4W93A

Human pancreatic alpha-amylase in complex with montbretin a
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The amylase inhibitor montbretin A reveals a new glycosidase inhibition motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 181
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4w93A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w93A01
5A6MA 1V03A 5LA0A 4GXPA 2G3JA 2WXDM 5HBFA 1QHZA 5A6AA 2J75A 3WUBA 3CZJA 1ZBKA 3GTNA 2YFNA 4TX6A 3N11A 5I2UA 2XSAA 3BCFA 2CNCA 1Q6CA 2YA2A 3T0AA 1HKMA 5I78A 4HA1A 2OW7A 3AZRA 1L8NA 5DEZA 5C71A 4KGLA 1VIWA 4B16A 1WP6A 4H8HA 3OGRA 3II1A 3KLKA 1VJZA 3VOCA 2W61A 3MSDA 1JG9A 4KH2A 3WN6A 3VKKA 2DSVA 3ARRA 6CGTA 3WBEA 3AJ7A 4WSJA 3L4TA 4J27A 3VIOA 4V2XA 5I77A 2FGZA 1VEOA 4CD8A 3WUFA 4DWSA 9CGTA 2WWCA 2XWDA 3W28A 4AZIA 4ZE4A 5FL0A 5CGTA 2JF6A 2VTFA 3AS0A 4URIA 2WAGA 3S2CA 2EACA 1E3ZA 1JD7A 4WSKA 4HOWA 1H09A 2J7CA 2QHAA 1N82A 3AISA 4F9DA 1OBAA 4RE4A 1UQYA 3FNDA 1CXIA 3G6LA 1MW1A 1WO2A 2A3AA 4W7UA 3QOMA 3ARYA 1G01A 2WC3A 1A3HA 5BROA 5A6BD 3AMKA 3ZO9A 2VUYA 2JIEA 4CUCA 1BPLB 3DDGA 1PIFA 4M81A 3WMCA 2F1BA 1W91A 1GZJA 3ARWA 3WD2A 3EJUA 2V5DA 2ZX9A 5AYBA 4UFJA 1RH9A 2BS9A 4P8XA 1CGVA 1UH3A 1KQZA 3UG3A 1PX8A 3KEHA 2DT3A 5GPRA 3EJSA 3DDFA 1K9DA 1ISXA 1WNOA 5JIWA 2XVGA 3K4DA 3VD5A 2DSWA 3MUIA 3PZVA 5HNNA 3QHOA 2WZEA 5AY7A 1NOUA 1LLOA 3T09A 1QI2A 4ZXOA 1GOMA 3WEZA 5DT7A 5CLWA 1Q6FA 4DM2A 5CSYA 3F5LA 5CPSA 4A3YA 5JBFA 2VQUA 1VENA 1CTNA 1MXDA 2E4TA 4MAZA 2CHOA 3CUFA 4ACZA 1G0CA 4YPJA 1UASA 2UY5A 3E1F1 1ISVA 4JKLA 4BQ3A 1J12A 5CJ5A 4D6FA 1E6QM 3WDPP 1K6AA 4D71A 1B90A 4QLKA 4P8WA 3VIFA 4A4AA 1JXKA 1V3IA 4PMOA 1KBKA 3CUGA 3OGSA 4BQ5A 3OLDA 5I24A 2XVPA 3OLEA 4NI3A 4B9YA 4U3CA 1BFNA 2WYSA 1QNPA 2D0GA 7TAAA 2AMGA 2WVVA 2W63A 1TQWA 4AZBA 3TONA 4TXEA 4PSRA 3GXNA 1BAGA 2D0FA 4MB1A 3WF4A 5A8PA 5LA1A 2GJPA 1OD8A 1W1TA 2ZX6A 4DWSB 1J01A 2WK2A 4UQEA 3WNOA 4LYQA 1KTCA 1W3HA 1BG4A 5M03A 4W88A 3AS1A 3OB8A 3W37A 2MANA 4AD0A 1C91A 3MSGA 5GNYA 4AZGA 6A3HA 2DSUA 3LXBA 1UUQA 4W84A 2XFYA 2WMHA 4LXFA 3VGEA 3B9DA 1HL9A 3CHCA 1WDRA 2J25A 7CGTA 3EDFA 2YDQA 1A47A 3NCOA 1UR9A 2D24A 1R8LA 2CBJA 4NRRA 1ISYA 3K8MA 1ZL1A 1D3CA 4M1RA 4V28A 2V3DA 3DX1A 3ARQA 4XZWA 2X2HA 1LF1A 4FF5A 4WLCA 3WF0A 2VZSA 3AS3A 1DP0A 5A94A 3T0BA 1EDTA 1BYCA 1NH6A 1H1NA 2E8ZA 1GONA 4HA4A 5EFDA 1HKIA 2X05A 2EBNA 1CENA 4J3WA 1BYDA 2VZOA 2XGIA 2UY4A 1XH2A 4GINA 1ESWA 2B31A 1V6VA 3AMLA 3VD4A 3HU7A 2PWFA 3K46A 4Z2KA 1MQRA 3SCPA 3MS8A 1XHGA 4C7GA 1J0IA 3BVVA 1GJUA 3U5YA 5I0DA 1ECEA 3VPLA 5GNZA 1HT6A 3W26A 1LQ0A 2TAAA 2WWDA 5EFFA 2WCGA 5A6LA 4E8DA 3LX9A 3FHAA 4B3KA 3GH5A 3M46A 1UD4A 3VDBA 1KR1A 1C8XA 4P7RA 2PBGA 3A6OA 3PBGA 3EDJA 1LG1A 1OT2A 2W5FA 1CGXA 1PS3A 1J9YA 4M80A 2G3NA 3WNPA 1W9VA 1EHAA 3BSHA 1HKJA 1KXVA 3BUBA 4D72A 5DF0A 4PUEA 1JI1A 3L4VA 3VO0A 1CXLA 5BRPA 4NXSA 1HP4A 1VJSA 4JAWA 3VIMA 3VD9A 2WHJA 2VCCA 1JZ5A 2VRJA 4ZXLA 1NWUA 3POCA 4MB5A 1HTYA 3KWXA 4BF7A 1RP8A 1WDPA 3W24A 4HU8A 4JIEA 1UH2A 4ZE5A 2GK1A 1EOMA 1Y7VA 1V02E 1CYGA 2D23A 3BLKA 2VQTA 2VC9A 4ML4A 3SUSA 2WVTA 3CZSA 4CD4A 3D4ZA 1O7AA 2Y4SA 1R86A 4TOQA 2XYLA 3RJXA 1ZS2A 1M04A 1NWRA 2A3BA 4D6EA 3OZPA 2NT0A 5E0CA 5IDIA 3GXPA 1E3XA 5AYIA 1UZ1A 2ZXAA 3BAJA 2PWGA 3AZSA 3PZNA 2XPKA 2YA0A 3DX0A 1B3XA 4GI8A 1V3LA 4FNRA 3ZT6A 3EDEA 1OT1A 3H53A 3ARSA 1DEDA 2BVDA 2XWEA 2G8ZA 2WMJA 1E1EA 2HISA 3WUEA 3BAYA 4RE3A 1O6IA 2G3MA 3W82A 4LGXA 4Q22A 4W7WA 5D4YA 2JIWA 5D9MA 2Y8VA 3CPUA 3NDYA 4PMDA 2D3LA 2DSZA 4EKJA 3M7SA 1UHVA 4IUGA 2ZICA 5HPOA 1ZBWA 4KRTA 2YIHA 1E6ZA 2VO5A 3AXXA 3BAWA 1M03A 2FDMA 1W3LA 1H4PA 2GFTA 4M82A 4PTVA 4JFUA 4PMUA 1AQ0A 4BZYA 4QCEA 4U5KA 4M24A 5A6BA 4UCFA 2UY3A 2VVNA 2CHNA 1NARA 2ZUSA 1JFXA 1W32A 3VIPA 3IGUA 3K1DA 2X0HA 2JE8A 4N0RA 1UKOA 3PZMA 2WPGA 3VIJA 3BAXA 1TFVA 1B9ZA 1W1VA 3CV5A 5BXPA 4D1IA 2RGLA 1EH9A 1TQSA 1OD0A 1H3GA 4AD3A 4UFMA 2ZOXA 3QHMA 1M7XA 3VM5A 4ACYA 4GI6A 3ZMRA 1UD2A 3AFBA 2QF8A 3WD3A 4UNIA 3WEOA 3IJ7A 4E4PA 5DMYA 1KTBA 4AWEA 4M29A 4PN2A 4J3XA 3WBAA 1XCWA 3B9AA 1C90A 5BXTA 2J4GA 1JIBA 3VIIA 3PZTA 5DT5A 4PMZA 2J8FA 4DUXA 1CWYA 1CGYA 4HMEA 3DECA 2ZXDA 3NYDA 3O2LA 3VGDA 3HJEA 4CN4A 1UD3A 1QI3A 3AYSA 4FNUA 2QV4A 4JHZA 2C7FA 4HOXA 4AISA 1QW9A 1U30A 2WCAA 2E9BA 3AHZA 3TTSA 1EQCA 2X1IA 2DSKA 3SCTA 3WD4A 2EPKX 1B30A 1J0KA 2DPEA 5A8OA 5IFTA 3VU2A 3N12A 3ZJ6A 1CXFA 4QP0A 4X0VA 1VEMA 3BCDA 4GQQA 2UY2A 1XV8A 3WF2A 5E6ZA 5FL1A 4CCCA 1SYTA 1XRVA 4FK9A 2QPSA 1B2YA 3BVXA 1IV8A 1H11A 4OJYA 5FIPA 1PBGA 4K68A 5DO8A 1XC6A 4AMWA 3BC9A 4HOZA 4EK7A 4M8UA 3RM4A 4A3HA 5FOOA 1UWTA 2WMGA 4ZFMA 2BV9A 3GBEA 1CPUA 1KGUA 2E9MA 3S5YA 1E6NA 3NIYA 2YDRA 1ZJAA 3W53A 1H5VA 1HJWA 3CO4A 1HN1A 4PRWA 2CKSA 4HZ7A 1EIBA 2Z1KA 2BY3A 3PTKA 1JYWA 3GXTA 4UZUA 5E0FA 2XFFA 1B3YA 1UWSA 1X6NA 4C7FA 2ZE0A 2WKLA 1D7FA 4JZ5A 2F61A 4PCSA 1ZU8A 4PTXA 5LA2A 1VBRA 4ATLA 3CLWA 4CN6A 2BHZA 4HTYA 2Y5EA 5F7UA 1G5AA 1I75A 4QDMA 3PZQA 4D6DA 1E6SM 1C7SA 1UQZA 3W38A 1VF8A 4HZ6A 3WD0A 1WZLA 1OGSA 4NZJA 3A21A 1PJ9A 3TV8A 1KR0A 3SCUA 1CBGA 3OZOA 1HJXA 2ZXBA 1Q6EA 5M17A 1V02A 1H2JA 1HVXA 3FN9A 1GOQA 3T0DA 1NWSA 5JUVA 5EMYA 5I6SA 3DX4A 4PSPA 4W7VA 1E5NA 1HVQA 1W2VA 1NM9A 1LL6A 2BY0A 1KCLA 4IPNB 4PBGA 2OWWA 3EJRA 3IJ9A 4CU7A 3SCOA 2CBUA 4GKLA 1OCQA 1QI0A 5E70A 4AZCB 3GZAA 1TQVA 3VTRA 1H41A 4OUEA 5HXMA 3A23A 2O9TA 1CECA 4TVCA 5JIPA 4IPLA 3WH7A 1GORA 4KMQA 5JBDA 5TD4A 2WMFA 3LMYA 3LRLA 3D51A 1MW3A 1JDDA 3D52A 2JEPA 1P6WA 2GJXB 1K9TA 2EEXA 4WKAA 1B0IA 3AIQA 1NP2A 3SUWA 2DT2A 1E6XM 1XSJA 1ITCA 3CHDA 4UOZA 1OSEA 2OLHA 3MUAA 4F9JA 2DT1A 5A2BA 3CMJA 3NSMA 4NZCA 3GXFA 3CH9A 1R34A 3LPPA 1KGWA 1V0KA 3ZQ9A 5IHRA 1BF2A 2D3NA 1W9PA 1E9LA 3O6AA 3WH5A 3TP4A 2YKKA 4L4OA 3OG2A 1PEZA 2PB1A 2GVYA 3W4RA 2V3FA 4U3AA 5M3WA 1JAKA 2FH8A 1BGAA 4TTGA 4WKHA 3WL0A 1H0GA 3WF3A 4CVWA 3EMQA 1VBUA 1JD9A 4BS0A 1HF6A 4KRUA 3SCVA 1MXGA 5A2CA 3NDZA 4WJXA 2RGMA 4JFTA 1JZ4A 4EANA 1JZ3A 1UD8A 1UZ4A 3KLLA 2CCRA 3L2MA 1GW1A 4NSBA 1U33A 2WHLA 3KZSA 3WF1A 3FW6A 3RPMA 2ZUVA 1B1YA 3RCNA 5BXSA 5DFAA 5A6JA 1JZ7A 1QI4A 2A3CA 1DWIM 2E8YA 4CD6A 3VVGA 4NZFA 1I1WA 1FOBA 1J0JA 5AC4A 3GXMA 3MMDA 4CD7A 5A6SA 5KZ6A 4LYRA 4QLLA 4D6JA 4MB4A 5I23A 3VIKA 2DH2A 1C8YA 2VL4A 2QMKA 1OIFA 4W8LA 4PMVA 1HP5A 1BG9A 3BLPX 5AC5A 1XSIA 1PZ2A 2BNJA 4Z2GA 2UWFA 1BYAA 2F1AA 1CNVA 2DGAA 1BYBA 3O9NA 4W93A 1EXPA 3SEPA 3SCWA 1HIZA 1R87A 2E3ZA 2VZTA 5M5DA 1O7DC 1AMYA 3FY1A 2XM2A 1JZ6A 2YL6A 3MUZ1 2VMFA 4GO8A 2WMKA 3G6MA 2DEPA 5JBEA 3UR7A 2J47A 2WLYA 3CHEA 3WY3A 2XVNA 1XCXA 1KWKA 1W1PA 4AD2A 1QWUA 2GSJA 1V0NA 5GQBA 2BVTA 4DO6A 1MFUA 1TA3A 4AZ6A 4W87A 2IXUA 4Z2HA 1GHSA 1PZ3A 1CIUA 1MYRA 1J0YA 8A3HA 3WH8A 4NX0A 1QNQA 3U7VA 6TAAA 3ARXA 1FA2A 2EPNA 5A6KA 2Y8KA 4ATDA 5ABHA 1PX4A 4S3JA 3ZT7A 3GXDA 3WNNA 4Z2IA 3N9KA 4AZCA 2ZXQA 4CD5A 1GOIA 3TTQA 2YBTA 3EJPA 3A22A 2EQDA 2YLLA 3AMCA 1SFSA 2WC7A 5CZKA 3VSVA 1R85A 2PWDA 1HWWA 2XN0A 3DHPA 3DX3A 5HDRA 4E2OA 4H41A 3VD3A 4BCEA 1KXHA 1L0PA 2OSYA 4MPKA 4DO4A 2AAAA 3WKZA 1V3JA 3RM8A 3IANA 3NJ3A 3NUKA 3AQUA 3THDA 3SCRA 4QFUA 3GH7A 1W2PA 4D1JA 1JYXA 1TVPA 3B8SA 4FLRA 1V6YA 4ATWA 5D9OA 1CGUA 1KWGA 5CGMA 3ALGA 1WKYA 3AHYA 4XV0A 5HOSA 2XUCA 4UFIA 4FNQA 3WDJA 1UD5A 4U2ZA 3MO4A 4LX4A 1GCYA 3GDBA 3UG5A 5KEZA 1E43A 4AD1A 1IZJA 3PZOA 4P7OA 3PTMA 5CG0A 3RMEA 1F4HA 2AOSA 4JHOA 1TE1A 1GOOA 2OWCA 3ALFA 1OB0A 5I3DA 3GNOA 2J7BA 3QHNA 3BVWA 4IISA 3N18A 4P7NA 4Y7EA 1C8QA 4H8VA 2WBKA 2W67A 3KL5A 3LXCA 2GDUA 1WCGA 1QPKA 5IHSA 4B15A 1CDGA 4R27A 1AQHA 1B3ZA 4J3VA 1E73M 4JFVA 1C3FA 2ZUNA 2EAEA 4FNTA 3W6MA 1UR4A 3AIBA 1HNYA 2ZX7A 3ARVA 3ZM8A 4UFLA 1MFVA 3W0KA 2VX6A 1NP0A 1W9BM 4PTMA 1WZKA 4WF7A 4MDOA 3L4ZA 4F66A 1E6PA 2CEQA 1LJYA 5BWFA 1QHOA 1OGGA 3PZ9A 4CCDA 1UKSA 3CZEA 2ZWYA 1ZJBA 1JFHA 4Z2JA 3QGVA 1GVIA 4H04A 1JYVA 2VVSA 1XD1A 1TUXA 3POHA 3CZ8A 4D6CA 4AIUA 1JDCA 3GXIA 4QLJA 3N1AA 4J28A 1UKQA 4AD5A 1TQTA 1DTUA 2Y2WA 1E0VA 1GUVA 4MNKA 1OM0A 1QNRA 4OOUA 3UETA 2GK1B 1GOKA 3OLIA 5I79A 5D8WA 1UR8A 7A3HA 4UOJA 3LXAA 4AZHA 4HPGA 5IXEA 1WAWA 1B3VA 1KB3A 3PN8A 2VOTA 4X9YA 4TTUA 3WY1A 2CETA 1TZ7A 3U5UA 4MJ2A 3AZTA 3WFLA 2DIJA 2XVKA 2ZUWA 2WANA 1WZAA 2BY2A 3WEMA 3AMGA 3VUPA 2BHYA 2C0HA 3U57A 1J0ZA 3RJYA 4AYSA 2G4FA 3NSXA 4GZIA 3UG4A 4MB3A 4FLQA 4UFHA 2YL9A 5ABGA 3D50A 4ZEPA 2O9PA 2J7GA 2EO7A 1ODUA 3ZOAA 4P7QA 4W86A 1YHTA 4KWUA 3MI6A 4D6GA 1DHKA 2FHCA 1BTCA 1OIMA 3BAKA 3RO8A 1WZMA 2X2IA 1JAEA 3GBDA 3LRMA 1ITXA 2WMIB 4D6HA 1QNOA 1HJSA 2J62A 3MUY1 1JDAA 3PZIA 4BQ2A 3ECQA 3UCQA 2VX4A 1NWTA 1ZB5A 2PWEA 2J7FA 5I5RA 1JNEA 4CVUA 2F7PA 3KE0A 4UR9A 1WE5A 1VFFA 1R75A 2XIIA 5C70A 2Z1SA 1ZBVA 2CXGA 1UR2A 3WNKA 4P7LA 4JKMA 2CYGA 2CESA 1E6RA 1LWJA 1CLXA 5CSUA 3FAXA 1GQLA 4W8AA 4AYGA 2WM0A 3A47A 3OLGA 5LYRA 1JGIA 4TVUA 4U31A 3EYPA 1US3A 1U2YA 1NQ6A 2ZUTA 4J7RA 3RDKA 1PPIA 2VJXA 3VMOA 3DYMA 2DIEA 2WCSA 2WB5A 2WVSA 2YOCA 4XB3A 2XN1A 4CCEA 2WVUA 3IJ8A 2BXZA 3AXIA 2EPLX 1GQIA 4M56A 1CLVA 5ABEA 4W5ZA 2OYLA 1QW8A 4PMXA 8CGTA 1KCKA 2JFEX 3AXHA 4WKFA 3D3AA 4CU8A 2EJ1A 1CZ1A 4BQ4A 5HPCA 3MKKA 3SUVA 4CGTA 3J7HA 1PIGA 1LWHA 4W5UA 1JF6A 2VX5A 3B9EA 4LQ1A 3MV11 4YHEA 1TQUA 3BXWA 1QI5A 4UQAA 4NF7A 1TR1A 3VGFA 1K9FA 4UFKA 2OYMA 5E9AA 1H0IA 3SUTA 3DHUA 1R7OA 1UR0A 2ZIDA 3DYPA 3N13A 2X2JA 2ESCA 4Q7NA 1M53A 4UQDA 3AIUA 2QPUA 4J3UA 4R5EA 1BQCA 1BHGA 1D2KA 1J18A 3H55A 3HMCA 1I1XA 4FNSA 1H49A 3FXYA 2QLYA 3WQ5A 1X6LA 3WQ6A 1DWFM 2WLZA 2O92A 1MW2A 3UERA 3WELA 1W9DM 4ZENA 3L2LA 1UWQA 1QHPA 2W4XA 2D0HA 2XG9A 3WQ4A 3QOKA 3SCSA 2VRQA 1EA9C 1OWQA 3WQVA 3AOFA 2Q8XA 2YA1A 1Q6DA 3W29A 4AIEA 2D1ZA 3S6TA 3N15A 3OIHA 2WBGA 1KBBA 3VD7A 1TCMA 1UKPA 4HPHA 3VNYA 2VRKA 3GNRA 1V6WA 3T2QA 3D5HA 1GPFA 3A4WA 1TMQA 4AEFA 4P8VA 1UA3A 3GYCA 1SMDA 1UH4A 3WY2A 2VCBA 3BVUA 2VURA 5A2AA 2BVYA 1UOKA 4L4PA 1SR0A 1BSIA 4NRSA 1E4MM 4OBRA 3GM8A 3SURA 1NOWA 4UZSA 1NOFA 4J3SA 3A4XA 1E5JA 3AHXA 2VX7A 2NT1A 2YFOA 1KXQA 1QNSA 1UWUA 1XYFA 4DWSC 2WHKA 3ZJ8A 5E6YA 4PMYA 4MJ4A 3UESA 3JUGA 4AW7A 1TA3B 1LL4A 2VR5A 1GHRA 3FAWA 1C92A 2IGTA 2WC4A 2NW0A 1J11A 1CXKA 3LPGA 2CERA 1E4NA 2XFRA 4FLSA 1W3KA 3ZR6A 2VI0A 1S46A 1VB9A 1V3KA 1W9UA 3AHVA 2XM1A 3T2PA 2PBOA 4WK9A 1G1YA 1UD6A 2F8QA 1CGTA 3CBWA 2D73A 1V6UA 1XYZA 5BRQA 3VDCA 3WSUA 4TUFA 3TOPA 3BMVA 4FLOA 2G3IA 2FHFA 3CC1A 2DT0A 2WZIA 3MMUA 3TTYA 3NSNA 3ARUA 1EOKA 4U33A 1EGZA 3FHQA 3WDHA 2NSXA 2J7HA 3CUIA 2GDVA 5ABFB 1Q6GA 3AHTA 3EMZA 4OOZA 3LPFA 3AYRA 2X8RA 2WKGA 2YLAA 2XTKA 2WMIA 3BAIA 1US2A 4HMDA 5BYWA 5CQ1A 3N04A 5A3HA 1XGZA 1E70M 3EJQA 4PMNA 1HL8A 1E56A 1R7AA 2WNWA 2XSBA 2BXYA 4AMCA 5CLTA 1QBBA 4HZ8A 3L4XA 4ACZB 1V0MA 2E40A 4DWSD 1MVYA 3WH6A 3SUUA 2WZHA 4AZ7A 1MQPA 1FH8A 4F79A 2XIBA 4UOQA 3K8KA 4GPNA 4KGJA 1TG7A 2XGBA 1UA7A 4J3TA 1M01A 1E40A 2BHUA 2EPOA 2VT0A 4JL1A 2X09A 1J0HA 1VFOA 2J7DA 4S3KA 4AC1X 3EBVA 1W9XA 2WSPA 1KQYA 2GUYA 3BUDA 1G94A 1EQPA 3D4YA 3OBAA 5FD0A 4UQBA 2IXVA 5CPTA 1EO7A 1MQQA 3WDIA 4FMVA 3WIJA 1MW0A 3WH9A 3PZUA 1WB0A 1VAHA 4HP5A 1CXHA 2OYKA 3AROA 4D6IA 2GJRA 3VSUA 3SIMA 1ODZA 4AY1A 1PX3A 3SCNA 5A95A 3M6DA 1XH1A 3ZT5A 4N42A 4GO9A 2G41A 3APGA 3CHFA 3WDRA 2O9RA 5FCZA 3AI0A 3K4AA 1V3MA 1V0LA 3GH4A 1V3HA 3EMCA 2OWXA 3HN3A 1PAMA 4JCLA 1W3JA 3WDQA 2BY1A 5A69A 4U2YA 1EHNA 4NXKA 4UQCA 2XJ7A 2JF7A 3GNPA 1YQ2A 1E4IA 4HA3A 1QBAA 2FH6A 1AVAA 4C7DA 5CPQA 3BLBA 1R33A 4YHGA 5ABFA 4HU0A 3CZNA 1FFQA 3ZJ7A 1VFUA 1VRXA 3MANA 5ECUA 1R46A 3VGBA 1AQMA 1GOWA 3PZGA 4LYPA 3UR8A 3WENA 2XVLA 4B9ZA 4OZOA 4JFSA 3AIEA 4OKDA 3F4VA 4H7VA 2FE0A 4H2CA 4JKKA 3ZSTA 4AXNA 3VMPA 2A3EA 4MADA 3L4YA 1LG2A 4YN5A 1CXEA 1HXJA 2Y24A 1ISZA 2DH3A 1UKTA 3AS2A 2EADA 1Z32X 1FH9A 5A8NA 3AIWA 2DDXA 2VCAA 2XHYA 5D9PA 4JFWA 1RD6A 1FP8A 4QAWA 2ZX8A 2CBVA 1FHLA 3RM9A 2ZX5A 2X0YA 4GIAA 1FFRA 3WMBA 1B3WA 4FNPA 2JEQA 1EO5A 2ZWZA 4BA0A 3WUGA 2XN2A 2GJXA 1FHDA 3BSGA 3L4WA 4OIFA 3SCQA 1E0XA 1ZBCA 4PYSA 2PI6A 4W8BA 3QR3A 1Q4NX 3W6LA 2WHMA 4Z2LA 1SZNA 3CTTA 1UR1A 1JZ8A 2WW5A 1GQKA 1UYQA 1UG6A 3BUIA 3H54A 3VDHA 4TX8A 4W89A 3CZGA 4MNJA 4XZBA 3HZ3A 4TVDA 1UWRA 3VX0A 1T0OA 2VZUA 1E71M 1GJWA 4EE9A 3HG5A 2CKRA 3F5KA 3EDDA 1BVZA 1ISWA 3BGAA 2FGLA 1E1FA 2F7OA 1CEOA 1E15A 3CUJA 3S5ZA 1XD0A 4AIOA 3ZIZA 1HX0A 3WY4A 4AD4A 2D2OA 2EXOA 1DWJM 2CBIA 3BUPA 2YJQA 3WL1A 3AMDA 1UWIA 2E0PA 3T2OA 2ZUUA 3IK2A 1JI2A 1B31A 4UQ9A 3M07A 3VM7A 3ARZA 2O9OA 3N17A 4H8UA 1F4AA 4PCTA 3I3EA 4MAVA 1X1NA 2DQXA 3ARPA 3IAQA 3TTOA 3EDKA 2JALA 3HG3A 3ZR5A 1GVYA 3RIKA 5A8QA 1VEPA 3ZJKA 1OGBA 1DWHM 3LRKA 2HVMA 3EJTA 4PMRA 2D20A 3BVTA 2ZUMA 1E72M 1JXJA 3A5VA 2FYVA 3VILA 1QX1A 1QVBA 4CKQA 3AIVA 3CGTA 1LL7A 3WD1A 2VNCA 5CXPA 3WQWA 2OSWA 1JYNA 3WQ8A 4DO5A 2PC8A 2J8GA 1JF5A 5D9NA 1SMAA 5FKYA 1C7TA 3CZLA 2V38A 3DX2A 3ZSSA 5E1QA 1BGGA 1E0WA 2PF0A 4B3LA 2PWHA 3VGGA 1WPCA 1EDQA 3VINA 3OGVA 2EABA 2J7EA 3CIVA 4PEEA 3K8LA 1J10A 4AZ5A 1WDSA 3A3HA 2F7RA 4GZEA 5EB8A 2EPMX 1RPKA 3W27A 2CPUA 2W62A 4WIWA 3VDAA 3WNLA 2YL5A 4E8CA 2WVVB 3BMWA 2YBUA 3CMGA 2J77A 1G9HA 1E55A 1DWAM 3ARTA 3AIRA 3HG2A 2J79A 5C8BB 1RP9A 3VMNA 3BH4A 3VX1A 4GI9A 3MV01 4IM4A 2IUZA 1BVNP 1K9EA 3RILA 4CU6A 2OSXA 3HG4A 1KFWA 2W91A 4EAMA 4JL2A 1XH0A 2X2YA 5EBAA 3MU7A 3KL3A 3LPOA 1OINA 5BXRA 2A3HA 1QWNA 1W1YA 3MMWA 3DYOA 4GQRA 4AEEA 2C8NA 4V27A 4PUDA 1C93A 2QMJA 2J74A 3UEQA 2VZVA 2ALWA 3VNZA 1IT0A 2BFGA 2YL8A 2V5CA 4MTVA 3CZKA 1JL8A 2FHBA 4XX6A 1XSKA 1HXKA 5D8ZA 3PTQA 1HJQA 2E9LA 1FP9A 3W81A 4X0NA 3AICA 1E4LA 3CUHA 3VIGA 5BCAA 4QCFA 4GZJA 3KL0A 1CGWA 3W25A 1JZ2A 3I3BA 3DC0A 2WSKA 1IZKA 4HMCA 1MWOA 4F8XA 3OA5A 3U7BA 4W85A 3WNMA 1HKKA 2W66A 3I3DA 2YDSA 4MNMA 4PTWA 1DWGM 1JNDA 2VR4A 5E09A 3VIHA 4DUWA 1HJUA 3WFZA 4XUYA 4RE2A 5GNXA 4OBSA 5IFPA 4MDPA 4AMXA 3IAPA 1HJVA 4MNLA 4UTFA 4U5IA 2CITA 1BLIA 4OGZA 3THCA 3L4UA 2V3GA 4JCMA 1QOXA 4CN1A 1EDGA 3VSTA 4DUVA 2CIPA 1GQJA 3F5JA 1WDQA 1KXTA 4PMQA 4RL3A 4P8UA 5A1AA 1V08A 3WMSA 4DM1A 3TA9A 1TVNA 1FH7A 2OW6A 3A24A 2D22A 2F7QA 1KGXA 2J78A 4LPCA 2W92A 1V6XA 1GNXA 1VFMA 5A8MA 1R47A 3VGHA 2F18A 3A4AA 2F2HA 2V3EA 3T08A 3PHAA 3BUQA
chains in the Genus database with same CATH superfamily
1W56A 5DS2A 5I0VA 4AW4A 1OM3L 3ZMEA 5CBAB 3OODA 3MRMA 1OK4A 1XWYA 3NEEA 4NNPL 4NQVB 1AQ8A 2WXDM 2TSBA 4TRPH 3W87A 5HBFA 4F91B 3V16A 1OKEA 5D2NA 4HZ1A 2TSAA 4M6OL 1YQVH 2HRPH 2FO1A 2CJ3A 4DOHB 3FRUA 3TBWB 3W0WA 2OM5A 1ZBKA 3WUBA 6ALDA 2H8PB 3GTNA 3GVWA 3RU6A 3GFXA 1HKLH 1YNTB 2ZCHH 1TJHL 1FFPA 5HI5C 1F5WA 5JOEA 4PGZA 2VFGA 5J6SA 3CWHA 3T0AA 3LH9A 3LRGA 4D0BB 1QQDA 1X9RA 4YSQA 1T40A 1WAUA 3ABGA 3TLQA 5LNDA 3BZ4A 3LBMA 3W7HA 2VDNB 4HA1A 5E8OA 2G5WA 4D0DA 5JA8B 1JDFA 1FUNA 4OZGF 1U93A 5DEZA 5T3ZE 1VIWA 2PPCA 4PJ9B 2JXMB 3DMMA 3LZ5A 2X53A 4X4ZA 4GC3A 4K38A 3N3EA 5ANHA 5T3ZH 3EA3A 4YXHL 1I7UA 1J8HE 3II1A 1PS9A 5IV2A 2HTMA 4AITA 2W61A 4CDGC 2DWSA 3GINA 2W9DH 2DQWA 3MV8A 1ZALA 2R91A 2EDXA 2ZOKA 5JR1H 5KBDA 3ORWA 4KH2A 5DRZA 4ZAKB 3WN6A 2WGXA 1EF2A 2WYZA 3L45A 2M8XA 4NQXB 1YE6A 5DJXB 6CGTA 3VKKA 2V0AA 3L08A 4WSJA 3ZDWA 1S7VA 4J27A 4HWBA 2GITB 5I77A 2DQMA 3EX6A 1T8XA 1ACYH 5HVHC 1VEOA 4I0PD 4K07A 2FX9H 4XO9A 4CD8A 6REQA 1S9KC 4GAGL 4HHHA 4AF0A 2VMCA 3VTAA 1KEML 3C2VA 1TR9A 3V6FA 3G5ZB 4QRSA 3PS7A 5EPDA 4R3UA 3AS0A 2FKPA 3GC2A 1NQKA 2YBRB 2FX8L 2D3JA 1I2QA 3LHTA 1I45A 4W4NA 3NPVA 5CN2A 2A85A 1E3ZA 1JD7A 2JXMA 2OMWB 3DMMB 4WSKA 2YD7A 3URNA 2J24A 3ZKNC 3CN2A 3DRQB 4J23A 1UFGA 1DJIA 4MNGA 4PJ7B 2QHAA 5B7MA 3KVPA 5CGBA 3AISA 3G1AA 5AW5B 4RE4A 3VZZA 1DVTA 2Y1ZA 1T1YA 1RZIA 3EWDA 4IL2A 2DQJH 3FNDA 4GYJA 4KPLA 4GMTH 2B20A 4S0HA 4Y5XC 1K4HA 1F4XH 3U6XS 1EP3A 3PPHA 1UOVA 1NFIA 4U1KA 4EVNB 5FI8A 1LEKA 4LKXB 2WC3A 4I2XE 3KDNA 5A6BD 4P5KA 3UEZA 2W38A 1HHIA 1VACA 1RZPA 1XFPA 3DFQA 4XX5A 2QHRL 2XGZA 3RUGE 2ZCKL 5AHFA 3RWHB 4A38A 3QFJA 4GJJA 1F11B 5AB0A 4HB7A 4X9IA 2ORBH 3L54A 3GRWL 4LVBA 4QXGH 2WUCL 3BTNA 3RY4A 2GVGA 4ZUTA 5BUGA 2HVBA 1XI3A 4NUJB 4I3RL 5B8CC 3NPUA 3SY5A 3NFUA 1JPGB 1EO8H 2CKBH 5FO7B 4UFJA 2I25N 3FL7A 1RH9A 1UIPA 3EA2A 4P8XA 3CPGA 1NDWA 1Q6QA 3T6ZA 2YZ8A 3B8VA 3RKDC 3ESPA 4QWWC 4AXWB 2NX5B 1WFJA 3I85A 3UG3A 1W5MA 4YBQD 4DK5A 5GPRA 3Q05A 5FACA 4JJHA 5GS2H 4XP5H 1ISXA 4GKNB 1HDMB 2UY6B 5CILL 2E28A 1YVLA 4ZUUB 2DRUA 2WZ6A 2X0WA 4XN5A 4E9YA 4NC1E 2BP8B 3GF8A 3VD5A 5IFJB 1ND0A 3SD5A 1YNKL 2FDBP 4N8CH 4PJAA 1QSEB 3NDYE 5H37G 5HHXL 1JXFA 3ZDYB 2WZEA 3LTYA 4LT9A 3SR7A 3Q94A 4ZW5A 4Q7IA 5IG7B 1FN4B 5CZSA 2CO7A 1WTLA 4OFIA 4U1SB 1R3IL 3PJSA 4OV6F 1R6WA 4DM2A 2UZIL 3F5LA 4A3YA 5JBFA 2VQUA 1LK3H 3AWEA 1L9NA 5DVKA 1IT9H 3L21A 1T7VA 2E7MA 1KCVL 2OB3A 5TQLA 5A7BA 3UXKA 4WXZA 3MUGA 1G0CA 2A0LD 1UASA 4KXDA 3D2TA 4XPGL 4OUUA 4WI3A 4YXKH 3E1F1 1PY0A 4R97C 1XH3A 4BQ3A 4R26H 2CG9X 5D7SL 5K9JH 1HINH 3LHWA 3E5PA 3SCMA 2F9BT 2GIYA 2YAOA 3UC0H 5IQMA 3P0XA 2W65B 1B90A 1XR8A 1B9KA 2X1WL 4CMHB 5CINH 4BGLA 5DANA 3SE4A 1V3IA 4A4AA 5CG7A 3OKMB 3CDGB 4PVLA 4L1WA 3BD5A 4R90H 4XNQA 2WNKA 4Y1AE 4ZYKB 1I3GH 5B80A 2Z29A 3RU8X 4NI3A 5F93C 5HNTA 2D0GA 1FGVL 2RTTA 2YAHA 4AWJC 4X98B 1S7UA 1T6VN 3LRSA 3O4LA 4NJHA 3EOTL 1TQWA 4XKYA 3T0CA 1W8NA 2CCWA 4TSBH 1XW8A 3PXJA 3A12A 5JIKA 1PQZA 4JLRA 1XCQB 3HZKB 4WUKH 5IB3B 1SQ7A 1DFXA 2NNFA 3GXNA 3FCSA 1BAGA 1P4BL 2V0TA 4QF1A 4ANVA 2O6EA 4B0MM 1M3JA 2NY6D 2JCWA 1J96A 3VXMA 1ZA6B 1ETB1 1VCAA 2ZX6A 3MWAA 1VGEL 5H8PA 2WK2A 1MFEH 2AABH 3VD0A 1J01A 4LYQA 5C9ZA 1MPAL 5IESH 4C56D 3RCYA 2ZCZA 1KT2A 5K9KB 1I8MB 4W88A 4ZS6C 1UJ3B 2Z1XA 4OIIL 3MSGA 4JHVA 6A3HA 4HG4J 2VDMB 5HHMB 3K2UH 2VJ8A 1UUQA 2UZIH 4HISA 3OC8A 4NAJA 4G7EA 1LK3L 4BUHA 3QQ4A 5E8DH 1QRKA 5I15L 2O93L 4C6QA 4L4TE 4LHQB 2WMHA 2CLVB 3H7VA 3DBSA 2UY7B 4HK5A 1N7ML 3FTUA 3IXTA 1POKA 1BQUA 2PCYA 3B9DA 4OJAA 5HHPA 4LNRB 1QVOA 4AAJA 1KKOA 1IM3B 4K6AA 1MCNA 3T4CA 1U8NA 5D1QA 1MWAB 1X5KA 3GI9L 5IHZB 1UR9A 5HMDA 2CH8A 1ZTMA 3HZMB 3IJQA 3EOAA 4B4FA 1RCOB 3CK5A 1ZL1A 1TNMA 2GKIA 5JYLA 4PJ7E 3T55A 4R4NC 1T1XA 4ZFOL 1A6WH 3P3YA 4DN3H 3JWNG 4B7IA 4FF5A 1Q6RA 2A9AA 2J4WH 4KKRA 4QLWA 1TPB1 3M5XA 2YEZB 3I65A 4F8LA 1DP0A 1IC7L 4EN2A 2ZSVA 3CU2A 4H9YA 1YEHH 5A94A 2VMDA 2OL3B 3GRGA 3WQEA 5D2LB 4NQDA 1P0SE 1TEGA 1T21B 4UWQB 5F1KC 1BYCA 2E8ZA 2NZ1A 4HJEA 1I3UA 4FXFA 4XG1A 1GONA 3CYJA 4XVTH 3MUHL 1BWKA 2XH7A 4FX7A 1G4MA 1KB5L 1I9RH 1IC4L 2V2WB 2FVMA 1G7LB 2CRYA 1Z9PA 3EF7A 4NM4H 2BP8A 2VN7A 1OAZH 4LNRA 2R1MA 1BYDA 3MHUA 2XGIA 3GR8A 1CO1A 2VERA 4BEIA 2IMMA 1BREA 5CSRA 5FV2A 5C0CD 4YXLL 3UDWC 3S1GA 1UGNA 3FFDA 3DG7A 5LQBL 4JEJA 2P46B 3CAVA 3FEQA 2B31A 4MMYA 3VKDA 4QYOA 3ILDA 4Y5YC 5D1ZI 4DWDA 4YWGH 1RZJC 4LVOC 3UGXA 3HU7A 3HGSA 2X4NB 5EO9A 1ZE3C 1DBAH 4WI7A 1IC5L 4YZWA 3E8VA 4NB7A 2PP0A 3E9UA 5ISZA 1BDYA 5JHDA 1ZAJA 3FGCB 4MHBA 1A5FH 2FT8A 3NAVA 1E90A 1PG7W 1X7SA 4GMTL 3FPXA 4XO4A 3CIWA 2DD8L 3MS8A 3PBVA 1ZP4A 5AVSB 1IGTB 1RZQA 3T2NH 3SKMB 2ITDA 3EWUA 4NPJA 1V7NL 4YOKA 1W8OA 2DM3A 5I0DA 4LBEB 3C2YA 4GQ0A 4X3ZA 5E95B 1Q9OA 2J72A 4FN0A 1HKVA 1QPNA 4HH8A 4PJ6A 1RV8A 5GNZA 3W26A 4D9RD 4X8JB 5D1XE 3VNJA 5BW7C 3QEUA 1W1A1 5A6LA 2UZ9A 2J56A 1MI5D 1MVUB 4F8OA 4E8DA 5LIYX 1SN2A 3FHAA 1EHKB 2B4CL 4H7CA 4B3KA 2LLEA 3RITA 3PNWA 1K6QH 5SWSB 4IHOB 1XTMA 5E9DE 4ZW8A 4G43B 3VDBA 4IJBA 4FXKB 1E5AA 1L6FA 5IHWA 1TQXA 3IDYB 3VFOB 4HJUA 1OT2A 2W5FA 5C0FB 4HHPA 1PS3A 3BEWB 4FQ2L 4H1LB 1CBVL 3A6CL 2OMTB 4A2RA 1OF2B 1XCFA 3BHBB 3DZ1A 3KLDA 1YCSA 1OAUH 3BSHA 4HCRL 1KXVA 4IMKA 2EDQA 4LLWB 4NQCD 5F88B 1HO1A 1REQA 4QHPA 5AFDA 5DJ0B 2C14A 3OAYH 4F40A 1U21A 4DN4H 3MA7B 3HCVA 1AYRA 2J5LB 2YXFA 2CDFB 3FOMB 4PBDA 5L4FA 3GUTA 4O11A 3NCYS 5CP7A 1IT7A 3WMPA 2ZAGA 3H4GA 4XCYA 5IEKB 3KGRA 1JPGA 1GKRA 1XBXA 2E25A 1DVUA 3VIMA 1BVKA 1DLHB 4G59C 4MQ7A 2VCCA 4IMFA 3QH3B 1HQRB 5I09A 5D2NC 2A83A 1Y0LB 3E0LA 1IC1A 1NMBH 3GPEA 3LEVH 3ZX1A 4BF7A 1RP8A 1CR9L 2UX6A 1J87A 2X6AA 3CFNA 4UU9B 2F53A 3T0TA 1JPSL 1XAKA 1OJXA 1UH2A 4HUKB 2GK1A 3DI1A 3Q1SL 1OEPA 2YHGA 4NQCE 3MVTA 3QDGA 4JVPA 4X6CE 2X42A 1PYFA 1IT0A 8FABB 2RR3A 4JRLA 5ALCL 3ZDXE 4C54A 4XRCB 3BGFC 5EOTA 3NJGA 1FWSA 4NSKA 2W60A 4D0DB 2VC9A 3M47A 3QNXA 1BBDL 2GTWA 4M7JH 4ECLA 4B5ZA 5FDWB 2E6FA 2JJSC 3I4KA 4BH8A 3C3UA 1MCBA 1QZ1A 2QJDA 2NX3A 1FC2D 4C58B 4G3YL 3N6YA 2WSQA 4UT9L 1IAII 2PPDA 2Y4SA 4JIIX 2DQGL 2YS4A 4MTMA 3KPNA 3QXWA 2UXGA 4UILH 1EGVA 4O18A 4OSUH 3QH3A 4OZFB 2XYLA 3RJXA 2OXHA 2WV8A 3EZ8A 4C8XA 1GT8A 3FT1A 2A3BA 3MRQA 1F4YH 1KBPA 3V5HB 5F7NC 4DZBB 1X8FA 1PTGA 1DPMA 3SYQA 1T83A 3BAJA 2ADYA 1RK1B 3ZTCC 3GD1C 2YA0A 3E49A 4F2EA 1OB1A 3DX0A 1MCLA 4JRYA 4FG4A 2DVTA 3QUYC 4NNCA 1ZANL 4ZYKA 3C6EA 3FBKA 4MQXC 3RIFF 2C3XA 5D96C 4CRPA 4PWJA 5D2YA 1XQ4A 2QL1A 3HE6A 3KW8A 2CLZB 1DEDA 3C60C 2BVDA 4FR6A 5J1TC 4JQ3A 1B88A 4REQA 5CCJA 4BWLC 2AVGA 3F7QA 3PXHA 1A2YA 2PABA 4A2SA 4KWVA 5C0EA 5HYJA 4P23C 1R3JA 1MEHA 2HISA 3U9UB 4XD3A 3BANA 3HTLX 3QHZL 4NP4H 3PQYE 3EOUA 1O6IA 2Y70A 2VQ4A 3W82A 4NENA 5TE7H 2ZKYA 3FB5A 3P4OB 3FIGA 4RWYH 3LB6D 2NVCA 3KEDA 3CN0A 1DEEA 2WBXA 2JIWA 3B8IA 5C9JB 3CFMA 1E9QA 3RUBL 4P57A 1AG6A 3AU1B 5K9KA 1M05A 1PG7X 1I8MA 1XG3A 1A4CA 3FUDA 3ME0B 4PJ7F 5C8JA 3CPUA 4BFJA 3BG5A 4OECA 4DOHE 1CL7H 1IBGH 2IOIA 3T07A 2R56L 5FYKH 3PY2A 4XBJA 1AD0A 3LCIA 1H6TA 5AC7A 1ETZA 3QJXA 4GE8A 2FFCA 4RFOH 5FYKE 2YIHA 4HUXA 3AGWA 1E6ZA 4JAMB 1R2SA 2AJVH 2VO5A 1D6EB 3BAWA 2C3HA 5ADPL 2CJSA 2YQ2A 3A67H 1IQDA 4XR8C 2UVEA 4QXWA 3STZA 4QRAA 5EOQL 4M82A 3OHXB 4S1QL 1EYWA 4LARH 3V5DB 2Y6ZA 3LA4A 4PMUA 1T6MA 5LCVA 1XO8A 2HT2C 3NZUA 4U5KA 3P11L 5HDWA 3NIDB 5EZIL 1AHMA 3ETTA 5E9DA 2VDRB 3BWUF 3V4PA 1TCDA 1NARA 2F08A 2VLJE 1QYGH 2XZAH 2F8IA 1QA9B 2ZUSA 1JFXA 1W32A 2V30A 3ARDC 4JGNA 1JHKH 2JE8A 4E36A 3LHVA 4HK3N 3R7QA 3NJJA 1HH6A 3I9GH 2DORA 3IF1B 1AYOA 4NQDB 3MQTA 4NKOB 1G6RA 1OVZA 2XH4A 2GVEA 3MMTA 3GMOA 1XIWB 5C09B 1J8VA 2RGLA 1TQSA 2E9JA 2DBLH 2R1XA 1H51A 1E4XH 4YSDA 3TNOA 2H32H 5CEYA 3JYBA 4PN6A 4HJJL 4GXVL 4UFMA 3BW9A 2ENPA 2ZOXA 1FDYA 2G2RB 4P46C 1RK7A 3VM5A 1IKFL 5HMEA 1T0NB 1X5AA 4UDTB 1XGQA 5E7FA 5I74C 1K85A 4B91A 4WFHE 4UNIA 2YLKA 1Z2KA 3IS1X 2ZOKB 4OIBA 3QM3A 2OQHA 4N2YA 4QKXB 3NCCB 4NO5B 4AIZA 3QNYA 4D94A 1IFHL 4UB0L 1QVOB 5M95B 1CLZL 2A4CA 4IICA 1MREL 4BKTC 3B9AA 3U30B 3QO1A 4X42A 1T4KB 4DW2L 4G2AA 1W8EA 2YD3A 3MJGX 5BV7B 5CF3A 4ZSTA 1YTEA 4PI2A 3C61A 5BXTA 1KBJA 3KXFB 4FQXC 2GSIB 4Q6YA 3SPIA 3R19A 1ZD6A 1ASQA 2X9WA 2DQFA 4TVPE 5HULA 2R29A 4I6KA 5KYXB 4R5VA 4NLHA 5A2JH 1S9YA 3SIKA 3TPKA 1IGJB 4N1CA 2PR4L 1E1CB 1VFSA 4WW2A 1AANA 4TVPD 1A3XA 3NYDA 2EZ0D 3O2LA 1UIOA 4AHQA 3GIZH 3FT0A 4LFYA 3HJEA 2FQFA 4A8IA 1UD3A 1OZUA 3CSYA 3WKYA 3AYSA 1JR1A 1Q8AA 3HGRA 4L9YA 4XVSL 1MZYA 1HHGB 3TT3L 2CIKB 4HOXA 1HHHB 1QW9A 2EXYC 2XWBA 1QYGL 2XZAL 4DVRH 4AISA 3PGFL 3SGJA 2VGFA 3MACL 2WZPA 5EDSA 2WNNA 3SCTA 1LO3H 1ZHLA 4FP8L 4K3EH 3QGKC 5D30A 3GDTA 2CHZA 3MJ6A 5A8OA 1Q90A 3G5YB 4PJHB 3DHDA 1G6CA 4PTNA 3STGA 2C1GA 1MRAA 1KPUA 1QUPA 2R83A 3N12A 2I7SA 3T3MF 5JHBA 3H2QA 2AGJH 3LKNB 4UT6A 1AGBB 4Y16C 1KJVA 1OAYH 1OAXH 3G5XB 3GSUA 3W7KA 1WBYA 3U6WA 5GS2D 1AW2A 3S35L 4GQQA 3F4CA 4PREB 5FXCH 3VNIA 3ZDXF 2VB5A 2UY2A 1EZ2A 1SF5A 5LO7A 2AL1A 3WEBA 1AXIB 1XV8A 5GGTA 3T6WA 3BPOB 1PU0A 4NJ9L 1EWHA 4X9FA 3AU2A 3WF2A 1A3LL 3MRCB 4ZAKD 5C86A 4RDQF 4NILA 5B4MC 2CAKA 1DN2A 5C9JA 3HJZA 1RU9L 1XBZA 2D7TH 1TTFA 3L3GB 4WFED 3U4FA 3NRPA 1A7NH 4CCCA 3O6KH 2QR6A 3LS9A 5DD6B 1SYTA 1RCYA 5F7FA 4DZAA 4E9SA 1GAFL 4DY1A 5DJDB 4F37K 2XBZA 3MJ7B 2QPSA 3TZNA 2VDKL 1B2YA 3BVXA 1IV8A 1V7YA 5FIPA 5PCYA 1X7QB 3T4AC 1PBGA 4K68A 4YSOA 1XDJA 4ZQKA 1HKFA 4LCYB 2W95A 5KVFE 4L3EE 3VYPA 3JWOC 2FQIA 3WJLC 4UNLA 1RQBA 4JO1H 1NFDE 1IAOA 2P10A 3IEBA 4IU3A 3Q5YA 1F07A 2NY5L 4KK8C 2DQHH 1ICTA 5D7IB 3D0CA 2O6CA 4OGXL 1FO0H 2C19A 3OKLA 2E9MA 1XHHA 2QELA 5F2FA 3T3PF 3IVUA 4IPJA 2O61B 1E6NA 1EZWA 3NIYA 1ZJAA 5ESVA 1KULA 4ICMA 4I7ZC 4MKNA 1NAML 1EHXA 4ORGA 1JZHA 2QCMA 3R43A 1I7RA 1DJSA 1FWGC 5SV4A 3NO5A 2EUVA 2UBPC 2HV5A 1SJMA 3T4YB 1AS6A 2NXYC 5L8LB 1U4EA 4UZUA 4L3EB 4HFUH 3D05A 4R7DA 4LPXA 4YLBA 4FFZL 3SJVE 1B3YA 5MENA 1QPXA 1V5JA 1X6NA 1UWSA 4XGZA 2ZE0A 4L8BA 3SDDD 3PPSA 2Z8WC 1V8EA 5D1ZA 3ILPA 3ZQXA 4RA3A 1F90H 1Z0MA 1ZS8A 5EUKA 1BEUA 1EJRC 1MUCA 3W3OA 2DZSA 1IIKA 4ATLA 3MV7B 4ZFCA 1FNHA 2XBDA 1KGIA 4HQQL 3GSOA 4J3OC 4X5PA 3T5WA 5JW4R 1CMOA 1PDYA 4WGVB 5EU4A 4HTYA 3C9NB 1G5AA 1TG8A 3Q8FA 2AJYL 1T4KA 3GPSA 3QZBA 4Q6KA 1NMAH 4GBXB 2IAMC 1NCAL 1QBLL 2D7NA 5DCBA 2YEVB 4B41A 5LNGA 2A21A 1UQZA 1FO0B 1AO7B 4EAYA 3RZCC 1YC7A 3WD0A 3TNNB 1WZLA 1NDYA 1RPXA 2O6FA 3SZKC 1VCGA 1BVOA 3RGVA 1DVYA 1RUML 1UWGL 1YEDA 1UT1A 1UEYA 5KSWA 1XIMA 1M3UA 2FDSA 3BQ5A 4CDHA 3OZOA 4EPKA 1P53A 4ZSOA 3BDYH 2QQ6A 1Q6EA 1EGJH 3U7YH 3E6FA 1OY0A 4KS0A 1V02A 3CEPA 1HSBA 1IX2A 4FZ8H 1HVXA 1YY8B 4R2GB 2Y3AA 3H7BB 3V6FB 1H2JA 4DI9A 4KZEL 5JPNB 1AXTH 4YFLI 1NWSA 1H3UA 3N3TA 5F88A 1L9QA 2OXHB 4YZFF 2F5BL 4LUJA 4LHUB 2AJZB 4KKLC 4Z3EA 1FLTX 4UQ2B 3UBXB 3MGTA 1E5NA 1XQKA 4WD0A 4U1IA 5KTEH 1PW3A 1B4KA 1HVQA 5B39G 1SM9A 1PD1A 2CKBB 1PKLA 2ZOOA 1JBJA 4H01A 2YPLA 5TAOA 1ZK5A 5AAWC 5T1KD 1M6JA 1I1RA 3V0GA 1KCLA 3CFKB 3NCEB 4X80H 2KZ1B 3BWAB 3VWKA 4Q32A 1LM8V 4E3VA 5CIPA 3IJ9A 1R5YA 3NGBC 1DCEA 1JZGA 2F1EA 2D9CA 4NFCA 3FQTB 2MPAL 4ODUB 2HJFA 1MDTA 3VUSA 1P5UB 3MLRH 4OZIF 4FXTA 2CRIA 1LNUB 3HHMA 4F7TA 4KUCD 5GJTH 1H41A 3DIFA 3NZGA 3T0WA 1H6UA 2NNXA 5JIPA 5AFAA 2QZ5A 4LIQL 1FHNA 4PI0A 5EZOH 1FZMB 2A1WL 5DJDA 1DVFC 2H41A 2XN9B 5I8EB 3P9LA 5GJNA 3CFEA 5DD6A 3RDTC 4TMPA 4PE8A 5TD4A 4B2DA 2WMFA 3HF3A 1USQA 3LMYA 2IOMA 3CIAA 4CNIB 4P57B 4IX2A 4KW2A 2YD5A 3D51A 2V6AA 1HH9A 1MW3A 4YN3A 4ATTA 3WE6A 3SB0A 5J6GA 4E38A 5CJOH 4YLWA 2PR4H 1BBJB 4KVNL 4G9FE 1NC2D 4X9HA 6FABL 1MZHA 3AUJA 1XB3A 4XP1H 1KFEA 4U6HB 2B1AL 3MDWA 3ZGIA 1NCDH 1QNZH 2OJZH 3QZPA 4FQXA 4H20H 2WQAA 2E6JA 1KLGB 4NJAL 1J1XL 4TQEL 5D7IA 3SBWA 1INQB 2A79A 4KXAA 1XINA 3Q2CA 3O2VL 2FB2A 3PP3K 1EF3A 2E74C 4GUPB 1UZ8B 1WGVA 3SE8L 3O3BA 3PWLA 3CMJA 3O0FA 5F1NB 1YZZA 5IKCA 3CB3A 3LZNA 2NZ9D 4TPRL 3TO2A 4AC4A 4RNIA 1WLHA 4QHUB 3CH9A 2MOQA 4E5XB 1G4TA 4S2SB 3QW3A 2Q8LA 4UIMA 2ZZ7A 3QPZA 5F2GA 1KGWA 3MUGB 1T7WA 2DWDB 4OWGA 2D3NA 3QK0A 1W9PA 4X5LA 2NXZC 1R3SA 2UZPA 5F4SA 2KLSA 3V0HA 3H9SE 2NW3B 3B2PA 2OR7A 1FBIL 1HSAA 1LP9F 1YYMH 1YPZE 2GVYA 3O41A 4NENB 1Y8BA 2PB1A 3ARGB 1A5MC 5DZNA 1OC5A 5F6IB 2OGYA 4U3AA 2N7AA 4NO0D 1CGSL 3G0UA 2FH8A 4MAYD 1ZSDA 5I8CA 2FQGA 2XV3A 1DJZA 4YHIB 1BMWA 1BGAA 1E0UA 4WKHA 1W0MA 5JW5A 3GTTA 2YN3A 3C0SA 4J3OD 3VC5A 1QR4A 2VITA 1I7TB 1QOPA 3UY8A 5AKQA 5EEYA 2ED8A 1BD2A 1TKWB 4JG1H 3N1GC 3R8BB 2K3HA 4WWID 2LT9A 2XUWA 4HU3A 3S5LG 1SO6A 4XWUA 1W17A 3VCCA 1Q0EA 1EJWC 4WJXA 3F5WA 3BKML 4N5EC 3NZPA 1AW5A 5DCEA 1HCZA 1NGWA 4ASTA 2PD9A 1UD8A 3VZYA 3D9AL 4XPTH 1VESA 3STZB 1EHLH 1GW1A 4AH2A 4MNQB 3GS4A 1D6VL 4NKQB 3RX8A 3KZSA 4JO3L 3FW6A 5F9DC 4AG4H 1HG3A 4CW1A 3OW1A 3WF1A 2ROYA 2FYYB 1SJVA 1T80A 2L4OA 4MDRA 3W7JA 1NBQA 3HAEA 4A3RA 2ZUVA 3P0YH 2Z2BA 4JFEE 4QO1B 4KWOA 1EYEA 4HJGA 2QS8A 2Z35A 4EI0A 5GGSY 3HS9A 3NCFB 4RFEA 3UZJA 4Y88A 1KF9B 1JPMA 4XISA 4QE5A 2A3CA 5SX4I 2WWKO 1NCIA 4G8IA 4GACA 4PJCB 1JRHH 4PL2A 3SGKC 1L6GA 2GBTA 2Z7UA 5T5NG 3FONB 5E5UB 4P2OB 5EU3A 4QBXA 4MAUH 3AU0A 1GYCA 4IIGA 3TOYA 1HYSC 4LRNH 4WHTA 4KI5D 4NPYA 5IMKB 4MNHA 5C9UA 2QR0A 2WIMA 4WGWB 4RGMB 5IVNA 3W2DH 3BLFA 2JK5B 4YDZA 2EVGA 5L88L 4GMSL 2FJGA 3NPZB 5EN2A 5F0PB 5EZPA 2VC5A 4MWAB 3CV6A 3BN9C 3KOYA 1W5PA 2DH2A 3QUZD 3HBPA 4O2EA 1C8YA 4O02B 2QMKA 3D39D 5I75B 1JJKA 1MDRA 4JHWL 4MPQA 1SBBA 4WNQB 4C83B 4BK8A 1ZGLP 5AC5A 1E2WA 1JGDB 4GVHA 1GZPB 3K0WA 1PZ2A 3QZNA 2OX4A 4RAUA 3VFPB 3AY4A 4Z3FA 1OFEA 2UWFA 3VB9A 4L4MA 1YMME 3VOFA 5FJPA 4CNIA 2FLMA 4AK2A 2PWUA 2WY3B 3LNIA 4JTCA 2FGWL 3HLAB 2P52A 5JIHA 1DL3A 4U1LA 1EP1A 3KM2A 3SEPA 3ITGA 3LHUA 3SCWA 3PDDA 2A9CA 4N2IA 1HIZA 1R87A 3TN5A 4E5TA 1DEEB 4N0YH 2VZTA 3NJKA 2AL2A 4QI3A 3ULUL 1AMYA 1JZ6A 4JHBA 1DBKL 3SAZA 5T5FL 4O8RA 2VMFA 2MCPH 5C9XA 5FX3A 4HU4A 3I2CH 3VAEA 2BHFA 4BJLA 3FCBA 2YWYA 2DEPA 3TCSA 3AU6A 5JBEA 4YHMH 2GBAA 3Q45A 3UR7A 4LF2A 5C0EB 4H9ZA 5DRXB 5HDLA 3GNMH 2G5BB 4ODHL 2PLJA 5FYKD 1DIKA 1P1VA 4BHUI 5KN5B 1XCXA 3N0AA 4HVBA 1S7SB 1HZLA 3TJ4A 4IU3B 1KB9J 3VG0L 1IAOB 3GW3A 3FFDB 4AD2A 4PWKA 4Y9FA 1PE1A 3FQ1A 2VDRH 3DGGA 3O6LL 1NEYA 2ITEA 4FULA 2MHAB 3LQAC 4OLUL 2BP0B 1A14L 2BVTA 2OMZA 4NQTA 1MFUA 4BCZA 1TA3A 2O7SA 5KYWB 1FQ9C 4MNQE 3O4OB 3VUAA 1SDDB 4W87A 2IWGA 1YEFL 1CDYA 2IXUA 1E5UI 1IGTA 2GJ6B 4L9LA 1Q4WA 4GW4A 1NSJA 2PPFA 4I77L 3VXMB 3RFAA 2XWCA 4KFPA 1MYRA 2Y2TA 2G60H 3MNWA 5GSVB 2OYPA 4KCTA 1FSKC 2DLEA 2N01B 3REWB 2EPHA 5SWZD 5J04A 3NVQA 1EX1A 3ARXA 3QWRA 2JB5L 3VH8G 4HNOA 5CLYA 1RQ5A 2XH0A 4AV4A 5EEZA 5A6KA 1D5ZB 4LUYA 2Y8KA 3O3EB 4I1RA 1N0XL 3ASWA 4PJBA 1UUOA 4JZNA 5ABHA 2JB6B 4GZ7A 1TLKA 4OJDH 1PX4A 1PUDA 2A1WH 4M6NL 4HV8B 4OLYH 1SW0A 1W3IA 4OT7A 3DTDA 2IS7A 4OFKA 5GS0L 4S3JA 3X1BA 1SY6A 3BH9B 2BJMH 3MR9A 4G9FA 4PVNA 3EWYA 1MFCL 3I68A 4PG2C 3OXSB 3JS3A 3QA3B 1OV8A 4JYDA 4XP6L 1NF0A 1WA1X 2QADB 4Z2IA 3MRHA 1ZVHA 3M41A 1OYAA 2AMXA 3DENA 3KZPA 4ADJA 2MOVA 4ERIA 4B5UA 2ZXQA 2HKHL 3IU3B 4PVBA 2PPEA 4CD5A 3DTUB 5DX7A 1H7PA 1RURL 3EJPA 1X5FA 2YB1A 1IRAY 4Z77A 2Y61A 4HS6B 3QNYB 4MX7A 4OUUB 3GMNB 2NTFA 3BUYA 3PSVA 5AW2B 1H1ZA 5LGJA 3HGJA 2XFXA 4CJ1A 3GNML 1IUZA 2EDMA 1XBDA 3VD3A 3SDCD 1U91B 1BVKB 4MQ7B 4X6FB 2Y6SC 5BW7A 3MZ2A 5DMJB 4BCEA 4CC0A 1C8PA 3O2WL 4H8WH 4XCYB 3B9VA 5IEKA 2VC7A 1FNLA 4UTTA 1WAAF 3VVVA 1IGJA 3PTDA 5AHIA 1FWTA 3IANA 2PDHA 2IQAA 2DUXA 3THDA 4LAQL 1S5HA 1KEGL 1XJBA 3UYCA 5D2LE 4QFUA 4GLRI 5DC4B 4WK4B 4GYKA 5L2KB 2RFGA 4D1JA 2DB8A 4LLQB 4RWYL 4GA8A 4D7PA 1RHHB 1JYXA 2XXFA 3B8SA 1V6YA 4KEMA 4MMXC 5DJCB 3O9WD 2I9EA 4L65A 4UTHA 2A6IA 2EYRA 1A7OL 1J86A 1DSYA 3GSNB 1AZCA 3QIUB 1KWGA 2BSRB 2X70B 3QUYA 8FABA 1WKYA 1S78D 3Q37A 4XV0A 4UFIA 3CFJB 4WEVX 4MA1C 1QAPA 4Z1AA 3WDJA 5DU7A 3N9SA 2J8UF 4XPFH 3ZIMA 1KYUA 1U6AH 2J13A 3MO4A 2CR0A 1ENUA 4PJ5E 4HWBH 1UXWA 3OVGA 5BOFA 5C07D 1KPUB 3UG5A 4Q4QA 1OG0A 1ACZA 4WO4C 4L48A 5HVWA 1IZJA 1BWWA 2XY1A 3EA1A 4AD1A 3VACA 3PZOA 1TJRA 2WNGA 5FJRA 4D2JA 5C0IB 5FM5M 4HF5L 3IARA 4EXPX 3MRQB 2IWFA 1G6RB 1DV7A 2GGIA 1A7PH 2K70A 4LVGA 3FZUC 4ZT1A 4JHOA 4JFXA 1TE1A 3UTTD 2P5WD 1BZ7A 3NSJA 1KM6A 4XWGH 4TR9A 3GNOA 4HIBA 3MRBA 3LZPA 4FZEH 1QK0A 5G2IA 5GS0C 1NVMA 4B5SA 2AGJL 4G80B 4IISA 2JJTA 4WUUB 3GZQA 1U58B 2AJUH 3U6XA 3CB8A 1TU2A 1EC9A 1XCTA 3N2JA 4U7SA 4YX2H 3EWCA 4H8VA 3IBEA 2Y5JA 1OIOA 4G11A 1MG2C 5DA4A 4R84A 3WQDA 1QO5A 4U6YA 1T7LA 1S6NA 2GDUA 3I9GL 1U92B 4S3EA 5D1QC 4IBYA 3L3OA 4MD0B 4ORMA 1B3ZA 5EORH 3D25A 4Y2LA 3HG0A 4EAEA 1NMBL 3T77B 3LEYL 5I1GH 2ZUNA 4W9ZA 1NCBH 4FNTA 1BWLA 3W6MA 2XKUA 3IRPX 2Z8VC 2HQAA 1HNYA 3WUWB 3KPQA 2QUNA 1NU5A 2R8WA 2ZRZA 4NQEB 2XICA 3D3VB 1EBAA 1M41A 4UFLA 4XXCA 3MDJA 5FM5O 4EEEA 1PKQA 2Y89A 3CDZB 3I6KA 4M3KB 4WY7H 2ON3A 1E9QB 1G69A 5I8KH 4IS6A 3GIVA 4OCRL 3LI0A 3NPSC 5C0BD 4EZLA 3SQMA 3O6FD 2IGFL 2ROXA 4NAEA 5C2CA 4PRBB 3E5BA 1C16A 1RCXB 1QFUL 5T8GA 2CEQA 3PR2A 3TO4C 4ZTPL 3U82B 4JHAH 4GP4B 1IWAA 5BU6A 5BMXA 4Y2DA 3N42B 3JV4A 2K3TA 3QDMD 5F7EH 1LQSR 1YUHA 2EYSA 4XMPH 3V0VB 4AVNA 3V7MA 2YR3A 1LOLA 2CGYA 2YAMA 2PODA 1KFLA 4Q8OA 3BOFA 3L3OB 1ML0A 4XMUA 4PJBE 4UT7H 4Y9GA 3EYSH 1YMMD 1GGCH 4M6OH 3REVB 3ULUH 1WTGT 3QGVA 1GVIA 5EO1B 2EEBA 2B81A 2WXJA 3QISA 4FQLH 1XD1A 1NC4D 3POHA 4N8VA 1UT9A 2BRQA 3VCLB 3LYEA 1O12A 4FOJA 2GTWB 2WZAA 3WJMA 4JFQB 1ZGLM 4K7VA 5KMYA 4UIOA 3TN0A 5ANMB 2ZOLA 3PUCA 3RL1B 4A68A 2AJUL 5KJRH 4X7SH 1I1YB 4DIXA 1AP2B 2QDWA 2ZKHH 3UETA 1Z9LA 1MFDH 2P8MA 2ZA1A 3VG0H 3W0WB 3C5ZC 1RIUL 2B4CC 4GG6E 2EXWD 1G7MA 3OLIA 25C8H 4BM7A 4D8PB 1GOKA 2B39A 3IJEA 5F7DB 3CWNA 5I79A 1N4XH 4U1HA 4LTSA 2WV3A 1S5VA 1C16B 1WIUA 5CZTA 3TX4A 3A6BH 2ZTJA 2GEQA 5AW9B 1AD9A 3QZEA 3S5OA 3UJIL 3RK8A 4NOBA 4AZHA 1WCBA 4GNVA 5DHDA 4HPGA 4YDKL 5EN3A 1KBGH 1UJQA 1CFQB 4KVCL 2QKIA 4LBSA 4B3EA 1KB3A 2R69H 1AY1L 2VOTA 5C0BB 4A6YB 3VFRA 3WY1A 3B3BA 3CFJA 4B97A 3B43A 3SQBB 3R94A 3AC0A 1BQSA 5HGGS 2V8ZA 3W1NA 4AQ1C 2DIJA 2XTJB 4IPPA 3I4EA 3P81A 4FYRA 1PSCA 4HZLB 1OFBA 3OVUB 1QOQA 5K39A 2Y5QA 3QJQB 2PP1A 4GXMA 2BY2A 4WSHA 4RX4A 4F92B 5HYJB 2BHYA 3NXLA 2VDKH 1C9DA 5CSZB 2SEBA 2CR3A 2WHVA 4WVXA 3BKCL 3WLSA 4OM0L 2XZ7A 4GX9A 3MV9D 4JY6B 1EXHA 4YNYA 3V5OA 4IJTA 4J2XA 3C09C 1I9CB 3L3JA 3CQQA 1Y5XA 2PFHA 3D50A 3WU1A 4O1BA 2VSKB 1IGSA 3AU1A 2ZRWA 3DFNA 5ECVA 1ODUA 4ZMOA 1ICPA 2BC4A 4DQOH 3ZOAA 2Q7AA 3FJTA 3Q1EA 4LB8A 4HGWB 5I03A 5IB5B 3O9WC 3MI6A 3N2XA 3URQA 2YYTA 2DQIL 4MA3A 1OIMA 3E3QE 5C0DA 4W9CC 4JPKL 3H6OA 3O3RA 2X2IA 3GBDA 4G8EA 5D37A 1BD2D 2ZXGA 3L65A 2QAFA 1FNSL 3F00A 2YD2A 2XQBH 2Z26A 2VDML 1CICD 4N8UA 1QNOA 3Q2DA 2R1LA 4Q52A 2OGJA 3PZIA 3O0KA 3O2DL 1ZQ5A 1Q5MA 3RGHA 1L9PA 3QFGA 1VFHA 4R0LC 1JPSH 3EHBD 3HRZC 1BEXA 1NWTA 1XBYA 2Y6SD 2QJMA 2CNZA 1YMHA 4ANKA 5I5RA 1JNEA 2HVJB 2H26A 4S1DD 4CVUA 1OALA 4RZCA 5F97E 1HW6A 4FZIA 2QYGA 3OR7A 1JWUA 4P3WA 1VFFA 1KLFA 1R75A 2JKLA 3TSDA 2XIIA 3BESR 4WI0A 3QIUD 3NIFF 1FNEA 2CXGA 5AW0B 3S35X 1M56B 1UR2A 2Z1SA 4PRPB 1YXDA 4NX5A 1FNFA 3QIWD 1ZLDA 4ZB2A 2NWRA 3HC3H 1HL2A 3LK6A 3GB6A 1ZLPA 1F8MA 4KXCA 3GEWB 5DQJB 1J1XH 1FWWA 1A4JA 3C5ZA 2VE6B 3CPLB 3FB7A 3QO0A 1XLFA 1JGIA 4TVUA 2HEJA 1MF2L 2FVKA 2NSOA 1D5RA 4KJWD 4LLVA 3MA9H 1TZIA 1GC1L 1PFOA 3EYPA 4JR5A 1U2YA 3EIFA 4GIYA 5CLXA 5BRZD 2DWTA 3RVVC 2XZCL 3LQGA 3M1ZA 1EFZA 9XIAA 2VJXA 1XKYA 3BVDB 3EBGA 3DYMA 4U1NB 1Q0YL 1XUUA 5EU6B 1TJ0A 1EAPA 1ID5I 2WVSA 2YOCA 3NEXA 4XB3A 2XN1A 3QQNA 2NQJA 3RGVD 2WVUA 3K3QA 4XSLA 4JZJC 4JTGA 4QHKJ 3B37A 2NY6C 3IJ8A 3PPEA 2Z64C 2B16A 2R2HA 3LEXA 5I26A 2PDJA 5ICUA 4HK0A 3H9SA 5DJ8B 2NNAB 4NRZB 4XBMA 3CE1A 3HQOA 4M56A 3T05A 1FV1A 3LCLA 5AOUA 3HGOA 1PKQE 1EGMA 4JG1L 3Q0HA 2CRZA 2OYLA 2XWXA 3UH8A 1XISA 4PMXA 3TT1L 1JN6A 1N10A 2VFEA 1CG9B 2ISDA 4Q4IA 4JB9L 4UYPA 3WXWL 3MQIA 1II4E 5ESAA 5D7JA 4WHBA 3D3AA 3MCLH 4HPYL 3STPA 5D33A 1ONXA 4HFWA 4CC4C 2EJ1A 4OF8A 5HGHA 1EEXA 3TU6A 4HJGB 2W0FA 1A6UL 5BMFH 1Q7QA 3VFCA 4BQ4A 3NACH 3W73A 4P2CG 4ZAKA 3RG1C 3TQVA 5I3KA 3SDXB 5PTDA 2EXSA 4EN3B 1ZHKA 5FKPA 3IDXL 4BKLB 3FTYA 3TW7A 5IBTL 1KV5A 4NEHB 4PP1D 5I07A 2HT2D 2K45A 3O81A 1AC0A 3OHXC 3RGBA 1W3TA 4LOUC 3VAVA 2NQZA 4OCLC 1B4LA 4AM0Q 1T1YB 3BT2H 5EIIG 2VM8A 1TQUA 2AABL 4ODBD 1D2PA 1AAJA 2FZ3B 3BIAX 3FN0L 1M7IA 1XGUB 2FK9A 4NF7A 1WFUA 2E9GA 3VGFA 1TR1A 4UFKA 3TFCA 1H8SA 4ZDHA 4HSNA 5IM7B 4OCWH 5J6HA 2PGWA 4Z1CA 1R7OA 1UR0A 4EIGB 5I19L 5FAAA 2R9HC 1Q72H 3C8KA 1KIPA 1MRQA 2XSKA 3IU4L 4YVXA 5K93A 1QWKA 4JJ5A 1G7IB 4WW1B 4E41A 2ESCA 4ZTEA 1MEXH 3MO1A 5A3ID 4A04A 1EWEA 3APYA 2OJZL 3G22A 2OMYA 1BAFL 2YMXL 4LLUA 1CUOA 2HXUA 1N7MH 3L1EA 4DEFA 3KVKA 4U1JB 1BHGA 5C0AE 3QCVH 3QUZC 4GO6B 3V9CA 4D9QD 1D2KA 4G8EB 4ZX5A 3UXLA 4ONGL 1I1XA 5K69A 5D7JC 2WPBA 5M1TA 2GLKA 1XIWC 4UINL 4MA3B 2Q8BH 1EAQA 1NLBL 2QLYA 4OZ4A 4LSQL 1X6LA 4X6FA 3U83A 5DT1H 4EXKA 1UB5B 1J1PL 1JPIA 5EA0H 3L68A 3UERA 4Z5RB 3PWJA 2WAQA 3I10A 2FPTA 4YGVB 3GSVB 1UWQA 4ROPA 2AW2A 2VC2B 3KS0J 4WI2A 3BW4A 5CH9A 1YMHB 1EEPA 4MZRA 2D0HA 2FZ3A 2GK0B 3EYQD 4XE0A 3SY0B 1L4IA 3CFKA 3X14A 4JB9H 2V82A 3FT3B 3M6YA 3QOKA 3SCSA 3WQVA 1MWAA 4G2DA 1LP9E 4MD0A 1DDTA 5F3FA 4KZ0A 1R9YA 4NU7A 4RH4A 4US5D 5IQ9A 3F7KA 2P1FA 3G1FA 1Z3RA 1KBBA 2XLLA 3UPRB 3VD7A 4BQBA 3REQA 1T5WB 1UXLA 3IFPB 1WEJL 1AQKH 1TCMA 2IBGA 3F62A 4UTWC 4YDJA 4QRSB 4UM9D 5K9QG 3VI4B 5L0QC 3DIVA 4ERSL 1JGUH 3K5RA 3ZKXB 2H90A 2VRKA 4APQD 2O5YH 4P5TB 2AXGA 4TL4A 3TC3A 5IOPA 2YEZA 4JQXA 1ZXQA 3UJJL 1A53A 4S2BA 3BKCH 4Y9AA 1TZGL 1SXAA 3EHBC 4A55A 3HPSA 2P3EA 3CPLA 3QO0B 1JWSA 4Z95L 8PAZA 3JZEA 3GRWA 4P2OD 3PGCB 4GOSA 3VXRD 2X30A 4N9BA 3V3WA 5DD3L 3W39A 1DQKA 3SQOH 4XMTA 1JRBA 1U8PB 4MYPA 5MI0C 1UOKA 3F03K 1ES0B 2WKOF 3MOAL 1UG9A 4M5YL 4IOFC 5C7VA 1EAPB 3G6JB 3T2NL 2D7PA 3UBGA 4K7PL 4L8SB 1EJUC 2ABBA 2J7LA 4KZDL 5HGBB 1UQSB 4LBAA 3GM8A 2I14A 4LSSH 3GEFA 2BOGX 2L0DA 3HFYA 5FOJA 4IZGA 3SURA 3P93A 4JFQA 5G4NA 4O9HH 4OFQA 3GAKA 1ODAA 1YPXA 4TMBA 4UZSA 2BSTB 5DZJA 3KUMA 3OD3A 4OT1H 4I0CC 5C6TL 3TNMB 4JFPB 1W0VB 2D9QB 4MJ6A 4NBXB 5INCB 1E7UA 1N59A 1YEYA 3B3IB 4KKAC 2ERJB 3GS7A 2BK8A 4HBCH 3FK3A 2MPAH 4A7SA 1RCQA 4YVVA 2JBMA 4R5EA 5D2NE 5JPMB 2AL2B 2WXOA 2ZXEB 4YHYC 5HINA 1QNSA 8XIAA 2A1YA 2D7MA 4U1HB 1IB5A 3ZE0E 1AO7E 1TOXA 1KJ2L 2ODOA 4DWSC 2WHKA 3RP1A 5GGUA 4ZMPA 1SZRA 1TX0A 1ANUA 2PDWA 4LCCC 1JPTL 2C3VA 2ID5A 4GY0A 4XKYB 2L7UA 4N28A 1S7RA 1JOIA 2C1PA 2JIXD 3GS0A 3IDIA 4J6IA 3VXNA 4AW7A 5I5MA 3IJIA 4UC5A 1RZFL 2NYYD 3W88A 3BWAA 4IDJL 4P23D 1UCTA 1FN4A 2QGHA 2QGEA 3AWOA 1TZGH 4N0FB 1I3RB 1CYWA 2B3RA 1F8IA 1O7VA 1VKXB 4CMMA 2GGEA 3USZA 2QCGA 2V2CA 4PP2B 1CQYA 2IGTA 2WC4A 5EKYA 2NW0A 5BCAA 3BZ5A 1O68A 4G5DA 4Z7NF 1MHCB 2E6QA 1KELH 2NY5H 4KRPD 1E4NA 4ZW6A 5H6HA 3T0EA 4FLSA 5E8NA 5L6YH 3G5EA 5HQEA 5I16A 4NJAH 2VI0A 1IAIL 1S46A 1GPOH 3N42F 5F2LA 2R1WA 4GSDL 3T40A 1V3KA 3ZE1F 6TIMA 4LUIA 2NXYB 4W1TA 3W7EA 4WK9A 4G8IB 1UD6A 2F8QA 1D5ZA 3U0WH 1UB5A 2D73A 3WYRA 1GEQA 3VXSD 2HS8A 2V63A 3BUVA 3GSXB 3E6HA 3LQAL 1LHZA 4JRYE 4HCDA 1FE8L 1V7MH 3TIDA 2Y2YA 1F61A 4G6JL 4A7TA 3V5FA 3ID7A 4YIWA 2VH5L 1XIHA 3G5XA 1CURA 4FLOA 3NSDA 3TXZA 2G3IA 2GY5A 4OCYL 4LU5H 3CC1A 2PW1B 4HMNA 4P4RA 3A3WA 4I90A 1CFBA 4JZOB 3LN5A 4WTWA 4Z0BH 4QRRD 1EOKA 2BNRE 3TEUA 2I07A 1EGZA 4LKXA 3TA3A 1U5HA 4O2EB 1YEEH 3WKMH 3CUIA 1YECL 3T04D 4ZD3H 5F21B 2JSFA 4EPBC 3H4FA 3RWEA 4YHOH 5BS0D 4HCHA 2X87A 4QDWA 4Q6XA 5KZCB 3UXDA 2NWSA 2UXFA 2W1NA 1KN2L 1NJ9B 3HBLA 1DVSA 2Q3XA 4RX0A 1ME7A 5FO7A 4WFHD 1W37A 1PDKA 4H13C 3PE9A 1TUFA 5L7XH 2YLAA 3EXTA 3AXLB 2CLLA 1M05B 2XTKA 4Y2DC 15C8H 2YCJA 4LJ3A 1TDQA 3IIZA 4PJAE 3N04A 3EO1A 5DMLA 1B0GA 1XGZA 4AQEB 3LD5A 2IAMD 4U1MA 4JMNA 3WTVA 1R7AA 1EVUA 1WHOA 2WNWA 2QUTA 3SDYH 1XF2B 4OF3A 3BJLA 3V10A 1NEZB 4DWSD 2DW7A 1MVYA 3FQTA 4QJ4B 3P4LA 1W72B 1ZJIA 4NWUH 4IMGA 3SUUA 3QUXA 4LSVL 4NT6A 4C55A 2F19H 3BN3B 4Z8FH 4BSJA 2R1KA 4NFBA 2IW0A 3N85H 3W5MA 3DGGB 3MZNA 1XLGA 2EINB 2BW4A 1KFJA 3HFMH 3SDDA 1GGIL 3E0FA 5AHLA 3JZYA 2XGBA 1M01A 1XYAA 2Y22A 4C5YA 6PTDA 2WINA 2QBWA 4LVDA 3CV7A 2OS7A 5TJWK 4O28A 2G75A 1MQ8A 3CQPA 2DEXX 3PABA 5EBGA 5DS1A 3RTQD 3I84A 1J0HA 2QVNA 2WZTA 3XIMA 4AE0A 5I5JA 2PDLA 2E9WA 4Y1SA 1NGXA 2PXYA 2ZP0T 4MXQC 3EBVA 1W9XA 4Y1AA 4FIRA 1BP3B 1KCUL 1A4MA 5DRIA 3VFTA 3QG7L 4MCMA 2GUYA 3BUDA 4KKPA 1BBJA 2PN5A 1KQYA 1NFBA 5G4WA 2AS5M 3UPMA 3HVNA 3QS3A 4J3OH 1G5GA 3UFIA 3VFMB 2DTML 4MY9A 3OBAA 2OFJA 4XMKH 4GJTB 4CEXC 1JF1A 3MJ9H 1S78C 3FRPA 2W9MA 4ENED 1DJGA 2WUCH 3D7PA 4L1TA 4PJBB 4MCZA 1XG4A 2X16A 4WJ8A 4IOIA 2P53A 5IW6B 1AD9B 1MQQA 4QNPE 3PBUA 1RFDL 3QZAA 3P0WA 2JELH 5AOZA 5FYJH 1RZGB 4QX4A 5D7IF 3VXME 4I7VA 2CUHA 3D0AA 2OZ0A 4MQSB 3PZUA 2J2ZA 1TVLA 1T7ZA 3GHPA 1VAHA 4APQC 5FFOA 3FF7A 1A65A 3V6BR 2I24N 5FJJA 4S2CA 5T1DL 4J9JA 3AROA 4O02A 5B21A 1YEIL 2OYKA 4D6IA 1WIPA 4OF5A 1DQJB 2X4TB 3SIMA 3BJTA 3OKEA 1BQ5A 3W76A 2E5CA 1EZVY 1G4PA 1PX3A 3SCNA 4EZMA 3MCG1 5F7HA 4KRPC 2OVLA 1TIUA 4ZS6D 1S2TA 4N42A 2Y63A 2G41A 3F7YA 1TV4A 2JKXA 3W2KA 2Z0IA 4L4LA 1A4AA 5J06A 4JPWH 4DSYA 1XC4A 3NGJA 2VQ1A 4W4QA 3UGRA 4QHNB 4Z1PA 3ESNA 4EZJA 5IB1B 2OR2A 4TU1A 4N1EA 5JW5B 1OHZA 2FX7L 2NXZB 3KJ6L 2EIKB 2CDEB 5AOJA 4GNJA 4N2NA 1FFNA 1CD1B 1GHFL 3TA4D 3LNPA 3H42H 4OCXL 1NUNB 3NCJL 4GEJA 3VXOB 2J9YA 2PP3A 4I48B 1A1MA 3D07A 3U6RA 1V3HA 3HFFA 1KCSH 1PCXA 1DN0A 3T6VA 3HN3A 4CNOA 3LZQA 8XIMA 1OOWA 2DW5A 3NM3A 2HTKC 4O58H 2GBVA 4FMFA 5EBWA 4OM0H 3FFCA 3VA6A 3WDQA 2EKSA 1VHPA 4AIZB 4ETQB 4PBVC 1EHNA 2A6JA 3C2EA 4UQCA 4JTRA 3EGSA 4G5AA 1D5BB 1XL4A 3TJHD 1G7UA 4HA3A 5CJQH 2BSRA 3QUYB 3LKNA 4ZQNA 1JCKA 4ZQPA 3SY0A 4C7DA 2UX7A 1S2WA 3BLBA 1SFJA 4AH7A 1O9WA 3O8XD 3QPQC 5DZPA 1AUSL 2N7BA 2X4QB 4PUNA 1QFUH 5AVYB 4E9LA 3E2HC 4ALAL 4HU0A 3QXAA 3HI5H 3ULVF 2G4JA 2ISWA 4XZNX 3LKRA 5EZLA 2Z0BA 5FUCC 3VRJA 4DVRL 1XS2A 3ZJ7A 3NBNA 3SE9H 1VRXA 3VABA 3TWAA 4FQXD 4JG0L 4AIXA 2PO6C 4OZFH 3CX5K 2OXGB 3VGAB 3ZGHA 5A16A 2JGQA 2UWEB 3SSJA 3B2VL 4LFHD 3R8QA 3SDXF 3R1GL 2HAZA 2RFXA 5JHMA 4OZOA 1A1NB 4ZBCA 4MNHB 4OKDA 1T22B 4H7VA 4H2CA 5ENWA 4UR7A 1MCIA 4HHAB 5SWUA 3W72A 2JB6A 4X8CA 2GQ9A 4XXWC 4S3FA 4KXZH 5IRPA 3FT4A 2IDTA 4J3OF 3H26A 1DLFH 2ZKHL 3QEQB 4ZBJA 3V9FA 1TTGA 3ZHDA 4D8LA 4ZOBA 1PEWA 1TSHA 4RGMC 3R89A 1UKTA 3H2EA 1J5DA 3UX9B 1DIEA 3G5YA 1KGCE 4G1MA 1LROA 2KDGA 1V79A 4OHQA 4AFYA 3E2RA 1DQML 3KG5A 4LPTA 2DDXA 3EPNA 3G8EA 3DX9B 2EVHA 4B5VA 2QQKH 2VCAA 3MSPA 4H2HA 1KBVA 1M42A 5HVFB 3GSWB 4IGBA 2VDHA 1YY9D 2DW6A 4C5ZA 2K9UA 2AQOA 1EJOL 3QWOA 5KWYC 3RVXC 4Y9CA 3S4SG 3MYZA 4HIJB 4PJEE 5ALCH 4GIAA 2X0YA 2XIDA 4M5PA 4EUPB 1EO5A 4ODSH 4GRMB 2XN2A 1FHDA 1UP3A 4QRNA 1S5WA 5KETA 4XGZB 4D7BA 3N41B 5EH1A 1H50A 4X6CA 2Z6JA 4KKXA 2F53D 5FJOA 3GB7B 4WHDA 2POZA 1FYTD 2E1DA 4W8BA 1OFDA 4IQJA 1CW2A 4N2KA 5DEJA 4PJ8D 2QZRA 2PDBA 4KK5D 4K5LA 1DORA 2DQUL 2XRAH 1ZEAL 3W6LA 5KYNA 4B3VA 2PTVA 5HSFA 43C9A 2PXYC 2I69A 5DQDL 1UR1A 4MD4B 2E7BA 5AL0A 1ECQA 2NLYA 1YEKL 2NX9A 4AH2B 1JQVA 3TMLA 5B7EA 2OMZB 3WLTA 3CSGA 4I18B 2D2CC 4KJYA 4OZHA 1NCWL 3V4VH 3NSCA 4ZZFA 4P46B 2VENA 5EY5A 3SDYL 4W89A 4XWGL 1K70A 2YKLL 2Y36H 5EO0A 4XZBA 4TVDA 4E5XA 1W1ZA 3VX0A 2DTSA 5T1JA 5IV2B 1IKNA 1AFVL 3FO2A 3LS5H 1NIDA 1E71M 3DWTA 1MLBA 4ES4A 3QKZA 5DBUA 5EBUA 3E6EA 2GJ6E 2BMKB 3HG5A 2AK1L 4HHGA 4WSGA 2P49B 2Q76A 1QBML 3X3FH 4Y1TA 3BGAA 1VZGA 3QDGE 3RKDD 2GZXA 3S42A 3O6LH 4BKNA 5CC5A 2HJLA 4N22A 3L3KA 4KHXH