4W93A

Human pancreatic alpha-amylase in complex with montbretin a
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title The amylase inhibitor montbretin A reveals a new glycosidase inhibition motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 181
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4w93A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w93A01
2J8FA 1V08A 3GZAA 1HJXA 1ZL1A 1KQZA 4W8AA 1JDAA 2G4FA 1NWRA 2XSAA 4WJXA 3FAXA 1K9DA 1XC6A 1TA3A 4Z2HA 1CLVA 1B1YA 1E6NA 1KXTA 4ACYA 1OSEA 2F7RA 2JE8A 4P8XA 2Y8VA 1B3WA 5LA0A 1GHSA 2YL9A 2WCGA 1GNXA 3W0KA 4PSRA 2RGLA 3N15A 1VFFA 5ABHA 1ISZA 1EDGA 2C8NA 3AMGA 1BVNP 1DWIM 3A22A 4PMQA 1WP6A 1QBBA 2AMGA 2EPLX 2EABA 1FFRA 4JKMA 5CJ5A 1TUXA 4M1RA 3DECA 1RH9A 1HIZA 4RE3A 4X0VA 1EOKA 1V03A 4D71A 4JFUA 5E9AA 5CSYA 3AMLA 3WUGA 1FP9A 2WVTA 3PZUA 1KCLA 4CD8A 4UQDA 3UEQA 4MNJA 4D6GA 3KLKA 3UCQA 4FLQA 3MSDA 4OOZA 5CPSA 4F66A 1R8LA 2EAEA 3VM7A 2XTKA 3WIJA 1KB3A 3GXIA 3EDJA 1BPLB 1JAKA 4YN5A 2G3JA 3WBAA 2X2YA 5A6KA 3VIOA 3HJEA 1W9PA 1C7SA 4JFTA 3SUVA 1TCMA 2O9OA 2W67A 1UZ4A 4CU6A 1WZAA 1JXKA 1UKQA 3AFBA 4D1IA 1W9XA 2YDQA 3VPLA 3LPGA 1GONA 3DX3A 3OB8A 3LPPA 3PZQA 3WUBA 3AHVA 3CZJA 3ZMRA 1VJSA 4TXEA 1EO5A 1J12A 1G5AA 5E0CA 2OWCA 3A5VA 2D2OA 2QMKA 4P7RA 4NZCA 2CKSA 2V3DA 1B3VA 1V3LA 1CDGA 1W9VA 4Q7NA 3CMJA 5A6BD 1UWUA 4CN1A 1UR0A 4HU0A 2E3ZA 3WELA 3CC1A 4AIEA 1J11A 4H04A 3WDQA 4UCFA 3L4UA 2D3LA 2OWWA 1AVAA 1T0OA 3VSVA 3F4VA 2A3HA 4UOJA 3VD3A 5A8MA 1XH0A 3VD9A 1KQYA 3SUWA 3SCOA 4XB3A 1WZMA 1W2VA 3BMVA 5A6LA 4Z2LA 1QNSA 4TVUA 1C8XA 4MTVA 3AOFA 1HJUA 2WNWA 1W3JA 2Y8KA 3MUIA 2BS9A 3W4RA 3AXXA 1TQVA 2EEXA 4AD4A 4C7DA 3JUGA 3TOPA 3AXIA 3K4DA 4WKFA 3N04A 4YHGA 2BHZA 2EPKX 4ACZB 4KH2A 3LXCA 1V02A 3WD3A 2ZX8A 1H49A 4DM2A 1ISYA 1IV8A 2W5FA 4MNKA 4BQ4A 4GPNA 4J27A 2CBIA 3POCA 5A8NA 2YIHA 1ESWA 1E0VA 2WZHA 4D6JA 5CG0A 4ZXOA 3VTRA 1UH3A 4MJ2A 4XZWA 1Q6FA 3AS0A 2Q8XA 3U5YA 2WHJA 3QOMA 2PWDA 1GUVA 3BLPX 3SCUA 1SZNA 3B9DA 2XGIA 2ZX5A 2WC4A 1JZ4A 4AYGA 2WWCA 1BQCA 3RIKA 1NP2A 1OT2A 3KLLA 4M29A 2ZUUA 5CPQA 2JF6A 3PZVA 3WH9A 3T2QA 2FHBA 4IM4A 1C90A 2ZE0A 3UR8A 1TMQA 3BLKA 4UZUA 1WDPA 2DQXA 1VB9A 1TVNA 2EPNA 1NOUA 1GOQA 4HMEA 2E9MA 4D6FA 5ECUA 3CZGA 3AIWA 3ECQA 4AZ7A 2VRKA 1DP0A 3WN6A 3THDA 4QCEA 1VBRA 3DX2A 1GOMA 1GOIA 4AXNA 1R7OA 1HWWA 4H2CA 2XVPA 2ZUTA 3THCA 2WZIA 1ZS2A 3SCVA 2GK1A 2VCAA 4HTYA 1J0JA 1YQ2A 2WB5A 4OIFA 3UERA 1E3ZA 2DSZA 2XWDA 2WZEA 3O9NA 4NX0A 4GI9A 3VDAA 4W5ZA 3PTMA 1N82A 2VRJA 3T09A 1WZLA 2DT2A 1PIFA 4F9DA 3VIPA 3GBEA 2VX4A 3EJRA 1W9UA 1GVIA 3U5UA 9CGTA 3AMKA 1YHTA 3S2CA 3NUKA 4CVWA 4BQ2A 1ZBVA 1FHDA 5DT5A 1W3KA 4XUYA 1LLOA 4UFKA 3POHA 4NXSA 1UR8A 1E55A 3EYPA 3TONA 1WDRA 2WSPA 3L4VA 2J7CA 3W25A 4U5IA 2Z1SA 4FNRA 3ZJ8A 3WNKA 1ZBCA 1GHRA 1EOMA 2XN1A 1X1NA 2E8ZA 4X9YA 1TFVA 2J8GA 2XVLA 3WMBA 2W61A 3VDCA 4Q22A 3EDFA 3ARWA 3M07A 1CXFA 3BVWA 1M01A 5A94A 2J75A 3BAXA 3AMCA 4MAVA 1MQPA 2ZICA 4WF7A 3D4YA 2YA0A 5A95A 3RO8A 3CZKA 3ZT7A 2JEQA 2Y2WA 3EMZA 3DX0A 3ZQ9A 1EDTA 3SCRA 2FE0A 3QOKA 2VCCA 5BXRA 3BVXA 1UR9A 4BZYA 2E40A 2FH8A 1JAEA 2EJ1A 4FK9A 2ALWA 5AYIA 4D6IA 1IT0A 1B9ZA 1JYXA 1UWRA 1OINA 4DM1A 1JZ7A 1M04A 2WMIB 2J25A 3TTSA 4JFWA 2F2HA 5I2UA 3IGUA 1J0KA 3CZNA 3VMNA 1E4LA 4GXPA 1E56A 2WMHA 1KGWA 1HJVA 1FH8A 3QHNA 4PN2A 4DUVA 4DUXA 4AZIA 4NI3A 4P7QA 1R46A 1OB0A 1Q6CA 2IXVA 2WW5A 1G9HA 1PS3A 1C8YA 2V3GA 2WVVA 1VF8A 1LQ0A 2VQUA 5HBFA 1JNDA 2VCBA 1J0ZA 3ARTA 1E73M 3ARSA 1GVYA 1C91A 4F8XA 1KGUA 1HJSA 2XFFA 3WL0A 3MUY1 2BV9A 1J9YA 2G3MA 1IZKA 3BAWA 5IXEA 3AHXA 4AY1A 4C7FA 4OGZA 2WVUA 2NW0A 1BVZA 3AMDA 1QX1A 4LQ1A 2ZWYA 2X0YA 5A1AA 2WKGA 1H3GA 2WANA 2VI0A 1Q6EA 1UWSA 3VUPA 1QW9A 1BLIA 3D5HA 3HG5A 3GTNA 5BCAA 2V3FA 4P7NA 3VIJA 1DHKA 2WHKA 1UOKA 1NWTA 5ABFB 1UH2A 4PTMA 2ZOXA 3FY1A 1ZJAA 1DTUA 1LF1A 3CTTA 4CD5A 4Z2JA 4WKAA 4W84A 3SUUA 1L8NA 4UFLA 3AHTA 1XRVA 2HISA 3HZ3A 1W9BM 5IDIA 4LXFA 3CMGA 3LPOA 4LYPA 3DDGA 1HKMA 4S3KA 5ABEA 1OWQA 5AYBA 2E0PA 1E71M 4W89A 2OWXA 5FIPA 4GI8A 4PEEA 1KWKA 3NSMA 4CCEA 2PWEA 2JIEA 3PZMA 1FOBA 3U57A 3A4WA 3LMYA 3IANA 4TOQA 4X0NA 3VNZA 2PF0A 2V5DA 1C8QA 3BUIA 3VD5A 7CGTA 1V3KA 2EADA 1BSIA 2XUCA 2DGAA 3OA5A 3EJUA 3CIVA 3ARRA 4JCMA 2BY1A 4HZ7A 3WY1A 3B9EA 3QR3A 3RDKA 3MI6A 1HJWA 4EAMA 2YA2A 1CXHA 3G6MA 3RJXA 4PMOA 3D52A 1FHLA 4H8UA 2GJXA 1HX0A 2XIBA 1UHVA 3MMUA 3TP4A 3WD2A 3A21A 2GVYA 2YBTA 2ZXDA 2OSXA 2VL4A 3B8SA 3WBEA 4AZ6A 1GORA 5I5RA 3K8LA 3CLWA 2VUYA 1GJUA 1HXKA 1E5JA 5EB8A 3GDBA 3VM5A 2J62A 3VIMA 3ZM8A 2D0HA 3WFZA 2D24A 3WF0A 3OLEA 6TAAA 1V02E 2WMKA 5IFPA 4IUGA 2VJXA 2WM0A 1KTBA 4CD7A 1I1WA 2GUYA 4UQ9A 2PB1A 3APGA 3VSTA 2WXDM 3MKKA 3AXHA 4AZCA 3WL1A 1K9TA 2DIJA 3VIKA 3B9AA 1EGZA 3WQ4A 3VD4A 2QHAA 1R47A 3ZSSA 3F5LA 3VDBA 4NSBA 1OGBA 1LL7A 1LL4A 5D9NA 3D50A 3BLBA 4W86A 4D6EA 3PZOA 1QI3A 4JHOA 3CH9A 2VZUA 1E5NA 2FHCA 3WSUA 2WK2A 3VGBA 4MB1A 1X6LA 3PZGA 2WHMA 3BGAA 4U5KA 3UETA 1W3LA 3ZO9A 1O7AA 5E70A 1GOKA 3AJ7A 2WMJA 2BHYA 3SCQA 5AC4A 2DPEA 4AZGA 3EJTA 1V0KA 3K8KA 4AZ5A 2VZSA 4FNUA 1IZJA 3BAKA 3WEMA 1CECA 2GDUA 1HKKA 3ZJ6A 1OT1A 3A47A 2CIPA 1TQSA 3NYDA 4KGJA 3VIHA 1PBGA 3WF3A 4NXKA 1EQPA 8CGTA 5I23A 2W66A 4OZOA 4J28A 4M56A 2VVNA 4E8CA 3W81A 4FNTA 1PPIA 3E1F1 4CKQA 3WDPP 1E4IA 4UQAA 3VGEA 4NRSA 3AHYA 3GXTA 1JNEA 3VINA 1PZ3A 5LYRA 4GZIA 1J18A 3PBGA 2E8YA 4J7RA 3GH7A 3ARPA 1R7AA 5AY7A 4ATLA 1MW0A 3PZIA 1VEMA 1QNQA 1QI5A 4CCDA 5CQ1A 2ZX9A 4KMQA 2VURA 2BY3A 4HPHA 1DWFM 3SUTA 3N13A 3BAJA 4LGXA 5BRPA 5JIPA 3OZPA 2VC9A 3S5YA 3RPMA 3SCTA 1KTCA 1A47A 2EACA 1HP5A 1Q6DA 3F5KA 2VX7A 2AOSA 1KXHA 1UKTA 3BUPA 3ARZA 5A2CA 4B3KA 4KRUA 4TTUA 3D51A 3AIUA 4M80A 4F79A 3DHPA 4U31A 4AD3A 2YLLA 2XIIA 1CXLA 4DO4A 2X05A 1ECEA 2VR4A 4JHZA 2JFEX 3J7HA 3PZNA 4PUDA 4JZ5A 1R34A 4AYSA 1TE1A 6A3HA 2XFRA 1NOWA 1FP8A 3AZRA 4WSJA 1UR2A 4U2YA 1E6ZA 3ARXA 1VENA 1OIMA 3WF1A 3BUDA 1V0NA 1XSIA 2UY2A 2WWDA 1ISVA 1DWJM 1LL6A 2PI6A 2XYLA 2W91A 4OJYA 3GXNA 1L0PA 3WDRA 4MB3A 1HP4A 1H5VA 1JI1A 3VMOA 4C7GA 3MUAA 3OIHA 2PC8A 2ZX6A 2CNCA 1MQQA 2BXYA 5M17A 4MB4A 4W85A 3VO0A 3U7BA 4AMCA 2ZXQA 2X09A 4U2ZA 1H1NA 1VBUA 4UTFA 4H41A 3A4XA 1TQUA 4IPNB 3PZ9A 3PN8A 3FNDA 3WH6A 4AD0A 1ZBKA 5D9MA 5KZ6A 4YPJA 1BAGA 2CXGA 4BCEA 4TX6A 3EMQA 4CD6A 3O2LA 1JF5A 2F7PA 5EBAA 3UG3A 1NH6A 4D6DA 5BYWA 2C7FA 1MW1A 4HMDA 1K9FA 1EH9A 4PMYA 5C8BB 3AROA 5FCZA 2GFTA 4DWSB 1XD1A 1XYZA 4CVUA 3NCOA 5I3DA 2D1ZA 5JBFA 1HJQA 2WBKA 2XM2A 4HU8A 1UKPA 5A69A 1HN1A 1QNPA 4HP5A 3K8MA 3N12A 1W3HA 2VZOA 1UQZA 1BG9A 1HT6A 5M3WA 2A3BA 3VGHA 1V3IA 2ZUMA 4MB5A 2WLZA 1AQ0A 5EFFA 3HG3A 3HG4A 1OIFA 2UY4A 4TVDA 2G3NA 4UQBA 2JEPA 4EANA 1WZKA 1LG2A 3AS3A 1NWSA 3W53A 3WENA 2DEPA 3BSGA 2YL5A 3GNPA 1S46A 2BVYA 5HDRA 1RPKA 5I79A 3QHMA 1KCKA 3VGGA 3L4TA 1SR0A 5BXPA 3WNLA 1V6XA 3ZR6A 3VIGA 3WY2A 2W63A 1C3FA 4XZBA 1GQIA 1M7XA 4NRRA 3WDHA 1Y7VA 1XSKA 5FKYA 2DH2A 2VT0A 1CZ1A 4QDMA 1CBGA 1F4AA 1D3CA 4A4AA 1QW8A 1E6SM 5FL0A 3A23A 5BRQA 3AS1A 1OM0A 4GI6A 3WD4A 4P8UA 1JZ2A 3L2MA 3CZLA 3AQUA 1CLXA 4A3YA 3CBWA 4PMNA 3CHDA 3I3DA 2ZUWA 1QI0A 2OYMA 4AZHA 1V0MA 1R33A 5GNZA 1CGYA 3G6LA 1BF2A 2WMGA 3CHEA 5HOSA 2BNJA 1SYTA 5JUVA 1VFUA 1E15A 5EFDA 1GOWA 2PWFA 4JKLA 1H41A 4PBGA 2J7DA 4P8VA 3VKKA 4EE9A 3CHFA 3N1AA 5A8QA 3TTYA 1VJZA 5BXTA 1WAWA 2XVKA 3FXYA 4WSKA 1V6UA 4D6CA 5HXMA 2G3IA 1XD0A 4M24A 2XWEA 1NARA 2GDVA 3VX1A 1JDDA 4AC1X 3BXWA 2D22A 2XVNA 2OW6A 2IGTA 3T0BA 1OD0A 3VU2A 1W32A 2JF7A 3WH7A 1UQYA 1MXGA 3AIRA 1CNVA 3KL5A 2IXUA 2VX6A 3ZT6A 3DHUA 3DYPA 3CUIA 1AMYA 2Z1KA 2VVSA 2W4XA 1V3HA 5A6MA 4D72A 2ZUVA 2O92A 1G0CA 3IJ9A 4ZEPA 4D6HA 4HOZA 3RMEA 3QGVA 3MMDA 1EHAA 1XV8A 2XN2A 2YBUA 1R85A 1V3JA 4DWSC 1ZBWA 4ACZA 4B16A 4TVCA 2WC7A 4GIAA 4ML4A 2J7FA 2CERA 1E0WA 2DT0A 3WDIA 4HA4A 2J4GA 4HOXA 1JL8A 4DWSA 5CXPA 4PCTA 2YL8A 4BQ3A 1H09A 3WD0A 3OGRA 2DIEA 2DH3A 1PX3A 4N0RA 3RJYA 5CGMA 3CZ8A 1NQ6A 2F8QA 3I3EA 5C70A 5C71A 4MNMA 4UFMA 5I0DA 4GZJA 1HTYA 1GJWA 2ZUNA 2J7GA 3GXDA 3K1DA 4GQQA 3VGFA 2WBGA 5BROA 4AEFA 3AIQA 4E8DA 3WEOA 1CGVA 3OG2A 1HL8A 3SIMA 1CENA 4W5UA 1XSJA 1UA7A 3GXPA 1CWYA 1B0IA 4OOUA 5JIWA 5I78A 2XGBA 4J3VA 3NDZA 3BUBA 1UKOA 3L2LA 3PZTA 3T0AA 2DSUA 1JYNA 2WYSA 1OGGA 4PMDA 1DWAM 4KRTA 2ZXAA 2VMFA 1VRXA 3GNRA 2CHOA 1TA3B 5A6SA 1EA9C 2EPOA 3PTQA 1J0HA 4PTVA 4DUWA 4WIWA 3MMWA 1DEDA 1B90A 3N11A 3VOCA 4QLJA 3W37A 4AW7A 1SFSA 4CU7A 1SMDA 2CETA 2BVDA 2PWHA 2ESCA 2WMFA 2DSWA 4CCCA 2YOCA 4J3TA 3IAQA 1UR1A 3EJQA 2E9LA 4UZSA 1BHGA 1W1TA 3H54A 4W7WA 6CGTA 4OBRA 3II1A 4FNSA 4B15A 4FLOA 1H2JA 4AD5A 4MDPA 2XJ7A 2F1BA 4IISA 3L4ZA 4U3CA 1M03A 3SCWA 3CHCA 1H11A 2XVGA 3BUQA 1R86A 4GZEA 2CITA 4CN6A 2X0HA 2YDSA 3MO4A 4QAWA 4FNPA 1BYBA 3NIYA 4OBSA 1CPUA 2XN0A 2JIWA 2QF8A 3W24A 3T08A 2DT3A 4WKHA 3VSUA 3SCNA 4JFSA 3RILA 5JBDA 3AHZA 5CLTA 3H55A 5CZKA 1QPKA 4H8HA 1NP0A 4Z2GA 4BQ5A 4JKKA 1JYVA 2WMIA 4P8WA 4PYSA 2F7QA 1JD7A 1A3HA 1MXDA 2BXZA 3WQ8A 3LXAA 4AMXA 4HZ8A 3EJPA 3I3BA 1X6NA 2A3EA 1GZJA 4AZBA 3AYRA 1RD6A 4UOZA 3W26A 2E4TA 3WQVA 3AIEA 4R5EA 4MDOA 3ZIZA 3GXFA 2EXOA 1VFMA 3WF4A 3WMCA 2UY3A 3CUGA 2AAAA 2J79A 3F5JA 5E0FA 3WEZA 4YHEA 3CZSA 3CUFA 3N9KA 5IHSA 4B9ZA 5FD0A 2YDRA 2D20A 3NDYA 4DO6A 3UG5A 1E40A 1PX4A 2G41A 2J7HA 3L4YA 5KEZA 1ISXA 3N17A 5BWFA 2X1IA 1GPFA 5GQBA 4UFIA 4Y7EA 1E70M 4W88A 1GQKA 3BVVA 3CO4A 2G8ZA 1NM9A 3SEPA 4RE4A 1QI2A 2YKKA 3KL0A 3K46A 2OYKA 4UQEA 3AYSA 1HVXA 3A3HA 3GH5A 4AWEA 3M46A 3T2PA 4L4OA 4WK9A 3FN9A 1GQLA 1JZ8A 2CBJA 5DF0A 3TTQA 3LXBA 1V3MA 1FFQA 2W62A 1WO2A 2QPSA 1E3XA 3CZEA 4TTGA 5A6AA 3DYMA 3W6LA 1VFOA 4W7VA 5ABFA 2XM1A 5A8PA 3AIBA 2NT0A 2WC3A 3VVGA 1WB0A 3L4WA 4ZXLA 4UFJA 3AISA 1US3A 3MS8A 4HPGA 3T2OA 4BS0A 5CGTA 5E09A 2DT1A 4FF5A 1F4HA 3CUHA 2QLYA 1KBBA 8A3HA 3ZJKA 4EKJA 4AIUA 4HZ6A 1TZ7A 1PAMA 4LYQA 1CIUA 1W1PA 4H8VA 4J3WA 1B31A 3MSGA 3W27A 5M03A 4UQCA 2VO5A 3WF2A 4UOQA 3MU7A 2X8RA 3S5ZA 3MV11 2MANA 3OZOA 1BFNA 3EMCA 5D8WA 1CXEA 1EIBA 5DO8A 1HL9A 2FYVA 1E0XA 1QHZA 1P6WA 1C93A 4MNLA 1HNYA 1RP9A 3IJ7A 1JZ3A 4NZJA 4MADA 4XX6A 4TX8A 4D1JA 3WQWA 1XH2A 3H53A 3EDKA 5M5DA 1KWGA 3VNYA 2JALA 2GK1B 4DO5A 1O6IA 1ODUA 2EO7A 3LX9A 3D3AA 3NSXA 2FGZA 3DX4A 3GXMA 5E1QA 3KWXA 2O9RA 1CTNA 1UD8A 2XPKA 1KR0A 1UZ1A 1FH7A 1ZB5A 1C7TA 1XYFA 1Q4NX 2VRQA 1QNOA 4FLSA 4PUEA 4RL3A 3GYCA 4HMCA 1JZ5A 5CLWA 1B2YA 2J74A 1V6WA 2EQDA 1R87A 1EDQA 4RE2A 5E6YA 2DDXA 3RM8A 1E1FA 5LA2A 1MW2A 3TA9A 4DWSD 3ZJ7A 2ZX7A 4PTWA 3KEHA 2QPUA 5GNXA 5A2AA 2V38A 2DSVA 1UD2A 5A8OA 1UR4A 2GSJA 3BCFA 4OKDA 3U7VA 1E72M 1OGSA 3NJ3A 1KBKA 4M82A 1US2A 4W93A 1K9EA 3WY4A 4CUCA 1TVPA 1BG4A 3PTKA 3VILA 2BHUA 1KR1A 4QP0A 3HG2A 1U2YA 1XCWA 5A2BA 4W7UA 3DX1A 3VX0A 3WNPA 5GPRA 1QVBA 1D7FA 4MPKA 1OCQA 2VR5A 3GH4A 2PWGA 3WY3A 3OLIA 3ARYA 1Z32X 2J77A 3AZSA 1QWUA 2CYGA 3SCSA 3EDDA 1HXJA 3VDHA 1WDSA 2UY5A 4UFHA 1BYDA 4W87A 3WNMA 3FW6A 2BY2A 1GOOA 1XGZA 3UESA 2V3EA 3WNOA 1JF6A 4QCFA 1WE5A 4JL2A 1I75A 2PBGA 1E4NA 1XHGA 3WH8A 3CPUA 4E2OA 3BSHA 1TQWA 4M8UA 3KZSA 3VD7A 1E43A 4AEEA 5E6ZA 1UD5A 2Y5EA 1JFHA 4PSPA 7TAAA 4NZFA 2VZVA 1UKSA 2CPUA 3RM9A 2BVTA 5D8ZA 3A6OA 1ZJBA 3MUZ1 4CN4A 4ATDA 4GQRA 1VAHA 3ALGA 3N18A 4B3LA 5BXSA 2WVVB 1AQMA 3WUFA 1HVQA 4ZE4A 1UD3A 1HKJA 4JIEA 1UWIA 1B3YA 1ZU8A 2CBUA 1MVYA 4AMWA 1V6VA 4P7LA 1E6XM 5A3HA 2WPGA 4Z2KA 4UNIA 2CESA 2FH6A 2FGLA 1TQTA 2J7BA 2X2JA 5DT7A 4QFUA 1HF6A 5FOOA 2QV4A 1EQCA 2V5CA 4GO8A 2OW7A 3IJ8A 2VX5A 4JL1A 2F61A 1JD9A 1UUQA 4P7OA 5CPTA 3EJSA 1ODZA 4Z2IA 3VGDA 4PCSA 1V6YA 2QMJA 2O9PA 1QNRA 4S3JA 4HOWA 2NT1A 4QLLA 4PRWA 1UH4A 1E9LA 3LPFA 1B3ZA 1JGIA 4WLCA 5A6JA 4FMVA 5HNNA 1KFWA 3FAWA 1C92A 3BAYA 1WDQA 4LYRA 1GW1A 4GO9A 2YL6A 3AIVA 4W8BA 1BYCA 2WHLA 1J01A 2VZTA 3MANA 1UA3A 1G01A 1KXVA 4GKLA 4KWUA 4K68A 2ZWZA 1CYGA 2VQTA 4AD2A 4LPCA 4CD4A 3KE0A 1UG6A 4J3SA 1PX8A 1JDCA 1UWTA 3EBVA 3NSNA 4KGLA 2XHYA 3RM4A 2ZXBA 3LRKA 2O9TA 4ATWA 2DSKA 3KL3A 4AISA 1AQHA 1E4MM 2WCSA 3ZSTA 1GQJA 4PTXA 3WQ5A 5I6SA 2FDMA 3L4XA 2XSBA 3MV01 4BA0A 1UWQA 1B30A 3IAPA 1V0LA 1W1YA 4EK7A 2J7EA 1KXQA 3OBAA 2YA1A 2W92A 3UR7A 5I24A 3BMWA 4FLRA 2J78A 1LWHA 2D3NA 2D0FA 4MJ4A 1HKIA 2WVSA 3UG4A 1XH1A 3SURA 3DC0A 4UR9A 3ARVA 4N42A 4GINA 1W9DM 2GJXB 1NOFA 4MAZA 2XG9A 1VIWA 2D73A 3ARUA 1CGXA 1UYQA 1TG7A 1WNOA 3OLGA 3W82A 3BH4A 3FHQA 3M7SA 5F7UA 5TD4A 1BYAA 5HPOA 1JI2A 3W38A 1QBAA 5D9OA 2TAAA 5IFTA 1ISWA 3A24A 3GBDA 1BGGA 4IPLA 2WAGA 3WKZA 3FHAA 2UWFA 3M6DA 2CHNA 2BY0A 1OBAA 4ZENA 1SMAA 2CBVA 1U33A 2J47A 5FL1A 4AZCB 4U3AA 2ZIDA 3VIIA 5I77A 1CXKA 1JIBA 4HA1A 1FH9A 2OSWA 1MQRA 1JXJA 2ZUSA 2OSYA 3HMCA 2PBOA 4V28A 3BCDA 1Q6GA 3AZTA 2X2IA 3LRMA 1PJ9A 3OGVA 3WUEA 3T0DA 2F18A 1J10A 3S6TA 5A6BA 3DYOA 4JCLA 4PMXA 2NSXA 2YLAA 2E9BA 1H0GA 1ITCA 3IK2A 5LA1A 1H0IA 2YFNA 1BGAA 1E6QM 5HPCA 1CXIA 2A3CA 3SUSA 1MFVA 3WQ6A 4U33A 2WCAA 4PMVA 5AC5A 5DEZA 4F9JA 5CSUA 1E6PA 1WKYA 1DWGM 1JFXA 3RCNA 4AIOA 2D23A 2YJQA 1D2KA 3SCPA 5JBEA 2YFOA 1JYWA 1JG9A 1FA2A 2VTFA 3HU7A 4R27A 2WKLA 2OLHA 3QHOA 2WSKA 3AS2A 2A3AA 1QI4A 1B3XA 2X2HA 1ITXA 3BAIA 1WCGA 1UD6A 1QHPA 2Y4SA 4V2XA 3CV5A 1CGTA 1OD8A 3ZT5A 1MFUA 3O6AA 5DMYA 3AI0A 3BC9A 2F7OA 2VNCA 4L4PA 4ZE5A 2OYLA 2HVMA 3BVTA 5IHRA 1QWNA 5GNYA 1JZ6A 1G94A 1UASA 1R75A 3VMPA 1UD4A 1NWUA 3BVUA 1LJYA 1E1EA 2XFYA 4URIA 2VOTA 4QLKA 1MW3A 1LWJA 1K6AA 1H4PA 5DFAA 1VEOA 3ZOAA 3GNOA 1G1YA 1MWOA 2GJPA 2FHFA 3WDJA 5D9PA 4XV0A 4JFVA 4PMZA 4AD1A 4CGTA 3HN3A 1PEZA 4FNQA 1EO7A 1WPCA 3W29A 1GCYA 3DDFA 1O7DC 3D4ZA 4LX4A 3ZR5A 1EXPA 3PHAA 3TTOA 4H7VA 1MYRA 1VEPA 1QHOA 1E6RA 2Y24A 1CEOA 2CCRA 4NF7A 2F1AA 2B31A 4M81A 4J3XA 1BTCA 3EDEA 4PMRA 1QOXA 3OGSA 3WNNA 3ALFA 2D0GA 3VIFA 3TV8A 3CGTA 1EHNA 4A3HA 4CU8A 2WLYA 2IUZA 2CEQA 4J3UA 1J0YA 1W2PA 1RP8A 5ABGA 3GM8A 1CGWA 1KGXA 2EBNA 2GJRA 4BF7A 1TR1A 3WFLA 4V27A 3K4AA 1I1XA 3ARQA 3WMSA 1W1VA 1LG1A 4B9YA 2BFGA 2RGMA 3A4AA 1XCXA 5D4YA 4HA3A 1CGUA 1DWHM 3AICA 4OUEA 3WH5A 4ZFMA 2C0HA 3CUJA 1U30A 4E4PA 4W8LA 1PZ2A 3W6MA 1PIGA 3OLDA 1M53A 2CKRA 4TUFA 4PMUA 4JAWA 1W91A 7A3HA 3LRLA 1J0IA 2EPMX 3WD1A 5EMYA 3W28A
chains in the Genus database with same CATH superfamily
1WHOA 3S97C 1GY2A 4FEIA 4BY3A 5FFGA 1AD9A 3OB0K 4D0CA 5D72H 1I1YB 3K91A 2PCEA 1Q9WB 2V2HA 1RCYA 5EKYA 1QRNA 2V17L 2F7RA 2GK0B 3NJFA 4AYMC 1CICA 3KXFD 4HKXB 1BVKA 1NCNA 3EYOB 1W5QA 4UB0L 3D69B 4HJJL 1POKA 5C0CB 1FFRA 3EWDA 4MDJA 3T4AA 3FU7A 4G6JL 3V0VB 2WUCL 3WUGA 1URLA 3EYVA 3M5ZA 2KPNA 1IAMA 4GLRH 2LU3A 4UQDA 1AI1H 4PMJA 3TWCH 3VA8A 4RFEA 5IREA 2X4UB 4YN5A 3BVNA 1QTWA 4UMAA 4JO5A 4O2CB 3LEYL 2OQYA 1PZ1A 3FEQA 1XG3A 3CFDA 3BK0A 1MDRA 2APFA 1QAWA 5E9NA 3BLIA 2NY4D 3WUBA 3NVDA 4O00A 4PBXA 5GJNA 2PRLA 4E5TA 5D7LA 3LXUX 5DVNA 4R4FL 4JPSA 4GJ1A 3M44A 2V7NB 4V1DA 4TQ8A 5FYJH 3KLHC 3HC4H 2ID5A 2E3ZA 3WELA 3ZL4L 4JR5A 1YECH 1A8ZA 5K9OA 4KUCD 4Y5YA 3VD9A 4GSDL 3GO1L 4B5ZA 2EG6A 2YMOA 1HJUA 3K4ZA 4OH2A 1KTLB 1HIML 3UJIH 4JGMA 4MBRA 2Y22A 3AXXA 3VXRE 2KT6A 1CFQB 4G8GE 5DHVH 5B1CA 1A5NC 1R2SA 1QNVA 1ZSXA 4B9PA 2K6WA 4LU5H 4AV4A 4IRJB 3B8TA 4K39A 1FWWA 1VBHA 5A8NA 1ESWA 5A2LH 4LLWA 3MACL 1NLBL 4XZWA 3AS0A 2CIKA 3GDMA 5T5FH 5IW1B 1Q6RA 1T40A 1TZHA 2LOEA 3ROOA 3MUCA 2AAVA 1Y1DA 1EEUA 4PRIA 4L1DA 2AK4B 1MZYA 3BP5A 4OF3A 4B2DD 1DP0A 3THML 5H8DA 2WWKT 2Y2YA 5BZZA 5KBMA 4F7CA 1PZBA 3U9UA 4AM0Q 3THCA 2PP7A 3L3KB 4LY8A 3FU6A 4AB4A 5KUKA 5LBSL 1WISA 3VWKA 3HPLB 1K5WA 4XVSL 1O7DE 4Y4KD 1LE5A 2ZC8A 3GB7B 2QZRA 3BUYA 5IFHL 2NTSP 4NKQB 4X5QA 5EN2A 5ESVB 4MCZB 2Q6WB 2J7CA 1D7BA 1HNFA 4XZLX 1EOMA 2WWMD 3T0VA 5L2KA 1UZ8B 3ID7A 2BOBA 5DD3L 3QUXB 4GAFB 2E9IA 3TEYA 2BVOB 2CUIA 3NSJA 4RDQG 2CGYA 3QPXH 4BZYA 1MFCL 2B14A 1KZYA 3ZJAA 4K5OA 1OPGH 1HHJA 2CBMA 5DD0L 2CKNA 1UJ3A 4P7QA 5CC6A 1E1CB 4ES9A 4F27A 4TNEA 3NURA 1C8YA 2E6PA 4H88L 2H32A 1FTXA 4MJ5B 4HUUB 4QPEA 1FIGH 1DYZA 1JTPA 4M1CC 3DX6B 2ED7A 4HLZG 3MRPA 1KIUB 4J6IA 4O1DA 2A6KB 1WHPA 2CHZA 1UZGA 1NMAL 5GGTA 2R0LL 4LQ1A 4MDIA 3QUZA 1M9HA 1I1FB 3GEWB 2Y06L 3HG5A 1TT6A 4ZXBB 3FPYA 2NXYD 4GP4B 1TQBC 1OLZA 1XLKA 1MWAH 1RHFA 4PTMA 4POYA 1V27A 4M6ML 3OQEA 1LF1A 1P4LA 3HIJA 1RULH 4WKAA 4LLDA 5T1LD 3SE9L 4RPQA 1KCSH 3PWPB 3IU3B 1HKMA 2O4EA 4CMHC 3V5OA 2G5UA 2Z7GA 1F3DJ 4GABA 5A2JH 2EH7H 2P8PA 2Z91A 3IDIB 5BJTA 2A85A 2DQHH 4LUSB 3ZKSD 2MSPA 1DQKA 7CGTA 2EADA 4PREA 3BHBB 2M2DA 1HJWA 4EAMA 3VWJB 2DWEA 1XLDA 4ZYKB 5B1KA 4QHKI 1CXHA 2DF3A 1IEHA 1M7JA 3BRDA 3VW3L 3GSNH 3EAKA 4BD4A 5KJRL 6TAAA 1V02E 1E3FA 1EZWA 1Y07A 4C55A 3ZHNA 1R5VA 1WA2X 2HVKB 2VL5B 3B9AA 5IBTL 3FB5B 1AJ7L 4P9HH 4MOZA 5TQ2H 2QHRL 3ZSSA 3NZHH 4ZK8A 3LSBA 2FLRT 4E41A 4EI5D 2PYEA 5D96B 5C08D 5IIEA 1AZ1A 3LLDA 1RUKH 4IUOA 2UY6A 2A4AA 4JMXA 1KGIA 3RI5K 3UTSB 1GOKA 2BHYA 3LQAL 3X13B 3WHE0 4AZ5A 2VZSA 4FNUA 3VNIA 1HILB 1OAQH 4NZUH 5F93C 4EIUA 1OT1A 1CF8H 2ITCB 1AIZA 4ZFOB 2PNDA 4I4WB 1ETB1 1S2TA 1V10A 5C0QA 1XLFA 4IF2A 5H37G 5H94B 3DV6A 1T0NA 1KG0A 3CLMA 2VDQB 4HNVA 3BZEB 1LRQA 2XKUA 4IW4C 7FABH 5JW4R 4X61A 1DLFL 1S7QA 2CBTA 2P52A 1A47A 2EACA 1Q6DA 4RNRA 1QFOA 1GJPA 2OX5B 1AR1C 5A5WA 3FONA 3WMLA 2AGJL 2HMCA 4H25B 1E6JH 2Z4QB 3ARFA 3MBXL 1KNWA 3QNZB 1RVFL 4AYSA 2W6RA 3CFIC 5DJYA 1OZUA 1S3HA 3AY2A 2P44B 1SJEB 3MBWA 4LY4A 1GC1L 4F37F 1MQKH 3ARXA 2XIDA 4FXKB 3JWDH 3PPHA 3O41B 3W0WA 4PRHD 4NP9A 1S9YB 4PJ8B 3RVTD 1HEHC 2ZXQA 1RZKH 4TLTA 4N8VG 4NO2B 3RG1C 2I69A 1QHQA 2W9EL 1U5HA 2FWUA 2VKZG 1HS6A 3SDCA 1BFSA 3ICJA 2PDHA 3GI9H 1KM0A 3GMQA 3O2WL 4PYHA 1FG2B 4E2BA 5B39B 4NJAL 2VC5A 5M3WA 3QGKC 4OGXL 3ETBF 4PRBB 3QQDB 5G2NA 5CBEB 1RSFA 5INCB 2Z7ZA 2JEPA 3LN3A 2Y9RT 3FGCA 1YIXA 2YL5A 3L3GB 3ZDZF 1X5IA 1U3JA 2G75B 43C9A 4ACTA 4ZL1A 3K71B 4Q7BA 4PZVA 4NRRA 1E4WH 1PKYA 4BWUA 3O4OB 1UZHA 4QDMA 3UC0L 4G3YH 4RDBA 3WG6A 5JR1H 5DZNA 4MCNA 3HF3A 1PDZA 2GWGA 3RB7A 1F4YL 3RFZA 3HO8A 4WW2C 1TJGH 4EI6A 2XXGA 2BNJA 2DLFH 4QCIB 4I9AA 1VFUA 2JQMA 5T1MB 2A6JA 1FDLH 4QRPA 2ACRA 5HYJD 3BEVB 3T2LA 1IGCL 4RDWA 4Y4HC 4NRYB 3WFCL 1P0NA 2XVKA 3MLSL 4Y9FA 4JRXE 5HXMA 4ANVA 5EOCH 5L0QB 2XKSA 2E59A 3B3IA 1LRNA 4IEFB 1A7NH 3Q2NA 4AC1X 1U91A 3UPRA 1EO8H 2BP3A 3C60B 1IJNA 2H1XA 3VU2A 3I7SA 4BH8B 2TSBA 1P6AB 3CUIA 3FO9B 3KPRB 4K2UL 1ZNNA 4JEJA 2ZFAA 1DJNA 4LQFH 4ZBJA 1HXMB 5GGTL 4TVCA 5T9CE 3KHQA 5HHPA 4RZCB 1JV5B 1EEQA 4PCTA 3PWGA 2AQVA 5SX4H 1THAA 3PWJB 1NFDE 5FGCE 2NQCA 2PP3A 1Q90A 3GRBA 2J7GA 1HI6B 3X1EA 3DSNB 2VFDA 2E7CA 1DLHB 3LN5A 1DV7A 1C5CL 3ZL1A 4KERA 2BIHA 3K6IA 3TVMA 1T03H 1ACYH 1Z89A 4OVXA 3SIMA 2ADGA 4MA7L 4R83A 1TV4A 2W8CA 2VEMA 4KI1A 2Y7QB 2QJJA 5SWSA 3MRFB 3DOIA 1N5AB 5GS0D 4LO9A 4DP7X 4KESA 2FX9H 5GRWA 4NU7A 2ZXAA 4UWQB 3IKCA 5DWUL 2VM8A 4PLJC 1DVFD 4AGQA 4MXQC 4XKYA 2BNQA 3B0VC 2L7EA 3MA9H 1K4DB 4CU7A 4KO6A 3QR1A 4P5UA 2BVDA 2YKLH 1VPOL 2CLHA 2DSWA 1DCEA 5F9OH 5T5NF 3KYAA 1IMHC 4AGLA 5TDNB 5E8EB 4PJXE 4AD5A 2CFFA 1D5IH 4OJCA 5LGKA 3NL2A 4Z1BA 2CITA 2AXFA 3QUXC 2XSXA 1XJBA 5DRCA 3B2VL 3SRHA 3PJXA 3RILA 2WSYA 3KDMB 4XCNA 1JPEA 4QG6A 2YB4A 2OZ3A 5KVEE 1IWAA 2PCXA 2R8WA 3ANUA 5F9WC 1JUKA 5IROA 4FS0A 2OMUB 3TASA 3H2QA 1OP3H 2XY2A 3L9YA 2EEDA 3CUGA 4KY1H 2YD2A 3V7AE 1T04A 5FD0A 2REQB 5A2KH 3PFRA 1GS7A 1EWEA 3CHSA 4JTLA 1GTNA 4B5TA 1WOBA 3N17A 3D3VD 5GQBA 2QEJA 2PGFA 3CO4A 4NQDA 2WZ6A 1OHLA 4AGNA 2E7FA 4K9EC 2XTJB 3RPDA 2QVMA 5FB8A 4LP8A 2AJSH 4DHLA 1JPST 2HFGL 4IJ3B 3FN9A 3GVRA 4B3VA 1PU0A 2CR0A 5D70L 1OE2A 4JO3H 4C54A 1YE6A 1TV8A 5A7BA 2P28B 2CSPA 3GMOA 2OOFA 5BOJA 3BIBX 2MNUA 3FU8A 3T2NL 1WB0A 4F0SA 1X7FA 4YGVB 1T6VN 4FF5A 5I26A 4K94L 5J5DA 2VSDA 3MSYA 1IGML 4TSCL 3TSDA 5AW0B 2PDYA 4L9YA 5A7EA 4D94A 4JIPA 4L6OA 3BFOA 2GLKA 4R26L 4MHBA 3IJ7A 1JZ3A 3NCJL 1S9VA 2QQ6A 3RQ3A 3CVDA 4NBZB 1V6TA 3EDKA 1S78C 1O6IA 3MR9B 1BYOA 4R0LB 3WQDA 2ZOOA 4MYWB 1CTNA 4P61A 2XQYA 3LEXA 4JGUA 4GWEA 2ZCZA 4DKFH 3BPOC 2MQGA 3GG7A 2J74A 2YAEA 1QNZL 1V6WA 2C9RA 5BV7L 3TEXA 3SBRA 1BV8A 2OR7A 2ZAIA 3ZE0F 5BOEA 4M82A 4CUCA 2H3XC 5E03A 5L8KB 4R96B 3RY6A 3OPZL 5D7HA 5CHNB 2BZ7A 3O4LA 4ERAA 1SEBA 3HG2A 4KHXL 4MAUL 3GQYA 4TYUA 4X60A 5D96C 2J77A 5EUOB 2J57A 1WDSA 3T0WA 4X8JB 2YXFA 4I0PA 4ZMLA 1MSPA 3M0LA 3C09C 3HUJF 4ZX6A 3BSHA 3ZZSA 2APBA 1JFHA 2AK4E 2QCHA 3KCWA 4HBKA 2BVTA 4FZEL 1P9MA 1B9BA 4GY1A 2P9RA 4YVNA 3WUFA 3VFMA 3D46A 3TT1H 3PAYA 1U8CA 1HCVA 2W80C 2PYFA 5U4NA 1NCBH 2I26N 1Q85A 4DW2L 1IAIM 2QV4A 43CAB 4YYCA 3CDYA 2CK0L 2F61A 1UXMA 1IGTB 4GG6E 3BLFA 4W9JC 1P6BA 1H8SA 2BS8A 2NT1A 3ARGA 3QYCA 2J8OA 3T0TA 3UIYA 5C6PB 3KPSB 4DY1A 4M6QA 3A3XA 4DB7A 1PZ5A 2LVEA 2YL6A 4U6VH 2WNXA 3GK8H 3NN8B 2GYIA 5GISL 4L5FE 1WGOA 1UYWH 1ZA6A 4D9LL 1TRDA 1CBJA 3N44F 3RGBA 1DVZA 1E4MM 2DJLA 2VFEA 3S3CB 3FTGB 3GSRB 3UFIA 3QB7C 4PJ8C 4WTXA 1F02I 2FNBA 3SE3A 4WUUA 1J88A 4P5MA 1U93B 3MMTA 4S1QH 4WRLA 5C6TL 3KH4A 4ONHB 1W9DM 2R83A 2WZ5A 3ARUA 4QGYA 1MUWA 2VDKB 1T0PB 4I2XE 4PB0L 2NX5A 2VXVL 4JBSA 1OHQA 2GCYA 1SJMA 2CHNA 4EF3A 2CBVA 1S5TA 1OTUC 3BVJA 2FEJA 1FH9A 1UM6H 1QAPA 2OSYA 1OGTB 1W5PA 4W6XB 2NQ5A 4HJSA 5H35B 2PBOA 2DMHA 3HAEA 1F0LA 3AZTA 2R0WL 2A74A 2AQQA 2NY5C 2BG5A 4D3CH 3M47A 3VYPA 1AHMA 2FWLB 4BDVA 1MFVA 5GZND 3WQ6A 3GTFA 4UAHA 3UMTA 4Z3IA 3CN3A 2FJFB 4PJCA 1KM5A 3ANVA 2VTFA 4PRDA 4BWLC 2IFGA 4ZZFA 1UQSA 4S10A 3QIWA 5E5MB 3KPLB 5C07E 1QHPA 3OKEA 3NP3A 1LO4H 4WHYG 3BC9A 4EIGB 4MVBC 4L4PA 1CIDA 3B3BA 4WDIA 2IXQA 2IPWA 2YAHA 2WQPA 1YUHA 2Z0BA 1R75A 5CPMA 2C15A 3BVUA 1LJYA 3LS9A 2OV0A 5L0QC 3EO1B 1S3TC 2O7SA 4YBLB 3L68A 5D9PA 4WAFA 1KD0A 1SQ7A 3QQ9C 5F9JA 4BZ1A 1PEZA 1W1IE 2GJ6E 3LOTA 1Q9OB 2VP8A 2QPXA 4KBXA 3BKCL 1FDYA 3ZKNC 2R2BA 2JKWA 4X6FB 4JY5L 4QXIA 3BSZA 3APNA 4UV4H 4X2UA 3GTIA 3VXSD 2YMXL 3TV8A 3CGTA 1UCBH 4U4BA 3P61A 4O15A 5KUMA 1ORQA 3GJFA 4ODTH 3R06A 4LOFA 4Z5RA 3HG1B 2C26A 3LKNB 1C5BH 5GRJH 4OF6A 3F12B 4KCTA 8FABB 3IEAA 2MCMA 1ZGLM 3P3UA 3MA7A 2C3VB 2H0FA 3GHRA 1PSKH 2X0UA 3STZA 4O17A 4GT7A 5LLIC 3TYDA 1FZKA 1XGRB 1O7SA 3HI6H 1A3LL 4X8GA 1UXSB 4HXBL 1Z9SB 1LYQA 1X5JA 5CZJA 1JDAA 1PHQA 5AHIA 3QWQB 1HSAA 2NY0D 3CIAA 1AZ2A 4ONGH 4YSQA 1S7VB 4JNYA 3GNDA 4Z2HA 1ZT7B 1B1YA 2O55A 1SMOA 2OXGB 3ZVHB 4UTWC 3VQ2C 1ZMYA 3UTZA 2PD5A 3DTUB 1ICPA 2P3YA 4TIMA 3P67A 1EDGA 4JDEA 4RV3A 1HINH 3L95B 1JPFA 2YXWA 3GPEA 2ZUQB 3ZE0B 1EP3A 4M1RA 3Q3GB 5DZJA 4UMSA 1KPRA 2F15A 3AMLA 3W11C 1ZE3H 2BGSA 3WTSA 3HM7A 1G7MB 2W88A 4FLQA 4OOZA 5CPSA 3A13A 1CCZA 2FWSA 1N6QL 4O18A 2RFGA 5JDSA 4AY8A 2F54D 4P06A 2A6IB 2VXUH 1X98A 4I0KA 4K5NA 4FFYH 5AB1A 1KO0A 3PANA 4BV1A 3HZYB 1L7TH 1JRHI 1Z3RA 3F01A 4CNUA 4HDIA 3LNHA 2DKMA 4I89A 4IKIA 5E4AA 4L4VA 1HH9B 3WK0A 1RA0A 4QUOA 1NELA 4MQXC 1KYFA 4KKQA 1XH0A 1XMEB 5D2LA 5A6LA 1XRTA 4ETQA 1WKFA 4HV8A 1W3JA 2Y8KA 3GZKA 4HJTA 1DN0B 1VGEL 3WL9A 3RNDA 3FYPA 2BHZA 2ROYA 3QORB 3S8GB 1FCCA 4DGWC 4DK6A 2CBIA 2F84A 1LO2L 1HHKA 1A9EB 2YIHA 2XT1B 4JN7A 5CG0A 4NB7A 2W3ZA 1G6RL 1XYBA 3QDGE 3FRUA 3F85A 1QBLH 1LWRA 5F0JB 2EO1A 2B4CC 3RNKA 2D7PA 1TMQA 3KNBB 1KJVB 1FJ1A 3N44B 3UXIA 3KVDD 4DTGL 1MCHA 3TCLA 1CDJA 2I9TB 5C0GA 3QYNA 3VK5A 1AXIB 1A4JA 1LQAA 4EKXA 2XA8L 3SD2A 2VCAA 4QRTA 1E3ZA 4YBQD 3ZLQC 4E42B 5E1AB 1TJ0A 4IGBC 4Y19D 1RIHH 4X6CA 1GVIA 4QHNA 1O5DT 1YHTA 3QFGA 4XMUA 1CGSH 4MJJA 2W9DH 4Q6JA 3EYPA 5IEKB 3DRTB 1N9PA 1XICA 4P23B 2CCLA 2GK2A 5E6ID 4I77L 1EVUA 4XODA 2WLLB 3NJLA 4B9KC 4Y5XC 4LRNL 5EU6D 5LXEA 4AY0A 1ZWIB 1O0VA 5B7YA 2TRYA 1TO3A 4C6OA 5DHEA 3FFDB 4M43H 3ECUA 3CXDH 1GOFA 3VFGH 4YHNB 2H1PL 2FH8A 4AWTA 3QSTA 2GDQA 3DKJA 4QE4A 3PPSA 1KKRA 2ZVIA 2C5DC 1RCOB 3GT6A 4QHRA 5FWRA 4LCWE 1YJDC 2X6CA 4BFRA 1FC2D 2RFXA 2V3GA 5JO5A 3LENA 1FQ0A 3ELQA 3BRFA 4WTZG 4IK6A 3ARTA 3WS6C 5C2GA 4F8XA 4JW3A 2JTDA 4G7SB 3PQYD 3E6HA 5GSRB 2BV9A 3QEUA 3QFJD 4X5LA 3TGXA 4BCYA 3B9KC 1IBGL 2IIJA 3HB9A 2HN7B 3NQIA 4N0CC 1KIQB 1N3NB 2D7QA 3TFKC 2H26B 4LGPB 3T6WA 5DZ9A 3AQZA 3WLWC 1YNTA 3LK6A 4LASL 1QLEL 3UEZA 2CC0A 5MHSD 2WZPD 4YLBA 1O5QA 1U8OB 4TMBA 3FOMB 4BZ1L 2ZKWA 4IQJA 1D8CA 3PG2A 1KEMH 1C08A 2QUVA 3OB0H 3RTQA 2ZZ7A 5IHZA 4S2CA 4AQ1C 1M1XA 3BSZL 4LYPA 4P4RB 3VKCA 5JIDA 4YS1A 1NUDA 2A99A 4GT0A 1KWKA 4BELD 5KWYC 4TNWF 3ARBA 1TPDA 4B90A 1IM3B 1JUBA 1RZFL 2B5IB 4JR9L 3PDOB 2HX9A 1B5TA 3UWWA 3O15A 4B9JA 3MP3A 4RSYA 1NMBL 4B7IA 3PJSA 3TP4A 4F3FB 2OSXA 4WY0A 1NMCC 4I6VA 1A4BA 4CVZB 4GGHA 4OLXL 1XS2A 3WK1A 3PABB 1KTBA 2GUYA 4JTFA 2Y5TA 4TO8A 4L0ZA 2RR3A 2JB6B 1FVPA 3MV7D 3WL1A 3V0JA 4L1HA 3VIKA 1OFAA 3UR5A 1GKRA 1OAKH 4N9GB 1KCUL 3M16A 1MI5A 2XWBB 3GNXA 1WTGT 4WFGE 4LAUA 4D6EA 1TU2A 4DEWA 4WFFD 3EYFA 4R6UA 5I03A 4G6KH 1IIGA 3EWYA 3GVVA 3P9MA 3S2AA 3BAKA 3OKNA 2EYTB 5J5RA 5EMKA 3MJ8B 5JOPD 2EDMA 4BZ2A 5I19L 4Y16B 3QVAA 3AYVA 3TZVA 4K4KA 2XLLA 5HMDA 3F7VB 3VQMA 4XBEL 8CGTA 2J2ZA 3TJHD 2PKDA 2QR0B 4TRPL 5ILTH 3GMPB 3GXTA 3TH3T 3VINA 4KRLB 4FXRA 4M8VA 4GCXA 5B1JA 3IJDA 4N8CL 2KLTA 3W07A 5HQEA 1VEMA 4X6EB 4YC2B 2ZSWA 2VURA 2LU4A 3TT3H 2AW2A 3IJEB 1A02N 3OZPA 3QIBD 3TFBA 4JYEA 4IBSA 4PGJA 1NEZB 3BAEH 4MAYA 5FPIA 2VMJA 4EUPB 1RJZB 2MNRA 4JHAH 4WENB 3KR3L 4DO4A 2IGFL 3ZDZE 1KSRA 2FYYB 1TUFA 3OYZA 5ABAA 5F7YC 4JRYD 1FNGB 3CPLA 4NQED 2UY2A 2P24A 2YLHA 3GXNA 3CAVA 4MB3A 1HP4A 2ACUA 1J5OL 1HFBA 1CDHA 5KANI 4F9PC 5E1GA 3BARA 4A2SA 4U2ZA 1PD6A 3MFGB 2DQCH 2Z34A 2HV5A 4AC4A 2BSLA 4YPJA 2JIXD 3BWAA 3IGAA 5I00A 3IMTA 4E68A 2C7FA 3BO8A 3CDCA 5C8BB 1FNHA 2P8MA 4B0MB 4RIRB 5ICXA 4YXHH 3CASA 3AWOA 4HP5A 5IF0A 1E4XH 4KKBD 5L9DL 1W3HA 1FI8C 2A3BA 4WR3A 3PBMA 2YCLB 4TSBL 3H0TA 3MY9A 1ENUA 4EANA 4G1NA 5KSAA 2B8OT 1DANT 3P3BA 2ZUQC 2VR3A 3V0TA 5EBUA 4UV7L 1SVCP 1FFOA 3L7EA 2VDNH 3P60A 1XSKA 2DH2A 2H8PA 5K9DA 2VT0A 1CBGA 4WCYH 2V8ZA 2Z25A 3GHUA 4PR5A 2WSQA 2NTFB 4XB7A 2INEA 3EH5B 4X99B 4LSDA 3D3FA 3DJTA 3HTLX 1I8MB 4Z18A 3H8NA 1REQB 4X9GA 5E9XA 3IMUA 5TE7L 2WMGA 1FNFA 5FYKL 2F8XC 3HZMB 3C6SA 1DVQA 4BK4A 4ZNEA 2R1YA 4OLEA 1YA5A 2OA9A 1R9XA 1J8HA 1XIGA 1A0CA 4H8PA 3H3PH 3TTYA 1ONQA 1U8KB 5BXTA 3H7UA 1XLBA 3UGUA 5K33A 1XD0A 2YSWA 1I7UA 4GAJH 4K8EA 2HUEA 2QLVB 5EZIH 3FO2A 1OCBA 3CK0L 3G7TA 3DI2B 4JJ5A 1OSPL 4MZRA 2C16A 3H4XA 2ZPKL 3RX8A 1QT1A 1RIVH 1VLXA 2N4IA 2CM6A 5I1KH 3HHMA 5E08H 5I0VA 5B8CA 2BXVA 4N2OA 2Q8ZA 4ZEPA 5M7QA 3QORC 4HOZA 1L6SA 1G69A 4U1NB 5ITFB 1G7QA 4J3OG 3P81A 3TN0D 1AQFA 4GUQA 2CERA 4FO4A 4HA4A 2HZGA 3QDMA 1I31A 2X4PB 3RRXA 1PX3A 1ICTA 4K7YA 1JVKA 2IOMA 1HTYA 4F1ZA 3ZS4A 3D18B 4PJEB 1EFXB 5E9DE 1IX2A 3GI8H 2HFFA 1NAMH 4ZQRA 1E9IA 3TBVB 5EULV 1MHCB 2WJEA 5KVGE 1B0IA 3SN1A 4Z77B 4J3VA 4AVIA 3KBVA 3PM6A 3GS0A 1TPXC 3L3IB 1FNSH 4K37A 2HDJA 4HJ0C 2PDCA 4DUWA 2C4FU 2CG9X 1F07A 2QKFA 4WIWA 1DEDA 3N11A 1EUAA 4AIXA 4LPUA 1OTTC 1DQML 1AP2A 1A4CA 4JIIX 2WIIB 4ZUUA 1NBQA 2HK0A 2OS7A 3S5NA 2YOCA 3DFPA 3KDOA 3IAQA 4CC0A 2WMPB 1EZSA 1ZCRA 2WV3A 3CVIL 4C6DA 2LLLA 1Q4WA 3H2EA 5DS8B 4ZSOE 2QDDA 3NG5A 3SQOH 4XC3L 2DVXA 4H9YA 4DN3H 5F7DA 2HS8A 1DQXA 2DT3A 2JK5A 3D25B 5AYUH 2GITA 3BWUC 3MJ7B 1ICQA 3N85L 2ZE3A 4QRRB 5DRZB 2PXYC 5FF6A 2V5TA 5MEPB 4RAUA 2B1HL 3NJMA 1YAIA 1QOPA 2F7QA 3FRPG 3T44A 3L23A 3DCPA 5AVTB 3AUVA 2ICES 4HHGA 3WLRA 1JHKL 1Z42A 4JTCA 4IRZA 4DJDD 2O5ZL 4BZ2L 5E0FA 1DR9A 3CZSA 4PGEB 3CUFA 2JJSC 4ODVL 3ABQA 4GACA 2ZOUA 5IJVA 2GJNA 4H9ZA 3OMIB 1M9WA 1GPFA 4ZB5A 5AHFA 1NEYA 3BVVA 1U4EA 2KH2B 2IANE 3PULA 3CZFA 4IGMA 4IMLA 2Z7WA 2N1KA 4E9LA 3BWZA 4QQUA 2O72A 3QG6B 2R29H 3DETC 1GZQA 3P73B 1FDZA 1FFQA 3GU2A 1T5WB 3U8GA 4RFOL 5A6AA 3FU0A 2Z4TA 4YDMA 1B2WH 1DBML 2BNUB 4PJDA 2OMYA 3OKDA 5DHDA 4XE0A 3K1GA 4GRWH 4GNVA 2IWGA 4FRWA 3O9WC 3HUJE 3MNVA 3BQUA 4TVPL 4FQHB 4X7TA 2FUTA 5E2WL 1NUNB 3EMCA 5DO8A 4TXVB 3DG6A 1DQIA 3VCLB 2B5IC 1SRDA 4PLKD 1S7SA 3EB3A 4FOJA 4R5VA 1UOWA 3VNYA 1N7KA 4RMWA 4ADGA 1LLWA 2JALA 5BVPH 1OAXL 5AHNA 2VLRB 1FBIH 3GG1A 3F00A 3OAZH 4YDJA 4IBUA 5JHLH 1XYFA 4DBDA 4F2FA 3LSOB 1FGVH 1MCOH 1WQ5A 2O56A 1G7JB 3QXDA 5CIPA 4DWSD 5AYYA 5GNXA 2DZBA 3AWGA 4KROD 3WY4A 4MCYA 3MYJB 3PNWB 3PTKA 2ZUYA 4PU2A 1KIPB 3NIGF 5AW5B 3X12A 1KLZA 2PDWA 4YE4H 2VM9A 2HT3D 3KWSA 5EIVA 1WD9A 4GAYB 4KDWA 1MCDA 4PVBA 5KVDL 5CN1A 2VAAB 4XG1A 3HMWL 3FW6A 2Y7DA 2UWEF 3TO4A 4MLRA 3CPUA 5D1QB 1IE7C 4M8UA 5TGBB 4X0KA 4WI5A 4IIGA 2Y5EA 4QNWA 1OE1A 4L5ZA 2P80A 1YEJH 4ZUSB 1M3JA 3H9HA 4KUZL 3UY8A 1UT9A 5CR8A 1KLGA 4YLCA 4A6YB 5EZJB 5DUPL 5DD5H 4NIYE 4DPQA 4M7ZC 4JIEA 4LLUA 1UWIA 5JOEA 3S2MA 4P3CH 5T3XE 2A0LC 1UOZA 3L81A 1Z5LB 2HT2D 4YC2C 5T3ZE 2R1XA 3EX2A 3UBXB 3QEQE 3SY5A 4PCSA 5JU6A 2RHEA 4GZ7A 2Y1HA 3U6RA 3STLA 4FMVA 2CKBH 4GAAA 3UTPE 2XJKA 1DVTA 1EEZA 1YN7A 2WHLA 1TTUA 1T7XA 1U8IA 1A6TA 1KCVH 2VQTA 3DX7B 2D03L 4NWTL 5I2IB 2XU2A 3VD0A 3WQPA 1MCPH 1AIFA 3EGXA 2IADA 2ZXBA 3TH4T 3EJJX 4F2MA 2H5UA 4QJ5B 1TR7A 2FX8L 5AN7A 3T77A 3L4XA 4LF3B 4UYQA 3U1SL 1V0LA 1AQKH 2W92A 3BLLA 4RCAA 4XXCA 1FYTD 2ABAA 1LWHA 3FUFA 4MJ4A 3NDYE 5BRZA 1CL7L 4N2CA 2NQ9A 4GRLB 1BOGA 3WQCA 2VLLA 3B56A 4W4NA 3VFUB 4FADA 3MRGB 3W38A 1QBAA 1UWGL 2CLZB 4IG2A 4IPLA 2EIEA 5EPMB 5LNGA 5HQLA 4ZENA 4AZCB 3RN6A 3ME3A 4TUKH 4UDTB 1DJYA 3CQFA 2NNAA 1E8ZA 3CUZA 1QO3A 5C0FA 3VXUE 4YJ5A 1GRWA 1A64A 2V2DA 1LE9B 3BLEA 3HR5A 4D8PA 3WUEA 3N42B 5A6BA 2KERA 4IDLA 4LARH 1EYWA 3TA3C 4YSTA 5FA4A 2HYMA 5D33A 3X1GA 1H0IA 3UQNA 1WDWA 4ZPTA 2P50A 4JO1L 1TTCA 2J4WH 5AC5A 3ZDXE 4UZGA 2CM5A 1PZCA 5F1IA 1IIHA 3HU7A 4TNVF 3BP7A 2HJKB 4X4XB 4AGMA 1SN5A 5E2UL 4YXGA 4PTNA 2PCPA 2PW2A 4RDQF 1JZ6A 4J8RB 2J1KA 1SHMA 5EUKB 4YS4A 4DELA 4HCRH 5EU3A 3VFWA 3EGDB 3W23A 4PFEA 4QBXA 1WC7A 3PV6B 5IWLA 2VXSH 4WNSA 1YEDA 3DUSB 2EICA 1DO5A 3VGAC 3WMQA 2Z24A 2AL2B 5I76A 2N56A 5MENA 4IRZL 3DTXA 3W29A 2Z26A 1SHSA 3RNQA 2EDRA 3QFDA 4U6XB 1PXGA 3M88A 3S4SA 4MFEA 2NLJA 4LESA 3QI9B 3TTEA 2VGLM 1XZ0A 3MCMA 3K30A 1XGPA 4N22A 3TBYA 4LAQL 2DQIH 5F89A 2Z92A 5EA0L 2EILB 4Y0GA 4V27A 4XGZB 5EU4B 1Q8JA 4MJ6A 5HDLA 4F2UA 3IMRA 3ES7A 2FO4B 4BK9A 1GGCL 1XG4A 5I1AB 1ETJA 1ZHLA 1CR9L 3KFTA 3EB4A 4JANB 4P2QA 2FGWH 3GLDA 1NCAL 3OLDA 4C56E 2H6PB 3P3RA 5IJCC 4ELMB 4JDVA 4XP4H 1G9NC 1N0LA 5HY9B 5DZVA 1Z9OA 4DNLA 4D8OA 1YEKL 1ZVSA 3H2CA 4HBQA 3U79A 1PKQB 2WQDA 4UTCA 4WKXA 1UJTA 1WCBB 3CFMA 4PG2A 1X3DA 5LA0A 3CT7A 2Y5SA 3IETA 4Z7VA 4CQ8A 3NM3A 4NN5B 1DWIM 5GIRB 4Z7NF 2EPLX 5CJ5A 3NRFA 3O3DA 4Z0BL 3GYEA 3W1MA 5FLVA 3DECA 2Z6FA 2G60L 4HWBA 1VGKB 5ISZA 4PJBA 3LV3B 3QA3B 4RQQA 2X3BA 2DDQH 3PZUA 3NIGB 3NOEA 4U6HB 3KLKA 3MOAL 4LB8A 5E99H 3CSPA 1EUNA 3CHQA 3GXIA 1JAKA 2WO3B 4OV5A 2QQLL 4PCFA 5A6KA 3VIOA 3UJJH 5EBMB 1D9KA 4NQSA 2NZLA 4RNHA 3NSCA 2UWEB 1OL0A 3WU1A 4FX5A 3KVPA 2D2CC 3G6JB 2X0VA 3DX3A 1W5OA 2QCNA 3L9BA 1VJSA 4TXEA 1WVZA 1ME9A 3LHZA 4L4TB 1BZ7B 2Z93B 4LSSH 4B60A 4ZUWB 5E4IA 3IV3A 4Q8VA 3UCRA 1EJ8A 3VC6A 1MZZA 4LVNC 3PPEA 3FQ4A 3KYOB 3KUMA 1H19A 1XI3A 1RLCL 2ZT9C 3VD3A 1AZRA 5FCSH 4O53A 3IGSA 2I27N 4Z2LA 1MRDH 3HV8A 1QNSA 4TVUA 2HBXA 4AMKH 2A3LA 3AGWA 4AQAA 4Q4MA 4I9MA 2C9PA 1XBRA 1TQVA 2BZNA 2HQAA 1WBZB 1HOCB 3RZCB 4ZD3H 2OM5A 1E9QB 4V11A 2ZX8A 2JQZA 2Y6SD 1IVTA 3U0TB 1T1WA 4U1LA 3UJTH 1VKXA 4RGOH 4YHMH 2X4OB 2XGIA 3L5JA 3BIKA 4HPOL 3TC6A 2ARJB 3V0HA 5MP6L 2ZUUA 2VIRB 3PZVA 1JWMA 5EUOF 1ZGLA 3IXAB 3LGGA 1GOQA 5CM1A 4RRPG 1VFSA 1H1ZA 5BU9A 2BWGA 3OAZK 4H2CA 2P5EB 2I60L 3EYQC 1YNKH 1J0JA 4FFWC 4J5NA 2KUTA 1IEBA 4YPGB 1T89C 1F05A 2ZYRA 4IHOA 3VDAA 3LQMA 1X97A 3M1BB 3S36H 4R3SA 2ZOTA 4ZW5A 3GBEA 1BVLA 5GGRY 2VLKE 3RL1A 4LDOB 2EF9A 3TH6A 1GL4B 2V9QA 1FHDA 2NNXA 1K7FA 2ZA3A 1WBJA 3E0VA 5ALBH 4F57L 2RMNA 4FNRA 3GGWB 3LBMA 1ZBCA 2XN1A 4Y1AE 1UMYA 4JM4L 2R24A 1KPVB 4LSTL 2J8GA 4PGZA 4HNOA 2JCCA 2W61A 4M5TA 2DBLL 1QFWI 3RA7H 5I6KA 2E4FA 3UD6A 3CZKA 2ENPA 1EDTA 1ITBB 2MCPH 3O3EB 5MERB 1JAEA 4XPBH 5K59F 3WIFB 5CS7A 3U7YL 4FTVA 2F2HA 1RU9H 1K4HA 4GXPA 1N55A 4DUXA 2UZYB 3VFOB 1QVOB 4IRJC 1K2DB 3LERA 3EG9B 1M65A 4UM8A 2WNGA 4N6FA 1W6WA 3SGKA 4C4KO 4M93B 3MV8B 4PW3A 5HBFA 3DENA 1JNDA 1EMTH 2ZBTA 1SZFA 1R19A 4M5SA 3RKPA 3MRIA 1EBHA 5CWSA 4QTFA 3W3OA 1NC4D 1IZKA 4IOFD 2Y7EA 3GTHA 4ODHH 2DIAA 2APTA 2H1LM 2OJEB 5JHDD 2BSEA 1H3GA 2ICWJ 1MQ8A 3LIUA 1D3HA 2X4QB 5I15H 4WK2B 3GTNA 1R5IB 3FOLB 5BS0E 3G3DA 1ET7A 1IT8A 3ULVH 3FY1A 1SOKA 1JWUB 1DTUA 1IAIL 3BQVA 2N3JA 5ADPH 3GIVA 1ZS8B 1QMUA 4OLWH 1ZLWH 5ALCH 2HJFB 2FL5A 4WY7L 3DURA 3EFDL 4ZDHB 3QMSA 4XPGH 1PQZB 4JAMA 3LGEA 3DDGA 4S3KA 3BH9B 3CAQA 4FP8L 1LILA 1YEYA 5AVRB 1WAAF 2AK1L 4PEEA 5ABZA 1I9JH 1BBJB 2DJUA 2A7RA 2Q7AA 2IH3B 3MRJB 4HJFA 1P53A 4R90L 3VD5A 1GTFA 4YVXA 2V8MA 1DJXA 1ML0A 3CIVA 3BE1L 2CO4A 4GUOA 4AWUA 1F3RB 3IPBA 4NAQA 5CZ0A 4U1MB 4NAJA 3MI6A 4LSRH 1PZDA 5F7MC 3BURA 2GVYA 2E7DA 1JGUH 4V33A 4MY1A 4HH9B 3QPQD 5I5RA 3SPJA 2Z35B 2FATL 4WI7A 4POZC 4A7GF 5TJWK 3B06A 2P1YA 4DF1A 2AJYL 4NQUA 1EZUA 1ND0A 2YXVA 1T4KA 1OK6A 5HHNB 5EEUA 1RFDH 4F1SA 2D31A 5JDJA 3SJVB 2Y62A 1TJPA 2VLJB 1T3FB 3QJXA 4I3SH 3MLXH 1UB3A 1WAPA 3CH9A 4FFTA 3WSUA 4Z7NB 3DFTA 2E9WA 3F65A 3KPOB 4G9FD 3AJ7A 1AANA 5IESL 2V5RA 1ADQA 2DPEA 5JZ7D 1QZ1A 2QVHA 4Q8NA 5C0CE 3OX8A 4ZXBC 4XVTL 4LUTB 2YPLA 2GDUA 3FH5A 4HWBL 1TVBB 1YN6B 1RY8A 4PTUA 1LMKA 2E6YA 1ZHAA 3EEZA 2ZWNA 3B83A 1DXIA 1PKMA 1P7QB 4NEHB 5C7VA 5E4OA 5DQJB 4C1NB 1MHHA 3NPXA 1PCSA 2OLSA 3QO1A 4WI0B 4YTUA 1FWJC 4J1UB 5EEVA 4B50A 4CCDA 1BX2B 4ANUA 3SGZA 1AD4A 4DEUA 5JIPA 1U1HA 4X3ZA 1HP5A 4P4KD 3V95A 1VYRA 1ZAGA 2VEGA 1CG9A 3VWJC 2WOYA 1MG3C 1NINA 1WK0A 1HZKA 3R0KA 3S3BB 1J5SA 1T0MA 2VDRH 4XPTH 4WWKB 1D8WA 2EXYC 4G7YL 5B1BB 4Z9KB 4MWAD 2WYHA 5E8NA 1P7TA 2QHLA 3AXLB 2G5BB 1A66A 1V0NA 1XSIA 3OKMB 2WWDA 1T4WA 1YEHL 2I5YH 4XSMA 3BEWA 3PWAA 4F40A 2Q86B 2G97A 3IDXL 1HXYA 4W85A 2GSHA 3OYXA 4PN6A 4UTFA 4WQ6A 5G4MA 2XZQH 2EYSA 2PO6A 1KELL 3O3AB 4CD6A 3WTWA 4ZCWA 3ZRSA 4JTTA 3M0IA 5BYWA 5CCKL 2FJGB 3AROA 2OZ4A 4OW6A 3EOEA 3C4UA 2EH8H 3A64A 2PPAA 4EVZA 4Q6IA 4NNXB 1QNPA 4X42A 3JU2A 4W9GC 5KITA 3OVQA 4N8VB 2DLHA 3NO1A 2GGIA 4UIMB 4XWOC 1GGBL 1UVQB 5HYSA 4BQBA 1LJMA 2FMOA 1IO4C 3GNML 3K74B 1KCKA 3VGGA 2DY3A 3WNLA 1XFBA 4PJGF 5A40E 4H9XA 3CH1B 4PUBH 3TO2A 1RK1A 1RV6X 5FKYA 1QFUH 4OM1L 2EINB 2PUQT 3FQTA 2E77A 5GRVL 5E5CA 1V5XA 3AQUA 1NFAA 3MBEB 1G6RA 3R8GA 4JICA 1DQWA 4PCNA 3LQLA 2AZUA 1MCJA 2OULB 3N91A 4AZHA 4FP1A 5EEYA 4HUKB 3SIKA 3CHEA 4O1EA 1NCIA 2DMGA 3QK0A 1PEWA 2VMCA 2B4GA 4FXKC 3QZOA 2GT9A 4O0ZA 1MCLA 3RWFB 1WDAA 3KBEA 3SDAD 1Z2KA 3QCUL 4LEFA 3KJ4B 3E5PA 1BZ8A 2D22A 2YB1A 3S37L 1XC4A 4PIBA 1THCA 4ZUTB 4Q56A 3R13A 4GP5B 5C97A 2W4XA 5A6MA 1D2OA 2ZUVA 2BRQA 4O5LH 4GGBA 3QGVA 1XL6A 3SPVB 3E6FA 4DAFA 2ISDA 4NP4L 4YXKH 4F2BA 4JHWL 3QDAA 3GSXA 5I09A 4DFHA 3MO7A 4AUUA 4RXGA 5AW3B 3CU1A 3K1DA 3W9DA 1ZV9A 4UTAA 3OG2A 3M1OA 4F33A 3PWPE 4A63A 2E25A 1I9RL 3IVUA 4XAWL 3L0NA 3UJSA 5TQ0H 3O4OC 3VCNA 4Y1SA 4Z0XA 1JCXA 4R7WA 1G7LB 3GNRA 5EMUA 4Q8QA 1BEUA 1UWFA 1J0HA 4HG4J 3DVGB 2E76C 2RB8A 1KLFB 5JXEC 4G7EB 4WRHA 4NAFB 2WMFA 1RUML 3QUMH 4MZ3A 4HLEA 1Q2RA 4QG9A 1TF4A 2B59B 3R1ZA 12E8H 5SWZB 3H23A 5DGQA 5RUBA 3W7HA 4JFDD 4YHKH 1MFAL 2J66A 4OUIA 4W9LC 2ED6A 3J2PA 1SO5A 1R86A 3T04D 5KBDA 5B3NA 2F6UA 1HHHA 3C60C 2A9NL 3ZXAC 3SCNA 2XFGB 1EX5A 5TIMA 5F0PB 3H55A 2A9AA 4H8HA 3G5ZB 5GS1B 4AXKA 1TTRA 3IN0A 5D7JB 2X3CA 2BXZA 3C8DA 2HFTA 2WBJB 3UTSE 4UT7L 1ADQL 2OSLA 1XHHA 1H0DA 4M93C 2CJUH 2XQ0A 4QT5B 4JY4A 3WXVH 3EBAA 4LWWA 4N9BA 3V6ZB 1AG0A 3ITYA 3CL8A 3ZIMA 1P43A 3MCYA 4HHLA 4YDKH 5C0AA 1JHTA 4O2FA 1VSCA 1CK0L 4D9RD 4JN1H 5KS9F 3HRZA 1IAOA 4AKQA 3VKJA 5DCDA 5AFAA 3QYSA 4AYEC 4BSVA 4Y9BA 5KYWB 2OBGA 1VLIA 3ME0A 1DE5A 2C9SA 1ZLWK 2BCKB 4W7VA 3DMMB 3PS7A 4M02A 1R3KA 1EJ6A 1YPZA 3HKZA 5IKCB 5FEZA 5F3FA 5FHBL 3DO7B 4XNBA 1HGWA 5IMKA 4AG4H 1BFNA 1CXEA 1HJCA 2JWYA 3LRSA 4MHHI 5AVSB 2ADIA 4L4TE 5ICZA 2WCPA 3B05A 3ZWSA 4XX6A 4TX8A 3WFHA 2DBJA 3FMGH 1ODUA 3QS3A 4XR8C 3W7OA 3VFTB 1UD8A 3LS5H 5I3FA 3LHWA 4O0KA 4WJ8A 1Q4NX 1NBZB 2F53B 2QBWA 1JVOA 1RMFH 5ESQA 1EDQA 1K7EA 1SW3A 3VXGA 4TSAH 2QF7A 2WQXA 2KZHA 3S96A 4PTWA 1AH4A 3EJYD 3BCFA 1OGSA 5I1IL 1OGAB 1N64H 1ETA1 2OZ4L 3Q06A 3OJVC 3DOHA 5KYYA 4K5MA 1NAKL 3P77A 5DMJB 2FX7H 3FTSA 4IU2B 1CT8B 5E0QA 4XCFH 1QCWA 1RLBA 2HX7A 5DTFB 1NUFA 1KM6A 3PHOA 1I75A 4PJGB 1XHGA 4H0IA 4G7VL 2ATAA 2XTJC 4ADSA 1K8DB 3R0UA 3D39B 3HNTH 4KK5C 4A2DA 4IJ3C 2OMNA 3RM9A 4WDXA 4DVRL 5AECA 1K6WA 1TTFA 1WOAA 3PPGA 2OZNA 1T2QH 3NJVA 3VUAA 2NR6D 1IL1A 2OLAA 1UD3A 5J9PB 5EU5A 2CBUA 1ACCA 3MXWL 2DQJH 1W1A1 1QNIA 4R88A 2CESA 4PUMA 2FQDA 3OBKA 1HF6A 5FOOA 2G2PA 4OJEH 1QTSA 1Q8AA 5EU7C 3U36B 3NXFA 1OTSC 1TCRA 3KPMA 2O9PA 1GYWA 4YUEH 5DMIL 3DG3A 2G37A 1KFWA 4R0LC 4QSHA 2APXA 3UTQA 4GO9A 4G8EB 2JH2A 1MLCB 2NX3A 1UA3A 3L7RA 5DRNA 1INEH 2RGSA 1D5ZB 2JI2A 5FCUH 1OM3L 2EVIA 2YWZA 3I9PA 2PD9A 1A50A 1IIKA 2NDFA 1JDCA 4UMBA 2EDEA 3N2JA 2FBJH 3KPRE 5H4ZA 2WCSA 3RLVA 1J1OH 4FA7B 5KVFL 5EO0B 4H8WL 3O6FD 5I74B 2V5SA 4LVGA 4FHJA 1IB5A 1ADOA 2Z1WA 3C75A 4MF4A 4XAZA 3AREA 3P74A 2YSSB 3AG1B 3OTTA 3MRBA 1GKEA 1WUZA 1U8HA 4MAZA 4A3RA 3F83A 3C0QA 1EPXA 3E0GA 3IFPA 2EZ0D 3TC7A 4JPKH 5ITBL 4LP5A 1Y0LA 4C65A 4UTAL 2H8XA 4DJED 3A24A 4GSXA 4LOUD 3RDTD 5HYIA 5DEGA 1UIPA 1S7UA 4BE6A 3BI9X 1QSFD 3PGCB 3H56A 3TURA 3GMLB 4IIEA 1ZD6A 4M7TA 1VESA 1TZIA 4HH8A 3CVHA 4F0MA 2NXZB 4HT1L 3TBWB 1PJ9A 3RRAA 1XAUA 3T0DA 3EBGA 2E9BA 3FKKA 3SIZA 1ES0A 3O45A 4C6FA 3PWVB 2O6CA 3KVMA 4PMVA 4E0RA 1HKVA 4LZKA 3MBEC 4PRPA 5H91A 4DZBA 1W54A 4G43A 2AV1B 2PTTA 1B3XA 5AHLA 1F3DH 3MDWA 4QTHA 2ETWA 3M0XA 2QW5A 4N2IA 1ZLEA 1NFIB 1R24B 1K6QH 4JB9H 2D8KA 4PJEF 1JNNH 1N5YL 3IMSA 3O6DA 1A6VL 1S7WB 1KA9F 4XNQB 3ONBA 1ZHKB 3K5SA 4F7MA 1CYXA 4OCMC 4KZDH 3WDJA 5IV2A 2IMNA 1WT5C 1S3RA 4OZ4A 2E67A 3VTTA 1S2VA 2B7NA 2WTRA 1GCYA 5B3SB 1V54B 3VFNB 4AWJC 5GJSL 3IVKA 5D71H 4ORGA 3ISYA 4XOAA 5FHAL 1A9BA 3N2BA 4HKBB 4RZ6A 4OGYH 5G1MA 3X3FH 5KS9B 4LAZA 4P2RA 5TTRA 2ADJA 2Y3NA 5LQBH 1LUCB 3F2CA 2E7BA 3FK4A 4RA0C 2V5KA 2XTJE 5FO7A 3MA8A 1TKWB 3DUUA 1EGJH 5FESA 2CD0A 2FR4B 2YW3A 2RGMA 5D4YA 4KIRA 5ANHA 1M41A 3RE0A 4K8RL 4N4PA 3BKMH 4HZ1A 4WI9A 3W6MA 1PIGA 2CKRA 4R9OA 1H61A 2XBDA 3PB0A 2BNRD 3LNMA 1S9KC 1PFOA 3W28A 2J3SA 1KQZA 4XBJA 1Z9LA 5EU7E 4F58H 3PYCA 1BM7A 5DMKA 1WBXB 2DORA 4NUJA 3TNNB 4XP6H 3MRHB 4XB8A 2CRIA 1YPXA 3P3TA 1GVFA 1ITUA 3H26A 1Q45A 1RI8A 3FCUB 5I6LA 2WCGA 4G6CA 3N15A 5ICYB 4QLRA 4TUJB 2BRRH 2HLAB 2WBXA 4XNYL 2V9TA 4O13A 2ZA2A 2MH4A 4O9HL 2HH0L 1HEZA 4R8WH 3IF1B 1UENA 2W38A 2EP6A 3ETTA 3QIUD 4QD2E 4YBLC 2FB3A 1NL0H 3H2PA 5HNUA 5IMOB 3MSDA 2MCG1 3UZEC 3AT8A 4LSBA 4CJ1A 4I3RL 4D8AA 1R8LA 2XTKA 3LEPA 3EDJA 4PCKA 4TS6A 4JGJA 4NZDA 5GS1C 3SDDA 2H8ZA 1QABA 1ZLDA 5EUOE 1UZDA 2DVUA 2E74C 1UKQA 2YEZA 4MJIB 1YDYA 3C2EA 3MCLH 4OB5H 3LZFL 4K7PX 1S1RA 2WSRA 3TFXA 1VCFA 1XYMA 2X0SA 2NMSA 3ZFHA 3GIZL 2XXMB 4PHZA 4WX2A 1CDUA 2CDGB 5DVMA 4NGHL 4Q3MA 2Q7NA 3VSVA 1XPGA 2F5AH 4ML9A 1JXFA 4M7JH 3DBPA 3ZYZA 3SPHA 4ZGYA 1RSCA 1JK8B 5HINA 4YBHA 4GUHA 3LKOA 2EEXA 4YHOH 2Y69B 4NO0D 4UMCA 3ZMNA 3TW9A 1O5KA 4ZO6A 3IS4A 3DMMC 4K1WA 2GG1A 3IMVA 3SADA 5I1GH 3MAWA 2F19H 1CFSA 3KPSE 3MBDA 4WO4B 2C1GA 4DXKA 3VG9B 3US9A 1JZ4A 2P3ZA 3ITTA 1TPB1 1I3RA 4XPFL 3RIKA 3ULVD 5CD3B 4L1XA 4ECNA 1KTDB 2JF6A 1U95A 2Q10A 5LIWX 4D0DA 2F5BL 3T40A 3F64A 1UB6B 5I71B 4WXZA 2E9MA 3O07A 2GW5A 4IX0A 3TF7C 3WHE1 1WJ3A 1VBRA 3CK5A 1IBZA 1U3HD 1BA9A 1PAZA 3KWWB 5I30H 2ZUTA 3DU0A 4N86A 3TJXA 3TZNA 4OIFA 5TE6H 5IUCA 1NCGA 2NUTB 3V0DA 3S42A 1PIFA 4F4RA 5HYEA 1R9FA 3HA1A 1F18A 1L3NA 4FHBD 1WEJH 5I8OL 3N1GC 4JFYA 2OL3A 2CLRA 2VXQA 3EOOA 4JQ4A 1EZLA 3HJ0A 4OCYH 1WDRA 3P8IA 4IP5A 2BP8A 2Z31B 1JR1A 3GW3A 5D2TA 3RU6A 1WWWX 1AGBA 3EO0B 1QUNA 1KNOB 1XQKA 4AQEA 4N5EC 1SLUA 3ARWA 2OMVB 3BVWA 1ELSA 2BIPA 4KZEL 1X4ZA 1MEXH 5JW3H 1DJIA 3VAEA 3SCRA 3O3UN 4Z8FL 3LRGA 1MAML 2PP0A 3QOKA 1Q0YH 3CVHL 3FO1B 3JWOH 3PBYA 2Z3FA 3E0IA 4YX2H 5K1VA 4PULA 3PC0A 3HB3D 2WMHA 1FCUA 2IPJA 2J1WA 3UTTA 2PS2A 1WAAE 4DUVA 4PN2A 4FQXA 2EDFA 4QS5A 1GG1A 1QRND 5GS3A 1QPRA 2YC1A 1PUDA 5IQ7L 1H5BB 1W3TA 4YXLL 3W56A 2F6AA 4JX4A 3FF7A 1RJQA 4K3DH 4NAEB 1G7IB 1N4XL 2YCJA 2RD0A 1GVYA 3PWLA 3KBSA 4UUJA 3TYAA 1KGUA 3DO4A 1XTMA 3ABSA 3V9EA 1U8NA 1UJQA 2ZCHH 3VFRA 1E5AA 1SM3L 3AHXA 4TKWA 4IBYA 5I6PA 4G8GA 2XV3A 1W2KT 2NW0A 2Y07H 4NDMA 1Y6NR 5CNHA 5MEOB 4Q4IA 3SJ3A 2KC0A 4XN2A 3SGJC 3SSGA 2NWSA 4E8GA 4P7NA 2NZ1A 3L17A 5B4MD 2NQZA 1YXYA 3CYJA 5B7ZA 2GQAA 3G6AB 4DGIL 1PY4A 3NA4A 4HJUA 4KQNA 1GEHA 3OAWA 4O4YL 3WKYA 1KBGH 2N7SA 4JNZA 3SUUA 2AF2A 4MXWH 3KBFA 1W31A 1S2EA 4OTXL 3EYUH 4WU5B 3N42F 1XGQA 5EWIL 15C8H 2YXGA 2ZG1A 3LPOA 4X98A 3LHPL 3CG8A 4P23C 5KETA 4FG4A 3UY7A 1A5AA 2WSDA 3HG1E 1XF0A 1D5XA 4J6RL 1Q6QA 4U1SA 5F7HA 4XAPA 2BY1A 3WD5H 3B9EA 5HNRA 2VWSA 4I9JA 4IPIA 5CLXA 1SQ2N 1TPVA 2GJXA 1BXUA 3VRJA 1PHWA 1UADC 4KRZA 3W00A 1SUXA 1AMKA 4FKKA 5FC9A 2CO2A 3GDLA 5GVJA 2VDPL 2A6LA 2WMKA 4M1GL 3QHFH 5CP7A 3L8QA 4XSLA 2FZMA 4HJGA 1K9TA 2EVHA 4I5UA 2IAMD 4OQVA 1SEQL 4G5ZH 2R27A 4M48H 2XCMC 2W65A 4PRID 4HFUH 5GJPA 2FHCA 4QSFA 2QGHA 1KFKA 1W5NA 3A3YB 2NY6D 4NP7A 3LDVA 1V8HA 4YAQA 4Y6GA 2BFVH 4X4ME 4Y4FB 4F15B 5GRYA 4DESA 2O5NA 3AFLA 1IZJA 3ZE0E 4EACA 4HKJB 1IARB 3EXTA 1ZANL 4O02B 3IE4A 4G11A 4JTUA 7PCYA 4GG9A 2V30A 5AENA 1CB7B 3CLEH 1VFBA 3T3PB 2HT4D 3I85A 5ANMB 4NQXB 2K1MA 3ECBB 4OM0L 3UZQB 5IT2H 5HR6A 1R7AA 2BSBA 4DAIA 5AY7A 5L2KD 3Q2LA 4KKXA 1ETZB 5HVHB 3CWHA 4KMQA 4WD0A 4ELMF 4HPHA 3EXLA 1TFHA 1S7TB 4LLYA 3HZVA 3P0YH 1Q94A 3RPMA 2G2RB 1FLTX 2J6VA 2EKGA 3MV9B 4KWWA 4RGNB 4JZJA 1L0XA 5EPDA 2LABA 1RZMA 3M5VA 3PWUA 2OQJB 2A73A 1LNUA 3DXAB 3KLQA 2AV7B 4JY6B 1C8VA 1YZZA 3D39E 4JM2A 1MIMH 3JT0A 4U2YA 1IXNA 5KN5A 1R9YA 4LVHB 1OCOB 1UATA 1A4AA 5HHOD