1SMAA

Crystal structure of a maltogenic amylase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
588
structure length
588
Chain Sequence
MRKEAIHHRSTDNFAYAYDSETLHLRLQTKKNDVDHVELLFGDPYEWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYHEAPSDDTAYYFCFPFLHRVDLFQAPDWVKDTVWYQIFPERFANGNPAISPKGARPWGSEDPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHCGYEFAPFQDVLKNGAASRYKDWFHIREFPLQTEPRPNYDTFAFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWREFRQAVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEDMSASEFADRLMHVLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPEKQNKELYEHVKQLIALRKQYRALRRGDVAFLTADDEVNHLVYAKTDGNETVMIIINRSNEAAEIPMPIDARGKWLVNLLTGERFAAEAETLCVSLPPYGFVLYAVESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords MALTOGENIC AMYLASE
publication title Crystal structure of a maltogenic amylase provides insights into a catalytic versatility.
pubmed doi rcsb
total genus 156
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1smaA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1smaA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1smaA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1smaA03
4Z2KA 1IGML 1EZVY 5MEOB 5C3TA 4P5MB 4AY1A 3O4LA 4NXSA 1GZPB 5F7MC 4WI7A 1ZLSL 4AENA 5KVMC 5IHZA 5E4IA 2MQCA 4LMQE 4PJDA 1T1XB 3OPZH 1T1ZB 5DT5A 1VACB 1ADQH 4JKWA 3VG9B 4UB0H 4XVUD 2Y7QA 4LEOA 2Z91A 1BWWA 2UZYB 3X13A 1NARA 1R7AA 4QWWD 4XCNA 5E1HB 2DLTA 2P5WB 3CFKB 5DGQA 2DLEA 1G6VK 5FAAA 5J11C 5FUCC 5HSFA 3VFPB 3DBXA 3BH9B 3CMOH 5C07B 3MLXL 2NY6D 1KPVA 3NIDF 4MAYD 7FABL 4W4NA 5L0QC 3K74B 5DF0A 2DS4A 5F3BA 5HGDA 4F7MA 1T1WB 2NXYD 3KYKH 1JWSB 4HZLA 3EOTL 1R3IL 1MWAL 2R4SH 5IVZB 4NYLB 1NC2A 3HZVA 2UZXB 1HXKA 3C60C 5HDBF 5FKPB 2X5PA 1JK8B 4TNWK 2NR6C 5EUKA 2V2WB 1NUGA 5D96B 1QR1B 2XZAL 4H1LB 1UACL 4EOWH 1RJLA 4HF5H 5DJYA 4QRSA 4M93B 4NRZB 1FN4B 1OAZL 4Q6YA 3T2PA 1K9FA 2J8UE 4NWTL 6TAAA 3OKOB 4OI7A 4K2UH 4GW5B 1FFOA 3UEZA 2DMCA 1OT2A 3HI1B 4JPKH 3TBWB 2PKDA 4XPHH 1U8MA 4DUWA 3C6SA 2CESA 1P7KA 4RRPG 4YH6A 1GQJA 4EN3D 1GPOH 5DJZA 1ACZA 5DI8A 2A6IA 3KLSA 3C08L 4Z7WF 5I6XB 1EHLL 1CDYA 1AY1L 3WELA 3ZSTA 2PCPA 2W60A 4OI8A 1ORQA 1ZA6B 3SDXE 2AXJA 3QUKA 4AZGA 2NTFA 2FEDC 4KJPC 1TETH 2APBA 4LVHB 4PJCA 2E6QA 3CHDA 5T3XD 2YMXL 4BYHA 5HHVH 3VD4A 5TFSH 4L4TD 1A6ZB 2QQLL 4HIHB 4AL8H 2F8OA 4JFFE 4OCXL 1BQHA 4TN9A 1QLRA 5F7NC 4C59B 5EC1B 1T04B 5AZ2L 4XCYB 2AABL 4OCYH 3GXPA 5MENE 3EYQC 1EJOL 3VX1A 4ONHA 3MGOB 5JQ6H 1SMAA 2ZPKH 3ARDA 4U0QB 3EYVB 2F5AH 2W0FB 1R3JA 1VCAA 4KXZH 3NSMA 4ZFOA 3QRGH 4FFZH 1XZ0A 3LPGA 3P9WB 4U6TA 4XP4L 3BH4A 5K9KA 2B1HL 4QRPE 3NACL 3TJEL 4EIZC 5FO7A 4X4YA 2EEAA 1FVCA 3SQBA 1OD8A 4WUKH 3DXAE 5HDOA 1R46A 3TGXA 1MHEB 3QCTH 1QW9A 3SDXB 1F4HA 2HKHL 5DO2C 4P7RA 4K7PL 2HT4C 1ZKAA 1U91B 3ALXA 3NFNB 4X6DF 1GOWA 1CICD 4FTVE 2GCYB 3CK0H 3C9NB 3VIJA 4QF1A 5C0EB 3NTCL 4P2QE 1TZHA 1XD0A 2CK0L 3M07A 2V5CA 2W9LA 5ENWB 2OL3B 3L7FB 3L3JA 4JFFB 5E94A 8FABA 5L2JB 4F2MA 1NC4A 1YEGH 5MENB 3BZDA 1BWMA 3QQ3B 1JYXA 4QT5B 2CRMA 5CBAA 3W25A 1ND0B 4LFHG 3U6RA 4PJGA 3WL9B 4PLJC 4GO9A 1EGZA 1KFAH 1AO7E 3TIEA 3CV5A 4XX1G 2WW8A 3BPOC 3TCLB 4NOBA 4QRPB 4Y88A 5F21B 2HFGH 2XICA 1RSFA 2X7LB 4CMHC 1CR9H 1C5DA 3DXAB 3JV6B 1BREA 1XV8A 3O3AB 1DEDA 5IQ7L 5DK0A 3KPRE 4FTVB 2IC2A 1KELH 3HG3A 5FA3A 2FX7H 5A2CA 1DN2A 3VFMA 4P2QB 3CAFA 4NZTH 4X80H 1F3JB 4XPBH 5GZOD 1LEKB 1M6OB 1RUKL 1MVUA 2I9LA 4YEFA 2HRPH 2APWA 4PTTB 5D9OA 2AXGB 3OR6A 1X3DA 1OAQL 3ULUF 3B9KB 1A7RH 5DJ0B 1A7NL 1CDGA 3NJ3A 2UVEA 4BQ9A 3IDIA 3W29A 2YD4A 1U8JA 1GHFL 3DMMD 2YBTA 2FH6A 3LKQB 3MREA 1OTUD 4GBXB 2NMSA 3ZQ9A 3UR8A 3MLUL 4CDGC 4HEPG 4ZFMA 3MRHB 3O0RH 3W4RA 4PLKC 3H7BA 4ONGH 5BQ7A 4G9FA 3WS6C 1XGYL 2V7NB 2F7PA 5HGAA 4XPTH 1OF2B 4AMXA 5I8OH 3KPRB 1I7TA 1QLEH 3EDKA 4P4RA 1IC4H 3EYOB 4XH2A 3DX3A 4LSDA 1H8OA 3EYUH 5JXEC 2EIZB 4EUPH 2YD3A 1LK2B 4ALAL 4NGHL 2EC9U 1HCFX 5D7JA 3PUCA 3RO8A 2WZIA 4Y4FA 1MRDL 1BIIB 1CLZL 1L4IA 2R0WL 4G6ML 5DFTA 1KN4H 1WZLA 4KPHH 1GCFA 1VAHA 4OLVL 4QNPF 3WH5A 2ZOKA 2JCCA 5ISZB 1P4BL 3BP4B 5AUMA 4PJFE 1JXJA 5GS2H 4MDIB 5B8CA 5EIIA 4PTWA 5C07D 5FYLD 4Q22A 4G7YH 3TYGH 3B3IB 5J1TC 4LPXA 3DVNA 1UH2A 2QTEA 1RK0A 1U92B 3A24A 3BIKA 3VXTA 4QRTA 2ESVA 1FYHB 2N56A 4XC1L 4GO8A 2J8HA 2DD8L 1T0MA 2PW1A 1UM5L 4NM4H 1LL4A 4HJJH 2JE8A 4YEEA 4BA0A 3AS3A 4HC1H 1QACA 2IANE 5LGKA 5D5MA 4LHQB 1NBYA 4GKNA 3PNWB 1D9KC 5I76B 5GSVA 2SEBB 3U0PA 5BRQA 2ADGA 3QIWA 1UWQA 5JO5B 4RNRB 4K71C 1BZQK 3L3GB 1Q9KB 3BAXA 1HJVA 1IBGH 4OGYL 3FQTA 5AY7A 3JV5A 5EN2A 2H2SC 4M7KL 2H9GB 4IJ3B 2WWKO 3PWNA 2ICWA 1J0ZA 2FATL 2QF8A 3EGSA 4KRLB 3L3OB 5TPWL 3E2HC 4PJFB 3W2DH 4YX2H 1D5XB 3D0VA 4DGIH 1OLLA 3VM7A 1EMTL 3VFOA 5HXMA 4H8WC 3D3AA 5F7DA 2X44D 4P7LA 3U4BH 4JKPL 4FQ1L 5C0FB 3O3BB 3F7VA 5IB1B 4ORGA 2VNCA 4WI8A 5DEFB 4TYUA 1PG7L 1WCBA 4FFWC 2WMIB 1DBMH 1G7JB 5ETUB 5SX5H 3U7YL 2RCSL 4LGPB 4D71A 1J1PL 4ML4A 2IANB 1H11A 2CKSA 4UFMA 3SKOA 4NJAL 3GSXA 1MREH 5L9DL 1W3HA 3V7AG 3D69B 3GB7B 5E2WL 1TJHL 4LSTH 1XCQA 4XPGH 2DIEA 4FZ8H 1JGVL 4KK6D 1HI6B 3ZR5A 5CILH 4FF5A 3CD4A 4F79A 2HG5B 2O5XH 1QHZA 3EO9H 3VXRA 1HILA 2JJWA 5GHWL 1TQCC 4IS6B 4XZUB 1QTYT 3MLYH 1XAUA 1TVHB 1QFWM 1YNTA 3SKMB 4KKCC 2HT2C 5EBMA 1WV7T 4L8SA 4RGNC 3WLBA 1KTBA 5L6YL 4HS6A 3BVVA 2DEPA 3SDAA 5BV7H 3U9UA 2WVVB 4TULL 4D9LL 4LCIH 2CIIB 5ERWB 5H94A 1F58L 4GG6F 1XGRA 2FEEL 5C70A 3LH2L 2WVTA 3IGAB 2ZX5A 1RUPL 1KPUA 1T80A 4RAUA 5FOBA 4JFFD 1N6VA 1BAFH 1H3PH 3M1BA 4U1JB 3BEWB 4OBRA 2AEQH 3BDYH 3G6JB 3NIFE 5DLML 5MEND 1AD0B 1BEYL 5DD5L 3WMSA 1GJUA 2WMHA 3P9MA 3GJEB 4EE9A 3PJSB 3K8KA 1D5BA 4NZRH 3X3FL 3OZ9L 4RA0C 4WU7B 1N59B 2A6DA 4HUWA 3RPIB 3L9RA 4QRPD 2A73B 1GORA 2DQIH 2VKWA 1BGAA 5KS9E 2HAZA 2R0ZL 5JPMB 4F9JA 4LKCB 3L3KB 4JHWH 4XPFL 3LRKA 5EU6E 3RVTD 1E6OL 3DXAD 1NLDH 3QNYA 5EZOH 2PTUA 3GIZL 1D5MA 4UZSA 4Q9QL 2BVPA 5IFPA 2D3VA 2DH2A 4OZ4B 2AXFB 1KB5B 2VAJA 1T7WA 4ZO7A 1XF3B 4FTVD 1IAIH 2XTJC 1VPOH 4C4KT 3HPLB 4J3XA 4LL9A 1BVLA 2J7CA 4P2QD 4WLCA 1OWQA 3MV9B 1A2YA 2C4FT 4OM0L 3BMVA 2E8YA 3QOMA 4XUYA 1SJEB 3P0VL 3PWVB 1B1YA 1JPGA 2RR3A 3B9KD 3R06A 2WZHA 2PETA 5GNZA 1Q8MA 2BNQA 2IGTA 4UFJA 3B2UC 2PWHA 1N2RB 1UWIA 3VIHA 1KCRH 4XNZC 4BUHA 5CD5C 1CFNB 1MCSA 4X5XA 2PF0A 1AO7D 4U33A 5IGXH 3GKZA 4HT1L 1UOKA 4R27A 2IH1A 5JBFA 1HYSC 1I4FB 3ZDXF 5C1MB 4GRWE 1RZJC 3QXWA 4KZDH 5CXPA 5ID1A 1KCVL 1RURL 2UYLA 3OKEA 3IDXH 1I85A 1MCQA 5HGBB 3U2SB 1FNGA 2P44B 3KPRD 5CJXA 4PJ8A 4RL3A 4M56A 1A0QL 1NBZB 1WZAA 2WANA 5D4QA 4PJXE 3IF1A 4HIIA 4PV8B 1VFBA 4MA7H 1G5AA 3N1PC 1FJ1B 2FJFA 2VDNL 2OI9B 3UO1H 3AB0C 2P8LB 1IKNA 2CH8A 5KSVB 2HFFB 3D0LA 4OF7A 3LRSB 3LSOB 4LLWB 4UT7H 2O5ZH 5GS0L 4L8BB 4HKJA 3M17B 1X6NA 2GAZA 2VJXA 1U8LA 3CUFA 2BMKB 1JN6A 4ODUB 4PGBA 3FL7A 1GNXA 5B4MC 1UWTA 1V3KA 3WHXB 4N0RA 1WFTA 3CDYA 2IADB 4GRWB 4XNYL 3DHPA 3MMWA 4JRWA 1H49A 1BGGA 3IU4H 2QQQA 1X5ZA 1XEDA 2PTTB 5EO0B 3V7MA 1XCXA 2O9PA 2DT1A 5KVFL 5CFHA 5T1KA 1HHKB 4POZC 1AGCB 4HV8B 3CNKA 4KWUA 3S88L 3GK8L 3ZT5A 4IUGA 3RY6A 4IRZL 4WCYL 3W39B 3ARBA 3LEYL 1W72A 3QUXC 1KCKA 2XM1A 4F33B 4WWKC 1C7TA 3QXAA 2D3LA 5GS3A 4M61B 1J05B 2AQ3A 2C9AA 2F15A 3OJDB 3SKNB 4M1DL 4U3CA 2NYYC 2VH5H 3K0WA 4CW1B 2R39A 3WN5B 5B39G 2EYSB 4TUOA 4P8VA 3RTQC 4Z2HA 4UINL 1MCIA 3P30L 3QJHA 2P47B 1EH9A 5JW4M 4I4WB 5E8OB 5EZLA 1ZVSB 4HPYL 4BF7A 3NFPA 4RGOH 4MNQA 4NQVA 1UCBH 2IAND 3CUPA 4TQEL 4KI5C 4L5FL 3VH8G 1MQKH 5DWUH 1EVTC 1B2YA 1L6ZA 2EPMX 1G7IA 4G5ZL 5GGRY 5C0ND 3U9PL 4LGXA 4NO2A 3SUWA 1ISYA 5IEHA 2EXWC 1RU9H 4GAGL 5CP3H 1LO0H 1Q9WA 1UJTA 3RZCC 3IKKA 3TBTA 1LDSA 4JO4H 2CDFA 2J4WH 3FQNB 5IF0A 4JZ5A 1DVFB 1ETZB 5EA0H 2FO4A 2J4GA 4HUNB 1S9XB 2VL5A 2HH0H 2EYRA 4Q74A 1RUAL 2JFEX 4OFYA 2A0LD 1LO3L 4XVSL 2CYGA 3E6HB 1P7QB 1A6VH 4K3DH 5DT7A 2A3CA 2VCBA 4PGZA 4PJ7A 3RRQA 5JNYA 4M6AA 3U5UA 3HCVB 5TGBB 3CLFH 4F7PB 2ZWYA 1SBBA 2VXTL 1C1EL 4JRYA 3FB5A 5TQ0H 4TOYH 1HWWA 5I17B 3RDTD 1A3RH 1FGNH 2PXYA 1LP9B 3F8UB 3P2TA 3GEWB 4GXVH 2X4SA 3BKMH 4YWGL 1B3WA 1H2JA 4ZYKA 1UD5A 4JIEA 3TO2B 1XCTA 5E24E 4R4FH 4PJBF 3QG6B 4NNYA 3LOWA 5KAQG 2VE6B 4KC3B 1QLFA 3DV6B 5I1IL 1JD7A 2C1PA 5KANI 1KPVB 3GMQB 4UQ9A 4F9PC 2EICA 3TTOA 3KPPA 3MRBB 4W88A 1J9CT 1LQ0A 2WWCA 4LBEA 4F7MB 2J6EL 4X6FB 1A6PA 3A4XA 3TF7C 1RHHA 2QLVB 3B9EA 3W81A 4I3SH 4CUCA 3WO4C 4PJCE 4LSPH 1KG0A 5JW4R 4M29A 1RZKH 3RUGA 5EZIH 3LEXB 1BJ1H 2VVSA 4YXKH 3SPVA 3V5DA 1RJLB 2DTMH 3MCLH 4QRSB 5KEZA 1RUQH 2ZSVB 5E6IB 1JZ8A 4I13B 4U1GB 4PTUA 3CUJA 3VNYA 1KB5L 2YD7A 5I23A 1ZHLB 3QHZL 4KK8C 3WD4A 4D0BA 5GS1A 4QGTA 2EADA 2AJSL 4KUCD 4P9HC 3Q6GL 1VA9A 3RFZC 4Z2IA 4LVNB 2ZX9A 3DX2A 4ZEPA 4HTYA 1E4JA 1MHCA 1Y0LA 2FJHA 2ITDB 2JK5A 4P4KA 4DGVL 3GH5A 4UUJB 4EDXA 2UY6A 5DJ2B 2ED9A 2WIMA 4YIQB 2P7TA 3QUKB 2NTFB 2I9TB 4MNHA 4NZUL 2FCBA 1H0DA 1MFEH 1B88A 2VR9A 5DJDB 1CQYA 4XCCL 5EU6D 1RMFL 4CU8A 5DRXB 4OFKA 1QEWA 4GMSH 1CXEA 2OJZH 1BQHB 1OD7A 2ZCLH 3FOLA 4NNXA 2DQHL 1L0YA 1CE6B 4Z8FH 3BKCL 2P5EA 1BFVL 1LJYA 3V0AC 4OFIA 4PJGE 4O4YL 3M8OH 2XRAH 4Z7UE 1SEBB 5ABFB 3WXWL 1XZ0B 1HINH 2OBGA 4FQLH 1TLKA 3VFVB 1L7TH 4W86A 4TNVK 1JGUL 1TJGL 4O02L 4X4XB 2G75B 1P53A 3LKPB 4P2OA 2D73A 3TN0B 3PL6D 4JFXB 4JM2A 1E4WL 3DIFA 3JWOC 4JJ5B 1U95B 4PRHA 2P24B 3JWDL 5HDRA 1YQVH 3PZTA 4ZAKA 1NGQL 1IE5A 1PY9A 1LMKA 4HXBL 4WNQB 4RWYH 5F7HA 1TQBB 5I66A 4ZS6D 3SIMA 3LQAH 3MXVL 4QTHB 4EAMA 2A3AA 3TO4D 3GMPA 5JA8B 2F74B 1N6QH 1NC4B 2EXYC 5A3ID 5DYOA 4JREC 4JQVC 3BOVA 1S7UB 3B8SA 5IMLB 1ZOXA 3WFDH 3TFKD 2WMFA 2X70B 1ZT7A 2WCSA 2CBUA 4QHMA 4Z7UB 5FUZL 1WFOA 5IM7B 4RMQA 4NO5A 1NFKA 2ARJA 2DQTH 1CZ8L 3OR7A 2FX8L 1V08A 5J6HB 4YHZH 5KVEH 3KDMA 5C8JA 3WEZA 2EEBA 5ABGA 3JWNC 1R34A 3BAEH 5DZOA 4LIQE 4TX8A 3NH7H 3REWB 3VGGA 3BIBX 2XT1B 5J0BA 1N8ZA 4PG2C 1UWEH 1EDTA 3L5IA 4KK5D 4LQFH 4MAUH 1A6AA 5D93C 4WK9A 3WBEA 2E0PA 4R2GC 2ZE0A 3T0WA 3H2WA 2EBNA 1GIGH 1LNUB 3N06B 3OPZL 2V9RA 3PBGA 1U93B 4Q97A 1ADQL 1LQSR 1B9ZA 1ONQB 2DICA 2Y24A 4UB0L 4EI6B 1KPRB 5I74C 4D6JA 3RKDC 2VXVL 4U1SA 1ZGLB 4ODHH 3AICA 1U8JB 3FRUB 4NI3A 1Q9LA 3UX9B 2IQAB 2ZICA 2Q3AA 4HGMA 5I71C 3QFDA 4E0RA 2IFFH 4POYA 1NPUA 3MO1B 1WZ1H 4F15C 3BYYA 4X9YA 1EFXD 1ACYH 4YBHA 5EU7C 3VIMA 3CMOL 2YEZA 1FZJA 1T22A 2ILLA 2R1XA 1E3ZA 1DVFD 1SZNA 2ESVE 2AEIT 2AJUH 2UUDH 5HHPA 2APTA 4BS0A 1AC0A 3BGFC 5IFJA 3KYKL 4V2CB 4TRPH 3OKLB 4XMLH 2R4SL 2HMIC 1JXKA 5KSUA 2ZCHH 2DYPA 1WUNT 2R2EA 3UTTA 4RSVA 1UXWB 4EOWL 4HF5L 5I1AA 5F1KC 4C83A 1G7LB 3D1MC 3PGCB 2CIPA 1KGXA 1UKSA 1VEOA 4MA1B 4K2UL 4QXTB 3B9DA 5IV2B 4LSUH 4N0UA 1JDCA 4PV9B 5IB3A 1V3JA 4JPKL 5I5RA 4XPHL 5FYJU 4JRXE 2DL2A 1OCWH 4MD5B 1RK0B 1HJQA 2D9QB 3MRNA 4C56A 5E8DH 1GPOL 1PSKH 2ESVB 1OTTC 2OXGA 1UA6H 3D85A 3RVVC 2VT0A 3VXQB 4JHBA 4K55A 5GJTH 5DRZA 1NC2D 4H20H 4JLRB 4QHUA 1KTLB 5LGHH 3V5HA 2BNRA 1E6RA 4H04A 2D4FA 3VGBA 3UP1A 2ZZUT 1UD3A 4JCMA 1MQRA 1TETL 1UKTA 3DYMA 3SDDC 1F42A 4HGWB 2BSTA 2ADGB 4CNIA 5HHVL 5TFSL 4FLSA 1GSMA 4EQ2A 3FW6A 1P6WA 4TXEA 5E6ID 1KXTB 4AL8L 1CDHA 5EN2B 1YEDA 4FLOA 1KR1A 1TQWA 2B4CH 3PWNB 5FHAH 4OCYL 3HMWH 1GXEA 4GOSA 4DWSB 3WJLA 5JQ6L 4R7NB 2ZPKL 1CFTB 2F5AL 2Z92A 3UCRA 4LLQB 5BS0B 4H0GA 1HQ4B 3QRGL 1HHHA 4NRXA 5F7DB 4FFZL 4JRXB 5K9OB 3QAZC 3RDKA 4D6DA 3IU3A 4X6CF 2NX5B 3SY0A 4NN5C 1MFVA 1JG9A 1HH6B 5BV7B 3MV8E 5IDIA 2FBOJ 5HI5C 1GGBL 4WUKL 3WKZA 3QZWB 5FKAA 2R2BA 2R1YA 3H3BC 3QCTL 5D6CB 4R4BA 4BQCA 3REVA 5C0DB 2OQJB 1TENA 2A9NL 5KG9A 3Q5OA 3CK0L 3K81A 1LWJA 3LRLA 4HKXA 1YC7A 5CGYD 4FFVD 4LSVH 2ERJC 2YPLE 2WNGA 4S11A 5B3JE 1INDL 1YEGL 3HZYB 1J86A 3EJUA 3QJFA 4F7EB 1H5BB 5JW4N 3WD3A 2XJ7A 2E40A 5HJ3A 1YNTB 5A6AA 1KFAL 3MGTB 3DO7A 3IETA 5D2LF 4LX4A 2AGJH 1WDQA 5FO9A 1QRKA 4FNLH 1B3JA 5F1OB 4AZ5A 4W68A 2GFBB 3IXAB 2HFGL 4Z7NE 3SDAB 1CR9L 3EYPA 3MV8B 5IBTH 4I3GA 1ZHNA 1Z5LA 5DHVH 5IVXE 4WI6A 2BVYA 1XGRB 2CUIA 2XSAA 3LPPA 2YLLA 4Q9RH 3U46B 5SV4A 5D2NA 1FIGL 4P46C 4PS4H 3HNTH 1CXIA 3BWUC 1KELL 2LU7A 3IJ9A 5FOBB 4HPGA 15C8H 2ZSWA 4KROC 3SGJC 3ZJ7A 2IMNA 4NZTL 4X80L 4XPBL 2F9BT 4G9DB 1NC4D 3TC9A 4LK4A 3W6MA 2HRPL 2YPLB 3PZIA 5EDXA 2HA1A 3S5LA 2H32H 3TBYB 4RCAA 3P9MB 5HHNA 2QHLA 3EO1A 1RQ5A 4ZDHA 5AZEH 1A7RL 2D7QA 3VRIA 1I7RA 2XACC 4BK5A 5EU3B 3SGKA 4L4PA 3GH4A 3D9AH 3OSKA 1PIGA 4NQDA 3S97C 1W2PA 4G80A 3PZGA 5EU4A 1M1SA 3U30C 4ACYA 3KS0H 4PRBA 3QNYB 3O0RL 3UZQA 4YO0A 4ONGL 5DVKA 1XSKA 1QA9A 3CH1B 5IVXB 2JB6B 1E28A 3UAJD 2V3FA 2V9QA 2VXUH 4DVRH 5FL1A 4QXWA 4XPTL 2XGIA 3VXUB 5I8OL 1NEZB 1QLEL 1A6TB 4G6KL 3ILQC 1T2QH 3FFCA 1IC4L 2COQA 3WL0A 2EDJA 3B5HA 1FL3A 4N9GB 3EYUL 2NW3B 3F5KA 4G8IA 4QYOA 2G4FA 1JYNA 3DUSA 1XH3A 2CKBH 2DOCA 4U6XA 5HY9A 3RHWK 2R2HA 4B7LA 2HVMA 2OMBA 3KYMA 1HDMA 5T3ZE 1KN4L 4KPHL 4PR5B 4CVXB 5BZDA 1AKJB 4RQQB 2X4PA 5GS2D 3CZFB 3O3DB 4QRQA 1HT6A 1NOWA 3GHEH 1DL7H 2MANA 1X5GA 3D3VA 1X5JA 1FL5A 4G7YL 4G9FD 4UDUA 3BN3B 3HUJE 4MA3B 3TYGL 3GBEA 2Q87A 2UYLB 1DQJB 1JPFB 3OKEB 3S6CA 3MNVA 1P9MA 4BSVA 1UG9A 4HSQA 3AISA 4PJ8B 1ZHBB 4PBVC 4NM4L 3WIIH 3VO0A 4HJJL 4HC1L 4PB9H 1OP5K 3MRJB 3MR9A 2CCRA 4X6BA 4QHLA 4P8UA 1BYBA 4XTRD 25C8H 4DO6A 2UVFA 1OOAA 3V6OE 2FGLA 5E9DE 4QCIB 3R0MA 1JGEA 3GH7A 4XGZB 2D1ZA 1UM4H 4V1DE 3K1DA 4LPTA 1IBGL 4Y5XB 3H3KA 1EGJH 3FT2A 4XRCB 3BPNB 1MHHA 1JNDA 1M01A 3IDMA 1BGXH 5A6JA 4HWBA 4XBPA 5C86A 4WSJA 3OG4B 1JN6B 4JG1H 4QRUA 4AT6A 1S7SA 2HYMA 2BVQA 3F58H 1P84K 1L7IH 1T89A 4YX2L 3W2DL 2BC4B 3QIBA 3O2VH 4DGIL 3CZEA 3TTYA 1YZZA 3U4BL 3HUJB 2XN9A 3VWJA 3J7HA 5FV2A 3VU2A 2ESVD 4HU8A 4XMKH 4YDIH 1A1OB 2VLJA 3L3HA 2O61B 4LPCA 1BQUA 4MNQE 2DWDB 1DBML 4KDTC 1NSNL 3O2LA 1P6FA 1G9NL 4QOKA 5J12B 1UB6A 1OGAA 1MREL 3WFHB 1JWUA 1JHKH 4LSTL 4XPGL 3VDHA 5FDWA 1QSVA 5E9DB 3CVIH 2BVUA 4JQXC 4V1DB 5CILL 5JDJA 5B38G 5KZCB 2GT9B 2ORBH 2FYYA 4OZHB 4X0KA 5EBLB 3VGDA 4RAVA 5TJWK 2O5XL 3EO9L 3ARYA 3HB3D 1JYWA 2FIKB 3MNWB 5IBLD 3MLYL 2JJSA 4FXKB 5CIPH 4M8UA 1T3FB 4JRXD 3AU1B 5BWFA 1QUNA 1B6UA 2X41A 2ESCA 1YEEH 4PJ7E 1J87A 3TESA 3AXIA 1FFQA 5DXWA 1KEMH 5A6MA 5EZLB 4JZJC 4W84A 5JLZB 5BV7L 3WUFA 3QSKB 1U3ZA 4JRYE 1MXDA 4LCIL 4U1LB 3P4OA 4HOZA 1NAMA 3RNKA 2VDPH 2RFXA 3UTZA 3PP3H 3T0XA 1HYRC 3UMTA 5A6BA 5AYIA 1CIDA 4U0RC 1JZ7A 4UU9B 1BAFL 1H3PL 1CTNA 1NMAH 2AEQL 3BDYL 5IF0B 3WUWB 1KLFA 3QUZB 3VWKB 3LX9A 4YFLF 3PP4H 4Z7VF 1U8KB 2XWJA 3ULUC 2D31A 2FO4B 4PMVA 3WE6B 5F7YC 1IEBA 2VL5B 2XZZA 3AAZB 1EA9C 2WXDM 3UTPE 5F1IB 2DQIL 2XZQL 1QPXA 3AS0A 3QEQA 5D1QA 3SDAD 3N12A 3WF1A 1RJCA 2OX5A 5DHXB 3MV8D 1FLRH 1YDPB 2YD5A 3S36H 2X4QA 4JHWL 4QRRA 5HYIA 1R75A 2XKNA 1NLDL 4I48A 5EZOL 3FB5B 2Z35B 3V0VB 2PXYB 4Q9BA 4P8XA 1V5JA 2NY2B 1IAIL 1VPOL 4XB8A 3RWGB 4GKLA 5K9JL 5H37H 5C0AE 2YPLD 3C8KB 2V5YA 3MUY1 3OB0H 1TPXB 3HI5H 3EFFB 4H2CA 1FLTX 3B83A 1GHRA 5E00A 1ZSDA 3QPQC 4TSBL 5IIEB 2XUCA 1KCRL 4Y19E 3KLHD 2CLRA 5IGXL 3U7VA 4Q58C 4F9LC 5JIPA 1RZ7H 3U0TB 5KJRH 4CU7A 2VRAA 4KK9D 3H9HA 4JN1H 1IC5H 4HPOH 1HSBA 4OUEA 1NBQA 4KZDL 1A9BA 1BQLH 4LCCB 4YHIA 1TA3A 2VAAA 5L8KB 4P57B 1Q1JH 1FVEB 1W9DM 2D9CA 4OQTH 3QDGA 4J3TA 4PBWD 3W37A 4D0BB 2UWEE 3DV4A 3X11B 1RIVL 4MA7L 3MRKB 5C0AB 4DO4A 4ELMA 2Y1VA 1UASA 3UO1L 5DHYA 4TPRH 4EI5C 3MRLA 3ZE0F 1EEQA 4IOIB 5F9JB 1QHPA 2FJHB 1XYZA 3AHTA 4P4KB 5GGTA 3RPMA 3RGHA 4YHLH 4N0YH 4M00A 4UT7L 2O5ZL 5J6GA 1AKJD 1NCNA 3EYSH 3V2AR 4XWOC 3EOYG 1MNUH 4Y19B 4MSWA 4WFGE 3O8XC 5HYQB 1MI5A 2EZ0C 1S3KL 4H88H 5A16B 5CGTA 4BSWA 2EDDA 4PMUA 1BMGA 3M6DA 5E08H 1I1XA 1RJZA 2WINA 4L8CA 2V5MA 4PJ8D 1G1YA 3DRQB 5J3HD 5DJ6B 1C8XA 3KHQA 4EKJA 3QA3B 1E4LA 1BYCA 1KEGH 2QL1A 3F12A 2A6KA 1EAPA 1SHMA 4HUUA 1LD9B 1ECEA 2UWEB 1FL6A 1JNNH 4FQIH 3THCA 4HZAA 1FPTL 1HSAB 3MSGA 5DQJB 5LA2A 1QPPA 2PB1A 4R7DA 5CP7B 2KPNA 4LCUA 2EEXA 5EOQH 5IMKA 1MCKA 5T3ZD 3SE3C 1U2CA 4Q7DA 4RGMC 4S0SD 4Z76B 1NH6A 3BYTA 4LLUB 3QEGH 4Y2DB 2EABA 4AW7A 2VH5L 3EW3B 5DD6A 4OIBA 3BP6A 4Y89A 4EJ1C 3TOPA 2JIXA 3BSZH 4IDLA 5F88A 3MRFB 3AQUA 1EO8H 4GG6A 1T7ZA 1BFTA 4XCEB 3GSNA 4NCC2 1J88A 2Q76A 1CFVH 1XHGA 1UENA 4RGOL 1UCBL 2FZ3A 1DHKA 3LY6A 1E4IA 3SJVB 2CLVA 2WHKA 2HTKD 1MQKL 4QHMB 5DWUL 5LQBH 4HMDA 3ILPA 5ECJE 2AJ3A 1MFNA 3OGVA 2XWTA 5E9DD 3ARBD 4CVWA 3WS6A 1NDMB 3B9VA 1ERNA 4U3XA 5C0IB 1RU9L 4XWGH 2FJGB 4V1DD 1KJMA 4L1DA 1WWWX 4X7EC 3FRPA 4XP6H 5F7LB 1AXSA 5ACZA 4ZXBA 4NCC1 3O6KH 4JO4L 3CZLA 5LXGH 1SQ2N 2J4WL 4X83A 1KENH 4XCFH 4WENB 5EA0L 4UNVA 4X4MA 5CEXA 1N8ZB 5DK2B 2J77A 2HH0L 4IRSC 1M05B 5D1ZB 2IJ0C 2QKIA 1A6VL 2NLJB 4K3DL 3UTTE 4NQXB 2XFXA 4MNQD 3LPWA 4UQ2A 4S3JA 3CLFL 4R4ND 4OCSH 4TOYL 2HVKB 5TQ0L 1QOXA 1T21A 1E73M 1A3RL 1DUZA 4FQQA 4AMKH 1FGNL 1GGUA 2BXYA 3BKML 1Q9LB 5CKGA 4QEGA 1DDHB 2FGZA 3WLWC 3QQ9D 3QFDB 4N0UE 1D5ZA 2HTLD 3PV7A 4R4FL 3TA3C 3MODH 3LN5B 2HLFC 4APQC 3DHUA 4MJ6B 5FGBA 2XV6B 1UQSB 2Q7YA 3GXDA 3VWKD 3DJ9A 2OSWA 1TITA 3N0PB 3QIUC 5FFLA 1CVRA 1HJSA 3BESR 4OF6A 4HIEB 4RE4A 1D9KA 2FL5B 2IPKB 2GI7A 1BZ9B 2BNRE 1ESWA 4OFYD 5DDHB 4I3SL 4PB0H 4MDPA 1I9IL 3PGFH 3OAYH 4LSPL 4E41A 3W38A 2DYPB 3UTTB 1RZKL 2EO9A 3KPMA 4L3EB 5EZIL 3TT3H 3GSUA 4JRYD 1TJIH 5F89A 4YXKL 4PSRA 5IB2A 5GS0C 2DTML 4TVPH 4L9LC 3MCLL 1RUQL 2PXYD 3LS4H 5I1AB 3AIRA 4C83B 1OHQA 3MANA 1LO4H 2H3NB 3LXCA 4BZ1H 4PGDB 3VI4E 1UT9A 3O9NA 2PNDA 2KZ1B 4A2LA 3GO1H 2FR4A 4NQCA 2W59A 1XIWA 1KLUB 1JDDA 4OCRH 4OZGA 4NBZB 5EB8A 4W4OC 3CO4A 5DJCA 3RX5A 3PGDB 3PF2A 2J8UF 2QR0B 5HVGB 5I3DA 1RP9A 4GRLC 1X6LA 3BPCA 1UXSB 1WWAX 4I0PC 2EH8H 2BNRB 3UTPD 1HZHH 2BNUB 5D8JH 2VOTA 1MFAH 1CIUA 1MFEL 1AGFB 3C5ZC 3K4ZA 4F3FA 2BSTB 4X7TA 5I77A 4JANA 1T2JA 3MUGB 1UFUA 1X4ZA 4KKBC 3IDJB 1MUJA 4M9OA 4GMSL 1WQVT 3HE6A 2OJZL 3O6FB 4EZMA 5A3HA 1X5IA 2ZCLL 3QDAA 1U3HC 4H8WH 3CZSA 4P59L 3SDXF 4F7TA 5LAXB 5IEKA 4Z8FL 2R56H 2ATKB 2V5TA 2Z92B 3M8OL 4AIXA 1R87A 2XRAL 5C0AD 1IC1A 2Z31A 2VZ1A 1VADB 2VMFA 1IGTA 1HINL 4JVUA 1NGXB 4FQLL 3L95A 3F7PC 1L7TL 4P4KD 4HOXA 2J62A 4YQXH 4WDIB 1VJSA 4HDIA 2OTWB 2Y25A 5IW1B 2YDSA 3CCHB 5DJXA 3MX0A 2NY0C 4DM1A 4Y19D 3MUJA 5DHVB 5MEQA 2XG5A 4YDVA 3RL1A 1VB9A 2BK8A 4LHUG 4WW2A 4IRJB 4PJAA 5D2NE 4PGCB 3DWTA 4PJHE 4P5KA 2PWFA 3L4UA 1YQVL 5HYSG 2GHWB 2NY4B 5ICYB 2WC4A 5KW9H 3H54A 1OM3L 3LQAL 2EDBA 4N9OB 1HNYA 1RIUH 1OP3K 2XGBA 2H32B 3DSFL 2WC7A 4J7RA 5EULV 4ZUVA 3TNMA 5CKAA 5SV3A 2Z93B 3WFDL 1M03A 4NP4H 1HXMB 1CDJA 2YD8A 3BVXA 1U8QA 1JDAA 3LRHA 4NQDE 3C6LC 3GMMB 3N9GH 3PDDA 5EIQA 3P73A 2DQTL 4XBEH 3RCNA 1U8PB 5M94B 3ROOB 4J1UA 5CZKA 5D6DC 5IW3A 1ZHNB 4PD4J 4YHZL 5KVEL 2CDGB 1BJ8A 2FECL 4ZSOE 5ICZA 3R4DA 1VRXA 4Y2DD 1V0MA 4HUVA 4LPWA 3RWCB 4Z5RB 1E71M 4WFGD 3BAEL 3NH7L 5JQHC 1KXHA 4ZAKD 3BZEA 3FFCE 1R3LB 1UWEL 4PJHB 1J0IA 3S35H 4R3SB 3FQRA 4LQFL 2ZUVA 4MAUL 3RPKA 4PJ9A 5AD0A 4CKQA 1F4YH 3FQUB 1W8NA 5C9JB 4HPHA 4Y5VB 3S5LB 1GIGL 2ED7A 2ZG2A 4ODWA 4ZPTB 1F6AB 1HHIA 3VRIB 1I7RB 4YHYC 2FB4H 3I75A 1Q9OB 3C2AH 4ODHL 4M1GH 1OTSD 4GKOA 4AZCA 1NFDB 2IFFL 3GBNL 1WZ1L 1BM3H 5AWNH 1ACYL 4DAGL 1XR9B 3VXPB 4NRYB 4ZSOB 1S7TA 4J8RA 4WKFA 1ZS8B 1PKOA 2VITB 2AJUL 4LCWA 5AAWA 1A21A 1OW0C 4LKXB 5FM5O 4LGRB 3FFCB 4DW2H 5D1ZD 4XMLL 3ZTNH 3DX0A 4UV7H 2WAGA 4EQ3A 2ZCHL 3ZE1E 3FT4B 1W32A 3LZFH 4P5TA 4FG6D 3QI9A 2XQBH 5TE6H 2BXZA 2W65B 4GQRA 5GPRA 1NEUA 4AMWA 2WYSA 4M8QB 4Z9KB 3VXNA 4WW1B 2AJVH 2E3VA 4OLWH 2VC2H 1RZJH 4P2RA 2Q8AH 5DRWA 3CVHA 3QXTA 2A3EA 4HLJA 3VFNA 4LSUL 1X7QA 3S5YA 4MB4A 4H0IA 3F5WA 1UA7A 2IALA 4RBPH 3WD1A 1AQKH 2XN9E 1OCWL 1Y6NR 5DA0B 3EFDH 5J9PB 3ZKND 5TDOB 1RZ8A 5E8DL 4BSVB 2GUOA 4YPJA 5I24A 1UA6L 4AM0A 1INEH 2IBZX 4I18A 4PJFF 3EOAA 5GJTL 4AC1X 1A22B 4H20L 4HWZA 1F11B 5LGHL 4HOWA 5EG6C 3G5XB 1DANT 1I1AC 1OGAE 4YNYA 1EBPA 2DYPD 3UTTD 1OD0A 1Y6MR 4MNLA 2H1PL 1F5WA 2APVA 3QHFH 3OBAA 1JGEB 4JAMB 5EORH 5FECB 3AHXA 1KYOK 3GSWA 2C0HA 4FK9A 1I8LC 3ZYIA 4NO3A 4JHZA 3HAEA 5HDLA 2B4CL 5FHAL 3WCYA 3HMWL 3JWDC 5CJOH 1YMHB 1XGTA 2VSDA 3W5MA 3WFBH 2XVKA 3DDFA 1IGYB 5CIPB 1OT1A 4RFOL 4MLIA 3G6DH 2OJEA 2K7QA 2XN9B 4N90E 1I3GH 1QSZA 1YEKH 4Y4KA 4DZBB 4YLQT 1YC8A 1EEZA 5GRVL 1WFNA 3KEHA 2P42B 5L2KE 2BNRD 1CXKA 5TDNB 3BXWA 5HHQA 5I8EB 2CR6A 3TONA 4RIRA 1H09A 2F53A 5FUCE 1UB6B 1L9NA 3RZCA 2ZUYA 1JWUB 4YHPA 5FYKE 2GTWA 3HPJB 3O9WA 3GMNA 1U8OB 3GI9H 4HKZB 1D6EA 2PR4H 3O6FD 4O9HH 4U1MB 1W72H 4UAOC 4LSVL 4BCEA 5DMGD 4X0KB 4S1RH 3LQZB 4RAVB 3OX8B 3FQXA 3BRGC 1RP8A 5M5DA 5AC4A 1PW3A 3RVUC 5J1AB 4MGXA 4CJ1A 3KPSE 1MIEH 2NY5C 2AGJL 2C7UB 2VQTA 3QEQE 2KQMA 3QPXH 3HZ3A 4FNLL 4WHTB 4Y5YC 2YA0A 1HJXA 5CJ5A 4JDZB 4P7NA 5L2KB 5IBTL 1FVDA 3KVQA 1M7DB 1ZVYA 5E70A 1CFSA 1TMCB 1SM3L 4XC3H 4IRJD 5J11B 1NAMB 3MACH 3RNKB 2E27L 4B53A 4Q9RL 2Y23A 4HG4J 2NY4D 1QSEA 1ZAGA 4PS4L 5ELIA 3HNTL 1UR0A 3G5VA 2YK1H 5L0QB 3RL2B 4PJEE 3BW9A 1XF5A 1W0VA 1E27A 3R8BB 4PMQA 15C8L 1YNKH 1JMXA 3BUDA 1RPQA 1EZVX 3FZUC 2ADIB 5IBUB 1CGTA 1MF2H 4ISVB 1WBXA 3SCSA 1GC1H 2XWJB 3C60B 4XP9H 2IXVA 5AZEL 3NIGE 1IEBB 1MELA 4OGAC 4K3EH 4PFEA 3KPSB 1QNRA 1A7QH 4KUCF 2BRQA 3QEQB 1QD0A 1P4IH 3EYFB 3NIFF 1MVYA 1CBVH 5E9AA 5FEBA 1DN0A 4U1KB 1H3UA 1EHAA 1JTPA 3OXRA 5IESH 5EZJA 3WSQH 2PYFB 1NJ9B 1WITA 4DVRL 2H6PB 4QDMA 3BQUC 3PDOA 5KS9F 4Y1AE 3D2UB 4NUJB 1DR9A 1T2QL 1RHFA 3SDYH 4UZGA 1T83C 3ALFA 4PJEB 4D72A 4A6YH 4PLNC 5E0CA 4PRNB 4HZ8A 4KY1H 1PKQB 1EHNA 2CKBL 5IHRA 1BBDH 4Z0XA 4OD1L 5HI4C 3SDCA 1ZSDB 2O92A 1BIHA 1JWMA 1S7RB 3HS0A 1EOKA 2ZX7A 1H3VA 4BQ5A 2VX5A 4NQDD 3DRTA 1MI5E 1NMBH 3W6LA 5LBSH 1TXKA 3GHEL 5C0GA 3MXWH 1DL7L 5IB5A 1Q0YH 2VL4A 3JVGA 1XGPA 2PO6C 4C4KO 3LXAA 2DJSA 4U31A 2DF3A 3SKUD 3FFCD 4D1JA 3WIIL 4PMOA 4ONFH 4M3JA 2EDOA 2GUYA 4Y1AB 3DETD 3EJZD 5F72S 4PB9L 4N0CD 25C8L 1C16A 4G7VL 2IAMC 1I8MB 3PWPA 3CH9A 1DQQA 2P45B 3MFFA 2J75A 1UM4L 5INDB 5MI0C 2MPAH 1J8KA 1LO5A 1I1FB 5I19H 1EGJL 4EEEA 4PJXF 3CZGA 1C7SA 5E2VH 2CUHA 1BGXL 4X6CA 1YYLH 5F7KC 4NDMB 1YMMA 4JG1L 1T5WB 1HHGB 1NGYA 2FX9H 3F58L 3S4SA 1L7IL 4GI6A 2BSSA 1A9EB 2ZUUA 2QEJA 3GM0A 3O2VL 5E5RB 3CLEH 5ESAB 3AMDA 2XYLA 1TE1A 3NN8A 2GY7B 3ARVA 3PN8A 4PEEA 4L8CB 4XMKL 5BJTA 4YDIL 3DC0A 4XP1H 3FO9A 3MLPA 2NPLX 5KSAC 2F19H 2HN7A 3BPOB 3F12B 5A2KH 3GYCA 3PXHA 3WSUA 4R0LA 4CMHB 2X4RA 3VXME 4XX1E 1FV1A 1FO0H 1JHKL 1G9HA 3L2LA 5EU5A 1UADC 4UIKH 4HBCH 1TNMA 1AGBA 1IT9L 2ICEA 5IWLA 1N3NB 2ORBL 3ZDYE 5I2UA 1QWUA 4X7SL 2X9XA 1KN2H 3K7UA 4EUPG 1J0JA 3QIBD 5I15H 2DWEB 1KT2A 1QFPA 2R0KH 2XN9D 4QLLA 1YEEL 1N0XL 1OGTB 4YBQC 5BZWA 3RVWD 1KEML 4KKAD 5JORA 3AZTA 3NCBB 3VSTA 3W0WA 4QOKD 1BBJA 4OLUH 1OGAD 1G7MA 5E8PA 1DEEA 5CMAB 5CEZE 4H26A 3VXMB 2AJ3B 2VDPL 2LU4A 2YRPA 5ABDE 3PWLB 4G6AC 4CL7A 1FAIL 3KPOA 3MLVH 4PJDF 3SE8H 2WVUA 1OWRM 2EDEA 4UILH 5BXFA 5E09A 4UOZA 5TD4A 4ZXBB 1RFDH 3QXDA 1HEZA 3GUTB 5DUMH 1CS6A 1NMAL 1FP9A 4JFDA 3VFUB 3HZMB 4WTZG 5IG7A 4M24A 5B21A 3MUIA 4YUEH 5GRJH 3IDGA 3PP4L 2NZ9D 4F57H 3QWOB 3OZPA 4NO0B 3RM9A 4KJWD 3BRDA 3AXLA 4P9MH 4N90D 2GJ6A 1XF4A 4E41E 2QKIB 1UVQA 2UY7A 5C0CA 4FLRA 1MJJA 3LEVH 1SEQH 2YC1B 4JFWA 2XFXB 2E3ZA 4OD3H 3QUYA 5L2KD 4MAVA 1FLRL 1CLOH 4KTDH 3S36L 4ACZA 3K2UH 3CDGB 3UG3A 3H3PH 5J8OA 3UDWA 4ATLA 4TVDA 2FGWH 3BXNA 2XVPA 4IDJL 3SGDH 1W3LA 1T21B 3WXVH 4LYPA 1DUZB 5HGHA 4BFBD 1RPKA 2GDUA 5A6BD 1KGWA 2NY1C 4ZTOH 2CETA 5FYKD 1UWRA 1ZL1A 4NQCE 3SO5A 2BJMH 4IISA 2GJRA 5FYKL 1VSCA 4OZGE 3RJXA 2D22A 2MHAA 1KWKA 3U7BA 1BF2A 4RFEA 3HI5L 2NR6D 3WIFA 5I1DA 2PN5A 3GI8H 1D9KB 4XZWA 1HH9A 5KVDL 2UY2A 3DLQR 3KXFA 3NCMA 4K71B 3KPSD 4OZFG 1QQDA 3D4ZA 2B39A 3QEQD 1RZ7L 5KJRL 2WLZA 3P77A 4M3KB 5AYBA 2DMBA 3QCVH 5DUPH 4JN1L 1IC5L 4HPOL 1E43A 1JAKA 1CCZA 4XVJH 4NJ9H 4LPUA 1IGIH 5IB2B 1LLOA 3UYOD 3E2HB 1BQLL 5F3HB 1CD1B 3GXMA 4UQAA 2FLRT 1Q1JL 2R4RH 1T0NA 4NFCA 4PJCF 4FMKA 2L7UA 3DX6A 4OQTL 4UT9H 1AQDA 2JJUA 4RGNE 3MCKA 4XAKE 1VFAA 4MCYA 1CN4A 3BWAB 4NIKB 4MX7A 4NQCB 3SE4A 1TFVA 4GMTH 3JTSB 1KJ2A 4JGUA 2C1OB 4OZGB 1Q6GA 4DN4L 4P23C 1BTCA 2DSVA 3HMXH 2FEDD 4KJPD 3RU8H 1W8OA 5ACMA 3X14A 4N0YL 3QXUA 2IBGA 3V7AE 3VW3H 1YY8B 3EYSL 1G7HB 1MNUL 4U2YA 1ITBB 3RWIA 2VXSH 2WWDA 4E5XA 1EDGA 3EYQD 1E55A 1LEIA 4H88L 2EKJA 3B5TA 1TQCB 3MV11 4HFWA 4IIQC 5E08L 3SCNA 2FWOB 1ZBVA 4BQ6A 1PZ5A 3NA9H 1QVOB 4MCZA 4Q6IC 4Y1AD 4JHAH 2CLZB 1JF6A 4I8DA 1KEGL 1LEGB 3Q5TA 3MRCB 4FQHB 1TCMA 4RGNB 4Y4HC 5DTFA 4FQIL 1JNNL 4J6RH 3AROA 4KGLA 5JIKA 1GAFH 3P9LB 4Y16A 4JM4H 4LARL 4ZFOL 5CPTA 2XSBA 2HT4D 2VABB 1QI3A 3NDZA 3AHYA 4P7QA 5EOQL 4U1IA 5GGSB 2BVDA 4PGEB 2YSSA 4PJGF 3V8CA 2X4OA 1GQIA 3AYRA 4RMUA 4XVUC 1FNEA 3OXSA 3QEGL 5AEAA 1MI5D 3DECA 4HX1B 5F7EH 3KPLB 3DUUB 1LL6A 3MV7E 3BSZL 3VCLB 3EBVA 3G04B 2N1KA 1MWAA 1EO8L 5D7IE 2CO6B 4PLJD 2WUBH 2XFYA 5T1LB 2C5DC 4MQTB 2VLKA 1CFVL 5CEYB 4ZUVB 3T0EC 1FH8A 2NXYC 2FHBA 3MLTB 3M45A 3QDJE 5LQBL 4OCLC 5ID0A 4N8VG 1U8QB 5DEZA 4ZE5A 5D9NA 4PUEA 3QEUA 4XXDB 4Z7VA 3CHCA 1ZHKA 3ARPA 4XWGL 3BVNA 4GQPH 2WQRA 4XP6L 4GQ9L 1R3HB 3T09A 2XTJB 1QNQA 3IAGC 4BH8A 4YPGA 1B0GA 4C7FA 2JB5H 5LXGL 1KENL 4XCFL 4WEUD 1RK1B 4G6FB 3UETA 2DQFA 1GZJA 3MJ9H 3MV7B 4U3AA 3VE0A 1CDUA 4J3SA 4OD2B 5AD0B 1ISXA 5D7IB 3V4VH 3D87B 4XNZB 5F97E 1CGVA 1GOIA 4EN3C 1OSPH 4YDJB 1H4PA 3TBSA 4OV5B 1B3YA 4JY6B 4OCSL 5FA4A 4OCNC 1N82A 1R86A 1CG9B 4L4TA 5INCB 3VXMD 4PLKD 1E9LA 2A3BA 4MNJA 4P2RE 4AMKL 1NP2A 3QDJB 4J4PC 4AMCA 2GK1B 3OKNB 5GGVY 3N1QC 2Z9TA 1CVSC 3CZKA 4PP2A 3RGVC 2A83B 2B0SH 4DKFH 3FQWB 4ZXBD 1U58B 3MODL 4X6EB 3V4PL 4W70A 1FE8H 5DR5H 2AKRB 2IUZA 4J8RB 1V7NH 4UNIA 4ZUUB 2V3DA 1X4XA 4W7UA 1ZGLM 4QLRA 2X10A 4NO0D 3AB0B 4LF3A 2ZUMA 1B30A 3VM5A 3MRRB 2X40A 1MCCA 5GRWA 3KLKA 2BOBB 3TT3L 4AIOA 1TJIL 1GOKA 3I02A 5LWYH 3BUTA 3UPAA 2D0HA 2KUTA 4TVPL 1DWFM 5I1GH 1CICA 5CEZD 2K3TA 5D5MF 4ODXB 1RH9A 4AZ7A 1TCRA 2OR8A 4BZ1L 2NY3C 1PG7W 1U2YA 1NM9A 2WWMD 3GO1L 1JHTA 4D6EA 1IEAA 1TVBA 3I6GA 5ABEA 3U83A 4OCRL 2GKIA 3BLBA 1K2DB 4KI5E 3EDFA 1DLHA 1D9KD 1NGZA 1KIQB 2X2YA 4WUUE 3NZ8B 5IR1B 3ZKMC 2Z4QA 1U3JA 2F53E 4HWZB 2EH8L 5FHBH 4S1DC 5IFTA 3QUXB 3VOCA 4PTMA 4E41D 1HZHL 5ESVA 4BK4A 3F7YB 2AJZA 5D8JL 3WS3B 2H2SD 1MFAL 1V3LA 3IJSA 4WWKB 3QDHA 1T4KA 4RZCB 4Z77B 4QLJA 4WV1C 3D39A 1A4KA 4ZQKA 2EDLA 2V6HA 4NKIH 2VUOA 3OAZH 5L8LB 3O41A 1AXTH 3U36B 1Y18A 4H8WL 3RTQB 5A2AA 3D4YA 3QUMH 1XGTB 4NQCD 1XIWD 5E2UH 4NRSA 4HWBH 2H2PD 1B4JH 2R56L 1JFQH 1IARB 2R1WA 4FHBD 1QVBA 4GAYB 4JZJA 5DD0H 5SX5K 5IW6A 4O51A 5A2JH 1GOQA 4XVTH 3AOFA 4XNMB 5GZOC 1I7UA 3ROLB 2VDMH 3LKNB 3RWDA 4YQXL 2AV1B 3DMMA 3FB8A 2EQDA 3JTTA 5IB4A 4WUUB 1A1NA 3SUUA 4GW4B 3MBEA 5IKCA 4WJ5A 1MQQA 3RZCB 2YA1A 3WY4A 1R5IA 1QSEE 5CPQA 2X1WL 2GTWB 1JNHA 1OTUC 2EKSB 4U3HA 5I1EH 5MEOA 4P5MA 1E3XA 1F45A 1GZPA 1U36A 2W9EH 5KW9L 2G9HB 1JTOA 5EO1B 1RIUL 2HT2D 4KKCD 1O7AA 1PX3A 2C3VA 4RGND 4XAKD 4MNGA 3UBXG 4O2CB 1T1ZA 2Z31D 1VACA 1S5HB 4NP4L 4YE4H 5DJAB 1X5AA 2ZUQC 3RNQA 2UY5A 1H15B 4B50A 3N9GL 2P5WA 4XBEL 3CFKA 2APXA 2R2CA 2XN0A 4U1HB 1PIFA 1QOKA 2W1NA 4UFIA 3VH8B 5SX4I 3VFPA 1TMQA 3BH9A 1ZT1B 4KMTL 4E9LA 2W4XA 1N7MH 3G5VB 1JWSA 2YS4A 3L7EB 5F7FA 3W11C 3ULUH 2J7LA 2BCKB 1EXUB 3QXVA 3QWQB 2VVNA 5IVZA 5K59F 5T1LD 4NYLA 4IHOB 1V3IA 4CCDA 4IMKA 1CFQB 1F4YL 3UCQA 2O26U 5FKPA 1JK8A 1SJHB 2V2WA 3WO4B 2PWDA 4TUKH 3ECQA 4F9LA 3IXTB 1QR1A 4H1LA 4HEME 1YPZE 2ADJA 2FB4L 2EO7A 2WK2A 2VI0A 1IAIM 2M26A 3C2AL 4NRZA 2J8GA 4OSUH 1RZKC 4M1GL 2EECA 1FN4A 3LPFA 3UROR 2EE9A 3L1OH 2C4XA 3OKOA 4GW5A 1BM3L 5AWNL 3HI1A 3TBWA 2OP4H 1NWTA 2GY5A 4KTYA 4XNUH 5EZJB 3N1AA 4G6FD 1MCLA 1G01A 4BQ2A 3BUQA 1GW1A 2WPGA 3MV7D 2AQ2A 4LLMA 4DW2L 4PP1C 3ZTNL 4CVUA 4YHGA 5IHUH 1MAML 2KKQA 1ZA6A 5KN5B 5CD5D 2OWCA 3PWPE 4M1CC 2X1OA 2PF6A 3LZFL 4D9RE 1MHPL 2XQBL 1M7IA 1YQ2A 3QR2A 3FTGB 1CI5A 4MVBD 1PJ9A 2VWEC 1A6ZA 1YPZB 1FP5A 2RGMA 3QDJD 4PCTA 2WQ8A 1IJ9A 2AJVL 4NC0B 1FGVL 4OLWL 5EC1A 1T04A 1RZJL 2VC2L 1AMYA 2Q8AL 4QXGH 4XCYA 2VXQH 1JJUA 3H9YA 4JFQB 5C0GB 3MGOA 4V28A 3CFEA 1DWGM 3OQ3B 3EYVA 1AQKL 2A6JA 3EFDL 3UJTH 1I1YB 3JBG7 3DX7B 1P7HL 1ZLUK 1TVPA 1US2A 1INEL 3MRMB 4GO6B 1DWHM 2QLYA 3VDBA 4NHCH 3JV0A 1LG2A 2WMKA 1IGFH 3QI9D 1MHEA 3I6KB 1KIRB 1UJ3C 3PWPB 3QHFL 3A5VA 2LE9A 1A1MB 1DQQB 5J13C 5EORL 1U91A 3NFNA 4JFPB 2GCYA 1C5BH 3C9NA 2WNWA 5I73C 4OB5H 4YDLC 3QHMA 2XWEA 4P2RD 5ENWA 3L7FA 2XFRA 1JUFB 1NLBH 5CJOL 4OF3A 5L2JA 1UZ6F 3WFBL 3UPCA 3WFLA 2ZKHH 3QQ3A 2ZXAA 2BSSB 3UTSE 1ND0A 1CDIA 4JREB 3IKCB 3WL9A 3G6DL 2YKKA 1NKOA 1YEKL 1E6QM 2BP3A 4BM7A 2V2TB 2YL9A 1KJ3L 3W0WE 1B3XA 3TCLA 5F6IC 1K8DB 4XV0A 1A6WH 1HWGB 3FB7B 1AHWC 3I85A 2HN7B 3QUXD 3GDBA 4L9DA 2QHAA 3DGGA 1KQYA 5I18L 2XG4A 2Y6SD 3MRIB 4YHNA 3DXAA 3JV6A 5EU7E 4CD8A 3O3AA 2UZIH 5EU5B 3W9DB 3DOSA 4O9HL 3GI9L 4MDJA 2PR4L 3DX9B 4FTVA 1W72L 2Z8WC 3WFZA 5JPNB 3RVTC 1AE6H 5H35B 4S1RL 4P2QA 3RTQD 1F3JA 4ODVH 4GKSB 3ZTJH 1YN7B 1M6OA 1LEKA 1WBZA 4M43H 4PTTA 3WNOA 5D93B 1CL7H 1H8NA 2AXGA 4R2GB 4ERSH 1GHSA 1SBSH 3B9KA 4M62H 3UYRL 1QFUH 1H8SA 2HISA 2GJ6E 3UTSB 1Q6CA 4Y4KD 4KI5D 3EJYD 2P1YA 1MIEL 4D6GA 1UZ8B 1Z9LA 2LVEA 2B20A 5I74B 5BZWB 3QPXL 1RJYB 2RJMA 4WUUD 3LKQA 2K9UA 3KGRA 4GBXA 2EXWD 2YDRA 2F53D 3BDXA 4NHUB 5I71B 1LE5A 3MRHA 3RZCD 1G7MB 5E8PB 4XC3L 4F15B 4H26B 2V7NA 1KXVA 4R97C 3CTTA 1Q94B 4PJ7F 3KPOB 3O9WD 3QIUA 1OF2A 3CXDL 4ZS7L 2YK1L 3KR3H 5BXFB 3BGFB 3EYOA 1YNKL 4UR9A 1MLBB 1MF2L 4OBSA 5IG7B 1KF9B 4JKLA 3WJJC 4DQOH 2EIZA 3N85H 3TJHC 1LK2A 1GC1L 2HJKB 4WI2A 3KXFE 4LGSB 1A14H 3T04D 5CSBA 1BIIA 1GJWA 4DK3A 2EDKA 3FOMB 2Y07H 3ISWA 4K3EL 3RI5F 2GJ6B 2VN7A 1KTRL 1A7QL 4WI5A 5ISZA 1P4IL 3BP4A 4AD5A 3K4DA 1CBVL 4MDIA 2WSKA 5I1HH 4G43B 3ARSA 1I75A 5FM4A 5HGHB 1U92A 5IESL 3WSQL 4HH8A 3PZNA 3MYZA 1QSED 2RBLA 2Q3ZA 3L5WA 1MRFH 3RUGF 3SDYL 2ICES 2Y2WA 4JFOB 4A6YL 5TF1H 5LVEA 3WH6A 2MHAB 3PNWA 4I0PA 4KY1L 5I76A 3U0WH 2SEBA 3WIFB 1F6LL 5I1DB 2ZUNA 1BBDL 2W38A 1FHGA 3ULVE 4RNRA 3C5ZA 1WT5A 2Y06H 3SDDB 2UV3A 3L3GA 1Q9KA 3E0GA 4X0NA 1A6UH 2Z1SA 2H9GA 2FEEI 1R5VB 5CBEB 1NMBL 1QBLL 3BMWA 4U1NB 4Z95H 3V52H 3L3OA 4CRPA 3SQOH 5LBSL 2QV2A 3MXWL 1ULVA 4PJFA 1Q0YL 1D5XA 3BD4A 4YK4C 4EBQH 3W28A 5CZVH 1GGCH 2DT3A 5C0FA 1CU4H 3O3BA 3RI5K 5IB1A 1SJXA 3AY4C 1CL7I 3QAZB 4GZIA 3WFEH 3H6JA 3HU7A 4ONFL 2WMIA 5DFAA 2JJTC 4MS8C 1G7JA 3D52A 3IJYB 2H45A 3OKMB 4KVCH 4NN5B 1UWXH 1MXGA 1HKJA 1GGYA 3FHQA 5C8BB 3UPRB 1VIWA 2IANA 5DMKB 4ZNCD 5ANME 4WGWB 2XIDA 2A9MH 3D69A 3VFTB 3GB7A 4WEMB 5HHXH 3FXYA 1GONA 1CWYA 1W9UA 4OOZA 4LU5L 2MPAL 4URIA 5I19L 5BRZB 3AM8C 1Z32X 5E2VL 4ODSH 2F5BH 5DVOA 1YYLL 4KKNA 4HUKB 1NP0A 5JXAH 2ERJB 2FX9L 4IS6A 3T0BA 4ELKB 1UWSA 4XZUA 1TVHA 3CLEL 4HFWB 3BP5B 1ZEAH 1ISZA 5I1KL 2CDEA 4JDVB 3SKMA 1U2HA 1FNSH 1E4KC 2VLKE 3EMZA 2YZ8A 3T4YB 3WEXB 1HQRB 4XP1L 2F19L 3ZT6A 4B0MM 2WVVA 1U8IB 2CIIA 3PWPD 5ERWA 1C12A 5L7XH 1X1NA 1FO0L 1MCDA 3HE7C 4D9RD 2A0LC 5ANMB 3A3HA 4Q0XH 3IGAA 4UIKL 4E2OA 4HBCL 1IAOB 2OR7A 4M5YH 2Y36H 5DURD 3EOBA 3SURA 1PZ2A 4P46B 1XSJA 4U1JA 3BEWA 3RDTC 4NQSB 5C6TH 5HDBE 4KROB 2H41A 3G6JA 1KN2L 1AD0A 2EXYD 3GJEA 4ZXOA 5I15L 3PJSA 2J6EA 2R0KL 2V3GA 4PYSA 4PTXA 1WLHA 1MWAB 4WU7A 3W9EA 1N59A 3RPIA 1BVNP 3FKUS 5FL0A 2VZVA 2A73A 1KBGH 3Q3GB 4PSPA 1N5YH 4LKCA 3L3KA 2BY3A 1IILE 5IJKA 1TUXA 1OB1A 4OLUL 4GPNA 3OJVC 4PRDB 1VGEH 3AREC 3U30B 5JMOC 2XA3A 2AXFA 2EIBA 1KJVB 1KB5A 3MLVL 3FAWA 4I77H 3PIQB 3SE8L 3HPLA 1KLGB 4UILL 5GRUH 1E6PA 2H26A 3R0NA 4DEPC 1RFDL 3MV9A 2F7OA 3UYPA 5DUML 3OLDA 4PYGA 5FF6B 2CMRH 4MQXD 1SJEA 4YUEL 5GRJL 2XTLA 4F57L 5JDSB 2CJUH 1VKXB 4XBGB 3N50A 3II1A 1N2RA 4M6MH 4P9ML 1CFNA 4U6VH 3HG5A 3LEVL 1SEQL 3W0WD 2ZOLB 4OD3L 3TP4A 1QX1A 2D7PA 1CLOL 4KTDL 3K2UL 1I4FA 2FGWL 4W7VA 4OLEA 3WXVL 5ITBH 1EX0A 5HGBA 4BUGA 2PBOA 1OAKH 4ZTOL 4FNPA 1FZOB 2BJML 5D1XC 3E3QC 2UUDK 1NBZA 3V6FA 3KLAA 3WEOA 4PV8A 2HMID 2BERA 2C8NA 1FJ1A 5D71H 3V4UH 1OSEA 2O9RA 4X6DE 4NRRA 5KSVA 2E6PA 4NN6C 2HFFA 4LF3B 1MCWM 3IANA 2GJ6D 3LRSA 5I1LB 2CBIA 1MFDH 3G6AB 4LLWA 3ABZA 3QH3B 2ZP0T 1BOYA 4MNKA 4NSKB 3M17A 3O3EA 4RFNC 2BMKA 2O5YH 3QCVL 5DUPL 4ODUA 2KZWA 3I02B 4Z2JA 4A3YA 4XVJL 5C09E 4NJ9L 1IGIL 3WHXA 2G60H 3SCMC 4JPIB 2IADA 43CAA 1QZ1A 3PL6C 4AIEA 2R4RL 1JPSH 4WO4C 5AYUH 4QCEA 2E7CA 3QUMB 4UT9L 2PTTA 5EO0A 1OTTD 5DRNA 3RVVD 4X9FA 1HHKA 3I6GB 1MWOA 4GMTL 1F13A 1AGCA 4HV8A 2YUXA 1L0PA 1DLHB 4MAZA 2BSRB 3HMXL 2D3NA 3MLWH 1MCEA 3TO4C 1SR0A 4OGXH 3W39A 3KXFD 4X6DB 1PBYA 2DN7A 2PC8A 1TFHA 4F33A 1T6WA 3VW3L 2WBKA 1I9JH 2VXSL 1VFUA 2L0DA 3SKNA 3OJDA 5J06A 1H9VA 4UCFA 3NSXA 3S35X 1JFHA 3WN5A 4ZQKB 2DI7A 2I07B 2QJDA 2EYSA 5C09B 3VDCA 3AFLA 1Y18B 2D03H 3HAEH 5MP6H 4W6WB 3NA9L 4MNGE 2E5EA 4MTVA 4I4WA 5E8OA 4JHAL 1URLA 1ZVSA 1AQ0A 5EB9A 5GRVK 2C3XA 2R1WB 1ADQA 5FB8B 4J6RL 4JZJB 2GJPA 1U8HB 1X5HA 5FUOH 2Q8BH 3VGAC 1GAFL 1JRHI 4JM4L 3RWJB 1WC7B 3GNRA 2ZUXA 2AJXH 2P5WE 3ULVD 3S37X 5CPSA 4TTDD 4K8RD 1EERB 1A7BA 2LFGA 4GXUM 4HUXB 5H37G 4U0RB 5CWSB 1JZ4A 3GZAA 4WIWA 3FQNA 4M02A 3MOAH 5F7EL 3HNSH 2FD6H 1DVFA 1ETZA 4PJ5A 4CD5A 1JNHB 5A1AA 2MKWA 1S9XA 1GGTA 5B38B 4OZOA 4QNPE 1OCQA 3E6HA 1P7QA 4OUOA 3PWUB 2NY5H 3HCVA 2C3VB 4MNGB 5TGBA 4PJHF 4PGJA 4F7PA 4OFPA 4MJ5B 2K1MA 2JEPA 4Y16D 5I17A 3S3PA 3RNQB 2VLLA 4NKMB 5CCKH 4K7PY 1LP9A 3GBLA 3TO2A 5CHNA 4YGAB 4DZ8B 3QG6A 4QHNA 3DVGB 4WEBH 1BLNB 2EDTA 2VE6A 3DV6A 2JB5L 4B9ZA 4D2NA 3GMQA 4M6NH 2WBJC 3OB8A 4F58H 4MWFB 3MRBA 1MCJA 1WF5A 4X6FA 3EAKA 1QBMH 3MJ9L 4R90H 1HK6A 1GYAA 3WDHA 4M8VA 3ZDZF 4KTEH 4X8JB 2VLKD 3IVKA 3F7RA 5E5MB 3LEXA 1CENA 4W5ZA 3A22A 1TZIB 1J12A 3T0AA 2ADJB 2JKXA 1IT0A 1KNOB 4HA3A 3NFSH 2ZSVA 5E6IA 4OI9A 2H8PA 2GITB 1BQHG 3VMNA 5CG0A 3STLB 1ZHLA 2B0SL 1BD2E 1AFVH 4RX4A 4DKFL 5FM8A 1FE8L 1T2XA 4D0DB 4WSKA 2BDNH 1MY5A 1BFOB 4XMPH 2J5LC 1V7NL 3LB6D 2XPGB 1J0KA 2ITDA 1HXYA 4UBDC 4EI5B 4LLMB 4UUJA 1QNZH 5DJ2A 2FDBP 4YIQA 3JUGA 4MPKA 2I9TA 3HFMH 1T0OA 1M7IB 5IQ9B 3QO0B 5DJDA 4MJ2A 3GJFB 5DMJB 1DBJH 5LWYL 1OAUH 4JFZH 5GNYA 3O8XB 3D5HA 5DRXA 4YHOH 3PHAA 3NABH 5I1GL 4KMLB 3S96B 5IROA 3RIAF 1EV2E 2G3IA 3ZE1F 1CE6A 4IM4A 1BD2B 3CFEB 3KPQB 4GG8B 1SMOA 2Z8RA 5FK9B 1RY7B 1TZGH 2XWBB 2A6JB 1SEBA 5ABFA 3OA5A 2MWCA 5CAYB 4KZEH 2NW2A 3VFVA 1BAGA 3VUPA 1CLXA 3ARDC 4X4XA 2G75A 5FHBL 5FYJH 1F90H 3LKPA 4M6OH 3TN0A 1LF1A 1NCCH 4OAWB 3LKOB 1T7XA 4JFXA 2PUQT 4PMZA 2RHEA 4RGMB 3AIWA 4O58H 4JJ5A 1U95A 3LAFA 5EWIH 2GJJA 2P24A 2OR9H 2R0LH 1XH0A 2DM4A 2AW2A 4NKIL 4EXKA 4WNQA 1AXTL 5C3LD 2ARJQ 1OAYH 4QTHA 2F74A 3QUML 5E2UL 4HWBL 3AGVA 3F6IA 1B4JL 1S7UA 3K1KC 3FO0H 5IMLA 4GQQA 3GSOB 3T2NH 1K9EA 5DD0L 2X70A 4Z7UA 4XVTL 1F3DH 1YHTA 5D8ZA 5IM7A 4U6HA 2VDML 5IOPB 1K8IB 3RIAK 4GIAA 4JCLA 43C9A 5J6HA 3DGGB 1IM3B 2E7LA 4YHNB 3NDYA 2Z0BA 4LASH 1WK0A 3D39D 4PLOB 3REWA 1SYTA 4FZEH 4N1CA 3O3UN 5I1EL 2P46B 4MDJB 4H5SB 4MQ7B 4JZOB 4KQ3H 3EMCA 2W9EL 4DVBA 3VXOB 4KHTH 4IRSB 3SO3C 1WBZB 4X5LA 3NYDA 1LNUA 1IMHC 3K3QA 5I8CB 3V79C 5BOZG 1U93A 4OIAA 4PJIA 5KOMC 1ONQA 4YE4L 4EI6A 1KPRA 2E7HA 2GEEA 1ZGLA 2DIAA 5EOCH 5ISZE 3FRUA 2WKGA 2IQAA 1KFWA 1V3MA 3FO2B 3MO1A 3H7LA 1LE5B 3MBED 5T1MA 3CHEA 3TA3B 1W2KT 4APQB 3G08A 3PHQB 3TPKA 4ETYA 4LRIA 3IDNB 1CNVA 1N7ML 5E8NB 2EPNA 3QIUB 1XF1A 1IGJB 1PEZA 2XQYK 3I3BA 4OF0A 4AJ0A 3ULUL 4JL1A 3CUIA 3OKLA 4HC1A 2BRRH 4KXZI 1G6RH 1J11A 1MPAH 5E2JA 9CGTA 1UGNA 3HLAB 4TUKL 4WJXA 4AEEA 1DBKL 1YEJH 5DMIH 1UXWA 5A40E 4K07A 1EEUA 4PJEF 4QLKA 5KTEH 1G7LA 4OSUL 4L9LB 4U7MA 3PGCA 3V95A 2JIEA 4AQOA 3L1OL 2P5WD 2W91A 1MH5B 5D7JC 4UT6H 4QXTA 4Y4FC 4J3UA 5EC2B 5IV2A 3GXNA 3BSGA 4PV9A 3OLIA 5F1NB 3MGAA 4AH2A 1XGQB 3NIGF 3H42H 4BFGA 4JKKA 4MD5A 4LSQH 4XNUL 4PCSA 3VIGA 4DGYH 3WNMA 3WF4A 3VD9A 4P23A 1S8DB 3L5WB 2C3HA 5B8CC 3VXQA 5HYJB 4JLRA 1KTLA 3QPQD 5IHUL 1ZA3B 4GRLB 4I0PB 1W2VA 4PRAB 3WHE0 32C2B 4HGWA 1PY4A 1KIPB 3C5ZB 3MUHL 2W5FA 3TBVB 1S7XB 1KXTA 2L4OA 3QULB 3GMOB 3CUHA 3NMEA 4QXGL 2VXQL 3ZYZA 1LWRA 4ELMF 3QIWC 4DWSA 2YD2A 1U3HB 4JFEE 4WU5B 4R7NA 3LS5H 1CFTA 3BC9A 5TDPB 3VSUA 5TH2B 4OTXH 4LLQA 5BS0A 3UJTL 1HQ4A 3I9GH 3KNBB 5K9OA 4JRXA 3NAAH 3NCEB 3B6SB 4EI5D 2NX5A 12E8H 1HH6A 3G9VA 2D20A 3W24A 4A3HA 3RQ3A 3D50A 3QZWA 4LNRB 3SN6N 4NHCL 3AI0A 1IGFL 2NY0B 5D6CA 4XWOD 1DFBH 1EUTA 1GOGA 5C0DA 2OQJA 3VFWB 2EZ0D 4WI9A 1C5BL 2PYEE 2VZTA 4OB5L 1ES0B 4OZFH 1PLGH 4MZ2A 3G6JE 1NLBL 1IRAY 4NBYB 5D7KE 1QR4A 3HZYA 2HKFH 1BD2D 3SGEH 4JAWA 2ZKHL 3QHTC 3N1GC 4F7EA 1K4CB 3QO1B 1H5BA 4JFEB 4MJIE 3C09C 5EOCJ 4HKBB 1CLVA 5IMMB 5H2BB 1DBBH 3PDGA 2CDEB 3BAWA 2C3GA 3MGTA 4OLYH 1IAKA 4MD0B 3FFDB 3O6LH 4HHAB 3VJ6B 3L5JA 1A6WL 2GFBA 3IXAA 3C6LB 3MV8A 5FV1L 1JCKA 2EEDA 1C12B 4OJYA 3QFJE 3MYJB 4K7FB 4GXUN 4L8SC 2UZIL 3TT1H 1VERA 1A4JB 5A2LH 3U46A 4HXAH 2HRLA 3MRGB 3NCFB 2PYEB 3MV9E 3EOBB 1AE6L 1QO3B 1KC5H 4G9DA 4ZFFB 4LHUB 1RVFH 4OKVA 3WDQA 4M43L 2YPLA 1CL7L 1EO7A 4ERSL 1UZ4A 3TBYA 7FABH 4M62L 1UM6H 5C2BH 5HYSB 1QW8A 1QFUL 2WMGA 2YUZA 4LVEA 4MJIB 3W9EB 3KG5A 3G5YB 3P0YH 1CFBA 5EU3A 2XKSA 3T3MF 4YHYB 1ZLVK 4QO1A 3ZDYF 4JY4B 3RWFB 1RD6A 3NGBC 1G0CA 3SCVA 2N4IA 1M04A 1B3ZA 1ROWA 1OB1B 4PJBB 2VX6A 1CGYA 5D9SB 1UACH 2C26A 2B2XH 3CH1A 5IVXA 5A8PA 2JB6A 1OARH 3QFJB 4LEXH 3KLHC 1QSFA 5F70A 3EDDA 3VXUA 1UHVA 3MLZL 4ZODA 1NEZA 3KR3L 1A6TA 4KK9C 1KULA 2H26B 2WKLA 4JFHE 1ORSB 3PTQA 4IRSD 4N9GA 2NW3A 4DQOL 2ED8A 4KKLC 3EJSA 1FNAA 4HP5A 2M8XA 3N85L 3B4NA 1BZ7B 1IQWL 4U5KA 2J1KA 2Y07L 4PMRA 2ZWZA 4PR5A 2F1BA 4FNTA 4H8UA 3U5YA 4CVXA 4GBXD 1AKJA 1MRCH 4RQQA 4LOUC 3CZFA 3QRFM 3WLWD 1I9RH 3O3DA 1XF2B 1MW0A 4W8BA 4OIIH 5IK3A 4CMMA 1UH4A 2WUCH 3BHBA 3CFDB 1VGKB 4APQD 3EIFA 4KRNA 5I1HL 4JPVH 4MA3A 5T3XH 5EPMB 4H0HB 1DQJA 1JPFA 2R29H 2F58H 1AH1A 1QI4A 3QIUD 4KI1A 4PD4K 5DGRA 3SCOA 1MRFL 1ZHBA 1G1CA 3BZFB 3V6FB 3KLAB 1TVDA 1OD9A 3MRJA 1ISWA 3UEQA 5TF1L 3TYFB 1I85C 2I25N 2VR5A 3U0WL 5CJXC 1I1AB 5BYWA 1YUHB 2QADC 4QCIA 3OAYK 2Y06L 4XGZA 1OGSA 5GS0D 1JMZA 4Y5XA 5E2TH 2FHFA 4XRCA 4QY8B 1A6UL 4OZGF 5ISZD 3CLWA 4LDEB 3STBA 3DGCR 1X9QA 4YFDB 3O3EB 4I3RH 4Z95L 2OTUA 5GRXG 3V52L 3WBAA 3SQOL 2HKHH 3KJ4C 2BC4A 5D9MA 4EBQL 3POHA 5CZVL 2UY3A 43CAB 3HUJA 3NTCH 1S5IH 1CU4L 2J8OA 3DI3B 1A1OA 1E72M 2O61A 2MKLC 3WFEL 4AG4H 5DRNB 2DWDA 4KVCL 4GRLD 4ORZC 4I0PD 5F93C 1LHZA 1WVZA 3WFHA 3K2MC 2A9ML 5I75C 2CKNA 3KYOB 4X98B 3C5ZD 5HHXL 2E7BA 3ARXA 4ZUSB 4FXGA 2XVGA 2Q6WB 3V6OA 5JBDA 5E9DA 3RWHB 5CP3A 3VIPA 4KKBD 4V2XA 4JDTL 2KL6A 1E6JH 1B0RB 4V1DA 3BUYA 4ODSL 2F5BL 2GT9A 4OZHA 4KJQD 4RWHA 5EBLA 1R7OA 4B16A 4UAOB 3RY6C 2CHOA 2FIKA 4PJ5E 3X12B 3QYCA 3BZ4A 3MNWA 2YR3A 3AYSA 3ARBC 3V6ZB 3DURB 1IAII 4YFLI 2I60H 4FXKA 1FH7A 1T3FA 1ZEAL 3AU1A 2Q20A 3BEVA 1E6NA 4OUUB 5F6HI 1C8YA 1FNSL 5GIRA 5GRZA 3AXHA 2WCAA 2PW2B 4WW2F 4HGKC 4PJAF 3A6CH 5SWZA 4ZO8A 3F65A 3LDBC 1EVUA 1JD9A 2XXCB 4YGVB 3KAAA 4CGTA 5JLZA 4XPAH 4Y5YB 4HUMB 2NY0D 4U1LA 1LP9E 3RWEB 1JF1A 1BYDA 5EBGA 2W61A 4Q0XL 4DKAA 5A69A 3WFCH 3P4NB 4HBQA 4M5YL 2Y36L 3O4OC 5F6HJ 4UU9A 2QV4A 1NCBH 4NF7A 1RZGB 5C6TL 5BXRA 1KV3A 3WUWA 3QUZA 1YEFH 3VWKA 1U8KA 4JFED 4KFZC 4PJ5B 4JY5H 3RIKA 3N9KA 3H9SE 4M7JH 3WE6A 2YJQA 1YNLL 3AAZA 4FNSA 4W6YB 1GC1C 1UWGH 5F1IA 5JOFB 1KBGL 1V0KA 1NDGA 2R69H 5JIHA 4AQ1B 5K9QG 1N5YL 3C6LD 3TNNB 1EHXA 3CFJB 1YDPA 3GMRB 1VGEL 4DUXA 2Z35A 2E9IA 5HPMB 5C0BE 4X8XA 3V0VA 2VLLB 1T03H 1WCQA 2AMGA 4I77L 5CHNB 2PYED 4LPVA 4PBXA 5GRUL 1IQDB 2AS5M 5HI3C 3EBAA 3RWGA 3BQUB 4QHNB 2AEWA 5EOTA 3PABB 4L3AA 4LHUD 1V7MH 4QKXB 3C8KA 5D7KD 1WFUA 3EHBC 1TQTA 2CMRL 1C3FA 5FYLH 1YY9C 2LAGB 1IEHA 4GH7B 2CJUL 3ZKSD 1W1TA 3EFFA 1JZ6A 1CXLA 5FYJE 1KIUA 3DX4A 2R9HD 3E6FB 5DQ9B 3H9SB 1FCCA 4M6ML 5FOJA 5IIEA 1NWUA 4GW1B 1GUVA 1JRHL 4U6VL 4WFEE 1MCWW 3U0TA 3IVKB 4OF5A 4H1LH 1HKFA 3MA9H 4LCCA 3QFJD 5ITBL 4OGYH 4MDOA 2H8PB 2PO6B 4P57A 5C0BB 1FVEA 1OAKL 4OCMC 4TNVF 4X5WB 2AV7B 5C0RH 4BKLB 3WQ6A 4GSDH 3FHAA 3MV9D 5DS8B 3X11A 2BZDA 3CFIC 4HG4K 3MRKA 4M9PA 1EMTH 5C0AA 2YD6A 4KAQH 5D71L 3V4UL 1W0YT 3Q2CA 5F9JA 3VIIA 4IOIA 2BVEA 2IAMB 1UJ3A 1HXYB 5GS1C 3ELAT 3MLRL 1PG7H 3FO1B 5GGUB 5ADOH 1NAKH 2OZ4H 4QFUA 1MFDL 2FH8A 5MI0B 1R85A 4Y19A 4GJTB 3BCFA 4N68A 2O5YL 4LLDB 5D7SH 5HYQA 4PREA 5A16A 1CPUA 3WIHH 1S7VA 1CT8B 2G60L 2BOCB 3CX5J 1AXIB 4RBPK 5FCSH 3WYRA 4LPYA 5D2LE 3WHE1 1JPSL 5AYUL 3DRQA 5DJ6A 5E0QA 2EYTB 4B7IA 5LGJB 1KSRA 1T6VN 3QA3A 1HL8A 1FZKB 4JFHD 1BOGA 1WBYB 1KTDB 1LD9A 3PZVA 2UWEA 1K6QH 5KSAB 2DTSA 2AK1H 2ICCA 1O7SA 2NW2B 1HSAA 5DQJA 3MLWL 5A43C 5CLWA 2J2ZA 4OGXL 5CP7A 4NQEE 4Z7QE 3KWXA 3LD8C 1WISA 1DUYB 2HLAA 1Z9OA 4OQ1A 2WV3A 4Z76A 4LLUA 1UD6A 1I9JL 3SBWA 3F62A 4KI5F 4Y2DA 4J12A 5JIIA 4AZ6A 4HZ7A 1MW3A 4E42B 2DQUH 4P2OC 2WC3A 4U7SA 2DT0A 1RUPH 3FB6B 1G7QB 3MRFA 4JM2C 1IZJA 3A0OA 4XCEA 2D03L 5MP6L 5D2LB 5FIPA 2OL3H 2V7HA 1AJ7H 4GUPB 5MEPB 1QNOA 4PJIE 1EUUA 4ZAKC 3NZHH 1CLCA 4PY7B 4GI9A 2VKXA 3SJVA 3O11B 2VDRH 5FUOL 2Q8BL 4G8FB 3WEMA 2FE0A 2W0LA 5A6SA 4U6HB 3VD7A 4BQBA 5LA1A 2AJXL 1NDMA 2X4UA 1DE4B 5CZXC 5C0IA 2FJGA 4MZ3A 3S7GA 5DVLA 4NQEB 3QGVA 43C9B 2EC9T 1FBIH 1E6OH 5DQDH 3STZB 5DSCB 4MXVE 4PYHA 4UOQA 3HNSL 1NCWH 4Q9QH 4HIJB 2FD6L 3RILA 4TOQA 1OTSC 2IQ9H 5J1SC 3DVIA 5DK2A 3BH8B 2XTKA 3RVUD 1M05A 5C0JA 4DVBB 3N1FC 5D1ZA 2W0PA 2NLJA 3KPNB 4NQXA 1BJ1J 4EUPB 1KUMA 5I78A 2NY5L 1K6AA 1Q6EA 4MMXC 3P0VH 1WWCA 2YL8A 1W1YA 4S2SA 1N6UA 4PJIB 4TUJB 2HVKA 3FT3B 5CCKL 1X5YA 3LMYA 3DROB 1X5KA 1JNJA 4FQ2H 1DDHA 2EDQA 1UYWH 3I84A 4HJGB 3B8YA 3LN5A 5T1MB 1I8IB 2M1KA 4WEBL 4MJ6A 5GZND 3GSQB 1UQSA 3FZUD 3RM4A 3G08B 3HR5B 3OKDB 3MMDA 4PJ5D 3T2QA 4F58L 4HIEA 2MQ0A 3BISA 4N0FB 2FL5A 2IPKA 1QBML 3VD3A 4L29B 3QOKA 1BZ9A 4R90L 2CD0A 5DDHA 1YEHH 4OGAD 3F6LA 2J7DA 3SUVA 1P7QD 5A8NA 4KTEL 1FFPB 2QQKH 2FDMA 4MB5A 4AEHH 3Q1SH 2F54E 4I9WE 2DKUA 4L3EA 5HVHC 2VDNH 1TQVA 5MHSE 1OM0A 1L0XA 1UH3A 4FS0A 2YPKB 5IFAH 3NFSL 4KUZH 3MJ7B 1N5AA 2H3NA 5BRPA 4PGDA 4JFYB 1AFVL 5JW4Q 1HHJB 3ULSB 5BS0E 3RBSA 4AH2B 1E0XA 1EEYB 1Y7VA 4OM1H 1QRNA 1KLUA 1A8JH 4XMPL 1EXPA 5D7LE 1R0AH 4MXQC 1FYTB 2NX5E 5E1QA 5GXBB 5I6SA 3PGDA 4P23B 3H9SD 2QR0A 3CDFA 4EANA 1UB5A 4D6HA 2ITCB 1TDQA 2YDQA 1QNZL 1UXSA 1E70M 1NUDA 1UQZA 4JFVA 1KR0A 4F66A 2BNUA 3MJ8B 4MMZC 3HFML 1AGFA 5BVPH 1DBJL 2F54B 1OAUL 3DTXB 4JFZL 4R96B 2VZ3A 3DX8A 3MUGA 4YHOL 2XNAA 3NABL 3IDJA 3GZKA 1D7FA 4N5UA 5C0BD 5I0ZA 2FECI 3O6FA 5FM5M 4IIQB 5D72H 1AR1D 4RX4D 3PHOA 5LAXA 1CECA 4UFKA 5E6ZA 1BPVA 4M1DH 4WHYG 4HCRH 4Q6IB 2ATKA 4AIZB 1TZGL 1NBVH 3LN4B 3T0EE 3FJTA 2EPOA 1VADA 4Y4HB 4KZEL 3S2CA 1NGXA 5D7LB 3P30H 2DJUA