1SMAA

Crystal structure of a maltogenic amylase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
588
structure length
588
Chain Sequence
b'MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALTOGENIC AMYLASE
publication title Crystal structure of a maltogenic amylase provides insights into a catalytic versatility.
pubmed doi rcsb
molecule tags Hydrolase
total genus 156
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1smaA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1smaA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1smaA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1smaA03
2CDFB 1NGWA 3L4UA 3HS0A 2OR9H 4XPTH 1ADQA 1M6OB 1RQ5A 1CFQB 3BGAA 3EYUL 4M29A 1F97A 3FN3A 1DEEA 1DEDA 1XF1A 3VFRB 2Y25A 1BYCA 1MRCH 4U3XA 2GEEA 4RGOH 4MD5A 1FHGA 2OS7A 1MVUB 2IADA 3BSZL 3D48R 4NJ9L 4TVDA 1EHXA 4UIMA 5C7XL 5CXPA 4MVBD 3TO2A 1R3HB 4X4ZA 5JIKA 1JPFA 5GRVL 3WEOA 5CBAA 4CW1B 5FUZL 1PY9A 4U4BA 4Y16D 3QUZA 5E8DL 4XWGL 1LJYA 2I07A 2PR4L 1QBML 2Z8SA 1X5XA 4I48A 2O5YH 5M03A 4HS3B 4PY7B 5I0ZA 2VL5B 3P4NB 4KQ4L 3EOBA 4YX2H 5IIEA 1DL7L 4FS0A 1S5HB 1B4JH 1QO3B 1I1AA 1KIPA 1HHHA 3X11A 2EEXA 5HY9A 4PJ5E 2GAZA 5F96L 2F53B 1S7SB 1YNLH 2OW7A 1A7NL 4GRWF 3MA9H 4LAQL 3PTMA 4EAMA 4OIFA 1GSMA 4M48H 4S11A 1HTYA 4JLRA 4R0LC 4F9LC 2JEPA 1RUAH 3NYDA 5BZDA 3L5JA 4DTGL 2V5RA 4TUOB 2ZKHH 3VD5A 2MCPH 4NQVA 3L9RB 3VFUA 1DQDH 4C56E 5BRPA 2OL3H 1V08A 4G7YL 4QHKI 4BZ1L 2Y07L 4Z95L 1QNOA 3M7SA 3SCMA 1WBZA 1NBZA 1KJMB 1I8MA 2QF8A 3VGAB 5I8EA 3AOFA 4TUFA 4KZEL 4LCYB 4MAYD 4JO1L 4UQ3B 1ZT4A 4WU5B 1F4AA 2NT1A 4FTVA 3HG1B 1UH3A 1GHRA 3FQRA 4WW1B 4GAGH 4GQRA 2APBA 2RJMA 3T09A 3SCTA 3RNKA 2R0KH 2BDNH 3MSGA 4HBCH 3BUTA 1QVOB 1RZKH 5E4IA 3JWDC 1BAFH 5T1MA 4TUJB 5BJTB 1E28A 4ENED 3NIFE 2IPUK 1H49A 3RKDD 3U7AA 5IJVB 4PRHE 2X0YA 3QHFL 4XMLH 1IGML 1ISZA 5IBLD 5A94A 3MNZA 1PW3A 2CNCA 2V5TA 4ZUWA 5FB8A 4Y5XA 2I5YL 1NCNA 1OIFA 3VM7A 1KG0B 3WY3A 5FOJA 4G8IB 1ZHLA 3L5WB 5DJ6B 1QP1A 3BISA 1XH0A 4H2CA 3MRNB 4BM7A 3NZ8B 2XM1A 1EAPA 1B9ZA 3GSQB 4NN7B 4WCYH 3TTSA 3KDMB 4X6CB 2E27L 2YLAA 5FUOL 1GGIH 1YMMD 2X40A 3CPLB 4XNXH 1L8NA 3SGDH 5JW4Q 3VXRB 1JIBA 3D18B 4MAYC 1RZIA 2VITA 1E43A 1AO7A 3D5OF 3AMCA 1AXIB 4N5ED 2R2BA 2P45B 4NKIH 4GI9A 4ZENA 4YN5A 3UAJD 3VGHA 1KPVB 4U1NB 2C3GA 2P24B 3VJ6B 2ENYA 5JPNB 3WFHB 5DYOB 3RKDC 3QJFB 3KE0A 4LYRA 1IL1B 2H8PB 2P7TB 4WTZG 2GK1A 1MI5A 1H5BB 3AXXA 2E6QA 1F2XK 1XYZA 4V27A 3SGEI 2MCG1 4GKOA 1GOOA 4H20L 3CXDL 3HC4L 4S1QH 3VFNB 2AK4E 1WZMA 5D7IE 5GHWL 2WMGA 5IVOA 3PIQB 4ZNEA 4G3YH 1EQCA 3MCLL 5C8BB 2EYRB 3RP1A 5DD0L 5DSCB 4WK9A 5I74C 4XP5L 4WHCA 1V7ML 3PGCB 3DIFA 1HHJB 4M24A 3SCUA 3DYMA 5BXFB 4HV8B 1J5OH 4WKHA 5A69A 4P8VA 5CEZH 3TNMA 3KL3A 5E2UL 4FLSA 6TAAA 1KELH 3QWRA 3H9ZA 4U1KB 1KT2B 1P53A 4W68A 2B5IB 5AYBA 1AQMA 2D4DA 5A95A 2WQ8A 1EGZA 5ICYA 4N5EC 4XB7A 1Q9OB 1RD6A 4JGUA 1A6TB 1QPXA 1A9BA 4JKPL 3UAJC 2B2XL 3IDXL 3RPIA 2XICA 2MPAH 2XRAH 3GEWB 3DX8B 2FHFA 2VLME 2Z31B 3QUZC 4MB4A 4WJ5A 4F7TB 1XH3B 3F7PC 3RCNA 3WQ8A 3KYNB 2ZCKL 2C9AA 2WIMA 1JDCA 3IFNH 1CDCA 2DMBA 1MREL 1BWMA 1U8LB 2HYMA 4G9FA 1QKZH 3WY1A 1BJ1H 2NX5B 4PSPA 1A7PL 4UOW0 3WMBA 2YEZA 1RIUL 2EICA 3EOAB 2RBLA 2Q3AA 3OJVC 4OGXL 3WSQL 1CLYH 4PGZA 4X80H 1OGGA 4C7DA 1JBJA 1OWWA 4B53A 1NOFA 3TCXA 1I9RL 4PV8B 1MFVA 1F58L 2FX9H 1J18A 4QTIH 4L3EA 2Q8AH 2EYSA 3KPNB 1FO0L 2PC8A 2FJFA 3GNRA 2BJML 1MHHB 2XWTA 3IJSB 2QSCH 4TSAL 2XQBL 3SCMC 4ZQKA 1OP5K 1CU4L 5A3ID 4PRHB 5TPWL 4EDXA 3WF3A 1TETL 2FSEB 3BDBA 2DQCH 5B8CA 5MENE 4HEME 1N7MH 5HDRA 1MCPH 3EYQD 4IHOB 3O3BB 4F7PA 1AO7D 5HVFB 1H3GA 3APGA 3K1KC 1KEML 4OCSL 2L7JA 3ZDXE 2UY2A 4JKLA 3HCVA 2FDBP 1RU9L 2LFGA 1D5MB 4Z7VB 4ZPTB 2MJWA 3HFMH 2EAEA 4J6RH 4WEUD 3U7WH 5I79A 2Q20A 3MRPA 4HFUL 2ADGA 3UCQA 3WIIH 1TQCC 2EO9A 4FN0A 3WCYA 1F11A 5K9KA 4PJEB 5DJ8A 3GKWH 1IAIH 5IOPA 5A6SA 1AGEA 1WF5A 4FG6D 3FQTA 5I1AB 1FORH 4NWTL 3EFDL 4Q7DA 4PYGA 4DKFL 3RY4A 3CDGA 4M5YH 5JR1H 2KPNA 1U2HA 3HMWL 2ITCB 2IH1B 2R1YB 2APTA 3KLHD 4Y5XC 5KEZA 5CQ1A 3EJYD 3P3YA 3FOMB 4N9OB 2O9PA 1OWQA 4LASH 2WIIB 4NQDA 4FQ2L 4Q22A 3ILPB 5C8JA 3MV8B 4X7TA 4NZTL 3W2DH 3VFSB 1YECL 4MJ2A 1J0JA 2A9NL 3JTSB 3LZFH 5EU3A 4OZGA 4WW2F 4X7EC 4XP4H 5HHVH 2VR9A 5C0DA 1LG1A 3UMTA 1TVDA 3TYGH 1VAHA 3PZ9A 1E6ZA 1MJJA 1EFXD 3ARPA 1TTUA 1ZJAA 3F12B 2QPSA 2N7BA 4X6BB 5I71B 3EYQC 3Q5OA 3QT2A 1ROWA 2W07A 4CNIA 3L4WA 4KMLB 32C2B 3T1FA 3V4UL 1ZA3B 5L8KB 1LK2B 3ULVE 4PR5A 5FO9A 1T2QL 3BAEH 4R96B 4G9FE 5F8RC 1MHPL 1A1OB 3VKKA 1EHLH 3GSNB 3VFGH 4LLQB 3RDTD 3DV6B 4NO2B 4MHHI 4FG6C 3UEZA 2J8HA 4JE4B 4F57L 2XACC 5L2KD 5J1AB 3NFNB 3KLHC 1N26A 1R6VA 3EJYC 4W7VA 5FGCE 1BX2A 5HVHB 2ZUTA 4W93A 3VA6A 4TTDC 2YWYA 3P77A 4ACZB 4QNPF 3IFLH 3M8OL 1WT5C 1KXQE 4MNGE 5EU4A 1H8NA 3CZLA 1M71A 3U0TB 4AMXA 4OCXH 1T7VA 1PYWA 5EUOE 1P2CA 1DUZA 2J4WH 2AERT 3GMMB 3V7AE 2OTWA 3ZO0A 3L3DB 4HPHA 5I8CA 4L3ED 1S7UB 1GGCL 3KPLB 4UIKH 5FA3B 2FIKA 1JGDB 1DLFH 12E8H 2XTJD 4HPYH 5J7CC 3L95A 2CITA 2WAGA 1JF1A 3R0MA 2ZZUT 3O2DH 3N11A 1UWGL 3T04D 4Z7WB 5D5MA 2K7PA 5ESVB 4NNYA 3WL0A 5ADPL 2CDEA 5J9PA 5CMAA 1IVLA 4GAJL 1HYSD 3WL9B 3MV9A 3EJZD 1NC4A 4DW2L 2RFXA 3MMWA 5FF6B 4LEOB 3OGCA 2IJ0C 2R56H 2FGWL 5DK3A 2I27N 1TVBB 4EXKA 2VDPH 3DETD 4UUJA 4FLOA 2F74A 4NSKA 3K7UA 5FM5O 4NKMA 2ATPB 4IUGA 5DVLA 5EU6D 5C0ND 2ZUQC 2IAMA 1GNXA 1CIDA 2VLKB 2VLRD 1SZNA 1V6YA 2J25A 3BAWA 5MENB 5KVDL 5CINL 4BH8B 4M7JH 2YSSA 4P49A 5AC4A 1CLZL 1C5DB 1S7RA 5F8QC 4C55A 2AI0H 3MR9B 3RI5K 2LAAA 1CT8B 1WJ3A 4JFXB 4J7RA 4M6AA 5JOPE 1PKQB 2H2PD 4D9QE 4PRBA 3BKJL 2CK0H 3EJPA 1TZHA 1MY7A 5GGQH 1Y7VA 1T0PB 2AQ2A 5ETUB 3VXPA 2X44D 4LGRB 4PTUA 4N8VA 1PIGA 1P6FA 3QQ9D 4LSUL 1F6FB 3EJZC 3IVKB 4HMEA 3ARGB 3KYAA 3QHMA 3LN4B 1B4RA 2X0HA 4PYSA 3LKOB 3LQZB 3WEZA 2VC2L 1HP5A 3DETC 4ODWB 1A3RL 3DMMB 1DWFM 3AIEA 3FB5B 1QR1B 1MQKL 5E8OA 4YHNA 5I66A 5CEXA 2R39A 2BVPB 4L1HA 5C0NC 2W61A 1EPFA 2FECL 1DN0B 1F4WH 1JTPA 1IAKA 4ZXBD 3RIFK 1IGTA 4JN2A 2XVLA 3WQVA 3LIZL 4F2MB 1S78D 2VXUH 3GMNB 5TE7H 1QBLH 4WV1B 4P3DA 3S5LA 5D5ME 4QWWD 3CFCH 2FJGA 1T66D 1XCTB 3UEQA 3KPRE 4V28A 4ONGL 4KAQH 1NWUA 5JBDA 3ZDZE 4FQQA 4Q6IA 1TXKA 3MX0A 1X6LA 3D69B 4NN6C 1NCDL 2H2PC 4OUUB 4ZOCA 3R0NA 4EOWL 5C09D 4YWGL 8FABB 1JNEA 2YRZA 3MV9E 1QBBA 1JNHA 1FVEA 1I3RB 4QT5B 1FQ9C 4HU0A 1VFOA 4XI5D 1C1EL 4BFGA 3QQ9C 5IEHB 3B9KB 3LQAL 3QRGH 3BPLB 3IS0X 5DFWH 3TO4D 5ABEA 4PN2A 5E94A 1EAJA 5FGCB 3WE6A 5GZOD 4LQ1A 3ZE0E 3KPQB 3P4LA 2A6DA 4P2OB 3ARZA 1MFEH 1LO0L 2HFEA 4Y7EA 1IV8A 4MNGB 4K55A 2IQ9H 3BPNB 3WJJA 4BQ9A 1YZZA 2D7TL 3MLRL 5CEZE 1NC4D 2H26B 5EUOB 3V7MA 4DGIL 4ZXBC 4R26L 4XCFL 3CIVA 3SN6N 4OBRA 4HUNB 2FE0A 1I1WA 1DQQB 1S78C 4F9JA 2PTTB 3V4VH 3CVHH 3D85B 1BVKA 1JGLL 2HRPL 2IAMD 4QWWC 3OB8A 1T66C 1P4BH 4FNQA 4MCYB 3ZKXC 1UR2A 3RIAF 2EYTB 2OSWA 2CETA 3PWPB 3WFCH 1BQUA 3VXSE 5IW6A 4Z5RA 4ONHB 5AYIA 1N6VA 5CJQH 5F72S 5ACLA 4XI5C 4DN4H 5L0QB 1GOHA 4AEFA 4KJPD 4HGWB 2IGTA 5C07B 4PEEA 3WLBB 3TO4C 5J57B 5GZOC 1N8ZB 2JALA 2OL3B 1G9NC 1WWWX 4GG6E 3X17A 4H8HA 1YUHA 2N56A 4TVPL 3TFKD 2XFXB 4E9LA 5A1AA 3WF1A 2H32A 1MJ7H 3SE9L 5BVPL 3E2HB 3BMVA 2CBVA 5IUSA 1JPSH 2QSTA 3VXUB 4XNMB 5D8JL 2R0WH 1XD0A 4CVZB 4EN3B 2XUCA 1ZGLP 1PDKA 1MXDA 1W9UA 4OLUH 5BV7H 2ESVD 5IM7A 2IAMC 4K3JH 1U8JA 1BQHA 3BESR 4JQIH 3DBXB 1ZV5A 5D1XB 4OZIB 4GXUM 1QQDA 3SDDB 3EJTA 2VH5H 4WJXA 4U49A 2BV9A 3TT1L 2WPGA 5DJZA 4HS6B 4BZYA 2ZOKB 3CHFA 4TTGA 4X6DF 2BNQA 5FCSH 1T5WA 4LPVA 5E08H 4KJPC 4QHUA 5EIQA 1G7QA 4KDTA 2DBJA 3E3QC 2AXHA 3V6ZA 4FQIH 4XP6H 4KKCD 4JM4L 2X4OA 1PQZA 3MLTA 1MFUA 1NC2D 5D1QA 5I23A 3ZSTA 3QWOA 2R2EA 1E6XM 1ZMYA 3TFKC 5F7MC 3EW3B 4L8CB 2EJ1A 3GSUB 5J56B 4QRRE 2O26U 5D7SH 7FABH 2VJXA 2DI8A 2UVEA 2F7QA 3N17A 4L1DA 4FNRA 1W72L 4FFYH 1G7LB 4Q9QH 2N1KA 1QI2A 4QOKE 3T4YA 2JIXB 1U8IB 2DM2A 5HGBB 4QHNB 3KPRB 4PJ9B 2DQJL 4MQ7B 3DURB 4Y1AA 1RJZB 5E1AA 2VDRL 3ZTJH 4HU8A 5M3WA 2XN2A 4OM1H 4YHIA 4A2LA 4HUWB 4KKNA 4JFOB 4P59H 4UQAA 4ELMA 4E5XA 5I5RA 1DSFH 2A3CA 4QRPE 1ITCA 5IR1B 1FNHA 5DRWB 4R5EA 3W38A 1JHTA 4CN1A 1XGRB 3HUJB 4D0CB 3VFTA 1U3HB 1FFNA 4EEEA 5M17A 3VGDA 3IKCB 5HDQL 3D5HA 4JPIB 3C6LA 1NGYA 2F8QA 4Q6IC 4FQCL 3O3DB 4N8VG 5C0BE 2Q86B 4GBXA 4JM2D 4OCYH 4Z7UE 5TF0A 5I8OL 3HNVL 3GGWB 2PTUA 2V3GA 5DUBB 4FABL 4WY7L 5IQ9B 2X2IA 4J3TA 1PPIA 4X7FC 4CD6A 1EO7A 1T1WA 1QSZA 2DD8L 4UB0L 2ZUUA 5TH2B 1DHKA 3NCMA 4AENB 3RWEB 2OK0H 2UYLB 4AL8H 5E8PA 5C3LD 3PNWB 2A6KA 4ZPVA 5IT2L 2W9DH 3QIUB 1P4LA 5E1HB 3EDKA 3WJJC 3FHQA 1JG9A 3MV01 3I85A 3RWCB 2W91A 3MODL 4MQXC 4L4TA 4LHUB 3JTTB 1FP5A 3V52H 5CP7B 3S5LG 3VGBA 3I3EA 3VXSB 4WLCA 4MZ3A 5DR5H 4TSBL 3NIGE 1TQSA 1G9MC 1TJIL 2JB6B 4PLNC 1MFAL 3MLSL 4NGHH 1HSAA 4IS6B 3UC0L 2I60H 1QPKA 3VINA 1UB5A 1C3FA 1R0AH 3OKYA 1CD9B 1OPGH 1QG3A 4XGZB 1I8KA 4PGBA 2W0FB 4GG6B 3TBVB 1FHLA 4U6VH 2NR6C 3H42L 2KZWA 1YYMH 3I3DA 1JZ4A 5BWFA 6A3HA 2JF7A 1CFTA 2OX5A 4KRNA 5HYJA 1BG4A 2BNQD 1S7TB 3RA7H 4I2XE 4WGWB 3H9SA 2D7OA 3SCOA 4PUDA 1ODUA 4UOW1 2GSIA 2VKWA 1IEAA 1GZPB 4BSWA 4GKNB 3BN3B 4LCUB 3EO9H 4RISL 4Y1AE 4CADA 3AM8C 2WC4A 1QLEL 2J6EL 4AZ8A 1GUVA 1HILB 1WWAX 5HHQA 3EGSA 2AXFA 5KS9F 1KCUH 3QIWB 5EH1A 1LMKA 4U0QB 1HF6A 4NO3B 4ELME 1RZGB 3CZFA 4PGCB 3P9LB 2CKNA 2DM4A 4LSRL 5F89B 1S9YA 4Y4KA 1UA3A 2A6IB 2VRKA 4QXGH 2ADFL 3BWAA 5DTFA 5DHXB 5JIHA 5F88B 1UD3A 5E2TL 5E95B 1HJXA 2FATH 4PJ7E 2Y1VA 3PWLA 4MLSA 2WUBH 2GUYA 3OKKA 2VLJE 5A8PA 3KJ6H 1YHTA 3SGKC 1QSFA 3C08L 4H0IA 1BGAA 4EQ2A 4MNQE 2VX7A 3W39A 2EXOA 4OGYL 3JWDH 2IGFH 3Q48A 1VRXA 2XG4A 3LKSB 3I9GL 7CGTA 4GBXD 3KPMA 1UWXK 4P46A 5FYKU 4HUVB 2NT0A 5TD4A 1ED3B 3FT4B 1ZA6B 2PBOA 5D1QC 3DSFH 4YHPA 4UFIA 1DZBA 5ICXA 5HSFA 4NBZB 2D7MA 3DX9A 4HEPG 3CK0L 4KRPD 4YDIL 5IK3B 3ZJ7A 4HKJA 3M07A 2VZUA 4BSVA 5JHDE 4HXBL 1OB0A 4M93C 3H54A 1JZ2A 1BQHG 4EI5D 1E27B 2COQA 2LTQB 2XYLA 5SWSB 3UTSA 2IWGA 5F1OB 2XG5A 4NZUH 4JFEB 1CD0A 1XGPB 3K4ZA 4P4RB 3DLQR 1JNLH 1FFPB 2D0HA 4PJXF 3KPSE 5EBLA 5HYJE 5EBWA 1H3WM 4XPGH 3A6CL 1KXTB 2Y9RT 4X0KB 2EBNA 5C6WH 3HR6A 3H9SE 3O6FB 2F5AL 3D3VB 1FBIH 2WWMC 5E03A 5EZOL 4GIAA 5CGYC 3UTTA 2PCPA 1L4IA 1W72B 1NL0L 2BCKB 2XA3A 1PX8A 5C0AB 4I9WE 3C6LC 3VXMB 1TVHA 1NAMH 1AJ7L 1H0DA 4GBXC 4GKZB 3REWB 1H0IA 2OR7A 4DOHB 3FT3A 2VDOL 5L88H 4WHTA 1AQKH 5ICZA 5D1ZB 3VG9B 1HINL 1T22A 5FUCC 1R3LB 2ZXQA 1XRVA 5DWUL 4HPGA 5F9OH 4PJFE 2A1WL 4NC0B 4P5TD 2IPTH 4HJ0C 2KBGA 3SE8H 4KRPC 5D4YA 5AYQA 4HA4A 1A8JH 1IBGL 3QG7L 4H26A 4JZJA 5B21A 2D24A 2QL1A 3MRDB 1IZJA 4JVPA 5C6TL 2P5EE 5DQ9A 1UM5H 4EI5C 4FXLA 5KSUB 4X6EB 4IRSA 4FQXB 4S0TD 4P2RE 2CLVA 4OLZH 4Y4HD 1I1FB 1F02I 2FD6H 4HDIB 1L6XA 2MFNA 4I3SH 4YHLH 5AZEL 5GS1A 1LE5B 4GPNA 1AGBA 3F5LA 3O6KH 3MUJA 1X5FA 3Q3GB 1ZAGA 1V0KA 4HFWB 4D6JA 4PRPA 3MRRA 2PW2A 3V8OA 1KTDA 3VW3L 4PREA 4P5TC 2GI7A 1MNUL 2OYMA 1Q6EA 3C5SA 4YHYB 5ALCL 4TUKH 1J05B 5GGTA 1IM3A 1NLBL 2ADJB 3ARFB 3VFPA 4EUPA 4PJ7B 5GS0H 2E4TA 1R85A 2BSSB 3DUSB 4ZO7A 1CS6A 3NTCH 3MRCA 4CN4A 1OM0A 4L29B 3LH2H 3S37H 3OR6A 5IFTA 2WM0A 3KWWA 5IMKB 4ZUUA 4Y4KC 1OGAD 2VLJB 5E2VL 5GGVY 4BUGA 4X9FA 3UTTE 5M7QA 3OGOE 2NXYD 3IF1B 2XPKA 3IETB 5IB1A 5F9DC 4NC2B 2ATKB 1E4IA 4NKDA 2FZ3A 3BN9D 1UM4L 2GTWB 5DFAA 1X5LA 2G2RB 4TPRL 1C5BH 3QNZB 5BRZA 25C8L 2O93L 2BS9A 1FZMB 3AHXA 3G6MA 3QG6B 3S34L 1K4DA 1A1MB 2ZCLL 2VUYA 1TNMA 1KGXA 3S6CA 2BX5A 3VD7A 3RWDB 1FC2D 4FQJL 3IJYB 3E0GA 2UZIL 1JHKL 1N82A 1W3JA 3IU4L 2YL8A 4ZS6D 5EU5B 4LYQA 1ORSB 1BMGA 3G5XB 4H0GA 2X4PA 5E7FA 5DFVD 3K2UH 3OKEA 3SDAD 3QXDA 2A0LD 3OLIA 1XF4A 4LLMB 4XTRC 5TGBB 5ADOH 1RPKA 4HWUA 3RFZC 3AMGA 5DUMH 3KPSB 5FFLA 4XB8A 1P1ZA 4JFTA 1JN6A 1XGTA 3H0TA 1HT6A 3SO3C 1NGQL 2FH6A 1HE7A 4F58H 1UJ3A 3OZOA 4OSUH 4YXLH 5DMYA 2WBWB 4PS4L 5CCKH 2C3VA 3PWJB 3UG5A 3BEWA 2WCGA 3BN9C 3RZCA 4W6XB 2XKNB 4MJ6A 3C5JA 4PRPE 3G6JE 3EAKA 5EUKA 3AMLA 3FO0H 3MJ7B 4PJGE 1E6JH 4PRNA 1SVZA 4U1LA 4XZBA 5BS0D 1EK3A 5E9DA 5EFFA 4APQB 1NFKA 5IXEA 4PJFB 3U82B 3D1MC 4NQEA 3ZYJA 2AV1B 1AFVH 2YD5A 3C8DA 5GS2H 3CSYA 3FFDA 5EU7C 3WUGA 3LEXB 1R8LA 1Q0XL 4ZS6C 3QUMA 3QXWA 1CN4A 5DK0B 3RY5A 4WW2A 1OAUH 3QI9A 5DFVC 2E0PA 3SDAC 4ORZC 3QUXA 4RAUA 3D39E 1GRWA 4WUKH 4YHZL 3CZGA 1IQWL 4P2RB 2XKUA 4N68A 4D9RE 4MA1C 1A7OH 4NI3A 2V5YA 1NMAH 1KC5H 1HXKA 2GTZB 3F7YB 4JZJC 4UU9B 2GSGB 1OAQH 1ZHKA 2G5BB 5DHYB 3FJTA 3L2LA 2BOBA 4MJID 2X41A 3NPSB 2VI0A 3VXNA 3MXWL 3QXVA 1YEKH 4U6XB 1BFTA 1KPUA 1X5IA 5I73B 3WS3B 4KI5F 3UG4A 1OD0A 1WV7T 2G75B 4IRSC 5K93A 1IGFH 2DYPD 1FH5H 4GXUN 3W0WA 4DJMA 2DQGL 5JUEL 2X70B 3TF7C 3MS8A 1VENA 1FNFA 3MA7B 1NCBL 2ZUVA 4HWNA 4HMDA 4IPNB 2O9RA 3CFKA 3CMJA 5HBFA 1GAFH 3F7RA 4Q9RH 1G1CA 2Y72A 2R4RH 2OXHA 2MSPA 3U4EA 1DDHA 3FO1B 3VWJA 4HUUA 5IHSA 5BRZD 4HAGA 3BKMH 3KYMB 5BCAA 5IMMB 4RAVA 3MXVH 2M26A 4QYOA 5SX4H 2I9TA 5F6IB 2XN0A 3AREA 5GRUH 1NANI 3RJQB 5E99L 2ZUYA 4L5FH 5IJKA 5MI0B 3MYJA 2K7QA 4JFQA 3S37X 3B3IA 2R1XB 4AMWA 1CE1L 5BXTA 1ZVSB 2Y23A 1GOWA 1W8OA 4ONOA 3SDYL 5AZ2L 3RWHB 1MSPA 5AUMA 4I3GA 3U79A 4AIXA 3MACH 4E42A 3MSDA 1UKPA 5CZVL 1QW9A 3IGAA 2CKRA 1Z9LA 2RCSL 3R1GH 4P7QA 3HZKB 1GC1L 4JFFD 4EXPX 5LKNA 5ANMA 5IFAL 4XVUC 2ADIA 3NDZA 1T20B 5JW5A 3LKQB 1BGXH 4RZCA 2VDML 1KJVA 4YE4H 1NFDF 2VZOA 4NO0D 3BSHA 2VDQH 1S7VB 2OQJA 3RJYA 4Y4FD 1KB3A 4FZ8H 1NEZA 2DTMH 4BH7A 3DARA 4TX6A 5CILL 4PJHB 4HG4K 1BZ7B 3BZDA 4KGLA 2BY3A 1N3NA 5E9DD 4KPHH 4HOXA 1TUXA 5GGUB 3SJVA 2EH7H 3PWNB 4PG9B 3T0DA 1CLVA 4EUPG 3QEUB 3UCRA 3VFVB 5EFIA 2IXUA 2VIRA 1K5NB 3GMQA 4ZDHA 5C0CB 5EBMA 1SY6L 2IANB 4ONFH 3ARDD 4OLEA 1ZTXL 4E41A 5JXED 3PHOA 1FL6A 4YHGA 2ZSWA 1OM3H 3RUGB 4LBEB 4OLYH 2P8LB 3UR8A 5IF0A 4I3RH 4PB9H 1RIHL 3I02B 2KKQA 3WKMH 2GUOA 1UJ3C 4UILL 2XVPA 3TIDB 3SO5A 2KQMA 2C7FA 4CVXB 2HVMA 1VFBA 4G6KL 3UO1L 1NMBL 4JG1H 2YK1H 3T3MF 3THDA 3KLKA 1KPRA 5I76B 4OZHF 4OJFL 4F80A 2Y4SA 5C86A 1AHWA 1F00I 3D39B 3H9HA 2WHKA 3MCKA 2YPKA 3QDAA 1Z5LB 1LP9B 3HE6A 4AZIA 5ESQB 4Z2HA 3N85L 2DQIL 2G41A 1M4KA 1OAXH 4RAHA 1AKJB 4ETYA 5I9QC 4DO4A 1E1FA 5JOFB 2ZX6A 4UCFA 3ROLB 5BVJB 4LVOC 3GBDA 4WW2C 1X3DA 1QI3A 3ARDC 1GH7A 3IAQA 1E4KC 1JNJA 1UFUA 4JL1A 5JXEC 3QUXC 1P7KA 3NZHL 3QH3B 4ZOBA 3RKPA 5EOTB 4K7FA 1YMME 1YNKH 5GSRB 1KJ2L 1HH6B 5DJDB 2WB5A 1PZ2A 4G6AC 4AG4L 1N64H 3DX4A 1A5FL 3O6MH 4FXKA 4K8RD 1H15B 2AJVL 1YEIH 1VEMA 4DVBA 1ACYL 4IPLA 3T0EA 2CIKA 4XPBL 4K94H 1A2YA 1NGXA 1JFQL 2J8UF 4X7CC 1YJDL 1HKJA 1U8QA 3D9AL 2D03H 1I7UB 4UZSA 4NZDA 5HHME 2B1HH 2UZXB 3A22A 1DQJB 1KYOK 4R0LB 5I1EL 5DRZA 4UQDA 1BAGA 4LSPL 1UXSB 3BHBB 3MLYH 1GHSA 5CKGA 2DQDL 1XMWA 2W0PA 2PYEA 1HOCA 3ZLQC 1G9NH 4X4ME 4E41E 4IDLA 1ZBVA 4OUOA 1AXTH 1VF8A 5JW4M 1P5UA 3AREC 4NFCA 3HNTL 5JMRA 3BKCH 4OIBA 2P8MB 4NRXB 1CTOA 4JIEA 3MJ8A 3VDBA 4N8PA 4WFGD 3KL0A 2VDNL 4WEBH 5A16A 5AD0A 1DQTA 2AXGB 5GGVL 1VJSA 3GJEA 2AV7B 1KB5L 3GH7A 3L2MA 1RULL 2CRZA 3OKMB 4K8RC 4KRMB 2NTFA 5HI3D 1MCCA 1OSPL 2CKBH 2QPUA 1U95A 1PZ5A 1INDL 5IWLA 4NQCB 3C6SB 3K2MC 4YDKL 4ZFZA 3RM9A 1PX3A 1RJLA 1WZ1H 4KTEH 4LLWA 2ZCHL 1IE5A 1C08B 3PDOA 4XCCL 1A14H 2DWDB 5M94B 4I5BA 4X99B 3GIVA 1N6UA 4CD5A 5F9AC 4U1HB 4AZHA 2ZUSA 4NWUL 2Z8RA 3MFGB 4H5SB 4JVUA 1E3ZA 4H1LH 4JHWL 1RZFH 1K9FA 1EDQA 3I6GB 5ABFA 5GGSB 1XF5A 1GGBL 1TMQA 1I1XA 3WHXA 1MRDL 4NBYB 3TJHD 4P9HL 4LMQE 4MA7L 3HE6D 3GTNA 4AXNA 2IQAB 4MAYB 1P6AB 2FCBA 3MGTB 2L4OA 3BPCB 3VRIA 1A64A 4X6DA 3OR7B 5CWSB 4AZ5A 3QDMB 4TSCH 4ZTPL 3DRTB 2VVNA 3C60D 5HI3C 1EEYA 1CCZA 3TA3D 4O2EA 5IHZB 3MLXH 3UJJH 2DQEH 3VGGA 1NAMB 1T6WA 4XPFH 2R0LH 4X6FB 3UTOA 1MIEH 2X9XA 1IGJB 1FPTH 1O7DC 1EXUA 5ID1B 4OKVA 5DHVH 3O3UN 1YEGH 3VI4F 2O5XL 1VSCA 2WWCA 2HKHL 3WD0A 2VR4A 1CIUA 4A6YA 3O2VL 2X4QA 3P11L 4MXWL 4LPYA 4YDJB 4IOSD 2VT0A 3BXNB 3BMWA 5DZNA 3BAKA 5I74B 3IDMB 3O8XD 3T0ED 4LARL 2HLAB 5KZCB 3OG6B 1J0YA 2YS4A 5JDJA 4B50A 4OD3H 3OAUH 3HS0B 2ICWJ 4Z2IA 3MUGB 1R7OA 1MCOH 1YMMB 3B9AA 3HE6C 3T0XA 2A83B 2CGRH 4JFSA 1FE8L 1DEEB 1MHEA 1W0WA 5D4QA 3ULVL 5AWNL 3BOVA 4MD5B 2IADB 1NQBA 3VSUA 4R6UA 1UD8A 1WBYA 2OSLA 1I75A 2HKFL 3C60C 4WKFA 1HHIB 1JPFB 2XZCH 1ZLUK 2OR9L 4R7NA 4XPTL 2EDJA 4PJCF 3BX7C 1GJWA 3AXHA 3QUZB 3CXHK 1UACL 3WH6A 4QP0A 1MRCL 3RWJA 4ERSL 3HRZA 2CJUH 4O00A 3DGCR 1IEBA 3EOBB 3WFEH 3STZA 3MV11 1BOGA 2X1PA 3O8XC 3T0EC 1KIPB 1HHHB 5HY9B 4LDOB 4HJGA 1WDSA 2XZAH 3EDJA 3TH2T 3RL1B 1D2KA 1ETZA 2VABA 3K0WA 3ZE2F 4JLRB 1JGVH 2OP4H 2WLYA 4AQ1B 2O5YL 3HMXA 5BZDB 4H41A 1DQMH 3ARBA 4JRWA 4YX2L 4P2QE 1DWAM 4FLRA 5KBNC 1T21B 5BOPA 5FYJD 4JO2H 4GUPA 3L7FA 3SCMB 4UV7H 1EUUA 1YNLL 4Y88A 1I8MB 2CBUA 5L6YH 3MA9L 4NM8H 3MJ9A 4M6NH 3STLA 2XN1A 1ZT4B 4M48L 2ZG1A 4FTVB 3JXAA 1PZ3A 1B3YA 1RUAL 1LD9A 3QDGD 4ZOEA 1FLTX 4CVUA 2ZKHL 4NXKA 4AD2A 2MCPL 1N4XH 2FHCA 1GQJA 1IM9A 2VLLA 4NQSB 2XTJE 3GNMH 2O9TA 1E15A 4FXGA 1TQCB 1E28B 5IWLC 4U6HB 3SUSA 1ZT1A 2OR8A 4JHAH 3L3OB 4JDZA 4NHCH 3KNBA 3MNZB 5KS9A 4E8CA 4IOFD 3TN0D 4ZUWB 4PP2A 5FB8B 2VAJA 4XNUH 1QYGH 2QR0A 4Y5XB 2VRJA 4LNVA 3DOSA 3GJFH 4WUUA 3H3PH 3OKOB 5TE4H 2R0KL 1VERA 3QUKA 4HBCL 4PG2A 3ROOB 1RZKL 1BAFL 4GT7A 4XNZC 5KTEH 2QKIA 2A9MH 4OCRH 5EU6E 5KSVB 3BVTA 5IB5A 4OCWH 4XMLL 2GJ6A 5ESAA 1ZS8B 5I8KH 1NP0A 2VLRE 4A2MA 2JCCB 3HC0A 3P2TA 3ZM8A 1AO7B 3SKJH 1I1YA 3SCWA 1EIBA 5HGHB 4B15A 1WIOA 3U57A 1G84A 1AP2A 2R2BB 3HLAA 5SWQA 3PP3H 2J8OA 4PJBF 1T5XA 5I16A 4WCYL 5C08D 1R3IL 1WICA 4XNXL 2GK1B 1MI5B 3VG0H 1G9EA 2GSJA 1WSST 5JQ6H 2D1ZA 4P3CH 3HE7D 4G43A 3FB6B 4IIQA 2AMGA 1V6UA 4L4VA 3QQ3A 2NY4D 5EPMB 5LWYH 5IFJA 2Q1EA 4WWKA 3DIFB 5A2AA 3AMDA 5TQ0H 4TNVK 3FFCD 4QXTA 5F1KC 4I18A 5BOZG 2X9YA 1EDGA 2NY5C 4PJXA 4N0UA 1FL5A 4KKAD 3BT2H 2DIJA 2J5LC 5ITFA 3CJJA 2HRLA 5E6IA 4GO9A 4G3YL 3ARBD 3PTKA 1MLBA 4GW4A 3WO4C 1JFHA 4D6FA 2XNAA 2ZNWA 5ICYB 3RZWA 1WNOA 1FFOB 1KFAH 2F18A 4JAMA 2CXGA 1LO5A 4FHBD 1A9BB 1S5IL 5GNYA 1GONA 4R9HA 3RPIB 1J5OL 1YMHA 5CEZL 2E3VA 5C09E 1MF2H 3DUUA 1KELL 2FRGP 3S3SA 4PGJA 3QOMA 4QRQB 3W9DA 1A6UH 3H2WA 1NUFA 4O2FA 2DQUL 2BSED 3D4ZA 3HE7C 5L2KB 4TULH 1K2DA 4FNUA 1ES0A 5FGBA 4X98A 1XGYH 4NUJA 2NY4C 2ENSA 3GSXB 1MAKA 4P23A 4ODUB 1A6AA 1CZ8L 3TVMA 2A3EA 1F42A 2G60H 3DI3B 2XRAL 2ZUQB 3NAAH 1P6WA 3CUIA 4WHYH 3QQNA 1CNVA 3BUBA 2YEZB 2W1NA 2NNAB 4OF5A 3BD4A 4ZFOA 5INDB 4KKAC 2FO1A 1CLCA 1HEZB 4M1DL 3T65B 5KSBF 1UD6A 4J8RA 2QADD 4L3EB 1W0VA 3ARBC 3IFNL 2OTUA 3PDDA 4JL2A 3UESA 3O2LA 4PJDF 2FJFB 3GBEA 1TPXC 2HJFA 1QKZL 4U7MA 2GJ6D 4PMNA 1T7ZA 2XWTB 3EYOB 2VZSA 2OZ4H 3CDCA 5T3ZD 2AJXL 4ZQKB 3OL2A 4RMVA 4EDXB 2D7PA 1CLYL 2P8PA 1QRND 2GITA 2F54A 4KI1A 4X80L 2F53D 3ZYOA 4HK0A 3GIZH 3BZEA 5E56A 4HHAA 2FX9L 5LCVH 4QTIL 3ZDYF 5LXGH 3HCVB 4YBHA 1BTCA 2BNRA 5IROA 2WP3T 1HDMA 3D0LA 2V3DA 5LAXA 3E3QE 3MRPB 4FFZH 5IVXF 1QEWA 2P5WA 2ADGB 1T04A 2H3NB 1F11B 2LVEA 5DJ8B 5IOPB 1M7DB 5EU6B 5T1LA 2VDKH 1AGEB 2UWEF 5DMJB 3FQTB 1UGNA 1DFBH 1I9JH 4OI9A 1T0NA 2VXQH 5D8ZA 5GRWA 3VTRA 1OAKL 5JXAH 3HZMB 1HJVA 2IFGA 4FNSA 2O61A 3RPKA 1IAMA 4JQVA 4M1CD 3OMZA 3STBA 4L4VD 1YN6B 4RE3A 1WTLA 5CJ5A 5K9QG 5ABHA 3T2PA 2IFFL 1J7VR 4NQXA 3HFML 3OB0H 4J6RL 3FW6A 3X3FH 4PG2C 4PCTA 2QADC 3WIIL 5C8JB 3OHXA 4F37K 1MAJA 1U91A 4LCWA 4QXUL 2UZYB 3GKWL 1IAIL 3TZVD 2HT3C 5EU3B 1QRKA 4OZGB 5DEGB 4NN6B 1UEYA 3NCJH 4KMTH 4ZXLA 1CFSA 3BP6B 4M5YL 4NYLA 4O58H 3VFWA 1PKOA 5JR1L 1AMYA 2JJWA 3EFFA 1MJJB 3IDGA 4HZLA 2VRQA 3MLWL 3IJ8A 5A6KA 4CNIB 5A2CA 4I4WB 5B39A 1XR9A 4UTAH 3T1FB 4LASL 3FRUB 4IEFB 1XFPA 1EMTH 4L3CA 4AEIH 4TX8A 4HD9A 5FM4A 4XP4L 5ERWA 3DROA 4D8PA 1KWKA 3L5HA 3BLBA 2FWOA 3KXFD 4ZXBB 4JN1L 4KV5F 4MXVE 1UWEL 1WAAF 2OWXA 1EJ6A 3B83A 3GZAA 3GJFA 1O6IA 3CUGA 4JRXA 2DSUA 4K7PY 1LEIB 3ZT7A 4DUWA 5MHSD 4WWKC 1EHLL 3VFGL 5KSAA 5B22A 2YZ1A 2QSVA 3W27A 3LPOA 1M71B 2EDWA 3TZVC 4I18C 3ZKXB 5ALBH 2BFVH 4AMKH 2F54E 1U30A 1WFUA 3KYKH 1P2CB 3V5KA 1YY8B 3AHTA 2OTWB 5I8CB 3IXTB 4U1JA 3F6IA 5D7LA 3WH5A 4U1MB 3S6TA 1SYSB 3L95B 2WWKT 4XRCA 1JF1B 4QEGA 1AXSA 3TO4B 4U1IA 1E6NA 1S7WB 1WCBB 3PZOA 2HFFB 4OCXL 1I3GH 2ERJC 4NDMB 4Z7NE 1UH2A 3FAWA 1HIMH 1U2CA 3HPLA 4HS8H 1D5ZB 5J9PB 2CKSA 5EZJA 2AEPH 5CMAB 3WUWG 1ZBCA 4D6EA 1KCRH 3OLGA 2QHRL 1ZVYA 1NC4B 1HX0A 3KEHA 3TCLA 1A3QA 3QR3A 3OGCB 4UIKL 4Z2GA 5JQHC 2VUOA 1DLFL 12E8L 4HPYL 5FGBC 4UUJB 5D93C 1XIWA 2F74B 1OB1A 3DV4A 3O2DL 4NSKB 1Q9KA 3CUJA 4ZS7H 4GRMB 4JZOA 4C4KT 3JWOC 1KLGA 5CG0A 2IPKA 2IAMB 2NLJB 4XBPB 4MWFA 3RTQD 1OSZB 1HKFA 4FNPA 1M03A 4RSVA 3DXAA 4YK4C 1XCQB 2R69H 5F6HJ 3KLLA 1FVDA 5A2IH 2VDPL 2OW6A 1JRHH 1VGEH 4W85A 1E4XH 3RNQA 3GI8H 4LCWD 3HJEA 4CD8A 1V02E 7TAAA 4Y2DD 4M4PA 3U30C 3BUQA 3QNYA 1CE6B 2APXA 1U8NA 2V17L 2CUHA 5INCA 1WZLA 5GJTH 1OD7A 3MMEA 4OZFA 3MGAA 3QBTB 4N8VB 4PTUB 1RH9A 4O02L 4AIOA 5EIVA 4MCZA 4XMPH 5E2WH 1QNSA 5IROC 3ZR5A 3KLDA 1U0QA 2ICEA 4PD4J 5TDPB 3VNYA 1BFVL 1GHFH 3PZQA 4OZ4B 4YHNB 3BUYB 5IB2A 4W84A 2ESVB 4YXKH 4MNJA 5CJXA 3DYPA 4JPWL 2BRRH 5B3JE 2EE6A 3WFDH 3RTQC 4F15C 1UASA 2G3IA 3LRSA 2M1KA 3BVUA 5D7LE 4HIHA 3SBWC 3ZOAA 3DGGB 4JRXD 4AC1X 4MMXC 1KEGH 1XGQA 3IDIA 3ZIZA 3S5LB 1NFDA 1V6WA 4P2YA 4FA8A 2DM7A 2XA8L 3TBSB 1G7IA 4FQQB 4Q6IB 1KB9K 4Y2DC 2V2WB 5F97E 5DLMH 1F4WL 1LE9A 1YEEH 5ISZA 2EIZA 1KJ3H 3AICA 1JNHB 1NC2B 4JAWA 3LPFA 5J3HD 3EUUA 3O6AA 4RWYH 4OLVH 1Q4NX 2VXUL 5KOMC 4GKSB 1QBLL 3QNXB 2BNUB 4ZE4A 1X4ZA 3GNPA 3FQNA 3CFCL 3FO2B 1MCQA 5E94B 2GIYA 4JRYD 1TQTA 4KAQL 1FH7A 1KOAA 3P0VH 2C26A 5DD5H 1QI5A 4KJWC 4DK3A 4WFFE 3QDJA 1DBAL 1U8PA 1FIEA 1XZ0B 1PD6A 3ALWA 3CLFL 3GMLB 2Y8VA 4DGVH 3QRGL 1XIWD 4MJ4A 2F58H 3L3JB 1MCEA 4PP1D 1JWMA 5ACZA 5CBEB 1CI5A 5FK9B 3BO8B 3OX8A 1MFEL 4AIZA 3ES6A 3RWFA 5IKCA 3U5UA 2IQ9L 5D7JA 5DJ2B 4MGXA 5GRYA 5B39G 5T3XL 3NFPA 4ZAKA 1FO0A 1LK3H 4NC1C 4ZUVA 4DUVA 4S10A 1JE6A 4HWZB 2DKMA 1EO5A 3BKYH 5FHBH 4Z5RB 5IW6B 1ZS2A 5SX5K 3WHE0 4KJYB 5J3HC 4H0HB 1PBGA 3A3HA 3V4VL 4CMHC 3CVHL 3LX9A 5CLTA 1UZ6E 1FRGH 1P4BL 4EZMA 2V2XA 3OKLB 4HIIA 3QIBA 3WFBL 3GFUA 4YNYA 4LU5H 3WFCL 3VGFA 5BQ7A 2H32B 3U7VA 1H3TA 4H8VA 3SDXF 5CJQL 3GM0A 2Q3ZA 3E6HB 4WSJA 2H1PH 1G7JA 4HW6A 4I0PA 1XIWC 4JFDA 1RJYA 3RU8L 4PP1C 1U8OA 1QZ1A 1IT9H 5D2NE 2XI9A 4KI5C 4YGVB 1U8JB 1BQHB 2ZP0T 4OV6F 4KHXL 4HGKC 3V8CA 1QQDB 4U5IA 2VWEC 4PV9A 3UPRA 1KULA 1FL3A 4ORGA 1INEH 3AUVA 2YA0A 4QLLA 2FHBA 4OD2A 2BNQB 4G8GA 4M5ZL 1T5WB 3HAEH 4QHUB 1ISVA 5SWZD 1G7QB 3CDYA 2OM5A 4MQSB 5BV7L 5L8LB 4UZGA 3V6ZB 2MQ0A 5CJBA 1YEJL 1XH2A 5HGAB 4K3JL 1JPGB 3AJ7A 4JQIL 1PQZB 5ISZD 4OZOA 4UV4H 5D1QB 4S1SL 3QDJE 4OBSA 2YPLA 5F7KC 1WDPA 3UZQA 2VH5L 1DBBH 2VLKD 1MW1A 3E8UL 2H9GA 3VRJA 1SEBA 2QBWA 1KFWA 1H3VA 1K8DA 3MGOA 2YD8A 3B5TA 4M93B 2FR4A 1H3PL 4FQIL 5I19H 1FP8A 1MPAH 1NOWA 3CFJB 4PMYA 3VMPA 5JIIA 2MKWA 1K4CA 2EEDA 2VAAA 4EI6A 2OYLA 2HJKA 3U1SH 4JEGB 4E5XB 5D7SL 7FABL 1W9BM 5IQ7H 5J1TC 1OGAE 1QFWI 4S1DD 4KXZH 1SYTA 2CLZB 3VFTB 5IESL 5IHRA 2J7EA 5HHXH 4OZFG 3BLPX 5IB3B 1VCAA 3C6LB 2EABA 2RR3A 4GBXB 4D6CA 4PRAA 3B2UD 3HR5B 1MCWM 1HYRC 3P9WB 4CCDA 4OLWL 3MJGX 3QJHA 4P59L 2XV6B 2J7DA 1DSFL 3SE3A 2PNDA 1N5YH 1QBAA 4KRPB 1T1WB 4PMRA 2ZPKH 1CTNA 1S9VB 3F8UB 4MS8D 1SBSH 3LCYA 1E71M 3IDYC 4K7PL 4HX1A 5E8PB 3LKPA 1Q72L 3GSRA 2A6KB 4Y5YC 1B88A 4ZPVB 1PGRB 4EI5B 4LGSB 4QLRA 4AMCA 3GRWA 1RUQH 1SYVA 5KVGH 1P4LB 4OCYL 1RY7B 2YBUA 2FYYB 2Y06H 3REVB 3W6MA 4L4TB 4TNWK 4ODSH 4IRJA 1G7PA 3MRMB 1YPZB 5EIIA 5IDIA 5AYUL 2HLFC 3BAXA 2OYKA 5LYRA 5DK2A 2CUIA 4IBLT 1PLGH 3HI6H 4GFTB 5GGTL 4HP5A 2W4XA 4GMSH 1OT1A 1BQSA 4JFDD 1CD1A 2FB4H 1CR9H 3BJ91 3HZVA 3OAYK 4S1DC 5GRJH 4LLDA 4X7DC 4AL8L 5K9QI 2OK0L 2HAZA 5FM8A 3T77A 2GDUA 4RX4A 2E6JA 4JB9H 4R27A 4LLUA 1E6OL 1I8KB 3QHTC 3RL2B 2YPLE 1B0WA 1G6RH 1XR8A 5D2LA 2YL5A 4X4XA 5D70H 2J74A 3B2UC 4V1DA 1OSEA 2MMXA 3NIFF 1UD2A 2WW8A 5BS0E 4YIQB 3ARXA 1W2VA 1P84J 4P5TB 3SUVA 3JV0A 1CFNA 3S88H 5C1MB 4NGHL 4OFYD 5IEKA 2ICWI 4C57C 2I60L 4KTYA 4UQ2A 5A6BA 1N2RB 1FJ1A 1R0AL 3NCBB 4BSWB 4MS8C 1OPGL 3GJFK 1D6VH 4CADB 3L4VA 1MJUL 4U6VL 5D8WA 3SOBH 3GMPA 2AXFB 4PJCA 1BLIA 3WQ5A 2B39A 1H3UA 1E4WH 3CZFB 2PTVA 2YRPA 3LEYH 4KVCH 4YHKL 4Y4KB 4Z2JA 5L7XH 3SE4A 4I0PC 5C0RH 15C8H 1FZJA 4MJIE 3EO9L 4X7SL 2B20A 5LBSH 3PWLB 2G9HB 5C07D 3VMOA 5CGMA 5HD8D 2L7UA 3GHEH 3GSWA 1KCUL 3PP3K 2ARJB 3CFBA 3KHOA 4GRWB 2BK8A 3PTQA 2VSCA 3ALPA 4QXGL 1R3JA 4TRPH 1H41A 1UCTA 5CJOH 2AEQH 3Q0HA 4XNQB 2FATL 4F7CA 3GMOA 3W39B 4PJAE 4W70A 3NGBC 5D7IF 2AEIT 3KPMB 4NJAH 2JF6A 4YHPB 1OY3B 4U1SA 2I9LA 4P99A 5ICXB 2I25N 1Z9MA 1HSBB 1L7IL 3RIFF 4Y19A 3BRFA 1U8HA 3DX9B 1ORQA 3KJ6L 1JTOA 3SO3B 4DZBB 2D3NA 4HKJB 4MD4A 2R2HA 4XVJL 4BSVB 2WCSA 4DKEH 3THCA 3QUML 1QLFA 1KIRA 1IGIH 4UR9A 3WD1A 1C16A 3UTSB 5FYJH 3PUCA 3O6LH 5A6MA 3VIKA 3LS5H 2WZIA 3MRKA 3AAZB 5HD8C 1JF6A 2VC9A 2E9IA 4RE2A 1NUNB 5EBLB 2JJSA 2VE6A 5EBWB 1ZGLB 1FG9C 3TJEL 3GXMA 6FABH 4N8CH 4UTBL 5EC1A 4NZUL 2V9QA 4LPWA 4NO5A 5BROA 1EX0A 1TVHB 1H0DB 2BY0A 1JNLL 5CAYB 3SDAB 4V1DD 3JWNC 3VDAA 4XPGL 1UENA 4OV5A 1CENA 3SE3C 3T4AB 4JFWA 3PN8A 1FBIL 4MA1B 3V0WH 2YIHA 2AK1H 4YPGB 1GOKA 4H26B 4JZJB 2Z93A 3A0OA 1D5XA 3VXOB 3MLUL 3VO0A 5DJCA 2GT9A 2X4SA 4DWSD 1MAMH 5DQ9B 3FN9A 3RHWK 1TQBC 5E7BA 4PJBA 3PL6D 2PI6A 2YA1A 4N90E 5L88L 1WB0A 1AQKL 1Q9LB 4IRSB 4PLOB 1GORA 4X5XA 2WUCL 5HPMB 4HKBA 4RDQF 1BBJA 1UC6A 3SE8L 4HZAA 4KRUA 5GGRA 2J77A 1L0YA 3BD5A 3IDJA 4GG8A 4KKLD 2GJZB 1AGBB 3LN5A 1RHHB 4LKXB 5JZ7D 2J88H 3F65A 4UDTB 1UM5L 3SDCD 5F7NC 3ZDXF 1DANT 4JY6B 1QNZH 3WNOA 1NCAH 3G6DL 5AG8A 3MRRB 2PW2B 4FQHA 3GSVA 3WSUA 4HWEL 4OTXL 2FD6L 1JI1A 3C5ZA 1XC6A 4I3SL 4YHLL 1MJ8L 3GXIA 1IKFH 2BSTA 3IFPA 4ODXB 1MUJA 1ZJBA 2F7OA 3CUHA 3O6KL 3C5SB 4RNRA 1MWAH 5ITBH 2XTLA 5HXMA 3V6FA 5HYSG 3KR3H 4GAYB 2R23A 3VFPB 4EUPB 3OGRA 4MJIB 4U6YA 4DWSC 1OAYH 1OP9A 4JCLA 3JUGA 3PL6C 2JJVA 1FYTA 3MRCB 3U6RA 3OR6B 4LSTH 4ZTOH 1DWIM 5D71H 3HI1B 1JP5A 2DYPB 3KWWB 4ZUUB 3MKKA 5B4MC 3IJHA 5BZWB 4TN9A 3L5IA 4PD4K 2OI9C 1E72M 5IB1B 3WUZA 2B4CH 1LF1A 1VGKA 1W2KT 4NKDB 2FZ3B 3IXAA 4KKLC 5I2IA 2JK5B 3Q1SH 3BGFC 3KG5A 1LEGB 5JZ7C 1IZKA 5GS0L 4HAFA 3SDCC 1G1YA 4XWOD 4HH8A 3ULVF 1BVLB 2M8XA 3CH1A 2XWJA 3NTCL 5BRZB 5LA1A 3LH2L 3S37L 3UPAA 1K4DB 3KWXA 2XWEA 3WQWA 4PRIA 2W60A 1FAKT 2W65B 4NM4L 5JA9A 3WH7A 3NABL 5KSBA 4JG0H 3QHZH 5HHOE 1J12A 3MV7A 3TBTA 3CMOH 2XWDA 1YDPA 1UA6H 3SEPA 3M46A 4OQTH 4U3CA 1AH1A 2ZWYA 1H09A 3NSXA 4LSVL 4ZE5A 1Y6NR 1C5BL 3OKEB 3LQAC 1K8IB 1VADA 2DJSA 4W6WB 3MRQA 1V3LA 4XAKD 3X13B 4UQ9A 1AGFB 4W8LA 3OXSB 4QRTB 1JGIA 1JN6B 3H0TB 3QR2A 1FN4A 5DDHB 4WFGE 5C0FB 2NMSA 4TVPD 1MQRA 1UJ3B 4JFFB 5EUOF 2ZJSH 5IMLA 3W26A 4WU7A 2JIEA 5IVXA 3D2UD 5E0CA 1TZGL 3K2UL 4HWBH 4Y5VC 3WN5A 4LRNH 3I2CH 4MJ6B 4YUEL 3C5JB 5T3ZH 5EUKB 2UWEA 5ADOL 3KPOA 5DUML 2JJSC 4PRNB 1KXVC 4W4OC 3R8QA 5E9DB 5HI4D 4NQEB 1BD2A 4OSUL 4YXLL 5DC4B 3FFDB 4WI3A 2C7UA 3T8XA 2CIPA 1TENA 5FHAL 1EJOL 1WBXA 4LVOB 5DT5A 4FQPA 4WW2B 3IJ9A 4QF1A 3ARDB 4M43H 5J11B 4V2XA 1E6JL 4MSWB 1E3XA 1RUKL 3QUXB 4NT6A 4RAUB 1XF2B 3DX1A 2UY5A 5JBEA 3ARVA 3P0GB 1CL7H 4UFMA 1G6VK 2J6EA 2XVKA 5E6YA 1JTTA 1YEDB 4NQUA 3O6FD 4ESKA 3D3VD 5IP4A 2VB5A 2HG5A 5ENWA 3AIBA 2BOBB 1IAOA 1QA9B 3WHE1 1RVFH 1KPUB 2DDQH 4NRYA 5C0AD 2EKSA 3IKKA 1FP9A 1KQZA 3BUIA 1E9LA 1AY1L 3X3GL 4DUXA 2VX5A 4C54A 3U2SA 1CDIA 4IDJH 1NMAL 1KC5L 4MXQC 1TDQA 1V5JA 4L8BB 3PZUA 3S2CA 4AEHH 1TA3B 3OGSA 1KGCE 3CFKB 4H8WL 2HVKA 4DKDC 3I84A 1YEKL 4OJYA 2VN4A 4YDLC 3U4EB 1DANU 4KK6D 3T2NL 2I24N 3BVNA 1B30A 3CZJA 1BIHA 4QYOB 4RAVB 2RAMA 1IGFL 3BPOC 1FH5L 3AREB 3ULUL 2ICES 1K3IA 1CF8L 1IGYA 2CQVA 5CGTA 3VH8A 4CL7A 3BUPA 3CBWA 3GBMH 3MV7D 3MOBL 7A3HA 2LU7A 4Q9RL 1IC4L 1J8HA 3V0AC 3VPLA 1WEJL 2R4RL 5KVFH 3BKML 5T1DH 3ALGA 1M05A 4Z76A 2XPGA 5AUMB 5EG6C 2XN9E 1HKLL 1TCMA 4GAFB 5CHNA 4E42B 1J1PH 5D5MF 3GH4A 3CX5J 5DO2C 2D9QB 3MBED 2GK0A 4L5FL 3O3AB 3ZDZF 1JNDA 3HNSH 4HUXA 4D2NA 1JDDA 5ANMB 2FYVA 2LV4A 4PB0H 4GQ9H 5M95B 5FAAA 4RZCB 1KJVB 1UXWB 1FCGA 2D0GA 4JFVA 5A8NA 4WO4A 2OQJB 5HYEA 2EC9U 4BH7B 3CVIH 4XVTL 4U3HA 2V3EA 2IEPA 3MACL 3VD3A 4MA8H 4KK6C 3QEGH 2Q87A 1QSEA 3VIFA 1AGCB 4G6JL 3ZE0F 4K68A 5MEPA 8A3HA 1C7TA 1F8TH 4A6YL 3B9DA 6CGTA 4R4FH 2CPUA 3MOQA 4OLXH 4QRUA 4YQXH 2CRMA 1BGXL 5EFIB 4YE4L 5IBTH 1KENH 2VIRB 2X4NA 3F58H 3SUWA 4G8EB 1HHKA 3AIVA 3GMQB 4FZ8L 4EDWL 2E7LA 1NDGA 1OQOA 2HJLA 5FYJE 3TBYB 1EERB 1T03H 2SEBA 4NZRL 1L0PA 1FL6B 3S35H 2ZSWB 4KPHL 4M6MH 1CFVH 3A47A 1W32A 2DLEA 3B2VH 3RVVD 2EH7L 5IF0B 3R06A 1H8OA 5FGRA 3MBEC 3A23A 1D9KA 1RP8A 1E6QM 3QDGE 4DN3L 2Y5TA 3RY6C 2WINA 1MCFA 1GZJA 3EYUH 2J12B 4ONFL 3PQYA 5FECB 1JK8B 5HYQA 3CU7A 3WN5C 4CJ0A 5HGGS 1GZQA 1RK1B 4J3UA 4GQQA 1KPRB 1OM3L 5DRXA 4YDVA 4NJ9H 1NKRA 2FGZA 3GXTA 1PVHA 4D9LH 5I18L 4WRLA 3NJ3A 4O2CA 4Y2OA 4I3RL 4MD0B 3MCKB 1TVNA 2CDFA 2ZG2A 2YPKB 3WKML 3HE6B 4NPYA 5FUZH 3HTLX 4XAWL 1F4HA 1M6OA 1N0XH 3OKDA 3S4SA 4FNTA 5GNXA 5EC2A 3AHVA 3S3JA 5CZXC 4GI6A 3VFRA 1KLFA 2XQYG 4XWGH 4AIEA 3C60B 2PR4H 2YXMA 1MVUA 4ATDA 1AC0A 1EUTA 5F7EH 1P7KB 4CRPA 4HZ8A 3RVVC 4XC1L 3UZVB 2MWCA 3HMXL 5EZIL 3W6LA 3FXYA 1BPLB 1OAXL 3PHSA 4RWHA 4FXKB 3AIRA 1M7IB 4PRDA 5KG9A 4Z2LA 1IMHC 1A1NA 1GGUA 1L6ZA 1FVCB 3LHPH 3T0EB 3O8XB 2CIKB 3PGFL 3TTOA 3MJ9L 1QSEE 5EO1A 4DTGH 4M81A 1A2YB 1UYWH 3N9GL 5C08E 1NGXB 4B9ZA 1VACA 3IDNB 1LWRA 1S5HA 1QO3A 4BZ1H 3AFBA 1PEWA 3RJDA 3O6ML 1XGUA 1S7SA 3GK8H 5DRZB 4F9PA 5JTWA 4XP1H 2JELL 4JO1H 1YEIL 3QOKA 4WO4D 1GXEA 2PYEB 2WQRA 5F7HA 1HOCB 3DHUA 4K94L 4TUOA 2YLLA 3FFCE 1FC1A 3L9RA 4MB3A 4P7RA 1KNOB 4CAGA 2B1HL 4DGYL 1EGJH 5JLZB 1KTRL 5AD0B 1BFOA 3EDEA 3QHFH 3LKRA 1W1TA 3DC0A 3HG1A 3QHOA 2ZOXA 2NTFB 5DFTA 1U95B 2I5YH 1PZ5B 3BFOA 4WW1A 3U48A 4ZFZB 5I6XC 4GO8A 1NUDA 5DO8A 3S36X 3WEXB 5BYWA 4LLWB 4DK6A 3BKCL 3WFZA 3OGVA 3WQ6A 5BJTA 1JV5A 3O4LA 4I5BB 43CAB 3GIVB 2A77H 4Z7UF 2Y24A 1XV8A 2E27H 3T2QA 1KTCA 5FUOH 3LEVH 2CKBL 2XVGA 4ISVB 4XNZB 2GJXA 3NH7H 4WO4C 5K33A 4EVNB 4Z78B 5EOQL 3BIKA 1WZ1L 4KTEL 4YFLF 2APWA 5GISH 4G8IA 3VH8G 1A14L 3WHXB 1C91A 5DJ6A 1U8MA 2GFBB 2H45A 3MRNA 5CD3A 1HHGA 1J1OL 2KDGA 4MDPA 2CDGB 4X83A 4WI7A 4RBPK 1R46A 1L0XA 2FX8L 3S35X 3AROA 4X6DB 4XX6A 3VXRA 2VRAA 3QCUH 5E8EA 3D18A 1V03A 5FYKE 1ZT7A 4F8XA 3QFJA 3CXDH 3NIGF 5GHWH 4HK3J 4O2EB 5T3ZE 3MCLH 3TPUB 2AW2A 1RV6X 3S98A 3EJRA 3HI5H 4B16A 4U1NA 1UEMA 3FAXA 2ZX9A 1V7MH 1QRNE 1EXUB 1KV3A 5KVMC 1HXYA 2F53E 3D3AA 3WFHA 1I9EA 3ESVF 3UJIL 1IL1A 2H8PA 2EACA 4QLKA 4OGZA 3PJSB 4TSCL 3K4DA 2X4QB 4K3HA 2VZ3A 1OVZA 2C8NA 3RO8A 5DD1H 1B2WH 4NP4H 2X2YA 2HVJA 2ARWA 1D6EA 1E0XA 2RGLA 2HH0H 5C0CD 3UJJL 2DQEL 1MCSA 2IAND 4KY1L 4LLYB 1MIEL 1O7VA 3GMRA 1GOIA 2IALB 1HHJA 3Q5YA 1HQ4A 2BVEA 4JKPH 5BXFA 1YEGL 2J5LB 1W2PA 3RM8A 4AD3A 3NCYS 3MOAH 1MHEB 4MDIA 1W0WB 1F3DJ 4F8QA 1Y6MR 3HG1E 2IPUG 1HZHL 3WO4B 4ELMF 4D3CH 3TIEB 3HRPA 3JWOL 2CMRH 3PZTA 2NW2A 3CUFA 4P2CG 5A2JH 1WBYB 2BY1A 2WNWA 3EO0B 4OD3L 1FNAA 3WYRA 2XJ7A 3OAUL 1OCWH 2ZCKH 3BDXA 1KIQA 5HDOA 4PJ7F 5C08B 4ZFOL 8CGTA 1TNNA 1QFWM 1SHMA 1UR8A 5EO9B 3KS0J 2W0LA 3DX8A 2VZVA 3HB3C 2A3HA 3F7VB 4PJ5A 3HE7B 1G7HB 4FQLH 5JOEA 1A7PH 1RJCA 2Z31A 3T1WA 1FOBA 2WYSA 4MQTB 2ED9A 4RQQA 3HRZB 2J7FA 3WSQH 2OWWA 2NY4B 5HDLA 1MWAB 4RMTA 4F7TA 1IEBB 1XH3A 5IV2A 2YJQA 1AKJD 1I9RH 3M17B 3KYNA 3STZB 3QPXL 5DS8B 1Q94A 3BCFA 4IRZL 2VKXA 4HJGB 5CSBA 3O4LD 3FFCB 3QEQD 2N4IA 2GKIA 4C56A 3GHBH 3S4SG 1ETZB 2APVA 2VABB 3PDGA 3U46A 4OF3A 4TSAH 4X6CE 1RMFH 1J0KA 2XQBH 3AXLA 3KXFE 3MRHA 4BQCA 4HOZA 1CU4H 3ZJ8A 1SFSA 3VXRE 4RL3A 2BOCA 2DLFL 2CJUL 3ARBB 4X4YB 3WFEL 3OJMB 1DBKL 4PV8A 2JKXA 4W88A 2DT0A 1WQVT 1ZSDA 1RU9H 1T0MA 4LP5A 1P7QA 3KPNA 2XZAL 1V3KA 1P9MA 1SVCP 2HA1A 2HWZH 1MHHA 4HFUH 3STLB 4BQ4A 3VGEA 1JWSA 1SY6A 2OP4L 5F21B 1U42A 1WCGA 4PRHA 3TESA 4F79A 4RGND 1OD8A 2FSEA 1YYLL 4NWTH 1RZ8B 3EFDH 2YFNA 4GXPA 4DKFH 2F2HA 2VXVH 2VLLB 1IC7H 2ICWB 4JO2L 5CSGA 3SCVA 3LPWA 3BZ4A 2CK2A 4ZPTA 5KZ6A 3WXVH 1ZT1B 4UV7L 1UZ1A 1Y18A 4NRZA 5L6YL 3KGRA 2FL5B 4M6NL 4X9IA 4FQ2H 2W9EL 1U93A 5KS9B 1NJ9B 4NZTH 1YECH 4R3SA 3MCG1 2CUMA 1AQDB 1WLHA 3P4OA 5I1AA 4WUUB 1GYAA 3NBNA 5GJSH 1KLUB 1FCCA 2DAVA 2ITCA 3QUKB 4LFHD 2IH1A 3GNML 4PJFF 2QADB 5I17A 4MPKA 4XMKL 1J9YA 3BGMB 2QKIB 1DR9A 1K6AA 3FOMA 1ODZA 3RGVA 2B8OT 3OF6A 5IB5B 1QNRA 2GJ6B 1AR2A 2WIIA 3M1BB 4NHCL 5KJRH 4NQCD 5CSZB 3MUIA 5FCZA 3VSTA 3GM8A 1MHPH 2P42B 1QYGL 4CKQA 3H7BB 3HC0B 1CICA 1QRNB 3H3PL 1EEZA 3C2AH 2BVOA 3CUPA 4GW1B 4RGNC 4UNVA 5SWQB 3F12A 3QXTA 1BPVA 2J78A 1Z0MA 4X6BA 4F57H 4HZ7A 1M7XA 1C12B 1KJ2A 4OCRL 5TDNA 32C2A 2AK4A 5D7IA 4R2GD 4OCWL 3VWKD 4BKLA 2E9WA 1EZVX 1DJSA 4QAWA 4JFPA 4R96A 1V8HA 3GSNA 3L5XL 4Z6AT 2NX5E 3M8OH 4PJ5D 4GS7C 3SKJL 1V3IA 3SKMA 4G43B 2QJDA 3DV6A 5F7UA 4W87A 1J0HA 3DVFA 3M45A 3QQ3B 4L4VB 2OTPA 4RMRA 3QHNA 3WUWB 1CDHA 4WEMB 2GVYA 1WDRA 4J1UB 5J1AA 4CMMB 3NFNA 3LKNB 3QDMD 5I75C 2IUZA 2C1PB 4WWKB 4YHOH 2AJSL 1E70M 5FV1L 3TZVB 4I18B 4PMVA 3QXUA 4PJXB 4P3CL 3Q6GL 4OFPA 1UWGH 4N0UB 3W81A 4ACZA 1FL5B 1U3JA 1UH4A 3U0TA 3MO4A 2FBOJ 2IH3A 4I1NB 4AZCA 1MLBB 1F3JA 5FKPB 1OBAA 3AIWA 1KXHA 3GMMA 3L3DA 4DW2H 1S7UA 1H11A 3LVEA 2J2ZA 4Z7VE 2ZXAA 1P7QD 5TQ0L 5FA3A 2FGWH 1JMZA 2ERJB 4R2GC 5GSVA 3VWKC 1YMHB 5KZCD 4NC1E 1K9DA 1ERNA 1MCBA 3V4PH 3ORJA 1KB5A 4PJEE 5CFHA 3BT2L 3INUH 3O41A 3W9DB 2DB8A 1S7QB 5DEFA 2DDXA 4LFHG 4OCLC 4PBGA 1BP3B 1RIVH 3KXFB 1B0GB 5C0EA 5FD0A 3O2WL 1ES0B 1W0YT 2QQKH 4FRWA 4X98B 5L8JB 2MOVA 4NUJB 5D93B 2WZHA 5FF6A 4LEOA 4JRYE 3FNDA 1GC1C 3TV8A 4HT1H 1FLRL 4HZ6A 1CLZH 3TT3H 3CX5K 2EXYD 3DSNA 1Q9WA 3MV8E 1MF2L 1W9PA 1HK6A 1JGUH 1RZJL 1A6UL 2XZQH 2WCAA 1JNNH 3O0RH 1MW2A 2B0SL 1JXJA 3BKJH 4YK4B 2XFYA 4ZFFB 3QUZD 3QULA 3W9EB 3G04A 5J1SC 4ZD3L 1XGYL 1O7SA 2QMKA 3AYRA 1W0VB 5MENA 1A9EA 4BH8A 1MVFA 4NN5C 3OF6D 2G60L 5D7KE 1C5DA 3U30B 4XB3A 3MR9A 2RB8A 5LQBL 1P9MC 1NSNH 1I1AD 2VC2H 4GLRI 3O4OC 5HYIA 2P8PB 1A3RH 2WLZA 1MQKH 4HK0B 4W7UA 5DMKB 5F1NA 3G6JF 5ETUA 4PJGF 2BNRB 3VIMA 2V2TB 4GW5A 5LAXB 4PGEA 1MFCL 2AK4D 2DH3A 2FEDC 1QEWB 2P5WB 3ARGA 2QLVB 3LN4A 2NZ9D 1HNGA 2EDLA 3G9VA 1X1NA 1XGZA 3LKOA 1A3LL 1KCKA 3P0YL 1WTGT 1C7SA 2EXYC 4ODWA 3V0VA 5LA2A 3DMMA 2FBJH 1T0NB 3SCMD 4DEPC 3RTQB 3BP7B 4ONGH 4F15B 2O61B 5LXGL 4EOWH 4LIQH 1AD9A 1I7RA 1DN0A 4X5LA 4FTVD 5CPQA 4NQXB 2V6HA 3BAJA 3CC1A 4CGTA 3FQXA 3PABA 3FB8A 3Q5TA 3BVVA 1C8PA 3OHXB 4F2MA 2KZ1B 3L3GB 4ZEPA 1U91B 4LCWB 1MHCA 3RGVC 2PW1A 4WV1A 3LQAH 4Y2DB 5FA4B 3WFLA 4ZUTA 4Z7WE 5T33L 4KZDH 1D5BB 3SQBA 1XCTA 1CFSB 2WK2A 3VFWB 4NYLB 5JXAL 1WIUA 3MQIA 3EFFB 3IDGB 1I1AC 4HZLB 4PLJC 2YOCA 1QFOA 3KZSA 1CICC 5E09A 1JCKA 1R33A 8FABA 2VLMD 3X3FL 1CK0H 3CCHB 4O51B 1I3RA 4OM0H 2R29L 1BWWA 3MNVA 4QCEA 4R8WH 3WIFA 3DUHA 5SWZE 4R26H 4DO5A 5I30L 5IEHA 1LL7A 5AY7A 1NBVH 2OMBA 5ERWB 1U41A 1N0LA 3U9UB 3V6OE 3KAAA 2MNUA 3NCJL 2NZ9C 3DROB 4KMTL 4P57B 3MRBB 4O58L 3U7BA 5CP3H 5GGRY 1TZIB 4P2OA 3RBSA 1KCVH 3UXFA 2FWOB 4MNGA 2VLKE 1KXQA 2E9BA 3WD5L 4G6ML 1WPCA 4OF8A 1EMTL 4JRXB 1YJDC 4NBXB 1X5JA 5EUOA 4HKZA 1J8KA 4W5UA 1OLZA 4AEIL 3WDJA 2VQ1A 1ISYA 4PRWA 3WQ4A 3G5ZB 1T4KB 1B3VA 3PZMA 3HPJA 3D85A 3VCLB 1DQLH 1PSKL 1PKQE 4FNLH 1ZU8A 4HIXH 3EMZA 1H4PA 1MI5D 4MCYA 2FLBT 3OPZH 4O5LH 1VBRA 3U0WL 3BH9A 1GQIA 1FGVH 1Q0YH 4AQOA 4CMHB 4MAVA 1A02N 5BVPH 4ONHA 4XRCB 3V95A 4GJTB 1AXSB 4JHOA 4ZFGH 3U36A 4U1IB 5K9JH 4J3SA 4LXFA 4JRYB 2F8XC 4TTDD 1IGCH 2YD4A 3MRGA 2BFVL 5D8JH 1X4XA 5ALBL 1Z6JT 2UY4A 3WLBA 3HPLB 4R90L 1EBAA 3KYKL 2BVQB 3MUY1 2OL3A 4UOJA 3BAIA 4IOIB 5DMGC 3TCLB 1JHLL 2X1OA 3QWRD 3LS4H 1PZUB 1R87A 3FCTA 1XIWB 2AJUL 1Q9KB 2BC4A 1PFCA 4JZOB 3TT1H 1K6QL 3VXUA 1I3GL 4XNMA 2IPKB 1BVZA 4EN3A 4HS8L 1FHDA 1FV1A 1MY5A 4MWFB 1JXKA 1OGTB 4UFKA 1KCRL 3L4YA 2UVFA 3EOTH 1X5YA 4HMCA 3SY0B 1W8NA 4X8JA 1QD0A 1E0VA 3DBXA 1P4IH 3LRKA 1BZQK 4LOUD 3LRLA 5D1XA 2VX4A 5E8NB 3SDDA 4P9HC 4C83B 3VI3E 1VPOH 3BE1H 2MQCA 2WHJA 4K71C 3RRQA 4HS6A 5KOVC 4CD7A 4JFHE 3ULVD 5I1JH 1W72H 3QNYB 2HMID 1I3UA 4G9FD 3EMCA 1U8NB 4QGYA 1HIZA 1ISWA 3U9PH 4OZFB 1DUYB 1V7NH 4RCAA 3PV6A 3ESUF 4WENB 1H3XA 2R69L 2W38A 4MCZB 1DN2A 1WE5A 4AY1A 1MW0A 1PJ9A 3FO9B 3CV5A 3GSUA 2ICEB 5CPTA 5E70A 3Q2CA 2OMNA 1BJ1J 4RDQG 5DGQA 1OL0A 1G7LA 4GSDL 2DMKA 1U8IA 2F5BL 1Z0NA 3QEHA 5GJTL 5HGBA 2EPOA 3MLVL 1U8KB 4G80A 5HDQH 3KPRA 1OP3K 4PJ9A 4JHBA 4MQ7A 3PWVB 1RJZA 3LRSB 3PWPE 4FQCH 4XMPL 3L3KA 1XGQB 4HUWA 3VDCA 4LOUC 3HNVH 3IDIB 2DIBA 2EDXA 1AC6A 3SGEH 3U0PA 1NFDB 1IKNA 3RVUD 3GRWL 1QHPA 4P3WA 5SWZB 5DRWA 1J10A 2LU3A 1G7IB 4YXKL 5C07E 1XGRA 2DD8H 1QLRA 4LVNC 1U3HA 3ULVC 2BRRL 4D6DA 5ISZB 2EIZB 3IKCA 2HMIC 3MRJB 1W3HA 3WFDL 2J62A 5E4EC 1NFIA 3O3DA 3L1OL 1PBYA 3GGWA 4JDTH 3FQNB 3MODH 4YAQA 1LO4H 1ISXA 4DKAA 4KTDH 3VXUE 1UZ4A 3IDYB 1A7QL 3TWCL 4Y5YB 4NQDD 4TSBH 2WBJA 5TH2A 35C8H 3SUTA 1TJIH 4RMQA 4TNVF 1SBBA 2UY7A 5TDOA 3RWEA 1KJ3L 2UYLA 4ZFMA 3DX7A 1FZOA 3QIUA 4RWYL 2WVTA 4OLVL 3VXTB 1INQA 1S9KC 1LNUA 3NIDE 4OZIE 1ITBB 2F7RA 5B8CC 3DI2B 4L8SA 1KR0A 4GINA 3H42H 4DAGH 2APFA 3JTTA 1J01A 3VXSA 1MRFL 1JWMB 5ACZB 1EXPA 2QQLH 3RVUC 3ES6B 3RWFB 5KVEH 4OD1L 4Z7OE 1UT9A 3TEUA 4BQ3A 4OZHB 4ZUVB 2J79A 1FO0B 1I1RA 1UB6A 4D0BA 4RRPA 4D9QD 2F9BT 4XGZA 4QHLB 4FLQA 4JQXA 2W0FA 3T3PE 4GG6A 2FO4B 4DGVL 5DC9B 2D7NA 5E24E 2F58L 1EOKA 1F90H 1MVYA 4PTWA 1UR4A 4I0CC 3VOCA 3MU7A 2GJJA 1QFPA 2UY3A 4LSRH 3DX6B 1XSIA 1CG9B 2V2XB 4DWHA 1LK3L 2AABL 5DI8B 1XSKA 4GKNA 5BQ7B 2UV3A 1M01A 3RMEA 5FHBL 4WTXA 1HILA 5DT7A 2Y36L 5IW3A 5LGJA 1FFQA 3EOYG 3QIWA 2C4FT 3FT2B 4I0PB 3U7YL 3P9LA 5F89A 4JFDB 1RJYB 2A6IA 1U8OB 2FJHB 3HUJE 5F88A 4KK5D 4MX7A 4CDGC 4CKVX 4N1CA 1KCSL 4CU7A 1RURH 4J12A 2J8UB 1RZKC 4UNTA 5J6HA 1C8XA 4PV9B 1FL3B 1JUFA 4ORGB 2OLHA 2H1PL 1MCWW 1MFBL 3MV9D 4OD2B 4O9HH 2CHOA 1WFOA 4XCYB 1JYXA 4KRTA 3CK0H 1P7HL 4YDIH 4QRRA 4MNMA 3NGBB 3U83A 2VXTH 5FV2A 5DQDL 4WNQB 4HXBH 3D51A 1FDLH 1NPUA 2W9LA 1E4JA 4QOKA 4PJ8A 4JR9H 5JDSA 2DIAA 4ZYKA 1VESA 4HUVA 2A6JB 1XF3A 3FT4A 1ZA6A 5CEZD 2H9GB 4LIQE 1L9NA 3VRJB 1SEBB 2DPEA 1T1YA 4JANB 2XGBA 1GJUA 1WWBX 2PKDA 3MGOB 5EOCH 3UBXA 4PJIE 2WBKA 4BUHA 5I15H 5IK3A 4F37F 5IGXH 1SM3L 1QWNA 4XXCA 4QRPA 2VQUA 2DL2A 5FCUL 1TCRA 5EZOH 2WHLA 4KK5C 3WDIA 2VAAB 2OJZL 2V38A 2HJKB 5IG7A 1DBBL 1S46A 3ZHDA 3E6FB 3KYOA 3HG4A 1MOEA 4HJJH 4KHTH 1EVUA 5C0BA 4K9EL 1RPQA 4OFVA 1ND0B 1CLXA 2X9WA 5BRQA 4Z7UA 3FRPA 2WXDM 3ULUF 2NTSP 1KXTA 3WKNA 1MPAL 1HNFA 5DWUH 3WD4A 1IKNC 5JW3H 4Q2ZB 3DECA 4W5ZA 2BVUA 4KJQC 4MAUL 3QG7H 3WDRA 2BFGA 2Z4QA 5I1DA 5JHLH 5BXRA 4PRAB 3CU1A 3EMQA 5HDBE 2BCKA 2NW3B 4JY4B 5IQ7L 2O5ZH 2YDSA 3N1MC 3RX8A 4BSJA 4M62L 1HH9A 4MA3A 1R3LA 3NACH 4JJ5A 3VD9A 3N12A 4HX1B 3LKPB 3UTQB 3GSRB 3RAJH 3C8KA 3R8BB 3WIHH 4BJLA 1TQBB 2WBJC 5EBGA 3UTZA 2EDBA 1OW0A 4AWEA 5SV3A 3D6GA 2PWHA 1C5CL 5HYSB 3O2DA 3WO3B 4XAKE 4LEXH 2YXFA 1C8QA 3BP4B 1G7PB 5EIIB 5FYJU 4L8SC 5KSUA 4X6EA 4FQXA 2ZPKL 3F6LA 4NZFA 4Z77A 1SBSL 5H37H 2Y7QA 3HZVB 3OA5A 1I1FA 3VW3H 3T77B 3F5JA 1BIIB 3THMH 1LE5A 1GIGH 5KVGL 4I2XA 4LLUB 1HI6B 3CGTA 3FL7A 3FB7B 1XR8B 4A3YA 5ALCH 4X4XB 2AGJH 3OSKA 5T5FL 4V1DB 4JQXC 2X05A 5FL0A 4HFWA 4GI8A 3S5ZA 4MQXD 1PLGL 4Z8FL 4GMSL 2IBBA 5GRJL 2FB4L 1CR9L 4HG4J 5IEKB 2X2HA 5D9SB 4DM1A 4BELD 2EDDA 4UQ2B 4QRRD 1NAKL 4NFBA 1BM3H 4ODTL 5DGRA 3EIFA 1QI0A 5F70A 4C7GA 3ULSB 2Q6WB 2Y5EA 4DWSB 3AIUA 1NCCH 5T1KA 4QOKD 1FGNH 1UQSA 4PJ8D 5SWSE 1DVFA 4FZEH 3PL6B 5D70L 3GMPB 4PJCB 3ARFA 1UM4H 4JFEE 1I3VA 2F19L 4PJ7A 2NR6D 3GI9L 2BSSA 3S88L 4QFUA 4ZXOA 1JYWA 1EHNA 1OGBA 2OI9B 3D3VE 1SMAA 5IMKA 4JFUA 2NY2D 5A43C 1RUPH 2VLJA 1YN7B 3BP5B 1D6VL 3BGFB 3I50H 4RRPG 2MANA 1EH9A 3SDCB 3IF1A 5F3HB 3IETA 4HIEB 3SOBL 1JHKH 2ATKA 3GSWB 4MNQA 5C0AE 1R5WA 2GTWA 1E4WL 4N9GB 3VXME 2WKLA 5HHPA 2G2RA 5CIPB 4DOHE 1Y0LB 3LV3B 4KVCL 5C0BD 2DQXA 1JWUA 5J89A 3QNZA 1ZBWA 1R3JB 1FZMA 2XKSA 3MFFB 4NNPH 5C0RL 1A1MA 15C8L 4JKWA 4UAOB 2ZXBA 3PGDB 4F7CB 1T7WA 1NOUA 4AH2A 5FO7B 4PJIB 5LBSL 3RWDA 4F8TA 1B6UA 5BO1L 1Q1JL 3GHEL 5JHDA 1TFHA 1KN2H 2GYSA 1HJUA 5FDWA 4PJ8C 1ORSA 2I9LB 2XYCA 4FQ1L 1UCBH 3F7QA 1U8HB 4R4BB 2AAVA 4TRPL 4Z7QE 1G0DA 1JF5A 4U33A 2GJPA 2DSKA 2XWBA 3KPSA 3MUAA 4PJDE 3FQWB 1KWGA 1QLFB 1BJ8A 1KIRB 4M3JA 4H88L 4XXCC 1I7ZB 1IARB 2NY2C 1C16B 4HCRH 4K3DH 4NJAL 4Y5VB 1WP6A 2DQTL 3SGJA 2V5CA 3JV6A 1W9VA 3PWJA 4NHUA 1I8IA 3OTTA 1NQ6A 4LRIA 4ATWA 5D1QD 2XKNA 5F7DB 1E0WA 2PUQT 1DBJH 4N0YL 3UPCA 2XOTA 3O3EB 2F1BA 5JO5B 5EC1B 3EJSA 1KN4L 2DL9A 3EYVB 1IGIL 2G3MA 4APQA 4PJFA 4YHZH 4M61B 5HVGB 2ZOLA 1DBML 1I7TA 3O6LL 4URIA 3TA9A 5HI5D 3LS5L 1KYOJ 2ED7A 2WSKA 3SHSA 1E40A 4JZNA 1NGPH 4JO4H 1Y6KR 3CVHA 3O9WA 3TONA 4LLVB 4Y1AD 1LGVA 5DURD 1GPFA 2P5EA 3UBXG 1OF2A 5DK0A 1W1PA 3JVGA 3VRLE 6FABL 2NSXA 3QSKB 3ARRA 2RGMA 1NKOA 2JLLA 4HTYA 1NMCC 1F4XL 4MNKA 1D5XB 2WWMD 4POZD 4P2RA 5DJCB 1Q6FA 2GT9B 4GOSA 3TM6A 2DQGH 5CGYD 4YLQT 2G4FA 5JUEH 1DVFD 2RQ8A 1OW0C 2G5BA 4PJBB 3D2UB 5DHYA 2FX7H 4YPJA 1NCBH 1HJQA 4KDTC 3HZYB 4XPAH 3C6LD 3FRPG 1GPOH 4X5XB 4LCIH 4HKBB 4BA8A 3ARUA 3WS3A 3KPPA 3V0WL 3IFOB 1MW3A 1MCKA 1CLOL 5GGRB 1WC7B 2G75A 4IJ3C 4P8UA 4HJ0D 2E9MA 3IDJB 4GG8B 5F3BB 4HBQA 1CGVA 1MAML 2X70A 4LF3A 1MLCB 4D6GA 4YDLB 5CEYB 5JA8B 4UQEA 5E00B 1HWGB 3RVXD 5HI5C 3I6KA 4ZUSB 3BPOB 1RK0A 1OGSA 1CE1H 4FQHB 3GSVB 3FO1A 5I1GH 4R7DA 2HFGH 2XZZA 4MLIA 4L4TD 4XZWA 3UTPD 1OWRM 2VZ1A 4KQ3L 1ODAA 5CZVH 2J88L 4RNRB 2RCSH 3V6FB 3BWUC 4POZC 1VB9A 4PUBL 2R23B 1BLNA 1QNZL 3WIHA 4F7MB 5IFAH 5JNYB 2ITDB 2R1XA 1DVFC 1UUQA 2IC2A 2VDMH 1FYTB 2BRQA 2XGIA 4Q74A 3AU1B 4L4OA 5BXSA 3MI6A 5CILH 1HNYA 3F5WA 3MRIB 5HYJD 1EHAA 3VA2C 5ITBL 1VGKB 3H9SD 3KR3L 3IXAB 3HZKA 5I2IB 1A3HA 1OAYL 1UKSA 4JFZH 4EKJA 3LKQA 3OG2A 1G0CA 3RVXC 4M7LL 2DI9A 3BCDA 4LSTL 4ZTOL 3PHQA 2WHMA 2CRYA 2HN7B 4EBQL 1BZ7A 5JPMA 5T3XD 2AOSA 1ADQH 1Z2KA 3SCQA 2J3SA 5KSBB 2B4CL 3SUUA