5M17A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-1,2-dideoxymannose
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
total genus 133
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m17A00
1GCYA 2YLLA 2XVKA 3WH9A 1XH0A 4H8HA 3AJ7A 1QW9A 3RDKA 2WHLA 2PI6A 3ZSTA 1D3CA 4OOUA 1OD8A 2GJXA 3CHFA 1KWGA 1CGTA 1EHNA 3WUGA 1SMAA 4EANA 1TVNA 3CUIA 2WHMA 2FGLA 3U7BA 2Y8KA 1QI3A 1WZLA 2D0HA 1GOMA 4KWUA 3CTTA 2FGZA 2GJXB 3HJEA 2D20A 1OBAA 2OYKA 1OD0A 3VGGA 4PMVA 2Y2WA 1JF5A 2CPUA 2E9BA 3POCA 1WZAA 1HJUA 5FCZA 5LYRA 4MNJA 2GJRA 1OM0A 2G4FA 2VUYA 1K9FA 2VOTA 1FHLA 1OIFA 2BNJA 4GPNA 3N12A 5A6MA 1E4MM 1UR1A 4PTMA 2FH8A 1AQ0A 1UR9A 5GNYA 3OZOA 5DMYA 5A8NA 1DP0A 4WKFA 2XVPA 3NJ3A 3AHTA 2WSKA 3L4YA 1E6XM 1S46A 2BXYA 3L2LA 2JIWA 4BCEA 2QMKA 2G41A 4PBGA 1BVNP 4BZYA 2E40A 2WMIB 5BXRA 1LWHA 3U7VA 1GVYA 4AIOA 1M01A 1VEOA 4TVDA 3OIHA 6A3HA 2VVNA 3ARYA 1HJXA 4Q22A 4P7NA 1JXKA 1R87A 4QLJA 4JFWA 4KRUA 1GOQA 3WQ6A 1QBAA 1V0LA 1E6NA 1HN1A 5D9OA 4H2CA 1KGXA 2WKLA 1PX3A 3FN9A 3GNPA 1KR1A 2A3HA 2W5FA 4DUVA 4URIA 3VIPA 3AQUA 3PBGA 1NP0A 3CZJA 4AW7A 5DO8A 3CPUA 4V28A 3RM4A 4KRTA 5DT7A 4JKKA 1CNVA 1FA2A 4H8UA 4P7LA 4YHGA 1K9TA 1VENA 1JZ3A 3RJYA 2D1ZA 3EMQA 2XVGA 5FL1A 1JI2A 3OBAA 1MFVA 3W29A 1E73M 1W9PA 1PZ3A 3ARPA 4GKLA 1HJWA 3U57A 4BQ2A 4B3KA 4UOQA 5ABHA 3SUVA 4FLSA 4B9ZA 4UQAA 1ISYA 3ARUA 4CN4A 5JIPA 2WVTA 1ZBVA 2RGMA 3WSUA 3VVGA 2V3FA 3VIIA 1W3HA 3GDBA 1UZ4A 1DWAM 3SCNA 3HN3A 1F4AA 2YL9A 1X6NA 5IFPA 2ZUNA 1JDCA 2J79A 1JZ4A 2D3LA 3KWXA 3AIUA 3IK2A 4HPHA 2VQUA 3L4ZA 1BYAA 2J8FA 5E0CA 3DYOA 2ZXBA 3AXIA 1CGUA 1Q6CA 5HOSA 4HTYA 3BGAA 2X0HA 5JBDA 4MAVA 1VFOA 3ZIZA 1B3VA 2XHYA 4CCDA 3SCRA 5A2CA 2WZIA 3NCOA 3VIGA 1GJWA 2X0YA 2Y8VA 3CZKA 1XCXA 4NRSA 3RCNA 1WDRA 1WDPA 3BMVA 2DSWA 1QI2A 4CU7A 1MW0A 3WD3A 1UWQA 1JD9A 4AD3A 3B9DA 3FAXA 1WAWA 3AMDA 4TUFA 3CUFA 2CXGA 5A6AA 4ZE5A 1E43A 4WF7A 2BHUA 1M04A 3UR8A 3KL0A 4AZCA 1G01A 4ACZA 5I24A 2E8ZA 4OUEA 1VEMA 5HXMA 2AOSA 2ZWZA 4F66A 3CUHA 3VD9A 4HMCA 3AS2A 1GUVA 1C93A 4D6GA 4AZCB 1UH2A 5E6ZA 4ACZB 4KH2A 5FIPA 1EDQA 4PTWA 4JL2A 1WPCA 5A2AA 3PZOA 4PSPA 2PBOA 1LL7A 2FHFA 2QHAA 3EBVA 1V3IA 1W1PA 2XWDA 4MB1A 1H1NA 4LX4A 3I3BA 1EDTA 1YHTA 3AZRA 1FH7A 3OG2A 3ZR5A 3WUBA 2W67A 5CJ5A 3RIKA 1PJ9A 3VNYA 2ZUMA 4H04A 1J12A 1E72M 3UETA 3UR7A 4AZHA 1M7XA 2WMJA 3TP4A 1MXDA 1CGVA 1D2KA 3N18A 1NM9A 1A3HA 2G8ZA 1CGYA 1HKJA 1XYZA 2C0HA 1EDGA 3DHUA 3TTQA 2O9OA 4M8UA 3KL3A 3PZGA 3W37A 2CHNA 1ODZA 1TE1A 2WMHA 1E5NA 4E2OA 3EMCA 4LYPA 5DF0A 9CGTA 1UD2A 2D0FA 1GHSA 3OGVA 1GOWA 2ZXAA 3WMBA 4A3HA 1JYNA 2ESCA 2OLHA 3WF0A 3SCOA 1Q6FA 2TAAA 1E3ZA 1UKSA 1WCGA 3AI0A 1HKMA 4IM4A 4WK9A 4P8XA 3E1F1 4D6IA 1UKOA 4X9YA 2WVSA 1H3GA 2QMJA 2WHJA 3G6LA 5D9PA 3ZJ7A 2WKGA 1B3WA 5LA2A 1E15A 2JEPA 3A47A 3ECQA 4AZ7A 4J7RA 4HOZA 1US3A 3TTYA 1CLVA 4HZ6A 2YDQA 3N17A 1JL8A 2J7GA 3DYPA 5JBFA 1OSEA 5D9MA 3VGBA 1SFSA 1FP8A 1ZB5A 1UD3A 4HOXA 4MNKA 4RL3A 1UZ1A 3W26A 1B2YA 4KGJA 4Z2KA 3FW6A 1KXTA 2PWDA 4CVUA 3KL5A 4C7DA 1LLOA 1GW1A 1GVIA 3I3EA 1PBGA 2QPSA 2ZOXA 3CLWA 3MV11 5IXEA 1PEZA 4PEEA 1KXHA 2VO5A 1VFFA 1OT1A 2UWFA 4P8VA 1NQ6A 3BCFA 4CD6A 4CD5A 1R86A 4UZSA 1C91A 5E0FA 2A3CA 1VB9A 4BQ3A 3ZT6A 1EQPA 1KB3A 5A6LA 3J7HA 3BAXA 3APGA 3AS0A 2JE8A 3CIVA 1KGWA 1ISXA 1EIBA 4MB4A 1W9VA 5IHRA 4WLCA 3CZGA 1TR1A 1MXGA 4AC1X 4W86A 3T2OA 2WXDM 1KQYA 1MYRA 1CZ1A 4UFHA 3ZOAA 3QHNA 5CSUA 4C7FA 1XSJA 1GZJA 2WAGA 2WZHA 1G0CA 1DWHM 4XZBA 2V3EA 1EOMA 1VBUA 3K8MA 1WZKA 2WLZA 3BAWA 4AD0A 2BVDA 2UY2A 1GOIA 5CGTA 1ZBKA 1BF2A 4PMXA 2Q8XA 2BV9A 4M1RA 4GIAA 3BLPX 2VX5A 1DWIM 3SUUA 2J7BA 2ZX7A 2PB1A 3VD3A 2O9PA 3A4AA 4BF7A 5JBEA 4IPNB 2G3JA 4QFUA 1JZ5A 3PHAA 2WVUA 4CN1A 2WNWA 1C7TA 4FLRA 3AIVA 4DM2A 4UFMA 1RH9A 4PSRA 3WH6A 4J3XA 2CKSA 1C8XA 2J4GA 4MNLA 7A3HA 4Q7NA 4H7VA 4R5EA 4J3WA 2YKKA 1HNYA 3POHA 5HNNA 1EOKA 2G3NA 3HU7A 3VILA 3VMPA 1JZ8A 1GOOA 1J18A 3WNKA 5BRQA 1WDSA 2W61A 3DC0A 2W63A 1X6LA 3K8KA 4U3AA 3KEHA 1E1EA 1EA9C 3FXYA 5EMYA 5CXPA 1CENA 2C8NA 4S3KA 5CPQA 2CESA 1VF8A 4B16A 1QNPA 1DWJM 1JI1A 1ZJAA 4J3SA 3ZT5A 2ZWYA 1RD6A 1V6YA 1H11A 3BCDA 3W6MA 1CBGA 1W32A 2VZTA 2VRJA 3VINA 4W5UA 2J77A 5FD0A 1MQQA 1OGSA 2DDXA 4AYSA 1G9HA 1RPKA 1SYTA 1HP5A 2C7FA 3CHCA 4Y7EA 4HP5A 5D9NA 5BRPA 1X1NA 3CZ8A 4GI9A 4J3TA 4LQ1A 1BG9A 3VMOA 4N0RA 1GJUA 1B3YA 1HKIA 3M7SA 1SMDA 2J7HA 1UOKA 1BHGA 4AZIA 2ZUSA 2WVVA 4OIFA 4W84A 4CU8A 2XM2A 1R8LA 5CG0A 8CGTA 1ITXA 1V3LA 3ZO9A 4JKLA 2BS9A 3EMZA 1V3MA 4CVWA 1B31A 3WEOA 5I79A 1F4HA 2WVVB 3NDZA 1GNXA 1UWRA 4GO8A 5CGMA 1V6XA 5E6YA 2J78A 2FDMA 4W8AA 1H0IA 1CECA 1E3XA 3W4RA 1XGZA 1HVQA 3K4AA 1AMYA 3OGRA 3AIBA 2ZX5A 3VIJA 3CZLA 3M6DA 2O9TA 3K4DA 2YBUA 2F2HA 4W88A 3WF3A 2XYLA 2A3BA 2YBTA 4TOQA 1XHGA 3VTRA 2X8RA 4TXEA 2YA0A 4U3CA 1J0YA 5CPSA 3GBEA 1EQCA 4J3UA 4LYQA 1O7AA 2WMIA 1MWOA 2WB5A 4UFIA 1BYDA 2OWXA 3U5YA 4Z2JA 1BYCA 3MSGA 4HA4A 1FH9A 5FKYA 1QI5A 4KGLA 4HA3A 5DEZA 1UWSA 2J8GA 1NWRA 2NSXA 1PX8A 5IFTA 2GDVA 3ZQ9A 2WMFA 4U5KA 2DT0A 3MS8A 3K1DA 4JZ5A 1TG7A 4AXNA 5A6BA 3ZT7A 2NT0A 3A4WA 2CETA 4TTUA 3FHAA 4QLLA 4UCFA 3RILA 4N42A 5M5DA 4WKAA 1CGXA 4PUEA 4WSJA 5I23A 2D0GA 3GNRA 3AFBA 1PIGA 1BTCA 1B1YA 1LL6A 1UWTA 5BXSA 4WSKA 4IUGA 1XRVA 3W24A 3VM5A 4FMVA 2ZUUA 4PRWA 1JGIA 3AOFA 4TVCA 3GH4A 4W89A 2DGAA 3VGHA 2EEXA 5A3HA 2XGBA 4PYSA 1VFMA 1W9DM 3ALFA 3LPGA 1UUQA 2BY2A 2WYSA 4QCFA 3OB8A 1DHKA 2WK2A 1VEPA 1W3JA 1WKYA 3EDEA 4P8UA 1GPFA 1GOKA 5ABGA 1UKTA 1E6ZA 4AD4A 4MB5A 2BY0A 2XVNA 2V3GA 2ZXQA 3IAPA 3WDHA 3BXWA 3TTOA 3VIFA 1KBBA 3WIJA 1BGAA 4L4OA 4JFVA 2PWGA 4AWEA 2BHZA 2VX4A 4W5ZA 1G94A 1WZMA 2GFTA 4PMYA 4MAZA 4BQ5A 2PC8A 3OGSA 3F5JA 5M03A 2GVYA 4GQQA 1KXVA 3SUTA 1HT6A 4JL1A 2EO7A 3VGFA 1OGGA 2CERA 1JXJA 1W91A 3WH8A 3CHDA 3CHEA 2D2OA 4ZENA 2XWEA 4JIEA 2A3AA 5CPTA 4UOZA 2ZICA 4CD7A 3T0AA 1IT0A 2XTKA 3SCVA 3WQ5A 2VRQA 1RP9A 4NF7A 1Q4NX 1D7FA 3VX0A 1QBBA 4DUWA 5JUVA 3F4VA 3N04A 1RP8A 3BC9A 4U33A 4W85A 1SR0A 2XPKA 1QVBA 3WD1A 1UD5A 1W9UA 3AYSA 4CCEA 5GQBA 2WC3A 1ZBWA 4CUCA 1TMQA 4HMDA 1NOWA 2OSXA 2CEQA 1BYBA 1CXKA 4JHOA 4M82A 1EXPA 4UQEA 2DSKA 4FLOA 1J01A 4UQCA 3AZTA 4MDOA 1H2JA 2VI0A 1HF6A 1JG9A 5LA1A 3BAIA 3QHMA 1W3LA 3UEQA 3O9NA 3L4WA 4BQ4A 3ARSA 2ZIDA 2VZVA 5BYWA 1ZS2A 2QPUA 4V2XA 1HJSA 1W3KA 1LJYA 1VAHA 2VR5A 4CD8A 1W1YA 2Y4SA 1CLXA 4AZGA 4Z2LA 3CUJA 4AZBA 1LWJA 5GNZA 4MJ2A 3THDA 3MU7A 4CD4A 4U5IA 5HPCA 3PN8A 4PCSA 1PPIA 1EO5A 3UESA 4AEEA 4U2ZA 3SUSA 2CNCA 2QLYA 5A6SA 1XC6A 3CZEA 4AD2A 3GNOA 3WF2A 1FP9A 3WDJA 3ARZA 3WUFA 2W92A 4UQ9A 1QPKA 2V3DA 3T0DA 1G1YA 3T2QA 4ZEPA 4B15A 4U2YA 2EQDA 3N9KA 3RO8A 3T08A 3MUZ1 1UD4A 5A95A 1E0XA 1K6AA 2O92A 5FL0A 3SUWA 1NWUA 2AMGA 3WKZA 1UD8A 3UERA 4HPGA 1CXLA 1JZ6A 3WD4A 1Q6DA 5EFDA 4LXFA 1OINA 2XFYA 4ZXOA 3ZMRA 1JNEA 2E0PA 4JCMA 1UWUA 4Z2GA 1UG6A 4HA1A 1QHZA 3AXXA 4CN6A 1JD7A 3WBAA 2QV4A 4FK9A 3MANA 1BPLB 2G3MA 3CBWA 3W25A 1QNRA 2W91A 3W38A 2X09A 3WEMA 2Z1SA 3SCPA 1V0KA 5ABEA 4JKMA 1J0IA 1W1TA 3IJ9A 3GH5A 1XH1A 1UH4A 4PTXA 2E9LA 3D3AA 5M3WA 3DECA 2JIEA 4LGXA 4HOWA 1J0ZA 3QOMA 1V03A 2NT1A 2CBIA 2WWCA 1JZ7A 3AIEA 3DYMA 4MTVA 2WCGA 3WNPA 1TA3B 5DT5A 1ECEA 4NZCA 4JFSA 4A4AA 3M46A 2YOCA 1CXIA 1V0MA 1CXHA 1XYFA 1O6IA 4ZE4A 4JFTA 4DM1A 1V0NA 1E4IA 3AS3A 1J0KA 3SURA 4GZJA 1JZ2A 2J7DA 3LPOA 1HX0A 3D5HA 3L4VA 3S6TA 1UWIA 4GINA 3WDPP 3PTQA 4P7RA 1E56A 2DEPA 3UG5A 1PX4A 4HU8A 3AIWA 3GXMA 3OLIA 2PWHA 3WDIA 1B90A 2PWFA 4XZWA 3VDCA 1H4PA 3PTKA 4U31A 3LPFA 2YL5A 4QCEA 3UCQA 4WIWA 4P7QA 1CIUA 1B3ZA 4HZ7A 3FHQA 3GH7A 2PF0A 2JF6A 3VDAA 3CUGA 5I2UA 3AHVA 3BH4A 5A1AA 4AD1A 5C8BB 4OOZA 2GSJA 4GQRA 1E55A 1CYGA 1US2A 2YDRA 3W6LA 4JFUA 2ZX9A 3W81A 2X05A 1C8YA 5I0DA 4OZOA 1E6PA 5CLWA 1XD1A 4PMDA 3BAYA 3AMCA 4LYRA 7CGTA 3WELA 4PMRA 3GXFA 2WANA 4AY1A 1V6UA 1BQCA 1LL4A 3GYCA 1E5JA 3AROA 2EPLX 3MUIA 3WNNA 1ITCA 3CGTA 4A3YA 3PZTA 8A3HA 5AY7A 1U2YA 4QLKA 1AQMA 3SCQA 4X0VA 1NWSA 4HU0A 1UH3A 2RGLA 3NSNA 4YPJA 3VUPA 1QHOA 2J74A 3MO4A 2WC4A 2ZXDA 4PN2A 4DUXA 4Z2HA 1XSKA 2WPGA 2YIHA 4C7GA 1U33A 4CU6A 3CMJA 1C7SA 2BXZA 4MADA 3TA9A 2XSBA 2WW5A 5A8PA 1V02A 1BG4A 3GZAA 1UR8A 3VD4A 2ZX6A 1GQLA 3AS1A 2ZE0A 5E70A 3VD5A 2VX6A 1M53A 3JUGA 2XGIA 1LG1A 3ARQA 2W66A 1BGGA 2DH3A 1E40A 1JDAA 3WF1A 3RM8A 1GQJA 3EDKA 4D1JA 2GK1B 3SCUA 1C3FA 1CWYA 1JNDA 2UY5A 1V6WA 1WB0A 4B9YA 3M07A 3AHXA 4X0NA 2Y5EA 2J7CA 4JAWA 3PZ9A 1QI4A 4M56A 4UR9A 1Q6GA 3VU2A 4TTGA 3IAQA 5IHSA 2BY1A 4F9JA 2Z1KA 4PCTA 3GTNA 2DH2A 1OCQA 1B30A 1XD0A 1MFUA 1UYQA 4WJXA 3OA5A 3NSXA 4AIEA 3WDRA 4ATLA 1R7AA 1J0HA 1J10A 1VJSA 4EAMA 5I3DA 1OIMA 1ZL1A 2VR4A 4J28A 2IUZA 1YQ2A 1HL8A 4OBRA 4HMEA 4XB3A 4DWSD 1M03A 2E9MA 3F5LA 5I6SA 1J11A 5AYIA 1ESWA 2GJPA 3AYRA 4YHEA 2V5CA 3NUKA 1AQHA 2F8QA 3IJ7A 2D3NA 1NARA 5FOOA 4CKQA 3MSDA 2VNCA 3WFZA 2DSZA 1GONA 4MJ4A 4UFKA 1KXQA 3MUAA 1UD6A 4D6FA 1XCWA 4F9DA 1N82A 1GQKA 1UR2A 1IZKA 7TAAA 1HKKA 3N15A 2DT2A 4PMUA 1WDQA 3OZPA 3QHOA 1UHVA 1R7OA 5A2BA 2VQTA 1UQYA 4QDMA 1KBKA 5JIWA 1TZ7A 4ML4A 2OSWA 3GM8A 4F79A 4QAWA 3WQWA 2EBNA 5AC4A 1U30A 4MNMA 3EYPA 2XUCA 5A94A 2VZSA 1E0VA 3AICA 2VZUA 4UTFA 1H0GA 1KGUA 3ARVA 3O2LA 5I5RA 2VCAA 4M81A 1AVAA 1KR0A 1I75A 4GO9A 4UNIA 3WENA 3VX1A 4OBSA 2UY4A 1IV8A 3HMCA 5EFFA 3B8SA 3T0BA 3RM9A 1VBRA 4UZUA 3DHPA 4GI8A 1XH2A 2WM0A 2OWWA 1MW3A 2EJ1A 1L0PA 3RPMA 5EBAA 1ISVA 3WMSA 4AIUA 3VIHA 3BMWA 1WO2A 2VTFA 2J47A 1ISZA 2WMGA 2DSVA 3TOPA 2WLYA 1HL9A 4V27A 4FLQA 5BXPA 4RE2A 5E09A 2JFEX 1CEOA 2D23A 3AIQA 4TX6A 2VMFA 3RJXA 1JAEA 1E71M 4P7OA 4E4PA 2FHBA 1UKPA 1H41A 3VOCA 1XSIA 3A4XA 4EKJA 3II1A 4UOJA 2XM1A 3WY1A 4BS0A 1EO7A 1JFXA 4UFJA 1C92A 1V02E 3VO0A 1JIBA 1OT2A 1QHPA 4PMQA 2MANA 1V3HA 4XV0A 2HVMA 2VC9A 1E6SM 5C71A 4D71A 2D22A 4Z2IA 3NYDA 4D6HA 3WNLA 2WBGA 4R27A 1CGWA 1GQIA 3AZSA 1UR4A 2CBVA 3ZM8A 1IZJA 4GXPA 1P6WA 3FNDA 2GDUA 4W7UA 3TONA 4IPLA 1BLIA 1VJZA 2OSYA 4IISA 3QR3A 3EDJA 4XUYA 3B9AA 2XFRA 2XG9A 1MQRA 3AISA 4P8WA 4YN5A 1JFHA 3ARXA 3W53A 1B3XA 3ZJKA 2UY3A 4PTVA 3WDQA 2VT0A 4W87A 1LG2A 5A69A 3G6MA 4F8XA 3WF4A 1MVYA 4W8BA 6TAAA 3ZSSA 1R85A 1E1FA 1WP6A 1NOFA 2YA2A 4UQDA 1FFRA 3OLDA 3TTSA 1LQ0A 2CHOA 3UG3A 1NOUA 3PZUA 2EPNA 4CCCA 5LA0A 1CTNA 4EE9A 1EHAA 2AAAA 3W0KA 3N11A 4W8LA 3U5UA 3WEZA 1NWTA 4MPKA 2YL6A 5HBFA 4NSBA 1E70M 5GNXA 1H09A 3CMGA 3IANA 1HJQA 2DIJA 2DT1A 1UQZA 2CBUA 3FY1A 3WL0A 2WC7A 3PZIA 2VRKA 3AMKA 2VVSA 5CSYA 3L2MA 2O9RA 4UFLA 3AMLA 1EH9A 1TVPA 1TCMA 4MB3A 4LPCA 1W9XA 1FFQA 2EPMX 2WBKA 3BSHA 2ZUVA 4KMQA 1JYVA 1J9YA 4ACYA 4M24A 4H41A 3VNZA 3EDFA 1DEDA 1E6RA 3WD0A 3F5KA 1BSIA 3VGDA 1B0IA 1JYXA 1BFNA 1CDGA 1VRXA 3AHYA 4UQBA 3GXIA 3ARRA 5C70A 5A8MA 3A6OA 2VCCA 2DSUA 2F61A 4RE3A 4AZ5A 3AIRA 1OGBA 1V3KA 3WQVA 2D24A 3GXDA 2OYMA 3LMYA 2BFGA 5AC5A 4AZ6A 3O6AA 3MMWA 1L8NA 3VDBA 4D6EA 3B9EA 2X1IA 2E4TA 3WQ4A 3A3HA 2DPEA 4TVUA 1I1WA 2FHCA 3W82A 4AISA 4FF5A 3BSGA 3ARWA 3GBDA 3NDYA 4DWSA 1E6QM 3KZSA 4AMCA 3N13A 5ABFA 1QNQA 5CZKA 3RMEA 1KWKA 3WH7A 2YL8A 5D8ZA 3WNMA 3WL1A 1B9ZA 1ZBCA 2VURA 4DWSB 1WE5A 2Y24A 1V6VA 3WBEA 5ABFB 2CKRA 3AMGA 1NP2A 1Z32X 3SCSA 4D6DA 3K8LA 2DQXA 3VD7A 4AEFA 4PMOA 2ZX8A 3KE0A 1QNOA 2J25A 4EK7A 4OJYA 3VDHA 3L4XA 2W4XA 3SCWA 4TX8A 3MUY1 3WNOA 4E8DA 3SEPA 4ZFMA 2CBJA 5TD4A 2ZUTA 2B31A 4XX6A 1ISWA 3WQ8A 2XIIA 1QI0A 1PAMA 3S2CA 2DT3A 4GZIA 6CGTA 1HVXA 2CYGA 3ZJ8A 5BXTA 2JEQA 4D6JA 4JHZA 3WD2A 1OB0A 3ALGA 1QNSA 4J3VA 2VZOA 1JF6A 2OWCA 3ZJ6A 1ZJBA 1UKQA 3WFLA 3ZR6A 1TA3A 3LPPA 3NSMA 5A8QA 4M29A 4NI3A 1W2PA 1CPUA 3L4TA 1VFUA 2IXUA 4WKHA 2YLAA 3BAJA 2WSPA 2E3ZA 4CGTA 4D6CA 4GI6A 3MMUA 3WUEA 5A6BD 4MDPA 1W2VA 1E4LA 3FAWA 4NRRA 1E9LA 1Q6EA 2W62A 1DWGM 1V3JA 2CIPA 4E8CA 2XJ7A 3OLGA 4J27A 1C90A 3VPLA 3CH9A 2IXVA 2V5DA 3VGEA 2X2YA 1JAKA 1E4NA 3OLEA 3PZQA 1MW1A 3VMNA 1FHDA 2XSAA 1GORA 2YDSA 1E0WA 4ATDA 1BAGA 4OKDA 2WCSA 1HP4A 1KQZA 1ZU8A 3VIKA 1A47A 4QP0A 3VM7A 1JYWA 3I3DA 5BROA 2EXOA 1FH8A 4D1IA 2VCBA 2E8YA 3VIMA 4B3LA 4PMNA 1NH6A 1VIWA 2CITA 5EB8A 1HIZA 5D8WA 1I1XA 1LF1A 2BVTA 2EPOA 4W7WA 3VIOA 2EPKX 5E9AA 3THCA 1MW2A 1DTUA 1J0JA 2JF7A 4JCLA 2XVLA 1V08A 3SIMA 3ARTA 4RE4A 3K46A 2YA1A 1EGZA 4M80A 1HXJA 2XFFA 3AHZA 1H49A 2J7FA 3W28A 2HISA 2OYLA 3PZMA 5A6JA 3T09A 3MMDA 5HDRA 3PTMA 2V38A 4L4PA 4D72A 2J62A 3BAKA 5CLTA 1K9DA 1W1VA 1CXFA 2J75A 4S3JA 3QOKA 1WNOA 1FOBA 3NIYA 4W93A 2FH6A 2BVYA 1QOXA 2NW0A 3AXHA 2CCRA 5GPRA 3SCTA 1HJVA 5HPOA 3UG4A 2A3EA 3WMCA 2ZUWA 1KCLA 1DWFM 4ATWA 3IJ8A 1C8QA 1KFWA 5IDIA 1Y7VA 1JDDA 2GK1A 2BY3A 1CXEA 4W7VA 2VL4A 1PIFA 1BVZA 2VX7A 2WMKA 1UR0A 1XV8A 5BWFA 1ODUA 5CQ1A 5D4YA 3PZVA 2WWDA 1GHRA 2PWEA 5A8OA 1OWQA 2WHKA 2XIBA 3T2PA 3L4UA 5BCAA 5DFAA 1G5AA 3N1AA 2PBGA 2GUYA 2G3IA 3VKKA 1TFVA 1W9BM 5AYBA 5ECUA 1QW8A 4HZ8A 3WN6A 3WH5A 3PZNA 2JALA 3EDDA 5KZ6A 4BA0A 3MV01 1K9EA 2VJXA 5I77A 1PZ2A 1KCKA 4ZXLA 4GZEA 4AD5A 4H8VA 1TUXA 3CO4A 2WCAA 4DWSC 1UA7A 4PUDA 3MKKA 1UA3A 2QF8A 3W27A 2BHYA 2J7EA 2DIEA 2YJQA 1MQPA 5M17A 4K68A 2WZEA 3QGVA 4PMZA 3BLKA 1H5VA 5F7UA 5I78A 5KEZA 5A6KA
chains in the Genus database with same CATH superfamily
2EHHA 1A0DA 2PTZA 3GHRA 1KLYA 5DCBA 2YLLA 3AJ7A 9XIAA 3SECA 1C9WA 4OFCA 1TJ0A 1XIHA 1TVNA 4EANA 3CUIA 3U7BA 1WZLA 2YFOA 1FDJA 3P5ZA 1GOMA 2C1GA 3P2VA 3TW7A 1XIFA 1XPYA 3GAYA 4R3UA 2JGQA 4NKCA 1OBAA 1F6PA 3KS6A 3VGGA 4PMVA 3UR2A 2PDNA 3CB3A 3PUGA 3E5PA 2GJRA 1OM0A 1LCOA 3URNA 2PA6A 1Z48A 1LORA 4UR7A 2HROA 4DYKA 3DGRA 1DVJA 4N9DA 1EYEA 4GPNA 5H8UA 3BLLA 2ISVA 3NQ8A 3C2RA 3TYBA 1TJ1A 3OZOA 5DMYA 5A8NA 3AHTA 3L2LA 1CB7B 4BCEA 2PC4A 3S5ZA 4AH7A 3WLIA 1P6BA 2PP3A 3U7VA 1GVYA 1GKQA 4EAYA 2Z24A 3NO5A 1HJXA 4MWAC 4PUKA 1W31A 3MWCA 1O68A 1UP0A 4KRUA 1QBAA 1E6NA 1HN1A 1ONRA 3WJYA 3ZWTA 2WKLA 1U5VA 3GNPA 2Y89A 1AH3A 4GA8A 4O1EA 2FJKA 3VIPA 4LF1A 4AW7A 1TWWA 1TV3A 3BL3A 3GO2A 3UXDA 3PBWA 4GIYA 3RJYA 3WK1A 5FL1A 1VFLA 2C16A 1Q8JA 3HG4A 2O7QA 4LV9A 2Z1VA 3ARPA 3C61A 1VYPX 2P8BA 3CV2A 3IGUA 3NVTA 1OFOA 3TLQA 4RXGA 4B3KA 4UOQA 3A9BA 3SY1A 2XIOA 4R9XA 3U2CA 1OJXA 2Z25A 3BV4A 2Z00A 4CN4A 4Q4QA 5HUPA 3MP4A 2A5HA 4S39A 3VVGA 1MXSA 2V3FA 3VIIA 2XH4A 3KRUA 5E5CA 3HN3A 4HNNA 3HGSA 1W5PA 4GX8A 2J79A 3C0LA 2PSNA 4JQ3A 2MNRA 1RCOB 2D3LA 1O94A 3KWXA 1XGEA 3FGCA 1Q6CA 1L6FA 1W3IA 3ZIZA 3FJ4A 3IV8A 4EXQA 4NI8A 5D09A 3MBFA 5A2CA 4DPPA 1G4SA 1GJWA 2X0YA 1TWDA 3S42A 2Y8VA 4HTBA 4AVNA 3CZKA 4TMCA 1XCXA 3UZXA 4CQ9A 3BMVA 2QDDA 3N3MA 1K1DA 1WXJA 3GS6A 3R7MA 3UPWA 5A6AA 4RNHA 2R1KA 2YYUA 3XINA 3UR8A 1LOLA 3C4UA 3KL0A 2P53A 1G01A 4LW7A 4ACZA 2E8ZA 2AOSA 4F66A 5LGZA 3H70A 3P5YA 2V6AA 1C93A 3EWXA 5E6ZA 2BOGX 1Q6QA 3N25A 4JGDA 1EZ2A 5FIPA 2PP1A 1S2CA 4PTWA 3M16A 2AKZA 3CS2A 4PSPA 4KS0A 3DC8A 5BRBA 4XG1A 5AECA 5DMMA 1YHTA 5H8PA 3WUBA 1AL7A 2W67A 3F1QA 3RIKA 2BB0A 2ZC8A 3B3DA 4DJFC 4F4RA 4BWLA 2FZMA 4HHPA 3C0JA 4YCPA 3P60A 1W8GA 4LS1A 3UR7A 1OF8A 4S3FA 1DJXA 1D2KA 1A3HA 3UF9A 5I09A 2O9OA 4M8UA 2QCLA 3G24A 1TE1A 2WMHA 1E5NA 4E2OA 1POJA 2EPHA 3EMCA 3W1QA 2D0FA 4CQ8A 3OGVA 3CTLA 4HZMA 2Z28A 1SR9A 3H4XA 5HMEA 3SCOA 1LROA 1XYMA 3DFHA 1XIDA 3CXOA 3TR2A 2GGIA 1S5VA 3V36A 3MHGA 1XX1A 2XFWA 3V0SA 1UKSA 5DN1A 2Y5SA 3AI0A 1HKMA 5LIXX 3MTWA 4D6IA 1H3GA 4QITA 2QMJA 3M5YA 3G6LA 2PDGA 2WKGA 3ZJ7A 5LA2A 1EX1A 3A47A 4AZ7A 5HNRA 3C2EA 3G5EA 1US3A 4HOZA 3TTYA 3JR2A 2D73A 4HZ6A 3HPSA 3N17A 1FHUA 2CWXA 3B8DA 1JQXA 2C13A 3DYPA 3VGBA 1SFSA 2C79A 3S9IA 2OCZA 4RL3A 4IIBA 3KVMA 5J5DA 3MCOA 5T9BG 3LA4A 1PL9A 4Q4SA 5I03A 1GW1A 2QPSA 4DXXA 1J6OA 1PEZA 4PEEA 3SN1A 1KXHA 2VO5A 1VFFA 1OT1A 3Q45A 4N6EA 4P8VA 1NQ6A 2QCHA 4CD5A 4E8GA 3CV7A 2A3CA 1PXGA 2WM1A 3ZT6A 1EQPA 4DX3A 4XIMA 3MDWA 4L4MA 4ZOBA 3BAXA 3CWNA 4ADUA 1K7FA 2VGIA 2JE8A 3WLSA 1EIBA 5CPNA 2F2KA 3BARA 3MQTA 1CZ1A 2HS6A 4XO6A 4UFHA 5CSUA 4N9EA 3N6HA 3RR4A 2BMBA 1XSJA 3TN4A 5T9CE 1TYGA 2WZHA 1G0CA 4XZBA 5PTDA 3XISA 4S1FA 1GVQA 3E2VA 1IWBA 3NZPA 1AW2A 3F4WA 3W7CA 3FLUA 1FWCC 1GOIA 2E1DA 4CNSA 1BF2A 5DLCA 3W74A 3UJFA 3MBDA 2CZEA 2DW7A 1ITUA 1FY6A 2GVGA 4GIAA 2J7BA 2ZX7A 1GTHA 1A5SA 1UIOA 2J88A 4KFOA 1GYMA 3A4AA 1LOSA 4BF7A 2YW3A 1J8VA 4IPNB 2L5HA 5DX7A 3QY6A 3AIVA 3WH6A 5TIMA 1C8XA 4MNLA 1XL9A 2PDQA 4H7VA 1S2WA 1EOKA 5HA7A 3VMPA 1F74A 4LUSB 3IVUA 4E2BA 4GHRA 3BWWA 1X6LA 1EA9C 3CAKA 4ERAA 5CZJA 2QCDA 3IRSA 4L1WA 2OKOA 1YNPA 1ZJAA 1RD6A 3WQPA 4GQBA 2PE4A 3ITCA 4H83A 1YPIA 1TRIA 1LRQA 2HE5A 2VRJA 3LCWA 7ODCA 1T7LA 1SPQA 1N55A 2HVOA 2R91A 3D3FA 4Y7EA 2PWVA 1UCWA 1ZJHA 2ZFAA 4X2PA 1YTKA 2XZ7A 1TX2A 4R85A 5K7JA 4J3TA 2QZRA 4LQ1A 1NFPA 4N0RA 5KZDA 4O4VA 2DORA 3QVQA 3A4JA 3M7SA 1XFBA 1WV2A 1BHGA 4AZIA 2ZUSA 3K2GA 2I5QA 4CU8A 5CG0A 4QBXA 4ERGA 1G4PA 3ZO9A 2Z7KA 4C1LA 4IPIA 1OG6A 2GYIA 5EYWA 3W87A 4CVWA 3R8HA 1XUZA 4GO8A 4NHVA 4Y9AA 4TO8A 4IL2A 3RFAA 2FDMA 3UWYA 5G1TA 4MWAE 1CECA 3W4RA 3OGRA 1I2NA 3I10A 3M6DA 2YBUA 1N2VA 2F2HA 5FF7A 1NDWA 3VFLA 3QTGA 4HCLA 4TXEA 1EQCA 4C1NB 4J3UA 1V8EA 1TQXA 4UFIA 4ASTA 2RDWA 1DOSA 3L5MA 1X39A 3LQGA 2OWXA 3MSGA 3WK2A 1XBYA 2B4GA 2VFEA 1F3TA 3V7PA 5LHEA 3MS8A 3O05A 2P10A 5A6BA 3ZT7A 3A4WA 3FXGA 3RILA 5M5DA 1P7TA 4PUEA 5I23A 4O1CA 5B7ZA 5F1VA 3P61A 3WBWA 1BTCA 4C6PA 5FJRA 2REQA 4QISA 4HGXA 3V1HA 2Z0IA 2V5LA 3N2MA 2RAGA 1XRVA 2HBVA 5GJNA 3VGHA 2HMCA 2XGBA 4PYSA 3R89A 3CQJA 1UUQA 2AL2B 4QCFA 4B5UA 1DHKA 4MKVA 3EDEA 1ME9A 3EWUA 1UKTA 4Z17A 4H6EA 5I00A 3QPZA 1HGWA 1RALA 4LS2A 5BMXA 3IAPA 3WDHA 2NXGA 1XDLA 4C6QA 3CK5A 1KBBA 4Y9PA 4OQVA 4WEVX 3ABQA 4OVXA 1FBAA 1XRSA 1G94A 1WZMA 2IKHA 4EX4A 4BQ5A 1DPMA 2PC8A 4DJDA 6REQB 1B3OA 3F5JA 2NVCA 5M03A 2FIQA 1KXVA 3B0YA 3DI0A 3F2CA 3SUTA 4JL1A 4LUTB 1OGGA 4JQ1A 3UCDA 2V68A 4KKXA 2XWEA 4JIEA 4DZHA 3NPWA 2FMOA 3TX9A 1R3VA 4UOZA 1IT0A 2XTKA 1JCMP 3B40A 3O0FA 1JCXA 2V5BA 2PDMA 4NF7A 1Q4NX 1IWPA 3W07A 2PGWA 4J40A 3F4VA 3B4UA 1Q6LA 1QVBA 4GY7A 4AY7A 4CCEA 5GQBA 4K39A 1TMQA 4IIGA 5AZ1A 1NOWA 5REQA 4K1WA 2CEQA 1CXKA 4M82A 3R12A 5HJXA 3UG8A 3WQFA 2NUXA 3AZTA 3P93A 3S2NA 3H7VA 1H2JA 2VI0A 3BAIA 3QHMA 3Q58A 1ZTVA 7TIMA 3UEQA 4UTMA 3L4WA 2VP8A 3REQB 4MM1A 2VZVA 5EMLA 3RMJA 1X98A 2VEGA 1ZAJA 1HJSA 1BXNA 1GW9A 4N9CA 4AZGA 4Z2LA 3ES8A 4AZBA 3Q65A 3SRFA 2VKZG 5CZ0A 4U5IA 2CNCA 4BEUA 1ZP4A 2QUMA 4AD2A 3IGXA 4GI4A 3R11A 1FP9A 3WDJA 3ZWSA 2W92A 4QE1A 2HTMA 1G1YA 5FAGA 4GWEA 4ZO6A 5A95A 5I3HA 1E0XA 3CQHA 3IJQA 1K6AA 5FL0A 3NQGA 2OZTA 4UR8A 2AMGA 3S83A 2HBXA 3UERA 4RW3A 3TNOA 3M0KA 3KTCA 5EFDA 2RJHA 3HFTA 4D2JA 4AEOA 2Q01A 4JCMA 4Z2GA 2G95A 1Q2SA 4HA1A 4CN6A 3VKCA 2XIJA 2QV4A 3T44A 1T8XA 2G3MA 1QNRA 2OB3A 3DHDA 4FNUA 4WJEA 3SCPA 3M41A 3THAA 3GH5A 1RUSA 1UH4A 4PTXA 4PUJA 3SY8A 1V93A 1IEWA 4IF2A 1TWIA 1OFBA 4HOWA 1J0ZA 3P8JA 3QOMA 1V03A 2VYOA 3N6QA 2F6UA 5FF3A 2CBIA 3AIEA 3ITLA 4MTVA 4Q4RA 2WCGA 3WNPA 3MI3A 4NZCA 3M46A 1E1CA 1J4EA 2BDQA 1CXIA 2CLEA 1EIXA 4ZE4A 4FIQA 3W7EA 1V0NA 4FP1A 3SURA 1XXXA 1EC8A 4LVGA 2QJMA 2YXXA 3WDPP 4P7RA 3UG5A 2O4QA 1R9XA 4JQ4A 3OLIA 2PWHA 3WDIA 2PWFA 3W7GA 2INEA 1P1MA 4JTQA 3L65A 5MHBA 3D47A 2GGHA 4EXAA 4F0RA 3GX9A 3FHQA 3TC6A 3GH7A 2I1OA 3CUGA 5D05A 1QCWA 5A1AA 3P80A 4DBEA 4ZA0A 4JNYA 2QXWA 2PDIA 3MHUA 4A8NA 1LT8A 4JFUA 2ZX9A 2PMQA 1C8YA 4OZOA 1E6PA 4Q4PA 1MUMA 4B5WA 1G67A 3AMCA 2QGYA 3ZVHB 4PMRA 1QK0A 3EX6A 1BQCA 3GR7A 1VQTA 1LL4A 1OZQA 1VS1A 2B0MA 4PBEA 5LHFA 2EG8A 3PZTA 8A3HA 3PSVA 4WXZA 4QLKA 2FFIA 1AQMA 1YMYA 1FX6A 2VFFA 1FWDC 4X0VA 1I9CB 1NWSA 4HU0A 4YPJA 5L6UA 3KM8A 4GXMA 3W7RA 3KP0A 3UPBA 3QQWA 4RX0A 4DUXA 4Z2HA 5XINA 2WPGA 1TV8A 2X1TA 5GJMA 3CMJA 5ECVA 3NQCA 4MADA 3TA9A 1OX6A 3M0MA 3QZ6A 3WK3A 2RKXA 5A8PA 1BG4A 3GZAA 2VDGA 3VD4A 3RLGA 2P5NA 1FXQA 3LHWA 1SGJA 3AS1A 2ZE0A 3KBSA 3URQA 3ES7A 4WX2A 5J8LA 1GWJA 1ZZMA 4JNZA 2R1PA 1GQNA 1DJYA 3W1TA 3WF1A 2RDUA 2DIKA 3GK0A 2YXOA 4D1JA 1WB0A 2W27A 3PWGA 4JAWA 3PZ9A 5D2TA 4E5TA 1DIOA 2BODX 4Y9NA 3SSZA 4UR9A 2HDJA 1Q6GA 3IAQA 2HCVA 4FNSA 5A6TC 4GYKA 5IHSA 3FKKA 1X8FA 2Z1KA 4QS5A 3LRMA 5F2LA 3RRAA 4WJXA 2VWSA 3NSXA 3NZ1A 1J10A 4LVDA 3TFXA 1DJQA 4AHOA 4J28A 1YQ2A 4OBRA 4DWSD 1FHVA 3O0KA 1S39A 4US5D 4LBSA 5AYIA 2OOGA 2V5CA 2BLEA 2DW6A 2GLKA 1YBQA 1UC5A 2D3NA 3OVRA 3OBEA 3S5NA 3NQMA 3MSDA 3QM3A 1XG4A 2OOFA 3TQVA 4JD4A 2ISSA 3RUBL 1KXQA 3MUAA 1UD6A 5M2FX 2PFHA 3MJYA 2XIQA 3M5VA 3VXGA 1UR2A 1IZKA 1YXDA 1HKKA 1JPIA 5BNKA 4PMUA 3QSRA 5BOOA 3OZPA 3CT2A 1FVPA 1JUEA 1EB3A 4D8AA 4LNYA 4TV6A 1SVDA 4HD5A 1TZ7A 3HPZA 3BQ6A 2Y1HA 4YJ5A 3UXLA 3UU0A 3UW6A 2O56A 3GVWA 1T99A 4MJZA 4B5XA 4FXRA 3H2OA 5AVNA 3BW4A 4HK6A 4Z0SA 2PD5A 2RFGA 3PSWA 3NL3A 4L1XA 3ARVA 2ZKMX 3CPGA 5I5RA 3ID7A 4S3DA 4RDVA 3NQDA 1LDCA 2JKAA 4RKAA 2OX1A 1KM3A 3IWPA 5EFFA 3DHPA 5HJLA 9XIMA 2WM0A 1UB3A 2OWWA 2EJ1A 3ATYA 3WMSA 3N73A 3WJWA 3BMWA 3LBCA 4MPQA 4AWTA 4JTKA 3TOPA 2WLYA 1IT7A 1HL9A 4V27A 5JVLA 2EKCA 2VFDA 1XC4A 2D23A 1OFDA 5IOBA 1JAEA 2J8TA 4E4PA 3A4XA 1R38A 4EKJA 3V0TA 3II1A 4QJ1A 4UOJA 1Q3NA 3UZYA 4M3PA 3GXNA 3WK0A 1OT2A 3P0XA 4DEFA 2MANA 3STEA 2ZZ5A 1YNYA 2DVTA 3EXRA 3GTXA 4WDUA 4XBJA 3UZJA 4IGSA 1CGWA 3AZSA 1UR4A 2CBVA 4GBUA 4H9VA 5LIYX 1W37A 4YLWA 4W7UA 4XQ6A 4PR4A 3TCSA 1UWAA 3OG3A 2XFRA 3IIPA 1RVGA 1MQRA 3WLHA 4YN5A 1XBZA 2DUXA 3ARXA 3BLOA 3THUA 1KTNA 3ZJKA 1MEWA 4IMAA 4KRZA 1LG2A 2AQOA 2NQZA 4IFOA 3G6MA 4H19A 3V75A 2FVMA 3UVIA 2X30A 1R85A 2G50A 2YA2A 3OLDA 2D2HA 3L5AA 2ALDA 3UG3A 1E9YB 2NZLA 2CFFA 4CCCA 4A8LA 3C52A 2AAAA 4UMAA 3TN6A 4MPKA 2YL6A 4ONVA 1JPHA 4Z1DA 3BW3A 1F8IA 3ITOA 4NNCA 4WOQA 4BFAA 1H09A 2CXEA 3IANA 2DIJA 2DT1A 2WJZA 3AYVA 4M0XA 2WC7A 3AMKA 3T0TA 1C29A 3L2MA 4UFLA 3EB2A 4E4UA 1TCMA 3CO8A 4LCQA 4GABA 3E2QA 3DIPA 3E9AA 1R3WA 4KMQA 1J9YA 4G1NA 4ACYA 4H41A 3S3GA 3BG9A 3VNZA 1I2QA 3ERPA 3F5KA 2Y61A 1BFNA 1XIJA 3A24A 1OK4A 1RHCA 3GXIA 5HQMA 2INFA 2ZRZA 1F5ZA 3FCPA 4S3CA 1LLZA 3A6OA 2F61A 3ENLA 1IHIA 2D24A 3GXDA 1U1JA 4I7UA 2BFGA 4QR6A 3GR4A 4HHHA 3I7SA 5KINA 3PG9A 4TVUA 3W01A 3H22A 3GUWA 4AISA 3QH2A 3T6CA 3PVFA 3HMJG 3GIPA 3P84A 1B57A 3N13A 4HHMA 1QNQA 1Y5XA 1ICSA 1KWKA 3RXZA 3RPTA 4GJ1A 4HNLA 4O4WA 4O0ZA 3QRHA 4DWSB 2Y24A 1V6VA 1F61A 3T40A 4OV4A 2CKRA 1NP2A 1Z32X 2PDWA 3K8LA 1AD4A 4PMOA 2PU1A 3OA3A 4AU0A 3H6OA 1QNOA 3KVJA 4JTAA 5D04C 4OJYA 1VFHA 2NQJA 2PRLA 4GMEA 3INPA 1KFEA 2ZUTA 1MRAA 2C18A 1QJWA 1AJ2A 5H91A 5C9RA 3GDKA 6CGTA 5BXTA 2FGBA 2GGEA 3CMFA 3ALGA 1QNSA 4J3VA 3S9YA 2CLPA 3G3DA 4LRTA 1JF6A 1R9ZA 4IJBA 3W84A 3WFLA 3TC7A 1PUDA 3NSMA 3LNPA 5H8MA 1W2PA 3WYZA 2XINA 1QUMA 1K4GA 2AL1A 3MT1A 2GL5A 3H2EA 2E3ZA 3P14A 2GDQA 1GK8A 4GI6A 4Z08A 3MMUA 2E68A 5A6BD 4TX9A 3T4CA 1OC7A 4K2SA 3KLLA 4NU7A 2XSXA 5MF5A 1MDRA 1HO1A 2VELA 4JIQA 1V3JA 2CIPA 4PRRA 3V4BA 1C90A 2PS2A 3QKEA 1DXFA 4LAMA 2FVLA 1ZCOA 4D8LA 4KIRA 3E02A 1DHPA 4XTDA 3OLEA 4OWGA 1NELA 4C6CA 3KZPA 4R7JA 5U4NA 1OFAA 4UB9A 2WCSA 3MA8A 4QSFA 3SM0A 1HP4A 3G22A 8RUCA 4B4HA 1JYWA 2EXOA 3DGBA 3GC2A 4D1IA 2XH0A 1KCZA 3VIMA 3HM7A 3C5QA 4GUJA 4GVGA 1FCVA 1AQFA 2ZZ3A 2QJJA 2BVTA 3COTA 3VIOA 2EPKX 4IG2A 4FF7A 1F73A 4OU1A 2YZ5A 1V08A 3LS9A 3AWOA 3K46A 2YA1A 3LSBA 3GHTA 4M80A 4Q6JA 1TWSA 1J5TA 2YR1A 3KBNA 5GVJA 2J7FA 3W28A 2HISA 4J2PA 1H7RA 4E38A 1U5HA 3T09A 3CM4A 4DJDD 3GKFA 3MMDA 5HDRA 1Q2RA 2FTPA 3G1SA 3BAKA 5G4WA 3F2DA 1XLFA 2X7VA 4IGHA 3DESA 3E12A 2Q09A 4A3RA 2J75A 2ONEA 3ONBA 2KX9A 2X1RA 4ZQMA 5LXEA 4K7VA 4X63A 3M4HA 4FS9A 5BW6A 1RV8A 1C8QA 5IDIA 3BK0A 4IMFA 1Z9AA 2BY3A 1P48A 1KRAC 2FZ9A 1YKWA 1EJUC 2WMKA 1IEQA 3G1RA 4M7TA 1ODUA 4KCTA 1EJRC 1GHRA 5A8OA 1OK6A 3DFPA 3A64A 2WHKA 2XIBA 3L4UA 5BCAA 3MUXA 5DFAA 3N1AA 2OEKA 4LT9A 1VPYA 3VCCA 3M0ZA 4HZ8A 3WN6A 5GJPA 3PZNA 5KZ6A 3KOYA 3MC5A 5I77A 3H4WA 1VFTA 1IF2A 4ZXLA 2OQHA 4U4MA 4AD5A 3TWAA 2Y7FA 1UA7A 1RBLA 1VR6A 5CSSA 1EUNA 4I6KA 4QTGA 4G7FA 2BHYA 2QCDB 2ZRXA 3ZZ1A 1L2QA 4PL1A 2NVAA 5F1UA 2WZEA 3MI6A 4DJEA 3QGVA 3BTNA 1Y8BA 3IIXA 4M6QA 3O7UA 1VCVA 3SQMA 5C2XA 1WOBA 3VDGA 4LWWA 4AUBA 4ZBCA 4DNMA 4ZQOA 3WH9A 3T7VA 4H8HA 4RNJA 1QW9A 2WHLA 2PI6A 2O7SA 4OOUA 5FJJA 1CGTA 4UTWA 1EF2A 3CWHA 1KFJA 5G4EA 1EXBA 3I65A 1R47A 1QI3A 2D0HA 2CLMA 3CTTA 2FGZA 2O4MA 1IE7C 1PIIA 3EB4A 2HS8A 3ABRA 4HT3A 4MKSA 2E9BA 5F2GA 1XYLA 2I16A 1O5KA 3NDOA 4NIRA 5FCZA 4KEZA 7REQB 2NWRA 4NYYA 2VOTA 5H2ZA 1TZZA 3CAQA 4XO7A 4AB4A 2BNJA 3ZLGA 5BOFA 3N12A 5A6MA 2E5DA 3V0UA 1FRBA 4FNRA 3WZ0E 1F9CA 2XVPA 1DIEA 3L4YA 1FWEC 1BVNP 3H2MA 1FWNA 4AIOA 1M01A 1VEOA 5AFDA 3OIHA 3A3XA 4KEMA 3HF3A 6A3HA 3LENA 3PB2A 2HEJA 3S2JA 2Q02A 1V0LA 5D9OA 2A21A 3E96A 5KETA 1S5WA 1KGXA 3KX6A 3GHUA 1IXPA 3A23A 3VNMA 3BDKA 1OFRA 3IEBA 1XIMA 4WVXA 3OODA 4HYWA 4URIA 3CPUA 4KRTA 4CEXC 1CNVA 1FA2A 5AZ0A 4YHGA 1VENA 2RHGA 1JI2A 3OBAA 4K3ZA 1KM2A 1HGYA 4NVTA 1RXOB 1E73M 1J96A 1W9PA 4X9SA 3CC1A 4JHMA 1ADSA 1JRCA 2QV5A 2QCCA 4E2VA 2OG9A 1N7KA 5JIPA 2WVTA 5HULA 1W8SA 3OQ8A 4JPGA 1A80A 1D3HA 1UZ4A 2PODA 3G1AA 3SCNA 1X6NA 1XUUA 2PCQA 2ZUNA 1JDCA 1QNVA 3OP2A 4KT2A 4QRNA 3MWAA 3ZVIA 2VD8A 3PB0A 1UP3A 2VQUA 3L4ZA 2J8FA 4F3HA 4GLEA 3DYOA 4DNHA 1CGUA 4DYJA 2OQYA 1KM5A 3BGAA 2X0HA 3G0XA 4WGXA 1QDSA 5JBDA 1B4KA 4S2CA 1IR2A 4DO7A 1B3VA 3B05A 4JTLA 1CLKA 5AHIA 1J6PA 3N9SA 2Y62A 2FZDA 3GB6A 3SGGA 3ANUA 4NRSA 3BW2A 3GTIA 1WDRA 2DSWA 2H6RA 3WD3A 3B9DA 1RK5A 3LCIA 1M7JA 3TQKA 3LCFA 4FOUA 2O55A 2Q8ZA 4WF7A 2QDHA 2BHUA 1M04A 5BMWA 2PPGA 3H7RA 4QX4A 3HFYA 1W3NA 4MFDA 1SO5A 3WJXA 4A8IA 1OC6A 1VEMA 4OUEA 3VD9A 1OEPA 1AH0A 2WJDA 3PWIA 3CH0A 3HGOA 3LHYA 1K8CA 4YTRA 3KHDA 2A7NA 4KH2A 5A2AA 3W70A 2HPMA 4N9BA 1LL7A 2FHFA 2QHAA 3EBVA 2P0IA 2PDLA 2QIWA 1W1PA 4LAZA 4MB1A 1H1NA 3L66A 3MKCA 4LX4A 4O0KA 3I3BA 4AFYA 4RNIA 3AZRA 1FH7A 5HAOA 2VR2A 5LIKX 4NZ3A 3RPDA 3FKRA 2MUCA 3R2GA 1E72M 2PU0A 2J24A 2ZZ6A 3B8IA 2YFNA 4I7WA 3DUGA 3IIVA 2R9RA 1XLAA 5DCDA 3O3RA 3H4GA 2X41A 2QQ6A 2OR2A 1CGYA 2ACUA 1HKJA 2R94A 2YSWA 1XGDA 3DX5A 3TTQA 1FWGC 3W37A 4LAUA 2CHNA 2GOKA 5KZEA 2A79A 2FYMA 2POZA 1Y5VA 3RX2A 3VA8A 1Z7AA 4LYPA 5DF0A 9CGTA 2V82A 1EP1A 3M9YA 3QGKC 2GOUA 4LJ3A 4TU1A 2ZXAA 3QZAA 1RJRA 4C6IA 3S0CA 1NFBA 2Y6ZA 1ZLPA 1ML1A 4J9JA 1LYXA 3QMRA 1WCGA 4O11A 1DIKA 1OQFA 1HQTA 2EKGA 3SFKA 4X9YA 2WVSA 1XKYA 2Y85A 1N8IA 4DF0A 3UZWA 3WLJA 2JEPA 4Z1BA 3RCMA 5IBXA 3LQLA 3T0CA 5D2XA 1X8CA 1WBJA 2YDQA 2DUAA 3BE7A 1WX0A 3TYDA 4JTJA 4HU3A 1FP8A 1ZB5A 1UD3A 3P0WA 2WV8A 1LBFA 1UZ1A 2Z4GA 5CJNA 2IKGA 2V5KA 2CLFA 4O14A 1K8XA 3VNKA 4KGJA 2BWGA 1KXTA 4ZL1A 4QE4A 5LNUA 3KL5A 1F3EA 1GVIA 3I3EA 4K1GA 3GY1A 3MV11 4EP8C 3FYYA 4GH3A 3V5FA 2I56A 4CD6A 1R86A 1F6KA 4ZB2A 4K8HA 3W7OA 1VB9A 2UV8G 1R2SA 3CIXA 1H50A 1KTBA 3APGA 3H55A 1H1ZA 3MCNA 3BLDA 2VEIA 1Q7ZA 3MP5A 3CV1A 3P8IA 4WLCA 3CT7A 2H90A 4RR4A 4W86A 4JTHA 4HJWA 4H6RA 1HG3A 3KWSA 3LI0A 1OYAA 1TE6A 3BJSA 1VP5A 3QHNA 4GD0A 1ONWA 1L9WA 3A5FA 3K8MA 3RU6A 2WLZA 1YIXA 1VFSA 2PDPA 3GDRA 4AD0A 2BVDA 2UY2A 3QLDA 2E28A 1H7NA 2Q8XA 2BV9A 3BLPX 3TYUA 1DWIM 1D7KA 3KOXA 3SUUA 4NUWA 2PB1A 4KETA 1S2VA 3VD3A 2VM8A 4QFUA 5HJYA 2WVUA 4CN1A 4H01A 1C7TA 4FLRA 5HUOA 4O1BA 2WPBA 4K36A 1RH9A 1GGOA 3SN0A 3CPRA 2CKSA 2J4GA 2CZFA 4LUSA 3TYAA 2IKJA 4JXCA 4I6VA 4R5EA 4J3WA 1R0MA 2D69A 3LRLA 5KMYA 2E77A 1K3UA 3VCNA 4MIMA 2IPWA 1TTPA 4I9MA 3UWUA 1GOOA 1J18A 5M1TA 4ZVJA 3GWQA 3NQBA 1ME7A 1WDSA 3BG5A 2BP1A 2W63A 4PRTA 1QU4A 1TQJA 4U3AA 2J6XA 4IGMA 4HN4A 3HBLA 1CENA 3OU8A 2PDKA 4S3KA 5CPQA 2CESA 1VF8A 2DY3A 3UWWA 4J3SA 2PDCA 4GXWA 3WG6A 3W6MA 1EJWC 2VZTA 4QG6A 2Y70A 4Q7BA 4W5UA 1BXBA 3PFRA 2X42A 2Z1BA 1KM1A 5FD0A 1OGSA 3UVAA 3QZEA 1G9HA 4AYSA 1RPKA 1SYTA 3R8GA 3MVIA 5D9NA 4B5SA 5HWMA 1BG9A 3S47A 4AAJA 1B3YA 3W2UA 1JQVA 4RW5A 3W1LA 4JYDA 4TQTA 3VNJA 1OADA 5FJUA 3KRSA 8CGTA 2P8CA 1PKMA 5I79A 4X3ZA 1F4HA 3IGSA 4GFSA 4AX7A 1GNXA 3TZFA 3SSJA 2PUZA 2NV9A 5K9DA 3UNDA 1YPFA 3LXBA 1FCUA 3WJZA 1E3XA 1XGZA 4LTSA 3E0WA 3K4AA 3GFYA 1AMYA 3VIJA 1S2TA 2O9TA 4C1NA 2DJLA 1ZJIA 2CC0A 4AWSA 2QIIA 3SJNA 2CLLA 1O66A 4U3CA 1TV4A 4ZO7A 3SQLA 1LUCB 4LYQA 1O7AA 5C2CA 3MSYA 3H54A 3BSMA 1BYDA 3LOTA 3LNMA 2QJNA 4Z2JA 4KGLA 5DEZA 2BGSA 5FF0A 1NWRA 2NSXA 3G1FA 3TA6A 2C3ZA 4LEFA 1XIIA 2WMFA 4GUHA 2DT0A 3IVSA 1FWTA 2QNEA 4Z1YA 3G0UA 4KCVA 5K3VA 2NX3A 3HIJA 4JY8A 3RR1A 3PANA 4WKAA 1CGXA 4WSJA 1G4TA 1GYNA 3GNRA 3L9CA 5CBJA 2DU2A 3RHGA 3DH7A 1DJZA 4P5UA 3M47A 3LY0A 1VYSX 1UBPC 3D0CA 4WSKA 1FDYA 2AL2A 2ZUUA 3U9IA 2C6QA 2HE8A 1JGIA 1RLCL 3GH4A 4Q4KA 2DGAA 2EEXA 1WBHA 5A3HA 1W9DM 2BY2A 4EPDC 3TTEA 3ONCA 3TC3A 1XQLA 5L9FA 1VEPA 4H6KA 1WKYA 3VOFA 3OHIA 4IFRA 1OC5A 4A22A 1LM1A 4AD4A 3LGDA 1V7YA 4MB5A 4MZYA 1EP2A 3N3TA 3VIFA 2FPVA 4JIPA 3HGJA 4L4OA 3TAOA 2PWGA 1EJ7L 2GQ3A 2AQWA 2BHZA 4I3GA 4W5ZA 4LUTA 3BGGA 2H8ZA 3DFYA 1TPDA 1R5YA 3L0GA 3WLOA 1UMYA 3RG6A 1AG1O 1HT6A 3H2CA 4JS3A 4GNVA 4XAPA 4IOTA 3BOFA 3WLNA 3CHDA 2BOFX 4ZENA 4A8RA 2A3AA 1EYWA 2Y5JA 2RJGA 4CD7A 3T0AA 2C14A 3XIMA 3B8VA 4AY8A 2FB3A 1D7FA 4DRSA 1Q6RA 4GVHA 3NO1A 4DUWA 5AC7A 1OVDA 3IRDA 3LU2A 4GIRA 3R58A 5RUBA 1H61A 4DPQA 1OFPA 3NZGA 4DI8A 5I07A 3M43A 1BYBA 4JHOA 4KQNA 1V79A 4S38A 1SZEA 4IIDA 2H8XA 3GVGA 1HF6A 2A1YA 1H7XA 3WX7A 1UOZA 1W3LA 3O9NA 4BQ4A 3O07A 4A21A 2ZIDA 3MYPA 1IGSA 4JDBA 3ISIX 1TSIA 1W3KA 1LJYA 2HJPA 2VR5A 4CD8A 2Y4SA 1CLXA 4IJRA 1VD6A 1MEHA 4DJED 1DE5A 3RK8A 4XZLX 2AAMA 4MJMA 3THDA 3L23A 3MU7A 2X1UA 4PCSA 1N8FA 4TV5A 4AEEA 4AG0A 3SUSA 2QLYA 3IUIA 1PO9A 1QO2A 4NZ5A 4F0KA 2W3ZA 4O19A 3ARZA 3WUFA 5I3JA 1QPKA 3T0DA 4AHQA 4GX9A 3T2QA 3CU2A 4US6A 4B15A 3RO6A 3N9KA 5XIAA 3T08A 3GG0A 1A5AA 5K4ZA 2QAPA 1UD8A 4HPGA 4RK8A 3WD4A 4O52A 3TJIA 3LV5A 4WJ8A 1OINA 4L64A 1UJPA 2XFYA 1XINA 4ZXOA 3ZMRA 3KCOA 1NSJA 1IR1A 1JNEA 3HG3A 2E0PA 1UWUA 4JICA 2ZA1A 4MVAA 3AXXA 4HSOA 3H24A 4D9PA 4F0LA 2GVLA 3MJMA 3R4IA 3CBWA 1L2UA 4QAIA 2F7FA 3WEMA 1V7AA 2Z1SA 3B8UA 3UBPC 4ZOAA 3VCRA 1W1TA 3TR9A 4EF8A 3IJ9A 3MO7A 1XH1A 1JRBA 4NXSA 3U2OA 4AF0B 3BLFA 3RRXA 5M3WA 3DECA 5C6MA 3SGUA 4B3ZA 1M3UA 4F0MA 4ZCWA 2PDJA 3EPOA 2OZ0A 5DT5A 3CL8A 1ECEA 4IZGA 4A4AA 2PZ0A 4ZSTA 2YOCA 4M51A 1XBXA 3EPMA 1I4NA 1CXHA 1O6IA 2ZRWA 3IGHX 3NEVA 5HWJA 3AS3A 4LBUA 4GZJA 2FPTA 5FJOA 5HMFA 4RE0A 3D5HA 1HO4A 4R7OA 4AMAA 4LC6A 4MKNA 4IX0A 3PTQA 3W73A 1E56A 2DEPA 4IPJA 2ZRYA 3AIWA 4PH6A 1EGVA 1KBLA 1B90A 4INFA 4XZWA 3E0VA 1H4PA 3BPWA 3LPFA 1M5WA 3UWEA 1LRNA 1CIUA 4HZ7A 4KBXA 4IWWA 1K02A 1VYRA 4LEQA 4LVFA 1SW0A 4LNCA 1W1A1 5I2UA 3AHVA 3RITA 4AD1A 4LUJA 4JIIX 4OOZA 3TAKA 2GSJA 1R3YA 4FX8A 3ZVHA 4GQRA 1W5MA 3B0UX 1E55A 2ABAA 2YDRA 3W6LA 3QV7A 3LMZA 2X05A 3LM7A 5HMDA 4PMDA 1GTEA 3WELA 3GXFA 5AC6A 2PD9A 3ITXA 4KEVA 3VK5A 3HA1A 2NUYA 3MUIA 2RH9A 1U2YA 4ILSA 1TTQA 4IICA 4I5RA 3SCQA 3DN5A 4OUIA 2HNEA 3GG7A 1UH3A 3VUPA 5EY5A 3KOFA 3PPHA 1CX9A 4Y6GA 1XSKA 3I6RA 3PAOA 1UUOA 1U33A 4L6DA 2GGJA 1C7SA 1O60A 1AK5A 3EA2A 3R5EA 3W6YA 1SW3A 3CJPA 1TUFA 1UR8A 3N6JA 4QG8A 3K1GA 1PZ0A 1TCDA 3PJUA 4NQ1A 2ADAA 4F48A 1YYAA 4PZVA 4PGLA 1Q85A 3EX3A 1M53A 4OBTA 1LG1A 1BGGA 1JPKA 3S6DA 3P74A 4QHRA 4WQ6A 1JDAA 1J79A 2QCFA 1GQJA 3W1MA 1SSDA 4MF4A 3B0PA 1CWYA 4B9YA 3GIYA 3AHXA 4FHAA 4X0NA 2Y5EA 2Z6IA 3QV6A 3LZ3A 4WGHA 2Y7DA 2EGZA 2QUUA 3DU0A 3VU2A 1TJRA 4TTGA 1EA0A 5I3IA 4PCTA 4GIEA 4RZ5A 4C60A 2DH2A 1OCQA 3W7QA 1UYQA 3B97A 4AIEA 2ZCGA 5T91A 3H12A 2ZQ0A 7PTDA 4EAMA 1F3XA 3DG7A 3O63A 3EWCA 2FDSA 4NAEB 1YLVA 1ZL1A 4XD3A 2IUZA 1DJGA 1HL8A 4HMEA 4E6MA 5A5WA 4H2HA 1QTWA 4RJEA 2E67A 3NUKA 3CL6A 4LCSA 1AQHA 4EPEC 3TV8A 1XBVA 4CKQA 4JTUA 2DSZA 2ZZ4A 1RCQA 3HQNA 1W56A 1KA9F 4W4QA 1XCWA 1ADOA 3QJAA 1N82A 3LEPA 5CC6A 4LU0A 4C91A 4KFPA 2V2HA 7TAAA 1Q13A 3N15A 1WDQA 1XWYA 2TODA 3QHOA 1R7OA 1JEZA 5AYXA 2R8WA 2VQTA 1UQYA 1LBMA 1KBKA 3MSRA 2XDFA 4HNTA 3GM8A 4F79A 4PUWA 2Z1WA 3VKBA 3LTPA 4IGNA 3ZLFA 5AC4A 4IH3A 4HB7A 3NR0A 3EYPA 5LXXA 2DZVA 2VZSA 4UTFA 2WQDA 3O2LA 1R3RA 1T8QA 3SAZA 2V81A 2VCAA 3LHZA 2OO6A 3FJLA 1KR0A 1I75A 2YCEA 3UA4A 3F4CA 3WENA 4OBSA 1F05A 1TTIA 1SJBA 2DUZA 3PF3A 3T0BA 1VBRA 3U3HA 2V8ZA 1XS2A 3CWOX 3BV7A 1ISVA 1WO2A 2J47A 3VE9A 4WHBA 2DSVA 4ML9A 4B5NA 2XU2A 4XD5A 4ZMGA 5C9WA 2YGYA 3W88A 4UMBA 1UBSA 4IIEA 5E09A 1IIGA 3KUMA 2I9UA 2VMFA 1XLJA 3ORWA 1D9EA 1XRTA 3GYEA 4P7OA 2FHBA 4ZQRA 1RD5A 1XSIA 4LVAA 2TSYA 1A5CA 4BS0A 3RNDA 1EO7A 2H3DA 1C92A 1V02E 1JIBA 4PMQA 2HVMA 1KBIA 4D71A 1KM6A 3S2MA 3S1WA 3WNLA 2I5IA 4YTSA 5J5RA 1MZHA 3UR5A 1JR1A 3WMLA 5HK4A 3LHVA 1P6WA 4CQBA 1FWIC 2GDUA 1WUEA 4GJJA 4UNKA 4IISA 2WQPA 3QR3A 5IRPA 2CZ5A 1K7EA 4XUYA 3B9AA 4GUGA 5G1MA 3AISA 4P8WA 3S46A 1JFHA 2E6YA 5AHMA 4W87A 3GC5A 2QULA 5A69A 1H51A 2Z2UA 3WF4A 1MVYA 4W8BA 4M7SA 1WP6A 1Q7QA 2Q6ZA 1FFRA 3NQVA 4L61A 3AAMA 3KW3A 4H9XA 1W17A 3RLHA 2CHOA 4DIAA 2BG5A 5LIWX 1H1YA 3PK7A 5LA0A 2VFIA 1DXIA 5KTLA 2Z27A 1EHAA 3W0KA 3N11A 3WEZA 3U5UA 3L0KA 5HBFA 1PS9A 4OTKA 3KBWA 3VKJA 3F4NA 1E70M 4MLRA 4DLMA 2RUSA 3FY1A 3SY5A 4F0HA 3PZIA 3H2AA 3GNNA 3AMLA 1A4LA 2PWUA 2I7GA 4O10A 2EPMX 1UUMA 3V5CA 3KXQA 3BSHA 4IUOA 4H9UA 2ZUVA 4ECLA 1JYVA 3IIZA 5G4HC 4QNWA 3UA3A 4FEZA 4UTJA 3EDFA 1DEDA 1R3TA 3O6DA 1JYXA 1CDGA 2BASA 3NZRA 5LZLA 3B8WA 3ARRA 3ZLHA 1ITQA 3DFNA 4NZ1A 2ACQA 2ZA2A 4HSHA 3G1VA 1OGBA 4OT7A 1SO6A 1T41A 3MMWA 3H8AA 4PUUA 2X1IA 2E4TA 2IPJA 3O6CA 2DPEA 1I1WA 4JX6A 3V16A 2WO5A 4KW2A 4QDWA 2GGGA 4R7WA 3STPA 4DWSA 3DENA 4RV3A 3IJLA 4US5A 1RA0A 5D8ZA 2VDIA 1B9ZA 2I57A 3H21A 4LBRA 1W1ZA 3WBEA 4C6OA 5ABFB 1VBHA 2DQXA 1H62A 2ZX8A 2TMDA 3L5LA 1QPQA 3BMXA 3SADA 2QCNA 3MUY1 4ZFMA 4MUPA 1QI0A 1PAMA 1K6WA 4JDYA 2JEQA 3WD2A 3UJSA 3AUJA 4S23A 2VZOA 4M6VA 3ZJ6A 3S6OA 1ZJBA 1UKQA 1TA3A 3BZGA 3LPPA 4RZBA 5A8QA 2VC5A 4M29A 4NI3A 2NQ9A 3OOQA 4XVEA 3L4TA 1YRRA 1JPMA 5F2MA 5AC8A 4UCGA 4D6CA 1L6SA 3M5ZA 1BQGA 3E0LA 3TSMA 3LZ5A 4IIHA 3KBVA 1E9LA 3PC0A 4FNPA 4Y8FA 4E8CA 2EJAA 4GYPA 1KRCC 3VPLA 4Z1CA 1QAPA 2IXVA 5DMLA 1HKWA 4UTTA 1E4NA 1LT7A 2Z6JA 3G3MA 1SU5A 2XSAA 4UUIA 1GORA 2YDSA 4FPSA 4LUYA 4O16A 2FZNA 1OCBA 2QPXA 1AMKA 3VIKA 1A47A 3I3DA 5BROA 1PKLA 4XSLA 2VCBA 4B3LA 1Q7MA 4NJHA 5EB8A 1A3WA 4A3UA 3APYA 4X22A 3TN5A 4AVOA 5D8WA 1I1XA 2B7QA 3P7YA 3OVPA 1MW2A 4PB4A 2B7OA 1RSCA 5EGRA 4JN6A 4JCLA 4EACA 2D2GA 5CJMA 1S5TA 1X38A 4OECA 2XFFA 5E0KA 4UMCA 1QPNA 5A6JA 1TB3A 2QUNA 5AVHA 3W75A 3PTMA 4L4PA 1IXQA 2J62A 3E5BA 3UWQA 1Q5MA 4LALA 5CLTA 3FYOA 2GJNA 1CXFA 3TZNA 2ATSA 1ONXA 3GW3A 1EWEA 2FQIA 7XIMA 3QOKA 1PWMA 4UTUA 3VFCA 4N4PA 1NU5A 5GPRA 2ICSA 1HJVA 3DFOA 3BGJA 1R2RA 1JGMA 3CYVA 3GG8A 1KFWA 1Y7VA 4GY0A 2GK1A 4DLFA 3BLEA 5C9ZA 4GUFA 1BVZA 3EPNA 1O5RA 3QC3A 1XV8A 2IPGA 5D4YA 1HUVA 3BCJA 1G7VA 1IGWA 4BK9A 1Z89A 2PWEA 1OWQA 4JTGA 3JVAA 2ASHA 5AB3A 3DAQA 3LCXA 3M0HA 3W23A 3E6EA 1KW1A 3ATZA 3UWVA 4JTEA 1LLWA 1W9BM 3BICA 3LHTA 5AYZA 4BWLC 1K9EA 4H8VA 4QXIA 1TUXA 3CO4A 2WCAA 2ZTJA 5I7GA 4DWSC 5D32A 1UA3A 1XFCA 1XG3A 2J7EA 2DIEA 5M17A 3QTPA 4K68A 3OVGA 3BLKA 1UPMB 1H5VA 4BF9A 4O8AA 3KOWA 4BJHA 5DXYA 2GWNA 3EOLA 1GCYA 1TKKA 4NP7A 5LNWA 1V6TA 1XH0A 3CQKA 2X2GA 2G96A 3JZEA 4G2DA 3W2JA 1OD8A 1KWGA 3CHFA 1PKYA 3DBPA 3JZUA 3WUGA 2CHRA 5FF4A 3R79A 3TROA 2FGLA 3FSUA 2Y8KA 3TMLA 1LTDA 4KWUA 3ELFA 1TIMA 4POCA 2GJXB 3EX2A 1OFQA 3HJEA 2D20A 3W22A 7REQA 4Q3MA 4DN1A 1OD0A 3GU9A 1JF5A 1BKHA 3TW6A 5EMUA 3C3NA 3POCA 3W71A 1M65A 1HJUA 4B91A 2CZVA 4MNJA 4UNLA 4GY1A 1GEQA 4L4LA 2VUYA 3W2LA 5J04A 1OIFA 1OX5A 5AHFA 1E4MM 4RPQA 4UWMA 2WNQA 4NAFB 1UR9A 4Y8EA 5GNYA 4QNEA 3PFMA 3W9ZA 3NJ3A 2ANUA 2WSKA 3NPXA 4LSBA 1S46A 2PTWA 2QMKA 4PBGA 1RVKA 5BXRA 3EA1A 2UZ9A 2NWSA 4TVDA 2PZNA 3JS3A 1VBGA 3ARYA 4Q22A 4P7NA 3M0VA 4QJ3B 4QLJA 2ON3A 4Y90A 2NX9A 4JFWA 3E0FA 2R24A 2XN1A 1PZ1A 3NEHA 1OCNA 4P61A 4FR1A 3UPMA 1PX3A 1EEPA 4PMJA 3W1UA 3QLLA 2P76A 4O54A 2A3HA 4PTNA 4DUVA 3AQUA 3PBGA 3DZ1A 2E1WA 3LCLA 3MI2A 3C6CA 1EX5A 4H8UA 3TXVA 1K9TA 3PTDA 4G56A 4YVXA 3MZNA 3W29A 3E74A 1BKSA 5CZSA 5CAHA 1HW6A 3T42A 3HTWA 5T26A 3K30A 3PJTA 1HJWA 3U57A 4BQ2A 2NVDA 5C7HA 3PUOA 4FLSA 4UQAA 3BZJA 3VOJA 3QXBA 1ZBVA 3R0KA 1WXYA 3KP1A 2ABBA 2RGMA 1ICQA 4DVOA 3H2NA 4Y2WA 3A5VA 1IWAA 5IFPA 1EC7A 1JZ4A 1Q45A 2C71A 1TJPA 1H7PA 1XLBA 3GVVA 3AIUA 3OQEA 1BYAA 3FA3A 3F03K 5E0CA 1DV7A 3AXIA 4GACA 5G2IA 3A22A 2Y63A 4MAVA 2ZADA 2ZBTA 2V2DA 3DKJA 3N2BA 4C6EA 4CCDA 8XIMA 3DFSA 3SCRA 3VIGA 3O16A 3S1UA 3W2MA 2PDYA 3VE7A 1TWZA 4O50A 1MW0A 4GQ0A 3QY8A 4NL1A 3FAXA 1WAWA 3AMDA 5FJPA 3LYEA 1E43A 1UZHA 4NJIA 3TCEA 3H53A 1OZMA 4XUGA 3B03A 5HNTA 5I24A 5AOUA 3RGTA 3AS2A 3W1RA 4L80A 1HL2A 1LZOA 1PTDA 4AZCB 1UH2A 4YMZA 4B5VA 3M44A 4GRSA 4CNUA 1EDQA 4PC8A 4GC3A 2BVWA 4AXKA 3WO8A 3EX4A 5D2YA 3QKZA 1V3IA 3LDVA 4I90A 5DBTA 3P81A 1BXCA 1RA5A 1KBJA 3E49A 1EDTA 3NL5A 2ACRA 3LUTA 3ZR5A 1FDZA 2IPFA 3VZZA 4LF2A 4H04A 1J12A 1GEHA 2Q3OA 4M6UA 3TJLA 2DZXA 1TPB1 4AZHA 2WMJA 3RX3A 4GE8A 1OCJA 3N2OA 3SRKA 1MNSA 1A0CA 2X16A 3N18A 1NM9A 3TSBA 2G8ZA 5CGQA 2C0HA 1EDGA 3DHUA 3QW3A 4RDZA 1AJZA 3PZGA 2WSRA 3AU6A 3S1VA 3K5XA 3O8AA 1UD2A 3IJDA 1SQ7A 2J9YA 1BWVA 1DJNA 1MO0A 3NG3A 5C54A 3QBUA 3WF0A 4LRSA 3C0QA 1TPWA 3SIZA 1X1ZA 1Q6FA 1E3ZA 5TNVA 2FZ8A 3GTFA 3TH6A 3M6YA 3C2FA 1CW2A 4IXXA 2IQDA 5EKYA 4WK9A 5FEZA 1MDLA 1ZHAA 1UKOA 3QQ1A 4O0QA 2NV2A 2V2CA 2IW0A 2WHJA 3B9OA 4KIEA 1E15A 4H7CA 4B90A 3MDUA 1E0TA 1ZQ5A 3ECQA 3NL6A 1M68A 1KTCA 4NY2A 1CLVA 1Z42A 4PODA 3KLKA 2OZ8A 3CAWA 1GG0A 2J7GA 1OSEA 4C6NA 4C6JA 3PPFA 4J35A 1WOAA 5C9UA 1SJDA 2PEVA 2JK2A 4Z2KA 3VAVA 2I14A 3FW6A 5HQEA 2PWDA 4CVUA 4ZTXA 1U83A 1BD0A 1PDYA 1QRQA 2AKMA 4HA0A 3ITYA 3Q2DA 3CLWA 5IXEA 5KITA 3VKDA 1DXEA 4D8ZA 3BCFA 1Z6KA 4YS1A 1S1RA 1C91A 3PPCA 1EBHA 4S3BA 1VGAA 3ZS4A 5A6LA 3EWDA 3IIOA 4C6DA 5LNVA 3AS0A 3DKLA 4V33A 4DJDC 1KGWA 1ISXA 3R6IA 3AXMA 1W9VA 4MB4A 4ENLA 3CZGA 1TR1A 3QFEA 3T2OA 4UTKA 2WXDM 1KQYA 1MYRA 1IIHA 3ZOAA 1GZJA 2WAGA 2I5GA 5CKSA 1YNQA 1T0OA 2V3EA 1VBUA 3R10A 2R82A 3DFTA 1KO0A 4ICMA 3W2NA 1ZBKA 3SBFA 1TJ2A 3D6NA 4DF2A 1PTGA 2DZAA 2IMRA 4EPBC 2BZNA 4MY9A 2O9PA 1QWGA 1TVLA 3T8QA 4NT0A 5EMMA 3PHAA 3EX1A 2WNWA 5FESA 4UFMA 4PSRA 3KHJA 3SJ3A 2YKKA 5DQPA 4CQCA 2DJXA 1XLCA 1A5MC 1ECQA 1QPOA 5HNNA 2QKFA 3HU7A 2Y7EA 3VILA 1Q66A 4IJCA 1K8ZA 1W5OA 3IK4A 3WNKA 5BRQA 2W61A 4FO4A 2AQVA 3DFQA 3DC0A 3K8KA 4NX0A 1E1EA 4Y96A 4LY4A 5EMYA 2C8NA 5F2IA 1QNPA 1JI1A 3ZT5A 2ZWYA 1YDVA 3URBA 5JMUA 1PYFA 4QEHA 3BCDA 1CBGA 1KKRA 1W32A 1UR3M 5AN7A 2Y0FA 1PWLA 1ZGDA 2R1MA 3VINA 1MQQA 2DDXA 1RK6A 2KAUC 4HP5A 1ZALA 3NOYA 5BRPA 1VLWA 1TREA 4QQUA 1X1NA 4GI9A 3TW9A 3KVLA 3NWRA 2QCMA 2WOQA 1GJUA 1HKIA 1M9HA 2A0NA 4YVVA 2XM2A 4DJFA 3LLFA 3OPSA 1O1ZA 2BS9A 1V3MA 3AU2A 3WEOA 4L65A 4GFIA 4FA3A 1XLLA 2WVVB 4DXKA 1UWRA 5CGMA 8TIMA 4J4KA 1V6XA 4PUNA 3FIGA 3PBUA 5E6YA 2J78A 3GDTA 4W8AA 4PB3A 1HVQA 2DP3A 3B8TA 4JIRA 4K38A 4RPPA 3SRDA 3CZLA 1HFBA 1LUCA 3K4DA 1DJIA 2WNNA 3VTRA 2QW5A 1J0YA 5CPSA 3GBEA 3F7JA 2WMIA 4IPPA 4JTSA 2WB5A 4QEEA 1RQEA 3OO2A 1FWHC 3U5YA 1BYCA 4HA4A 4JY9A 5FKYA 3UY7A 1QI5A 3LXCA 1UWSA 1DQUA 4M1BA 5IFTA 4XIAA 2H9AB 3ZQ9A 3K1DA 4KEUA 2R1NA 2CETA 4TTUA 1LOQA 3G2GA 4UCFA 4N42A 4JR5A 5DXXA 2D0GA 4RDWA 3AFBA 1PIGA 1B1YA 2GUBA 3ABOA 3B4YA 3L0NA 1LL6A 4IQLA 4ZQCA 4WRHA 3W24A 4FMVA 4F0SA 4FAMA 4PRWA 3AOFA 4TVCA 3EWWA 4W89A 1P0EA 3M0JA 3ANVA 3CNYA 1H5YA 1AODA 3FK4A 4FIRA 2WYSA 1C8VA 3RLUA 4XKMA 2ZTKA 3EWZA 1POKA 1NDYA 1GOKA 3R0UA 5ABGA 2VGGA 5ENLA 1I8JA 1E6ZA 1PTAA 2YCKX 4MGGA 1W54A 4Q8NA 3VUSA 2V3GA 1Y0EA 4G7EB 2ZXQA 1MUCA 4GNJA 3GIQA 3BXWA 6XIAA 3FJNA 3TTOA 3HV8A 4ZTYA 3M7WA 3WIJA 1BGAA 4H3DA 1ZY9A 4JFVA 4QDPA 4AWEA 5XIMA 5I3GA 1XP3A 3LN3A 2V5JA 3OTRA 2GFTA 1S5MA 2GSHA 5I3FA 5C7VA 1NVMA 1G4EA 1Z44A 2GVYA 3ICJA 2CERA 2PDBA 5EMJA 1JXJA 2HWGA 4JIHA 4UC5A 4HKPA 1ZAIA 3WH8A 3CHEA 2D2OA 4CNTA 1LQAA 3WQCA 1A5BA 3U2ZA 1XIEA 2JQXA 3QEZA 3SCVA 2J6VA 2VENA 4YWSA 2VRQA 3FA5A 1RP9A 3VX0A 3O6YX 3D46A 4Q32A 1IYXA 4ZR8A 4K6AA 1DQWA 5JUVA 1RP8A 3BC9A 4U33A 2ISDA 3N4AA 3WD1A 4Z1AA 1YXYA 3AYSA 2A2IA 2WC3A 1ZBWA 4CUCA 1XLKA 3W7LA 3GAKA 1GT8A 4LAKA 1EXPA 4FLOA 1FKWA 4MDOA 1A5KC 4XWUA 4A3QA 1AFSA 4DO5A 1SFTA 3W85A 1JG9A 3AC0A 3G0SA 5EMKA 3V3WA 5LA1A 4LOCA 1J2BA 3C2VA 2NV1A 1X7IA 4AVFA 3ARSA 2WSYA 5B7YA 2J27A 1ZS2A 1R9YA 2BTMA 2OODA 1RY0A 4GCXA 1FWAC 4GVIA 3LBMA 1W1YA 5BWAA 1VKFA 1W0MA 4AHPA 2GQAA 3FV9A 3OBKA 4AYGA 1LWJA 2BGQA 4MJ2A 4CD4A 5HPCA 5B80A 1G6CA 1GVOA 1EO5A 1TMHA 3KDOA 1ZENA 5A6SA 1XC6A 3CZEA 1FWFC 3STCA 2QCGA 4I9TA 4UQ9A 2V3DA 3PR2A 4U2YA 2EQDA 3W1XA 4HN8A 3MUZ1 1UD4A 2NLIA 2O92A 4FALA 3SUWA 3UJ2A 4YYCA 1PB0A 1DTNA 1CXLA 4LXFA 3AJXA 2B7NA 3GD6A 2W9MA 4L5ZA 4GYFA 1MI3A 2R14A 3GRIA 4FI4A 1A5UA 3RAOA 4C6MA 3T8LA 1XR2A 5CBIA 2TRSA 4HNCA 3MPGA 1JD7A 3WBAA 5LIUX 3MANA 4GZ7A 4CEUC 3THQA 3W25A 4ZGYA 4AF0A 1JUKA 4Q8OA 2X09A 1V0KA 4NZFA 3CHVA 4BR1A 3RX4A 1MNZA 4LUIA 3HQ1A 3G1XA 2GVJA 1A0EA 4Q7IA 2E9LA 3WQEA 3PNZA 2JIEA 3GSMA 4LGXA 1KRMA 2HK1A 3HJZA 1Q6OA 5G2WA 1UZDA 2POTA 1UPPA 4QIUA 3TUUA 4HHLA 1TA3B 1NY1A 4JFSA 4FR6A 1REQB 4HIBA 3UY8A 1PHQA 1CI1A 4C6LA 3H7UA 3TSDA 3W00A 3FDGA 4DM1A 4ZQPA 2F6KA 1J0KA 2AMXA 2J7DA 1HX0A 3L4VA 3S6TA 1UWIA 4GINA 1NFGA 1XLGA 2QS8A 3SW6A 4KWOA 3HOJA 2ZZ7A 1S3TC 5C2GA 1QPRA 4K7YA 4KERA 3VDCA 1RBOB 3NNTA 3PTKA 1FTXA 1MZRA 2YL5A 3PPGA 5DELA 1ZFJA 3ANYA 4P7QA 2HNHA 4XKYA 4F2TA 3ME3A 3ABSA 5H1WA 1JCNA 1LQ2A 4JTDA 4X61A 1GG1A 3GZ3A 3BH4A 3LLDA 1SZNA 1JPDX 3KFTA 4ZB5A 1U1UA 3WQGA 1CYGA 1US2A 3M64A 3GDLA 1SO4A 3W81A 4QE5A 5I0DA 2OTDA 3U4AA 3GTHA 4J1OA 2WZTA 2CLHA 4LYRA 1JCTA 1DQXA 5IDZA 3OIXA 2WANA 2ZRUA 4AY1A 1P5BA 1V5XA 3GYCA 4V1YA 1E5JA