5M17A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-1,2-dideoxymannose
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
349
Chain Sequence
b'NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
total genus 133
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m17A00
2BV9A 2XHYA 2VMFA 1HVXA 2CEQA 4ATWA 3CTTA 1VF8A 3CHEA 4PSRA 1NOUA 2WPGA 3GNPA 4DUWA 2W91A 4UOJA 4GZIA 1R86A 5FD0A 1MFUA 3CO4A 1GJUA 4OJYA 1HKMA 2UY4A 3RJXA 2XWEA 3BC9A 1C8YA 2XJ7A 1JD9A 3BLKA 1DTUA 4F66A 4AEEA 5A6KA 4QCEA 2WMJA 3RILA 4HA3A 4QLJA 2WK2A 2DH3A 2E8YA 2YLAA 4AY1A 3KL3A 1B3YA 3PHAA 1V0LA 3SCPA 1HKIA 3DYOA 1X1NA 2WZHA 1NP0A 1E3XA 4LX4A 3AXXA 4FLQA 3BAIA 4U33A 2D20A 4W85A 6TAAA 3A6OA 3WD1A 3BAYA 1HJXA 2VX7A 1JNDA 5A94A 2ZXDA 4KGLA 1VFMA 4PCTA 1QBAA 1UZ1A 2YA1A 2UY5A 2BY3A 3T08A 2E3ZA 3WL1A 2OWXA 3S6TA 3LPFA 1GOQA 3OLDA 3PN8A 1UWIA 1NWUA 3AICA 2V5CA 2ZXAA 3UCQA 3L4WA 1ZBWA 1DWGM 4CCEA 1V3IA 5HOSA 3ZJ8A 3MSDA 3SUVA 5CPTA 3OBAA 2DIEA 1VBUA 4N42A 1GPFA 2CBIA 3N9KA 4KGJA 4M1RA 3WEOA 1MW0A 4UQDA 4P7LA 4TUFA 4JKKA 3ARVA 1ZBKA 1KFWA 4ATDA 3ARQA 3POHA 5CSYA 2BVYA 2O9TA 1RP8A 3CUIA 5BRQA 4CU6A 5GQBA 2ZX5A 1E4LA 3TTSA 2XVLA 3G6LA 2FH6A 4WSJA 2D0GA 3MSGA 4AWEA 2ZX7A 1S46A 3W29A 1JZ4A 4PTMA 3WELA 3ZR5A 3MUZ1 3ZR6A 4W5UA 4Z2GA 1E6SM 3UERA 1W3JA 1KXHA 3VO0A 1FH9A 1GHSA 1XH0A 2UY2A 1JFHA 3AMKA 1JZ3A 1JYVA 4BCEA 2EEXA 4TX8A 3PZNA 4B15A 4C7DA 5M3WA 3BGAA 2J7DA 3U7VA 4B16A 5M03A 3I3BA 2D22A 5TD4A 2V5DA 2HISA 3SCQA 1JIBA 4A3YA 2D0FA 5DT5A 1KB3A 4V2XA 2GK1B 1HJWA 4BQ5A 1R8LA 3OLEA 5ABGA 3VDAA 1JAKA 4W84A 4Q22A 4NI3A 3AISA 3BCDA 4AD4A 1E0XA 1M01A 2J7BA 1TA3A 1AVAA 5E6YA 2WCGA 4FF5A 1IV8A 4AIOA 1TMQA 4AW7A 5I3DA 4D6DA 4AZGA 3AHZA 4W86A 1ZJBA 2A3EA 1MVYA 3NYDA 5CSUA 3MV01 1VFUA 2VZOA 2D3LA 5BXPA 2GJRA 3SUSA 1Z32X 1UH3A 2EPKX 5CPSA 5I23A 1U2YA 3WQ5A 1JZ8A 1BF2A 1CEOA 4CCDA 2DDXA 1FH7A 1B9ZA 1US2A 1E6NA 1JZ2A 4BA0A 1FP9A 3VIFA 4ZFMA 1GOIA 3MMUA 1CZ1A 1JL8A 4AZ5A 2DT3A 1J0IA 1CGYA 2E9BA 1TFVA 3FAXA 4M56A 5DMYA 2W66A 3FNDA 3OA5A 3PZUA 4W89A 3CUJA 4U2ZA 4OBRA 4ZXLA 2JEQA 4A3HA 3A47A 4QLLA 4F79A 4H8UA 3W6MA 2ZUMA 5BWFA 2BY2A 4HA4A 4WLCA 5ABFA 3WH8A 1FFQA 4LXFA 1X6NA 3A4WA 4K68A 3KWXA 2EBNA 3VD4A 2J79A 2DSVA 1BPLB 3CPUA 1W1VA 1QNSA 4RE4A 1WP6A 1V0NA 1E40A 2Y8KA 1M7XA 2IXVA 1ZJAA 1TCMA 4UCFA 2FDMA 5I5RA 1AMYA 1EDQA 4Z2JA 1VFFA 3UG3A 1FFRA 2ZX8A 4GQQA 5KZ6A 5E6ZA 4HU8A 3PTKA 3E1F1 5EBAA 5IFTA 4V27A 2WC3A 2VZSA 4W8BA 2PC8A 5KEZA 1UA3A 2NW0A 1PX4A 1GOMA 1NWRA 4PMQA 1JYWA 3EDJA 4URIA 4RE3A 2MANA 3VIJA 4CN6A 2VURA 3VDHA 1GQLA 4MB1A 1PX8A 1KCLA 2VNCA 1ISZA 1JI2A 5A1AA 3CZLA 4V28A 1UR8A 2X09A 4RL3A 3VGGA 1KCKA 1NARA 1J0HA 5BXSA 1SMDA 5EFFA 4AZHA 1V6YA 1NP2A 3WY1A 4R27A 1VBRA 1CNVA 3CZ8A 4YHGA 5HPCA 1BVZA 3BAJA 3W4RA 3SCTA 2J7CA 1EXPA 3ZOAA 4PN2A 1FHLA 3I3EA 1DWFM 2W5FA 4MADA 3VVGA 4ZXOA 5I6SA 1JDCA 4FLRA 3VD7A 2ZICA 3CLWA 1BGAA 4CCCA 2VZVA 1J0YA 2VRJA 3AI0A 1BG9A 3WMBA 3AHYA 1CXIA 2F2HA 1NWTA 2XM1A 3T2QA 1TUXA 1DHKA 2CYGA 4X0VA 2Y4SA 1E15A 1E43A 2OWWA 4AD2A 3VGBA 3AIVA 2VQTA 3W25A 3L4UA 3GH4A 4MNKA 4M80A 5I77A 1EA9C 3AHTA 5I24A 3VINA 1B3XA 3ZIZA 4DUXA 3T2OA 1CPUA 1XV8A 4XB3A 4MNJA 3AIRA 4P7QA 3BAXA 2PWHA 2WVVA 1V6WA 3AS2A 3CUGA 1BHGA 3ARZA 1WZAA 4TOQA 3BMVA 1KGXA 2BY0A 4HZ7A 4J3SA 1GOKA 5JBEA 3WNMA 4AC1X 2RGMA 4MB4A 2VCCA 2J78A 1QNOA 3U57A 4Z2KA 1OD8A 4UQEA 1WDQA 3K8LA 4YHEA 5E9AA 3VNYA 5FKYA 1UOKA 5JBDA 3N11A 1E73M 3GM8A 3FY1A 2QPSA 1TVNA 1GQIA 3DYMA 1WNOA 2NT0A 1CXKA 5IHRA 4IPLA 3PZOA 5DF0A 5I2UA 3THCA 2DSUA 4E8DA 2WM0A 4DWSB 2QMKA 1V0MA 2X0HA 2WC4A 3AJ7A 1OGBA 4M82A 1SMAA 1WKYA 1VFOA 1XD0A 3EMCA 3IK2A 4BQ3A 1LG1A 2Y5EA 2CPUA 4TTUA 1J10A 4GPNA 3APGA 1JAEA 2G3MA 3VIOA 2VRQA 2WSPA 4CVUA 2J25A 1OSEA 1XCWA 1H0IA 1ISXA 1FH8A 1ZS2A 3HU7A 4HOWA 3VIHA 5JIWA 4AD5A 2OYMA 4XV0A 1UA7A 4OUEA 1MQPA 5DT7A 1E6RA 1SR0A 4UFKA 1J9YA 5A6SA 5C8BB 6A3HA 2WWCA 1RPKA 3SUTA 1BG4A 4EE9A 1JZ7A 2OSXA 5E0CA 3WL0A 4D6JA 4JKMA 2J4GA 1W2VA 3J7HA 2WLYA 5A6JA 2YBUA 4JIEA 2TAAA 4IPNB 3S2CA 1CGTA 1AQMA 2O9RA 3UESA 3W26A 1HN1A 4ACZA 5A2BA 1KXVA 4HP5A 3FHAA 1D7FA 4W93A 5GPRA 3AS0A 3AIUA 3VM5A 3W81A 1UKPA 3HN3A 3WNNA 1G94A 3OGVA 1HJQA 1V3LA 4CD6A 2YIHA 2E0PA 2BXZA 3ZJ7A 1HNYA 4JHZA 2E40A 4L4PA 2CESA 3G6MA 2CBVA 4UFLA 3EBVA 1PIFA 1GOWA 1B3VA 1BVNP 3CHDA 1H4PA 4AZBA 2CNCA 3WDHA 1OWQA 4AZCA 4PBGA 5D8WA 1UHVA 3SURA 2JF6A 4PMDA 3VNZA 3WKZA 4JKLA 5CXPA 2WXDM 3B9EA 3T0BA 1WDRA 1E1FA 4H04A 1KQZA 1MW1A 3AIEA 5LA2A 3AHVA 2BY1A 2VO5A 1W1PA 1XGZA 3WF2A 1C92A 2XFFA 2BHZA 2AMGA 1OBAA 3K8KA 4M24A 3GXFA 1U33A 1Y7VA 2XUCA 4GO9A 2IXUA 3MS8A 3PZVA 4KRUA 4J3VA 2FHFA 3BLPX 3CHCA 2OYLA 4ZE4A 1TVPA 2V3EA 2EJ1A 3AMLA 3WBAA 1UD4A 1L8NA 1VEMA 4JCMA 1ODZA 1CXLA 2ZWYA 5GNZA 1V3KA 4UQ9A 3VKKA 1KBBA 4AD1A 2YL6A 3CBWA 1TA3B 3LPOA 1PX3A 1KXQA 4XZWA 4XX6A 1W9DM 4PMNA 2G3IA 1GOOA 3ARUA 2F8QA 2X1IA 3WUBA 1K9FA 2GJXA 1UH4A 3UETA 2DT2A 4P8XA 1BYBA 2UY3A 3ZT7A 1OD0A 3WDRA 3K8MA 1UKTA 4M8UA 3WQ4A 1B2YA 4MB3A 4AZIA 2NSXA 4PMYA 3ZM8A 2WHLA 1E6ZA 5CZKA 2AOSA 1EGZA 3VIMA 3DHUA 5D9MA 4W87A 3VUPA 1UR4A 3W28A 1W9BM 2J47A 1W9VA 3WD3A 1PZ3A 3WF1A 1ZBCA 3QOMA 1LWHA 1W3LA 2DSKA 4JL2A 1LL7A 5GNXA 3F5KA 3AZSA 3JUGA 4HOZA 4ZEPA 1I75A 1JD7A 8CGTA 1UWQA 1BLIA 3ALGA 2VC9A 4BF7A 1IZJA 1HT6A 4H2CA 1VEPA 3ZSSA 3N12A 1OT1A 9CGTA 1UD6A 3W24A 1GORA 3M6DA 3OG2A 2J8GA 2DEPA 1CLXA 2GVYA 2YDSA 5C71A 1E4NA 2CKSA 2WC7A 4HZ8A 2YLLA 1XRVA 1GQKA 4PMOA 3AQUA 4M81A 2ZUUA 5ECUA 1L0PA 4AMCA 5AC4A 5CPQA 2ZUSA 1J18A 2WHJA 2ZWZA 1UQZA 1E55A 1W1YA 1VJSA 1M03A 1GVIA 1CGWA 1KR1A 3F5JA 1E71M 2BS9A 3EDFA 4UFMA 2Q8XA 4LPCA 1R85A 4QCFA 3UG4A 2OSYA 1PAMA 3WNPA 5M5DA 1VAHA 1LJYA 3ZQ9A 1H5VA 2WB5A 1BGGA 1V3MA 1EH9A 2CCRA 2WBGA 2XFYA 2WNWA 1FOBA 1E1EA 2BFGA 4JAWA 1CWYA 1C91A 4J28A 2XSBA 4UQAA 3CIVA 2XVPA 3VIKA 2WZIA 1Q6EA 2VTFA 3VDCA 1GZJA 1LLOA 2VX4A 4D1JA 2WAGA 1H3GA 1HIZA 3SUWA 4KMQA 3CUFA 3GNRA 1H2JA 2EPNA 1OT2A 1WE5A 3TTYA 3VTRA 3KL0A 3ECQA 4QAWA 3U7BA 1R7OA 4CU7A 2XFRA 1FP8A 3L4YA 3QR3A 2FHBA 2DPEA 1CIUA 3ARSA 1VIWA 1C93A 1V02E 2JE8A 3AOFA 4AXNA 1CGVA 2J75A 1ISWA 2JIEA 3F5LA 1PJ9A 2J8FA 3W6LA 4TXEA 4FK9A 1GVYA 2A3BA 1UKQA 4U2YA 4D6IA 1E70M 1HJUA 3W38A 1BYAA 1CDGA 1B3ZA 1HX0A 3KE0A 3VMNA 1Q6CA 4GI8A 5CG0A 1QI5A 2WMGA 1ZU8A 3L2LA 4JFUA 1JZ6A 4CVWA 4H7VA 1LL4A 1Q4NX 3L2MA 3WSUA 1EDTA 2DH2A 4LQ1A 3PTMA 2DSZA 3WBEA 1KBKA 3IJ9A 2UWFA 1UWTA 1XCXA 4D1IA 2OWCA 2HVMA 1LG2A 1W9UA 4MJ2A 3GBDA 1MXDA 2GJPA 4ML4A 4S3KA 3ZT6A 3SEPA 3GZAA 1TG7A 3ARTA 4PCSA 4UR9A 5CLWA 5HXMA 5JUVA 2VQUA 2XGBA 3K4AA 2WMKA 5HPOA 2D24A 4CUCA 1J0ZA 4MNLA 2VR4A 1BFNA 1V6XA 4B9ZA 1K6AA 3LPGA 4RE2A 4H41A 3ZSTA 2ZUWA 2VT0A 3KZSA 3QHMA 3FN9A 1WCGA 2BHUA 2C7FA 3N18A 2ZUNA 2W63A 1PPIA 1KWGA 3POCA 3NIYA 1D2KA 2YOCA 2EO7A 1WAWA 4X9YA 3RM8A 4XZBA 1W9XA 1DP0A 4Z2LA 1NH6A 2A3HA 5A8OA 1JXJA 4PMUA 2WCSA 5E0FA 2QV4A 4TX6A 3AXHA 1ISVA 2CHOA 1HVQA 3HMCA 4GXPA 3CZEA 4UTFA 3WFLA 3T09A 5C70A 4GI6A 3RCNA 1DWAM 4GZJA 1QI2A 2Z1KA 2WLZA 1UQYA 3WIJA 2WVUA 5FCZA 7CGTA 4UOQA 3SUUA 1QNRA 4TVDA 2XGIA 2E9MA 3DHPA 4EAMA 4EKJA 5IFPA 2GK1A 4ACZB 4KRTA 3RDKA 4P7NA 1E5NA 2VCAA 4P8WA 2ZXQA 5E09A 3WF4A 4MDPA 4MPKA 1M53A 4AD0A 2VL4A 3ARPA 4OIFA 1UD5A 2ZX6A 5E70A 3UG5A 1J01A 5FIPA 5A95A 4TTGA 3MMWA 3AFBA 4UNIA 2WMIA 2GUYA 5D9PA 4DM2A 2BXYA 3THDA 1VRXA 2ZXBA 1H0GA 2YL5A 2NT1A 2XWDA 4F8XA 1DWHM 4PYSA 4GKLA 1IT0A 2J74A 3IANA 2DGAA 2DIJA 4HPHA 3AZRA 1DWIM 3MUIA 1GUVA 1HJVA 3A4AA 1WB0A 4JHOA 4D71A 1MYRA 1BYCA 3RMEA 1B90A 3PZQA 3WUFA 2JEPA 1UR1A 1CGUA 4Z2IA 1EHAA 6CGTA 2DQXA 4PMZA 3NSNA 4Z2HA 4J27A 4FLSA 1KQYA 2X0YA 1O6IA 2FGZA 3UR7A 3AYRA 1EOKA 2WWDA 2IUZA 1HXJA 3VIGA 3AHXA 2WHMA 3W27A 4PSPA 1GW1A 3AIWA 2G41A 1W2PA 2RGLA 1C8QA 2EPMX 4PRWA 3RJYA 3VILA 1MWOA 4OBSA 1MFVA 2ESCA 1JZ5A 3NSMA 4CN4A 1K9EA 3NJ3A 1JDAA 4MAZA 3PBGA 2YL9A 1Q6DA 4PMRA 3OGSA 4LYRA 1GQJA 5CQ1A 1J0JA 4R5EA 1CXHA 3A4XA 2PBOA 4UFHA 3W82A 5A2CA 3VU2A 1W32A 1KGUA 1EO5A 1K9TA 4UFJA 5AY7A 1FA2A 5DO8A 2VZTA 5LYRA 4AIEA 1E0VA 3ZT5A 1BYDA 2FGLA 5A8PA 5I78A 2YDQA 3IJ7A 3WH9A 4AD3A 1U30A 3II1A 3AMGA 1CTNA 1OINA 2WKLA 3M7SA 1LF1A 4LGXA 1GJWA 3BAKA 2VJXA 2YDRA 1E3ZA 1UD2A 4OZOA 4U5KA 2WBKA 4XUYA 3RIKA 4S3JA 1V03A 4UOZA 1QHOA 5IDIA 2YL8A 3GNOA 2V3GA 4WSKA 4NZCA 1WZMA 1G5AA 1RD6A 3FXYA 1E9LA 2OYKA 1UYQA 5BCAA 2WMFA 3B9AA 1JDDA 1KXTA 1RH9A 3I3DA 1B3WA 3EDDA 3VGDA 2B31A 5HDRA 2A3AA 3UEQA 2E4TA 2QLYA 3AS1A 4QP0A 4P7RA 3O6AA 1JXKA 1VJZA 1JI1A 1F4AA 7A3HA 1HKJA 4D6CA 1G9HA 3OB8A 3WENA 4CD8A 1V6VA 3AXIA 2Y2WA 1NOWA 3CMJA 5CJ5A 1N82A 3L4ZA 2BVTA 2C0HA 3PZ9A 5GNYA 2WCAA 3OIHA 1XYFA 1JYXA 3OZOA 3OLGA 3EMQA 1TZ7A 1O7AA 3MKKA 4C7FA 1QI4A 1E4IA 1C90A 2YA0A 4CU8A 1W9PA 1E6PA 5DFAA 1JGIA 1EQCA 4H8HA 1I1XA 5EFDA 4P7OA 2Z1SA 1B0IA 1J0KA 2O9PA 2XVGA 3K46A 3A3HA 3AIQA 1BSIA 2BHYA 3WQWA 1HL9A 2W61A 3UR8A 1G0CA 1XC6A 4N0RA 1NWSA 4GI9A 4M29A 1E72M 4YN5A 4WKFA 2ZUTA 4WKAA 4E4PA 1VEOA 4WIWA 4OOUA 1WPCA 3CZKA 1LL6A 4DWSA 4GIAA 4LYPA 3N17A 3GYCA 3N04A 1EQPA 1CLVA 4Y7EA 1UR2A 3SCUA 4LYQA 3CGTA 3BSGA 2J7HA 4MAVA 1H49A 1CECA 1UD8A 1WZLA 1C7TA 4JFTA 1BTCA 2OLHA 1UG6A 3GTNA 3N1AA 1LQ0A 2PWEA 3VMOA 4A4AA 4CD4A 3ARXA 2G8ZA 1SFSA 5A8NA 2W67A 4MJ4A 4GQRA 3BCFA 1C8XA 2VX5A 1KR0A 1B31A 3GDBA 5CLTA 3DC0A 3QHNA 1RP9A 2QMJA 2JF7A 4CKQA 2VUYA 2ZE0A 1GNXA 5ABFB 4OKDA 3NDZA 1B30A 2XIIA 4YPJA 3BH4A 3VIPA 3PZGA 3ZJKA 1KWKA 3B8SA 4J3UA 4F9JA 4AZ7A 1SYTA 1V6UA 4CN1A 3ZO9A 4D6HA 2WVSA 1YHTA 2VVSA 1C7SA 2YKKA 4W7VA 3VD3A 3NDYA 1UWSA 3WDIA 3QGVA 1I1WA 5A6BA 3MMDA 2ZX9A 3VOCA 3WQVA 1OCQA 3QOKA 3FAWA 3WUEA 2O92A 5A8MA 3WQ8A 4AISA 1ZB5A 3M07A 4GO8A 2JFEX 2D2OA 3VGHA 1E5JA 1B1YA 1US3A 4Q7NA 4B9YA 8A3HA 1ZBVA 4TVUA 4NF7A 2W92A 4HZ6A 3W53A 4HPGA 3WDPP 3WEZA 4EANA 2XM2A 1X6LA 4H8VA 1OB0A 1JF6A 4J3TA 1EOMA 1ZL1A 4MTVA 3WD2A 5CGMA 1P6WA 4ZENA 7TAAA 2VX6A 3MANA 1XSKA 4UZSA 5I0DA 1TR1A 4HMDA 2F61A 2QHAA 4HMCA 3WH6A 1W3KA 1G01A 1HJSA 3OLIA 4W8LA 1UR9A 5A6AA 1XD1A 2W4XA 3VIIA 3ARRA 2VI0A 3WH5A 3TP4A 1UUQA 2WKGA 3BAWA 4JZ5A 3SCWA 4CD7A 3MO4A 4QFUA 1GCYA 1JF5A 5AC5A 4L4OA 4WJXA 4FMVA 3VPLA 5ABEA 2CHNA 4PEEA 1UKSA 3TTQA 4W5ZA 4HA1A 3ARYA 1XSJA 5BRPA 2ZUVA 4PTWA 3K1DA 3VD5A 1HP5A 2GFTA 4P8UA 1V3HA 3GXMA 3VGFA 4C7GA 5IXEA 1UKOA 1J11A 3GH7A 1GHRA 3CH9A 2Y8VA 4W7WA 1MQQA 2BNJA 3RPMA 4UFIA 1V02A 1W1TA 1NQ6A 2J62A 3N13A 1QNPA 1FHDA 1MXGA 3SCNA 3VM7A 4PUEA 3MV11 3SCOA 2WMIB 5HBFA 2GSJA 1PBGA 2WZEA 3SCRA 1NM9A 4U31A 2WANA 2FHCA 2V3DA 1QOXA 4BQ4A 4D6EA 2V3FA 2YA2A 4E2OA 1XHGA 3NSXA 4ZE5A 2WSKA 2VVNA 2YBTA 3WDQA 1V3JA 1UZ4A 4BQ2A 1H09A 1H11A 3AMCA 2WVVB 1ESWA 2J7GA 3U5YA 2AAAA 4ATLA 1QBBA 1JFXA 3LPPA 1W91A 2XIBA 2DT1A 5F7UA 5JIPA 3SCSA 2WHKA 4BZYA 3D5HA 3KL5A 5D8ZA 4HTYA 4E8CA 2GDVA 1C3FA 3BSHA 2J7EA 3ZJ6A 5BYWA 1CGXA 3VX1A 1OGGA 2DT0A 1E6XM 3KEHA 3WDJA 1QVBA 4U3AA 2CBUA 2YJQA 2QF8A 3FHQA 3NUKA 3AS3A 5A2AA 1LWJA 4UZUA 4W7UA 3TA9A 3AIBA 3CUHA 3PZIA 1QI3A 4IUGA 3SCVA 3WMCA 1EO7A 3L4XA 2D23A 2OSWA 5EB8A 1QI0A 2WVTA 1MQRA 1K9DA 5BXTA 4X0NA 4IISA 5BROA 2QPUA 3EDEA 3AMDA 5A69A 2JIWA 2PWDA 2VZUA 4MDOA 5IHSA 1PEZA 3VD9A 5AYBA 4JCLA 4JFWA 3WMSA 1XH1A 5EMYA 3PZTA 3LMYA 3F4VA 2DSWA 1KGWA 4CD5A 2J77A 3DECA 1WZKA 2J7FA 1PIGA 3L4VA 4NRRA 3T0DA 1QPKA 4MNMA 4FLOA 2V38A 1XYZA 1E56A 4JL1A 1BAGA 3NCOA 4BS0A 2XSAA 3OGRA 1JG9A 4UQCA 3O2LA 1WDSA 2BVDA 1ODUA 2C8NA 3K4DA 3WUGA 4KH2A 4D72A 1DEDA 1QNQA 1NOFA 3AZTA 2WYSA 3VX0A 2CKRA 1EHNA 5LA1A 4JFVA 1ITCA 4KWUA 3DYPA 3MUY1 1W3HA 5D4YA 4GZEA 2XVKA 3BXWA 2PB1A 4AYSA 4TVCA 3TOPA 4P8VA 1DWJM 5M17A 2XTKA 1QW9A 5BXRA 4EK7A 4AZCB 2D0HA 1UH2A 4U5IA 4HMEA 4AZ6A 3IAQA 1A47A 1JYNA 1WO2A 3ARWA 3TONA 1F4HA 1HF6A 1QW8A 3B9DA 2CXGA 3T2PA 1ISYA 2EPLX 3BMWA 1E6QM 2EPOA 1CBGA 1ECEA 4PMXA 2D1ZA 3CHFA 1CXEA 3IJ8A 2ZOXA 1G1YA 1E0WA 5A3HA 3WD0A 4UQBA 1BQCA 3ALFA 1D3CA 2FH8A 2CERA 4WK9A 2VOTA 4OOZA 1VB9A 1V08A 2W62A 3EYPA 2EQDA 1M04A 3O9NA 1OIFA 3EDKA 4PTVA 3ZMRA 2O9OA 4PMVA 3VGEA 4D6GA 1J12A 4IM4A 4DM1A 1CYGA 5AYIA 4QLKA 1UR0A 5D9NA 2PWFA 2PI6A 3L4TA 2GJXB 4JFSA 1HP4A 2G4FA 2CIPA 1R7AA 5I79A 4D6FA 5FOOA 4GINA 1MW3A 2ZIDA 4ACYA 2PBGA 1WDPA 4AEFA 4CGTA 1UD3A 2A3CA 3CZJA 3EMZA 4PTXA 3AROA 1YQ2A 1E4MM 5HNNA 1XH2A 1EIBA 1V0KA 2CETA 1ITXA 3N15A 3FW6A 3GBEA 2GDUA 4DWSC 2CBJA 3WFZA 3HJEA 1EDGA 3MUAA 2X2YA 4J3WA 4NRSA 1Q6FA 5FL1A 3W37A 3WN6A 1UWUA 4AIUA 4HOXA 2X8RA 2EXOA 2X05A 5FL0A 2VR5A 4W8AA 2JALA 5D9OA 3TTOA 3WNLA 5CGTA 3PTQA 1HL8A 4MB5A 1TE1A 3QHOA 3GXDA 4J3XA 1OGSA 3RO8A 3WD4A 4QDMA 4DWSD 3T0AA 2PF0A 2G3NA 1A3HA 1HKKA 2E9LA 1OIMA 3CZGA 4W88A 3U5UA 1MW2A 4PUDA 1H41A 2Y24A 3IAPA 3VDBA 3RM9A 1AQ0A 3AYSA 3WF0A 5LA0A 4WKHA 3WQ6A 1CENA 2CITA 2PWGA 1CXFA 1XSIA 3WH7A 3GH5A 1AQHA 1VENA 4U3CA 3MU7A 1H1NA 5DEZA 3RM4A 4DUVA 2D3NA 2E8ZA 3WNKA 2XPKA 4HU0A 5A8QA 2WMHA 1PZ2A 5A6MA 3CMGA 1QHPA 4NSBA 3W0KA 2XVNA 4B3LA 2G3JA 2WW5A 4WF7A 3D3AA 2XYLA 5A6LA 1UWRA 2VRKA 1Q6GA 3WNOA 1IZKA 1OM0A 4J7RA 4F9DA 2VCBA 3M46A 3SIMA 1GONA 4B3KA 1JNEA 1R87A 3VMPA 3OZPA 5A6BD 3GXIA 3WEMA 5ABHA 3PZMA 3WF3A 2XG9A 5JBFA 1QHZA
chains in the Genus database with same CATH superfamily
4B4FA 2XHYA 1EZ2A 2BBFA 2VMFA 2CEQA 4ATWA 1NOUA 2WPGA 4IMAA 3GNPA 1R86A 5FD0A 2O7SA 2QUVA 1MFUA 3N3TA 1KFEA 4JXCA 4OJYA 5HNUA 3SW6A 3M5XA 3BC9A 1LTDA 4AEOA 4WVXA 4QCEA 3RILA 5FJRA 4HA3A 4OU1A 1ONWA 2WK2A 3W2JA 5MKGA 4PR4A 4EP8C 2DH3A 5K9XA 2OODA 3MPGA 4P2VA 3PHAA 1NJJA 1V0LA 4EIVA 1XM3A 4NIRA 4IL2A 3PWIA 4A3RA 4XBSA 4RR4A 4ZSUA 4W85A 1K03A 3PJXA 2GGIA 4GZ7A 4XAPA 5HR6A 3M1ZA 4PCTA 3BOFA 3UYCA 1YPXA 2UY5A 4DQWA 3WMLA 2BY3A 4ZB0A 4BF5A 4XAGA 2FZ8A 2E28A 2E3ZA 3IGUA 4L4LA 3WL1A 1PV8A 3LPFA 1D7KA 3VABA 4QISA 3HOJA 1NWUA 3UU0A 1VJIA 2ZXAA 3UCQA 1M7PA 4QX4A 2QCDA 2PU0A 3ZJ8A 1DXIA 2OQYA 4JEQA 1JCTA 1GPFA 4M1RA 3N2XA 1YYAA 4YTRA 1FWFC 3S2LA 1CI1A 1YDYA 3QFEA 3V18A 3W7JA 3ARVA 1ZBKA 3CH0A 4WOZA 5CSYA 1LBLA 1I45A 1U83A 2HTMA 1Z6KA 5BRQA 3TTSA 3GC2A 2XVLA 2V5LA 5HK4A 2XU2A 2PD5A 3MSGA 4E4UA 1ENUA 3WELA 2BB0A 3SFKA 4OV9A 4Y9OA 3UERA 1VPYA 1FH9A 4E2BA 2PGFA 1UUMA 2B4GA 4M6VA 1RK6A 3EKLA 1R3WA 5BW6A 1O1ZA 3BVJA 4C7DA 4YCPA 5M3WA 3LQGA 3U7VA 4B16A 5T26A 5CAHA 3E9AA 3EOOA 2ZRYA 4V2XA 5D04C 3T05A 1TIMA 2GK1B 3RX4A 5CJNA 5ABGA 4JTFA 4H19A 1H50A 1JAKA 4DBEA 4Q22A 1E0XA 1M01A 1VC4A 2CFFA 1AVAA 3MJYA 2ONEA 5I3DA 3AHZA 2A7NA 5D09A 2A3EA 5KZDA 2DZBA 2I9EA 3T6CA 4K6AA 1RQHA 3QMSA 2VZOA 5BXPA 4DZIA 4MUZA 3MUCA 1TWWA 3QMRA 1SSGA 2VEGA 3TJXA 4CCDA 2Y6ZA 4E2VA 1FH7A 3EWBX 1US2A 4Q33A 4WX2A 4IIHA 4BWLC 1J0IA 3BE7A 1I4NA 5DMYA 4ZA0A 2CWNA 5FAGA 3GTIA 4EOUA 4EWND 4OBRA 3M0IA 3QV9A 1BXBA 2Z2BA 3A47A 2BY2A 2OZ0A 2W9MA 3T42A 2G95A 4X3ZA 3I68A 3WH8A 4K68A 3KWXA 1T6MA 4M3PA 1PL9A 5T9CE 2EBNA 4FB7A 3VD4A 1YXYA 1BPLB 3W87A 1C8VA 3KAOA 1QNSA 1RV8A 5HMDA 4QG8A 5D37A 1G6CA 1M7XA 1OFRA 5AZ1A 3PY2A 4Q8OA 3FJNA 4UCFA 4AG0A 3GG0A 4C90A 1NY1A 1AMYA 1VFFA 1PKMA 3UG3A 4ZL1A 4NI8A 4HA0A 1TKKA 3PTKA 3E1F1 5EBAA 4BI7A 1I60A 1GOMA 2PCQA 3GVQA 3HJZA 1JYWA 3EDJA 2RDXA 4JN8A 3SRDA 4RE3A 3VIJA 4CN6A 3VDHA 4Q4PA 4MB1A 2B81A 4HPNA 1KCLA 2VNCA 3ABOA 2F6KA 3H2OA 2ZBTA 5JH1A 1JI2A 3G1HA 3REQB 2V63A 4G7FA 4U4MA 4LWWA 3BG9A 1J0HA 5EFFA 4GOAA 3UCDA 4DBSA 5M2FX 1VBRA 1CNVA 4YHGA 5HPCA 4GBUA 1AZ2A 2J7CA 4EF8A 1EXPA 4LB4A 1EA0A 1XIEA 2HCVA 1IE7C 2R24A 4ZXOA 5I6SA 4V1YA 3S9IA 4GYKA 2VRJA 5K9DA 1CXIA 4L6HA 3RCYA 2FLIA 1TUXA 4UBPC 3GS6A 4X0VA 1L6SA 1GEHA 4NNBA 2OWWA 4AD2A 1EX1A 4JY9A 3L4UA 3GH4A 1W6TA 2H3DA 4M80A 1J2WA 2PDPA 5I24A 3VINA 4RZ6A 2PP3A 4WY0A 4MNJA 4WEVX 5C2CA 3AIRA 2Y7DA 3QJAA 4HJWA 2PWHA 2WVVA 3CUGA 1BHGA 5BOFA 4TOQA 1U1JA 2DV0A 1I9CB 5LIXX 4NP7A 2RGMA 5PTDA 2VOMA 2F84A 2QUMA 3BG5A 2X1RA 5JBDA 5EBUA 1OABA 3FKKA 2QPSA 1TVNA 2QDHA 4GH3A 4AC7C 4XG1A 5LHFA 3NO1A 1TV5A 4JDYA 5D02A 5H8PA 4CQCA 1GVSA 3THCA 1XLJA 3W7RA 1JULA 2Y85A 4DWSB 2X0HA 3L21A 3AJ7A 1OK6A 1OGBA 4H7CA 1LLWA 1LG1A 1TTPA 4ERIA 2Y5EA 4C6LA 1VPQA 4NJGA 3APGA 4YWSA 2YR1A 3D6NA 4HGXA 2E77A 1JAEA 1OCJA 1RK5A 1H0IA 1FDJA 4CNNA 5A8GA 2OYMA 4XV0A 4ERGA 4EF9A 3VKAA 1A5SA 1MQPA 4LT9A 1SR0A 3L7RA 3PWGA 4UFKA 2CLOA 3G0SA 6A3HA 2WWCA 4EE9A 4JKMA 1H5YA 3PVFA 2VFGA 2WLYA 2O55A 5A6JA 1VS1A 1AQMA 2DW7A 1HN1A 5A2BA 1KXVA 4HP5A 1Q66A 5GPRA 3QQWA 1P48A 3W81A 4CD6A 2YIHA 1H7RA 3UQNA 4ROPA 2E0PA 4KEMA 4ZSTA 3BGGA 3UWVA 1LRNA 3URQA 3ZJ7A 4JHZA 2QULA 1ZFJA 4L4PA 5FEWA 4C91A 2CESA 2CBVA 3TJ4A 4UFLA 3LENA 1BVNP 1H4PA 3NQ6A 4Y8FA 4S3CA 4F0KA 2A7PA 3PPGA 3DI1A 1UHVA 5DQPA 3VZYA 2QVNA 4LCRA 2JF6A 1NQKA 1MXSA 3OPSA 3A9IA 1R3YA 5BRBA 2TSYA 2PDMA 5CXPA 3IUIA 3B9EA 1QU4A 1LBMA 2VFHA 2BY1A 1XGZA 2AMGA 3BJFA 4NZ1A 3HBLA 1GVOA 4M24A 3GXFA 3RITA 2OLSA 4GO9A 1Y7VA 2O7QA 2IXUA 3W83A 1CT5A 1LORA 3VE7A 2FZBA 1U5JA 4ZE4A 3AMLA 1Q7MA 1O95A 3WBAA 1FKXA 4R7JA 4JCMA 3URAA 2ZWYA 3OTRA 1ZRQA 3A4JA 4UQ9A 3L67A 2YL6A 4ZQNA 4XZWA 4XX6A 2C19A 2G3IA 2B0MA 1Z69A 1YMYA 2A7RA 2F8QA 2V2HA 3HPXA 2WJDA 3UETA 4PUNA 1H7PA 3CB8A 2Y7GA 1XLFA 1UKTA 3S9ZA 1PHQA 3JRKA 4C1LA 1F3TA 3WQ4A 4MB3A 5KMYA 1UZHA 3ITTA 3O06A 2OLAA 3BW2A 1BVWA 5XIMA 1LYXA 1OF8A 4L9ZA 2E68A 2R14A 3MDWA 4NJKA 4A2RA 4UWMA 5F4WA 3WD3A 2AKZA 4O0QA 1W3LA 3T4WA 1LL7A 4JX5A 1Q85A 3LHTA 4HK6A 4ZVJA 1TX0A 3WLSA 1UWQA 1BLIA 3GDRA 3UA4A 3MI6A 2VM8A 3O3RA 3N12A 1OCNA 3UD6A 1FWEC 3LLFA 9CGTA 2V5BA 1GORA 4L56A 1VBGA 3M6DA 3OG2A 2DEPA 1AW5A 1CLXA 3B9OA 1TQXA 2CKSA 2WC7A 3CV7A 3JVAA 3E5PA 2YLLA 1GQKA 4QRNA 3K2GA 5ECUA 5AC4A 4EPBC 4WQ6A 4O1FA 3R0UA 1J18A 1TWSA 1E55A 1W1YA 2KX9A 2GWNA 2DUAA 3Q67A 1E71M 3HV8A 4QAIA 4ORIA 8XIMA 2OSYA 1EJXC 2R1LA 1UBPC 4IPPA 5M5DA 3QQ0A 4GQBA 3BTNA 3MVTA 1E1EA 1P0NA 5A6TC 2Z26A 3EB4A 3VI2A 3HQNA 3UZXA 1FCUA 4HQVA 1Q6EA 1EZWA 4P5UA 1A0EA 1TPFA 3VDCA 2WAGA 1IR1A 1H3GA 3FFSA 4NT0A 3BQ5A 4NU7A 1HIZA 2PAJA 3H21A 3CUFA 2CLFA 5CC5A 2JKEA 1IXOA 2PTZA 1JEZA 4MLRA 1IGSA 2XFRA 1FP8A 3B0PA 3GUGA 3PP7A 4FEZA 1ZY9A 4C5YA 2DPEA 1CIUA 3ARSA 2JE8A 5F2IA 3LD5A 3AOFA 3VNJA 4AXNA 4FI4A 2OEJA 3P93A 5LXXA 5BU6A 1ISWA 3F5LA 5CC7A 1PJ9A 1MSSA 3CPGA 1A0CA 2A3BA 1GG1A 2NXGA 2QXWA 1ICQA 3H26A 1VFHA 1B3ZA 3KE0A 3I7QA 4LYKA 4LF1A 3UYIA 3VK5A 4GACA 5TAOA 2WMGA 3GFXA 2PDNA 2QVHA 2XN2A 1JR1A 4CVWA 3IIVA 1A80A 1B4EA 3WSUA 1OFAA 5C9UA 2DH2A 4A35A 2YW3A 2GVJA 3CXOA 1EKOA 3K5XA 3XINA 2QW5A 3NEVA 3UT0A 2UWFA 1R3VA 1I2OA 2FMOA 2GOUA 2OWCA 3Q58A 5HWJA 4MJ2A 4PCNA 1XLKA 3M64A 3ITCA 4JTSA 1EF2A 3W7QA 4ML4A 1QO5A 2C16A 3BZJA 1LWIA 1OJXA 2ZZ3A 1S1RA 3SEPA 1TG7A 2CC0A 5JVLA 3LGEA 2ISFA 2XGBA 3GNXA 5CZJA 2RJHA 3AYVA 5FJIA 5TBOA 3S1VA 1QOQA 4Z0JA 1J0ZA 4UNLA 4LAZA 1K6AA 4EACA 3H24A 5BWAA 3CV2A 1N7KA 3G8EA 2VT0A 3FN9A 4S3DA 3W6YA 2ZUNA 4QEHA 4LSBA 3POCA 3NIYA 1D2KA 2YOCA 2GQAA 4XZBA 4CLMA 1W9XA 1DP0A 4N6FA 2GGJA 4Y96A 1JXJA 2BDQA 2NV1A 1G7VA 4N9BA 4XO7A 2C6QA 3H55A 2PGWA 2DZWA 2XGZA 2CHOA 4DEFA 1KBLA 3TYCA 4R9XA 5HMFA 1T40A 4M6QA 5LSMA 4GI6A 1LQ2A 4O18A 2ZC8A 1LT8A 1QI2A 2CXEA 1NAL1 3V0TA 2R94A 1Q45A 3WIJA 4LVBA 1FXQA 3LTSA 1ZUAX 4G7EA 3G22A 5FCZA 7CGTA 4O4WA 3MCOA 4UOQA 3V4BA 2ZTKA 2E9MA 2OTDA 2I5GA 3EAUA 3E6EA 4LRTA 3MI3A 5E5CA 4Y9PA 4CQ8A 1S2VA 4IWWA 3B8WA 3HFYA 5ECVA 1FCVA 4MDPA 1M53A 3SQMA 3V1PA 3ARPA 4OIFA 1P1MA 3UXIA 3AFBA 5B80A 4UNIA 2WMIA 5I07A 3HGSA 2Z6JA 3HG2A 1VRXA 2ZXBA 3N25A 4JPGA 4C6EA 3M0MA 2VEIA 5CBJA 5CBBA 3C0LA 1IT0A 3T1GA 4GIYA 4HPHA 5RUBA 3PF3A 3UJSA 4RZ5A 1FTXA 1JRCA 3OHIA 3B3DA 3RMEA 1B90A 3LRMA 5LGXA 3WUFA 7ENLA 1CGUA 5C54A 4Z2IA 3IRSA 3OO2A 5K3VA 3ABRA 4PMZA 4WGHA 4LF2A 4J27A 4IIGA 1KQYA 3KCLA 1M6JA 1O6IA 2Z2AA 4I7UA 2C1HA 4JTEA 4DI8A 1EB3A 1TMHA 1JCMP 2WNNA 1XISA 3LHVA 3P80A 1ZAJA 1GTHA 5E93A 1R3QA 4QNWA 2WPBA 7REQA 3RJYA 1XLLA 1MWOA 4OBSA 4NZ3A 4PB4A 3NJ3A 3W22A 3RR4A 4M0XA 4FX7A 3N9RA 3W00A 3NFUA 3KVKA 4MF4A 3OGSA 1KM2A 4UTHA 4GVHA 3RRXA 2FPVA 3AO0A 4UFHA 5A2CA 1W32A 3QPZA 3S5ZA 4IXXA 1K9TA 1B57A 4D9PA 5HUOA 3TEVA 3ONBA 3H53A 2VZTA 4LH8A 2FGLA 4XIAA 1X97A 1G67A 3NL2A 3II1A 1ZP3A 3NQGA 3MWAA 1P0BA 3H2AA 4HNCA 1BQGA 1F61A 1LF1A 1KKOA 3EOSA 3BAKA 5EGRA 4L1WA 1J79A 4U5KA 3LOTA 1K7FA 3WYZA 4Q4SA 1S3TC 2ZZ4A 1EJVC 4YTUA 3TJIA 4PUMA 2OCZA 2FFIA 2OZTA 1RD6A 1XINA 1UYQA 4PTDA 5KTLA 1KXTA 1B3WA 3DCPA 5HDRA 2A3AA 3AS1A 4QP0A 4P7RA 2W3ZA 1DJHA 2PDJA 1VJZA 1FWRA 2VC6A 3WLIA 1JI1A 1SW3A 3S8HA 1HKJA 4A8IA 3EA1A 2P0OA 2CLPA 1PKYA 3BW4A 3FYPA 2Y2WA 3FJ6A 2WV8A 3ES8A 3L4ZA 1V6TA 3PZ9A 4I3GA 2WCAA 4HTBA 1XPYA 5TIMA 1K77A 5J5DA 5E9XA 3OLGA 3EMQA 3M9YA 1ICSA 3T81A 1C90A 1IZCA 4UB9A 4L80A 1EQCA 3GKAA 4H8HA 3RXZA 4G8TA 3LUTA 2O9PA 2XVGA 3K46A 3BK0A 2P5NA 3A3HA 2B7PA 5C55A 1X1OA 1VP5A 2W61A 1IYXA 1OFDA 1SZRA 3RMJA 3H2NA 1VLIA 4GI9A 1VPXA 1E72M 3ME3A 4YN5A 3QC3A 2OG9A 3I7RA 3SZ8A 1W3IA 3MVIA 1XIDA 4WIWA 3CT2A 2R6OA 1WPCA 4XIMA 3GYCA 3QW4B 4YL2A 1DTNA 4Y7EA 1GJPA 3SCUA 3CGTA 3BSGA 1Q2SA 3FA3A 1KV8A 4X22A 2QUTA 1CECA 4REQA 3LBCA 2AL2A 2NQJA 1FUYA 1QPQA 1UD8A 3GIPA 4GNJA 3GE7A 3L5LA 1BTCA 3CUXA 1UG6A 2DJLA 2RDTA 4S2BA 1PKNA 2G8ZA 1SFSA 1YXCA 3IGXA 2P8CA 4GQRA 1C8XA 3GG8A 8TIMA 1SVDA 3V75A 4CKQA 4H9UA 4DYEA 2YZ5A 5T91A 4XTDA 4GCAA 2R82A 3GXNA 3ABSA 3CU2A 4AZ7A 5AHIA 1V6UA 3VC6A 1PYFA 2GJNA 4D6HA 2WVSA 1GZGA 2JKAA 3FV9A 3P81A 3NDYA 3IIOA 5A6BA 4ALDA 3MMDA 1M65A 3O0KA 5FA5A 3QVQA 3FAWA 2G3FA 4N2YA 5A8MA 1Q65A 3CQJA 3KHDA 4KBXA 2I5IA 4ZR8A 4LVAA 2DZXA 2GSHA 1B1YA 4Q7NA 2ZZ7A 2PDKA 3QY7A 4NF7A 2W92A 2R91A 5HQMA 1DBTA 4HZ6A 3W53A 3TSDA 4TMCA 4HN4A 4H8VA 5IM51 3LM7A 2EF9A 4O8RA 4UCGA 4TO8A 3FCPA 3NQFA 4PMJA 1SFJA 1MZRA 3NXLA 4JICA 4F48A 2GQ3A 5CPNA 5DCDA 5CC6A 4HMCA 5CPMA 3SIZA 2Y0FA 1G01A 1HJSA 3MP4A 4NJJA 3N34A 3UBPC 4MKSA 1XD1A 5GVJA 3W1UA 3ARRA 1Q6QA 1UUQA 1AZ1A 2DUZA 3MO4A 2XH7A 3RLVA 4GHRA 1D8CA 3VPLA 4UIOA 1XDLA 4HA1A 1UMLA 1XSJA 5BRPA 3S2MA 5AZ0A 4EXAA 3GXMA 1MMFA 4O19A 4C7GA 2ADAA 1LROA 3CMFA 1J11A 3VKDA 2I14A 3T44A 2YFNA 3L5AA 2BNJA 3RPMA 4UFIA 5AHNA 4G1KA 1NQ6A 3ITYA 3LCIA 2SFPA 3IJQA 1XLBA 4ICMA 4IGMA 3NO5A 3EA3A 3TKFA 3M41A 1LM1A 3MV11 9XIAA 3P84A 1TWZA 4MWAE 4B4HA 2GSJA 2HSAA 3SCRA 1NM9A 4U31A 4TV6A 2WANA 1QOXA 1DJWA 3NSXA 4ZE5A 2WSKA 2GGGA 2BASA 1WXJA 1JJKA 3W85A 1LUCB 1J96A 4O0ZA 1ESWA 3V16A 2VXNA 3U5YA 2AAAA 3RHGA 2XIBA 3W23A 1XXXA 2DT1A 5F7UA 1TV2A 2ZC1A 3E38A 4BZYA 3KL5A 5D8ZA 4E8CA 3PFMA 2GZXA 5EMMA 1YXDA 2J7EA 5CC3A 5BYWA 1F6PA 4GUIA 3GG7A 4JTKA 3WDJA 1QVBA 1BWVA 2QF8A 4KCTA 3FHQA 3B0VC 3D47A 2F6XA 3AIBA 4Z1CA 2PDFA 1OG0A 1EO7A 2D23A 3BANA 2OSWA 4NYYA 1QI0A 1KFLA 3IGHX 2AQVA 2OJPA 5BROA 4CQDA 1PHWA 3KUMA 3I7SA 5L9FA 4RX0A 4MDOA 3IJIA 4F0MA 1W3TA 2HROA 1BSLA 1NELA 4QG6A 5FEPA 2NV2A 1NF0A 3TWAA 2ATSA 2YXGA 3KTCA 4LV9A 3WMSA 4Z0SA 4QS6A 5EMYA 4MY8A 3LMYA 2G97A 4AQLA 1KGWA 2AQOA 4UMCA 1KCZA 3C2FA 4MZ8A 1WKFA 3N3MA 1QPKA 4LCSA 2DFAA 2V38A 5DX7A 3P0XA 3KVMA 2PDHA 3VZZA 1KLZA 4AB4A 5K7JA 4UQCA 5G4WA 1UASA 3N2TA 2BVDA 1TV8A 3R0KA 5EY5A 1H7XA 4HPJA 4N9DA 2QDGA 3WUGA 6XIMA 1QNQA 4X63A 3U2CA 3U48A 3VX0A 1X98A 1Z41A 3M0YA 3QEZA 3NO3A 1L6YA 5D4YA 3M0HA 2PB1A 1S5NA 4TVCA 4RNJA 1V51A 2XTKA 3R11A 4O4VA 5I3JA 4GYJA 3QZAA 1U1UA 4WRHA 2QS8A 4GE8A 1UIPA 4AZCB 1BTMA 1YADA 2R1MA 3IAQA 4CQ9A 1X38A 4K3ZA 5B7YA 5DY2A 2FB3A 1C29A 3GKFA 3TMQA 4ZQRA 1I2RA 2ISWA 3ITGA 4K1GA 2QCNA 1G1YA 1E0WA 4PZVA 3R0DA 2QR6A 1GG0A 3WLJA 4QTGA 1F05A 1F6YA 4WK9A 5LNVA 4PA8A 1VB9A 3R5EA 1GGOA 2W62A 3LMZA 4YTSA 3C6CA 2EQDA 4YTQA 4CNOA 4C1NA 5D33A 4B5XA 2O9OA 2NUXA 2VGBA 4K36A 1AODA 4GY1A 3KM8A 4B2DA 1OC7A 3PBYA 2PWFA 2H6RA 3LHUA 4H3DA 4KF1A 4AUBA 4FOUA 5KITA 4HNLA 4RPPA 2PDUA 2NZLA 2VHLA 3CAVA 2PDQA 1BWLA 5HQEA 1ZJIA 3L66A 4J9JA 3N6JA 1XFCA 1UD3A 3TNBA 1KFJA 5BU9A 3AROA 1RJQA 1XH2A 1VFTA 1ITXA 5C9RA 3S1GA 3VNDA 2GDUA 3RLGA 1TJPA 3GXPA 2X2YA 3G1VA 1NSJA 3OVPA 1P7TB 3QMTA 3SN0A 3E2VA 1EYWA 5D9OA 1HL8A 1NFBA 3EPOA 4UTLA 4QDMA 3RRAA 4MHBA 3V7PA 5I09A 2ZVRA 3EZ4A 1RBLA 2E9LA 4W88A 4GISA 4PUDA 2Y24A 3IAPA 1L6GA 3W1NA 3VDBA 3S1UA 2PTYA 2IW0A 3KOWA 4WKHA 2C79A 4WGXA 1E1CA 3MSRA 3WK2A 2Q8LA 1XSIA 3WH7A 1VENA 5DEZA 1H1NA 2D3NA 1M7OA 3TH6A 4Z1DA 4NAEB 2XPKA 4HU0A 4X60A 1CB2A 2WMHA 1PZ2A 1ZAHA 3TZNA 2ZA2A 3CMGA 4L1GA 4HU3A 4U10A 2WW5A 4R88A 3PNUA 4WF7A 1IEQA 2XYLA 3VDGA 1UWRA 1M41A 4F9DA 3LHWA 2Y7EA 3G8RA 1F8MA 1GONA 4B3KA 3OVQA 2IPGA 1JCJA 1ITQA 1J5TA 3ZFHA 3FJLA 4RXGA 4HCDA 4X61A 2P3EA 5A6BD 3GXIA 1QXLA 4Q4QA 1YPIA 3WF3A 3EX3A 3CTTA 1VF8A 4PSRA 1DJIA 3U8GA 1A5AA 2CWXA 5C9WA 3CO4A 4MFDA 2UY4A 3RJXA 3WJWA 1C8YA 1UB3A 1XC4A 1DTUA 4F66A 4AEEA 4IMEA 4QLJA 1OZQA 4YVVA 1LOSA 5GJNA 5AVNA 2V30A 3BURA 3UVAA 1X1NA 3GSMA 2OMAA 3NGFA 5CG7A 1NP0A 3ZVHA 2J88A 3IJLA 3BAIA 3V3WA 4U33A 2D20A 6TAAA 3A6OA 4LUYA 4PL2A 4GUJA 1HJXA 3QQ1A 5A94A 2ZXDA 3PBUA 4UTJA 5EU9A 3LERA 4A21A 1V5XA 3K1GA 3TX9A 3T08A 3MI2A 2OWXA 4LEQA 1TWDA 4L64A 1GOQA 2C91A 2MUCA 1TJ1A 3OLDA 3BQ6A 4LVGA 3KVJA 7ODCA 4CCEA 1PVNA 3UVIA 4A05A 2POZA 1A50A 1EJWC 1H7NA 1V3IA 3M0VA 1LOLA 3C8FA 3SUVA 3OBAA 1VBUA 3L9CA 4DB7A 2YXXA 4IGNA 3A22A 1NFGA 1MW0A 3DDMA 3LDVA 3MQTA 1OYCA 4UQDA 4TUFA 4CNPA 3B9NA 3NR0A 3XIMA 2QEZA 4JKKA 3ARQA 3POHA 3SGGA 4Q8WA 4RKAA 1RP8A 4RDZA 1V7YA 2P10A 3TIMA 4RDVA 4BF9A 2Y5JA 3G6LA 3R4IA 4HHPA 1KBIA 3ZR5A 3MUZ1 4ZQPA 3SECA 3VKCA 4OUIA 2JBMA 3VO0A 1GHSA 4FSAA 2I56A 1JZ3A 1DJQA 4BCEA 4TX8A 4F2TA 4FNSA 4B15A 5FJJA 2XIQA 3I3BA 4I5XA 3EOEA 4A3YA 4ML9A 2D0FA 5DT5A 1H51A 3GIYA 4W84A 4NI3A 1X8FA 3AISA 4AD4A 5FEZA 2J7BA 2QUNA 5H6HA 4C6FA 4R34A 3DG6A 4C1KA 4C6OA 1IV8A 2CZFA 7PTDA 4AW7A 4AZGA 1ZJBA 2FZ9A 1YTDA 1MVYA 3NYDA 4BKNA 2Y61A 1R2SA 2D3LA 3CUZA 3BGJA 3TK7A 5CPSA 5I23A 1XIJA 1JZ8A 4MWAA 1OG6A 1CEOA 2DDXA 3I6EA 2HBXA 3IVUA 1B9ZA 1E6NA 1W5OA 2F7FA 4BJHA 3VIFA 1GOIA 3HGOA 4Y90A 5IOBA 3MMUA 1JL8A 4AZ5A 3TN4A 5I03A 1TJRA 1CGYA 3CB3A 3OA5A 4C5ZA 3PZUA 3HO8A 2FVLA 1GPWA 4B92A 3CUJA 4JTDA 4U2ZA 4ZXLA 4Y9AA 2QJNA 3XISA 5REQB 4QLLA 4F79A 3D46A 4Z1AA 1VYPX 3W6MA 5ABFA 3KLLA 4XAYA 2XH2A 1GVFA 1X6NA 4LXFA 4G56A 3GX9A 3RR1A 4FNUA 2OO6A 1YBQB 2WNZA 3CPUA 1US0A 2YFOA 4HNVA 1WP6A 1DJGA 1NEYA 1IQ8A 3SBFA 3SI9A 3ABQA 5CZSA 1KFCA 2Z7GA 3EEGA 2VFFA 4KQNA 3PUGA 5HNRA 4GQQA 5KZ6A 3H70A 1RXOB 2XZ9A 5CH9A 3W7LA 4UTTC 4W8BA 3UZYA 2PC8A 1UA3A 1SPQA 4GIEA 1FWIC 1NWRA 2QJHA 2Y8UA 4JTLA 1Q8AA 3KCOA 3V5OA 4PMQA 3VNMA 2MANA 1JDEA 1A5KC 4FS9A 3ABXA 3DFOA 4K8GA 1XLCA 1WBJA 4DO6A 4ES4A 4I7WA 1KM5A 2GPTA 5EMKA 1ISZA 1L6WA 1W3NA 4A2SA 5A1AA 4B2DD 2BMBA 2X09A 3G1XA 1AG1O 5AECA 2E5BA 1SMDA 5F2GA 1PCKA 4NAFA 4R7WA 3MY9A 2G37A 3W4RA 1UIOA 1KTBA 3ZOAA 3I4KA 2O0TA 3I3EA 1DWFM 4CNUA 2W5FA 2YSWA 3RX3A 2E6AA 1JDCA 1XFBA 3INPA 3CLWA 4ZB2A 4BEUA 5DELA 1J0YA 1BWKA 2HVOA 3AHYA 4DXKA 3FOKA 1DHKA 4JTCA 2Y4SA 1E15A 1E43A 3STFA 2QCHA 5I3IA 3VGBA 3AIVA 4AIBA 2VQTA 3W25A 4MNKA 4XZIA 1AUSL 3AHTA 4DUXA 1B54A 1CPUA 1XV8A 3BDKA 4FX6M 4P7QA 3C8NA 3BAXA 4RDYA 3P82A 3N6HA 3AS2A 1WZAA 1KGXA 4JR5A 3DFPA 4J3SA 3CIXA 4OHQA 5JBEA 3WNMA 2PTWA 3OQ8A 2D69A 1QNOA 4LALA 4NQ1A 1UJQA 1XIFA 4UQEA 4Z2KA 3W02A 5I7GA 1WDQA 3K8LA 4YHEA 1XL9A 5BMXA 3C56A 1A5BA 1KRCC 2GVEA 4XISA 3QV7A 3JZUA 3R6IA 3DYMA 1KM1A 1R5YA 1CXKA 3B4UA 3LG3A 5IHRA 3GFYA 3W9ZA 2WM0A 4DO4A 1V0MA 3S2NA 4GQ0A 1SMAA 1WKYA 1VFOA 2DZUA 3LLXA 2O56A 2CPUA 1W37A 1TREA 2G3MA 4EPKA 1YDVA 2J25A 1OSEA 1TV3A 1FH8A 3FJ4A 2QCGA 3UJEA 1UA7A 3DFTA 5DT7A 1E6RA 2Y89A 3LV5A 3QTPA 3C61A 3SM0A 1XS2A 1IEXA 2VGFA 3LNMA 3DFQA 4H9TA 2H9AB 4LVFA 2HBVA 3LZ5A 1W2VA 2ZYFA 3M7WA 1LDCA 4QSHA 1TRIA 3P6LA 4HSNA 3T78A 1RLCL 3UESA 3W26A 4NASA 4GABA 4KEZA 3WBWA 1XR2A 2PEVA 3PB0A 3T40A 4DJFA 1OYAA 3QYQA 4XKYA 3AIUA 2POTA 3P67A 1UKPA 1JQXA 3WNNA 1G94A 1HJQA 1SZNA 2BXZA 1HNYA 1S5MA 4TU1A 5M1TA 5MHBA 2H90A 2ZA1A 1GOWA 3QSRA 2DZVA 4H83A 2CNCA 3WDHA 1JPMA 2NWSA 3KW3A 4O16A 4KWWA 5D8WA 3SURA 3E96A 1RHCA 4TIMA 3VNZA 3T0CA 2VC5A 4JKLA 2HXUA 2WXDM 1MRQA 1DJYA 4ASTA 3UA3A 4JQ1A 1K02A 3EWWA 1C92A 2RFGA 2BHZA 1OBAA 4LS0A 1U33A 4IIDA 3APTA 2C13A 3P60A 3MS8A 3PZVA 4E4FA 4KRUA 3BLPX 3CHCA 2YCKX 1UD4A 2REQB 4PC8A 5GNZA 5E1QA 3VKKA 4O52A 3CBWA 1TA3B 5C2XA 2GJLA 3LPOA 3GVWA 5A5WA 3UPWA 3GAKA 3RLHA 4PMNA 4LNCA 2X7VA 1GW9A 1GOOA 3C2RA 4F2BA 4ZMGA 3TE9A 3G1DA 3R1ZA 3B40A 3W76A 4LAKA 3VOGA 3OA3A 4LBUA 3ZM8A 2WHLA 2PRMA 1N55A 3GB6A 2ZQ0A 3ZWSA 3H7UA 2ACQA 5E0KA 1KM4A 4ZO9A 1QPNA 4GUGA 3R8GA 3LRLA 3W28A 2J47A 3AUOA 2HS6A 3WQDA 1PZ3A 1LWHA 1WA3A 4ZQOA 2DSKA 3F5KA 3AZSA 1FCBA 2R9RA 4HOZA 5DN1A 1LOQA 3ES7A 4INFA 8CGTA 2VC9A 3O0FA 4BF7A 1J5SA 3TAKA 3W24A 4MWAD 4KWVA 4XKMA 2J8GA 3P5ZA 1RUSA 3C2OA 2GVYA 3OEXA 1DKWA 4HZ8A 1DIEA 7XIMA 2ZUUA 3T55A 1L0PA 4LTSA 5CPQA 5AB3A 1F6KA 1H1ZA 2QJGA 5LNUA 4Q8TA 4DXXA 3ATZA 2PURA 1JGMA 2C1GA 1ZSXA 3MP5A 1M03A 3W73A 4LUTB 3ERPA 3F5JA 1FDYA 3G1SA 3DG3A 4UFMA 3F7JA 1EC8A 1HQTA 2XZ7A 3UG4A 2Z0IA 5AYZA 3M0ZA 4S3EA 4L1XA 1H5VA 3ZQ9A 1BGGA 1V3MA 2WBGA 3N4AA 2WNWA 3O07A 2BFGA 3HPZA 1CWYA 2ACRA 1EEPA 3IJDA 3DBNA 1DORA 4JQ3A 2XSBA 4QR6A 4UQAA 2B7NA 2OGJA 1QWGA 1PO9A 4L7ZA 5AYYA 1CB7B 3A64A 1XLIA 4KMQA 1MEHA 3GNRA 3H22A 3LHYA 4AAJA 1H62A 2EPNA 1OT2A 4M5PA 3VTRA 3ECQA 4QAWA 3L4YA 3LSCA 2FHBA 1W1A1 2J24A 4S38A 4LBRA 3M5VA 3G0XA 4TV5A 4PBEA 4UMBA 4X2RA 1QASA 2J8FA 1PCWA 1JPIA 4WDTA 3PULA 4FK9A 4M6UA 1F2JA 2PDGA 1E70M 1HJUA 3W38A 2WSRA 2OQLA 4S3BA 4WDUA 3G1RA 1P0DA 2FVKA 1Q5MA 3LSBA 4GI8A 2JK2A 4K8EA 4NG3A 3NZ1A 3Q94A 3LN3A 4YVXA 2FB2A 2FMNA 1SJCA 3W71A 4JFUA 2WZTA 2CLLA 3GWQA 1FWHC 3W7NA 2PTDA 4O17A 4PRTA 1IHIA 4NL1A 2ACSA 1O1HA 4KIEA 4GYPA 1X7FA 1KBKA 3IJ9A 3FA4A 1XCXA 4ZFCA 3UFYA 3SQLA 1SU5A 2PLKA 1MXDA 5BOEA 4GUFA 3R13A 1HO4A 1TV4A 4S3KA 3SJ3A 4E38A 2RJGA 2I9UA 3ARTA 3GZAA 5DLCA 4FZIA 4PCSA 3GD6A 1VIZA 4WDWA 2VQUA 4HVXA 5HPOA 3DBPA 3FDKA 4CUCA 2Z2UA 2ZZ1A 3HA1A 3MBDA 4PRRA 3EWZA 1BFNA 4B9ZA 3WZ0E 4RE2A 1UP2A 3EGJA 2GOKA 4O1CA 2EKCA 1PPIA 2C15A 3F2DA 2XIJA 2EO7A 1WAWA 4K8HA 1REQA 4Z2LA 3MO7A 1S3HA 5A8OA 1VYSX 3C52A 4B5TA 3PUEA 3UWYA 2UBPC 3LU2A 3MKVA 3DFHA 2WCSA 5E0FA 4FA3A 4H1ZA 4DYJA 1XX1A 3KDNA 1ISVA 3CWOX 1HVQA 2W27A 2X30A 3CZEA 3HMJG 4M1BA 2F38A 4BR1A 3A5FA 4WD0A 5HNTA 3M6YA 4GZJA 4GYFA 4O8AA 1UQYA 3TW6A 3LM3A 3TN6A 1YEYA 3TZFA 3RYSA 4BI5A 2TRSA 4TVDA 3B0UX 3DHPA 2HRWA 3P62A 3H4GA 3TROA 4ACZB 3TUUA 2VCAA 5E09A 3WF4A 2CZDA 4HSHA 4MPKA 4AD0A 3N73A 4O10A 3QLDA 5E70A 1XDMA 2BVWA 1J01A 5FIPA 3UG5A 2DIKA 3V1HA 3MMWA 1LP6A 3KFTA 3STEA 2BXYA 3MMTA 2GQ9A 3SY8A 3THDA 3V35A 3RAOA 1QW7A 1P5BA 1MEWA 3TYUA 1IWPA 2A21A 4PYSA 1RBAA 2IKIA 2J74A 2W0UA 2DGAA 2DIJA 4ZQCA 4B91A 3RF9A 1H60A 3R10A 5CZ0A 1XF0A 3VC5A 4IMFA 3MUIA 1HJVA 3MHFA 2FPYA 3P3BA 4ADTA 4D71A 4DJFD 1MYRA 1QOPA 3FX4A 1EHAA 2DQXA 3NSNA 4Z2HA 1CLKA 2C0AA 5FI8A 3LBOA 1A3XA 3AYRA 3NA8A 4MFEA 4WY0F 2WWDA 1EJ7L 1HXJA 4XWUA 1TMLA 2IQTA 4NKCA 1FXPA 3B0XA 1VR6A 3AIWA 2OU4A 3U9IA 5LGZA 1V7AA 2RGLA 2J9XA 4LAUA 1C8QA 1DIDA 2EPMX 4RZBA 4EXBA 4MY1A 1JZ5A 3NSMA 4CN4A 3WQEA 4FNPA 4DHGA 1JDAA 2X1SA 1OF6A 1Q7ZA 3W7OA 1HUVA 4PMRA 5CQ1A 4R5EA 1TPUA 4XQ6A 4I6KA 4RCXA 1KGUA 2E6FA 4Q8PA 5DO8A 3ZT5A 3O05A 3S5YA 2NX1A 5A8PA 5I78A 2YDQA 4LW7A 3R12A 3IJ7A 2OGYA 2VWSA 3WH9A 4AD3A 3VCCA 3AMGA 3C2VA 2WKLA 4MUPA 3PBMA 4AHOA 4LRSA 4KEUA 4TMBA 3ELFA 1UROA 1YTEA 1OFBA 1GOXA 4S3JA 4GY0A 2EPHA 3FIGA 2AAMA 1HZYA 5TF0A 1QHOA 4HYWA 5FF7A 5IDIA 3FKRA 3TYDA 4TR9A 2V3GA 1AH3A 4PL1A 3FXYA 2QGYA 1H61A 2WMFA 1X7IA 3B9AA 3IIXA 3I3DA 3EDDA 3S9YA 5K2ZA 2VR2A 1Q13A 1PZ0A 4LAOA 2NVAA 5IBXA 2E4TA 2IKHA 2X1UA 3O6AA 2I57A 2OPJA 1JXKA 5AC8A 4PTNA 3THQA 7A3HA 1OX6A 3LI0A 5KZMA 1FHVA 3WQOA 4D6CA 4BEQA 1IIGA 3RLUA 3WENA 4CD8A 6ALDA 4OBTA 5I3HA 1VGAA 1W1IE 5GNYA 1XYFA 2E67A 4IQEA 5HA7A 3OZOA 1S38A 2OELA 2Z1XA 3MKKA 2G5WA 1B4KA 1W9PA 1PE1A 4MGGA 3UGVA 4CQAA 3OODA 3BG3A 1G4EA 4PUKA 3AIQA 5AKQA 3BL3A 2UZ9A 1BSIA 2BHYA 2XN1A 3CPRA 1RA5A 1HL9A 3ANUA 1PZ1A 4IFRA 3VNLA 3CK5A 1G0CA 4N0RA 4M29A 2J9YA 4WKFA 1XIIA 4Q8VA 3HURA 1VEOA 4JIRA 4OOUA 3FEMA 2KAUC 3LGDA 5FACA 3N04A 1EQPA 2NQHA 4Q8UA 4LYQA 1B3OA 1H49A 1BRLB 3CTLA 4AFYA 3PR2A 4NXSA 1XI3A 2BODX 3GTNA 3LCWA 5JMUA 1YNPA 3P0WA 2OX4A 2PWEA 3PJWA 4A4AA 2W67A 3UJFA 3SY5A 1P7TA 2VX5A 1KR0A 5CLTA 4DI9A 3DC0A 1RP9A 2QMJA 1QPOA 4KCVA 4IGSA 3W1AA 4JNZA 2VUYA 1GNXA 4NNCA 3B06A 3BH4A 3VIPA 2CU0A 4DZ5A 1YDOA 3MZNA 4GK8A 1KWKA 2IPFA 4F9JA 4U28A 3A24A 3ZO9A 4GUHA 1C7SA 4I9MA 1JUBA 1DL3A 1EL3A 1UWSA 1U1HA 3VOCA 3GVGA 3QOKA 1ONEA 2HVNA 3WUEA 4AISA 1ZB5A 4RE0A 4H6KA 2JFEX 8A3HA 5LNWA 1ZBVA 2Q8ZA 4HPGA 3AALA 3WDPP 1UC4A 2XM2A 1X6LA 1Y5WA 3NOEA 4QITA 4RPQA 4MTVA 3WD2A 1P6WA 4ZENA 7TAAA 1ZCCA 1TZ9A 1FVPA 2VX6A 2PE4A 4AWSA 4UZSA 5FJTA 1VHCA 1TPVA 1XRFA 3WH6A 6REQA 3LA4A 4EPEC 3PUDA 3WH5A 3TP4A 3WJSA 3ORWA 1XG4A 5D2WA 3TMLA 1GCYA 2WJEA 1TX2A 2J6VA 4FMVA 1A4MA 2CHNA 1UKSA 4G1NA 3UGRA 4PTWA 3DN5A 1K3UA 3CL7A 5IXEA 1UKOA 1DE6A 2PA6A 3BMXA 3GHRA 3GH7A 3CH9A 3SDOA 4W7WA 2J62A 3N13A 1UJPA 4N7QA 1QNPA 1FHDA 2ZZ6A 1MXGA 3SCNA 2G50A 3W86A 3GC4A 3SCOA 1YPFA 4FR1A 4GQGA 4POCA 3CEPA 2P3ZA 3VAVA 2WZEA 2Y88A 2Q3OA 2V3DA 5I02A 3MYPA 1VQTA 2QCMA 4MSSA 2V3FA 2YA2A 2VC7A 2WQPA 4S2CA 3WDQA 1TPH1 1V3JA 1UZ4A 4WY0B 1WOAA 2WVVB 3LCLA 3TQVA 3W1PA 4L61A 4XD3A 4BFAA 4IH3A 5FSEC 3BLIA 3V0UA 4ATLA 1JFXA 1MUWA 1S2WA 3ID7A 1ZHAA 4NY2A 1K8XA 1WBHA 2FKPA 4HTYA 2GDVA 2YCJA 1TV7A 3BSHA 4ICNA 3T8LA 4MZYA 5D38A 2NQLA 3KEHA 4HIBA 2DP3A 2GDQA 2YJQA 3HQOA 2DQWA 3KRZA 3NUKA 2IMRA 3JW7A 3KLKA 1LWJA 3GHTA 4Y8EA 1Z89A 4IUGA 3OJGA 2VFDA 3WCZA 2WVTA 1K9DA 3E0VA 3BICA 1R9XA 2OXNA 3DOPA 3VOFA 2ZADA 2HE8A 4IMCA 3KRSA 3E02A 2Z7KA 3KS5A 4YMZA 2LLEA 1P1XA 3KTXA 2JIWA 2HPIA 3LXCA 1RLDA 4G2DA 4X9SA 1QT1A 4JGDA 1NIUA 5IHSA 4GCXA 1PEZA 4HJFA 3W7IA 4JOMA 2QKFA 4JCLA 5EPDA 4Q7IA 3E0IA 3F4VA 1JDFA 3NXFA 3TWBA 2J77A 2ABBA 4WUIA 3OZMA 3YPIA 3B97A 1PIGA 1QTWA 4NRRA 4HSOA 4FLOA 2BXVA 3KOFA 1XYZA 1PSCA 1S39A 5HANA 1BAGA 3IWPA 4Q6XA 2XSAA 1WDDA 1TJ0A 1JG9A 1KA9F 3O2LA 4WCJA 1ODUA 1QK2A 2I1OA 3RG6A 4QROA 3UZ5A 1P6CA 3GDLA 5LA1A 1PXGA 4KWUA 4CEUC 4YCOA 2GLKA 4P8VA 3LZ3A 1N8IA 1K7XA 3M5YA 3O6DA 4EK7A 4DY1A 3W1QA 4HMEA 3CV1A 3L0KA 1A47A 1JYNA 4FAMA 3V5CA 1HF6A 2RH9A 1ISYA 2GGHA 3MC5A 1ECEA 2D1ZA 3CHFA 1CXEA 3ABZA 1SZGA 5J5RA 2HXTA 3WD0A 1PWMA 1XKYA 1W8SA 4WSHA 4WZHA 3ALFA 1D3CA 2A2IA 2FH8A 4IF2A 1RCXB 3HV9A 4HNOA 4PUWA 1M04A 3NNTA 2Z1WA 1OIFA 4DWDA 4PTVA 1GTEA 1DQUA 1Z42A 2Z00A 3ISIX 1YBQA 3VGEA 3TXVA 4IM4A 2V68A 4DM1A 2OOGA 5AYIA 1GKQA 3A5VA 5HWMA 3N29A 5D9NA 3URBA 4XZMX 1XUZA 1R7AA 4GMEA 4D6FA 4IJCA 1ADDA 2ZIDA 1XG3A 3QH2A 1WDPA 3KBWA 4IICA 4AEFA 1YQ2A 4A8RA 1IEIA 5HNNA 2PC4A 1V0KA 3DZ1A 1T96A 4NXKA 3T0TA 3OYZA 2NQ9A 3F1QA 3PWAA 3NQ8A 4J3WA 1Q6FA 4JTGA 3NEHA 4AIUA 2X8RA 3QV6A 2ATMA 4H9XA 5FL0A 2VR5A 4W8AA 3W1RA 1R2TA 2OX1A 1KM0A 4J3ZA 1KRBC 3WNLA 2ZRVA 5CGTA 2DY3A 3GXDA 2WSYA 4J3XA 3RO8A 1IT8A 3N6QA 3WD4A 3E0LA 3H7RA 1AMKA 2ZRXA 1TQJA 2PF0A 4N6EA 4R3UA 4MMWA 1MW2A 3WQFA 1H41A 1XYAA 4LY4A 3RM9A 4MVAA 3OU8A 8RUCA 2E5DA 4Q6JA 3SAZA 1POJA 2CITA 3GTFA 4MY9A 2E8ZA 3O1NA 1OQFA 1VLWA 5FF0A 5FSDC 4K1WA 1Z8AA 5A6MA 3W0KA 4NSBA 3RCMA 1S2AA 1P43A 2PU1A 2E6YA 2BTMA 5A6LA 3WNOA 1O60A 3M46A 4GBDA 2X0SA 5AHFA 1M9HA 4FNRA 4E3VA 3VMPA 5DRIA 1ELSA 2Z1BA 3R43A 2NXHA 2QAFA 3C2YA 2BV9A 2BGQA 3IRDA 1BF6A 1EEXA 2H3BA 3CHEA 2Y7FA 3DG7A 3SY1A 4XAZA 3QGAC 4XO6A 1MNZA 4UOJA 3W72A 3A23A 4F3HA 1HKMA 2XWEA 3AU6A 1JD9A 1F74A 3BLKA 4F0HA 5A6KA 2IKJA 2WMJA 2X42A 4I5RA 1DHPA 1ECQA 3NVDA 4KETA 4YS1A 3TJLA 4ERAA 1B3YA 4KFPA 3CM4A 4G9PA 3SCPA 1HKIA 1ZQ5A 3RU6A 3UY8A 4LX4A 2OVLA 4IXHA 3WD1A 1QNVA 3NZRA 2CHRA 2VX7A 6PTDA 4QE5A 2BOGX 2DUXA 1QBAA 1UZ1A 4LJ3A 4A3UA 1F07A 3QRHA 4LV4A 4XVEA 1KO0A 1UWIA 3AICA 2V5CA 1HKVA 1XYMA 5FESA 2PDIA 4C6DA 2A5HA 4LOCA 2H8ZA 3KOXA 5HOSA 4LUSA 5CPTA 3G0UA 4N42A 1RCQA 2CBIA 3O7UA 3N9KA 4KGJA 4J40A 3WEOA 3NM3A 2BOFX 1UOZA 1ONXA 1RSCA 3PK7A 2YCEA 1OX5A 3TN5A 4ATDA 4W4QA 3FGCB 3NQCA 1GKRA 2BVYA 2O9TA 3CUIA 3E0FA 4CU6A 2ZX5A 1E4LA 2OR2A 3T07A 3HM7A 3EX4A 1OFQA 1JZ4A 2UV8G 5U7SA 4PTMA 5CPLA 3H2CA 4PB3A 4W5UA 3EXRA 4MKNA 2FJKA 1KXHA 4NVTA 2V8ZA 2PZ0A 1NU5A 1IF2A 1XH0A 2D2GA 2UY2A 1JFHA 3AMKA 3W01A 3HZ3A 4Y9MA 1JYVA 3FYYA 3PZNA 2ISDA 4I9TA 4EPDC 3QFWA 1SR9A 3BGAA 2J7DA 5M03A 4G7EB 2YPIA 3M43A 1XQKA 3OW1A 5TD4A 2V5DA 2HISA 5DMMA 1FDZA 4DVOA 2GSEA 5H91A 2A79A 2PS2A 1R8LA 3BLLA 3OLEA 4A8NA 3VDAA 3CS2A 1RQEA 3LV6A 3TN3A 3BCDA 2VP8A 1TPB1 1TA3A 4C6NA 3KBSA 5E6YA 4AU0A 4IOTA 4FF5A 4GFIA 5D32A 2IQDA 4RLIA 1TMQA 4C6QA 5G2IA 4D6DA 1JUEA 3H6OA 2DZPA 3GR7A 2INZA 2V5KA 4NZFA 3GLCA 2V81A 1A49A 5CSUA 3LXBA 4J4KA 3MV01 4DZAA 1Z32X 3P7YA 1UH3A 2EPKX 1OY0A 1XIMA 5J8LA 1U2YA 3WQ5A 5LIYX 3UPBA 1BF2A 1A4LA 4BA0A 1E9IA 1FP9A 3PANA 1CZ1A 1EWDA 1FY6A 3FVMA 4OT7A 2NSOA 2E9BA 3FAXA 4M56A 3FNDA 3TAOA 3W7HA 5JXQA 4DNMA 4O50A 3I10A 4CNSA 3GHSA 3S6OA 2G96A 2JEQA 4WXYA 3UZZA 3MCMA 2ZUMA 5BWFA 3R2GA 1OFEA 2HQAA 2ZA3A 5DBUA 1VRDA 1FFQA 4A29A 3A4WA 4Q8NA 4HYVA 3BWWA 3GW3A 2YCLA 3R7MA 4LS2A 4RDWA 1DJNA 1GEQA 3NYZA 3UXAA 3WLLA 4RE4A 4LC6A 4ILSA 4ADUA 1LBFA 4NILA 3FSTA 1ZJAA 2FDMA 1Q6RA 7REQB 4HHLA 4JTJA 5EYWA 1EDQA 1FFRA 1SM9A 2ZX8A 5E6ZA 1X6UA 1XGDA 2WO5A 4H01A 3GR4A 2E1DA 1IXPA 1S2CA 5JU6A 3IACA 5IFTA 1ZPTA 5AHEA 2WC3A 2VZSA 3C3NA 1I0BA 4DBUA 5KEZA 2NW0A 3HB9A 3L12A 4ONVA 4IG2A 3PG9A 1EC7A 3UY7A 4URIA 3DEQA 1GQLA 6ENLA 2PMQA 4O28A 4DO7A 1EIXA 1AD4A 4GGHA 1TTJA 1KCKA 1NARA 3LK6A 5BXSA 4M6PA 3H2MA 3NM1A 3EOLA 4FOKA 4E8GA 3CZ8A 3W2NA 3KOZA 4OVXA 2J6XA 4PN2A 1FHLA 4MOZA 4FPSA 3S5NA 3VVGA 2X2GA 1U5HA 1Z7AA 3NPVA 3VD7A 2PF8A 1BGAA 4CCCA 2VZVA 4JIHA 3CAKA 2F2HA 2XM1A 3GUWA 3T2QA 4KESA 4IJRA 5FF2A 3UF9A 2TODA 4IIFA 4C65A 3TYAA 3H2FA 2E6DA 3TA6A 5I77A 3UXKA 4TQTA 5FJPA 1EA9C 1TPWA 5TQLA 4PFHA 3MKCA 4HD5A 3SRKA 3TSBA 1V6WA 3FK4A 2PD9A 3GC5A 3TQPA 4UC5A 4HZ7A 2BOEX 2C14A 1TELA 4C6BA 1GOKA 2ODOA 4Z1BA 4JIQA 1ZENA 2OKTA 2X41A 4MB4A 2VCCA 2YDAA 1JCNA 3WLHA 1OD8A 1FWDC 1O94A 1YIXA 3VNYA 2HDJA 1GYLA 1UOKA 4US6A 3TYEA 1E73M 2X16A 1X8CA 3MUXA 3FSUA 1GQIA 4MPQA 3EWUA 1WNOA 1KTCA 3W7KA 4RNFA 2IPWA 2NT0A 4IPLA 2R1NA 3PZOA 3I6TA 3NZPA 1Z44A 4E8DA 1DV7A 2GWGA 2QMKA 5LHEA 1MUMA 1XD0A 2P53A 1GVEA 3R8HA 4RJEA 3EOUA 3IK2A 3U2OA 2HNEA 4TTUA 3E74A 4GPNA 3TC6A 4REQB 2AL2B 2PWVA 3VIOA 2VRQA 4CVUA 1SZEA 1GWJA 5HJYA 4FXSA 4J2MA 5GJMA 1P0EA 4DN1A 1ZS2A 3VIHA 5JIWA 4AD5A 1OX4A 1OFPA 4UTUA 4DXVA 2ZTJA 4AVOA 1IR2A 5DANA 5C8BB 3TOYA 1BG4A 5T9BG 1V79A 5HINA 1JZ7A 2OSXA 2MNRA 5E0CA 3WL0A 1FCQA 4K7VA 1OZMA 3V5FA 2VYOA 5EKYA 4PGLA 1A53A 2O9RA 2CZVA 4L6OA 1SO6A 4ACZA 1VH7A 3C2EA 1D7FA 4W93A 4NJHA 3AS0A 4IP4A 3VM5A 1DPMA 4DBWA 3HN3A 5CJMA 1WXZA 4LEFA 3OGVA 1V3LA 1W8GA 2OZ8A 3GYEA 4ZBCA 1U22A 2E40A 1UP3A 3EBVA 1PIFA 3TV8A 1B3VA 2ISSA 2PDBA 4S1FA 4MYAA 1OWQA 3E2RA 1PWLA 3AWOA 3QZEA 1IWBA 3LCXA 3LBMA 3OZYA 3CHVA 1TTIA 1XCFA 4JQ2A 3AXKA 3T0BA 3UNTA 3R8RA 1WDRA 4H04A 1KQZA 3AIEA 3PAOA 2QJIA 1UBSA 2VO5A 1W1PA 3WF2A 3USZA 3KBMA 3GVRA 2R8WA 1R9ZA 3N2MA 1PTAA 3L68A 3W7PA 2D2HA 3NPUA 2OYLA 3S5OA 2EJ1A 1L8NA 3TYBA 4HNTA 5FF4A 3N4EA 1ODZA 1CXLA 4MZ1A 1KXQA 1R3RA 1W9DM 3EPNA 4UTWA 2X1IA 1K9FA 2GJXA 1UH4A 3SN1A 1TR9A 4P8XA 3QGKC 1QAPA 3OOQA 3ZT7A 4US5A 3WDRA 3K8MA 4O1AA 1WKDA 3G5EA 4M8UA 2ZRWA 2VEFA 3GDMA 4JYFA 3E3HA 4GVGA 1XGEA 3MT1A 4PMYA 1E6ZA 4C60A 2BP1A 1WUFA 4JX6A 2AOSA 1EGZA 3VIMA 5D9MA 1VFSA 4MWAC 1UR4A 8XIAA 3H4WA 3PB2A 4AF0A 3GAYA 2JQXA 3GZ3A 3WF1A 3OIXA 1FWSA 3G1AA 5BOOA 1WV2A 4GX8A 5XINA 3JUGA 2NUYA 4RV3A 4ZEPA 2NLIA 1JD7A 3N19B 4NJIA 3ALGA 1IZJA 5F1UA 1HT6A 1F3EA 4JYDA 3ZSSA 4CEXC 3GY1A 4JTIA 3BCJA 3S1WA 3LGGA 4OECA 4PMOA 1XP3A 4AMCA 3WJYA 2C1IA 4TX9A 4DAFA 2ZUSA 2Z27A 4JHMA 1UPMB 2WHJA 4B3ZA 3DERA 1VJSA 2QJJA 4A8LA 1FKWA 2PFHA 1CGWA 1KR1A 4IPIA 3LI1A 4XZHA 4QJ3B 2BS9A 3EDFA 3LX9A 4JQ4A 2Q8XA 1R85A 4QCFA 1W1ZA 2PDYA 3C86A 1K7EA 1XQLA 5I00A 1VAHA 3PPCA 4WDXA 3USBA 1LJYA 4R9OA 1N8FA 3Q45A 1AL7A 1VD6A 1YLVA 1EH9A 1YTKA 2XFYA 1R9YA 3M0JA 4PB5A 4J28A 3WX7A 2X1TA 2XVPA 3LB0A 4ZTYA 4OQVA 2WZIA 2XH0A 4FX8A 4ZGYA 2E25A 5C5YA 3WQGA 4HNNA 1H2JA 9RUBA 1WE5A 3KL0A 3GW0A 3U7BA 1R7OA 3A12A 3WBYA 5I3GA 2QGHA 2HZGA 1VIWA 3NPWA 3BARA 3IJ6A 1CGVA 2J75A 1AFSA 4ZO8A 3W6LA 3DFSA 4TXEA 1GVYA 2A4AA 5G4HC 5CPOA 1UKQA 4U2YA 1BRLA 4D6IA 5U4NA 1BYAA 1TO3A 1CDGA 2GQ8A 2AL1A 1HX0A 1Q6CA 4PULA 5CG0A 2FTPA 1QI5A 2AKMA 2NWRA 5HAOA 3R89A 1YNQA 1ZU8A 1JZ6A 4EVZA 4QDWA 5AVHA 4H7VA 1XWYA 3TW9A 4N9CA 3STPA 1A5LC 4ZOCA 2GUBA 2A0NA 4MYXA 3C0JA 1PTDA 1Q3NA 4D1IA 3RNDA 2F9RA 2CLEA 3GBDA 1ZLPA 2V69A 2RAGA 4XD6A 3OQEA 4C1NB 1KD0A 1R47A 3ZT6A 3IGSA 2Q02A 5CLWA 5HXMA 3IEBA 5JUVA 3K4AA 1UW9A 3DGRA 1F3WA 3BV4A 2D24A 5LNSA 2OEKA 4XSLA 4MNLA 2VR4A 3F4NA 3VYLA 1MRAA 4H41A 2AGKA 1Q6LA 2ZUWA 3CYVA 4J1OA 4FIRA 3QHMA 2BHUA 1TPEA 2W63A 3EKGA 3F03K 4JDBA 1R3TA 2RHGA 3RM8A 1DIKA 3RGTA 4DJDA 1NH6A 4QQUA 1XYLA 5FJUA 4D8LA 2QV4A 3AXHA 3DI0A 3EPMA 3A9BA 3HMCA 4GXPA 1D3GA 1B9BA 1F5ZA 3TDFA 5C70A 4OTKA 1VHNA 4O1DA 4GH1A 2WVUA 3WQPA 1W5PA 1BKHA 3SUUA 1QNRA 2XGIA 2XISA 1FWAC 3ZS4A 1KC7A 4GNKB 2GK1A 4IX2A 3H23A 3RDKA 3VOJA 4P7NA 1E5NA 3WLKX 4JNMA 2ZXQA 1ALDA 3RO6A 4B5WA 3A21A 1E1CB 3EX6A 3I4EA 4GVFA 3G3DA 1HO1A 2GUYA 5D9PA 4DJFC 4DM2A 1X96A 1SJDA 1H0GA 3W7GA 2YL5A 9XIMA 1A0DA 2XWDA 4F8XA 3VCNA 3KX6A 3F4CA 3I6RA 3SRHA 1DWHM 1SQ7A 4GKLA 2OEMA 3IANA 4DJEA 1WQ5A 1GVQA 3SADA 4FP1A 3QYSA 3AZRA 3MSYA 1FX6A 4MIMA 1F76A 1H63A 5AYXA 4YU1A 1WB0A 4GG9A 4XK2A