1YE4A

Crystal structure of the lys-274 to arg mutant of candida tenuis xylose reductase (akr2b5) bound to nad+
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPRSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFNDPWDWDNIPIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fine tuning of coenzyme specificity in family 2 aldo-keto reductases revealed by crystal structures of the Lys-274-->Arg mutant of Candida tenuis xylose reductase (AKR2B5) bound to NAD(+) and NADP(+).
pubmed doi rcsb
source organism Candida tenuis
molecule tags Oxidoreductase
molecule keywords NAD(P)H-dependent D-xylose reductase
total genus 105
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ye4A00
1T40A 4PRTA 1X96A 2PDQA 2IKGA 3LNMA 4NKCA 3BV7A 3GHUA 3M0IA 4GQGA 4IJCA 3P2VA 4ICCX 4GCAA 2BGSA 4G5DA 1YE4A 3KRBA 1HW6A 2PDWA 4XVDA 1PYFA 1Z89A 3B3DA 1ZUAX 3LQGA 3RX2A 3LZ5A 3V0SA 4GIEA 5LIWX 2I17A 2PDNA 4H8NA 4PUWA 4JQ1A 3GHSA 2FZDA 4FAMA 4WDTA 2R9RA 4PMJA 5HNTA 4XZIA 1SM9A 2FZ9A 2NVDA 3LZ3A 4JTRA 1RALA 4WDXA 4QXIA 3COTA 1PZ0A 3BURA 3LD5A 3EAUA 4WGHA 5DANA 2IS7A 2PDBA 2ACUA 1ZGDA 4PR4A 4XO6A 2PF8A 4YU1A 3UFYA 3WBWA 2VDGA 3CAQA 2HE5A 3UWEA 4YVPA 3EB3A 5JH2A 4XZMX 1EF3A 1YE6A 4ASTA 4EXBA 4AUBA 2F2KA 1VBJA 1JEZA 2FZBA 4OTKA 3WCZA 4F40A 2C91A 2CLPA 4YVXA 1EL3A 4EXAA 4LB4A 5HA7A 3ONCA 2HVNA 4LBSA 4LB3A 3UZWA 1A80A 3MC5A 5LIKX 1US0A 1AH0A 2PD9A 1GVEA 3R58A 3R6IA 4HMNA 1S2CA 1LWIA 1RY8A 3S3GA 2PDPA 2BGQA 2BP1A 1XJBA 3V35A 2PDKA 1QWKA 3M64A 4XO7A 2IKHA 3FX4A 3UZXA 4LAUA 2NVCA 2PDIA 3ERPA 4JTDA 1Z3NA 1YNQA 3UZYA 2ACQA 3D3FA 1RY0A 2PDMA 2IPJA 3ONBA 2HE8A 3MB9A 3GUGA 3BCJA 1M9HA 3M4HA 3Q67A 4LBRA 2PZNA 2ISFA 3V0UA 2PFHA 3R8GA 4GACA 2HEJA 3LEPA 3BUVA 3CV6A 1AZ1A 1T41A 2INEA 4DBWA 3CMFA 4XZHA 2HDJA 5AZ0A 1LQAA 3V0TA 5LIXX 4JTCA 3H7UA 1S2AA 1IEIA 2WZTA 3GHTA 3UYIA 5LIUX 2J8TA 2ALRA 3UZZA 1ZQ5A 1J96A 3U2CA 1Q5MA 3UG8A 3G1RA 2HV5A 2IPFA 3G5EA 3WBYA 2PEVA 3LBOA 5LIYX 3RX3A 4YS1A 3CASA 3VXGA 1EKOA 1Z9AA 3H7RA 1AH4A 4PRRA 4L1WA 3CAVA 4JQ2A 1XF0A 3O0KA 4R9OA 1MRQA 1AZ2A 4L1XA 5C7HA 3V36A 2R24A 2WZMA 2PDUA 4JIHA 2AGTA 4Q7BA 4H7CA 3T42A 1X98A 4JQ3A 4JIIX 2F38A 1VP5A 3UP8A 4FZIA 4WDWA 1FRBA 3WG6A 3R94A 4LAZA 4Q3MA 2A79A 3DOPA 2PDJA 2PDYA 3LQLA 3O3RA 2IPWA 4PUUA 2I16A 3R43A 5JH1A 2PDFA 1S1RA 3QKZA 1Z8AA 4XZLX 1EXBA 3R7MA 2HVOA 2PDGA 4GQ0A 4HBKA 4FA3A 2FGBA 4ZFCA 2IKIA 4WEVX 4XZNX 1C9WA 3DN5A 2P5NA 3F7JA 3NTYA 2QXWA 2IPGA 4XVEA 3LN3A 1PWLA 4IGSA 2IKJA 2PDXA 1MI3A 4XK2A 3C3UA 2DUXA 1QRQA 3WBXA 4IJRA 3N6QA 2PDLA 2IQ0A 2FZ8A 4XAPA 2PDHA 4QX4A 1AH3A 1AFSA 2IQDA 1K8CA 1ADSA 2DV0A 2INZA 2PD5A 1ZSXA 3UGRA 3RX4A 4FALA 1XGDA 4JQ4A 1IHIA 3CV7A 3R8HA 1S1PA 2PDCA 1YNPA 4JQAA 2FVLA 3H4GA 1R38A 4JTQA 4JIRA 5HNUA 4DZ5A 1UR3M 3N2TA 1PZ1A 3GHRA 4MHBA 4DBUA 2DUZA 3EB4A 4RPQA 4WDUA 4GA8A 2ACRA 5M2FX 3FJNA 5KETA 3Q65A 5AZ1A 1X97A 4QBXA 4WRHA 3LENA 4DBSA 1PWMA 1HQTA 1OG6A 1MZRA 4GABA 4YVVA 1Q13A 3LUTA 4JTAA 4QR6A 2ACSA 4I5XA
chains in the Genus database with same CATH superfamily
4G7EA 1KR1A 4POCA 2PGEA 5FF0A 1BXNA 2GDVA 5G2WA 1KBKA 3P82A 1GG0A 1QI2A 1EPXA 5JVLA 3TEVA 1GVIA 1YE4A 2BODX 3B3DA 4DWSC 5AHIA 4EF9A 2OZ3A 1PHWA 1WBJA 1WO2A 3LZ5A 1JNDA 4PEKA 2YDQA 1FA2A 4UQDA 2ZRZA 2OO6A 3T4WA 4CU7A 4LCQA 1GKPA 1Q6EA 3TFXA 4OV9A 3PJTA 4G7FA 3FDKA 4YTQA 3SCVA 3PTMA 3SFKA 1R7OA 1TVLA 4H41A 4MUPA 1BSIA 1SM9A 1UP0A 1ZY9A 3FYOA 1TV3A 1ITXA 2VUNA 3FHQA 1XINA 1S5NA 1TUXA 1GJPA 2BY1A 4JTLA 4OHQA 1UIOA 2XIJA 4UFKA 2Y85A 3IJLA 3W24A 4YU1A 3O15A 5RUBA 1GKQA 2F61A 3H12A 1DJWA 3A3WA 2FTPA 3LGEA 4D6HA 2WLZA 2ZE0A 2Z29A 4MNLA 1B30A 3O6YX 4CGTA 5BWFA 4Q4MA 3QMRA 1P1XA 4OT7A 4OTKA 3RCNA 4PTNA 1JQXA 1FHDA 2G3JA 3G1XA 3T4CA 4EXAA 3UJRA 1YDYA 2JEPA 4IMEA 1ZB5A 3W1MA 4FLOA 2ZXQA 3T09A 3PC0A 5BCAA 4KCVA 4B15A 2OWCA 2NQ9A 3B8VA 1JPDX 5CJ5A 2B4GA 1UR2A 2HBXA 3GFZA 1L6SA 2CZVA 1VFTA 3WLLA 3BO9A 4XAFA 3AXIA 2JIWA 4PUEA 1ISYA 5K9DA 1YPFA 2W3ZA 4OECA 2CZDA 1XSKA 3IUIA 5FACA 4E8GA 4GJIA 1OVDA 3B8UA 1M53A 3PF3A 3RNDA 1Y8BA 3VM5A 3CBWA 1YX1A 1NOUA 3P81A 3RHGA 2BVYA 1C8XA 3BAXA 4AHOA 3OVRA 2WHKA 4RE0A 2Q8XA 4Y96A 3WLKX 4LVDA 3W88A 4BF9A 2Y62A 3W7QA 1EUNA 3A3XA 3M0JA 1E5NA 1W5PA 4NT0A 2HDJA 5AZ0A 1PYMA 1AJZA 1GYMA 4JEJA 3TN6A 1QHZA 3C86A 3LGDA 4HPHA 3L0GA 1UZDA 3JVAA 2VGBA 2QW5A 2DSUA 3W1NA 1TMLA 3K4AA 3C8FA 2ZA1A 3IACA 1WV2A 4V27A 4N0RA 5CZJA 1J0HA 2Z24A 3D3AA 5AHLA 3UWQA 2GQ8A 5H6HA 3A64A 1VGAA 3LBCA 1XDJA 1AZ2A 3BG5A 4XQ6A 4FIQA 1Q4WA 4MJZA 1MW3A 3VZYA 1CGVA 1B3XA 1BLIA 5BRPA 4DJFA 2I5IA 4PULA 3T08A 3ZMRA 1T7LA 2JKPA 5CZ0A 2OYMA 2XSBA 3JS3A 3VIKA 2H6RA 2DUAA 1IXNA 1FWSA 4N7QA 2CLLA 1W5QA 3DOPA 1W1YA 1CW2A 2KZHA 1U30A 3PWGA 3W1XA 4ZL1A 6TIMA 3VD9A 1JZ4A 3OG2A 3LOTA 1Q7QA 1OEPA 1UH3A 3RU8X 3ZO9A 2YLAA 2DQXA 4LPCA 2D23A 4OKDA 2QAPA 3DYMA 1KCZA 2QIIA 3FKKA 3RMJA 1GZGA 3BAJA 3GXNA 3B8DA 3H23A 4XIMA 1WX0A 2RDXA 2TPSA 4YTTA 2WZIA 1XR2A 2WJFA 5A8NA 2KAUC 3A13A 1UG6A 1XLBA 4Z08A 3SN4A 9XIMA 2O55A 4U4MA 2QCMA 3VKJA 1GTHA 4F0RA 5D8ZA 3TYCA 3N6QA 2XVLA 1AMYA 2YXGA 2DZWA 1XIGA 4PUDA 4QX4A 4AAJA 4C65A 1RQHA 1OCNA 2DW7A 2DIKA 2PLMA 1ZCCA 1W91A 4RZ5A 3GU2A 5AC5A 3S1GA 3DESA 3WL0A 1X1OA 1BD0A 3ITXA 1RVGA 3I7SA 3S5ZA 4D6IA 2VWSA 3LHVA 2DP3A 4ATDA 1XH1A 1AQFA 2QUVA 2JF7A 3SCOA 3H4GA 2PSNA 4MYXA 1R47A 4GYJA 3BE7A 1W37A 2TRSA 2GYIA 3WQ6A 3W3OA 1W32A 4B9YA 4R3UA 4UTMA 2CLEA 1C92A 1XX1A 1EC9A 3OLDA 4GK8A 4EOUA 4H6QA 1ODZA 2G97A 3M0MA 3W1PA 3TW9A 1QNQA 1B31A 1PZ1A 2ISSA 5HBFA 2E6DA 1DEDA 4HYVA 3E2SA 1U5VA 1LL6A 3AMLA 4LFYA 3BLPX 1TTIA 4XAYA 2FZNA 5KETA 1Q6GA 3BCDA 4MWAC 2PRLA 1REQA 1TV8A 5T9BG 4R7WA 4IISA 3OGVA 1LG2A 3ARYA 4JTAA 3NOEA 5KMYA 2FMOA 1A5UA 3L65A 1BQCA 3GHUA 3CZGA 1QPOA 4AX6A 2GSEA 4YWSA 1EUAA 1TTJA 3GX9A 1BEUA 4PTDA 2BGSA 1OFOA 4PMZA 1UZ4A 2GJRA 1VEOA 2OOGA 2DQWA 3MT1A 1CXEA 1AW5A 1WDQA 1UWTA 4XSLA 4O4WA 2DJLA 2EGZA 2PI6A 3N04A 4LAMA 4BJHA 1E0TA 5CBIA 3S4TA 4FF7A 1FH7A 4HU0A 4JNYA 1HO1A 4TQTA 1YTDA 4DXVA 3KCOA 4WDTA 4YPJA 4BKNA 5E9XA 4G7EB 1ADOA 1L8PA 3W85A 1IYXA 3PBUA 4KEMA 2EG7A 1KV5A 3LZ3A 3W6LA 3EMCA 1C3FA 4ONVA 1UOKA 3UWZA 3VNKA 3T78A 4QXIA 3ITOA 3LHYA 3O7UA 1IZCA 4CU8A 2VJXA 3BG3A 5I5RA 1RP9A 2VZVA 2TAAA 1S3TC 3PNUA 2WCAA 4ATLA 3STPA 1T8QA 4NNAA 4KF1A 1XFCA 2GFTA 5BXSA 1JZ8A 1UKSA 1XYLA 3H6OA 2ZIDA 4CD7A 4EAYA 3LXAA 3KZSA 2WW5A 1HZYA 2R1NA 1T96A 4K38A 4J9JA 4MWAE 1JCYA 1JL8A 4JKLA 3O6DA 4O1EA 1H7WA 1QR7A 2QGYA 3R0UA 2Z27A 1I1WA 2DH3A 4JX6A 5DLCA 3UT0A 3KOYA 3I7QA 4PMXA 2F8QA 1GQIA 3H2OA 5IDZA 1LT7A 2VFHA 3IJDA 4XG1A 4HVXA 3MMDA 2WKLA 3MC5A 2CETA 2ZTKA 3HGRA 4NSBA 2V82A 3VDAA 3F03K 1T6MA 1ONWA 3MMTA 3KRSA 2OLSA 4OWGA 4PH6A 1S2WA 1J10A 4QCEA 1O68A 4GC3A 3PK7A 3BW2A 4LVAA 4UTTA 4KKXA 2D20A 1JPMA 3E02A 5HJYA 3VPLA 1OX4A 4GGBA 4IIFA 5G2IA 1JQVA 2EJAA 3FX4A 4IP5A 1SSDA 2QVHA 3VUSA 5CPNA 6A3HA 3ALGA 4HZ7A 5A6BD 3E38A 2ZTJA 1JD9A 1WZLA 3T8LA 1P7TA 4XX6A 4Z1CA 1Q6LA 1V3HA 3V0UA 4DBWA 1J01A 3M5VA 4MJMA 2B31A 4KEVA 2QDEA 1Z42A 3GR8A 3W1TA 2VEGA 4MPQA 1GQKA 4MY1A 3L23A 3QSRA 3LCWA 2X8RA 4ZE4A 2C1HA 1W3HA 3CHDA 1UZ1A 2AL2A 4W89A 1OGSA 3WN6A 1LQ2A 4DUWA 4QCFA 3WD3A 2VT0A 3UJFA 1ZJBA 2W0UA 3N73A 3E0WA 5E6ZA 1RLCL 4AWUA 4R85A 4O1DA 2VGGA 3T44A 2V5KA 1EC8A 3GVRA 1QO2A 1Q6DA 4HN8A 3MCNA 4PMUA 3VZXA 4FLRA 3HURA 4ZENA 1IZJA 1D8WA 1P0KA 3L4XA 3U48A 3WH5A 1N8IA 4QG8A 2Z7GA 1UD3A 4BQ2A 4UC5A 4DBEA 2WM1A 3G6MA 3PS7A 3WFAA 3QF0A 3D0CA 2G3IA 2PWDA 2NQ5A 4JAWA 3GFYA 3W29A 1G94A 2XJ7A 1C91A 3P61A 2ICSA 3UPMA 3UCDA 3D5HA 2H8ZA 3CH0A 1RH9A 4GBDA 2IPWA 3WJSA 4O19A 5DCDA 4X2PA 4LBUA 4RUBA 2D1ZA 3FAWA 2AL2B 3ZR4A 2VZTA 3TUUA 2J78A 2VENA 4M1BA 1P7TB 5LA0A 5LKYA 1SVDA 3AS3A 2W6RA 5SWUA 3E5BA 3L66A 3W2JA 1B4EA 1GPFA 1SFTA 3DENA 3F7JA 4HPGA 2UV8G 3DGRA 4JR5A 2XHYA 1C7SA 3VKAA 2Q3OA 1X6LA 1PWLA 5REQA 1OGBA 1ZS2A 4LANA 3RPMA 1H7RA 2QJGA 3IS4A 3MUXA 4QROA 4O4VA 5HNRA 4TTGA 4EKJA 1DV7A 1SJAA 1F3WA 3H2NA 4GO8A 1V03A 4B3LA 4GJJA 3I6TA 4DWDA 4PMRA 1FWEC 4GNVA 1T99A 3W83A 2V0TA 1IHIA 1E1FA 2OYLA 1QXLA 5DO8A 2OPJA 3M0XA 3TH6A 2X2YA 3AOFA 1HX0A 4D8LA 4KETA 1PS9A 2ZX9A 2YL9A 1CDGA 1A49A 5IXEA 1FWBC 1NH6A 4FNQA 4AYGA 2E68A 3R25A 2XGZA 3NFUA 4ZO8A 4Y2WA 3D47A 3U8GA 1W1PA 3CGTA 1XLAA 4AMAA 3OVPA 2FDSA 3IGUA 1W1TA 3LLXA 1VQTA 4RNFA 5HUPA 2Q02A 3KL3A 3NR0A 2CITA 3FJNA 3RLGA 3MDUA 4E2VA 5H8PA 1PWMA 3GDLA 3M16A 3ZT7A 3T9PA 4A29A 3BSHA 1P1MA 2OGJA 5HXMA 3B06A 2Y8VA 4M5PA 3VDHA 3HPAA 3KLKA 3E5PA 1FWHC 4R27A 4C6QA 1Q4NX 3MHFA 5D04C 1JFHA 3G1YA 4HT3A 3W7GA 4AYSA 4PMOA 3KBWA 4CNOA 3QOKA 3DG3A 5LA1A 2BFGA 1TPEA 4W8LA 1YBQB 3EOEA 4X0VA 5A6BA 5I24A 4L5ZA 2HVMA 2PTYA 4JYDA 4IL2A 3GHSA 3QQ1A 3QV8A 3NQ7A 1NDYA 5FKYA 3VCRA 1WKEA 3L4UA 3PZ9A 4HMEA 4C6DA 3UBPC 4C6EA 2WM0A 3K4WA 2NVAA 3AJXA 4HHHA 3R12A 1EP3A 3GZAA 4PTXA 3NO1A 3TKFA 1XIDA 4QEHA 1JAEA 1EGVA 1YMYA 2HS6A 1W9UA 3MSDA 1R3WA 3LPGA 1A5AA 4C6PA 4LUJA 1TA3A 5BXPA 1CXKA 1K7EA 5CZTA 2W27A 3AYVA 3VOFA 2GVEA 1OFDA 4FLSA 1KCKA 3VZZA 3UFYA 3TIMA 3WBWA 6ENLA 2WB5A 3CK5A 3ZJ7A 1G7UA 4KESA 3W7DA 4O0ZA 3DAQA 2ZUSA 4RE2A 1AJ0A 2AGKA 1KM1A 3PZVA 4ASTA 3TW6A 1IT7A 1V5XA 3HOJA 3L5LA 1KFCA 1LOLA 2INFA 3APGA 1VLWA 3GTXA 2PUZA 2EF9A 2XINA 3AS0A 1EL3A 1JXKA 2FYMA 4GZJA 4LB4A 1B1YA 3O6AA 2IQTA 3CYVA 4MWAD 4Z2LA 2XFWA 3W38A 3W7OA 3FKRA 4XBJA 4FXSA 4GI8A 3GSMA 1RVKA 1ZZMA 4ZQMA 5EMMA 2WCGA 1J0ZA 4LALA 3LRMA 1IGWA 3AIBA 4US5A 2XZ9A 3HJEA 4GISA 1QASA 3LPOA 2VURA 5BOFA 1GOXA 4PCPA 2HMCA 5IBXC 1PZ2A 2WYSA 1HKMA 3QYSA 3JUGA 2OO0A 3CTTA 4IX2A 3W73A 3D3FA 3ORWA 2BHZA 3TXVA 2OJPA 3GUGA 1Q66A 1XCWA 1B90A 3Q67A 1N8WA 1RSCA 3ABZA 2XWEA 5AYIA 1VENA 3BW3A 2A7NA 5BXRA 1ONEA 3MJMA 1WKDA 2P1FA 3NA8A 3CMFA 2FHBA 3HV8A 3PZTA 1DE6A 4C1KA 1SZNA 4MNKA 2GOKA 2EKCA 4B4HA 2CESA 2EAWA 3H7UA 1IEIA 3O16A 2TYSA 1OX4B 4L6OA 2PWEA 3PJUA 4LWWA 4F48A 2E5CA 2AKMA 3OEXA 1CEOA 3TWAA 1JUKA 3UG8A 3WQCA 3WBYA 2NQLA 3LI1A 1RPKA 1MEIA 2V2HA 2PE4A 1VH7A 2CNCA 3W75A 1XIJA 3W7LA 4B5VA 4BZYA 2YBTA 4C6LA 5AC6A 5DMYA 1EO7A 4JQ2A 3I3EA 3OA5A 2WMIB 1X1NA 1ME7A 4HMCA 3N4FA 4L1XA 5CQ1A 3IIPA 3LPFA 3KCJA 1LBMA 1JXJA 3GD6A 1JRBA 1EIXA 3S46A 1X98A 4NF7A 5ABGA 3LM3A 3AIWA 5TQLA 3NEVA 3C2RA 2PGRA 5FA5A 1FRBA 2WVVB 1RPXA 3ITTA 3GU9A 1NDVA 2YX0A 3LI0A 4FEZA 2ZUVA 3SY8A 3WDPP 2Z6IA 1BPLB 1FX6A 2W9MA 2HJPA 3E0IA 3KW3A 3HU7A 1OABA 1XS2A 3GXPA 1RZMA 1OQFA 5EFFA 3KCLA 1DP0A 5HDRA 4FA3A 2ESCA 4I5UA 2SFPA 2BY3A 2PLJA 4HZ8A 4QQ3A 3II1A 3WUEA 1TPDA 4NQ1A 4PL2A 2R6OA 4BQ3A 2D22A 4DI8A 2ZQ0A 4LYQA 3FEMA 1DWFM 2ZA3A 2QPSA 3GXFA 3C3UA 3HIJA 2DUXA 3W26A 3L4ZA 3K8LA 1XQKA 4YN5A 2XSXA 4XAPA 1CLXA 4K3ZA 3T7VA 1VYRA 3B03A 1AFSA 1BRLA 2PD5A 3W72A 1U33A 1TRDA 4DRSA 4G8TA 2G8ZA 4GFIA 4DELA 1BYBA 1GVOA 2PDCA 3GG0A 4IMAA 1U5JA 4AVFA 2NXGA 5CH9A 1YNPA 1UKPA 4IT1A 4DUOA 3DYPA 4XSMA 1O60A 2GGHA 1Y7VA 3NIYA 3IGSA 4YTSA 3FXYA 2E09A 1EJSC 1KBBA 3DIPA 3N29A 6REQB 1XPYA 4GIYA 4JTEA 4IIGA 4L65A 2F6XA 3LBMA 3N2TA 3FVDA 5ECVA 4HNUA 1OJXA 1KLYA 1IWAA 1QNSA 6REQA 2ZZ3A 4AVNA 5M2FX 1DWHM 3FEQA 3GTHA 3TWBA 4AMCA 3BAIA 3BICA 4F0KA 1QOPA 1PKMA 4X63A 4WY0B 4YVVA 4I90A 4WR3A 3ATYA 4V1YA 1A50A 4AC7C 3W25A 2PDQA 2C15A 3U3HA 1DIOA 1PCKA 2PGWA 4HMDA 4GQGA 2GVJA 1K03A 4IJCA 3PP7A 1KM6A 1Q6FA 4DUXA 3AHZA 3C56A 3CO4A 1U2YA 5D9PA 2BDQA 3UY7A 4QLJA 3IRSA 4BF5A 3CZLA 2HS8A 3WENA 1C29A 5AYBA 4JL2A 3P3BA 3QHOA 4AZHA 1YLVA 3DFYA 2BGNE 3CV2A 2PC8A 3VIJA 1IZKA 3ABSA 3VC5A 4IIHA 4GIEA 3RG6A 3PNZA 5AHMA 2PTZA 3C2EA 4X22A 4HCDA 3WJWA 2A3BA 4NYYA 3PZMA 4RZ4A 2QCCA 1UKOA 3S2CA 2H9AA 3U6WA 3SBFA 3M5ZA 1CLKA 1MSSA 2V8ZA 3I4EA 3W82A 2J9ZA 2Z1BA 4DB7A 5AVHA 3DFTA 5LA2A 5G5IA 1HJVA 5I7GA 3HN3A 3MO7A 5HANA 2FQIA 2OYKA 3IEBA 3EMZA 4KWSA 2W91A 2VTFA 4FNTA 2WQPA 4GXPA 2VDGA 1EC7A 2VGFA 4ZQOA 2A4AA 4UTFA 3B40A 4IPPA 4Q4RA 1D9EA 4KWVA 1OK4A 4LCRA 1LZOA 3SRKA 3EXRA 4AZIA 4J27A 5C2XA 1VBUA 5JU6A 1WKYA 2F6UA 1XDMA 4AUBA 2ZXAA 3WL1A 4UTIA 4TIMA 3RO6A 1SZGA 3RN6A 2GJXB 1TWZA 2C91A 3URQA 4UQ9A 2WMFA 2G3NA 3AYTA 4UNKA 1VS1A 1GORA 3U5YA 4O15A 5KZMA 2YSWA 1G1YA 2QVNA 2AAAA 1YYAA 3OB8A 5DMMA 3EB2A 2FGZA 3LYEA 5LNRA 2FMNA 5F4SA 1XIMA 2BB0A 3WFLA 4NI8A 3R6IA 3OTRA 2QIWA 3WLHA 3QOMA 4J3WA 1CXHA 4WLCA 3SGZA 4HNOA 2FH6A 1OFAA 3AJ7A 1XJBA 1UQYA 2QMKA 4Q6JA 2G0WA 4V1XA 3ZVHA 5C55A 1B3ZA 3FLUA 2DVXA 3A6OA 1FHUA 3M0HA 2PDIA 3JR2A 5ENLA 3GY1A 2PDMA 1ZTVA 4DF2A 2IPJA 2QULA 1GOKA 3CIXA 1J0KA 3TSDA 3W2NA 2OZTA 3SADA 1Y5XA 5KITA 4FPSA 4I7WA 4XTDA 4PZVA 1J2BA 3T8QA 3QY8A 1NWSA 1WAWA 2ISVA 4AWEA 3KL0A 2OU4A 4DO4A 2A6LA 1FWIC 4UXDA 5FD0A 1B54A 2E40A 2QCEA 4QG6A 3W1RA 1HKIA 2EG6A 3VOHA 4UFLA 2DZBA 4CD5A 3OHIA 3RM8A 4GY7A 1E6NA 4KCUA 3G1RA 3NZQA 4LNCA 3DHFA 1YXYA 3DYOA 3MP3A 4Q8NA 3EGJA 4CNPA 5AKQA 2VD8A 2QQ6A 3AAMA 1CX9A 2V3DA 3H7RA 5CPLA 7REQB 1H7NA 3VDGA 3SURA 1OZMA 4CD4A 3CAVA 4W5UA 1VEPA 1EJWC 2WMJA 5TAOA 1K9TA 2A2IA 4LUTA 2DU2A 4GYPA 1QPQA 5LSMA 3ZLFA 2PDUA 2ZZ7A 2FB2A 3VAVA 2NQJA 1L6YA 4WXYA 3UP8A 4FZIA 3I6EA 2YJQA 2X09A 2CKSA 4ZQPA 1DJZA 4O57A 1ZL1A 2QCGA 4NG3A 1JAKA 2IXVA 2HRWA 3SUVA 4WJEA 3AYRA 1E4IA 2WSYA 2JGQA 3N6JA 2O9OA 1YADA 4FNUA 4OIFA 1TX0A 1TFVA 4MLRA 2J8FA 5I3HA 1I1XA 1SFLA 1EPVA 3POCA 3GKAA 2Q01A 4KCTA 2P10A 2RJHA 1CXLA 1R2RA 2X30A 5HWNA 3PFRA 2VDHA 1IF2A 1FH9A 5CG7A 4AWTA 5BNKA 2UY3A 1K4GA 1EWDA 4QJ1A 4AW7A 1D8CA 4IZGA 3KS6A 2X1SA 3ZLHA 4ZO6A 4YIWA 3TTOA 4DI9A 3MBFA 1J5SA 1LBFA 1GONA 1QJWA 2PDHA 3EXSA 3I68A 2P3ZA 4LY8A 5AN7A 1FP8A 5PTDA 3WLJA 2ANUA 2W92A 3BH4A 1BYDA 1UD4A 1ZAHA 3CV7A 3E9AA 3LLDA 3UG3A 5H1WA 1M1BA 2VVNA 4CEXC 4RPPA 4IQLA 4Q33A 2A3CA 4B16A 3WF3A 1L9WA 1UUOA 5IFTA 1UB3A 4U5KA 3S2MA 2P53A 3SGGA 1U83A 3WH7A 3HQNA 3PBVA 1NVMA 2Z26A 3PY2A 3KVMA 1R3RA 2Y5EA 4ZOEA 5B7ZA 1JCTA 2GGGA 3FYYA 1OYCA 4FR6A 3CWNA 4NL1A 3V75A 3DGBA 4JY8A 3L5MA 3A9IA 4Q8TA 4LC6A 4DZHA 1F8MA 5FCZA 5FEZA 3VIPA 4UCGA 4P7OA 1FFQA 4Z2KA 4G6CA 2Q09A 1JCXA 1R46A 4OUEA 3R1ZA 1JZ7A 1DQXA 1KFKA 3G3MA 5LHFA 3AMDA 3LNPA 3LENA 5AHNA 3H21A 1BG4A 1EZWA 1DIEA 3DXIA 4D6EA 4QIUA 5AC4A 4HNNA 3T07A 3EDDA 4GINA 3M07A 4MGGA 2BMBA 2FJUB 3ITCA 2QPUA 3A5VA 1H1NA 3W84A 1FWWA 3ARXA 2HSAA 1H5VA 4OZOA 3TJXA 1FP9A 1NOFA 1TREA 3R0DA 3PJXA 4QLKA 4AEFA 2J7CA 1QPRA 4US5D 1EOMA 2E8YA 4XD6A 3GU1A 4WGXA 4I8YA 4PTVA 2V69A 3TQKA 3WQ5A 3N9RA 1TIWA 8TIMA 1RV8A 4PYSA 1PX8A 1HL8A 1W1VA 4R9XA 5LIWX 4GXMA 5EMYA 4GNJA 4I6VA 1S5WA 3M1ZA 1K8XA 2OQYA 3BTNA 4AXKA 4P8UA 4Z1YA 3E2QA 2R91A 4GY0A 3LY0A 2VEMA 4HB7A 1UA7A 3CH9A 2NVDA 2C8NA 4JTUA 4S2BA 1OB0A 1O66A 1PTGA 5FF4A 5HMDA 5C9WA 4AD4A 1DWAM 1E6SM 1C90A 4N6FA 1PZ0A 4QDPA 1EEPA 2YOCA 3N25A 2JF6A 4ZGYA 2PTWA 4A21A 4XWUA 4U31A 5A94A 1UROA 2G96A 3NO5A 2CLIA 3ZM8A 2YL8A 1QTWA 5LNVA 2GVLA 3WEOA 1PTAA 5HINA 4PB3A 2H90A 3OLEA 1GGOA 4Y9MA 4YVPA 3OZPA 2YCKX 5XINA 2CLFA 1V6VA 3W7MA 4A3QA 2DT0A 3QQ0A 1MDLA 4DXKA 1FKXA 2Z1WA 4ROQA 1M41A 3L4VA 3M46A 1CGYA 3DU0A 2AQWA 4PUNA 2YYTA 4J3VA 2YW4A 4DJEC 2XIMA 4HPNA 1I4NA 3RIKA 1UR8A 4EWND 3AISA 2Z0IA 4EIVA 1RP8A 3TJLA 4TVCA 3PTDA 3SFWA 3NG3A 1Q6RA 1V3JA 1GHSA 3WD4A 2ZX6A 2OR2A 1R3TA 1MUWA 3S5YA 4MB4A 1Q63A 4EPKA 3QXBA 2QCNA 5BXTA 1IXOA 4FS9A 3OGSA 1LWIA 1JGIA 4NJKA 5KTLA 3IUDA 1TG7A 3VKKA 1I2QA 1QPKA 4TTUA 4HSNA 2NVCA 1IXPA 3Q4DA 2CBJA 4QM1A 9CGTA 1XD0A 2PWVA 4ORIA 4JFWA 4U5IA 4M7TA 2GL5A 3N2CA 4LBRA 3MU7A 3BVJA 1XRFA 2OMAA 3P0XA 3A4JA 3IWPA 2PODA 1OYBA 2ON3A 2WOQA 3UWYA 3AUOA 1EQPA 5IRPA 4K6AA 5CSUA 3ABRA 5FSEC 1FDJA 5FOOA 3WDRA 3PB0A 4KMQA 1L2QA 3UYCA 3RUBL 2QJJA 3BV4A 5DBTA 1RCQA 3U2CA 2WSQA 4O50A 2HWGA 1NTHA 2ALDA 2WC4A 4O0KA 4YS1A 1X8FA 3FW6A 2PMQA 3FSUA 3FAXA 3WF4A 3FN9A 4KGLA 3UETA 4I9JA 3SR7A 2OFJA 4D2JA 1SW0A 5C7HA 3DKJA 3QHMA 1KLZA 1XIEA 3W02A 2VX5A 2VHLA 2FVMA 3CM4A 1VZWA 3SCPA 1V79A 3VNYA 3WO8A 3S1WA 4RW3A 4H9VA 2QCLA 3NM1A 5E70A 3WG6A 3W87A 4Q3MA 3WUBA 1CIUA 3CZEA 4IMDA 2QDGA 1AQMA 4LUIA 1MW2A 2PDYA 3RPTA 3GQYA 1AL8A 4TVDA 4FNSA 3VGFA 1CB7B 2PDFA 1JI2A 2X1RA 5E0CA 4B5XA 1GQNA 2VGIA 1F76A 4CCZA 1C93A 3LPPA 4NASA 4EANA 4G1KA 3TTEA 4BFAA 4HBKA 1VRDA 2HQAA 3H54A 2F6KA 1QW8A 3OIHA 3PANA 2W63A 1C9WA 4PGLA 1CBGA 3NTYA 2D0GA 3XIMA 1C8VA 2DDXA 4IGMA 2G4JA 1UCWA 1ENUA 1KFWA 1GVRA 2EEXA 1J11A 3HFYA 3IIXA 5JUVA 3RXZA 1QDSA 1OF8A 2PP0A 1V6YA 2DSVA 1GCYA 2XFFA 2Q6ZA 3GUWA 4LT9A 1PJ9A 3P74A 1KXTA 4OVXA 4IPNB 1OM0A 2IQDA 3SM0A 1S2UA 2E7FA 4LY4A 4KBXA 4U3CA 3T2OA 3QPEA 1H49A 5DCEA 4FALA 4Q7IA 1XD1A 4P5UA 1TPB1 4DNHA 4JYFA 2Z6JA 1XW8A 3PTQA 1UWRA 5TBOA 3HFTA 3H55A 3GWQA 3V7PA 1F4HA 2PWHA 4RV3A 5G4WA 3AHVA 2YCIX 1XLFA 1B0IA 1XLEA 1WDSA 2E67A 3NQFA 3VFCA 3WK2A 3BK0A 9RUBA 2PU0A 1AW2A 1UWUA 2WVSA 1YTEA 4UOZA 2RKXA 3LCFA 3ME3A 1LG1A 3IGXA 3NVDA 4ORMA 4RPQA 3TA6A 1ECQA 1SJCA 3RLHA 1A3HA 3OPSA 5CEWA 3G18A 1QUMA 4J3ZA 2G3MA 4EACA 3KOFA 3ANUA 4B5TA 5A8QA 3AXKA 3IV3A 3KWSA 1CGTA 4Y9OA 3HG3A 1E9LA 3C2FA 1HT6A 2C71A 4PRTA 3SW6A 4GIAA 3SUTA 3TDFA 3NGFA 4Q8OA 3MHUA 3M5XA 2YDRA 4P61A 1JDAA 4JTIA 2FHFA 2J77A 5MKGB 4XB3A 1SJDA 2VFDA 1VEMA 4CQDA 3BOFA 3TX9A 1J18A 1RCOB 1XBZA 3F1QA 2ZBTA 4QS5A 1XLJA 1E0UA 1VIWA 3TA9A 4YL2A 3C3NA 4PUWA 3CQHA 1MXSA 3H24A 4HYRA 3SQSA 2VEKA 3DERA 4DNMA 4RZBA 3W74A 1UMLA 2OOFA 1M5WA 1KC7A 3G8EA 2VR4A 1LDCA 1TV4A 1C8YA 2ZDSA 1K77A 3DH7A 2I57A 2REQA 5EMUA 2WVUA 2X41A 4RXFA 1JF6A 3BZJA 5F1VA 2HXTA 4H1ZA 3ALFA 4X61A 1OCQA 4K7YA 4ZFMA 1QAPA 3TOPA 1S39A 1Y65A 2JKEA 2IS7A 1N55A 2CERA 4BI7A 4NXKA 1JZ2A 4FX7A 4S1FA 3AIUA 4DBDA 5HMEA 2A7PA 1V0NA 4GFSA 2ZRXA 3SCTA 3W00A 4IMGA 3L4YA 1KQZA 4TX6A 2WNNA 1K70A 3BARA 1TR9A 3B0VC 3STEA 4W7UA 1UKQA 3WDHA 2WV8A 2QF8A 1JEZA 3P6LA 3NZRA 2GQ3A 4GZ7A 1XFBA 3F4NA 5CSRA 3W4RA 3WH9A 5BROA 3ONCA 4MB1A 3PBYA 4NZFA 3QKEA 4JX5A 4EP8C 1XLLA 1YDVA 1ESWA 1JDEA 5LIKX 1KNWA 3MWAA 4H2HA 3U5UA 5LXXA 3B4UA 1LF1A 4RDVA 3GNRA 3WDQA 1VJZA 1FDZA 1RY8A 3GNDA 4ZMGA 2O4QA 1TA3B 3W7KA 4UTLA 3BW4A 1X8CA 2XPKA 4QEEA 1I6NA 2GDQA 2J7FA 1W8SA 2ZA2A 1TWSA 2Y7EA 3LX9A 1E1EA 3WSUA 1I0DA 3CWHA 2J13A 3GW3A 1B4KA 3BCJA 3UWUA 4KS0A 1FWNA 3VYLA 1VHCA 4DVOA 3CQKA 1TRIA 3TYEA 1WDRA 4CVWA 4NP7A 5CPMA 3AYSA 3HJZA 2VX6A 1N7KA 4ATWA 1MMFA 1DQWA 3CMJA 1T0OA 4IUGA 4MTVA 3VTRA 3P67A 3G1HA 1KM5A 4QJ4B 2A3LA 3TTSA 2WZTA 4F0MA 4LF2A 4GLEA 3GNOA 5LIUX 1E3XA 3C2VA 5CC5A 3TC6A 3K13A 2YBVA 3VM7A 3K2GA 4HOXA 3E6EA 3BAWA 3LBOA 3TLLA 4GH1A 3V1HA 5F2IA 3MANA 4QDWA 1E4MM 2Y61A 3DG7A 3N1AA 1AH4A 1H1ZA 2RDTA 2MANA 1VAHA 2OEMA 3V1PA 4BA0A 1SU5A 2JKAA 1EX1A 2OX1A 4GKTA 4HTBA 3VGEA 5I00A 3O6CA 4DX3A 4UR8A 1V7YA 3Q2DA 4XZ9A 3T42A 4JPGA 1TYGA 4JIIX 4O1AA 1O95A 2YXOA 3VOCA 4LNYA 5D30A 1XLKA 1XBVA 4UMCA 1JJKA 2A79A 4GMEA 3W81A 2JGYA 3GAYA 4UTWC 3CQ0A 3WD0A 1H62A 1X6UA 3NQ6A 4AIBA 3I65A 1OIMA 5D4YA 4V2XA 4ICNA 4JFSA 3BMVA 3HG2A 3R7MA 1HJWA 3QW4B 4J5NA 4MOZA 4U3AA 1K9DA 4AHQA 2H9AB 3W53A 3FGCA 4H19A 4CCEA 3MI2A 1V6TA 3UY8A 3VKDA 3EWWA 3THAA 3L9CA 2J6XA 2W79A 3CHCA 1SW7A 4K36A 1BVZA 2IKJA 1WAUA 3BLFA 1WUFA 3KM8A 5CGTA 3C2YA 3FHAA 4NZCA 3RRXA 2WMGA 2QDHA 4PRWA 4IHCA 3K5XA 2INZA 1DXIA 2ZKMX 4S3EA 3WMLA 2CPUA 1VYPX 3R8HA 5CKSA 3G1DA 1BTCA 3UR8A 4A3HA 4NAFA 4NJIA 3F4DA 2A3AA 4HK5A 1XIFA 2E6YA 4CU6A 1FY6A 3A5FA 5HWJA 1Q6CA 4OFCA 4PBGA 4NZ5A 3K4DA 2DT1A 5U7SA 4WSKA 5I3JA 1QU4A 1TJ2A 4EPDC 3MUCA 1PXGA 3BDKA 3S6DA 5TIMA 4C5YA 5DX7A 2UY4A 2CBIA 4EXQA 2BS9A 3U4AA 4MHBA 2R1PA 4JN7A 1F61A 1VHNA 5A1AA 4W7VA 4AD3A 5A8OA 2DSKA 4ZXOA 1W1ZA 3ENLA 3CPRA 1H61A 1XKJA 2HTMA 2Z1VA 1HQTA 1X6NA 2F9RA 3N12A 4OGZA 3DBNA 4O12A 3G0XA 3CUFA 4RJEA 4C1NA 2R8WA 5FSDC 5EBUA 3EOOA 2J27A 1H2JA 1M7PA 4C6CA 2QCHA 4P8WA 5FAGA 2QAFA 3LG3A 3B9DA 1A5NC 1QW9A 4WIWA 4JHZA 1KBJA 4N4PA 2VM8A 7ODCA 5HQMA 5E09A 4JEQA 1XBYA 1GYNA 3RX2A 4YHEA 4YTUA 1UR4A 1MNSA 2PTXA 2NV2A 3GTFA 2CHOA 4URIA 3IIOA 2TODA 2J7DA 5HAOA 5EL1A 4PTMA 1KM0A 4BF7A 3MUIA 3TZFA 4KCWA 2EKGA 5A6MA 3N4EA 3W86A 5M03A 1B57A 4Z2IA 4P8VA 4O17A 4YCOA 4PMVA 4JNZA 5JIPA 4FX8A 4HA0A 4QE1A 1E4NA 1NU5A 2BTMA 3PG9A 5ABEA 1UWSA 2BG5A 1ML1A 3HGSA 2Y2WA 3C0JA 4MJ4A 5A5WA 3C0QA 3QC0A 3P62A 1W1A1 2H3DA 1P5BA 1VBJA 2CZ5A 2D24A 3MUAA 3L5AA 1XGZA 3ZR5A 3GBEA 3MKKA 1EBHA 5D05A 4H7ZA 3A4WA 3TLQA 3GC4A 2TMDA 2D2GA 1QT1A 3QSTA 2XFRA 1A80A 4P7LA 3KL5A 1AH0A 3G77A 3LXCA 2ZZ6A 4L1GA 5D9MA 2Z2BA 2WZHA 2PD9A 2BVWA 3RU6A 3ARWA 4LUYA 1HKKA 4N9BA 4JIEA 5ECUA 4C6MA 3MI3A 4F4RA 2BGQA 1HL2A 1VPQA 4GYPC 5HWMA 2PDKA 4WOQA 4TUFA 4MJ2A 1XL9A 3UZXA 2B7OA 4ZTXA 1DXFA 1KQYA 2ZX8A 3SY1A 4UTHA 1E0WA 1V8EA 5A2BA 5I2UA 5EY5A 2Z1KA 1EJVC 3UZYA 1E6PA 3B9OA 3OZMA 2WKGA 1ME9A 1FCQA 1G4EA 2V5BA 2WKJA 1WNOA 4UTTC 1OADA 1O1HA 3WQGA 2HEJA 2FZMA 5EYWA 4DYEA 4O52A 2YZ5A 3FA3A 2INEA 1V3LA 4WJ8A 1H3GA 3ITVA 1E73M 1TWWA 1DTUA 5E1QA 1TPWA 1R5YA 4IP7A 1D3GA 4ZSUA 5AC8A 4N9DA 1KKOA 4LEFA 4XISA 4F0SA 2TSYA 4JTCA 3GXIA 2ZICA 1PX3A 4Q8VA 4GQBA 4RDWA 1XDLA 3UYIA 4UOJA 1GT8A 1KM4A 2P76A 3WK1A 4O13A 2XWDA 4EAMA 2PRMA 4HK6A 2BWGA 4L4OA 2EPOA 3OLGA 4WKHA 1OK6A 2V38A 3IJ9A 5A69A 4HOZA 3CUJA 2PP3A 4HCHA 3VKBA 3W7EA 3WK3A 3U2OA 4GY1A 3A4XA 5D2WA 5CGMA 5I78A 2O7SA 3PUDA 2AGTA 1Q65A 3W1LA 4MIMA 3D46A 5J04A 2EPKX 3I3BA 4RK8A 3OBEA 2PA6A 2QGHA 2J7EA 5FJTA 2CC0A 1AD1A 5D03A 2VQUA 5I6SA 1H7XA 5D33A 5IM51 1FKWA 4F2TA 2GUBA 2YFOA 4DUVA 5AFDA 2E1WA 4ML9A 4Q7NA 1LM1A 2V30A 5F1UA 1BVWA 1OY0A 1VFLA 5CZSA 3OVGA 4AIUA 1XXXA 3K1DA 1W9VA 1ZJAA 3T0CA 1AD4A 4ML4A 3NQAA 3B0YA 3EX2A 1YDNA 4DYJA 4O8RA 2PDGA 1A5KC 1BWKA 1REQB 4LV4A 2YCLA 2X40A 1MQQA 4S3GA 5CJNA 4I9AA 3IRDA 2WNZA 4WEVX 4UTWA 4WVXA 5AC7A 2QXWA 1R9ZA 1QCWA 5CBBA 3MKCA 2ISDA 4MY8A 3UU0A 1Q2SA 3TYUA 3IJ6A 3KE0A 4DZAA 3FVMA 2Y8UA 4XK2A 1QRQA 2V5JA 4O53A 4M29A 5K3VA 1GZJA 1YNYA 3B05A 1HIZA 5D9NA 4ENLA 1AH3A 2NZLA 2E9LA 4A3UA 3NNTA 3N3MA 1A0EA 4OE7A 4XAGA 2FKPA 3CZJA 5EKYA 1EJRC 3BMXA 2HK0A 1RR2A 3H53A 4QNWA 3WQVA 1POKA 1NF0A 2V9DA 2ZXDA 3VK5A 2W61A 2EPNA 4JICA 4ZQRA 4UTKA 4MKNA 4ZODA 1EFZA 5DF0A 1E72M 3G1AA 2FJKA 3T1GA 1TO3A 1TZZA 3B8SA 4PFMA 2BV9A 2NSXA 1P0DA 2CWXA 5JIWA 1CYGA 3MSRA 4RNHA 3S6TA 4PMYA 1BYAA 4ACZA 4JOMA 5G4EA 2WJZA 4IM4A 4DJDC 2B7NA 2DUZA 3B9EA 1LT8A 4XTIA 2I14A 3THQA 1R7AA 1W5MA 3G0SA 4GBUA 1TPFA 5FESA 4XKYB 5A6JA 2WK2A 1DJIA 2PCQA 4AZ6A 4Q8WA 1W3JA 3M6DA 1W3LA 1F74A 4IPIA 1VCVA 1VYSX 4QR6A 3GC5A 3CUGA 2J9XA 5HPOA 4NKCA 3WJYA 3N15A 4J1OA 4LGXA 2J7GA 3UEQA 5CGQA 3N4AA 3IIVA 3CL8A 5F7UA 1VRXA 4JTJA 1ODUA 4MM1A 5E0FA 3DECA 4N2YA 3O2LA 1DJYA 3LQGA 2RJGA 5DEZA 3NQDA 4I7UA 1VBRA 3VGBA 3B8TA 3QJAA 1JDFA 3EPNA 2DIEA 3BG9A 1GYLA 4KIEA 1EOKA 3NQGA 3TN4A 2ZX7A 2FZDA 3W07A 4QTGA 2VXNA 5K4XA 2W67A 1AK5A 3QPZA 2VOMA 2HROA 2EPHA 5FF2A 4N6EA 3CWOX 3S9YA 1VLIA 3JU2A 1ZBWA 4RZ6A 3WDIA 5C6MA 1NDZA 3CAKA 4FMVA 3ABOA 3GRIA 1FWRA 2VVSA 1TMHA 3UESA 5BMWA 3OP2A 3EAUA 4R88A 1DPMA 1TJ0A 2FFIA 1XSJA 1HNYA 1A5SA 4M0XA 1M03A 4XO6A 2VEFA 3PFMA 1WCGA 5E0KA 3BCFA 2HE5A 3M6YA 1PEZA 2IUZA 4E8CA 2FTWA 4N9CA 1D3HA 3OHMB 4WXZA 5FEWA 3UD6A 4BWLC 2A3HA 4B90A 3AO0A 4PA8A 2H3BA 4HPJA 2FLIA 3RRAA 2F2KA 3WUFA 3JZUA 2XDFA 4REQB 4GYFA 4R5EA 1XI3A 4ZEPA 4L4LA 4LB3A 1DBTA 2XH0A 4H01A 3UCQA 1IEVA 2E77A 4LXFA 2WMKA 4OBTA 4KFNA 5H8UA 2DJXA 4DAIA 5F4XA 1EEXA 1ALDA 1D2KA 3EDKA 5CPOA 3W7HA 3ZJ6A 4NJHA 4TVUA 5C54A 1LQ0A 3G8RA 3M64A 3QZAA 4QP0A 2FTYA 1KRMA 2BXYA 3B0UX 1CZ1A 4AZ7A 2WHJA 4BR1A 3KBNA 1XYZA 4E8DA 3QTGA 2NLIA 4ZB2A 1RY0A 3VDBA 4RNJA 4W84A 2HPMA 1WPCA 4GUGA 4ZVJA 3C6CA 5A3HA 1HF6A 1H5YA 3SZ8A 3BUVA 1HGYA 4DPPA 4P2VA 3LHUA 4AB4A 2E0PA 4FXJA 1BRLB 3PWAA 3B9NA 5LIXX 1A5BA 1WXYA 2XGIA 5IHSA 3ARUA 1OBAA 3PUOA 3OOQA 2MUCA 3GHTA 1FWFC 2Z2AA 6CGTA 4IGHA 1TPVA 1F5ZA 1VD6A 1NY1A 1Z41A 3V4BA 1ZQ5A 1J96A 5DY2A 4M1RA 4H8HA 2VI0A 4CLMA 5BRBA 3E3HA 2F84A 3G5EA 5AY7A 4W93A 5HULA 2RUSA 1WBHA 1ZNNA 4WY0A 3AHXA 1OFPA 3I6RA 2E9BA 4A2SA 4J3XA 3NGJA 1C8QA 4L1WA 4UQCA 2WSRA 4UQEA 3DC0A 1XYCA 3LCIA 1SO3A 2NQZA 3USZA 2CLKA 1A47A 2I5QA 1EHAA 1OT1A 4PCSA 2YA0A 4N9EA 3S1VA 2EPMX 3PSVA 1QI0A 3UJEA 4QFUA 4JTFA 5D32A 3TCEA 4MMWA 5D2TA 3R94A 3MP4A 2X7WA 2QEZA 1XPGA 3WQEA 1ME8A 3O3RA 4CN4A 3R43A 2FPYA 3LSCA 3MZNA 3QKZA 1Z8AA 1LRQA 2O9PA 3VNIA 3E0VA 1JYWA 2V2CA 4M7SA 3PZGA 2Z7KA 1F7BA 3ISIX 4JCLA 3OO2A 1EXPA 3ZSSA 1JNEA 2DZVA 4Q32A 1PO9A 3S9IA 1KBIA 4PFHA 4IGSA 1QI5A 3AROA 1XYMA 2GGIA 4AIOA 2A5HA 3NOYA 1BXBA 3N2XA 2OLHA 3C5QA 3WZ0E 4Z2HA 1TCDA 1E55A 3WQPA 1UD6A 4YMZA 3IK2A 4Q8QA 1CECA 2DV0A 3W01A 5HR6A 1EDGA 3H2AA 5IFPA 4Y7EA 1UH4A 5TF0A 3V3WA 4HNVA 1XGDA 1MVYA 4BS0A 5BU9A 4DXXA 4XV0A 2WC7A 3F5JA 1F8IA 4HHMA 1GJUA 3GR7A 1IR1A 4LAKA 5D37A 2VZUA 4MWAA 4D6GA 5HNUA 3W1QA 4CEUC 1BWVA 3KAOA 1BGGA 7REQA 2Z28A 2VO5A 4NZ1A 1UD8A 1NWTA 1EQCA 1EJXC 2C14A 3UCCA 2OCZA 1XCXA 4YXGA 5FEXA 3WLOA 3KBVA 4E0CA 1FCVA 3ZIZA 3SGUA 4L6DA 3PN8A 3U4FA 3EKZA 1QNRA 3PTKA 5FJIA 5EPDA 4UFJA 4Y9AA 4DBSA 1ECEA 3VE9A 3RAOA 3VINA 3L2MA 4G1NA 4D1JA 1B3WA 2QZRA 1CWYA 1TV2A 3ES7A 2CLMA 3N11A 2VCCA 3TOYA 3WNMA 2PDWA 2QNEA 2DEPA 4AZ5A 3TNOA 2ZYFA 3KZPA 3GK0A 3OBKA 4TX8A 3TFCA 1J4EA 1TSIA 1AMKA 4G2DA 4REQA 4AZCB 3MMWA 1U5HA 1XQLA 4KERA 4C6KA 4MZYA 2YYUA 4GZIA 1NSJA 2P8BA 4ACZB 2NX9A 4ES4A 2XVGA 1BAGA 1LRNA 5FEPA 3VFLA 2YBUA 1Y5WA 2WJDA 3NL2A 1B9BA 2NUXA 1IIHA 2YZRA 2Y4SA 3HTWA 1CPUA 4JTRA 1SZRA 4W87A 4MY9A 1PZ3A 2PP1A 4JCMA 5I07A 2OQLA 2YA2A 4NXSA 5AVNA 3O8AA 5H8MA 5GJMA 3UR7A 4UFIA 1Y5VA 4DJED 2YCEA 3TTQA 2VEPA 2DY3A 3FGCB 3CAQA 3UWEA 3EB3A 3VX0A 3W28A 1EF3A 2OB3A 2BASA 3BWWA 1BWLA 1N82A 2FFCA 3EWUA 3QBUA 2ZRWA 1UH2A 2WPBA 3XISA 3M0LA 3WQ8A 3I7RA 2E6AA 3N2BA 1VFSA 3V5FA 2ZRUA 1RLDA 2CLPA 4NAFB 5C2CA 1SR0A 1JUBA 4GX8A 4FP1A 1QI4A 2AQVA 1KCLA 4F66A 1ISVA 4QG9A 1F73A 3ZXWA 3AXXA 1G4TA 1TCMA 1E1CA 2ZWYA 3ELFA 1O5XA 1TE6A 3WLNA 4QJ5B 1TZ9A 3CU2A 1KKRA 1LL7A 3TE9A 3VNZA 2ZZ4A 4XD3A 3AIVA 3VO0A 2WC3A 1L6WA 3QN3A 1NM9A 3N18A 5BU6A 4H6KA 1K6WA 1VFHA 3LMZA 1LUCB 1MRAA 4ECLA 3WQWA 5ABFB 3ARPA 3GW0A 2AQOA 3HGJA 5IBXA 1IT8A 1OCBA 1R86A 2C19A 3BSMA 3RDKA 3G3DA 3CUZA 1BKSA 3M4HA 2CYGA 3OYZA 3MS8A 2YPIA 1VBGA 4PTWA 1PX4A 4AF0B 4ERAA 2PFHA 4H6RA 3VCNA 4E2BA 3STFA 1GW9A 2OX4A 4GI9A 4S3JA 5MKGA 3STCA 1RJPA 1RBLA 2A21A 4RR4A 3J7HA 3AIQA 3NQVA 1LQAA 2P0OA 1VF8A 3CAWA 1R87A 5I06A 1HL9A 1TJPA 3REQB 1T5AA 3QEZA 1P0BA 4X60A 3T81A 5L9FA 3G2GA 3NAVA 4ERIA 3M41A 1WKFA 1XLIA 1FBAA 3T2QA 3STGA 4JS3A 3F5LA 4MNJA 1JYNA 2HV5A 4ADTA 4N42A 2UBPC 2J47A 2C16A 1GOMA 3CEUA 1Z9AA 3B04A 3GKFA 2ZFAA 1D7KA 2FVKA 3LCHA 1GHRA 4JHMA 4EK7A 4UCFA 5HPCA 1EWEA 4JTSA 4JIPA 3W1AA 3WD1A 4LAOA 5I77A 3GDBA 1PUDA 4JIHA 1XYAA 4GGHA 4H7CA 1QK0A 4L4PA 3BGJA 4JGDA 3HQPA 3TC7A 4JTGA 4EWJA 1UR0A 1KRAC 1VP5A 3WD2A 4WDWA 1BF6A 4J2MA 4MAVA 4CQBA 1GG1A 3GDMA 2OEJA 3BMWA 3ZVHB 4J2PA 4I3GA 1UJQA 1DQUA 3MQTA 3BLDA 1G0CA 3DFNA 1OC5A 4O1CA 4C7FA 3UG4A 4PODA 4EVZA 5BW6A 3M7WA 4C6BA 4KRUA 4IFKA 2GJXA 4J35A 3VMNA 4O16A 2CLHA 2VRQA 2QV5A 1XRTA 3OZOA 4LVBA 1FWGC 4YCPA 4YYFA 5CZKA 1I60A 3AQUA 4GHRA 4AD2A 1RA0A 3T40A 3NWRA 3DEQA 4PUJA 4QJ3B 4JXCA 4XZNX 3SJ3A 1DIDA 2IPGA 3ITGA 4E5TA 2DSZA 3UERA 1QMLA 2PDXA 4OOZA 5XIMA 3WLMA 2D2OA 3VU2A 4LRTA 1DWJM 1H0IA 5C7VA 4E3TA 4ZB0A 2FZ8A 4R53A 1Z32X 1YBQA 1E5JA 4AEEA 2P88A 1K4HA 4X9SA 3SAZA 1QW7A 1ZSXA 4KRZA 1TV7A 2DVTA 4LS2A 4F8XA 5A95A 4JQ4A 5HJLA 2QJMA 3S1UA 3UXAA 2CBVA 5D38A 3O0FA 3OIXA 2XH4A 1TX2A 4E2DA 1EB3A 4IIDA 1GVFA 3QW3A 4JNMA 3ZT5A 3GIPA 1CGWA 1CCWB 3L67A 3O1NA 2V5DA 5CC7A 4IMFA 2PBOA 4DN1A 3N6HA 3F2CA 3V5CA 3U2EA 5JQ9A 1LWJA 1KRCC 4F2BA 4C91A 1DHPA 7A3HA 1TTQA 5CSYA 1XGEA 1W6TA 4MSSA 1WXJA 3P8IA 4UQAA 3WEZA 3TONA 3W37A 2RDWA 4IF2A 2W5FA 4NHVA 1HGWA 2VC6A 4KPLA 3AWOA 4L80A 3MDWA 2ACSA 4HU3A 4I5XA 1AQ0A 2E6FA 1JD7A 4C1LA 4GIRA 1NP2A 3NXLA 1J79A 3ANVA 3E0LA 3EWBX 3KRBA 2GGEA 4RCXA 4WCJA 1Z48A 4GZEA 2ZUTA 4PB5A 4G9PA 4W9TA 3LXBA 2DZPA 4PB4A 5HUOA 4INFA 4OOUA 3S83A 1DJHA 3GVQA 3V0SA 1YDOA 1VPXA 1ELSA 3UJSA 5T9CE 3RITA 3C0LA 1LTDA 3O07A 3W7CA 4H9MA 4BQ5A 2AOSA 2WXDM 4WD0A 4KEUA 4LU0A 4NX0A 4ZOBA 5FL0A 3UVIA 2CHRA 2Z1SA 1W3IA 1B5TA 1SJBA 2XZ7A 4MFEA 3LERA 3PB2A 3CQIA 4Z1BA 3N2OA 2FZ9A 4ZQCA 5DT5A 4BCEA 3S5SA 4S3FA 3ARQA 4ADUA 3GYEA 1PKLA 3UF9A 4HIBA 5F2LA 5GPRA 2NQHA 3TQVA 4JL1A 4AU0A 2PZ0A 4C90A 2E25A 1ZGDA 4PR4A 1RHCA 5FJUA 2Q8ZA 3RCMA 1OX6A 2DGAA 4W86A 2VP8A 3WNPA 5E6YA 3L0KA 3EPOA 4XD4A 3TR2A 1P6BA 4WKAA 2PTDA 4KQNA 3AFBA 5HK4A 1S46A 2ATMA 2RH9A 4IICA 2W66A 2E3ZA 4QITA 2QUMA 3UW6A 2WWCA 3PWIA 3FDGA 2WLYA 4LBSA 1BGAA 3WQ4A 3KRUA 4KT2A 3U0HA 3ABQA 2OWWA 2J4GA 4HOWA 1W1IE 2WSKA 3AI0A 3LV5A 1XRSA 3C4UA 5KSWA 4LUTB 1GVEA 1BXCA 1SGJA 3CUIA 3R58A 1JDCA 1S2CA 3GAKA 1NF7A 8RUCA 4M3PA 3S3GA 5BRQA 4LOCA 1X7IA 1I2RA 3W2KA 1UJPA 1A4LA 1DHKA 4FOJA 4DWSD 3TTYA 2QF7A 3E74A 6XIAA 1M7JA 1E0VA 4L64A 4KFPA 1PB0A 1FUYA 5KINA 3LM7A 4JBRA 3MB9A 4S38A 1M9HA 2HK1A 1DTNA 3C2OA 1MW1A 1UBPC 4Q4PA 1KFEA 1T41A 4IP4A 4GVIA 1NQKA 4PUMA 3IV8A 2PPGA 3V0TA 1IXQA 4UOQA 3PR2A 2NV1A 1HJXA 1S2VA 1XV8A 1H51A 1LOQA 2X0HA 3UZZA 1QNOA 3WY1A 4IMCA 4AD1A 1YIXA 4W4QA 2WSPA 3TCSA 4A35A 5GNZA 2NWRA 3ZT6A 3GYCA 3URNA 7PTDA 4M8UA 2ZADA 3CASA 3VXGA 4B2DA 2PWUA 3SO7A 3AMKA 3GC2A 2GUYA 5EMJA 4HSHA 1R30A 1O5KA 2GWNA 3V16A 2FPVA 3WMCA 2XUCA 3HMJG 3O0KA 4R9OA 4WQ6A 5G1TA 1EIBA 4W85A 1R3SA 2OSWA 5FL1A 2VL4A 1OFRA 4ALDA 3WX7A 4W8BA 2CIPA 2X7VA 5CC3A 4NNCA 2I5GA 4QRNA 1MEWA 5B7YA 2X1TA 2XIIA 1TZ7A 1I45A 1LUCA 2IW0A 2UWFA 4S3AA 3DUGA 4ADSA 1A5CA 1XG4A 3LQLA 1EJ7L 4RV8A 1TQXA 4GQQA 3CO8A 1P0NA 3RCYA 1S1RA 1VFUA 4XZLX 3VE7A 4D6FA 4RXGA 5HMSA 2PB1A 5K9XA 1BQGA 1EXBA 3NDYA 1XLCA 3FIGA 1GUVA 2WZEA 1GVYA 1TTPA 5AOUA 1FWCC 3VIMA 2IKIA 4I5RA 4K37A 4QSHA 2PGFA 1T8XA 2Y63A 2J62A 3MCOA 4C6OA 1ZAIA 1W56A 4UMAA 5MHBA 4Q22A 3TN5A 1R9XA 4NZ4A 3R4IA 4HNLA 4IFRA 1G01A 2OT1A 2OLAA 2C0HA 1WXZA 2VCBA 3PPGA 1E6ZA 2AMXA 3HM7A 3THDA 3WJZA 3CQJA 2DT3A 4TMBA 1F07A 1Y0EA 3UGRA 1VKFA 3LDVA 1O6IA 5D02A 1GEHA 3QVQA 1CB2A 4E4PA 3KHJA 1ONXA 1YRRA 2YLLA 4ERGA 3AUJA 4AY7A 4UUIA 4BEUA 3WLIA 2ISWA 3KBMA 1MNZA 2UZ9A 2VUYA 3WFZA 1RXOB 1TELA 2GQAA 3BLEA 3NCOA 1FXPA 3PZQA 1EHNA 3CUXA 1LWHA 5J5DA 2GGJA 4FX6M 8XIMA 1EH9A 4AIEA 5AHEA 1QVBA 3MUZ1 4HZ6A 3G6LA 4W88A 4XBKA 3FNDA 2EJ1A 4WOZA 5L6UA 3P5ZA 3SIZA 1UUMA 3ZWSA 2GJLA 1VBHA 3Q65A 1QHPA 3HQOA 2XSAA 2CFFA 2DW6A 5DMNA 3S5OA 2EO7A 3TMQA 3N17A 1PL9A 4K8EA 2XVKA 1X96A 3GDRA 1ZENA 2IKGA 3LNMA 3E2RA 5A6AA 5I02A 3BV7A 5K4ZA 3QFWA 3M0IA 1PAMA 2DSWA 1GOWA 4NRRA 5DBUA 1M3UA 3P2VA 1JPIA 3SDOA 1XWYA 4G5DA 3A47A 3TYAA 1MXGA 3WQFA 3S1XA 1GZ1A 4E38A 1Z6KA 1XC4A 1X1ZA 4Q4SA 1B3YA 3EWXA 2VCAA 2GDUA 3ZFHA 1GJWA 2BXZA 2GSJA 2R1MA 3HPFA 3CXOA 2I17A 3EPMA 1W5OA 1BTMA 2P3EA 3P14A 2R1KA 4FAMA 4AX7A 1NAL1 5CXPA 3IGHX 3USBA 5HNTA 1K1DA 1EYWA 5D2XA 1H41A 3QGKC 2FH8A 4MWAB 3F2DA 3L68A 3MO4A 3GXMA 3LHTA 4WDXA 3GNXA 3BAYA 4YYCA 3BURA 4L6HA 2J7BA 3LD5A 4ZO7A 1WP6A 3LHWA 5M3WA 5F2MA 1O4UA 4GI6A 4ICMA 2WHMA 1V02A 3CB8A 4IOTA 2C7FA 4CNUA 4NZ3A 1JYVA 4JFVA 4NJGA 4XKMA 4PUKA 3Q45A 4ZCWA 2V81A 3UXKA 1QWGA 1OINA 2GVGA 4HA1A 3UNDA 3F5KA 1H11A 4IQDA 4PC8A 3RM9A 2WAGA 3QC3A 1DVJA 3IJIA 3MUY1 3W76A 4L9YA 5A6KA 3A23A 3PBGA 7TAAA 2NT0A 1GOQA 5CSSA 3VIOA 1VFMA 4F40A 4DAFA 4M6PA 4IPLA 4H6EA 1HXJA 3QGAC 4Z1DA 2DH2A 5IDIA 4AWSA 1SW3A 1WQ5A 3UZWA 3LCGA 1K9EA 1KFBA 1W3TA 4FO4A 2YIHA 1TMQA 1F9CA 1A5OC 1FHVA 2OKOA 3H4XA 3RFAA 1E6RA 4GXWA 2BP1A 1HUVA 1MDRA 1ZALA 4R34A 3TAOA 1E71M 1GTEA 1QWKA 3NSNA 2WNWA 3E49A 2IKHA 4X0NA 1TVPA 5K7JA 3K30A 4S3BA 3GVGA 1ICPA 1YTKA 2VQTA 4GH3A 1QNVA 4C60A 5LGZA 1CGXA 5XIAA 3CHFA 5J8LA 1DOSA 3EX4A 4GVHA 5KEZA 2O4MA 1GWJA 4IIEA 1GPWA 4TU1A 1KRBC 4GG9A 4CN6A 3IIZA 1EX5A 2ISFA 2V5LA 2JBMA 4RLIA 2V3EA 3SB0A 4U2YA 3SJNA 3H26A 3UA4A 4C6FA 3TZNA 1WDDA 2NX1A 1E6XM 3PZUA 4GE8A 4HGXA 1HJSA 4D8AA 4EF8A 3WNOA 1NOWA 3VOIA 3AALA 2DZXA 1I8JA 3IUHA 1PTDA 4XD5A 3EMQA 3R5EA 1QI3A 3W71A 4A4AA 3EA2A 1H50A 1QBAA 1S38A 2KX9A 3RILA 1HKWA 3F4CA 4S3CA 1LOSA 3ZR6A 3EEGA 2VYOA 2EG8A 2YFNA 3KTXA 4XIAA 1QATA 3PPHA 2IPFA 2PS2A 4IIBA 2DZTA 3KOWA 2J88A 4RL3A 1HO4A 4NVTA 3S47A 4DYKA 4I8DA 2E9MA 4PRRA 5BOEA 1F6YA 2BOGX 3QZ6A 3TYZA 4DLMA 1SO5A 5GVJA 1OT2A 3GXTA 1F6KA 3URBA 4Z42C 1E56A 1RAKA 3ANYA 4D8ZA 5EA9A 4TOQA 4JQ3A 1ZP4A 1TQJA 1DJNA 3MZ2A 4Y8EA 1KB3A 3PHAA 1XLMA 2I9EA 1U1JA 3WBEA 1KD0A 4C6IA 2CW6A 2WBGA 3QY7A 2WO5A 3G0UA 1P4CA 2XIQA 4MKVA 4PBEA 1M04A 5DELA 1LORA 4Q4KA 2GWGA 5LGXA 4Q8MA 2D0HA 5EMLA 4O18A 3CS2A 4NNBA 4A3RA 3FFSA 4ZO9A 4JD4A 3LRLA 3TROA 2FGBA 4O1FA 4M6UA 3WKZA 1GW1A 4J3TA 3CIVA 1RQEA 3QR1A 1NJJA 3Q37A 4S39A 1WE5A 4ACYA 1ADDA 4XVEA 5IOBA 1HVXA 5CJMA 4GUHA 3E0FA 1VIZA 3G24A 3P8JA 1R9YA 4XBSA 3PG8A 4I7VA 1RD5A 1ZBVA 4EX4A 3FJ4A 2ZZ1A 2Y24A 1Q2RA 1XYBA 2VFFA 1MZHA 1KBLA 4U28A 3N9SA 4MDOA 1R3QA 2EXOA 1ZRQA 2D3LA 3M0KA 4TR9A 2GVYA 4N4QA 4A8RA 4B92A 2V67A 2WHLA 1NQ6A 3VNMA 1SUXA 3WELA 3LTPA 3TVAA 4US6A 1W5NA 2JALA 4MUZA 1FTXA 3PVFA 2Z00A 1MUCA 3SCUA 3W7NA 1H7PA 4C6NA 3RGTA 2FDMA 5I09A 4C7DA 4QLLA 3JW7A 1Q3NA 4HJWA 1L6FA 4FXFA 1UR3M 3BL3A 2YCLB 3SN1A 1TR1A 4OU1A 3HV9A 4AG0A 1UASA 3U9IA 4NRSA 4DBUA 1YKWA 2NT1A 3GB6A 3WLSA 2BY2A 2DORA 4D72A 4WDUA 5FIPA 3AU2A 4IQEA 2WBKA 4D6JA 3MPGA 3T2PA 2QKFA 1S2TA 3OW1A 1XC6A 3I10A 3WQOA 4H8VA 2YGYA 4QBXA 2JIEA 2P8CA 2X05A 4HU4A 1N8FA 4CNNA 4GUIA 3NSMA 2BXVA 3AMCA 4JTKA 2VMFA 1W2VA 3BOXA 5FJJA 4KFOA 4HZMA 2V5CA 3NPXA 4V28A 1WB0A 3W6MA 1M01A 4GCAA 1IIGA 2HCVA 1MO0A 2A0NA 4QE4A 4GKLA 1GQLA 4Z1AA 3EX6A 4UTUA 8A3HA 4B5UA 5FJOA 3BLKA 2PDNA 2Y5JA 1KO0A 4DWSB 2G95A 2B81A 4JQ1A 4KRTA 1DKWA 1X7FA 1VC4A 1JGMA 3NZ1A 3LMYA 4PMJA 3I3DA 4UB9A 4RKAA 4WY0F 4P7NA 5AYYA 2D69A 1ITUA 3B97A 1GK8A 3SRHA 3HPXA 1ITCA 5DFAA 2QJIA 1Q7ZA 2CCRA 3RLVA 1W2PA 2GLKA 3MHGA 1TJRA 3CMGA 4RW5A 3VCCA 1B3VA 3AICA 4IFKB 1E40A 3N14A 5DANA 3EZ4A 2PDBA 5HMFA 3UA3A 1NFGA 5CLTA 4DJEA 2BY0A 3PZOA 4FIRA 3TQPA 1I75A 2GPTA 3KFTA 4CN1A 5HOSA 2X16A 1R3YA 4LYRA 1A3WA 4B2DD 5C5YA 3R10A 4Q4QA 3NVTA 1RJRA 4R33A 4ZQNA 4CD8A 2NW0A 3TSBA 3PM6A 3EWDA 4KW2A 3CB3A 5TD4A 5FF7A 4DQWA 3T6CA 3M7SA 4IJBA 3S8HA 5EBAA 2NSOA 3S5NA 4JDBA 2HVNA 1VJSA 3SQLA 4H9UA 2PLKA 3FSTA 3WEMA 1V7AA 3DFQA 1L8NA 1FWAC 3SEPA 3BQ5A 1AQHA 3SECA 2DT2A 5CPQA 1DJXA 5CAHA 1XIHA 2RHGA 5CG0A 1QOXA 2Z1XA 4GX9A 3PPCA 1OD0A 3ARZA 3DG6A 2Z2UA 2JEQA 3SI9A 1UWIA 4JDYA 2XH2A 1E4LA 4XO7A 4DO6A 1DXEA 1XG3A 1OCJA 4FB7A 1V3IA 3C61A 4DF0A 4B91A 3SRFA 3DDMA 1HKJA 2CZEA 2JFEX 1H63A 4Q6XA 5I79A 3B4YA 3N2MA 3VDCA 2P50A 4Z0JA 2ACQA 4HSOA 3WUGA 4ROPA 3EOSA 4B4FA 1NELA 3M0VA 4CVUA 1V77A 3NXFA 1UOZA 7ENLA 1W9BM 2QCDA 3CNYA 4JYEA 3QV7A 4BQ4A 5EU9A 3A22A 1J6OA 3OJGA 2HZGA 3S6OA 1IE7C 2WPGA 3VNDA 3KP0A 4Y6GA 3BSGA 4H7VA 1XKYA 3NYDA 5C0QA 3QYQA 1X39A 1VB9A 2O9TA 1L6GA 1JCMP 2QPXA 3M5YA 2G3FA 2UY2A 3G22A 1RUSA 1UP2A 3SSZA 3SIMA 4MDPA 2RFGA 3UR5A 3KVLA 1JVNA 4CQAA 3MW7A 4QDMA 4IH3A 4NY2A 3W27A 4F0LA 3DCPA 1IEWA 7CGTA 3WH6A 4HNTA 3OVQA 2QUTA 1TVNA 2BLEA 2VZOA 1AJ2A 1XUUA 1XLDA 1KWKA 1IEQA 2VDIA 4UMBA 3IJQA 4LRSA 3WLRA 1GOOA 1UYQA 1M7XA 4FNRA 2F38A 3W7RA 1M68A 2D2HA 3MMUA 2EBNA 1JIBA 2C6QA 1KM3A 3KBSA 2BVTA 4HJFA 4GYKA 3QY6A 2R82A 4NU7A 2VC5A 2JE8A 2OSYA 5AYXA 2PDJA 3CHVA 2C0AA 3AZRA 3MYPA 3BXWA 1MFUA 3KOZA 4JKMA 2C18A 2W62A 5ABTA 4AF0A 3IPWA 2Y0FA 4O1BA 3C0SA 2I56A 3A21A 3RR1A 4CKQA 4D71A 3VKCA 4AY1A 2QCFA 1Q6OA 3SCSA 1EGMA 4CD6A 1ZAJA 5ABHA 2C13A 3FK4A 4L4MA 4LS0A 4MB5A 2VRKA 5G4HC 4D1IA 1E6QM 5M5DA 4NAEB 3V18A 5JBEA 4F0HA 4FLQA 4X3ZA 3DFHA 3POHA 1V4YA 5CBJA 3W70A 1P6WA 3VGDA 3ZQ9A 1W17A 4IGNA 4J4KA 2PDLA 1CT5A 3ZYZA 2B7QA 1SO6A 3L4WA 5LYRA 3CL6A 2XG9A 3EWZA 3VOGA 3DHPA 5AB3A 2X1IA 3LTSA 3M47A 1YXDA 2FPTA 2NUWA 1FDYA 1F2JA 4TV5A 3ZWTA 5JXQA 2VC9A 4G56A 3XINA 5A2CA 4P7QA 3MVIA 1RJQA 2CHNA 4XUYA 3ZJ8A 3FJ6A 3GR4A 4BHYA 4DEFA 1DIKA 4H8UA 4AD0A 4LUSB 2WWDA 6PTDA 3W7JA 4CUCA 2OZ8A 4HHLA 1PVNA 5CLWA 1CENA 4H3DA 3EB4A 4NYUA 1QBBA 5H2ZA 3H2CA 2IMRA 5I3KA 3TC3A 4K7VA 3ZZ1A 4Z2GA 1E0XA 1O12A 4FI4A 4WKFA 4RNIA 5AZ1A 1XYFA 3CLMA 1KTNA 1Z69A 3REQA 1WUEA 1MZRA 2RAGA 4AY8A 1JF5A 3LUTA 3UVAA 2XIOA 1T40A 2OG9A 3GFXA 3MTWA 6TAAA 4J40A 4DM2A 1JDDA 1XHGA 2XFYA 3IJ7A 5DT7A 4CNSA 1F3XA 2D3NA 3GLCA 3K1GA 1JPKA 4HYWA 1A0DA 4H04A 1SQ7A 3KP1A 2VX4A 5KZ6A 3HG4A 1EP2A 3R0KA 3QM3A 4H4IA 3MA8A 1HJQA 3SCQA 3V5OA 4FNPA 2RDUA 3EOLA 1UKTA 4TMCA 3KS5A 5EMKA 1DJGA 2ZRVA 5T26A 1V6WA 1SYTA 1PV8A 4EPBC 4LCSA 2A1YA 5C70A 5DMLA 1AL7A 3MJYA 1JCNA 3ZLGA 3EYPA 3HZ3A 5HQLA 4L56A 4DZIA 3AS2A 3T0TA 1OYAA 3P84A 3VIFA 1RCXB 2I9UA 2X42A 2CBUA 3TSMA 3GO2A 4KH2A 3TQ0A 4X9YA 1DWIM 3COTA 3ZJKA 4JZ5A 3N13A 4O10A 3APTA 1VCGA 2O92A 1IGSA 4NAEA 4QAIA 2YA1A 3AC0A 2YB4A 1PE1A 1KR0A 3RJYA 1NFPA 3S42A 3EWCA 3EA1A 1IT0A 1XRVA 3PBMA 4ZSTA 4DY1A 5JH2A 2XIBA 4XZMX 3ABXA 2QCDB 3WDJA 1UC4A 1WZMA 4Y9NA 1H4PA 1XSIA 3S0CA 2HXUA 2PU1A 2POTA 3CUHA 3WCZA 5LHEA 5F2GA 4HTYA 3TMLA 1F3EA 4ZXLA 3R13A 4DJFC 1JFXA 3BOLA 1BKHA 2ZC8A 3WYZA 3EX1A 2Y88A 4F3HA 3EXTA 3ZVIA 3VMOA 3BANA 3Q94A 3QLDA 1PIGA 4AHPA 2V3GA 2NV9A 3SRDA 4Q8PA 4M81A 3S2NA 4S23A 5DCBA 1A5MC 3DI1A 5REQB 4CCDA 2D2JA 3I4KA 2C3ZA 4GCXA 4DWSA 1XH0A 1NFBA 5G1YA 3KTCA 3NQMA 3CYJA 4KWWA 1CXFA 1KXQA 4LAUA 3GBDA 3QFEA 2H8XA 1SPQA 4GWEA 4IG2A 1A53A 2EQDA 3AIRA 1Z3NA 3VNJA 2POZA 2WVTA 1OIFA 1SZFA 1E9ZB 1BF2A 4UTJA 3SCNA 2PZNA 4CNTA 3CZ8A 2ZOXA 8XIAA 2OKTA 4HD5A 5HJXA 1LLZA 2A85A 3CV6A 4FR1A 3W1UA 5DRIA 1UA3A 3R2GA 4KWUA 1V02E 3AS1A 3SUSA 1W8GA 3WLQA 4OUIA 4Y9PA 2WJEA 1U1HA 2PLCA 2VOTA 3CIWA 1PIFA 1S2AA 4MF4A 7TIMA 3NUKA 4NILA 3U57A 2XM1A 5I03A 5M1TA 3UZJA 3OU8A 2PEVA 2ZUMA 3TP4A 1FQ0A 3G1SA 3DHDA 3BPWA 1EKOA 1KM2A 1SZEA 1I2PA 1GVQA 4AZGA 3LGGA 3G1FA 2AAMA 4PSPA 4DF1A 3MYOA 5DXXA 4GJ1A 1XF0A 4LS1A 1EYEA 4HN4A 1KGUA 3V36A 2V6AA 2R24A 2L5HA 1FCBA 3EX3A 2ZXBA 4PE8A 3EKLA 5D9OA 4HA4A 1I0BA 1TJ1A 1KCXA 4GC4A 2ZWZA 4LAZA 1EZ2A 1NDWA 4OV4A 3TYBA 3OQEA 4CQCA 4UR9A 3THCA 2Y1HA 2XM2A 4A8IA 3AHYA 1D7FA 1YEYA 4IWWA 1QHOA 2F7FA 4A6GA 4A3YA 3TAKA 4RDZA 4QS6A 5I3DA 4J3SA 4LUSA 1PSCA 3IARA 3VNLA 3R79A 4GQ0A 4PMQA 3B0PA 1YHTA 3K46A 3PBWA 4ZFCA 1V51A 2J6VA 2P5NA 3DN5A 4J28A 4O8AA 4DLFA 1AVAA 1E43A 2Y7DA 4IL0A 2VNCA 1S5MA 2QYGA 1MI3A 4IJRA 1EDTA 4BI6A 4JY9A 1ZBCA 3FA5A 1MFVA 4O28A 1FVPA 4GUJA 3IAPA 1ADSA 3DZ1A 1UWQA 3DHUA 4XAZA 1F05A 3KXQA 2GOUA 4B9ZA 1BFNA 3GIQA 3NL6A 4B3ZA 2VC7A 1O1ZA 3TXZA 4MZ8A 1KWGA 1WZAA 2WMIA 3WH8A 2FVLA 5LZLA 1H09A 1CGUA 1RK6A 3ITLA 3VIGA 4JIRA 5C71A 1ITQA 3T0DA 3E1F1 5AECA 4E6MA 1H0GA 1KXHA 3RR4A 2OODA 1TWIA 1SR9A 1LCOA 2QT3A 3GHRA 1J0JA 5CPSA 4GO9A 3NJ3A 1VPYA 1TPC1 3H2EA 3PAOA 5JMUA 1KFJA 4GA8A 2OTDA 3BGAA 4XZWA 4DJDA 3WF2A 2Y70A 5E93A 4PSRA 4L7ZA 1L0PA 3E2VA 5A2AA 1PIIA 4GOAA 1JR1A 1E3ZA 4AEOA 2WVVA 3MBDA 3DFOA 3KHDA 3OA3A 2BHUA 4AFYA 4IPJA 3L2LA 3KBJA 1H60A 3AMGA 2P0IA 3IAQA 1EGZA 2ADAA 3TJ4A 1R2SA 1OX5A 2WANA 1HP4A 5BWAA 4WX2A 4XVDA 1W31A 2Y89A 3ZSTA 4UBPC 4L9XA 1LRTA 1PHQA 2CU0A 2OWXA 1UD2A 3EKGA 4S2CA 3NZPA 3PUEA 1KA9F 5MF5A 3GVVA 4JFTA 1CXIA 3NPUA 3ZOAA 1UR9A 1J0IA 2J24A 4JFUA 4H8NA 4EE9A 4V33A 1G4SA 4UWMA 2HISA 3NQ8A 1WDPA 4P7RA 3VOJA 2OEKA 4XZIA 4C6JA 1XLHA 1Q7MA 3EEZA 2QV4A 1GKRA 1BG9A 1EF2A 1RALA 7XIMA 4LV9A 3P93A 2C1IA 2OELA 4ZE5A 3GH7A 3HO8A 4M80A 1W54A 3ID7A 4F79A 1K02A 4P8XA 4BEQA 1TKKA 3NPWA 4YTRA 1DJQA 4H9ZA 4UIOA 1FFRA 5DY3A 3L7RA 1V0KA 5BZAA 2JQXA 1G9HA 2J74A 2Q8LA 1XM3A 3MY9A 3P0WA 3FV9A 1BSLA 2Z25A 1B2YA 2YXXA 4MNMA 2PBGA 3GG8A 1OHLA 3QZEA 1BHGA 3BC9A 2Y8KA 1FH8A 3VD7A 2REQB 3M0ZA 5FAJA 3HF3A 1MWOA 1A4MA 3W2MA 1Q6QA 3O06A 1V6XA 3RK8A 2QDDA 2AKZA 2ZZ5A 4M51A 5I0DA 3SQMA 2CXGA 4TV6A 4GD0A 2PWGA 1ICSA 1HP5A 4GVGA 5GJPA 1OFQA 2Y6ZA 3C52A 4AZCA 4QHRA 4K1WA 5A6TC 3JRKA 1UUQA 3HB9A 3V35A 3RLUA 4J3UA 2XTKA 4GPNA 3QHNA 6XIMA 3PPFA 3KEHA 1J0YA 1O7AA 3NURA 4HHPA 4C7GA 1XISA 4X2RA 3ERPA 5KZEA 1GEQA 3WMBA 4K39A 3NM3A 5AYZA 3N9KA 2PF0A 4YHGA 1JULA 2O0TA 4EPEC 4GACA 1RQBA 3AHTA 3PULA 9XIAA 3IJ8A 2D73A 1R0MA 1SMDA 3VMPA 1I2NA 5HATA 1RBAA 2X1UA 3FXGA 2BOFX 1N2VA 2BX7A 3GTNA 4NIRA 4XUGA 1JI1A 2ZVIA 3NQ2A 2DIJA 4RDYA 5I3IA 5JBDA 3EOUA 1A5LC 2VFEA 1R85A 1IEXA 2GJNA 1UQZA 1AODA 1AW1A 2ALRA 2J8TA 4IXXA 1V0MA 1MXDA 3A9BA 3RYSA 3PZIA 3TK7A 3IK4A 2C79A 4AQLA 4HP5A 2FHCA 4S3DA 1ZBKA 3ARSA 4U33A 1EA9C 2VFIA 3BLOA 3WIJA 5G2HA 3AXMA 4K1GA 3ITYA 3TV8A 2OZ0A 1NWUA 1SMAA 3FOKA 1FCUA 4A22A 2PRHA 4M24A 3A24A 3GXDA 1MRQA 1UC5A 3H4WA 3ARVA 3L12A 3SY5A 1K9FA 2VWTA 3WF0A 5FI8A 4Q7BA 3P60A 3ARRA 1W9XA 1G7VA 5F4WA 2JK2A 4LTSA 1W3NA 3KX6A 4Z0SA 3CLWA 3RMEA 2PC4A 3RPDA 4DJFD 5D09A 3PJWA 1J8VA 2QUNA 4HKPA 4QQUA 1P0EA 4CCCA 3GNNA 3W9ZA 1TPH1 3UQNA 2R14A 4PUUA 2I16A 3ES8A 3OBAA 2ZC1A 1THFD 4DHGA 3TNBA 2E5DA 3GDKA 1TPUA 2VR5A 3WF1A 3YPIA 4QSFA 4U10A 4GI4A 2G50A 4FK9A 2CXEA 1K8YA 1DE5A 3CEPA 4AXNA 1OC6A 2GSHA 2MNRA 3HMCA 1A3XA 3R8RA 4UR7A 1XIBA 4MLJA 4B5SA 3HA1A 3MKVA 2YDAA 3N34A 4DO7A 1FWJC 3SUWA 4MG4A 3MV11 2DVUA 1AA1B 3MCMA 5GNXA 1UR1A 3CJPA 3NL5A 3EBVA 3ECQA 5CC6A 1US3A 3LSBA 2HBVA 3NQEA 1J2WA 1Q8JA 3IVSA 3URAA 3T0AA 4K8GA 2ZUNA 5ABFA 2YR1A 4MADA 5KZDA 2VELA 3L4TA 1LL4A 2UY5A 5GQBA 4HNCA 3CV1A 3DC8A 1F3TA 3BJSA 4AVOA 4JN8A 2J8GA 5HR7A 4LW7A 1NWRA 1XIIA 1R38A 1TB3A 2ZVRA 4YNGA 1TE1A 1YW1A 3B0XA 3CPGA 1LROA 1ICQA 2J7HA 1SO4A 3DBPA 2GK1B 1GVSA 5EFDA 1EJTC 4ILSA 3H7VA 2BNJA 1PCWA 1C7TA 3MI6A 5E9AA 2FIQA 1SFSA 4WF7A 3LCLA 2VEIA 2DFAA 1A0CA 1U1UA 3G1VA 4F9JA 1JZ6A 4ZB5A 3N3TA 1R8LA 4PCNA 2Y7GA 3KTSA 3QMTA 1CI1A 1E9IA 1JUEA 1QO5A 1QFEA 2QMJA 5B80A 1E15A 1Q8AA 1Q45A 1UHVA 3CT7A 1UBSA 1U22A 3KDNA 3NQBA 8CGTA 2QHAA 1JZ5A 4KGJA 6ALDA 1O94A 4ICCX 1KV8A 3QLLA 1V6UA 4W7WA 1HW6A 2WMHA 1K7XA 4TXEA 1ZUAX 4HU8A 3NSXA 4KEZA 5C2GA 4RX0A 3QPYA 4M19A 1MYRA 3Q58A 4O0QA 3BGGA 3R11A 3VGHA 1YPXA 2GK1A 3OG3A 2XH7A 1CNVA 4WZHA 2R9RA 3LS9A 4D6CA 5D8WA 3QTPA 3M0YA 3D6NA 3QV9A 1TUFA 1XUZA 1UMYA 4K8HA 3MVT