1YE4A

Crystal structure of the lys-274 to arg mutant of candida tenuis xylose reductase (akr2b5) bound to nad+
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
319
structure length
319
Chain Sequence
SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPRSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFNDPWDWDNIPIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H-dependent D-xylose reductase
publication title Fine tuning of coenzyme specificity in family 2 aldo-keto reductases revealed by crystal structures of the Lys-274-->Arg mutant of Candida tenuis xylose reductase (AKR2B5) bound to NAD(+) and NADP(+).
pubmed doi rcsb
source organism Candida tenuis
molecule tags Oxidoreductase
total genus 105
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ye4A00
1A80A 1R38A 4JTQA 2C91A 4L1WA 2IKIA 1VBJA 4WDXA 4XO6A 2PDWA 3UZWA 1XGDA 3G5EA 3UZYA 2F2KA 3V0UA 3G1RA 2DUXA 4QXIA 4LAUA 2PDPA 3MB9A 2ISFA 2PFHA 5JH1A 3V36A 3LN3A 4Q3MA 3NTYA 4DBWA 1YE6A 1IHIA 3UZXA 3UFYA 2BP1A 4QBXA 1UR3M 4PRRA 2INEA 2NVCA 4PR4A 3RX3A 1S1PA 1PZ1A 5KETA 4Q7BA 3ERPA 1MZRA 1X96A 1QWKA 2P5NA 2PF8A 2PD9A 1XJBA 1RY0A 4XO7A 2PDLA 3P2VA 3LQLA 3UYIA 1AFSA 3RX4A 3H7RA 2WZTA 4QX4A 2PDKA 4WDWA 1J96A 1EKOA 3CV6A 1YNPA 3FX4A 3M4HA 4WGHA 4GQ0A 4F40A 4GCAA 3GHRA 3EB3A 1HW6A 1T40A 4GQGA 1IEIA 1EL3A 2A79A 3GUGA 3R8GA 4R9OA 4JQ3A 4YU1A 1PZ0A 5C7HA 1XF0A 1MRQA 3CASA 4PRTA 4FALA 4YVXA 3LBOA 2IQ0A 3Q67A 1MI3A 3QKZA 2ALRA 1EXBA 4JIRA 2DUZA 3R94A 2CLPA 4DZ5A 1AH0A 1HQTA 4MHBA 4IJRA 3LNMA 3LD5A 4G5DA 3D3FA 1LWIA 3N6QA 1FRBA 2IQDA 4LBSA 1Z9AA 2IPGA 4DBSA 5HNUA 3ONBA 3WG6A 2ACSA 2FVLA 3B3DA 4I5XA 4XK2A 1GVEA 3EAUA 1Z3NA 3S3GA 2IPFA 3R7MA 1X98A 3WBXA 1YE4A 2BGSA 2PDMA 3T42A 1ZQ5A 2PD5A 1M9HA 3O0KA 3V35A 2AGTA 3R8HA 4GACA 3BCJA 4DBUA 2FZDA 1PWLA 4JTCA 1Z8AA 2INZA 4PUUA 4XVEA 2FZ8A 4YS1A 1SM9A 5HA7A 2PEVA 4ZFCA 3COTA 1OG6A 4OTKA 3GHTA 3EB4A 4FZIA 1RY8A 1AZ1A 3WBYA 3LZ3A 1S2CA 2FZBA 2ACUA 2FGBA 3C3UA 3U2CA 2IKJA 5LIXX 2IS7A 4JIHA 2WZMA 4YVPA 2ACQA 2PDBA 3FJNA 4JQ1A 1JEZA 4LB4A 3UG8A 1AH4A 4WDTA 4XVDA 4JTDA 2PDFA 1Q5MA 4WEVX 4PUWA 1US0A 1ZUAX 3WBWA 3H7UA 3LENA 2I16A 2HVOA 4IJCA 4XZIA 3N2TA 3R43A 4FA3A 1ADSA 2VDGA 2HDJA 3BV7A 2IKGA 1C9WA 4JQAA 4WDUA 2QXWA 2HV5A 3KRBA 2R24A 3CV7A 3O3RA 2ACRA 2PDNA 2PZNA 2F38A 3CMFA 1T41A 1AH3A 4XAPA 3M0IA 2HVNA 3H4GA 1PWMA 5AZ1A 4LB3A 2PDCA 5HNTA 2PDIA 5LIKX 1Q13A 3RX2A 4LAZA 5LIYX 4ICCX 2HEJA 3DOPA 5DANA 2PDXA 2FZ9A 2IPWA 2PDHA 1X97A 2PDYA 1LQAA 3BUVA 1S1RA 3F7JA 3M64A 3CAQA 4FAMA 4XZHA 3UP8A 4XZNX 4EXBA 3VXGA 4JTAA 5M2FX 3LZ5A 4JQ2A 2IKHA 2NVDA 4HBKA 4GIEA 4LBRA 5JH2A 4NKCA 3UGRA 3GHSA 2I17A 4YVVA 2PDJA 3LQGA 1AZ2A 4JTRA 4H7CA 5AZ0A 3LEPA 3GHUA 4JQ4A 1ZGDA 1ZSXA 3R58A 5LIUX 1Z89A 3ONCA 4GA8A 3UWEA 4PMJA 1VP5A 4QR6A 4EXAA 1S2AA 2PDGA 2HE8A 4HMNA 3V0SA 1YNQA 2HE5A 3BURA 1PYFA 4ASTA 5LIWX 2PDQA 1RALA 4AUBA 4WRHA 2IPJA 3Q65A 3WCZA 3DN5A 3UZZA 1QRQA 1K8CA 2DV0A 2BGQA 2PDUA 2J8TA 4RPQA 4XZMX 3V0TA 2R9RA 3R6IA 3LUTA 3CAVA 4JIIX 4L1XA 4H8NA 4GABA 4XZLX 3MC5A 1EF3A 4IGSA
chains in the Genus database with same CATH superfamily
1OX4A 3WIJA 3GS6A 4A35A 4PSRA 1TYGA 3W23A 3ZYZA 5FL0A 1ZCOA 1A5BA 3SY8A 1UPPA 4GI4A 1W1TA 1XGDA 1UR8A 1A5SA 3VGFA 4TX9A 4M19A 4TMCA 3NZRA 5DXXA 1E4MM 2OG9A 3CUIA 3QHNA 5HJYA 4DZIA 1JDAA 4LYRA 3VDGA 1TTIA 3SUTA 2QNEA 1YE6A 3MDWA 2TYSA 4W88A 5I3JA 1OFRA 4HPNA 2BP1A 1ZTVA 3LCGA 1W3HA 3GFXA 2WPGA 5E9XA 1S1PA 1V6UA 4A2SA 1JZ4A 5KETA 5C2GA 1GKPA 2ISSA 3UY8A 2EJ1A 3PAJA 3LHUA 3QC3A 3MANA 4QLLA 1PEZA 2JE8A 4X60A 3AICA 4NRSA 4LCQA 3QY7A 3NQ2A 3AXHA 1CW2A 1W2PA 1UH4A 4H1ZA 5AOUA 3W86A 1IEQA 3H7RA 2FTYA 1EEXA 2E3ZA 1NOUA 3TONA 2HXUA 5I03A 1HJXA 4MB3A 2ZZ1A 1S46A 3BXWA 4UNIA 4UTIA 2TMDA 4XAZA 4AB4A 1MUMA 3KDNA 6ALDA 2OLAA 1WE5A 2CWXA 3TXZA 3UQNA 4Y9MA 3KS6A 1E9ZB 1OINA 1XS2A 2ZC1A 4QITA 4WHBA 4P5UA 1ZALA 4LV9A 2J9YA 1QT1A 3QKZA 3VFCA 3NQ7A 3KOXA 5A6SA 4AHQA 4YXGA 4RKAA 5CPMA 3F4NA 2D0HA 1V7YA 3BOXA 1LWIA 1KBBA 2QF8A 3S2MA 1ZY9A 4Z1AA 2Q71A 1E15A 1YXDA 3MMDA 1FY6A 2OYMA 1RZMA 2FVLA 4E38A 3ZSTA 2WQPA 4V2XA 5D30A 3NQVA 4LEFA 4ZE5A 3E49A 2PWVA 1FWFC 3GVVA 2QUVA 3B0VC 2Z27A 5L6UA 4RNJA 4L5ZA 2R8WA 3SADA 3TP4A 2A6LA 3UJEA 2AGTA 2H9AA 5BOOA 5CAHA 2V6AA 3UXDA 1GJUA 3P62A 3AMLA 1V51A 4GX9A 2XH7A 2A3CA 8TIMA 4UNLA 1R3TA 1YDYA 2TRSA 1IWBA 5TBOA 1TV5A 3OODA 1RBAA 4NNCA 3WMBA 1T5AA 2F9RA 1NFBA 3GAKA 3BWWA 2JQXA 5C55A 1RPKA 3W1RA 2FGBA 3HQPA 3W1QA 5EKYA 2HROA 1PJ9A 3GC2A 4DNMA 2JKPA 3W85A 5CAKA 4D6JA 2ZKMX 1FX6A 4H7ZA 2YCIX 5AYZA 2ZZ4A 1MEIA 2G96A 4LJ3A 1V3KA 4XIMA 1PV8A 2Z28A 2XH2A 4AX6A 1XCWA 4JS3A 4WXYA 3FCPA 4JTDA 2PDFA 3UERA 1TV7A 4DUWA 3ITVA 4A21A 3BLOA 2OOFA 2YIHA 5C71A 3IK4A 3DYPA 4PUWA 3T0AA 2J7GA 1BF6A 2QCHA 3AZSA 1CIUA 2G97A 3EXTA 4TX6A 1JYNA 3HB9A 4EANA 2E9MA 3TC6A 2DSUA 2VO5A 3C0SA 3NJ3A 4S3BA 4D6HA 1S38A 3MV11 1CXEA 2Y7EA 1KO0A 4WDUA 3L4TA 1X1NA 4G1NA 4IIHA 1B1YA 5BW6A 5DF0A 5M17A 3B06A 2HV5A 4GNJA 1B3YA 1HL8A 2GSEA 3UR5A 5A69A 1NDYA 3U3HA 1QI0A 4ZXLA 5D9NA 4O16A 3SUWA 1P48A 4Q4RA 1T0OA 4POCA 4KEUA 1R7OA 4ADTA 3EOOA 3CZLA 4GY7A 3LRLA 3LB0A 4H9TA 2H3BA 3IVSA 3QN3A 5CSUA 4W84A 1Q7QA 3KBWA 2PDXA 3WDRA 1VIZA 1U1HA 4XB3A 3GDKA 1K9FA 4M81A 3AC0A 3CAQA 2VCAA 1AQMA 4JCMA 3KDOA 4QLJA 3K1GA 1QOXA 1XLAA 1EBGA 4HIBA 4MAVA 3BTNA 1UD4A 3AS1A 2GQ8A 1TB3A 3CO4A 4I6VA 1I6NA 1UBPC 1CECA 4IXHA 4U2ZA 1GPFA 2QLYA 1IF2A 1R6WA 2A3HA 3GR8A 3ZR4A 2YXGA 2G4JA 1KM5A 4AIEA 3P60A 2OZ8A 1J2BA 2CLKA 3ORWA 2C16A 5EGRA 1ZENA 2PCEA 2UY5A 3UWEA 1U1UA 3WQVA 5FF3A 3DFQA 4EXAA 3ENLA 1DWIM 2KX9A 2WHLA 1MXSA 3E0VA 3STPA 3LHZA 1Q6EA 4ASTA 4D6IA 1PAMA 3GW0A 1H49A 3RFAA 3TJLA 3ZT5A 5FESA 2J6XA 4O8RA 3RR4A 2G5WA 4U10A 1RP8A 1E6ZA 2GOKA 2YR1A 3TWAA 4GC3A 3I6RA 4IX2A 1EGZA 3AO0A 4N6EA 3AMCA 4Y9PA 1I2PA 2VENA 2C1IA 5G2WA 2ZX9A 3M0YA 1V3MA 2GQ9A 4QS5A 3VIIA 4UZUA 1BG4A 3UWUA 3ARUA 4GWEA 3TKFA 1TRIA 3KWXA 3QPEA 4L1XA 5D02A 3TFXA 1XIFA 3GXFA 1JCNA 1UP3A 3T0DA 2QEZA 4O14A 4QCEA 3N34A 1POKA 1ICQA 3N18A 4AD3A 1HVQA 1VGAA 4PMNA 3VNLA 5MKGB 3LXBA 2WC4A 2F2KA 2AKZA 2G3IA 4C7GA 4I6KA 2GVLA 2XGIA 5KSWA 3C3NA 4RXGA 2Z24A 5FJUA 5JH1A 1MW2A 3LN3A 4V28A 3A12A 3PZQA 4IUOA 1UW9A 3M0HA 4NI8A 1NDWA 3N17A 2OFJA 1SPQA 4MUZA 1KM2A 1G7VA 3UNTA 1IEVA 2NVCA 5C2XA 2VWTA 3TSBA 1MXGA 4D2JA 3VCCA 4MADA 1UKQA 1A5OC 2ZX8A 4M82A 1F73A 3CU2A 4J3WA 1KFEA 1PCKA 4ACYA 1XX1A 3ARWA 1J4EA 3OVRA 2QAPA 3EXSA 4X2PA 4IPJA 2PD9A 4CQBA 1VHCA 4DYKA 3JR2A 3UYIA 1AFSA 2QUMA 3TYCA 3BK0A 3RX4A 3I3BA 3LTSA 2ABAA 3MMTA 1JPKA 3LX9A 3IGSA 4WDWA 2BB0A 1CLKA 4ZTYA 5HJXA 3OZOA 5AHMA 3KBMA 4ZB5A 4Q8MA 3TZFA 4LRSA 1DOSA 3TH6A 2WHJA 4HSHA 1B3OA 1E1CA 5FEZA 4IISA 1X8CA 4OUIA 2XDFA 2EAWA 1TA3A 3FXYA 4O0QA 2VWSA 2B31A 4US5A 1HX0A 2ALRA 3WY1A 1X7FA 3JU2A 5HMDA 2NZLA 4OGZA 3V5CA 4BK9A 1DTNA 7CGTA 1XYCA 3JW7A 3VIPA 2ATMA 5HUOA 1ZBKA 2I9EA 3KZSA 1W6TA 4LYKA 3BICA 2XN1A 1U1JA 4O19A 1DJYA 2BY1A 1OWQA 2ZUWA 1HKKA 4C6FA 4GG9A 4G8TA 1Z32X 2WCSA 3B8TA 4MY9A 1QWGA 3BSMA 4M8UA 3W4RA 1BLIA 2AL2B 2Y1HA 2BX7A 3DESA 4R34A 1WPCA 1JRBA 4F3HA 3ARZA 3NQBA 4AVNA 4NQ1A 3O0KA 3CUXA 3PBMA 2FZDA 4JTCA 5FEPA 1JDCA 3MZ2A 3L0KA 4D8ZA 1RBOB 1UWQA 1EF2A 2XSBA 1A0CA 1OZQA 3W1TA 1BEUA 3ARXA 5D2WA 4C91A 4D6EA 3OG3A 2GWNA 3GHTA 3MHGA 1FDJA 2F7FA 5FJPA 3TWBA 1UUOA 1Q6RA 2VKZG 4Q33A 4UQDA 3EKLA 4D8LA 4IL0A 3KL5A 2CXEA 4V33A 3R4IA 3TNOA 4LBUA 3EPNA 2A1YA 4H8HA 3RO6A 3WFZA 1QNRA 4OKDA 2PDBA 3QSTA 3MSDA 4HNUA 5GJNA 1GVFA 2ZTKA 3UVIA 1G0CA 3GNRA 3L4YA 3W88A 3RPMA 1PIIA 1XUZA 3O63A 2OQLA 3GQYA 3S9IA 2V9DA 3RYSA 1TR9A 2GJXB 2VEGA 1YPFA 5FJOA 5JVLA 5A6KA 1MVYA 1AD1A 1DIOA 2VCCA 3LCIA 4TV5A 1QNPA 2JF6A 4JX6A 3TFCA 3PZGA 3W70A 1E1EA 4L64A 4ZQMA 4L61A 3L5LA 4EPEC 4LY4A 4ZL1A 4ORIA 4HZ7A 1ESWA 4EPDC 2DSKA 4KQNA 4BQ5A 2E1DA 2PDCA 3P61A 3I4KA 3RX2A 3G18A 1XLIA 4MWAE 1YTEA 3EWWA 5HJLA 2A7RA 1O1ZA 2FMOA 1VLIA 1TTJA 3THAA 2CEQA 3PZ9A 1EJ7L 4HNCA 4ML9A 4DWSB 1HUVA 4FAMA 4XZHA 5FF7A 4HZMA 1BFNA 4WVXA 3WUFA 1XSJA 1TE6A 4HPJA 4JQ2A 4H9MA 3PVFA 1NU5A 1XYFA 4KIRA 1XDMA 2QMJA 1W5MA 3AXMA 1H7RA 2ZA2A 3TE9A 4WCJA 4JD4A 5M1TA 4NP7A 1TQJA 4D6DA 4MB1A 4MGGA 1IIHA 1SQ7A 3VGGA 1DP0A 4PTMA 1VCGA 4GX8A 3AOFA 5BOFA 1I2OA 3P82A 3T4CA 4F66A 2VRJA 1FWGC 1LQ0A 2QV4A 4TU1A 4GK8A 3K8KA 4PTVA 7REQA 3UWZA 3GIYA 2PDQA 1JIBA 1EC8A 2VOTA 3E0LA 1KBIA 4NZJA 2ZRXA 2J47A 3AQUA 1BYBA 3T2QA 3NL2A 3NL5A 3GB6A 1EUAA 3IACA 1UYQA 1JCMP 1YNYA 4UQEA 2DV0A 1PO9A 4AD0A 1C92A 1H63A 5D9PA 3KXQA 3C2EA 4C6EA 4RDVA 4UTFA 2R9RA 1AQ0A 3WEMA 4M56A 3AJ7A 3CAVA 1CNVA 2QCEA 3LSBA 2P3EA 2QCFA 5HAOA 1OX5A 3UWYA 3G1FA 2EBNA 4B2DA 3FJ6A 4Q8PA 4I9JA 3V1PA 3PPHA 2DVTA 3AIBA 3IJ8A 4WKAA 2PS2A 4K8EA 5C8BB 3KOWA 4LAUA 3M46A 4FF5A 1TJ2A 4H8VA 4LF2A 3TYUA 2XG9A 1RXOB 3NTYA 4OBRA 5C70A 4GFSA 3VPLA 3GC4A 3UZXA 1A0EA 1R8LA 3S47A 4K2SA 4ZB0A 3VD5A 1L0PA 4ZQNA 4FR1A 4XAFA 2PI6A 3PUDA 1BSIA 4MLJA 3ERPA 4M7SA 1D8WA 1QWKA 4L56A 3V1HA 5A94A 3FHQA 4LV4A 4ECLA 3D5HA 4DM1A 3UG4A 3FOKA 2Z6JA 4IHCA 2CU0A 4NAFB 2V5JA 1WZLA 2ZCGA 5MF5A 1GOIA 3WF0A 4XUYA 3A3XA 3WQ8A 4W9TA 1GOWA 4TO8A 3M0VA 1UKOA 2P88A 1SZRA 3H4WA 1J96A 1GHRA 3S5YA 4IXXA 3GO2A 1EH9A 2WVTA 2Q8ZA 2X8RA 1YNPA 3N19B 4UIOA 3E0WA 1WYIA 1EX1A 3S9ZA 3WLKX 3VDHA 3VOGA 3ITCA 5M3WA 1OD0A 5CPLA 4QSHA 3N9SA 1Q6OA 5FEWA 4NILA 3W2JA 1Q8JA 5D8WA 2XUCA 2JIEA 4IWWA 1S5NA 3MPGA 2CZVA 5CLWA 3NQAA 3R94A 4C90A 4AY8A 1QR7A 1S2UA 2NW0A 4ZQOA 4HVXA 4WY0F 1BKHA 2XYLA 1A53A 3QFEA 3C8NA 7ODCA 3B8UA 4HYWA 4FF7A 1Z69A 1R9YA 2ABBA 1SO5A 3MZNA 3B8VA 1A5NC 1F6YA 5MKGA 2DZVA 3WH9A 5C5YA 3GXPA 4UFHA 3TVAA 3BLKA 2YLLA 1AJ0A 2YW4A 3HN3A 3S0CA 1IZCA 1OFOA 3NG3A 3M0LA 4A22A 2YCLA 3SEPA 4DF1A 2RDUA 1Q4NX 5EBUA 2BOFX 3WQDA 3MTWA 4Y9NA 1EJUC 4JTTA 1B2YA 2ZRVA 4OJYA 3AYRA 3MVIA 1UA3A 2QS8A 2XVNA 3IANA 3L66A 5I06A 3WYZA 1DIDA 3DYMA 3LG3A 1SZEA 3CIVA 1ZCCA 2XM1A 4UFLA 3WLIA 4XBSA 3C0JA 3GKAA 2C8NA 2XIBA 4ZFCA 4D1JA 3H8AA 4QE5A 2V69A 1OJXA 1TJ1A 3U2EA 1XKJA 4DM2A 3BJSA 4CNOA 3N12A 1ITUA 4LVFA 3UWQA 4H19A 1WP6A 4GO8A 1ECQA 3KP1A 3VOIA 3H2EA 1QAPA 4BWLA 2IKJA 4IL2A 2A5HA 4JL2A 3B40A 1RVKA 5I23A 3NQDA 3W9ZA 4PRWA 1NQKA 2QPXA 1CX9A 4FNSA 4QEEA 4X0VA 2BODX 3RPDA 1RK6A 2XWDA 3LXCA 1EJXC 3A21A 3LDVA 2QIWA 2NQHA 3OYZA 5AYYA 3S5NA 3E2SA 2PB1A 4QISA 4C6BA 2DZSA 5F2LA 1H60A 3RAOA 5T9BG 5CG7A 3TN5A 2H8ZA 1QW8A 5A6AA 4DJFD 2QJMA 3E9AA 4LC8A 3ZJKA 4B4FA 3NQMA 1R46A 2PUZA 3HFTA 4NAEB 2V68A 1BVZA 3KEHA 5PTDA 1C93A 3M1ZA 3NQ6A 4MLRA 3P8JA 2VGBA 1AQFA 3WX7A 2EPNA 1GOQA 4M6VA 5CGQA 3NZPA 3ALFA 2DPEA 4IG2A 3AHVA 4UTTC 3TC3A 2CITA 1BYCA 1XHGA 3V18A 5HNTA 3EX3A 4HMEA 1D3HA 1TVPA 4ICCX 5IM51 4E8DA 4JGDA 4B15A 1KBKA 2GUUA 1R3WA 2DH3A 1XC6A 3PBYA 3FLUA 4PB4A 4PTXA 3MU7A 4CNPA 3FYYA 4TTGA 1EHAA 5KZEA 5C6MA 4JN7A 5FF0A 3W7DA 5C9ZA 4MJ2A 3VIMA 5JH2A 3W3OA 1QPQA 2YKKA 1KV8A 4QSFA 4U5IA 4PE8A 3GHSA 1J0YA 3M7SA 4JCLA 2BVDA 5REQB 4PC8A 1WXZA 3LEPA 3BLIA 4GYFA 3SGZA 3EOEA 1ZSXA 5DMNA 3OHMB 2H3DA 5EY5A 2CLIA 2JF7A 1ITCA 3CT2A 1VFTA 3AI0A 3LCLA 4K38A 3NO1A 4WKFA 1D3GA 1BQGA 2XJ7A 1UZ1A 4CCEA 3GH5A 4NJJA 4MYXA 3JS3A 4HCHA 5B80A 3H6OA 1TCMA 5IBXC 3WUGA 3M44A 3FA3A 2POZA 3WF4A 3T6CA 3W87A 4QDMA 3QC0A 2ISDA 3MDUA 2Z1BA 3MYOA 2OGYA 4CQDA 2FTWA 2P1FA 3VAVA 4R27A 2BFGA 2CKSA 4UOJA 3V0TA 4FR6A 1HL9A 3FGCB 1NWTA 1AUSL 3TQ0A 5J5DA 1B31A 1RJPA 2E8ZA 2V82A 4H8NA 4BKNA 3C52A 2X16A 1E1FA 3NWRA 3VNKA 2RJGA 4AWSA 2GUYA 1A5LC 5A95A 9RUBA 3KOZA 5FF4A 1JCJA 1A80A 2CXGA 4RZBA 5FJIA 4Z2JA 1GEHA 1CWYA 3VGEA 3SR7A 1ZZMA 3ABXA 4OVXA 2OEMA 3VIOA 1O5XA 2V30A 3FV9A 1YDVA 4XWUA 3G1RA 6TIMA 2XFWA 1WBJA 4JFUA 2NQ9A 1SFLA 1Z42A 2QCMA 3NEHA 4PBGA 3WEZA 3M43A 3WJYA 2I5GA 1CGWA 1H5VA 1ISWA 4Q32A 2W4XA 5CC3A 3DUGA 4PRRA 5HOSA 4LUSA 1FQ0A 5KITA 1CXHA 4ZTXA 2RUSA 1B4KA 3ABQA 4HP5A 4N9DA 4O1EA 1LUCB 4DJDC 2NLYA 3NUKA 3QZ6A 1N55A 2WB5A 3U2OA 4KFNA 4UTJA 1PX4A 1H41A 3LQLA 3N11A 1F07A 3CJPA 3AIVA 4C65A 4LNCA 2ZTJA 2DFAA 2PDKA 3N15A 4RE3A 3M0MA 3P93A 4DJEA 2W67A 5FJRA 4DF0A 2QPSA 2NQ5A 1SW3A 1UUQA 2VFHA 3FVDA 4RZ4A 4A3UA 1E3ZA 2A79A 3CHCA 3CV1A 3GUGA 3EX6A 3LK6A 3MO7A 4BF7A 3QMSA 1JVNA 3NQFA 4Y2WA 3C2YA 4O13A 5I3HA 5T91A 2QCNA 1PVNA 4AF0A 3H70A 4OE7A 2DT3A 3ID7A 3UG3A 3SFWA 1YHTA 1RH9A 1W17A 4YCPA 2ZE0A 4U3CA 3D3FA 4N42A 3GU2A 3S6DA 2DORA 4ERIA 5DBTA 3SRFA 3TYEA 3BVJA 2O7SA 3ALGA 4R53A 3LHVA 4V15A 5H2ZA 5DT7A 3RM4A 4BZYA 1J6OA 3W7RA 3W6YA 1T99A 5EA9A 3LNPA 3VUPA 1VB9A 1JQVA 4JYDA 3UPBA 3S3GA 1XYZA 3WBXA 1D3CA 3R0DA 1OFQA 3WH6A 1QNSA 1H11A 3AWOA 1XPYA 4GMEA 2BHUA 1M53A 5G1YA 4Z42C 5EMJA 4J2PA 3W1LA 3USZA 4OHQA 1QO2A 4GH1A 1XRTA 1ICPA 3G0UA 5CBJA 4PMVA 1QATA 3CUJA 2G37A 4H83A 3C2VA 2H6RA 1QHOA 4H6EA 1W3LA 1PZ3A 3A5FA 3P5YA 3U2CA 2FDSA 2W27A 3AS0A 3PJXA 3WD0A 2ODOA 1EZ2A 3WH7A 1E5JA 1GZ1A 3C0LA 1US3A 1XYMA 2C79A 4Z08A 2V8ZA 4MVAA 3DIPA 3WL0A 5TAOA 5EMUA 4Z2GA 2XSAA 4UTHA 2HBXA 1KXHA 2DDXA 1FVPA 4AIBA 4I7WA 5KINA 4RJEA 3QHOA 5TD4A 3H2AA 3RILA 2Y24A 7TIMA 5K2ZA 3LGDA 3TAOA 4TTUA 2WSQA 3BO9A 3SUUA 1G9HA 1A47A 1UP0A 3Q4DA 1G69A 3LM3A 3WDIA 3C6CA 4BFAA 3UYCA 4G7EB 3MT1A 4KGJA 2XIJA 1W9BM 1TPH1 3ABZA 4S3FA 1R87A 4JNZA 4HPXA 2E9LA 1PWMA 4C6OA 3RK8A 3BW2A 2VRQA 1NDZA 1HGWA 4DAIA 3T40A 1KXTA 5LIYX 2X0YA 2FPVA 3U9IA 2F61A 4PUJA 1E0XA 4REQB 1GQNA 4PTNA 2VP8A 5JU6A 2PDYA 2XIIA 2R82A 1LQAA 1J11A 2NX1A 4RW5A 4LUTA 3FJLA 5A3HA 3M07A 4RE2A 2FZMA 2XINA 5LHEA 1H09A 3N3MA 3TYDA 4Q7NA 4NNBA 4QIUA 1VFLA 3ANUA 1QBAA 2CBVA 4S1FA 2J25A 2AOSA 4WR3A 1NOWA 2HK1A 2OT0A 1PUDA 3ARVA 2H8XA 1BYDA 3N4FA 3A13A 2PTDA 3NVDA 1RP9A 1E51A 8XIAA 1YDNA 1Z89A 1NOFA 2PP3A 3B97A 3NOEA 3GU9A 1VP5A 4HTYA 1IT8A 3F2CA 3OA3A 1DJZA 2Y63A 1IXPA 3WFAA 4JKKA 1TTPA 1FWSA 4S38A 4FNTA 4ONVA 2IPJA 3JVAA 1GQIA 4W8AA 1TV2A 3L2MA 3UZZA 3TQPA 2OEKA 1GVYA 2WJDA 1V77A 1EGVA 4H6RA 3WLJA 3W7KA 4N9EA 2EXOA 3DI0A 4LANA 3TX9A 3WMCA 3B8IA 2YJQA 4XKYA 4BF9A 1XICA 3GFYA 1O4UA 1JG9A 1FKWA 3HA1A 1VJZA 4AYSA 2TAAA 4MZYA 3TJ4A 4HZ8A 2W6RA 4GJJA 3MC5A 1ZJAA 4E2VA 1YMYA 1M68A 4DZAA 3CHEA 1HP5A 3LLFA 4WDXA 4B9ZA 1TRDA 5JMUA 3L21A 2CLLA 4GUJA 4Q8WA 4QE1A 3EMZA 1E43A 1GOOA 3PSWA 3TEVA 1QO5A 5E70A 4HU8A 3B0UX 2YL8A 3EOUA 4DWSD 5RUBA 2PFHA 3CQ0A 4X22A 4C6IA 4DBWA 7A3HA 1KCKA 2A2IA 3KBJA 5AECA 4NT0A 1UR3M 1F74A 4BR1A 5A6LA 3P0WA 4KWWA 1TMLA 3EPOA 4C7FA 2CWNA 2QCDA 2O9OA 4A4AA 3IK2A 1B57A 1E6PA 2Z1SA 4W7WA 5HQMA 4BQ4A 2YGYA 3MUIA 4JDYA 4B3ZA 3VNIA 1JYWA 2PBOA 3RXZA 4I9AA 4F0HA 1OCJA 4NIRA 3W7LA 4TOQA 3E6EA 4GNKB 1E70M 4DB7A 3AJXA 4RV3A 1Q6GA 1R0MA 4DJED 3CV6A 4GY1A 4L7ZA 1GG1A 3LERA 3NZQA 1QPRA 3VOCA 3SUSA 4EIVA 2C13A 4GQGA 6CGTA 2BS9A 2Y5SA 3SIZA 5F4XA 4AXKA 1UR9A 2XHYA 2GL5A 6TAAA 3VNDA 2PRHA 1E4IA 3W7QA 3SRDA 3UCQA 1F4AA 1E6NA 1XLBA 1IR2A 4YVXA 1JUEA 3ISIX 1JD9A 1MNSA 4PL1A 3SQSA 3EOSA 1JZ5A 3E2QA 3L7RA 1G1YA 1AD4A 3ZWTA 5LNSA 5HQLA 1VPYA 2W79A 2IPGA 1KFWA 4CQCA 2PWHA 2DY3A 4B16A 4RDZA 5I02A 3SQMA 4C5YA 2PRMA 3W82A 3WLSA 1ZL1A 1G5AA 4IGMA 4B5SA 2GK1A 4JFTA 5AVHA 1OGSA 1F8IA 2HTMA 2VM8A 4ACZB 2FB2A 4H6KA 4LUJA 3T1GA 3H7VA 1J0HA 1Z8AA 2EQDA 2VR4A 4PL2A 3WQPA 4C6NA 2A21A 3NXFA 5CXPA 1JCTA 5D4YA 3COTA 1OG6A 2DJLA 2XU2A 5ENLA 1AZ1A 2XVPA 1NWUA 1V02A 1VYSX 5BXRA 3URNA 4WJEA 2REQA 3KL3A 2TSYA 3WLMA 5ABGA 2WWCA 1EPXA 2XIOA 4ATWA 3FAWA 2J7EA 1W8SA 3GNPA 3TV8A 4LAMA 1AODA 3DENA 1H3GA 3DFSA 2XFRA 3LHWA 3G0SA 3NXLA 3FHAA 1WDWA 1O1HA 5JIWA 4OBTA 4ZODA 1QOPA 3SN0A 2VJXA 4K7VA 1XL9A 3N3TA 1UH3A 1Q2SA 3URQA 1OIFA 2VC6A 3D0CA 4IJCA 4XZIA 3UWVA 1J93A 5ABHA 2VDGA 2P3ZA 4TXEA 2HDJA 3KE0A 1Y0EA 1TELA 4TQTA 1SGJA 2J62A 3CHVA 4R33A 1WO2A 5E09A 2DW6A 2WM1A 1UKTA 4JN6A 4AVFA 3DX5A 3U7VA 3LRMA 1V3LA 1LYXA 2WBKA 1REQB 3O15A 1DXFA 2QQ6A 2E6YA 1T41A 1UD2A 3M0IA 1GKQA 1UD6A 1UZHA 1Y7VA 1XIJA 2GZXA 4NF7A 4LSBA 1XIGA 1KFCA 3WMSA 2V0TA 1X7IA 3HV9A 2VNCA 4GIYA 2PWEA 5TQLA 4UC5A 4PA8A 1EHNA 3FJ4A 6REQB 3W83A 4CU8A 1LF1A 3CUZA 3IEBA 2ZRYA 1G4PA 4LCSA 2CLMA 1I9CB 1ZLPA 4HHMA 2RAGA 2YCJA 3H21A 4NKCA 1SO6A 4XQ6A 4Q8NA 4LVDA 4G56A 4IFKB 4Z0SA 4MKSA 3LQGA 1ISXA 1OFEA 1H7NA 1EEPA 3VABA 2E67A 2NXIA 4MPKA 4XZ9A 1XD1A 3AISA 1VFHA 4W87A 5A2BA 2R91A 4PMJA 3N2BA 4PUKA 5JQ9A 2VR2A 3JRKA 1M03A 2J8FA 4AZCB 2QCCA 3L67A 3Q2DA 3WNPA 3UD6A 3OTRA 1XFCA 4QTGA 3FEMA 3KOYA 3U4AA 5M03A 3KLKA 1C3FA 4JHZA 4X61A 5I7GA 3TNBA 2PWGA 3B9DA 3B04A 3ATZA 2J7DA 1CCWB 2C71A 1S5MA 2C1HA 1TCDA 1W9DM 1ME8A 5LKYA 4JOMA 4AZ7A 2DH2A 3QY8A 1VH7A 4NZFA 3W28A 3LUTA 3OQ8A 3FEQA 4DYJA 5BNKA 4ZBCA 4G7EA 4JIIX 2WVVA 1FP8A 3NDZA 2YCEA 4AMCA 5IDIA 4FIRA 3P0XA 1R3VA 3MSRA 1RAKA 3IIZA 3ZVHA 4JTQA 4J3SA 3WLOA 1BRLB 1PTGA 1W0MA 3V4BA 4GUGA 4EX4A 3DFOA 4A8RA 4FXSA 4REQA 3NAVA 3V0UA 1J0IA 4X63A 2P10A 4CD6A 3NZ1A 2FDMA 1I60A 4BI7A 1EP3A 1LBMA 5EYWA 1O7AA 4UCFA 3VC5A 1FWAC 1QPKA 3RU6A 2FTPA 1VAHA 1DEDA 4WKHA 1TV8A 2ZX7A 5BWFA 1KD0A 3FK4A 3PBGA 1FH9A 2IXVA 1H1NA 2J7FA 4KEVA 3E96A 3CGTA 5GJPA 1A5CA 3BCDA 2AKMA 3GIPA 4MAZA 3D46A 4QHRA 4M1RA 1IWAA 3ITLA 4ORMA 1UROA 2NV9A 4QGCA 2WAGA 1LOSA 1T8XA 4QQ3A 1V3JA 3G1DA 2WZTA 1B3XA 2RKXA 4GZJA 2D3NA 1EIBA 4H01A 2O55A 4AVOA 2OJPA 1RJQA 4P2VA 4L1GA 3M4HA 4NZCA 3TR2A 1YLVA 5FOOA 2WXDM 2XH4A 1HG3A 1ZJHA 4FX7A 1FWNA 2OQHA 1RD5A 4TIMA 2YL9A 4UQ9A 2G3FA 3FKKA 5CG0A 1XF0A 1LOQA 3BG5A 1FP9A 3IV3A 3CHFA 3MS8A 5CPOA 2ZUUA 5LA2A 1HQTA 3WJZA 4CVUA 3DERA 3GYEA 2OB3A 1XLEA 3IARA 2VT0A 3ZFHA 3C4UA 1SFSA 5IXEA 4YTSA 4HTBA 4H9UA 4BEUA 1AL8A 2ASHA 4FX6M 5HNUA 2Z29A 5K4ZA 3VZXA 1B54A 3PK7A 1Q2RA 4P7LA 3PZOA 1RHCA 4W5UA 5D09A 4UFKA 1EJRC 4I90A 1XISA 4XK2A 1H5YA 5BXPA 1UR4A 3INPA 1BYAA 1OX4B 3GR4A 4QAWA 1X39A 1NWRA 3AHZA 3R8HA 1RQHA 4UTUA 1LZOA 3LS9A 3ANYA 2X1RA 2PBGA 2E6FA 1IR1A 3AROA 1T8QA 1LRQA 4ATDA 4D8AA 5A1AA 3TW7A 1T6MA 4ZCWA 1XLLA 4H9ZA 4JTIA 1RJRA 4GH3A 1GYLA 5AYBA 1WAWA 3FSTA 1VYRA 2FZBA 1FCBA 2DZWA 2FIQA 3HF3A 3MI6A 1Q6DA 2X05A 4GYPA 3C3UA 4ZEPA 3W7MA 4O8AA 1YTDA 9CGTA 1ME9A 3OHIA 4B5NA 1HGYA 3TXVA 2PLJA 2VTFA 4KRTA 1EIXA 3BLPX 5F4WA 3GDLA 4GUIA 2L5HA 1ADOA 1XH0A 1AH4A 5JXQA 1GVSA 4IMFA 1YXCA 3DGRA 4WEVX 1US0A 4M51A 5DCEA 3UU0A 1E55A 3QM3A 1DXEA 4FLQA 1FXQA 4AZHA 3D6NA 3AU6A 1IIGA 1PIFA 3APTA 4FA3A 2POTA 4EKJA 3AMKA 4W93A 4AYGA 3EEZA 4W7VA 2IKGA 3VI2A 2VC9A 3QV7A 4BI5A 3HURA 1X6UA 1JNDA 1J2WA 3O05A 3KTSA 2WK2A 5KZMA 1F6KA 1GONA 3PTQA 4OIFA 5D32A 4IF2A 2GJPA 1YPIA 3ZT7A 3B05A 2VX5A 1GYNA 3N04A 3T0TA 3APYA 4HJWA 5SWUA 1O66A 4DN1A 1E4NA 2QMKA 4LW7A 5CCZA 4B5UA 2WZEA 1F3EA 3MJYA 6XIAA 3HBLA 1B5TA 3O0FA 1E72M 3NFUA 3AZTA 4CNTA 1LT8A 4PTWA 3GRIA 3L23A 5HDRA 4A29A 3WQEA 3AWNA 4UQCA 4B3LA 3UA3A 4EXBA 2GGGA 3L65A 4PCFA 1W9VA 4HBKA 3TYAA 2H9AB 3KUMA 2PP0A 3RDKA 2ZICA 4O10A 2X30A 1AA1B 2C18A 3GHUA 1EDQA 3TMLA 1ONXA 1JZ2A 5AB3A 3VNZA 4H2HA 1R30A 4C6MA 1W3NA 3H2FA 1W1A1 4GFIA 3TTSA 1S2AA 4GO9A 1DHKA 1JF6A 4HMNA 1K77A 1J8VA 1WZMA 2ZUNA 3BH4A 1CYGA 3RLUA 2PSNA 3QVQA 2WCAA 1UWAA 4JY9A 1JDDA 2WYSA 5I5RA 3QHMA 4KCVA 3BCFA 1LDCA 2C15A 3QMTA 1EO7A 3H2NA 4Y96A 5CQ1A 3G3MA 4AZ6A 1LWJA 2OTDA 3URBA 4RPPA 2VQTA 1BVNP 2PTYA 5BU6A 1O95A 2ZXQA 2GVEA 4IMAA 4HA0A 4F2BA 1HN1A 1FBAA 1I8JA 2QJHA 2WKLA 2JBMA 4CVWA 1EYEA 4IGSA 3RCNA 2DIEA 1EC9A 3TDFA 3GZAA 3PB2A 4MWAC 4MTVA 1R3YA 1O12A 3FDKA 5A8PA 4Y7EA 1RCOB 1XIBA 3MI2A 3CS2A 1JZ3A 8XIMA 4Q6XA 4UR9A 3VNYA 2ZXBA 1DQWA 2ISWA 4IPPA 3STCA 4ZSTA 2WV8A 4IMEA 2OLSA 3R5EA 1TPUA 3SB0A 2WJFA 4DF2A 1VF8A 2VC7A 1TKKA 1W31A 2R1MA 3GX9A 4JIEA 1D7FA 3I7SA 4HNTA 3CLMA 2RHGA 4IFKA 1A4MA 1S39A 4PTDA 1VYPX 1LBLA 1W9UA 3WLHA 2DSWA 2R94A 1LL6A 1XGEA 2JGQA 3CUGA 3W1XA 1KM1A 1WZKA 4AQLA 2D23A 4MNMA 1OGGA 1ZNNA 5AHLA 4DO5A 1EXPA 1DWJM 3GVWA 4G2DA 2NSXA 5T26A 3SI9A 3TA6A 3AUJA 1BSLA 4HN8A 1DJHA 1O94A 4J3ZA 4YN5A 3KS5A 3EB3A 1L6GA 1HW6A 1TZ7A 4UB9A 2NQLA 3PZNA 5I24A 5GJMA 2OZ3A 2X1TA 3R12A 1FCUA 2GVYA 1JCXA 1PZ0A 3G1VA 3CUHA 4Z1BA 3F1QA 3L5MA 4FALA 3CIWA 3PF3A 4DWDA 4OFCA 3F4CA 3PUOA 2IQ0A 3P6LA 1MI3A 3WF2A 2RH9A 4NHVA 3UWWA 2O7QA 3LM7A 4KBXA 3W25A 5LXEA 1A49A 3WJWA 1MFUA 1BRLA 1P4CA 4TVDA 4AZGA 2AAMA 3RJYA 2PLCA 2W5FA 1A5KC 1TZ9A 4EOUA 4NZ5A 1KLZA 2BNJA 5L9FA 5DELA 1GORA 3GVQA 4RNHA 2BVTA 7PTDA 1JPMA 2Y8KA 3R7MA 5LA0A 3LSCA 3MJMA 2P76A 2YCKX 1D8CA 4QS6A 5HPOA 3IJIA 3UPMA 3K2GA 4ZMGA 5KZ6A 3GD6A 4WXZA 1F05A 4HU4A 1BD0A 4H8UA 1JFXA 1DJGA 1VRXA 1KXVA 3DBNA 3VX0A 3W76A 1KRBC 4S3DA 1J5SA 1A5MC 4PGLA 2HK0A 3U57A 1RY8A 1J5TA 4YTUA 4O12A 1FWTA 4MZ1A 2RJHA 4E4PA 3MMUA 2ACUA 3HGJA 1R85A 2CNCA 4GVIA 1AW2A 4L9YA 1E0TA 3NM1A 4F0KA 4ZE4A 1WDPA 4AU0A 1GVQA 2OT1A 1U2YA 4JIQA 1L2QA 4JHMA 2VI0A 3O6YX 3M0KA 4XSLA 1KCZA 1UCWA 1YQ2A 4KWVA 4Y9OA 3WMLA 3M7WA 1I4NA 3DBPA 1RUSA 1Q8AA 3EA2A 2QYGA 3SSJA 2CW6A 3O1NA 1OIMA 3EMCA 4UTWA 2Z26A 4J40A 3PZIA 2HCVA 1ONRA 5A8OA 5IFTA 4J4KA 3VM7A 1PHWA 3W6MA 4KH2A 1E1CB 3AYSA 3POHA 2FB3A 3VOFA 3K8LA 3JZUA 1TA3B 2VEMA 1XD0A 3PWIA 3LCHA 3MKKA 1P6CA 2F84A 3UW6A 4AAJA 1RPXA 2PA6A 2OWCA 2RDXA 1MNZA 3E5PA 3AYVA 2BOGX 5KMYA 3POCA 5CSRA 2ZZ6A 3NL3A 3UF9A 3NGJA 1CPUA 2G50A 1OSEA 1WDRA 3UJRA 1K9DA 3DHFA 3KW3A 4DPPA 4HYVA 3HOJA 4AWTA 1W5OA 5DO8A 2VC5A 3KHJA 1IXOA 5HPCA 3WNOA 4QJ1A 3BLEA 3N4AA 3A22A 3EEGA 4DELA 3VKAA 5HUPA 1QMLA 3CO8A 3TTEA 3AUOA 4DXVA 2ZE3A 2ZUTA 4KGLA 5A6JA 1MEHA 3C2RA 1YYAA 3AMDA 2WJEA 4LTSA 2ONEA 4FOKA 3IJDA 2R1LA 2WMGA 4WGXA 4XISA 2OEJA 2WMJA 1VHNA 2XVGA 1V0NA 3L4XA 3V0SA 4HNLA 3KAOA 5JBDA 1JQXA 4JPGA 3O2LA 2EGZA 3IJ9A 1JAEA 2X7VA 3BW4A 2BBFA 1N82A 4FOJA 1KBLA 3KBNA 3CTTA 2YBVA 3S83A 1C8VA 3VKJA 3XIMA 2VFGA 4UUIA 1G67A 1F3XA 3PWAA 3ZJ7A 1RR2A 1P7TA 4GGBA 3VMNA 1X6LA 2ALDA 3MV01 1WXYA 4O1FA 4LVGA 2CETA 4HKPA 2PMQA 2NXHA 3S2CA 1XH1A 2GWGA 1W56A 1A3XA 5CGMA 2BY3A 1XLFA 3R89A 2BY0A 4F9DA 1K4GA 1OY0A 3LXAA 3SCRA 4CD7A 1SZNA 2DUXA 2PC4A 4FNPA 3S5OA 3QYSA 2J4GA 1M7OA 4UFJA 3RPTA 2QDGA 1IHIA 4LOCA 3MWAA 1KA9F 5LSMA 3EZ4A 3SURA 4F0SA 1LM1A 1U5VA 3HU7A 1MUCA 4E5TA 1B3VA 3P3BA 4AXNA 4HNOA 4EPKA 3OLGA 3VZZA 1QNQA 4I5UA 1US2A 1MXDA 5DQPA 1ISYA 4EP8C 2QVHA 3EPMA 1ISZA 2FQIA 1ZFJA 2OWWA 4UMAA 1BGGA 2PF8A 3NR0A 4JL1A 3UGVA 5FF2A 4RDYA 1GPWA 1GNXA 4NJHA 4WOZA 5EMMA 2CLEA 3LTPA 1EWDA 2QJJA 4R7OA 5I00A 4HU3A 5DFAA 3VE7A 1V6VA 2E25A 1DJXA 1PZ2A 4YTRA 4PN2A 2B7PA 4AD1A 1TWDA 2XGZA 4K3ZA 4P7OA 1W9PA 4RL3A 3MUY1 3I3EA 4TX8A 3CPUA 1KTBA 4GQ0A 4DXKA 4K8HA 3UY7A 3QY6A 4GCAA 1XLKA 1XV8A 1CLXA 2QJGA 3KHDA 3K46A 3ABOA 3GTNA 5I6SA 1RA5A 1YEYA 3DHPA 3MI3A 2C6QA 4HNVA 2G4FA 4LGXA 2WPBA 1GOKA 7REQB 2HS6A 2X7WA 1TV4A 3IUHA 1UG6A 3RJXA 4JIRA 1FFRA 4XUGA 4IIBA 4YTTA 1AH0A 2H90A 5F2GA 2BLEA 4MHBA 3RLHA 1EJVC 3TMQA 1F61A 3GZ3A 3LD5A 1N7KA 1XH2A 5BZAA 2B81A 2DT0A 2IQDA 3ZIZA 4M5PA 3SIMA 3HV8A 3IWPA 2EPHA 2Y2WA 2BHYA 3WQWA 1XBYA 5I07A 4Q4MA 4I5XA 3P14A 2HS8A 2GSHA 1OZMA 2C0HA 1KB3A 4HMDA 2P0OA 4LFYA 3EAUA 4IUGA 1Z3NA 3GNOA 4YYCA 5GQBA 4LU0A 3W7NA 5AHNA 3RRXA 2ZC8A 3NOYA 2FGLA 1BXBA 3FKRA 2PD5A 1FWJC 3F2BA 1DJNA 1SFTA 2W63A 2I57A 1KM0A 5I3FA 3SW6A 4C1LA 2VGGA 4A8IA 1QW9A 5BRPA 1MQPA 4V27A 1TPB1 1SM9A 2D2JA 1YKWA 5JIPA 1C9DA 4DYEA 3MP4A 3BGGA 4CN1A 1I45A 1ZAIA 5E0FA 4EWJA 3W1UA 4I7UA 4N6FA 4DNHA 4AIOA 1DJWA 2E6DA 1EZWA 1S2CA 5FD0A 1IGWA 2UY3A 1UZ4A 3OG2A 4WSKA 1CDGA 4ZB2A 2IQTA 2WWDA 1A5AA 4GXWA 2YA2A 2VGIA 4ROPA 1V8EA 5GVJA 5HNNA 2VDIA 4XIAA 3T55A 4BJHA 1OC7A 3WUBA 1THFD 4DPQA 3W84A 2AAAA 4KCWA 3C5QA 4GGHA 2WVUA 4HK5A 1R2TA 5H8UA 1ZPTA 3T08A 1FA2A 3LENA 4IZGA 3NPWA 3AIUA 1E3XA 4XBKA 3U5UA 4NRRA 4C1KA 3TW9A 2PLMA 3P5ZA 3MA8A 1LRTA 3TQVA 4AIUA 5LGXA 4Q8VA 4O11A 3H12A 3QRHA 1ELSA 2PODA 3S5SA 4O4WA 1SR0A 4ILSA 3F4VA 2I5IA 1YADA 2C3ZA 2P50A 1V02E 3VDCA 5DT5A 1GJWA 5CJ5A 3AS3A 3L2LA 1XG3A 4AWUA 4MB5A 3AZRA 5C7VA 4U3AA 1X97A 4O28A 5G4HC 3B9NA 1XCFA 3B8WA 3HPZA 1U5HA 1XINA 5U4NA 4V1YA 4R85A 3S2NA 4P61A 4DX3A 4LX4A 5CC6A 3M5VA 1OC5A 2YCLB 4MY8A 1KC7A 1KFJA 1FWBC 3T4WA 3S4TA 3WD2A 4WY0A 2C7FA 2NX3A 3VNMA 1CXKA 4CD8A 2HMCA 4LVAA 3NSNA 2D0GA 1JR1A 2E09A 1OT2A 1X6NA 4YVVA 5E0KA 4PODA 4O1AA 4KS0A 2GQ3A 4J7RA 3PR2A 1W1PA 4MWAA 5AZ0A 5FAGA 3IAPA 1L6SA 3WQFA 3M6DA 1TQXA 4FPSA 3GVGA 1Q6LA 3R58A 4KWSA 3VOHA 3KZPA 3PPCA 2C14A 4DBEA 1Q65A 3EWYA 2OOGA 1Y65A 3QGAC 3O07A 3SECA 3BGJA 3WLQA 2QHAA 2J7CA 4K36A 1LOLA 2CPUA 2J88A 3CAKA 2TPSA 3UXAA 1RALA 2W62A 1RCXB 2WLZA 3QOMA 5CLTA 4OQVA 3F4DA 1F3TA 2YYUA 3LI1A 4QFUA 1VZWA 3CBWA 1EFZA 4N9CA 1E40A 5A6BA 1JJKA 4MYAA 1XFBA 2Q02A 2OXNA 3AALA 3B0PA 4XZMX 2C19A 3YPIA 4ZQCA 3HPSA 3GG1A 2EKCA 3ECQA 3APGA 4PSPA 3I4EA 1M3UA 2Q8LA 1AVAA 3UR8A 4AZIA 2QAFA 3VYLA 2Z7GA 3S42A 4CQ9A 2DT1A 3CH9A 2BVWA 2LLEA 3G2GA 2ISVA 1PCWA 3L4ZA 1WBHA 4TV6A 1U5JA 2E8YA 3NURA 4JTKA 1VRDA 2Y70A 4ZXOA 3RUBL 4HN4A 3D47A 2O9TA 2X1UA 1GW1A 5DXYA 4NJIA 2ZOXA 3EWBX 4S39A 4UNKA 1SVDA 4IG2B 1QHPA 1H7OA 3S1VA 1DPMA 3S1WA 4ZOAA 1LCOA 3S5ZA 3UFYA 1FDZA 5BCAA 3VD7A 1XR2A 4FIQA 4LS0A 4AZ5A 3RX3A 4C6KA 1LL7A 1XC4A 2A4AA 3K1DA 3DAQA 4CU7A 1E0VA 1K70A 1MO0A 2GOUA 1OYCA 4ENLA 2PTWA 3PANA 4WSHA 1KBJA 2NUWA 1G6CA 1RY0A 1XBXA 2FPTA 1MW1A 3VC6A 3CC1A 4YLWA 2BGNE 3GSMA 2WNQA 4PB3A 1VFUA 3GXTA 4FXFA 2FLIA 4DY1A 4KT2A 2VX4A 1EKOA 3CZGA 1X1ZA 1B9BA 1H0GA 2YOCA 3H23A 3BJFA 3QXBA 4O57A 1MW0A 4ES4A 2P8CA 1TR1A 4BEQA 4B90A 4URIA 5CZTA 1ENUA 2FZNA 4JQ3A 1UP2A 2BY2A 5A8QA 3OOQA 4L6OA 4XD3A 2V2HA 5LYRA 2OODA 4UXDA 3K4AA 2Z4GA 3OGRA 4AEEA 2OWXA 3E02A 4E8CA 1B3WA 3II1A 3F5KA 1IZJA 4MY1A 4JKLA 3LRKA 1M7JA 4IQLA 4M1BA 4Y8FA 2YW3A 4H9VA 1SJCA 4F0RA 1EDTA 2ZRZA 1WA3A 5J5RA 3BQ6A 2IMRA 1FHDA 4JHOA 4AW7A 3U0HA 3W26A 1BXCA 2B0MA 1QXLA 5AHFA 3WNLA 4Q7IA 4RNIA 4GJ1A 5C9WA 1QI2A 1YRRA 3W1MA 2WM0A 3KCJA 1OK6A 3A4JA 3GXIA 4GJIA 1AMYA 4GIAA 1X98A 2XN2A 4KEMA 4CD5A 1VIWA 4LUYA 1Y5WA 1ZQ5A 2GVGA 4C5ZA 2ZRUA 3MP3A 3CLWA 1R47A 4DBUA 4W5ZA 5CJNA 4IP7A 4K8GA 3M41A 2UV8G 1KQZA 2VUYA 3WLLA 1DXIA 4JDBA 5EL1A 1GTEA 1K9TA 3GBDA 4JNYA 3A4AA 2WZIA 4AD5A 3VKKA 3R1ZA 3NPVA 3KVJA 3VIKA 2R1PA 3LZ3A 2EKGA 4GKLA 4AC1X 2OO0A 4LUSB 3TSDA 4PULA 4BS0A 1K02A 1XLHA 1F8MA 2EF9A 2WSRA 1VS1A 1YPXA 2QV5A 3I7QA 3OGSA 1YDOA 1M1BA 3E2VA 1F2JA 3UXLA 3BSGA 3IIXA 1NP0A 2ZUSA 4J28A 2ZADA 4HD5A 4QJ5B 4IPLA 2Y6ZA 4MG4A 4Z17A 1FHUA 4JQ1A 2Y5JA 4XAGA 2ICSA 4CD4A 3THUA 1M5WA 5HNRA 3AXXA 1DJQA 4O50A 2ZUMA 3IRDA 5D03A 4Q8OA 2D24A 3GAYA 3SGUA 1T7LA 5CPSA 3GG0A 3W7PA 2PP1A 3MCNA 1ZUAX 1VBGA 2F6UA 4GXMA 1JAKA 2ON3A 4DQWA 1GGOA 2GGJA 3EYPA 1JCLA 1OB0A 2VDHA 2QUNA 3TW6A 1UH2A 4L80A 2XFFA 5D38A 1WV2A 3N29A 5EB8A 1LWHA 4Y6GA 1ZJIA 4GUHA 3VKDA 2CZ5A 5I2UA 3U8GA 1EGMA 2A3AA 3PPFA 4AF0B 3S46A 3SBFA 2JALA 3HMJG 3O3RA 1NSJA 4WJXA 2HWGA 5CSYA 1P5BA 1CTNA 2ADAA 5D9MA 3EX2A 2QT3A 5DLCA 5AZ1A 4U2YA 2W0UA 3MCOA 3SCVA 4LAZA 2V81A 3DOPA 3C0QA 1OFBA 5DANA 4QP0A 2PDHA 1NQ6A 1VPQA 1L9WA 3G1SA 3G8EA 4C1NB 3WQ6A 4XTIA 1DE6A 3CMGA 3LCXA 1XM3A 3M64A 2J77A 4H6QA 4AC7C 1K1DA 4GNVA 1RD6A 4XZNX 3RU8X 2EG8A 5A8GA 3LZ5A 4QJ3B 4H2CA 5EPDA 3O7UA 1OADA 2A85A 4I8YA 4WSJA 5C9XA 1UR0A 4ERGA 2E7FA 4KERA 3W7HA 4HPGA 1HL2A 4Q4PA 2CFFA 4QM1A 2OCZA 4KFPA 2V5DA 2O9PA 2NSOA 3AHTA 2WOQA 4FX8A 2Q3RA 3OZMA 5HWMA 2Z1VA 1R3QA 3KFTA 3W7GA 1JDFA 1DBTA 5LIWX 1OQFA 4WZHA 5HBFA 1CENA 3L5AA 2AQOA 2AMXA 2C1GA 1OCQA 1XRFA 1XRVA 3ITXA 1WDDA 1VR6A 3IRSA 4R9XA 1CGYA 1FFQA 4DXXA 1KTCA 3IJ7A 3EDFA 1VJSA 1VCVA 3PPGA 2ZVRA 5D8ZA 4RPQA 2NT0A 2OKTA 1W2VA 4US5D 3RNDA 2X09A 2ZZ5A 4O1BA 5AVNA 1CBGA 1O68A 4QG9A 5I78A 1QI4A 1K3UA 4PZVA 4M80A 3U48A 5T9CE 2ZIDA 3NIYA 3PG9A 4LY8A 1TJPA 3W7OA 1MZHA 1BPLB 1FWCC 4G9PA 4KKXA 4EACA 1MMFA 3OJGA 1K03A 3UZWA 1VBHA 3UZYA 1A3HA 3TYZA 3PP7A 2I9UA 1PTAA 3WDPP 2PDPA 1MUWA 4IQEA 2CIPA 3DECA 2XVLA 2ZQ0A 1RV8A 2Z1WA 2OZ0A 3RITA 2GFTA 1SMAA 3TN6A 1I1WA 3SO7A 4GKTA 4RE0A 5BWAA 4UR8A 1NFPA 4D71A 4AMAA 4PUEA 4L4OA 4ADUA 4I5RA 1FKXA 2JKEA 1PZ1A 1RLDA 3FDGA 3WLPA 2X2YA 4DJFC 1BWVA 1FWDC 4Y90A 4Q7BA 3PJTA 3SJ3A 2FH8A 2PGEA 2UY2A 1TWSA 4GBDA 4HGXA 4LUTB 4LAKA 1WOBA 3ZQ9A 4MPQA 1O6IA 4LWWA 1XJBA 3MSGA 2J8GA 2EJAA 2CHOA 3ZS4A 1AJ2A 5HWJA 3GW3A 1PX8A 3CM4A 3FIGA 1E0WA 3FVMA 4X2RA 1WKFA 3CH0A 4G6CA 2BASA 3DFPA 3DFTA 3DG6A 3T07A 1UR1A 3SRKA 1E56A 1P43A 1SMDA 1BXNA 3TAKA 2CKRA 1TE1A 3FA5A 1WQ5A 5E9AA 2D20A 1KCLA 3EWDA 4H04A 3G1YA 1T40A 3W2LA 3H4XA 1XIMA 2J79A 1EL3A 2FJUB 1B4EA 2HZGA 4AH7A 4R9OA 4AZBA 1M7PA 2G3MA 1EC7A 1U83A 1DWGM 4OBSA 4OT7A 3S1GA 2J75A 1H4PA 1X8FA 5G2HA 3W2MA 1EXBA 1SFJA 3P67A 3B8DA 3MW7A 4HOZA 1WKEA 5K9DA 4KWUA 3EMQA 2XZ7A 5G1MA 4P8VA 3N6QA 5DY2A 3N14A 2I1OA 4XKYB 4LBSA 4DBSA 3WD1A 3B3DA 1R9XA 4FP1A 4BQ2A 2E6AA 5LNWA 1NWSA 1JF5A 3P74A 4TVCA 2EG6A 5CZJA 4EF9A 1BWKA 3OB8A 4N02A 3UETA 1XPGA 3SM0A 4A3HA 2IPFA 4WUIA 1YE4A 1MWOA 1LBFA 1S2VA 4D6CA 4B5TA 3H2CA 1PYMA 3CQJA 3RRAA 1DWAM 4EVZA 1Q7ZA 1V6WA 3K13A 3BLDA 3QQWA 3TROA 2I14A 5TF0A 3G22A 4XVEA 1UWIA 1J01A 4MMWA 2FZ8A 4GVFA 1L8PA 1EB3A 4HJFA 4V1XA 8RUCA 1JDEA 4M6UA 3WJSA 1TWIA 3ES7A 3W7JA 1J0ZA 4TMBA 4NYUA 1KTNA 1BKSA 1YBQA 1OEPA 1KR0A 2Q8XA 4XKMA 4MNLA 2QCDB 5DMMA 1WUEA 4Q8UA 1XXXA 3N6JA 1W3JA 4NZ4A 5DY3A 1L6FA 2OKOA 3WF1A 3LLDA 1XIHA 3B8SA 3BV4A 3TTOA 4K1WA 3HG3A 4YJ5A 1ZAJA 1GWJA 4QLKA 2BWGA 1CZ1A 1UOZA 3T8LA 3NZGA 3LPPA 5D05A 4GISA 3UG8A 4HA1A 4GLEA 3KVMA 5EFDA 4J35A 4IPIA 4WD0A 4S2CA 1H0IA 1H7PA 4A8LA 1JYVA 4JNMA 5I3KA 1RA0A 4NG3A 3W81A 3WBWA 4W4QA 3SRHA 5CKSA 1UR2A 3LBMA 3MWCA 3R43A 1E4LA 3H2MA 3RR1A 4GD0A 3C2FA 4GI9A 1CGXA 3EOLA 1VFSA 2Y7DA 4KWOA 5FEXA 3TYBA 2ZA3A 2VZOA 5D2YA 4RW3A 1UMLA 3QZAA 1CEOA 3TUUA 3FS2A 4QCFA 3L0GA 5BMXA 3WFLA 4D6FA 2D1ZA 1XUUA 1TSIA 5LGZA 2ACRA 2PDNA 1ZHAA 5BYWA 4B2DD 3V7PA 5HK4A 2JK2A 3SCOA 1JCYA 2B7QA 3F5JA 1BGAA 3A9IA 4Q4KA 4IIFA 1R3RA 2CESA 1VQTA 2CHNA 1WOAA 4N4QA 2OPJA 5ECVA 5G1TA 2ZWYA 2ZRWA 1OGBA 1XI3A 3ZR5A 3ICJA 5CBIA 3T0CA 3CQHA 3UP8A 4XAYA 3G6MA 2ZX6A 1IYXA 2GK1B 4YHEA 4RNFA 1Y8BA 2DZAA 1WCGA 1HJSA 4CN6A 4KCUA 3KTXA 4LYPA 3ZLFA 2J6VA 4GHRA 2DEPA 1TMQA 3OBEA 5HULA 3WD3A 4O1DA 3LA4A 1Q66A 2B7OA 3GTHA 3KVKA 2J9XA 3OLIA 1KGWA 4GI6A 5HMSA 1NH6A 3T9PA 4W8BA 2OGJA 2REQB 1HFBA 6A3HA 4DBDA 3M9YA 1QK2A 3BAYA 1UD5A 3QGKC 3EDDA 5A8MA 2Z6IA 4XD4A 1H51A 3F5LA 2XGBA 1IT0A 4M0XA 2VFDA 5IFPA 3CWNA 3DZ1A 3S2JA 3QFWA 1S5WA 2YB4A 3VFLA 3BZGA 2A6NA 2DT2A 2KZHA 3LGEA 2PGFA 3KBSA 3WH5A 2V3EA 2XIMA 3PB0A 1SJAA 1JXJA 3WENA 2MNRA 3R79A 1P0DA 4GYKA 3EBVA 2VZSA 1SJDA 4JYEA 4M7TA 3URAA 3W2NA 1Q45A 1TX2A 1JNEA 4DUVA 2YL6A 1B9ZA 1RBLA 3CV2A 4BWLC 1NF7A 3PS7A 3SCTA 2Z2AA 2NWRA 3DG3A 3LHTA 3ZMRA 1KR1A 3THDA 4QXIA 4C1NA 1FTXA 5H8PA 3LBCA 2Z2UA 5C2CA 1W5PA 2FFCA 1CXIA 3WK1A 4F0MA 3UVAA 3W75A 1KFBA 2Y5EA 4N9BA 3SY1A 4QBXA 2XTKA 1V6XA 4K6AA 4PUDA 1W32A 3K30A 3ARSA 2IW0A 4LXFA 4GXPA 4RX0A 3NQCA 3CL8A 4J27A 1XP3A 1F3WA 4XO7A 2VX7A 2X40A 4US6A 2UBPC 1MFVA 3FSUA 3CNYA 3ZWSA 2VVSA 4QX4A 2Q6ZA 4IFOA 3DYOA 3S9YA 3BMWA 2PTZA 4OV4A 4UOZA 1R9ZA 5FCZA 2CLFA 1I2QA 3S2LA 1WDQA 2PGRA 4IT1A 2VL4A 3E3HA 3EDJA 4E4FA 3DH7A 4PMYA 4NSBA 1PBGA 1QJWA 1FWIC 1C8YA 2YDSA 3A3WA 5H1WA 4NU7A 3ARQA 3O06A 4E8GA 5CBBA 1ZS2A 2CLPA 4QJ4B 5G4WA 4NX5A 4CNSA 1BVWA 2P8BA 3F03K 4JEQA 3R0KA 1UJPA 3DCPA 3SQLA 4C6JA 3WLRA 3M5YA 4U31A 4A2RA 5D2XA 3CAWA 2WBGA 2WKGA 4F2TA 3TLLA 1SW7A 1ISVA 1H2JA 2WVVB 2O0TA 3N4EA 4ZZ9A 4NL1A 3KCOA 8CGTA 1AL7A 4HZ6A 2WMIA 4Q8TA 3ARPA 3NDOA 1UD8A 3CEPA 4RE4A 5ABTA 1KGXA 1Y5XA 3MHUA 3ZVHB 1QPNA 4HK7A 2PDMA 3IIOA 5XINA 3N1AA 1UPMB 4KRUA 4XZBA 2GUBA 1PB0A 4YYFA 1P0NA 2WW5A 5ABEA 1V03A 4HK6A 3OVPA 4UOQA 3V5OA 4YS1A 4EAYA 1PPIA 3VD3A 5ABFA 3L4VA 3OPSA 3W1AA 3EB4A 3W53A 2D2HA 3VVGA 2VFEA 3M47A 2ZFAA 3KX6A 2G41A 4QE4A 3EWCA 4JXCA 3STEA 3UG5A 1DYSA 4NXSA 3G1HA 4PMRA 3DFHA 3USBA 5D04C 2OSYA 4YVPA 2Y0FA 2HBVA 1TO3A 4PFHA 1E9YB 4O4VA 4LB4A 3WK2A 1XDLA 5FA5A 2BXVA 4DWSC 1YW1A 4WDTA 3OIXA 1QOQA 4B92A 1LTDA 1IV8A 4H4IA 4CLMA 1SJBA 2FHCA 3TR9A 3PSVA 3AHYA 2BXZA 4S2BA 1SYTA 3W72A 2DZTA 4IX0A 1VBUA 1VFMA 1KRMA 2V3GA 3BLFA 4IP4A 4AHPA 5LA1A 1KCXA 1W5QA 1VENA 2XIQA 1FH7A 2VZUA 1NM9A 1XKYA 1WZAA 1P0KA 4WLCA 4CCDA 1IQ8A 3DU0A 1O5QA 2A3BA 1F6PA 3SCSA 1JZ7A 4L4MA 4J3VA 2R24A 1DV7A 4NX0A 1OFPA 1PXGA 2O4MA 3E74A 5GPRA 3GM8A 1DL3A 4RK8A 2ATSA 3PBUA 1DWHM 3N73A 1EBHA 4PUNA 4DJEC 3UJ2A 2D22A 4NI3A 1XBZA 4FEZA 3DXIA 4DLMA 1HVXA 2E0PA 5CZSA 2J27A 1VEMA 1OC6A 2X2GA 1A3WA 1OABA 1TPC1 4Q4QA 4RZ6A 3WDQA 1QU4A 1H1ZA 4JTAA 3SN4A 4B9YA 2VCBA 4EWND 5A2CA 4LBRA 3EDKA 1P0EA 4A8NA 1OD8A 3GK0A 4F79A 3TU9A 1XLDA 3LV6A 5CH9A 2OMAA 4JTFA 1AZ2A 2WHKA 3LYEA 4MSSA 4U5KA 4JQ4A 4C6CA 3VKBA 2VVNA 3O6CA 3L68A 4W7UA 1L8NA 4H7VA 2QJNA 4W85A 4IGHA 4QG8A 1B90A 1LLOA 4BCEA 3OVQA 3H54A 3WF3A 4H9YA 3WELA 1UUMA 3VINA 4ZVJA 4EPBC 1VEOA 5BMWA 1KLYA 4WRHA 5K9CA 1N2VA 2JGYA 3SUVA 3QLDA 4DJFA 3BSHA 1QRQA 1K8CA 3PFMA 2GDQA 2YBUA 3DC8A 4KETA 1XYBA 1S2TA 3KLLA 3HJZA 4IPNB 3SJNA 1HNYA 3PZMA 3FAXA 5U7SA 1FDYA 3R6IA 2GQAA 1GKRA 1G4EA 4NVTA 4JTLA 3W71A 5TIMA 3NEVA 4FLSA 4KCTA 3B4UA 4A3QA 3A23A 3GWQA 4XZLX 4EXQA 3GE7A 3MO4A 4ZO6A 5AY7A 3W1PA 2C91A 3FY1A 3O6DA 3QV8A 9XIAA 5CSSA 5IDZA 1GTHA 1YXYA 2VUNA 3HQ1A 1XLGA 4M6PA 3N9KA 1HJVA 3G77A 3GY1A 3PNZA 5HR7A 2ISFA 1PX3A 2PCQA 3EX4A 3A4XA 2PE4A 3MBFA 4I9TA 1CXLA 4CN4A 1XQKA 4F0LA 2B4GA 5FSEC 3R8RA 3L9CA 3QYQA 2YBTA 1GVIA 3TJIA 1ITQA 1JD7A 4R88A 3NL6A 2AMGA 2FPYA 4UFIA 1MZRA 3UA4A 1XWYA 2DSZA 2W66A 3A64A 4CGTA 4UTKA 1TMHA 2HPIA 3OZYA 4GZEA 2CLHA 4L9ZA 2V5CA 3BDKA 3P2VA 2ZX5A 5T8GA 3UEQA 1K8YA 2YA0A 1WB0A 4ZENA 4UTTA 3WNKA 4CUCA 2HQAA 3RLVA 4DO7A 1QNVA 2NXGA 2X0SA 4J2MA 4TR9A 5DRIA 1HO4A 9XIMA 3UBPC 3FFSA 2OR2A 4ZQRA 1FUYA 4WGHA 3RN6A 3GHRA 2FMNA 3VGBA 1L2UA 4DHGA 3I6EA 1P6WA 1GQLA 1R5YA 3HGSA 3BG3A 3F2DA 4QG6A 3WDHA 3NO3A 2YXXA 2Y7FA 1Z7AA 3TLQA 2E5CA 4PRTA 3C2OA 4BA0A 5FAJA 1YTKA 3SAZA 3LBOA 1NP2A 3GXNA 1UWSA 1Q63A 4IJRA 2J9ZA 2A0NA 4M6QA 1C7TA 4PMXA 3VCRA 4G5DA 1TJRA 1J79A 4JBRA 1DQXA 2VHLA 4AWEA 1FRBA 3ME3A 1GEQA 3ONBA 3PUEA 1QNOA 1PL9A 1ZJBA 3R0UA 3CHDA 4FMVA 1SZFA 4HU0A 1L6WA 3KOFA 3THCA 3MVTA 3QPZA 4KEZA 3IJLA 1Q7MA 3I7RA 1D2KA 5IBXA 3TOPA 5FKYA 5XIMA 1M04A 3V35A 2WNWA 3SCUA 3QLLA 3VDAA 3M6YA 3QKEA 1I2NA 3CIXA 3A3HA 5FL1A 5HA7A 1DE5A 4LS2A 1HO1A 3OIHA 3RF9A 3VK5A 2YDRA 3WBYA 1PS9A 1M01A 3NYZA 3CT7A 3VA8A 3IJ6A 3TZNA 4JY8A 1QCWA 3OW1A 3PZUA 3GBEA 1GCYA 1CGVA 1HXJA 3ITOA 1FCQA 2OVLA 3R2GA 4FOUA 3GG8A 1MEWA 2EPOA 1NY1A 1ZBCA 1J6PA 1A5UA 1VCFA 3P81A 2D3LA 1QI3A 4ZO9A 2ZZ2A 2WZMA 1OK4A 1J0KA 3FJNA 3TJXA 3HPFA 3I68A 1JRCA 1NARA 2AGKA 5AYXA 3B9EA 2G3JA 3VIHA 2EPLX 4K68A 1G4TA 5XIAA 3BAIA 2R14A 3WL1A 5AC7A 5I79A 3OVGA 5GNZA 4JICA 4KESA 4BY3A 3ZJ6A 1K8XA 1V0KA 2HVOA 1W37A 4ERAA 2WKJA 3PTDA 2CZFA 1EJSC 3W74A 3ZSSA 1OX6A 2PTXA 3OLDA 2A7PA 1X1OA 4DJDA 5BRBA 1JGMA 5A6MA 3BJTA 3Q37A 2QXWA 1TG7A 5JBFA 4YMZA 3RCYA 1SSGA 1Z44A 2V2CA 1KWGA 2PWDA 4PH6A 2QGHA 1MYRA 2PZNA 3PULA 3FN9A 1ALDA 3WQGA 5I3DA 2HVNA 1RQEA 3ZM8A 3H4GA 4FXRA 3PY2A 2DVXA 3THQA 2Y88A 4GY0A 5LIKX 3S6TA 4JEJA 5LNUA 2NT1A 3T7VA 5C0QA 4JYFA 4OOUA 4HHPA 2A7NA 3RG6A 4P7NA 1ML1A 3F7JA 1VEPA 3NPUA 4PEEA 4GZ7A 4YL2A 2Z7KA 1Z6KA 1CLVA 3ARTA 4YNGA 2XPKA 2J7HA 4ZO7A 2WSKA 2WSPA 1UKSA 2DZPA 5CPQA 1ONEA 4WK9A 5M2FX 1U33A 2ZZ3A 3IUDA 2YZRA 2IKHA 3UGRA 3W7EA 4HPHA 2VR5A 3ITYA 3ARRA 3UCCA 1VFOA 1W1IE 3CEUA 1ECEA 5HANA 2HNEA 1GG0A 1NFGA 3BAJA 3VIGA 3R10A 4XBJA 2EHHA 4RR4A 2RFGA 2JEQA 1ME7A 2HJPA 3GTIA 1UD3A 4JZ5A 4FSAA 5LIUX 3SCNA 1W1B1 3ONCA 3ABRA 3QJAA 2PDGA 3T81A 2HE8A 3CQKA 3QTPA 4LUIA 3BURA 1SUXA 1V3HA 3NM3A 1PYFA 4IQDA 2DU2A 2Q09A 3R11A 3T09A 3LOTA 2Z1KA 1LP6A 3VZYA 3DN5A 3I65A 5F2MA 2BDQA 2CBUA 1UIOA 3I3DA 3CUFA 3GVRA 1HKWA 1PHQA 2ESCA 1BAGA 4FXJA 3FXGA 3W01A 2C0AA 4JR5A 1K9EA 4F8XA 4JX4A 3W73A 4DO4A 1JZ6A 1RK5A 1MDLA 3T05A 4O52A 2OZTA 1W3TA 4PCSA 4YHGA 3VMPA 1EF3A 3W07A 2AL2A 4R3UA 2SFPA 3OZPA 4J9JA 4YPJA 5BXSA 2G3NA 2PLKA 1UHVA 7ENLA 1W3IA 1AW1A 4IMCA 2IKIA 5A5WA 4DVOA 2F6XA 3BMXA 3HJEA 2ZUVA 3WNMA 4H00A 1QUMA 4UBPC 5E6ZA 2VRKA 4AISA 1WKDA 3PNUA 2E4TA 4C6PA 3M0JA 3STGA 3MB9A 4FNUA 1I2RA 1W54A 3GXMA 4OWGA 3ZJ8A 4AX7A 3NO5A 2DZUA 1JPDX 4JAWA 3MQTA 3JZEA 5BRQA 2YA1A 3GXDA 3GNXA 2DP3A 4DI9A 2V67A 2INEA 2WANA 3ZR6A 2CERA 1KV5A 3E0IA 4YCOA 3HQNA 4N0RA 1GVRA 3SDOA 1JZ8A 5AKQA 2WNNA 4XD6A 2W9MA 1XLCA 1OFAA 2OELA 2XVKA 2E9BA 3BARA 2QKFA 3ZT6A 5EFFA 5F7UA 4Z2HA 1OCBA 2E28A 4HB7A 2VD8A 3WJXA 3VIFA 1UIPA 4K39A 4C6QA 1J12A 3HTWA 2WHMA 4JFWA 1U30A 3A5VA 3QQ0A 1XIEA 2O92A 2GJXA 4B3KA 4F2UA 1TREA 4ZQPA 3B0XA 3IIPA 1HKVA 1L6YA 4KF1A 2CZEA 1UZDA 1V79A 2TODA 3R8GA 4E3TA 1HF6A 3O8AA 3PAOA 1FWEC 1TTQA 1KRAC 5FJJA 1FXPA 4MNJA 4NY2A 2QZRA 3UXKA 4FNRA 2YDQA 3CASA 4M3PA 3WZ0E 1NELA 3AIWA 3DKLA 3U5YA 4DZ5A 3ZLGA 4PEKA 3Q45A 3BMVA 3V75A 4BHYA 4AY7A 3GC5A 2F6KA 5AC4A 2YSWA 2QIIA 3RIKA 3P84A 2FHFA 4X3ZA 5ECUA 4UMCA 4NZ3A 2RGMA 5AN7A 2HRWA 1FWRA 5F2IA 1P7TB 4ICNA 4IIGA 2IXUA 3IGXA 2WMHA 4P7RA 3NA8A 3W2KA 4WOQA 1BQCA 1BTCA 2Y85A 4DWSA 3CZEA 3BAXA 6ENLA 2X0HA 1NVMA 4OUEA 3N6HA 3QH2A 2J13A 3E2RA 3LLXA 1XYLA 4JTHA 1Q4WA 2G0WA 1PWLA 1ZAHA 1GK8A 1KKRA 3HG5A 3VGDA 7XIMA 3W37A 4O0KA 2UY4A 1K6AA 4ROQA 4N2YA 2VEPA 4J5NA 4RLIA 4MJ4A 3VNJA 4L6DA 1D7KA 3JUGA 1N8FA 4KW2A 4LT9A 5K7JA 3WBEA 3GTXA 4CEXC 3P8IA 3W22A 1BF2A 3G3DA 3KRUA 4EE9A 4IH3A 4L4LA 2IUZA 3SZ8A 4IFRA 3V3WA 3I10A 3W2UA 3IIVA 1TZZA 3ELFA 2O9RA 3UZJA 3G6LA 3TQKA 4RV8A 3MKVA 4J3XA 2EEXA 4PBEA 5K9XA 1WX0A 2V3DA 3J7HA 4GQQA 3E5BA 1M41A 1YIXA 4WQ6A 3EWUA 1S3HA 3CB3A 5AYIA 3G1XA 4MF4A 2I16A 1IT7A 1W91A 5M5DA 4DJDD 1PDYA 2V38A 4HSNA 1CB2A 3BV7A 2QGYA 5E5CA 1V5XA 2QF7A 5BOEA 3TA9A 1V7AA 1KFKA 3KRBA 3EDEA 4AD4A 3PBWA 2PPGA 3CMFA 3BOLA 2G8ZA 4PUMA 4ZSUA 1E6XM 5CGTA 4LB3A 1W9XA 1DQUA 2QPUA 4GZIA 4LQ1A 1RVGA 2BSLA 3IUIA 2OO6A 4DUOA 1EOKA 2CC0A 3WUEA 2IPWA 4AFYA 1CXFA 2E40A 1A0DA 5EMKA 3BUVA 1S1RA 3TCEA 1SSDA 4N7QA 2BTMA 3T2PA 2CZDA 1GOMA 1I0BA 4XZWA 1JUBA 4ICMA 4RXFA 3U2ZA 4U28A 4NAFA 1JPIA 4GIEA 4P7QA 4D9PA 3VX1A 2HISA 2PURA 4H7CA 1TV3A 4WF7A 2YL5A 3G1AA 3QW4B 3DFYA 2R6OA 2QW5A 2VFIA 2FVKA 1XSKA 1C91A 4Q4OA 3LHYA 3ANVA 1UC5A 3CPRA 3N25A 1HTIA 5CC7A 5CJMA 4E2BA 3BPWA 4QR6A 3VIJA 1QVBA 3K8MA 1C90A 1JULA 2QJIA 3BC9A 1H62A 1YNQA 1BG9A 4IM4A 1G01A 1J18A 2FGZA 1TPFA 4QDPA 3QTGA 4AUBA 4HOXA 3WCZA 4JFSA 4X9YA 4RUBA 3H26A 2ZDRA 4OZOA 3AFBA 2WQDA 1UQZA 3MSYA 4F4RA 4R7WA 4UFMA 3RHGA 4B4HA 3QEZA 4DZHA 2J8TA 3MUCA 4I9MA 3GDBA 1PTDA 5D2TA 1UQYA 3EA1A 4NXKA 3DKJA 2JEPA 1JUKA 2J74A 2Y8UA 3OA5A 3CMJA 1K8ZA 3M0XA 1GUVA 1V0LA 2NX9A 3LTYA 1AMKA 4S3AA 3Q58A 1XLMA 1S2WA 4LS1A 4S3CA 1F7BA 1EUNA 4GYPC 3W24A 4L1WA 4X0NA 2XZ9A 1EOMA 1I0DA 4M24A 3EA3A 2A3LA 3TTQA 4CU6A 2VZVA 4CQAA 3WEOA 1ODUA 2ZA1A 3QGVA 1MRAA 2NUYA 4G7FA 3ITGA 1ADDA 1QK0A 3LCFA 1I75A 1Z48A 3BZJA 1QI5A 3UCDA 3SN1A 3CZ8A 3K5XA 4PR4A 3H2OA 2Y4SA 3DFNA 3B03A 4Z1CA 1EJTC 1C8QA 3NVTA 2VELA 2NLIA 1U22A 5EMYA 2VEIA 2P5NA 3VU2A 3H53A 1IXQA 2XN0A 2WLYA 3SFKA 4HMCA 4WY0B 3IPWA 1ZP3A 3KRZA 1WXJA 3WLTA 4E0CA 1NDVA 4ZFMA 1P6BA 2VURA 1JPHA 4FO4A 2V5BA 4A6GA 1DIEA 1BTMA 3HQOA 2DIKA 4C6DA 1EQPA 4MWAB 4CNUA 3W38A 5JBEA 2CCRA 3FX4A 2GGEA 4DLFA 4NZ1A 5IHRA 1EA0A 2MANA 4F40A 1VBRA 4KIEA 5LXXA 4K37A 3MUZ1 4Q6JA 3TN3A 3NQ8A 4NAEA 3GH4A 4S23A 3MCMA 4MNKA 5C7HA 2RDTA 1PKNA 3TOYA 4PBFA 4B5XA 1VLWA 2Y62A 1OYAA 3Q67A 5G2IA 3BE7A 4MB4A 3H55A 3MBDA 3DDMA 2AL1A 4DO6A 3LNMA 3QQ1A 3DHDA 4HCDA 4S3KA 4KFOA 2WVSA 1TWZA 4INFA 3GUWA 3VD4A 1Z9AA 4XTDA 3VKCA 1FWHC 4WJ8A 3WG6A 2ACSA 4QROA 4ML4A 2NQJA 1AG1O 1E6RA 1S5VA 3C61A 1LG2A 3IGHX 5EMLA 4ADSA 4QEHA 1AQHA 4B91A 3E38A 4ALDA 5D33A 3WK0A 2P0IA 1P1XA 2BG5A 1M6JA 5DMLA 1IXNA 5E93A 1OVDA 2JKAA 3H22A 4PCTA 4YTQA 5F4SA 4C60A 3CWHA 2X1SA 3BCJA 3P80A 1HJWA 4UTMA 3DG7A 4A3YA 4PUUA 4R5EA 5REQA 2DIJA 1UWTA 2VFFA 4CNNA 2QUTA 4PB5A 2GSJA 4LF1A 4HCLA 4HA3A 5HQEA 5AHEA 1F5ZA 3L4UA 3M16A 1KM3A 4IQJA 2DQWA 1RLCL 3AHXA 3QR1A 2VEKA 4MZ8A 4J3TA 2D69A 2WNZA 1TPVA 2QULA 2QDEA 1CB7B 1OFDA 2FYMA 1IWPA 1OM0A 3SCQA 4LEQA 3HGOA 3DI1A 2QUUA 4XD5A 3VOJA 2Z0IA 3EXRA 1P0BA 3UT0A 2OYKA 5FJTA 5BXTA 3PBVA 4H9XA 4NJKA 3N2CA 4RCXA 1D9EA 1FOBA 4S3GA 1UOKA 5AC6A 3QMRA 3QR0A 4OV9A 2W3ZA 4DAFA 4C7DA 4GE8A 2GDVA 2FJKA 4UR7A 1ZRQA 3UESA 3FYOA 3GNDA 2BMBA 4R7JA 1TUFA 2PGWA 4XVDA 4MJMA 3C56A 1MDRA 3BLLA 3FGCA 4A3RA 3SY5A 3NNTA 3HG4A 5IOBA 4IICA 3RLGA 1ZBWA 4GYJA 3MY9A 3H7UA 3PTKA 1GQJA 3QZEA 1NTHA 3BG9A 1XW8A 3A9BA 2VEFA 3BL3A 2INFA 3N2TA 1CGTA 3N2MA 4IIDA 2FVMA 4E4UA 1HKIA 5D37A 1CGUA 1V0MA 2YDAA 2W92A 4HHHA 1V3IA 5C54A 2FFIA 1GW9A 2D73A 4ZGYA 1IEWA 1LORA 3K4DA 2PWUA 1GOXA 4O1CA 4GQBA 4HSOA 2WJZA 1V93A 1NJJA 4AEFA 3GG7A 2F38A 3PWGA 1AH3A 4XAPA 5F1VA 1E0UA 1V6YA 4U33A 2R1KA 5LNVA 2HXTA 2PDIA 1VKFA 4L4PA 3M5ZA 3CWOX 4UMBA 3WK3A 1EDGA 3VM5A 3MP5A 2X41A 3AS2A 3VGHA 4IJBA 3A24A 1FHLA 2XISA 1LG1A 4NUWA 5B7YA 3PM6A 4FS9A 3M0ZA 3GIQA 2BZNA 3B9AA 3VE9A 5EBAA 1LUCA 4FB7A 3WD4A 1ZB5A 4Y9AA 3VXGA 4MIMA 4DEFA 1LROA 3L12A 4GUFA 4JKMA 2OSXA 1W1VA 1FCVA 4QNWA 2PDJA 3REQB 4GIRA 4DIAA 1UWUA 5A8NA 1ZGDA 4MFEA 5G4EA 3OO2A 1S5TA 4JTGA 3V16A 4PMDA 4X9SA 4RZ5A 3TK7A 4E3VA 3O16A 4GA8A 4HT3A 5AC8A 1W5NA 4U4MA 3C86A 2G95A 2QDHA 3OGVA 1E6QM 3N13A 1TJ0A 1F76A 2OX1A 2YX0A 4JTJA 1EWEA 4EK7A 5CPTA 3Q65A 4XSMA 1QTWA 1QPOA 4JN8A 1UBSA 3GKFA 2J66A 3VCNA 4OOZA 3W1NA 3F4WA 1KNWA 3NSMA 1R2SA 1DVJA 2I5QA 2BGQA 1OBAA 3STFA 1H61A 4Q8QA 5J8LA 4JIPA 4O18A 3HPXA 1ONWA 4I3GA 3EGJA 1HKMA 3E1F1 3VDBA 3G0XA 3GNNA 3RO8A 3BAWA 3PG8A 1E71M 1K7XA 5LNRA 4GABA 3AIEA 3QOKA 1W8GA 2YB1A 4OU1A 1KWKA 2PU1A 1QASA 1UC4A 1VJIA 2BOEX 3WO8A 2NUXA 2J24A 3BOFA 4XO6A 4KMQA 3WQ4A 1RQBA 1TPWA 4MDOA 3G5EA 5MHBA 4MUPA 3NYDA 4UCGA 5LHFA 1F9CA 2GYIA 3GU1A 2NWSA 1LT7A 2QCLA 3C8FA 3V36A 3TN4A 3KWSA 1LLWA 2OLHA 3CYVA 1BHGA 1JFHA 4J3UA 4MJZA 3GDRA 3W7IA 3LMYA 1PDZA 1ZU8A 3T44A 1DTUA 4LAOA 2Z00A 3LGGA 5FSDC 4UTWC 2AQWA 1UKPA 5FIPA 2E5BA 1X96A 3AXIA 2V5KA 1QDSA 3EKZA 5K3VA 1K4HA 5HWNA 3MMWA 4UQAA 3QR3A 3XINA 1PKLA