1SMAA

Crystal structure of a maltogenic amylase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
588
structure length
588
Chain Sequence
MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALTOGENIC AMYLASE
publication title Crystal structure of a maltogenic amylase provides insights into a catalytic versatility.
pubmed doi rcsb
molecule tags Hydrolase
total genus 156
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1smaA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1smaA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1smaA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1smaA03
2WCSA 3BQUC 1W1YA 4X4ZA 3UTTE 3QP3A 3BKYH 2ICEB 1VA9A 3MODL 3C5ZB 4JN1H 1OM0A 2OWWA 3HI5H 3ULSB 4ONOA 3DVIA 1L0QA 5DQJA 1HYRC 1CFNA 5F3BA 4NRSA 5TQ0L 1G9MH 4WHDA 4JR9L 1G1CA 2FECI 4J1UA 2QQKL 1UADC 1AIFB 3L9RA 3GSQB 4MD0A 1US2A 1D6VH 4CU7A 3KYNB 3CHCA 5DTFA 1N64H 1QBBA 5HPMA 3AVEA 4JFDB 2Y24A 4XWGL 4UT9L 4UBDC 1J0IA 3RDTB 4KMLB 1YUHA 3QPQD 3PUCA 4CMHC 4WU7B 4K3EL 4R27A 1SM3L 3UTSB 3LKPA 1OSZA 1J0KA 1YNTA 4NQDE 3C2SA 3VX0A 1YJDC 3UG5A 5FD0A 1UR2A 3RA7H 3HS0A 1GQLA 1DUYA 1RZIB 3CIQA 3VGBA 3C5JB 4Q0XL 5C07B 4JZNA 4AL8L 4JHAH 1HKJA 4POZD 3DGGB 2PO6C 3BAKA 2AJZA 4I3SL 3VIGA 5FYKL 4POYA 3UTTA 1RH9A 2DIBA 1P84K 1HOCA 1JJUA 1H0DB 5KG9B 3RGHA 1IM9A 3FO1A 3NDZA 5E9DA 1F3JA 5F1NB 5A2AA 2HJKA 4ZTPL 1EO8L 4WV1A 3MCLH 2R2EB 1FYTE 1QRNE 1Z9LA 5KSVA 5IMKB 2PWDA 1T83C 4JRXE 1FNGB 5TDNA 3CDYA 4OF0A 2J5LC 4NBZB 4UU9B 3GSRA 3WJJC 1HJVA 1YEJH 5E9AA 5I6XB 2H26A 3KE0A 3HNSL 3VRJA 1MCHA 1IL1A 4XCCH 4J27A 1OAYH 4PTVA 4OQTA 4N8PA 1BFTA 1N2RA 3HI6L 1Q8MA 2P5WE 1M6OB 2J7EA 4ZUTA 3BN9C 3S96B 4NQDA 3SGJA 1Z9MA 5C0AD 4J4PC 1I8KB 4XVSH 2VISB 3FKUS 3QB7C 5DUPH 2HVMA 2VR5A 4RE4A 3DROB 2DQUH 4OLVL 4OCRH 4W88A 1JRHI 3DJ9A 3H9YA 1GJWA 2VITA 1ZHNA 1R33A 1QO3B 4JHOA 3SUVA 3SUTA 2VRQA 1ECEA 3LKRB 3DLQR 4OF6A 2ATKB 1KJVA 4M48L 3CC5A 4S0TD 4WSJA 3FO2B 5IMOA 1MWAA 2XIDA 4XBEH 2AW2A 3AREB 2WQRA 1ZU8A 4ODXB 4XCFH 2A6DA 3PWPD 1ZA6A 3BISA 2FEDD 5F7EH 5T3ZL 3W38A 5D2LB 3MV11 4NO0B 1H0GA 1FYTA 1QRNA 3QH3A 1UQSA 1WDRA 3RTQC 1B0IA 4JRXA 3EOTH 3K2UL 4LGSB 1JI2A 4HG4K 5GS0C 1K5NA 5DQ9B 5D8ZA 4GMSH 3OX8A 2PXYC 4XAWL 5D7JA 5BO1H 3LXBA 4HPYL 1FNEA 5FGBA 4W84A 3SDAA 1MHPH 1DBJL 1PYWA 3LB6C 2GTZA 1A3RL 4ZXBC 1U8MA 2NT1A 1UWIA 3WKNA 4BFGA 4Y8AA 1OSEA 1ZT1A 1WK0A 4PRHB 4XNXH 1ZSDB 3NPSB 4HLZG 5D1QD 5ECJE 3C6LC 3P3YA 1QLFB 2C0HA 1LL7A 4HHAA 1JDDA 4H5SB 2P24A 1MREH 3SE3C 3HZYB 2ZUYA 2VZTA 3KPPB 4J6RH 1HINL 2YL5A 1K3IA 1KB9J 4HGMA 5LQBH 5MERA 4F8XA 4MNHA 2E9JA 3TT3L 1WBXA 5DK2A 4DK3A 3VIIA 2JE8A 1GGBH 5I1AA 5K9JH 5EULV 4NN5B 4HF5H 4NZUH 1KG0B 5E8DH 5EOQH 3RL2B 4AG4L 3NACH 2I5YL 5DO8A 1CIDA 5MHSD 5C3LD 2F53B 4FQCH 1WCGA 3LY6A 4O2CB 4BQ9A 3WHE0 4NZCA 3WH5A 4LLYB 1EBAA 3GNML 2DQIL 2MNUA 3P4OB 4WUUD 2YSSA 2KL6A 5C0AE 2A1WH 1RIHH 4JGJA 5D7KE 3WDQA 3D2UB 1A6ZB 4X7CC 3FO9B 1EUUA 3S5LB 2A0LD 1NMCB 4FFYH 2Q76A 2C3VA 1TJHL 1BPVA 5HDOA 5IESL 1BJMA 2J8UB 1KCSH 2D3VA 3OGRA 4J8RA 5CGYD 5MI0B 3PDOA 3CLFH 3TVMD 3BWAA 3MR9B 4NQEB 4JO4L 1UZ4A 1HCFX 1S8DB 5F9WB 1E0WA 4PJFB 4RFNB 4UTFA 3NZ8B 1EJOH 4GRWE 3CHEA 4K8RL 3PWPE 3GMQA 3O8XA 5TD4A 4WEUD 4LLUA 1NMBH 1IC5L 4NQSB 3QEGL 1S7UB 1ZL1A 3QRGH 3ULUH 5DJYA 4G6JL 2Y36H 4R97C 3RZWA 4UI2A 3MLTB 4GKZB 5I71B 5KJRL 2J75A 5DRXA 3KZSA 2UVFA 3WN5B 1Z5LB 3ARFD 2CKSA 3TPKA 4X98B 1VKXB 5KVEL 4Z7WF 5FO8B 2AJVL 4X7SH 1DQDL 1VGEH 3DRTA 5CEZD 7A3HA 5DVNA 3TA3D 4X99B 5E8OB 3RVUC 4MQ7A 5D5MF 3W39B 3OZ9L 1MCPH 3PJSA 5C0AA 4AMXA 3QZWA 5ANME 5JO5A 2EO1A 1I85A 1MEXH 5EBMA 5BZWB 2A3CA 2F7OA 3MOQA 4JFEB 3EKCA 2DT3A 2DT2A 3U0TA 5IB4A 4R2GD 3L3KB 5CJOL 1JZ2A 3GIZL 1CE6A 3U7WH 3DUSA 3WY2A 4UQ9A 1CK0H 3ZKMC 4FQ2H 5JW4N 1J87A 4EKXA 1TCRA 1NCTA 5IFAH 1KPRB 1I4FA 1YMMB 3DVNA 4PMZA 2DQXA 2BY0A 4RFEA 1TJGH 1S7VB 3IDYC 5FGCB 5LWYH 2WVTA 1TZHA 4B9ZA 4ZPVB 4E41D 1T7ZA 8CGTA 4FQXB 5DJ2A 1KCKA 3EYOB 4FNSA 4M7KH 5MHSE 1E71M 5TFSL 5SWQA 2XY1A 4ORZC 4GRLC 1FLRH 5CJBA 2YD2A 5MP6H 3AXIA 1KIPB 4KROC 2EIBA 1NGXA 3H3BC 1GC1C 3O0RH 4U3XA 3GNOA 3NUKA 4MSWB 2WWMD 3KLAB 1TUXA 2XIBA 1LEGA 3KPRD 4WUUE 2IMNA 4AMCA 4GT7A 3QZWG 4WWKD 5SWSB 2YMXH 5E08L 1QSFD 1R3HA 2FO1A 1MFCL 4JZJA 4XB8A 4DO5A 1GHRA 4KKAC 1E6QM 4UIKH 5ANMA 2EH8L 1GW1A 1BSIA 3QUKB 2GSGA 4QRRD 4TVPL 2FYYB 1U3HC 3IVKB 5EFDA 3U6RB 3BZFA 4LCIL 5KSBB 3ARSA 4C83A 3GXTA 4MJIB 3WHXB 1NGQH 3H6JA 4YLQT 1U8NA 3VGDA 1B3JA 2YR3A 1EMTL 4X5WA 5C0GB 3PZNA 2XG4A 1OHQA 4CVXB 4GXVL 3U9PH 2YZ8A 1R7OA 4IS6A 4O4YL 4L9LA 3CUHA 1X5AA 4I9WD 2R1XB 3MJ9A 3N0PB 3TYGH 4K3DH 3CK0H 4ZO9A 4RIRB 1KTDB 1PIGA 3HN3A 1LK2A 4HU0A 2QL1A 1KN2H 1DBAL 1KN4L 2OR9H 4EN3B 4J3VA 2V9RA 1IMHC 2UWEB 1X1NA 4M5YH 1CI5A 1UXWA 3GUTB 1QVOB 3QI9B 1CD1A 1F97A 3WEXB 4KKCC 1AGEA 1ZOXA 3WLBA 5CEZE 2J1KA 4XMLL 3BFOA 1JF1A 1CPUA 1GZQA 1G9MC 5EO0B 4PY8J 5KAQF 2DLFH 5JXAH 5E7BA 4AXNA 2PKDA 1KUMA 4XPTH 2YC1B 2VZSA 1GOKA 5I1GH 2IAMB 4XP1L 4H8WL 1FG9C 2E7HA 3CMGA 3RWHA 3FAXA 1DQML 3TVMA 1A14L 5EOCJ 4PTTB 1SVCP 4ODUB 5IHUL 2XYCA 2AK4D 5DO2D 4NT6B 4PLOB 2ZKHL 5D1ZC 3JWDL 1IVLA 3T0BA 1DWIM 4ZFZB 1UKPA 3G5YB 4OZGF 5BYWA 4E41E 3RNKA 4M93C 4PJDF 3ALFA 1CT8A 3LSOA 5DHYB 5JR1L 3BPLB 1AQHA 3GZKA 3HMXA 3HB3D 1QA9A 1G0CA 3VJ6B 5DT1H 4YDLC 2WWDA 1ONQA 1T21B 1F4WL 2LABA 4ATWA 4U2ZA 3DETD 4MYWB 3L7FA 4QOKD 2FHFA 3VNZA 4NNPH 3KPRE 3R4DA 4F7CA 2LU3A 3TA3A 2VCCA 1QSFE 2YL9A 3G04B 1KB5L 4IOFC 1INQB 1W3HA 4QRRE 4DAGH 3SKMB 1W9XA 1NC4B 1CFSB 5J3HD 1DBBH 4E42A 3HNVH 4P46D 3AXHA 3KYOB 4ZQKB 4CADB 1XF3A 1RJYB 4JDZA 1P4LB 1HVQA 4XTRD 5ADPL 2VRKA 4JL1A 4A6YB 4NQTA 4Q2ZB 4Y4FC 3CXDH 4I9WE 1XYFA 1L0XA 3F62A 4AM0B 4YHNA 3MREB 3UEZA 3BQUD 2XM1A 2APBA 4P23A 4NSKB 3MA7A 3BP7A 2Q3ZA 4WTWA 3W6LA 4TVCA 4UV4H 3JVGC 4RWHA 4IUGA 1JYVA 3LQMA 1R86A 4MXQD 3EJUA 3SGEH 3D3VB 4WDIB 3GJFH 5DMJB 3VXTB 2VZ1A 5F9JA 2XWJB 3OF6D 4G8IA 4ELMB 4YDIH 2Q3AA 3KPRA 5K9KA 4WWKA 2CGRH 4YFLI 1QSFA 1G7HB 4Y5YA 1ZEAL 3LS5H 1FDLH 4QRRA 4GMTH 3VXPA 1IARB 4Z7WE 4LCCA 3BP4A 5J57B 2VKXA 1KBBA 4L4TA 4HFWA 5IMMA 3WXWH 2F8OA 4WU5A 5D5ME 5JOFB 1OTSD 1MY7A 1OY3B 3ARZA 2AK4E 4IMLA 5LG1A 1R34A 1TZ7A 4GZJA 4JO2L 4N8CL 3UC0L 1FNSH 3VFSA 4PRIB 4F33B 3KPQB 1WIPA 4V28A 2CJUH 2PCPB 4ONGH 4JFUA 1N4XL 4JN2B 4Y4KC 3GKWL 2D31B 3BSHA 1FE8L 4OD3H 2GHWB 1UKQA 1EFXB 3V7AG 4HK0A 2BSED 2N1KA 4HV8B 5DYOA 5C9JA 3LHPH 4NJ9L 5KSAB 4QOKE 2VXUH 1S9YB 1LE9A 1R5WA 5TF1H 4ZG1A 3SCOA 1V7NH 1VBRA 3VRLE 1P4BH 5CGMA 2OK0L 1BG9A 1G7PA 1YEDA 4JHWL 3VWJA 1QFOA 3HAEB 4FG6D 5EU7E 3MLSL 3SPVA 2E9BA 5CSGA 2ARJB 3RNQA 5EN2B 5LXGL 4I77H 2EDBA 4LLAA 5D4YA 1YYMH 1HP5A 2DI8A 1H15A 1A7NL 1KGCD 1NUGA 5IW6B 4RAUA 5KTEL 2HMIC 3BVXA 2VSCA 3RWJA 4MDIA 4I2XA 5BCAA 4CGTA 4Z7WA 2R56H 4GW5B 1UZ8A 3BN9D 3F58H 4TYUA 1RPKA 5I1IL 2EXWD 3VXUD 2EE6A 2AK4A 3DI3B 1VPOL 4ODSH 5F8QC 3NCYS 1FV1A 4LSPL 3LCYA 4PV9A 1UWXH 4HLJA 1KXTA 5E00A 3D39A 3HR5A 4QXUH 3RZCD 3MRKA 4EBQH 4PGZA 2NT0A 5EBLB 5IB5B 2HT2C 4HQQH 1PEZA 3EYSL 5JUEL 5IWLC 5JBEA 2EIZA 4X6CB 4NNYB 4Y5XB 1ZLSL 3QXWA 1H2JA 1XF4B 2DH2A 2J25A 1DQTA 5I9QB 2EAEA 1IRAY 4YX2H 5GS1C 4GAYA 3QA3A 4DEPC 1Q1JH 3ULUC 1KTBA 5GS0D 4A2MA 5DR5H 1ZS2A 2FHCA 2FJFA 4W86A 3V5KB 4F79A 3MOAH 4U7MA 5IVXA 4PJ5B 3I75B 2YD4A 1BQLL 3T65A 3AU1A 4S1SL 5DEGB 1LE5A 2IG2L 4LNVA 1LO3L 3BMVA 5H2BA 2Y06L 1IQWL 5T1LD 1IGCL 3GMRA 4K55A 5KW9H 4OGXL 5JNYA 1Y6KR 5DUBB 3S37X 4XCYB 5IV2B 4Z76B 1P7QD 3OG2A 4JY6B 4FNUA 1KACB 4OLWH 3BQUA 3BXNA 5F7DB 1DQQB 2EYRB 4RGOH 1C08B 2VXVL 1G01A 4P4KC 4MNGA 2J47A 1QSEB 4ELKB 2YDSA 2D24A 3CO4A 4PJ7F 2C1OB 3P9LA 2FSEA 4KZDL 3W53A 5E1QA 4MNQD 3U46A 4L4OA 3HG4A 3T0EB 2XN9A 1ULVA 3GBNL 3I6LD 4QRPB 1JG9A 2D7TL 2DD8L 1V08A 1UQYA 3OF6A 5T33H 2GEEA 1JWSA 1QTYT 3PP4H 4OZGE 4ZO6A 2B1HL 3OJDB 1R75A 4PJDE 1QHOA 3RGVD 4ZMAT 2NY0D 5GJTH 4GG6F 4BH7A 4DVRH 5HGDA 1E15A 4M61B 4U6VH 4FNQA 1IKNC 3WBEA 3B8YA 2DQFA 2NPLX 4I3GA 15C8H 1UHVA 3ZDYF 5AD0A 1KGCE 5EUOF 3NMEA 3WNKA 2V7NA 3DARA 1UKSA 3VXUE 1HDMA 5I0DA 3X3FH 1DEEA 2OR7A 4NUGL 3NVQA 5DMYA 3D4ZA 1WZMA 3L4ZA 1FPTH 4HGKC 1GPOL 4NZRL 1OARL 1JAKA 4H41A 1U0QA 1RZJL 4D6CA 5E8EA 3V0VA 1GOGA 1HN1A 2HFEB 1JZ7A 3SDXE 5CSZB 3M8OL 1FCGA 3EOBB 3QCTL 2FL5A 3UTQB 3S2CA 5EU6B 1T20B 3JWOL 3C5SA 1BGXH 4NZJA 1TZIB 3LX9A 3DMMB 2FLRT 1G7JB 4MXVF 5H35B 1K9FA 3UJIH 1I1WA 1A6WH 4PRPA 1T83A 2X4UA 2OL3H 4XMKL 4Q22A 4L3EB 3L2MA 1T2XA 4HPGA 4NO2A 4X6BB 4ZSOA 4BQBA 4F7TB 1P2CB 3ARBD 1KB3A 2WMJA 3W2DL 4I18B 4G6ML 1KTKE 5C9KA 2NY6B 3WBAA 1WWBX 4X9IA 2I07B 5FYKU 5A6BD 1S46A 5M94B 1ZJAA 5TE6L 4PJXB 4S1QL 5EWIH 3VXUA 4EKJA 4J4PA 3LKNB 1DDHB 2PC8A 4FQQA 3MLWL 1QWUA 3VFPB 5IP4A 5E2UH 4W68A 2Q87A 3IFOA 5FA3A 2C8NA 3GXMA 3X3GL 1VADA 3VD9A 4JKWA 3SDXA 5CP7B 1BEYH 1YEIL 1V3IA 4H20H 2ICCA 4U1MB 4IRZL 3RWIB 4URTB 1XF2A 3I6LE 4D8PA 1INEL 3MLRL 1GSMA 2WCAA 3C6SA 3RTQA 3P30H 1K4DA 1HCVA 1UYWH 5DD5L 3IT8D 3QEHA 1HIMH 4GS7B 2H9GA 4V1DB 2PXYA 2BVDA 1A3QA 1EHLL 1LD9A 4TQEL 1NH6A 1KTCA 4JPVH 4J23A 1IGTA 4ZXBA 4E8DA 2X1XR 1TETL 4QXTB 3BXWA 1YNLH 3CD4A 5BWFA 2YA0A 3Q3GB 4TUJB 3QYCA 3G6JA 2EYSB 5GRJH 2CMRH 4LK4A 3D4YA 1N8ZB 3C6LA 3D85B 4ODTL 1NC2B 4NDMB 1WSST 2WP3O 4BZ1L 1RJZA 1FL3B 3TIEB 1P7QA 4LSTH 1TQTA 1JHTB 3WQ4A 1FIGH 5F3HB 3V9FA 1BFSA 1JDAA 5DEZA 4XVJH 4UZGA 3SE3A 4JRYD 3KYMA 3RM8A 3AHXA 4HK3J 4ZUUA 5GRYA 3BGMB 2A6KB 4JQXC 4JY5L 2RCSL 2VDKL 2HN7B 4OKVA 1CVRA 1T1WB 1UJ3B 2VAAB 4S1RH 4ONFH 4U3CA 5I15H 1H11A 1OIFA 3BVWA 3MMEB 2NLJB 2VUOA 4N1EA 3PHQA 2CBJA 3RGVA 3UX9B 4NQVB 2G3IA 5GISL 1CFVL 1N59A 3IDIB 3BD3A 1ACYH 2ZPKH 1P1ZA 3S37L 2FATH 3OLIA 3EYFA 1QYGH 3PWJB 2ZUUA 2OJEB 3LQAL 4OGYL 5CAYB 4L8SC 1KCUH 4K3JH 5GGRB 3ZE1F 3JTSB 1U93B 1A9EA 1ISVA 2C7UB 5GGVL 4D9LL 5DFVC 5ABGA 1U8KB 4JFYA 3BI9X 2XVGA 3VFUB 5C09A 1DJSA 1J05B 1QOKA 1Y0LA 1TNNA 2EE2A 5I75C 2F54D 4Z7QE 4GIAA 3IF1B 4BSVB 2ZIDA 4W81A 4PGDB 1DUZA 4JFQA 2OSXA 2NMSA 2P4AB 5I8EA 4XVUC 3WE6B 4XI5C 4Y1AD 1YY9C 2A74A 4JM2F 4CRPA 3F5JA 5AYBA 5IHZB 2BVTA 4AZHA 3GMNA 3BIKA 5GZOC 3ES6A 2E4TA 3BPNC 4ZFOA 3AC0A 5IBTL 4MAYB 2DBLH 3WNPA 1XCTB 5DS8A 3H3PH 1J1PH 3VH8B 4CMMA 1SY6H 2R8SL 5K9OB 5HHPB 3FCTB 4M1CD 3EMZA 1M71A 4HIEA 3LKSA 3ARBA 4PJ7E 3LMJH 3GXNA 1ZBCA 5C92A 2W0FB 1GOMA 2CK2A 4UTAL 4JJHA 1AP2A 4JRWA 1ZT4A 5A6BA 3D9AH 3UO1L 5CILL 3WXVL 2VDRH 2K1MA 2J6EH 3VXRB 1IGJA 4P2QE 2DI7A 2GVYA 4PUBL 1WFOA 1F3RB 2YBRB 1C8PA 3L5XH 3ARDB 3VFVB 5LJYH 1A5FL 3DHJA 1VJSA 3ZDYE 1XIWB 5EUOE 5LAXB 3R06B 4PV8B 2VXQH 4BKLB 3HUJB 1HH9A 3IU4L 4J3XA 1FFNB 2VNCA 2K7QA 3LKQA 3O81A 5CIPA 4N9GB 4JRYE 3V6ZA 5L9DL 2NY7L 4KQ3H 4XHJC 2VXTH 4JKPH 5I30L 1RZKL 4GXPA 4D0DA 2VOTA 1HZHL 4H8HA 4U1GB 4PMUA 4Y4FD 4RRPA 1KJ2B 5AZ2H 3L95A 4P8VA 3CFEB 5C0DA 3WQ6A 1A1MB 4G5ZH 4QT5B 4M8QA 4NCC2 4ZAKB 1MAMH 5D1XB 2VX7A 3V52H 5EFIB 5FM4A 1BBJB 4FXKB 3IFLL 4WY7H 1CGTA 4TVDA 3MLVL 2XWBA 4OLUL 4XUYA 2IWGA 4PJ7A 5GGQL 4LVOB 1W2VA 4UINL 4L5FL 4OGAD 4MXVE 1RJLA 1HNYA 4IIQC 5JXEC 1UT9A 5IFTA 1R3JA 4PJEB 5AUMB 4EI6B 3OZPA 1R5VA 1SFSA 5F1KC 1CLCA 1F58H 1TTUA 4P2QA 1FH8A 3BH8B 3QEQB 3H42H 3QG7L 2UUDK 3H53A 3BVNA 1T2QL 3HZVA 2F54E 2CKBL 1FRGL 4D1IA 5EUOA 5I1CH 3BLKA 3DVGA 4LEOB 5CBAA 5JW4R 5IEKA 5A8NA 3IFNH 2YK1H 4Y1AE 4J2XA 4JRYA 4EI5B 4X80L 4RRPG 3U79A 3HG1D 4DZBB 1E0VA 4AD3A 5HGGS 2IPUG 4PBGA 5FYJH 4WKFA 4M56A 4NZFA 4NRYA 4YO0B 3HJEA 1S7TA 4U6TA 5I73B 1WV7T 3AZRA 2O5YL 4ZOCA 2V3GA 5TE7H 4Y4KD 1NWUA 2MQ0A 2V7HA 5T1KD 1AD9A 1J8HB 1X5YA 4JM2D 3L3JA 3INUH 5IFPA 4NQXA 2ZUNA 3PZUA 2VABB 3JTTB 2XPGB 5D9PA 4IMKC 5I6XC 2L0DA 1C5BH 4Q9QL 3CZ8A 2AERT 4OD2A 3GBLA 4LDOB 3BW9B 3CHFA 1EH9A 4NKMA 4QLRA 5FKPB 3IU3B 1IFHL 3LS4H 5HVHC 2DM4A 3HI1A 4E0RB 4XC1H 3KPMA 2WSKA 5JPMA 1HNGA 2P8MB 2F54A 3KWXA 4DZ8B 1YQVL 1OPGH 5EZOH 4TXEA 1UGNA 5KVDL 4ISVB 3Q5YA 4X0KB 3LV3A 4KVNH 1KIRA 2H2SD 4H88L 4YBHA 1BIIA 5C6PB 5DURD 1UR8A 3NOIA 3PGCA 4QO1A 3I9GL 1AY1L 5D1ZA 4OIIH 5J12B 5GQBA 3EZ8A 3SUUA 2W9DH 2IAND 3ARWA 3TT1H 2ENSA 4FFZH 5DUMH 1X4XA 1EXUB 3OPZL 2HT2D 32C2B 5ESQB 2ADJB 3SHSA 3MROA 2B0SL 4UT6L 3RWEB 1U8LB 3BKJH 2NY5H 1RZ7H 3WUWB 4XVTL 2BSRA 4MD4A 2EYTB 3S88L 6A3HA 2GT9A 3KLKA 4I1NB 4LIQH 4QHKJ 3IXTA 5DXWA 4G9FA 4ODHH 4MA3A 3FQNB 3CFCH 3TYFA 5ICYA 2VLRB 2R2HA 1U8IB 2XNAA 5E99L 3FT2A 1XZ0B 1KNOB 4F7PB 2M8XA 4C7DA 4HWNA 4NWUL 2BRQA 1JWMA 3ZE1E 1TQBB 3ULVH 1CDHA 2XQYG 1AGDB 1HSAB 3TGXA 2C4XA 3N1PC 3HG1E 2BXYA 3G08A 3GK8H 4I13B 4WSKA 2GDVA 4L1HA 1WTLA 3LPOA 3DUUA 2Z91A 2EECA 4Y4FA 5J89A 1KCLA 3GHBL 3TWCH 1KB5B 3F7QA 4BQ5A 5GZND 4P4KD 2V2TA 2M2DA 1U91A 1CF8H 3JVGA 3RVWC 1SEBA 5GS3A 1A6TA 1YECH 4XX6A 1FVDA 3R8BB 1F11A 1U8OA 1YEGH 5EB8A 3RIAF 2AEIT 5DD0H 5I1DB 1R24A 1FLTX 2AEQH 1MQKH 2JIWA 4MAZA 3MUAA 3CFDB 5D4QA 2A3AA 3AHTA 4M7JL 5JZ7D 1E0XA 3AB0B 5C08A 1WPCA 1UCBH 2DM2A 5L8LB 2IEPA 1E4NA 1JGEB 2EE9A 2Z35B 3GB7B 3N9GH 4ZFGL 4LVHC 3EFFA 4NKDB 1KGXA 5FHAL 4HJJH 4OZFH 2WZIA 4NHCL 1SJHB 2R1WA 4Q9RL 1YMHA 5CHNB 4D6DA 4OLZL 1FC1A 1FSKB 1EJ6A 4Y7MA 5L2KD 1UWRA 5JA8B 4E5XB 5CPQA 1CR9L 2XV6B 5T3XL 2IANE 2Q6WB 5FOOA 2XKNB 4KRPB 4MX7B 4X5XB 3MLZH 5EOCL 4Y4KA 4UOW0 3O3UN 4LPVA 5DRZB 4R4FH 5FDYA 1YZZA 5KVFL 1KPUA 2VVSA 1AKJB 2H1PL 3OKDB 3OKEA 3U0WH 3B5GA 3WN5C 5C7XL 4QHNB 4KTDL 3T4AB 3OHXB 2R29H 3MOBL 1FFPA 1QUNA 2IH3B 4YXKH 5T1MB 3T2NH 2OW6A 4TVUA 4PJ8B 5L88L 3VINA 5H37G 1FAIL 4JHZA 2P8LB 2DQHH 3QWQB 4WI9A 1K2DA 3QEUB 4WFFD 4OB5L 4M00A 1YN6A 5LCVL 2DQDH 4NGHH 1R5IB 4MQTB 3CU1A 3EJQA 1OTUC 1A6VH 3LAFA 2OSWA 3OKNB 4UV7L 1EVUA 3BP5B 3V2AR 3CMOH 3O2DH 1MFBH 2C7FA 3DSNA 1KLGB 4PJIB 3UTZA 3WN6A 3LPPA 3NCMA 5HYJB 2GK0B 3S35H 5DQDH 3OSKA 2FX7L 4Z95H 1E1EA 4LLWA 4OIFA 2E8YA 3SKNA 1J9CT 1YEHH 1LO5A 5ALBH 4JCLA 5MEND 2FBOJ 5B8CC 4HUUA 4R26L 4RISH 3QIBB 5ICZB 2HLAA 1K6AA 1CGVA 5HGAA 5IWLA 3ARQA 5IJVA 1BFVH 2Z1SA 3Q2CA 2AABL 1OCWH 4RDQF 1N7ML 4D6IA 1YC7A 5MEQA 1NBQA 2XXMB 3KPOB 4I0PC 4KDWA 2R0ZL 3H9ZA 1H8NA 1JPSH 1ZKAA 1NCDL 4DJMA 3K8MA 1AE6L 4M6ML 4PD4K 4OZ4B 2X4QA 2ZZUT 2VLLA 4M6AA 4I4WA 4M82A 1HWGB 3Q1SL 1GGCL 5T1DH 4HZLB 1ODUA 4DQOH 3MRCB 3MANA 3MRHB 3SCUA 1KLUA 2EDLA 43CAB 4XH2B 3GSVB 1BOYA 3KNBB 4X7FC 4LBEB 3O4OB 5TQ0H 4MB1A 1EHNA 3LEXB 4Y16C 1B6DA 4KGJA 5F89A 2PTTA 1CICD 1CG9A 5CWSB 2ESVB 1MCWM 5L2KE 3MV8B 4QRUA 5BQ7A 1MIEH 4UT9H 3W27A 2EKSA 4D1JA 2GJJA 1X4ZA 5E2TH 4DTGL 1DLFL 1RIVL 3MA9H 1GQIA 3U0PA 3QNZB 4IDJL 1U2CA 4K3EH 2WBJC 1I7ZA 1A4JB 1V3HA 4NFDA 3SIMA 4P4KA 2CSPA 2G3NA 1A6AA 1OTTC 5I8OL 3THCA 4PREB 4LLQB 3O6FD 1ORQB 4KK8C 1JGLL 1QKZL 1E3XA 4AL8H 4BA0A 3P4LA 2D03L 4DW2L 4QTIL 1XF5B 4GAJL 5D9SB 4YPGA 2VL5A 1LGVA 1T1YA 4M6OH 2JALA 5FCSH 1U95B 2V3EA 5D8JL 2QKIA 1MI5B 4ZUWB 1Q4NX 1NWRA 4ZTPH 2Z4QB 1H3UA 3X12A 3SCNA 4QP0A 1Q9WB 1FFQA 4P5MA 2OI9B 3ZKQD 1CXLA 4O2FB 5T5FL 4DKEH 1V0MA 1FIEA 1ZK9A 3OAZH 1LO2H 1MAKA 3VGFA 1QBLH 1E4XL 1MVUA 5EG6C 1B9ZA 1MQRA 5L2KA 4WEMB 5DWUH 3KPTA 1PKQB 4WFGD 4WIQA 1W3KA 3HI6H 4S11A 2V2WA 2OSLA 3WY3A 3QO0B 5MENE 4TUOA 1MLCA 2EZ0C 4S3JA 4K7PX 3EYQD 1Q9KB 3QDJD 1YY9D 3O41B 1U41A 3HCVB 3MFFA 4MJ6B 3BCDA 1BP3B 2W0PA 4PYSA 4KK5C 3TV3L 1ZB5A 2WUBH 2EIEA 5FO7A 5HVGB 4YQXL 2OZ4A 1B2YA 2HVJB 3GSXA 2A3BA 4EK7A 1AXTH 2JJVA 1HHKB 2BVQA 4LOUC 4P3DB 2DT1A 2NZ9C 3OXRB 4QF1A 2CIKA 1T6WA 3PGFH 4RGNB 2BHUA 3GSNL 4YFDB 2NXZB 5H8DA 3U5UA 2WINA 4ONHB 4HP5A 5A3HA 3U7AA 2VC2L 3K2UH 4H0IA 2X4RA 4JANA 5GHWH 3QXTA 5DEFB 1PZ2A 4GKOA 3FRUB 1V03A 1ROWA 4I0KA 1KGWA 3MGOA 4DFIA 7FABL 4R7DA 2D9CA 4XAWH 5D6DA 3TBWA 5DC4B 5CLWA 5A2CA 3MUHL 5D2LF 5FYLL 4OFDA 5MENA 2P44B 4YEEA 3VMNA 1FA2A 4TUFA 1T5XB 4GKSA 2RGMA 1QRKA 3ZT7A 5IMLA 4N5ED 1KCVL 2AJXH 4PJ9C 1PSKL 4JM4L 4ACZB 5CINL 1T0NA 4QXGL 3C5ZD 1UACL 3EO0A 4P3WA 5FEBA 2FGZA 4G8GB 2JFEX 1R3LA 1IQDA 5DJ6A 3CPUA 4KI1A 3VW3H 2GFTA 1HINH 1JBJA 1DLHB 4J28A 1E27A 1FFOA 4OZIB 1HWHB 3MUY1 1XGPB 3O6KL 2NY5C 3L5WA 3L4VA 3TT3H 5JIWA 2I9TA 5FAAA 4QRTB 5GGUA 4PJCB 3K46A 3F65A 1NAMB 1GQKA 3BZ4A 5HGHB 3BD4A 4B7LA 2NY1B 2A9NH 1GH7A 3RDTD 5C2BL 2I5YH 3O9WB 4F57L 3HC0B 5IHBA 4LLDB 2WSPA 5C86A 1CICA 3GNPA 3UTSD 3A6BL 5LGJA 1RAMA 2DI9A 1MW0A 2V17H 3AI0A 1GGUA 3B6SA 4WFGE 3UJJL 8FABA 3CBWA 2ZOLB 3DBXA 4YZFF 4LCUB 2K9UA 3GNMH 1CFTA 5HDLA 3NCJH 4AEFA 2DQIH 2OS7A 2J4WL 5C07D 1LDSA 3UYRH 3QDJE 3SUWA 4PR5A 1MCNA 3EYUL 4OFYD 4D0BA 4PG9A 1UWQA 2C1PB 3ULVC 1M01A 5F1IB 4JQXA 4D0CA 2WP3T 3QG6B 5E6ZA 5JUVA 3O6FA 3IJSA 1ZHKA 2WNWA 3VFOB 3PWNA 4FN0A 4YDVA 4HZ7A 2VIRA 4WKAA 5IESH 3HFMH 1IV8A 2YEZB 5IOPB 3SQOL 5E56A 3LQZB 2FLBT 3FO0L 1ES0B 4W7UA 3MBEC 3QUYB 4KJWC 1FZMB 5FDWB 2DKUA 5F72S 4K8RH 1DP0A 2CEQA 4WNQB 2GTWB 4J7RA 1JNHB 4FQJL 4X6EA 2J8UF 2B5IC 2NW2B 1UM5H 1NARA 3FN0L 3DXAB 5GRXG 1M1SA 5EBGA 3SCMC 2ZCLH 4OD1H 3T0AA 4C7FA 2MMXA 1NL0L 3GM0A 3NCEB 3UAJD 1FG2B 2VXSL 4EE9A 4GSDH 4PJFF 5IJKC 4TSCH 1PZ5A 1BZ9A 3MJ6A 5KVEH 4BK5A 1DQDH 4BQ4A 5DRNA 3T1WA 2Z93A 3MUGA 1ZLUK 4P4RA 3W9DA 2VZUA 4DN3L 4UZSA 1MLBA 4KDVA 4UILH 4NN7B 2RJMA 2J8FA 4AD4A 1M7XA 2ILLA 5I8CB 3VILA 1QD0A 3U48A 1A2YA 1ZT7B 3ARED 2RQ8A 5HI3D 4HT1H 5I9QC 4KXZI 4ENED 5IW1B 3GIZH 1WC7A 1DSFL 5DVKA 4IRJC 5I1LB 5SWZD 4UIMA 1D5MA 1BQHB 4FQLL 1UKTA 3PABB 1IAIM 3ZO9A 2X4NB 4KK9C 1OAXL 1J1OH 4WHYG 3D69A 3X14A 4K9EL 4HFUL 1JV5A 4Z7UA 1K8DB 3QIUB 2WW5A 3B2VH 1E4WL 4M1DH 4WCYH 5D96B 5C0IB 4P2OB 1OP9A 5DMIL 3UTSE 3M1BB 2XTJC 4K7PL 5FL1A 3FB8B 1S7XB 3HZMA 4YUEH 4EOWH 2CBIA 3V8CA 4PRHD 2A77H 3VOCA 1RV6X 5E8PB 1FHDA 3U4EA 3K0WA 2DWDB 3BKMH 1YY8B 5F88A 2F7QA 5C07E 3NZHL 4AY1A 3OB0H 3D3AA 4ZD3L 1U33A 3QRFM 3EOAB 2YN5A 4RMSA 1FH9A 1QPXA 3ZO0A 1E4LA 2GK1A 3MXWH 1JGIA 4G43B 2X41A 4QCFA 5EPMB 4FZ8H 2UY7A 3O3EA 4XAKD 3P73B 1EEYA 4PLJC 3ULSA 1A8JH 2DTSA 4LASL 4OF8A 4KJYA 4F9JA 2IALA 1EMTH 1YPZA 5CMAA 3RVWD 2X4TB 1VFAB 2EH7L 1SQ2N 2GSIA 2HLFC 3P11L 2RAMA 3VNYA 2DAVA 3F4VA 2F53D 3WJLC 1G6RH 4XX1G 2IF7A 3KYNA 3IFPA 1FORL 2DSWA 2P48B 5KSBF 2BNQB 4N8VB 2B4CL 2UZXB 3RDTA 2BVPB 1QPPA 5DLML 1GL4B 1KN4H 2WIIA 1JD9A 1HNFA 3D2UD 3LOWA 4AIUA 3WF2A 4LQFL 5D7LB 4TSAL 5GGSB 4XMLH 5C8JB 2R0KH 5CPTA 1ADQL 1F4YL 5B22A 1CENA 4TTDC 3GBML 4QLJA 1RUAH 4OFYA 1QR1A 1SEQL 5ACMA 3P40A 4CJ1A 5ILTH 1HJXA 4NQED 5CEXB 2EXYC 3FONB 1H0DA 4MQXD 4Y4HB 2UWEF 3UDWA 1G7QB 4XCNA 3DHUA 4OZHB 4XP1H 4TTUA 3I6KB 4XP9L 1AGCA 2R2EA 5LGKA 1R3KB 2EDFA 5D2LE 4JEGB 5SWZE 4H1LH 1FNGA 4NN6C 5IEHB 2MKLC 5I18L 3GXDA 2ZKHH 2G9HB 2CKBB 3NTCH 1BG4A 3JWDH 4M1GH 3AIWA 1AHWC 3IKCA 4QNPF 3GKZA 3EBAA 5CXPA 5A8MA 4L4VA 4OJFH 4R90L 1Q0XH 2Q8AH 2AEPL 3C60B 1J1XH 1KQYA 1YEFH 3B9KC 3HPJB 4OGZA 1M6OA 4YFLF 1X5LA 2LFGA 5JR1H 2H32H 3S96A 2AGJL 4YHKL 5GS2H 1Z32X 2JIEA 4PRHE 1IT9H 2X7LA 5BS0B 1I8KA 2VISA 3TBVA 3DROA 4LSRL 3UZVB 4XNUL 5IGXL 4KKLC 4OTXL 1NJ9B 4JLRA 3QJFA 4OCMC 4S10A 3QUXC 5HI5D 3RKPA 1LVEA 1MNUH 3IDUA 2HYMA 1YA5A 3ZJ7A 5TPWL 1AFVH 1S5IL 5A1AA 5J6HB 2FJHB 4XAKE 1YMMD 3WEMA 3POCA 1F90L 5E6IB 3PGDA 4KQ4H 3NA4A 1WBYB 3BGFC 3DO3A 5ITFB 3K81A 4CD8A 3MACL 1EDQA 5SWZA 3OKOA 4FQXD 5A6SA 3NIYA 5ADPH 4H2CA 2F53E 1KELH 3VFTB 3D1MC 2JCCB 3MRLB 5DQ9A 1IBGH 1ZS8A 5E8NB 3MBXL 4UDUA 1V7ML 2OL3A 2QV2A 5J8OA 4OFKA 1V02E 2J7CA 5GRUL 1EAJA 4ZE5A 3UG4A 3RMEA 5SWSD 1IAIL 5L0QC 4E8CA 3EAKA 7TAAA 4QWWD 2Y6SC 1HEZB 2IBGA 4PRHA 4OLXH 1ZSDA 2HTKC 3ABZA 3UJTH 2X2HA 4XC3L 3PL6C 4JDVA 2J8UE 3EIFA 4OUUB 1TJIH 3REVB 3CZLA 4MJID 1UG9A 1ZHLB 3W37A 1NOWA 4UUJB 5IK3B 4NQEE 3HZYA 1SBBA 2ERJB 3KPPA 2ZOKB 1MRDL 4PJFE 1G1YA 4WO4B 3IS1X 1BAFL 3ZDZF 4G8EB 4ZS7H 2W9EH 1NFDB 2R4SH 4BH8B 1BZ7B 1F13A 1C16B 1FO0L 2GJZB 3ARTA 4DGYH 3PQYA 4ELMF 1OTTD 5IVZB 2H2PD 4MCZB 4XXCC 2WM0A 1KG0A 5AAMA 2AI0H 4ACYA 3WFEH 3W5MA 3KYKL 5IBUG 2F53A 1V6YA 4TPRH 4AIZA 1A21A 3JXAA 4O2CA 5DJDB 5GRVK 2YHGA 1A9BB 3PWUB 3QI9D 4LLYA 5F6HI 3WFHB 1ZTXH 1RY7B 2FO4A 2P5EA 1GIGH 3GKWH 1V02A 3F7PC 4DGVH 3TO2B 4M8VA 5TDOB 3D2UA 5D93B 3TO4C 4JVUA 1R46A 4NJ9H 3FO9A 4NM8H 4OZOA 4HIHB 1T5WA 2IAMD 2OK0H 3WEOA 4J3UA 1U8HB 4OAWB 1A7OH 3MLSH 3PP3K 5IVOA 5LXGH 1LK3L 3FN9A 1S8DA 1BOGA 4PJFA 1H3PL 1A7NH 3ECBB 1YMME 3BD5A 1MJ7H 5IG7A 4EVNB 2X09A 4WLCA 2XGIA 1CL7L 2ATPB 2RB8A 1BM3L 5FGCE 3O6LH 4YXHL 3K8KA 3WIHH 1CFQB 1EK3A 4KK5D 3MLTA 3D25B 3JV4B 4Z78B 5TDPB 3NCYP 4LSPH 5DD1L 5DFWH 4OI8A 3BUDA 2IH1B 3WN5A 4G6KH 4OQ1A 3LKOB 4FMFA 3NSNA 4HUVB 4W85A 4FABL 4X98A 5HPCA 3MLYL 4DCQB 1D6EA 3KPLA 1UM6L 35C8H 1VF8A 3EYSH 1W8NA 5SWSE 5HHNB 5E8OA 3ZMRA 3W39A 2F19H 2GJ6B 3X17A 4PLKD 2WWKO 2YUZA 1X5ZA 2ZSWA 3OJ2C 5B3JF 3IJYB 2XVLA 4K8RC 2PNDA 4LSSH 5BZWA 5KSBE 5JW3H 4BF7A 3E8UL 4HS6A 1XIWC 1IGYA 4MJIE 2Y5EA 3OWEA 1I9JH 3P4NB 1WE5A 3L3KA 2UY2A 1P5UA 5HY9B 1Z0NA 3O4LB 1MCDA 4X6CF 5ALCL 2EJ1A 4S1SH 2CK0H 1FHLA 2IG2H 1U6AH 1YMMA 1LO3H 5FUZL 3BRDA 4GW1B 1G0DA 2MCPH 5B8CA 4XZUA 1S7VA 1IQWH 4GRMB 1IGCH 2X44D 1G7MB 5IW3A 4Z0BH 4PJ9D 4HK3N 1K6QL 4K2UL 1TZGL 2OJZL 4FQXA 2JB5L 3EYOA 2FWOB 1MUJB 3QIWB 2UWEE 4NQUA 3BZEB 5GSRB 3WFBH 5L7XH 3M45A 3AMDA 3D3VD 3OKYA 3WS6A 5FM5O 5DJ8A 4Z7VE 1UWUA 5JBDA 4OV5B 5TGBB 5CEYB 1DWFM 1RZFH 1XYZA 4MSWA 4Q6IB 1JHLL 4PGJA 1SY6A 3K7UA 4B53A 1XH2A 4KK6D 3QUMB 1H0IA 2ZCHL 3GBNH 4QNPE 1WZ1L 3VA6A 1NDMA 3MNZA 4AY0A 3QUKA 4CNIB 1XGZA 5BVJB 3S6TA 4GFTB 5B38B 3IVKA 5KSBA 2B1HH 1A0QL 4Y16A 5EC2B 4MJIA 3DNKA 3FQRA 1KTLB 5A69A 1C12B 1MQQA 1WCQA 4CVXA 3KLHC 4LLMB 1FHGA 1I3GH 3FJTA 1JXKA 4JGUA 4PRID 4KVCL 1ND0B 4G6FD 1BLIA 1UB6B 2AKRB 4PY8I 1PZUB 5BMFH 1DR9A 4RIRA 1KTDA 3F8UB 4NUGH 2V6HA 2QADC 5KS9B 3ZTNH 1XRVA 1GPOH 1OARH 4KJQD 1EFXD 1RZJH 3QFJB 1SBSH 5E94A 1QVOA 4B0MM 4LHUB 5KSAD 4Z7VA 3UYOD 1WT5C 4P5KB 3WEXA 3MBED 1J10A 4KJWD 5I16B 3W28A 4PTMA 5GSVA 4A2LA 5EO0A 4CDHA 4CD5A 3VO0A 1VFBB 3UPRB 4XMKH 2Y5TB 1XGQB 2IAMA 1EZVY 2JEQA 1AI1L 4MB5A 2AQ3A 1RZGB 3SCMD 3TBYA 2IJ0C 3IDNB 2OLDA 1T22A 4G7YL 3G9VA 2AXFB 4PTTA 2GSJA 3FZUD 4ODUA 5D7SL 1GZJA 3B8SA 3AY4A 4PRNA 3MV7B 3WL9B 4R96B 5IROC 3TJEL 3X13B 3A23A 1F6FB 3MCKB 3C9NB 4X7TB 5ESVA 4X7DC 1MJ8L 4QY8A 2CESA 1NAKL 3G5YA 1KXVC 1MWAH 3L3OA 1BX2A 4MAUH 3EO9L 4U1JA 3WMSA 1JUFB 4ORGA 2NY4C 2J7LA 4O9HL 3MLWH 3G5XB 4HU8A 5BV7B 3ZDZE 1MCOH 3D3VE 3VJ6A 2DJSA 4KRTA 5BOZG 5JHDB 1T21A 5I78A 3TIDB 4YGVA 4FQPA 1LHZA 3DURB 2XSAA 4ELME 4KXZH 1QFWL 2HWZH 2G41A 1NOFA 5D2NB 3SDDB 4PJXF 1QR4A 2XZAH 4HXBH 3FAWA 3EJZD 2F5BH 3Q0HA 3SEPA 3JWDC 4NSBA 4YBLB 3QQ3B 4RWYL 4JG0L 1INEH 2JF6A 3MLRH 1K4CB 2YPLB 5DF0A 5DD5H 1CFSA 4EUPB 1FZOA 2Y07L 5KVGL 4JREB 3C08L 3KYOA 1FGNL 1I1FB 4WGVB 3OXSA 3AM8C 5C70A 4F37F 4BYHA 2HISA 1RJYA 2WBKA 3ARYA 3QHTC 2HJFA 4PRIE 1P4LA 2YRZA 3QFDB 4PB9H 1E72M 1UZ1A 1MFDH 5B4MD 4M80A 4AM0A 3VI4F 4P9ML 3OGOE 3QUZB 4OCXL 3VGAB 1AC6A 4PJ9A 3GSNB 1W3LA 2EEXA 4UB0L 3SDCB 4ODTH 1WKYA 3AJ7A 1QSED 1J01A 3ARUA 2YWZA 4HX1A 4CL7A 3VIHA 2X4OA 3D3VA 4KPHH 3T0ED 1VFUA 4QRPD 1X4YA 1MHCB 5HI4C 4U1SB 2BOBB 3G6AB 5EZIL 3DO7B 3IDXH 2HLFD 4P99A 4WRLA 2FGLA 4JY5H 4NP4H 5A6JA 4TNVF 2ICWB 1NKOA 2JB6B 2GAZB 2RBLA 3T3MF 5A6MA 4X9FA 3OG6B 3IDMA 4U3AA 1S7QB 2P47B 4M43L 1HIZA 3H8NA 3EJYC 5LGHH 1JFQL 2Z92B 2UWFA 5F21B 3HE7B 2IQAB 3E6HA 4HZ8A 1P69B 5B3JE 3O2VH 1KR0A 4PRIA 2AAVA 4F33A 3KPQA 2BVEA 2XZCL 2NYYC 4XPFH 1E4XI 2A3HA 5CZKA 1BD2D 2RIKA 3V4PL 2VRAA 2LVEA 1JYWA 2EDTA 1LEKB 1VEOA 1BFOA 4JN2A 2EXYD 4LVNC 4X8JB 6TAAA 5EU6D 3WIJA 2D31A 2WUCL 3TCXA 3CVHL 1NDGB 3W0WB 5DJXA 3FQTA 3DMMD 2VDNL 4ZDHB 4HV8A 3CSBA 1A1OB 1KC5L 1S9YA 2O9TA 2EPNA 1FZJB 3MBEA 1TTFA 3MJGX 4D3CL 3L1OH 3HAEA 3K4AA 2AV7B 5IBTH 2G4FA 1JNDA 3UP1A 3GH7A 5I19H 1KJ3L 1JGVL 3FQXA 2NY6D 1RUPL 5IW6A 2HA1A 1I3RB 2CDEB 3CHDA 3R1GH 3AROA 4ALAL 3MXVL 5FYKD 3SCMA 2R8SH 3BAIA 3E2HC 3FXYA 4GW5A 1T3FB 1Q94B 3B9VA 3ZKNC 1C8QA 5I3DA 1DL7L 4RE2A 4JQIL 3O9NA 3VD5A 5BRZA 3A3HA 1MCBA 3STLA 2CLRA 3V6FB 1QLEL 5FOJA 4UTAH 2WMIA 1NBVL 4OM1H 4BK4A 4OZFA 5EU3A 1HQRB 3H7LA 3UO1H 4IJ3C 5CILH 2Q7YB 2Q8BH 3TC9A 4QCIA 3V0AC 2PYFA 4GRWH 1JHKH 1OAZH 3I50L 1VFMA 3MRQB 5EBLA 2E7BA 1IGML 4E2OA 2HFFB 4X4YA 1QSEE 1C1EL 4DOHE 4NNYA 3AAZB 4IOIB 2ICWI 4APQB 3IU4H 1N0XL 3T0EE 4QRPE 4R7NA 5ETUB 2BOCB 5IKCA 4YHYC 2H6PA 5IFJA 3HMXL 3JSSA 2FYVA 3W26A 3I3BA 3NJ3A 1IGIL 3AS0A 4DUWA 1HZHH 5HHMB 1A22B 2NTFB 2BJML 2WMHA 3HE6B 1M05A 1LDPL 2ZXBA 3NA9H 3I75A 2YPKA 3BHBA 1A7RL 3KJ6H 5J13B 5DEGA 3HUJF 1T7XA 3ECQA 1EQCA 4H26B 2Q86B 4JPIA 3SY0B 3P4MA 1CZ8H 1T4KA 2VLJB 2G75B 1RUMH 2XOTA 1MJJB 4KUCF 3C8KB 4L5FH 1T7VA 3D85D 4KI5C 4OZFG 5DUBA 1NC2D 5T3ZD 1TR1A 1I3VA 3SKOA 5IV2A 2VQ1A 2X05A 3S3PA 1BD2E 3E0GA 3VUPA 2JK5B 4KMTL 5F7DA 1UVQB 3UBXB 1XR8A 3VFMB 3D5HA 2F8VA 5EU6E 4NJAH 1GZPA 1T2QH 4OV6F 3MJ9H 4KC3B 2X4PA 1QSEA 1LP9B 2NY2B 4HC1H 1NCAH 1NMAL 5CJQH 4XBGA 1HH6B 5FECB 4P3CL 3T0EA 3WDJA 3VIFA 2O26U 1U3JA 3EFDL 1K8IB 3UTPD 5K59F 2YFNA 2B2XH 5L2JB 4Z2LA 4PJEF 2QSCL 1NBYA 4X80H 1QI5A 2B31A 3WJLA 1QPKA 4PEEA 1MRCL 2MTPA 5GNZA 4YAQA 4M61A 1IM3B 4ZUVB 2D23A 2DIJA 4DVBA 1F2XK 4PRAB 5DFAA 2OM5A 4H25B 1TENA 4MGXA 3KJ4C 1WITA 3OKMB 4POUB 4GW4B 3A24A 1INDL 1W0WA 4RMWA 4Y2DB 1D5XB 5FYKE 2K3TA 2DQGL 4ATLA 3QULA 4KTEL 3PN8A 4PJXE 2R0LH 1R0AL 1CLVA 3EDFA 3EDJA 1U3ZA 1W72L 2CHOA 2DWEB 1IAKB 1ITCA 3WF0A 1BD2A 1DBKL 4QDMA 1QW8A 4UNTA 2DSKA 5CPSA 1J5OL 4HH9A 3APGA 3UTQA 1X7QA 4IRSC 1T20A 1KTRL 3NN8B 3QCVH 1SMDA 3FB7A 5DI8B 1YQVH 1TZIA 4YE4H 3VIKA 3OG4B 3H0TB 1G7JA 3BPCA 5H35A 4MAYD 3DSFL 5HHVL 3RX5A 3U2SB 3VI4E 2O5ZH 4JB9H 3LN5A 3MYZA 4NHUB 5DMKB 4UT7L 1PY4A 5I2IB 1E6OL 1ZBVA 4MAVA 4D6JA 2OMBA 2AJYH 4A3HA 4X6BA 1S3KH 1NCCH 1BBDL 3BUQA 3LXAA 4MA8L 5CEZH 1T66C 1DN0B 3MRDB 1RZJC 2I60L 2NXZC 5BVPH 3OPZH 4WW2B 2IADB 1OSPL 2P43B 1HJUA 4WHTB 3VG9C 2B0SH 4UT6H 3UBXI 4M9PA 1U92A 5F71A 4PBVC 4PPTA 3SQBA 1OP3K 3S88H 2ZWLT 1B2WL 3BAWA 5T3ZE 3ARDD 4MVBC 3IANA 3T3ME 5D6CB 4JO3H 4EXKA 4MXWH 3CPLA 1XIWD 4YBQC 4P2RE 3VFPA 2EDJA 2MWCA 5EIIA 5E2JA 1I9EA 3NDYA 1WTGT 1TTGA 2F58H 1FH5H 4FMVA 3G5ZA 5EZLA 2PWFA 2GI7A 4KUCD 5E99H 5K33A 4U1MA 4I8DA 1BYBA 2NW0A 4NZTH 1F42A 3C8DA 4NWUH 3TFKC 2X40A 3UTPE 3T8XA 4ZAKD 1E6JL 4NO3B 5DJAB 3W82A 1KXHA 1HXJA 5D1XD 1HHHB 3V8OA 3BAEH 5INCB 3N17A 3U4BH 1B4RA 1TPXB 3GHBH 5ITBH 3ARGC 5JMRA 1RK0B 1PG7X 1NEUA 4NUJB 1JNEA 3RU8H 4R8WL 3L7EB 4Z7OE 4ZO8A 3QEQD 2FJGB 2EYSA 5D7JC 3RDKA 1N8ZA 1GAFH 3D85A 4JPKH 1NC2A 3V5HB 1R3IH 3PL6A 4YDKH 1U8QB 3TIEA 4U0RB 1JHTA 4MJ5A 5ABFB 3WH9A 2OP4H 4P2RA 5F3HA 4R4ND 1UA3A 4M7JH 4BFIB 1KGUA 4PY7A 3NH7H 4UDTB 4EI5D 1ZHBA 1XGUB 3FT4B 4J3OC 4G42A 2O5XL 4O51A 2ZUVA 5BRQA 5FHAH 4X0NA 4HWEL 1CECA 4LNRB 2VAAA 3DRQB 1SYVA 3OV6A 3MMEA 2G60L 3NCCB 4PJAB 1J88A 4XXCA 3RVXD 4MNKA 2QADD 1L0YA 2CR6A 2H8PB 3RX8A 4FNLL 1FZKB 4NQVA 2KZ1B 1CR9H 4TVPD 2CLVA 1DQLL 3IDIA 4GQPH 4NQCB 2BHZA 3V6OE 3MRNA 3MU7A 5EOCH 3SE8H 4PG2A 5F97E 3PWJA 2WMKA 4HA1A 2PBGA 1JAEA 3JTSA 3P9MA 1U93A 5E2VH 2ADFL 2C7UA 4KY1H 3MQIA 3HHRB 4D9RD 4LVEA 1U8KA 2P45B 4UQCA 5C7XH 1J05A 3BAXA 1B0GB 5DMGC 4Z18A 2D73A 3WELA 4HKZA 4BSVA 4PGDA 2E3ZA 4PS4H 1CFNB 1RU9L 1UR0A 1JCKA 4OSUH 1MXGA 3BN3B 1PD6A 4V2XA 1KYOJ 4TUKH 4JAMB 4J1UB 1A64A 4P5TB 5LCVH 4AYFA 1KR1A 5TQ2L 5IHZA 4MD0B 3U1SH 3BWUC 4NN7C 1NEZB 1EFQA 4PBXA 3W11D 5DTFB 1BVLA 4F58L 2XXCB 3UESA 4G3YH 4Q74A 1U8JA 4M9OA 1R85A 4UV7H 5ENWB 1XCTA 3QDAA 1Z0MA 1EIBA 1YUHB 3VFWA 3A47A 2EBNA 3HR6A 3VH8A 3FY1A 4CW1B 1GYAA 3WH6A 3LKPB 1OSZB 1YNTB 3FCTA 5HHPA 3RJQB 4PRWA 3FMGL 4N0RA 1LQSR 1E6SM 1J12A 1ZANH 3HS0B 1G0YR 1DUYB 5JDSB 2ITCA 4X9BA 1O7VA 3EGSA 2ARWA 2KUTA 4BUHA 2XM2A 1P4IL 5D70L 5K59E 3LD8C 3MJ7B 1Z9OA 4PJEE 1I7TA 4LARL 2AABH 2JF1A 4P59L 1I1AB 3UTTB 4PJIF 3QEQE 1HOCB 4C57C 5HNNA 2FCBA 4R3SB 4Y0GA 3ARDA 1WUNT 1IM9B 3NIFF 3VFVA 1X5GA 1NCDH 3FO1B 5E9DB 1F3JB 4PP2A 2XWDA 3WKMH 1XIWA 5LAXA 1NPUA 4WV1B 5ID0A 1DFBL 3PWLA 1E56A 1IAII 5IB3A 1AXSB 4N9GA 5AYUH 1HL9A 3UROR 2PWGA 3Q1SH 4HOZA 2WWKT 5CD5D 3WD3A 1QG3A 3GSRB 3OR7B 4JFXB 1CLYL 1GVIA 1LNUA 2H26B 3C2AH 3VRJB 1DVFB 2VDLH 1IL1B 5CZVL 2NY3B 1N2RB 3VH8G 3W29A 3LZFL 1GHSA 5HHOD 1EUTA 2R23A 5D1XA 1U36A 4JFOA 1BBJA 4FXKA 4TVPE 2J79A 1IZJA 1U58A 2Z8WC 4MADA 4JFZL 4LU5L 5MEOA 4ZUSA 3KVQA 3DX9B 3UCRA 1BFNA 4CVUA 2VITB 3H9SE 5JIIA 2QTEA 1GONA 1HWWA 5I8OH 2DTMH 4S2SA 2HJLA 4PJEA 1YC8A 1VRXA 4D9RE 4X0VA 4GO8A 1QNZH 3QEQA 4KRLB 5CJXC 1JGLH 4GBXB 3QDHA 2FR4B 5DHXB 2YXMA 3DI2B 1ZA6B 1OLZA 4AEHL 2VR4A 1Q6DA 2W9LA 5CSUA 3EJYD 1UQSB 5JW4Q 5D1QC 3WY4A 4HZAA 3OAZK 4EI5A 2ZG3A 4DZBA 1CNVA 1RUKL 2NYYD 2A38A 1NBZA 4GQ9L 1P7HL 4F37K 4KRPD 1MCJA 1FNEB 2C3GA 4KAQH 3BUBA 1PYWB 2B20A 3ZE0F 1PG7L 2EACA 4ZOBA 3SURA 3W5NA 4O00A 5EB9A 4NKIH 3PDDA 2NNAB 1H3XA 1AKJD 1CL7I 2VABA 4X4ME 2XPGA 3EMCA 2DIEA 2OX5A 4WI3A 1WT5A 3VFNA 3H9SA 3BW9A 3IJ8A 4PJ8D 4GOSA 1LQ0A 2EO9A 2BC4A 4B7IA 3QDMA 3IU3A 3MRPB 2PN5A 4C58B 1UD3A 3MLUH 1YEKH 3U30C 2AK1H 5MERB 4NO5A 1KBKA 4DUVA 3RVVD 2UUDH 1UEMA 3VFGL 1X6LA 2WXDM 4DZ8A 2BDNH 1WBXB 3NFSL 2DLHA 1FVCA 5DK2B 5JW5A 3S34L 4ISVA 4TNVK 4X0KA 5I1AB 3ZKND 4YXLH 4PN2A 1RURL 2A0LC 3EW3B 4FP8L 3U82B 3AZTA 1I3UA 1P6AB 4ZPTB 5HYJD 2NX5B 4UFHA 4QHKI 1D5IH 4JQVC 4LSVH 5CGYC 3TVMC 2FX8H 1KXVA 5HHOE 3QIBD 2DOCA 2Y8VA 3MGTA 5ESQA 3BX7C 3NGBB 3JV0A 1U8LA 3VMOA 1WAAE 3QJHB 3IETA 4GINA 5E1AB 3KR3L 5FB8A 4X4MA 1MHEA 2HH0H 1UA6H 2C3VB 5GS0H 4JAWA 2OYPA 3MRBA 2X2JA 4JFTA 2OR8A 4H1LA 4L4JA 5FO9A 3T04D 3PDOB 3ARFC 1PSKH 4JM4H 5CINH 1WGOA 4A6YL 1ETZB 1U8IA 1VFFA 3TA3C 4JZ5A 3O8XB 3M07A 1KNOA 3BIBX 5L6YL 2ZX5A 2E9LA 1O7DC 2X1OA 3AM8A 4XPAH 4LCWB 5DJYB 1W8OA 4NPYA 3IXAB 3BKCL 2ESVD 4JFVA 1HSAA 1PX4A 3MV8D 5DD3L 1CBVH 2MPAL 1MCLA 3EJRA 4HWZA 2Q8XA 4R2GC 1QEWA 4WO4C 4XWOD 1FNHA 2J12B 3AMCA 2YPVL 3S5YA 1SZNA 3WH7A 4GUPA 2V5MA 4R0LB 2NCMA 5HHOA 3BLBA 4YHOH 4K94H 3AIEA 1KWKA 2O92A 2NXYB 4QHMB 3SJVB 4OZIF 4ODVH 4A4AA 5C0AB 4BZ2H 3QZWB 4PTXA 1WAAA 4M5ZL 3OQ3B 2BNUB 4PJCF 4TNWK 2J4WH 5EBMB 3RY6C 4H1LG 3BDXA 5I1DA 3EYUH 3WFCL 3U0TB 2FD6L 1J18A 2FH8A 4LPWA 1E6PA 3DUSB 1EHXA 3CMJA 1TCRB 1JYXA 3MLPA 2P49B 2WWMC 3GB7A 3GFUA 3DVNB 2QF8A 5EH1A 5EDXA 4RMVA 2R0WL 1R8LA 2R4RL 1U3YA 1TZHB 5E1HB 2ZUSA 4FTVA 3LIZL 5CHNA 3OMZA 5DJ2B 3SGDI 3SN6N 4PJIE 5SWQB 1FGVH 5DT5A 5HYJE 2X70B 3ROLB 1H3GA 2X1IA 2J88H 1F6LL 2W07A 3NIFE 4LCCC 4TRPL 1PLGL 1L0PA 4AQOA 2Q6WA 4H0GA 1LWRA 4RAHA 2IPKA 4UQBA 3FN0H 1NUNB 5J1SC 3S3SA 4MX7A 1LEGB 4JFFD 4IRSD 1W3JA 1MAJA 2XWTA 3P0YH 4JE4B 4JZJB 1WEJH 4HXAH 3OKDA 2CO7B 2XVKA 1I7RB 5ANMB 1GOQA 4BQCA 1IZKA 4QHNA 3EHBD 4DN3H 1VERA 4OCYH 5BXTA 3OHXA 4C83B 4PJBA 5T1MA 3HI5L 4JIEA 4PJ8A 1AD0B 1XH3A 4LF3A 2GUYA 2YD8A 4X5WB 2P8LA 5F7FA 3QSKB 1G9ML 3QEUA 4RGND 5DRWB 1X5IA 2NXZD 1L9MA 2XIIA 4L9LB 1QFWI 1D6VL 2CDFA 1QLRA 1N64L 5HTSA 3BUYB 3BP5A 2R39A 1LK2B 3VG0H 2ESVE 5DJCB 3MV8E 2YRPA 3TBSB 4PJIA 2X0HA 1WBZA 5HYJA 2GK0A 5CIPH 4DKDC 2ZSVA 4MZ2A 1KEMH 1Q9OA 2E3VA 1NGYA 5FGRA 3RA7L 1CD1B 5IFHH 1VFOA 1UJTA 4Q58C 5DO2C 3DOSA 4MHHI 5ICZA 1Q0YH 4EZMA 1JF1B 3OB0K 1GZQB 3VRIA 1KF9B 4FFWD 3STBA 3MRMB 4OOZA 2DDQL 5FK9B 4ZD3H 2LQRA 2VR9A 4G8GD 2CD0A 5EO9B 3GMPB 3MCLL 3WIHA 4OZ4A 3C8HA 3RWHB 1ZLWK 1UD8A 3ZE0E 3HB3C 2ED9A 1BQCA 2BFGA 5SV3A 2XA8H 3BYTA 1EHAA 3RILA 3DETC 2QR0B 4HZLA 4KJPD 3ARGD 4HPOL 3MRCA 5EORL 4NXSA 1YEJL 4LASH 4N0YH 3U7YH 4W7WA 1KBGL 5D7IA 4XNZC 4XCCL 1OAYL 4LBEA 2VRJA 5EU7C 4LXFA 1HK6A 4PYGA 3O9WD 3RNKB 5J6GB 3U83A 5ACLA 1CT8B 3LSOB 5FHBL 3MV8A 3BUPA 1VACA 1FORH 4JDTL 1PKQE 5I76B 1QA9B 2Z31C 4P46C 4DKFH 4QEGA 5DLMH 5DUPL 2DQUL 4K3HA 3ZT6A 1A4JA 4JFFE 1RULH 1TQSA 3HC4H 2QHAA 3DX0A 5TE4L 3QHNA 3BT2L 4PREA 1AXIB 4OFPA 4NC1E 1ORQA 2CHNA 2KH2B 3ZKXC 1HT6A 4BFBD 1SJEA 3GBMH 4XBEL 3W6MA 1XF5A 4XCFL 4E42B 5D9SA 3MPCA 2EEBA 1JPGA 5AG9A 1FP5A 4MXQC 4W87A 1XF3B 1L6XA 3QUYD 1U95A 3OAYH 4RGNE 2HT4D 1QSZA 4JDZB 4ZUWA 5GRWA 5F6IB 2YKKA 4HOWA 1JPTL 3CZSA 2DQEL 4HWBL 4PRBB 1D2KA 5MEPA 1Q9WA 4Y5VC 4GMSL 1FFRA 4AIEA 4YHNB 1MQPA 3BP6A 5FUCC 1T04B 5BO1L 4YWGH 4P23B 4JG1H 1RHFA 3BP7B 1MHPL 4KU1A 4PJGA 2WMPA 2OWXA 1OL0A 4RNRA 3S6CA 5DMGD 4DN4L 2V3DA 4R90H 4OZHF 2AEPH 3ARXA 4X6FA 1OTSC 1BVZA 2EDDA 3QO0A 5F9JB 1X3DA 3VE0A 2HKFH 2R69L 3PBGA 4YR6A 1Q9KA 1CU4L 4JFFA 4IRSA 5K9KB 4WWKB 2KBGA 4MJ6A 3U7BA 4YEFA 1MREL 2E7CA 2YOCA 4Y5YB 1E6RA 4J6RL 3QQNA 4LSRH 5ICXB 4NKQB 2Y1VA 1CLOL 5D71H 1CLZL 4G8GE 1AQ0A 3BP4B 4L4TB 4CD6A 4HFWB 4AMKL 5IMMB 3ALPA 1T0OA 4WU5B 1GGBL 4OZIE 5A2KH 3KDMB 1W72B 1OQXA 4HF5L 4NZUL 5EOQL 2TAAA 2ED8A 2DM7A 4HA3A 4FQCL 4PJCE 2X2IA 3IJ7A 5JTWA 4ONHA 2VWEE 3MACH 4FG6C 1U8PA 5HJ3B 4FZEL 2JTDA 3O3BA 3C09B 2LAGB 3QIUD 2ZUQB 4U6YB 2BFVH 5DEFA 4UOJA 1BLNA 3MNWB 3MBXH 2A1WL 1RIHL 3JUGA 1V7MH 4HZ6A 3FT3B 5DYOB 2EXWC 2P8PA 4YHMH 4NFCA 4PB0L 1M7DA 3A5VA 4Q7NA 2YD9A 4NRZA 1YNKL 4MWFA 4O5LH 1BWWA 2EDRA 4LSQL 4RBPK 5HGBA 1G7PB 1KCSL 2V5YA 1YEDB 3VWJB 1NP2A 3SPVB 3CLFL 2JCCF 3RNQB 1RFDH 4ACZA 3RZCC 4FLOA 2VX6A 4RAUB 3CTTA 4FQ1L 1B30A 2YLAA 4HAGA 3RWJB 4MDIB 3ZL4L 4I2XB 1UFUA 4UQ2A 2GY7B 1NMBL 4M4RA 4MA1C 3S36H 1KCRH 4NYLA 9CGTA 2ID5A 4AIOA 4PCSA 3QRGL 4W4OA 3ULUL 5IF0A 1V0KA 4W89A 5CCKH 4Z2HA 3ARGA 1A4KA 3B9EA 3G6MA 1FO0H 1OD8A 4PV9B 1I8LC 4PJCA 2DSUA 3AYRA 4D6HA 2BNQD 1KXTB 5H37H 3D39B 3MRKB 5AWNL 3OZOA 5C0CB 2RFXB 2Y2WA 3HC0A 4LLDA 1I1YA 4X7SL 1VGEL 2EIZB 5KZ6A 2P5WA 2W60A 1XGRB 1MCPL 1NFDF 4PIRF 1AGFA 4QTHB 3LDBC 5D7LD 3DX3A 4GAYB 3QA3B 3MRGB 1ZVSB 3IJHA 3WDPP 2EDXA 2VH5L 2PB1A 2B39A 2C1PA 1WVZA 3QNXB 5F1IA 4OCWL 5CD3A 4NCC1 3QG6A 3U7WL 5IB2A 5IVXB 2X10A 3MKKA 1CK0L 3VFOA 3ORJA 4G80A 3AU1B 4WENB 3NSXA 5A2IH 5FV1L 2J7DA 2LTQC 2YEZA 5IOPA 4KFZC 3ARPA 4P48A 5H2BB 1TJGL 1LK3H 3LQZA 4K94C 1FN4A 5LWYL 3X11B 1CD0A 2EDQA 4M7KL 5C2UB 4Z0XB 3CUJA 4WNQA 1FLRL 2GTWA 4W5ZA 3RGVC 5MP6L 3MNVB 2NY0C 3ZIZA 4XB7A 3O0RL 3C60D 3BXNB 5KEZA 3KLDA 2EQDA 2WHJA 3HLAB 3CUFA 5I66A 1LO0L 3LMYA 4MNGB 4NZDA 2FH6A 4HUNB 3ZJ6A 3BPOC 2YMXL 3RKDD 1Q6FA 3WQVA 3P9LB 2FSEB 1TQCC 5BS0D 3ZHDA 1OM3L 3WO4C 5HD8C 3MLYH 2XN9B 4UIKL 1IAMA 1NLDL 1UM6H 3QWOA 1BPLB 1JWSB 4N9OB 3LH2H 1NGQL 3BESR 1EGJL 4BH7B 3KXFB 5HGDB 4NNXB 2DQFB 2XYLA 5CKAA 2CIIA 2Z1KA 2PF0A 3E8UH 2O9RA 5AD0B 1ZT7A 5FCZA 1OB1A 5F6HJ 3MX0A 2BNJA 3MCG1 4HKBB 4CMHB 2OTUA 1HDMB 5CBEA 3TYGL 4K3DL 3CK0L 5I1LA 4WW1A 2GIYA 5ALCH 1BQHA 1CDIA 1DEEB 4PGBB 1QNOA 2QQNH 4IISA 1Q72H 3PABA 1KN2L 3NABL 3D50A 3N04A 3SGKC 2BNQE 3AIQA 4M5YL 2PO6B 2BMKB 3ARBC 5FV2A 3QIUA 4PMVA 3GSOA 2FL5B 4DWSC 3M1BA 3MLXH 3C5SB 1S7XA 3FB8A 1KJ2L 2YJQA 4YDJB 1I75A 3UMTA 4MA7H 2ZUMA 1T1ZA 5JXAL 5EC1A 5D7LE 3TZVB 4PRPB 1BREA 3POHA 1JHLH 4XPTL 5HHXL 2X4UB 4HCRL 2OYKA 4TULL 5I1GL 2J5LB 1ZLUH 1EVTC 3PDGA 1Q9LB 2ZCHH 4YIQA 4ZSOB 4WO4D 2FB4H 1FCCA 5EPMA 1NFIB 4I48B 2N7AA 1VBUA 4OZHE 1A0QH 4BSWA 1G7LA 4U6XA 1LLOA 4HIXH 3O3AB 4Z5RA 1BQHG 3SOBH 5LA1A 1YEEH 3WMCA 5JOEA 3HG5A 3PWPA 2X4TA 3VXUB 3GO1H 1HKLL 3DHPA 3GMOB 1MPAL 2FIRT 4OOUA 1WFTA 3GGWB 5DT1L 4N8VA 2UZYB 1GGIL 1NCWH 5FA3B 2EDWA 4HKXB 1VADB 4CU6A 4U05A 2PYED 3SDXB 5CJXA 1WICA 1HTYA 3F7VB 4M7LH 5BS0E 2G3JA 5BRPA 4PMXA 1XF2B 25C8H 5AG8A 1CCZA 1W1PA 5D7LA 4DAGL 2WZEA 4XCEA 2JELH 5D1QA 3RTQB 1K4DB 1JWUB 2D7QA 1OBAA 1F6AB 1G0XA 1MIML 1DBBL 3QEHB 1HXMB 3HNVL 5KS9F 2B1AL 2H9GB 3SGDH 5CEXA 5ABHA 3FONA 2CDGB 4NM4H 2PXYB 2FZ3A 1G7QA 4HUWA 1UH4A 4RQQB 5JDJA 2BZDA 3OKKB 4OZHA 1AI1H 4D6EA 3F5LA 4IOSD 4G7YH 3CXDL 4ZXBB 5IB1A 2OZ4H 5D7SH 4XP6H 5IVNA 5AC4A 4KHXL 3LPGA 3F12A 3G6JB 3WNNA 1W1TA 2G9HA 2CKBA 2HFTA 4HC1A 5E0QA 3C6LB 2JCCE 2IFGA 3ZHKA 4UV4L 4N8VG 1RJZB 1MJ8H 1P7QB 1QFPA 3IDJA 1NAKH 2IGFH 3N1GC 4C4KO 4F9LC 3KGRA 4ZODA 4WGWB 3HPJA 2WCGA 3KYMB 3A6CH 3WF3A 2HRLA 3GMLB 5AAWA 3B43A 5T3XD 2GJ6D 4OCSH 2MFNA 4IHOB 2VDMH 4WUUA 3AOFA 4LYQA 3LS5L 3BVUA 1FDLL 1QFWH 3FOMA 4GMTL 4Z77B 3PHQB 1DCLA 1TVBA 3SO3C 4QLLA 4PYHA 3UERA 4BQ6A 4F15C 3O4LD 4RWYH 4JG0H 4JQVA 1N59B 3FQWA 3WD5L 1NFDE 2MJWA 3EYFB 5KVGH 2H3NB 1XH1A 3C08H 1WBYA 4LPYA 4JY4B 1FYHB 5ITFA 2G3MA 1U42A 1MYRA 1Z9SA 2CIPA 5IBLD 2E6QA 1X9QA 2CJUL 1ZA3B 4PP1D 3B5TA 2DBJA 1H3VA 4ONGL 4JFYB 5C09B 5KSUB 2XPKA 1Y0LB 3BGAA 3QIWD 1HKFA 2JCCA 1VSCA 2X9WA 2VAJA 3O11B 3MRLA 4GI9A 4OD3L 5E8NA 4P9MH 3ILQD 4JFQB 4U0QB 5I8EB 4M1CC 4GZIA 4V27A 3ARFA 1AJ7L 2VXUL 2PYEE 5TF1L 1AO7B 4OCNC 1I8IB 1KT2B 2A74B 3DIFB 4XNQA 5E4EC 4XPGH 1US3A 3UYPA 5IHLB 2AQ2A 4WIWA 3GMNB 1IC7L 3ES6B 1MFVA 4ZFOB 2WZPD 4I77L 1YYML 5EZIH 2A2QT 5DS8B 4OUUA 1QQDA 4R97B 2YBTA 1ZHLA 3K3QA 4UUJA 1JFXA 4CMMB 4R4BB 3AISA 4PMNA 2R56L 5CZXC 3MSPA 3F58L 1M71B 2X9XA 2Z31D 2EDKA 2ZOKA 1B1YA 4WO4A 2ORBH 1AR1C 4ODSL 1NFDA 2VDPL 1OP5H 2MSPA 4BH8A 4CUCA 2E7LC 1EBPA 4L8CB 3VI3F 1ZT4B 1S9WB 4QHUA 5IVZA 3E6FB 4QXUL 4LAJH 4HGWB 5C0ND 3EMQA 3MSGA 4ZTOH 5A6KA 4RMRA 4HQQL 3RY6A 1BECA 4E41A 4PLNC 3N9KA 4PUEA 2VDOH 1TDQA 1G84A 2F7RA 1A9BA 1HH9B 5FUOH 4LHUD 3I6GA 1AGBB 3WFHA 3LKQB 4YX2L 5F96L 1C7SA 3SE4A 1BTCA 1AQDA 5CKGA 2PYEA 4OGAC 5HSFA 5T3XE 2GJ6E 3TO2A 3CVHH 1Q1JL 5TDOA 3LEYL 5A3ID 4D0DB 2VDNH 4ZFMA 4LEXL 4WHYH 1UUQA 4FXGA 3L95B 3CSPA 4HUXA 3IDYB 3KPSD 3CH9A 4D3CH 4M8QB 3DX8B 4CBPA 1D5ZA 4N42A 1U8HA 2CRMA 4UQ3B 3O4LE 4F9DA 4GRLB 4ZNCD 3HNTL 3GZAA 4KROB 1JGVH 2XWBB 5KW9L 5J9PA 3MV7D 4P5TC 5K93A 4IM8A 1RJLB 4EVNA 1O7SA 2D2OA 4XXDB 2ATPA 3WNMA 4RE3A 1K3ZA 4LYPA 1R3JB 4MB3A 1IEHA 1R5VB 5I17A 2JJWA 1NSNH 4LGPB 4P2QB 4P0DA 2OQJA 3JV4A 2DLIA 4O2EB 3DV4B 1ISYA 3HZVB 1U3HB 3VXSB 4AH2A 4MB4A 2X1WL 5JHDD 5KZCB 4AENB 4HUVA 2XN2A 3DVGB 1OGTA 5CBAB 4JM2C 3I50H 1KSRA 1IGMH 3F5KA 4AMWA 3SDDD 1C1EH 5HHNA 3O2LA 3PP4L 5SV4A 1ACZA 2GJ6A 5FXCH 1F3DJ 5A2BA 3W24A 5EUKA 4DVRL 2NQCA 3H3KA 4U6VL 2FDMA 1S7TB 5T5NF 3S4SA 2YPLD 3KYAA 1IGIH 3LN4A 2P7TA 2V7HB 3P4NA 4AQ1B 2RR3A 4MPKA 2XT1B 1AD9B 3TPUB 1RPQA 3O4LA 3PV6A 1KB9K 1OWWA 3PP3H 3CZNA 4UFJA 3L3JB 3VD3A 1L7TH 1A7RH 1JNLH 3QHZH 3PIQB 2H2SC 5D5MA 2QHRL 4F7EB 1FPTL 4GW1A 3CH1B 4OD2B 1DVFC 3WUBA 2V3FA 5C6TH 4NKMB 3CUPB 4Y19B 3MMDA 2CRYA 4UAOC 5KS9E 3SDCD 1JRHH 3BOVA 1KXQE 1IAOB 3SDYL 4UZUA 3RJXA 3HI1B 2FWOA 4KZEH 5ERWB 3KPMB 3QIWA 3W25A 4ETQB 3I2CH 5JPMB 5DHVB 4Q9CA 3HPLB 2V5DA 2F54B 3RIKA 3HZKB 1BGXL 1OIMA 3G6DH 2ZWYA 4DGIH 2D3LA 1FL6A 3F5WB 1A6WL 4NRXB 1MFEH 4Q6IA 2NW3B 3SUSA 2OL3L 2ZJSH 4FF5A 3PGCB 4P9HL 4QOKA 5D1ZB 1PGRB 5E70A 3S4SG 5FYLD 1V3LA 2ED7A 4CNIA 2EC8A 1T03L 3KPSE 5FUCE 2AJSL 2QSCH 4M93B 3O2WL 1I1XA 3CSYA 3DTXB 3CFKA 3AFBA 1C12A 5EOTA 4LKCA 3P0VL 3QOKA 1Z3GL 1EOKA 3FTGB 5CS7A 2Z31A 5EWIL 1LP9F 1WWCA 2ICWJ 4LLMA 3MV7E 5CSBA 4YDLB 2BSRB 4MD4B 4P46A 1OD0A 1UB6A 3L6FA 2AKRA 4AZ7A 5F7KC 2NSXA 3MZTA 1HXYA 5E2UL 2FHBA 4HBCL 4G9FB 3TN0B 3RWFA 3TYFB 4QYOA 4C56B 5A16B 1BEYL 3DX6A 5GZNC 1PVHA 2XNAB 5JHDE 3CGTA 1FNAA 4UQEA 1KFAL 4LHUA 1RK1A 4M4PA 4O58H 2PW2A 5D2NE 1JWMB 1NGZB 5L8JB 5I16A 3P30L 1VDGA 3G08B 1UYWL 3T1FB 3KS0J 4XPHH 1CS6A 3DUUB 3HMWH 3DSFH 4Y4FB 4Y5VA 1VFBA 2P46B 3AXLB 1XD1A 3UPRA 3AIUA 2YPLE 5EU5B 3KPSA 3D18A 4UT7H 5JZ7C 1E6OH 4RZCA 1RZGA 3ZYIA 3IDNA 1I9RH 5I24A 2V2TB 1U91B 2AXFA 3DX7B 1CQKA 1A6TB 1YNLL 5HD8D 3VSVA 2IFFL 3MV7A 1XCWA 5GRJL 2CMRL 1CDJA 2ZUWA 4JVWA 4PCTA 1N0LA 1OSPH 2CLZB 3MCKA 4X7TA 1E43A 5A8PA 4LSTL 3OGCB 4PGEA 4M29A 2XFFA 3CDGB 5C08B 3QR3A 2WW8A 3L4XA 3TTSA 2KKQA 1E0OB 1I7UA 4APQD 3EFFB 3NAAH 4LHUG 3UPAA 1D5BB 1HX0A 1P6FA 1RVFH 4WW2F 4IM4A 3TIDA 1DWJM 1YHTA 4N1HB 4ZEPA 1OT2A 3DURA 1YN7B 1YMHB 3PZQA 4W4NA 5I77A 4S1DD 5KOVC 1HJSA 3NCOA 3GHEH 5HHMD 2VDQL 2AXGA 4OZGA 3MO1A 3HE6D 5FYLE 4KHTL 4L3CB 4E9LA 3QAZC 5C0JB 4PJDA 1TCMA 4ODWB 4NWTH 3BC9A 1ACYL 2ZPKL 4EUPA 4EEEA 5JPNA 1TA3A 4Y4KB 4DWSD 2FATL 3THDA 2PUQT 3ET9F 3TCLA 4KKBC 1KCUL 4K3JL 1VGKA 4PRDA 4CU8A 1LWHA 3A6OA 4HJGA 1BJ1J 4BA8A 1XCXA 3PWVA 2YL6A 3OKEB 5KAQG 4M7ZC 1AMYA 1B88A 3PZIA 1JGUH 2ZICA 1FFPB 4LCYA 3G6LA 3O3DB 2DICA 4R8WH 3TTYA 3ZTJG 1RHHA 5D6DC 5AZEH 1D9KC 3SDCA 2XFXA 3RIFF 3RZCA 2NXYC 3ZJKA 1NAML 2NY2D 2HRPH 2CITA 1MCQA 4JCMA 1UR1A 3RP1A 1P5VA 4OLYL 4MNQE 4U1SA 2WWCA 5EZJB 2HG5A 4YHLH 4YHPA 5I1EL 3DO7A 3F7YB 1MF2H 1FC2D 1J1PL 5ID1A 4XT1C 3A67H 5E2WH 2DGAA 2XVNA 1SY6L 4WI7A 2EKJA 4XNYH 1I8LA 1OAKH 2XTLA 2GAZA 5ISZB 1N5AB 3LMJL 3WFDH 2ZX6A 5TH2A 1IC4L 5DVMA 1I1RA 1XGYH 2EDOA 4HUUB 4Y2DD 5F93C 4FQIH 2HLAB 3HU7A 1S7QA 3DX4A 5HGAB 3BEVA 1B0WA 1CTNA 4H8VA 2FRGP 2K7PA 1JI1A 4GJTB 2J6EL 3N06B 5MEQB 1GUVA 5T1LA 5IM7A 4HIJA 3L5XL 4RAVA 3R8QA 1OT1A 5GS1B 1UR9A 1CICC 3RPIB 4DEPB 3LEVL 2GFBA 3D0LA 1P84J 2GK2A 2Q20A 4PJAF 5J11C 3TESA 4I3RH 5A8OA 1J7VR 2ADFH 2X4QB 1CDUA 3CJJA 4I4WB 4QRQA 1N6VA 1GOWA 3UCQA 4P49A 2HVKB 1W9BM 4UTBL 2WHKA 2VXTL 4TTGA 3VMPA 2IQ9H 4LP4A 1KLUB 3FB6A 2J7BA 4ZDHA 4Z7NF 1ISZA 1A1OA 2WVSA 4BCEA 4LSUH 5AZ2L 4MNQA 3O6FC 4G5ZL 2PTTB 5F89B 2C4FT 4JKMA 2IBZY 1HSBA 1HQ4A 1MAML 1T0MA 4U5IA 5HHME 2VQUA 5DJZB 2I9LB 4WY7L 1CXKA 4GXUM 4B3LA 4KUZH 4Z8FL 2GQHA 2GW5A 1W0VB 2OTWA 3MMUA 4QGTA 1F4XH 5DZOA 1BJ8A 1TMCB 4HUMB 4P4KB 4C55A 1Q94A 3MFGB 1V3JA 5E5MA 5GJSL 3WUEA 3RWGA 4KWUA 1F58L 4PSPA 12E8H 1ZBWA 3H42L 3MV9B 4YK4C 2APTA 2ITDA 1HQRA 4MTVA 4G9DB 2Q7YA 3A0OA 1NP0A 2DDXA 2PBOA 5C0FB 5I1CL 1GGTA 1S5HA 1TIUA 4YPGB 4CVZA 4F8TA 5I74C 4RGMB 3IFNL 2YK1L 2HFFA 4Q7DA 2MHAB 2QKIB 4IOIA 4C59B 4NXKA 3X12B 2O61A 3EYQC 1CXFA 3I3EA 2ZXDA 4U2YA 4P5MB 4K71B 4IBLT 4W70A 5FYJL 2A6JB 5JMOC 4P57B 4AD2A 3VWKB 3GH5A 1JNJA 1CLYH 5TE7L 3RWCA 3ME0A 4GKLA 2LU7A 3HE6A 3SGKA 3NFNB 1NM9A 2GUOB 4HDIB 3INUL 2DMCA 5LVEA 3STZA 1HHIA 2OSLB 2V2WB 3BUIA 3BCFA 5I23A 2DSVA 4TUOB 2FGWH 1C5BL 4DWSA 3ROOA 4H26A 3MFFB 4EIZC 2CUIA 4F3FB 2G75A 3JUZA 1MJJA 2X5PA 2RHEA 4LGRB 4L8BA 5FO7B 1V05A 4GG6E 2Y7QA 1S7WB 4XC1L 4M3JA 3GSXB 2A83A 1IGFH 2JK5A 3TJHD 2BVOB 2BVQB 5EZOL 1QBMH 1UVQA 1L4IA 3QQ9D 5CZXD 3UBXA 4BQ8A 3AZSA 2DYPB 1QFHA 4WUKH 1TFHA 1A6PA 4QF1B 2CIKB 5IR1A 4P8WA 1AR1D 5LBSH 43C9A 1HH6A 3CFJB 1LG1A 4AEHH 2R2BB 5FECA 4OIIL 1CLXA 3WDRA 4N5EC 1W9VA 2W9DL 3CZFA