1YE4A

Crystal structure of the lys-274 to arg mutant of candida tenuis xylose reductase (akr2b5) bound to nad+
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPRSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFNDPWDWDNIPIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fine tuning of coenzyme specificity in family 2 aldo-keto reductases revealed by crystal structures of the Lys-274-->Arg mutant of Candida tenuis xylose reductase (AKR2B5) bound to NAD(+) and NADP(+).
pubmed doi rcsb
source organism Candida tenuis
molecule tags Oxidoreductase
molecule keywords NAD(P)H-dependent D-xylose reductase
total genus 105
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ye4A00
2HEJA 3CAVA 3N2TA 3EB3A 2VDGA 4XZHA 4WEVX 4PUUA 5HNUA 3LNMA 3H7UA 2IKGA 4GACA 1X96A 3UZWA 4I5XA 2I16A 4QX4A 4DBUA 2HDJA 1QWKA 4PUWA 3V36A 2NVCA 4OTKA 4JIRA 2NVDA 4H8NA 4L1WA 1US0A 2PDPA 5DANA 1J96A 3U2CA 3UZZA 4AUBA 3WCZA 2IPGA 1ADSA 2HVNA 1EL3A 3CV6A 4LBSA 4WRHA 3V0TA 3ONCA 3CMFA 3FJNA 5HNTA 4PR4A 4QXIA 4LBRA 2PDNA 5AZ1A 2PDIA 2PZNA 1Q13A 1LWIA 3UGRA 1FRBA 3R94A 2PDCA 1YE4A 1YNQA 3C3UA 1ZUAX 1A80A 3UG8A 1YE6A 4L1XA 2IQ0A 2PDJA 1Z3NA 1S1RA 3O3RA 3LEPA 3WG6A 4FA3A 4YVVA 4LB4A 4XZMX 2FGBA 4PRRA 3R8GA 3WBYA 2PFHA 3DN5A 2IKJA 2R24A 1MZRA 2F2KA 2IQDA 1SM9A 2PDYA 1C9WA 4MHBA 2R9RA 2ALRA 1X98A 3F7JA 3N6QA 4RPQA 2QXWA 2ISFA 1Z89A 2HE5A 4R9OA 3CAQA 3GHSA 3O0KA 4FALA 4IGSA 3V0UA 3M0IA 2HE8A 2A79A 2P5NA 1ZGDA 4GABA 1IEIA 1VP5A 1RY0A 3EAUA 3V35A 3LN3A 3G5EA 4YU1A 2PEVA 2PDKA 3VXGA 4JQ2A 3Q67A 1M9HA 1AH0A 3S3GA 5C7HA 1S1PA 1S2CA 3BUVA 4WDWA 4IJRA 1XF0A 3R7MA 4Q3MA 3Q65A 1UR3M 3BCJA 4DZ5A 5LIXX 1EF3A 3LQLA 4YVPA 2PDUA 1QRQA 2HV5A 2PDFA 3GHRA 1GVEA 4FZIA 3BV7A 2PDGA 4YVXA 3R8HA 1XGDA 4FAMA 2IKIA 1AZ1A 3MB9A 5HA7A 1RALA 4QR6A 2BGSA 4ASTA 2I17A 1IHIA 4JIIX 5LIWX 1PWLA 4GIEA 4GA8A 4ZFCA 1EKOA 1ZQ5A 2BP1A 3GHUA 4Q7BA 3WBWA 4LAUA 3LUTA 4JTDA 5JH1A 4YS1A 4HMNA 3RX4A 4XO7A 1MI3A 4H7CA 3UYIA 4XVDA 4JIHA 3ERPA 4LAZA 2AGTA 2IPFA 4WDUA 1PZ0A 1R38A 2PDWA 2FVLA 3DOPA 1HW6A 3LQGA 2HVOA 3H4GA 1EXBA 4HBKA 5JH2A 3LENA 2INZA 3LD5A 4JQ4A 2PD9A 3UWEA 3CASA 3CV7A 3EB4A 3R58A 4WGHA 5LIKX 1Z8AA 4PRTA 1ZSXA 4F40A 4IJCA 2C91A 2PDMA 3FX4A 1AH4A 3RX2A 3V0SA 3H7RA 1OG6A 2FZ9A 3UP8A 3LBOA 2J8TA 2BGQA 2F38A 2PDLA 4XK2A 2IPJA 2FZ8A 4XZIA 4JQAA 4JTAA 1Z9AA 2IPWA 4EXBA 4XO6A 3P2VA 3M64A 4ICCX 5M2FX 4GQ0A 2WZTA 1S2AA 3RX3A 3GHTA 4XZNX 4WDTA 3G1RA 4XZLX 1T41A 1AZ2A 1PWMA 3R43A 2ACRA 4XAPA 3UFYA 3UZXA 3COTA 4JTQA 2IKHA 1XJBA 1YNPA 3KRBA 5LIYX 4QBXA 3BURA 1PYFA 2PDHA 4JQ3A 3B3DA 3LZ3A 4EXAA 4DBWA 2DUXA 1MRQA 1HQTA 1T40A 4JQ1A 2FZBA 2PDBA 4PMJA 4WDXA 3MC5A 5AZ0A 2INEA 2CLPA 2WZMA 3D3FA 3QKZA 1VBJA 1Q5MA 3M4HA 3T42A 2PD5A 4G5DA 2FZDA 4NKCA 1K8CA 5LIUX 2ACUA 3NTYA 2PDXA 1RY8A 3ONBA 4JTCA 1X97A 1JEZA 2PF8A 2IS7A 1PZ1A 3UZYA 3R6IA 2ACQA 2DUZA 3GUGA 4GCAA 2PDQA 1LQAA 1AH3A 4XVEA 2ACSA 5KETA 4JTRA 4LB3A 3LZ5A 4DBSA 1AFSA 3WBXA 2DV0A 4GQGA
chains in the Genus database with same CATH superfamily
4EAMA 3UWYA 1H7XA 1UIOA 5A6BA 4NXSA 3KVKA 2ZX9A 3TV8A 2EQDA 3TXVA 3HJEA 4ZA0A 1ICSA 1MXSA 3VGBA 4J9JA 2RJGA 4KIEA 3IIPA 4QP0A 3SSJA 1M03A 3FOKA 4A3RA 4HZ8A 3TDFA 3HGOA 2DZUA 4P7LA 3MP4A 3CT7A 4N6FA 4NAFB 3S2NA 3RRXA 2YXOA 1XIMA 3BLDA 3R89A 2W4XA 1QJWA 4HQVA 4AXNA 1V51A 4G1NA 1IIHA 3KOYA 3RMJA 1F74A 2JK2A 3NL6A 4EWND 1BPLB 1E1EA 3GX9A 3H22A 3IVSA 3KTSA 5CZ0A 4ERGA 3E6EA 1TPFA 2QV5A 3IV8A 3VINA 3ABSA 2H9AB 5AZ1A 5C2XA 1AL7A 4V1XA 3CMJA 3H26A 4TX8A 1KXHA 3ELFA 2VO5A 5M03A 1SSDA 3K2GA 5BXSA 1YNQA 3NSXA 1ONRA 4GY1A 2ZZ4A 3QHOA 1DE6A 2VYOA 5BCAA 3O06A 1GCYA 2JGQA 4FXJA 3THQA 1Z3NA 4IP7A 3ITOA 3ARSA 4O15A 2E1DA 4CCDA 1CXKA 3FLUA 4ZSUA 4YWIA 2JIWA 1XICA 1EZWA 1W9PA 1Q8JA 3VKDA 4YPJA 2FMOA 1XISA 3PWAA 2ZRUA 1VPQA 4DRSA 1ZAIA 4AY8A 4B92A 3SRKA 5BWFA 5D33A 3N2OA 1H11A 4HHHA 1FWEC 5E1QA 3NEHA 3CUGA 4L64A 3WUGA 3TAOA 3JVAA 2OFJA 5TF0A 3N73A 1QPQA 4JL1A 4EPBC 1HUVA 8CGTA 4ZCWA 4FX8A 2ZIDA 4GABA 4C1KA 1XBVA 1H1ZA 1V6YA 1YX1A 3VIIA 2GJXA 1IXPA 1C91A 1X8FA 4DB7A 5PTDA 1SJBA 2PEVA 2PDKA 3V5CA 2YKKA 3L2MA 4JXCA 4HU4A 3SR7A 3Q67A 1M9HA 3TC6A 3HB9A 3MV01 4PB3A 1ITCA 1OG0A 3RNDA 2NQLA 4O16A 3LU2A 4MPQA 3FDGA 1C8VA 3ITVA 3Q65A 4CNNA 1UR3M 1SUXA 1W1A1 1TPVA 4LALA 1ADDA 1TZZA 1B4EA 4JY9A 1QRQA 4YVPA 1HJSA 4YYCA 4NU7A 3MCOA 3H4WA 3CV2A 4GYJA 1CXEA 4P7OA 1WPCA 2BY0A 3BZGA 3EOUA 3UXLA 4DJFD 4S3EA 3PBGA 2FPYA 5C8BB 1A5NC 4JTUA 1CBGA 3W7KA 1K9FA 2O9TA 2XFWA 4MYAA 3C2EA 4CN6A 3W38A 4Z2LA 1JZ5A 1QBAA 5A8QA 4QRNA 5TBOA 1VEOA 4HPXA 4G1KA 3G77A 4GNJA 3DDMA 4QLJA 4ZE4A 4UMCA 1B5TA 2O0TA 3ARPA 3AFBA 4MUZA 2CZFA 1US2A 1VCGA 2O9OA 3OOQA 2DVTA 1SFJA 3OJGA 1V3JA 5LHFA 2WKLA 2ZZ2A 5FF3A 1KGWA 1AQFA 2DFAA 3DKLA 4WDUA 2PDWA 3HFTA 1KCLA 3PNZA 3QW4B 3WD4A 3NGFA 4GXMA 2QQ6A 4WD0A 1VLWA 4PMOA 3ZJ8A 3CEPA 4BQ4A 2Y8VA 3GVVA 3E1F1 2XSXA 1N82A 3CASA 3EB4A 2DPEA 5D38A 3R58A 1NWRA 1JAEA 3UXKA 1O66A 4DN1A 4JGDA 3UJEA 4WVXA 1QI5A 3N4FA 4HN4A 1ZSXA 4AZCB 2W9MA 2VFHA 1QNQA 3RR4A 3EBVA 2VDIA 2GFTA 3WJSA 3V0SA 2EO7A 3WMBA 3TOYA 2X1SA 1SMAA 3TJXA 4GPNA 1TPEA 5LNRA 2HPIA 4L4PA 2ISDA 1UJQA 3W6MA 3EDKA 3VGHA 4WOQA 3TTEA 4FF5A 3NXLA 1YADA 1FWTA 5TQLA 4OV4A 5HMSA 1JDCA 1WDRA 4AHPA 3TROA 4GGHA 2G4FA 4D2JA 3MUY1 1G9HA 4XZNX 4MWAC 4XZLX 3TQVA 3TSMA 3TYAA 3UEQA 1T8QA 5E09A 2F8QA 1M7XA 4BI5A 1WZMA 5C2CA 2ZA2A 5CC3A 1V0KA 3G8EA 2RDXA 2PS2A 4DJDD 1NDYA 1VQTA 4OUIA 4O1DA 2Z6JA 4IPIA 3TZNA 1O5XA 3IJIA 1AL8A 3U3HA 4H8HA 4IMDA 2QJJA 5GQBA 3WQOA 4QS5A 1XLDA 1YXCA 3TLLA 2UZ9A 3WK2A 5K2ZA 2QUVA 5AVNA 3KTCA 4B5SA 1J5TA 3J7HA 3SQSA 4B4FA 1EC9A 5EMUA 5I3FA 3NTYA 5EFFA 2AQOA 4Q4RA 1RY8A 2BVYA 4YIWA 2J4GA 5I3IA 4NVTA 4KF1A 3R1ZA 5BRQA 5KZMA 5EMKA 1J11A 1DXFA 3EX6A 2NQZA 2R1NA 2VX4A 2VOTA 4FOKA 1EGVA 1PSCA 3SDOA 2GZXA 1I45A 3VK5A 3AXKA 3TTSA 1TV5A 2ZZ1A 2JQXA 1O1ZA 1VAHA 1SMDA 2NX1A 1XYZA 3K5XA 3MJYA 2PWUA 2WKGA 3M0HA 5DMLA 2E8YA 2ZDSA 1QO5A 2YDAA 1E0UA 2J66A 3PPGA 1EUAA 2XJ7A 3HQPA 5H91A 1V6WA 3PZNA 4A2SA 3FJLA 4N4PA 4K1GA 2HS6A 3ABQA 1YLVA 4US5A 3BCFA 4FLSA 2GQ8A 4A2RA 3BAJA 3GW0A 1OHLA 5A8PA 1UD2A 5DEZA 2V81A 3EB2A 4R34A 1BHGA 2HDJA 2XVPA 3AXIA 2VD9A 3T78A 3Q2DA 1TTIA 4QISA 4OQVA 2PWEA 4J3VA 3S5YA 2XH7A 1LWHA 1XYLA 4LU0A 3CV6A 3K4WA 3MCMA 3IJ8A 4MDPA 3MMWA 5AHFA 2YL9A 3R5EA 2XDFA 3GH7A 2WV8A 2ISWA 2Z2UA 3T0CA 1KBJA 1K70A 1EJSC 2ZYFA 4HYVA 1Q13A 1DQXA 5HR6A 2BS9A 1TPB1 4GLEA 2ZDRA 2DT0A 3W81A 3BAYA 1LLOA 3NIYA 3VZZA 3E2SA 1PHWA 1S3HA 4H04A 3AIRA 4LC8A 1A5MC 4RZBA 2P76A 1S5VA 3TA6A 3ZWTA 3LNPA 4XZMX 4PRRA 2YGYA 1LL4A 3UA3A 3NQ6A 3WNPA 4C65A 2HNHA 4AVOA 3WMCA 4L9YA 2Y85A 3OLDA 1S3TC 3SGZA 4AW7A 1V6TA 2ALRA 2HVMA 2J78A 2WJEA 4YMZA 4IXHA 3N17A 3HFYA 3LA4A 2FH6A 1I0DA 1LDCA 1H1NA 1Y0EA 1KXQA 5BOOA 1DJIA 1KKOA 3FVMA 4JYDA 4WLCA 1S2UA 1P0DA 3VNLA 1HO4A 3W1RA 1KA9F 1TZ9A 1C93A 2BOFX 1JDEA 4HGXA 1QW7A 3QMTA 3LRKA 5HXMA 1G1YA 4IOTA 5BZAA 4L80A 3WNKA 4K38A 3TFXA 3APGA 3VDAA 4OECA 4H9MA 1K8YA 4IP5A 3SQMA 2EGZA 4GBUA 4UTLA 3V1HA 5A6BD 2EKCA 1EJWC 4JTJA 1OSEA 2E40A 1GOOA 5I23A 1ZNNA 3FJ6A 1FUYA 4QHRA 3PBVA 4F48A 3T4WA 1VC4A 3SJNA 3SJ3A 2J7FA 2PE4A 1B3XA 2X16A 3B4UA 4P8UA 4IL0A 5GNZA 2E7FA 3PZMA 2J9XA 4ZB2A 1DJYA 3GLCA 1XDLA 4IIHA 4MJ4A 2XVKA 4PMYA 1EKOA 3QLLA 4U2YA 2B0MA 1KBKA 1AW1A 1OYCA 3VD5A 4WCJA 3KS5A 3UYIA 1A4LA 1KR0A 4Q8PA 4JIHA 1ISZA 3AMDA 5DY2A 1VGAA 3DGBA 4JX5A 3DOPA 3VM7A 4AHQA 3LHTA 5JH2A 4YCOA 2V82A 1BVNP 4XAZA 1H7OA 2CHRA 4DXVA 1V6XA 3VAVA 4LOCA 3WQ5A 1EQCA 1VHCA 4ONVA 3VKCA 4LVBA 2GGIA 5KINA 1MW1A 4I9JA 3NL2A 3UXAA 1TCDA 5DBTA 1K7FA 2DVXA 1V3KA 3MO4A 3S5NA 4A29A 2FJKA 1ISWA 3N14A 4M82A 5F2IA 2V5KA 2R1MA 3TC3A 1ZAHA 3HN3A 5H6HA 3M6YA 2CKRA 4JTKA 1TYGA 4LS1A 1EDTA 1XLCA 1ICPA 3UQNA 1PVNA 4ERAA 4NASA 1UKPA 1WZKA 3QFEA 4KRUA 1KV8A 3LTSA 1UOKA 3GWQA 5CC6A 4XD4A 2QS8A 3FGCB 2V3FA 3FSUA 4JHOA 3KL0A 4HA1A 3S9YA 2A7PA 3F5JA 1OFPA 1BQGA 5D37A 1DHPA 3PAJA 3WJWA 1SW7A 3UZXA 3LBCA 2GVYA 4W7UA 3GC2A 2YR1A 3EWDA 1UC5A 1JD7A 3CQJA 5DBUA 4R33A 1J8VA 1E3XA 1JZ8A 1QBBA 5EMMA 5JBEA 1HVQA 4AIEA 1XBXA 2VEGA 4LNYA 4L4LA 4WUIA 3VGGA 2GYIA 1ISYA 4U28A 3H55A 5F1UA 2FYMA 2J77A 1EHNA 4AHOA 2Q02A 3NZRA 3T0BA 1W8SA 4NAEB 4A8RA 1LF1A 4QDPA 2QAPA 4FOUA 2FZDA 5L9FA 4IHCA 2HPMA 5D02A 3ITXA 3G0XA 4H83A 4PE8A 2YSWA 3ONBA 4JTCA 3QC0A 1UR2A 1VEMA 1LG1A 4AEFA 1CXFA 3LK6A 3VIFA 3UCQA 2QCMA 2QJIA 1CIUA 3S2CA 3MYOA 4R85A 1ECQA 1W3JA 1DTUA 2OSYA 1AH3A 2Z1BA 4IIDA 3NDOA 1LWJA 3WH6A 5G1TA 5C9WA 2ACSA 3KBMA 1RJPA 2IUZA 1PB0A 5A5WA 3NAVA 1YDVA 4IICA 4PFMA 2J7GA 4E2BA 1MNZA 4M6QA 2V5LA 1OX5A 1BAGA 2D22A 1ONEA 1NP2A 2QF8A 1FWWA 4QSFA 1ISVA 1REQA 3TN3A 1CGYA 1QPOA 3CZEA 2QJMA 1T7LA 1UG6A 4IMEA 9XIMA 5REQB 4YTTA 3PANA 4AMAA 5LA2A 2XU2A 1XH1A 4NZ1A 1JCTA 2WHMA 4FNTA 4B5TA 4MADA 1KTCA 4CD8A 4EOUA 3ZSTA 3FAWA 4JX6A 1JVNA 5C55A 2WC7A 1GWJA 1XYMA 3G1XA 3VOJA 2VM8A 4ATDA 4C6IA 4AYSA 2NVDA 2EXOA 4Q33A 3G0UA 3ZIZA 3WLMA 1B1YA 3BVJA 3NGJA 1VBHA 4AUBA 3WCZA 3SCVA 4O8AA 3EX2A 2WSRA 1FWJC 4WRHA 1W2PA 4Y9MA 1EF2A 2VFDA 3GDTA 2BY2A 2O92A 5KEZA 1SQ7A 1WB0A 2PDIA 5CAKA 4ZTXA 3KX6A 5ABTA 1ME7A 4KWOA 2Z1XA 5A8OA 2POTA 3BXWA 3EDFA 2EG8A 1TB3A 4FB7A 5F4WA 2XIJA 1GQKA 1JUKA 1ZJHA 2O4QA 1KM4A 3ZOAA 4B2DA 1O60A 1OD8A 2P0IA 2DSKA 3OLGA 1FHUA 2IQ0A 5DMYA 1FQ0A 1TRDA 1J5SA 1XIEA 1V3HA 3W1QA 4P7QA 3K4DA 1T6MA 2NSXA 5LXEA 5A2CA 2Y24A 4PTXA 1WXYA 2VL4A 2D2OA 4Q8MA 3RRAA 3TAKA 1WAWA 4OJYA 1MQRA 3O6YX 1J4EA 4E3VA 3M46A 2HXUA 4MHBA 5HANA 1HGWA 2VD8A 4F0RA 4NILA 6XIAA 1RBOB 2F7FA 1GZJA 4RE2A 5DCDA 2W67A 3VPLA 4G7FA 4RW3A 3T07A 5AC7A 2ZRZA 1CCWB 1JPMA 2QCFA 1E9IA 4F66A 3BW2A 1LG2A 3MUXA 1GQJA 1A5OC 3PSWA 4TMBA 4DJFC 2OZ3A 2Z0IA 4FNRA 4O0ZA 3KVLA 3OA5A 4EAYA 1D7KA 2WVSA 1S2WA 1EX5A 2Y5SA 3VDHA 4OV9A 2QAFA 1R5YA 2C79A 4ZB0A 4GZ7A 3NSMA 4OZOA 3N6JA 1Q7ZA 3GXMA 1S1PA 4AD3A 2YZ5A 4GBDA 4PTWA 1JPDX 1RR2A 2X2GA 3C2FA 5HAOA 4AY7A 4Q6JA 2YLLA 1AD1A 2FH8A 3OVQA 4DLFA 1XG3A 1XUZA 5DELA 4YTRA 2PDFA 2BNJA 4RW5A 4E4UA 3NCOA 2GSHA 4B3KA 1BKSA 1EJTC 5IHRA 1XPGA 5HA7A 4O19A 2XZ7A 3OVRA 4GQQA 3EA3A 2PURA 2YIHA 4RNHA 2Z2BA 1RCOB 2C3ZA 4KBXA 1CW2A 2WWDA 1AJ0A 2EPHA 3HGJA 1E15A 3TCSA 2CLIA 3W88A 1GKRA 3LUTA 3A12A 4JTHA 3OGRA 5TD4A 1P43A 1JNEA 4XO7A 2ZICA 3VOCA 5FACA 4E2VA 4XVDA 1XBZA 3AS2A 4MNJA 1V3IA 2WM0A 4IIEA 1HKMA 2PODA 4U5IA 4X9YA 1HW6A 2ZUVA 4KEUA 1IT0A 1F8MA 2D2GA 1AA1B 2AMGA 2F6UA 2ZXBA 1J0KA 3N3TA 3FY1A 4S38A 1ZFJA 1PYMA 3S2JA 3KDNA 4WGHA 1CLKA 3PULA 1C3FA 2Z28A 1QI2A 2NQ9A 4Q8VA 1LUCB 1R3SA 4G7EB 1GW1A 2V68A 1OG6A 5HQEA 5DRIA 2V2CA 1DJXA 2PCEA 4D8ZA 2DZVA 3B8WA 3P67A 1MW3A 4JEQA 1X7FA 3XINA 3F4WA 1UC4A 4DUWA 1NDZA 2BXYA 1W0MA 1F3WA 3DFTA 1Q6RA 4GYKA 4MAVA 3CIVA 3P2VA 4IFRA 4C6MA 1WAUA 3RJXA 5AYZA 3T44A 1L9WA 3EWYA 1G7VA 4XSLA 1G0CA 1YXDA 4W86A 1AZ2A 4KKXA 4QDMA 2ZC8A 3HG4A 3DX5A 2J47A 2DQXA 1WX0A 3TNOA 2I5QA 3QPYA 1MWOA 4PFHA 2ZZ7A 1BGGA 4UXDA 1DHKA 3N11A 5LIYX 3GG1A 1V03A 4LUSB 3AIEA 3L65A 3VIHA 2QZRA 3BLFA 1A47A 2FHCA 3DG6A 1EWEA 5ABEA 3GDMA 2WJZA 4ZQCA 3ITLA 3QMRA 2D69A 3S83A 3M9YA 4GRSA 3W2MA 5I79A 2P3ZA 3BZJA 4H2HA 3L4YA 4WXYA 3USBA 1QI3A 4UUIA 4RLIA 3SN4A 3VNYA 1RK5A 4JL2A 4L9XA 5GJPA 3WQWA 3WD3A 5BWAA 1RBLA 2Y5EA 4C6NA 4H6RA 4Y9NA 1XRTA 3HTWA 4Z0JA 2Y88A 3QV9A 2V69A 2WMFA 1NH6A 4IH3A 5G1YA 2QLYA 3AHTA 3MVIA 1UYQA 5FSEC 1Q6DA 1ODZA 1XLLA 2ACQA 1UH3A 1NIUA 5JU6A 3MU7A 2HWGA 4NX5A 4TX9A 3O05A 4GINA 3LI1A 1SZGA 3R12A 5CPLA 4DBSA 3LZ5A 1W5NA 2NXHA 1J6OA 1EJUC 2VWTA 4C6FA 3DEQA 1FFRA 3AZTA 3QTGA 4EACA 5JIPA 1EP1A 4E4PA 4AFYA 3CQ0A 3HV9A 3IARA 3ECQA 4Q8WA 3DFHA 2DU2A 2NXGA 2A3CA 4G56A 3W02A 2YOCA 1OGGA 1X38A 2B4GA 1N55A 3C0SA 5A6KA 4PUUA 5HNUA 1FCUA 4M56A 1Y7VA 1ITQA 1HL2A 4YYFA 1J0IA 1V08A 3BAXA 3EKZA 1LM1A 3ZLHA 1ECEA 1X6NA 2PA6A 4OHQA 4O1AA 4LRTA 1DXIA 1QWKA 1FWAC 3H24A 4H8NA 3I7QA 3EEZA 3VX1A 1DEDA 2F2HA 1ADSA 1QHZA 1W3NA 4Z1YA 1POKA 1RBAA 1IEVA 4YTUA 2PWGA 1KM1A 2WB5A 5C0QA 1EYWA 3HMJG 1R9XA 1Z44A 4D6DA 3MDWA 2CYGA 2PTXA 1OGBA 2QGYA 2AAAA 3R94A 1YE4A 2OG9A 3C3UA 1MUCA 3GY1A 3PZGA 5K4ZA 2PDJA 4GISA 3U5UA 3FAXA 4HNOA 4JY8A 3WG6A 1XPYA 4TXEA 3NZ1A 1JDDA 4ORIA 3IACA 3LCWA 2PFHA 2I1OA 3NPXA 4AISA 5H1WA 4GH1A 2OVLA 2W61A 1AW2A 2BWGA 2DSZA 2OQLA 2YA2A 4H7VA 1WDQA 4E2DA 1PIIA 1LJYA 5EPDA 5M3WA 4ZQMA 1LYXA 1J0ZA 1QWGA 2BX7A 3T6CA 3TIMA 2ZRYA 4QFUA 3VGDA 3AZRA 3TP4A 1PZ2A 2VUYA 4MJ2A 2OQYA 1V02A 4ALDA 3HURA 1R3YA 3P61A 3RK8A 1J9YA 1RY0A 1MXDA 1FHLA 4NZ5A 2HBVA 5LA1A 1O12A 1F76A 4X0NA 5CJMA 1PUDA 3F2CA 3V4BA 3GU2A 2G41A 1V6UA 3GVGA 1JUEA 2GGJA 1D3GA 1DJWA 1WDWA 1K77A 2OCZA 3CIWA 3BOLA 3WL0A 5HJYA 2CBIA 1QNRA 2YYTA 4D9PA 3AJ7A 1HGYA 4MKVA 3WQ8A 1JZ2A 1W8GA 2V5CA 3W7JA 5JQ9A 1Q6EA 3FEMA 2A21A 3LS9A 3GVRA 2Y1HA 1JI1A 4IP4A 3RIKA 3ITGA 2R8WA 4JIIX 1A0DA 3AMLA 1EP2A 2R91A 1S5TA 2NQJA 3QN3A 2V8ZA 2GVGA 2DY3A 2GJNA 1MQQA 3G6MA 4TQTA 4LPCA 1XGZA 4NIRA 5GNYA 5A6SA 2CHOA 1FH9A 3FDKA 3PS7A 3OQ8A 4ECLA 3S6DA 2FTWA 2BY3A 3ARXA 3KLLA 4XUGA 1SZEA 2FVLA 1C8YA 1B3YA 3CU2A 3WSUA 1GEQA 3PUGA 3H4GA 2VC9A 4MNKA 1XIHA 3VA8A 5LGZA 3RM9A 1XLHA 4MSSA 2A4AA 3CV7A 4HNNA 4A3HA 1EGMA 4JFWA 2BBFA 1TUFA 5LIKX 3H21A 4Q4KA 4HPGA 1MFVA 2BODX 3PNUA 5MKGB 4YNGA 3D46A 4HK6A 3T7VA 1GJWA 2PAJA 3II1A 4L5ZA 4B3LA 3ZO9A 4LVFA 2F38A 4N42A 3G24A 1PEZA 7CGTA 2B31A 3AJXA 1XSIA 2V0TA 5J04A 3ARWA 1JYXA 1YEYA 1W9VA 5FOOA 3PBWA 2G5WA 4D6HA 3OZYA 4C1LA 2YBUA 3IJDA 4O1EA 5E9AA 1U1JA 4RNFA 2J27A 4REQB 1JF5A 3QPEA 4HHMA 1AQHA 4IIGA 3SAZA 4O13A 2A1YA 1RQBA 2XPKA 3QY8A 3CXOA 2F6XA 1H7RA 1K03A 1Q6FA 4F0LA 1TMQA 2MANA 3N9KA 4XIAA 1OINA 3W83A 1KFKA 4I7WA 3RYSA 3JZUA 1VBGA 3K4AA 4LY4A 5EA9A 3EOSA 3IRDA 2HSAA 3MI2A 2QJHA 5AC5A 3C0JA 1A4MA 5AHEA 1LT7A 3DHDA 3N29A 2V9DA 4UQCA 1UP2A 2MUCA 1E72M 2GDUA 3RO8A 5G4WA 1VBRA 2QCNA 3HPAA 5D2XA 1OBAA 1F73A 4C6QA 1SJCA 3CWHA 5FESA 1QATA 2HQAA 3H7VA 1NF7A 1KXTA 2WKJA 3DBPA 3VOGA 4G5DA 1YTEA 1EXPA 3LCHA 4F4RA 4ATWA 1R8LA 1H09A 4PB4A 4B15A 1TPDA 4H6KA 2PU1A 1PDYA 4PUKA 4DLMA 3MMUA 4XAGA 3Q94A 3TN6A 4MB3A 3RG6A 3PPHA 2ZX7A 2IXUA 5KETA 1O94A 2I5GA 4JTRA 2O9PA 5RUBA 1KNWA 5ECVA 2VKZG 1SSGA 4HHLA 4JTGA 2OU4A 3WBXA 4PA8A 5LNWA 4JTIA 3IANA 4GO9A 1MSSA 2OLHA 4G8TA 4DJEA 3LXCA 1V4YA 1REQB 2VWSA 2ONEA 1PDZA 4D1IA 3PJXA 3GFYA 1O5QA 3MBDA 4K8GA 3EX3A 7REQA 4UZUA 3CL6A 1G67A 1BWKA 3EWWA 1GOIA 3EOOA 2QCHA 1EFZA 3WDPP 2J9YA 4O1BA 3PTDA 3I4EA 4UZSA 3G3DA 4DBUA 3TUUA 3M5YA 3CUXA 3S5SA 3HGRA 3ITCA 1US0A 5BRPA 4I8DA 1TJ0A 4JOMA 3VGFA 4YN5A 4TV6A 4UFIA 1NARA 1WKDA 2CZEA 4BCEA 2J8GA 1XIFA 1OGSA 3FJNA 2OX1A 5HNTA 2PGRA 1DYSA 2VEPA 1IEWA 3ANVA 3HF3A 3DAQA 2PDNA 4PGLA 3LHVA 2CWNA 3TU9A 2VFIA 2HBXA 2PBOA 4BFAA 1B31A 1E73M 2WW5A 2VQTA 4GNVA 4JAWA 3OBAA 2X40A 4PBEA 4RX0A 1PTAA 5B7YA 4DY1A 4GUHA 3ARRA 2WVVA 3L5MA 3F4NA 4HNTA 1RXOB 3A4XA 4W8LA 1XSJA 1N8WA 1H62A 2ZZ6A 2BHZA 3TJLA 3GFZA 2IKJA 4MYXA 1FOBA 4QTGA 1GQLA 4MFEA 3UZJA 3LXAA 3F7JA 1KKRA 1TZ7A 4I9TA 5A6LA 4E6MA 2FHFA 1DIKA 3N34A 4WSHA 1AQ0A 3WFLA 3CAQA 3E3HA 1EWDA 2WC4A 4PCTA 2EJ1A 3M0IA 3GNDA 3TYCA 4AD4A 3LGGA 1V77A 4E8DA 3MJMA 4UTWA 3LMYA 2YBVA 5D09A 2Z00A 4RKAA 3G5EA 1M7JA 5E0FA 3ARTA 3M0MA 5FEPA 1RUSA 3SECA 3STEA 3C8NA 1M68A 1QO2A 2VGFA 1DWIM 1K7XA 1GOMA 5IM51 4JQ2A 4RK8A 2XINA 2EBNA 3EKLA 5L6UA 2Y2WA 2OEJA 1WP6A 3ZFHA 3KOWA 1W1PA 3G3MA 3RLVA 4CUCA 2NV2A 4KEZA 4UTTC 3NDYA 1AK5A 3EX4A 2WK2A 3S1GA 4DWSB 3E38A 3ZVHB 1HKVA 3W24A 1K8ZA 5T8GA 1OT1A 4GIAA 2IKIA 3D6NA 2C13A 1X1OA 5JMUA 3VFCA 4MVAA 3BQ5A 2Z1SA 4GXWA 3SRDA 3UD6A 3H2NA 4GCXA 4GIEA 3PZOA 3M0JA 4HNUA 2RJHA 3VNIA 3GHUA 1VJSA 3VD4A 2CLLA 4HZ6A 1QW8A 3UJRA 3W22A 7TAAA 3RX4A 4XG1A 3KBSA 1R0MA 4F0HA 3C2OA 4XBSA 3H23A 1W1B1 2E0PA 1EIBA 1E0XA 3WX7A 3RDKA 3PK7A 4LNCA 1RJQA 3PB2A 4HJWA 4V33A 1H7NA 1HFBA 1YPIA 3I6TA 3TWAA 1JZ7A 4K37A 2H8ZA 1KRMA 3U2OA 3AIWA 4BWLC 1E6SM 1R3WA 1UUOA 3V16A 1CENA 1WZLA 4PL1A 4IQDA 5BXPA 3U6WA 5MF5A 4LUTB 3F4CA 4XKYB 3RILA 1WKEA 2FVMA 3IIOA 5A8GA 4AEEA 4IUGA 3HQ1A 4F40A 3AIBA 3B0UX 1C90A 3W1NA 3WLJA 4CN1A 4JD4A 3TTQA 2NX3A 3CBWA 3CHVA 1CB2A 1PKYA 2QDEA 3VKAA 4O52A 3ALGA 4IG2A 1O95A 2G3IA 4I9MA 2UY5A 5I00A 3CJPA 3TN4A 2W92A 3NYZA 4GUIA 1V5XA 4PUEA 2OMAA 1ZTVA 5IFPA 1EB3A 4QAWA 4C6CA 1BRLB 4K7VA 2JBMA 3AU2A 3B0YA 1XR2A 4W5UA 2ZXDA 3B04A 3WQDA 2OZ8A 2ZXQA 1BGAA 3M5VA 5HUPA 1PWMA 3L0NA 3W7EA 5D05A 1TWZA 4JTQA 2OELA 4DZIA 2QCDB 1V6VA 3UNTA 3BCDA 4EPKA 1LQ0A 4E8CA 4ZQOA 4H4IA 4A3QA 4S3FA 4UR9A 1SZRA 4O12A 4DBWA 3PR2A 4OWGA 5DFAA 1DOSA 1MRQA 4M51A 5CKSA 3STFA 1JXJA 1JZ6A 2G3JA 1XKYA 2PDBA 4FPSA 2A0NA 5K7JA 1O6IA 1ZJIA 4NI3A 3M0KA 1MFUA 4GHRA 3LHZA 3D3FA 5D04C 3QKZA 3TSBA 3GAKA 3RCYA 3MMDA 4LYKA 4IX0A 3WDIA 2QUNA 2WANA 4AWUA 2RAGA 4XBKA 1W31A 2XGIA 5K9CA 2BFGA 1E1FA 1VF8A 2WSKA 3D47A 3CL8A 3GU9A 2B7QA 3QZAA 4IG2B 2BXVA 4NJIA 3UNDA 3O1NA 3H6OA 1TR9A 2YCLA 4DNMA 1PIFA 3TMLA 1IXNA 1R2TA 3NVTA 2DEPA 3VDGA 1X6LA 3GXDA 3LLDA 3TE9A 2WO5A 1QFEA 3OQEA 3P0XA 3IEBA 3WQVA 3CAWA 3UWWA 1E1CA 3SCRA 2F9RA 3KL3A 3O63A 1A0EA 3ARYA 3AS1A 1UZ4A 3ID7A 4S2BA 4ZL1A 4WSJA 5LNUA 3VZXA 3BAIA 1SPQA 4AC1X 3W01A 1UZDA 1QVBA 1Z7AA 3MA8A 4H2CA 3H54A 1BG9A 4DI8A 5I06A 3TR2A 2WHLA 4ZZ9A 1XH0A 4HK7A 4CNOA 3A3XA 4LT9A 1JCXA 3HPXA 4M0XA 4J27A 3T2QA 5I07A 5JBFA 3JW7A 4MF4A 4AD2A 3WD1A 3RU6A 3QBUA 3SFWA 2ZADA 2I5IA 5DLCA 3WY1A 4TTUA 3NJ3A 4UFMA 2UBPC 1XM3A 3CGTA 3H4XA 2ZUNA 1HG3A 2VMFA 3KLKA 3AYTA 3MS8A 1P6WA 2AL2A 2OX4A 3IPWA 1MEWA 2QMJA 4GZJA 4EE9A 1F6YA 3P5YA 1SZFA 5D4YA 4Q8NA 3NEVA 1G7UA 4Y7EA 1TX0A 4CNUA 3CT2A 1FRBA 2DORA 4B4HA 2YB1A 2JKEA 2Z7KA 3BOXA 1EUNA 4MZYA 3LXBA 3UG8A 1JXKA 4US5D 5D8WA 1EPXA 3VD3A 4H9ZA 3EDEA 3UXIA 4C5YA 3EWCA 3W07A 3W2UA 1IEXA 4GNKB 1W9BM 1R7OA 1KLYA 5FSDC 3A4AA 3GTXA 4FR1A 4KFOA 3ZT7A 3OP2A 1VZWA 4NZCA 5F4SA 1O5KA 4WY0A 3VIOA 2HE5A 5EGRA 1XGEA 1FP8A 3WN6A 4IL2A 1X39A 1LQ2A 1WDSA 1O4UA 3P74A 1J2BA 4L6OA 1OABA 3ISIX 1ONXA 7PTDA 5CGTA 3EAUA 4BQ3A 5G2WA 1XLMA 3D3AA 4FIRA 3TTYA 2DH2A 4CVWA 1QDSA 1U22A 2QKFA 5JXQA 2X7VA 3VABA 1TV2A 1BFNA 4OBTA 4W85A 5IXEA 2XVLA 1XRSA 5GJMA 2PTYA 1VBUA 3SEPA 1XCFA 2PTZA 5FCZA 4AWEA 3LTYA 3WEMA 4I90A 5C7HA 3WQ4A 1OT2A 4YTSA 3SI9A 4LF2A 2BV9A 4O8RA 3LV5A 3WNNA 3ZLFA 1U30A 2FB3A 8A3HA 4M7TA 2VTFA 5LKYA 1OFEA 1JCNA 4HNLA 2QUMA 3SB0A 3E0VA 5CBJA 4JX4A 1PKLA 5HPOA 3NQCA 3WJYA 5I09A 1PZ3A 5AHNA 3GRIA 4A3YA 2VCAA 3U0HA 4Z42C 3HJZA 4S3JA 2WMIA 4PL2A 3SY5A 5C7VA 1MYRA 5LNVA 2XH2A 4S23A 1P0BA 1C8QA 1EIXA 3EX1A 2AOSA 4JFUA 4HMNA 1WQ5A 1LT8A 5EMLA 1IT8A 3LHUA 2YCKX 4XTDA 4BF5A 1FCVA 3VNJA 4F2TA 2GDVA 5BMWA 4DNHA 4IF2A 2FIQA 3W2JA 3GAYA 1P6CA 4WKAA 1QNPA 2YX0A 3TW6A 5C2GA 4JTLA 3IIZA 3UPBA 4HA3A 2GVLA 1JCLA 3IUHA 3SURA 2G96A 5KSWA 4C6BA 2YCLB 4MB5A 2YFNA 3LLFA 4UQEA 4LAOA 4E2OA 3MQTA 4O1CA 2BTMA 5J5DA 4LWWA 1TKKA 3PVFA 1Z8AA 2WVUA 1ZY9A 1XLIA 3WQPA 3W74A 2VCBA 4B5XA 2CC0A 1K6WA 1JQVA 5GJNA 2X7WA 3GNNA 1ENUA 3INPA 1K9DA 5E93A 1GJUA 1MEHA 2X09A 1V0MA 3E0LA 1QNOA 2DW7A 4K8HA 2WCGA 3FK4A 3NL3A 1XIBA 3BO9A 4AH7A 2JE8A 4FXSA 1IXOA 4O17A 2WLYA 4B5WA 2OT0A 1Y65A 4JTAA 1OADA 4V1YA 4UQDA 1OVDA 4RR4A 3DYPA 3EWZA 4BWLA 1JYNA 1H51A 3AMCA 1GGOA 5K9XA 3RPTA 1TCMA 1WE5A 3NQMA 4FOJA 4UTIA 3BMXA 4R53A 2A6NA 3MI6A 4GI6A 4WIWA 1J79A 4IMFA 3TC7A 7ENLA 1VEPA 2QGHA 1Q85A 1U1UA 3R4IA 1GQIA 1KLZA 2XN1A 1D8WA 4GJIA 4K39A 1EGZA 2ON3A 1DVJA 3IRSA 2Z25A 3WK0A 4JQ1A 2E6AA 4KETA 3A4WA 4QSHA 3IJ7A 1B2YA 2FDMA 2PC8A 5IHSA 1ONWA 2PLCA 3KWXA 4MWAE 1E0VA 2FHBA 2E4TA 1D2KA 3WF4A 3AIQA 2J6XA 3UPMA 4LV9A 1I2PA 1TJPA 3GXPA 2ESCA 5M5DA 4H6QA 4L4OA 1LCOA 3DHPA 1Y5VA 2XZ9A 4PUDA 4QROA 2PF8A 2NT0A 4HVXA 4V15A 3I3BA 5C70A 3MDUA 1E0TA 2X1RA 3EDJA 4Z2HA 1Q2SA 2GUYA 3P82A 4GJ1A 1NFGA 2C15A 3VNDA 1IZJA 4W8BA 1ZBVA 1QK0A 4REQA 3KOXA 4Z2KA 4JS3A 3AS0A 3ARQA 4AX7A 2D24A 4J35A 2XN2A 2DJXA 3TA9A 3W1AA 4LY8A 1DV7A 2C1HA 3TTOA 3N04A 4JFSA 1KW1A 3RCMA 4NP7A 3NQGA 3MHFA 3W1XA 1X1ZA 5FEWA 1G4EA 2PB1A 2C1IA 1TTQA 4WEVX 1UKSA 2UY3A 3WK1A 4NRRA 3H2OA 3SUTA 1VH7A 1YIXA 4XTIA 1OFRA 4KERA 2Z26A 5IFTA 3M0ZA 2RUSA 1E9ZB 1RLDA 2XIIA 3EZ4A 2VHLA 1TREA 2OWWA 2G0WA 4LH8A 4KFNA 1L8PA 4A8LA 5JUVA 1EA9C 4FLQA 3CZLA 5DANA 3U2CA 3KCOA 2R1PA 2WCAA 3PTKA 2OEKA 3DFPA 2XVGA 2IPGA 2CITA 3GTFA 1F4AA 1PTDA 4GI4A 4DJED 1EC8A 4HA0A 3DFYA 3QGKC 1JQXA 1F3TA 4M7SA 1BSIA 5D9NA 2YFOA 1JZ3A 3NDZA 3W00A 3PP7A 1IGSA 2BSLA 9RUBA 3CLWA 3SFKA 4RE3A 1LZOA 3C5QA 4Y90A 4IGNA 3LRLA 4J1OA 3Q45A 1R86A 1GZGA 1EPVA 3EEGA 2ADAA 1MZRA 1P1XA 1AD4A 1SW0A 5CZKA 2PZ0A 4B90A 3KBWA 1FWRA 2E9MA 3R2GA 3W72A 1P7TB 4EVZA 5EB8A 3L4ZA 2J13A 4JFTA 2XISA 3K30A 4LUIA 4J3ZA 5C9ZA 4QS6A 1SO4A 3NUKA 2TRSA 3IAQA 1IEIA 3VIGA 4P8XA 4LCRA 1JGIA 1W17A 4ROPA 3TCEA 3ZWSA 4UFHA 3NO5A 1FWSA 3KZSA 4R27A 3U48A 1LRTA 2BOEX 5HWJA 4DF1A 1I9CB 1XCWA 3N12A 1IQ8A 2XYLA 1OF6A 1QCWA 5CPMA 3BUVA 1S2CA 3OTRA 2VURA 1DIOA 3W73A 1DWGM 3ATZA 4DZ5A 4NG3A 4XV0A 1HX0A 4M6VA 3ZT5A 3UY7A 1XYCA 4C7GA 1DWAM 4PCFA 3I65A 2ZE0A 1XUUA 3MO7A 1R6WA 2QCCA 4QR6A 4YHEA 4O28A 1E4NA 1XV8A 4W9TA 1G69A 3NQ7A 1YNYA 4ZFCA 4MPKA 4S3BA 3UESA 1QW9A 1E56A 4C6LA 1AUSL 4JTDA 3AXMA 4I3GA 5K4XA 2FGLA 3MCNA 4GQRA 2AGKA 4NHVA 2P10A 1SO6A 3A3HA 3WDQA 4KCTA 1VIWA 4ZSTA 2V2DA 4MIMA 3APTA 3KHJA 4HBKA 3LHWA 5J5RA 3E2RA 3LENA 3CEUA 1U5VA 3LM7A 4AU0A 4LVGA 5AHLA 3A22A 3OW1A 2XFYA 3L7RA 1J12A 4WHBA 4S3DA 1BYBA 3QR1A 2D0HA 2XGBA 3SCSA 4JTSA 3BDKA 5D9OA 3UERA 3MSYA 4IISA 4ZXLA 2QCEA 3OHMB 5I3GA 3QY7A 4PCPA 3NQDA 4JIPA 1B9ZA 1XG4A 3DG3A 4NAFA 1PPIA 1L2UA 2C91A 3UW6A 2J88A 3WLKX 5BXRA 4PULA 1RLCL 3EA1A 1TQXA 3SCQA 3GTHA 3GR4A 3AIUA 1H3GA 3ZS4A 3KRUA 1V93A 4KRZA 4DM1A 4XK2A 4PMZA 3H2FA 4IIBA 1PX3A 1R9ZA 4LCSA 2FZ8A 1E4IA 5FI8A 2FMNA 4LUJA 1NELA 2Z4GA 1XINA 3SSZA 1DJQA 3M0VA 2BY1A 3N2CA 1NY1A 4S2CA 2A2IA 5M2FX 3CL7A 4F0KA 3HU7A 3VNKA 4C7FA 3MPGA 4NJKA 3CHEA 3O07A 2FDSA 4LJ3A 3PAOA 3DENA 1G6CA 4XAFA 1XWYA 4IT1A 1TR1A 3UYCA 3N9SA 4GVIA 3T05A 1AW5A 4ZOBA 2YW3A 5A1AA 3M7WA 3L12A 3GNRA 1NU5A 2VVSA 3O6AA 3ZQ9A 2ZOXA 3LZ3A 1G4SA 1FXQA 2WMJA 4C6DA 4E38A 3BG9A 1ZP3A 1LOLA 4MFDA 3MUZ1 5KMYA 3CM4A 4M8UA 3TN5A 2NUXA 3QZEA 3C6CA 1ZU8A 4Q4PA 5A69A 3EGJA 2YCJA 5A2BA 1JAKA 4LS2A 4GX8A 1Q8AA 1B9BA 4JDBA 1XLKA 1BYAA 1YBQA 2QCLA 5CC7A 2WMHA 5HUOA 1NP0A 3V5FA 1JDAA 4MZ8A 1I1WA 3TYBA 1PZ1A 2YXGA 2RHGA 3TKFA 1B3ZA 4XBJA 3LTPA 4ZENA 1RQEA 2BGNE 3THCA 4GYFA 1QR7A 2J74A 4FX7A 3CHDA 3NM3A 5CPSA 4UTWC 3C0QA 2DV0A 2OSWA 1TTJA 5AB3A 2R1LA 4DVOA 4X60A 3W7MA 1W1YA 2WLZA 1WA3A 3N2TA 1OB0A 2G50A 3BSHA 2OO6A 3ZR4A 2PLKA 3KM8A 4NZ4A 2YL8A 1SJAA 4PMQA 4DUOA 1XLGA 1B3WA 2DZWA 4LXFA 3DXIA 1ESWA 2IKGA 4UTTA 2Z1WA 4CQ9A 3UZWA 4QEHA 1UD5A 1FH7A 3PPFA 3RM4A 2FZMA 3BH4A 5DY3A 2OLSA 1XFBA 4JCLA 4HPJA 2VP8A 2KAUC 3ZVIA 3VIMA 2QIWA 2XIMA 1KQYA 2OQHA 4PTNA 3SRHA 4NX0A 2YYUA 2J6VA 2CLFA 1QHPA 1IR1A 4R3UA 1CDGA 1EOMA 5FL0A 3AI0A 5CBBA 1TV8A 1LUCA 1RZMA 4QDWA 4IMAA 5EL1A 2PZNA 1UD8A 3RM8A 4J2PA 2DZXA 3UGRA 1S2VA 3PBUA 4J28A 3OZOA 1ZB5A 4HHPA 3RF9A 1T5AA 1LBLA 1TA3B 2FTPA 4J3XA 1TRIA 5CH9A 5F2LA 2ABBA 3GG8A 1NWSA 3KDOA 3MP5A 3UGVA 1OF8A 1PCWA 3N6QA 3BLEA 3OZMA 5I03A 1OFQA 2CLOA 3GNOA 3RJYA 3GHSA 3I10A 3N4AA 3K8MA 4YCPA 1LOSA 5F2MA 4QQ3A 3S1VA 4GOAA 1J0YA 2VX5A 2ISSA 2QR6A 3VU2A 4Z1BA 3VOFA 4DIAA 3VIJA 1HT6A 2EKGA 4PBGA 4LEFA 1XI3A 1M3UA 1RCXB 3KL5A 5LGXA 2HXTA 5HDRA 1H49A 4LW7A 3N13A 2VR2A 5T9BG 1Q45A 5BNKA 2PI6A 5AVHA 2CEQA 5DX7A 2Y62A 4N2YA 1YDNA 1WCGA 1LLWA 2NSOA 3LQLA 3PZVA 3B0PA 3RGTA 2GJRA 2X1IA 1YTDA 3MSRA 1PTGA 5HNRA 3R8HA 2A5HA 2PP1A 1N7KA 1PIGA 2PRMA 4ORMA 1E6XM 4PMVA 2Y8UA 1RALA 3S1XA 3VNMA 4U2ZA 1OK6A 3WBAA 2E3ZA 3L4WA 4E3TA 3MSDA 4OVXA 1ITXA 3OGSA 4KFPA 1XQKA 4LAKA 1TWSA 5JH1A 1OFOA 4C90A 3SUUA 2NUYA 3MHUA 1MI3A 2ZVIA 2JF6A 2YCEA 3PZ9A 3EMZA 2QUTA 5U4NA 1YDYA 2OZ0A 1LOQA 4LANA 1DIEA 1F4HA 2DZSA 4H1ZA 1X8CA 1IIGA 1NFPA 3BW4A 4ZXOA 1VKFA 2OGJA 3E74A 3BW3A 3PG9A 3EWBX 3PTMA 1VS1A 2VI0A 4RCXA 1F7BA 2NQHA 2P88A 5D2WA 5AOUA 2W63A 2OZTA 1KR1A 2Y89A 4PRTA 3W26A 3QV8A 5HMFA 2BVWA 4D6JA 4XZ9A 3EWXA 4CU7A 1H1YA 1SR9A 2GQ3A 2VNCA 1MDLA 1HP5A 3BARA 1I75A 4CNSA 2BGQA 3UR2A 3WL1A 3FN9A 3W7QA 5CBIA 1A3WA 2A7RA 4CVUA 3B97A 4QG9A 5DT7A 1UHVA 4GD0A 4AXKA 3DH7A 2VEKA 1IR2A 2IPWA 3NPVA 4LBUA 2NZLA 3D0CA 2GK1B 3ITYA 2GVEA 5FAJA 4JNMA 1EOKA 3OLEA 1L6YA 1DQUA 3QSRA 3G1RA 3F5LA 1Q7MA 4ZO7A 4WKFA 2ZTKA 3R43A 2BB0A 3THUA 3EPMA 1DP0A 3MP3A 4YTQA 1HIZA 4GFSA 1S5NA 3W1UA 2QHAA 4PMUA 1FKXA 4M6UA 1JRBA 2AQWA 3WH9A 3T0AA 3HV8A 4G6CA 4QJ5B 1O5RA 3B3DA 4TO8A 1P0EA 1HQTA 2V38A 3AQUA 4WGXA 4BY3A 4IQLA 2NT1A 2EPMX 3GM8A 2INEA 2OYLA 1KBIA 4M3PA 1JL8A 5XINA 1TVPA 3RLHA 3DCPA 3PJTA 2ACUA 4S3KA 5A6TC 1JNDA 4BK9A 4D8AA 2YJQA 3CNYA 2ZC1A 3P6LA 2IW0A 2P8BA 3TJIA 3UPWA 4KPLA 1HJQA 2BVTA 4FX6M 4AQLA 1OZMA 3VMPA 4Q8OA 1HNYA 3PPCA 1YHTA 3GR7A 3IUIA 3MV11 1J0JA 4C7DA 3BTNA 3W1TA 1RAKA 4K1WA 1BF2A 4EK7A 4O54A 3B03A 4X0VA 1H0IA 3AC0A 1GKQA 5KZ6A 1UR0A 2O56A 3H2AA 1UH4A 3NQ8A 2O4MA 3VE9A 1F5ZA 1IWAA 4BI6A 4N9EA 2YL6A 4IFKB 3U5YA 3M47A 1WXJA 1A5SA 2D3LA 5C6MA 2GDQA 2JIEA 1OC7A 3E5BA 1US3A 3H7UA 5BW6A 3VCCA 2TODA 2I16A 4X2RA 1A5KC 2DIKA 3CO4A 5IBXA 3KBNA 1CECA 4MWAA 4DJDA 1IXQA 1W5OA 3ARZA 4WJ8A 1PO9A 4S3AA 1TWIA 4LVDA 2FPVA 1ZJBA 4QG8A 4NQ1A 3W2KA 3W4RA 3YPIA 3ONCA 1PX8A 3AXXA 3S5OA 1HP4A 3RLUA 1V3LA 1X7IA 4J3TA 3TLQA 3N3MA 1LWIA 5HQLA 1B0IA 3O7UA 3UXDA 3GSMA 4GUGA 1MQPA 3CUFA 2W0UA 1A80A 3LRMA 5CPOA 2ABAA 3WYZA 1DJNA 1GOQA 4NY2A 3LEPA 2DT2A 3DGRA 4PUJA 2JEQA 1XL9A 1G01A 2OOGA 2AKMA 4H9XA 3O16A 3H8AA 3VUPA 1E40A 1R46A 2ZXAA 5M1TA 3H2CA 1WNOA 2ISFA 4IX2A 4WKHA 3SCOA 1E43A 4O14A 1IT7A 2VEMA 3O0KA 3NPUA 1PHQA 2E09A 3VMNA 1H5YA 1L6GA 1EJXC 2A79A 1W1IE 1K1DA 1HF6A 2NLIA 3JS3A 1EH9A 3P3BA 3QC3A 5AYIA 4ZGYA 3QY6A 4Y9OA 4FLRA 3O9NA 5B80A 1D3HA 1Q7QA 3GVQA 3PB0A 3LV6A 1JF6A 3GDLA 4E5TA 4UTKA 3NZQA 1VFOA 4IPPA 2EHHA 2DIEA 4W8AA 1XHGA 3R7MA 2HMCA 2V5BA 2ZRWA 4P8VA 4KS0A 2FTYA 1W32A 1WDDA 1BEUA 1Q2RA 4TUFA 1A50A 1GVEA 5FEZA 1VENA 2YLAA 2VZVA 4FZIA 4C60A 4MKNA 1BTCA 2OGYA 1W9UA 4CN4A 1OX6A 1TIWA 1EBHA 3LX9A 2WHJA 4GZEA 4LTSA 3S8HA 3POHA 3CUZA 3M07A 2H3BA 3WJXA 1VHNA 1GQNA 4CQDA 1Y5XA 1C8XA 1ZQ5A 3VCNA 4CQBA 3CUIA 3CO8A 1NJJA 5KZDA 3W71A 2V5JA 4YS1A 1UMYA 3C8FA 5IOBA 1DXEA 4P5UA 3W7HA 2H6RA 1J01A 4W87A 4H8VA 4LAZA 1DJZA 5DMNA 5HWNA 3C56A 2NX9A 3N19B 4AD5A 1OQFA 4WF7A 4O57A 4LFYA 2FZNA 2V3DA 3PFMA 1OIFA 2Y8KA 4AG0A 2ZZ3A 3XIMA 1RSCA 3GBEA 4CEUC 2XFFA 3HMCA 3LDVA 2W27A 1TFVA 2OWCA 1ZS2A 4UCFA 3DERA 2V67A 4Y96A 4F8XA 3VGEA 1Q6LA 1E5NA 5BOEA 1AODA 2DH3A 2DT3A 1XBYA 1GONA 2PWDA 1TA3A 3RMEA 1WOBA 3UR7A 1A3HA 1E4LA 4FEZA 3G1AA 3L9CA 4UTMA 4Z1CA 2R82A 3QV6A 1FDYA 3FX4A 4GXPA 1AH4A 3LSCA 3RX2A 3OZPA 1E3ZA 2NWSA 2WPBA 3WK3A 1BSLA 3W82A 3MY9A 3RCNA 1NAL1 1WZAA 1QMLA 4HPNA 4W7WA 4XZIA 4ICMA 4L6DA 5AFDA 1C7TA 1JULA 2X0SA 3L4XA 1Z9AA 3E0IA 4Y8EA 3L5LA 2PUZA 2ZUTA 3ABRA 1BVWA 1TTPA 4EPDC 1HTIA 2J8FA 2D1ZA 3BV4A 5CSRA 1J93A 1FVPA 3TFCA 4DEFA 2Q6ZA 2E6YA 2G4JA 4IUOA 3ZM8A 3GZAA 2VFFA 4TVCA 1Z42A 3UFYA 3LPGA 3P81A 3LGDA 3CC1A 4HP5A 4O53A 3H70A 3DC8A 3C61A 4GI9A 5CSUA 2PRLA 3GE7A 4J3SA 3N1AA 4ZVJA 3R0KA 2W66A 3GQYA 4Q4OA 4OBRA 3USZA 2FZBA 3R10A 1TE1A 3QKEA 4HOZA 4I6KA 3UWUA 3QQ1A 2A6LA 2VQUA 1HKIA 4N7QA 1HJWA 1VYPX 1UQZA 1E6PA 5FJPA 4XIMA 3T42A 2I14A 4QG6A 3W2NA 4ES4A 1KXVA 4R7OA 5LHEA 4H41A 4R7JA 3A5FA 1BXNA 5HMDA 4IPJA 3M44A 1RD5A 1LQAA 3W7LA 1OCJA 1WUEA 3BMWA 4RZ6A 1KM3A 2WSQA 3C2VA 1GHSA 1JDFA 2Y0FA 3PZTA 2DZPA 4JCMA 5AN7A 3G1HA 2NLYA 4LB3A 4GQBA 2X30A 2OT1A 3M0LA 3WLQA 3OA3A 2GK1A 4JTTA 4Q7NA 2AL1A 1KRCC 3L67A 4URIA 2JKPA 4Q6XA 4H9UA 3QQ0A 4KWVA 4X2PA 3WFAA 3C4UA 4QCFA 4AIUA 1U5JA 3FFSA 3AS3A 1JPIA 1EEPA 3BLLA 2XH4A 4IQJA 3CHFA 1VRDA 2UY4A 3RHGA 1YYAA 4LV4A 2XN0A 1UJPA 3NYDA 1F2JA 1TV7A 4QGCA 3N18A 2Y7FA 4DO6A 1MNSA 3QTPA 3VC5A 3BG5A 2CW6A 2ZE3A 2NQ5A 1I8JA 2PDPA 3NNTA 3UZZA 4ZE5A 2SFPA 3QQWA 3BSMA 3PUOA 5FJRA 4C6KA 1EL3A 3KWSA 1QOQA 5LXXA 3AHZA 1NVMA 2A3HA 4AAJA 1F6KA 3QV7A 3G6LA 3WNLA 1GJPA 3VKKA 2XIBA 3RITA 2CLEA 5LA0A 4AZ5A 2P3EA 4BJHA 1UZHA 1VFFA 4B3ZA 4X22A 3VMOA 3LHYA 3M0XA 4TVDA 1OWQA 1HXJA 3TQ0A 4UOZA 4NJHA 4GVHA 2MNRA 4D6FA 1RPXA 1FWGC 1BVZA 2DQWA 1BF6A 3R8GA 4F3HA 4R9XA 2GSJA 4L4MA 1YPXA 3DN5A 1UKOA 2WAGA 3MT1A 5ABFB 5IBXC 4AY1A 3SUSA 2R24A 2F2KA 4JYFA 9XIAA 4KWSA 4Z2IA 2R9RA 4RPQA 2XH0A 2QXWA 1BG4A 3GC5A 4ATLA 4HNCA 1XS2A 4DWDA 1Z89A 3C86A 4PEEA 5LYRA 3LLXA 3GTNA 2VUNA 4FALA 1KCZA 5HJXA 4G2DA 3SGUA 2RGLA 2JKAA 4PYSA 2P5NA 1RK6A 1MW0A 2YW4A 1XLJA 3PN8A 1VP5A 3TYZA 4ADTA 4E8GA 3TNBA 5ABHA 1VD6A 1OM0A 3UVAA 3W75A 3UWQA 4W84A 4X61A 4TVUA 4GK8A 4FK9A 1R3QA 4HZMA 2XWEA 3B4YA 4FHAA 3QHMA 4G9PA 4ICNA 2DJLA 4DYKA 5F4XA 2WNWA 2A85A 1XYAA 4GJJA 3Q58A 3AHVA 4NZ3A 4EANA 3P5ZA 3AMKA 1A53A 2YDSA 1P5BA 4RV3A 1ME9A 4C6PA 1CPUA 4KIRA 4HYWA 3RPMA 1K9EA 4LYPA 1TELA 5AC8A 1FKWA 2X05A 3HIJA 1QOXA 5I3DA 4NYUA 4AIBA 1A5AA 1KWGA 4QLKA 1BWLA 3W86A 1CGTA 3VYLA 2TAAA 4L61A 1TJ2A 3VD9A 1ZHAA 1UUQA 2TSYA 1UWUA 2VGIA 1PAMA 1TPH1 3KAOA 1ZALA 1EEXA 4GUJA 2OWXA 3H2MA 3NXFA 3P7YA 1MO0A 2VX7A 4OT7A 4N6EA 5CQ1A 2D20A 2DZAA 4GFIA 2Y70A 3KZPA 1D8CA 4WSKA 4PC8A 5A95A 3GG7A 5CCZA 3ALFA 3GZ3A 3TYDA 3F03K 2QEZA 4I7VA 3LD5A 4GIRA 1ME8A 3I7RA 4ACZB 1BXCA 1VPYA 3CUJA 2NV9A 1UMLA 2ZX8A 2BLEA 2E8ZA 3ITTA 3L66A 3QMSA 2QDHA 2G8ZA 2DUAA 1ZAJA 4RE0A 2X0YA 4Q4SA 3KHDA 1H50A 2GOKA 1VFUA 3K1GA 4BS0A 4DJFA 3URBA 2ATMA 4ILSA 5EKYA 2D0GA 2Z1KA 2PF0A 3B8TA 2BHYA 3LCIA 1AJZA 1CGWA 1Q6GA 2Y7GA 4NNCA 3OEXA 3IJQA 1P4CA 3BPWA 1KWKA 2UV8G 4JKKA 1NTHA 3WF3A 1AG1O 4DBEA 3GHTA 2C1GA 2PGEA 4N0RA 1TE6A 5A6AA 5HNNA 4PTVA 4M19A 2X0HA 3ZJKA 4UNIA 1IE7C 1QHOA 3R8RA 4RDWA 5FJOA 1ISXA 2F6KA 1RQHA 4Z08A 4ERIA 4GC4A 3LCFA 3LGEA 2EAWA 1G4PA 4ZOEA 2TPSA 3G18A 4QJ1A 1QI0A 2I9UA 3CZKA 1JPHA 1JPKA 2YL5A 6CGTA 2OXNA 2QVNA 1AQMA 3ABOA 1F9CA 2HK0A 3S47A 2J7HA 2QT3A 1UOZA 1ICQA 5FF2A 1J6PA 4HU0A 2PBGA 5E70A 1WBHA 1LBMA 4WDXA 3SW6A 1R2SA 3CMGA 1NQ6A 4EWJA 5I0DA 2WZMA 3GUWA 1CXLA 1Q6QA 2C8NA 4KEVA 3MBFA 3GBDA 1B30A 3OBKA 1EQPA 3ARUA 4DPQA 4CD5A 4WJXA 4AZCA 1W3IA 2DGAA 4C91A 4HMCA 3A5VA 4JIQA 3PG8A 3RAOA 1EJVC 4XD3A 3ZJ7A 2VFEA 5D03A 1GT8A 3VKJA 1SU5A 3GS6A 2VFGA 3SCUA 1UA3A 4GCAA 2DUZA 1J2WA 3GG0A 2HNEA 4JN8A 3RUBL 3DC0A 1W9DM 2GJXB 4FF7A 1KFJA 3DFQA 3DI1A 4OKDA 3MSGA 1H7PA 2Z29A 4PCNA 4FP1A 2H3DA 4CQ8A 5HINA 1L6WA 4NRSA 3TSDA 3P60A 2ZWZA 3URAA 4Z2JA 5D9MA 1R87A 3VVGA 3TXZA 2PTDA 1BWVA 5A6MA 1W9XA 4QITA 3KCLA 2J62A 2VDGA 3BC9A 3TX9A 4YHGA 3PWIA 4XZHA 3CH9A 4JICA 2EG6A 1V8EA 5EU9A 1L6FA 3WDHA 2VZTA 2IXVA 1GVYA 4HK5A 2GOUA 5E6YA 2ZQ0A 5I77A 4MB4A 4PSRA 1KO0A 4LYQA 4FLOA 2D3NA 4QEEA 3EOLA 4PUWA 5CPQA 2C0AA 4D1JA 2G95A 5H8MA 3P80A 4O0QA 3FW6A 2KZHA 4B9YA 1R2RA 2WWCA 1UBSA 3LM3A 2HVNA 3GYEA 5A3HA 1RCQA 1CB7B 1XYFA 3WQEA 3CMFA 3F1QA 3B8UA 3DYOA 1TJRA 2WPGA 4QXIA 1U2YA 3AUJA 4XSMA 2VZUA 3IGHX 4HU3A 2WSYA 4I8YA 3E96A 1X6UA 3I3DA 4GVFA 4O18A 3GKAA 4G7EA 3T9PA 1BD0A 6ENLA 4O4VA 2J7DA 3WLHA 4TIMA 1F8IA 3PZUA 1QUMA 1ZCOA 1RH9A 4GE8A 3PFRA 3SY1A 5C71A 2QCGA 2VEIA 3N2MA 2P0OA 3G22A 5CEWA 2CFFA 5FF4A 2ATSA 2QF7A 3B06A 1KM2A 1Q65A 1FDZA 4H8UA 4PTMA 2ZA1A 2XFRA 1F3EA 2WZEA 4UC5A 1DJHA 4Z2GA 3GDKA 4UTUA 2G97A 5CXPA 4UFJA 2WJFA 1V0NA 3AO0A 3K13A 1GKPA 2W6RA 2OO0A 2BOGX 3BG3A 3CYVA 4UWMA 3V35A 4HPHA 5I6SA 3UG4A 3FA3A 1Y8BA 4MB1A 1ALDA 1VPXA 4ZOAA 3SCNA 3IIXA 3AALA 4UCGA 3WMLA 3PBMA 2G3MA 2I7GA 4DO7A 4P2VA 2RDWA 4CD6A 3O15A 4WDWA 4XB3A 2WCSA 1XXXA 3SUWA 2YDQA 3AZSA 3WUEA 2ZWYA 3KP1A 1Q66A 1V3MA 2AMXA 3IVUA 2RH9A 1JGMA 4AZGA 3L0GA 1KFBA 3NQEA 1UPMB 1GYLA 4ZTYA 1B90A 3DECA 5FJIA 1B57A 4P8WA 1NDVA 4RE4A 1C29A 4V2XA 3BK0A 1KRAC 2E25A 3QXBA 4QAIA 4ZO8A 1UBPC 5B7ZA 3NA8A 4HN8A 1FFQA 1B4KA 3LI0A 2BP1A 3CV1A 4Q7BA 4GVGA 2VVNA 3GB6A 3QJAA 2ALDA 3M5ZA 4XD5A 2CCRA 1W1VA 1T99A 2W79A 4H7CA 4M5PA 2Q8XA 3HQOA 3OIXA 1UR4A 3EXTA 3T09A 3KBJA 3GIYA 4L65A 1R38A 3OGVA 5DQPA 4CQAA 3FIGA 2V3GA 1UP0A 3MW7A 4D6GA 2YA1A 2AKZA 2D23A 5IDZA 4J40A 4A21A 3BAWA 3NPWA 5XIMA 1MEIA 3H2EA 1KB3A 3W87A 2CHNA 1VLIA 3FYYA 2GL5A 1O7AA 3NOEA 2P53A 1LRNA 3GIQA 4CLMA 1JFXA 1KFCA 4OFCA 1OFAA 3AISA 3G2GA 3W7NA 3G1YA 3BJTA 1KTBA 1XLBA 4FSAA 4KGLA 3PWGA 3REQB 2B7PA 2PDMA 3U2EA 4EF9A 1A3XA 2WMKA 3H7RA 5D2VA 1XRVA 4R5EA 2EJAA 5CPNA 4UQAA 3T2OA 4N9DA 2HRWA 1TJ1A 3NWRA 1JJKA 1U5HA 3DI0A 2VCCA 4I6VA 3BE7A 2E67A 3WH8A 1QT1A 4LUSA 3S46A 5T9CE 4ICCX 4AWTA 1DBTA 3W1PA 3TZFA 4TX6A 4AF0A 1XC4A 1CGVA 1P1MA 1BKHA 4DJDC 3ME3A 4YJ5A 5REQA 2AAMA 1RJRA 3ABXA 4LGXA 4DXXA 4AVFA 1GOWA 1JYVA 4NJJA 4BQ2A 1UWRA 4KMQA 3U8GA 1LBFA 1NWTA 4RNJA 5DXXA 1POJA 3LMZA 3BURA 3LPPA 5FIPA 2GJPA 1PCKA 3R79A 1OX4B 3NQFA 4DBDA 4AYGA 3CWNA 3GH4A 1TVLA 2J79A 1UKTA 1LRQA 4MLRA 5GPRA 1OYAA 1JR1A 3WUBA 4NYYA 4PMJA 1DWFM 3CZ8A 4N9CA 3R25A 2EPKX 4IJBA 2J75A 2GWGA 2J24A 3B8VA 2CWXA 1VBJA 4X3ZA 4KT2A 5BU6A 1HN1A 3OLIA 1K8CA 3CPRA 1QXLA 4W4QA 1I2NA 4PZVA 1S5MA 2DZBA 2OB3A 3W1MA 2Q09A 4GWEA 4C6OA 5A2AA 4XZWA 4DELA 3GDRA 4FR6A 1W2VA 5E0CA 1A5UA 2PDQA 5D8ZA 2B7NA 4C1NA 1V7YA 2BVDA 3B05A 4NUWA 3F5KA 1FCQA 4PSPA 1AMKA 3SBFA 4UR8A 5BXTA 3WFZA 4FO4A 4GIYA 4GKLA 3UVIA 1KFLA 5LZLA 2ZVRA 1KD0A 2PU0A 2X1UA 4IMGA 1EO7A 4U33A 1FTXA 1GPWA 4WOZA 3V75A 3VX0A 2C19A 3VDCA 2UWFA 3L5AA 2CNCA 3AWOA 3TW9A 3BJFA 3P62A 3W7OA 2YBTA 4CU8A 5HULA 2HISA 3ANUA 5ABFA 4UB9A 3RR1A 2V3EA 3MZ2A 3AUOA 2GLKA 4I5XA 4IZGA 3BLIA 4US6A 3QRHA 1IGWA 1TVNA 2P50A 3CQIA 4IQEA 3TH6A 1GZ1A 2PC4A 3CYJA 4JIRA 4O11A 1HZYA 3L4VA 4NZFA 2QMKA 2CESA 3QHNA 1KRBC 2DT1A 2C16A 1LLZA 1QI4A 4YL2A 4HNVA 1K3UA 3W76A 5DCEA 3CZGA 1PL9A 3LCGA 1Z32X 2EG7A 4W93A 1M6JA 4PBFA 3OIHA 1AJ2A 1TMLA 2ZRXA 3U7VA 4DJEC 3EYPA 5HK4A 4AMCA 4GH3A 3SZ8A 4HTYA 3RXZA 3WH5A 4BF9A 4A05A 1V0LA 2X41A 1YE6A 4LC6A 5E0KA 1TUXA 1S1RA 4AIOA 1Q4NX 1UB3A 4FA3A 3TYEA 2FGBA 3L21A 3W6LA 2FVKA 3WBYA 2RDUA 1JCJA 4HSOA 4AZ7A 2CIPA 1XC6A 2QDDA 1KM0A 2X8RA 1SM9A 3RU8X 3W2LA 1XIGA 1LORA 4AZ6A 4CCZA 1CEOA 3G1SA 5FD0A 1W5MA 1FHVA 3MHGA 3K1DA 3AWNA 4KWWA 1U1HA 2C7FA 3VM5A 1HVXA 1VCFA 1R3RA 2J25A 3EMCA 3NQVA 3D5HA 4K3ZA 4Y9AA 4A22A 2AL2B 4CD7A 1ZZMA 1EO5A 4HJFA 1J10A 1WKYA 4ML9A 4LX4A 4DWSA 3TWBA 2OR2A 4BKNA 1OFDA 2A3LA 4LS0A 3AICA 2Z7GA 1VFTA 1W3KA 5K9DA 1PS9A 3K8KA 4AX6A 4FXFA 5CJ5A 2YPIA 3BCJA 1NOWA 2WOQA 2Z27A 1MDRA 1L2QA 3LBMA 3MKKA 3PUDA 1T8XA 4A35A 1M04A 4PCSA 1TV4A 2VRQA 1FWNA 3STGA 1IF2A 4JTFA 3SCWA 3SCPA 3AYRA 1PE1A 2I56A 4ACYA 5I3HA 1R3VA 3S2LA 2P1FA 4ASTA 4QJ4B 1H63A 3WQ6A 3E49A 3URNA 1FBAA 1FX6A 4FIQA 4UMAA 4UMBA 1GVFA 2GGGA 4MDOA 2JFEX 4IFKA 3W6YA 2A3BA 4LAUA 4MZ1A 2C18A 2GUBA 1UIPA 4RZ4A 1DWHM 2Q71A 1PZ0A 1UPPA 4LUYA 4N4QA 2WYSA 4IXXA 3LQGA 1H7WA 2QPUA 2Y5JA 3UJ2A 1EDGA 1EXBA 2WZIA 3U57A 1KFWA 5IRPA 1R9YA 4MNMA 2C71A 5HPCA 4CCEA 2PD9A 3AIVA 1EJRC 3AYVA 1K8XA 2FFCA 4PB5A 4MWAB 4XD6A 4NAEA 3B9EA 2CZDA 3AOFA 4IJCA 3C3NA 3FHQA 3RLGA 1NDWA 3G1FA 3ZLGA 1TWDA 3MI3A 2GUUA 2VR4A 6REQA 4JKLA 5D32A 2GPTA 3W23A 3C52A 3U4FA 4XISA 4DUXA 4XZBA 2QV4A 3W7RA 4NL1A 5CLTA 2ZX6A 2A3AA 3A13A 5A6JA 1YMYA 3CB3A 3A21A 4PTDA 2Q3OA 4QIUA 3JRKA 3RX3A 1N2VA 3QGVA 4FS9A 2QCDA 8XIMA 1GYNA 2ZA3A 3FGCA 1DWJM 3MWCA 1SJDA 2HROA 2J7EA 3DYMA 1TWWA 1H5VA 3TMQA 4C6JA 2CKSA 1LP6A 3ABZA 1HL8A 4NXKA 5D30A 4M1RA 3W7GA 4B91A 3S6OA 4OIFA 2QDGA 4O4WA 4JEJA 2VELA 2CPUA 1N8FA 2BZNA 2OKTA 3NURA 3W7DA 2D0FA 3ZSSA 4HCLA 5CSSA 2QPXA 1PXGA 3MC5A 5AZ0A 9CGTA 4WR3A 2Y4SA 1HJUA 3GTIA 2E68A 2H9AA 4IM4A 4AVNA 4N02A 3WF0A 1R85A 2PD5A 4FMVA 2ZCGA 4BEUA 1JYWA 3GXIA 2VXNA 3B0VC 3FVDA 1JI2A 1XDMA 3WELA 4L6HA 1WXZA 5AHIA 3WEOA 1XIJA 3PHAA 1XLAA 4V27A 2VRJA 3E02A 4W88A 3M43A 1QPRA 4D72A 5AHMA 4KCUA 3KRSA 4DI9A 1M65A 1K02A 1H60A 2VRKA 5GVJA 4O0KA 4J7RA 2ZZ5A 2HEJA 5H8PA 3KW3A 2VOMA 3VNZA 1CXIA 1JIBA 5DF0A 4XUYA 4WY0B 5DN1A 3PM6A 3OYZA 2ZUWA 2CZVA 1MUMA 3GIPA 4J2MA 5BYWA 4GC3A 1S38A 2PP3A 3L68A 4H6EA 5FAGA 1DE5A 1WUFA 4DM2A 2JALA 2Y6ZA 5HQMA 2VC7A 3OHIA 5T26A 3UWVA 3V1PA 3IV3A 3ZVHA 4WXZA 5EFDA 3TW7A 3PUEA 5K3VA 4R7WA 3DBNA 4BEQA 1I2OA 1KTNA 4M6PA 5I7GA 2EPOA 5CC5A 4GYPA 3V0TA 2REQB 4KH2A 1OCQA 1PKNA 4RXGA 4LBRA 3KEHA 3U2ZA 4ZQPA 1G5AA 6PTDA 3GD6A 1DORA 3WD2A 3WF1A 2OSXA 4PUNA 3T1GA 3BMVA 1E5JA 4L56A 1BXBA 1UA7A 4Z1DA 2GWNA 4AB4A 1F05A 3O3RA 3OVPA 1T96A 4MY1A 1UR8A 3UA4A 4ACZA 1V7AA 5CG0A 6TAAA 3A47A 3LY0A 1MZHA 1H4PA 4IPNB 3OG3A 1K4HA 2EPNA 4R9OA 4RXFA 5FJUA 1OC5A 1WO2A 1TMHA 4IGSA 2D2HA 3T40A 3DFOA 4QE5A 3TR9A 5EMYA 3BJSA 2NXIA 3BLPX 2CBVA 3E5PA 4LAMA 3EKGA 4ZODA 2YZRA 1IV8A 3WH7A 1E70M 4PODA 4AEOA 4K8EA 1LL7A 2NW0A 2D2JA 4JIEA 2OEMA 2OPJA 3WENA 1L8NA 1ZL1A 1X1NA 3VXGA 1Z48A 1AH0A 2QW5A 2QNEA 3A24A 4LF1A 1W1TA 1EYEA 3SY8A 2YB4A 2WMGA 3ARVA 1EJ7L 5F7UA 1ZBKA 5TIMA 4Q3MA 1EP3A 2XWDA 2ZFAA 4QQUA 4DZAA 1S2TA 3AYSA 4FNUA 8RUCA 2CBUA 3GHRA 3KOFA 4MY9A 1Y5WA 3WJZA 3NSNA 1FA2A 2PDGA 3LYEA 4ZO9A 1XGDA 3CUHA 4TU1A 2RKXA 1CZ1A 2ISVA 4BQ5A 3FEQA 3CTTA 3KFTA 4V28A 3KBVA 3B9OA 2DZTA 1HJXA 3B8IA 4IFOA 3N2XA 4EIVA 5G2HA 4ZQNA 1KV5A 1EDQA 5BROA 1FWIC 4MKSA 3T4CA 4F9DA 2ANUA 5LIWX 1QASA 4UTJA 3ZYZA 4GA8A 1RP9A 2W3ZA 2L5HA 4H01A 3L4TA 4E0CA 4KRTA 1A5LC 3W70A 3SADA 1H2JA 1BYCA 3IGSA 5TNVA 4Q4QA 4EPEC 1SO5A 3CZJA 2POZA 4QLLA 3TQKA 4S3CA 5HR7A 3A64A 4M29A 4PH6A 3G1DA 5D2YA 3MWAA 4K7YA 2R6OA 4P7NA 2WM1A 1VFSA 1F3XA 3PY2A 3ZXWA 4HZ7A 3QGAC 1YDOA 4J3WA 2ZX5A 2F84A 1RVKA 2QJGA 1BLIA 3L2IA 4OU1A 3UWEA 3R13A 1GORA 3RO6A 4EKJA 3T2PA 3T8LA 2EEXA 1VRXA 1TPC1 1ZENA 5EY5A 3E12A 4OBSA 5BRBA 3C0LA 4DX3A 4HMEA 1FH8A 4I7UA 1NWUA 4HTBA 1RD6A 4DO5A 1OIMA 4HKPA 2UY2A 7ODCA 1ZCCA 1KBBA 1W91A 4NNAA 1UD6A 3MZNA 1IYXA 4GG9A 3AAMA 3G1VA 3TONA 4Q8UA 2BASA 3GW3A 4FNPA 3WLSA 4QE4A 3RFAA 5DXYA 1TPUA 3QW3A 2CXEA 5CAHA 1ZPTA 1T0OA 1D3CA 3SN1A 3EMQA 2AQVA 4GQ0A 2J7CA 2V30A 1A5CA 3W37A 1GVRA 3G0SA 1L6SA 3CS2A 4U3CA 3T8QA 7A3HA 1ZBWA 1JFHA 2ACRA 4ADSA 3C2RA 1GOXA 2PLJA 3W7CA 2IKHA 4U4MA 1XJBA 4F0MA 4QBXA 2VGBA 3WZ0E 1PYFA 2R1KA 2DUXA 2FPTA 3S9ZA 2CU0A 5AYXA 2C6QA 4LEQA 4LYRA 2VJXA 1G4TA 3B40A 5G4EA 3WUFA 2G3FA 1H61A 3VC6A 3SQLA 1Q5MA 3E9AA 4CU6A 4GUFA 3A4JA 2ZKMX 4B5VA 4TR9A 3LSBA 3NQBA 3WLNA 1F6PA 2GQ9A 3SM0A 4AZIA 7XIMA 4Q4MA 4ML4A 3FV9A 2OKOA 4MUPA 3JR2A 3UZYA 1A5BA 2D73A 3IAPA 3MYPA 2TYSA 4PEKA 1DL3A 2CBJA 3P0WA 1UROA 3NR0A 1W5PA 4LCQA 3S9IA 3B0XA 1V02E 5XIAA 1GTHA 4UOQA 3IWPA 1D7FA 2X2YA 3R0UA 3QR3A 4LSBA 3FA5A 5AC4A 1W37A 3M41A 2E9BA 2GGHA 4GX9A 1I1XA 4YLWA 1UR1A 1KC7A 3A9IA 5FJTA 4M80A 4H9TA 1CXHA 3QFWA 3TOPA 2Q8ZA 1I0BA 3AU6A 1TG7A 2DVUA 4Z0SA 4UTHA 4MOZA 1ZBCA 4S1FA 1UUMA 5JVLA 1KM6A 2O55A 3T81A 4DUVA 3BGGA 2XM2A 5MKGA 3A6OA 2TMDA 4QX4A 1RPKA 4QCEA 4A3UA 4HD5A 4CNTA 4O1FA 4ZBCA 4NSBA 4AZBA 4UR7A 4TMCA 4JNYA 4O10A 3EXSA 1D9EA 3WLIA 3O6CA 1R30A 1UP3A 1XW8A 4BR1A 4ZOCA 3LPOA 4LBSA 3W0KA 3O2LA 1E6ZA 1W3HA 3FHAA 3WLLA 4UIOA 5FJJA 3KVJA 5AYYA 3TYUA 4ZMGA 2E28A 3WKZA 2Y7EA 3FXGA 1QAPA 2VENA 4QNWA 1SGJA 3UG5A 1QU4A 1TV3A 3FNDA 3L2LA 4C5ZA 4H7ZA 3DKJA 1AMYA 3AROA 1CWYA 3DU0A 4D8LA 1NEYA 1DQWA 3NVDA 4RV8A 1YKWA 3MANA 5CJNA 4TOQA 3HOJA 1QNSA 3W7IA 3WLTA 3UT0A 5DRCA 2PDYA 3HPZA 1X98A 1C92A 3M16A 1CGXA 2XSBA 5AC6A 1F61A 1YTKA 2DSVA 1EA0A 1M1BA 1CGUA 1UCWA 4B5UA 3F2BA 3UG3A 4P61A 5T91A 1C9DA 4PMXA 3U9IA 2E9LA 1IWBA 4F79A 2WNQA 3WBEA 3CLMA 1OJXA 2QPSA 1PJ9A 2PGWA 3O6DA 5FKYA 3R0DA 3LN3A 2FB2A 1QPNA 3MVTA 1DIDA 1FHDA 2NV1A 4YU1A 2WMIB 4L9ZA 2R14A 3PJUA 4K36A 1WYIA 3G8RA 3P84A 3QSTA 4L1GA 1BQCA 1SVDA 1YQ2A 3QH2A 4D6EA 4JZ5A 4JKMA 3QOKA 1XF0A 2B7OA 4RUBA 5E9XA 1GOKA 2X1TA 1B3VA 1XSKA 1QTWA 3EA2A 2CLHA 4GKTA 4HYRA 1XLFA 1EF3A 4RDYA 4WJEA 1NOFA 4KGJA 2GJLA 1I60A 4FI4A 3QYSA 1P7TA 3I3EA 5CGQA 3W7PA 1EX1A 3DHFA 4CD4A 3EOEA 3ZR6A 3T0DA 1EBGA 2VR5A 1W5QA 2I17A 3IGXA 1IHIA 1Q63A 3BANA 1FWHC 2QJNA 1QNVA 1XD1A 3CPGA 4P7RA 3KTXA 8TIMA 3CK5A 1E0WA 2VC5A 4DYJA 3M5XA 2F61A 2WJDA 3MUAA 5HATA 4A4AA 4J4KA 1CNVA 3GXNA 1GEHA 3NZGA 2CLKA 1HKKA 2IPFA 2H90A 4EX4A 1VFLA 4Q7IA 2O7SA 3LOTA 5CSYA 3S1UA 1GTEA 5DT5A 4C6EA 3W27A 1HKJA 3HPFA 3PZIA 3B9NA 3SCTA 3A23A 2YA0A 4EF8A 3SO7A 1CLXA 4IGHA 5G1MA 1VFHA 4K2SA 4HSNA 1R7AA 4AD0A 4MMWA 3T0TA 3W1LA 1SR0A 1FCBA 1W6TA 3NO1A 3IIVA 4MG4A 3VOIA 3OO2A 1TO3A 3TEVA 2QULA 4JFVA 3OBEA 4WK9A 3W3OA 3WNOA 3HZ3A 5JIWA 1TSIA 3OYXA 4DHGA 1XKJA 3P93A 1E6NA 4QJ3B 3UR5A 5FF0A 1JUBA 3FYOA 4J3UA 2E6DA 3CPUA 1E55A 1OK4A 3L23A 4JHMA 3MTWA 2VT0A 2OTDA 2NUWA 3CH0A 3N4EA 3HM7A 1VCVA 1N8IA 3MKVA 2PPGA 1U33A 2E6FA 3QF0A 3NQ2A 1ZRQA 3HO8A 3UCCA 1JRCA 2OLAA 3LPFA 3NOYA 3I7SA 4CGTA 4EXBA 5DO8A 3QPZA 4XO6A 3WIJA 5F2GA 1YPFA 3P14A 3IS4A 2WZTA 3HA1A 3L4UA 5FL1A 1SO3A 2CERA 3M7SA 4F2BA 1OC6A 1UZ1A 4CNPA 1MUWA 3JZEA 1NFBA 4U10A 5D2TA 5KZEA 2WVTA 4BA0A 2V6AA 3GNPA 1GPFA 3BQ6A 3CB8A 3QLDA 1NSJA 4CKQA 3SGGA 1YNPA 2O7QA 4EXQA 3NG3A 4UQBA 4MM1A 4MNLA 3OODA 3S1WA 2PDHA 4YWSA 2WHKA 4FXRA 4MY8A 4HSHA 1UWQA 1SZNA 3T08A 1DJGA 1T40A 3QOMA 3NM1A 2WQPA 4DPPA 4ZQRA 3MKCA 4X63A 3WEZA 3I68A 1ZLPA 2QIIA 1PKMA 4YXGA 1QPKA 2EPLX 1B54A 4H3DA 3KXQA 3V3WA 3BLOA 1WV2A 3W84A 4A8NA 5ENLA 1P0NA 4ZEPA 4LRSA 1VB9A 3THDA 1JEZA 5I2UA 1I4NA 3HG2A 3BSGA 5FA5A 1CLVA 4NT0A 1HL9A 4F0SA 5CZJA 3S4TA 1GYMA 2ZUSA 3KP0A 1XIIA 1OEPA 3A3WA 3GUGA 3MUCA 4Y8FA 4D6IA 1SFTA 4PMRA 2PGFA 4R88A 4XKMA 4GO8A 1YXYA 3IJLA 2HJPA 3OPSA 1V79A 3CAKA 1NOUA 5A94A 1KGXA 2PWHA 4DAFA 5EBAA 4Q32A 4PUMA 4HA4A 3CAVA 1RA0A 4CCCA 1VJZA 3XISA 4DWSC 3QEZA 6TIMA 1E51A 2PWVA 3PBYA 1UW9A 1OZQA 2GVJA 1YW1A 1SFSA 2Z24A 2GGEA 4GACA 2GQAA 4HU8A 1M41A 3QM3A 3EPNA 3IJ9A 3M6DA 4UTFA 1LROA 3WLRA 3FS2A 4KWUA 3UCDA 2I57A 1IEQA 1S5WA 4MTVA 1W3TA 4L1WA 3NL5A 1J96A 1MW2A 3KVMA 4RNIA 3DESA 2QUUA 3VILA 3UF9A 5G4HC 1JZ4A 4TTGA 3S0C