CADA 3ILQD 2CPUA 3WIHA 1TTUA 1CD8A 1S7RB 2HH0L 4KHTL 4PGBB 2J75A 4HUUB 5C92A 2VX7A 1I9JL 1CFQB 1T7XA 3AUVA 2CBUA 1CTOA 1EJOH 2X41A 5M17A 3TT3H 4R9HA 3LEYL 1K6AA 1CDGA 3QQNA 3E3QC 5C0IB 3CFJA 3HTLX 3L3KB 4L8BA 3MRKA 3LAFA 4KMLB 2JELH 1LF1A 5D2LE 3TT3L 4AM0A 4XZUA 4YK4C 1JYNA 4Y8AA 1U8MA 2GTWB 1X1NA 1DSFL 1BG9A 1B3WA 4KC3B 5GRVK 3X14B 5INDB 3NCJL 5SWSE 2EBNA 3WFEH 4QEGA 5FEBA 5MERA 3ES6B 4HIJA 1X5FA 1CXIA 2XTJE 3LQZA 3FY1A 4IOFC 5E0FA 1S7QA 1CT8A 5FOJA 4KKCC 2G5RA 3HAEG 4HWBA 3P9MA 4KRPC 2Y24A 5ESQB 3SJVD 3V4UH 1ZE3C 5HHVH 1HILB 1DANU 4DKEL 3C5SA 3N9KA 5I8KH 1JZ7A 2NY6B 1MVFA 2N7AA 4KDWA 1BQSA 4HUVA 2DSZA 3QIUC 1EOMA 3SJVB 1UA7A 4X9FA 2OS7A 3PGDA 2APBA 1HWHB 4GBXB 3CX5K 3T8XB 3DARA 4M03A 5T3ZD 4JFWA 3VXSD 3PGCB 4OSUH 5I8KL 3ULVH 1UD5A 3IANA 4HA3A 3UEZA 3RZCD 1Q4NX 3C5ZC 4AZ8A 5DD3H 4K71C 1Y0LA 4MXVE 3GJEB 4PRHE 4Z7WA 4J3OC 4OFYD 3VXSB 3DJ9A 1K6QH 1QR4A 1CDCA 4HZLA 2ZKHH 2PYEA 4NUJA 5E5MA 4KI5D 1HN1A 4HT1H 3CIVA 1ORSA 1EO5A 1AC6A 1N0LA 3QCVL 1BJMA 1A6TA 1BGXH 4LAJH 3CIQA 1K6QL 4F58H 3AIVA 4YHOH 3O3BA 3L4XA 4QT5B 5K33A 2ZKHL 2B1AH 2EXWD 4HT1L 3O6KH 4XB8A 1TZ7A 3CLFH 3FT2A 3S36H 5IEHA 4YHGA 4F58L 4NKOA 3L95B 2WBWB 2B1AL 3D50A 4IMLA 2W0KA 2XWEA 1CLOH 1TCRA 1UWEH 3DGCR 2ICWA 4FHBD 4L4VE 4Y5YC 4AZCA 4ZUSB 1P84K 5L7XH 3F7VA 2ATPB 1XGQB 3N17A 5GIRA 4P7RA 4WHCA 2VZTA 2J78A 2HLAA 4R26L 1CLOL 4PJ7F 1UWEL 3LS4L 3QYCA 4AIEA 1TJIL 4PGZA 5GRUH 2P8LB 3OB8A 3T77B 4PRWA 3HUJA 5M95B 4Z77A 4POYA 3CFCL 1KTRL 2APVA 3L7EA 3SDAA 2NNAB 2CKBA 4PREA 5GRUL 2BVOB 2KBGA 4W7WA 3MV7B 5GGSB 4K9EH 4P3CH 1KJ2A 4BQ9A 2ERJB 2YZ1A 3VFUA 2GJ6D 5CIPB 5BCAA 3KYNB 5IV2A 2WMGA 1U8QB 5I18L 5LA2A 3KPNB 4K8RL 2GY5A 4FP8H 4HJ0C 2ITDA 1IBGH 2W65A 3C5JA 3UMTA 4K9EL 4JFQB 3MNWB 1CWVA 5EO9B 3R8QA 1KPVB 5KVMC 1TUXA 2VX4A 3EJRA 5FA4B 2R8SH 4RGOL 4FP8L 1IBGL 1VFAB 4Z7NE 4G8FA 5IQ9B 3DVIA 4MA1C 5DVKA 1OARH 4Z18A 1PYWB 4AEHL 1ETZB 1FZMA 3D69B 3DGGA 5GJTH 4XHQA 2IGTA 3PQYE 5DJ2A 4HF5H 2NXZC 4JHWH 1EMTH 2IBGA 5A2AA 4NZTL 1OARL 1V8HA 1EVUA 5A43C 2F54E 5IFAH 1JDAA 4OBRA 3ARYA 2VCCA 4P2OD 2F54A 4V2BA 3WUWB 4PGEA 5CFHA 3VTRA 1S7SB 1NCAL 1LMKA 4Q74A 1WO2A 1WBYB 4KKNA 2PXYA 4NRYB 2CDFB 5AYIA 4WIQA 2WZIA 2ZOKB 5J1SC 5AC5A 3IK2A 1VPOH 3U83A 2GJXB 4QRPE 4LGRB 1QI5A 4ZAKC 2X4QA 4WFGD 3HPJB 3U5YA 1T66C 4G80A 1A22B 5JW5A 4PMOA 2YPLD 4AMKL 4YX2H 1IAIH 4R7DA 3LS5H 3BKJL 3WQ8A 2KDGA 4GG8A 2ED9A 4U1NB 4V28A 2XWBA 1MW0A 1IKFL 3WEZA 4GI8A 3HFMH 3T3PF 3BD3A 1N0XL 3B2VH 3SDXB 1VENA 2Q86A 3OXRB 1IAIL 2FEEL 2J8UE 1MF2H 2DLFL 3B6SB 3AIEA 2J8UA 1K9EA 1KIQB 3AZSA 1KLGB 1GAFL 3V6ZA 4H8HA 3HFML 1JWUB 4UV7H 3MLPA 1WKYA 1NM9A 3B2VL 3L2LA 1J8HA 1UZ6E 4JFVA 4XPGL 3UAJC 5D96C 5TGBA 4D9LL 4GRMA 1ZA6A 3WD2A 3VH8A 2J77A 2I5YL 1AIFA 3SKJL 3DI3B 4Y4KB 2F9BT 4GKNB 4NF7A 3VMNA 4DCQA 4UT9H 3WN6A 1NANI 5D72L 1YYMH 5FKPB 3TGXA 3L5JA 3FFCD 5E2WH 2X9XA 2VDOL 2CIKA 1ZOXA 1ZLUK 4NCC2 4I9WD 4RGMC 3VI3E 3LRKA 3L1OL 3WF2A 4JDTH 5I73B 4QRQB 4FQPA 1T0PB 4KVNL 3FFCB 2FSEB 3H9HA 2W4XA 3L9RA 1MCCA 5E2WL 1W91A 3ALPA 2YLAA 4WKFA 3HZYA 3RUGB 1V0KA 3A4WA 2J6EH 5AYUH 4NRZB 1F3DH 4KK8D 4WU5B 4UILH 4N9GA 4Y19E 4MB4A 2I07B 3PWLA 4H41A 3PABA 4LIQL 4PTTB 3TWCH 3HE7C 1JP5A 4QOKD 4Y1AE 3S96A 1GOHA 1S5HA 1A6UH 2J6EL 5JZ7D 3NCYS 5AYUL 1UEYA 1P4LB 1AR1C 3U7BA 4WKAA 4JPKH 2F61A 25C8H 1ZMYA 4QOKB 2ORBH 1P6FA 2A1WH 2UY6A 3IDMA 1TMQA 4JFUA 43C9A 3MACH 4H20L 2FGZA 7CGTA 3EJTA 4U3HA 2FIKA 4JPKL 5D7JC 5GISH 2ORBL 4ODUB 1G7IA 1QFWM 3SDCC 1CICD 3EOBB 2LTQC 5GS1C 5D6DC 4PJFF 2K7PA 5I9QC 2BCKB 3VRJA 4ZDHA 2Z0BA 3GH5A 1CICB 2E9JA 3VIGA 1OLLA 1BFSA 4JLRB 4F7MB 2A6DB 1E6JH 4HK3N 3ZZ1A 5LGHH 3O6LH 1FYTE 2VXTH 2EDKA 4JQIH 5DXWA 3BDBA 4QTHB 3MFGB 4KJPD 2F74A 5DHVB 4NGHL 3UZVB 4FFVC 4AH2B 4PMXA 4D9QD 3GXTA 4O58H 5LGHL 4JY6B 3FB6A 2V17L 2VXTL 1I1FA 3ARQA 3DROB 4RX4D 1KCRH 4K8RD 1IEAB 5D7SL 4MQ7B 1XSKA 2NY5L 2BMKB 4XX1E 4P46D 5MEOA 4LLAA 3CFKA 1OP9A 3K8KA 1DVFC 2FR4B 3WIIH 3Q5TA 3THDA 1JV5B 5HDBE 4P46B 4HUWB 1XGRB 3VPLA 2D4FA 5DEZA 1RZJL 1ZHKB 1PZUB 3WY3A 4NC0B 2KZ1B 2EICA 5GGTL 5ICXB 3WIIL 2EPMX 4UTAH 2CETA 5BXTA 4GKOA 5F6IC 2QADC 3MOQA 1G9MH 4BZ1H 3QIBA 4B9YA 4OV5B 2ADFH 3P0VH 5F9WB 4N5UA 4YXHL 3A21A 4RMUA 1DWIM 1B3XA 3FAXA 2HFGH 2WINB 4UTAL 1BVLB 4M48H 3VXOB 3CHDA 2OL3B 3RA7H 1G9ML 2Y23A 5E9DE 4WHTA 5HI5C 4UBDD 5I1EL 3CCHA 3ET9F 2ADFL 4PD4K 3VIJA 1QR1B 1M7IB 1J1PH 1SQ2N 1E15A 4PJ9C 4NC1C 4NN7B 1TZHB 5K59E 1P5VA 5IHSA 4JZJB 3BHBB 5AD0A 4GW4B 5F7HA 3BPCB 1HQ4B 4N0UB 3BXNB 1I3RA 1C8QA 5IVNA 3QG6B 5JHDE 5HD8C 2LU4A 2X9WA 3MBEB 1NBYA 1J1OH 5IBLC 4FMKA 5D5MB 4EIZC 4WHDA 3EJJX 4NN5C 4NZRH 4HS8H 5KANI 5DK3A 3HE6A 1IZJA 1BBJB 4XAKD 3AIUA 2XA3A 1J1OL 5ISZA 5JO5B 4R4FL 1F2XK 5DK0A 5C0GB 4JL1A 5SWZD 5CZVL 5IVXB 1U8HB 3WDQA 4OT1H 2LAGB 4NZRL 4N9OB 1J86A 1IGJA 3VG9B 1GOGA 2UUDK 1H9VA 5DSCA 1FA2A 3U0PB 4GG6F 2BOCA 2GK0A 5I16A 5SWZB 3EJYD 1I1AC 3GZKA 1UZ4A 4M3JA 3HNSH 3OLGA 2UZIH 5FCZA 2DQJL 3JTSA 5HHXH 4FQ1H 4Z78A 4JFOB 1UH4A 4MMZC 4YEFA 1G5AA 4Q9QL 1YNKH 2ESVB 2GK1A 1RJZB 4FQQA 3HNSL 3A23A 1V0NA 2UZIL 4UQAA 2D23A 4FQ1L 4UR9A 1LG1A 2XOTA 3WH6A 2ZXQA 1HKLL 3V0WH 1YNKL 1PLGH 5C8BB 5CHNA 5ID0B 1T5WA 5E8NA 2BNJA 2FGWH 2W67A 1ND0A 3V0WL 2YD6A 4PJXF 5EORL 2OSXA 5EPMA 3KR3L 4HAGA 1JJUA 4TVSa 4WW2B 5D4QA 2AJ3A 3B43A 5EZJA 1XAUA 2DBJA 4KTYA 4X0KA 1UWRA 3MRBA 4P7LA 3S5ZA 1NBZB 5GS0C 3NOIA 2ICES 4RISH 4ONFL 3RTQA 4YHEA 1KT2A 3O6FD 4JFEE 5IBTH 4EN3A 1HOCA 5L6YH 1DBML 5J13C 3FQUB 2EDFA 2AKRA 2HJFB 4Q7NA 3REWB 4XP6H 1FO0B 1NH6A 3O6FB 4XCNB 3SGJC 2FO1A 5IBTL 2QQLH 2EADA 3NIGF 4JFFD 4EDXB 3EHBD 1UR4A 4I48A 1G7PA 1UWSA 5DJ6A 3SE9H 1OAZH 1DTUA 4D0BB 4QRRA 6TAAA 1G7MB 3ZE2E 3IAGC 1AHWA 4JFFB 3S3PA 4PD4J 4JE4B 3PJSA 3C09B 3BP7A 5ERWA 4LSDA 1E55A 1CBGA 2VN7A 3V79C 1J7VR 3SE9L 3WN5B 1IZKA 5BXRA 3W9EA 3VDHA 1VFFA 1KB5L 3ZT7A 3MRNA 3BUPA 3S97C 5C07E 1HF6A 2R2EA 3A4AA 5C07A 4UFLA 3NFSH 5L88L 5FDWA 1JMXA 4MD4B 1MJ7H 1HP4A 3DDGA 4YHIB 1EUTA 3QXVA 5FK9B 1HH9A 1BQLH 3BUYA 5B4MD 3APGA 3RVXC 3PUCA 3L5XL 4NQDA 1MJ7L 2VSDA 5B8CC 1A9BA 3HA0A 2FB4H 2XZQH 2BVEA 2Z91A 4JHBA 1MAML 1I8IB 2R29H 4X6FA 1ZV5A 4U1MA 1BQLL 5EOCH 4D0DB 3QCTH 1JHLH 2VZ1A 1G7JB 1NWRA 3V5KA 2HG5A 1ZGLP 3POCA 1BD2A 2FB4L 2Z92B 4AISA 5IHUL 3QDJD 3ARWA 2XV6B 2R29L 3EO0A 2X1OA 3TV8A 2V2TB 5IKCB 2CKRA 4K7PY 3SBWC 3FHAA 5BJTB 1TQBB 2E7MA 4O2CA 1MWAA 2Y7QA 3UO1H 5IMLB 2F8XC 5BOZG 1DQMH 3QDJB 1MH5B 5J12C 5BS0D 2APWA 3DO3A 3FCTA 2IQAA 4U1JA 5D8JL 3GMRB 1D5ZB 3BDYL 4ATDA 1JFXA 1Y6NR 3BXWA 5BS0B 3LKSB 4FLRA 1SR0A 1JUFA 3CV5A 3C60D 3NPZB 5CSGA 3SJVE 4WK9A 4I0KA 4KK5D 3UROR 5IB1A 3GJFB 4FXLA 5IXEA 3QHFH 2NY4C 2QSVA 4IRJD 3WQ5A 5MHSD 3C60B 2P1YA 4OZFA 3U7YH 1HTYA 1ZTXH 5F89B 3DMMA 4N1EA 2VJXA 4X4YB 1FZOB 1QSZA 1S8DB 5C0RH 3R06A 4KTDH 1KJMA 3QQ3A 1CFVH 4WI5A 1W9DM 1Q0XH 4HJJL 3VXSE 5L2JB 1HINL 3EJZC 3QHFL 4MJIB 3B3IB 4JFHD 4LEOA 4LCUA 3RZCA 4ZO8A 3U7YL 3AVEA 4MDJA 1ZTXL 3TBWA 2HWZH 3TBVA 2BS9A 4ZFFB 4KTDL 5M7QA 3F6IA 4OFYA 2CESA 1AO7D 1E4NA 4RAUB 3K3QA 5I8EA 3HR6A 2WHJA 1S9XB 2L0DA 3AS3A 3WSQH 1KB3A 1DBJH 5CGMA 4GUPA 5MEPB 1GHSA 3MXVH 4MZ2A 4Z8FH 3BUQA 1FNSL 4Y4FC 5TJWK 5SV4A 3WSQL 4TTDD 3OLEA 3WKML 4YUEH 3MXVL 5T1MB 3S35H 3SY0A 4F57H 1W32A 1TNNA 2UYLA 3DBXA 4Z8FL 1CGSH 5F7UA 1VGKB 4D0CB 3VH8G 3LB6C 2BVQB 3L5WA 4CMHC 4F57L 3WLWD 1QZ1A 3RVUD 3AMGA 5IJVB 4G3YH 1CGSL 5FM5O 2C3VB 1BBDH 3HI6H 4PJ5D 5DMIL 1RP9A 5F9JA 2XXCB 4LDEB 3KPMA 3FO1A 1XGUA 2ZUTA 1T7ZA 3MV7E 3EOTL 3DLQR 3WNLA 3DVGA 5T3XH 4G3YL 3T4AB 4PJ5B 1BBDL 3WY2A 4YNYB 3VRLF 1GZQB 1AKJD 1FIGH 1HE7A 3HI6L 1I7UA 4O2EA 4HD9A 2YL9A 4PTXA 5FYKL 4OFKA 2XIBA 4M61A 1BZ7A 2GJ6E 2Y5EA 5T3XL 3FO9A 1I7ZA 5I30H 2GJ6A 5KS9F 3I6KB 1AKJB 1XIWA 2IG2L 4KU1A 2VR4A 3OKKB 2ZWYA 1VHPA 1F4YH 3D2UD 3OXSB 3WFHA 3WF0A 3RHWF 4K23H 3QNYA 2ZXAA 3RPIA 3QZWB 5CP3A 2XFFA 5I1CL 3VI4E 4HP5A 3D2UB 3V8OA 2D22A 1U8LA 3A6OA 4K7PL 4K23L 1HX0A 2Y8VA 1LO0H 4MS8D 4B3LA 2I9LB 3LEXA 5BVJA 1EGJH 4XTRC 1EAPB 4JG1L 1Q8MA 3TO2B 1GL4B 1PEZA 2JK5B 4Y4HD 3LKPA 3BZFB 3PWJA 4Y7MA 1VEMA 1GJUA 3K4DA 1EGJL 4P2OA 5LBSL 3WUGA 4ALAL 3HG4A 2MANA 4HMEA 3TCXA 1EHLH 5EU3B 4PRBB 2RIKA 1CXLA 1IQDB 4Y4HB 4RBPK 2DKMA 2Z4QA 3ARZA 1AGCB