4W93A

Human pancreatic alpha-amylase in complex with montbretin a
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The amylase inhibitor montbretin A reveals a new glycosidase inhibition motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 181
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4w93A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w93A01
3EJPA 2VX7A 2DT1A 2CCRA 2D0FA 4H8UA 2DQXA 4AZGA 3U5UA 3A4XA 4C7DA 4BQ4A 1UKQA 5JIPA 2ZX5A 1J01A 4UZUA 3N11A 1CNVA 1WDRA 1GJWA 4FNRA 4UFKA 1E1EA 3WF2A 4GO8A 1C90A 1P6WA 2XWEA 3K8MA 1E6ZA 4CD5A 3IJ9A 1WCGA 1PZ3A 2XUCA 4KMQA 2J7CA 2W91A 3F5JA 2X2HA 3SCRA 2XHYA 1BVZA 4UQ9A 1FH7A 3UG3A 1DWFM 2PBOA 3MANA 1BFNA 1ESWA 4CGTA 3WD3A 4M1RA 1NOUA 2WLZA 2J25A 2FH8A 4UCFA 3BSGA 1E9LA 3AIQA 4MNKA 4OKDA 1TQSA 2WMKA 1HP4A 1CIUA 4U3CA 3VIPA 5CGMA 3SCPA 3PZIA 4JHOA 3KWXA 2WZEA 5KEZA 4PMYA 4LQ1A 2QLYA 5IHSA 1VFFA 3GBEA 3SCUA 2VZUA 3BCDA 2ZUMA 3OBAA 4H7VA 1E5JA 1X6LA 3VU2A 3B9AA 4H2CA 1OGGA 4NXKA 1AQMA 1ISZA 1CGXA 1XSJA 4PMDA 4NZFA 3ZJ8A 3BLBA 4AY1A 2Y8KA 3VSVA 2VT0A 1HKIA 1HXJA 1L8NA 4B9YA 2W4XA 1GUVA 2YLLA 5IDIA 3A6OA 5I78A 3AS1A 1KBKA 5HNNA 4F66A 1WDPA 3BVWA 3DX2A 1LJYA 3QGVA 1E72M 4LX4A 2DSWA 1UKTA 1E71M 1QOXA 4DO5A 2GJPA 3MUZ1 5GNYA 5GPRA 3RJXA 4PN2A 2CITA 1OBAA 6A3HA 2DSVA 2E9MA 5C70A 5JBDA 2ZWYA 3VDCA 3D4ZA 2JALA 2WHLA 1TUXA 3ZM8A 4W85A 4JHZA 4D6EA 3ZR5A 4D6CA 4UQDA 1GOWA 4V27A 3SCWA 4UOQA 3S6TA 3UR7A 4AZHA 4AZCA 4HU0A 1FA2A 5CQ1A 1IZJA 3MUY1 1CXKA 4PUDA 3GTNA 2WWDA 3LX9A 4E2OA 3F5LA 3W4RA 2YA2A 2FH6A 1ZL1A 4Z2KA 1ZB5A 3AJ7A 3SUWA 4D6IA 5BXPA 3JUGA 1HF6A 4Z2GA 1JAEA 4PMNA 3TV8A 4W8AA 5A1AA 1PS3A 3KZSA 4Z2JA 2YFNA 4AZ6A 4GKLA 2EPMX 3VX1A 4PTMA 3VIGA 5BCAA 3CZKA 5GNZA 5D9MA 5A6BA 1OCQA 5IFPA 2G41A 4TUFA 1J0YA 2G3NA 3W29A 5A2CA 1W3KA 4CD8A 3EJTA 3VIKA 4AD2A 1ZBKA 4WKAA 5A69A 1D7FA 1UZ1A 3DX3A 3A47A 2VNCA 3KEHA 3CGTA 4IM4A 2FHFA 3N12A 1RPKA 4GZJA 3EJUA 3CZNA 1MXGA 1UKSA 1DHKA 4MNMA 6CGTA 1UKOA 1GOIA 1VF8A 4M82A 3BUQA 2X0YA 1B3VA 2DGAA 3WDRA 4CU7A 4GZEA 1OGBA 1QHZA 4W84A 3AS0A 3IGUA 4UZSA 2BFGA 1GOKA 3ZSSA 4CU6A 1KGXA 3QHMA 4AMWA 4ATWA 1BPLB 2EADA 1MW3A 2WBKA 1PPIA 3BLKA 2EO7A 3DX0A 2WSKA 4GXPA 1F4AA 4DWSC 2WLYA 4J3UA 3GXIA 1JNDA 4CN6A 1FP9A 4EAMA 2DH2A 2DIJA 1KWGA 3VDAA 1E5NA 2W92A 4Q7NA 1J0ZA 4P8WA 1V3MA 1B3XA 3GXMA 3MS8A 2D3NA 3T2OA 3LRKA 1V08A 1JZ2A 3IANA 1KTCA 5D8WA 3ZJ7A 1BG4A 2DSUA 3CBWA 5A8PA 4W93A 2EPNA 5AYBA 2JF7A 4PMQA 1OIFA 4M8UA 4AMXA 4NXSA 4GPNA 1OD0A 3UG4A 2W67A 3A5VA 5BROA 4HTYA 1O7AA 3ALFA 1QPKA 3VGHA 4Z2IA 4HA3A 2YL6A 3VIJA 7CGTA 3W82A 1QI4A 3U5YA 3FNDA 3PZGA 1R46A 1QNRA 3TTOA 1HWWA 4QCFA 3ZT6A 1PIGA 3BC9A 4W7WA 1ECEA 2D20A 2VX4A 3ARVA 1LL4A 1CGUA 2F7OA 4J3WA 1B3WA 3WH8A 1UA3A 3WH6A 2QHAA 2PB1A 1ZU8A 1SR0A 1W1TA 1CLXA 3O6AA 1V3IA 3WNNA 1M7XA 3BAYA 2XWDA 2ZUSA 4XB3A 1Q6DA 3UEQA 4E8CA 2E9BA 2ZUVA 4OGZA 3PZ9A 3ZOAA 3BAIA 3K4AA 5AYIA 1NP0A 1KTBA 2WXDM 1UD3A 3VGGA 1XYZA 1OWQA 1W2VA 3WF4A 1TQWA 3VX0A 1MQPA 3VIOA 1OIMA 3T0DA 2VVSA 5CSYA 1CXFA 1R8LA 4UR9A 1JXJA 3FAWA 4KWUA 5DT5A 4FNUA 3SURA 4W7UA 4CN4A 1US2A 2J77A 3WQVA 2AAAA 5BRPA 1CXIA 4W5UA 1TCMA 4OJYA 1ITXA 1ZBVA 4EE9A 3GM8A 4BS0A 1QI2A 1HVQA 1UKPA 3DC0A 3T09A 4MB1A 3M07A 4HA4A 4PMVA 4WK9A 4B3KA 2G8ZA 1G94A 1LWHA 2IGTA 1G9HA 3DDFA 3CHFA 2VUYA 3A22A 3AHTA 1ISXA 5CZKA 2WMIB 5E6ZA 4HMDA 2OWCA 1UR2A 3M6DA 3OGRA 2ZX9A 2XVPA 3AYRA 1E4NA 4MB3A 4OBSA 2Y24A 3UERA 4C7FA 4PTVA 1KBBA 4BQ2A 3EDFA 1JFHA 2PBGA 4HZ8A 4KRUA 4TOQA 4CUCA 2VO5A 2XSAA 1QNPA 1W1VA 4HU8A 1PBGA 4JZ5A 1T0OA 4JL2A 5C8BB 2XVGA 2WKLA 4R27A 3FHQA 4PYSA 4ACYA 4PUEA 4HZ6A 4TVUA 3APGA 1UA7A 1EH9A 1KQZA 2GJXA 3WD4A 2F8QA 1BGGA 3LXCA 4ATLA 4HPGA 4EANA 4HPHA 3U7BA 1UR9A 1ZS2A 3HG5A 2QMJA 1QWNA 4PEEA 4AC1X 2YDSA 1QHPA 3AS2A 2ZXAA 3WD1A 3VD9A 1DP0A 4JFTA 3WQ8A 3L4WA 1HJSA 3PN8A 1QW8A 1UH4A 1XCWA 1H09A 3POCA 2D1ZA 3CIVA 1BLIA 1DEDA 1CTNA 4DWSD 5KZ6A 4W8LA 2WBGA 1DWIM 2WMJA 1WKYA 1OM0A 2F1BA 2DDXA 2E8YA 3AZSA 4EK7A 4LXFA 2ZXQA 3FN9A 1DWHM 2AMGA 3ECQA 1I1XA 2VZVA 3BUDA 4ZE4A 1MVYA 3NSMA 1V6WA 3WY3A 5A94A 1TZ7A 2JEQA 2BY0A 1WP6A 3BAXA 3GNPA 2GFTA 3EBVA 4D71A 2IXVA 3TTSA 2TAAA 1H5VA 1KFWA 5AC4A 1KGUA 1AVAA 4UFLA 3L4ZA 3LXBA 1UWIA 3QHNA 4NSBA 4AD0A 5JBEA 4W86A 1KCKA 5FOOA 3B9DA 3AIUA 3CLWA 2VJXA 4BCEA 4WKFA 3MUIA 3NIYA 2J7HA 2NW0A 2XPKA 2ZOXA 2J75A 4J28A 5E1QA 2FGZA 1GJUA 4MJ4A 4AD4A 3DHUA 1CWYA 5A6LA 3CUGA 2YBUA 1V6YA 2GJXB 3RM9A 1W1PA 3RPMA 1W2PA 4H04A 1C8XA 1BAGA 2BXZA 4QLLA 4MB4A 3ARPA 4KGJA 1UUQA 1D2KA 1R7OA 2CERA 1TG7A 4XZBA 2PWGA 5CPTA 5JBFA 1LLOA 1OINA 3SCNA 3W38A 1E56A 1US3A 3MV01 4FK9A 4PTWA 2CPUA 3WNPA 3HZ3A 3VTRA 5DEZA 3W24A 2NSXA 2Y2WA 4HOWA 2BY2A 1KWKA 1NOFA 1R47A 4NF7A 3ARSA 1AQ0A 4M24A 2WMHA 1MFVA 4RE2A 3WL1A 3L4TA 3SUTA 1GCYA 1KGWA 4ZENA 2DIEA 3RO8A 1BHGA 2G3IA 2D0HA 1XV8A 4UQAA 4GO9A 1LL7A 3WUGA 1G01A 1VFMA 3EJQA 1J0HA 4LYRA 1EIBA 4E8DA 1LWJA 1HTYA 3WUEA 4NX0A 3W27A 4P7LA 2WW5A 3AYSA 1J11A 4UFIA 1VENA 4D6JA 3ZT7A 1JZ5A 1V0KA 4WLCA 4JAWA 3A4AA 1UD4A 3WDIA 1KB3A 1YQ2A 2CBUA 1E3ZA 4URIA 2PF0A 5FL1A 2PWFA 4YPJA 2X2YA 4W88A 2FHCA 3H55A 1WPCA 1JYWA 3FY1A 4PCTA 4QLKA 2BHUA 4UFMA 5JIWA 4BZYA 5EB8A 5D9NA 2VRQA 3WF3A 4F9DA 1GVYA 3WELA 4CKQA 1D3CA 1VEOA 1DWGM 1L0PA 4ML4A 4ZEPA 4MPKA 3MO4A 2VRJA 5ECUA 3AIEA 2JF6A 3WH7A 1JZ8A 3L4UA 5ABFB 3RIKA 1VBRA 5BYWA 5M3WA 5HPCA 5IHRA 2F7QA 2D2OA 1JG9A 1EXPA 4WIWA 4U3AA 3EJSA 4MNLA 5DO8A 5A6BD 1W3LA 2W61A 4L4PA 1UASA 2CBVA 1Q4NX 2W62A 1XYFA 1E15A 1ODZA 1W9VA 3M7SA 3WQ6A 1QI3A 3AMKA 1R86A 2XN2A 3BAJA 4UQBA 3AHXA 4F9JA 2DSKA 3CUJA 1UG6A 1TE1A 2YDRA 1KR1A 3S5YA 1NQ6A 1HL9A 1V3JA 2PWEA 3GXTA 3W28A 2XM1A 4YHGA 1MW1A 3VNYA 1CENA 3O2LA 4DO6A 3WDJA 7A3HA 3WD2A 2Z1SA 1QBAA 3LXAA 2E0PA 4Y7EA 3CZLA 3CZSA 2VURA 4HMCA 3W81A 1A47A 1VFOA 2YOCA 2EPKX 1EO5A 2UY4A 3VINA 2D73A 2QPSA 4AWEA 3WIJA 4QFUA 4M81A 1JZ6A 3OLIA 4MB5A 3WMBA 3SCQA 1HNYA 3L4YA 3VIIA 2YL8A 2UY3A 5I3DA 3ZJ6A 3ARQA 4PSPA 1R85A 2OSXA 1GHRA 3PZUA 4B3LA 4CD6A 2UWFA 2ZX6A 1E6XM 3MKKA 2ESCA 1EDQA 2OWWA 4ACZB 3PZOA 3CHCA 1B30A 3VD7A 4HZ7A 1E6PA 1V6UA 5AY7A 2WWCA 2WHMA 1UH2A 1NWTA 2BV9A 1E1FA 2CNCA 1C8YA 2YA0A 1FH9A 3IJ7A 2VCCA 1HN1A 5GNXA 5ABEA 3N18A 1PZ2A 2A3CA 3W25A 3SEPA 5HOSA 3KL5A 2F1AA 4HMEA 4W8BA 2WB5A 1UWUA 3BMVA 2QF8A 2J8GA 2IUZA 4FLRA 2BY1A 1JZ3A 3CUIA 1E40A 3CUFA 1GHSA 1V0NA 1HT6A 2XJ7A 3WBAA 1K9EA 2FDMA 1GPFA 1V3KA 2DT2A 3UG5A 1GQIA 1UWTA 4DM1A 4NI3A 5ABHA 3ZT5A 3BLPX 4AIUA 4QAWA 1LL6A 3MSGA 3NDZA 1HX0A 1ZJAA 3EDKA 5HBFA 3DHPA 3WY1A 4LYQA 1JYXA 5A6JA 1SYTA 1V0LA 2O9OA 3F5KA 2EPOA 2WANA 4FNQA 3WUBA 3AZRA 2B31A 5A8OA 3CMGA 3L2LA 3L4XA 3TOPA 3KLKA 2X2JA 5I6SA 1QX1A 3EYPA 4JFVA 2YL9A 2J7DA 1R87A 2XN0A 4LYPA 2VMFA 2GJRA 2BHYA 1E73M 4MAZA 1UWSA 4OIFA 1G0CA 5I2UA 3CHDA 1C92A 2XFRA 3THCA 4EKJA 2HISA 2A3AA 2CIPA 3HG4A 3WMCA 4MADA 2JE8A 4D6DA 3BAWA 1HJUA 3KL0A 2WCSA 1UR4A 2DT0A 1R7AA 5D4YA 2WK2A 2WC7A 1E4MM 1JFXA 2VR5A 3SUUA 2CESA 2DH3A 1GQLA 1HJWA 5E70A 4W89A 2BVTA 1FHDA 5EMYA 2WVSA 1BGAA 1ITCA 4FNSA 5E9AA 3BVTA 3HJEA 3AFBA 3T08A 2EAEA 1J0KA 2ZICA 4UNIA 1ZBWA 4ATDA 1E6SM 3K8LA 2X05A 4HA1A 2OWXA 2NT1A 2FGLA 3ALGA 4M80A 1JYVA 3GXFA 3TP4A 4N42A 3WY2A 4Q22A 4QLJA 3MMDA 3D50A 3S2CA 3VIHA 1PEZA 2EPLX 1J0JA 3OLDA 3NCOA 1R34A 3VDBA 4AZ7A 1SMDA 5FKYA 2RGMA 3II1A 1TVNA 5CSUA 1H2JA 4AD5A 4AXNA 4DUVA 3AI0A 1I1WA 1WZLA 3NDYA 1W3JA 1R33A 3ZIZA 4HOXA 2BS9A 5BWFA 1AQHA 3L2MA 4D6HA 3BH4A 2ZUUA 2WYSA 3ARTA 3A3HA 2C8NA 1EO7A 1K9DA 4AISA 1XH0A 2A3BA 2A3EA 3AHVA 4LGXA 2OW6A 1XD0A 3N9KA 2J74A 2OSWA 1HKJA 1TVPA 3E1F1 1Y7VA 3CZEA 5DMYA 1UZ4A 8CGTA 4U5KA 4ZE5A 2F18A 5IXEA 4BQ3A 2HVMA 2V3EA 3OLEA 4FLQA 4QP0A 4K68A 1PX3A 3WNLA 1ISWA 3IAQA 3QR3A 3ZMRA 4DM2A 1CLVA 2D3LA 2O92A 2WPGA 3BMWA 3W6MA 3DECA 3AROA 1Q6FA 1SZNA 3AMGA 4A3HA 3OZPA 2GDVA 3EMQA 1VFUA 3WFZA 4M29A 2J7FA 3VILA 7TAAA 5ABFA 2Y8VA 4NZJA 3WNOA 1CECA 1E43A 2VZSA 2ZIDA 3W26A 3LRLA 5DFAA 1HJVA 3HN3A 3MU7A 2PWDA 3AZTA 1GZJA 4OBRA 1H0GA 1PAMA 1W3HA 3VGDA 3WBEA 3CHEA 2G3JA 3OB8A 3WH9A 3OG2A 4AZCB 3LRMA 1JZ7A 4XUYA 1W32A 3PBGA 3BAKA 5JUVA 4V2XA 4W87A 4FLOA 1X1NA 3AXXA 2J8FA 1MWOA 4PMOA 1AMYA 3CPUA 1UQYA 4RE3A 5LYRA 1GQJA 1HKMA 1QHOA 1W91A 5M17A 3A21A 5EFDA 3D3AA 4JFUA 4PMUA 3TA9A 2XIBA 3GH7A 4R5EA 2XSBA 1FOBA 1CGYA 2WMIA 4AZBA 1JDAA 1PX8A 4NZCA 2EEXA 1V3LA 1V0MA 2O9TA 2Y4SA 4AEEA 2YL5A 3BVVA 2WVVB 4IISA 4CU8A 3AIVA 2CBJA 3WL0A 3VIFA 3CZJA 3TTQA 4GINA 4WKHA 2G3MA 4JKKA 1UR1A 3SUVA 4GZIA 3A23A 3PTKA 3UETA 3VMNA 3WD0A 3CMJA 3GXDA 1GORA 9CGTA 3PZQA 4ACZA 2J79A 5FL0A 6TAAA 1JD9A 4TVDA 2F61A 4PMXA 4PCSA 2Y5EA 1E6NA 2D23A 1GOMA 5DT7A 3RM8A 2EBNA 5A95A 1U2YA 2UY2A 2QV4A 5CPSA 3WQ5A 1ODUA 1JYNA 1C93A 5CXPA 1C91A 1ISVA 5M5DA 1PJ9A 4TX8A 2JIWA 1ZBCA 4J3TA 4JKLA 2V3DA 4TTGA 2FHBA 4XZWA 2WVTA 2YDQA 1LG2A 4FLSA 3DYOA 4P7OA 3ARZA 1UHVA 3OZOA 4PRWA 5CJ5A 2XVNA 4W7VA 4J3XA 2E3ZA 1PIFA 1VBUA 3EDDA 3MSDA 4IPLA 5HPOA 3VGFA 2IXUA 2PC8A 4GI8A 1C7TA 2JFEX 1J0IA 5A6SA 4BA0A 1BYAA 4PMRA 2F7RA 2VQUA 1MFUA 1NH6A 4TVCA 1HJXA 1H1NA 2F7PA 2O9RA 4P8XA 1XCXA 1WAWA 3KE0A 1RP9A 4HOZA 2GK1B 2W66A 4P7NA 1BG9A 1VIWA 2ZE0A 3CTTA 3EMCA 2WNWA 3WQ4A 3NUKA 2EACA 3DDGA 3VSUA 1W9PA 3GH5A 4IPNB 4KRTA 1E3XA 1CGVA 1WO2A 2J4GA 4P7RA 3FXYA 3WEOA 2AOSA 4UOJA 2G4FA 2PI6A 3VGBA 1UD2A 3RM4A 2D0GA 4FMVA 3RDKA 1RH9A 3WEZA 4KGLA 1IV8A 1EHAA 3AXIA 3SCVA 1JL8A 1O6IA 4PSRA 3BVXA 2BNJA 2ZUNA 4DWSB 2XTKA 2CHOA 1S46A 5E0CA 4ZXLA 3OGVA 3CV5A 2XYLA 3ARXA 3KLLA 1HL8A 1H4PA 2WHJA 4PBGA 4B16A 3SCSA 4JIEA 4XX6A 2BHZA 1BSIA 5E0FA 4TXEA 1E0XA 4WSJA 4WSKA 4CN1A 1LQ0A 3POHA 4WJXA 3N04A 3W0KA 1JNEA 2BVYA 3GBDA 1HP5A 1UWRA 4H41A 2C0HA 4JKMA 2GK1A 3FAXA 1LG1A 3ZR6A 4DUXA 1HKKA 4J3VA 1B0IA 4UQEA 1PX4A 4M56A 3PZVA 3N1AA 2MANA 3HU7A 4MTVA 4CCCA 3AXHA 3ARYA 2ALWA 1E0WA 5GQBA 4U2ZA 3BGAA 1MW2A 1I75A 1W9DM 1W9XA 1CEOA 1EGZA 3LPFA 2J7EA 4DUWA 3ARUA 2FYVA 1V03A 1X6NA 3OIHA 3VD5A 1J18A 3D4YA 3VDHA 5BXRA 4AYSA 4OOUA 3U7VA 3BUBA 3WNMA 4V28A 2CKSA 1RD6A 1MXDA 1TMQA 2CHNA 1C7SA 1QNSA 2D22A 4U5IA 4OZOA 3FHAA 3TONA 2CKRA 1J10A 3D5HA 5CLWA 2F2HA 3BUPA 3N15A 1NP2A 3GZAA 3VMPA 3AMCA 2ZWZA 4P8VA 1A3HA 4JL1A 5CGTA 1UD6A 2GUYA 3ZO9A 1E0VA 4UFJA 1V02A 3PZNA 1WZKA 2V3GA 2J47A 3CC1A 2VCAA 4AMCA 1JD7A 1M04A 1VJSA 3KL3A 3B8SA 1E70M 5C71A 5A6MA 1TQUA 3K4DA 2W63A 1QVBA 3GH4A 2O9PA 3ARWA 3QHOA 2YBTA 4KH2A 4B15A 3ZQ9A 1B3YA 1G5AA 3W6LA 3MUAA 4AD1A 1TR1A 2E9LA 2VZOA 3CH9A 5D8ZA 5D9OA 1BQCA 2X8RA 3A4WA 3DYMA 1VB9A 2VTFA 1B2YA 1UH3A 2VOTA 4F8XA 1QI0A 4S3KA 4GI9A 1WZMA 1V3HA 4E4PA 1Q6CA 1MW0A 1DTUA 4D6GA 3SIMA 1W9UA 3CZGA 4AW7A 1NOWA 1GW1A 3WENA 4AZIA 2YLAA 4X9YA 1WE5A 3PZTA 4D1JA 2JIEA 1BYCA 3I3BA 3NSNA 2VZTA 5I79A 2PWHA 2XGIA 3WF0A 5D9PA 2J7GA 5CG0A 1TA3B 3VIMA 3GDBA 2WM0A 4U2YA 5IFTA 1DWJM 4QCEA 1KXQA 3AS3A 3WN6A 2WCAA 3PHAA 1BVNP 1Z32X 3D51A 3AIBA 4UTFA 2OYMA 2WAGA 1MYRA 3UR8A 4NRSA 2CETA 1CZ1A 1WDSA 3EDJA 1XSIA 2ZX7A 2XGBA 5ABGA 1HVXA 2VR4A 4ZXOA 3VM5A 1JI2A 3PZMA 2VX5A 1CGWA 2QPUA 3A24A 3TTYA 2CYGA 2UY5A 3EMZA 2GSJA 4MJ2A 5FIPA 4A4AA 3WFLA 2X09A 3T2QA 1UD8A 1VJZA 1HIZA 3GNRA 3H54A 2GDUA 1EHNA 4F79A 1CBGA 4DO4A 2E4TA 3VO0A 1E4LA 3J7HA 1C3FA 1UWQA 3K1DA 4JFWA 2VQTA 1JZ4A 1B31A 2J62A 4OOZA 1H3GA 1JF5A 4TX6A 3I3DA 2OYLA 1GNXA 4UOZA 1GOOA 3VSTA 5M03A 1R75A 3T0BA 1MQQA 1E4IA 1KQYA 1EA9C 3RILA 1UR8A 2WZIA 4D6FA 3CO4A 1TQVA 5TD4A 1TFVA 3T0AA 1GVIA 1KXHA 4AIEA 2XM2A 2OW7A 4MAVA 4L4OA 5BXTA 3H53A 1H0IA 3U57A 1FHLA 3VD4A 1KXVA 3OGSA 4IUGA 4NRRA 2J7BA 1VEMA 3BSHA 1J9YA 1VEPA 3LMYA 1JAKA 1UOKA 1EDGA 4GQRA 1DWAM 4Z2LA 1UQZA 4UQCA 2NT0A 1W9BM 4GIAA 2XFFA 2D24A 1BYBA 3DX4A 1CXLA 4BQ5A 3GXPA 2X1IA 3WEMA 3GNOA 2ZX8A 2CBIA 1OT1A 5F7UA 4TTUA 1BYDA 2WVUA 4FNPA 5LA2A 3D52A 2RGLA 3VUPA 1ISYA 3PTMA 2V3FA 2EXOA 5EBAA 3VM7A 5EFFA 3MMWA 3EDEA 2BXYA 1IZKA 1B3ZA 1QI5A 4LPCA 3WF1A 4YN5A 1CXHA 1Q6GA 3WDPP 4P8UA 5A8MA 3B9EA 4JCLA 1M53A 3WKZA 3K46A 4ZFMA 5AC5A 2WZHA 3IK2A 3UESA 3LPGA 2YFOA 1JIBA 2WC3A 3VMOA 3LPOA 4J3SA 2WMFA 3CUHA 5LA1A 2DPEA 5CLTA 4B9ZA 5A2BA 3DYPA 4H8HA 4PTXA 1JI1A 4CD7A 2Q8XA 3RMEA 2QMKA 3NSXA 3G6LA 3RJYA 2WHKA 3SUSA 1QNQA 1V6XA 3AOFA 1B90A 1B1YA 5A2AA 1TQTA 1H49A 2W5FA 1OB0A 1WB0A 4X0VA 3WDQA 2VCBA 3AIRA 2WSPA 4RL3A 4AIOA 1BTCA 4CVWA 2BVDA 4C7GA 1XGZA 2VC9A 1YHTA 2XN1A 3MI6A 4CCDA 2VI0A 1CXEA 1LF1A 1JDDA 4MNJA 4Z2HA 4CCEA 5A6KA 1EQCA 3IJ8A 1FFRA 2J78A 3THDA 3F4VA 4N0RA 4WF7A 2OLHA 4AZ5A 2GVYA 4H8VA 3WNKA 4YHEA 3SCTA 1KCLA 5A8NA 3L4VA 1J12A 1WDQA 2FE0A 3AHYA 1IT0A 5I5RA 2A3HA 3ARRA 4QDMA 1UD5A 3VKKA 1EQPA 2XIIA 5DF0A 4HP5A 1CGTA 2VX6A 3NYDA 3VGEA 1M01A 3VNZA 1OT2A 4DWSA 1B9ZA 1EDTA 3EJRA 3VVGA 4JFSA 2V5CA 3LPPA 1RP8A 4UFHA 5LA0A 1OSEA 1UYQA 4AYGA 1FP8A 2XVLA 3SCOA 1TA3A 5I23A 2VVNA 4D1IA 1QWUA 4D72A 3QOMA 4FF5A 1CYGA 5BXSA 2VRKA 3WUFA 1K6AA 3BXWA 4MDPA 3MMUA 1GQKA 1MQRA 4A3YA 4RE4A 4XV0A 2ZUTA 5I77A 5A6AA 2JEPA 1C8QA 1NWSA 1HXKA 2X0HA 3UCQA 5HXMA 3BCFA 4GQQA 1E6QM 2CXGA 1OGSA 3DX1A 1Q6EA 3GXNA 3HMCA 2WVVA 2WC4A 5HDRA 1U30A 3FW6A 1JDCA 4U33A 5E6YA 1H11A 2YKKA 1XH1A 2XG9A 1H41A 1XRVA 4J7RA 1KXTA 2WCGA 2Z1KA 5BRQA 2OSYA 1CPUA 1GOQA 1FFQA 1NM9A 3QOKA 3NJ3A 1G1YA 2EJ1A 3ZSTA 3AISA 5A8QA 3VOCA 2ZXBA 4W5ZA 1K9FA 4S3JA 1ZJBA 1V6VA 1NWUA 3WSUA 2EABA 3G6MA 1E55A 1GONA 5FD0A 3HG3A 3AIWA 2X2IA 3N17A 2V38A 3WY4A 2V5DA 1SFSA 3CZ8A 1XSKA 2BY3A 3BVUA 4U31A 5FCZA 1XD1A 2YJQA 5I0DA 1FH8A 1NWRA 2E8ZA 3AMLA 2ZUWA 3K8KA 3VD3A 1CDGA 2WMGA 3WDHA 5A3HA 3AICA 1BF2A 2VL4A 3W37A 1NARA 1HJQA 3OA5A 1M03A 1W1YA 2DEPA 4CVUA 4J27A 1JGIA 2YA1A 4CD4A 3VPLA 1UR0A 4JCMA 8A3HA 2XVKA 2OYKA 1KR0A 1EOMA 2EQDA 2ZXDA 4FNTA 3W53A 4X0NA 3AMDA 5E09A 2CEQA 1OD8A 3WQWA 1EOKA 2XFYA 1JF6A 2YIHA 1QW9A 5CPQA 3MV11 4AD3A 3PTQA 3N13A 1XH2A 3M46A 5I24A 3I3EA 3S5ZA 4P7QA 3WMSA 1QNOA 1SMAA 1JXKA 3T2PA 1U33A 3BUIA 3IAPA 2WKGA 3HG2A 1V02E 1F4HA 1XHGA 3AHZA 3GYCA 1XC6A 3WH5A 1QBBA 1VRXA 1E6RA 3OLGA 2E40A 3RCNA 1K9TA 4AEFA 2DSZA 1N82A 4BF7A 3O9NA 1WZAA 1VAHA 3ZJKA 4OUEA 4PMZA 4GI6A 2C7FA 3AQUA 1WNOA 2DT3A 1O7DC 4MDOA
chains in the Genus database with same CATH superfamily
5CPLA 5AKSA 1S5IH 1UEMA 3AM8A 4K9JA 1UTDA 2CRIA 3KPRD 1B4EA 2DT1A 2VX7A 4C7DA 4IX0A 1NAMB 3QQ3A 1UKQA 2QJDA 3DG3A 3BP7B 2AXFB 2VGFA 4IHBA 3RL1A 3N11A 2LLLA 2YD5A 5C7XH 1H3VA 1PL9A 3CFDA 3MQTA 2C26A 1SJEB 4K8RD 3FONA 4KKCD 4YS4A 1PAZA 2A6NA 4LSQL 3C8HA 4YJZL 1TCRB 2GQHA 4JR9L 2H1XA 1AHMA 1HZYA 1V93A 2EG6A 3R4IA 2Q87A 1N10A 1RZIB 4GO8A 4RMBA 1SOQA 4XP9L 1F61A 4LPVA 4P9HH 1P6WA 5D93B 3LA4A 3KAAA 4DZ5A 1VZHA 2HLEB 4KROB 4A6YB 5SX5H 4IBSA 1SDDA 1E6ZA 2VGGA 4J5NA 5U4NA 3HNVH 1GVOA 1TPDA 1PZ3A 3O0LA 4PJHA 4PS8A 4AHOA 2XUCA 3O8XB 4RSYA 3MVTA 2FB4L 5DZOA 2NV1A 4DP4X 3Q44A 4ZBJA 2F38A 4AG0A 5K5YA 2X2HA 3SCRA 4GLRH 3QFEA 2P24A 1CGSH 3NIDE 2NUYA 3TCSA 2FUTA 1ZLVH 1OQXA 1DWFM 4M6UA 5DCDA 1EBPA 4H9YA 4C1KA 5DJYA 5LVEA 2PKDA 3Q01A 1QP1A 4G9FE 3C9NB 4K3EL 4RCAA 5B38G 4RR4A 4PJ7B 1BFNA 1ESWA 4CGTA 3EYVB 2VIRA 1NOUA 3EWYA 4M1RA 3S2LA 2WLZA 2DMCA 1HOCA 1SXAA 4UCGA 4EPEC 3WEMA 3KS5A 3HE6D 4H1LB 3GUTB 4I9XA 5E2WL 4BWUA 4DO7A 5I3JA 2WSYA 4NLHA 5ACLA 3UZWA 4JANB 1IKNA 4PJEA 4L61A 4KROD 3VZYA 5CMAA 1FV1B 3VSQA 3VIPA 3GJFH 1P4IH 3GS7A 2QVNA 3SCPA 4JHOA 2HCZX 1E4JA 3ROLB 5KEZA 3V7MA 2NZ9C 3O8XD 4TNVF 4YXHH 4LLUB 4DPPA 2CKBH 4LQ1A 3QCTL 4TTDD 2QLYA 4HCIA 4S3BA 5ALBL 3G7TA 1FFOA 3G8EA 3AY4C 4O51B 1VR6A 3PHQB 1DO5A 3SQMA 2N1TE 5EEXA 1YBQA 4HC1L 3VDGA 3OBAA 1E2WA 4CL7A 2A6IA 2BSRB 3TVMC 3AXLB 3OOQA 1TV3A 4JMXA 2IPJA 1CGXA 4RGMB 1FYTE 4JKPH 4PRID 1XSJA 4QRPA 4YDIL 1Q0YH 3OF6D 4H26A 3QI9C 1KCUL 2Y8KA 5H35A 2PWVA 3H2MA 3OMIB 1HKIA 1L8NA 5LN8A 2AW2A 5B39A 1ZSXA 4RK8A 3S96B 3FUHA 1F42A 3W27A 3MRNA 3P77B 2APWA 3TKFA 1DBAL 1BIHA 3FQNA 4X9HA 4XXWA 1ZSDA 5PAZA 1U6AL 4IRZL 5C0BA 4DCQB 3A6OA 5FDYA 5TE4L 3RE0A 5AG9A 1ZVYA 1JNJA 3G3DA 4DZBB 4Z42C 5IRPA 1KBKA 4F66A 1TVBA 4GT0A 4N9CA 3BUYB 4LBAA 3WNJA 4FQCH 1WX0A 1S2CA 4MLJA 3PPGA 2LQRA 1LJYA 1Q6QA 3QGVA 1E72M 5DMNA 4OZIB 4G7SB 3E12A 2NY5C 2BSSB 4O54A 3MOAH 3F64A 3HG1B 3AWNA 1YJDC 3LLXA 3PG9A 2GJPA 4MXWH 1A1MB 4DIXA 3RJXA 3R8GA 6A3HA 4LH8A 1ZWIA 4LUYA 3QGAC 5BW7A 2ZWYA 4F15C 4OY9A 4LIQH 3DSFH 3VDCA 5F1UA 3D4ZA 1TUXA 5FUCE 4W85A 5H4YA 2MCAA 3W1PA 4PWJA 5FKPB 3L1GA 5CD5D 3ZR5A 5CHNA 1W1B1 1GKPA 3NQVA 1FNLA 3HN8A 1XMEB 2AK1L 3OAYK 4PJGE 4QOKB 1N4XL 2E6PA 5I2IB 3CFKB 3GB6A 2VLKE 3D6NA 1ZLDA 4TQIA 2QKIA 1SRDA 2ADIB 2NLIA 3V0UA 3SCWA 3VD2A 3IXTB 3UR7A 4RNRB 2FVMA 4AZHA 3VG9C 4MNHB 1FWDC 3VXSA 2R4RH 4G59C 4YZWA 1LK2A 4PUDA 1TJXA 4HYVA 3C5ZB 5HJBA 5ICUA 2F58L 2YPLE 2D7TH 1XICA 1TTQA 4KCVA 1ZL1A 4Z2KA 1BJ8A 3AJ7A 1ZB5A 2ODHA 1LWIA 3GYEA 4D6IA 4KQ3H 3BQ6A 3VYLA 1T2QL 5D7IF 4IPIA 1W2KT 2FO8A 1HF6A 4GY1A 3TC6A 3W07A 4Q9RL 5ECVA 2PD9A 5REQB 5EBWB 1QMUA 2VWTA 4GC3A 1JAEA 1F3DH 2L7QA 1RJCA 1N2RB 1PFOA 1LO2H 5E03A 3U9PL 3B04A 3O6DA 4BFBD 4MDIA 1A5FL 1ECQA 1L7TH 1AANA 3MLPA 1DJHA 2Y61A 4GKLA 4EO5A 4NB7A 1Q3NA 5DEGA 1GCFA 2CCLA 3QUKB 5KYXB 1G43A 3B06A 3QUYB 4GXWA 2J9YA 3NURA 4LV9A 4N9EA 3OJDA 3TIDA 3FPXA 2IXQA 4Y8FA 4F0HA 5JPNA 3NZGA 2KL6A 1B4RA 5HHPA 1ZIBA 1HCFX 4PBXA 1OGAA 1SN5A 3UAAA 3CDCA 1P7KB 3PREA 1L9NA 4O0QA 2VDQH 4CD8A 4RGOL 3C5JA 2CK0H 1PFCA 3D46A 5CR1A 4TXVB 1ZBKA 3SUVA 5C6TH 3MLUL 5CAKA 2OO0A 1W3NA 4ZSOB 2W9MA 3LENA 4KPLA 2MOQA 2ZXEB 4JKWA 1P0DA 1URIA 5TQ0H 2GAZB 4W4OC 3CU2A 3FJ6A 2PYFA 3FK3A 1HHJB 2MIZA 3CZNA 2IQDA 1OCJA 1GK8A 1HZHL 2QQQA 4FERA 2Y5QA 5DD6B 1TRIA 4L3FA 3ANYA 3GMPA 4Y4HD 1GOIA 1VF8A 3LSBA 1B3VA 2DGAA 4M82A 1AJ7H 3JV4A 3HPLB 3MRMB 2H3KA 4MQ7B 2NX5A 1RERA 3AS0A 4LVNB 5F7LB 3RF9A 1BD2B 4GAJL 1RLDA 3IGUA 3K81A 2V5TA 3QE5A 3ZUNC 4ALAL 2YS4A 2KC0A 4E9LA 4ZMTA 1LBLA 1HZLA 2BFGA 1SEQH 1AGFA 4G43A 4HPOL 2APBA 3QUYD 1T03H 1XIIA 3MJMA 3CSPA 1KGXA 3C12A 4X7TA 3TJEH 4AQEA 4CU6A 5CG7A 4M7LT 3O4OB 3D8MA 1BTMA 2J66A 1FORL 5GS2D 5CC5A 5J8LA 4ATWA 4Q9BA 3DXAE 3P9MB 3SDCC 2GGGA 1K8DA 3E5BA 3RX4A 2CK2A 3D39D 3H7LA 4K2UH 1TYGA 1YN6B 1U1HA 1P7QD 2VFHA 1IGYB 4XWUA 2XUWA 5FF7A 4XMLH 3L48A 1JXGA 4EPDC 1YEDA 3DX0A 5C0DB 2Z6IA 2BVQA 3QDHA 3QEQB 4LFHD 4PLJC 4ZO8A 1F4AA 4GXPA 3GU9A 4DBWA 1K3IA 3K6IA 4EWND 1MREL 4NKOB 2WYTA 1G9MH 5EEZA 1XB8A 4XRCB 1UP2A 2DWSA 2V9RA 4AX6A 3E0FA 5KJ4A 1BBJA 4XN7A 4IU2B 5GGQL 1CU4H 3ULSA 3VQLA 5I5MA 1MNSA 3IIOA 1WWCA 1JQVA 3LMZA 3TVAA 4M7ZC 1I8JA 2YEQA 1R2SA 2B1OA 3FO1B 1O7VA 1TO5A 5HHOA 3HZYB 3K71A 4D6GA 1GMIA 1DJWA 3R25A 5GGSY 1B3XA 1QMLA 3MCKB 1T6VN 5DJ8A 5JLZA 3W5NA 4K71B 2EDWA 4HK3N 2IQAA 5AL8A 4DPQA 4N0CC 3LCGA 4OQVA 2NNFA 2X6BA 2FLMA 4WJKB 1CE6B 1XLIA 1YG9A 1G7JB 4WAFA 1KTCA 1Y6NR 5EBMB 3T77A 3IMBA 3TFXA 1LO4H 3C8KA 4AGQA 5BZWA 3MRQA 4AEIH 2E9IA 4B6ZA 4BM7A 5A8PA 1I8LC 1NEZB 1I1YB 5LCVH 2V81A 5H2ZA 5L2JA 1N0XH 3KM8A 3PPSA 2WQRA 1FUNA 3A12A 2VM3A 5AVQB 4HKZA 5E2WH 5DMGD 1UUSA 1J5IA 2X38A 4TULH 5BZZA 2IH3A 1I1AC 3GAYA 1MJJB 2HFEA 4LP4A 1OY0A 3K3QA 2ZAGA 4O8AA 5HNUA 4YIQA 1J05A 1QUPA 3VGHA 1NCDL 1UC4A 4UTAH 2KX9A 3KWSA 4NZ5A 4MNQB 4U1GC 2OZ4A 4Z7AA 1NWPA 3GMOA 1VS1A 4PD4K 3E3QE 3FNDA 2DQDH 2R8SL 1IEBB 3PZGA 5F0PB 4ROQA 1KG0B 4XPTH 4REQA 1QNRA 3PWPD 4WWKD 5FUZL 4L5ZA 3TTOA 4H0HB 3W87A 3OG3A 4NN6C 1Z9PA 2B9AA 3RL2A 3ZT6A 4Z7NB 2DUAA 4W9EC 3FDKA 4A29A 3V7AG 1M6UA 1WC7B 3VNIA 2IPUG 3HPLA 1CGUA 2FEDD 2F7OA 4JB9L 2FZDA 5I6XC 2DTSA 1FO0L 1B3WA 5T3XH 5H8PA 3O7UA 4A7GA 5E2TH 3MLRL 4YVVA 1OGAE 3MJ9A 4LZKA 3K7UA 5FCUL 3W1MA 5CINH 1CLXA 4XSLA 3O6AA 4CADB 4Z8FH 4KUCD 1PU0A 2BDNH 5T91A 4NSKB 1M7XA 2DWEA 3BAYA 1HYSD 3NPVA 2XWDA 3G1VA 1Q6DA 2PGWA 3T2LA 1JUFA 4OFPA 1LRQA 5AW1B 5ILTL 5L7XL 1VLIA 2IPFA 1M71B 5DHMC 1DL3A 1BGXL 3BH8A 1U3NA 4OGZA 1U8NB 3PZ9A 1B88A 4MA7H 3BAIA 4ZPVA 2J4WH 4OVXA 2VRAA 5CS7A 3WFDL 5AYIA 3TAOA 1UYWH 4OTXH 4RV8A 4QE5A 1G7QA 2XZZA 3G5XB 1RIHH 5MI0C 1FL3B 3FB6A 3L1FA 1XR2A 1KTBA 3VGGA 1WGVA 1Z5YD 4HUCA 2V4LA 4ZYKB 5LB1A 4G8GE 2ZQKA 1W2VA 4Q4EA 1PLGH 1MQPA 4IF2A 4MYWB 1J9CT 1VFBA 4EN2A 5I6XB 1OIMA 3VIOA 4LKCB 1FI8C 1MVUA 2CUAA 4U1HA 4APQD 1AHWB 2QFPA 5EB9A 3FAWA 3RVWC 5I28A 3JS3A 4UR9A 5GZNA 1KTDA 4NN6B 4PH6A 1GGIH 4AGNA 4QR7A 5F1SA 3BXNA 5AW5B 2EDOA 4EUPA 4CN4A 1GTFA 5F3FA 3QHZL 4JFYB 1RJRA 2D7MA 3R0KA 4XCCL 4H6KA 3D06A 1KIQB 1YRKA 2IAMB 5MHSD 1US2A 2J77A 2ZCZA 5BRPA 5HWJA 2XH0A 3VOGA 4C5ZA 1CXIA 1A4JA 3QIBB 4XBPB 1LQSR 1DLHB 4FS0A 1AO7E 4L7ZA 1TCMA 4LRNL 4C6JA 4OJCA 1RJYB 2HVJB 1EDYA 2WGXA 2WJZA 4BWLC 2F53E 5D2YA 1MJUH 2FZBA 4Q6YA 1XRTA 3V6OC 4YQXH 2F53D 2BWDA 3E2HC 3LSOB 2D9QB 1QO2A 3EX2A 4JFEE 4OTXL 4HIIB 3KX6A 4BS0A 2VXUH 4NBXB 2DTMH 3LPWA 3U0PA 4OCMC 2Q8ZA 4NZTH 1Q5MA 3MKVA 3PGDB 3RNQA 3W0WB 4WEVX 4FJ6A 2CJ3A 1ML1A 1G94A 1NC2B 4IM8A 3L3GA 4TRPH 3L54A 1K2DA 1YE4A 1J2WA 3NZRA 4JTTA 5LNWA 5AYUL 3DDFA 4TVPH 4KUZH 5D2LB 4WJEA 4OF6A 1IM9B 2VUYA 4CC0A 4DKDC 5GZNC 1KXVC 4J3OG 4B9CA 4U3SA 5CZKA 1JPMA 3ZIMA 3ME3A 1KBGH 1MQKH 2BNQA 1CLCA 4HMDA 1WK0A 5AW6B 2OWCA 2Y9RT 3QDGB 2NY3C 3KDMB 1HQRA 3QPQD 3B7SA 3ZU8A 4PV8A 3LCFA 3QKEA 3QO1B 5LDUA 3P81A 3HAEG 4RMUA 3AYRA 1ZWIB 4HB7A 3MBDA 3QIBD 1NELA 5F2MA 2Y24A 3L7EA 3VI3B 4C7FA 3EDFA 4QXTA 1OP5K 4JTAA 3NJGA 3V1PA 4DJFC 1JFHA 2PBGA 2YEZA 5E8NB 1HHGB 1OSYA 3OB0K 4MY1A 2GPTA 4F8NA 4HISA 3TJLA 5IQ9A 4YZFF 1MQ8A 5EU3A 1JTOA 1UZ8A 2IWEA 3FZUD 2DTML 4BK8A 1PDYA 2XSAA 4RZCA 3WS3A 4HU8A 3SCMA 5EF2A 3APDA 2HDJA 3AXKA 4UT6H 2FJHA 4XZUB 4TUJA 3PV7A 5E51A 4R27A 5FJTA 4R4FH 4XCFL 1ZPLA 3FHQA 3ABKB 1NMBH 2CXEA 1JJKA 3V1HA 1GPOH 1UA7A 3OSKA 5IQMA 1R9YA 2GJXA 5IK3B 2F8QA 5CIPH 2BVOA 1NICA 1U3ZA 4LPYA 2W9EL 4MAYA 3BQUD 1A5LC 1U4FA 5K9OA 5C0BE 4GAJH 1RY8A 3QV8A 1CVSC 4PEEA 2CO1A 4IGSA 1JZHA 2EINB 2LFGA 2J43A 2ZXAA 4PJEE 4WI9A 3WG6A 1NUDA 4ZXBD 2MUCA 4LVNC 4HJTA 4NQDD 1KCRL 5FR3A 1TOXA 1NCCH 1LTDA 2P1YA 1G0YR 2E6YA 1FGNH 2WXFA 2YWYA 2I57A 3H7VA 4UNUA 2YARA 1SLVA 2EDTA 2N3JA 3RIFF 1H09A 2VGLM 3SY1A 4D9RE 3DI0A 3W2JA 4PJXB 1PZBA 5IMOB 2OEMA 3X1FA 1YMYA 3QYQA 3ZL2A 43CAA 3DGGB 1DBJL 2J5LB 5KZ6A 2IOOA 4KY1H 3NT0A 4DWHA 3DHJA 4XTRD 2C13A 4W8LA 5IV2B 4Y5XC 1X8CA 1KIQA 1NLDH 2BLEA 1KTKE 3HEIB 4L8DA 3R7RA 4TR9A 2G4EA 5G2IA 2E74C 3BFQG 1A4AA 1WFNA 3WGUB 3ZTJH 1MOEA 2ZXQA 3FBQA 5GGQH 2HT4D 5CP3A 5HGDB 3H4GA 2HJLA 1ECYA 3QXAB 2R9HD 4GRWH 1HXMB 3ZWSA 5KINA 4RGNB 5KZCD 1I1XA 3PWIA 1IIKA 3MBEA 2VC2L 4NP4L 2I14A 3F84A 4KXZI 4DT2A 3BUDA 1QT1A 2QW5A 2X1SA 1MVYA 4UTTC 2V2WB 5AB2A 2AXWA 2BMKB 5D96B 4FYTA 2ISWA 5DUBB 1FNHA 32C2B 1TG8A 2CDEB 1AE6L 1NIAA 1U58B 1P9MA 3V9CA 2BY0A 4MMZB 5BS0B 4PU2A 2XQBL 4JTKA 3PF3A 4HEME 5T8IA 5GZOC 1ZAGA 1H3WM 1MHCB 4NC1C 5CMAB 3AU1A 3P0YL 1HH9B 4HFWA 4FIRA 1AXSA 3P30H 3OVPA 1I85A 3KCWA 3F2DA 4ZQOA 2C4FT 3TTSA 2ZWNA 4PJAA 5MEOB 1UIPA 2ED6A 4R26H 4AI7A 1OM9A 3HG1E 1ETA1 4M5ZL 1EFQA 2BSDA 1F7BA 1W37A 1S9KC 3NN8A 4BQ6A 1AVAA 2K6YA 4H44C 1NJ9A 3LV5A 1P4UA 3UNTA 3WO3B 4HLZH 4C6QA 2VIRB 1OANA 4PMJA 3CWNA 4Q4MA 1ZS8B 3VYPA 2XKNB 3QHNA 1CLZH 3FU7A 5FOOA 4NQCE 2OX5B 4M6OL 4DP9X 4F27A 1VC4A 3BFWA 2AK4D 4DN4L 1PL3A 5GJTL 2OMTA 4GS7B 4ZZFA 2A74A 3GNOA 3C5SB 1A5KC 1XDLA 3WFHA 3MUIA 1H0DB 5AW0B 4DP1X 3K6OA 4GBXA 2J8UF 2C34A 3LNIA 2ZOXA 4P5TC 2E1DA 1Q8MA 4J28A 1S9VA 3SO5A 3KYMA 4GYJA 2DQDL 4MJ4A 5FYLE 5FFOA 4CD5A 4IS6B 1CWYA 3RNDA 1SJDA 2PPFA 3MCNA 1RHHA 4J3ZA 3VI3F 6FABH 1YMMD 3OPZL 3W1AA 1NOAA 4H04A 1G7IB 4OCNC 4HIHA 1F11A 2ZOWA 2CWNA 1PV8A 4FI8A 4Y9EA 2Z6JA 3CFNA 3R43A 4LOUD 4MB4A 3MGTA 2J9ZA 3PANA 1ZA6B 4M7KL 1O9WA 3BWZA 5SX4H 1UUQA 3VFSB 5EU6D 3E2QA 3JTTA 2WN2A 4KKAC 1KJVB 4AQAA 5IFJA 1D2KA 2CERA 1BVLB 4NQUA 5D7LA 4ZZKA 5L2JB 5D2VA 3BRGC 3CT7A 4QNEA 4D8LA 1QZNA 3U9PH 3QZMA 5BZWB 3X1NA 4YH6A 5LGYA 2NR6A 3A4JA 1II4E 3F12A 4XC3L 4KI1A 3WKMH 3EW3B 4HNOA 1P5UC 4MJMA 2CDEA 4AK1A 2PWGA 3O8AA 3GJFA 4GH3A 1LLOA 3SCNA 3HM7A 4Z7OE 1NFDA 2IGFH 1J6OA 1E56A 3E74A 4FK9A 3UWYA 3HPJA 2W0FB 3FB7B 4M93C 3ZE1F 1BEUA 2Y72A 3HZ3A 4LIQE 4S1RL 4JY6A 2NSXA 1UOZA 3F58L 4J2PA 2ZP8A 3NAAL 2DJMA 3QJXA 1YNTF 4UV4L 1KWKA 1XRSA 2GVLA 3X11A 2VN4A 1R47A 4WW2C 4RGMC 5BZDA 3NN8B 2AITA 3GC5A 2CWXA 4XO5A 2YK1H 3W56A 4HHGA 5IEHA 4IG2A 1MFVA 5I8EA 4C6BA 4PJIF 4RE2A 3WL1A 3IEAA 1Q85A 3KLDA 1GCYA 4ZENA 2F1EA 4R0LB 2DM4A 3QW4B 1QKZL 2VEGA 1DN0A 4AU0A 1HWHB 2D0HA 4DZ8A 4PIBA 4JREB 1TETL 5AWNH 1EFXB 4NBYB 5EC2B 1WITA 1J0HA 5KOMC 2R29A 4NN7C 1OG0A 4V33A 4LYRA 3SM0A 5FGCB 1XFCA 2E4FA 3SDYL 3VCCA 4I13B 3WE1A 4NX0A 3WN5A 5JHLL 4P7LA 1AJ2A 5ICZA 5J57B 3UZZA 2EH8H 4X5XB 4P49A 1FH2A 3KPSD 1X5ZA 4I3SL 3ZT7A 1B54A 4I5BB 3BKML 4BRJA 4WLCA 3OM3B 1F45A 3A9BA 4KRTA 4TVPL 2E77A 4PB0H 3H6OA 2AQTA 1UQSB 2C7UA 4ANKA 4URIA 4OCXH 4P5UA 5F4XA 2OTUA 4I77L 2PWFA 5FL1A 2P5WD 2X1QA 1Z9AA 4NNXA 4FO4A 2A4EA 4YPJA 2P5NA 2JJSA 3H55A 1OGTA 1OD9A 3BP4A 3TBSA 2VD8A 3KYNB 5L2KE 3TESA 3EPOA 1A6ZB 1QZ1A 4PCTA 5JO5A 1Z2KA 1RJZB 1DJIA 3QAQA 5H4ZA 5JIWA 2FLBT 4C8XA 1ZTXE 2NZ9D 3O8XC 1IM3B 2VRQA 3KRUA 1F8TL 3N91A 4AQ1A 3WF3A 4F9DA 2HKAA 2W94A 2R1XB 2TSBA 3BDYL 1BIIB 4YDLB 2WP3O 2RBLA 5GGSB 4I8YA 1N5YH 2BCKA 2K8QA 4Y4HA 4NOBA 5JPMC 3B2DC 3U0TB 4ZEPA 4UQIM 3MO4A 4MPKA 5GS1A 1KGIA 2YZ1A 3QUKA 5KYXA 2JF6A 3S3CB 3B37A 2IFGA 4Q8BA 1LQ2A 5T3ZD 3LRSB 2Z1VA 3QIUD 4LVOB 4U6YA 5BYWA 2VXSH 1VBHA 1XGPB 2ZSVB 3AB0C 1C5BH 3UWVA 4L1BA 2XH7A 4HPYH 1RULL 3LK6A 1R5IA 3N43F 5AZUA 1M2OA 3T8MA 4N2DA 5HYJB 1C9DA 1XRFA 1XG3A 3DERA 3KS0H 3S9YA 4XMZA 3S2AA 2D2OA 4NO2A 4X5RA 4DGYL 2AJXH 4PW9A 3BVNA 2GUUA 3LQLA 4RDVA 3UYIA 5DQ9A 1R9FA 2O4MA 1YUHA 3EJSA 3SIZA 5C2UB 3FKKA 4MNLA 1MWAH 5DO8A 5BO1L 1OC6A 4HJGB 1MZYA 3OAZH 4TLTA 4YMPA 3CCHA 3VH8A 3SY6A 1W3LA 1PUDA 1UUNA 4L4PA 4F0KA 2HFTA 2W62A 1Z5LA 4XNYH 2YBRB 4ZAKA 1EYEA 3T0WA 4Z7UE 1W9VA 5FEZA 1QI3A 1QFWI 3GRBA 3KBEA 1CICC 2PDJA 3AMKA 1R86A 1KBVA 1SPDA 2Y36L 4H88L 5BQDA 3OKMA 1DZBA 5E0KA 3BAJA 1K5WA 3B1UA 3EIFA 3KDMA 3WSQL 1Q63A 2ONEA 5FF2A 1OZUA 2DSKA 4BFIA 3IFPB 3QDMA 2O72A 3CUJA 2J71A 2UYLA 4H00A 3H9ZA 2RHEA 4Z7WE 4HT1L 3RWFB 5E0QA 1KR1A 4AVFA 4XNXL 3UJJL 3S5YA 3ZE2B 4E42B 1USQA 1U5HA 1I9CB 2PWEA 3GXTA 4M8VA 3IDYC 1Q7ZA 2OXGB 5E94B 3TYCA 3M7OA 3N2BA 3ZPDA 3VNYA 2QQKL 4L23A 3SYPA 3TEUA 3B7YA 3U83A 3NGJA 1T04A 4WK4B 3WDJA 4DO6A 5DJDA 4XVJL 3V5FA 5EC2A 4C6PA 6REQA 4FS9A 3LNEA 2OULB 3V0DA 3REQA 5D6CA 3EXJA 1IE4A 1WCQA 1KIPA 2P49B 4ZMOA 3VFGH 4PJIA 3JYCA 1VFOA 4O57A 2EPKX 4N0FB 3ILPB 2F9BT 3KBVA 3QWRA 5FEPA 3WLSA 5F89B 4O28A 2VKXA 1A3LL 4M7LL 1HOEA 4GFXA 4Y19A 2OI9C 3NPZB 3Q7JA 5F7FA 3RVXD 3RZCB 2F54A 2RFXB 4EIUA 2C1GA 4HJ1A 4WW1B 2QCNA 2Z0IA 1MEIA 3M9YA 2OOGA 4LL1A 4R7WA 1FO0A 1IC0A 3W76A 3CH0A 3OLIA 4MB5A 4OLWL 3QPEA 4JNZA 5F2GA 5HMDA 3VIIA 1RIHL 3JW7A 2YL8A 2UY3A 1P43A 5EZJA 4E9QA 1R30A 4MA8L 1H8NA 2FX9H 1J8HA 4JM0A 1R85A 1GHRA 2GDQA 2CKBB 3LIZL 3QC6X 3PZUA 4AENA 4X6FA 2YW3A 4CD6A 2UZXB 3G6JB 3ISRA 4BYHA 5BQ7B 1E6XM 4HXAL 4OGXH 3X1EA 4N22A 3Q6GH 1KM6A 1G7QB 5HHNA 1RIVH 5IW6A 4L4VE 5GZOD 2ESCA 5AOKA 1NANH 3G04B 3TYEA 3KLQA 1VRDA 3T05A 2R1PA 4B92A 1IL1A 3PZOA 3LIZA 4I0PD 1OJXA 4HZ7A 4H9ZA 1BMGA 3GBML 2A6IB 2NXZC 4KZDL 4DP2X 4YK4C 1AL8A 4E5XB 3NQCA 4M4PA 3RWGB 3NQGA 4MOZA 3KP1A 3SYQA 4R85A 3KPSA 2XICA 1FZKA 3CQFA 4NPYA 3WJJA 4JN6A 4M6PA 2WHMA 3FQWA 5EZOL 3Q2WA 3FU8A 4GOSA 3T3ME 3P9LA 1NWTA 4IICA 3CLEH 2P5WA 4G2AA 4QUOA 3PPFA 3B2MA 3MV7B 3EYSH 3SDOA 3GSVB 3H3PH 5HDBB 2RCSL 2W1NA 2YA0A 5DQDL 2BMKA 2NY2B 4DJEA 5ABEA 2R9HC 2UZYA 3TV3L 5I1EH 1BOGB 3O3DB 3NCCB 5GRYA 1FWCC 3A3XA 3W3OA 3QR1A 3W25A 2X28A 3P8JA 4F4RA 5F9OH 4HMEA 3VXUB 1UP0A 2BSLA 2WB5A 1BJMA 5IW6B 2W60B 1NSJA 2P0IA 2ZADA 1SO5A 3TYFA 3WIFB 2IUZA 3RVTD 3KTXA 4YCPA 5I1DA 2GHZA 3LHUA 3EUDA 2BY1A 4P57A 2R1LA 4HXBH 4YNGA 2P10A 1E40A 3FULA 4C1NA 1SJAA 4GBXC 3CUFA 3M0KA 3L17A 1GHSA 4NKDA 1V0NA 1HT6A 3O3RA 4KEZA 5HJLA 1TO3A 4Y88A 1DOSA 3AVEA 1ONXA 1XQ4A 1MI5B 5F6IC 2O4QA 2E09A 3EKLA 4ZXBC 1UWTA 1G1CA 3DKHA 4EVNA 3ILEA 2ZVRA 1OP3K 4LSSH 1FLTX 3PTDA 4Y90A 3SAZA 4AIUA 4ZFOA 2BP0B 4QAWA 4UYQA 5EU4A 2WUBH 3IU3B 5FV1L 3AM8C 3VXNB 1DKWA 4MJIA 1R3VA 5DYOB 1DBBH 4M48H 4D3CL 2OZTA 1WWBX 3DVIA 4GAYA 4UT6A 2ZTKA 4G7FA 1RZIA 1MHCA 4XWGH 3OA3A 4FFZH 4O2CA 1WBHA 3DMMA 5KG9B 2BNRD 3BP6A 2OMYB 3FPYA 4EBQL 4KK8C 4Y4KB 2Q76B 5ABDE 3DJTA 5T1LD 4NQCB 3FZUC 1SYTA 4LAZA 1N19A 4RZ4A 4ADGA 3QDAA 2Q01A 4Z7UF 3BJ91 2YCEA 4PUUA 2EPOA 1GKOA 3VZXA 2E25A 4G6KL 5LIWX 4WJG3 1M6OB 3G0UA 3LDBC 1MUJA 2OFQA 3HMXL 5BOPA 2Q71A 3TZVC 4LAKA 2FQDA 4X7FC 5E99H 1J5OH 1NGPL 3LM3A 3SQLA 3UGRA 3KLKA 4HAGA 4PQXA 1CICA 2C3WA 3VRLE 5I76B 1P1XA 3BTNA 2R23A 5IQ7L 1PZ5A 1RU9L 2AZAA 2HTLD 1EWHA 2JKJA 5L88H 1TZAA 2YL9A 1A7BA 1EO8L 3M8OL 1MRDH 2XN0A 4JGDA 3RXZA 2DZBA 3SDDB 3C6LB 2H6UA 4N20A 1TJIL 3GK0A 3UWEA 1NGZB 1UCBL 4OAWB 1PCKA 1LLZA 4GP4B 5F0MB 1YEDB 5C0DA 1VKXB 1E73M 3UYCA 5JR1L 2X4RB 3TZNA 1BWWA 1BD0A 3IDNB 3B2UC 2CLVB 3H2PA 4UTAL 4MAZA 1EJTC 2A79A 3F03K 2BBFA 2DQUH 1H6TA 1KELH 4OIFA 3SKOA 2OMVB 5C3IA 1SZRA 1XYAA 1I4FA 4XAWH 1Z7JA 3CHDA 2DM7A 2H0EA 2HT2D 1C92A 4ONOA 3THCA 2G50A 3FB5A 2L7JA 3EOTH 3FOKA 2X1OA 3IF1B 2CIPA 2GG1A 2ZWLT 2GSGB 2FB2A 3WMCA 3DBXA 2JE8A 4D6DA 4X4XB 3BAWA 4JB9H 3VXSE 1OFEA 4O02H 1YX1A 3TN4A 5I7GA 1QFWM 1KM0A 2WC7A 1FSKC 2K9FB 2WK2A 3S34H 1E4MM 3GLEA 4WW2F 4PI0A 2ZKMX 3HR6A 1U5VA 4C6MA 1TWIA 2FSEB 2Z7YA 5FHBL 2ILLA 3MO1A 5E70A 3VXTB 3EO0B 4OGYH 4DGUA 1X8FA 2M1KA 2BZDA 3PJNA 4JJ5B 2OP4L 1EZWA 1W0VA 5BVPL 3TH4T 4TVPD 5FEBA 1MF2H 3ZDZF 2D7NA 2H32H 5T1LA 3WQPA 3GUFA 4RIRB 3NOEA 3OW1A 4DF2A 1IKFH 2X4NA 4BUQA 4OCYL 4KO5A 4WO4D 3UJRA 3AFBA 2CRZA 1IR1A 3P2TA 2HKHL 3VFWA 1FVEB 1NDGB 2EH7L 3PBVA 3VI4B 1NF7A 4PP2A 4YJ5A 1TQCB 3HAEA 4ATDA 4OZGF 3S35X 5GSRA 4FADA 2AGTA 4HGWB 5FECA 3GB7A 3WFCH 4BF9A 4B9FA 2X05A 3ABGA 1I82A 2E46A 3GFUA 2FGLA 2OWXA 3ALGA 4RPQA 1MDTA 3MB9A 4XBGB 4YIWA 4WEBL 4MD4A 4XNQA 1HYSC 5KETA 4EACA 1LBFA 3MA7B 1EF2A 5TFSL 3NACL 3TP4A 1EV2E 3VACA 4NO2B 1O60A 4ODSH 5DRXB 2I07A 1XUUA 3BHBA 3U30B 5L9DL 3CFIC 3HKZA 1DVJA 1MG2C 1IGCL 1ZHBB 4Z7WA 3CFCH 3EO0A 3ORJA 3M0HA 5GGVH 5HHMD 3TFKC 1PEZA 3X1BA 3GU1A 1J0JA 4PJGF 1YMHA 3OLDA 1I4FB 3FO0L 4Z7VE 3RIFK 2A9DA 3U36B 5DJCB 3JUZA 3VDBA 3ONCA 3ZLGA 1YAZA 1I53A 1K77A 2WYIA 4JY4A 1VBJA 4LT9A 4OU3A 5D2XA 2Z28A 3ZHFA 1EXGA 4NCC2 2Y70A 4XTIA 2HQAA 4NKQB 4F2ME 3K2MC 2X6VA 1IO4C 2OPCA 3O6FA 5GSVA 2NWSA 2QCDB 1I1WA 3BKCL 3NDYA 1YYML 1R33A 3SYOA 2H6OA 2GLKA 4HN4A 1OQOA 2OR7A 3ZDYF 4MRCA 3ZIZA 2B7OA 2BS9A 3IVSA 5C0IA 1AQHA 3QC0A 4LSTH 4ALAC 2A6JB 4EZMA 3W74A 1WHPA 1PZ5B 2QZ5A 2YDAA 1KZQA 2CR6A 2NQ5A 2P5EE 1FZMB 1U41A 2F19L 1XF1A 4YHOH 3QPZA 4QHMB 4NN5C 8PAZA 3QUGA 4MQXC 1QFHA 3DIVA 4H6EA 2DQEL 1JV2B 4QDPA 1VKXA 1ACYL 2XU9A 3TT3H 4Y1AE 1NGZA 5AZEL 3UAJD 4OB5L 3VW3H 4WJ8A 2MSPA 2WY3B 1XWVA 4QRUB 1XH0A 4XH2B 2A3EA 4LGXA 1OHLA 1S9XB 3QUMH 2OW6A 1NDWA 1I1AD 3FQ2A 2CUMA 3BGGA 4X60A 3NIGE 3L95B 5F21B 3WK0A 3PWNB 2DUXA 4X98A 1XGYL 2Q76A 5FYLL 1IQ8A 3QJRB 4RW3A 1AO7B 4UBPC 1ORSA 2XZCL 3P4OB 5KYWA 3WLWC 3V6OA 3VTAA 4BH7A 1BRLA 5E7FA 1KDIA 5DY3A 4U1SB 4EI5A 3RPIA 1T6WA 5JIKA 3TWYA 4U5KA 2UUDK 1W1ZA 2X70A 2F18A 5IXEA 1H3PH 4HH9A 4N0CD 2GWNA 4OQTA 2WNKA 5BWAA 3RUGE 3EBGA 1AW2A 3MV9A 3LN3A 2VUNA 2BVPB 3DK0A 1LNUB 3NDOA 1OVZA 1BSLA 3MRBB 4QP0A 1PX3A 2P8MA 4MTMA 4C6NA 3QZPA 4EF9A 4X6EA 1N6QH 2L5HA 3ZMRA 1D2OA 2MHAB 5FXCH 1LDSA 4AUYA 2BCMA 5D1XE 1K8CA 4GSUA 3N4EA 1ZSDB 4P8QA 4PCKA 1EPFA 2ITCB 5IW1B 1J9QA 3V4VH 3M0IA 3BJSA 1DVQA 3BT2H 4MMYB 4I4WB 3BWAB 3RU8L 1NJJA 3CV6A 3H6AA 2GDVA 3EMQA 4ZMGA 1MFCL 1VFUA 1ZMYA 3UTPE 4F9LC 4K9EL 1RUML 2J7FA 1CG9B 4L0PB 5D38A 3BKMH 3VILA 4ZTOH 7TAAA 3EX1A 1S5NA 1AKJB 1F5WA 3W1QA 3W6YA 5ABFA 5H8MA 3G6AA 2FWLB 4ODXA 1UW9A 1SLXA 5K33A 2N7BA 2NXIA 3NJMA 3WNOA 1VF5C 3UACA 3L66A 1CECA 1E43A 4LVDA 2DBLL 1J8HB 2X5PA 2X4QB 2ASHA 3AJXA 5ESQB 2DMHA 1GTHA 3APNA 2J2ZA 3MV7A 1EPXA 4QOKE 1P1ZA 3P3BA 2AHIA 4L4JA 2AK4E 1E5UI 3T07A 4IEFA 1L6ZA 5AOMA 2VDML 4LDOB 4ZXBB 4AT6A 2YRPA 2YX0A 3UAEA 4Z7NE 3AZTA 4OBRA 1WTGT 4NBZB 3IIZA 1H0GA 1PAMA 3O07A 5FLUA 3MODL 1YEEH 4AUUA 3RPBA 3OB8A 2G3JA 4LOCA 1CF1A 4PGDA 4HWBL 5IB5B 4FG6D 5KANG 3RBSA 4D0BA 4PPTA 1YDPB 1E4WH 1FDYA 3LRMA 2G75B 2BGQA 3TJHC 2LU4A 3NL6A 1FWRA 1VQTA 3PBGA 4HIHB 5AQ0A 3BAKA 5TJWK 1A7QL 2NZLA 2OMNA 3IPEA 2SEBA 5JUVA 1TZIB 5EN2B 2CM6A 3C9NA 5TH2B 5GS0H 1EA0A 4UIMB 1TWWA 4TOYL 3AQDA 2J8FA 1EK3A 1UM6H 1YPZE 3EG9B 3HI6H 5TE6H 1PLBA 4CMHB 3T1WA 4IRJC 4NC0B 3DH7A 2GKIA 4QE1A 3NCYS 1L9WA 1HXMA 4KUZL 5M17A 4FR6A 3VTMA 3A21A 1CLKA 3BPOC 3QSKB 1X9RA 1RZ7H 5IM7B 1UMYA 3D3AA 1XF5A 4JFUA 4Z23A 5IBXA 2Y7MA 3LY0A 2PO6B 3MJWA 3HR5A 1FY6A 2W5PA 1KPVB 3UC0L 1QLFB 5E24E 1L6YA 1R2TA 5LNRA 5BS0D 2HPOA 2BFVL 1GZGA 1FOBA 2J8TA 1CGYA 2R1MA 2W0KA 2WMIA 1R24A 4PJXA 4X99A 3O6FB 2ZSWB 4JZNA 4OZ4B 5GSVB 5C3TA 4AYEC 1O4UA 3QFWA 5HAOA 4MYPA 4DAIA 2QYGA 1V3LA 2PYEB 4Z5RA 1V0MA 4ZPTA 3S5SA 1XG4A 2O9TA 1SJEA 1SR9A 2E27H 3U2CA 4BWTA 2XG5B 3LNGA 3OKOA 2MCMA 5T33L 2AQPA 1E6JH 4TQEH 3LKPA 1N68A 4KBXA 4YN3A 3AIVA 5IIEB 4L1DA 4Q97A 1CL7I 1NMBL 2A9NL 1LEIB 3NL2A 1WEJH 5C9JB 1S5VA 1Z6KA 4A8RA 3OWEA 2ISDA 2XXGA 3CK0H 4TL5A 3VXUE 3BLLA 2ZSVA 3P54A 2RB8A 4XVJH 3PTKA 4NG3A 2V7HA 1P69B 3UETA 1P84K 3MTRA 2QVFB 3O4LA 5FYKU 5HVHB 1L7TL 1ESOA 3UABA 1J1PL 5BVJB 4HYTB 4CC1A 1ICPA 3CMJA 3JV4B 3Q2VA 3PB0A 3VK5A 1W1A1 4R96A 3QDJE 2J79A 6TAAA 4UDUA 2YPVL 1N8ZA 1W0WB 3VFVB 2F61A 4PA8A 5DS1A 2HX8A 3HHMA 3WCYA 1DIKA 2Y5EA 1E6NA 1SUJA 1T1YB 5J8OA 2L8AA 4KERA 3QW3A 4S10A 3ULUE 1ZVHA 3GEWB 3SQOH 3BANA 3HC3H 5LAXB 1NSNH 3CEUA 3NCYP 3GSXB 4WFHD 2PRHA 1TPC1 4YWSA 3OKMB 5JTWA 3DUSA 1KPRB 2DQGL 2F08A 4F7KA 3UTQB 1C93A 4G8IA 4LKXB 2WZPA 5IJKA 3HB3B 2VOMA 4LSPL 2ZRYA 4F8TA 3FU5A 4IRJB 4XWGL 3T4AA 5EU9A 1ZHKB 5AD0B 4PGCA 3QB7C 1X7TA 1OVDA 4L6DA 4G1EA 1XIBA 1L6GA 1EVTC 4B97A 2PC4A 2CJUL 4MZ2A 4U7KA 3DFQA 4XZWA 2VFEA 4DYEA 1JNHB 1KV5A 1JZDC 4FLSA 1QA9B 3U4AA 5JMRA 1K70A 2O6EA 2VDRL 2FNBA 3SSGA 4QT5A 1KIRA 1NBZA 4JIIX 2IDTA 5ICZB 4M7TA 2PETA 1B5TA 1IF2A 1F58L 4AE0A 2XVNA 1OAUH 3BPCB 4UV7H 3UYRH 1QPPA 2SODB 4J3XA 5D4JA 1TU2A 2BSSA 3PJUA 3URQA 2E3ZA 3QVQA 1PIFA 3OAWA 1OY3B 3S9ZA 4NQVA 1UUOA 5CCKL 2CDFA 3IGHX 7TIMA 1T1XB 3VGFA 4CQBA 3V6BR 4NZ8A 3QI9D 4LAOA 5DJ6B 1J0IA 4JPSA 2O61A 4PL2A 3LEPA 1LJMA 3WJJC 4DGVL 2DYPA 2NNCA 4PW3A 3C2AL 1CJYA 1OGTB 3BP4B 3W7NA 2F7RA 3HG0A 4YTSA 1XTLA 3FYPA 3DV4A 1RBAA 1HW6A 4DK3A 3SBPA 4TVCA 1ZIAA 3RWDA 5JU6A 4RW5A 5D33A 1W6WA 4PV9A 4GMTL 2J3SA 4LCWD 4Q9QH 1WAWA 1MFDL 5HGAA 3V7AE 1SHWA 1UATA 3IJSA 5CILL 2XPGB 2R0ZH 2W66A 3RR1A 3QQWA 3CFKA 4P7NA 3HUJA 4D9LH 5K1VA 2BOGX 5G4EA 3F7RA 2BASA 2ZONA 5CFHA 1EFXD 2QJGA 2R0WH 3L3HA 4LKCA 4P23D 2LVEA 4XE0A 2ZE0A 3CTTA 4B50A 5EU5A 4U1JB 4AYFB 5DUPL 5EA0L 3EMCA 1CQKA 3IGFA 3NUKA 3RI5K 5ES4B 3DDGA 5L4FA 3NQ2A 4KFOA 1NIBA 3V18A 1FCGA 3VIGA 4E8GA 1H6EA 1JVLA 4ZUVB 5HYSA 3U1SH 3TEZA 1A3RH 4S1QL 1A1OA 3PDOB 4K3ZA 2ICWB 3L13A 3OC8A 5B1CA 2IH9A 2R29L 3AQZA 1CGVA 1UA6L 5LXVA 3P5YA 2J4GA 4ZQKB 4J2QA 1OX4B 3O1NA 3QPXL 1AZVA 2VDOH 3QCUH 2BJMH 3NH7H 4FL4C 1DN2A 2WO4A 3D6GA 4FQLH 4NKMA 1F8TH 4QRRE 4UOJA 5AUMB 1DIDA 1EJWC 2H8ZA 2YCIX 4G5DA 3ULVC 2D0GA 3NIFE 4AWJC 4W6YB 3TBYB 5B7FA 1NEYA 3QWQB 2ATMA 3BWWA 4IH3A 4L9XA 3RDKA 5CC6A 3B7UX 3M7WA 1K7FA 1QSFE 5L0QC 1WA1X 1N0XL 2P8LB 3GNNA 1UCTA 5IQOA 2N4IA 4XMPL 1ADQL 3G08B 3FA5A 5CSRA 4RVBA 3L9RB 3PBWA 3NQDA 3O11A 4FFVD 5B8CC 3BVJA 3HPFA 4BQCA 2WXLA 4HCRL 3DMMC 3L3JA 4Z3GA 3KDNA 4AL8C 4APQA 2I5IA 1YJDL 5AVRB 2BNQE 3DHMA 5MP6H 3S8FB 2L4OA 3ZBMA 2FO4B 5E0CA 4JG0L 3N2MA 3OGVA 4KZCA 6ALDA 1FRBA 5I3FA 4HZMA 4AMKH 1FNFA 4RESB 1NGPH 2VJ8A 4AJVA 1M7IA 1D6EA 2CO6A 3L1OL 1KCSH 5D7JB 2GQ3A 2WP3T 3ARFA 1I3RA 3FQ1A 1P6FA 2ATPA 1PZCA 3NL5A 4H7ZA 4K8RC 4KKCC 1PQZA 1T6BX 4R0LC 5HPMA 3R2GA 1A64A 2JTDA 1OSPH 4NP7A 3D9AH 2EDLA 3Q13A 3MMEA 1TV4A 2KS0A 3AREC 4CN1A 3ZVIA 2IANE 3BD5A 4W9ZA 3JV6A 4AGPA 3TBTB 1GOXA 2CIKA 1JNEA 2HFFA 4GJIA 2E59A 1ONWA 2BVYA 1KN2L 2VAJA 1SLUA 4Q6IA 4WW2B 5L2KB 2MKWA 1HP5A 4I6KA 4KVNH 1VERA 3HPAA 2X1XR 3MP4A 4Y9OA 4YU1A 4NO0A 5FM5O 4JKMA 2GK1A 1CDIA 2F8VA 4DETA 1NUGA 4L8SA 4J3VA 4J3BA 2FJKA 1B0IA 2DQTH 4UQEA 5K69A 4M56A 1XPYA 1WBYB 2VEPA 2ZAHA 4HNUA 3BO8B 3NEHA 4IHOB 4ERIA 4FNLL 2LE9A 4C5YA 1HOCB 1GIGL 3HU7A 3TYUA 4LASH 4A3UA 3VXOB 1MFBH 1TETH 4N28A 5AWNL 3DA0A 3AXHA 4PJ7A 1NIUA 4N2AA 3P61A 3ARYA 2ZQ0A 4EF8A 4HSHA 2DQ6A 2IO5A 1E0WA 4NWUH 3I9GL 1DFBL 4J6IA 5EUOF 1ZDSA 2FUQA 3CE1A 4ABWA 3WFBH 1H6FA 4I5UA 4LE8A 4L9LB 5SWSA 5ICYB 1M2VB 3BJFA 2Y7SA 3CHSA 3LNFA 4JPWH 5SWQB 4A8IA 2QDWA 1MRFH 1I75A 1W9DM 3QY7A 1CEOA 2YUVA 4K5PA 4DUWA 2J7EA 5IBLD 3O8XA 1AGCB 1X6UA 1NCGA 4AW4A 1U1JA 3OR7B 2KHAA 1BBJB 1SPQA 5GRJL 2HRLA 1X6NA 2IG2H 3GS6A 3OIHA 5JQIB 3MDUA 1FF5A 5C9ZA 2JJSC 4NWTH 1ZLSH 3V4UL 4DF9A 1I9RH 4KQ0A 3L3JB 1BQSA 4RFNC 2QL1A 5TPWH 3DI1A 1ZTXL 5D4HA 2POZA 2Y22A 2NYKA 5T1KA 3Q5YA 2A7RA 4BQ4A 4P2OD 4FZEL 2IH3B 4R6UA 2JSFA 2GJ6B 4HCLA 2ICWA 1RY7B 1GIGH 5ITFA 3FYIB 4U4IA 2D2JA 1XF0A 2Z2UA 2Y7OA 2VDLL 1RD6A 3NIDB 4IT1A 1BZ9B 4XO4A 1TMQA 2CHNA 1Q0EA 3ARGD 3R7MA 2HPMA 3IS0X 4ELKA 2D22A 2AMXA 4NEHB 5B3JF 3V79C 5AYYA 4OZOA 1DBBL 3VYOA 4DKTA 4PRRA 2IPKB 3BGJA 3HUJB 2ZRXA 4JY9A 4OF8A 2F2HA 5JUEH 3N15A 5IJVB 3AFLA 5HDWA 5LGHL 1AIFA 3VMPA 5IOKA 4FIQA 3XIMA 1F41A 3JV5A 3AMCA 4RLIA 1F6LL 4YHZH 2Q8AH 4I4WA 5A40E 1IEWA 1TB3A 4HNVA 3CK0L 1P7TB 3L5AA 5D2NE 5I15H 1RALA 4OUUA 4P8VA 5HVFB 5CGTA 1UD6A 5LGJA 3JVAA 4ONGL 2GABA 5IMMB 1ED3B 1WJ3A 3M4HA 2LU7A 1RQ5A 4UFJA 3MX0A 2AJSH 2OL3H 4Y2OA 2H2SC 1TCDA 2V3GA 1ZTXH 4EXKA 1IBGL 1BBDL 1B6DA 4C6OA 1YY8B 3R11A 4OQTH 4X8JB 5J4MA 3P0VL 1TEGA 3CC1A 1P0SE 3ATDA 2B2XH 1NFKA 3D09A 1XW8A 4AMCA 1T21A 3GDKA 1M04A 2XWCA 1C9SA 4O12A 3SDAA 5LGKA 3KL3A 1E70M 4JM2D 3M0VA 5K9DA 3K4DA 3MRRB 2F0CA 4WDUA 4H1LG 4KJYA 3QZWG 2W0LA 3ITCA 3IACA 4RQQA 2O9PA 3PDDA 5HI4D 2B15A 2NY2D 5TDNB 4WVRA 2YBTA 1GT8A 3BZEB 3B9NA 5LGHH 2PI6A 3APFA 3BN3B 1U2CA 3GTIA 3B3BA 3OZ9L 4WDIB 2HLFC 5HHXH 1OIOA 3MQIA 2QKIC 2EUVA 1ZP3A 2X6MA 4AKPA 3GQFA 4P61A 1G5AA 1RLWA 5I5JA 3V5KA 1QTSA 5IGXH 3FIGA 4HHLA 4HJSA 5DGRA 1J93A 1TR1A 2VELA 4JRFA 5EG6C 3PGFL 3IVTA 1IBZA 1GC1C 2J5LC 1DXFA 3EEGA 3ZKXB 3EO1A 1TQBB 1I2QA 5D8ZA 4PD4J 4DVBA 5D9OA 1YUKB 5E1AA 1ALDA 2PP8A 4XCYB 2DQJH 3A4WA 3WMLA 1VB9A 2ERJB 1YNTB 3QEGL 1MDRA 2ZZ3A 4LBUA 1CTMA 3MOAL 4J3OF 4E9VA 2QDEA 1UH3A 3CIQA 4UMGA 5DFTA 2PRMA 3S5OA 4FTVB 1YDOA 2V2XA 3GJFK 4UTBA 4ZQNA 1YMME 1WT5A 2P3EA 3C52A 4GI9A 1NCWL 5AD0A 3W3BA 4Z3EA 3M41A 4NRZA 1GXEA 3O9WA 4E4PA 2XQYK 1XLHA 4RETB 3G1AA 4Y9AA 3CVBA 4EXPX 2Z92B 5FLVA 3HC0A 3FRPB 2AL2A 1IGJB 4MWAA 1W9UA 2V82A 3CZGA 1GW1A 3MLVH 2JB6A 4AF0A 3TIMA 1I9IL 5IQ9B 3QORA 2PFHA 2R8WA 5KITA 4RIRA 2Y6ZA 2DY2A 1CDHA 2ZT9C 5LAXA 4EN3C 1FVCA 2FO1A 2FJGB 1IU1A 3CG8A 4JIPA 3SKNB 2QQLH 4D1JA 3B34A 5EDXA 4XBMA 4RGNE 1K2DB 2JIEA 4EXAA 3QUZC 1WEJL 3GTVA 3SFKA 5B7MA 3D47A 3OEXA 2VZTA 3MLSL 1E3FA 4EJ1C 5D4IA 2G2RB 4PVNA 3N6QA 5LSMA 3Q6GL 3TR9A 5JQ6H 1MZRA 3ARDB 2C1PA 2IV8A 3NQBA 1BVOA 4KFMA 4FHAA 3HGRA 3IDIA 2WM0A 1H8OA 4CNIB 3TYGL 5AB0A 2P26A 4CDGC 5DS8A 5IFTA 3MZGB 5T3XL 1AGEA 1IGIL 3FT3A 4XP4L 2WLMA 3S9DB 1DWJM 2B4GA 5RUBA 1XDTT 1A22B 1KXQA 3DOSB 1NCAL 2PCYA 3IDGA 4P3DB 5GIRA 3WN6A 4CRPA 4PJFA 4GGHA 5CEZD 1BVNP 3C08L 4WV1A 4HV8B 3WLWD 4LB3A 2OYMA 2NX5D 3JYBA 4R3SA 4JRYB 2QCLA 4N02A 4PUJA 3PNUA 4PG2C 3HBPA 3DG7A 4DBDA 4E41D 3B8WA 1ZHLA 3EDJA 1JFQH 2H32B 3WTSA 3DX8B 1DBKL 3QFDA 4G42B 1VPXA 3HPZA 3O6CA 3NABL 5AYTA 2YMXH 3K2IA 3PS6A 1GYUA 4XO7A 4XVTL 2V7NB 5GJMA 4KDTC 3FX4A 4MJJA 1FGVH 1JPSL 3HLKA 1OFRA 2BZ7A 1SUXA 1THFD 4FFZA 4AV0A 4HJFA 4DXKA 2D4FA 2W27A 1K3ZA 2Y1ZA 3TU9A 4P2QE 1AMKA 3EMZA 1N67A 2XJLA 2AMUA 4MJ2A 5JW5B 2V5RA 3QNYA 5F88A 4H83A 3U6WA 1J9SA 4E41E 1MFEH 3V8CA 3FGCA 4O0KA 5FJJA 3W75A 3AYVA 4YL4A 1YEWA 5D7HA 5FX3A 4HHAB 3CVHL 3SPCA 1M56B 3RUBL 5HPCA 1AQDB 1YXCA 4B5XA 1X38A 3UMNA 3KJ4C 4MDJB 4AT6B 3TEYA 2BSEA 1YEFH 4U1IA 3ZYIA 4DKEL 3VABA 4C56E 2ADJA 3ZWTA 2P5WE 3NZ8B 1CBGA 2QVMA 1K85A 2DZUA 5DMKA 2VISA 3V0SA 2E4TA 3VO0A 5I1JL 4FHBD 2E3VA 1P4LB 1BVWA 1E4LA 3EX6A 3J7HA 2FR4B 2ED8A 3KPSE 3QY6A 1IBFA 2PURA 2VQTA 2F2KA 1A0QH 5CJBA 1NUFA 2PDYA 4WGWB 3VGAB 1D9EA 4TRPL 3PY2A 1JMXA 3QYSA 2FATH 4O1DA 1MCNA 4QMEA 2XTJB 1I3RB 3SE4A 2DQTL 3IS4A 1I2NA 3UO1L 4GX8A 5EEYA 3ATZA 1H3GA 4HZLB 4WY7L 5FF6A 3U3HA 2EP6A 4EXBA 3I3DA 4FF9A 4DEUA 5ESQA 1Q65A 5E9DE 2OYLA 3MRNB 1CT8B 2W38A 3P77A 4R2GC 1KEGL 1SXNA 1W8OA 3RVVD 4M9PA 1DSYA 5CZVL 1N6UA 3VSTA 4BHUI 3WFEH 2AEWA 1UWAA 3DURB 2EYSB 1D5ZB 4IQDA 3ALWA 3V0GA 3BWUC 4G1KA 1A7OL 1NMAH 4MD5A 4C4KO 4ADTA 1VSCA 3D34A 1YEIL 2AJYL 3JWOC 3BFOA 4QG6A 3BPWA 4LSTL 4F1ZA 3ULVL 3CO4A 5IB5A 3T1GA 1NSNL 5LO7A 1GC1H 1N7ML 4G6MH 3RCNA 1N2VA 1LXMA 4JIRA 4AY7A 4MUPA 1JPGB 4P2YA 1GJIA 3PV6A 1X7QB 3AQXA 2FPYA 4L4OA 5BXTA 4BK4A 3H53A 4CSZA 2DYRB 2XNAB 4KNQA 1CFQA 4ZD3L 1ZT1A 2NY6C 3IWPA 5DHXB 1FHLA 2FLIA 2XTJD 1ZA3A 1TWDA 2FTPA 2P53A 1G7JA 3FONB 1NIFA 2WBJC 4J35A 5GS2H 3NQIA 3WO4B 3G0XA 3MYZA 3PL6C 5FYLH 2YCKX 4MHBA 4G8GB 4KF1A 4Y4FD 2ZP9A 3F7VB 4QXIA 3ZTJG 5JA9A 4IUGA 4H9UA 1VEMA 2C3GA 3KPQA 2IH1A 1AGCA 2C15A 3T4WA 2DVTA 2YAPA 5CC3A 1CG9A 2XIDA 1EDGA 3AO0A 4O02L 3GR4A 4PRTA 3NO5A 4XVDA 5HMSA 4Z2LA 2EH8L 3S34L 2HRPL 3CD4A 4TNEA 2AAMA 4OZGA 2W9DL 4UQCA 3FVDA 3QXBA 4JVUA 2VLRE 1X5XA 3STEA 3NSJA 1EJ7L 3TU6A 4LLWB 2Z4QA 4DGVH 2Y88A 5F4WA 1P4LA 3PCYA 1N9PA 5JLZB 1BYBA 3WHE1 4JO4L 5IVZA 4PLJD 3C2OA 2VXQH 3FT2A 4ENZA 15C8H 2QCDA 2X1IA 1DVFB 3I2CL