1YE4A

Crystal structure of the lys-274 to arg mutant of candida tenuis xylose reductase (akr2b5) bound to nad+
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
b'SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPRSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFNDPWDWDNIPIFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H-dependent D-xylose reductase
publication title Fine tuning of coenzyme specificity in family 2 aldo-keto reductases revealed by crystal structures of the Lys-274-->Arg mutant of Candida tenuis xylose reductase (AKR2B5) bound to NAD(+) and NADP(+).
pubmed doi rcsb
source organism Candida tenuis
molecule tags Oxidoreductase
total genus 105
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ye4A00
1XGDA 4IJRA 4JQ3A 4JQ1A 4XO6A 2I17A 3WBXA 3Q65A 3BCJA 1AH4A 4L1XA 2IKJA 2IPGA 4LB4A 3EB4A 4IJCA 2ACQA 3LENA 1ZUAX 3UWEA 3M64A 3DN5A 3UZYA 1YE4A 3GHRA 3MB9A 2DUZA 4XZIA 1JEZA 4JQ2A 2IPWA 3C3UA 1X97A 4DBSA 5LIYX 4PUUA 2PDIA 3R8HA 2BP1A 4XVDA 3LQGA 4NKCA 4QBXA 2PDQA 3M4HA 4H8NA 1PWMA 4LB3A 2R9RA 3H7RA 1RY0A 1QWKA 1MZRA 3H7UA 4FALA 4DBWA 1YNQA 3EB3A 3WBYA 2PDMA 3RX2A 1AH3A 4JQ4A 3B3DA 4GACA 3T42A 4WGHA 4JTRA 1ADSA 2ACRA 1ZQ5A 1ZSXA 2PDYA 3DOPA 4QR6A 4XZLX 2F2KA 3WG6A 1C9WA 4DZ5A 1EL3A 4JIHA 4YU1A 3UG8A 2DV0A 4WEVX 3WCZA 4XVEA 3FJNA 1VP5A 2F38A 1HQTA 3R6IA 4JIIX 2ALRA 3U2CA 2ACSA 2PFHA 3H4GA 3LEPA 1J96A 3RX4A 3LNMA 1T40A 2NVDA 2ISFA 4YVPA 1EKOA 3RX3A 3KRBA 3CAQA 2PEVA 2WZMA 3NTYA 4PRTA 3V36A 4XZHA 3MC5A 3LQLA 2QXWA 4H7CA 1HW6A 4YS1A 4LAUA 2PDGA 4XO7A 5C7HA 2FZBA 1GVEA 2IPFA 3FX4A 4PMJA 3V35A 1MRQA 1OG6A 3N2TA 1Z8AA 2PDNA 1X96A 2IKIA 2PZNA 2HVOA 2IKGA 4WDTA 4F40A 1A80A 4GQ0A 4XK2A 3UGRA 4JTQA 1Z9AA 3R94A 1Z89A 4FZIA 5KETA 4R9OA 4JTAA 4ASTA 3GHUA 4AUBA 5LIUX 3COTA 3P2VA 3UP8A 3BURA 3V0SA 2FZ8A 4JQAA 1VBJA 3GHSA 3ERPA 3UFYA 2VDGA 3R58A 4Q7BA 2PDCA 3N6QA 2IPJA 3UZWA 5AZ1A 3D3FA 2IS7A 5JH2A 2INEA 4GABA 2PDFA 1S2CA 2FGBA 1Q5MA 3BV7A 1MI3A 1IHIA 2CLPA 2WZTA 4XZMX 3O3RA 1PZ1A 5HNUA 3O0KA 3V0UA 2PDJA 4WDXA 1Z3NA 3R7MA 1X98A 5DANA 2AGTA 2HVNA 4MHBA 2IQ0A 3CASA 3LZ5A 1RALA 3M0IA 1FRBA 3VXGA 1K8CA 2IKHA 2A79A 3Q67A 4WDWA 4XAPA 2HE8A 1EF3A 2PD5A 3LN3A 1AFSA 4HMNA 2INZA 1YNPA 2PDKA 1ZGDA 4HBKA 2PDBA 1AZ1A 3R43A 1IEIA 2I16A 4QX4A 1PWLA 4YVXA 3V0TA 4LAZA 5AZ0A 1S2AA 1US0A 3LBOA 4EXAA 4FAMA 1LQAA 2DUXA 1AZ2A 3UYIA 1UR3M 2HE5A 2PDWA 1SM9A 2P5NA 4I5XA 4G5DA 3WBWA 1S1PA 3F7JA 4RPQA 2FZDA 3CV7A 1T41A 1S1RA 5HNTA 3QKZA 3GUGA 5HA7A 2BGSA 4GA8A 3CMFA 5LIWX 4JTCA 2PF8A 3LUTA 3UZZA 2PDUA 1LWIA 3CV6A 3GHTA 1Q13A 2ACUA 2FZ9A 2C91A 3G5EA 2PDHA 2PDLA 4GCAA 2FVLA 2IQDA 4JIRA 3S3GA 4PRRA 2J8TA 2PDXA 2HEJA 1PYFA 5JH1A 4L1WA 1PZ0A 3BUVA 4IGSA 4GIEA 4YVVA 2R24A 5LIKX 5M2FX 3R8GA 1XJBA 1M9HA 5LIXX 1XF0A 2HDJA 4LBRA 3EAUA 3UZXA 1YE6A 4WDUA 3ONBA 4ZFCA 4ICCX 4GQGA 1EXBA 3LD5A 4EXBA 4XZNX 2PDPA 3LZ3A 4PUWA 1R38A 4WRHA 4OTKA 2BGQA 1RY8A 2HV5A 1AH0A 1QRQA 4JTDA 4DBUA 3CAVA 4FA3A 2PD9A 2NVCA 4Q3MA 4PR4A 3ONCA 4LBSA 4QXIA 3G1RA
chains in the Genus database with same CATH superfamily
4DI8A 1QI0A 4OQVA 2CHRA 3O6DA 1TVPA 2C0AA 2CBIA 2IKJA 3TXVA 1KM4A 2NX9A 2E3ZA 4DJED 4HTBA 2EGZA 4LT9A 1W1A1 3FY1A 4REQA 1RQHA 4B15A 5REQB 1JRBA 3RFAA 5B80A 2WHJA 2NQLA 3MO4A 5AECA 1ECQA 4W8LA 1BVNP 3WJYA 4NASA 2Z1XA 2FDMA 1E5JA 1NY1A 2IPWA 4PGLA 4PMZA 3AWNA 4C6LA 1RCQA 4S3CA 4ZQCA 3VD7A 2PDIA 4OKDA 1F74A 4NIRA 4DZHA 1ITQA 2CLEA 3V7PA 4EPBC 5CPOA 4M6PA 4NNAA 4P7LA 4A3HA 1V3HA 3KX6A 3NDYA 1NQ6A 4UOQA 2FHFA 6ALDA 2PU0A 1OZQA 3V5OA 2QGYA 3PAJA 5PTDA 3PZ9A 1EPXA 3B3DA 5IRPA 4JTFA 4W7WA 4AW7A 4Q8TA 1GVQA 4IFOA 2A3CA 1ECEA 3KVMA 2F9RA 8XIMA 5ABFA 1R3QA 4Y9AA 4OBSA 1B3VA 3DOPA 3UVAA 1W37A 5EL1A 1S5VA 4GE8A 4C60A 1BLIA 4G1KA 2V3DA 2E0PA 1QO2A 4QP0A 3UG8A 4J28A 4I7UA 2FH6A 1W31A 4WEVX 4Z2KA 3VUPA 4JIIX 3TNBA 2PS2A 2VJXA 5TNVA 3MS8A 4AWSA 2R6OA 3KOYA 1BXNA 1D7FA 1BKSA 4PL2A 4LCSA 2J77A 3CAQA 5BXTA 4FXRA 3S8HA 2XFRA 3BOLA 4HA0A 3VNIA 3U2OA 1REQA 3MWCA 1R9YA 4C1NA 3GW3A 5IM51 2PU1A 2ZX7A 5C8BB 1S5NA 1X6UA 1E71M 4DXXA 1TPB1 1J4EA 2Y61A 2AQWA 4NT0A 1MRQA 3BCFA 4HMCA 3KZSA 1XIBA 5A8PA 4AY1A 4BKNA 1EEXA 4CCEA 2QKFA 5F2IA 3TQ0A 4IMGA 3AYVA 2PBGA 3O16A 3GR8A 3DC8A 2QDGA 4XK2A 3VM5A 4NZ5A 3WH7A 4HKPA 1E1EA 1TZ9A 3MJMA 3R94A 4J3VA 2BZNA 3WDQA 4RK8A 1Q6QA 3T81A 2GQAA 1MFUA 1K9FA 2Z1KA 1SFSA 3AO0A 1UC5A 3CYVA 3PC0A 1BQCA 5FAJA 3VZZA 1NDWA 3UQNA 3R13A 1PHWA 1V0LA 1XG4A 3BG5A 2YDQA 3UU0A 1GG1A 3WQ6A 1KFLA 2VDGA 3VNMA 3SCSA 1H50A 3UZWA 3MI3A 3KVLA 3E96A 5CZ0A 4DJFD 3SAZA 1B9BA 2OX1A 1FCUA 3MWAA 4OWGA 4CVUA 1EUAA 1GZ1A 2GGIA 1IZJA 1AJZA 3CMJA 7TIMA 4D71A 3V5CA 1WBHA 4JIPA 4HOXA 3GTHA 5CSSA 3OG3A 1HJUA 4FX7A 3W53A 3A24A 1ITUA 1RLDA 1JXKA 4QE1A 2QULA 4KGJA 4JFTA 2J88A 2GQ3A 1JZ7A 1BFNA 1O7AA 1OCJA 4N2YA 1D9EA 2FVMA 2TMDA 2AL1A 1J0KA 2X05A 3HO8A 3IAQA 3R2GA 2EG6A 2NUWA 4CNSA 3QVQA 3IIOA 3N4FA 4W4QA 3QC3A 5D03A 3K8KA 1JD9A 5HMSA 2PDBA 1H7NA 3TH6A 1OX5A 4NG3A 1UKSA 3TJ4A 5EBAA 1UR1A 2FIQA 4U3AA 2QW5A 3R89A 1Q8AA 2W66A 2AAAA 3K5XA 1EC8A 7REQB 2OOGA 4HD5A 3DFOA 1Z41A 4Y9NA 3SY1A 2CFFA 1WBJA 2VP8A 1WDSA 3L68A 3CUJA 1GOOA 3KDNA 3PPGA 2QCDA 3HIJA 2QDEA 5FF3A 3F7JA 4Y9OA 1M1BA 2AKZA 1UD3A 2E6DA 3SFWA 1YHTA 4GA8A 3T7VA 4HSNA 3A64A 1XH0A 3SRHA 2PF8A 2PGFA 1DWGM 1EDGA 3WDHA 3VGDA 5DXXA 3CHFA 4TV6A 3PJXA 2BHUA 2WVUA 3NO5A 4N9BA 3QPZA 1Z32X 1BKHA 2H3DA 3PS7A 1YTKA 5AFDA 4UOZA 4DF1A 3OODA 4IXXA 1Z69A 3CEPA 2VFDA 1QOXA 4JHMA 2MUCA 3W4RA 2PAJA 4ES4A 3N11A 1V6YA 2E7FA 1NOUA 2HJPA 4QQ3A 2KAUC 4D1IA 1EX5A 5DFAA 1NWTA 1TWZA 5JH1A 4ILSA 2QS8A 2WMFA 4K39A 5DCDA 3DENA 4ZTXA 3GSMA 4LH8A 3IK2A 2R24A 5LIKX 3CO4A 3LA4A 2NXGA 2NQ5A 3EAUA 3U48A 1NARA 3W07A 4WDUA 1UD4A 1X1OA 4GVGA 4EX4A 3VINA 2PLKA 3RLUA 2AL2B 4IQJA 3B4UA 1B4EA 2ATMA 4FXFA 2G3NA 4ZO7A 1Y65A 3CH9A 1XYMA 3CAVA 1GYMA 4MNMA 4XZWA 1XC4A 1QCWA 4UR9A 1E6NA 2C13A 5KZMA 4RKAA 1S3HA 4KFPA 1L6FA 4HJWA 2PC4A 3T08A 1SW0A 3C61A 2XFFA 3CMGA 2P50A 1OFDA 2BXVA 2XH0A 4PMRA 4QJ5B 2PB1A 2QDDA 3O05A 3W01A 3LHZA 4AZHA 4W9TA 1TREA 2CZEA 3M64A 5HJXA 4JTGA 4AZ6A 2F8QA 3UZYA 4FIRA 1JFXA 3VGBA 4MSSA 3VMPA 3GG1A 5DO8A 3ZLFA 1Q85A 1XLLA 3R0DA 4PYSA 3BLFA 1W3LA 1NH6A 4GX9A 2QMJA 4OV4A 4Z1AA 1EZ2A 2J66A 2QCFA 1BYCA 3G3MA 3UXKA 5FEPA 3SQSA 4N4QA 3WJWA 4U33A 4LY4A 3W3OA 1W1B1 2QUUA 4J3WA 4IF2A 1KTBA 4W5UA 1FVPA 4NL1A 4EIVA 1P0KA 1FHUA 2V5CA 3BPWA 3G6MA 2PPGA 5E0KA 3NSNA 3LCHA 3ARYA 3M1ZA 4P7RA 1H5YA 3BE7A 3HMCA 2DVUA 3QOKA 4LEFA 2VUYA 3MO7A 2WXDM 3KDOA 2ZQ0A 4R7WA 3ZXWA 4S3KA 2YLLA 4A21A 1UZ4A 3VNYA 3ARZA 4BEUA 3ZT7A 3DYOA 5C2CA 5CGTA 1YKWA 1UD5A 2GSEA 3HJEA 1UG6A 2HSAA 1POJA 4ZMGA 4EXQA 2RAGA 3W2LA 4A4AA 4AZ7A 3EDJA 4ICNA 1FWCC 2FHBA 2DY3A 2Z2BA 1LT8A 4O0KA 3N2CA 3W7CA 2A3AA 2VXNA 2GZXA 4EWND 1FWWA 3VOJA 5I24A 3ENLA 5FL1A 2NVDA 4JD4A 4DYKA 2D22A 2QPXA 4NSBA 1GVFA 2EG8A 2ZZ7A 4UOJA 1FWTA 2PEVA 5D9MA 4BCEA 1SFJA 4RDYA 4H04A 3TWAA 4GI4A 3IJLA 3W6MA 1OT2A 3MMWA 1U1HA 4MWAA 3VC5A 3O07A 4LAUA 3SCOA 1AVAA 2OZ8A 4XO7A 1BAGA 4PMOA 3TA6A 4K7YA 1QK0A 4NRSA 3WNPA 3BJFA 1A5CA 1W3KA 4LS1A 5BRBA 3OZYA 3S83A 3OHIA 4UTIA 2UY3A 5ENLA 1XUZA 3QR3A 3S9IA 1JR1A 4N42A 3GBEA 3N73A 1E0XA 3NQBA 3ITGA 3M07A 1TVLA 3M9YA 4LC8A 1E4IA 5D2XA 1GHSA 3F4CA 4ZL1A 2QCCA 5LIUX 2D23A 5EMJA 1E3XA 4DZAA 4HIBA 4PBGA 2W0UA 3GU1A 1CEOA 3LXBA 1EWDA 4AC7C 3W02A 4PMDA 4PTVA 2DSUA 3QV6A 4KRZA 4DB7A 1T99A 1RVKA 2INEA 3QHOA 2JE8A 4UQEA 3ZOAA 4A22A 4DJDA 1TPWA 3DKJA 4M6VA 1J01A 1UC4A 3DFHA 2Y5SA 1DWHM 3LCLA 1IZKA 3CTLA 4AVNA 1C9DA 1ZHAA 4ICMA 5BMWA 3AIWA 1TWDA 4X60A 1L6GA 1E51A 3PP7A 3V75A 4JEJA 3A9IA 4QQUA 9CGTA 3HB9A 3VXGA 3TLLA 2NWSA 4W84A 1LRNA 3AZTA 4JTKA 1FP9A 2BVYA 2HE8A 1M7JA 2ZZ2A 1MUMA 3C4UA 1E0WA 1XRFA 1OYAA 1TIMA 2G5WA 1P0DA 1GW1A 3TQVA 4MB4A 1XPYA 1XISA 1XIDA 1OFQA 3WK3A 2A85A 3FDKA 3EX4A 4H8UA 3S1XA 1I60A 5AZ0A 1ZBWA 3THCA 1JCTA 3EDEA 2G97A 3B9AA 1MDLA 2ONEA 4CVWA 2ZBTA 4UCGA 1UR3M 2F61A 2BY2A 3T0DA 1GPFA 3N34A 2ZRUA 3BQ6A 3CUFA 2CXGA 4D6CA 1Q6LA 5CPSA 1PAMA 4MJZA 1FWRA 4QEHA 2BB0A 2ZC1A 3E5PA 3GU9A 5H2ZA 3EOSA 5ABHA 3GUGA 3VX1A 5IBXA 1PE1A 1NF0A 5T26A 1XUUA 2ZTJA 2FTYA 1B57A 4BHYA 5IFPA 3UZZA 3PTKA 1FH7A 1RJPA 4YPJA 4NYYA 4RE3A 1TE1A 2HXTA 4IOTA 3KOXA 4E5TA 4PODA 3S5OA 5I78A 1NU5A 4FR6A 1KM3A 4AY8A 4JNMA 3ZT6A 1JPDX 1B2YA 2E6AA 4NZCA 1T8XA 4GGBA 5G4EA 3LLFA 2XSXA 1DJIA 4ZE4A 4HOWA 2QV5A 5GNZA 1M53A 1YPXA 4F48A 3E5BA 1P4CA 4P7NA 1HVQA 3PTDA 3FYOA 4UNIA 5DXYA 4R85A 1UH2A 4KEMA 3T0AA 4IGSA 4Y6GA 3M0HA 2E8YA 3T0CA 5FSDC 3LMYA 4B9YA 3AUJA 3GH5A 4H9ZA 1LBFA 2HK0A 3T78A 4QLKA 1MW0A 2XVKA 1TR9A 1GVSA 1PJ9A 2RFGA 4XQ6A 4F3HA 3UY8A 2BGQA 1ICQA 3A4WA 4LCQA 3WEMA 2QMKA 3W1UA 4F0HA 3WQ8A 1CLVA 1JCMP 2Z1BA 3PBWA 2ZE0A 2C16A 3LOTA 2CKRA 3LYEA 1UZDA 3L5MA 3GTNA 1OINA 1W0MA 1O66A 1XH2A 4Y90A 3PJWA 5D38A 1QOPA 3CUGA 1W5MA 1DVJA 1NWSA 2GGJA 2Y7GA 1VBGA 4NF7A 2E68A 3BL3A 5AC7A 1F7BA 1PZ2A 2AGKA 3ITXA 3L2MA 4XD6A 4BS0A 1O12A 3HPZA 1HGYA 3LU2A 4ONVA 1TA3B 3KCOA 4M24A 4GHRA 3DEQA 4GIYA 3LTYA 4ZQNA 2A0NA 5T9CE 1VYRA 2BP1A 4JFUA 1LRQA 2NSOA 5LNRA 3S5SA 3GFYA 4LVAA 3NAVA 3RR1A 1TJRA 4DJEA 1SO6A 4CU8A 1VPYA 2C7FA 2XYLA 3UPMA 3CQIA 4DBWA 3QV9A 1SO5A 4RXGA 1JDDA 1DEDA 2VFIA 1AMYA 3WNKA 1RP9A 4Q6XA 3TJLA 3VI2A 5CXPA 1A3XA 3BMVA 2VNCA 2DH2A 3DDMA 3EWBX 1WB0A 1NFBA 4XD4A 5ECUA 4CUCA 1FFQA 2GOUA 4D8ZA 4GX8A 3OA5A 1JL8A 1ZSXA 3CHVA 1QI4A 1UUMA 3P0XA 1GOMA 4F0SA 1QPOA 2OWWA 1FH8A 2DV0A 4LEQA 1TWWA 5CPTA 1EPVA 3RK8A 1HF6A 2ODOA 2Z7GA 1SJDA 2I9EA 3R6IA 8RUCA 3SCNA 4FNSA 4IM4A 1V0MA 1UB3A 3BAIA 1MEIA 3LNMA 4XAGA 1KFEA 3LLXA 3MP4A 4DUWA 2CPUA 4LUIA 3EGJA 5D2YA 3E49A 3AXIA 1RSCA 3KFTA 4B5NA 1HGWA 3S0CA 3RDKA 2R8WA 3GVQA 5FF0A 3H24A 3SGGA 4EF8A 1H49A 1M65A 3U2ZA 4DBEA 2ZZ6A 3QM3A 1HKKA 3NL3A 1IXPA 2BG5A 2D24A 2CBUA 4GINA 2RGMA 3FXYA 4QS5A 4AC1X 1MEHA 5HAOA 1BXCA 4V33A 3GK0A 4HZMA 4OBRA 4K7VA 1AL7A 5LHFA 4ZQPA 2C1HA 4PTDA 1DE5A 2P1FA 2ZUSA 4B4HA 3ZVHB 1GEHA 2HCVA 5BU6A 2FDSA 3MKKA 1NQKA 3L5LA 3KAOA 1VEMA 4GWEA 3WL0A 3P2VA 3UP8A 3IGXA 3BURA 3L4VA 1QHPA 1W3TA 3UG4A 3EMCA 4DWSD 1XLKA 4LUTA 3UNDA 3C8FA 4JY8A 4ZB0A 2EPOA 2DZVA 2Y8UA 1LUCA 3G18A 3C0SA 3KHJA 2Y63A 3D3FA 4OOUA 4POCA 4XKYB 4E0CA 3F4WA 4Q8UA 1HP4A 1DHPA 1WKDA 3NQVA 4F2UA 3P62A 3W88A 3LY0A 4XZMX 3C2OA 2P0OA 2QHAA 3SUVA 5BZAA 3V0UA 4QTGA 4Q4OA 3XISA 3ARUA 3S1GA 2DJXA 3DHDA 3B0PA 2JALA 1F4AA 1SZEA 3W75A 1CGUA 4B5SA 4IUGA 2OMAA 4UTTA 3VGFA 4JAWA 3GNOA 3AXHA 2ZRZA 3CM4A 4HNOA 2WMIB 4HMNA 2NV2A 2XGBA 4C6JA 1OYCA 4DJFA 2XN0A 1JGIA 4PMUA 3ZWSA 1FWBC 4TX6A 3QQ0A 2BOEX 3LX9A 1PWLA 1UD2A 4CN4A 4UFKA 1SO4A 3CZEA 4O1AA 5M17A 4C7DA 1CXHA 2OOFA 2ZUTA 4H6KA 1VPXA 3ARXA 3U5YA 3C8NA 1JYVA 4EXAA 1P6WA 3O2LA 4IMFA 1HTIA 4EAMA 4HOZA 4MKNA 1UQYA 2O55A 3QGKC 7PTDA 2CHNA 4M80A 3GE7A 2ANUA 3DHPA 3TR9A 1A3HA 2FZDA 2DFAA 3PUGA 3NURA 4R33A 3KTCA 1CLXA 3N29A 1KM0A 4I9MA 2XVGA 5IOBA 1PTDA 1FUYA 4LYKA 1WO2A 4W86A 2JGYA 3STCA 1N7KA 1JI2A 1OG0A 1PCWA 2BGNE 2G95A 3SCQA 1TMLA 4PUEA 5AC8A 3E9AA 3CQKA 1GOQA 1EB3A 1VCGA 1WDWA 4DX3A 1LF1A 1ISWA 3RF9A 3LCIA 2OYKA 3E6EA 3RLHA 4BF9A 1O1HA 4IGMA 1EJ7L 2J75A 4Q32A 2OQLA 2YL6A 3B97A 3S5NA 1UR0A 4IP5A 5I02A 1Q6OA 1TTQA 3OGVA 1ICSA 3MANA 3UZ5A 5LIXX 1F5ZA 3OIXA 3BSGA 4DUVA 1YEYA 3E0WA 1R2RA 3FKRA 3VDBA 4CD6A 1V3JA 5MHBA 1Q2RA 2XG9A 3WF2A 1W5OA 4BQ3A 3WL1A 4UWMA 2EPNA 2NV1A 1CYGA 4PR4A 2Z00A 4K1GA 5BU9A 2QVHA 3UPWA 3NQAA 1XGDA 4IJRA 4JQ3A 1K9EA 5JQ9A 4QJ1A 2GVYA 2XVLA 1RZMA 1SPQA 5E93A 1UYQA 4L4OA 4LB4A 4IP7A 7ODCA 1PVNA 1D8WA 1XCWA 3IJDA 4URIA 4HHPA 4IQEA 5AY7A 1OFPA 1E1FA 3DFPA 4HCHA 2FKPA 3J7HA 1PKYA 5I77A 4CQDA 4NJJA 3U8GA 1GPWA 3OVPA 5D9OA 1X97A 2Q71A 5D30A 4BJHA 1P5BA 4ZA0A 3OW1A 3W00A 3ZR4A 4JX6A 3MCNA 2G3JA 1QI2A 2DSWA 1LL7A 4U5IA 5CBJA 3H7RA 3CPUA 2TPSA 3EWCA 1KV5A 1TCDA 3FK4A 1YNQA 3PWGA 4O19A 3P8IA 5FOOA 1CI1A 3LG3A 3FLUA 4IH3A 1P1XA 3G8EA 1EGVA 4F9JA 3WF3A 3FVMA 4JYEA 1BVWA 4NI8A 4F8XA 5ABFB 3VABA 1HX0A 1Y5VA 5EMMA 3LXAA 1GQNA 2ACRA 1OQFA 4H01A 4IIHA 2WB5A 4I3GA 3WF1A 4W7UA 4XZLX 4GUJA 4L9YA 3AWOA 1UD8A 1E15A 1UKTA 4GMEA 5AVNA 3TDFA 2QJJA 4BQ2A 2OEJA 1EIXA 3E1F1 4BA0A 1XXXA 2E8ZA 1LQ2A 3KVJA 4J27A 4DO7A 4QCEA 4RZBA 5LYRA 4G7EA 5DMYA 4JX5A 4H00A 3W0KA 1EJTC 4YVPA 4BI5A 3EEZA 4D6GA 1NF7A 2ZVIA 3F2CA 1BWLA 1GOXA 2Y7DA 2ZZ5A 1R5YA 1REQB 3NQMA 3WLQA 4C1NB 2ZA1A 4CEUC 5T8GA 3MVIA 2XFWA 4F0RA 3M41A 4XTDA 1RAKA 2X0YA 3OVGA 2WKGA 3PZQA 5CKSA 2DZBA 5I3HA 4ZB2A 2PGWA 4QJ3B 2BTMA 2E4TA 4UB9A 1YRRA 1W3JA 3RO6A 1DORA 4QNEA 3UEQA 1A80A 1K1DA 3O9NA 1DWIM 3NSMA 3WNNA 1JRCA 4JTQA 3UA3A 2Y2WA 1W3IA 2QCGA 2Z29A 3W7DA 4J35A 4CQCA 2WZHA 4AEFA 3S2LA 2WHKA 4CN6A 1RV8A 3EB2A 4BI7A 4GZJA 2HISA 2R14A 1GEQA 1E56A 4YLWA 4O18A 2DT1A 4IIFA 2VEGA 3R58A 1J6PA 5LA1A 3ITYA 4LC6A 3ABZA 5H6HA 1CB7B 4CU6A 3W7RA 2DVXA 2PUZA 3VDCA 5JH2A 2Y7EA 4LCRA 3M0XA 4XBKA 4GABA 2VURA 3B9OA 1M03A 5HATA 1YDVA 2QYGA 4ADUA 4WVXA 2D0FA 1PS9A 3E2QA 5FJOA 2Q3OA 4W5ZA 8A3HA 4GY1A 3H70A 1CIUA 4A8NA 3RJYA 1UKPA 1UMLA 1VRXA 4XAPA 1T6MA 1BG9A 3E2RA 3I3DA 2DT0A 3FCPA 1JZ6A 4QRNA 3FEMA 3EXTA 3GDBA 1TJ1A 2VHLA 3O8AA 3F2BA 1SYTA 1DJHA 3PBGA 1AZ1A 4F9DA 1VEOA 4IG2A 2BXYA 3MDWA 3S4TA 1RH9A 3VFLA 4GD0A 4LAZA 3PF3A 2HS6A 4NX5A 4N02A 2V5JA 4IFKA 4M51A 1CDGA 3P5YA 3CAKA 4S3JA 1HXJA 1ZY9A 1K8ZA 2DZUA 2YW3A 3QR0A 2VZOA 1PEZA 3ZQ9A 2GVGA 3MVTA 2VWTA 2CLMA 2VGIA 1ZJHA 2X2YA 3P5ZA 2X1RA 2YCIX 2B81A 4P7OA 3FYYA 3QGAC 5KZDA 1OCQA 2RH9A 4JDBA 1QU4A 1V0NA 1FCVA 1J11A 4XAFA 3YPIA 5LNSA 3KCLA 3GDLA 1A50A 2ISVA 2VGGA 1C7SA 2EBNA 1MUCA 2GGGA 4YHGA 5A8GA 2J9XA 3EWUA 3PNZA 4L56A 2Y62A 1SZFA 1DP0A 2YFOA 3U7VA 3UWVA 1EJVC 5HR6A 4OHQA 3HGSA 5F2GA 1TTPA 1VF8A 1I1XA 3PK7A 4AFYA 4K37A 4MOZA 2GQ8A 3DECA 1P0BA 3AXXA 2XWDA 1UQZA 3GXFA 1UIOA 3VGGA 3DFSA 5FJTA 3BVJA 1TG7A 3A12A 1OGGA 2H9AA 5FAGA 2DP3A 1XSKA 1A5OC 3ZLGA 4HCLA 4HHLA 3ZZ1A 3SY8A 1GQJA 3MW7A 4N9EA 3THAA 3CAWA 1TJ0A 5D32A 1Q7QA 4MUPA 1AH0A 2FQIA 1UPMB 3BLPX 3HPSA 1K6AA 1QTWA 1YPFA 3K2GA 3DG7A 1RK5A 1SUXA 4PA8A 1M7XA 5I3IA 4LYPA 1I2RA 4C6FA 2X40A 2G3MA 3G1RA 2EAWA 1KBBA 3M43A 4O1DA 4JQ1A 3WBXA 1KA9F 3Q65A 3UWYA 3EWXA 4MAZA 3UJEA 1C90A 3HG2A 1HKIA 3O6CA 3NO3A 4V28A 3QH2A 3NSXA 2I1OA 3S1VA 1J79A 4TXEA 1PKLA 5EYWA 4C6CA 1CGYA 4KWOA 2PGRA 5D02A 3GHRA 3MUAA 1XD0A 1MFVA 3ORWA 1ADOA 3VCCA 1QFEA 1R7OA 1XLJA 5FEZA 3TW6A 2X7VA 3TFCA 2YXXA 1XYBA 3GH4A 3IK4A 1CGXA 4QBXA 2PDQA 5BNKA 3SURA 4KEVA 5F7UA 4ORIA 2W3ZA 4X22A 4LUJA 3LBMA 4GI8A 3QMRA 2XFYA 2QGHA 3WDRA 5BOOA 3FAWA 1QI5A 2IUZA 2WCAA 1KRMA 4MAVA 4UMCA 2Z0IA 3VMNA 4E3VA 2WCGA 5B7YA 1C3FA 3H2EA 2SFPA 3W7MA 4BQ4A 1R3SA 2D2GA 1JFHA 4UFJA 4GUGA 5HNRA 3TN4A 4HK6A 2G37A 1JGMA 3GKAA 2O0TA 2PDYA 4H41A 4RNJA 1UWIA 3GXNA 3M7SA 3KOFA 3WG6A 4AX7A 1OFRA 2QCHA 1AODA 3MMDA 1NEYA 4P5UA 1H61A 4QAIA 4N0RA 4ERGA 4JIEA 4RW5A 1ODZA 1Q6RA 2ALRA 3R8RA 3W1QA 3ZFHA 3MA8A 2QVNA 5CZKA 5F1VA 3SY5A 3TYBA 4Z1BA 4KCWA 2XHYA 3AIVA 5A2BA 4JNZA 1QMLA 4D1JA 5LNUA 5E9XA 2IMRA 3UR7A 1K8XA 1DL3A 2VOTA 4JTSA 1QNPA 5HULA 7XIMA 1G4TA 3FA3A 2CCRA 5C7HA 3HG3A 3N15A 4Q8WA 2OLAA 2CEQA 5A69A 3W38A 4LANA 4L5ZA 3W1PA 1JQXA 5C9WA 1H51A 4H9XA 2VVSA 1X96A 2VC6A 3G0XA 1TB3A 5DX7A 1LLZA 3UGRA 4MTVA 2OT1A 3FDGA 4H3DA 1KD0A 1ZB5A 3N2BA 5TD4A 3PNUA 3TC3A 1A5LC 3WNOA 4R9XA 3W2NA 1KRCC 2VWSA 4WY0F 2J7CA 3OPSA 3VDAA 3W7GA 3ABOA 1OHLA 3OBEA 3F1QA 2ZFAA 2G41A 3KBSA 2RDWA 2V67A 5IFTA 1KR0A 2WV8A 3WF4A 5E6YA 2V5BA 3CV2A 1JPMA 3BWWA 3Q37A 4JTIA 3H2NA 3DBPA 1JCJA 3E38A 4WSKA 1CGVA 4YYFA 5SWUA 4RZ5A 2F7FA 2V3EA 1UWRA 3TW7A 2CLIA 3HQ1A 4FNQA 2ESCA 3M47A 2FGBA 1AW2A 3BV7A 2PP0A 1QHZA 2CLPA 2DT2A 3LERA 1XYLA 3EWYA 4G6CA 1PZ1A 3CO8A 5HNUA 3MUIA 3FNDA 4JGDA 1XCFA 2HVNA 3TCSA 2ZICA 3G1HA 3W22A 5I09A 3TTQA 3MKVA 2V81A 4D8AA 3A4JA 1V5XA 2Z1VA 3OLGA 5JMUA 2V3FA 3RILA 5I3DA 3ZO9A 5BXRA 2P0IA 5E1QA 3OG2A 5AC4A 1J2WA 4ACZB 1LT7A 1Z6KA 3PUOA 5F4XA 1QXLA 3WQCA 2BMBA 2QUNA 1P0EA 5I2UA 2EKCA 2DW6A 3EWWA 1B1YA 4KGLA 1MXSA 3RM4A 4KT2A 1FXPA 2ZWZA 1S2AA 3SM0A 4WGXA 3XIMA 3BANA 3CJPA 3VD3A 1US0A 2VM8A 4UR8A 6XIAA 4C91A 2CXEA 4MFEA 2ZRVA 3C56A 3GQYA 1AZ2A 3MI2A 3IARA 2R82A 4I5XA 1WDQA 4IPJA 4AEEA 2HBXA 3TYEA 2HZGA 4US5D 2NZLA 3E0LA 3AXKA 3ITOA 4GZEA 3AYRA 4O1BA 5D04C 1Y8BA 1S1RA 2E5DA 3K8LA 3UJRA 1JDEA 3TZFA 2BDQA 1PDZA 3TROA 5LHEA 4JNYA 5LIWX 1DWJM 3TTEA 1J0IA 3EA1A 1SGJA 3NQGA 3RAOA 4XUGA 3B0YA 3E02A 3GHTA 1XSIA 4GIAA 2NW0A 3FSTA 3TYAA 1VIWA 3V18A 4I90A 4C6QA 3T4WA 1HJQA 3VZXA 3TJXA 1IZCA 3T2QA 4TR9A 1KXTA 4MY1A 3G0UA 1DJYA 1VAHA 1G9HA 3ZR5A 1JDFA 1SJBA 2EPMX 4RE2A 1L0PA 1EX1A 3CIVA 3L2LA 3OTRA 4S3AA 3CQHA 2ISDA 3W37A 3KEHA 4WCJA 4H9YA 1NDVA 4GOAA 5G1TA 3ZJKA 2VRKA 5DT7A 4BEQA 3R0KA 3UJFA 3VO0A 5KSWA 4ZO6A 5LXEA 1RLCL 2W63A 5TQLA 4ZFCA 3LK6A 3DYPA 2D0HA 2PDPA 3B4YA 4Z1DA 3IAPA 1AL8A 2PWGA 4FPSA 1DJWA 3FKKA 1JF5A 4L65A 1KR1A 3N4EA 4ADTA 1LORA 3CH0A 3L65A 2CYGA 1JF6A 5GPRA 1E9LA 3FSUA 3PWAA 6A3HA 1AH4A 4S3EA 5CAKA 1LG2A 2PLCA 3JS3A 3ARQA 4MZ8A 4KCUA 1BXBA 2JKAA 3L12A 3F4DA 2BY3A 3WMLA 4LXFA 5MF5A 3WQGA 3MUCA 3EBVA 1RQBA 3SBFA 3VIKA 1W9DM 3THDA 3CIXA 1XP3A 3WK1A 4ZQOA 1OC6A 1GVRA 7CGTA 1QHOA 1XH1A 4LALA 3LCXA 4ZE5A 3BK0A 1QWGA 3OZOA 1H1YA 4NNBA 2Y8KA 4NKCA 3RCNA 3UBPC 4IQDA 2QJGA 1HKVA 4Q8PA 4DXVA 1J12A 3ES8A 3GAKA 3ZM8A 4N9DA 2VL4A 4QJ4B 4K8EA 5XIMA 4CQ9A 3G1XA 1IR1A 4H6QA 1I0BA 3H55A 2NXIA 1LLWA 2PDMA 5A6AA 4WQ6A 1YBQA 3EXSA 1HNYA 3QBUA 4M1RA 2MNRA 4RUBA 2QR6A 4Q8QA 3W7EA 6CGTA 1XYZA 3HGRA 1TMQA 1H7PA 5I79A 1UKOA 3ZSTA 1AG1O 3A47A 4MLJA 3UETA 3GY1A 3IIPA 4NZ4A 1GNXA 1S5MA 1GJPA 4OBTA 1O94A 2DIEA 2Y1HA 1SU5A 3JU2A 4RV8A 4UMAA 4WOZA 4BQ5A 2V5KA 3NDZA 4LFYA 4Q8MA 3UWZA 4D6DA 3KUMA 1MVYA 1EKOA 1TWSA 2YYUA 4O13A 1KO0A 4XX6A 4LX4A 3PSVA 2WSPA 2Y5EA 2XVNA 3ZSSA 1W1IE 2C14A 4B3KA 2VEKA 1XRSA 2YBTA 4YS1A 3ZJ8A 2PDGA 1WKYA 1IEVA 2J25A 4K3ZA 4NRRA 1GVEA 2FB2A 2HWGA 1RD6A 3QFWA 4O8RA 4NI3A 1GGOA 5EMYA 3U6WA 4AB4A 3FVDA 4H6RA 3B40A 3TSMA 3O0FA 1LZOA 1GJUA 4GCXA 4AD3A 2QT3A 2HXUA 3WQDA 2HVOA 1XBVA 4BR1A 3MBFA 4D6EA 4PL1A 3LCGA 1J6OA 4GYKA 3GH7A 4FZIA 5IXEA 1HP5A 4PUDA 4OZOA 4EPEC 3URNA 5DELA 4ZQMA 2H8XA 4LUTB 3TQKA 3L0KA 2X41A 5K2ZA 3GHSA 3RU6A 1EDTA 3EA2A 5BXPA 2VENA 5DBUA 1Q7MA 3TQPA 2WC4A 3S9ZA 5LXXA 2IS7A 1HIZA 4MYAA 2Q02A 1QNVA 4KRUA 4MMWA 1YXYA 1VD6A 2OT0A 1AQ0A 4LUYA 4LRSA 1XPGA 3VNJA 3L4UA 1B3XA 2ZYFA 4JIQA 2RKXA 4L7ZA 3GR7A 3TONA 1RK6A 1VJIA 5DANA 3FYPA 2YKKA 5HINA 1JCYA 1FA2A 2XDFA 1FRBA 1K8CA 2EJ1A 4XUYA 5CC7A 3AMGA 2C18A 1E55A 3T05A 6REQB 2OFJA 1LROA 3W70A 4ORMA 4EP8C 3AIBA 3L4TA 3PSWA 3L23A 4HNUA 2CW6A 3QQWA 1RJRA 5AOUA 2J62A 3HG4A 1ONRA 3UA4A 4UFMA 3QYQA 3OQEA 1S5WA 4MZ1A 1V6XA 1KM2A 3RM8A 3BAJA 1FWIC 3CEUA 3FIGA 1UZHA 1LCOA 1HJVA 1XQLA 2HE5A 1SM9A 1E70M 2GK1A 4XTIA 3BXWA 4R88A 3S2NA 3GG7A 3KTXA 1KWGA 1L6SA 5BOFA 2NXHA 3O63A 5A2AA 1IIGA 1EO7A 1UOKA 2DDXA 2WJDA 4GJ1A 2Z28A 3R25A 2WSKA 2I56A 2WMJA 4A2SA 4YXGA 1W17A 1XGEA 2DH3A 4FOUA 1TA3A 4ZZ9A 4LTSA 4DY1A 5LSMA 1Q6GA 3EDDA 5HOSA 2YXGA 3NWRA 3M0LA 5CAHA 4IQLA 3MSGA 2R1MA 1UWUA 4PRRA 3UWQA 1KFJA 3BAWA 3MP3A 1LQ0A 2VFGA 2W61A 3NPUA 4Q33A 4M6UA 1UP0A 3RPTA 4HTYA 1H0IA 4J3UA 1LOQA 4P8XA 5D9PA 4JPGA 3L2IA 3W84A 5DCEA 3SR7A 2NUYA 3RMEA 1JZ3A 3KBWA 4HA3A 4GI6A 3A5FA 5DMLA 1SW3A 3G3DA 3OHMB 4UMBA 4J40A 4JYFA 3KXQA 1RUSA 1KRAC 4PUWA 2EPLX 3KHDA 3H7VA 5CGQA 1FXQA 3NXLA 1K9DA 2PD9A 4OUEA 5EKYA 2GOKA 3GW0A 4IMEA 1XIJA 4B5XA 1D3CA 2H8ZA 1SFTA 4DNMA 3LLDA 3QN3A 3A13A 2JBMA 3N04A 2R1KA 3FW6A 3UG3A 4IICA 2GUYA 1I75A 2ISSA 3A21A 3VD5A 3ABXA 1CGTA 1E6SM 3M0ZA 4XG1A 4PMQA 1D3HA 2WLZA 1RQEA 4U10A 4FNUA 3RR4A 1TR1A 4O4WA 3KBVA 3MT1A 3QEZA 1AQMA 2JKEA 2NT0A 4DBSA 4KMQA 1YNYA 4GKLA 2XIIA 1EHAA 4HGXA 4PN2A 4H7VA 1RD5A 4LGXA 1G7VA 1ZAHA 3HGJA 3N3TA 4NAFB 3QLDA 1E6QM 3DYMA 3ZVHA 3SCUA 2OSXA 3THQA 3LCFA 3SIMA 4AZCA 2OCZA 3SRDA 1P7TB 1ZJBA 2VX4A 3N14A 1V02E 1PL9A 4IPLA 4JQ4A 4NZ1A 1N55A 1HJWA 2W91A 2TRSA 5HQEA 3T42A 3BSHA 4DUOA 4PBFA 4DUXA 1NVMA 1QATA 3SCWA 2UWFA 3ITLA 4AD4A 3W7JA 3PJTA 3QYSA 4B3LA 4ZQRA 4XKYA 4JZ5A 2DW7A 2OR2A 1ZNNA 4YU1A 3EX2A 3UR5A 1XSJA 4AWTA 3F5JA 4GY0A 3UPBA 3GXMA 3GR4A 4G7EB 5FEWA 1U5HA 2H6RA 1WP6A 3W86A 5A8NA 2UZ9A 2A3BA 1P48A 2EXOA 1TV2A 1G69A 3BW4A 4Q8OA 3RO8A 2XU2A 2R1NA 4X0NA 1H60A 3AZRA 2V5LA 4GYJA 2VZUA 2QXWA 1KLYA 5KEZA 5GNYA 3UW6A 2Q09A 1F8MA 5K9XA 5AN7A 3B06A 3KRZA 5J8LA 2CITA 3T2PA 1OCNA 3I4KA 3ZJ6A 3GVGA 3W73A 1IT0A 3WQ4A 3V35A 4DAIA 4RNIA 1RR2A 3N2TA 4TOQA 3VOIA 2PDNA 3SJ3A 3D5HA 3Q94A 4ZENA 5JU6A 1W6TA 3MU7A 1M6JA 4K1WA 1KKRA 4H8HA 4UTFA 2XH2A 5I5RA 3C6CA 4Y9PA 2I5QA 4I5RA 1QPQA 2FTPA 3VOGA 5FF7A 3TX9A 2FTWA 4OE7A 5A6SA 4YNGA 1RXOB 1QASA 3ZVIA 3H12A 4HP5A 4JEQA 3WH5A 4KS0A 1JNEA 1ZZMA 4KESA 3GNPA 1U83A 1Q8JA 1OC5A 2HQAA 3MHFA 3K30A 1O4UA 2PDCA 1BWVA 5HUOA 3CQ0A 1FWFC 3HJZA 3B0UX 3WMSA 3HN3A 2PCEA 4C6NA 3W74A 2V69A 3WYZA 3SUUA 2WO5A 4NJHA 2UY5A 2DIKA 5GJNA 4Q4RA 4P7QA 2WZTA 2P10A 3H53A 3NM1A 3L5AA 1P6CA 5JIWA 1I2NA 2Y0FA 2PP1A 4RL3A 3VCRA 4HZ7A 3VILA 4A3UA 2P3ZA 3CV1A 4LV9A 3CASA 2AOSA 2ON3A 3N2XA 2HPIA 1L2QA 4AZBA 4BFAA 2IKHA 1FHDA 5HWJA 4WDWA 3BQ5A 1TMHA 2FFIA 2E9MA 1EFZA 1I8JA 1XCXA 3FFSA 4BWLC 3CUHA 4IG2B 4H9TA 3K4WA 4JL2A 3CZJA 5CZTA 4IL0A 1YNPA 3TV8A 1ZGDA 3WQOA 1R3WA 2I16A 3CLMA 4IFKB 1VPQA 2I9UA 3EWDA 5I3JA 3V0TA 4E4UA 4WSJA 2NQJA 1C29A 2CZFA 3LMZA 1MXDA 4QNWA 4KERA 2ALDA 4O0ZA 1LQAA 1B3OA 2DUXA 2VELA 3R11A 1DOSA 3IPWA 4RV3A 1XIEA 1DJQA 2O7SA 2GUBA 2PWFA 3AJ7A 4L4PA 4QEEA 3AYTA 5EPDA 2BV9A 4PB3A 4QGCA 4DIAA 3GVWA 4GZ7A 5HA7A 1DPMA 2VT0A 1DXIA 1EP3A 2WVVA 1BF2A 4AYGA 1ITCA 3I3EA 3GZAA 3IJ8A 3AI0A 1GK8A 3E0IA 4ZVJA 3KWXA 3AIRA 1M7PA 1BYBA 1V6WA 2ZZ4A 5F2LA 1J5TA 3MI6A 4OJYA 1R6WA 3RRAA 4M81A 3QPYA 1KXQA 1XKYA 4HYWA 4TIMA 3W7KA 3GIQA 4JXCA 3NL2A 2H9AB 1OGBA 3OYXA 1PZ0A 2WQPA 5AHFA 3WQFA 3W6YA 3DHFA 1EJSC 3G1FA 3I6EA 2YGYA 3VVGA 4MJ2A 1KBKA 1OF8A 3RCYA 3W2UA 3W1MA 3BJSA 3UZXA 2QDHA 4Y8EA 2XUCA 3UYCA 1IXQA 4B91A 1E43A 2CNCA 3VGEA 2AKMA 4KWUA 1TUXA 1V7YA 3P7YA 1RJQA 3AMDA 4MFDA 5K9CA 1E5NA 5C9XA 4KFNA 3AIEA 4WZHA 4DI9A 2ZUNA 4JTDA 5TIMA 3UR8A 2ZRYA 2E5BA 1F6KA 3BG9A 1G01A 1WZAA 3CL8A 3VUSA 3FAXA 3S46A 4N6FA 3C86A 3GYEA 2I17A 3CHEA 3EXRA 4BZYA 1KFKA 4PCNA 3PWIA 1X1NA 3BCJA 4L1XA 1XKJA 4GVIA 3UR2A 5HQMA 1JPKA 4C5ZA 2G0WA 3MSDA 3S1UA 2GJNA 1E0TA 2GLKA 3UJ2A 4IJCA 1QK2A 1VIZA 4AHQA 3VKKA 2V30A 3G1SA 5HMEA 4A8RA 3L0GA 4H2HA 4UUIA 2J8FA 4XAYA 5EU9A 3AS0A 3TA9A 3VDHA 2VC7A 5EFFA 4D8LA 3NOYA 1V02A 3HU7A 3ISIX 5C5YA 4M5PA 3MB9A 2QF8A 1U5VA 4P2VA 3IVSA 3P82A 4JQ2A 4FLSA 1EJWC 4DO5A 1GCYA 1EJXC 4KRTA 4Y96A 2DJLA 2O9RA 3R8HA 3TE9A 3WX7A 1L9WA 4ACYA 4LB3A 1WXYA 2YXOA 3VKCA 2YCEA 4F0KA 1QW9A 4LUSA 2YB1A 4UFLA 1M3UA 3OBAA 2Y7FA 1GOWA 2FVKA 1EDQA 3H7UA 3A6OA 2X1IA 3PJUA 4WXZA 1JUBA 1TPFA 4RNFA 4ZSUA 4PMNA 3HPFA 1E6ZA 3P81A 1X8CA 4GACA 3GAYA 9XIAA 4Z2HA 2XN1A 4FIQA 4HT3A 4JTRA 4QE4A 5HANA 1XX1A 1XLHA 1PSCA 3KE0A 2Y89A 1N82A 4ERAA 2B31A 1BD0A 3R0UA 3NQ6A 2ZX6A 4S3GA 1F6YA 3Q45A 1JVNA 1PIFA 5DMMA 4XVEA 4CEXC 3AHVA 5K4ZA 4NHVA 3O6YX 1OZMA 1JCNA 4IMAA 1OC7A 2ZZ3A 5FSEC 1J96A 2IXVA 2OLSA 4J3ZA 3CZGA 3LHYA 1C8YA 4DEFA 1X38A 1TE6A 1ZBCA 4B92A 1QVBA 3LRMA 2X1TA 4LNYA 2WZEA 3WF0A 2BVWA 1MMFA 2PE4A 1I2OA 4FEZA 2Z7KA 4DPQA 1W5PA 2ADAA 3WH9A 3ZR6A 4MDPA 2VCBA 4PMJA 4KF1A 1A0CA 1EHNA 4DO4A 3BO9A 3NEVA 1Z8AA 1HL2A 3C52A 2IKIA 4XKMA 2IKGA 3NNTA 4F40A 1S38A 4PFMA 3W7PA 3D6NA 3TSDA 5TBOA 1VC4A 4F0MA 1K02A 5M5DA 3H2AA 2JF7A 2QLYA 1CW2A 4R9OA 4LNCA 2G4JA 3CB3A 5HWMA 5HJYA 4DNHA 1GVYA 4XV0A 2HNHA 4JQAA 3SRKA 1LJYA 2PTWA 2Q8XA 1XDJA 5EFDA 5A8OA 3JRKA 4O50A 1C8VA 5JBEA 3TOYA 3S2CA 3N6QA 2QPUA 4FOJA 1ZTVA 3OLDA 1LP6A 4FNPA 4J3XA 1OGSA 1NP2A 2OQHA 5FKYA 1MNZA 1EF2A 1P0NA 4N7QA 4PSPA 4B2DD 3E0VA 4TO8A 3CBWA 3TTYA 4MVAA 4MY8A 4LS2A 3DI0A 2ZRWA 1PPIA 2EPHA 4D6IA 1UMYA 2YJQA 1TRIA 1V0KA 3RITA 3U3HA 4DWSB 3D47A 4MHBA 2JK2A 3OJGA 3TVAA 5C71A 1X8FA 4XBSA 4MUZA 1UR4A 3GZ3A 3CGTA 5FJJA 3AXMA 3PZUA 3V5FA 1BVZA 4FXSA 1EP1A 1GZJA 1POKA 2PD5A 4NJIA 3OVRA 3GTXA 3WLIA 2TODA 3SUWA 4R53A 2QV4A 1VFOA 2PDKA 1J9YA 3REQB 1HKMA 3ZS4A 1KWKA 5I0DA 1ME7A 3A4AA 5G4WA 4CNNA 5AHEA 3M0KA 4AG0A 1DQUA 2XN2A 3I6TA 4OV9A 4ZGYA 2G50A 3EWZA 3LBOA 2YL9A 1P6BA 2NX3A 1KGUA 1BQGA 1DQWA 4S23A 4YJ5A 3WBWA 4G1NA 1MO0A 4RNHA 5D9NA 3EOLA 3NVDA 1E4NA 1G0CA 4EE9A 4QROA 2XSAA 3BLDA 1OADA 1XFBA 4I7WA 5CSRA 1WCGA 4I8YA 3RYSA 3NQ8A 3PHAA 3RJXA 1UWSA 2C79A 4U4MA 2G3FA 3EDKA 1TO3A 5J5DA 1LWIA 3C0QA 4JTLA 4CCCA 2XM1A 3IUDA 2V63A 4B5VA 3VE7A 3I7QA 1IYXA 3GNRA 3MBDA 1DKWA 3NXFA 1O6IA 3C2YA 2PDXA 1QNRA 2C1GA 2VR2A 1UA3A 1AMKA 4NQ1A 4FB7A 1O5QA 4UCFA 5H8MA 1C8XA 1VJSA 5M03A 1ISZA 1SZRA 3WO8A 1VLWA 5C54A 1TIWA 3KM8A 2BX7A 1NELA 3ID7A 3BARA 1LL6A 1O5XA 3DERA 3GBDA 1F3TA 3EOEA 4BF5A 5IDIA 1A3WA 2X09A 1BSIA 3RRXA 4GQGA 4A05A 4EPKA 3TLQA 5KITA 3KP1A 4GYPC 1JUEA 3QMTA 3M0VA 1RPXA 3Q4DA 1VFHA 1SQ7A 1SR9A 2BHZA 4ML9A 4M1BA 1GYLA 5FJUA 6PTDA 1XYAA 2VX6A 5U4NA 1ISXA 4TMCA 1OM0A 1D3GA 1M04A 2CZVA 1GOKA 4MDOA 5TF0A 4DWDA 2DVTA 3FV9A 3VCNA 2HPMA 3W81A 2REQA 3EB4A 3HM7A 4XAZA 3LENA 3VD9A 1NJJA 1XBZA 5MKGB 1KM5A 2IW0A 1PXGA 1V3LA 4AZGA 2ZXQA 2J9ZA 3UF9A 1BYAA 1DIKA 1G4PA 1TELA 2NVAA 1I1WA 4W87A 3WLNA 4DWSC 3TN6A 1W56A 2D69A 3A3XA 1EZWA 5LIYX 4RZ4A 4PCTA 4RDZA 2CBVA 3WDJA 4UTKA 2NV9A 4H8NA 4FK9A 1OFBA 1TV4A 4ZOBA 2B7QA 3ME3A 2AMGA 4OIFA 2GJLA 2RHGA 5I3KA 3V16A 1EYWA 2ZXDA 1WKEA 1YBQB 2QEZA 3WQPA 3EB3A 2J6XA 5FCZA 2J7DA 2EQDA 4QDPA 1U22A 1GTEA 5HMDA 5XINA 3ANUA 3HMJG 2O9TA 1Z7AA 2GL5A 1K6WA 3O6AA 3VPLA 1KB3A 3W85A 1AD1A 4HK5A 3LNPA 1C9WA 5KZEA 3GVVA 3VTRA 4JIHA 1ENUA 2WBGA 4PFHA 1JNDA 1E9YB 3GDMA 3FJNA 4I6VA 1VP5A 1I2QA 3CB8A 3VIIA 3MMUA 2EKGA 1VB9A 4QM1A 5LNWA 4V27A 3NQFA 3T2OA 3B04A 4XWUA 4JFSA 4KH2A 1T40A 2V2HA 3WSUA 2ISFA 1VRDA 4GUIA 1TKKA 4PCPA 3WNLA 3GXDA 3UXLA 1L2UA 5A94A 1BEUA 3MC5A 2J79A 1W2PA 5E6ZA 4ACZA 2J13A 4C90A 3SCVA 3NGFA 5I6SA 4E2OA 3RIKA 1KFCA 3SFKA 1TRDA 3HQNA 1IE7C 1WDPA 3W7LA 2DORA 4U2YA 2XGIA 1RP8A 5FEXA 4UZUA 1FBAA 5CG0A 5FL0A 1LL4A 3NZRA 2VFEA 1ZALA 1F73A 3VNKA 3UXDA 1I45A 3W1XA 4G2DA 3ARVA 4LSBA 2X2GA 4ASTA 1R7AA 3GHUA 1NFGA 4FNRA 3G6LA 4NY2A 3GC4A 1YX1A 2GVJA 3HPXA 1K8YA 3WLSA 3V0SA 1VBJA 3OP2A 2YL8A 1WZMA 3RGTA 1ZBVA 5EBUA 1I0DA 1R3YA 3QSTA 2VYOA 4UQ9A 4KIRA 4LF1A 3B8DA 2GWNA 2WMGA 1VHCA 3TZNA 3OA3A 1IXOA 3VM7A 1YXCA 3A22A 5FJIA 3S5ZA 1HT6A 1VEPA 4WD0A 3O3RA 3PG9A 5IHSA 1XWYA 5A5WA 3CK5A 1DIDA 1UH4A 4MWAD 4EK7A 1JPIA 1XLDA 5ABGA 1IIHA 1W91A 2ZXAA 4AVFA 2PDJA 2PLMA 3VIOA 3N19B 4WSHA 2E40A 3KL5A 2WWCA 4FLRA 3ANYA 1JG9A 3PPFA 3G8RA 4G8TA 3LZ5A 3KWSA 1X39A 5A6BA 4LWWA 2C15A 1V3MA 3Q67A 3WD4A 2CKSA 2QUVA 4JHZA 2DGAA 1V7AA 2GVEA 3QY6A 4C6DA 4N6EA 4M0XA 4UQCA 4WR3A 3VMOA 4HPXA 3UGVA 1VHNA 3WFAA 5I03A 1UCWA 3SN4A 3DESA 2VQTA 5CZSA 3KOZA 1YIXA 2IQTA 1R2TA 2AQVA 3OLIA 4I9JA 3WLPA 2ZZ1A 3CLWA 1U2YA 3NL5A 4NZ3A 3URBA 1WA3A 2VX7A 4Q4KA 3UXIA 1TPEA 5KTLA 4MKSA 3APYA 2JGQA 2GK1B 2VOMA 1XM3A 5AHNA 1KCZA 4AZ5A 4ECLA 1DJXA 2DZWA 1IGSA 2BVTA 1KQYA 1KLZA 3B8WA 3UCQA 4MB3A 2GGHA 2TAAA 4UTJA 1K7XA 5J5RA 3ECQA 1VZWA 3AC0A 2FPYA 2JEQA 4A6GA 1ICPA 1AQFA 4ERIA 3GDKA 4ENLA 3FXGA 2IXUA 5BMXA 3SIZA 5D33A 3F4VA 3PUEA 4UZSA 4C6BA 2YCLB 2FH8A 1X7IA 4JTCA 1MW2A 1SJCA 4XISA 3QTPA 3Q58A 1I4NA 2KX9A 4HHHA 4DLMA 3BLIA 1T5AA 1ZENA 2F2HA 4GCAA 3MYOA 3GU2A 4IIGA 2WK2A 4UQBA 4ZTYA 5C55A 3SN1A 2RDXA 3BCDA 2WAGA 1MSSA 1GHRA 1EA9C 4O8AA 4ATWA 3A3HA 4O16A 3FJ6A 5C7VA 2XISA 5EMKA 3PB0A 4YWIA 3W1LA 2X16A 4DAFA 1PYFA 3F4NA 4GXMA 4H2CA 4Z2GA 4L1WA 3NZGA 2VZTA 2D3LA 4G7FA 4IFRA 2CHOA 3QKEA 4PULA 1SVDA 2VZVA 2QCEA 3TR2A 4LBUA 4DPPA 1XJBA 1UWAA 2HDJA 4LS0A 1HL8A 1YE6A 1UD6A 1A4LA 3HQOA 3QW4B 2BY0A 3GXPA 4EXBA 1UUQA 1CCWB 2Z6JA 2HV5A 3TYZA 2O9OA 4XSLA 3W82A 3LPOA 3G0SA 1ZP3A 3TW9A 1S2VA 4IJBA 1O5RA 2QCLA 3TWBA 2NLIA 2I5IA 2INFA 2JIWA 1PBGA 3RPDA 3KZPA 3VDGA 3G1DA 5D2WA 2GDUA 2IPGA 6TIMA 5FACA 1QR7A 3N2OA 2QUMA 3WIJA 1J0YA 4H8VA 1UOZA 1PKNA 1QBBA 5U7SA 1TZ7A 5AYXA 4GH3A 1H7XA 1PO9A 4K8HA 3U4AA 5GJMA 3BMXA 3WLJA 1XLIA 3DBNA 1B54A 3P6LA 2VX5A 3C3UA 1A0EA 2ZCGA 1IV8A 2V68A 3K4DA 4WJXA 2BHYA 1H09A 3GC2A 1EXPA 3OEXA 3N6JA 5DF0A 3QLLA 5G1MA 3W71A 1ZJIA 4TX9A 3NFUA 2Y5JA 3TYCA 4IL2A 3LV6A 4AZCB 1ONWA 4AHPA 1L8PA 4Q8VA 1YYAA 4ZOAA 1WPCA 4O12A 1JYNA 2YL5A 1TPDA 2GSHA 4P8VA 4Q4SA 4DELA 3PG8A 5CJMA 3WBYA 3P93A 4AMCA 4NZFA 1TYGA 1WZKA 1XIMA 1C91A 1OYBA 4IWWA 4JR5A 1Q4NX 5H8PA 3PM6A 2R1PA 4GQRA 1PKMA 3CT7A 3BGAA 4ZO9A 2VGBA 3AAMA 1ZQ5A 2A21A 3E2SA 4GNVA 3WBAA 3VA8A 4YTRA 4ADSA 5K9DA 1WDDA 3SJNA 4EF9A 2YR1A 3R5EA 4QHRA 4RE0A 2ZRXA 4UIOA 2NUXA 1OX4B 3G1YA 4WKHA 2BXZA 3VZYA 4X2PA 4PEEA 3AMCA 1XICA 3RX4A 2J7HA 1CXFA 2V9DA 2Z2UA 3WJXA 1OF6A 4S2BA 1CXIA 3RX3A 4WF7A 4IMCA 4LVGA 1K3UA 3KVKA 6REQA 3DGBA 4XZHA 3UZJA 5I7GA 5JUVA 1PTAA 3DCPA 3PTMA 3VNDA 2Z1WA 1JZ2A 1XLAA 4H7CA 1F9CA 3NVTA 5CPMA 3SCPA 4AD5A 2WKLA 4O0QA 2G3IA 4IGHA 1VFFA 4MKVA 3BLOA 1OG6A 2JFEX 3GFXA 1KM6A 1M41A 3KL3A 4GQ0A 2VZSA 3USBA 1KCXA 1PHQA 3I4EA 3B8TA 2XIBA 4F2BA 2DU2A 4JTAA 3DKLA 1KTCA 4NUWA 3GFZA 2QJNA 4F4RA 2CIPA 2FZ8A 1Z42A 3SUSA 1DWAM 4JHOA 2B0MA 5IHRA 3VC6A 3NPVA 4INFA 4Q7BA 4MM1A 1HJSA 4W88A 1DTNA 5AZ1A 4YN5A 1JCXA 4JKKA 4C1LA 1L6YA 1NDYA 2E9BA 3TP4A 4C5YA 3A5VA 3CWNA 1KFBA 3PZTA 4TQTA 3TKFA 4HPNA 1XS2A 2F6KA 3QGVA 4QISA 3KW3A 3VKBA 1SW7A 3VNLA 4D2JA 4HNLA 4O1EA 4OUIA 4WDXA 1JZ8A 2Q8ZA 4GZIA 1UUOA 2R94A 3W7OA 2IQ0A 3POCA 3TN3A 3AUOA 4UFHA 1O1ZA 4UNKA 1YMYA 2DZXA 2GUUA 5HMFA 1RHCA 2YA1A 3WJZA 2OVLA 2D73A 3FN9A 4KBXA 4YHEA 2E6YA 2YCJA 4BF7A 4D6HA 3IJ7A 3I10A 2WVTA 1EWEA 4MIMA 1TJPA 4FXJA 1TX2A 4B2DA 1OFAA 1U5JA 1JQVA 1V79A 1V6UA 1FWAC 2ZXBA 3KTSA 5CLWA 1ML1A 4W85A 1BGGA 2OZ3A 1OD0A 5G5IA 1R9ZA 4FAMA 1VFSA 1W1YA 3MDUA 1K9TA 3ZT5A 5HPCA 4CNUA 2WSQA 3OOQA 1OSEA 4G5DA 1Y7VA 3SRFA 2YDSA 5I3GA 4H83A 3LTSA 4FP1A 7ENLA 3AJXA 5I00A 2WVVB 4IXHA 2BGSA 3CMFA 3B9EA 4LAKA 3B9NA 2VFHA 3TJIA 4AHOA 4E4FA 3DXIA 4DRSA 3B05A 4MWAE 3OYZA 4H7ZA 5FA5A 4ZEPA 2HROA 1W9BM 4IHCA 4ZXLA 2CWXA 4ALDA 4AD0A 3G5EA 2PDLA 3ICJA 2YYTA 1YDOA 3CUIA 2DSKA 3T1GA 1UBPC 4A2RA 3WD3A 4BWLA 4HK7A 3LHTA 3NQCA 3SI9A 1DQXA 4KWSA 4NAFA 2J7BA 2HBVA 1E40A 2W62A 2PLJA 4UR7A 2VTFA 1G4SA 1TV7A 2NQ9A 1V4YA 4F66A 4IIDA 5BRPA 1P7TA 4E3TA 4YVVA 1Q7ZA 1W1ZA 2C0HA 3SADA 1ME8A 3K13A 1ISYA 5AHLA 5JBDA 4HSOA 1VCFA 1M9HA 4NILA 1TV3A 3GKFA 3F5KA 3EPNA 1R46A 3I6RA 4GH1A 4DYJA 4C6IA 1ONEA 4C7FA 4PE8A 3SN0A 4H6EA 1F76A 4JYDA 3QR1A 4HHMA 3TTSA 4WJ8A 3LZ3A 3UY7A 3U57A 5FJPA 1F6PA 1WOBA 3M46A 1AA1B 3M5ZA 1LM1A 1FHVA 4I8DA 5D05A 2NVCA 1OY0A 2HRWA 4NVTA 3ATYA 2OO0A 2CLHA 1MW3A 4HMDA 1NWUA 1S2WA 2PCQA 4Q4QA 4NX0A 1O60A 4LAOA 1OEPA 1S46A 3NG3A 2WANA 1C7TA 5C70A 3LHUA 4OT7A 4NAEA 3D46A 1ZUAX 3I3BA 4HZ8A 1F4HA 3NO1A 3DN5A 3CHCA 2Y85A 4HPJA 4JFWA 3TC7A 2OPJA 4WK9A 1V08A 1LYXA 1XGZA 4FNTA 2J47A 4AYSA 1JEZA 2PTZA 2OB3A 5C2GA 3DU0A 3M16A 4LU0A 1RA5A 1XDMA 4X3ZA 1J0JA 4O1FA 3F03K 2W79A 3CZ8A 4S3DA 1V6TA 1US2A 1W1VA 2J7GA 1X1ZA 4LUSB 1U1UA 3PTQA 1QPRA 4X9SA 1H7OA 4PRWA 5B7ZA 1SSGA 1WAUA 5GNXA 1QWKA 2OSYA 4CLMA 4QLJA 4NXKA 3T9PA 2DUAA 5E0CA 4FALA 3NZPA 4IPPA 1XD1A 3ZIZA 1B3WA 3AROA 1EO5A 3N3MA 3PB2A 5L6UA 3HOJA 1TTIA 1K77A 4WGHA 3QZ6A 1E1CA 4BY3A 4CD7A 2HTMA 2P3EA 4K2SA 1ADSA 3LHVA 3H54A 1WUFA 4FO4A 3WD0A 3U4FA 4QG6A 4S39A 3DZ1A 1GKPA 2JF6A 3EOOA 1E72M 1H5VA 4XSMA 1U1JA 4GXWA 4CNOA 5DN1A 4DZ5A 4PTMA 4JN6A 3PY2A 2DIJA 2A3EA 2I57A 4QAWA 4IX2A 1HQTA 1JZ4A 1M7OA 4JY9A 1FKXA 2ZOXA 2ABAA 2QQ6A 1XBXA 1OK4A 4L6OA 2ZUWA 3LEPA 1X6NA 1CLKA 1VBHA 1QAPA 1KV8A 3QZEA 4MYXA 4TVUA 2WZMA 1SFLA 3NTYA 3GNDA 4Z1YA 1QO5A 3AHYA 2DZSA 1NTHA 1E9ZB 4H1ZA 3AHXA 3TYUA 4FX6M 1VLIA 1NP0A 1VR6A 3AZSA 5LGXA 3W6LA 1O68A 1XIHA 2OGYA 2TSYA 2EEXA 5A6KA 1HKJA 1K03A 2FZNA 2ZUVA 2V2CA 4H9UA 1DXFA 4TX8A 2OQYA 1FWEC 3IVUA 3WUFA 3IRDA 1OIFA 1HZYA 3A23A 2P8CA 2PRHA 2WNZA 3S6OA 5C9RA 3B8SA 3O15A 1Z89A 1O95A 2HS8A 3W27A 1ZRQA 3RXZA 3W7IA 2O4QA 2QJIA 4AUBA 1ITXA 3MV01 5DEZA 3DG6A 2D3NA 1WX0A 4LVDA 2DQXA 2YSWA 1FWDC 1JUKA 3IV3A 1IEXA 1LRTA 5AYZA 1CT5A 3EEGA 2WJEA 3SDOA 5DLCA 2O9PA 4B16A 1FY6A 2X30A 4LPCA 1EEPA 4BI6A 2G8ZA 1DTUA 2OKOA 1KXVA 3W29A 3IJQA 2PDFA 3TMQA 1M68A 4E8CA 1PZ3A 3TXZA 3T40A 1PB0A 4FLQA 4KPLA 4UTLA 1NWRA 3DFTA 2ZX9A 1UZ1A 2BVDA 1OT1A 4J2MA 1V6VA 3DHUA 2J8GA 2E28A 1OB0A 1UP2A 4O15A 4PTNA 1K4GA 3L4XA 2GJXA 2OO6A 2P76A 4IMDA 3BGJA 3NQEA 1ME9A 2XJ7A 1OFEA 1IF2A 2OEKA 1HVXA 1W3HA 1IR2A 3V4BA 3HFTA 2XZ9A 3EOUA 5C9ZA 3T55A 3VK5A 3GX9A 3II1A 3FEQA 2PRLA 3GTIA 1LOLA 2PDWA 3B8IA 4WY0A 5I3FA 2VRJA 4TVDA 3VIFA 1HKWA 3GO2A 6XIMA 4RPQA 1CXKA 4WOQA 4YTUA 5FF4A 3BZGA 3WQWA 4WUIA 3PBUA 3CL6A 4CCZA 4F0LA 3FJLA 3QKZA 1QNSA 1UJPA 1N8WA 2YZ5A 1F3EA 3ES7A 3GYCA 3WLHA 1J5SA 2DEPA 3UD6A 5KINA 3IVTA 4GY7A 3AALA 1KQZA 2FZ9A 3WLKX 3ZYZA 5FJRA 4M6QA 2FVLA 1ZBKA 1YADA 3N1AA 5D37A 2UBPC 2YA0A 3T09A 1WV2A 2RUSA 5LNVA 3WENA 1ZCCA 2NT1A 4MADA 1Z44A 2FJUB 5HR7A 4ZOEA 2GSJA 3P3BA 3B9DA 4YMZA 2ZUMA 1E4LA 1V77A 3HV9A 2W6RA 4CNPA 5M2FX 3VFCA 4L9XA 1QW8A 4S3BA 3TOPA 3LTPA 4HYRA 2CLKA 4AWEA 2VEIA 4GNKB 2FHCA 2EG7A 4AXKA 3MKCA 1EXBA 3ZLHA 1RY8A 3RMJA 3USZA 1UKQA 2YCKX 4DBUA 5C6MA 4AIEA 3NOEA 3VE9A 4W89A 4HCDA 4HNCA 4PTWA 3F2DA 4KKXA 3CHDA 4GISA 2A2IA 4NXSA 2EO7A 3L4YA 3LS9A 3TU9A 2REQB 5AHIA 2A6NA 1XLCA 4AEOA 4TU1A 1GTHA 5CG7A 3CT2A 5CC5A 2R1LA 1EQPA 4HU4A 4MNKA 8CGTA 3C0LA 2V8ZA 3ITTA 3UWEA 4V15A 3IJIA 3MHGA 4A35A 3AS3A 2JKPA 1LG1A 2VKZG 1TPH1 3BZJA 2WHLA 1EA0A 3S6TA 5BWAA 3QW3A 4UTHA 2X1SA 3EYPA 1GVOA 1JXJA 1ISVA 1W2VA 1E73M 3MV11 1H63A 1T0OA 2B7NA 4L6HA 1GW9A 4PUNA 4AX6A 1EUNA 3WKZA 3GWQA 1PUDA 3ARTA 4XVDA 1WYIA 1EJRC 2Q3RA 1V3IA 2QAPA 3QHMA 3M4HA 4Z0SA 4S3FA 4AIOA 3AOFA 4GLEA 2P88A 4UNLA 1XRVA 2UY2A 1MZRA 1E0UA 4GYPA 2DSVA 3DFQA 2I14A 3GNNA 2ZA3A 4WKAA 5H8UA 5HK4A 4V1XA 3VIMA 3DG3A 3OB8A 2RJGA 2OX4A 1IEQA 1YTEA 5M1TA 5AYYA 3GTFA 4UTMA 3QV7A 3KS6A 2O56A 1SSDA 4AF0A 3WCZA 3CZLA 4W7VA 1DHKA 5A1AA 3BAXA 3OO2A 1EBGA 3T07A 3U2CA 3W1AA 5LA0A 1E0VA 3B8VA 4DWSA 3N9SA 3IGHX 1CENA 3OGRA 1W1PA 2A4AA 4RJEA 3AMLA 4JICA 4DF0A 1RVGA 5EY5A 1I2PA 2PTXA 3IIVA 4PTXA 3E12A 3INPA 1UP3A 2ICSA 4QSHA 3REQA 4EACA 1MXGA 2XH7A 1KKOA 5EGRA 1MUWA 2KZHA 3LHWA 1TX0A 4GVFA 2XTKA 2W92A 3C0JA 1FOBA 2HNEA 1FTXA 4HB7A 3BLLA 3HBLA 3HA1A 2VCCA 1W9XA 2C71A 3C2RA 3E0FA 3U0HA 1FWGC 3AU2A 5FD0A 4K6AA 3EZ4A 2OLHA 3WQEA 1K7EA 1RBLA 4KWVA 2QUTA 3IIXA 3P60A 2W5FA 5KETA 3KP0A 8TIMA 4UBPC 2PA6A 2QJMA 5KZ6A 3AS1A 4ZCWA 3SEPA 4YWSA 3BLKA 1XLMA 3COTA 3G24A 4ZR8A 1FWJC 1YPIA 4O17A 4I6KA 1BHGA 3ERPA 2UY4A 5T91A 1GZGA 4TMBA 3QQ1A 3W24A 1DBTA 2J7FA 4IX0A 3WLRA 5FI8A 2WSYA 4ZB5A 1KCLA 1VFTA 2ZUUA 3TIMA 4TTUA 3P14A 3W23A 1H4PA 5T9BG 3CPGA 2PWEA 1WXZA 2CLOA 2CWNA 3GS6A 2VVNA 4QDMA 1F8IA 3O0KA 4NJKA 1FH9A 1X98A 1WQ5A 2AGTA 3IRSA 2E1DA 4YIWA 5JVLA 3APGA 1NOWA 1TV8A 4ZSTA 3A9BA 5A2CA 1RALA 1BTCA 5CPLA 2C3ZA 1CZ1A 2PBOA 3DFNA 2INZA 5CPNA 1Q66A 3V1HA 1JCLA 5CSUA 1OD8A 4OVXA 2Q01A 2WLYA 3KCJA 2OWCA 1AJ2A 2X0SA 4Y7EA 4HNVA 4PMVA 2ZTKA 4B4FA 1ZL1A 3QOMA 4M7SA 2WHMA 3UWUA 3A4XA 2XZ7A 3E3HA 4IIEA 2DSZA 3BGGA 3WEZA 4Z2JA 1YLVA 3ARWA 1KW1A 3WZ0E 4B90A 4M8UA 2E67A 3UYIA 3BDKA 1EOMA 2GVLA 1VQTA 5I06A 4FS9A 4O52A 1MNSA 2OGJA 3K8MA 1SMAA 3RPMA 2FGLA 3IUHA 3CV7A 3C2FA 5BCAA 4GG9A 3G1VA 3T8LA 5HNTA 4KCTA 4UTUA 7TAAA 3WNMA 5MKGA 5C0QA 4XZBA 1MRAA 2WC7A 2BASA 3W26A 3MUY1 1TFVA 4GO9A 2GDQA 2E6FA 1LWJA 4RE4A 2XVPA 5CC6A 2J78A 2ACUA 4OFCA 1XI3A 3QPEA 4LVFA 5A6TC 4CU7A 4JS3A 1FWNA 4HPGA 2QAFA 1US3A 1UHVA 3FGCA 3JZUA 4JTUA 3I7SA 3APTA 3IJ6A 1HUVA 3RUBL 4QFUA 2Q8LA 1XRTA 1XLFA 4W8AA 3QSRA 3T4CA 3DAQA 3H2CA 1H41A 4PC8A 3LGGA 1W9PA 1IT7A 4GIEA 3QJAA 3VIHA 1J0ZA 2A6LA 2VUNA 3PFMA 4IIBA 3JVAA 3OIHA 3MMTA 3OU8A 1G67A 3PBVA 3VOCA 3R4IA 4C6PA 2VD9A 4QG9A 3L4ZA 1A5SA 4XZNX 3M5VA 3AISA 4HN8A 4LF2A 4O28A 3ALFA 2D2HA 1ZPTA 5DRIA 5CPQA 2W67A 1F3XA 3JR2A 4JTTA 1CXLA 5K4XA 1ZLPA 1W5QA 2V0TA 2C6QA 2CZDA 3IJ9A 1QUMA 3HZ3A 3N9RA 1ZAJA 3W1RA 3PR2A 2YA2A 4FR1A 4C7GA 2XPKA 1B4KA 3DUGA 4GK8A 1A5AA 2ACQA 1Y5XA 3W1NA 3PZNA 1CECA 3GXIA 3QV8A 4R7JA 2B7OA 3BOFA 3UVIA 5DBTA 1YE4A 3NPWA 3WEOA 3W25A 4HYVA 2WNWA 1AD4A 1HFBA 4G56A 1GYNA 3T44A 2C19A 1QPNA 1PYMA 2W27A 5HPOA 2ZKMX 1D7KA 2D20A 3MPGA 4KIEA 2PTYA 2FPTA 3NPXA 2PF0A 5CC3A 2VEFA 4ZBCA 3SGUA 4DN1A 1UR9A 3I65A 4W93A 4C6KA 1Z48A 3GRIA 2D1ZA 1JDAA 3M5YA 1A53A 2YW4A 3CIWA 3UT0A 5F2MA 2X0HA 1IWAA 5HUPA 3AMKA 1BYDA 1WOAA 4C65A 1S5TA 1W9UA 3PZMA 1BGAA 2POTA 3AQUA 3N9KA 2E1WA 4E2BA 2DQWA 1E4MM 1GUVA 3DFYA 3VNZA 3WFZA 3EPOA 3LCWA 2VO5A 2WBKA 3VKAA 3DIPA 1GVIA 1XG3A 2GFTA 3WD2A 1B5TA 1T7LA 4X61A 4GKTA 2X8RA 3Q2DA 5A8MA 3I68A 2O7QA 4J1OA 2F38A 4J5NA 3WUGA 3ABSA 1UROA 1W5NA 4ROPA 2EJAA 4GXPA 2PFHA 4YYCA 2RJHA 3SZ8A 4YTTA 1VENA 3PBMA 2F84A 1GONA 1EH9A 3EMQA 4DM2A 4E8DA 4L80A 5H1WA 1E9IA 4Z2IA 4UTWC 1UBSA 1VS1A 4ATDA 4GJIA 1G94A 3V36A 2V2DA 1EGZA 2Z2AA 4REQB 1M5WA 1TVNA 1R3VA 2DZAA 3FA4A 1KXHA 3LPFA 1VCVA 1FP8A 1FWHC 5E70A 4CNTA 3URAA 1G6CA 2OWXA 3WUEA 1VH7A 4Z42C 4EOUA 4Q6JA 2TYSA 4PH6A 1IGWA 5CBIA 1GKRA 3HFYA 1OCBA 1AW1A 4WDTA 3STGA 5AC5A 4CQBA 1CBGA 2OG9A 3BC9A 1Z9AA 3OBKA 3MHUA 4FSAA 4IGNA 4DXKA 2OKTA 2RDTA 3LGEA 3ATZA 3SCRA 3H8AA 4N9CA 3BG3A 4U28A 3IGUA 3KL0A 4GQBA 3P80A 4US6A 2YCLA 4A8LA 1V3KA 2B4GA 4DHGA 5F1UA 1PIIA 3UFYA 1YDNA 4MPKA 3JUGA 3ARSA 3PUDA 3NIYA 2CERA 2XGZA 1P1MA 4WX2A 4KCVA 3CL7A 2WJZA 5G1YA 3GDTA 5K3VA 1Q5MA 1VBUA 4K38A 3HGOA 3H26A 3P8JA 4H9VA 3O7UA 3GG0A 3XINA 3ANVA 1HO4A 3ZMRA 2Y24A 2WKJA 4JN7A 1QOQA 2EHHA 4QSFA 3ARPA 3TUUA 3NGJA 4E2DA 2E25A 4FF5A 4M29A 3WH8A 4PMYA 3M0IA 1RCXB 3NR0A 4LYQA 4MZYA 3K4AA 4GVHA 4X9YA 5TAOA 1DE6A 1JZ5A 4RZ6A 4P61A 2WPBA 3WFLA 2NQHA 3CTTA 3LN3A 1QBAA 3H2FA 1E6XM 2Z1SA 2BS9A 3L7RA 5DCBA 4MNJA 3GLCA 5E09A 1KBJA 4HBKA 3OLEA 2FYMA 1IEIA 2VD8A 3CYJA 4D9PA 4KETA 4ZODA 4RW3A 4P8WA 2QF7A 5CH9A 1VBRA 1TJ2A 2YIHA 3SW6A 5LGZA 2WMKA 1ZU8A 1XHGA 4JFVA 2POZA 1R2SA 4QDWA 4M19A 5CJNA 4EVZA 4HQVA 4V2XA 5JIPA 2DZTA 4Z17A 3TMLA 2V38A 1S2TA 3HTWA 5DRCA 3L4WA 4KQNA 3MCMA 1J10A 2PC8A 1AK5A 2J7EA 2PGEA 3W2MA 3BSMA 3CXOA 4UQAA 4CGTA 2QPSA 4L4MA 2X42A 3NQDA 1VYPX 4DO6A 1Y5WA 3W2JA 3RU8X 4GRSA 3HF3A 3CNYA 5CZJA 1OABA 4QCFA 4AISA 4GBUA 4PMXA 2P53A 3BLEA 3TFXA 1P43A 3IIZA 4Z2LA 5DMNA 4LOCA 1PX3A 1LTDA 4NP7A 3VIGA 5FIPA 1CGWA 3C3NA 2CZ5A 1DWFM 2IQDA 1L8NA 4JIRA 1MWOA 3DH7A 2J8TA 2Y8VA 3NZQA 3S42A 3T0BA 1BRLA 4AMAA 5HXMA 2HEJA 1HN1A 1AW5A 5BWFA 3LV5A 3LM7A 1ODUA 5G2IA 3QY8A 3MP5A 2DT3A 2BLEA 3LBCA 1YDYA 8XIAA 4CCDA 3EA3A 3VKJA 1G7UA 5M3WA 4LBRA 4E8GA 1FDZA 1FWSA 1IWBA 5BYWA 1CNVA 4AWUA 4GGHA 3LM3A 4MG4A 3B0VC 1Y0EA 4O14A 1JD7A 4OTKA 3PANA 3PZVA 1QRQA 3SSJA 3KS5A 3S5YA 4A3YA 4FA3A 1GQLA 3W2KA 1R3TA 1OX4A 3RG6A 2O4MA 1G1YA 4A3QA 1BSLA 2ZIDA 3NJ3A 1XR2A 3NA8A 1GKQA 3MZNA 3N6HA 4NAEB 2GPTA 2QCDB 5F4SA 3M5XA 3VYLA 3FHAA 2CLLA 3VKDA 4LJ3A 3ABRA 3BTNA 3AIUA 1X7FA 1XDLA 1THFD 3GVRA 3RLVA 3ITCA 1YXDA 5REQA 4OU1A 3BW2A 4TV5A 1WKFA 4GC4A 4JX4A 4DZIA 1Q6CA 4L9ZA 3WLTA 3G77A 1XLBA 2WQDA 2FLIA 4XD5A 2BSLA 2E77A 4ZO8A 2Z25A 5J04A 3LI1A 4MPQA 4Q7IA 1R8LA 4YTSA 5A6JA 3NQ7A 3S1WA 1BG4A 1C93A 1AQHA 2R9RA 3IV8A 3M0YA 3C2VA 1UASA 3S6DA 4H9MA 1OWQA 2Y88A 1T96A 2QCNA 1AJ0A 1E1CB 3MSYA 4IPNB 2OEMA 4O11A 2FGZA 1A47A 4K8GA 3ITVA 5DQPA 2E9LA 1QNQA 1FQ0A 5AHMA 4DLFA 1BWKA 3MZ2A 2F2KA 1FFRA 4Y8FA 1TSIA 2V6AA 1KBIA 2G96A 4HNTA 2YOCA 2JQXA 1DV7A 3G22A 1MYRA 1HL9A 4B9ZA 2A7RA 1J18A 4JN8A 3N4AA 3IACA 1KGWA 5CSYA 4MGGA 4GFSA 2OXNA 4GC3A 3H22A 3HPAA 3K1GA 1LOSA 3NYZA 2WZIA 3TCEA 1BTMA 5H91A 3SCTA 4GUHA 4FLOA 4WIWA 5AVHA 2A1YA 1FDJA 1HW6A 3IUIA 1E6PA 3MCOA 2W9MA 4J3TA 4RPPA 4HU0A 3GIYA 1A4MA 2QNEA 3AHTA 2IPFA 4MY9A 4X63A 3FHQA 5E9AA 2NWRA 4B5WA 1ZFJA 4QITA 1UH3A 4MLRA 2FB3A 5E5CA 1NM9A 3LGDA 2YBUA 1B3ZA 1H1NA 1R0MA 2X1UA 4I9TA 5GQBA 1B30A 1UR8A 2OZ0A 1D2KA 3KOWA 1GOIA 4OGZA 1KTNA 2WVSA 2PODA 1LLOA 2VMFA 1DJGA 2VCAA 4DVOA 3P0WA 1GQKA 1N8FA 1OJXA 2WNQA 3D0CA 2Q6ZA 1HJXA 2ZX8A 3TAKA 2IPJA 3CU2A 2VQUA 3WMBA 4JOMA 4F79A 3NQ2A 5GJPA 2F6UA 3M0MA 1MDRA 1JJKA 4NU7A 4US5A 1KM1A 5L9FA 3AHZA 1S2CA 1MI3A 1IHIA 1K70A 3MTWA 3VOHA 3BOXA 3S9YA 1ESWA 4PUKA 4PUMA 3QMSA 1A5KC 4GFIA 1CWYA 2WMHA 2J74A 2ZDRA 1JYXA 3CUXA 1Z3NA 2JEPA 5DT5A 3URQA 3GIPA 3CWOX 3MYPA 4PZVA 1UWQA 2ZE3A 2GJXB 3UESA 4WKFA 1MZHA 3K46A 3BMWA 4FMVA 2Z6IA 6TAAA 3LSCA 1B3YA 1EJUC 3WDIA 2BFGA 3CZKA 4YL2A 5F4WA 1UR2A 4E2VA 5G2HA 1PDYA 4MWAB 1ELSA 1FKWA 3LSBA 2WC3A 1QDSA 4YTQA 1SR0A 1WAWA 3CC1A 2NX1A 1EBHA 1YW1A 1R47A 1Q63A 3CS2A 2YFNA 3GNXA 4WY0B 1ZAIA 4KWWA 5CEWA 4AY7A 2PURA 4HU8A 5AKQA 7REQA 4CKQA 1NFPA 2D2JA 2XM2A 4YCOA 3N18A 2AQOA 3UCDA 4TVCA 1Q2SA 1FCBA 1T41A 2WNNA 3SSZA 4U5KA 3QC0A 1G5AA 1PTGA 4H4IA 5BOEA 4M7TA 3UG5A 1WUEA 3POHA 2ZVRA 2EF9A 5CJ5A 1IXNA 1E6RA 2PDUA 2YPIA 1IT8A 3LRLA 1NDZA 3PFRA 2PP3A 1GWJA 2C91A 3PZOA 1J0HA 2PZ0A 1QI3A 1DJZA 1R87A 3H23A 3N2MA 4O4VA 3S3GA 2CLFA 4PB5A 1V51A 3STPA 4L6DA 5A8QA 3H4WA 4QLLA 2FMNA 2XIOA 3VX0A 3WD1A 5BRQA 3RLGA 4AVOA 2HK1A 5K7JA 3WLOA 3LB0A 1U33A 3BUVA 3L21A 4JL1A 2XH4A 3GDRA 4IUOA 1KGXA 1OBAA 4MJMA 2F6XA 3R8GA 2A7PA 1RPKA 1XF0A 2NSXA 2OJPA 1MEWA 4E6MA 2VI0A 2ZWYA 4R7OA 3FS2A 3UNTA 3MSRA 3WY1A 4MB1A 3A3WA 2VEMA 4WRHA 1PX8A 3QY7A 3SQLA 2AL2A 1Q6EA 1VFUA 3L9CA 2NQZA 3MY9A 1JPHA 4W8BA 1ONXA 4Q3MA 2WYSA 1JAEA 3SB0A 3EKLA 2Z4GA 1HG3A 4LAMA 4ML4A 1BF6A 4B5TA 2CESA 4J7RA 1Q3NA 3S2JA 2WOQA 2GWGA 2MANA 4UQDA 3U2EA 1PIGA 2CETA 3NZ1A 3C2EA 3PPHA 1OIMA 2Z26A 3I7RA 1EC7A 3P74A 3AS2A 1R86A 4GQQA 3OZPA 1XLGA 4P8UA 4B5UA 3EMZA 1LBLA 1N2VA 2BOFX 3ABQA 4R3UA 3W1TA 3EKGA 5CGMA 4A3RA 4GJJA 1ZP4A 3G1AA