4W93A

Human pancreatic alpha-amylase in complex with montbretin a
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title The amylase inhibitor montbretin A reveals a new glycosidase inhibition motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 181
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4w93A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w93A01
4H7VA 3W24A 4P7RA 2G3JA 1WZAA 2VRKA 4EANA 3A4AA 1W3LA 1KB3A 1JYNA 2WM0A 4UFJA 3WD4A 2RGLA 1UD4A 4ACYA 3SCWA 2GSJA 5DF0A 1L8NA 1S46A 3A23A 1JF6A 2BNJA 1QPKA 3J7HA 4BQ2A 3DYPA 3WEMA 3RMEA 3PBGA 3BAXA 3BC9A 3VSTA 4IPNB 3K46A 4B3LA 3WBEA 2CHNA 1PIGA 2YFNA 2PWGA 1BYCA 1UWSA 2CBUA 4AISA 2VQTA 1GOQA 2WB5A 3PTKA 3BUIA 4FNSA 1HN1A 3THDA 2YL9A 1WP6A 5KZ6A 1AQ0A 3WDRA 1UWUA 1NP2A 1HKJA 4NRSA 2YDRA 1TQTA 5BXTA 3VIKA 1MW1A 4RE3A 1BHGA 1UR0A 1AQMA 2VX7A 3WENA 4F9JA 4YHEA 1P6WA 2G3NA 3BCDA 4OBRA 4TX8A 5HDRA 2WMJA 4W8AA 3CZKA 3UG5A 1UA3A 3EYPA 3AIRA 1UWIA 2FDMA 2VZSA 1V3HA 1MQPA 1PX4A 3BCFA 3WMBA 4HMEA 5D4YA 2WCGA 2WW5A 3E1F1 1BG4A 3HJEA 1JNEA 1ZJAA 2OW6A 3AIUA 5BYWA 2D73A 1CXEA 1KTCA 1UKQA 2EAEA 3B8SA 5A6SA 2WVSA 2D3NA 2O92A 3D3AA 1R8LA 1B3VA 2WKGA 3BAJA 1LL6A 3NYDA 3CUHA 3SUUA 4NF7A 4ZE5A 1V3LA 3NDZA 3AXHA 3VGGA 1EGZA 3SCNA 3W29A 4W84A 3VD9A 3N18A 1C8XA 1ITCA 3U5UA 4MJ4A 1TA3A 1QI2A 2WC3A 3F4VA 2Y5EA 1I1WA 3UR8A 4AMCA 1BYAA 5M3WA 3PZIA 3WNPA 1IV8A 4UCFA 4CN4A 4PMRA 3LPFA 1U30A 3VD5A 3MMUA 1JIBA 1MQRA 1J0HA 7A3HA 3NSMA 4V27A 1KR0A 2BHUA 3BMWA 4OOUA 1HJVA 2WMKA 3BVXA 2A3HA 4PUEA 1C8QA 1WZKA 2D24A 3IK2A 4MNLA 4W7UA 3SCVA 4FLQA 1R86A 4V28A 2CBVA 4BQ5A 1EQCA 3TOPA 1ISZA 2E9LA 3AS0A 1NQ6A 3FHQA 5M03A 4P8UA 2JE8A 5I78A 1UQYA 1TVNA 4W93A 1PPIA 3TTYA 3N9KA 1G94A 5D9OA 1K9DA 2O9OA 1H11A 2O9TA 3ALFA 4L4PA 3SUTA 1C93A 4JIEA 3EJPA 4X9YA 5GNXA 1UHVA 2W4XA 3AROA 2ZX6A 2BFGA 3QOKA 1KFWA 2OSYA 4GZJA 2WLZA 2ZOXA 3L4VA 3N04A 4GQQA 1FHDA 2GJPA 3VDBA 3APGA 4CU7A 3PZVA 1V3KA 4QAWA 2YL6A 3WBAA 1M04A 2X2IA 4MADA 1GOMA 3BLBA 1XSIA 3DECA 1B30A 3EJUA 5BRPA 4D6HA 4U3CA 1W9VA 3K4DA 2AAAA 2Y4SA 1J11A 2X8RA 1YQ2A 1WDRA 3OGSA 3VGEA 1JFXA 2YDQA 4WKHA 1CPUA 3T0BA 1HVXA 5DFAA 2EADA 3CZLA 5DO8A 3VINA 1V08A 3N12A 4LQ1A 4F79A 4PYSA 3ZOAA 3BLPX 3WKZA 2VZOA 2EEXA 3AZSA 2NW0A 3CHDA 3MUY1 3SCRA 4E8DA 5FL0A 1JGIA 2X09A 2F18A 2XPKA 5M17A 1JAEA 1BFNA 2CNCA 3ARPA 5A3HA 1C90A 1C91A 4CU8A 4ATWA 3WNOA 3SUVA 2J4GA 4KWUA 3ZJ7A 3D4YA 1BVNP 3G6LA 3GXNA 3N15A 3PN8A 3GH5A 3UESA 3MV11 1XH2A 3PHAA 1JZ4A 3WH9A 4OBSA 3DC0A 1WNOA 2QPSA 2JALA 2IXVA 1V6VA 4Z2GA 3FAXA 1R7AA 4ML4A 1AQHA 5A95A 1E15A 4CN1A 5I23A 2PBOA 4C7GA 2G3IA 3L4ZA 1E4IA 1TVPA 2V38A 4KRUA 1EH9A 3FW6A 1RH9A 2QHAA 1QNPA 4AIOA 1V6UA 1EOMA 2QMKA 3BAKA 1CBGA 1JL8A 1XD0A 3BVVA 3FAWA 1VJZA 2G41A 1VEMA 8A3HA 4HU0A 5CGTA 4ACZA 1IT0A 4QP0A 3SCPA 1EXPA 2VO5A 4FK9A 4W8BA 3VD3A 4AWEA 2XSBA 1NM9A 4PRWA 1OCQA 3A6OA 4M29A 4P8WA 2GK1A 3CHFA 1ISXA 3PZNA 4AYGA 1UZ4A 1JI2A 1CGYA 4PTVA 3POCA 1JNDA 4HA3A 4UZUA 4NX0A 2E0PA 1TQSA 4UNIA 4MNKA 5JBEA 2DH3A 2PB1A 2XFRA 2W92A 4JKMA 3AS3A 5A6JA 1UWQA 1V6XA 1LL7A 1J9YA 2D3LA 4DWSB 3VILA 1J0KA 1HX0A 1C8YA 1G1YA 5I3DA 5E6YA 1NOFA 1XH0A 2W67A 1M53A 2DSZA 3TTOA 1OBAA 1DP0A 4D1IA 1CGVA 1DWFM 2VX6A 3TP4A 1MFVA 2BY3A 1ZJBA 1OGSA 3WF3A 1RP8A 1MW3A 3OGRA 1V02A 2JEQA 2DT1A 3PZQA 4CCCA 4GKLA 1X6NA 4LGXA 2ZX8A 1ZBCA 3RJYA 4TUFA 2JF6A 4MNMA 4U31A 3PTQA 5ABFB 1PEZA 3WEOA 5I5RA 2GVYA 1GORA 2PF0A 1ODZA 1ZU8A 3SCQA 4TX6A 2F1BA 3L4YA 2GJXB 3ZQ9A 4M8UA 2D20A 3LMYA 3VD7A 4EAMA 4U2YA 1DWHM 4JCMA 2A3BA 1CZ1A 1MW2A 1UH2A 3OG2A 1PIFA 3CLWA 2EPLX 4EKJA 3W6MA 1W2PA 1EHAA 1NH6A 3F5LA 1E4MM 4Z2LA 3EJQA 5FKYA 3ARXA 4QDMA 3WF1A 1WO2A 2VC9A 1CECA 1KWKA 4WF7A 3WUGA 4TVCA 2TAAA 2YA1A 5IHRA 3MUZ1 3OLEA 1CIUA 2GDVA 4JFTA 1E0XA 3W4RA 2UY5A 2VRQA 1GJWA 4HTYA 7TAAA 1QWUA 3FY1A 4CKQA 2EQDA 1NWUA 1JZ6A 1R75A 4UQBA 5JIWA 1U33A 1US3A 4UFHA 3VGHA 1J12A 3ARZA 1PX8A 1UR1A 4WKFA 1UWTA 4DO5A 1FH7A 1SMAA 4CD6A 1JAKA 3MSGA 4HZ7A 3GBDA 1W9PA 1T0OA 2BVDA 5E70A 3EMZA 1HL8A 2ZIDA 3BGAA 2J25A 5HOSA 5ABGA 3UR7A 4H8UA 1HP5A 1XGZA 4AZCB 1QW8A 2XTKA 1TFVA 3WEZA 3VU2A 4MB5A 3WUBA 3WQ8A 1UD3A 4DUVA 4HOZA 3AHVA 4MNJA 1ODUA 3JUGA 4LYQA 3WNNA 2VCBA 1KWGA 2V3FA 4QCFA 3T2QA 2WNWA 1R87A 1VJSA 5JUVA 3BSGA 2CITA 4J3SA 1OSEA 1QNRA 4OUEA 5FIPA 2RGMA 1UQZA 2W61A 3VPLA 3VKKA 4GI9A 1E5NA 1PZ2A 2F7OA 3BUBA 4Q22A 2WMFA 5GQBA 3HG3A 5AC5A 4BQ4A 1OB0A 1Q6GA 3SCTA 3HN3A 1V02E 1HKKA 4M80A 4KRTA 1DWGM 4LXFA 3U7BA 4H8HA 3AIWA 2XYLA 4PMNA 1OT1A 5C71A 1K9FA 3BVUA 2XM2A 3WF2A 1MWOA 1I75A 4Z2IA 4TTGA 1D2KA 3OLIA 1UD8A 1QI3A 5E0CA 4PTMA 3UG3A 1BSIA 3QR3A 3GXIA 1A3HA 5CG0A 1KCKA 2E8ZA 2WSPA 4ZE4A 2OYMA 3ZR5A 3GDBA 1GONA 3D5HA 1BVZA 2D23A 2UWFA 1H49A 4AMWA 4LX4A 2ZXAA 3AFBA 2FYVA 2XN2A 3AMCA 4JL2A 2WMGA 1I1XA 1WDSA 1LWHA 3NIYA 1FFQA 3OBAA 5IHSA 1HF6A 5CSYA 4A3YA 3LPOA 3NSNA 3I3EA 2F7PA 2VI0A 1VIWA 2WMHA 3VIFA 1XSKA 3QOMA 4CUCA 1GW1A 3AHXA 2UY3A 4R5EA 4PMYA 4FNPA 3GM8A 4D6JA 3ZO9A 3FHAA 5AY7A 4AZIA 1J0IA 1VF8A 3UG4A 1CYGA 2EPOA 1O6IA 1J0YA 1W2VA 5ECUA 1TA3B 2BVTA 3CUIA 3AMDA 3SUWA 3SCUA 4UQEA 3WD2A 1UKOA 1WCGA 3NCOA 4AD5A 4HOXA 2X0HA 2VOTA 1CENA 4YHGA 3K1DA 5CJ5A 3TV8A 1Q6EA 4B15A 3POHA 3OA5A 2CERA 5BCAA 3O6AA 2OSXA 4FNTA 4S3KA 1E40A 3D4ZA 2EO7A 2ZWYA 3W38A 4XB3A 3F5KA 1HJSA 5ABHA 2OLHA 1FH8A 4M82A 1HTYA 3WD1A 2CCRA 3WELA 4D72A 4C7DA 1OGBA 5A8PA 4DWSD 2IXUA 5A6KA 4DO6A 5CSUA 2WHMA 5C8BB 5DEZA 4AD1A 4R27A 2F61A 3IAPA 2VNCA 3AIQA 4OGZA 1EO5A 3VM5A 2O9PA 3A4WA 2X0YA 1VFOA 2QMJA 1LF1A 2WXDM 1V3IA 3AIVA 1OINA 5GPRA 3ARQA 3RO8A 2XVNA 1H41A 2W63A 4U2ZA 5M5DA 3H53A 1DWAM 4HA4A 3SURA 3WF4A 4KGLA 2D0HA 5LA0A 1FH9A 1V6YA 2EABA 4Z2HA 4PTWA 1UASA 1H4PA 4CD7A 1XC6A 4JFSA 5CQ1A 5BWFA 2WANA 3DHUA 2JFEX 4W8LA 2XJ7A 3WDPP 4AZ5A 1HKIA 4AC1X 5E9AA 1E56A 5F7UA 2DIJA 3CHCA 3BMVA 4GIAA 2CHOA 4MB3A 1R33A 4PCTA 1CDGA 2YA0A 4AYSA 5CLTA 4QLKA 4HMDA 1R7OA 2DPEA 2J75A 4PSRA 4FLRA 2WVUA 2VL4A 1GOWA 4CD8A 1W3HA 4H8VA 5E0FA 2EPNA 3TA9A 1W3KA 1Q6DA 2VR4A 3WDQA 2YBTA 1N82A 3VIJA 4MB4A 4J3UA 2AMGA 3DX3A 5GNZA 4P7LA 1QBAA 1GUVA 4WSJA 5AC4A 2XVKA 1H2JA 2W91A 2FGZA 3VIHA 3FNDA 1UKSA 3HG2A 1WZLA 3WY3A 1QI4A 2EACA 2XFFA 4D6GA 1UH4A 3VMPA 4J3XA 1JZ2A 2CKSA 2J7CA 1K9EA 1NOWA 3OLGA 1KCLA 4J28A 5DT7A 3AXIA 4JCLA 1W1VA 4GO8A 1JDCA 1QHPA 1JXKA 4Z2JA 4GPNA 3RM8A 1XYFA 1E71M 4AIEA 4S3JA 4OOZA 3VTRA 1VENA 4M1RA 3N1AA 2E9MA 3THCA 2ZXQA 3L4TA 4UZSA 1B3XA 4P7NA 5A8QA 1W1PA 1GQIA 4JFWA 1VEOA 2A3CA 3HG4A 3MUIA 2QV4A 2CKRA 1GOIA 5CZKA 3L4UA 4ZXOA 1UH3A 5D8WA 5JBFA 2XM1A 1TCMA 4HU8A 2J7FA 5BRQA 1Y7VA 2EBNA 3QHNA 6A3HA 3T2PA 2ZXDA 4ACZB 1E3XA 3RM4A 2YLLA 3AZTA 3WNLA 4KMQA 3QHOA 2DIEA 2GK1B 2UY4A 1SYTA 2F2HA 4WJXA 2WMIA 2XVPA 1GHSA 3AOFA 3IANA 1CXLA 3VMOA 3II1A 2XIBA 3DX4A 3GNOA 2J74A 4QCEA 4W85A 5LA2A 5A8OA 4W7WA 4PMZA 3HZ3A 2FHFA 1B3WA 1UA7A 1XH1A 1VBUA 4Z2KA 6TAAA 4JHOA 4XZWA 2PWEA 1W1TA 1E6ZA 3K4AA 1VFFA 1PZ3A 4JKKA 4OKDA 1UG6A 1FP9A 1CEOA 1W9UA 2PBGA 1JDAA 4CD5A 1LWJA 4H2CA 1SR0A 2FGLA 4GI6A 2J7BA 3WUEA 3WN6A 3IJ7A 1KBKA 1D3CA 1WKYA 1ECEA 3ARUA 1LJYA 2WVVA 3H55A 1B3YA 1BTCA 4IPLA 3KL3A 4DM1A 3SCOA 3L2MA 4HMCA 4AZBA 1C7TA 3CC1A 5E1QA 1UR2A 2PWFA 3M46A 3N11A 3UEQA 1JYVA 3GXPA 3GNRA 1CNVA 1BYDA 2BY1A 1UUQA 4P7OA 1B2YA 3M07A 3AICA 1V0KA 2XWEA 1PBGA 4GO9A 1CXIA 3W53A 1GHRA 1HL9A 1BLIA 1Q6FA 4CCEA 3A47A 3VNZA 3U57A 4MTVA 1E4LA 2YDSA 3U7VA 1WZMA 1GQKA 3HMCA 3OZPA 1CGTA 2FH6A 5BXPA 3PZGA 3VIOA 5D8ZA 1PX3A 2J7EA 2YL8A 2Y2WA 3O2LA 3W82A 2GDUA 5IFPA 3CMJA 1X6LA 2D22A 3ZIZA 4JAWA 2C8NA 1FOBA 1E70M 2B31A 3T2OA 4PSPA 1A47A 2GJRA 4FNQA 5E6ZA 5BROA 2F7QA 1CGXA 3IGUA 1HJWA 2EPMX 1CXFA 3PZTA 1QBBA 1B1YA 1CXKA 2G4FA 1HWWA 3GXDA 5HNNA 4BQ3A 2HVMA 3CV5A 5A8NA 2OWXA 4BZYA 4DWSC 5A2BA 5HXMA 2DT2A 4YN5A 5C70A 4UQ9A 1MXDA 2J8FA 3W81A 4AD0A 2ESCA 3AIEA 2F7RA 1ZBVA 4QFUA 3ECQA 5CGMA 3IJ8A 4NXSA 2XSAA 1UKTA 5I6SA 3BLKA 1G0CA 2XN0A 4A3HA 1EO7A 2BHYA 5D9PA 2ZUTA 1B90A 1Z32X 4HZ6A 2VURA 2ZUMA 3NJ3A 4GINA 2E40A 4AD4A 2W5FA 2YLAA 2OYLA 1XCXA 5HPCA 3OLDA 3EDJA 3SCSA 4EK7A 2VX4A 2ZICA 4ZFMA 1DWIM 4AXNA 3CGTA 3VVGA 2OYKA 1C7SA 1WB0A 3LRLA 3AQUA 3BVTA 4W7VA 5I77A 3CO4A 1CGWA 1HXJA 3WDJA 3WQ6A 3S5ZA 5HBFA 3ZT7A 1H09A 3DHPA 3EDKA 2V5CA 2WWCA 4PCSA 2J7DA 3B9EA 1TG7A 2BXYA 1E73M 1UWRA 3ZJ8A 4CVWA 3WQWA 3MSDA 4ZXLA 1C3FA 1LG1A 2WCAA 3BUPA 1JI1A 2ZX7A 1CTNA 3UERA 2J8GA 1V6WA 2WHKA 4UTFA 4TVDA 1LQ0A 4QLLA 1R47A 4RL3A 2PI6A 1QNOA 1PS3A 3AISA 1E4NA 2Q8XA 4M56A 2WSKA 2DSUA 2DSWA 1D7FA 1E0VA 1ISYA 4D1JA 2X1IA 1BPLB 5CPTA 5FL1A 3KLLA 1V3MA 5GNYA 2VTFA 4NZJA 4DWSA 1BGGA 1H0GA 1GVYA 3WY4A 1QX1A 2QF8A 3GNPA 4PMOA 2Y8KA 1R85A 4IM4A 1GVIA 1W3JA 1H1NA 4UFMA 3U5YA 4L4OA 1NWSA 2VR5A 2CBJA 2X2YA 3PZMA 1VEPA 3CZJA 3ZJ6A 3S6TA 2YA2A 3EMQA 1JD7A 2WBKA 1KQYA 3AYSA 1BGAA 3EJRA 2XFYA 2WZIA 2JIEA 1UKPA 3MS8A 3BVWA 3VSUA 2YJQA 2BVYA 4IUGA 5AYBA 3GXFA 2BS9A 3L2LA 1H3GA 1JG9A 3K8MA 1W9DM 4WIWA 5A2AA 3ZSTA 3WD0A 2GUYA 1NOUA 3SEPA 1ITXA 2IUZA 3ARWA 2ZX9A 3I3BA 4PTXA 2Z1SA 3ARTA 3VGBA 2WC4A 3W25A 3CMGA 4BS0A 2GJXA 1J01A 3AXXA 2GFTA 2WPGA 1E6SM 3I3DA 1US2A 2CEQA 3UETA 5DMYA 3LRMA 5KEZA 4LYRA 4D71A 2EJ1A 5A6MA 4OIFA 2D1ZA 3KL5A 5A8MA 1OT2A 3S2CA 4UOZA 4UR9A 3UCQA 5A6AA 4W88A 1QOXA 2VRJA 2ZUVA 3M7SA 2J7GA 1QI5A 2FHCA 3EBVA 2J47A 4AY1A 4MAVA 3W6LA 2VT0A 4AIUA 1LG2A 3VX0A 3A21A 3B9DA 3VDCA 2E8YA 1JZ7A 2O9RA 4AMXA 4D6FA 1B0IA 4MB1A 5I2UA 4CD4A 1KXQA 1WPCA 3LPPA 4MAZA 2DT3A 5EB8A 5JIPA 2PWHA 3AYRA 4LPCA 1W9XA 1KXTA 3AHZA 3BAYA 4XV0A 4Y7EA 1HJXA 4ZENA 3VMNA 1B3ZA 4DUXA 2BHZA 4UFLA 3DDFA 2ZUSA 2XUCA 2CXGA 1KGUA 2BY0A 3ZR6A 4WKAA 5A6BD 1AMYA 1W32A 3CPUA 2FE0A 2VVSA 2CIPA 4W5UA 4AEFA 5CPSA 3IJ9A 1CGUA 1JFHA 3VIIA 1ESWA 3H54A 1CWYA 4PBGA 2WHLA 3DX2A 4NI3A 2A3EA 4PMVA 4D6DA 3TONA 3BSHA 3VUPA 2ZE0A 1SMDA 1CLVA 3WH5A 3HG5A 1TE1A 3HU7A 1OM0A 3OGVA 1V0MA 4UOQA 2V3GA 1G5AA 2ZWZA 1BF2A 3VDAA 3ARVA 5FCZA 1DWJM 3KZSA 3GZAA 1Q6CA 3FXYA 1R46A 4PMDA 2NSXA 1NWTA 1QNSA 4B9ZA 1IZJA 4BA0A 1EA9C 3KL0A 4AZ6A 5LA1A 1GQJA 3CZ8A 2VMFA 1E9LA 1UR9A 1XSJA 5ABEA 2YL5A 4KGJA 1V03A 4NZFA 1EQPA 3EMCA 3MUAA 1ISWA 1E0WA 1VAHA 2YKKA 1EIBA 4AEEA 2VJXA 1QHZA 3AMKA 2J7HA 4FMVA 2WZEA 3B9AA 4WLCA 3CZNA 2XN1A 3WY1A 3LX9A 1MW0A 1W1YA 1M7XA 3DDGA 9CGTA 3O9NA 1JZ3A 3LXCA 1HJQA 3AS1A 4JFUA 3W37A 1Q4NX 3OIHA 3TTSA 7CGTA 2C7FA 1OIMA 4AZGA 4QLJA 1EDGA 2DQXA 4TTUA 2OW7A 3PZUA 1TUXA 1ZBWA 3SUSA 3MU7A 1UD2A 4UQCA 3BUQA 2PWDA 1TQVA 3ARRA 3N13A 1VB9A 4XX6A 2WMIB 4TXEA 5I0DA 2WVTA 4H04A 3RDKA 1F4AA 2X2JA 2DSVA 2Y24A 3WNMA 3A5VA 2YOCA 2Y8VA 2QLYA 3BAWA 2J79A 2XGIA 2JEPA 1M03A 1NP0A 1M01A 3GBEA 3BUDA 1KGXA 3RCNA 5A1AA 3WH7A 1GCYA 1TZ7A 3PZOA 1VRXA 3KEHA 3OZOA 4A4AA 3AMLA 3L4WA 3WY2A 1E6RA 4UQAA 4TVUA 2OWCA 1UR4A 3AHTA 4XUYA 1UOKA 1L0PA 2CESA 4P7QA 1XHGA 3WFZA 4E4PA 2J62A 3NUKA 1E1FA 2WKLA 4AZHA 4RE4A 1PAMA 4NSBA 2X05A 2WLYA 1E72M 2WVVB 4C7FA 3A3HA 4D6CA 1QNQA 1G9HA 1SFSA 2D0GA 2FH8A 5EBAA 5EFDA 3L4XA 4MJ2A 5IXEA 1E55A 1IZKA 4D6IA 3AJ7A 1H0IA 3VGDA 4YPJA 3KLKA 5A69A 2XIIA 5TD4A 1HP4A 2ZUUA 3W0KA 3MKKA 1QI0A 3DX0A 2CYGA 1E3ZA 3RPMA 2DT0A 1E5JA 2VQUA 4J7RA 3W27A 3QHMA 1XCWA 1ZB5A 2HISA 4OJYA 3CIVA 4UOJA 4E2OA 1K9TA 4P8XA 2XVGA 2PC8A 3F5JA 3N17A 1QW9A 2ALWA 3EDDA 4JL1A 1J0ZA 2ZUNA 1BYBA 1DTUA 2W66A 2F8QA 4N42A 5JBDA 1GPFA 3ZMRA 3T09A 3VSVA 2XVLA 3WFLA 3WF0A 2UY2A 3VIPA 1WDPA 4HP5A 4P8VA 3DX1A 4HPHA 5DT5A 1HKMA 4GXPA 4UFIA 2VUYA 4BCEA 3ZSSA 2XHYA 2DGAA 3WMSA 1EHNA 4DO4A 1KBBA 2XGBA 3LRKA 1E6NA 8CGTA 3WH8A 1DHKA 3CUJA 2C0HA 5CLWA 3CH9A 1ZS2A 3AZRA 4V2XA 5IFTA 1XD1A 4BF7A 5HPOA 4J27A 3D52A 2VZUA 4DUWA 2BV9A 4HPGA 4URIA 4JZ5A 2JF7A 4W86A 2BY2A 4MDOA 3DYMA 4ATLA 1KTBA 1GQLA 6CGTA 4HA1A 1G01A 1O7AA 5EFFA 1ZL1A 2J77A 2ZXBA 2MANA 1TR1A 4J3WA 4PMXA 1R34A 4UFKA 2YIHA 4FNRA 3BXWA 2XWDA 4H41A 3WD3A 3VNYA 3VGFA 2G3MA 4W89A 4PMUA 3QGVA 5I24A 1E6QM 1HVQA 3EDEA 4PN2A 5FD0A 3CTTA 2NT0A 3GH4A 4XZBA 1BG9A 4WK9A 3WDHA 1JZ5A 5A6LA 2D2OA 3EJSA 1JF5A 1VFUA 3A4XA 1X1NA 4ATDA 4D6EA 2CPUA 4F8XA 4CN6A 1KXHA 3VIGA 5LYRA 4PUDA 1E1EA 1B31A 3EJTA 1UD5A 1OWQA 3CUFA 3WQ4A 4GI8A 4FLSA 3VO0A 1JYWA 1GNXA 1H5VA 4B3KA 3WIJA 1GOOA 3WL1A 1UD6A 4AD3A 4UQDA 4IISA 1KXVA 1U2YA 3A24A 1C92A 3W26A 4CGTA 4X0VA 5BXRA 2E3ZA 5CXPA 3MV01 5IDIA 1LLOA 3AMGA 4U5KA 3RM9A 2EPKX 2DDXA 3OB8A 2DSKA 3AI0A 1BQCA 1TQWA 4MPKA 1SZNA 2WHJA 3GYCA 1RP9A 1HIZA 3PZ9A 3RILA 1MFUA 2D0FA 3VD4A 1OD8A 4GQRA 1ISVA 4GZEA 4FNUA 5D9NA 2WAGA 1EDQA 3CZSA 4FF5A 1J0JA 5CPQA 3AIBA 3ZM8A 3VOCA 2G8ZA 4M81A 3KWXA 1MXGA 1CLXA 3CHEA 3CZEA 4NRRA 4JKLA 4Q7NA 2QPUA 1AVAA 1WDQA 4NXKA 3CUGA 1CXHA 3LXBA 4K68A 3VIMA 2VZTA 3DYOA 1LL4A 1KR1A 2WYSA 3GH7A 3VDHA 2AOSA 3WH6A 2VCCA 5A94A 2EXOA 2ZX5A 3WL0A 1NARA 1JZ8A 1J18A 3CBWA 1K6AA 4U5IA 1OGGA 5A6BA 5FOOA 5I79A 4AD2A 3LPGA 1MVYA 5EMYA 2WWDA 4AW7A 4MDPA 3BH4A 1NWRA 2J78A 3G6MA 2V5DA 1EDTA 4PMQA 1WAWA 2JIWA 1JXJA 4TOQA 1GZJA 3VM7A 1VBRA 2VCAA 3AS2A 4U33A 1GJUA 2XG9A 3VX1A 3KE0A 3BAIA 1FA2A 5A2CA 3M6DA 1F4HA 2OSWA 4GZIA 1MYRA 2VZVA 3T0DA 3WUFA 2WBGA 1V3JA 4EE9A 1VFMA 1FFRA 3S5YA 2X2HA 3MMWA 4OZOA 4F66A 4FLOA 1B9ZA 2WCSA 3EDFA 3T0AA 1KGWA 4AZ7A 1V0NA 2WK2A 4HZ8A 2CETA 3SIMA 3TTQA 1QWNA 3ARSA 1E43A 3LXAA 3ALGA 3MMDA 4DM2A 1EOKA 3RJXA 3ZT5A 1XYZA 4J3TA 1XV8A 3A22A 2NT1A 3GXMA 1J10A 2E9BA 1KQZA 2V3EA 3FN9A 5D9MA 2WZHA 2YFOA 1E6XM 4RE2A 1OIFA 3WMCA 4PEEA 2A3AA 1DEDA 1QVBA 3CZGA 3MI6A 3GXTA 3WDIA 1HXKA 3NSXA 3RIKA 4U3AA 4WSKA 4B9YA 3MANA 3ZJKA 1HT6A 4KH2A 4LYPA 3WQ5A 3D50A 5ABFA 3K8KA 1PJ9A 1W9BM 2W62A 1RPKA 1V0LA 3AHYA 1UR8A 3T08A 3W28A 1O7DC 1OD0A 1ZBKA 2ZUWA 1UYQA 1TMQA 4CCDA 4B16A 1JYXA 1RD6A 4N0RA 4X0NA 3GTNA 3MO4A 1BAGA 2OWWA 2FHBA 2VX5A 5AYIA 4ZEPA 1E6PA 4NZCA 1YHTA 1QHOA 3K8LA 1GOKA 4E8CA 2E4TA 2CBIA 1FHLA 1WE5A 3IAQA 1W91A 2F1AA 2Z1KA 1UZ1A 1XRVA 4J3VA 4JHZA 4HOWA 1HJUA 4W5ZA 3ZT6A 4CU6A 2IGTA 1HNYA 1TQUA 3D51A 4M24A 5BXSA 2WC7A 4W87A 3NDYA 2DH2A 2YBUA 2VVNA 3PTMA 4JFVA 1MQQA 2V3DA 3WSUA 3WNKA 5E09A 2DEPA 1FP8A 4AZCA 1JDDA 2BXZA 3WQVA 4CVUA 4F9DA 3ARYA 1JD9A
chains in the Genus database with same CATH superfamily
4OV4A 1Z9LA 4KAQH 3F2LA 1S2AA 4QIRA 2ZXWB 1A3ZA 3NQKA 1F6PA 2E6PA 4Y4FA 1MHPH 3J7HA 5L7XH 3S2AA 4L3CB 4NI8A 1I8IB 3CU7A 2Q8BH 3GD6A 2PR4L 2YFNA 1RKRA 2YARA 4LVGA 4AISA 3HB3B 1IQWL 3GI8L 3PTKA 1ZTVA 4K1GA 4RAVB 4L9LA 4GRWE 3EFFA 4RE3A 1AQMA 1X96A 1X9UA 4UAHA 1RZKL 3WENA 5GGTL 1IFGA 1OOWA 2HXAA 3WNIA 2EO9A 2C18A 3FOMA 4OVXA 2B20A 1MMFA 2FDMA 3VRJA 4U3HA 2GAZB 4YS1A 3FRPB 4LVEA 5IJVA 1EA0A 1LQSR 3CV7A 4NUMA 4MDIB 3OKMB 1G4TA 3P2DA 1FCQA 5LSMA 1E8WA 3MUCA 4UQ3B 1MSSA 1RQ5A 5BVJA 3SYQA 4JNMA 1JK8A 1FQ9C 1NDGB 1YEGH 3P11H 1QP1A 3HS0B 3O6FB 4XWUA 3D1MC 4M7JH 3KYKL 3T7VA 4F2EA 3ZXAC 1UA6L 2WOYA 1TF4A 3JV6A 1E5UI 4G83A 3NZ8A 1IC7H 5T1LB 4GXMA 3B1TA 1N18A 3UYOD 2N4IA 3GHPA 2YD9A 5GS1B 5HD8C 2PLTA 1TVNA 3V18A 2PDKA 5FFGA 3VTAA 3QGAC 2O9OA 4N3UA 4X9YA 2W4XA 1OZUA 4FKEA 4QNPF 2FL5B 5I74B 2BGNE 2PR9A 3AU1B 3FO0H 1P7QD 2R2HB 3COOA 2XH0A 4GQQA 3VA8A 4ECLA 3OG6B 1YEKH 1A3WA 4I13B 3ATYA 1M56B 1MRQA 1M04A 2HUEA 4DIXA 2GSIB 3B6SA 4WUKL 2L0DA 5C7VA 4PJ5B 3QI9A 3OGSA 3VJ6B 4GG8B 3HKFA 4K94H 1HVXA 5SWSE 4PYSA 5LNEA 2FWOB 3B4NA 1MAML 4ZO9A 4ATTA 1XFPA 2VZOA 2R27A 4R6UA 5ICUA 4JY5L 4KKXA 2NW0A 2X1WL 5IRPA 2OJEB 3SCRA 1CDHA 4LESA 4MZYA 4R4FL 2X09A 2H1XA 5A3HA 1C91A 3HGJA 4KWUA 1F90L 2IC2A 4PLNC 3PCYA 2GFBB 4GT7A 1GPOL 3PU7A 1AZ2A 3WYZA 4UQ2A 4IYKA 3GSNH 1E9YB 4MKNA 3WJSA 5KAQF 1KGIA 3BLFA 4FXJA 1EUNA 4G5DA 1QVOA 3HN5A 3RU8L 4F9LC 2DZSA 1BVKA 1A6WL 1VJZA 4O1EA 3EH5B 3V52L 4I3SH 3W00A 1SO5A 1XDLA 4HALA 2IO5A 1K8XA 4Z76B 1T4KA 2OCJA 1AH0A 5DMGD 4FF7A 2ESVB 4K8EA 2DKMA 1WAPA 4EIUA 4IPIA 1EL3A 1VYRA 1A6TA 1L9WA 2DI7A 1K8YA 3J2PA 4OD2B 1DP0A 4D1IA 5ABDE 3GZOA 5CR1A 3VFWA 3AADB 5HHXL 3SZ6A 3Q43A 4LGXA 3RR4A 4JQVA 2XTJD 4MNMA 4BGLA 4YHYB 5ITFB 5L2JB 4M6NL 3U83A 3H7RA 4H26B 3HJZA 2V9RA 1U8LA 3UJIH 5FI8A 3FB5B 3E8UH 5FA3A 5FO7B 3ABGA 2A3BA 1A7OL 1CZ1A 2MNJB 3OG2A 5FAJA 4JVWA 2VFFA 5D55A 3LMJH 1CI5A 3CH0A 1GIGH 1SQMA 2YYUA 4RX0A 3D2UB 4L37B 1GJWA 4UMGA 4WI0A 4JRFA 3IDXL 3A0OA 3NEHA 1XP3A 2VXUH 1BZ9B 2RFGA 1GSKA 3N6QA 2IADB 5E1HB 1EUTA 3B0VC 2VEIA 2UXTA 1S9YB 4MB5A 4HEPA 2NXZC 4I1NB 2Q76A 1NJ9B 5AAPA 5D2NA 1MRCL 1NCWH 4WEEA 2VC6A 5JLZA 3VXSA 4GVIA 2CKBA 4QHNA 1IILE 3WGVB 2OTPA 3ETTA 1Q8MA 4FX5A 4TPRH 2CRIA 1NY1A 2WXRA 3K2IA 1Q6GA 4Q8BA 4GSDH 2BP0A 4FG4A 2DORA 3B9NA 3UWZA 4J8RB 1GEQA 5DVPA 1MEXH 2MPAH 2NX3A 2GSEA 1F5WA 3EX6A 1UPPA 2L04A 2HMID 3MDUA 2C4FU 3BRGC 3P67A 2F5BH 4Z6AT 1GONA 2ZCKL 2VIRB 4Z9KB 4PJHA 4K5MA 3BWSA 4WDXA 1MFAL 2TSYA 1HF6A 2BOEX 2CMRH 3I9GH 1XUUA 5BS0D 2TMDA 4OFYA 4PUKA 2E56A 2BP1A 3GJFH 4MA8H 3IJYB 4NQCD 1HCYA 3IDYC 3AMDA 4HK3N 3V6ZA 3VNMA 4MJJA 5LGXA 1BBDL 4XVDA 1KPVA 3MNDA 2QCHA 3NJKA 3R11A 2J2ZA 4LMQI 1DBJH 3GJEA 3Q58A 3ARGA 1ZGLA 2YD4A 5F3HA 2HB0A 4H19A 4KTEH 2BMKA 3QZPA 5A8PA 2Z6IA 1UACH 2ZCHH 5KSAC 3KYOB 3KEDA 5C8BB 3EUUA 1RJPA 1R3JA 1P84J 5MEPA 3E7JA 1DFBH 2JB5L 1U8MB 3IEBA 3HR6A 2VUNA 5AVZB 5DFVD 3S0PA 3TYFA 4JUTA 3THQA 1AZBA 1DQQA 2UY7A 2XVNA 2RDXA 3QQ1A 2NZ1A 3VC6A 1QSVA 3NL5A 5TDNB 3SJVE 4J1OA 4BK4A 1MUMA 4HTBA 1AKJB 5MEQB 4AJWA 2ICEA 2YWZA 2UZPA 3KPSD 3TM6A 3QYNA 3UPBA 5KUKA 2BRRL 4PV8B 1FNFA 4F58H 1JCXA 3FFCA 4CC4A 1U92B 1WAAE 5CD3B 2X6AA 4ABQA 1P4BL 1PKQB 1YC7A 2QHRL 2P0IA 3PYCA 3AY4C 1U8OB 2V33A 2Y6ZA 2DYSB 3FU9A 2FNBA 3TZFA 4KF1A 3IB4A 5D71H 3DV4B 5EMLA 2QNEA 1UH4A 4NWTL 4N6RB 2ERJC 3W39B 3O6DA 1FO0L 2VDRB 3M0ZA 1IEAB 3EIFA 5DT7A 5DN1A 4JCLA 4GOSA 4XSLA 3TF4A 3ULSA 4GD0A 2GQ3A 1JHKH 2GQ8A 3PGCA 3ARBD 1RAMA 1ZGDA 3K2KA 2CLIA 1Z6JT 4KQ4H 3MCYA 4B5NA 4HS8H 4BM7A 1IE7C 4QOKB 3GZKA 6A3HA 3E6HB 5G5IA 1YN6B 3AZTA 3OVPA 2UY4A 2WMIA 3LZLA 5CSZA 4LIQH 5JXAH 3II1A 4D8AA 5LA2A 1KN2H 3QS2A 2DP3A 4JY4A 4HK5A 4YWGL 3HI5L 5D7KD 2FBJL 3EKCA 4TULH 5HYQA 5D1XD 2OX1A 3MZNA 1R3IL 3GY1A 5E8DH 2AAVA 4OE7A 3MLZH 1FKWA 4RFOL 2YPLA 2IGFL 2XXCB 4OZ4B 3ESNA 2JI3A 2F5AL 2BWGA 4LFHD 3HW7A 4HMCA 4AT6B 4Q9QH 3M5YA 1P48A 2WQDA 2OULB 3GYEA 4N6FA 4XC1L 3GXPA 5AYUH 4NQDA 2B7DT 1UUQA 4GIPD 2OXGB 3NZGA 5DEGB 5ESVB 1Q6FA 2AERT 2X4PA 1WZMA 3TCLB 3WS3B 1D6VH 3IM1A 5AN7A 3VWKC 3Q45A 2QGYA 2J8HA 2A5HA 3MA7B 3T2OA 2DWEB 3N2TA 1UVQA 3EO0A 3W1XA 4DBEA 1NFKA 3H9HB 4P04A 4NJJA 3OG4B 4XMPH 4HU3A 3WN5C 4ZPVA 1JN6B 4PS7A 5ID0A 3ROOA 5J5DA 3W81A 1NC2A 4BQCA 4QFUA 3PJUA 4NXSA 1MHEB 3F7VB 1OAUH 1UOLA 2XN0A 2G2RB 4OCNC 1DDTA 1NEZG 4R3SB 2CO4A 2VKWA 3BPOC 3SCSA 3BZFB 5EU7E 5IEHA 2NTFA 4G8IB 3V9CA 4V1DA 3DFPA 2PA6A 4W1TA 1ZA3B 43C9A 2P3YA 5EZOH 4HK0B 3UH8A 4UWMA 3IDJA 3FDKA 4PEKA 3WKQA 4TNWF 2C7UA 3NL6A 4ZW6A 1JRHI 3GSNA 1QFWH 5FHAL 3KWSA 2NXYC 1F97A 3V0EA 5LXGH 2FSEA 4M1BA 4S2CA 3MV7A 2UVEA 3IRPX 3KDMB 3P0YL 3E9AA 3G6AA 5FL1A 1J8HB 1BQHB 3UZEA 3REWB 3M44A 4LHUD 1W3JA 2D2GA 4UIKL 2FLIA 1NWSA 4QPEA 2NXZB 4MCNA 3V7MA 4B27A 3NFNA 2N1KA 5I0WA 1YJDH 2FMNA 4DXXA 2LT9A 2HXUA 1SW7A 3DUSA 3H9SB 3V0SA 4WW2A 2D7MA 4JCWA 1ZVHA 1XF3B 4UBDC 4LLMA 4BUHA 1X5FA 3TYAA 3WQFA 2YBVA 4HHAA 4L1HA 4EPDC 4GUHA 5JYMA 1OT2A 5HPMB 3ZKQD 3MTXA 2DYPA 3M7SA 5D2LA 4AWUA 2ZCZA 3DI2B 3U9UB 1KXQA 4JO3H 4N20A 2AKRA 2WQPA 1ZE3H 4X4XB 3F62A 3BQ6A 3WIHH 4PJ7F 3ZVHB 2D9CA 5IB4B 4LS1A 3O07A 2F6AA 3S1WA 3GWQA 2BFVL 2E9IA 4ZX3A 3UQNA 3NP3A 3B9VA 3JT0A 2FIKB 4YHOH 4GIYA 3MV9E 1OZQA 1RFDL 3QW3A 5LKYA 3EGDB 4UM9B 5FKAB 4XVJH 3GMPA 3DGDA 4JG0H 1Q6OA 4R7LA 4H9MA 4OGXL 1JXGA 1TTBA 1TB3A 1ZLSL 4QTGA 4PRPA 5DS2A 1QNSA 3JVAA 4O1FA 4LVHC 3ITVA 4AZ6A 3D39D 2CJ3A 1XZ0A 1XSJA 1MZZA 3RNKB 1FG2A 3BKYL 3NPZB 1EIBA 1DLFL 1VCAA 2ITCA 2Q3AA 4KJPD 1YNYA 3C87A 3R0DA 3IN0A 4AVJA 4JFUA 2YAFA 2YRLA 1UROA 1GOHA 4EE2A 2WD0A 2Z35B 3H56A 4WJKB 5A16B 2VR6A 4PGJA 4I9JA 1GAFL 4XWGL 1WAEA 1R3WA 1VADB 4UR7A 4BH8A 4GACA 4C91A 2B81A 1YUKB 4GMSL 5EGRA 4H8PA 4LCUB 3NO1A 2BZNA 1LO4H 3D6NA 4KEUA 1XR9B 5EO1A 1GKPA 3SGEH 4UTIA 3LCYA 4A2DA 2CM5A 1MFDH 4WVRA 1QRQA 3L3KB 3RAJH 3GJFA 5HHOA 1AGCA 3GU9A 4Y2OB 4IGHA 1WYIA 2AW2A 1UC4A 1RUMH 2GGHA 2X05A 1N8OE 4OM1L 4HNOA 4MFHA 4ZUUB 1BFOA 4ODUB 5CIPA 2FH8A 2OMVB 1ZAGA 3IETA 3QQDA 2Q8AL 4YPJA 5F71A 4LT9A 3G6DL 2O6EA 1ZSDB 1R19A 2WY3B 1I4FB 4FCHA 2AQWA 4FULA 1XIIA 4KO9A 4QRSB 4UOJA 5C2BL 1K9TA 2Y7QA 3KTSA 3VFSA 1XFCA 1UB6B 5C2XA 1WCBB 3DG3A 5AVXB 4IXXA 2E4FA 2NQ9A 4L4LA 2J8UB 2H4EA 3W73A 1WDPA 5IFHH 5SWQB 1A8JH 5BUAA 4BJLA 2V9UA 4NRZB 4BDVB 4CNSA 2VUYA 4I9XA 1D6EB 2GC7C 3ILPB 4Q8MA 1KB5A 3MYZA 4QE4A 2V5SA 3M43A 4ZQNA 1FDLH 1HH9B 5FHBL 3DBSA 5HPOA 4YIQA 3TPUA 5I17A 4K9EH 4JZ5A 5BW7C 3GG1A 1X44A 3TBTB 3H2WA 2J77A 4IUOA 1A1MA 2BVPB 4PMXA 3FBQA 3VE7A 4AGLA 4JIRA 2XKSA 4UWQB 1LEIB 3WD3A 4KU1A 3VGFA 3EOUA 2G3MA 3FCTA 1XIJA 4A2GA 4PI2A 3LERA 4JDZB 1HVQA 3KBSA 2HX7A 4WUUE 3O3BB 4E4FA 1M6OB 1MI3A 3L2NA 3TW7A 1F4YL 3TBSA 3EJTA 5JW4Q 1CU4H 3DFTA 1KCSH 3VWKB 5E23A 5D1ZB 4G1EB 4NUWA 1OK4A 2X6UA 4C4UA 4EN3C 2UZYA 5DUJA 3UVIA 3LEPA 1C92A 3SQMA 4LBEA 2VDPH 4X0VA 5IDIA 3R8RA 3MLVH 5F89B 3AI0A 1TQWA 3WN5B 1I7TA 1HHJB 1F07A 1MFUA 3ZL4H 4K5NA 5FJJA 3ZYOA 2XZCL 2MOGA 4CBPA 4E9WA 3LCHA 3OKNB 4PUUA 4JFZH 3N42B 4LLYB 4NX5A 5K9QI 1PL9A 1BJ1H 1NGQL 4GAFB 3BPOB 3WSQL 3B9KA 1XLLA 5KSBB 3OBKA 4PJFE 4IIFA 4R5XA 3VFLA 5SWZE 3BH4A 1H19A 1TJGH 3GO2A 2K70A 4U33A 4TUKL 3C4UA 1QPRA 4Y1TA 3VXTB 3DBNA 4ENED 1NEYA 4FJ6A 2NXYB 3Q37A 2ACQA 2VXNA 3S5YA 3EDFA 2QVIA 5D96C 2I5IA 2PYEB 1LO2H 3BHBA 4FG6C 2NT1A 1T6BX 4HPOH 3OJ2C 2PTDA 1E6XM 1OAKH 2FJGB 4GAYB 1RUQH 2YXWA 2AK4A 3GXTA 4KK8D 1A5UA 3NSXA 4G7VH 2X0WA 4ZQPA 3U2CA 1DJWA 3QNZA 4M43H 2H3DA 1NBVH 3B83A 4G8FB 1S5MA 4UNKA 4G6KL 3T08A 3LD8C 3BVDB 5CJXC 4M3PA 1YPZA 1BIIB 3MFFA 4F7CA 3LH2H 1UYQA 4B16A 4E9RA 2J8UF 1JYXA 2EDYA 2VLKE 1YMYA 2HLAB 4M93C 3GTIA 4GY0A 4OT7A 5D2VA 4LAQL 3LKNA 4FPSA 4C58B 3W1ZA 2O6DA 2HVKB 3CC5A 5LCVL 5DA4A 3OR7B 3WTXA 4KRZA 2F1AA 2RHEA 1MIEH 2ADGA 4LSRH 5FYJU 4OCYL 4JHZA 1A4KA 1HJUA 4W5ZA 4MCMA 3QORD 2EE9A 2IGTA 3EWBX 2AKZA 5F1VA 4W87A 3NDYA 3RHWF 4LH8A 1F61A 4XP5H 4B7LA 2DEPA 1FP8A 3HFML 4AVFA 3CQJA 3U9PH 2CU9A 3PGDB 4H7VA 4FNLL 3CSTA 2EUWA 3T0TA 1JPMA 3MREB 2MKWA 1WBXB 4Q74A 4O10A 1IAKA 3KBHE 2QDEA 1L8NA 4LQFH 5B4MD 2AF2A 1QSFE 5I18L 4R84A 3L7EB 1A2YA 3GRBA 2JK2A 2XNAA 2WZ0A 1KSRA 3MODH 1NUDA 4OLWH 1BYCA 4PYHA 5J7CC 2Y1HA 4N0CC 1AD4A 1EJTC 1ZD6A 3THDA 3FV9A 4NQED 2UWEB 5CKAA 4OV9A 2C1PA 3TW9A 3ZTJH 3H70A 5DJ0A 3TJLA 1HKJA 2BVEA 4NC1E 3HFFA 5GIRA 4H9TA 2FMOA 2WMJA 3LNGA 3SN0A 3CZKA 4HUNB 1CUOA 4YGVB 1Z9MA 4FQ2H 1G7PB 5EEYA 2EKSA 4I9WD 5J5EA 4HC1H 3MLTA 4H0IA 3FTYA 3MMEB 3N42F 3OU8A 2D73A 4YDLC 1KTCA 4LTSA 3B8SA 3SY1A 1HO1A 3U46B 1KUMA 2MKLC 2D3NA 3D3AA 3QMSA 3MRMB 1HSBB 5KSBF 1F58L 2X4RA 2OR9H 1TA3A 1SBSL 4Q8WA 3KS0H 3G0SA 4JFEA 2WBJB 3SQOH 1LEKA 4EOUA 5K1NA 4FGMA 1HZHL 3N06B 1BM3H 2DTMH 4Q4IA 1OJXA 4C6CA 3EJYC 4ZUSB 4KXAA 4XNDA 3REVA 1NPJA 2HRGA 4AHOA 5D9OA 2O9TA 3BOVA 4JNYA 4F9PC 4GPVA 4ANKA 5HA7A 3CXDH 3M86A 5JXED 5AYZA 1O7DE 3V0TA 1ZVNA 4FXKC 1KLFA 3NCWA 2QV5A 1OPGH 4OGAC 4AV4A 1EJFA 2RQ8A 3GQFA 5D30A 1XR8B 4LHQB 5DHVB 3DIFA 3HPZA 3BLBA 1I9CB 2CHWA 5A6TC 2W0PA 3QK0A 5EORL 1ZLUH 2ZUQC 3DROB 3GT6A 2IBBA 5LGHL 4WKHA 3NQIA 1RU9H 1TZOA 5DO8A 3VINA 2INZA 2XRAL 1OAQL 4HFUH 4LQ1A 4PCYA 3WKZA 1MXSA 1AJ2A 1XIWC 3BLEA 3LBOA 4GQ9L 1EGMA 4XPBH 4GE8A 2WIMA 3HLAA 3QBUA 1BVNT 3ZTJG 1SJEA 5M17A 2XQYA 4K8GA 1C1EH 4GG6E 4YSEA 1EJRC 1N55A 4M7KH 1N7KA 4QYAA 3ZIYA 3GH5A 3UESA 1Y18B 3MV11 4JAMB 5DHEA 5KVDL 3Q8AA 5F4SA 3UNDA 1J9TA 2IQ9H 2YPVA 2P7TB 4A37A 1CB4A 3C5JB 1CD1A 4J6IA 2OZ4H 3OX8B 4H9VA 4IFKB 2QMKA 3G0XA 1CBGA 5FS5A 3GLEA 2I07A 1XISA 1FGNL 5EEVA 4I9MA 3BN3B 4M29A 3E0IA 1FNAA 3FT4A 4PJ8D 3F64A 2QGBA 1LOLA 1QG3A 1TJIL 3TBYB 2D31A 3KPOA 1R9ZA 3KWUA 1RJQA 2BNRB 1TVLA 4N4YB 2DSZA 3S83A 1W72H 4JMNA 3FQ2A 2VX6A 4PR4A 2GG1A 4UM8B 2Y23A 2YO3A 3QUXD 5E6SB 4FN0A 3RLHA 3UIYA 3P30L 4GS7C 5I1HH 5KYYA 1UEYA 4MZIA 5D1QC 1IT9H 1K8IA 1E4JA 5HJXA 1CZ8L 5K9OB 4NZRL 3GIQA 3WJMA 3HVNA 2F1BA 3JZEA 3TN0D 1PD1A 4UDTB 4JCMA 2J12B 2F54E 4HWZA 1J1PH 3KOXA 2YZ5A 3GB7B 2EP6A 2J4WL 1MH5B 4HIPA 2PUQT 3DI0A 2ACUA 3CT7A 1CB7B 4DJDA 4GP5B 1CFMA 2H3NA 3PWVA 4RGND 3LN5A 3EEGA 3QIBD 3RX3A 2Q86B 4D0CA 3VCCA 4CD6A 1CD0A 2A6DB 3SGKC 5E00B 4LPWA 5KTLA 5D96B 3AVEA 4IMAA 2TSBA 1TFVA 3C6LA 4O19A 4JQ1A 5C0AB 1YCSA 4LYQA 1CBVL 4DW2H 2QBWA 1QNRA 3SO3C 1RAKA 3GR7A 2O93L 4JEGB 1H3UA 2W61A 3DC8A 3CUXA 3NZSA 5IQLA 1CFNA 4XP9L 4YFLF 3W1MA 3GIZH 4H8HA 4L9XA 5GJTH 5C71A 4XP6L 3OODA 3GK8L 1HI6A 4M93B 5IR1B 1PZBA 3QTPA 2P5WD 2ADYA 1YY9C 3OLIA 2XYBA 2MPVA 4R8WL 1AHWC 4IPJA 3QR3A 1TU2B 1A4BA 2OZ3A 3SPJA 3TFCA 1U21A 1OE1A 1E5AA 4NKQB 5A2FA 3K3QA 1MCHA 2VR3A 2UWFA 3UP1A 1ZV9A 2XN2A 1LT8A 2C3VB 3JVGC 1LWHA 3T6ZA 1R3KB 3BH9B 3N2CA 1CLYH 4IX0A 4FZ8H 3S5LB 4LASL 1VIWA 4NSKA 3S36H 2AI0H 1VIZA 3T4WA 4QSHA 4NS0A 1Q0XL 3EOEA 3S37X 3Q13A 3FTGB 1KULA 3ES7A 3P02A 3RWGB 3ALPA 1IEVA 4GYPA 1O9ZA 3HHSB 2X6BA 5F97E 4NKOB 3F7JA 4AIBA 4PGEA 3VA2C 2DFAA 5GS2D 4PJAA 1U0QA 3DOHA 3PL6A 5ETUA 3SRHA 2CLZA 1KCWA 1N68A 2Z8SA 4OZHA 3E5BA 2O5YH 3W38A 1X1ZA 3OZ9H 3HB3C 2EDDA 4HWUA 1I8AA 2V8MA 2WYHA 1VP5A 1J1OH 2PCXA 2WIIB 3D6GA 3CU1A 2C3GA 1SN5A 4H4IA 4PRHD 3U1PA 5I0ZA 4O51B 4XP4H 4E5XA 1Y6NR 4F33A 1PW3A 2EGZA 4MWAA 1YYLL 4AVKA 3OIXA 4YDLB 1XYLA 4ZPTA 4DEPC 5HGBB 5BOPA 2JFEX 2FZDA 3RUBL 2XJ7A 5T3ZH 4AZ5A 2C9AA 3CHCA 1OY3B 4MYAA 3BO8A 3MRGA 4F2MA 2IFFH 1YPXA 2OU4A 3CAWA 2HFEB 3HS0C 4RA0C 2VC2L 2YBTA 1KM0A 5G1TA 2LQRA 4NO5A 4IIGA 4KUZH 5AZ1A 2LU4A 1TVBB 4EZLA 4Y5YC 3TASA 4GSUA 1YXYA 2V5TA 3A6CH 5JU6A 3NIGB 1WZLA 4V2BA 1M7PA 5IVXA 4LCYB 2YOAA 1UWEH 1S9XB 1K9EA 5AWNH 4MD4A 4HIXL 4IOIA 3W07A 4Q8UA 2N7BA 4X2RA 3RM8A 1LP9B 1Z2KA 2DQUH 5AW3B 4FXKB 1F73A 4R97B 3MUIA 5CZKA 1XL9A 4X9SA 3B7RL 3TEXA 1L7IH 3ZRSA 4URKA 1F1GA 3AWGA 4ACZB 3FQRB 4NQSB 4IRSC 2HS6A 1UM5L 3QHOA 5E4AA 2FK9A 1PCSA 2ZUQB 3CBJB 1SYTA 3UX9B 3CASA 3S4TA 4HC1A 1DN0B 4S2SB 3FU7B 1HOCB 1IC1A 3RL2A 3QEQD 3APMA 5DZOA 4OLYH 4OCXL 1H15B 1XIWB 1KBLA 4XCFL 2PBGA 1C9WA 1NIBA 3WLBA 4J40A 4YR6A 3V55A 3ULVC 5AW7B 4D2NA 5EOQL 3HPJA 1SXZA 5E0KA 3RVWC 2AITA 1PKMA 3QQ3A 2OGYA 4ZAKA 1UR2A 2PWFA 3UBXB 1WFNA 4U1IB 3TYZA 4PWJA 1XF5B 3T3MB 2BY1A 3FJNA 1Q72L 3N2OA 2DW7A 4X4ZA 3VFTB 5JPNB 1IQDB 4IIBA 1XYCA 4MTVA 2X4QA 4PD4J 2ZCLH 1HHGB 3GG7A 3VIOA 5D8ZA 3ISWA 1UWXK 1Y6MR 2VABB 3CMJA 2XPZA 2EVFA 3Q67A 5CBAA 3K13A 2X10A 1K3ZA 5E6ZA 4A2SA 4KV5F 3HI6L 3W02A 2NYZA 4A22A 3E12A 4MJMA 4IU2B 1X5AA 4Y19E 2DT2A 4DX3A 3NAAH 2ETWA 2E9WA 4B2DA 2OMTB 2ZXGA 5I1JH 1Q8AA 2V7HA 1L9OA 2NQ3A 4GRMA 5GGUB 2P47B 2Y06L 4M8RA 2CFFA 3N0AA 4XMTA 1EEZB 4YWSA 3Q05A 1NLDL 2AL2B 4D9QD 4QO1A 4YHYC 1HESA 1SGJA 5EUOE 2BX7A 1AXTH 1OARH 4H40A 3UTQA 3EX4A 1TIUA 1SMOA 4I9TA 1HXJA 1DVFD 1MY5A 3WQ6A 4FQJH 5CGYD 1FWEC 3L21A 2Y63A 5HATA 3IDNB 1QO3B 4TSAL 1UWRA 5K59F 4YDKL 3RY5A 3NVQA 3PP4H 3LEYL 4AGOA 2CLPA 4PH8A 4QJ3B 3KHQA 4NFBA 3NIGF 4AC7C 2OZ4A 4LUTB 1TX0A 5FDWA 5C09A 1OM3H 2YPIA 1EAJA 2QJDA 4ONHA 5JOPE 3K74B 1RQHA 3R4DA 3PFMA 4Z78A 3PULA 1A8ZA 3KLLA 1LP9F 1N3NA 4G42A 3RGVA 2V81A 1ZVSA 3EKZA 3CHRA 1J8SA 2ED8A 2J6EH 2HWZH 3N14A 3BZ4A 2X2YA 4QRNA 1OAYL 3AYSA 2IPUG 3OPZL 2J1KA 3A4JA 1OTUC 4JIIX 3SO3B 4MNQA 2GBTA 4S1SH 2VXSL 3UZXA 3VAVA 4PFEA 1W72A 1SF5A 3VGBA 4PJDE 4FTDA 4P99A 3KXFA 1DQMH 1ACZA 1CLZH 2JKPA 1BJ1J 2DZUA 3SR7A 3DLQR 3EBVA 5E2WH 4MAVA 4WY0F 4HOMA 5F1SA 1SN0A 1AHWB 3QDJA 1JZ7A 4PRNB 5HMFA 4MB1A 2VDLH 2Z2BA 4M62L 4QXTB 5B38G 3L95B 3PWAA 5GGRA 2ZT9C 2Y1VA 2MWCA 1AD0A 3OHMB 3TA4D 4UTLA 3QCUH 4TLUA 1JZHA 4OVUA 1I9EA 3AXLA 1BXXA 4Z7VE 3T3MF 1W32A 3TWCL 2CIPA 3NCYP 1PO9A 5D7SL 4ZS7L 3VXNA 1CGUA 2WZMA 2CZNA 3NCYS 1QLRA 4IBLT 1FXQA 3UAJA 1OLLA 1R6VA 1D9KA 5CZSA 1YRRA 1ETB1 2B39A 4MDJA 2BW4A 5IVOA 4LNYA 2WXPA 3GC3A 3L81A 4X5WA 5KBPA 2PDBA 1BVLB 4YXLL 3OGVA 3RX5A 4JQ2A 1LTXA 1BP3B 4HMNA 1KM6A 2B9AA 5C07D 2NSXA 5MENE 2V5YA 5GS3A 1UOWA 3HOJA 4OZIE 5GRUL 3KL0A 5J12B 3N3EA 3UYRL 3IFLH 1NGPH 4X61A 4RBPH 4ORMA 3K6FA 4JTCA 4KKRA 1F6FB 2EDKA 3L1FA 3H3BC 1KM5A 3AXKA 4QHMB 1X9LA 4PJEE 4JRYA 5BZZA 4DEPB 2OW7A 3PZUA 4I9AA 2VQ1B 1N8FA 2GQ9A 1RHFA 4R83A 1KIQA 3ROLB 3NQ7A 1R1CA 3JWOC 3TN6A 4BKSC 3F4NA 4HLEA 4I4WA 2BWIA 3NIFB 3H7LA 2DSVA 3BAWA 3KJ6H 4I0CC 3TJIA 1NICA 1OHQA 1E6RA 4ZUWA 3CFMA 1M71B 4DN3H 4GP4B 3QR2A 1RV8A 4F7EB 4Y5YB 4XUYA 4K36A 5BRZD 1L0PA 4JFDB 2K4WA 3DX8B 3CV2A 1JGDA 5CFAA 3EOBB 1OT4A 4JO1H 4X99B 3H4XA 1ZY9A 3UA4A 2VDKH 2FVMA 2PZNA 3UABA 3B5TA 3UTTD 1F3EA 3R8HA 1FJ1B 2FQEA 2FX7L 5A69A 1HNGA 3QRGL 3VE0B 2R0KL 5JIHA 5IMMB 2Y6TE 3QQ9C 3W27A 4IK6A 1ZB5A 3DHFA 2FTAA 3CFIC 5JOEA 4IRSB 4K8RH 5KYWB 1W31A 3P9MB 5JHLA 4QTIL 4YBLB 3ABOA 4AOFA 4F3FA 4DLMA 3DX1A 4GKNB 2R14A 5DT5A 4KEVA 4Z7OB 2OX5B 3OKDB 2D4DA 4BCEA 3PHOB 5AYQA 1F5ZA 1ECYA 1NCHA 1UXSB 4V2XA 3ZR4A 2OB3A 4J27A 2R0WH 4XAWL 3V4VL 3KOFA 4ZQTA 5D6DC 4X8JB 4N0YL 2BY2A 5BVPL 4UTWA 5C7XL 5B22A 1G01A 2AEQL 3EXJA 3QSRA 3J8F7 2ZXBA 4G7EB 5FYKH 5CLYA 3UROR 4TVPH 3BXWA 2XWDA 3TH4T 3U3HA 2R2BB 2XHNA 3QDGA 1V05A 1WAUA 3O11B 2OQLA 2RJGA 1JF5A 5EA0L 3LTSA 3F58H 3O2VH 4KWOA 1MEHA 2ICWB 1I1AA 4HCLA 3QJSB 4K7FB 1YDPA 3V4UH 3QIWD 1A3XA 1GNXA 4KKAD 1GOOA 4AQAA 1W6TA 3WL1A 4IISA 1R3QA 3EPMA 4CGTA 3KBNA 1CFSB 4MZ8A 1W0WB 5C0BA 1A7RL 3QFDB 2EDMA 1LLOA 3AMGA 3DETD 3TZVC 4Y4KA 3IS0X 5ABTA 1AFVH 3RILA 3VD4A 1WC7A 2IWGA 2GHZA 1SU5A 4ZA0A 4O2CB 4Q52A 2JIXA 2NQCA 3UJTH 1ZPUA 2Y7EA 5J3HD 4N8CL 1OGAB 4K68A 2A2IA 3VIMA 4ESKA 3FSTA 2ZYRA 3NQ8A 2MTAA 1N0LB 3ZLFA 4RQQA 4HF5L 1B2WH 5EBMA 2X4SA 3NIFF 4AW7A 3C6SA 2R9HC 2XN9A 1VBRA 3NCJL 1SSDA 3VYPA 1WA0X 1PKOA 5LBGA 1FA2A 2CA3A 1TEYA 2OTWA 4RMBA 4BSVA 3ZS4A 2VZVA 3SKNA 1BYPA 3R06B 4JY6A 1PG7H 3CFBA 1K6WA 3TTQA 1QWNA 5KSVA 3MMDA 1T40A 4OIIH 1SY6H 4LNRA 5J6GB 3QE5A 3TO2A 4EVNB 4B9PA 3X3FH 3SFKA 4HJIA 1KQZA 3NACL 1P1MA 3MLWH 4PEEA 1P6AB 2OFJA 5TGBA 4DAIA 4YSQA 2WLHA 4NL1A 4GSXA 1HXKA 1LOQA 43CAB 4NENB 5B38A 1U8CA 4JHMA 3DOSB 2RB8A 1BWMA 2YCKX 3KPMB 2GJ6D 1UR8A 4JQ3A 3U8GA 1AFSA 3K1KC 4Z7UB 5DJDB 3TWBA 2PTUA 2GEEA 2JJUA 1RURH 1ZLWK 4ELDA 2YGNA 1UGKA 4PLKC 2EPHA 3NEOA 4Z7OF 3MYPA 2A83B 5AW8B 2FHBA 1CYWA 1ZT4A 1MUWA 4X80L 3GRWL 4A6YL 4FQXC 1XGQA 2VL5B 2A9CA 4P5RA 2HCVA 1TZAA 3L5WB 1K6QL 4BKTC 4JHVA 3ULVF 1BFSA 2NX9A 5C9JB 5D7LA 2QJMA 4K07A 2VVNA 2W60A 5CEZH 3O8AA 1UXWB 1OV8A 2P42B 3R4IA 3ABKB 3CQHA 4RPQA 3UP6A 3A4AA 1RALA 5I5MA 1KB3A 2GSJA 1A7NL 4CVZA 2P50A 4DESA 4AH2B 1ZLDA 1DIDA 4HJJL 4EIGB 5AVTB 1BOGB 3CCHB 2J6EA 4LCWB 4AL8H 3O05A 3PFRA 3RLUA 2IS7A 2MNWA 3ZLQC 2YDRA 4L1SA 2QSTA 3THAA 3O3EB 3QFJE 3FONB 4Z7WB 3LENA 2F8XC 4DKDC 3P0GB 5L2KA 1TRDA 4BE5A 4NNXA 1FAIL 3HE7A 4X4YB 2QTEA 2WCGA 3DTXB 1GYVA 3KPRA 4JFYB 2CR6A 4NNPL 4LCQA 1JWUB 1UKQA 2IPTL 1W5QA 2NNFA 3KPLA 1EPXA 2WVSA 1CL7H 1REIA 3NDZA 5DD3H 2OEKA 2NVCA 1AUSL 4E5TA 5EUKA 3N18A 2AXWA 2XWRA 4AY8A 5JHDB 5KYXA 3LBMA 3U4BH 3RX7A 2A73A 3FTUA 3VH8G 4WNQB 2E7BA 3NSMA 1T21A 3FT2B 3BVXA 4XNYH 4GBUA 3ZVVA 1T5KA 4LL9A 1RVFL 1WZKA 4MNLA 4W7UA 3S5LG 4XBPA 5BWAA 2JK5B 2QSCL 2CDEB 3HC2A 4AMKH 5E95B 2Q20A 3ZE0B 3EH3B 1EC9A 3TU6A 4P23A 5TJWK 5INDB 5B3JE 1F6LL 2ISFA 4DQOL 3BW2A 3AT0A 4MS8D 4JZOB 1HCFX 4LRNH 1WUNT 2E7DA 2JKSA 4BKNA 1XLAA 3M0KA 3P69A 3ILEA 5I6LA 3GDTA 2YL6A 4C56E 3DURB 2W59A 3ITYA 4I48A 1KPRA 4Z7UF 4CVXB 1KIPA 3K4DA 2X8RA 1DL7L 2OTUB 3THUA 4DEWA 1BF6A 4A63A 4LEXL 5C0ND 4PB9H 3NPWA 1J2BA 4HKXB 2EADA 4U3SB 4A2EA 1GC1C 1Q9LB 2ZQ0A 3N12A 2OLSA 3MLRL 2NDFA 2K6YA 3X13B 1G4SA 1UJ3C 1QCWA 4HIJB 3NZRA 4Z3TA 1X5MA 3PBWA 1JGIA 3CH1B 1YDOA 2EDRA 3ZYIA 3SBWC 3V79C 4MM1A 1I3RA 4CRPA 1R5IB 1IKNA 1NANH 3CIAA 2APBA 4PJBE 4WFHD 2B2XL 3RB5A 2JQXA 1K5WA 3K30A 4F27A 4REQA 3H6AA 2FDBP 2VAAA 3B2VH 2E28A 5H2BA 3CX5K 2PP9A 3FU3A 1OCQA 3A6OA 3LEXB 5D1ZC 1CO1A 4PTVA 1Z7JA 1TQSA 2XFRA 4KNQA 1B0GB 1HKLH 4Z7WF 2DUAA 4PWHA 1O95A 3KLHC 3LQZB 5E51A 3O9WD 3TZVB 1K7FA 1DSWA 3UGRA 3MC5A 4UV7H 4HWNA 3G5XA 3W1QA 4YHMH 1A14H 2DT1A 3PZQA 5EFIA 4PRID 2VISA 4GI4A 2QJIA 4JFFA 2EICA 1WYJA 3LLDA 4XD4A 4KQNA 1ZTXE 5TK2A 3GO1L 4X6BA 2J3SA 2HKHH 4JTGA 5C0IA 1RZIA 2BP8A 1ET7A 5E2UH 4N2AA 2DD8H 4W9EC 1QK2A 4FQQA 1SDDB 3H7VA 3O4LD 1VC4A 1QBML 1PZ5B 4L1GA 2WKOF 1HJCA 3IVTA 4YC2C 2G37A 4HTYA 4GKOA 1QWUA 5F3BB 3AWFA 1R75A 4FQCH 1FCVA 1J4EA 2EH8L 2QCDA 4GUIA 1EPVA 3ZE0F 1BD2E 1A53A 2ZOTA 2KPNA 3T6VA 5KVMC 2WYIA 3S88L 5HOSA 1VCFA 2E25A 4ZSTA 4JANB 5DJ6B 3WEZA 3O3UN 3LUTA 5KS9B 4YSCA 3TLQA 2AQPA 3G22A 2J20A 2HK0A 3B3DA 3X12A 1KWGA 4YDVA 4M6OH 1A5NC 4GAGH 1Q7QA 3QZNA 1LE9B 3P0XA 1IR1A 4LCCA 4Y16B 1XBYA 2RGMA 1EP3A 3RVXC 5HDLA 3EWXA 3FT3B 3MACL 1WZ1H 2XT1B 5BZDA 4WWKA 1SHXA 4M80A 4KRTA 3Q44A 4PMNA 4QHKJ 5T1DH 5H35B 5DGQA 1WBYB 3PJXA 4TTGA 1K4CA 3UP8A 2QQNH 2RR3A 4ANWA 1XRFA 4FQXB 1A3HA 5CG0A 4M5TA 3UTPD 3CQKA 4POYA 1HQ4B 5KZCD 5K2ZA 2HAZA 4XAGA 3R5EA 1X7QB 4C6IA 3NYKA 3AMCA 1UZ6F 2CBTA 4RCXA 4Q3MA 3BEVA 2VI0A 2F7FA 4GC4A 1U8NB 3ZXWA 3LY6A 4JFHE 4UI2A 3APCA 5AUMA 4X2PA 1EFZA 4AVNA 1A9BB 3IBEA 2IFGA 5IESH 2EPOA 1G6RL 4YAQB 4KPHH 2GQAA 3VGAC 5IVNA 2OZTA 2QAFA 2BVUA 4R96B 1JV5B 5L8LB 3BKCH 1SY6A 4GX8A 1FWNA 4NEHB 5D72L 3L3HB 1YRKA 2EO7A 3F5KA 3MGAA 4PJXA 3N3MA 3EJZD 4JPWL 2PDIA 4MMXA 2O4QA 3LSBA 1ELSA 5EPMB 1KBGL 4OGZA 4ES8A 1H5BA 1S7QA 4XO3A 1NFPA 2QMJA 3W0WB 4F1SA 4KXDA 1PV8A 1FWGC 3N1FC 3CAQA 2C16A 4HA4A 3WF4A 1ZANL 3AU0A 3BZEA 2UUDK 1DQVA 2D0HA 2J8TA 4FYTA 4JFSA 4DI8A 4O4YL 4P05A 3IGLA 5CJOL 3QFGA 1QAWA 5F7UA 5ISZA 1IX2A 2B59B 1DE4A 1OXYA 4QWWC 1N8IA 3N2MA 1GXEA 2P8PA 4YHPA 4P3CH 1PWMA 2WBJC 3UJ2A 4JHBA 4LBRA 4NY2A 3ZFHA 3L3GB 1B3OA 3ILQD 5KJRH 2QL1A 2M26A 3G6JE 2C3XA 1PCWA 4J3XA 3PUGA 3V3WA 1SJMA 4RWYL 4PJ6A 3WLMA 1TMLA 3AXIA 4OCRH 3PP3H 4Y9OA 1E71M 3W1NA 1LK2B 5KAQG 3RY6C 2WO4A 3N1AA 2E9MA 4DP7X 2ZXQA 4JN2B 5JW3L 1GQIA 3LNDA 2AL1A 2CKRA 3L4UA 4PTTB 4QY8B 5HYIA 1TPC1 4RISH 4HU8A 5BRQA 4JIHA 5CPOA 1A3RH 3HC4L 1E3XA 1CIDA 1N26A 3WNLA 1E0UA 3DG6A 4GUCA 5AD0A 4ZYKA 4URTB 2Q02A 1SZGA 1GHSA 4U1NB 4NZ5A 4P2RA 3GNOA 2B4CL 3NSDA 1KRAC 4W7WA 2ADFL 4R5TA 1TTFA 2V7NA 2QDDA 4HKPA 4Y89A 6TAAA 2DMGA 4O14A 4M1DL 4YDIL 3VXUE 5C08D 4BSWB 3NOEA 2YXXA 1W9UA 1UJ3B 3UC2A 2BERA 2FVLA 2J7BA 2VSMB 3FRPG 1G9NH 4HS6A 1N2RA 3M7FB 5CAKA 3ZW3A 1B3YA 3G1VA 3N19B 1B4LA 3ZMEA 4X5PA 4HGMA 1C7TA 2VDQL 3T3PB 3GXUB 4AITA 2EC9U 3G7TA 3AICA 2KH2B 2XWEA 1HZKA 4WW1A 1RIVL 4OCMC 2PURA 3FQWB 2OELA 4CCEA 4YPGB 1JS4A 4R9XA 3HMCA 4NJAL 3OB0K 5I75C 1A1NA 1NEZA 4IRJA 4N90D 1E2ZA 3ZIZA 2RHGA 3CN0A 3FN0L 1E70M 2VR9A 1ERNA 5TQ0H 4AXKA 4KWVA 2I5GA 2CJUH 4LU5L 3EYSH 4HU4A 1BW8A 4H1LB 1TE6A 4KJWD 4FABH 5J8OA 5M7QA 2CUHA 5DD6A 4NYUA 4DK3A 4JZNA 1XGYH 4AQEB 4N0FB 3DG7A 1UUNA 1WH0A 2X9ZA 4AKOA 3MQIA 3FS2A 2XG5B 1SJDA 4FJZA 1S8DB 1I31A 5AC6A 2EXWD 4ELMB 4NT0A 5DK2B 5DMMA 3GEFA 1U3HC 1KJVA 2HKFL 5J1AA 3WDJA 1S2CA 5G5DA 1QQDB 4FFYL 1O5QA 5BMWA 3QJUB 4PFHA 5CCHE 4MY1A 2XZQL 4CNIB 4YC2B 1X5IA 3MRLA 2A6JA 3QCVL 1TX2A 3TJHC 2R69L 3WFEL 1PS3A 2CO2A 4WR3A 1ISYA 1IAOA 3M16A 3L16A 3QJOA 2ISDA 4DWSA 3OR6A 3IFOB 4IK7A 1DJGA 1JZJA 4MMYA 3WLPA 4UF7C 3PJSA 3DXAA 1J87A 3GG0A 3E0WA 5INCA 5EZJA 2Y5TB 1ID2A 4XN1A 4AUJA 2X3AA 2XVBA 4QD2E 3O6LL 2VGIA 4DXVA 2Z93A 4GUQA 2IUZA 2Z1SA 2VLJE 2PFHA 2E6JA 3WTVA 3X1BA 3S47A 3JWNE 5C6MA 5CP7A 2GBUA 2FQGA 3TH6A 1YE4A 1T1XA 5AYYA 5A6AA 1H8NA 4PJ9A 2DY2A 2VDNB 1AIFB 1J88A 4L3EA 4XNXL 2VXQL 2AQTA 3WFDL 3RVVD 1NMCC 4XZUB 3HV8A 1LG2A 1J86A 1O6SB 4N28A 3D25A 5FKPB 4U0RB 5E6UB 1WDAA 5JIPA 2Z7YA 4K0OA 2QEJA 2V5LA 3VXMA 1KXTA 3BG9A 4MKSA 2WQVA 4ZENA 4QRUA 4Y4HD 5K9DA 1VCVA 5EB9A 3T3PF 5ECGA 4N9BA 1NINA 4EACA 3UO1L 2FE0A 3IF1A 3EWCA 3LNPA 3V10A 1YKWA 3FQUB 3BP4B 3Q6FB 5AAMC 3SDDA 3VGAB 4EBQH 3BJTA 4M48H 3U1QA 4M61B 4PMVA 3LZQA 1EF2A 2V5JA 1IC4H 3MRDA 1OM0A 1DBKL 2BO0A 1INQA 3BARA 4YLQT 3BWWA 2AV7A 2FWUA 3ENLA 4L23A 4H6RA 5J9PB 3UJJH 3QG6A 4RZ4A 3PV6A 2CO6A 4TV6A 4C60A 3IPEA 5FAGA 4I77L 1V03A 1ORSB 4NZFA 5DC0A 1ISWA 1E0WA 4NNYB 5E0QA 2IAMB 1FFOA 4MOZA 3SAZA 4Q8NA 3JWOH 4B9FA 5B1JA 2CLRA 5HY9B 3MNWB 2OCCB 4DAGL 2E67A 3SQRA 4GLEA 2ORBL 5FYLE 3UAFA 3T1WA 3MZ2A 1IO4C 4MUPA 4XN4A 5AHLA 1J5IA 8TIMA 2GYIA 4IDLA 3SUSA 2YPKB 1PAZA 3BUQA 4KKNA 5I0DA 3F85A 1P2CB 4L3CA 5E03A 3O8XC 5GGQH 1I8IA 3L0KA 5B39B 2AVGA 1G7MB 2VDRH 2XGIA 2FFCA 1GCYA 1VRDA 3KEHA 1KV7A 4G9FE 5HTSA 3WIHA 5DD5H 4UQAA 4LV4A 2ZZ6A 2OWCA 25C8H 4IDJH 4MZ2A 4RAVA 2RA1A 4JPVH 2V8ZA 3OP2A 4UC5A 3CAVA 2XBDA 1ET5A 3KHJA 3CN4A 2ATSA 1LM8V 1E6OL 3L3IB 3KCJA 5H6HA 1TFPA 3L5AA 2Y69B 2OL3L 3N4AA 3MVTA 3P14A 3TQKA 3KLKA 3ABLB 1BOYA 2R56H 2F2KA 3FRPA 3I6KA 4R97C 4MYWB 3OKMA 5MERA 4M6MH 2P76A 1UWFA 3RURA 1QFWI 5MHSE 2P8CA 4UQ3A 1HINH 2QR0B 5FM5O 4QRQA 4ODBD 3KW8A 3GHEH 3LEVL 1B54A 1EEYB 2W66A 1FZJB 5GZND 1LGVA 1NDGA 4KZDH 5C0CB 3T1GA 1GPWA 3O6FA 4PJCB 1P1VA 2LW3A 2VP8A 4HPHA 1SVZA 4PGBB 1A5FL 3NSYA 1WHPA 1DJSA 3AAZB 4UINH 3VXRD 4CMMA 1G1OA 4BHUA 1UFUA 2CRZA 2YYTA 4PLJD 4S3EA 5T1LA 3H12A 5SWSD 3FJLA 3PBMA 3Q8BA 3UGEA 4JRXA 1EX5A 2BV9A 3WS6C 4CC1A 3CL8A 1NIDA 5G4MA 5K9CA 1O7AA 2IAND 1FYTE 1I3UA 2FL5A 3N0PB 3V5CA 3AU1A 4M7SA 4OFCA 1RK5A 1C16B 4JEJA 3ATDA 1ACCA 4P4KC 3GMLA 5C9WA 4KROD 1QZ1A 4XPHL 5T5NF 4YK4C 4QKXB 4JX0A 2WPBA 2JMRA 5JPNC 2WP3O 1R2SA 1LILA 2J43A 4UMCA 4D3CL 1SO3A 2EIMB 1Z5LB 5I75B 3CUFA 3VI3E 4K3EH 2MNUA 4FLSA 3QEUB 7ODCA 2UWEF 5DRNB 3EWZA 3QY6A 4AD3A 3CZUB 4BFGA 1LP6A 3V7AG 3IJHB 5KVGE 3G04B 3CSGA 5E9NA 2HSAA 4U5KA 2DDXA 4YVVA 3K80A 2LLGA 4K37A 35C8L 1DANU 5TE6L 2NY0B 3WLKX 2N59A 4AEIH 2NYKA 3JTSB 4F2FA 4RZ6A 3UWQA 3URAA 2AEOA 3NQCA 5C0RL 2BS71 3RFRA 1F3TA 2GFBA 4L2YA 2PE4A 3EA2A 1NIEA 1TPB1 4GNJA 4JO8A 3PFUA 4ERIA 3DIDA 4EUPB 2O4MA 2YGYA 3GX9A 3IYLW 4NO2B 1DJHA 1KNOA 4NUGL 1J18A 4ETQB 3C2AL 3IIPA 3F6JA 4AD2A 3B3IB 3BWAB 2NUPB 5LNDA 4QRTA 3RWJB 1U3HB 1FY6A 1U1JA 4XPTH 4GBXC 3SJ3A 1V7NH 3MT1A 1FH5H 3QUMB 5ALCH 2OAAA 4Q4EA 4A2RA 2OSWA 5ERWA 1DQKA 4GAJL 4Z76A 3L1OL 3LXUX 1G7IB 3MMWA 3GMQA 4TMCA 1UADC 2ESVA 2WSYA 1A5BA 1FL6B 3Q01A 4GH1A 4HH8A 4OD2A 5D9MA 3AM8A 5HVHC 5EIVA 4WDIB 1IAIM 2YN5A 5ITFA 1TTQA 5L2JA 1U2HA 3SGEI 4W9KC 4H26A 5FJRA 3I9IA 2C9QA 3X11B 4OD3L 1Q9OB 1M3JA 5GJNA 4PBXA 3IRSA 2CO7B 5FO7A 1IM9B 3B1UA 3ZHKA 3B8TA 4PJCF 5FCSH 2YUZA 5HGDB 5K33A 4XXCC 2ZE3A 1SEQL 3K81A 2OWWA 2VX5A 2R1WB 3DMMD 3K6SB 3HKZA 3D2UA 4L37A 4ZFCA 2F53E 4JQAA 1NMCB 5HYFA 3QEGH 1BXBA 1IGYA 1BZ9A 1NGYB 3FT0A 4N9DA 5K1JA 3CHXA 1A6UH 5IFJA 4NJGA 4KQ3L 3QFEA 2BXZA 1S9YA 3M1OA 2P5EA 4GQPH 3APDA 4MY8A 1AG1O 4E2BA 1WZAA 4P5UA 4AEHH 1KCRH 3GFXA 1NJ9A 4LAKA 3VG0L 1NTDA 4E41E 3ZE1B 4U7KA 2LFGA 3LHPL 4WQOA 4RDQF 1LYXA 1F6AA 4FX6M 3BAXA 3ECBB 2PWGA 4YHLL 4F5CE 3BDBA 4FMKA 1ZDQA 3AG3B 2B08A 3BQUB 4FI8A 5BXTA 4J8RA 1JHTB 1PTGA 1BQHG 5HYJB 5I16B 5HJLA 4AIXA 1G7JB 2WNGA 3QJAA 2BZDA 5J12C 1S7XA 5J89A 3ITGA 1J5HA 3S48A 5CMAB 3WHE0 4YJ5A 3PPGA 3H23A 2FEEL 2VIRA 4KDWA 3SQBA 3BCFA 1ZCRA 4HUUA 4R7DB 3GUGA 1MQKH 2GW5A 5FO2A 4AK2A 1WFIA 5IB2B 4PG9B 5IFAH 4PMEA 4GAAA 3PPCA 4MJIE 4IJRA 3P8JA 3O6ML 4XGZB 5IIEB 3ORJA 3I9PA 4RPPA 3SJVD 3QJHA 3IJYA 1KJ2L 5AZEL 2BPBA 3BT2H 4CN4A 5FPIA 4H8WL 1NLBL 3HI1B 3O8XB 4EI5C 3MKVA 3BMWA 4GYKA 2BCKA 5I15L 2W88A 2JFCA 3ERXA 1FI8C 1TTAA 1YXCA 1EHLH 4H25B 4C1NB 4NN7C 2G2NA 2ZYFA 3LNMA 1C5BL 3U79A 3KYOA 3TTYA 2WB1A 1C93A 1OAZH 3EJPA 3UYIA 2VXTH 1BRLA 4ZFOL 2ITDB 3QOKA 2H2SC 1IMHC 1DCEA 1SM3H 5DC2A 1U8MA 2G30A 2VN3A 3TSMA 1AQDB 4M8QA 1JSYA 2CCLA 3APGA 5TDNA 5EWIL 5HDBB 4N2DA 1SBBA 4XD6A 4NERA 5MEQA 2P3ZA 1XSIA 1OG6A 2APSA 4IICA 3EJUA 4FEZA 4U3CA 4J5VA 1W9VA 3H24A 4ZTPH 4PV8A 4FQHA 5AW5B 3V0HA 2VW4A 5CC5A 5ILTH 5CD3A 1U92A 4WWOA 4KRNA 3F84A 5AG8A 1PKQA 4YBLC 3ZOAA 4QDGA 3NYZA 5K9JH 5DMNA 3HF3A 3L5IA 4FFVD 4IOSA 4PIRF 4E8DA 5IKCB 5BZXA 4G3YL 1KCVL 2PW1B 1FHNA 1KBJA 3UPRB 2WBWB 2DWDB 3ZJ7A 4N6RA 3W39A 3S9ZA 1IEAA 1YEEH 4AYBA 1WNOA 4KERA 4OW6A 4ML4A 5GGVH 5TPWH 2G3IA 2ZJSL 1OCJA 4P4KB 1E4IA 5T3XH 4YYFA 2BJML 3ZE1F 1IAMA 4YK4B 2YLKA 2Q7YB 1ICQA 2OK0H 1HHKB 1KJ3L 1M05B 5CJBA 3RKDD 5HYSB 4NP7A 3E6HA 1MKFA 3HZYA 4H8QA 4QRBA 1EB3A 3DZ1A 1FAKT 3QJXA 2HJFB 2OXHA 4HA3A 4LPVA 1TMHA 3CFCH 4CJ1A 2ZP0T 1DYZA 4XO5A 1RMFL 1UWQA 3TR2A 3IDIB 5F0LB 4LAMA 1HX0A 3VI4E 4FFZL 4RFNC 2I69A 4DUOA 3W1LA 2W67A 4H6QA 3S36X 1W2KT 1DWFM 4YCPA 2WTRB 3RWDB 1I8UA 5ECVA 2P1FA 4XN5A 3LZPA 1T6MA 3RJYA 1AR2A 4TSCH 3LS5L 2X87A 4QRPE 3U2OA 1ZHAA 4KNUA 3EAKA 4HEMA 1RIHH 5ABFB 4RRPM 3DJRA 2PLMA 4XQ6A 1YTEA 4AT6A 4X8GA 4EPBC 3GE7A 4PJ7A 2CZEA 4XH2B 1OP5K 4U2YA 4ZMPA 2OXGA 1GHFL 5DEGA 5ESVA 2V2TA 1NPUA 1UH2A 1O0VA 4YQXH 2Q8ZA 3NJLA 5IBXC 1KNWA 4F9LA 2A6KA 4LLAA 3WS3A 5HJ3B 4EIVA 4GBXB 4I2XB 2YA1A 1JNNL 4C6BA 3KH4A 3HPXA 2NR6D 2UY5A 5HANA 4P49A 5GGSA 3MA7A 1AQKH 4J35A 1UT2A 2LFEA 4R2GD 4ORIA 3MI2A 1FWJC 1J12A 3G1HA 3RUGB 3H9HA 5T5FL 4ZMLA 1I60A 5E70A 2XWBB 4HYRA 4S1RL 3R25A 4DPCX 4XP1L 1TREA 1JN6A 1ZFJA 4HJSA 5JW4R 4DNMA 1IGIH 1Z9OA 2GVJA 1MCOL 3LKQB 1JF1B 3GINA 5BO0D 4Y1AB 3LCGA 4AWTA 5HVHB 1MHEA 3UFYA 3F7VA 3ITOA 3E0VA 2G2RA 4LEBA 5HDBF 4GP8B 1KIRA 2XQBH 2WNWA 4R3SA 4XHJC 2DVUA 1RERA 2D7TL 3IPBA 5E6IB 3BZFA 2R1LA 7FABH 4GI9A 1E5NA 4G8IA 2Y7GA 4L4TE 3GPEA 4S1DC 5AC5A 1TLMA 4QI3A 1WEJH 1HCZA 3SCTA 2X0UA 3E0FA 1F9CA 4AMAA 3SY5A 1B4KA 1U8IB 4I85A 2EKCA 1SW0A 5SX5H 3PAYA 3DX9B 2L8AA 3BP7A 1IBGL 1Q9WB 4J3BA 3MV8B 4NO0B 1QPOA 3P9LA 1FL5A 3RR1A 4MYXA 1MCJA 1C5CH 4QX4A 2FYVA 3WIIL 1T0NB 1WDSA