5M17A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-1,2-dideoxymannose
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 71
total genus 133
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m17A00
1HKMA 2EBNA 1DWFM 5AC5A 2OWWA 1CPUA 1XD1A 3SCUA 1AMYA 1VJSA 1K6AA 1WDSA 4JFSA 3VPLA 1R85A 5BWFA 7A3HA 4D6EA 3SCOA 1HJSA 2ZUSA 3AOFA 5BXSA 3MUIA 1HL9A 2PI6A 1W3KA 3LPOA 1V6WA 2OYKA 3JUGA 4WLCA 2XGIA 3CPUA 4U2ZA 3RPMA 3PN8A 2EJ1A 1UD5A 1WZAA 2ZX9A 1JAEA 3ARSA 3AROA 3IJ7A 4PCSA 3RIKA 4ZXLA 2WBKA 3VMNA 2A3CA 5C8BB 1AQMA 1WDPA 3I3EA 3DC0A 4U3AA 3T2PA 4IPLA 5I77A 1PBGA 1KGXA 3VDCA 1G9HA 5A69A 4C7FA 3ALFA 3KL3A 5LA0A 5LYRA 1BTCA 1L0PA 2XHYA 5I79A 4MDOA 4J3UA 2VR5A 3I3BA 1BPLB 5BRQA 4PMOA 3AMLA 3T0DA 2UY5A 1QHOA 1WDQA 2BV9A 3ZR5A 4CU8A 1DP0A 3MMWA 1LQ0A 4ATLA 1H0IA 2WZIA 1W3HA 2BS9A 3DHUA 5A8NA 1MW2A 3GDBA 2E8ZA 1ZBCA 1QI2A 3WQWA 3CGTA 2ZXDA 3N17A 5CPSA 4P8VA 4AD4A 2DEPA 1W9PA 4UOJA 5EFDA 1TG7A 1Z32X 1DHKA 2CBIA 5DT7A 2WHMA 1H1NA 1NWUA 2X1IA 5HNNA 1AQ0A 1XH2A 2HISA 4H8HA 1UR4A 3POHA 4WJXA 3K4AA 4W86A 4QLJA 5A2AA 5I24A 3TONA 4W84A 1BSIA 2EEXA 2D0GA 1PIFA 1OBAA 4D6FA 2Z1KA 2W92A 4WIWA 1E0XA 2OYLA 3FNDA 1R87A 3WKZA 2D3NA 4CVWA 1YHTA 4BQ2A 5A6LA 1K9FA 1QI0A 1J0IA 3EMZA 3N1AA 3W6LA 2ZWZA 5CLWA 1B9ZA 2XTKA 3WNKA 1HJWA 3ARQA 3MSGA 1TCMA 5BXPA 1UD4A 4J27A 2CNCA 1V3LA 2WNWA 2ZX5A 4EK7A 2QV4A 3RJYA 3SCSA 4ACZA 2WVTA 3GXDA 4NSBA 1SFSA 5M17A 4GQQA 3RDKA 1MQQA 4E4PA 1GOQA 4JFWA 2CXGA 1FHLA 2WPGA 4R5EA 1BQCA 1KFWA 4KGJA 4AZBA 1EGZA 2CESA 3RM9A 1RP9A 1ZU8A 4EKJA 5D4YA 1QOXA 3U7VA 4PYSA 3SURA 4ZE4A 1P6WA 4MADA 4HU8A 1CLXA 4IM4A 4Z2GA 4B9YA 4F8XA 2EPNA 1E4IA 3A4XA 3WIJA 1UWRA 3AISA 3NJ3A 3T2QA 5GNXA 3AQUA 3QHMA 4NF7A 1NWRA 1QNPA 1VRXA 3CHEA 5BXRA 1W9BM 4D6DA 3T0BA 2J74A 3BCFA 1CDGA 3IAQA 1GW1A 4MNKA 1B31A 1JI2A 5IFPA 1H41A 1FHDA 1E1FA 3VILA 1EH9A 4M29A 1GOIA 4PTWA 2E0PA 3KWXA 1W9UA 2VURA 2XVPA 4HZ7A 3AMCA 5A6MA 4MTVA 3BMVA 5BCAA 2XPKA 2UY4A 3OZOA 1J0KA 3RM8A 3EYPA 2J7GA 4OIFA 2BVYA 3UR8A 1DTUA 4PN2A 2WC4A 3QOMA 3SCTA 4UOZA 3LPPA 4U33A 2J75A 2G8ZA 2PWFA 1E0VA 1UKTA 1MVYA 1VFFA 3FW6A 3MO4A 5A8PA 4UOQA 1GHSA 4NRRA 4PMQA 2WHJA 5KEZA 2X05A 3RILA 1EDTA 1BVZA 1V3HA 2QLYA 3WMCA 5A8MA 1UQZA 2WLZA 3ARXA 1DWGM 2DSUA 2CBUA 4PMYA 4RE3A 2Y8KA 4PTVA 3GM8A 1VENA 4P7NA 1KQYA 1EOMA 2O92A 5JBEA 3WUBA 3FY1A 4ATDA 1PX4A 1UYQA 5CPQA 5A2BA 1E6NA 3AIBA 3AS0A 2XFRA 1H5VA 1LF1A 1BYBA 4GZIA 1JDCA 2A3AA 5EBAA 2GDVA 2WMKA 2O9RA 2XSAA 4KWUA 1FH7A 1OGBA 1CGYA 6A3HA 3W24A 2W5FA 2FHBA 3N13A 1ISXA 4F79A 1HJXA 1WZKA 1FFQA 2EQDA 2UY3A 3CUHA 2YLAA 3ZSTA 1WNOA 3A4WA 3GH4A 3UG4A 1E4NA 5A8OA 3WF0A 1E6PA 1ISVA 1ISYA 3OIHA 3OGVA 4AMCA 2VVSA 3ARTA 3O6AA 3A4AA 2GK1A 3CH9A 4BF7A 3VM7A 3W37A 1RP8A 5FL1A 1J9YA 1B3XA 5GNYA 2XM2A 3N11A 2CCRA 4GO8A 1NOUA 3ZIZA 1J11A 2WVVB 4H04A 3M46A 5E09A 5IXEA 3WBEA 1M7XA 3WD2A 4MNMA 1CENA 5I23A 2VOTA 3F5LA 3KL5A 3QHNA 4MB3A 3ZJ8A 1K9DA 1E73M 4MAZA 4UR9A 2OSWA 3K8LA 5A6AA 4D6IA 1JZ3A 4X0NA 2D22A 4DM1A 1X6LA 4JAWA 3ARZA 3WBAA 2V5DA 4MPKA 1UD3A 4CU7A 2E8YA 3T09A 3E1F1 2WXDM 1V3MA 2OLHA 4PSPA 1KR0A 1US3A 5E0FA 5BYWA 1E4LA 2XJ7A 3GYCA 4HZ6A 2J79A 1ODZA 1UD2A 1C7SA 4PMRA 2A3HA 1UD6A 3MUAA 3IANA 4ZFMA 1HKIA 1CGXA 1VFMA 1GVIA 4D6CA 1VBUA 5M3WA 3VDBA 3VMPA 1E5JA 1JIBA 1UKOA 4HOZA 3VOCA 1F4AA 5I5RA 4H2CA 3CHCA 2D23A 4AD1A 3CHFA 2YL6A 3VIMA 2X2YA 4QP0A 4B3KA 5FCZA 4AZ6A 1RH9A 1U30A 1OT2A 8CGTA 2BHYA 4Z2HA 3ZJ6A 2BNJA 1FP8A 3UEQA 2WKGA 1RD6A 1D2KA 1MQRA 5BRPA 2GJRA 1UHVA 4EANA 3VU2A 3HMCA 2D1ZA 3I3DA 1JZ4A 2VNCA 3N18A 3OG2A 2XM1A 3WF2A 1ZB5A 3AI0A 7CGTA 2WSKA 3MMUA 2GFTA 3VIFA 3M07A 3RCNA 1FA2A 1CLVA 1X6NA 4J3SA 5CPTA 3UETA 1GORA 1JAKA 1EOKA 3FXYA 4X9YA 1UR8A 1V6VA 3BAYA 1GQKA 3PZVA 2ZIDA 1H4PA 1B3ZA 1XSIA 4LQ1A 2CIPA 5D9PA 1XV8A 5DEZA 1HVQA 3AZRA 5A95A 3AS1A 1XD0A 5I3DA 1ISZA 3VX1A 1MFVA 2DT1A 2YL8A 3DECA 3VD7A 2JF6A 2WC3A 1CXEA 2FH8A 4U3CA 5A1AA 1BFNA 1JYNA 4JIEA 3K8MA 3WD4A 1HKKA 2CHOA 2YOCA 1CEOA 5D8WA 1UR1A 2ZWYA 3BAWA 5ABFA 1HT6A 4U31A 3BLPX 4F9DA 4AY1A 4BA0A 3WDRA 5HXMA 2O9TA 2J47A 4AYSA 1US2A 1E3ZA 4ATWA 1UH3A 3WMSA 1VEMA 3AS2A 4GI8A 3BLKA 3LPGA 5A6JA 1UR2A 1WZMA 2XVNA 2WMIB 4RL3A 4V2XA 1HL8A 4OZOA 1E70M 1JXJA 4TX6A 5LA1A 3ARUA 2UY2A 3AIQA 3D5HA 1ZBKA 4UQBA 2W66A 2WMIA 4JKLA 4N42A 3WFZA 1GNXA 5JIPA 2ZXAA 5A8QA 1V0KA 2O9PA 4MB4A 2FHFA 4DWSD 4DUVA 1UR9A 3AMKA 2E40A 2W63A 4H8VA 4RE4A 2JEPA 5A6KA 3AIWA 4CKQA 1W1YA 5D8ZA 5CQ1A 4AD2A 5CLTA 1HIZA 1GQIA 2RGLA 4OOZA 2DT2A 3MV01 3UERA 1QPKA 1DWJM 1R8LA 1B3WA 1X1NA 2ESCA 3SCVA 1MFUA 1EDGA 4V27A 3FHAA 5M03A 2B31A 1UKSA 3PTMA 2CKRA 4W93A 1L8NA 2VQUA 3RO8A 3T08A 1JZ8A 1CGVA 2JIWA 1V6YA 3TTQA 4GKLA 4C7DA 3BC9A 3HU7A 3UCQA 1LWHA 1HN1A 3W38A 4HOXA 3W25A 1EHAA 1J0YA 2AAAA 3VIPA 2DSVA 1OGGA 3W6MA 2WM0A 3BSGA 1R7OA 1QNOA 1QHPA 4GINA 4KH2A 4MDPA 3HN3A 1ESWA 5CSYA 4JCLA 3VIHA 2ZICA 1SMAA 4CN6A 1U2YA 1MQPA 3J7HA 5A2CA 4M82A 4UZSA 4NZCA 1UWUA 2W4XA 2Y24A 3UG3A 1QVBA 1UZ1A 2ZX6A 3RJXA 2QPSA 4OKDA 1OD0A 1JZ5A 2JFEX 1Q4NX 2VR4A 1EXPA 4WSJA 4FMVA 3W4RA 2XG9A 2CETA 1B1YA 3PZOA 1CIUA 3QGVA 4X0VA 4CD6A 1M53A 3GH7A 2BVTA 2CITA 3WD0A 2ZE0A 3WF1A 3ARPA 2MANA 5I6SA 4AIOA 2WAGA 5AC4A 3VKKA 3AXXA 2GJPA 2BY3A 3WQVA 1W3LA 2WVVA 2YA0A 3TP4A 3SCPA 2J7HA 1Q6EA 2EXOA 3AIVA 4H7VA 3ECQA 2BY0A 3BAXA 1KWKA 1JZ7A 3PZTA 3BXWA 3KEHA 3IAPA 3SCNA 4TXEA 2VRJA 3NYDA 1W3JA 3PTQA 2RGMA 2QMJA 2WMGA 3AXHA 3ZM8A 1JFHA 4M56A 3APGA 2YDSA 1LLOA 1GOMA 5A6BA 2WANA 1KB3A 3L4TA 4PMNA 4CCEA 1C92A 3VIOA 3SCRA 2VZSA 3EMCA 4GIAA 1MW0A 4AXNA 3TTOA 1XGZA 4LYRA 3CO4A 3TTSA 3FAXA 4UTFA 5I78A 4U5KA 4ACYA 1GOWA 3ZT6A 2DSKA 2A3EA 4XV0A 2J7DA 4FLRA 3PZMA 3PTKA 1ZBVA 3K46A 4F66A 1W1VA 3ZQ9A 2JEQA 2OSXA 2Y2WA 2VVNA 2PC8A 3U5UA 5AY7A 3DHPA 3EBVA 1JG9A 4J3VA 2AOSA 2EO7A 1N82A 4AZCB 4GO9A 1EHNA 2VCBA 1O7AA 3WMBA 1V02A 3WFLA 2V38A 4HTYA 2F2HA 4B15A 1CXIA 3KZSA 5EMYA 3U7BA 2NSXA 1E15A 3L2MA 3M6DA 5D9NA 4NRSA 2YBTA 3ARVA 4W89A 3AZTA 2HVMA 2O9OA 4CD7A 1CXHA 4J3WA 1BYCA 1J0HA 2DT0A 3OLGA 4IISA 4PCTA 1KQZA 3ZR6A 5A94A 3ZO9A 2WCSA 2OWCA 4AZ5A 2QHAA 3CZ8A 2PWDA 1UKQA 3BAJA 3GNRA 1WE5A 2J7BA 4FLSA 4UNIA 3VNYA 3VDAA 2UWFA 4FK9A 2VUYA 2VCAA 3MUZ1 2VRKA 4PUDA 4W8LA 1A3HA 2PBOA 1GONA 1CECA 4HMDA 3GNOA 3WNLA 3AFBA 2D20A 4P8UA 1VIWA 4P8WA 2GUYA 3WEOA 1H2JA 2VCCA 1UOKA 1QNQA 2F61A 3WD1A 1PPIA 4R27A 1J12A 4LGXA 3PZGA 1BAGA 4AZ7A 3VIGA 5CZKA 1CBGA 1CXFA 3GNPA 3QR3A 1WZLA 4QCFA 2W91A 3CZGA 1UWIA 4HMCA 3BMWA 5GPRA 4W7WA 1WCGA 1AQHA 1E1EA 4PMZA 2QMKA 1KXVA 1MXGA 4LPCA 3VNZA 2FDMA 1G1YA 3AS3A 1VBRA 2V5CA 1LL6A 3NDYA 5F7UA 2CYGA 1OGSA 1WB0A 1W9VA 1XHGA 3WEZA 3UR7A 1ITXA 3W53A 1VEOA 5KZ6A 5HBFA 1JYXA 4A3HA 2Y8VA 3AHZA 1SR0A 1JYVA 1K9EA 2C0HA 3SUTA 1IT0A 4V28A 4PBGA 4IUGA 4UZUA 2XFFA 4ZEPA 1C8QA 1B3VA 2CBVA 4YPJA 3SCQA 1FFRA 1GQJA 3WF3A 3VD3A 1CYGA 1GZJA 4QLKA 4F9JA 1CWYA 4HA1A 4UQEA 2E3ZA 2PWHA 4Z2LA 2BY1A 4P8XA 5GQBA 1I75A 3MV11 2IXUA 4ACZB 1CGUA 3WY1A 3CHDA 4CCDA 1W1TA 3MUY1 5AYIA 5C71A 4AZIA 4P7RA 1E40A 3VIJA 3IJ8A 3DYPA 1V3IA 5ABGA 3WNPA 2D0FA 5FD0A 4D1IA 3THDA 3CZJA 1VFUA 2JF7A 2YBUA 1TFVA 4JL1A 4HMEA 3BH4A 3OLDA 1PZ3A 3AXIA 3O2LA 1W32A 2VZTA 4UFKA 3WDHA 3L4ZA 1WAWA 2YDRA 1HVXA 1E72M 3VIIA 3GBEA 2DQXA 1G94A 1KBBA 4PTMA 4LXFA 1JYWA 3VIKA 1V0MA 3II1A 2JE8A 4URIA 1XCWA 1VEPA 2DH2A 4CUCA 2NT1A 3WUGA 1BG9A 3L4WA 3L4UA 3L2LA 4GPNA 2CEQA 4K68A 4MJ4A 4QCEA 1JZ6A 4W87A 7TAAA 5CGTA 2BY2A 4CD4A 2VZVA 5IHSA 3MMDA 3OBAA 1ZBWA 1FOBA 3OLIA 1J18A 2GSJA 4YHEA 3WENA 3WH5A 2PWGA 4S3JA 4Z2IA 2VQTA 4Y7EA 3EMQA 1E9LA 1V0NA 1HF6A 3K8KA 4LYQA 4D71A 2WK2A 3PZNA 6CGTA 4UQAA 1EO7A 3VD9A 2XYLA 2J78A 3BCDA 3AHTA 4KRUA 3QOKA 1Q6FA 1XH0A 2DT3A 2XUCA 4ZE5A 3WQ8A 2W67A 4HPGA 2J7CA 5DT5A 4QLLA 1W9DM 1GCYA 3CMGA 4MB1A 1XRVA 1KCLA 1CXKA 1M01A 3CBWA 5DMYA 4B9ZA 1HP5A 3OA5A 3B9DA 3F5JA 4JFVA 4Q7NA 1PEZA 1GJUA 4A3YA 1KXQA 4U2YA 3SUWA 1NWSA 1V08A 2Y5EA 4JCMA 1NQ6A 2WMHA 1DEDA 3WF4A 1UZ4A 2JIEA 1C3FA 3G6LA 4DWSA 4AZCA 2YLLA 3M7SA 3SUVA 4L4PA 5ABEA 4P7QA 4AD0A 4Z2JA 5DF0A 4ZXOA 4JHZA 5E9AA 2Y4SA 4UCFA 1QBBA 5CSUA 1Q6DA 1V03A 4E8CA 1M04A 3TOPA 4Z2KA 4W5UA 4AD5A 1BF2A 2FGZA 4D1JA 3GXFA 4HP5A 1V6XA 1WPCA 3OZPA 4BQ4A 1IZJA 3EDKA 1Q6GA 4BZYA 2XIIA 3CTTA 1WDRA 3A3HA 1GOOA 3PZ9A 3FHQA 4AZGA 4YHGA 4ZENA 2XWDA 1QI4A 1XYFA 4CVUA 2VRQA 2Z1SA 1KR1A 4M24A 3EDEA 4D72A 3AICA 1ZL1A 2DH3A 5CJ5A 1HX0A 3T0AA 3KE0A 3KL0A 4OJYA 5DFAA 3PHAA 1B0IA 2XVKA 2ZUMA 3W27A 1EA9C 2ZOXA 1PZ2A 1W91A 4W7VA 3W26A 1W2PA 2E9LA 2ZUUA 1E4MM 2WZEA 4UFIA 2NW0A 2YL9A 3A47A 2EPLX 3CZEA 4DUXA 2G3IA 3THCA 3AHYA 4TVUA 3SEPA 4E8DA 1UH4A 1MWOA 2DIEA 2D2OA 1C90A 1OIMA 2A3BA 4D6JA 1OSEA 2VTFA 1UWSA 1EQPA 5E6ZA 3VGGA 1GOKA 4PRWA 1TA3B 3PZUA 3WNMA 1RPKA 2VI0A 2ZX8A 1WKYA 4J3XA 4AZHA 4DUWA 4LX4A 1CNVA 4BCEA 1LJYA 5JUVA 1E0WA 1W9XA 2WB5A 4JKMA 2E4TA 3N04A 3SUUA 4HA3A 1ISWA 2D24A 1UR0A 1NM9A 1QNSA 4W5ZA 1E6ZA 1QNRA 3RMEA 4KGLA 3CUJA 3OGRA 1BGAA 4CN1A 1XH1A 2EPKX 5JIWA 5ABHA 1BGGA 1JI1A 4JL2A 4QFUA 3VDHA 2C7FA 2BVDA 5IDIA 1HJVA 1KXTA 1R7AA 1EQCA 2YA2A 4DM2A 3AMGA 3U57A 4AC1X 4XB3A 2WCAA 4WKFA 5CXPA 3SUSA 4PTXA 3ALGA 3W28A 3GZAA 3AIRA 1JNEA 4M80A 1JZ2A 2WYSA 4PEEA 5FIPA 3N15A 8A3HA 3VGFA 3WELA 2Q8XA 1SYTA 1HNYA 4TTGA 1JDDA 3N9KA 1NWTA 3IK2A 2XWEA 3WL0A 4JFTA 2XSBA 4GZJA 4MNJA 1B90A 3CLWA 5EFFA 2FH6A 3LPFA 1E6QM 1H3GA 3FAWA 4AW7A 5E70A 1C93A 3WQ5A 1PX8A 4HU0A 1GVYA 2WLYA 4HZ8A 5E0CA 1OM0A 3AZSA 3ZT5A 4A4AA 1UWTA 1BYDA 2WVSA 4HA4A 3SIMA 1EIBA 1NP2A 1JD7A 5A6BD 5ABFB 1W1PA 4KRTA 1J0ZA 3D3AA 3CIVA 2J8GA 1YQ2A 2VX6A 1VFOA 5IFTA 4B3LA 2WSPA 1CTNA 2X0YA 2G4FA 3NUKA 2XGBA 3CUFA 4PMXA 1LWJA 1UWQA 1JDAA 1HJQA 1OCQA 3VTRA 1KBKA 1M03A 4J3TA 1E6SM 2GJXB 4AISA 2VX7A 1NH6A 4M81A 1CGWA 3WN6A 3MKKA 3A6OA 1VF8A 3GTNA 3WEMA 1PX3A 1G01A 3ARRA 3EDDA 1W2VA 4Q22A 2GJXA 1G0CA 2V3GA 1EDQA 3WD3A 3AJ7A 4TTUA 1V3KA 3GXIA 5A6SA 3ZJ7A 2QPUA 1E55A 3BGAA 1AVAA 1PJ9A 2ZX7A 3W81A 5E6YA 1QI5A 2V3DA 2WW5A 3BAIA 3ZMRA 3POCA 1VJZA 3VM5A 5D9OA 3CZKA 4S3KA 3WNOA 2WC7A 1C7TA 2J62A 3NIYA 1LL4A 5HPCA 4BQ3A 4W7UA 1LL7A 4D6HA 4RE2A 1U33A 4XUYA 1KGWA 1TUXA 1C8XA 2X8RA 3VO0A 1HKJA 3CMJA 2WHLA 3NDZA 2GDUA 4MNLA 3WH9A 1JL8A 4UQ9A 3TA9A 3FN9A 3CUGA 2ZXQA 3VGEA 2BHZA 4WSKA 5JBFA 1XSJA 1PIGA 2D0HA 1KCKA 4CN4A 4DWSB 2E9BA 2ZXBA 1TVNA 2DPEA 4H41A 3VD4A 3B8SA 1ECEA 4BS0A 1GHRA 3B9EA 2CPUA 2PB1A 1NOFA 5DO8A 9CGTA 3F4VA 1MW1A 4CD8A 4HOWA 4W8BA 2J77A 2CHNA 2D3LA 3S2CA 4W88A 1TR1A 2BXZA 2WKLA 2CERA 2NT0A 1CGTA 4XX6A 1JFXA 3F5KA 4AD3A 1BLIA 4MAVA 1I1WA 2FHCA 4IPNB 1WO2A 1B30A 3WH6A 1LG1A 4OBRA 5ECUA 3WH7A 4B16A 3MS8A 1NARA 1JGIA 3UESA 1CXLA 3MSDA 1QW8A 1CZ1A 1QBAA 1FH8A 5IHRA 4WK9A 2JALA 2DSWA 1JD9A 3VX0A 4BQ5A 2OSYA 3N12A 1UA3A 3VGBA 5HPOA 1OD8A 3AIUA 1UD8A 2ZUWA 4H8UA 1QW9A 4JKKA 2OYMA 5D9MA 2VJXA 3AYRA 4AEEA 1G5AA 2WHKA 3K1DA 1ZS2A 2W61A 3AIEA 4UFLA 1XYZA 2J7FA 4FLQA 3CZLA 5CGMA 1JNDA 3L4XA 5HDRA 1A47A 2WBGA 4OUEA 3MU7A 4TUFA 1V3JA 2DDXA 1UQYA 4FLOA 3S6TA 2DSZA 2EPMX 1C8YA 1UA7A 2J25A 1BG4A 1B3YA 1K9TA 1UH2A 1KGUA 2YJQA 4JHOA 3W29A 5A3HA 4M8UA 2J7EA 3WDPP 2J8FA 1DWIM 1BYAA 4PMVA 3VGDA 2J4GA 5HOSA 3EDJA 4XZBA 3K4DA 1MW3A 2TAAA 4CD5A 1C91A 1ZJBA 1GJWA 6TAAA 1TMQA 4UFHA 5FOOA 2VT0A 3WDQA 2BFGA 2CKSA 2V3EA 3UG5A 2WMJA 3IJ9A 3ZSSA 3WUEA 3NSXA 3O9NA 3HJEA 2VMFA 2VZOA 1OWQA 3OB8A 4EAMA 2E9MA 3ZJKA 5C70A 1R86A 1UUQA 3AYSA 2EPOA 2DIJA 1E6XM 1ODUA 1VAHA 3EDFA 2X0HA 5I0DA 3CUIA 3W0KA 3ARYA 1IV8A 1GQLA 1J01A 3VVGA 3B9AA 4GI6A 2ZUVA 4WKHA 1V6UA 4CU6A 4J28A 2F8QA 2CBJA 1TVPA 3WQ6A 3MANA 1WP6A 3BSHA 3VUPA 4XZWA 1HP4A 1QI3A 1QHZA 5EB8A 2WZHA 3WH8A 1OINA 1IZKA 2PWEA 1D3CA 3GH5A 3BAKA 1HJUA 2V3FA 4UQDA 1S46A 2X09A 1TA3A 2VL4A 1E56A 5JBDA 4TX8A 1ZJAA 1E3XA 3WQ4A 3U5YA 5I2UA 3PZIA 1V0LA 4MJ2A 1I1XA 4GI9A 2W62A 4C7GA 1O6IA 1KXHA 4TOQA 1NP0A 1TE1A 2G3NA 4JZ5A 3ZT7A 1JF6A 1MXDA 2PF0A 4QDMA 4N0RA 1NOWA 2GVYA 4YN5A 1H49A 1J10A 2FGLA 3VD5A 1UKPA 1MYRA 4P7OA 4WF7A 2IUZA 4GQRA 5FKYA 2VX4A 4PSRA 5LA2A 5TD4A 1GUVA 4LYPA 3WSUA 4PMUA 3LMYA 1JXKA 3ZOAA 4GXPA 2C8NA 1UG6A 1Y7VA 2YL5A 2PBGA 1FP9A 1J0JA 4OBSA 2G3MA 1E5NA 3NSNA 1H0GA 4TVCA 5BROA 4OOUA 1JF5A 1DWAM 4KMQA 1DWHM 3GXMA 4HPHA 2BXYA 3ARWA 3OLEA 2G41A 2VO5A 3QHOA 3PBGA 3VMOA 3AHXA 4CCCA 1GPFA 4M1RA 3RM4A 2XIBA 3L4YA 1D7FA 4FF5A 1VB9A 4PUEA 4UQCA 2DGAA 3DYMA 2ZUTA 4DWSC 1XC6A 2GK1B 2YIHA 2OWXA 1E43A 1EO5A 3NSMA 5BXTA 2YA1A 3VGHA 4AEFA 3WNNA 2WMFA 4E2OA 1ITCA 4AIEA 2G3JA 1XSKA 1H09A 2YKKA 1F4HA 1HXJA 1OB0A 4EE9A 3WDJA 2QF8A 4J7RA 4L4OA 4MB5A 2AMGA 3AMDA 1E6RA 4TVDA 5M5DA 4ML4A 4NI3A 1TZ7A 1H11A 1E71M 2XFYA 4UFJA 4QAWA 4WKAA 3OGSA 1PAMA 3WL1A 2VC9A 4P7LA 3T2OA 3SCWA 3DYOA 4AWEA 4CGTA 2WWCA 2IXVA 2BHUA 2WCGA 4W8AA 1BVNP 1BHGA 1KWGA 3PZQA 1SMDA 3L4VA 1FH9A 5CG0A 2YDQA 4PMDA 4JFUA 3TTYA 3NCOA 1OT1A 2WWDA 3WUFA 5AYBA 4GZEA 4U5IA 2VX5A 2WVUA 4D6GA 3VINA 5FL0A 4W85A 1LG2A 4AIUA 2VZUA 1V02E 3AHVA 5GNZA 4UFMA 3GBDA 1OIFA 3WDIA 2XVGA 2XVLA 3G6MA 1XCXA 1B2YA 2ZUNA 3W82A 1Q6CA
chains in the Genus database with same CATH superfamily
1HKMA 4GE8A 3V18A 5AC5A 4L80A 5D04C 4ICMA 1CPUA 5HMSA 1VJSA 4JFSA 3SZ8A 4LB3A 2QV5A 4GD0A 1EJWC 3WLKX 1HG3A 5HJLA 1QAPA 1KM4A 3LPOA 5K9CA 2Y5JA 2XGIA 3W75A 3CPUA 4FX8A 3RPMA 2H6RA 3BDKA 3WLSA 1XDJA 2ZX9A 3IJ7A 3E0FA 2NQ9A 4ZXLA 1XLLA 2A3CA 3DC0A 3A24A 5IM51 2ZRWA 2OOFA 4GUGA 3ALFA 3EEZA 4F0LA 3KL3A 4MOZA 2XHYA 4RW5A 4O57A 4MDOA 3ZR4A 4BWLA 3THQA 3U2CA 3I3BA 1BPLB 5BRQA 3BW2A 1TIWA 4PMOA 4F48A 4WOZA 4A05A 2FFIA 3G3MA 3GAKA 1I60A 2BDQA 2BV9A 2RDTA 4CU8A 4FXFA 4ATLA 3FA3A 1W3HA 3V7PA 3A13A 2E8ZA 4HA0A 1ZBCA 2HV5A 1QI2A 3I4KA 3WQWA 3LGDA 3N17A 3OVPA 4C6EA 1W9PA 2TYSA 4O1CA 3NPWA 5DELA 2R91A 1H1NA 1NWUA 2X1IA 3CL8A 1AQ0A 2HISA 4H8HA 1UR4A 4WJXA 3TQVA 4W86A 4QLJA 5I24A 4W84A 4PB3A 1BSIA 2QJHA 1PIFA 2Z1KA 7REQB 2OYLA 3FNDA 1R87A 4D9PA 3WLRA 1WV2A 2BWGA 3S6DA 3E5PA 1W1ZA 1YIXA 3NEHA 2INEA 5HAOA 2BODX 5DBUA 2PWUA 1ME8A 1Q63A 1QI0A 1K4GA 3N1AA 3W6LA 5CLWA 5H91A 3RN6A 4O0QA 4GACA 4J27A 2QV4A 3SCSA 3DFOA 1SW7A 1SFSA 5M17A 3NQFA 4GQQA 1ICPA 2QCLA 4LAUA 1MQQA 4HT3A 4JFWA 2IKHA 3IGHX 1UROA 3PSVA 4EKJA 2I56A 4IM4A 1VFSA 2VDIA 3AISA 3C0SA 1RBAA 5IBXC 2PGEA 2HVNA 3RGTA 1NWRA 1ONXA 5F2LA 2DUAA 1XRFA 1MXSA 1Y5WA 1S5TA 3B40A 3BCFA 3B9NA 2FTYA 3IAQA 4HMNA 3T44A 4XO6A 1B31A 5IFPA 3VILA 3B3DA 4PTWA 4UNKA 3GTFA 3AMCA 3BMVA 5BCAA 2UY4A 3DCPA 1J0KA 5HR7A 1G67A 3B8TA 3SCTA 4UOZA 3LPPA 1P6CA 1GVFA 2J75A 4IMGA 1GTHA 1MVYA 1UKTA 1ZAHA 4O16A 4UOQA 2OKTA 1T40A 3WQDA 4WDWA 4F2BA 5G1MA 1Z7AA 1X1OA 4LV4A 5IRPA 1XLAA 2DSUA 2CBUA 4L56A 2PLKA 2Y8KA 4P7NA 1A5OC 2O92A 3THAA 5D03A 5JBEA 3QR1A 4Z42C 1KRCC 2NV2A 4ATDA 3QEZA 4XKYB 1UYQA 1DORA 1GJPA 1LF1A 1VFLA 3W1LA 2A3AA 4G5DA 2V2DA 2VR2A 2NVCA 2GDVA 1ZP3A 2O9RA 2XSAA 4KWUA 1FH7A 1JRCA 2HCVA 2FMNA 1XIIA 1OGBA 3SGUA 3G1RA 3O16A 3W24A 4E38A 4LF1A 1G4SA 1NJJA 1ZLPA 4F79A 3TJXA 1DOSA 4K7VA 3W7CA 3DFSA 4QSHA 3ZSTA 1WNOA 3A4JA 4ILSA 1IT8A 2Z2UA 1E4NA 3FIGA 2C15A 3MQTA 4OWGA 5CH9A 4JQ4A 5HANA 3WF0A 1E6PA 2VVSA 1TUFA 1I0DA 4BKNA 2ZC8A 1BVWA 5F2IA 4ROPA 3UU0A 4F2TA 3SR7A 1RP8A 2OR2A 2BVWA 3ITOA 1J9YA 1B3XA 3MDUA 5GNYA 1ZALA 2CCRA 2R24A 2WVVB 4KW2A 3FK4A 3M46A 3LB0A 3GR8A 3OYXA 1M7XA 4MNMA 1CENA 3W22A 3KL5A 3HIJA 3FKRA 1K9DA 1E73M 1VRDA 4UR9A 1P1MA 1DIEA 1QU4A 3TYUA 5BZAA 4DM1A 3IUHA 4WD0A 3ARZA 3WBAA 2V5DA 1KA9F 1UD3A 2KAUC 1VPXA 3LA4A 1PHWA 2Q3RA 3QYQA 4ZQOA 3CMFA 3KOZA 1V3MA 1KR0A 3W7PA 1E4LA 1QK2A 1A5KC 1WKDA 3TU9A 1P7TA 4IT1A 4PMRA 2A3HA 1TWZA 1UD6A 3WQPA 3QQ1A 1K4HA 1HKIA 1AZ1A 4NP7A 1XLMA 4H19A 3RX2A 4D6CA 3VDBA 4LYKA 4AVFA 3DBPA 1TWSA 2IKGA 4H2CA 3CHCA 2D23A 3CUZA 4MJMA 2DVTA 3CHFA 2YL6A 4AZ6A 2ZRXA 3B0PA 8CGTA 4LY4A 1ZAIA 4Z2HA 4PUWA 4FIQA 3UY7A 5CKSA 1FTXA 1XM3A 3V0SA 2C1IA 4ERGA 3ITXA 3HMCA 3I3DA 1JZ4A 1ZRQA 1I2QA 3AI0A 1A5CA 2E68A 2GGEA 5C0QA 1FWAC 1W1A1 3B0YA 2CLIA 3CV1A 1JUBA 5CPTA 4NQ1A 1REQB 1GORA 1JAKA 2QCMA 2QUUA 4ROQA 4X9YA 1UR8A 1V6VA 3MHGA 4OGZA 4Q4QA 5JH2A 4LS1A 1F3WA 4DJDC 1H4PA 3KRBA 1XSIA 1PYFA 2C1HA 4LQ1A 4JTCA 3UCDA 2CIPA 3PJTA 2V63A 4ZB2A 1V51A 1H1ZA 5A95A 5CBIA 1K70A 2I14A 2ZVIA 2DT1A 3RCYA 1YPFA 3VD7A 3IACA 3RU8X 4U3CA 1BFNA 3HGRA 5F1UA 1L2QA 3FLUA 3S1UA 4GMEA 1CEOA 1EYWA 2ZWYA 4KWSA 1HT6A 2XDFA 2ZZ7A 3BLPX 2VXNA 4DVOA 4BA0A 3WDRA 2G0WA 4JEJA 5HXMA 3STGA 1US2A 1E3ZA 3LX9A 2ASHA 4WVXA 4ATWA 2OXNA 2OEMA 4GI8A 5LHEA 3KXQA 2HK1A 1WZMA 3BSMA 3QXBA 1IQ8A 5FF2A 2WMIB 3GX9A 3TW7A 1A3XA 3FJ6A 4GCXA 3MJMA 3KBWA 3D5HA 1EC8A 2VC7A 2NXGA 2W66A 3IVSA 4UQBA 3TH6A 1EC7A 1THFD 1EWEA 3SO7A 1V0KA 2O9PA 4MB4A 3UJ2A 4DWSD 4ZQRA 5I3IA 3M0ZA 4JTDA 2ACSA 2BGSA 3AIWA 1W1YA 3NO1A 1A50A 4OOZA 3UERA 1QPKA 3BOLA 1RR2A 1YTDA 6REQB 1DWJM 4V27A 1ONRA 5M03A 1YDOA 1G69A 1PZ1A 2VQUA 3NVDA 3LXBA 4C90A 1V6YA 4GK8A 3S46A 2WZTA 3RX4A 4GKLA 2IPWA 3TTQA 3BC9A 5KSWA 1XLDA 1O60A 1HN1A 3W38A 4B2DD 1DQXA 1SO6A 3FXGA 1C8VA 5F2GA 3GXTA 2WM0A 5HATA 3BSGA 1QNOA 1QHPA 1EX1A 4GINA 4MDPA 3HN3A 3LQLA 1GOXA 2ZICA 3IJLA 4ORIA 4CN6A 2YW4A 3WBYA 1U2YA 4L1WA 3I7RA 2B7QA 3H26A 1IGSA 5A2CA 4HQVA 1A3WA 1FDZA 4UZSA 1RALA 3DXIA 1VFHA 1R38A 4ALDA 4N4PA 2BTMA 1Q4NX 3EKLA 5LNRA 1EXPA 3WO8A 1I2NA 1XYCA 4LUSA 1CIUA 3CYJA 1J5TA 1ZP4A 2BVTA 2BOGX 2CITA 1M41A 2XU2A 1T5AA 3WLNA 1X96A 1GVQA 1D8WA 5AC8A 4MZ1A 1SO3A 2BY3A 3B03A 3WQVA 4DZIA 3OO2A 1F8IA 1OG0A 4R9OA 1VH7A 1QR7A 1W8SA 2QYGA 3KEHA 3IAPA 3ZZ1A 4NAFA 1ZZMA 2VRJA 4NNBA 1ZJIA 3W1NA 2YDSA 1EZ2A 4QJ3B 3SGGA 2WANA 1KB3A 4PMNA 4H8NA 5BU9A 2VZSA 3EMCA 4M6PA 1DJNA 3M0LA 1K8CA 3W02A 1ZPTA 2P53A 1O95A 3G1AA 3KTXA 1GOWA 2DSKA 4XV0A 2I57A 2QIWA 9RUBA 3GNNA 3S3GA 3PTKA 1MZHA 4IMEA 4F66A 2JEQA 2Y2WA 3DI1A 1GKRA 4H9ZA 1N2VA 3W2JA 4KEVA 3UNTA 4J3VA 3GAYA 1EHNA 3WMBA 3FEMA 4JD4A 4JHMA 4AHQA 4BHYA 5K9DA 3U7BA 2NSXA 4ZQCA 2HDJA 4HGXA 5FESA 2ZDRA 3KAOA 1AODA 1MUCA 4FHAA 5D9NA 3AXMA 4UTKA 3LU2A 3AZTA 3WQFA 3W7DA 2O9OA 4CD7A 4YVPA 4WSHA 3N25A 3O1NA 5CC6A 4J3WA 3QM3A 2EKGA 2VC5A 4AAJA 1FKXA 1J0HA 5U7SA 3OLGA 3QY7A 1Z42A 3ZR6A 1ZENA 1IR2A 4FXJA 4H2HA 2OWCA 5LHFA 3LRLA 1WE5A 2J7BA 5DMNA 2FLIA 5I02A 3NO5A 4HIBA 3V75A 4TMCA 3KLLA 1A3HA 1S3HA 4EPDC 4IP4A 4ZCWA 1IIGA 4LUYA 1H7WA 4HN4A 1CECA 4O14A 4DI9A 3GNOA 1EGMA 3AFBA 2D20A 1VIWA 2GUYA 1UOKA 3VOGA 3GWQA 3W84A 4MUPA 3ZS4A 3UGVA 4R27A 2E1DA 2OT0A 2Y7EA 2E25A 4QG6A 3USZA 4FAMA 2YCLB 4IGHA 4QCFA 1XDLA 4HMCA 5GPRA 2I5QA 5TQLA 4W7WA 1E1EA 4CNPA 4GLEA 3TV8A 4BR1A 5C2XA 4US6A 3R94A 4MY1A 1NFBA 1IEWA 1W9VA 3Q2DA 3S9ZA 1XLKA 3W53A 2EG6A 4WOQA 1VEOA 1X97A 1AQFA 2QCDA 5AZ0A 1YE6A 4OV4A 1SR0A 4OV9A 3L9CA 1F73A 1K9EA 1KNWA 1S2CA 4UZUA 2Q8LA 3EX1A 4ADSA 1K7FA 5DCEA 1WBJA 3M9YA 4TV6A 3E0IA 1EJXC 3JW7A 1VP5A 1QO2A 1FFRA 3DESA 3WF3A 1XQKA 4RPPA 4A3UA 3ABZA 2PWHA 2ISVA 3KOFA 1KRMA 1PYMA 4XZLX 1LOLA 4EVZA 3DI0A 1EX5A 1RVKA 3CHDA 4R7OA 2PA6A 3G77A 3C2FA 3KFTA 1W1TA 5AYIA 4AZIA 1E40A 5G5IA 3UWVA 2CLLA 3IJ8A 3NQ6A 1XYAA 3WNPA 2D0FA 3ITGA 4KT2A 3I6EA 1AJZA 1O94A 3QF0A 4BI7A 3THDA 1VFUA 3UG8A 1TFVA 3WJXA 1MUWA 3OLDA 3AXIA 1W32A 1W6TA 3UA3A 1OC6A 2YDRA 1LBMA 1Q65A 3GBEA 1A4MA 4LXFA 1G7UA 3VIKA 2DZBA 3ONCA 1F8MA 1JCMP 1VEPA 3IJ6A 4CUCA 4Z1DA 3L4WA 1EPVA 3ELFA 3RAOA 3NOYA 4Q8OA 4QCEA 3KVMA 7TAAA 4IL2A 5CGTA 2BY2A 2VZVA 2FMOA 5IHSA 3OBAA 3KHDA 2RJGA 4JYDA 2PWGA 4S3JA 2IQTA 1ZTVA 3DFTA 1V0NA 1HF6A 2WSYA 4I6KA 3TC7A 4LYQA 4QIUA 6CGTA 4X61A 2DW7A 1I2RA 2Y7GA 2XYLA 1R3WA 4FF7A 1ZHAA 3BCDA 3AHTA 1WUEA 4ZE5A 3FYPA 1B3OA 2W67A 2J7CA 4RDWA 5DT5A 1W9DM 3CMGA 3FYYA 1GQNA 4BEUA 4DN1A 4DZAA 3H2AA 3GZ3A 4PUUA 4C6KA 3V5OA 1GG1A 2V82A 4ZO7A 3OA5A 3H22A 2B4GA 3XIMA 3FFSA 1KXQA 2QUMA 4RX0A 2OLSA 3FA4A 1DHPA 2JIEA 4DWSA 3MP5A 4AZCA 3M7SA 5F4WA 4B5WA 5GJPA 2PD5A 1EEPA 4P7QA 4AD0A 5ABEA 1OFOA 1ZNNA 4S3EA 4UCFA 4YJ5A 1Q6DA 3GB6A 2F6KA 2DZSA 5IBXA 4E8CA 1IXOA 1S1RA 4QDWA 2FGZA 1KLYA 4M7SA 1F2JA 1WPCA 3OZPA 4DYJA 3EDKA 1Q6GA 1YLVA 3ZLFA 4O15A 2XIIA 1XBXA 3FHQA 4LBUA 3NQDA 1P0DA 2VRQA 3EWWA 4YYCA 4AHOA 2ATMA 4M24A 5HWMA 1ZL1A 5JMUA 2DH3A 2QT3A 5CJ5A 3T0AA 5DFAA 4OJYA 4IJCA 2DFAA 3PHAA 4M7TA 2XIJA 3KLKA 1EA9C 4R3UA 1W91A 2GWNA 1W2PA 3W26A 5FJPA 1XIFA 2E9LA 4UFIA 2WZEA 2WSQA 2EPLX 3CZEA 3AHYA 5EBUA 4B3ZA 1OX4A 4NZ5A 1OSEA 2Z6IA 2BG5A 5E6ZA 3EWCA 2VI0A 2TPSA 1EEXA 3E6EA 4J3XA 4AZHA 5CZ0A 2PTWA 4LX4A 3UWYA 1XIGA 3N2XA 3O0KA 1TR9A 5JUVA 3BWWA 5E9XA 2W27A 4JKMA 6ENLA 3NURA 2R8WA 1P0EA 1ISWA 4W5ZA 1NM9A 1QNSA 1P48A 5DX7A 3LNPA 2AGTA 2CLKA 3EXTA 1XH1A 5ABHA 1JI1A 1K02A 1XS2A 2E6DA 1BWKA 1TTJA 1XIBA 1EQCA 3GLCA 5AKQA 2IKJA 5LXXA 3AMGA 2FGBA 4C6FA 3SUSA 3VC5A 4YLWA 5JVLA 4M80A 3U2OA 2WYSA 3BZGA 3OP2A 2E77A 2ZCGA 3N15A 2PRHA 3EWYA 3FS2A 1QFEA 3PJXA 3VGFA 2Q8XA 4UTLA 4TTGA 3LUTA 1JDDA 1B90A 3CO8A 3PC0A 1JPKA 4Q8QA 3FAWA 4NASA 4AW7A 4LUIA 2LLEA 3BZJA 3GK0A 4S3AA 5CSRA 1PX8A 4UC5A 1OFEA 2Z7GA 4HZ8A 1FWWA 2E6AA 1R47A 2Z2AA 3ZT5A 3RU6A 1XKYA 3SIMA 4CNUA 1SUXA 1R3RA 4HNTA 1W1PA 1ZCCA 1Z9AA 2V67A 4JTUA 3LTYA 3QPZA 3CTLA 2R1NA 8XIMA 3MUXA 2EAWA 4O0KA 2EPHA 2Z7KA 3UR2A 1E6SM 2GJXB 1W54A 3CWNA 3W1UA 1NH6A 4FX6M 1CGWA 3WN6A 1VF8A 5HWNA 5XIMA 3WEMA 4NY2A 3KM8A 3W1XA 2V3GA 1EDQA 5A5WA 3WD3A 3AJ7A 4J4KA 1V3KA 2GQAA 3RCMA 1AVAA 1PJ9A 3SJ3A 4POCA 1UJPA 4IWWA 2VENA 3G1SA 3GHTA 2PSNA 3H12A 1KFLA 3CASA 3ZMRA 3DU0A 2WC7A 3NIYA 4BQ3A 4S3FA 1FWBC 4HPNA 5FEPA 3UZJA 1LRNA 4UTHA 1NF0A 3QY8A 3BJSA 2X8RA 2YZRA 3CMJA 3NDZA 3TQ0A 2X16A 1XICA 1XQLA 1G4EA 2E28A 4IGNA 3FN9A 2DVXA 2TODA 3NQVA 4ZOEA 4WSKA 3V5FA 5JBFA 1OFQA 5F2MA 1GYNA 2HXUA 3PFRA 1KKRA 3LCLA 3FX4A 3S5SA 3ENLA 1EPXA 3U0HA 3A5FA 1GHRA 1OFAA 1XKJA 1MW1A 3BOFA 4HOWA 4I9TA 3ANYA 3DKLA 3EWXA 5FF0A 4XX6A 4GVGA 1JFXA 4DBSA 1BLIA 2DW6A 1UUOA 4CNNA 1I1WA 5L9FA 3QZAA 5HK4A 2FHCA 3TJIA 1UZDA 3TXZA 3HBLA 4B16A 1DV7A 4GRSA 5SWUA 4I8YA 4MGGA 3W88A 1QW8A 1QBAA 4TR9A 4BQ5A 2OSYA 3N12A 3HG4A 5HPOA 2QGHA 3K30A 2QUVA 4JQ1A 2H3BA 1QW9A 3H7RA 2DZPA 3PNUA 3V16A 4AEEA 1SFLA 1ZS2A 2W61A 4UFLA 1XYZA 4FLQA 4WXYA 4FXSA 1JEZA 3L4XA 5MKGA 2VEIA 3NTYA 3P74A 1TRIA 3VA8A 1NDYA 4MIMA 2DDXA 3S6TA 1YNQA 2V30A 2DSZA 1J2WA 1JCNA 2ZTJA 1BG4A 1OC7A 2FJKA 4B91A 2C3ZA 1K9TA 4OT7A 2RDWA 5D37A 4O17A 1SFTA 1IF2A 4PCNA 2QUTA 1J96A 2J4GA 1O68A 4IUOA 1TJPA 3GNDA 1UW9A 1A0CA 4I5UA 1AW1A 4E2VA 3OBEA 2YFOA 3TR2A 1RAKA 1TMQA 5EPDA 1FWSA 4PL2A 3WDQA 4E5TA 1SO4A 3M5ZA 4ZO6A 4HYRA 5DY3A 3LSCA 2WMJA 1FX6A 1E1CA 3NSXA 4CNSA 4UXDA 4E3TA 1Q3NA 5I7GA 2P76A 2QR6A 1R86A 5DCDA 1Z3NA 3STFA 4B2DA 1ECQA 3MI2A 2DIJA 3EDFA 4V15A 4CQAA 1XIHA 1SJBA 3CUIA 3W0KA 1LTDA 1J01A 3B9AA 3KHJA 4PC8A 4WKHA 4IIBA 5K9XA 2QVNA 4WUIA 2PDHA 3NZPA 5D32A 1M6JA 1QOQA 3WQ6A 2GGIA 3MANA 1Q85A 4UNLA 4XZWA 3EWZA 5EB8A 3N9RA 4LFYA 2UBPC 1FCBA 1TSIA 3S2JA 1VCVA 1HJUA 5FAGA 1F3TA 4UQDA 1O5XA 2QS8A 5CPLA 2NSOA 5HQLA 5F1VA 2H90A 1ZJAA 1I1XA 2HSAA 4Q3MA 2P0OA 1O6IA 4QG8A 3WLLA 4TOQA 5IDZA 1TE1A 1QJWA 3LTPA 2PF0A 3EOUA 3HQPA 2OPJA 3VUSA 1NOWA 4B4FA 1A80A 3C56A 1TO3A 4MWAD 3LD5A 2FGLA 1CT5A 1JUEA 2IUZA 4GQRA 4LF2A 5C9ZA 2HS8A 5FKYA 4PSRA 2ZFAA 5LA2A 5TD4A 5XINA 1MSSA 1TWWA 4PMUA 1Z41A 4NKCA 3GHRA 2C8NA 2A7RA 2YL5A 1U1UA 1S5MA 4IPJA 1KM6A 3H6OA 2ZA2A 5T26A 3BICA 4JQ2A 4GFIA 1DWAM 4HPHA 4L64A 4M1BA 1BD0A 4NAEA 4XZHA 3UXIA 1HO1A 4KFNA 1JVNA 3PBGA 4DJFC 1YDYA 1HKWA 4V33A 4M1RA 2NZLA 2D2HA 4FF5A 2YYTA 2DGAA 2RDUA 4LUTB 2WNQA 3PPGA 2GK1B 3DFHA 2P50A 4PMJA 3L12A 3LV6A 2Q8ZA 3WNNA 2C14A 2QDGA 1ITCA 3I7QA 4Z1YA 3RX3A 1XSKA 2CZEA 1H09A 1ITQA 3WYZA 4EE9A 3WDJA 4J7RA 4L4OA 1E6RA 2NUWA 4XZ9A 2W79A 1N7KA 2FDSA 4A8RA 1TZ7A 3UFYA 6XIMA 2OQHA 1R46A 5DN1A 3ABSA 1GVSA 2QIIA 2FPVA 3PG9A 3WL1A 1SZFA 4J2MA 1POKA 4P7LA 5C9WA 3QSRA 4NVTA 1K8ZA 1VIZA 3P61A 4R33A 2GVGA 4H6RA 2OX4A 4EXQA 4KIEA 1SMDA 2I17A 1GZGA 5CG0A 2ACRA 2Q6ZA 4ZA0A 1OT1A 3WUFA 4O8AA 4U5IA 2V5BA 1LG2A 2C71A 5H6HA 5GNZA 1AH0A 3GBDA 2XVGA 3CAQA 4Q8WA 1XCXA 2B0MA 3SRKA 2ZUNA 3WNMA 4AY7A 2EBNA 2GL5A 2OFJA 3GUGA 4PTNA 1XD1A 2W6RA 3SCOA 2YFNA 1HJSA 3T78A 1L9WA 3AOFA 4AYGA 4KEMA 1B5TA 2PI6A 3S2LA 4N9CA 3NQ8A 1XLFA 4U2ZA 1YMYA 3KBMA 4PE8A 1WZAA 3ARSA 1JAEA 3WLPA 7ENLA 3PSWA 3O0FA 4IJRA 4CLMA 3PJWA 1EL3A 2WBKA 3TX9A 3VMNA 3N2BA 1AQMA 4K1WA 3UR5A 3I3EA 5AHLA 3GY1A 3T2PA 3N6QA 5A69A 4C7FA 1M68A 5HQMA 5LA0A 5J8LA 3CT7A 3IV8A 5LYRA 3BLIA 3GVQA 1L0PA 4J3UA 3W7IA 2VR5A 2PPGA 4EX4A 4RDYA 4GYJA 3CEPA 2XN1A 5T9BG 4B5VA 2FVKA 3ICJA 1QHOA 1WDQA 1DP0A 1MI3A 2Y5SA 3E5BA 3PK7A 2PDKA 3F7JA 1UOZA 2WZIA 2BS9A 3DHUA 5A8NA 1VR6A 4IL0A 1MW2A 2ZZ3A 4XISA 2V2CA 5KTLA 5B7ZA 4AD4A 1DJXA 3WLOA 1Z32X 4E8GA 1DHKA 2CBIA 2V8ZA 2WHMA 5HNNA 2PP0A 4L1GA 1SZNA 2GWGA 4IPPA 1KFCA 5A2AA 2C0AA 5G1TA 1KD0A 4MMWA 3ATYA 2VEPA 3A23A 1R9YA 2H3DA 4XD5A 3MPGA 2W92A 4YYFA 1W5PA 3GXNA 1DIDA 2YCJA 3WKZA 3LK6A 2YCIX 3TLLA 2D3NA 1YHTA 1K7EA 5CAHA 4QNEA 5AECA 3EMZA 4JYEA 1XISA 5HWJA 4FI4A 2DY3A 3ARQA 1TCMA 1UD4A 4HN8A 2DORA 4EAYA 4UTJA 4AIBA 5FACA 3P80A 1QK0A 3RDKA 5FAJA 2QJNA 3M5VA 2Y70A 5AHMA 2CXGA 4B4HA 1FHLA 2WPGA 3VZZA 3G1XA 1A5BA 3Q4DA 1EGZA 1RP9A 1ZU8A 3HQNA 5D4YA 5LIKX 3SURA 1IEQA 3QV8A 4JTSA 1P6WA 3HPFA 1VC4A 3EX6A 4B9YA 1A0DA 2PZNA 3LS9A 4JIIX 3P62A 3A4XA 4FIRA 4CQBA 5GNXA 4LAMA 4NF7A 1EBHA 3HFYA 1W9BM 1F7BA 3W1QA 1H41A 2HZGA 5G2HA 4M29A 2HROA 3PM6A 4H9TA 2OLAA 4MTVA 4IQJA 1MEWA 4MYXA 4H6QA 3C8FA 4JYFA 3EYPA 2J7GA 3V1PA 4GWEA 4KWOA 2WC4A 2BB0A 4LC6A 1CW2A 2X41A 1JCYA 5ABTA 2PWFA 1ADOA 4ZSUA 4IIGA 1TPVA 1A5LC 1VFFA 3FW6A 1GHSA 4JEQA 3FEQA 2WHJA 3TNBA 2NVDA 2RDXA 1PKMA 1V3HA 3LG3A 1I2OA 5FI8A 5HULA 1UQZA 4PMYA 1DWGM 4RE3A 4LSBA 3LCIA 4YU1A 1VENA 1KQYA 5EY5A 1EOMA 3BQ5A 1PX4A 1ADSA 4Y90A 5A2BA 4EP8C 5RUBA 2XFRA 1H5VA 1BYBA 5CEWA 4MYAA 4LU0A 3TVAA 3L0NA 3C3NA 4RLIA 3K1GA 4L5ZA 5LGZA 1OZQA 3QKEA 2VFFA 4E4FA 3EWDA 1HTIA 1GK8A 1ISXA 4K8GA 4OQVA 1WZKA 1IYXA 5BU6A 5LZLA 4LRSA 3CUHA 2YLAA 3B0XA 1RPXA 4FOJA 4IFOA 3ZVIA 4JN6A 2PP1A 1SVDA 3NO3A 1X38A 4J40A 3STPA 4AMCA 3O6AA 3A4AA 3WK0A 5FL1A 1XC4A 3I7SA 1NFGA 4GO8A 3NM1A 1TPH1 3ZIZA 2X2GA 1J4EA 3OQEA 5E09A 2CLMA 2HVOA 5IXEA 3EOEA 3WBEA 3EZ4A 3G1FA 5XIAA 1RHCA 5I23A 3F5LA 1SSGA 2Z2BA 3QHNA 3PUEA 3F1QA 1OFPA 2CLEA 2MUCA 2J8TA 3K8LA 3NA8A 4D6IA 3G18A 4F4RA 4YTUA 1JZ3A 2YPIA 2GDQA 1TPDA 3JRKA 4Z1AA 1X6LA 4JAWA 1TV2A 2A5HA 3TLQA 3INPA 3N14A 1X8FA 2E8YA 1UIOA 4O19A 1HL2A 3E1F1 1UPPA 1S39A 1VFTA 1I8JA 3IUDA 1DXFA 3EPNA 2J79A 1ODZA 1C7SA 4LAOA 3MUAA 4ZFMA 1CGXA 1W1IE 1VBUA 2VFGA 1DJGA 4Q8UA 3VMPA 3H2CA 4HOZA 3U8GA 3VOCA 4FOKA 1R2RA 1HQTA 4AD1A 3CQIA 2WV8A 3VKBA 1UWAA 3VIMA 2NQ5A 2X2YA 4GOAA 3W23A 4S39A 1U30A 4JBRA 1OT2A 4P5UA 2BHYA 1XYMA 3W7EA 3KBVA 4O54A 1RD6A 3GU2A 2Q01A 1D2KA 1MQRA 4GNJA 2GJRA 3S42A 2D1ZA 3B0VC 2F2KA 3N18A 3OG2A 2OOGA 1ZB5A 3G0UA 3MWAA 4GIEA 3MMUA 1IWAA 1DJIA 2DUZA 3APTA 3D0CA 3M07A 4IHCA 1SM9A 3RCNA 2VGIA 1X6NA 4MPQA 3GSMA 5C6MA 4JTRA 4KIRA 4ZSTA 4AG0A 3FXYA 1GQKA 1ICSA 1LRQA 1WDDA 3DBNA 2IW0A 3CV2A 1B3ZA 1XIJA 1XYBA 1FKWA 5D9PA 3ITCA 4E3VA 7ODCA 3AZRA 3R2GA 4QBXA 1XR2A 1MEHA 1XD0A 4BF9A 5I3DA 4IICA 4QR6A 2PMQA 1BXNA 2YL8A 4AY8A 2D73A 4Y9PA 4C6IA 1KCXA 2NWSA 4JIEA 3K8MA 1SSDA 3WD4A 2GUUA 3GFZA 5D8WA 1UR1A 4QSFA 3SADA 1Z48A 3P81A 1Q6QA 5GJMA 2O9TA 2J47A 1UH3A 1TV4A 3AS2A 3LPGA 1YKWA 5A6JA 5F4XA 3RMJA 4AB4A 4PR4A 1F07A 1HL8A 4XO7A 3RR1A 4TX6A 1WQ5A 2V81A 2C6QA 3AIQA 1RA5A 2P0IA 3GU1A 1TB3A 2ACQA 2WMIA 4JKLA 4RJEA 4PFHA 2TSYA 2OELA 3PWAA 1LT7A 4MY8A 1UASA 4GVHA 3BQ6A 4M19A 1UR9A 2E40A 2W63A 4H8VA 2JEPA 4XZMX 5DBTA 4CKQA 5D8ZA 2GQ9A 1GQIA 3G24A 2DT2A 3MV01 3TR9A 1X1NA 1B3WA 1CB7B 3SCVA 4US5D 1CCWB 3NYZA 2B31A 4XD6A 1PCWA 2G4JA 3BLLA 1L8NA 6REQA 3RO8A 3LCFA 5D05A 3EX3A 1CGVA 4DPQA 6TIMA 4O4VA 4C7DA 1B4KA 2DZTA 2FIQA 1LWHA 3IVUA 3IJIA 3W25A 3PBWA 1EHAA 1J0YA 1QATA 1S2WA 3OPSA 2OCZA 3TCSA 3NWRA 1LBLA 3C2YA 2QCGA 4HZMA 4IXXA 5AYXA 4C1KA 2G50A 4NXSA 3M16A 4JCLA 1PKNA 3VIHA 3M0JA 1FCUA 1MQPA 5CC3A 3J7HA 3P93A 1Y8BA 5FJRA 4NZCA 2PP3A 1UWUA 4DO6A 3G1YA 4IFKB 1N55A 4EACA 2Y89A 2ZX6A 4IX0A 3LYEA 4EPEC 4FMVA 2JBMA 1XPYA 2CETA 3P5ZA 4GYPC 3PZOA 1FQ0A 3STCA 1XW8A 4X0VA 2P3EA 4CD6A 4QJ5B 2ZE0A 1DJWA 3NQ7A 3TAOA 5I6SA 2IPJA 2WAGA 3VKKA 2I5GA 2WVVA 3TP4A 1TZZA 4DPPA 1KM3A 3BURA 4IJBA 1Q6EA 4UBPC 5I3JA 1HO4A 1R2TA 1Q13A 3W86A 2A4AA 4YTRA 2C79A 2JKAA 1KWKA 4MM1A 5CJMA 1EJSC 3BXWA 1SU5A 2WJEA 4N9DA 5AVNA 4JXCA 1FWNA 3AXHA 3ZM8A 4M56A 3APGA 3ZYZA 1I2PA 4Q4MA 2ZE3A 1LLOA 3CV7A 4NAFB 3L4TA 3SFWA 3VIOA 1CI1A 1RQEA 3QR0A 4AXNA 4BI6A 4ZZ9A 3QPEA 3FDKA 4AWUA 1KTBA 2PE4A 4IIDA 2DZVA 2BZNA 1R5YA 1RZMA 2A3EA 2J7DA 2QCEA 1C9WA 4TQTA 2UV8G 3L2IA 1AJ2A 2ON3A 3PR2A 3K46A 4GXMA 1QTWA 1AA1B 1W1VA 3TZFA 2GYIA 3DFNA 4TU1A 1K7XA 2PC8A 2PRMA 3U5UA 3Q58A 5AY7A 3TUUA 4GUHA 3DHPA 2NQZA 4FR1A 1Q66A 3TW9A 2AOSA 2OB3A 1CB2A 4J3ZA 2VCBA 2R1PA 1O7AA 1RBLA 4KKXA 3WFLA 1RSCA 2F2HA 3KZSA 3RYSA 4Q32A 1E15A 3TCEA 3QQWA 4HNCA 4D8ZA 4O4WA 1DJHA 3GIYA 4IIHA 3FV9A 2HVMA 4HHPA 2HE5A 4Q4PA 1CXHA 2RJHA 3KUMA 1VKFA 4XD3A 2QUNA 1KQZA 5A94A 4JX5A 1KKOA 1S2VA 1Y65A 2WCSA 2WSRA 3ZO9A 4AZ5A 3CZ8A 2HNEA 3UBPC 2GJNA 3OQ8A 3W87A 3AO0A 3MJYA 2VCAA 2VRKA 4W8LA 2EF9A 4B5XA 4L4LA 4NL1A 2PF8A 1B57A 1FWHC 4ZTYA 3WNLA 4P8WA 1H7NA 3E2QA 3UWUA 4IP5A 2C13A 2F61A 2YXXA 3WD1A 4AWTA 4FA3A 3TAKA 4N6FA 4D8LA 3QC0A 1PPIA 1VBHA 1J12A 4LGXA 1AW5A 1OZMA 3PZGA 4MFDA 3VIGA 3RK8A 4R53A 1TJ2A 1Z89A 2NX1A 3QR3A 3GNPA 3W7MA 4PBEA 4GNVA 4MHBA 1WKFA 3I65A 1UWIA 3MYPA 3EPOA 1RY8A 3ES7A 2YCLA 4PMZA 2QMKA 1KXVA 3EWBX 2FDMA 1G1YA 3AS3A 2V5CA 1ELSA 5F7UA 3IIXA 1P0BA 3GG8A 2QJGA 1OGSA 3TIMA 3M0XA 1XHGA 3G1DA 1RV8A 2BXVA 4Q4RA 1XG4A 3GYEA 1ITXA 1OX6A 4ORMA 1L6SA 3PNZA 5HBFA 5KZ6A 4GC4A 2Y8VA 1JYVA 4DLMA 1PDZA 1KFBA 3SUTA 2E6YA 2OU4A 4WHBA 4A6GA 5E0KA 1X39A 2QCDB 4ZEPA 3RRXA 4LAZA 1B3VA 2Z6JA 3A22A 2OMAA 2CBVA 1LWIA 5CZJA 4NUWA 3E0LA 4Q8VA 3SCQA 3GD6A 1YTKA 4ASTA 1GQJA 4TX9A 3IIVA 4R85A 3LRMA 3WK3A 2NV1A 3DFQA 1CWYA 2FZBA 2PC4A 1V5XA 4HA1A 4DF0A 3KRUA 2X40A 4RNFA 2FZDA 2IXUA 4UR7A 2YBVA 2VFIA 2PDUA 4HTBA 4IQLA 3HV9A 5C71A 3LHVA 4Q7IA 4PB5A 8TIMA 4HNNA 2A7PA 1G4PA 3VZYA 3DYPA 4GJJA 1V3IA 5AHFA 4FNRA 1TJ1A 2VDHA 3AWNA 4ZODA 1Q6OA 3O07A 5E5CA 1BRLB 2YBUA 2ALRA 4DF2A 3NZ1A 2ZRYA 4C6PA 1PZ3A 2XISA 3LCGA 4UFKA 3GTXA 3L4ZA 2HE8A 3VIIA 2DQXA 4LT9A 4DXKA 1V0MA 2BP1A 2RKXA 5HJYA 3PJUA 4ADUA 1H51A 5LIXX 4URIA 1XCWA 4HU4A 4N6EA 1BG9A 3H8AA 3ONBA 3L2LA 3GIQA 1JZ6A 4W87A 4AU0A 1FWIC 1VBGA 4CD4A 3L67A 4GA8A 1DL3A 4DF1A 4DJED 1PB0A 2GSJA 4XIMA 4B5UA 3BLFA 2VQTA 1YW1A 3B06A 4K2SA 5FJJA 4Y96A 4UMCA 1LBFA 3M64A 4UQAA 3I4EA 1YE4A 4L1XA 3RLGA 3BW4A 1KO0A 1Q6FA 4IPIA 2Z24A 3IGXA 1GCYA 2IMRA 2VWTA 1CX9A 1XRVA 1KCLA 3S1GA 2Z1XA 2J6VA 3W2LA 3MBDA 5DMYA 3MWCA 1HP5A 3ZXWA 4MWAA 1QDSA 4N2YA 2RUSA 4A3YA 4FX7A 5HQEA 3W7HA 1AZ2A 1QPOA 1V08A 3AXKA 5M1TA 4JCMA 3G6LA 2YLLA 4FNPA 3SUVA 4L4PA 3G0SA 1T8QA 4Z2JA 2YB1A 2IS7A 4KCUA 3R0DA 5E9AA 2Y4SA 3T7VA 1V03A 1RXOB 3N9SA 4Z2KA 5CAKA 4L6HA 1W31A 4QISA 1BSLA 4HP5A 4BQ4A 3IGSA 1IZJA 4PCFA 2B7OA 4BZYA 1MNSA 1GOOA 4YHGA 4ZENA 1TV5A 2XWDA 4RV8A 4I5RA 3WK2A 4CVUA 3MTWA 3L65A 3P14A 3L23A 1O5QA 3CHVA 1LM1A 4X60A 3EDEA 2PFHA 3AICA 3R0KA 3KL0A 4CEUC 1RQHA 3UVAA 2ZADA 2AKZA 4HVXA 4IMAA 4I3GA 3HPSA 3MHUA 4W7VA 3T0TA 1I0BA 1RQBA 4XSLA 1VLWA 1E4MM 2RHGA 4OUIA 1S2AA 1XLGA 3ABOA 2PDFA 3MUCA 4JX4A 4DUXA 1KV8A 2DVUA 1A0EA 4R9XA 3GKFA 3THCA 4NZ4A 3TTEA 5K4ZA 4LB4A 2D2OA 1C90A 5EMUA 4D6JA 4R7JA 2VTFA 1UWSA 1SO5A 3UPBA 4PRWA 5DMMA 1TA3B 1OX4B 3NPVA 1EBGA 1EFZA 1E9YB 1YDVA 2ZX8A 4QROA 1LT8A 3W7NA 2E7FA 1QPNA 2DU2A 4NU7A 3TZNA 3LCWA 3W2KA 4HA3A 3DKJA 2PDIA 1U1JA 5KZDA 5CPMA 1VZWA 2PDMA 4LW7A 1Z8AA 4CN1A 2EPKX 3C86A 5JIWA 2ZKMX 2HXTA 3BJFA 1HJVA 1KXTA 3KVJA 2YA2A 3R58A 4ZOBA 3U57A 3DX5A 4XAYA 3GTIA 2WCAA 1H62A 3S1XA 1OYCA 1D8CA 3GZAA 4REQB 3KDOA 3NPXA 4Z17A 3B9OA 4ADTA 4X2PA 1JZ2A 3R43A 1EA0A 2H9AA 1WA3A 3WELA 1SYTA 4LCRA 3CC1A 3N9KA 1GEHA 3NZRA 2JGQA 2IQ0A 3IJDA 3PFMA 4LWWA 3HG2A 2ZBTA 1DIOA 1FXPA 3CLWA 5EFFA 2FH6A 1E6QM 4PUKA 2YXOA 4G8TA 5E70A 4ZFCA 5LNUA 3MZ2A 1OCJA 1S5WA 3DG6A 2DZAA 3G2GA 1GVYA 2WLYA 1OM0A 2A7NA 3AZSA 1LYXA 4A4AA 4Y8EA 2WVSA 3CK5A 2GJLA 4MWAC 1X6UA 1JD7A 3OIXA 4HNVA 3HPXA 2O7QA 4KRTA 2I5IA 2POTA 1IXPA 2J8GA 2VX6A 1VFOA 5IFTA 4B3LA 3H7UA 2X0YA 4UTMA 1LWJA 2XN2A 1EP2A 1UWQA 3AJXA 3TYBA 4K6AA 1HJQA 3Q37A 1JCJA 3S9IA 1SZGA 4AISA 3M1ZA 4DNHA 2CHRA 1WAUA 1PX3A 3G8RA 3W3OA 4J1OA 2GJXA 1G0CA 4KF1A 3MYOA 1QWKA 1XLCA 3TFXA 3GRIA 1K1DA 1UB3A 4O1FA 4IGSA 3CV6A 2BGNE 2WW5A 1XUZA 2Z00A 4ZB5A 4ZOAA 1VJZA 1NVMA 2DJXA 4WX2A 1PIIA 3FJ4A 3IJQA 5D9OA 3VCRA 3CZKA 3WNOA 4QHRA 1RA0A 2VEGA 4RNIA 4RE2A 2GLKA 4JPGA 4XUYA 1KGWA 2ABAA 4L9ZA 1TUXA 1GT8A 3P0XA 2CW6A 2J66A 6XIAA 1H7PA 3H2NA 1XLIA 1VBJA 2GDUA 4MNLA 3WH9A 1JL8A 4WXZA 2O56A 4CQCA 3ME3A 1YBQB 3VGEA 3TYEA 2BHZA 3H2FA 2CXEA 2XIOA 1KCKA 4DQWA 4C1LA 5LNVA 4DWSB 1RK6A 2E9BA 2ZXBA 4BFAA 2JK2A 4MSSA 4EF8A 1TVNA 4FZIA 1NIUA 4H41A 1QW7A 4YVXA 4M51A 4RNJA 3PWIA 2CFFA 1TYGA 3F4VA 4GQ0A 4W8BA 2PDCA 1AW2A 2NT0A 3LM3A 4J5NA 1CGTA 5C2GA 5AFDA 4PA8A 1VHCA 3O06A 2PDXA 1WO2A 3VDGA 3VKJA 4QE5A 2OX1A 1KTCA 4G6CA 1LG1A 4JN8A 3QZEA 1JPMA 3M0KA 3W00A 1VPQA 3TMLA 1SQ7A 3V0UA 4HNOA 4Q6XA 4NJKA 4LNCA 4NG3A 4AWSA 3QGAC 3VX0A 1UA3A 3AIUA 3GC4A 3Q65A 2A85A 4JS3A 5D9MA 3EOSA 1UP0A 2YB4A 1I4NA 1YNYA 2YXGA 1G5AA 2WHKA 2I9EA 2GQ3A 1JNDA 3U3HA 3EOOA 2WBGA 3QSTA 2PTZA 4IIEA 4DZ5A 4OUEA 4AF0B 4YXGA 1V3JA 1LQAA 4FLOA 3IRDA 1C8YA 4NIRA 3B8WA 3VNKA 1UH2A 1VCFA 1VPYA 4HHLA 2J7EA 2J8FA 1DWIM 4O1AA 1BYAA 2VM8A 4PMVA 3VGDA 3DOPA 2NWRA 3R79A 3EDJA 2WQDA 1LLZA 1ZCOA 4CD5A 4UFHA 1J93A 5FOOA 2VT0A 3E2VA 1QWGA 1P0NA 2CKSA 1Q7QA 3UG5A 2Y7DA 3HA1A 1DXEA 3OZMA 1JPDX 5I3HA 3PBMA 3EA3A 3O9NA 4KESA 3HJEA 2VMFA 2VZOA 3OB8A 3ZJKA 5JXQA 5LIYX 2EPOA 2IQDA 4IP7A 1E1CB 3P0WA 4MLJA 5I0DA 3HFTA 3VVGA 4YL2A 2NXHA 3T9PA 3R6IA 3T6CA 3LSBA 4MFEA 4CU6A 4J28A 2AQOA 4LANA 3T4WA 2CBJA 1WP6A 3S2NA 3VUPA 1TPWA 3H4WA 2NQHA 1Q5MA 1OINA 4JTGA 1XLBA 4E0CA 1Y5VA 1D3CA 3MO7A 5LGXA 3GH5A 1IIHA 3T1GA 3UWQA 3NDOA 1POJA 3NR0A 1F3XA 2VL4A 4TX8A 3WQ4A 1LLWA 4I90A 1FY6A 4GI9A 2BMBA 1UP2A 3TQPA 1H7OA 1KXHA 3NQEA 3VOIA 2G3NA 4LBSA 4JZ5A 3VNLA 3ZT7A 1JF6A 3U6WA 3IIOA 4QDMA 4N4QA 4N0RA 4ZL1A 4QX4A 3LGEA 5AC6A 1J10A 3G3DA 3VD5A 3K13A 4K36A 4AXKA 4P7OA 2GUBA 1ZFJA 3RUBL 3REQA 3THUA 1GUVA 3WSUA 4C6DA 2NLYA 3SIZA 3ZOAA 4GXPA 1LP6A 1UG6A 1Y7VA 1TQJA 3LM7A 4TIMA 1ZUAX 4HSHA 4OE7A 4GJIA 4HCHA 2G3MA 1JF5A 1DWHM 5DANA 3O05A 2BXYA 1FWFC 3WLTA 2QEZA 3W1PA 4PL1A 4F0KA 4B90A 1TPB1 3MCOA 3TSMA 3AHXA 4GX8A 2XIBA 3L4YA 3W2NA 4RR4A 4NJHA 3WLHA 2ZUTA 5J04A 1XC6A 4DJEC 2A3LA 2BASA 2YA1A 1DJQA 4CCZA 1U5VA 2WMFA 4HPJA 2ISSA 4E2OA 2HQAA 3DHDA 1EGVA 4H7CA 1QPQA 3MC5A 4TVDA 4ZR8A 3R1ZA 5M5DA 4ML4A 3N3MA 3TKFA 4NI3A 4RXFA 1OF8A 1TRDA 3V5CA 5BNKA 4WY0A 5D2VA 1OQFA 4WKAA 2EG8A 5AHNA 2VEMA 3DYOA 4CGTA 2B81A 2IXVA 1U5JA 3MY9A 5C2CA 4R7WA 1DJYA 3H2OA 1ZSXA 3NOEA 4LUJA 4W8AA 1BVNP 1P7TB 3L4VA 4AFYA 4MF4A 2YDQA 4JFUA 4WZHA 3TTYA 1O1HA 5FF3A 3NCOA 4PZVA 3AU2A 4XAPA 5AYBA 3TQKA 4D6GA 1BKSA 4W85A 2E5CA 2PDWA 8XIAA 3LXAA 4C1NA 1XGDA 5K2ZA 4P2VA 3G6MA 2B7NA 1B9BA 3PVFA 1JULA 1PWLA 1W3IA 1RJRA 1P1XA 3SCUA 3HOJA 1WDSA 2GVJA 1BF6A 3VPLA 3IARA 3NL5A 3BV7A 2TMDA 2FQIA 3M4HA 1G4TA 1KTNA 5BXSA 1HL9A 3T81A 5DXXA 3ERPA 3RR4A 2ZZ1A 3VE9A 1P0KA 1YEYA 3MDWA 1Q2RA 3PN8A 1KFEA 4PCSA 2RAGA 5CGQA 3CH0A 3RF9A 5C8BB 1UPMB 1A49A 1WDPA 4U3AA 2PGRA 1KGXA 3B8VA 2J88A 1RD5A 3BANA 2NLIA 3GW3A 4HCDA 3LXCA 3F4NA 1MRAA 5I79A 3DERA 3W1RA 4HJWA 3K5XA 4JX6A 2OG9A 3WJWA 3T0DA 2UY5A 1Q8AA 1DIKA 3M5YA 2Y8UA 2PLMA 4X63A 4KS0A 4WEVX 1J2BA 3EXSA 4PULA 2P3ZA 1DE5A 1CLKA 1H0IA 3KCJA 5C9RA 2ZZ6A 4GBDA 1ONEA 3GDBA 5EA9A 1H63A 3CGTA 4IMDA 2ZXDA 4P8VA 3VI2A 1TG7A 3QFEA 3HGJA 2Q02A 5DT7A 1FCVA 1W1B1 1LOQA 3POHA 5K4XA 4Q8NA 3K4AA 4G9PA 4WJ8A 1R30A 7XIMA 3SDOA 3TONA 3IPWA 1F6YA 2D0GA 1OG6A 4D6FA 2Z4GA 1VCGA 4WIWA 3VXGA 3IWPA 4BQ2A 5HMEA 1B9ZA 3WNKA 4GQBA 2B7PA 5BXPA 2JKPA 2VC6A 3WLMA 2CNCA 1LRTA 1V3LA 2WNWA 4IF2A 4EK7A 3T42A 1I45A 3RJYA 4ACZA 2WVTA 3LOTA 3OOQA 3UF9A 4QJ1A 4E4PA 2DQWA 1GOQA 1OC5A 3R5EA 1BQCA 4DZHA 2O55A 5JU6A 2PDPA 3H4XA 3EGJA 3W1TA 4RCXA 3RM9A 3V36A 4I5XA 4PYSA 2A0NA 4HU8A 4MADA 1CLXA 4Z2GA 2BBFA 3PPFA 4KEUA 2EPNA 1E4IA 4QEEA 3GUWA 3ZLHA 2FVLA 3AQUA 3N2MA 2BSLA 1N8IA 5CC5A 2QJJA 3FSTA 1QNPA 5BXRA 3S5NA 3T0BA 2J74A 1CDGA 1GW1A 3L0GA 1VYSX 4MNKA 4REQA 4GFSA 3ZWTA 4BY3A 1FHDA 4GNKB 3EXRA 1E1FA 1EH9A 3KWXA 1W9UA 1S3TC 3P5YA 5A6MA 1OADA 3COTA 2XPKA 3OZOA 5AYZA 3RM8A 3UR8A 4A3QA 4JOMA 5I3KA 1SZRA 4NZFA 3QOMA 4U33A 2BOEX 3OA3A 2ODOA 4Q4KA 4L9XA 2ZYFA 1E0VA 6PTDA 3C3UA 2XN0A 3MO4A 5A8PA 3W7KA 5EL1A 1RJPA 4NRRA 1QXLA 1PO9A 3LY0A 2X05A 3QTGA 1TPUA 1EDTA 3VKDA 1T99A 2QLYA 3WMCA 5A8MA 4GUFA 2WLZA 2PD9A 1TPEA 1EJUC 3UXLA 3VZXA 3WQEA 4GH1A 3TSBA 4G1NA 1H50A 1XL9A 1EC9A 1QNVA 5CPQA 3M7WA 3NL3A 1F6PA 4X9SA 4GYPA 4G7EB 2WMKA 5BOOA 4AX6A 3G0XA 2R82A 4AC7C 5LNWA 3NPUA 4MG4A 6A3HA 5MHBA 1R2SA 2W5FA 5I06A 4NJIA 5CBJA 5G4HC 3PY2A 1E0TA 3WLQA 3P6LA 2EQDA 5CZSA 4JICA 3A4WA 1OVDA 4HU3A 3UG4A 2A21A 5A8OA 2ABBA 1K8YA 4INFA 3ARTA 3PAJA 4UTTA 3S47A 3VM7A 4E2BA 4Y9AA 3LNMA 4M6UA 3I10A 4UMBA 2VP8A 2QJMA 3N11A 4QTGA 4IG2A 5HR6A 3PP7A 3EWUA 5CG7A 4LNYA 3L66A 3ABRA 3SQMA 2R1LA 1I6NA 4XBSA 3VCNA 4S3BA 3ZJ8A 3GTHA 3N73A 1BKHA 4MAZA 2OQLA 3U2ZA 1YBQA 4QJ4B 4WR3A 3CNYA 4H00A 4X0NA 2D22A 4LVFA 5B80A 2V68A 2WKJA 3F2CA 4MPKA 4G1KA 4CU7A 1V93A 4BEQA 3MT1A 1HFBA 5MF5A 3GNXA 3SFKA 3VNMA 5BYWA 1US3A 2XJ7A 2ZA3A 3TN5A 4NYUA 3V4BA 1YXYA 3L5LA 3NL2A 5DRIA 1UJQA 3IANA 2YX0A 1D7KA 1VYPX 4FNUA 4LBRA 2ZZ5A 5M3WA 1E5JA 2Z28A 2AKMA 5I5RA 4GGBA 4C6MA 3E3HA 4A35A 1QMLA 4Q6JA 1EUNA 1R3VA 2ACUA 1QRQA 1DVJA 1FP8A 3WJSA 3TN3A 3UEQA 4WDTA 3NFUA 1GKQA 3EB3A 5LIWX 4HK6A 2VGGA 3AC0A 3VU2A 4UCGA 2VNCA 2XM1A 3GG0A 3GKAA 2VELA 3UZXA 4QAIA 1RCQA 7CGTA 2WSKA 1TPC1 2WQPA 3VIFA 2PGFA 1V79A 1FA2A 1CLVA 4J3SA 2AL1A 1PV8A 3ZVHA 3UETA 1EOKA 4GC3A 3BAYA 2OZ0A 4OU1A 4DBWA 3SQSA 4I8DA 2PCQA 5FEWA 1TZ9A 2PS2A 4M5PA 5HMDA 1HVQA 4KPLA 4ZMGA 4N9EA 1RCXB 1GZ1A 3BUVA 1ISZA 3DIPA 2AMXA 3VX1A 1ME9A 4KQNA 3CAWA 4NT0A 2YCKX 3LRKA 1CXEA 5ECVA 4K38A 5A1AA 1LOSA 1DPMA 1HKKA 4YCPA 3C0QA 4HK7A 3APYA 3BAWA 5ABFA 3W7QA 3UQNA 1W17A 3URNA 1BXCA 3EX2A 1A5NC 3TN6A 3W72A 4F9DA 3O6DA 2J13A 4AYSA 4AVOA 3NQCA 2E09A 2VHLA 2V2HA 1R3YA 4KBXA 3B8UA 3DGBA 4WRHA 3H4GA 3CB3A 4C65A 2XVNA 4RL3A 1IE7C 4V2XA 2X1TA 4AX7A 1JXJA 4JY8A 2G5WA 5TNVA 5LA1A 3ARUA 2UY2A 2VDGA 1YDNA 1ML1A 2ADAA 3WFZA 1GNXA 4YTQA 2FHFA 2X7WA 3AMKA 2IPGA 4RE4A 5A6KA 2PWVA 3DGRA 3IK4A 1OX5A 5CQ1A 4AD2A 1W5NA 5CLTA 4JNYA 2CZVA 2RGLA 3JVAA 2HTMA 4E6MA 1BXBA 1R8LA 3C61A 1EDGA 4GISA 2GPTA 4MY9A 3CEUA 4DI8A 1UKSA 3I68A 4FPSA 1JZ8A 2ZA1A 4Z1BA 4J2PA 3HU7A 1PSCA 1L6GA 3LCXA 3SY8A 4DUOA 3DFYA 2I16A 1RBOB 2AAAA 3VIPA 1FWDC 1U83A 1XP3A 2VFHA 3ZLGA 1R7OA 1XLEA 5FJIA 3GC2A 1ESWA 2XIQA 5AN7A 5TAOA 2FPYA 1UZHA 7TIMA 4M82A 3EA1A 2PZ0A 2W4XA 4PUJA 3UZZA 2KX9A 1S38A 2Y24A 2Z1BA 1QVBA 1UZ1A 3RJXA 3VK5A 4OKDA 1OD0A 3GC5A 2FZ9A 2JFEX 2VR4A 4JTTA 3N29A 3W4RA 2NQLA 5H8MA 2QCFA 4IFKA 4C6QA 3KTSA 4LCSA 3QGVA 4A8LA 1TELA 8RUCA 3WD0A 2R94A 4H9MA 2GSHA 3O15A 3UP8A 5AC4A 4HNUA 1HKVA 3AXXA 2GJPA 1EJVC 2VFDA 3T0CA 1W3LA 4R34A 4C6NA 2YA0A 2PDBA 4XK2A 4JIPA 3U2EA 4Q33A 4DYEA 2BY0A 3BAXA 4KCVA 3CQJA 1XFBA 4JTAA 1XWYA 4IFRA 1YTEA 1NTHA 3SCNA 4TXEA 3TC6A 3NYDA 1W3JA 2INFA 3PTQA 2QMJA 3EOLA 1FWJC 5HNUA 1JFHA 1OFRA 1MDLA 1GOMA 3O63A 1HW6A 9XIMA 4GIAA 4ZGYA 4NI8A 4LYRA 3FAXA 2C16A 4UTFA 3E0WA 3DZ1A 1PCKA 3AAMA 1WOAA 2O4QA 4MVAA 3ZT6A 2WJZA 3WBXA 5REQA 4UUIA 3UT0A 2JKEA 1LCOA 4H6EA 3GIPA 1NQKA 2OSXA 3ZQ9A 2VVNA 1TIMA 1P43A 4QE1A 2O7SA 3HPAA 4NNCA 2E67A 2EO7A 1N82A 1TMHA 5H8UA 3TWBA 4EOUA 4GO9A 2G97A 2QDHA 4KRZA 3OVGA 5BW6A 2V38A 4V1YA 3URQA 1W8GA 1KBLA 3UWWA 1XBZA 1JDFA 3M6DA 1IXQA 3NZGA 2YBTA 4O28A 4W89A 3KZPA 1XX1A 3A9IA 4GZ7A 4QXIA 4DBDA 1XIDA 2ZTKA 1BYCA 3IRSA 4A2RA 2EGZA 3TC3A 4HPXA 3UJEA 3R11A 4H1ZA 5D09A 4HYVA 3GDMA 2QHAA 3UJFA 4G2DA 2PWDA 3F4WA 3GNRA 2PDJA 1FWEC 4D2JA 4FLSA 4UNIA 3GDLA 3VDAA 3MSRA 1KFKA 1QCWA 4F40A 4FK9A 1K6WA 2VUYA 1UP3A 3MUZ1 4XWUA 4PUDA 2CZ5A 1FWGC 4HMDA 1NSJA 4DO4A 4JQAA 4P8UA 4Y9OA 3LHTA 4CNOA 2VCCA 4C6CA 1J79A 3DHFA 5AC7A 1TTPA 4A8IA 3QMSA 3PWGA 1SGJA 1AFSA 1BAGA 4AZ7A 2OEJA 4WGHA 1S2TA 1CXFA 1WZLA 2X42A 4UTWC 2W91A 3CZGA 3BMWA 1KRBC 4JN7A 1WCGA 2CU0A 4JIHA 3R8HA 4QEHA 4LPCA 1XDMA 3CWHA 3VNZA 4LALA 4X2RA 3QV7A 1T0OA 4LVAA 2ZQ0A 1M7OA 1VBRA 2QF7A 4S3CA 2CYGA 4ERAA 3MW7A 4H7ZA 1WB0A 1Q2SA 3KBJA 3DG3A 1GVOA 4ZBCA 3GDRA 1C9DA 4M6VA 4MJZA 4JTHA 3IVTA 3UR7A 1PXGA 3QYSA 4A3HA 2Z1VA 3AHZA 5HUPA 4HBKA 4V28A 1IT0A 2YSWA 1TQXA 2XFFA 3OHIA 1C8QA 2PURA 3RLHA 2V5JA 3H54A 4C6BA 4YPJA 3GR7A 3BOXA 1O1ZA 5C9UA 3S83A 5KETA 1FXQA 1CYGA 4JNMA 4DELA 4LOCA 3R0UA 3KDNA 2BY1A 4P8XA 3TWAA 1S5VA 3KS5A 5GQBA 4ACZB 3TOYA 1D3GA 3URAA 1SJAA 1CGUA 3WY1A 2WJFA 4CCDA 1P5BA 1RJQA 2XFWA 1R9ZA 4KCWA 3VIJA 3WJZA 1LORA 2XH4A 1GEQA 1M7JA 3GVRA 1TV8A 4QGCA 1KC7A 2OEKA 3CIXA 1HGYA 4D1IA 1MNZA 4MKSA 2SFPA 5KZMA 4LEQA 5T91A 5AZ1A 1X98A 4HMEA 4GY7A 3BH4A 1L6YA 3CAKA 3FGCB 3WDHA 3VFLA 1HVXA 1G94A 2BOFX 2AL2B 4Q8PA 1JR1A 1W5MA 3GVGA 3RRAA