4W93A

Human pancreatic alpha-amylase in complex with montbretin a
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The amylase inhibitor montbretin A reveals a new glycosidase inhibition motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 181
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4w93A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w93A01
1R47A 1JNEA 3S6TA 5AY7A 1JD7A 4EAMA 3WH6A 5E09A 1ZU8A 2WHKA 3AYSA 1BSIA 4JCMA 1B3XA 3BSHA 1HL8A 3VGHA 4BS0A 3CZGA 4RE2A 1HX0A 2CKRA 2VTFA 3B8SA 1BG9A 2WMGA 2W61A 1O6IA 2WWCA 1SYTA 2EABA 1CXLA 1V0NA 2Y2WA 2QMKA 2W4XA 4M1RA 4AZ5A 4Z2LA 4E8DA 3CC1A 4NXKA 2J78A 7CGTA 3WY4A 4OBSA 4U2YA 4URIA 2XVNA 3VD5A 1AQ0A 1JAEA 1KXHA 2ZX8A 1PJ9A 6TAAA 4JL1A 4W7WA 1MXGA 3WUEA 1HIZA 4U5IA 2CKSA 4DUVA 4DM1A 4DWSC 3AROA 1LJYA 2VX6A 4PMXA 3EDFA 1EHNA 2HVMA 2GDUA 3H55A 1AQHA 4F9JA 4W8BA 1PX8A 2XTKA 1KCLA 2WPGA 4DUWA 1CBGA 5HBFA 3CTTA 3OZPA 1F4HA 3BAYA 1PIGA 3QOMA 2ZE0A 4GQQA 4Q7NA 4UR9A 3BCFA 2ZXDA 2YIHA 1XC6A 2YL8A 4ZFMA 4B16A 2CIPA 4HA3A 2JIEA 1MW0A 2CCRA 2BVTA 3CMJA 3VGDA 3D50A 4F9DA 3MV01 3WIJA 3NIYA 2ZX5A 4D6EA 2NW0A 4CD6A 1WE5A 1E73M 2ZXQA 1VB9A 1X6NA 2Z1KA 3WEOA 5FD0A 5E1QA 4LQ1A 3UETA 1GOQA 4P7LA 4Z2HA 3WFZA 2YL6A 3ZM8A 4D1JA 1GCYA 3G6MA 5I78A 4M29A 1HJVA 1RPKA 4UQBA 3CO4A 3WMBA 2VVSA 2J62A 2X2YA 4UOQA 3VDAA 4PSPA 3AS1A 1C8YA 3QR3A 2XYLA 1ZS2A 1NWSA 3W6LA 2ZX7A 4NF7A 1HVQA 3AMDA 1V6UA 2CERA 3GXNA 3T2PA 3FNDA 3KL0A 2ZUSA 2VX7A 2WWDA 3AIVA 3SCVA 1JXKA 3FAWA 3DYMA 2GFTA 3WF3A 1UQZA 1SMDA 3RM9A 3ZSTA 4LPCA 3WSUA 1UUQA 1XHGA 2JF7A 4M80A 1BYDA 3T08A 2WXDM 1E6QM 1XSIA 2VX4A 4Z2GA 1ZB5A 4WKAA 4CVUA 1X6LA 3VDBA 1UD6A 1ZL1A 4P8VA 3OG2A 2BVYA 1GUVA 1AVAA 4M82A 2CHNA 1IT0A 3UEQA 3LXCA 4XUYA 4CN4A 2FDMA 2WZHA 1VBRA 2XVGA 3EJTA 3S5YA 1HN1A 3VTRA 4CGTA 1UQYA 4HA1A 2PBOA 3ARVA 1BVNP 1GNXA 3CHDA 3VINA 2J7CA 1DWAM 1XCWA 1RP8A 1B3YA 3HG4A 1HJXA 4UQAA 2D0GA 5IFTA 3VIMA 4UQDA 1QNSA 3WDRA 2WHLA 2OYLA 3CPUA 1OIMA 3WL0A 3VGBA 3SUUA 1TCMA 1BFNA 3A5VA 2PWEA 1D7FA 3W81A 1BYBA 3WF0A 3WN6A 3RJXA 4C7FA 3S2CA 2D73A 3PZIA 3A22A 4W93A 2X2HA 3TP4A 4WLCA 1PEZA 1Q6DA 1EH9A 1TUXA 4TVUA 4ACZA 2X0YA 3GNPA 2J75A 3WF1A 4D6GA 2DGAA 4MJ2A 3NSXA 2E0PA 4Z2KA 3UERA 4D6IA 2FE0A 1R85A 1J0HA 3VGFA 2WMJA 1UWQA 3PTKA 4LYQA 3GZAA 3AIBA 1GORA 3SCRA 2VOTA 2VC9A 4U3CA 5LA0A 1R7AA 2WK2A 1Q4NX 1CXIA 2WZEA 4UQCA 1K6AA 1ISZA 1K9EA 5JBEA 1KXTA 4CCCA 2J7DA 1QNPA 1G5AA 1JYNA 1PZ3A 5I23A 3RO8A 4HU0A 4A3YA 3AMGA 3GXPA 4CU7A 4LYPA 5A6MA 2A3AA 3NYDA 5FOOA 1DHKA 3GH7A 4X0NA 1WKYA 3VOCA 1JAKA 1NOWA 2J74A 3N18A 1XSJA 1UR2A 1EO5A 3N11A 4D1IA 2TAAA 3U57A 3VUPA 1E3ZA 4FNQA 4JHZA 5FCZA 1E43A 1U30A 1FHDA 3MV11 1GZJA 1KBBA 2EO7A 4V2XA 1ZBWA 3DC0A 2YA0A 2WANA 2YL9A 3DX4A 3AMKA 5CPSA 3BAIA 2PWDA 3IJ9A 2QV4A 4BQ4A 3M6DA 1R7OA 3BMVA 3EJQA 5F7UA 1V6XA 3SCPA 3SCQA 4FNRA 2ZICA 1XGZA 2J7HA 3WD2A 3L4WA 3AHVA 1WAWA 2EEXA 1OGSA 2E4TA 1BVZA 5A8OA 2A3EA 1B30A 1EXPA 1CPUA 5EBAA 2FYVA 4XZWA 4DWSD 4HMDA 4OOUA 3WQ6A 2FH8A 4AZBA 5E70A 5GQBA 1HVXA 1V3LA 3WNPA 1E6ZA 1EOKA 4PTWA 1B90A 4FNTA 4EE9A 1MXDA 3W53A 2YFOA 3W25A 2IUZA 1KB3A 1HJQA 3EMZA 3O6AA 1IV8A 4NSBA 1J01A 2BY2A 2XN0A 3HU7A 1UR1A 2VL4A 3LX9A 3TTSA 2G3JA 3WY2A 4DO6A 2WB5A 4C7GA 3ALFA 4AD2A 4CN1A 1G0CA 3B9DA 4GKLA 3QHOA 1K9FA 4AEFA 1NARA 1BHGA 3D3AA 5I79A 1FFRA 2J79A 5I0DA 2JFEX 3WEMA 1R87A 1HP5A 4AD4A 3WF2A 1W3JA 3SUWA 4U3AA 4DO5A 4TX8A 2D0HA 1D3CA 3A21A 1H4PA 2WMIB 3BUIA 1TR1A 4NXSA 3TA9A 3UCQA 4W85A 3AJ7A 4DO4A 4NZJA 3AFBA 4GXPA 3ARWA 3THDA 2D2OA 1JXJA 3DDGA 1E0VA 3AICA 2E8ZA 3D51A 2YBUA 2GUYA 3VX1A 2DSUA 8CGTA 3PZOA 3WQ5A 2BNJA 4PMNA 4U5KA 1PIFA 3NJ3A 3RDKA 3BUBA 3MI6A 1JF5A 5D8ZA 1J18A 2WC3A 1HKIA 2WVUA 2F18A 5A2AA 1EOMA 4UFJA 4AC1X 3BAWA 1VJSA 1UA3A 1XD1A 4W5UA 1RD6A 4FNUA 1KQZA 1JFXA 3VM7A 2V3EA 1E9LA 1V0KA 5HPCA 5D9NA 2YA1A 1XYFA 2Q8XA 2OSWA 2Y5EA 2D24A 4HMEA 1EQCA 4FK9A 3MANA 4LGXA 4XZBA 5A6BA 3LPPA 3QHNA 3A4AA 1OM0A 1CDGA 1QNQA 4NI3A 3M46A 1UOKA 4AWEA 3D52A 3GH5A 1E3XA 3HG2A 3MUY1 5D8WA 2VR4A 4B15A 3MMWA 5CZKA 5A8MA 2YDQA 2DPEA 4WKFA 3SUVA 3OGRA 1O7DC 1DWIM 3BAXA 2V5DA 2X1IA 4CU6A 1K9TA 3S5ZA 1PZ2A 4W88A 1VBUA 3G6LA 3DYOA 4H04A 1WDRA 2QF8A 4ATWA 1KWGA 2EQDA 1FA2A 1CYGA 3PTQA 1E56A 5KEZA 3MMUA 4M24A 3AZSA 3BUQA 1PBGA 1C93A 3OZOA 2ZUNA 3DDFA 2XM2A 4CCEA 4W89A 4HPHA 3PZQA 4P8UA 1J12A 1V0LA 3MS8A 1FP8A 2XHYA 3POCA 2RGMA 1HXKA 3CHFA 3CV5A 3VSUA 5ECUA 1XH0A 2XVKA 4PMDA 2O9PA 1Q6FA 1TQSA 1XYZA 4OOZA 3WNMA 1VEOA 3T09A 5KZ6A 5GNZA 1BQCA 3ARQA 3FY1A 3L4XA 1FH9A 2OYMA 3RM8A 4MNKA 4H2CA 1DWFM 1QI5A 1V03A 2O9TA 4W87A 2V3GA 3WELA 3W6MA 5A8NA 2XJ7A 5GNYA 1OSEA 2W62A 5FKYA 2XVLA 3ZR6A 4OUEA 5BYWA 1UA7A 1BAGA 1W2PA 3A47A 5AYIA 4CN6A 3M7SA 3I3DA 1FHLA 3W28A 5CXPA 4WSJA 2YOCA 2DSWA 1E6PA 4LXFA 1J9YA 1DWJM 2PB1A 2G41A 3WKZA 3NDZA 4WKHA 1W3KA 2AMGA 4P8XA 1EDTA 2WW5A 2FHBA 4FLOA 2CXGA 4P7OA 4ZXOA 1R33A 1HT6A 1ISYA 1QVBA 1OGGA 5E6YA 4PUEA 4AD1A 2PC8A 1UR8A 3KLLA 2F61A 4B9YA 3CZ8A 1VF8A 1G01A 2J7FA 3N12A 1UKPA 2VO5A 2WYSA 4PBGA 3MUIA 4TTUA 1SZNA 3HJEA 3AHZA 3SCUA 4PTVA 2C8NA 4F79A 4FLQA 2WVTA 4NRRA 4GPNA 2EXOA 4FNPA 4V28A 1PPIA 3T2OA 1QI3A 1QW9A 1G9HA 4KMQA 3ARYA 4JHOA 2UY4A 1G1YA 2UY5A 2WMIA 2WNWA 1B3WA 4UCFA 1K9DA 4H8UA 4J7RA 3T2QA 2A3CA 4CUCA 1V6YA 2XM1A 5E0CA 3WUGA 1XH1A 2PF0A 4IISA 5BXRA 3IAQA 5CLWA 3L4TA 4PEEA 2EAEA 1TQTA 2IXUA 3GXIA 2VZTA 3EDJA 3EJUA 1WCGA 3JUGA 2E3ZA 3ZJ8A 1EIBA 4AIUA 3W29A 1EHAA 1H3GA 1G94A 3AXXA 1HP4A 1ODZA 5EMYA 1FH8A 2CBUA 4GZIA 4JKLA 4UQEA 3GXMA 1SR0A 2D23A 4NRSA 2GJXB 2JEQA 4UFLA 1NOUA 1QBBA 2XG9A 5M5DA 3L4ZA 1GQIA 4PMOA 3BCDA 1WDSA 2WCAA 1MW3A 3VIHA 3FW6A 2E8YA 1VFOA 1Q6GA 2V38A 1W9VA 2CBVA 5HPOA 4X0VA 4UNIA 1U2YA 1Z32X 5CGTA 2BVDA 4IPLA 1KGUA 2DIEA 3VIOA 1KBKA 3TTYA 5A6SA 2F7RA 3VM5A 2Y8KA 3VD4A 3WDIA 2BY3A 1EGZA 3SCNA 1OT1A 4HMCA 2Y8VA 1NM9A 4KWUA 2WC4A 3IANA 3ALGA 1W91A 3LMYA 4W8AA 2YLAA 4D6DA 1J0ZA 5I77A 2JALA 5C8BB 4ACYA 2ZX6A 2BV9A 1X1NA 3L4VA 1TMQA 1QWNA 2BXYA 4TXEA 4QLKA 4GO8A 1UKQA 3HG5A 3L4UA 3II1A 3NSMA 1V0MA 3VMOA 2WCSA 1WZKA 3ZT7A 1XSKA 3OLEA 2W66A 1VEPA 3HN3A 3THCA 1JZ2A 2VQUA 1MFVA 5BRPA 3CUHA 4EKJA 1CNVA 1L8NA 1E70M 1QBAA 1ESWA 2DDXA 3LXBA 4QP0A 3NSNA 1WP6A 4MADA 3KL5A 4FF5A 4XV0A 5DEZA 4QLJA 5A95A 4YHEA 1JG9A 3CLWA 5IXEA 2VCCA 2J25A 1JDAA 4PMVA 3WY1A 2NT1A 3AIWA 5I5RA 4CD7A 3VMPA 3AZRA 5M3WA 1JZ5A 3L2LA 3MU7A 1CWYA 3U5YA 4CU8A 4NX0A 3HMCA 1ISWA 5JIPA 4GIAA 3LPFA 1TQUA 3VSTA 5A6JA 4NZFA 4CKQA 4AW7A 1CLXA 2D22A 4JKMA 2VZOA 4UZSA 2XWDA 3WL1A 1OD8A 2CBJA 3AHXA 1KXVA 3AMCA 1R34A 4PUDA 1JI2A 1TA3B 2F7PA 3ZT5A 3SCOA 5E9AA 4IPNB 2J8FA 3N04A 3WFLA 4WF7A 6A3HA 2AAAA 3D5HA 1B2YA 3BUPA 3UR7A 2G8ZA 3LRLA 5E0FA 3AS2A 1ZBCA 1W1PA 3WDJA 2WCGA 2EPOA 3MUAA 2X8RA 2VCBA 2YA2A 1E0WA 5LYRA 5E6ZA 3U5UA 3OIHA 3N13A 3PTMA 1CLVA 4JFUA 2WHJA 1TQVA 2UY3A 4JFTA 3PZNA 5D4YA 3CH9A 2VX5A 4M8UA 4MB1A 4AYGA 2G3MA 1E1EA 4AZCB 2Y24A 1UWTA 2ZUWA 3LPOA 4D71A 3VILA 4ATLA 5DF0A 1XD0A 3PN8A 3AHYA 2YFNA 2YKKA 3A23A 2ZUVA 4CVWA 3CHCA 5A1AA 5BXTA 1GHSA 2BY1A 1E4NA 3B9EA 3U7VA 5M03A 2EADA 4OIFA 4W84A 3L4YA 4W86A 2CHOA 4QAWA 1E0XA 1BPLB 2XIIA 1A3HA 2ALWA 3VNZA 3KE0A 4DUXA 1QI4A 3HG3A 5A6LA 2ESCA 5A3HA 1GOOA 2YJQA 2VRJA 5DO8A 2CEQA 1OBAA 4L4OA 1GVYA 3SIMA 1J0YA 1UR9A 1BYCA 3AQUA 1FFQA 5AYBA 2J4GA 1TG7A 1W3LA 1W9BM 4F8XA 2CYGA 3W0KA 4D6FA 3TV8A 2W63A 1KR0A 4GZEA 3WH8A 2XN2A 5HDRA 3WY3A 1UH4A 2J7GA 1UKTA 1JFHA 1WNOA 1V3KA 3D4YA 3WQ8A 4MJ4A 2VMFA 1UR4A 4UOJA 3BAJA 4QDMA 4HZ7A 4QLLA 4RE3A 5D9MA 2GDVA 2WZIA 1M04A 4AZCA 5D9PA 4HOZA 1MQRA 4UFMA 5AC5A 3ZSSA 1E4IA 1GOWA 1CEOA 3WBAA 3VD9A 3UR8A 1ISVA 4L4PA 3CUFA 2FGLA 1H2JA 2DEPA 3GNRA 5LA2A 1SFSA 5GPRA 1ITXA 4P7NA 3POHA 4W5ZA 2VUYA 4TTGA 1QHZA 5CSYA 1CGUA 2XSAA 4PYSA 1W32A 4XX6A 4AD0A 1E55A 1N82A 1US2A 3ARPA 3LRKA 2QHAA 2OW7A 1R86A 1LF1A 2PWFA 3IGUA 4AMCA 1E4MM 1PS3A 3K8LA 4N42A 2AOSA 1UASA 5A69A 1V6WA 2EPMX 2JE8A 1V02E 2F1AA 1TVNA 1GQKA 2D3LA 2BXZA 3O9NA 3NUKA 2WSPA 2D3NA 5AC4A 5ABHA 9CGTA 2O92A 1VIWA 3ARSA 4QCEA 1E71M 3ARRA 4DM2A 2WC7A 4OZOA 1UKSA 1I1WA 3N17A 4HZ8A 1CGYA 3H53A 4KRTA 2WAGA 1VEMA 1DP0A 4MNMA 1HXJA 3SCTA 3F4VA 4KH2A 3O2LA 1GONA 5A94A 2WMHA 5JBFA 1BGGA 4ACZB 3FAXA 2XSBA 3UG3A 1J0IA 3CMGA 1VFUA 1M01A 2DH3A 3DECA 4JFVA 2ZUTA 3PZUA 2CITA 3CZJA 2BFGA 4MNJA 3AZTA 4YPJA 3SEPA 4AEEA 4GO9A 4CD4A 1P6WA 4CD8A 2FH6A 2WHMA 2EPLX 1W1VA 2XPKA 5M17A 1YHTA 4JCLA 4BQ3A 2DT1A 3IJ7A 1HWWA 3GXDA 2WMFA 4BCEA 1JYXA 3PZMA 3AS0A 1D2KA 3RMEA 4IUGA 4TUFA 1QWUA 1SMAA 2VVNA 1UYQA 1I75A 4YHGA 1WZMA 1CXEA 2OSYA 1O7AA 1E40A 2WVVB 1CXFA 4K68A 3F5KA 3OBAA 4AZGA 3ZMRA 4ATDA 2J47A 1CGWA 3EJRA 2DT2A 3J7HA 3WQVA 3SCSA 2VCAA 2VZSA 3TTQA 5CGMA 3BVUA 1ISXA 1TFVA 2VURA 3OGVA 1C7SA 4Z2JA 2J7BA 1B3ZA 3VDCA 1W1TA 3OGSA 4PTXA 3GBEA 1WDPA 2ZUUA 4RE4A 4AY1A 1PAMA 1WDQA 4HOWA 8A3HA 4N0RA 3WD0A 1LLOA 1TE1A 4HU8A 1UH3A 2V3FA 1GW1A 1PX4A 3SCWA 1WB0A 3N9KA 3CBWA 3W27A 3WD3A 4U31A 5DT7A 3WH5A 1JGIA 3DX1A 1M7XA 3GXFA 1WO2A 1NH6A 1VFMA 2GJXA 4QCFA 4JIEA 3WD1A 3MSDA 3AMLA 1E6NA 3A24A 4J3XA 1OWQA 3K8KA 2X2JA 3IK2A 2FGZA 4B9ZA 3QOKA 4PMYA 1E72M 1FOBA 1VFFA 2VNCA 3VD7A 1E4LA 3M07A 3VSVA 3CHEA 3FHQA 4WK9A 1DWGM 1ZJBA 1ZBVA 2DT0A 2DSKA 2CBIA 4MB5A 1UD5A 1F4AA 4E8CA 1B0IA 1H09A 2FHCA 1C3FA 4OJYA 1FH7A 2F7QA 5ABFA 2GJPA 3ZT6A 1XV8A 2OSXA 4JL2A 1GJUA 1OGBA 1LQ0A 1XCXA 2W67A 4BF7A 1L0PA 3CIVA 1C8QA 1LL6A 1C91A 2YBTA 2WVSA 2JEPA 3PHAA 1XRVA 2VR5A 5A6KA 4JKKA 3DX2A 1UG6A 4J3TA 3MUZ1 1C90A 4AISA 1BGAA 4E2OA 1UR0A 2W91A 6CGTA 1CGXA 4TVCA 3PZ9A 1A47A 5ABEA 2D20A 3VIIA 4AMXA 1QI0A 4D6CA 3BH4A 4U33A 5FIPA 1HJSA 3F5LA 3UG4A 4BA0A 1J0JA 1RP9A 4PMQA 1I1XA 3WNKA 2EPKX 2GVYA 1V3IA 2XVPA 2C7FA 1LL7A 5A6AA 5EFDA 1C92A 1VAHA 1M53A 1CGTA 1H41A 1UWRA 3AHTA 4LX4A 2QPUA 4LYRA 2IGTA 4MB4A 4MDOA 2NT0A 2GSJA 4GINA 1Y7VA 3EJSA 2X2IA 4UFHA 3WH9A 3WMCA 3RPMA 4KGLA 1JDDA 1KTBA 1ITCA 1QW8A 2NSXA 4Y7EA 1W9XA 1CGVA 3GDBA 1BTCA 4JAWA 4PN2A 1UD8A 2DQXA 2YDSA 1GJWA 5A8PA 1H49A 1GQJA 4MPKA 3TONA 4ML4A 2VI0A 1JZ8A 4PCSA 2E9BA 1E5JA 1W1YA 3CZLA 4P7RA 2WSKA 2RGLA 3RJYA 4ZEPA 4H41A 1E6XM 4AIEA 1H0IA 4PTMA 4HTYA 1QX1A 3CZKA 3B9AA 1EDQA 2UWFA 4V27A 4C7DA 1OCQA 2VQTA 4J28A 3WUBA 1B1YA 3VDHA 3K46A 3LRMA 4S3JA 3AOFA 3HZ3A 1BF2A 5CJ5A 1KR1A 2C0HA 3W4RA 3WNLA 2Y4SA 1ODUA 1WPCA 5A8QA 3FHAA 4AD5A 3VPLA 2F8QA 3L2MA 3CUGA 3EMQA 3GXTA 3KWXA 2W92A 2EACA 1QI2A 3WMSA 3BUDA 3ARZA 2OWWA 5I6SA 2XFYA 3VIJA 5C71A 5I24A 1W9PA 2WKGA 2ZWYA 4GQRA 4RL3A 4WIWA 2QMJA 5IFPA 2G3IA 2X09A 5IHSA 1GOKA 4MAVA 4EANA 3DX3A 2Z1SA 1HKMA 2BHYA 4MTVA 1U33A 4M81A 1OINA 3BLBA 4UTFA 1JDCA 3VIGA 4Q22A 3GM8A 1MQPA 3NDYA 2OWXA 4A3HA 5DMYA 1JZ3A 1JF6A 2WBGA 4W7UA 4AXNA 5BXSA 2QLYA 3MSGA 2ZOXA 1H0GA 5A2CA 4JFSA 1QPKA 4FNSA 1HF6A 4PCTA 2E9LA 1V02A 3KZSA 3F5JA 3AXHA 5CSUA 4PRWA 1QHPA 4PMUA 1E5NA 3EDKA 3WDHA 1B9ZA 1JI1A 1JNDA 3BVWA 1UWIA 3ZR5A 3VGEA 5BRQA 2F2HA 2D1ZA 3BLKA 1KQYA 2UY2A 2GK1A 4KGJA 2VJXA 3EYPA 2PWGA 2PWHA 2J77A 5CPQA 3BAKA 1H11A 1R8LA 3LXAA 1MW1A 4W7VA 3OLGA 2PBGA 1T0OA 4OBRA 2WBKA 4P7QA 1EQPA 4F66A 1W3HA 3W37A 2JIWA 2YLLA 3K1DA 3BVXA 2ZWZA 1UHVA 4U2ZA 3N1AA 1NOFA 2F1BA 3SUTA 3WH7A 4D6JA 4J3WA 3MMDA 3AI0A 3VGGA 3GNOA 5BROA 1CXHA 3A4WA 2W5FA 4BQ5A 3OLIA 1HJWA 1LL4A 2XWEA 2JF6A 3ARUA 3VD3A 5BWFA 5JUVA 1J11A 1QNRA 1KTCA 5CPTA 3CZEA 2OYKA 3TOPA 3N15A 1V3MA 2EJ1A 3MKKA 1GVIA 2G3NA 1VRXA 1J10A 3DX0A 5C70A 5I2UA 1H5VA 3KEHA 1KWKA 3WD4A 3PZTA 1W2VA 1C7TA 5CQ1A 1J0KA 2E9MA 5D9OA 1OB0A 3ZO9A 1W9UA 3VU2A 3AYRA 1JYWA 3ZJKA 1QNOA 1NWUA 1UD2A 2J8GA 4PMRA 3ZJ6A 4AIOA 1CECA 1M03A 3NCOA 5CG0A 2DT3A 3WBEA 3VVGA 3IJ8A 4J3SA 5IHRA 5A2BA 1HKJA 3RCNA 5HOSA 5HXMA 4J3VA 3QGVA 3I3BA 5FL0A 1DEDA 1B3VA 4W8LA 3UG5A 4UFKA 3WQ4A 1TA3A 4OKDA 3RIKA 3CZNA 5JBDA 1QHOA 5GNXA 2XGIA 3GYCA 2ZXBA 3VIFA 3K4AA 3BC9A 3W82A 1KFWA 1V3JA 3WNOA 1V3HA 2VT0A 4TOQA 3VKKA 2ZUMA 1DTUA 2ZXAA 4E4PA 1NWTA 3EJPA 3FN9A 3T0BA 3WNNA 1NP2A 4OGZA 4DWSA 1V6VA 4JZ5A 3KL3A 1TQWA 4AZ7A 4YN5A 2QPSA 4XB3A 3BSGA 2MANA 3A6OA 4UQ9A 3VX0A 3OB8A 4H8HA 1BYAA 3WUFA 4AD3A 3TTOA 2CESA 4A4AA 3VIKA 4JFWA 1E15A 3H54A 2DSZA 1EO7A 2XN1A 2A3HA 5CLTA 3ARXA 4BQ2A 4GZJA 1KXQA 4R5EA 1PX3A 3DHPA 1JL8A 1JIBA 3LPGA 3D4ZA 3VIPA 1GHRA 1RH9A 4DWSB 3ECQA 7TAAA 1NWRA 3AXIA 4AZHA 2YDRA 1EDGA 1LG2A 4GI8A 3K8MA 2B31A 1UH2A 2E40A 1CXKA 3AIUA 3WENA 5BXPA 5ABGA 1W9DM 1MVYA 1UZ1A 1CTNA 2XFRA 4HP5A 3PZVA 3W24A 1IZJA 5IDIA 3EDEA 3A4XA 1MYRA 1HNYA 3T0DA 3ZJ7A 4D6HA 1S46A 2O9OA 1AQMA 2IXVA 3CGTA 2V5CA 1UZ4A 2WLZA 4EK7A 4AYSA 3AISA 1JZ4A 3W38A 1GQLA 5DT5A 2HISA 4CCDA 1GOMA 4D72A 2V3DA 1CENA 3WDPP 3I3EA 2WKLA 2OWCA 3IAPA 4B3LA 2VRKA 1V08A 1BLIA 1JD9A 1JZ7A 1LWJA 2PI6A 1R75A 2BHUA 3VO0A 4H8VA 1Q6EA 2XGBA 3WEZA 4TX6A 3DHUA 2F7OA 4GI9A 5I3DA 1WZLA 3QHMA 2X05A 3APGA 2BY0A 3BMWA 4NZCA 1MWOA 3GBDA 3WDQA 2D0FA 3ARTA 3AIQA 1UKOA 2OW6A 4HA4A 1DWHM 5HNNA 1BG4A 4MB3A 2DIJA 1UD3A 1HKKA 1TVPA 3PZGA 3MO4A 1ZJAA 2EBNA 4H7VA 5A6BD 4WJXA 3U7BA 4FLRA 3AIEA 1HTYA 1NP0A 2OLHA 3EMCA 4Z2IA 3WF4A 2BHZA 4MAZA 3BXWA 2DH2A 4TVDA 5TD4A 2X0HA 3DYPA 4AZIA 1UWUA 2VRQA 1KGXA 3EBVA 3K4DA 2VZVA 1KCKA 3E1F1 4FMVA 1GPFA 1CZ1A 2GK1B 3CUIA 4UFIA 3UESA 1ECEA 4MDPA 4AZ6A 2YL5A 3AIRA 1UD4A 1R46A 1LWHA 3KLKA 4J27A 3ZOAA 1LG1A 3BGAA 1AMYA 4FLSA 4S3KA 1JYVA 1JZ6A 5JIWA 1MW2A 2WMKA 1XH2A 1US3A 3PBGA 3ZQ9A 2FHFA 1YQ2A 4PSRA 5EB8A 2GJRA 3VMNA 5ABFB 1OIFA 4R27A 4QFUA 1E6RA 4KRUA 4PMZA 4B3KA 3T0AA 1H1NA 4M56A 3RILA 5BCAA 1IZKA 3W26A 1MQQA 5EFFA 1CIUA 1E6SM 3OLDA 1HL9A 2XIBA 3EDDA 1TZ7A 4HZ6A 3BVTA 1E1FA 2VZUA 4IM4A 3ZIZA 4BZYA 2CETA 4J3UA 3AS3A 4ZE4A 4HPGA 3VNYA 4UOZA 7A3HA 2CNCA 2ZIDA 4P8WA 5LA1A 1EA9C 2ZX9A 1B31A 4ZE5A 5FL1A 1KGWA 1GOIA 3WQWA 4UZUA 2CPUA 3CUJA 3A3HA 4ZXLA 2J7EA 5DFAA 1WZAA 1Q6CA 3SURA 2EPNA 2XFFA 1OT2A 1FP9A 1VJZA 2WLYA 1VENA 3SUSA 1ZBKA 2DSVA 2WM0A 3GTNA 2BS9A 4X9YA 4AMWA 1OD0A 1C8XA 4ZENA 4MNLA 3BVVA 3BLPX 3OA5A 2G4FA 4HOXA 4CD5A 3FXYA 2A3BA 1NQ6A 4WSKA 4GI6A 2WVVA 2XUCA 2O9RA 1MFUA 3RM4A 3GH4A 1QOXA 1UWSA 3CZSA 1HJUA
chains in the Genus database with same CATH superfamily
2EXYC 5ECVA 3H4HA 1G4TA 1O66A 1W1A1 2XIMA 1JTTA 1G7IB 3HC4H 4O17A 1EJXC 2QFPA 3QUXD 3VXMB 1QAWA 1P2CB 4O52A 2FNWA 3RX3A 4PJ5E 3RUBL 3TFXA 2X9ZA 3EJCA 4LK4A 4JCMA 3EUDA 3BSHA 5KBLA 3GVRA 3VGHA 4XVDA 3QUHA 3QPKA 2FYYB 5FGCE 1CT8A 3KBHE 3L3DB 4IRSD 4L1WA 4AWSA 5CSSA 3TQPA 5HJBA 3EO0B 2XG5A 2CKRA 3M4HA 4Y88A 3L3JA 3Q2WA 1CDUA 4XC1L 3U46A 3CQIA 4HHMA 4ALDA 2ZYFA 3Q44A 5FV1L 4H6RA 3QNYB 3BIKA 1CD8A 5L2KB 4HIQA 5K39A 1E3FA 1R3TA 4I7WA 2D3VA 3VJ6A 3U25A 3MROB 2EABA 3J07A 3NSDA 5GSRA 4NY2A 2Y3NA 1V0NA 4PJAA 5TE4L 2EVFA 2Y2WA 2W4XA 3T05A 4AZ5A 5LGXA 4KK8D 4E8DA 3SGUA 5EO0A 3CC1A 3L3JB 3U46B 2B7QA 1ETJA 4NXKA 4OZFB 2Q8AH 1Q4WA 1HKWA 2CKBB 3C09B 4K23H 5EWIH 2V7HB 5EEWA 4MY9A 1FVCB 1NIBA 4U2YA 5I03A 3GZOA 3L3DA 4ZO8A 5HWMA 2CK2A 3QBUA 4GKOA 2C3VB 1ZVHA 2L7QA 2VLKD 3CT7A 4B5VA 2MOVA 1JAEA 1KXHA 1NCHA 2DIAA 4L37A 4PW4A 1Q6LA 2ZX8A 1DVUA 2J88H 2H8ZA 1JCYA 2V6AA 3MCNA 4XKYB 4JL1A 4PRBB 3PWPE 1DUZB 2ZKXA 3FO2A 5D7LD 4PJIB 4DJEA 4RR4A 4L3CB 2ZZ3A 1T66C 3FSUA 1GSMA 4GBXB 3DIVA 4PRAB 1O95A 5D8JH 3VQ2C 2I9UA 4H9ZA 3SCMC 3G08B 3AROA 5PAZA 4CDHA 5KSAA 2EAWA 3WFCH 1LD9B 4AZ8B 1H61A 2IS7A 4GQ9H 1O0VA 2HVMA 4I4WB 5ILTL 2OGJA 5FKAB 1EC9A 5E1IA 2OP4H 3NIGF 3PQYD 2AKRB 3FUFA 4FZ8H 1AJZA 1LQ2A 1M6OB 4W8BA 3FTWA 1CDHA 2I32A 2WPGA 1NELA 5F1VA 1NBQA 2G2PA 5HBFA 1EP3A 3MV8D 3CTTA 3I85A 1LRTA 3OZPA 3PB0A 4AITA 3BAYA 4L5FH 5E5MB 2FPVA 3W85A 4GQQA 3B5TA 4E5XG 2Y85A 3VVVA 1IXQA 4Q7NA 3K2UH 4HALA 1X9RA 3AU1A 2XIJA 4UR9A 4XZ9A 4CEXC 4HSOA 3M0IA 1YMMB 3C60A 5DJAB 3VFSB 1IC0A 3CX2A 1I9RH 4NC2B 3THMH 3P82A 2BNRB 3VXTB 4QOKB 2XN9E 3HJZA 4LLVA 4X9HA 3TK7A 3I6GA 1Y0LA 2W79A 4JDZB 3PABA 5TPWL 3U6RB 5DQPA 1K3IA 1OEPA 1MW0A 2DQGH 5ESQB 7REQB 3ULUH 3KWSA 2BVTA 1SDYA 2JELH 4NENB 5C08B 5LN4A 3CMJA 5AFDA 4LDLB 4P5KB 1F3WA 4MYPA 4MLRA 4F9DA 2OV0A 1ZWIB 4BK5A 1GKPA 4JQVA 2FZDA 2XICA 3E2QA 4GXFA 3GYEA 1DVTA 4I85A 3PL6A 3DHJA 3W9EA 3KPQB 1F5ZA 1AG0A 1RIUL 3NFSL 4RAUB 4WW2C 3WBWA 4AH2A 5MENA 1AD9B 1DJHA 4R97C 5DRZA 1Z9PA 1ADDA 3SRKA 3LXUX 1A0EA 1E73M 1PDKB 5A6IA 4KKLC 3H9YA 2XG4B 4HIJB 5HHOE 5IM7B 1OF8A 1SQ7A 3B4YA 4L9YA 5FD0A 3II3A 1E4XL 4PYHA 4HWBH 3UQNA 4LEXL 3VAEA 1DFXA 4A2GA 4IPPA 4HWEL 5T9CE 8PAZA 2DD8H 2FJHB 4O13A 2NY3B 2XN9B 4DVRL 2NOYA 4PGEB 5GZOD 2JI2A 4HCFA 1MJ8L 3WNIA 4B91A 5AN7A 2DJLA 1WAAA 3QJSB 1KC5H 3Q5TA 4UQBA 3WMBA 3RVUD 3ZDZE 2HJFB 2J62A 3HI5H 1ASQA 4B9KC 1MIML 1QACA 2JIXB 2BWIA 3HLAB 1M65A 3VDAA 4XN2A 2UX7A 5EBLB 3WO4B 3QNZA 1C8YA 3QR3A 5CJMA 4PJ9C 2A4EA 3LYEA 5K9XA 4J2MA 2R0KL 1CLOL 3KPSA 3GT6A 2EE2A 5TDNB 3X3GL 2NQ3A 3DK0A 3E8UH 1L2UA 3O6FA 4WW2A 1V6UA 2WJDA 2F54D 2CERA 4E2BA 3HBZA 3TFBA 2DL9A 4JFPA 1NMCC 5AB2A 2ZUSA 4NDMB 2GHWB 5IMMA 3LGDA 2WWDA 4X7DC 1A64A 2FEEI 2G0WA 1LUCB 4G5ZH 4XKYA 5JR1H 3QR2A 1BGXH 1OT4A 3NL2A 3CV6A 1JXKA 4XAGA 5D5ME 3FF7A 3ZJKA 1ZIBA 2W9EL 3UGRA 3CQQA 5EUOE 5GZNA 3DC8A 1JGDA 1GZQB 4XAZA 4LPCA 3NTCH 4ORIA 1X8CA 3L3HB 1FDZA 1TEFA 2JF7A 4XOEA 1RJQA 1B4EA 3A13A 5E9XA 1X5LA 5SWSD 1GHFL 1E6QM 4UAOB 1FO0L 1XLFA 1X97A 5CJQL 3MODH 3N91A 1DQMH 4FFTA 4LOUD 3KCOA 3N2TA 2J6EA 2F68X 2GJZA 4CVUA 4LS0A 4WKAA 3BHBB 1XYBA 1MO0A 1UD6A 2J2ZB 2VDQB 1OP5H 3B0PA 1KBWA 4JY5L 4ALAH 2L7UA 3PPCA 4AUBA 3OG2A 5CIPH 3TBVA 4TS6A 4W70A 1ONRA 5D7KE 1PFOA 4M82A 4H8WC 1IT0A 2FT8A 5KSAC 3MBFA 5FAGA 4GQ9L 5HMFA 5HHNB 4UTWC 2Y22A 2BP0A 1D9KB 1IEWA 1U3NA 2V82A 2EYRB 3DV6A 1NFAA 4CN4A 4KUZL 2WZHA 1RUMH 1FYHB 1WVZA 4PJ6A 5HATA 4JFED 1TJ2A 1M7PA 3EJTA 3S5YA 1NY1A 1AKJB 4IJBA 3G5XB 2PBOA 4HA1A 1GW9A 1VKFA 4FQXA 3BRGC 1TYGA 2IMNA 2V4LA 4OCRL 3DFSA 2VDKB 1RJPA 3GX9A 2ICWI 3HE7B 3A9IA 2I9LB 3F7YA 4S1QH 5EUKB 5IG7B 4LWWA 1A7NH 4PJHB 5ERWA 2VLRD 4W4QA 3D8MA 5ANMB 4A3UA 3HG4A 2GSGA 2Y72A 2D0GA 1P4CA 1YEYA 4KUZH 4PAZA 4ODSL 3WDRA 2OYLA 2XXGA 3UBXI 3B3BA 3GIZH 4XAWH 4S1DD 1L6XA 2PYFA 5DJDB 3SGKC 5JW3H 5HQLA 2UY6A 3AAZB 3ARFB 1BP3B 3A5VA 1TJ1A 4U6YA 5KYWA 4O0KA 2G5UA 2J13A 2VDPL 3QDGD 1BYBA 1OTUC 4JO5A 3ALPA 4YHYC 5AHEA 4C7FA 3GBMH 3MRKA 3OQRA 4IQHA 3TR9A 2EIZA 3I02B 1OM3L 2X2HA 1DLHA 2RQ8A 3UXAA 4WAFA 3BKYL 9XIAA 4OCLC 1YYMH 1TUXA 3EYFA 1KD0A 3GNPA 4QS5A 3WF1A 1KLFA 2AW2A 2KZBA 4XI5C 2A6DA 5SWZE 4Q9QH 3L9CA 3O0KA 1Q2RA 2PYED 1AZBA 2VLRB 3CN1A 1IGIL 4HSHA 2E0PA 2DAVA 1AMKA 2PR4L 3TJEH 1LL1A 4Z2KA 3UERA 1M2OA 3BG3A 4MS8D 3RPTA 2WMJA 5GJNA 3L0GA 3RO6A 1A3LH 3AIBA 3E6FA 2MNJB 1AKJD 1NCBL 5CU5A 4ZFOA 3SCRA 3T8LA 2BIHA 4JFEB 2Z4GA 2ADJA 3L5HA 1Q4NX 2C4FT 3GSNB 2IQAB 1J8HD 1LM8V 5DWUL 4C83B 3G5YB 4OFYA 4P5TB 4LW7A 3ME0B 1HHGA 3D07A 4P06A 5E2WL 3S2LA 1K9EA 4TXVB 4BF5A 5JIQA 4RMRA 1IJNA 4M8VA 4XTRD 2FO8A 2OFJA 3GDLA 1JNNH 1UOVA 4PJ8C 1XF2A 1A02N 3OKDA 1QNPA 4H83A 5IVXB 1D5IH 1KOAA 3CH8A 1PZ3A 2EC9T 4GRLA 3QPYA 2FB2A 1MWAH 4LCYA 4U1MA 3X3GH 3AMGA 4CU7A 1XTLA 4MZ8A 3RR1A 4LNRA 4KFMA 1AIFB 3T5WA 3ELFA 5D6DA 4C6DA 1QABA 4KTDH 2RDTA 5T33L 4LEEA 4RDZA 3MJ8B 4X0NA 2JKNA 5CBAB 3MR9B 4XAKD 4WQOA 3PYCA 3P61A 3VOCA 3FF8A 1JAKA 1NOWA 4I9WD 1SFTA 2PDWA 2N0MA 2J74A 1S7UA 5D2TA 2W9EH 4FXGA 2EH7H 4Z7UA 5I30L 1XSJA 5HR6A 2OYPA 4H40A 1ZD6A 2NUTA 1EO5A 4QO1B 4LMQE 3UJTH 3J27A 3N11A 2QDVA 4S3CA 1IFHH 4JPVL 3FQNB 5EU6B 2ED7A 5LB1A 5AYUL 2HXUA 5I3JA 1HHHB 3T4AA 3B06A 2Q6WB 4NAFA 3DRQB 4MQTB 1RZKL 3G6AA 4WNQB 3QDMD 1YTKA 1E43A 2RHEA 5GHWH 4YIWA 3DIDA 4L4VE 3RFZA 2P3ZA 3T3MF 4P2YA 5I1HL 3J2PA 2EO7A 4PGCA 4O11A 4JM2F 4YSRA 2ZT9C 4GYJA 2YL9A 4X2PA 4CQDA 3RPBA 5FYLL 3ZHKA 2H9AA 5I2IB 1IFHL 1TZ8A 4LDOB 3GD6A 2B15A 4LP5A 2R1XA 3IJ9A 2C3XA 2WPBA 3AT0A 4NUMA 4BXVA 3TVAA 4M61B 3NFPA 2QV4A 3VFRB 4XZ4A 1LWIA 1MQKH 1QHQA 2NY1B 1R7OA 5JOPD 4REQA 1XINA 4HXAH 4N0CD 5HJ3A 1HYRC 2EYTB 4IIEA 2JIXD 3OGSA 2RJHA 3IUDA 2A6JA 1G9MC 3TCLA 3WFHB 4FKKA 4AVFA 3TXVA 1P7QB 3TN5A 1ZOXA 4LHUD 2FVLA 2ZICA 3RRXA 1G7MB 4M6UA 3I65A 3GB7B 4A6YB 5FGSA 5IMLA 3RN6A 3WD2A 4H88H 3V4PH 4O2CA 2XN9D 2R69A 2HT2C 3OBEA 4LCSA 4DPQA 5D93B 3GMRA 3IGAB 1BVZA 2FLRT 3L08A 4OAWA 4Z7OE 3KDMA 1OFAA 3PPFA 3V18A 5DJ6B 1DN0A 4L3EA 4ZTOL 1A5LC 4UDTB 1ZT1A 4IJ3B 4Z7WE 1FHGA 1CPUA 2WQXA 4A2MA 1B30A 1KCXA 3LEXB 2Q8AL 1R3LA 2GTZB 2TODA 5FJUA 3OMNB 3USZA 4HX1B 5IGXL 4ICCX 3DNKA 4LAQL 3ETSA 4HWZA 1JPDX 1MFDH 2V9UA 4UIMB 1D8WA 3OPZH 1IGFL 2ROYA 1DQML 4EI0A 3GLCA 2E6QA 4IGMA 2WJEA 3WNPA 1TJGL 5FSDC 4GUQA 4PTWA 4G6MH 4Q8QA 1ICTA 4DGVH 1B90A 2CM6A 2Q76A 4E41A 3NZRA 3UW6A 5E5RB 1BTMA 1IXNA 5T1DH 2OZTA 1T99A 1G7UA 4Z77A 3LQAC 4X22A 1QK0A 1KB3A 5U7SA 4MBRA 3O6AA 1QO3B 5K5YA 4NSBA 1J01A 25C8L 3CN4A 2BY2A 4WTXA 4C47A 3MNMA 3WQOA 1JGLL 4OVVA 3RTQB 3W87A 3QRHA 1EFXB 5D4IA 1Q7ZA 2CLMA 3TTSA 1E2WA 2D2HA 4QOKD 4PJXF 2BNRD 1LO5A 3WY2A 4GMTH 3P62A 5JHMA 1QBLH 3VI3A 3D87B 4APQB 4O8RA 2BG5A 3UWVA 5DEGB 3C5XA 1LK3H 5D1QD 5BJTA 3BKJH 2HUEA 1DBAH 3N73A 2A9NH 1XIIA 1BOYA 4RDBA 3WE6B 4AD2A 4OSUL 4AG4L 2ADGB 2ZQKA 5MHSE 4LKXB 5BQDA 5GS0L 2ZP9A 4WDUA 3IFLL 4NC0B 3B9DA 4PD4J 5T1LA 2LW3A 4U1NA 2QR6A 3HUJA 3DI1A 3JTSA 3FIGA 3QHOA 2E28A 2VISB 1K9FA 5TK4A 4DW2H 2Z2BA 3EKZA 4AEFA 4LBAA 3K6NA 4YXHH 5H2ZA 1XR8A 3PQYE 1HOCB 2IOOA 3L4CA 2HVJA 2CFFA 2DW7A 3WS3B 3TYEA 4CSSA 4GKNB 3NGFA 4B27A 2J79A 2WQAA 5HI4D 5I3KA 4GBXD 3WEMA 1FORL 3I7SA 3WLQA 4Y96A 1QSEE 1WA0X 4I3SL 3SSJA 4JLRA 3AU6A 4NRXA 5D7LB 1P69B 2AQNA 3EGDB 4OT1H 1CFNA 1OGAB 4YNYB 2PC4A 3CXOA 3SUWA 3PULA 2YPKB 5KSBA 3ISYA 4DO5A 3AZUA 2WTRB 2D0HA 2VLKB 1KV5A 2K0RA 1MFMA 4G9DA 1H4PA 3GTVA 4HH9B 3GI9L 1TR1A 5T3XD 4KCTA 4FTVB 1WDAA 3AJ7A 4P2VA 1BCIA 1J5IA 5EA0H 1IEBA 1CI5A 5F3HA 5T5NG 3FQTA 5FM4A 3P2VA 5LCVL 2GY7B 2GQ9A 1SFLA 4GXPA 3LKSB 1M3JA 1F11A 4ZMVA 1TJ0A 3V0FA 3THDA 3EOOA 4WVRA 1GG0A 5L2KD 2H2PC 2D2OA 3O8XD 4Z3FA 4POYA 4NL1A 3NO1A 1CBVH 4HJ0C 3CEPA 3RR4A 1DVXA 2NWSA 2G50A 2JK2A 2WBJB 1L9MA 3CDZB 4PJGE 2YAFA 4KPHL 3W84A 1K70A 3IKCB 4IMFA 2AJXH 4QGCA 4AL8H 2PGFA 4Q56A 1NICA 3MJGX 4OGXL 3O05A 4PRPE 2W9DH 1ND0A 4U5KA 6PTDA 4ES8A 5IESL 1A3RH 3NJ3A 4NT6B 1N0LA 3QNXB 3CVCA 3MI6A 1H3UA 3QUXB 3UBHA 4EIZC 4WW1A 5D2XA 1WS7A 1J18A 3CFCH 4B0MM 3VRJA 3UXDA 3ROLA 3UDWC 1FZKA 4LCWB 2MCPL 3LM3A 5A2AA 4HA0A 1FQ9C 1EOMA 2WWMD 2RQEA 3PUCA 2PMQA 4LT9A 4PJ9D 1VJSA 4OGXH 3A4JA 1XD1A 3MLTA 2OMUB 4DGIH 2WXLA 3GHTA 3BPOB 4RESB 2V3EA 1CZ8L 3PGCB 3ZIYA 5HPCA 5DBTA 4HCRL 5E2TL 1HL5A 1ID2A 1P48A 5B1JC 5HY9B 1C9SA 1PXGA 4AEIL 2ZKHH 3AABA 2Q8XA 3FJNA 2OSWA 4WI5A 1XGQB 1FWEC 1SYVB 4HMEA 2D24A 2PA6A 3LZ5A 3QJOA 1EQCA 4C8XA 1V7ML 5A6BA 5EBMA 4YHLL 5DU7A 3N9RA 5D7IF 2Z91A 5HHQB 4B96A 2FJFA 1KYFA 3Q6GH 5D55A 2DY3A 1K3ZA 3LGGA 5GRWA 3BI9X 3MX0B 2WXGA 1DEEB 1OARH 2EDLA 3L9RA 2XWRA 5C9JB 4PB0H 1CZ8H 2QUTA 3GH5A 4YTUA 1QLEH 1RZMA 5EOCJ 2C4XA 2G5BB 3QQ3A 5AAMA 3SDAA 2YHGA 4HFWB 3OVGA 3QK0A 3P14A 4U6HA 4B15A 2EKSB 3TVMC 4A2RA 1YEKH 1P4UA 4G6FB 3VH8B 2P24B 5A8MA 3CHVA 2WXMA 3SUVA 3FCUB 3SDDA 2B59A 1Y5XA 1WAEA 4KO6A 3TN0D 1QZNA 2IALB 3JV5A 3TU6A 3N4EA 2QT6A 2UYLA 4FULA 4CJ0A 1PSKL 1R0MA 1T1ZB 1F4XH 3O6ML 3TBTB 4XHJC 3VFMA 1RK0A 2DL2A 1HE7A 1I8KA 1PZ2A 1TITA 1DO5A 4MAYA 5E6ID 1K2DA 1DE5A 4DRSA 1Z5HA 3P8JA 4CSZA 3EBAA 1ET7A 2E9IA 2AP2A 4GEIA 4NN5B 1EV2E 4AEHH 2AK4B 4XPAH 4NUQA 1FPTH 2CK0L 4MJIA 5D2LA 5E4EB 2VJ0A 4FA6A 4OZIE 1C93A 2E68A 3OZOA 4S2BA 5KSUA 3MO1A 4WEBH 3RVWC 2ZUNA 4OBTA 3BTNA 5F7DA 2P8PB 1JZHA 4CCEA 4AU0A 1YO4A 3K2IA 2VCOA 3ZGIA 4EI5A 4HLEA 1Y1DA 1KV7A 3PZQA 1JCKA 5FFLA 4NQCB 1YNKH 3SKJL 5C8JA 3PWIA 2NYZA 3DG3A 1OCWH 2J1ZA 4P23C 3ES6B 4BZ2H 3L5LA 1PHWA 3Q4DA 3IMWA 4NO5B 1NFBA 4UM9A 2CDFA 2FB4L 4NQCA 5DVKA 5TFSH 2VYRE 5LDUA 2AEIT 2WD0A 1YBQB 2Q6ZA 2OLAA 3Q8FA 4AOFA 4J4KA 3NEHA 4HPNA 4DP9X 2OO6A 1YEFH 3NQCA 2PP9A 2XVKA 3B2DC 1AXTL 2WZMA 5T1KD 3KX6A 1U8NB 2HT4C 2W5PA 2WLIA 4H20L 3L5XL 2O9PA 4OUOA 5C6WH 1B4RA 1XYZA 2DIKA 3VXUD 4GRMB 4XNYH 1K2DB 1TXKA 3EO9H 3W9DB 1X38A 1BQCA 2PTZA 3CL6A 5GNZA 1HIMH 3EGSA 2V7NB 3F12B 3MZTA 5AZEH 3UX9B 3TBTA 3U9PH 1LP9B 1T1ZA 3VFMB 1S7SA 4P2AA 1FH9A 3NL6A 4KHXL 1JJKA 2F08A 1KB5A 2FVNA 4B9JA 1H5BA 3UIZA 1V03A 1GKEA 3BWUC 1JVKA 4EEEA 4RNRB 4W87A 1N8IA 1MI5A 3CXHJ 3QEGH 2XJ7A 5GS0H 3P9LB 5INDB 1OAQH 4LVHC 3IARA 4MXQC 5PCYA 4HKPA 5HGHA 2W62A 2XKUA 3IMUA 5JHLL 1B4JL 3NL5A 1WS8A 4QRTA 3LYRA 3G6DL 3T2NH 1LBMA 3VWKB 2LU7A 3C0LA 2VAAB 5BRZD 4LMQI 4N2DA 1EIXA 1VCGA 3C6LA 2VIRA 2BP8A 5TTRA 3CLFL 1JCVA 2QQLL 5I8OH 3E2SA 3PHOA 3I3DA 1AQDB 3IM1A 4B2DD 2E7DA 4O2EA 2XPGA 3OHXC 2V5TA 3QEGL 5CXPA 3OKYA 4ESKA 3BANA 3OX8A 4I9MA 3TAKA 4ZD3H 4U1JB 3GRGA 3QTPA 3VFNA 1BLNA 2W0FA 3FT9A 4KY1L 1E9QB 1FVDA 1I7RA 1U95A 2P1YA 3A12A 4TUJB 1DL7L 1J9YA 1DWJM 5EC1B 1VJIA 2PB1A 5JUEH 1W3KA 4J1UA 2Y9RT 1EDTA 2F5BH 2B0MA 5LHDA 2WW5A 4P5RA 3HVDA 2YOAA 4O58L 1NPNA 3BUYA 4JGDA 3O3DB 3STLB 2R0LH 2VDMB 2HBVA 3OYZA 4ZXOA 4WO4B 4RSYA 4AK2A 3B37A 1KBJA 4WUIA 1HT6A 1YYLH 2BVOA 2XRAL 3L7EB 3VRJB 2XTJD 1L5GA 2HFFB 3LMJH 5FM5M 3WTUA 3JV4A 1RZKH 5E6YA 4MWAE 1DVQA 3QULB 3QUXA 4RFNC 1E4XI 2DWYA 1QUNB 4EIBA 3T77B 3GBLA 5C0JA 2YD6A 4YO0A 5CJ8A 2GPZA 4YHKL 4U1GB 4DESA 3CQ0A 1VF8A 4YDLC 2PTYA 1INEL 3ANUA 1X9UA 2J7FA 4DK5A 2C9XA 5D7EA 1NDWA 4YFLI 1ZS8B 3AHZA 2VWSA 2C8NA 3RVXC 1MIEL 3QZBA 1VKXB 4NG3A 2HKAA 2Z26A 4F79A 4XO5A 5IJKC 2YB1A 2NPLX 2WVTA 2P4AB 4FLQA 4HT3A 1L9NA 4OLUH 3ARGD 2VXUL 1XRFA 1YNQA 5KEZA 1XIGA 1NLBH 3F7RA 4A2EA 2B1HL 3MDWA 3V7PA 3W2DH 3INPA 2VMDA 2Q7AA 2FJKA 5C07D 4QBXA 4V28A 2CBQA 2BFVH 3IS4A 1E4KA 2RH0A 1DLFL 1QNZH 2F8IA 1FHVA 3VCLB 3QSKB 1YE4A 2VD9A 4N2AA 1ET5A 3ZW3A 3WFEL 4TLKA 4KMQA 1MFCL 3OKKB 3TA3D 3S3GA 2YQGA 2UY4A 2AEQH 3NP3A 4NZ3A 2WNWA 4L2LA 1CFTB 1EJ7L 4UCFA 3W57A 1VSCA 1K9DA 2E6AA 5AZUA 4RFEA 1FN4B 5HDOA 2F84A 4FP8L 4JM2A 4U3XA 4AEIH 1K77A 2XM1A 4I7UA 1ETZA 4ORZC 2INEA 2OX4A 4LOCA 3WUGA 2DWEB 4N2EA 4XNMB 1VZWA 3NN8B 3L3IB 4FS0A 4XCYA 1DVZA 4LAQH 1W1ZA 5FYKE 1O12A 1KCWA 1KJ2A 2OR9L 3CU1A 4HK3J 1WBJA 1ORSB 1E4WH 4NZRH 3NIFB 4US5D 5DRCA 4NJJA 2IXUA 5I17B 1TPC1 4PJXA 3KR3H 3KGRA 4NQED 5TFSL 3IV3A 2VISA 1ZV9A 1Q90A 3EDJA 1T20A 3JUGA 1VADB 1KTLA 2EIJB 3V1HA 3HA1A 5MHBA 3I84A 5T1LB 4PGBB 1T0PB 3IJEA 1EIBA 3BIBX 3EOLA 3MV8A 1V4YA 3O2WH 1DQJA 1T8XA 4BEQA 1A2YA 1BBDH 2YR3A 2EE3A 3AXXA 4PCKA 2VL5B 2P8MA 1IQWH 4DZ8B 1ODZA 1XB8A 4NUJB 4IIQC 1EWHA 2VYOA 1T03L 2WGNB 3BE1L 4OUUB 4MA7L 1TETL 1A8ZA 3V0DA 2D23A 2GUOA 3KVJA 2BOBA 3KVDD 1A4CA 2PU0A 1OC6A 1YC8A 1OFQA 3WX7A 4PREA 1KELH 2XCMC 1EX0A 5I6XC 2NQHA 5F7YC 5M5DA 3B0UX 4Z95L 1QO3A 3QFDB 3O15A 2LT9A 1R3SA 1VR6A 1LE9B 1AO7B 2KPWA 4Z77B 4I48A 4JQIH 3SZ6A 1A14L 5CGYD 1A6AB 4WWPA 5CP7A 3QAZB 3VIHA 1VFOA 1Q6GA 2APTA 3T3PF 3C60C 1UZGA 3TBSB 4WCYL 3SE9H 2NNCA 4YR6B 4GRWH 5C3TA 5A16B 3CYVA 4IU3A 3PDOA 2GTWA 1R3JB 1U2YA 2Z7ZA 3D1MC 3DKLA 3THML 1Z32X 3WNJA 4ZTYA 2P45B 4OT1L 5D7JB 3QE5A 2F6KA 2WXJA 3TTYA 1GGIL 3CU7A 4LHQB 2Y8KA 1U58A 4IJTA 3U2SA 1MF2H 4R3UA 1AGBB 1EGZA 4S3FA 3MJWA 2CCWA 1OT1A 1X4XA 1GZPB 2WMPA 4F1SA 4KZEH 4R34A 2RUSA 1ZVSB 4XN1A 3LS5L 4GP5B 2QV5A 4ERIA 4CA4A 4HJGB 4HK5A 3NPZB 4L1LA 2WC4A 4DK6A 5IBTH 4D6DA 5DDHA 3AWOA 2W07B 5AVQB 5AZEL 5IJVA 2A6JB 4KI5C 4GMSL 2FECL 2LOEA 2XSKA 2NY6D 4ACYA 4BQ9A 3IVSA 4U1KB 3VXME 2BV9A 4CQCA 1QWNA 3HGRA 4ODSH 2AQSA 3MMEA 4ZUTB 1BQLL 1EUTA 2FWOB 1DJNA 4QLKA 3II1A 5AB9A 4OLXH 1K8DA 2WNXA 3NCEB 4OD3H 4JTUA 1PVHA 3S5SA 4TF4A 1T1YA 2BMKB 1UM4H 4HKXB 4MA3A 3RWHB 1N8FA 2WCSA 2Q87A 1TZHB 2F54A 4P04A 1QSVA 2N0KA 5D70L 5KJ4A 3N0AA 3UBGA 1P5UA 3CEUA 5CSZA 2W66A 2X7VA 1CFQB 3DSFH 1RQEA 2PTTA 2ADAA 1W0VA 2NVAA 3THCA 1HKFA 5TPWH 2CDEA 3B7SA 4WWKA 2Y7QB 3P0XA 2VQUA 4L9LC 2Q6WA 1ME9A 4MKSA 3QR1A 4NAFB 3CUHA 2ENSA 1FWGC 1AXSA 2AQWA 2IH3B 4UMGA 4S1SL 3ZKXC 4JG1H 1QBAA 3FFCB 4QO1A 5F7FA 1OFDA 3LKQB 2B7OA 3Q58A 2DQTH 2FEEL 4NRYA 1UC6A 5FX3A 1SVZA 1WEJH 1CURA 4PBWD 5J7CC 5DY2A 1OYBA 3KL5A 3LSCA 3S35L 1ZK9A 4JX5A 4POUB 2IDFA 2VSKB 5T1JA 4LCUB 2J27A 1JG9A 5IXEA 2VDNL 4PJDF 3JT2A 2J25A 4PMVA 3T0VA 1T7LA 2VDLB 4WWKC 4P2QD 3VFUB 2YW4A 1GK8A 4CD7A 5D2LE 1PTZA 2MKLC 4OZIA 3M1ZA 2NXYC 2FQGA 2XLLA 5LBGA 3OQ8A 3L2LA 4MIMA 5T1MA 1CWYA 3U5YA 4BCZA 2XOTA 3IBEA 3NDZE 4CU8A 5EU7E 1TO5A 1H8LA 4M5TA 1GIGL 4E41E 3LPFA 2YCLA 4JQ2A 1BKSA 4BR1A 4FXSA 3MMUA 1RZJL 2X4TB 3BP5A 1GVOA 3Q2CA 5HWJA 2J66A 2XINA 4M6NH 1FH2A 3TIDA 1OD8A 1FNLA 4DZBB 3HG0A 4M9PA 1GEHA 4QRFA 3AHXA 3RU6A 3B8TA 1OVZA 2UWEA 2TRSA 4ABVA 3G2GA 5AAPA 3FFCE 4MYWB 4PL1A 1HZYA 1TA3B 3BWUF 4S3AA 3W74A 4ZVJA 4UNTA 3ZT5A 1F1GA 3P84A 3SCOA 3VW3L 1I0DA 2JB6A 4AYID 2Z6IA 1F2QA 3DZ1A 2J8FA 4IPNB 3DPBB 1N64H 2ZAGA 3ARDD 2R0KH 3N42B 1CU4L 3M44A 4XNBA 3GK0A 1B2YA 1COBA 1KENH 3BUPA 4HYVA 3DUSB 4JFDE 4KNUA 5E0FA 1TFPA 5ABAA 5DRNA 5DS8A 3DFPA 3LKNA 4P59H 2PZ0A 4WZHA 3AS2A 3MKCA 3GWQA 2JFCA 3WDJA 4HAGA 1F3DH 1KM3A 3CWGA 2X4QA 1KTNA 4IL2A 4O14A 3BW9B 4HNTA 5BS0D 4M48H 1Y07A 1QBMH 3OGCB 1GKRA 3MUAA 3GDCA 4HNNA 4JEGB 5D7SL 5EIIG 3L95B 2BP3A 1TVHB 3ZHFA 2N1KA 3W7LA 5IQNA 4DKTA 5D7IB 4ATTA 3FQWA 4BZ2L 3TEWA 2Z92A 5LHEA 2DVUA 4LGSB 3VXPA 5EIIA 5L2JB 3OIHA 1BZ9A 2PYFB 1U8HB 5CP3H 2Y63A 2DKSA 1S3RA 2CO7A 4LKCA 3KRZA 4Y2DD 3HZYA 5CP3A 1MCOH 3TPUB 4IMCA 3QEUB 4PJFF 1A4JB 1KRAC 1FZMB 3QAZC 3S36H 5T5NF 1O1HA 2WZPA 2PD9A 2UY3A 1N3NA 5LAXB 2VLME 4GPVA 2AABH 3QG6B 5D1ZD 5ANMA 5HYSB 5IEKB 1PKLA 2AGTA 3AXKA 1QQDB 4RISH 1UGNA 2QCEA 2HWZH 3HE7A 5F9AC 4X5PA 4D2JA 5JH2A 4AYGA 2G3MA 5M7QA 2XGZA 2HE5A 1N70A 1SEQL 1Y6KR 1QFOA 1E1EA 2ICEC 3HLKA 4ZQKA 5F89A 3WTWA 2I5IA 4W85A 1AKJA 3K6OA 4ERGA 3S83A 5B8CC 4D71A 5B38A 3QH3A 3VILA 5DF0A 2A6IA 1HH9B 2PO6B 1N59A 2YFNA 3A23A 3M7OA 4PV9A 3PF2A 4Y8AA 3RVTD 1EJ6A 1JV2B 2R2HB 5IR1B 2V5LA 4IQEA 2OXGB 4N9GB 4ZFFA 1UXSB 4S2SB 4UQIM 5JXAH 1CG9A 3P5YA 2G0KA 4JNXA 3U7VA 5M03A 3ULUF 4XO3A 3DVNA 4HOMA 3JV0A 4FYSA 4OIFA 1O5PA 1ZE3C 4MKNA 3ZE1E 4MD5A 5L4MA 4LFHG 5CUSL 4QAWA 1OQXA 1OZUA 3C2YA 3E0FA 2GFBA 1A3HA 1X44A 4YMPA 4P2RD 5JPNA 3X1NA 2LAGB 3VNZA 2FTAA 5I9QB 3DMMC 4LFYA 3U9UA 3FOLB 1EZVX 1TVBA 4OQTL 4BI7A 3ULUD 1VHNA 2PUQT 4WTWA 1GVQA 3LZPA 4G3YL 1YE6A 4KESA 3K4WA 4F33A 4DUOA 1F6YA 3UBFA 5KITA 1J5DA 2EKJA 3P30H 4FG0A 1H7OA 2QIWA 2QDWA 1S7RA 5I02A 1YEIL 3EHBC 3DJZA 4BFJA 1A5FH 2ZCLL 3RUGE 4RA0C 4WY0A 1W8EA 3SIMA 4CNOA 4PUWA 1CB7B 3DBSA 3GIZL 1BYCA 1TU2A 1P5UC 2NXZC 1LEIB 5AYBA 3EYOB 4JQVC 4ZTEA 1MCFA 3SR7A 1EUAA 1PCKA 5BUGA 1T40A 1W3LA 1A1MA 3ELAT 2O56A 4LH8A 1KNOA 5CH9A 4OLYH 4YTQA 3P3RA 1ZSXA 2QW5A 5KBMA 2GBUA 4O8AA 3BFQG 4KBPA 3ZTDC 4KCWA 1Z69A 4LEBA 2OX1A 1NGPL 2QL1A 3C2RA 2BSSB 4MASA 5T5FA 2QSCL 1KR0A 2FJSA 4BFRA 4B4HA 3IJQA 1DQXA 2J1XA 1EBPA 2GL5A 4GZEA 1JMZA 4PLJD 2G95A 4YXHL 3KUMA 1TPVA 4YIQA 4N2LA 2J88A 4L80A 4NPYA 5H1WA 4GXUN 3N3TA 5AW9B 3D48R 1XLAA 4XXDA 3TZVD 2GJNA 4K3HA 3QNZB 4GC4A 1G4RA 1UENA 4LEXH 5AOMA 3EYSH 5LGJA 3NJNA 3LH2H 2A99A 4TVPE 2JIXA 3HLAA 4XC3L 3VRLF 1J05A 5JOPE 2OXGA 4N9GA 5A7BA 5IFJB 3MLVH 2BASA 2ZADA 2E5BA 3WQ8A 5K4ZA 4XHQA 3GB6A 2PEVA 1ES0B 1Z5LA 5DGQA 1HXMB 3D3VD 5T3ZE 1U8IB 4UOJA 1XKJA 2OMNA 3IPBA 4M3JA 5FKPB 4X2UA 1KULA 2QUNA 4HZ7A 4ZQKB 5HYQB 3BARA 4LAZA 4RE3A 5D9MA 3RWDA 3QUYD 1P0BA 1UC4A 3PXHA 4AZCA 3V4VL 4NZ5A 1X5YA 4ES9A 3RU8H 1JWMB 3VOGA 1J87A 3MRMB 3TGXA 1OAJA 4WFHD 2OZ4H 4AF0A 4JG1L 2W59A 3ZSSA 1E4IA 2IDUA 1T89A 2XG4A 2EE9A 4XC3H 3BZFB 3NCJL 4FQPA 5KANG 2JLPA 3TW7A 4G72B 5IQ7L 4OF3A 1W15A 1WKDA 4AQLA 2R9RA 1VQTA 5GS3A 3MLWL 1MHEB 1Q9OA 1GMEA 2FGLA 4M0XA 1NGWB 5DTFB 1A6UH 4F2BA 2QZQA 2AJVH 1UXLA 1FGVH 2Z92B 2FO1A 4HKZB 4X99A 4JBRA 1FNFA 4H26B 4J40A 4Y19E 1SFSA 5GPRA 3L95A 2OSLA 3OMZA 1QBML 3GVVA 3RU8L 1AH1A 4QOKE 1ZWIA 1I1RA 2XYCA 3V6ZB 4OM1H 2BWQA 1N8WA 4ADUA 4RLIA 3POHA 1A9EB 3CFKA 3JSSA 4X80H 1DJSA 1R0AH 1VBGA 3VSQA 3RL2B 3HG1D 1EYEA 4TQTA 2YXVA 3MU3A 4QRBA 5ESQA 1V5XA 1W32A 5DS8B 5DRNB 4AD0A 2QJMA 5CAKA 1DANU 3O16A 1MEHA 1Y0LB 1N82A 1HCFX 2B16A 4YDZA 1MCHA 2WSDA 3ARPA 3IRPX 4BV1A 4GVHA 3R79A 1QRNA 2YPVL 2OW7A 2PCEA 3QUZD 5IJCC 5K9OB 2VB5A 5HHPA 2IGFH 2HBXA 3O81A 1IGWA 3PVFA 2H41A 2VLJE 4MJ5B 2P9RA 2PWFA 2XACC 3Q1SL 4QT5B 2GUBA 4QAMB 2RFGA 2OMTA 3CUZA 1E30A 2AOSA 3D0VA 3FSZA 1FWCC 2NY2D 1U8PB 4XNZB 3VXSA 5A69A 1YEGH 1GT8A 2AF2A 2W0LA 1IVTA 3WBDA 2A1WL 2UWEB 2OMVB 5IROC 1MQKL 1TVNA 4K7YA 2AKRA 4UT7L 3ZZ1A 3O9NA 4Y9FA 3RY6A 3GC4A 4G59C 4I2XB 1BVLA 3I9IA 3MBWA 4B60A 1GVSA 4YDVB 4LLAA 4DVOA 3EEZA 2LTQB 2DZEA 3URAA 3G08A 2EO1A 3CK5A 4JHBA 4KWVA 1E71M 4FG6C 2XX0A 4LHUG 4E2DA 3Q2DA 2OL3H 1CW2A 2F5AH 4B5XA 1PG7L 2BVUA 2BVWA 3H53A 5CD5C 4KRTA 1A6VH 3VFUA 1OADA 1PZ5A 1A66A 2HROA 1KIUA 2HTLD 4L37B 5A43C 3QJRB 3NQFA 4GE8A 2PLMA 3O2LA 4AMAA 1GONA 2XY1A 2WMHA 1CICC 2OX5A 1GGBH 1P7KB 5E5CA 4KKAC 1IGMH 4OZFA 1CFSA 3FSAA 4Y6GA 3QZWB 2XSBA 4PP2A 3UG3A 3MN8A 5MKGB 1YPZA 1PSKH 3GJFH 4NYYA 2DH3A 2V9QA 3QIWB 1CE6A 2AABL 1OPOA 3DECA 3GRWH 1PLBA 3MV9E 4JFVA 3BE7A 3MT1A 3PZUA 4Q8PA 4LLQA 2KERA 4R5TA 3DJTA 5K39B 2X3AA 5AAWA 1F6KA 2CITA 2OOGA 2V30A 4IMEA 4ONHB 3DMMD 3QB7C 1WKEA 3ZYZA 2NNRA 4XP6H 2CDEB 2SFPA 1N6QH 4I5BB 4GO9A 3H2QA 3BJSA 5BWAA 6ALDA 2FH6A 3EJZD 2QPDB 4RZKA 3DOHA 4EDWL 2EDQA 2XPKA 2L7JA 1QEXA 4FA3A 3WLNA 1S2VA 2DT1A 1G5GA 2FAUA 4Z1CA 3LI1A 7FABH 2VITA 4HK0B 1JVOA 4WGWB 3JU2A 4KY2A 2D31A 4YEEA 1GGTA 2WMFA 1LLAA 1OSYA 5LO7A 3VTTA 3TEYA 3SE4A 3S3PA 3W0WB 3TJHC 3PZMA 3AS0A 4EUPA 1K8DB 4X5RA 2KZHA 4FIQA 1G7IA 1NCGA 2YCIX 1TNMA 2HE8A 2PXYD 1A4BA 1E5AA 5FO8A 1DQDH 4LSSL 1OFRA 1E2VA 1EBAA 3GD1C 5F2FA 5KUMA 4S0TD 4YHGA 1CXEA 2QKIA 1XICA 5DDHB 1S5TA 2DQUL 3CCHA 3F83A 4PJ9A 3EWWA 2SEBA 4GJJA 2K4AA 3NPWA 2J47A 2PU1A 1TKKA 1ONQA 2E5DA 3WQVA 3J7HA 2Z31B 5AKTA 3VXRA 4K7VA 3MP3A 2VCAA 1FFTB 4UTTC 4B9PA 4ORGA 2CMRH 3PNUA 2VZSA 4PJBB 3TTQA 2IG2L 4Y2OB 1ISXA 2VURA 1OP3K 3I50L 3GGWA 1DV7A 1G7JA 2G3ZA 2K3HA 1X5AA 3VDCA 4LCWE 4YC2B 4PTXA 3UO8B 1AD1A 5F1NA 4F2TA 4KH9A 1WDPA 1PAMA 3MGTA 4L0YA 2Z9TA 4JFOA 4KK6D 4B92A 5A16A 5TE6L 4N0RA 4YR6A 4Y5YA 3WD0A 1TJXA 2BNRE 4L29B 1UH3A 4QRPB 4K3DH 3A67H 3P74A 5ENWA 2EDXA 2D4FA 3FCSB 4L8DA 3ZHDA 4F15C 3JS3A 3DVGA 1JVNA 4D7PA 3RPIA 1ED3B 1WB0A 3N9KA 1HYSC 3CBWA 1AGEB 1NUFA 4IHOA 4GAJL 4NJ9H 4OCXH 5DT7A 3IIVA 1JGIA 2BRQA 4Y16D 1X9LA 2EDDA 3IRZA 4A38A 4X61A 4XWUA 3BOXA 4UTBL 3AG2B 5SX4H 4G6AC 3E12A 1O60A 3OTTA 3TBBA 4JIEA 2YD3A 3EH4B 4OUUA 1FLRL 2HRPL 3L5WB 4PWIA 3GG7A 4ELMF 4YYFA 3LV6A 3SCMA 1M71A 1YQVL 4DZAA 1R5VB 3NSJA 4Q2ZA 3FXIC 2M2DA 4XT1C 1G87A 4C1LA 3VC6A 2OULB 4HWBA 1E72M 4DVBB 5C7ZA 3LCXA 4PH6A 1E4LA 1NTHA 5F7MC 4ZMZA 1PKMA 3VNMA 5CSBA 3MZNA 4NP4L 4WK9A 4UT7H 1BD2B 4Q6JA 1ZJBA 3E2HC 5KZCD 3S5OA 3UAAA 1KTLB 1VADA 3ECBB 4UBDD 4L8SB 2QADC 5CO1A 4G8GB 5I17A 1IC5L 4HW6A 4WSGA 3VE0B 3KRBA 4H9YA 3W2NA 2BZDA 4X9BA 3QO0A 1JPTL 1T1XB 4APXA 2MQCA 5GRXG 3B1UA 3QZEA 4DPCX 4ZMXA 4ZUVB 3MNWA 2F7QA 4X5XB 3V6FA 3V8OA 3SQLA 2AK1L 2VWEE 5HDWA 4EN3C 4LRNL 3EPOA 1F4WH 3MRIA 4HHHA 4H9MA 1MVFA 4JL2A 3HPLB 3FKUS 4N0YL 5EUOF 4AEHL 3P4MA 4UMBA 3OAZH 4BKLB 4HIPA 2IV9A 4N1EA 1LQ0A 5I5IA 3MRDB 3UTQA 5IJBC 2J20A 4RZ4A 5CD3A 4W4OC 3BDKA 3G1VA 4NHUA 4BF7A 1XZ0A 1C5DB 3EXLA 4TNVK 2OMYA 2QADD 4MKVA 3RRAA 2V9DA 2CIIA 4XTDA 4C6FA 2WIIA 4DNLA 4IHCA 2OKTA 5LGHH 4P3DA 1M1BA 3P3YA 2OM5A 1BAFH 2PLJA 1NAMA 2YQ2A 3W1QA 1GXEA 2R2EB 3PWLA 4WJ5B 3T0EE 4C4UA 3UPRB 1MJUL 1U93B 3DTUB 3MUZ1 2FZMA 4JMNA 5DMGC 1IU1A 5CEYB 1IAOA 5L9DH 3HVNA 4E2OA 2ABBA 4WK4B 1ADSA 3E96A 1UYWH 4MVBC 3X11A 3QA3B 1JCTA 1UBPC 4JBSA 4KITB 2QUUA 4M1DH 1FRBA 5D2LF 3KEDA 1NGXA 4PJEE 1WA3A 1WKFA 4NU7A 1YUHA 2HFEB 2CZNA 4AMXA 3B7RL 5ACZB 4CNPA 4WXYA 4PJBF 1OCBA 4JRYE 5FIPA 2BJML 4GB9A 3L3KB 5LN8A 3MA7B 4A04A 4YHNA 2VR6A 5DD1H 4PMQA 3LUTA 5ECGA 3PHQA 3BO8B 3JV6B 4HJUA 3WNKA 5J89A 1CX9A 2YZ5A 4LBUA 4GRSA 5I1EL 4DJFD 5E8DL 3FKRA 4MLSA 2WJZA 1ACYH 1CLKA 1V3IA 2C7FA 4ZA0A 5JW5B 4X7FC 3UYPB 3FTGA 3IIXA 5F2IA 3O3DA 1K85A 4EIVA 4QXVA 4FADA 1M53A 2V2HA 2NX1A 1R38A 1HILB 1RJYB 1QFEA 1H41A 2REQB 3KW3A 5EC1A 3PJXA 4NRRA 2QPUA 1QT1A 4WU7A 3UROR 3UBPC 2H2PD 4DY1A 1WFOA 2IGTA 1E9QA 1FVDB 1I7RB 4FQ1L 3UAJA 3RIAF 4ADJA 2F6UA 4MDOA 3RUGF 4Z7VA 1XBXA 1EEPA 1PWMA 3CXHK 3GRWL 3N4AA 3W88A 4ZSOB 2ZOKB 4GFTB 1D8CA 5CZRA 3LKRB 5J1SC 2X1RA 2HLAA 2Y7GA 5H8UA 3W75A 3WH9A 3KXQA 3HA0A 3N9GH 4XP5L 5DZNA 4NOFA 3KXFA 5H4YA 3B9NA 1K7XA 5A8GA 2XQBL 3VWKA 2NSXA 5CEZH 3ABXA 4JO1L 4L3FA 4MNQB 3V0HA 3GMOB 4NJGA 1W9XA 5F2MA 2CO6B 1OE1A 3GDBA 4HHAB 5SV3A 1K3UA 1T2QH 4WHTA 5MEPB 3LQGA 5INDA 4LNVA 3P9LA 3T8VA 5DRXB 1H49A 4AQAB 2LU5A 1ZA6A 2E7HA 1F3JA 1GQJA 2DDQL 4GY7A 1XS2A 3RNQA 3TONA 4FERA 5E9DE 4KMTH 2VI0A 2WN2A 5LCVH 5C7XH 2IQ0A 2HZGA 4FIRA 4F2ME 2E1WA 3RJYA 3DX7A 3OB0H 1RUAH 3CAFA 3HRZC 4MFHA 1S7SB 3UMNA 5JNYA 2HVBA 3KYOA 1E6XM 5DT1H 1HQTA 1VHCA 2PDJA 4RPQA 1RJZA 4RPPA 3W6YA 2YD0A 3WUBA 3W9DA 1QX1A 2NX9A 1LQBC 4GVFA 4GRMA 3CZKA 1NUNB 4JEQA 1BMWA 1FL5A 5A6TC 3NVQA 2HG0A 4V27A 2K4WA 3NQDA 3MCMA 4JMXA 1B4JH 3W1PA 1I9RL 4JM2D 4MMYA 1FA4A 3D2UD 3NFNA 4LAKA 4P23B 1NGQL 5I6LA 2CO3A 3ISRA 3GTFA 3MV9B 4FCAA 4MQSB 5EHFA 4ELME 5C0CA 1P0EA 5E95B 3CVHB 2H6PA 4YVUA 2NQCA 2ZXGA 2ALDA 4LUYA 2HJKB 3HZ3A 4KRPD 2DQFB 1THAA 4OQTA 5GSVB 4BZ2A 5CJ5A 3PSWA 1MCPL 2DYPA 1EYWA 4GVIA 1V79A 4JFEE 5B7YA 1E42A 5CPNA 3D3VE 5T3ZD 2WLLB 4OGQC 1S9YA 3FHAA 4CC0A 4ZD3L 5I3IA 1NSNL 1Q66A 4OM1L 1JUFB 1P1VA 3CUGA 3W76A 5D9SA 2OMXA 5F7DB 2JQMA 4ETYA 2Y0FA 4GX8A 1ACXA 3PCYA 3KWXA 4QHUA 4YHML 1KUMA 2OMBA 1ZPUA 1KCUH 5HUPA 1OD9A 4Z3HA 2P0IA 2GTQA 4K8EA 1GTEA 2A0NA 1X5XA 1L9OA 3SZ8A 3FK3A 1DR9A 2V0AA 5I6SA 2EIDA 2EH8H 2XWCA 2ITDB 2JCWA 4RMVA 1LE5B 1I9CB 1TPH1 2HX7A 3QUGA 5HHMD 1E7UA 1NDTA 4N2HA 3CL7A 2ZWYA 4HLZG 5KUKA 1VC4A 5D5MF 4YHKH 4KCUA 4M8QB 1Y1UA 2A6KB 1IZCA 1UROA 4NM8H 4BBWA 1RQHA 2G3IA 3DBXA 5JHLA 4DJDC 2R8SL 3FYYA 1H50A 3QV6A 2X4UB 4FZIA 4Y4KA 2EIKB 4EANA 5DUJA 1KRCC 2EKSA 2Z1SA 4F57L 3QIUA 3USBA 4ZDHB 3H4WA 1Z42A 4JTIA 4H8WL 3VWJA 2GGIA 1ETA1 1VGAA 1NIUA 2HB0A 5EOCL 1IARB 1P1XA 1MFDL 4Y19A 1P53A 3OTRA 3NPSC 4IYKA 4N2OA 1A0DA 1J9RA 1K4HA 4KERA 1U33A 3BN9C 3WK0A 2HP4A 4BHUA 2DUAA 5HHQA 4UTFA 4G71B 3NJFA 1GEQA 5A2KH 3N2BA 1A0QL 2PUZA 2JKRM 1P1ZA 3E3QE 3VIGA 4TX9A 5IUCA 3UPAA 1AZUA 2O4EA 1FC2D 4F7PA 5MEQA 4FEZA 4TMBA 3Q6FA 4ASTA 1A9VA 1J8RA 2OPJA 4HNVA 1AACA 1H3PL 5DMYA 4O00A 2ERJC 4HZLA 4WUUD 3S36X 3HIJA 3TFCA 4WO4C 2X4RB 3PGCA 3HC4L 4JQXA 4AXNA 1SYSA 1O9VA 3GG8A 1VFLA 4GGBA 1HS6A 1KPUB 5FYJH 3M1BB 3U9WA 1H0GA 3OG3A 2ZA1A 3G1RA 1LJMA 3FQUB 4JFSA 1QPKA 1FZKB 4C6CA 3W11C 4ENLA 4NUPA 1EF2A 1O9WA 4PCTA 1RLWA 1K8YA 1S2UA 2FATL 2E9LA 2IDCA 1UVQA 2P5ED 5AC7A 1MAMH 1Q13A 3K6FA 2EDHA 3QCTH 4KKRA 5BO0D 1D3GA 3MVIA 3GNDA 5BOFA 1AI1H 3MV7A 1FO0A 5HVWA 1VACB 4PRWA 1QHPA 3PB2A 2R29A 1XGTB 3CPLA 4I2XE 2MPVA 1W0YT 2G30A 2Q3ZA 3EDKA 3PV6A 4L4VD 2OZ3A 1B9ZA 1JI1A 1K8IA 2K1MA 3DHDA 1T2QL 4MXQD 4FJYA 4OU3A 4ICWA 3ZR5A 4ENZA 3MRGB 1AOHA 1KNWA 3W9ZA 4C6KA 5LZLA 4C56D 3VGEA 3UR2A 3ME3A 4XP9L 4PJIF 2F2HA 2VR9A 4GNKB 1G4PA 1IAIM 1KQYA 2PLKA 3MGOA 5GS0D 1BYNA 2NY0C 4Z7NF 2PWVA 1F11B 5JIMA 3UJIL 1EXUA 1FP5A 4IBVA 3NFUA 1F6AB 2ZAHA 1KV3A 2QPXA 3ID7A 2J77A 4K6AA 4P9HC 4RRPA 2NLJA 2EXSA 5CBEA 3LXAA 4BIKA 2GUUA 2V5MA 4PLNC 1AGCB 2V2XA 2WBKA 5AVNA 1YAZA 4PTTB 3PR2A 3W37A 5MERB 2FO4A 2J3SA 4MAUH 1RUKL 5EO1B 2JQZA 5LNGA 5JZ7D 2JIWA 2WTRA 2VEFA 4WGHA 2EE0A 2CZDA 4JICA 3BKML 4WVXA 1KB9J 1S5VA 3DI0A 4YHZL 3D08A 3N1AA 1OGAA 2WQDA 1UFGA 3IXAB 1BZDA 3LEVL 4FXJA 3X14B 1QWHA 4MCYB 2Y69B 5I06A 5AYTA 2EDKA 4QKXB 4GKNA 3GMQA 4ZI8A 4GUGA 1KCSL 5GISH 3W00A 5GJTL 4F24A 2QDGA 2Y06H 4HSAC 1BZQK 3RWGA 1HJWA 4C5ZA 5I15H 4ROPA 4IDJH 3NNTA 4XBMA 1S5WA 3HUJB 4M7JL 1Q0XL 4G6JL 5BWFA 1P4IL 3CFNA 5CCJA 1U5HA 2VDIA 5TJWK 3D47A 3DBNA 1CCZA 4WFEE 3MCLH 1JNJA 1U1JA 2GPTA 3WLLA 3EHBD 3CZEA 4OLXL 3TOPA 5A3ID 3WN5B 4AXWA 4C58B 4KIRA 3CXFA 1GVIA 3ARDA 3U4FA 3PIQB 2OCZA 2VC6A 4PTTA 3DX0A 2KMWA 3CV7A 3ETBJ 4ZPVA 1M1XA 4AYFA 1SXAA 5C0AB 5DT1L 3A3YB 3VXRE 4PRIB 3X1GA 5BO1H 1T8QA 5XINA 1MDTA 3OU8A 2G75A 3MXWL 1JGEB 4MRBA 5B39B 3PZTA 1MZZA 3V0SA 3WD4A 4BFKA 5HHXH 3P4NB 3N2XA 1J0KA 2F58H 5ACLA 2R8SH 4EXKA 4L8CA 1TV7A 1DJWA 2YUVA 4P5SA 2GJ6D 3LV3B 4WFFE 3ZO9A 1W9UA 3TJIA 1X5GA 3I74A 2I7OA 1ZHNB 1UIPA 1YG9A 1F8MA 2Z29A 3HHSA 3NL3A 5FJJA 2FT6A 5B22A 3MRLA 3VOIA 4AG0A 5HSFA 2XHNA 1Z9SB 1URLA 3ZJ6A 3WLHA 3NQ8A 1XGUB 3GG1A 2XNAB 1KBIA 1ZHLA 5J1TC 1M03A 5FDYA 4XMLL 1ZFJA 1MVUB 4K5LA 3NZHL 3NCOA 4LEFA 4UIMA 4XBPB 3VVGA 5INCA 4NZ4A 3H3BC 4O5LH 3IJ8A 3HE6D 4J3SA 5IHRA 5A2BA 4A3RA 3L7FB 4QRPE 3JVAA 4Z76A 3D2TA 4MDJA 1R3LB 4M3PA 5LIWX 3IFPB 4U3SB 4NO0B 3PJNA 3APMA 1DN0B 2RAMA 3Q2VA 2ZJSL 1H3PH 4AEOA 3OHXA 4NZ8A 1B3VA 1RR2A 1OX6A 4DFHA 3Q94A 4W8LA 3VXQB 2FPYA 4X4YB 4DF1A 1O4UA 1QATA 2HS6A 3WQ4A 3K2MC 4OKDA 4PB4A 2X6UA 1FX6A 3CZNA 1MSSA 1PF3A 4FL4B 3TN3A 3PGDA 5AG8A 1Q1JL 3FN3A 3SQSA 4WW2F 3UTSE 3EGXA 1RU9H 2BNQD 5GNXA 2VDOL 4OZGA 2HRWA 1SJMA 4MWAD 2XI9A 2QQQA 3ES8A 1TZIB 4KRZA 4BFIA 1AYRA 2X4RA 2IKJA 1Y6NR 4L9XA 4PLOB 5AOKA 3MAWA 4G80A 2ICWB 5T3ZH 2GZXA 2B4CC 4X5QA 4JO3H 5C9WA 1VA9A 4AY7A 1ZLSL 3VKKA 5GRJH 1WCQA 1DTUA 3UCCA 2R1XB 4R2GC 3HZKB 1NFKA 3BW3A 4HNLA 2VRAA 1R9FA 4R9OA 4E4PA 2A4ZA 5GGSA 2A9MH 5JHDE 4DAIA 3T0BA 2NYKA 3TT1H 3C8FA 3UA3A 1VFHA 4Y7OC 1V6VA 4NERA 1IBGL 3S47A 3TO4C 2A7PA 4FEMA 2YMXL 3BSGA 4GUOA 3WG7B 2OR9H 4MJHA 2IEPA 3VWJB 3E5PA 2R4RH 5CILL 2G5WA 4L23A 4IWWA 4XPBH 3OB8A 4H8HA 1PYFA 3G6AB 4TQEH 1BYAA 1OP4A 2ZOTA 3R8GA 4OZGE 2IQTA 4DBSA 1HHHA 2CHXA