4W93A

Human pancreatic alpha-amylase in complex with montbretin a
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
publication title The amylase inhibitor montbretin A reveals a new glycosidase inhibition motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 181
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4w93A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w93A01
3EMZA 1VEMA 4NZCA 1MW1A 3VMPA 2DSWA 2V38A 1GJUA 3VSUA 3PZMA 3TA9A 2WHLA 1H5VA 3MKKA 1R7OA 2ZUVA 3EJRA 4M56A 3FXYA 1NM9A 1QNSA 3WF3A 3HU7A 1E55A 1CGUA 1UR4A 4DM1A 1QWUA 3KL0A 1BYAA 3JUGA 4PMQA 3MUZ1 1HJSA 3A23A 3K46A 4W8LA 3NDZA 3VMNA 1GONA 2PWGA 2X2YA 4LXFA 2A3CA 1HP5A 5A6BA 2JE8A 1NARA 3L4VA 1ZL1A 3PZGA 2WZHA 2VX7A 2YIHA 1V3KA 1R46A 2CYGA 1BQCA 3WUEA 1NWRA 4FLQA 4CD8A 4JL2A 3VGBA 1V0KA 2VO5A 3UG4A 1HXJA 3GZAA 3M7SA 1FHLA 3WENA 2E40A 3ZMRA 5I0DA 4UOZA 3OGRA 2NT1A 4UQBA 1GOKA 4KRTA 1KTBA 2J7EA 1JI2A 3T2PA 3BUIA 1HKJA 3THDA 1QVBA 3IAPA 1JYNA 5D4YA 4TVCA 2RGLA 2PWHA 2XIIA 4PUDA 3GH4A 4WF7A 1XH2A 2YDQA 4JHOA 4W5UA 1HWWA 5A95A 2BFGA 5D9OA 3QR3A 3U7VA 4UQEA 3TTSA 3WDQA 3SCPA 2ZE0A 3AXIA 4YHGA 3WSUA 1IV8A 3MI6A 1AQHA 1JYWA 2WCAA 1XGZA 1MFVA 4NXKA 4UFJA 5DO8A 3CZ8A 1QI4A 2BY3A 1KFWA 2D2OA 2D1ZA 2WW5A 4MADA 1GVYA 1LQ0A 5JUVA 1TE1A 2C7FA 3WQ6A 1UWRA 1OINA 4PTMA 1ISYA 4TXEA 1XCXA 4KGLA 4FNUA 3PZTA 3CBWA 1W3KA 4YPJA 3WD3A 2WK2A 4TVUA 3RILA 4L4PA 5E0FA 1D7FA 3DX2A 1M03A 1TQWA 5C70A 1W32A 4WSJA 4DO5A 1YQ2A 3VIOA 2W5FA 3ZR6A 3AIBA 4UZSA 4AZ7A 3D50A 2GDUA 4OOUA 3WH8A 3BAJA 1JNDA 3BSGA 3VNZA 2VZOA 1W9XA 3A24A 3KWXA 1VF8A 3T0BA 1OB0A 2Y2WA 4XX6A 1Q6CA 4J28A 2XIBA 4AZHA 2BHZA 3ARVA 1KWKA 3WD2A 3ZM8A 3L4TA 2WWDA 9CGTA 4U2YA 2IXVA 4FLSA 5A6KA 3VIGA 1SYTA 3CMGA 4CGTA 2ALWA 1DTUA 1ZB5A 1CLXA 3ZJ7A 2ZUNA 3CZLA 3SCOA 1V02A 1UD6A 5GNZA 4DUXA 3VIKA 2J7HA 3HG5A 1VEOA 1NH6A 1E56A 3CHCA 1FOBA 1QI0A 2PWEA 4W87A 5I3DA 4GI9A 3T09A 5DFAA 4JIEA 2Y8KA 1Q6GA 4WJXA 3THCA 3IAQA 1E6NA 1VJZA 5KZ6A 3B9EA 1PIFA 1C91A 2F1AA 3UR7A 3S5ZA 3WQ5A 5HBFA 3RJYA 2EO7A 5GNYA 3HG3A 3ECQA 4GQRA 1Q6DA 3ZOAA 2GDVA 3W29A 2JALA 4URIA 4ATDA 3OGSA 4CN6A 3EDDA 2J8FA 3T0AA 8A3HA 1MW2A 2DT1A 3RJXA 5I6SA 1HXKA 4NRSA 3WF2A 3ZT5A 1ISZA 2WBKA 3W0KA 1V6VA 1WZLA 1MQPA 1OM0A 3AXHA 4QCFA 5JIWA 2F1BA 5A8MA 2EBNA 3D4ZA 1G0CA 3T08A 1U30A 3T2QA 1HT6A 1Q6FA 1MFUA 1CPUA 1CXFA 2PC8A 1FHDA 4WKHA 3T2OA 3TV8A 4DO4A 3A3HA 1ODUA 1HKMA 5CJ5A 4IPLA 1JXKA 5D8WA 3SUUA 3WQ8A 3EDJA 2ZX9A 1H11A 1DWGM 2J75A 4FLRA 1E0XA 5C8BB 1TFVA 2XHYA 4U2ZA 3W4RA 3NJ3A 3BAXA 1KXQA 5C71A 2DGAA 3BLKA 3KL3A 5IFPA 4R27A 2G3NA 2F7OA 1CGXA 3MU7A 2VRKA 1OSEA 2DH3A 1OIFA 3A4AA 2FHCA 1GCYA 1V6XA 2YA2A 1DWAM 4D71A 1CYGA 2WMJA 4J3UA 2EXOA 2W4XA 3AZRA 1HJQA 3I3BA 4P7OA 3RM9A 1BG9A 3WDIA 1B30A 4GZJA 4P7QA 3LXAA 1OT2A 1UH2A 1H1NA 3FN9A 1V3HA 3D51A 3RIKA 4PUEA 4Q22A 1CGVA 1EA9C 4U33A 2CEQA 3K4DA 1T0OA 4B16A 1DWFM 3KL5A 3BCDA 4L4OA 2BY1A 4JFTA 1H2JA 4HMDA 4CU8A 3N04A 4DM2A 3DX1A 3APGA 4PMVA 1B3WA 3BUQA 1QX1A 1K9EA 1WDSA 3ZQ9A 4UNIA 3WEMA 1OD8A 4BS0A 1JDCA 4UFIA 2CBUA 3BVTA 1E1EA 1B1YA 2Z1SA 3TTOA 5D9NA 4LPCA 3WMCA 3N9KA 2YFNA 3BMVA 5F7UA 1NWSA 1J0HA 2Y5EA 3AHYA 1J18A 1CXIA 3PZIA 1W2PA 4XZBA 2OWXA 1E6QM 1XRVA 4ZXOA 3BVUA 2YL6A 3AOFA 4TVDA 4AD5A 3WNKA 1NP0A 2D23A 2WB5A 2WVSA 3VD5A 5BXPA 1H49A 4ACYA 2BVYA 5A2BA 2WMIB 4AY1A 3AHVA 1KBKA 1ITCA 3GXMA 1E40A 1V02E 2J7FA 4B3LA 2OLHA 3QGVA 1BGGA 5GNXA 2O92A 1GOWA 4IISA 3VO0A 1UD8A 2VX5A 1HF6A 4CD6A 2AAAA 1J0YA 2V5CA 2F2HA 2WMIA 1JFXA 1GOOA 5JBDA 3CLWA 3WKZA 4W5ZA 2ZIDA 3VSTA 3UG3A 1G01A 2VZUA 4H2CA 3DX4A 1VENA 3A47A 1EOKA 1PX3A 5HNNA 2VL4A 4JKKA 2MANA 1GOIA 2WSPA 1G9HA 1E6XM 1C7SA 1UR0A 4BQ5A 2AMGA 1M7XA 1X6LA 1TQTA 1BSIA 1R87A 2YL5A 2JF6A 3ARPA 1B3ZA 1I75A 1TA3B 3WQ4A 2WKLA 4LX4A 3VD9A 3LXBA 5HOSA 1H09A 4HA4A 5A1AA 1MW3A 2QMKA 1E15A 4PTVA 4U5KA 1B3XA 4GKLA 2F61A 1HN1A 3LRMA 3WDJA 4F9DA 1ISVA 4AEFA 1ZBCA 1ZJAA 3W37A 1TA3A 4QCEA 1KBBA 2F7QA 2JF7A 3RDKA 4AD4A 2BHUA 1EGZA 1PX4A 5IFTA 2ZUUA 1OT1A 1K9TA 3LPGA 3LX9A 2XVNA 3TTQA 5ABGA 4XB3A 4W85A 4FNRA 4V28A 3LMYA 2WANA 4OKDA 4P7NA 1UHVA 5BRQA 3AYSA 4AWEA 3EJUA 1XH1A 2B31A 5A2CA 4J3TA 5A6JA 3AIEA 3N15A 5E70A 3ZT7A 3MSGA 3CUFA 1BFNA 2CCRA 4JFWA 3AJ7A 5EFDA 3OB8A 6CGTA 1GOQA 3AIRA 2VURA 4UFMA 1F4AA 1TCMA 4GINA 1KCKA 3CHDA 4FK9A 1BPLB 3AROA 4D6IA 1VFMA 2VVSA 3PZOA 3RM4A 2VNCA 1PX8A 7CGTA 3FY1A 3MANA 4PRWA 1QPKA 3OZOA 4U3AA 2W61A 1W9UA 4XV0A 4DUWA 1CWYA 5A6SA 2XUCA 1VFUA 1R34A 2GJPA 2WC3A 3EJSA 2WMKA 2OYKA 5IHSA 5A8QA 1KGUA 4U3CA 4PTWA 3GNPA 3LPOA 2V5DA 5A6MA 3VD4A 1CENA 2UY5A 1LF1A 1CXHA 3TP4A 3EDEA 1KGXA 3GXDA 1QWNA 5I79A 3VSVA 4AZGA 1SMAA 1JAEA 4FLOA 2BV9A 3AXXA 5CZKA 3GNRA 3OBAA 3EDFA 3WD0A 4E4PA 5A8NA 5M03A 2CBIA 3PN8A 4MDPA 3PTMA 2BVDA 1J11A 2XJ7A 5GQBA 1QNOA 2WLYA 1E5NA 4B9YA 4J3WA 3W27A 6TAAA 3VVGA 3EJQA 1QNPA 4J7RA 3SCVA 2TAAA 3AIVA 3SIMA 4A3YA 2D0FA 4MB1A 4IUGA 2XN1A 2XM2A 4B15A 2EEXA 3W26A 1QBBA 2GVYA 3BAKA 3QHOA 4H8HA 5M17A 4EANA 1DHKA 1MQQA 3GXPA 4NZFA 1EOMA 2D0HA 3H53A 2XGIA 1QI5A 3VIFA 5FOOA 1HJUA 1PJ9A 2EABA 3WY1A 5CLWA 4D6CA 1JZ7A 1BF2A 3AS1A 3VDAA 1PIGA 2EPKX 1C93A 2PWDA 1X1NA 2J62A 1L0PA 4IPNB 4QLJA 5A6LA 4C7FA 1KR1A 2J77A 1HNYA 3CZSA 4AD2A 3L2LA 1TVPA 1V0MA 3G6LA 4D6GA 1GQJA 5FKYA 2OYMA 2G41A 2PI6A 2FYVA 5DT5A 2DPEA 1QNQA 3WDHA 3M6DA 2WCSA 4PEEA 2XSAA 2O9TA 3MV01 3VDHA 3W53A 1QBAA 2UY3A 1UH4A 1QI2A 3ARUA 1WE5A 4AZ5A 4YHEA 1HJWA 1E43A 3POCA 1W1VA 1US2A 4MTVA 1CGYA 1UD2A 1PZ2A 4KMQA 1Z32X 4TTUA 3BUBA 3F5JA 1VFOA 3VU2A 2WVTA 2GK1B 4PMXA 2YA1A 1AVAA 1HVXA 1CEOA 4NXSA 4UCFA 3ZT6A 2YDSA 4JAWA 1JIBA 5EB8A 1E6SM 4GO8A 4KWUA 3I3EA 5ECUA 1JNEA 3ARYA 3AHXA 3D3AA 4C7DA 3VM5A 4PMZA 4PMRA 3AZTA 2GK1A 4RL3A 2YDRA 3WNNA 2XFYA 3VGDA 4NZJA 3AHZA 3WY2A 3VPLA 2PB1A 3CUIA 3OLEA 5KEZA 2QMJA 3DYPA 4X9YA 1QHOA 1E0VA 1E3XA 4RE4A 3MSDA 1H3GA 3AMKA 5DMYA 4YN5A 2YBUA 5A2AA 4PMUA 1OGBA 1XHGA 4CU7A 5I23A 4CUCA 2WC7A 1W3LA 3BUDA 1UR8A 1G94A 1ZBVA 3DX0A 1UQZA 1Q4NX 2XPKA 2Z1KA 1HX0A 1X6NA 4HTYA 3L4YA 4P7RA 1E3ZA 1C90A 1B3YA 4D6DA 5A6AA 4H04A 1BHGA 1E4MM 3NSNA 4K68A 1VBUA 2PF0A 3AS0A 1DWJM 5LA0A 2YLLA 3CPUA 2EQDA 1BVNP 5I5RA 3WEZA 4HA1A 1A3HA 4D6FA 3CZNA 1JFHA 5CGMA 3BCFA 3PZQA 4M29A 1GNXA 2J78A 1HL8A 2G3MA 4R5EA 2JEPA 1MXGA 2CERA 2XM1A 2CIPA 3VIJA 2UWFA 3CHFA 4B9ZA 4J3XA 1CBGA 1MQRA 3EMCA 4H8UA 1M01A 3FAXA 2BNJA 2DDXA 4NI3A 3NUKA 1JZ6A 2WVUA 4UFLA 1F4HA 5AC4A 1HJVA 5BWFA 2J8GA 2CPUA 4LYQA 1GQLA 1FH8A 7A3HA 5I2UA 3IJ8A 1LL4A 1JZ5A 5BXTA 1UKQA 5LYRA 3FAWA 4MAZA 1UH3A 1OCQA 3GTNA 2E9LA 3UCQA 2CBVA 2VC9A 2E8ZA 4AXNA 2A3AA 1TZ7A 3WF1A 1CZ1A 1WZAA 4CCEA 3EMQA 1UD3A 1VJSA 1EXPA 4AZIA 2VTFA 3MMUA 4KGJA 2XN2A 1GHSA 1UG6A 1V03A 3UETA 2E9MA 4OJYA 3RO8A 2ZXBA 1J0ZA 3DYOA 3ZIZA 1IT0A 3VGEA 3N13A 4HPGA 3VX1A 1TQVA 1EDGA 3VILA 1JF5A 1UR2A 2PBGA 5E0CA 3B9AA 1E0WA 1JZ4A 1HJXA 1SFSA 3UESA 3SURA 4XUYA 3WF4A 4PCSA 3WBEA 2XWEA 2DSUA 4W88A 4H8VA 4HU8A 1VFFA 1E70M 4QFUA 3UR8A 1JDDA 2BY2A 2J7GA 3BH4A 1XD0A 3TONA 2YA0A 1JD7A 4BA0A 3GDBA 1E72M 5BCAA 3IK2A 4BQ4A 3PZVA 3PHAA 2D22A 3OA5A 3VGHA 2EAEA 4OOZA 3WD4A 4JFUA 4P7LA 2X2HA 3W82A 2XYLA 2OSXA 2BXZA 1Y7VA 1UD5A 1SZNA 1M04A 1R7AA 4JCMA 1UKSA 1XSIA 3BAYA 3D4YA 2WYSA 4X0NA 1S46A 2F7RA 3LXCA 3FHAA 4A4AA 4WKAA 1NQ6A 4Y7EA 3MO4A 4ZEPA 1WDQA 4W89A 3U7BA 3CUGA 1NP2A 5ABFB 1MYRA 1C92A 1O7DC 1D3CA 1XC6A 3MUIA 3OLIA 3WEOA 2WKGA 2V3GA 2OWWA 4CD5A 2DSZA 1EDTA 3OZPA 2W63A 1L8NA 2D73A 2VX4A 4QP0A 1ZBKA 2BXYA 2FDMA 3WFZA 3EJTA 3W28A 2EPNA 2HVMA 2G4FA 3GXNA 4EKJA 4H7VA 1WDRA 4U5IA 5CGTA 1EIBA 4QLLA 3QHMA 3SCWA 5AYIA 3ARTA 1UA3A 2DIEA 2IUZA 2W67A 4UR9A 3N12A 3WF0A 3PBGA 3W6MA 3U5YA 3I3DA 3RPMA 4JZ5A 3VIHA 4AMWA 1E6ZA 1GW1A 4W7WA 1WCGA 1JYVA 3NSMA 5CPSA 1K6AA 3A22A 1H0IA 1YHTA 5I78A 5IHRA 1UOKA 2JFEX 4DWSC 1RD6A 2WLZA 3GNOA 4S3JA 4FNSA 1KWGA 1UWIA 1HVQA 2FHBA 3RMEA 5JBEA 2J7DA 2GUYA 3W24A 3SUTA 1R33A 3A5VA 1NWUA 1LG2A 1VEPA 2BS9A 1SR0A 3DHUA 4CD4A 2A3BA 3L4ZA 3A4WA 1V3JA 4QLKA 4MB5A 4X0VA 4PCTA 8CGTA 3T0DA 5HXMA 2WHMA 3J7HA 2WBGA 2VUYA 4P8UA 2XN0A 3AICA 3WH6A 5CXPA 3WNOA 4DWSD 5IXEA 2WWCA 1ZS2A 1OGGA 3AZSA 4DWSB 5D8ZA 1J0JA 2WCGA 1CGTA 3ZR5A 1J12A 4WIWA 3EJPA 5BROA 1WPCA 1EH9A 3O9NA 4M81A 4MNJA 1FH9A 2ZWYA 2XFRA 1EQPA 5E9AA 3WD1A 2XWDA 2XVPA 1CXEA 2OSWA 4WKFA 2DSVA 1W9PA 1EQCA 2ZUWA 1CDGA 3W38A 1GZJA 2XTKA 4DWSA 1W1TA 3MUY1 3OGVA 1GOMA 2W92A 3CV5A 1BLIA 3B8SA 1U2YA 1FP9A 1EO7A 3H55A 4P8XA 4RE2A 4MAVA 4TUFA 3IANA 1WNOA 1TQUA 1BGAA 3ZJKA 4H41A 4GI6A 4F79A 1V0LA 4Z2JA 2W91A 2WXDM 1GVIA 4ACZB 1MVYA 2G3JA 3CIVA 3GXTA 4BF7A 3ARRA 1UD4A 5IDIA 3FW6A 1QI3A 3GBDA 5CQ1A 3WH5A 1R8LA 4W7UA 2QHAA 2CXGA 2CESA 1QW8A 2X05A 4F8XA 4UFKA 2GSJA 5E6ZA 1W9DM 3KE0A 1ZJBA 4GIAA 4ACZA 3GH7A 3AQUA 1UZ1A 3L4XA 5DF0A 3VGGA 2DT0A 1GUVA 1WKYA 6A3HA 1TVNA 1V3IA 4AMXA 1J0KA 1JG9A 4JCLA 1DWIM 3WNPA 3K8KA 1FFQA 3UEQA 3WELA 1HKIA 2XFFA 4M82A 4D6EA 5AC5A 2FH8A 5A69A 2FHFA 1V6UA 4HPHA 1MWOA 2VZVA 1UKTA 1MW0A 1J10A 2AOSA 3WMBA 4PTXA 1E71M 2PBOA 4EAMA 3MUAA 4F9JA 4LGXA 5TD4A 4AIEA 2ZUSA 1IZKA 1PZ3A 3CTTA 4J3SA 3AYRA 4AYSA 1OWQA 5M3WA 3AMGA 4HZ8A 1TR1A 3HJEA 3VNYA 2DEPA 2X1IA 4HMEA 2XSBA 1CGWA 4DO6A 4AC1X 3BMWA 2V3DA 2VVNA 4KH2A 1RH9A 5DEZA 2VR5A 2W66A 3BLPX 1UWTA 1V3LA 1KXHA 4Z2GA 3PZNA 1H4PA 1BTCA 4LYRA 3AMDA 1AQMA 3AFBA 2DH2A 5BRPA 2VR4A 2UY4A 1V6YA 4TOQA 4AZ6A 2VJXA 2F18A 2VZSA 1PAMA 4MDOA 2X0HA 2G3IA 3DDGA 5CPTA 3NYDA 2YL8A 4ZE5A 1R85A 5A6BD 2HISA 2VRJA 4V27A 5LA1A 3A6OA 3AIWA 2F7PA 2O9PA 4CCDA 3AIUA 1FH7A 2IXUA 3VM7A 3FHQA 3DX3A 1WO2A 3WNMA 3ZJ8A 4M1RA 2VCBA 4OBRA 1HKKA 2VCAA 3ALGA 4AD3A 5DT7A 3E1F1 2EJ1A 1D2KA 4QAWA 2FGZA 3RCNA 3WN6A 3GBEA 3WDPP 4NF7A 1US3A 1JZ3A 1QW9A 5ABEA 1UA7A 1N82A 1V08A 2G8ZA 3SCUA 5HPOA 2VQTA 3GXIA 2YKKA 1ZBWA 1W1YA 3L2MA 3WL0A 1ODZA 1JI1A 4OGZA 5AY7A 1JGIA 4EK7A 3N17A 3N18A 4FNTA 4AIOA 2A3HA 2F8QA 3SUVA 1BG4A 2UY2A 2ZX7A 1U33A 4ZE4A 1KR0A 4FNPA 4Z2KA 5LA2A 4PMYA 4E8CA 3VMOA 1JD9A 3EDKA 1XSKA 4Z2HA 1BYDA 3BAIA 2CHNA 3BGAA 1UR1A 4ATWA 3ZJ6A 4OZOA 3WUBA 1UYQA 1E4IA 3BLBA 1B9ZA 1E4LA 3WDRA 3BUPA 4AIUA 5E6YA 1UR9A 4M8UA 4W8AA 3WH9A 3WUFA 4WSKA 4UOJA 2EPMX 3VIPA 3N1AA 2E8YA 3VD7A 2FH6A 2WNWA 1UWSA 5A8OA 3CUJA 1LL6A 1O7AA 2V3FA 7TAAA 3PTQA 2OW6A 5I24A 2J25A 1R86A 2ZX5A 2Y8VA 4BCEA 2WZIA 3MMWA 3ZO9A 3BXWA 2O9OA 1G1YA 3NDYA 2WHJA 5E1QA 5FL0A 1AQ0A 4BQ3A 2X2JA 2FGLA 4BQ2A 2WVVB 3KZSA 2D24A 3DHPA 1QHPA 2E0PA 1AMYA 1I1WA 1OD0A 2WPGA 3ZSSA 3HMCA 1GQIA 3LPFA 3VIMA 5A94A 4WLCA 4ZENA 3EBVA 1KXTA 2Y24A 3BSHA 4JHZA 3KLKA 1KQZA 1ITXA 2WMGA 3NCOA 1BVZA 1CXLA 1JZ2A 1HTYA 2WVVA 2EACA 2XG9A 4MNKA 2Y4SA 1W91A 1KXVA 3SCNA 3ARQA 3IJ7A 1FA2A 1E73M 2W62A 2WC4A 2DT2A 3GYCA 2C8NA 4UQAA 2WMFA 4LYPA 4MJ2A 4OIFA 1O6IA 1PPIA 3TOPA 3S2CA 1WDPA 2ZX6A 4ML4A 4OUEA 4ZFMA 3WBAA 2VT0A 5FD0A 1KGWA 2QPSA 3CZKA 3VD3A 1CLVA 3AISA 4M24A 1W2VA 1E4NA 1K9DA 4Z2IA 3NSXA 3PZ9A 4Q7NA 1OBAA 3M46A 4MJ4A 2WM0A 4W7VA 1JXJA 3LRKA 4FNQA 3ZSTA 2FE0A 3HN3A 3VOCA 2OSYA 5A3HA 3U57A 4A3HA 1LG1A 4ZXLA 2J74A 3WL1A 5GPRA 1TQSA 5FCZA 2VRQA 1B2YA 3VX0A 1PBGA 3HZ3A 1NOFA 4GO9A 5EFFA 3K4AA 5FIPA 3F5KA 4NRRA 1CXKA 1C7TA 3BVXA 4D6JA 4AZBA 3NIYA 4UQDA 1K9FA 3UERA 2YLAA 2BVTA 3RM8A 1B31A 1XYZA 4D72A 4FF5A 2EADA 1LL7A 1GJWA 1J01A 2CKSA 1VBRA 3AHTA 2JIWA 4HOWA 2VOTA 1JDAA 3AS2A 4AISA 1EHAA 3AMCA 4W84A 3IGUA 1VRXA 5CPQA 1E9LA 4D6HA 3VDBA 3BAWA 2O9RA 1RP8A 1WP6A 3BVVA 2J47A 1KTCA 4CCCA 5A8PA 1MXDA 3W25A 2D20A 4GZIA 3QHNA 3SUSA 1E6PA 1W3HA 5M5DA 1GORA 3IJ9A 1WZMA 1XV8A 1RP9A 1DWHM 2J7BA 1UKOA 1CNVA 1C8YA 3VGFA 4CVUA 1M53A 4CN4A 4S3KA 2XVKA 4CN1A 2ESCA 3QOKA 4OBSA 1I1XA 3TTYA 3SCRA 3HG2A 3F5LA 2J4GA 3PTKA 3O6AA 5BXRA 3AS3A 1W3JA 1R75A 2GJXB 2D3LA 3DDFA 5I77A 1QOXA 2WSKA 3FNDA 3SCTA 1C8XA 2QPUA 3AIQA 3SCSA 1V3MA 1A47A 4UQCA 2ZWZA 2YOCA 2DT3A 2OW7A 4PMNA 1CTNA 3CUHA 3ARXA 3OIHA 4M80A 1FFRA 1GPFA 3SEPA 3CZEA 4PN2A 1B90A 2NSXA 4MB3A 2VI0A 2GJXA 4XZWA 4FMVA 4HOXA 1GHRA 3WY3A 1ISXA 1SMDA 3WMSA 3N11A 5EBAA 4JKLA 4CKQA 1HP4A 4P8VA 4CD7A 1C8QA 3VTRA 1NOUA 2E9BA 4PBGA 2NW0A 3PZUA 1PS3A 3OG2A 3O2LA 1QNRA 3ARWA 1NWTA 5ABFA 3WFLA 1XCWA 4WK9A 1J0IA 4HZ7A 3M07A 4J27A 2WAGA 4AD0A 3H54A 4HU0A 4TTGA 2ZXDA 4JFSA 1TMQA 4GI8A 4N42A 1KCLA 1QHZA 3VDCA 4AYGA 3A4XA 1UKPA 1B0IA 4D1JA 3K8LA 4RE3A 2OYLA 4PSPA 5HPCA 2BHYA 4GXPA 5D9PA 4AZCB 1XSJA 1XYFA 2EPOA 1TG7A 3WUGA 1P6WA 2V3EA 2J7CA 5JBFA 1UZ4A 3VINA 4AMCA 4LQ1A 2OWCA 1BYBA 4ATLA 2PWFA 3U5UA 2CKRA 2EPLX 4PMOA 5CLTA 1JAKA 2GFTA 3QOMA 4GPNA 2XGBA 3VIIA 4J3VA 1NOWA 3D5HA 5BYWA 3EYPA 4JFVA 2CBJA 4GZEA 3WIJA 1RPKA 3W81A 4AZCA 3LRLA 1ESWA 2VZTA 3BVWA 3ARSA 1V0NA 2WHKA 1JL8A 2YL9A 1ISWA 3K1DA 2ZXQA 1OGSA 1VB9A 2X0YA 1BAGA 3CZGA 2VMFA 1XH0A 4HMCA 1UASA 2YJQA 2VCCA 3POHA 1HL9A 3VUPA 2ZXAA 2YBTA 4UOQA 1UWUA 1DEDA 2CHOA 4W86A 1UUQA 3GH5A 4GQQA 3S6TA 1ZU8A 3G6MA 4CU6A 1PEZA 1W9VA 4UQ9A 1ECEA 2YFOA 1H0GA 3ARZA 3S5YA 3L4UA 2D0GA 5EMYA 1LWJA 4E8DA 2ZICA 3GM8A 3L4WA 4JL1A 2CITA 4F66A 4AEEA 1WZKA 3WQWA 2DIJA 3OLDA 1WAWA 4QDMA 1E6RA 3B9DA 1TUXA 3AI0A 3W6LA 4E2OA 3MMDA 2IGTA 4V2XA 1LWHA 4MPKA 5E09A 3ALFA 3SCQA 2A3EA 4NX0A 2E4TA 1UWQA 3AMLA 1J9YA 2BY0A 2QV4A 2E3ZA 2ZUTA 4EE9A 1GQKA 1EDQA 4N0RA 3GXFA 2X09A 1CIUA 4CVWA 1B3VA 1XD1A 4U31A 4PYSA 1CECA 5CSYA 3CH9A 3CC1A 2ZUMA 2CETA 4W8BA 2WMHA 5BXSA 4B3KA 4UTFA 5HDRA 1KB3A 4JKMA 4Z2LA 1FP8A 3MV11 4TX8A 2QLYA 2ZOXA 4UZUA 2J79A 3DC0A 1LLOA 1H41A 5D9MA 1KQYA 3SUWA 3KEHA 1W9BM 4W93A 1E1FA 2DSKA 2RGMA 5JIPA 2GJRA 3KLLA 3II1A 1W1PA 5AYBA 5FL1A 4AW7A 5CG0A 4DUVA 4IM4A 2C0HA 1BYCA 1DP0A 1JYXA 2XVGA 1Q6EA 2X8RA 3CZJA 3OLGA 3WNLA 1LJYA 3WQVA 3D52A 3MS8A 3DECA 1VIWA 3UG5A 4HA3A 4KRUA 3BC9A 4TX6A 1EO5A 3CO4A 2ZX8A 3CHEA 1VAHA 4C7GA 1WB0A 4NSBA 4PSRA 3F4VA 1IZJA 3LPPA 3K8MA 3A21A 1V6WA 2D3NA 3VKKA 2QF8A 4HP5A 3WH7A 2JIEA 4MNMA 2VX6A 4BZYA 2WZEA 2XVLA 3WY4A 1G5AA 4HZ6A 1JZ8A 4HOZA 1EHNA 5CSUA 2CNCA 4UFHA 1C3FA 3DYMA 1OIMA 2X2IA 1UQYA 4MNLA 4PMDA 1R47A 4D1IA 5ABHA 4P8WA 2VQUA 1E5JA 3CMJA 3HG4A 4AD1A 2DQXA 2NT0A 1JF6A 1HIZA 2JEQA 4MB4A 3CGTA 2Q8XA
chains in the Genus database with same CATH superfamily
3RHGA 1DOSA 1MKFA 1RUML 1MW1A 3VMPA 2BFVL 4R26L 3RJDA 1NM9A 5DURD 1UR4A 4FFWD 2AQOA 4PYGA 1K5NA 1BYAA 4TF4A 2WGXA 3BL3A 1JZGA 1MUCA 4NPKA 4WY0F 4ZOEA 5AW2B 3GSWA 3T8MA 1E4KC 2YIHA 2H1LM 4NUGH 2YBVA 1H6UA 1RZGA 3GHBL 3UTOA 5ACZB 1J87A 3RMJA 4J23A 4PGDB 5IB5A 4MYWB 4EUPB 5DJCA 5IM51 5DRCA 4M6NH 4Q58C 4RGMB 5D1QC 4TVCA 3A67L 3OPZL 3H4FA 5A95A 2F53A 3U9UA 3I74A 5KVEL 3IRDA 3EAKA 5DQJA 1TXKA 3ZYZA 4XBGB 1R9XA 3MI6A 5HYIA 1XGRA 1S3RA 1ZEAL 5IR1A 2GYIA 4POCA 1TLKA 4MADA 1IM9D 1TE1A 4PTMA 2Z4QA 1RV8A 4TXEA 1XCXA 1MCEA 1DKWA 1AE6L 4NAFB 4L4PA 3MOQA 1M03A 1AJZA 3VIOA 4AM0Q 2BSSB 2ZKXA 2ZCGA 3EGXA 3ESVF 3ARGA 4Y2DD 4UTUA 2H2PD 1L5GB 4XXDB 4HFWB 3HE7B 2J1KA 2Y7NA 3N2CA 2YQ2A 1JERA 5I71C 3FTUA 4OCSL 4F7CA 5DD1H 2OEKA 4KITB 3V4VH 2AGJL 4DERA 2NV9A 4GOAA 3MN8A 4H00A 3ORJA 4HZ1A 4D8PB 2X7VA 3WJYA 3BKYL 3W7JA 1NFIB 1M7DB 3I9IA 5FO8B 3SD2A 1OYBA 2YS4A 3VIKA 3P2DA 1UA6L 4O57A 6REQA 1YE6A 4PR4A 5AUMB 1PYWB 3UDWA 1X5AA 4G9PA 4TMBA 3B9EA 4KPHH 3ZTJG 5EHFA 2W9DL 4ZPVB 2JI1A 4EI5A 1CX9A 1XFCA 1GOXA 4URIA 4IIBA 2E75C 2H6UA 1DUYA 3MLZL 3QZWA 2NVAA 1DQQA 1V6VA 4AI7A 2EBNA 2N56A 4FA7B 2E5CA 4TQ8A 5KTEH 3DROB 1KV7A 2OL3B 4B5EA 4PJAF 3VI3A 4N3UA 1C1EH 4IF2A 1MDRA 5HWNA 2Z7KA 1E0XA 3GTFA 2Z91B 5C71A 1UB6A 3QQ4A 1RMFH 2DH3A 2A5UA 4YTTA 4R9XA 5HGBB 1QBLL 5CIPB 1NEYA 5MKGB 1KDJA 4LOCA 4AQ1C 2FBJL 1B30A 2YGNA 2OMYB 3GU2A 2DQGH 3B8TA 4JVPA 1RZKL 2BVUA 4U33A 1S5IL 4NUJA 3A13A 2M2DA 3PF3A 4HDIA 2XPYA 3MLTB 3BP7A 1EMTH 3ETSA 1B3WA 1MFAH 4OQTH 3TSDA 1ZT7B 1KPUA 3QVAA 1XC4A 3PRZA 3FYYA 2VIRB 1WV7T 1EEYA 5D7HA 4ZBJA 2FLMA 1CLYL 3E7JA 3GC2A 4QRUB 1XRVA 1QNIA 3FU5A 3H4HA 1F3WA 2WB5A 3AXMA 3JWOH 3Q3GA 4XD3A 3AHVA 4MJIA 4J4KA 4QDPA 3OHXB 1F74A 3D12B 5ESQA 3K0YA 4WW2F 2DWYA 1IGIL 1SO6A 5T1LA 4OFCA 2H0PA 1GOOA 5K9DA 2HWZH 1G7PA 1TITA 5DZJA 4MD5A 3ORWA 4XCCH 4MDRA 4PRRA 3VWJA 2WXHA 4N7QA 2IS7A 2YD6A 3W7MA 2DVTA 3NQEA 1AYOA 3PHOA 5LKYA 1T21B 3MZ2A 1OG6A 3IJQA 1MEXL 5HWJA 1EV2E 5AVTB 1TTCA 3MNZB 1EK3A 3DMMD 5JLZA 2XHNA 4HA4A 2NR6C 4Q9QL 1MW3A 4U5KA 3WDJA 3KR3H 1A5SA 4NFDA 1SW3A 1ZA3B 3EKCA 4JHBA 5D8JL 5B1JC 2N59A 2ERJB 3EWXA 2V33A 4HPNA 2XVNA 2X5PA 1LT8A 5GS0D 5I18H 3OG3A 2C18A 3UJIL 3IRPX 5L88H 2X6MA 3U83A 3OKLA 5ISZB 2HH0L 2MCAA 4TV6A 1Z9SA 3U4FA 2CC0A 3GS4A 4ZMPA 4MZRA 1HO4A 5ADPH 4GRSA 5D2YA 1DJGA 3UABA 1EEUA 2Y1ZA 5DLCA 3MCKB 2Y23A 1Q3NA 1R34A 4R90H 1AANA 3V6FA 1EFXA 4U3CA 2GT9A 5A6MA 3GINA 1AL7A 3VSVA 3TYEA 1DE5A 5JPNC 1XYCA 1CT8B 3BVNB 1KYOJ 1TF4A 4KK8C 3TBSA 4FAAB 4IL2A 4M5TA 3DENA 4AKPA 1D9KD 1ZMYA 2FJUB 5F3BA 1ULVA 3EA1A 4P5KA 5EPDA 3MWCA 1LO3H 2PMZA 4FA6A 2EEXA 2OEMA 2NYZA 4HS3B 4OFYD 4LUYA 5M17A 4IQJA 4NZFA 3MRQA 3BPWA 2X28A 5FOOA 4Z78A 1CGSL 5J9PB 5FYLL 1E6OH 1JPDX 1N4XL 1YJDC 1Y07A 2PWDA 2J62A 5AVUB 1AUSL 5J4MA 4I2XB 3PABA 3TVMD 1TTGA 5C97A 1MCDA 2JELH 4ZUUA 1QNQA 4LQFL 5CCGE 3GIZH 2O6EA 3LTPA 1J05A 3DA0A 1FWGC 4K39A 4N9CA 2LU5A 1B57A 1PZ2A 4R0LA 3EGDA 1VFOA 2G4EA 4P9MH 4X7TB 4TNFA 2A3LA 1E4KA 1BZ7A 3GNNA 4DTGL 4O2EA 2OMZA 3ZDXF 3VM5A 1RY0A 1ID2A 1LTXA 1MCOH 3QDMB 4FFZA 3VPLA 4K5NA 3S6DA 2WUBL 4DJFD 3CFKB 4Z7WB 2COQA 3K0WA 1E3XA 1YEKH 1HFBA 4MTMA 5J6GA 5A2AA 3P0YH 1PG7W 5IK3A 2NZLA 3MLRL 1EQWA 2EILB 4YGVB 3LN4B 5DMKA 3X11B 4PCNA 1X6NA 2IPFA 1Z6JT 3LHUA 4Z7VE 5IVXE 4XT1C 1KC5L 3W2KA 4LDOB 3SBPA 8FABB 4FFYL 4M1DH 4MVBD 5DRNA 3CUXA 1ZIBA 1UUMA 3Q58A 3CSYA 5F1SA 3EO0B 1EYWA 4XMPH 4L0ZA 4LAQL 4ACPA 1I1FB 1OKEA 1ZLSL 2AKRA 4E5XB 2CWNA 1J8HB 2JSFA 4PS4L 3FH7A 1CBGA 4F8LA 5SWUA 4H8UA 1SFJA 2WVUA 4P57B 4JVUA 4Y5YA 1BWVA 3IJ8A 4R88A 2JKTM 4LSTL 1JCXA 4PJEF 2G9HA 1A8ZA 5CGYC 1EZVX 4Q52A 4L4VA 4ZO9A 2A3AA 1PCXA 4JFFA 1JZFA 4AZIA 3S0PA 3ESUF 3WL9A 3BG5A 4ZQPA 2EC9T 4Y2WA 3NP4A 3ME0A 2HVNA 5AWNH 4XUYA 5KYXA 4DJDA 3H7LA 1I1YB 1JCTA 1A1NA 3MV8D 4HU8A 4BV1A 3SPGA 2KI6A 1G9ML 3OZYA 2J7GA 5M94B 2YA0A 5F9JA 4BA0A 3GDBA 3OW1A 5BCAA 3QUMH 1FWBC 3P73B 2UX6A 3IK2A 4BH7B 3F7VB 4HN4A 1HILA 4RA0C 4IGBC 4FQIL 3V5FA 3RWHB 1DVUA 2WIIA 1LK2B 4BF5A 3FJ4A 3THML 1OB1A 3QFDA 4WTZA 3LCWA 3GMPA 1WWCA 1CL7L 1NCCL 4Q6IC 1L6ZA 2I60H 4FFVC 4MZ3A 1G7JB 3T7VA 4DBUA 5D96B 2R56H 4JRXE 2G75B 2HVMA 1RQEA 1KRMA 2XGZA 3IGAA 3MLYH 2Z7YA 3OR6A 1JEZA 3C2AH 5I03A 4YHKH 3W85A 2QFPA 2QQ6A 5I66B 3MJ7A 4YDKL 4XHJD 4JZ5A 1GW1A 1FVEA 3NSMA 5CPSA 3LXUX 4FL4B 4ODHH 3RIFF 2HKHH 3NPVA 2OMTA 2FATH 3WXWL 1ESOA 3UTSD 4HOMA 3HI6H 3EGJA 3OJVC 3SW6A 3L3GA 4PS7A 1OWRM 2H26A 1XGTA 3BRGC 3PY9A 1RK0B 4DZ5A 2QFRA 4DWSD 4KHXL 2WWCA 2CE6A 2BZCA 1ZS2A 3C5ZB 5DJ8B 5LHEA 5D8ZA 4OCNC 4GT0A 4EN3B 3V9FA 4YX2H 2EDNA 3K6NA 3WD1A 2H41A 5MEQA 4JTSA 4JPQA 3WLNA 4JCWA 1CDYA 3L9RA 5I07A 1ADSA 2TSAA 1MZZA 1DL3A 1NDVA 1YN6A 3HC3H 3CV5A 3RA7L 3DG3A 4DI9A 1U2YA 2AL2B 1F58H 3GQFA 5I1AA 4PUKA 2GCYA 2X9WA 3HI5H 2PDUA 2WNGA 1TIWA 3P4LA 5DS8A 2H8ZA 2QDGA 1LJMA 3FW6A 2V2WA 3VD0A 2ZOWA 2Z92A 2VRAA 1SUJA 4Z7UE 2NZIA 3VCNA 3LHVA 3ILPB 2Z64C 1NC2A 3SPIA 2F7FA 1C5DB 4B5SA 4ICXA 4JY4A 2YPKA 3Q8BA 4QRFA 2Y36L 4MDJA 2LAAA 2NR6A 3T3ME 2X4NB 4M82A 3RY5A 5CJBA 1VP5A 4LF2A 5FGBC 3GAKA 4EDXB 1UKTA 4XO8A 3GJFB 2AOSA 1NF0A 1NIEA 1F0LA 1H6FA 4F9JA 3Q48A 1DQIA 3T3PE 3DGRA 1X38A 3RX7A 4FPSA 3QQDA 2XSBA 4LCUA 2VAAA 3BMWA 5HNUA 3BLPX 4EBQH 4O4YL 3EHBB 4Q8WA 3L3KA 2KZWA 5C0CD 2VDLH 1WT5C 4X7DC 1QSEB 3HUJB 3MUUA 1CBJA 2CLVA 5BRPA 1G0YR 4RFOH 1O7DE 4TOQA 3ARDD 4YLBA 1R85A 3KYNA 1OXYA 1CC3A 2F7PA 2XWTB 1XTLA 4CLMA 1AXSB 4FXSA 3ALGA 3E1F1 2WXKA 5A16B 3T6XA 4NNYA 3P9LB 3G08A 1QW9A 3NACL 2QCNA 4B3ZA 1E4XI 1UM5H 1T7ZA 2Q1EA 4GY1A 2YZRA 4OGZA 1WOAA 3B0UX 4AUBA 1ZHKA 1C8VA 1EGJA 4Z1CA 1QAWA 4C4BA 2X7LA 3ULVD 5DMJB 1GTEA 4ELKA 2YD9A 5HHME 4QXGH 1DZBA 3BGAA 4AM0A 1CFNB 3WH9A 1FLTX 1BQ5A 1JGVH 3RLSA 4CNIA 2V3FA 4DXVA 3FO9A 2CO6B 4XZHA 2VXSH 2BMKB 4U1GB 5FF0A 2VDGA 1MFEL 1TPEA 4B9FA 4P4KD 5EBWA 3NVQA 5KN5A 2GGGA 1A0QL 3RTLA 4P2QE 3OBKA 1LEKA 1BXXA 3TZVC 2AJZA 3FZUC 3RGBA 3BIKA 5HJXA 1AMYA 4A6YB 5IB4A 1BQSA 4UINH 4IU3A 1A6UL 2VGIA 3T44A 2YPLD 4MA8L 1Z9AA 1IB5A 1CXLA 4AT6B 3PHQB 1QASA 3X1GA 1J79A 1PLAA 4DF0A 3HR5B 3E8VA 3FF7A 3GYCA 2V82A 4OIFA 3N3MA 1MLCB 2VT0A 3CZKA 3WIIH 2W0PA 2OTWB 4BCYA 2AK4A 3F8UB 1OTTD 3V0IA 1QFWI 1X97A 2UZPA 3RNKA 5HHVL 5GRVK 3V4UH 3P30L 5F7EH 4RDYA 3UTZB 3PXHA 5A3HA 3WL1A 4OV5A 1Z8AA 3EFDL 3V18A 3N43F 3G5YA 2P8LB 5FIPA 3F5KA 4LL9A 1W6LA 3GC4A 2QJDA 3AU6A 2ZZ1A 1B31A 2NY6B 3GHRA 1NFGA 4RKAA 3W23A 2XTJC 3PNRB 1D6VH 1JRHH 3EWCA 3D18B 3GKWH 4YS1A 3SQBA 1B5TA 1TVHB 5EL1A 1YNTB 4WEVX 5GS1A 1KTCA 4CCCA 4MNQE 3E6HB 1E90A 1RJYA 2PCEA 1WG3A 4EIGB 3UXAA 4KXCA 3SY5A 1GORA 3SQMA 5ID0A 5AKRA 2X4OA 3OQEA 1R6VA 4OBSA 1O5KA 3E2VA 2WB7A 4HA0A 4OECA 3TTYA 3X3FH 3CQQA 1ONWA 3HG2A 1DBBH 1KF9B 1KTDB 2J4GA 3MRIA 2E27H 5J5EA 3T78A 4PJ9B 2ENPA 1I7UA 5KSBF 4ALAH 1UB5A 2JKEA 3BJTA 2CLIA 5FEZA 1EPXA 2APVA 5IF0B 4CNTA 4Y2LA 2ZSWA 1BD2A 2ODOA 3GSUA 4E0RB 3DO4A 1NPNA 3O2DL 1HH6B 5F89B 2YGOA 4X5RA 4B0MB 2DQTH 1T2QL 1XUZA 3G1XA 1QNRA 2YUXA 1NWTA 4LWWA 3L2NA 3GK8H 1UXWA 4U6HB 4KKBD 2PDQA 2WP3O 2EE2A 4X83A 5J6SA 3S9DB 2NQDA 1KCLA 1QHZA 1LMKA 3USZA 3ILDA 4L4LA 3K8LA 3DI1A 2BHYA 5LBSA 2XZZA 2V7HA 4OLVH 1OHZA 4IRSB 4ODVL 5JZ7C 3BQ5A 4OH2A 5CLTA 3TYCA 1WBYB 2XGBA 1U4FA 2FQEA 4Q6IA 2VHLA 4AZCA 1S2TA 4Q32A 2YL9A 1VB9A 1P7QB 4JKPH 1UASA 2YJQA 4O0ZA 3JTBA 4ES8A 3S88H 5LNGA 4RV3A 4ZW6A 4WUKL 4Q9RH 4PYHA 1I8LA 3UTQA 3LRGA 5KVDH 4QHPA 3L4UA 1LWJA 2DF3A 1QBMH 1A4KA 2HSAA 3SBRA 3FQRB 5T3ZL 5I76B 4KKAC 1CR9L 4IZGA 4F7PA 1XGQB 2XZQH 4L3AA 3SQSA 3BOFA 1G6VK 5EUKA 4LAOA 3BLIA 4R85A 5CILL 3FJLA 3TBVB 4HISA 2EIZA 3GXFA 3VG9C 3FT3B 4A7GF 4J8RB 2ZUMA 5GS2H 2VZ3A 4GNJA 1HIMH 5GGUA 1KB3A 3QDGD 3MY9A 4YHNA 2ZOXA 3PJLA 2EVHA 2Y63A 4EZJA 5LDSA 3APDA 2RGMA 1Q0YL 5I19L 3GT6A 2ISSA 3MCNA 5E8EA 5AYBA 1EDYA 5D7IF 4HIBA 4MWAD 4ZTPL 1NDZA 4O28A 1A3LH 1YEGL 4LNRB 3PGCB 4MCYA 4U7SA 1OP9A 3TTEA 4NSBA 2XRAH 4YXKL 2FUQA 2D3NA 4HP5A 3SO5A 2VDMH 5GS0H 4PGBB 2J4WH 1R47A 3MRCB 2C1PA 2CO3A 1G7IA 5CP3H 3PV6A 4E5XG 2Q8XA 4QTHB 5IFJA 3IGSA 2AI0L 2AQSA 5F9WC 4Q9BA 3QUZD 3P2TA 4FQJH 4M56A 5FGBA 1E7VA 3WF3A 1N8ZA 3EFOA 3MLUH 1GEQA 3LRSB 1GONA 4LXFA 5C2UB 2GUUA 3L4VA 3W7DA 4AE0A 4WOQA 2GQHA 4I3SL 1KM2A 1NWRA 2B7OA 1X1ZA 4YBHA 5F0LB 3VI2A 1WT5A 1U2HA 4X8CA 1PJWA 2VO5A 3L6FB 1MAML 4MMWA 1YECL 5B21A 3VFTA 3O0LA 4BQ6A 1FLRL 3B9KD 4ICWA 3L5XH 1JYNA 2FJKA 2WXLA 2PWHA 3CT2A 1H8NA 3SPHA 1TTRA 4HS6B 3UA3A 3GMOA 5CN3A 4X9FA 2DIAA 3H56A 4F57H 1X98A 4JTUA 3RZCD 1LRNA 3EYQC 4XO3A 1JCLA 1P48A 8XIMA 3O4OB 4Z7NE 1JYWA 1UPPA 2P3EA 3MGTB 4MMZC 4OIAA 5CNHA 5AW7B 2AHIA 4ASTA 4EKXA 1LQ0A 1OOWA 3T4WA 3O2WL 3IRCA 1ND0B 3EH1A 4FNUA 1D5IH 3O8XD 3WD3A 1JMXA 2G2RA 3PWPE 1IT9L 1GIGL 1RL1A 4BHYA 3KCJA 3MAWA 4FG6D 3F12B 4XPHH 5CS7A 4AZ7A 1DYSA 4UNVA 5DWUH 2D7PA 4OIIL 4CBPA 1INEL 3KWXA 2VDKB 4PJIF 3QH3B 4V1YA 2VQ1A 4JDEB 35C8L 1MWAL 3UZQA 4QRPE 5EZOL 3TZVA 2IXVA 3N29A 1QLEB 1XIDA 5MP6L 3NJVA 4UBPC 2H1PH 3ZJ7A 2AEPL 4Y9MA 4FXGA 3CXDL 4Y16B 3T9WA 2R83A 1FYHB 2BNQA 1WXJA 2HNEA 3HG5A 1Q7QA 1H3VA 1Z9OA 3B7UX 1E56A 3OPSA 2DD8H 3NDZE 3L13A 4K94C 3THCA 3Q2CA 2VLLA 2ZFAA 2PPGA 4HBQA 2ZUYA 3UR7A 1R5YA 1GT8A 1J5OH 3ECQA 3RQ3A 3NABH 3DX8B 1X7QB 5FW7A 1P5UB 3EWBX 2J8FA 3VOGA 2DT1A 2DQEL 2WLKA 2EHHA 3AXHA 2A9AA 3EPOA 1HT6A 1Q6FA 1FO0H 3LKQA 5B38B 1FHDA 3NYZA 5CJ5A 5C2XA 1WFOA 1NCIA 1JPTL 2C19A 3SUUA 2IPGA 1DWGM 5CINH 3V75A 1J1OL 2FDSA 4PUJA 5JDSB 2Z27A 2YARA 3FN0H 3R1GL 3ARFC 4GUGA 5CLZA 5EBLA 5F70A 4FG2A 2HVKA 4J3UA 4PWKA 3ZK0A 1OAUH 5AC7A 4I48B 3WO3B 5JDJA 5D7LA 4X6BB 3K72B 4JGNA 1V3HA 3SJVD 3RIKA 1YMMB 2WXMA 1YRRA 4HUVB 3KL5A 4Z76B 1IEBA 3BG9A 3HHSA 2P5WA 3IDYB 3DX1A 3MUGB 3HA1A 1R3VA 4HIJA 3BWUF 4H5SB 4NUQA 3AG1B 2CCWA 1IC0A 3KPRD 4BS0A 4Z7QB 5J04A 5A6TC 3G04A 5ACMA 4LPCA 3ONCA 4YR6A 5IFHL 2H3KA 1NSJA 5ESVB 5JUEL 1W5MA 2Y07L 1JV2B 3DJZA 3VH8A 3BW2A 3LYRA 3OKKB 3L3DB 2YL6A 4HWBA 4PRAB 5I8CA 4XI5D 4CW1B 4WFFD 1VLIA 4F7TA 1H49A 4P5TB 3KPOB 1DQVA 3H0TB 3L5HA 3OKNB 3SY0A 1TJGL 3GZ3A 1XGYL 1GOWA 2J12B 4KQ4L 4O02A 5MENA 3QP3A 1UWGL 2ATSA 4HGMA 4XNQB 5HYJE 4EXKA 2GVEA 1F2QA 2I56A 2ZQKA 4L29A 1AXTL 1PZBA 1ZTMA 4OE7A 2YUVA 4JFOA 4R7NA 4ZB2A 3O6FD 3UAEA 2LLGA 5CGQA 4JREB 3NZUA 3IDGA 1ZHNA 4O5LL 3BSMA 2NXYC 4XZ4A 1C16B 4YL4A 1RKRA 2NNAA 1TTQA 2CDGB 1BM3H 4XP6H 5FYLE 2P80D 3G0XA 4AEFA 5KVGL 3CCHB 4KROC 4QCEA 1JVOA 3G1HA 1W1ZA 4IOFD 3LX9A 4N8CL 2FYYA 2HE5A 1A9EB 2FGWL 2IWFA 5BRQA 4A2LA 2FZ3A 3QORB 2HLFD 5CN2A 3UYPA 3O6YX 1T89C 3AIRA 5F4SA 4UTJA 3DXAB 1Y1DA 3M7OA 3FSOA 1VFMA 2NX3A 2V67A 2V9RA 2YRPA 4LLMA 4PRWA 1DFBL 4Q4QA 2W61A 1VFUA 4OU3A 5AL0A 1TIUA 4XKMA 1LO5A 6PAZA 5A8QA 2PTVA 2OR7A 2V5DA 7PAZA 1D6EA 4R3SB 5CD5C 1XT5A 3GZOA 2RA1A 4S1QH 4H8WC 4FLOA 5CZKA 1I60A 4XPBH 2HMID 1LUCA 3EGSA 1VA9A 3PTMA 1CQYA 5G4WA 4OZGA 1J9SA 3PFQA 2WOQA 3UT0A 2QZQA 4DZAA 4PV8B 3FQNA 3PGFH 3T0WA 2O61A 1HQTA 1CCWB 2VXTL 4PJGF 2GKIA 1QNPA 2XJKA 3BN9C 1L7IL 1RBAA 1TSRA 1MQQA 5CUSH 4OZHE 3AS1A 2GOKA 4YJZL 4GP8B 4TLUA 4S3FA 1W8GA 3S2AA 1I45A 3SI9A 1UZ8B 4DBDA 3CFBA 3FXGA 3N4EA 1HNYA 4K8EA 3NSDA 1MQ8A 3Q65A 5TDNB 2EXWC 4ZMAT 2AV1A 1YY9D 2VN4A 4MTVA 4XTRD 4IMCA 3LEYL 4NSKA 2Y7EA 4MDIB 4A2SA 2J8TA 2C14A 4BK4A 3FFSA 4F2BA 2AV7A 3L8QA 4K23L 3UWQA 4M48H 5I3KA 1B3JA 1F4XL 1H3TA 3QI9D 3CUIA 3SZKC 4REQB 4G3YH 4NC0B 3JBG7 4LSQL 2VB5A 1O94A 4LSSL 3CIQA 3QK0A 2P88A 5F4WA 1RK6A 5DJYB 4MMZA 3HZMB 1VHPA 5J6HA 1CF1A 1QOKA 1O6SA 3QC6X 4WU5A 5DJXA 3CPUA 5T5NF 5T9BG 3CZNA 3M5ZA 4PC8A 1W8OA 4ZFOB 4R5EA 2JEPA 4XKYA 2X53A 2ICES 5EMJA 3Q4DA 1PFCA 3VIJA 4DN4H 1KJ3H 1FWXA 3VFNA 2W60B 3S34H 3KDPB 1P1ZB 1EGVA 2CLLA 1IXPA 1LP9B 3FAWA 4FHKA 3NEHA 4D8LA 5DA4A 1BQUA 5DHVH 3JT0A 1TZ7A 2BNRA 3C6LC 4I1PA 2NUYA 1MIMH 2Y7DA 2Y6SC 3BPNB 4YE4H 3E74A 4PCKA 4FQXC 3FU7A 1ZGLA 3GFUA 3I85A 4EE2A 3K2GA 3F2BA 5JOPD 3JWOC 1AJ0A 2E3VA 4CC1A 3MC5A 5XIAA 4LMQE 5B3JE 3D3VE 1JDDA 4JO2H 4LB4A 1OX6A 4QHKI 3G0UA 2VW6A 1KLGA 1VFSA 1LRQA 4IJTA 3BE1L 2YRZA 2PUZA 3MUCA 2OA9A 1Q94B 4NKOB 3RP1A 2H6OA 2GWNA 2WTOA 3X1NA 1RAKA 5F6IC 4JN1H 1R7AA 3W1RA 5CEXB 3D4YA 3WNIA 1S46A 4GYJA 3L1GA 4A4AA 4LVOC 4PRNB 2HE8A 2VFFA 4DCQA 1M2VB 1NP2A 2TSBA 3MSYA 1ZALA 2GAZB 3M0LA 4UUJB 4JQIA 1KB5B 1K6WA 4EO5A 3V35A 1N55A 4QTIH 4R84A 2CZVA 5SWSB 5EUOA 1WAEA 4CADB 3VFGH 2VDIA 4FQCH 1E28B 3RPMA 1GVQA 1E6ZA 5A6IA 1H0IA 5DCBA 4WWKD 4G8IB 5KJRH 3FU8A 3P7YA 4GRLB 2FR4B 3HIZA 3V5KA 1HVQA 4MFEA 2J7DA 3W24A 1VEPA 1N0LB 2C1HA 5ALCL 4D2NA 2VH5L 2NV1A 3OV6A 3GTHA 3T0DA 4UBDD 1HXMA 2WBGA 2F54A 5C9JB 1EGMA 2VUYA 4P8UA 2JKLA 2XIJA 5F7LB 4BEIA 4AU0A 2R4RL 4IU2A 3MRNA 4KOBA 4FP8H 5F7MC 3UO1H 1Q9OB 2JKSA 5C0IA 4ERAA 4XN9A 3NZ8B 2P7TB 4WKFA 3AQXA 2CGZA 3QJOA 1X6UA 1DO6A 2ESVB 4OUUB 1FP9A 2YBRA 3H55A 3MTWA 2PDGA 4FZEH 4H41A 3M0VA 4RAUA 2A73A 3EH5B 1RULL 2DBLL 4OGXL 5I1KL 2CLPA 2ED6A 4NQCA 2CLZA 3ZDZF 4JPGA 3GXTA 4ANKA 1QR1A 4OFIA 5C2CA 3QHTC 3UX9B 1QW8A 2BP8B 3MXWL 3T1GA 1WA3A 1CB4A 4PJ5E 1P0NA 4YPGB 1R3KB 5DF0A 2PDNA 2CGRH 1WKYA 4GVIA 3CWGA 2W65A 2B7QA 4HLZH 4UAOC 3WLRA 2DQIL 4YVUA 4DGIH 3DTXA 1LVEA 1EB3A 3P69A 2FH8A 3D25B 3DKHA 1BZQK 5IESH 4L2YA 2OODA 1U8PB 4CMMA 2IDQA 3TQKA 5IJVA 1SN0A 3BPOB 4EAMA 4A2HA 1YY8A 4OT1H 5C9KA 3GMRA 1I53A 5DEZA 2NSQA 4OM0H 1EJUC 5BW7A 3NNTA 2FJHB 3KP0A 1BX2A 3QAZB 3W0WE 1ADDA 3NIDE 4JXCA 2J66A 4O4WA 1NBVH 5HY9A 1TCDA 1OSYA 2JCCA 4YC2B 5AW4B 4DYEA 4US5D 1VLXA 4BUHA 4C47A 3KPSE 4ZE5A 1YTDA 4KY1H 5A6BD 1KLYA 4OI7A 1USQA 3HG1D 4MQXD 4L4JA 4GXWA 1G7MA 3M1CA 3WN6A 5FEWA 3RWFA 2VE6A 1GZGA 4X9SA 2VQTA 3L0NA 1KBWA 1YW1A 1XL6A 1RFDH 3WL0A 2UXGA 1JGIA 1IFHH 2OI9C 4IIQC 4N2HA 1OL0A 2HRPH 3W7KA 5FHAH 1QKZH 5KTLA 3BAIA 1OM3L 1E9PB 5I74B 3UWZA 4OZOA 4YHIA 4LCIL 1S78D 3SO3B 4FIRA 5HYQB 3WDRA 3QQ9C 4L3FA 4XE5B 4ABWA 1VSCA 1GYVA 4XVSL 3MNMA 4FTVD 5TGBB 5J13C 4OI9A 5U4NA 2VOMA 3FKUS 4QUOA 3CWNA 3PTQA 4Y88A 4DVBB 3D39D 2Y8VA 4BCEA 1KIUA 3CH8A 2VDOB 1UFUA 3GR7A 3KZSA 1PTAA 3DHPA 3KOZA 2XCMC 1REIA 4HYRA 3WJMA 3WEXB 4Z7IA 1TTFA 4QY8B 4X6EA 4XX5A 2Y24A 4DYJA 3BSHA 2Z1VA 5BQ7A 2WMGA 4BZ1H 4MNKA 4K3DH 5CJQH 3O6KH 3RF9A 3IJ7A 1MMFA 4LYPA 3MJWA 1RQ5A 4XAKE 1MRFH 5F97E 4CBZA 2ZA1A 1CLVA 2ALDA 2L4OA 1W2VA 1E4NA 3TL5A 4J3ZA 1CI5A 3BXNA 3IT8D 2DW5A 1JFQH 5E6IA 4KIRA 4EP8C 5TQ2H 3ZSTA 4Q8BA 3GHEH 1BF5A 1SYSB 5GPRA 4PJHE 4HK5A 4G9FB 1FL6B 2Z6JA 2EJAA 5KBMA 1UWFA 3ABOA 4GXFA 1WC7B 2N0KA 1CXKA 1CE1L 5D71H 3UERA 2WNZA 4NUMA 3O3AB 4PP2A 5AW5B 4OLZL 3TBYB 1GZPA 4N0UB 5DRZB 5H37A 2G4JA 2Y70A 4LUSA 3QDJD 4D6HA 5T1MB 2X4RA 1XLIA 4V11A 4EJ1C 5DCEA 2GUOB 5IREA 3RX2A 3MV9A 1WEJL 4BFBD 4MY1A 4AF0B 2BDNL 2V2CA 1U3YA 3QJAA 1MCPL 4XG1A 1EF2A 1RUMH 5DEFA 2D7QA 2BFVH 2WWNA 2QPXA 3QBUA 4HKBA 5E56A 5T3ZE 1YPZF 3L5WA 5FIEA 3PUUA 1G7HB 4CNUA 1INQA 1FVDB 3SCTA 2QPUA 2R2HB 5I75C 4PJCB 4OQVA 4G70B 1N6QL 3QCUH 1HC1A 5I15L 2WZAA 4LASL 4WO4B 5IQNA 2NY2D 5HHQB 1OG0A 4Z7VF 3GHBH 3NP3A 4M5YL 2HEJA 4ORGB 2WV8A 1OF2A 3ZTDC 3P62A 5K1VA 3QG7L 4L9DA 4UTIA 1BM7A 3EA3A 5ABFA 3WFLA 3A67H 1XCWA 4QHMA 3OX8A 4JFEA 3TO2B 1UMLA 2ADIA 3OPZH 3NFSL 2LOEA 3MVIA 3PVFA 2XLLA 5KVEH 1TIMA 4U05A 4RXGA 5ABTA 3PYCA 1UKPA 1AO7D 4NC1C 1DVXA 2UX7A 3L3IB 1R3SA 1C5BL 2Q6WA 4O16A 2ICSA 4B5VA 1MNZA 2YEQA 1E9YB 1ACCA 4L5FL 1JAKA 3QOMA 5EOQL 3GSNA 1HKLL 1GVOA 2EVJA 2XOTA 4JFVA 4V2CB 1F3DJ 1NBCA 1AE6H 3F65A 4TULL 3H2AA 2HTLD 3PUOA 2XKUA 1DJSA 4JNMA 4G1EA 4LCCB 5FAAA 1WFTA 1E27A 3S6TA 1PLGH 3ROLA 3ARZA 5GS2D 4L9LB 3PREA 3NZHL 4YEEA 4UWMA 4ZX4A 4OCSH 3B9DA 3F4CA 5FOBB 3N85L 1RJQA 5E1AB 2AGJH 1B4LA 5E51A 3ULVF 2E6JA 5BV7C 3SO7A 1HEHC 2UWEE 4QE1A 3QYQA 3BKYH 2CPCA 5DT1L 2Y3AA 2D03H 3V4LA 1FNEA 5E00B 1UA6H 3PAZA 3DHJA 2V5YA 1XF5A 3VXRE 4FYSA 4GKZA 3EX3A 3UNDA 4K7FA 2W9DH 3VFWB 3IDMB 1GMEA 1KPVA 1H41A 4AH2A 4PJ8C 2Y5JA 4NNBA 3II1A 4CNSA 3ESPA 2FPVA 3QIUD 2FX8H 1S4IA 1QABA 3NCYS 3B2DC 4ADJA 3JWNE 3DECA 3K4WA 4HA3A 3M5XA 1T66D 1DJXA 2DZEA 4S10A 1OD7A 3W1TA 3WH7A 2EKSB 1EHNA 4FFWC 3OPUA 4Q89A 4UFHA 2Z34A 2V2XB 4PMDA 4QLWA 2Q87A 4CMHC 2N3JA 4X60A 3CQJA 3EXLA 5ECGA 3UJRA 2FBJH 4MB4A 2P8CA 3WQPA 2HBVA 4K9JA 3GO1H 2UV8G 2NY0D 1RZKH 3BTNA 1S5IH 1XBVA 5XIMA 2K6ZA 4G7SB 4XZNX 1H9VA 1YUKB 3RU8L 4L8SC 3S2JA 2A79A 3ID7A 6XIMA 4HYWA 2VXVL 5B1KA 3K6SA 3UYCA 1E67A 1NARA 2V8MA 3QWRD 4TR9A 3HS9A 1XRSA 2VD8A 4S3AA 1CLYH 1N5AA 2DWDA 4Z0BL 3OGCB 1FYTE 2CJUL 1P1MA 1KTBA 3RITA 4Q56A 4QEHA 3MFFB 2GJ6B 4Z7UF 3MRHB 4RW5A 4LBEA 3NESA 2AAMA 1WBZA 1IGIH 3CU2A 4UQEA 4X6DF 1Z7JA 4R9OA 1ZK9A 3P1VA 4YHGA 4CCZA 1W80A 1M1BA 1MAJA 4RAVA 1TWDA 4HKJB 2E6YA 4BK8A 3FPYA 4HU3A 4NXKA 1Q45A 4IGMA 4NN7B 2ORBL 4Y2DC 2H2PC 1T0MA 2C7FA 3SAZA 4F1SA 4EF3A 2V8LA 2EDXA 4IIQA 4KGLA 3N40P 3KXFB 3T3PF 1MEXH 2QF7A 5JXAL 2IANE 5D1QA 4UMAA 2DLTA 1YEWA 5BO0D 5I09A 1YYML 2HJFB 4Y9FA 2DZUA 4LS1A 1ICTA 1UOZA 3BSGA 3FUNA 3VNZA 3W71A 3EXTA 5D8JH 2UYLB 2P5EE 3BRFA 1ECQA 3U30B 4HSOA 1FBIH 1H19A 2ADJA 2E86A 4MQ7B 3L4TA 1CD8A 1QEWA 4HHPA 3UJIH 5A6KA 4TSCL 4N2LA 3TN4A 4RQQB 3IGKA 1XIMA 2MOQA 1PY0A 2HH0H 4ABQA 1E5BA 4D0DB 4WVXA 4ZO6A 5JTWA 2OZ3A 1WUFA 5B7MA 1F8TH 5GNZA 4DUXA 2VKXA 4LY4A 3EZJB 5AQ0A 4GI9A 2J3SA 5KZ6A 2R1LA 1YEHH 1LYXA 3Q2DA 4NPJA 3TF7C 3RLGA 4R4BA 3T2NH 3LCHA 3B8DA 1L6XA 1X5MA 3IMVA 5I6SA 4NRSA 1U1HA 2V5MA 5LAXB 5K9XA 2I5YH 2WB1A 2P1FA 4AZ8B 3WI9A 2YRLA 5I1IL 4Y9GA 4NI6A 4JOMA 4AY8A 3HAEG 1Q1JL 3OF6A 2DKMA 3L68A 1SBSL 1ZTXL 2VN5A 2DVXA 4IGNA 3D0LB 5ITFA 3OO2A 3CDGA 1A25A 4BFEA 1NGYA 2WWKT 4Z7OE 4MSWA 4GP4B 4C6KA 4Q4SA 3MDJA 5SX4I 3HFYA 1ZP3A 5KVGE 1NPUA 5HGDB 5FYLH 3C8KB 3FN9A 3CO8A 1URZA 1N4XH 1RSCA 1LL1A 3EYSL 3O4LA 5CCJA 1I3UA 4AL8C 5JO5B 4DRSA 3AQZA 1QX1A 1LBFA 4N86A 4LQFH 2YAEA 1XVSA 1OCZB 2WIMA 4KU1A 5J11C 1DLFL 1KT2B 3U36A 1MH5B 2ICWJ 3PZIA 2NTFB 4HUWA 3KBFA 4FNLL 2Q8BL 2OZNA 1W72B 4AQ1A 2J9XA 4DTGH 1L0XA 5JW4M 5D1ZI 2TODA 1ITCA 3LS9A 5JHDA 1QPNA 1ZENA 1A22B 1OTUD 1BLNA 5H4YA 2WUBH 3WLLA 4OZIF 3BDKA 1JFXA 5DD0L 4OU1A 2LVCA 4AGNA 4A2DA 2JKJA 3MLRH 3DMMC 1F3DH 4LFHG 4XBPA 1LILA 4NO2B 3Q1SL 1KC5H 3B7SA 4G43B 1QP1A 3BHBA 4FFYH 2G5BA 4RFNC 1X6LA 3FMGL 1B3ZA 3QV7A 4NNAA 2ADGB 4XCYB 4CVXB 1MPAL 5GS0C 3OM3B 4LAQH 4EUPG 1I8UA 4YHYB 1ZLSH 3MVTA 4UIOA 9PCYA 4BXSV 1WIPA 2ZF8A 4ZSTA 5HI5D 4L9ZA 2CBTA 5JOFA 4S3CA 1QO2A 4CVZA 5I1GH 5CZRA 4LSTH 4FNRA 4V28A 4NNXB 4JX0A 4K2UL 4RMBA 2WLLA 1KULA 1XH1A 5A2CA 3V0GA 3K6FA 3ZT7A 2F74A 2E76C 4GXVL 3ML8A 4UU9A 4RSVA 2YB4A 5TF1H 2K4AA 3PCYA 5ICYA 4UDTB 5G55A 3CNYA 1GA2A 4BFIB 3OKEA 1G9EA 1NVMA 5LBVA 2R1MA 3NAVA 4PWEA 5IQOA 5IBLD 4DUWA 1V27A 5CBIA 1MEWA 2GJPA 4X6CB 1A7PL 5B1JA 5IRPA 1G9MH 2B16A 1INDL 3NAAH 2UY5A 3BAEL 2PFHA 4F7MA 2EKJA 3MSRA 3L3JA 3BGMB 1FV1A 1XW8A 1LORA 1CTMA 1T4KA 2BOGX 3GG8A 3BMXA 1XO8A 4NQQA 4E4PA 2V5JA 4PJ8A 3THMH 3DX6B 1C08B 5E8DL 1T1ZB 1RJRA 5C0AA 4L05A 4FO4A 3KYKL 2OS7A 1NCCH 2C9XA 3VVGA 2YHGA 2TAAA 1R5WA 3TVMC 4YYFA 3MBEB 1S9XA 1AQDA 3MCLL 3I9AA 3QHOA 1AQKL 1TU2A 3H53A 4L1HA 3OXSB 4HXBH 3VDAA 4FX7A 4ODXB 4RIRB 4I5BB 1JSYA 1AY1L 3C8DA 3U9PL 5JPNA 1KR1A 1RK1B 5AYQA 4B91A 1OP3K 4ZB0A 2OTPA 4NNCA 1A7NL 1XF2A 3BICA 1QBAA 4FQQB 4JK0D 4B5ZA 3HC4L 3HPLB 1HJWA 2IPTH 5JNYA 4MZ8A 4F3HA 4DJFC 4FN0A 4L8SA 1THCA 4LUIA 1CI3M 3P77B 2NX5B 3IFOB 4X5LA 3U2SB 3UY7A 3L5JA 2JK2A 4AY0A 1YEEL 3MA7A 5BXFA 1LLWA 1OCNA 4GIRA 3E8UL 4HNTA 4RL3A 5E5RB 2YDRA 4NN5B 4Y90A 2PB1A 3TH2T 1VHCA 2QMJA 4JRXD 4PJFB 1WVZA 4OF8A 4MVBC 3KCPA 5FLVA 4HNOA 1OGBA 3NA9L 1VC4A 1EZSA 3FJ6A 3EH4B 2CUAA 1YDNA 3CV6A 1AFSA 3G3DA 2QVMA 3BYTA 4ZS6D 4D6DA 3WLHA 1ZV2A 3BOLA 3LD8C 3BP5B 4Y2DA 3KPQA 2W5PA 4W4QA 1HL8A 4NHUB 2XM1A 3QXUA 3PWLB 3UPWA 4YTRA 4L80A 5FF7A 3W74A 1KTLA 4UR8A 4OI8A 4QYOB 4QRAA 3LY6A 3GUTA 3CN0A 5EFIB 1HHJA 4ZAKD 3TWCL 1NMCB 5G2WA 5IHLB 2IC2A 3MA9H 2YEZB 2E9LA 4QRRE 2KL6A 4XMTA 1A6ZA 4HC1H 1AD0B 3NPSC 4K37A 1GC1H 1MCSA 5KSVB 1GHSA 5IW3A 2PWUA 1YCSA 2R1PA 4L4TB 2I57A 1JWSA 3MNVB 4EQ3A 1U91B 4K7PX 2CO2A 3VILA 4O4YH 3MRDB 2GI0A 3VXUE 1KM1A 1SFSA 12E8L 1YC8A 1YNYA 5CP7B 5D93B 5FYJU 4B53A 4XOAA 3NZ1A 3ZE2E 4R7XA 3V3WA 2X0VA 1IR2A 3LOWA 3MODH 1B9BA 3PZVA 4PP1C 4P3CL 1EJ6A 5L8LB 3MACH 5AB3A 2XYLA 1BBJA 3T0EB 1VPOH 5F3HB 2IQ9L 4F8PA 1CLCA 3NACH 1E51A 4IT1A 3SZ8A 2DYSB 1EHXA 4CQDA 5B3SB 4FB7A 2FWLB 4XHJC 2QSCL 2V68A 2GK0A 1F6AA 1EDTA 3NO3A 2IOIA 2ATPB 2G4FA 5L4MA 1IBFA 1OFPA 4H7VA 2ZRWA 4QLLA 2IADB 3VYNA 5AYIA 2VN6A 4MUZA 1NIDA 3RUGF 4IGBA 4PRPB 1KCRL 3MRFB 4R6UA 3TF4A 2QPEB 3MBXL 4N8VA 3V5HB 1UOKA 4YHLL 2JFEX 4DWSC 1MFEH 2FYMA 5BVJA 4PIBA 4W9KC 5AVSB 1A0QH 4S3JA 4FNSA 2R1XB 4NO5A 3QQ3B 4LDLB 2DQCL 1E9ZB 5XINA 1I9CB 3MU3A 4JFDA 3STZB 1A6UH 4MB5A 1ZA6A 4G6CA 3B7TA 4OLWL 2BBFA 4ISVB 1H61A 2ZP9A 1NA8A 3EJYD 2WBJD 1W0WA 1W0VB 2V6AA 4F2MA 4Z0JA 3WFHA 2H32A 3U2IA 1P7KA 1P0KA 5HHMD 1EQCA 3W38A 3NEEA 2W92A 5HHVH 5T1KD 3KVPA 1HZHL 4B9PA 3FQTB 5D2LB 3P30H 5CR8A 3TH6A 3F6LA 3N73A 1NFDA 1JNLH 3QRFM 2V5RA 3S3SA 3LDBC 3LB6D 3CIVA 3DMMA 5K9KA 4P2QD 4OGYH 5MHSE 5IG7A 1HHKB 2QR0A 1KIQA 3UPCA 4E9WA 3N2OA 4IG2A 6TIMA 3RTQB 5D1ZB 3AQUA 4RGNE 4LVHB 1ZGLP 3X13B 4OFDA 4YSDA 2HB0A 4JCLA 1QNVA 3KAAA 1M6UA 1G7VA 5BMFL 5A69A 2FHFA 4HPHA 5KYUB 2R1YB 2H9GA 2DUAA 3WMBA 2P24B 2A77L 4NRZB 1J5CA 1NGQL 1UBSA 3ARDC 1G6RL 1F42A 5AZ1A 5LSMA 2WQWA 3VOHA 4WW2C 4KH2A 2PP7A 5KINA 3I75B 2BCKB 2CWRA 4JDZA 3C08L 4RVBA 5LWYL 5K39B 1XYMA 1U8LB 1TQBC 5A2FA 1K85A 5GRJL 1ZJHA 1JGUL 4OLYL 5C9ZA 2WQ8A 4PB5A 2ZOKA 4MDOA 3BZEA 4Y7OC 4HJTA 4DESA 3O2DH 3PQYB 1AD1A 2RDTA 3TGXA 3U7YH 3DGDA 1FC1A 1PY4A 3ZJ8A 1HKKA 1HAUA 3ULVC 4MNQD 1BRLA 1ZE3C 5I8KL 4P04A 3SCUA 4QXTA 1EYEA 1MF2L 3FIGA 4HWUA 2Y1AA 4AK2A 4N0FB 4OFYA 1VFBB 4PS3A 1PU0A 3IWUA 2A3HA 1I1AD 2BIPA 1QO3A 1X5ZA 4ODVH 1N68A 5KZDA 4P4KC 3AWOA 1OHQA 2I9TB 4NJHA 4FXFA 1J4EA 1GGYA 2FH6A 2XUWA 1SDDB 3CUJA 3FGCA 2OXHA 1G4EA 3N9GL 3O9WD 3QUYD 1NGZB 4Y1AA 2L3BA 4WUKH 3ZVVA 3TCLA 3KPLA 4TPRL 5EU9A 1GRWA 3HPJA 3BLLA 4KQ0A 1FNLA 2KKQA 3QCTL 3LHPL 1TEYA 1IC7L 4P2CG 1FNFA 1HNFA 2QQNL 1LGVA 5T3ZH 2PZ0A 3JTTA 3W1QA 1OTTC 3HV9A 2BOBB 1CR9H 3NCOA 4X42A 3NJHA 4P46D 4H1ZA 1JZ2A 1T1WA 2DV6A 4DJFA 4YXHL 3QPXL 1OSPH 3IGXA 5EEVA 3ARQA 5F1NA 1I0BA 1Z9LA 4MJ2A 1LQAA 1O6IA 4YJ5A 3G77A 3QHZL 4HNVA 3ZW3A 4YDIL 5CILH 1IM3D 5F2LA 3ELFA 2WUCL 4KJYA 1GOHA 2Q76B 3BGGA 2V2TB 5E9DB 2WM0A 4A8NA 2FO1A 3IDXH 1IHIA 3HN3A 5IUCA 3VU1A 5ICZA 4PJDA 2NY3B 2XPGA 1Q0YH 4IX2A 4OZFB 3D69B 4A3UA 3W7PA 5BO1L 4HIHB 4L5FE 1R24B 1YEGH 3DV6B 5LXVA 3WMQA 2IV9A 4W84A 1UACL 4YXKH 4OT7A 1TPC1 2DQFB 4E9TA 1FNHA 1XCFA 1RP9A 4RSYA 3IKKA 4Y4HB 2XVKA 3WLQA 4UMBA 2XINA 2AI0H 2CHDA 4LLDB 3DVGB 3ZKXB 3D5OF 5HHXL 1TZGL 3MV8A 1YYLH 3EO1A 3SCSA 4TQTA 2CW6A 2RFXB 4FXKB 3O41B 4MASA 4GY4A 2OW7A 4PMNA 1PSKL 5L6UA 3SEPA 1HH9A 5H2BA 5LXXA 3LN5A 2YAHA 4GIEA 5I30L 2I1OA 1T5WA 3T8VA 1AGBA 1GGIL 1KJVB 3VE0A 4I9TA 2XA8L 1MAMH 1M7PA 1YECH 2DAVA 1BYOA 3OG2A 2HDJA 1SR9A 4APQD 1S7TA 2X1RA 1L9NA 2PTUA 2PPFA 3T0CA 2KQMA 3D07A 4ZMWA 4ZFFA 3LG3A 3XINA 2AEIT 1A6TA 4F40A 4TOYL 4FR1A 2BVOB 2ZYHA 2XXGA 2IXQB 2K8QA 3JWNH 2L7UA 2X89D 2GIMA 4NQVA 3O2WH 3PWVA 4DKFL 1HHGA 2FDBP 4YHOL 3W1LA 3PXLA 2ZXQA 4KTYA 1X8FA 2WSRA 1IT9H 1GIGH 4D0BB 4UNUA 3UTSA 1AHWC 1FXQA 4UT6A 1HL9A 3TYGL 5D02A 2HJKA 1UQSB 2UZ9A 1E4JA 5FWRA 3UTTB 1INEH 1ECEA 3DIVA 3WQWA 4XHQA 3H2FA 35C8H 1CN4A 3OTTA 4LLWA 2B5IB 1BSLA 3C2RA 1MWAH 3SRKA 3I6TA 5EZOH 3KWWA 1Q2SA 2FTYA 2C9AA 1VCBC 3QM3A 2JNZA 4YZFE 2AEPH 4HAGA 5IB3A 4Y9BA 4XP1L 3FCSB 2Q3RA 4F5CE 5D4HA 1CLKA 1XR8B 2B3RA 2GITB 3V5CA 4MWAC 5CSYA 1L6WA 2QLYA 4Y4KB 2H0JA 2J79A 2EIEA 3PWPD 4M6MH 4TNGA 2PXYB 4AIZB 2DQEH 3ZUCA 3U1SL 2Q3ZA 2C9UA 3NQ8A 2GJRA 1A6AA 4UQ3B 4KERA 1DP0A 1TOXA 4UAHA 5B7FA 1LJYA 1JPTH 1XBXA 3WAJA 1RVFL 3BWZA 3NQ7A 6ALDA 5EGRA 3FS2A 3WZ0E 4U3XA 4CGUB 3K8MA 5EU6E 3GIPA 4F2UA 4QRPD 1SLXA 4MNMA 1J1OH 1JK8B 4ZSOA 2DMBA 3V4PA 1X39A 5D7JB 4FDWA 4H25A 4D1IA 4PIRF 4JB9L 1FZMB 4Z3HA 4H0HB 3AAZA 4NRXB 3K13A 3F4DA 4IBYA 4NO3A 5C0CA 3H23A 2IDCA 2OGJA 4RISL 3BFQG 4KKRA 1V4YA 3B9KC 4ZXBB 3L54A 1DBAH 1M9HA 4WW2A 3HO8A 5IFHH 5JUEH 3EOTH 4FLQA 3RZCC 3GZAA 4I3RH 1HXJA 4UOZA 3NPZB 4BSWA 4QRQA 4YL2A 2NT1A 1KG0A 2BLFA 2P42B 3T2PA 1XCTA 4LIQL 3FCTB 4L3EB 1B0RB 1NTHA 1TJGH 4KFMA 2R2BB 4ZVJA 5U7SA 2XQBL 1XGYH 1VBHA 2J72A 5DRXA 5DZPA 4UDUA 3N9RA 4XCEA 2VKWA 3L23A 2ZA3A 3FOMB 4BSVA 1UEYA 3KS6A 4DEFA 4N4PA 4KQ4H 1IV8A 4C58B 2FQIA 2EEBA 2ATMA 2CK2A 2KZ1B 2EIJB 4FG6C 1XBZA 3L0GA 5C0BB 2FMNA 1I7RA 1ZSDA 5HHOA 4S3EA 3R89A 1UWRA 2GOUA 1AXTH 4P23B 3HHMA 4J2PA 3SHSA 2KPNA 1NDGA 1ZTXE 5EDSA 3UG8A 1MJJA 3ONBA 2Z2BA 5DMIL 4WXYA 4P4KA 4JZNB 1KIPB 5L2KA 4O5LH 3RR4A 1QK0A 1XCQA 1EA0A 3P4MA 3NIDF 1N10A 5KVGH 2YPLA 2EH7L 3UBFA 2GPZA 2R8WA 4N8CH 2FGWH 1THFD 5HHNA 2W3ZA 2VEPA 4ERGA 1S2WA 2QSVA 3NN8A 3VAVA 2Z35B 3Q7JA 3AWGA 2PYEE 5I1DA 4Q4IA 2QAFA 5AVXB 3CTLA 3QEGH 5LNWA 3K2KA 4W87A 5HYJD 1F97A 5IHZA 2Y8KA 2HFGH 4KTDL 5HQEA 4WEBL 5D4QA 1AC6A 1CE6A 5JYMA 1DFBH 3NWRA 3VXOB 2EIKB 4XCNA 2GDVA 4NP9A 3CEUA 2XIMA 2G3XA 1RCQA 1WJ3A 4LS2A 2HK0A 2PRLA 4A7QA 2ZWNA 1JV5B 2VMCA 2MCG1 4KS0A 4Z1YA 1WTLA 3MRGB 2F1BA 5EEUA 3HFTA 5FYLD 1U8QA 2ZQ0A 5J1AB 3GTTA 3C12A 1NCAL 4YXGA 2EC8A 2XN9B 3GHPA 5I6PA 3T4YB 4IQEA 2R0LL 3FNKA 2XKSA 5DQPA 4RNHA 4FLRA 3KEDA 5EMUA 1D7BA 2BP3A 3MU7A 3PBVA 3W1AA 1T3FA 3PPSA 1L7IH 1LQBC 2V5SA 1BF6A 5MERA 4S1SL 1QFPA 3I3BA 1XIEA 4GZJA 5BU9A 2EAWA 3L1FA 1PZUB 3V6ZA 4WFEE 2C91A 3BZDA 4DGYL 1PHWA 2ISFA 1B4KA 1RZIB 3DGGA 4XRCB 2V9DA 5HDBE 4M8RA 4XI5C 2Z1PA 3ZRFC 2YK1L 5FW6A 4Y19B 2CCVA 2C79A 3R0NA 5CJXC 1P2CB 3LV3B 2GTWB 1JDCA 3PXJA 5CZ0A 2IDSA 1IGYA 1O9ZA 4I18C 3WN5C 2N7AA 3NSCA 3H9SB 3IS4A 4JANA 3SDOA 4LH8A 1KYFA 3ARFA 2X1TA 4DZBB 3HC0A 2WZTA 2VMDA 4BFRA 1O5DT 1XINA 2OULB 1H3PL 3ZE1E 3TOYA 1WBXA 1AZRA 2DU2A 1O95A 4A04A 4MAYB 1F4XH 2Z31D 2QHLA 4N02A 5ALBL 3NIFB 5J56B 2QZRA 4IBVA 3O6FC 5I6OA 3R4IA 1K8CA 4C6IA 2QGDA 1PNCA 5I6XB 1EC7A 2OZ4A 4LPYA 1VENA 4L18A 5T26A 3CVHA 3FSAA 1QFUL 4N2KA 3EH2A 4FG0A 4ODUA 5I1CL 3SBWC 1EFZA 3OKMB 4IOFC 1UR0A 2DY3A 1BKSA 2HRWA 1HESA 2OFQA 1R6WA 2PRMA 3VD9A 3LXBA 5LN4A 1P0BA 1WWAX 4OSUL 2HLFC 4R7OA 1WLHA 1B3XA 4XAFA 1HN1A 3LRMA 3OVQA 3V9EA 1ZJAA 4JPVL 3WUWA 2JF7A 4J12A 4KY2A 1RUAL 1K9TA 5AVRB 3QMSA 4N2BA 5T8GA 1WA2X 5FO7B 3LNMA 5E70A 1T03L 4A29A 4PWJA 1IKFL 3OB8A 1ADQL 3I6LE 3D85B 4N0YL 2JQMA 1KCKA 3OC8A 1AW1A 5CD3A 1X7FA 3QDGA 3AROA 2ENQA 4JEGB 4D6IA 2YD7A 4LRIC 2B08A 4I0KA 2AJYH 2HMIC 2F9BT 4LLYA 1OGAB 3CIWA 3WBYA 5TH2B 5IVNA 4NENA 3CL8A 1ZT4A 2YCLA 1DYZA 3BE1H 1MQKL 2ENJA 4LSRL 3SKNA 3VQ1C 1JAEA 2BV9A 3US9A 4AE1A 1N2VA 1BXVA 1SEQL 1T89A 3RBSA 2VDQL 1JXGA 3M5YA 1X5GA 2A1WL 3B3DA 5E8PB 4NAEA 4OZFG 2JKNA 4JMNA 4PJBE 3R12A 1LOSA 3EJQA 4ZMTA 1PY9A 3EOSA 3R8RA 1W3IA 2Z25A 5AD0A 4W9IC 3UYRL 3IJSA 3VIFA 1PJ9A 1YY9C 4BSJA 2UWEF 1PIGA 4XTRC 5L0QB 4XSMA 2EPKX 2WV3A 3P3TA 1FN4A 3KCLA 1M1XA 3VXSA 3DUUA 3SOBL 4D6GA 3D3VD 3DX9A 1A5UA 5B38G 3M6DA 1GOFA 4TNWK 3JXAA 1QI2A 1R17A 2D9QB 2R2CA 4YCPA 2VLJB 1UD2A 3QI9C 3UGXA 2YX0A 1MXSA 4OM1L 3VXMA 5ALCH 4OVVA 2VLKA 1AVAA 1NELA 4UCFA 3M47A 4XB8A 4P2AA 2NUTB 7XIMA 1NGWB 4NZ5A 1N3NB 2R4RH 5E4EB 4KWUA 3IN2A 5IQ7L 4J4PD 1KYDA 4JZOB 4YNYA 1RLBA 1ZVHA 3CN4A 3AHZA 5DS1A 3VFOA 2KPWA 1PEWA 1XF4B 3RL1B 3EOUA 3MSDA 4C1NB 4UIKL 4PRHE 2GUBA 3CAVA 9XIAA 2UZXB 3IMTA 3DFSA 3NO1A 4JRYB 4EOUA