1TWWA

Dihydropteroate synthetase, with bound substrate analogue ptpp, from bacillus anthracis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
273
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHPS, Dihydropteroate synthase
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 97
structure length 266
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1twwA00
3MCNA 3TYZA 3TYBA 1F6YA 3H23A 2VEFA 2E7FA 3TR9A 3BOFA 4DAIA 1EYEA 4NHVA 1AJ0A 3H2OA 3V5OA 1TX0A 2OGYA 4S3BA 5JQ9A 3H2AA 3NOYA 4MWAB 4S39A 1Q85A 4HB7A 3MCOA 3MCMA 3H2CA 2Y5JA 2H9AA 4DJDC 3TYAA 4MWAD 1TX2A 1TWZA 4MWAC 2YCLA 4CCZA 4PZVA 4DJEA 3TZFA 1Q7ZA 2YCIX 4D8AA 1Q8JA 3H2FA 4DAFA 2DZBA 4DB7A 3TYUA 2Y5SA 4NILA 2VP8A 4MWAE 3H2EA 1AJ2A 2DZAA 2Y0FA 1Q8AA 3H24A 4S23A 4DJFA 3H21A 3H2MA 4DJDD 4O0QA 4D8ZA 2H9AB 1Q7MA 4S3CA 3K13A 4O1EA 3TYCA 3TYDA 2YCLB 4S38A 4D9PA 4C1NA 4C1NB 1AD4A 3H2NA 4O1FA 3TZNA 2DQWA 2BMBA 4DJED 1TWSA 4DJEC 4S3DA 1TWWA 4G9PA 4S3EA 4S3AA 2YCJA 2YCKX 4DJDA 1AD1A 2VEGA 3H26A 3TYEA 4MWAA 4S3FA 1AJZA 4DJFD 1Q7QA 4DJFC 4NIRA 3H22A 3BOLA 4NL1A
chains in the Genus database with same CATH superfamily
4CNOA 2Z28A 5AECA 2ACSA 3GVVA 3VKBA 3RX2A 1E70M 4LNYA 2EHHA 2W67A 3R0UA 4MJZA 2GDQA 4DNMA 3H2OA 1F74A 1RK5A 3WLHA 1XLLA 4JKLA 2WNZA 4S3BA 3V1PA 3ENLA 4L4MA 4QDPA 4NKCA 4GKLA 3QW3A 1P6WA 4OBTA 1UW9A 3WQOA 1PHQA 5BU6A 3TA6A 5EBAA 1MRQA 1JIBA 2D0HA 4LAUA 2DSKA 2F6UA 1EDQA 2R24A 3W23A 3W7KA 2ZBTA 2J74A 3KBNA 3AIWA 4XZNX 4I7UA 1RH9A 4S23A 1SO6A 5DXXA 3S5NA 2AQVA 2Z2UA 5C9UA 4MHBA 4ZXLA 5HMDA 5A6TC 3UNDA 1BKSA 4S38A 4JL2A 3PZOA 3BH4A 3LRKA 5HWJA 1C3FA 2PTZA 4YU1A 4NP7A 3H2NA 1GOMA 1LCOA 1SGJA 3D46A 3BO9A 3BZJA 4ZQMA 1KR1A 3SIMA 1VR6A 3PUDA 4Q3MA 1M65A 1UR9A 3CUIA 1QJWA 4PFMA 2QR6A 4AYGA 5GVJA 4JKKA 1YE4A 3E9AA 1QASA 2X8RA 3CT2A 4GIEA 4EXAA 2ISSA 2I56A 2QIWA 2BBFA 3LTYA 3BAIA 2E1WA 5KZEA 1KA9F 2FKPA 2XJ7A 4N9DA 4GINA 4L61A 2V5DA 3U5UA 3TQKA 3H2AA 1K6AA 2CC0A 4TR9A 4OTKA 1NF0A 1XISA 3L5LA 5D9MA 5DMNA 3GX9A 1DJZA 1VJZA 1VCVA 1XIDA 1RSCA 4BZYA 1HT6A 2DW6A 2DSUA 1RCXB 2XH0A 4JCMA 4MPQA 2X1RA 2OB3A 5HR7A 1R46A 1H0IA 4DIAA 2FLIA 3HPFA 3HQ1A 4WKHA 1S2UA 1JDDA 4HA3A 4HTBA 3O9NA 2Q3RA 1JYVA 2QDEA 3UWZA 4Z2GA 4IP4A 1VYPX 4FSAA 1PBGA 3VNDA 1M7XA 3E0LA 4A2RA 1V0KA 3KE0A 3TXVA 4W89A 4KT2A 4R34A 1TFVA 5CC3A 4GVFA 3FS2A 4GA8A 1TCMA 3BDKA 2Q8XA 4YYFA 3FKRA 3B8WA 4DLMA 3DX5A 3ANYA 1XLEA 3UXLA 1MW2A 2E25A 3NSMA 4MNMA 1TJ0A 3DIPA 1JNEA 3F4WA 1FHUA 3VOJA 2FTWA 4ZBCA 2V5KA 1IE7C 1E51A 4ADUA 2RJHA 3W28A 1H2JA 3BMXA 1AJZA 3P0WA 5D02A 4OQVA 1X96A 2FZ8A 4WKFA 5FEXA 1QVBA 2H6RA 1UWQA 1G1YA 4YCPA 3KHJA 4WDXA 4FLOA 4NJKA 2HVMA 3IIZA 4QSHA 2NW0A 4I5RA 1XDLA 2A3LA 3DFQA 4A2SA 1F05A 3CYVA 2WCSA 2OODA 1O5RA 4O11A 1Z42A 2DJXA 3GKFA 5FIPA 3PTDA 1GVEA 3QW4B 3MCMA 2NWRA 3UXAA 1I75A 1TR1A 1UQZA 1IR1A 1GOQA 5EL1A 1OK6A 1BXNA 2OR2A 1QNPA 3NGJA 1UHVA 1R2TA 4ACZB 3UETA 1Y8BA 4J35A 1SQ7A 1J93A 5HNNA 4XX6A 5EMKA 2PWFA 1AL7A 3NA8A 1J6OA 3ALFA 5CEWA 5GNXA 4LOCA 2YFNA 1M53A 2ZICA 3NZPA 1UMYA 1UWIA 2VZSA 4QNEA 4GYKA 1IWBA 4YVXA 1CB2A 4LVBA 4O13A 4B5UA 4H9TA 2WZMA 3AXXA 2IMRA 2VGGA 1J0JA 1E4NA 3AHVA 3DBPA 4JDYA 4PRWA 3QYQA 2D22A 1Q6DA 3W88A 2PP0A 4JX6A 2VD9A 3SCTA 3V5CA 1VRXA 3A4WA 3OO2A 1IWAA 4G9PA 3EKZA 2ADAA 2YDQA 1WDWA 4ZE5A 3QMTA 4PCPA 2DVXA 2X1SA 1H1YA 2GQAA 4UXDA 4YIWA 4FPSA 4QGCA 5FI8A 3RPDA 2OLAA 1JEZA 1TMHA 3B4YA 4G7EA 3RJXA 1NF7A 1CT5A 1VEMA 3HM7A 5DF0A 1B57A 5A5WA 1QOXA 3TLQA 1RJRA 1KLYA 1Q6OA 3E2SA 3MY9A 2CLOA 1TUXA 3HTWA 3EPMA 2A6NA 3AXKA 4JX4A 3P5ZA 5JH1A 4D6CA 3LCIA 1PTDA 1ZPTA 1W9VA 1Q85A 4MGGA 3RDKA 4J3XA 3GFXA 3S42A 1H61A 5CBIA 1HW6A 5M17A 4OECA 1GPFA 1RQHA 2PMQA 5K9XA 4QM1A 3VKAA 3LPPA 6PTDA 3FEQA 3ABOA 3CL8A 1KRBC 1V77A 4GJ1A 3MQTA 2QT3A 5BROA 1I8JA 2GK1B 1VJSA 4X63A 3TMQA 3MJMA 1OF8A 3HOJA 5D33A 3QMRA 3BSGA 1A5OC 5CGMA 2G4FA 3CO8A 1PX8A 3HU7A 1G94A 4Y8FA 3ZXWA 1A5MC 4L6HA 1GYNA 4DI9A 4NI3A 3ZFHA 4KCUA 2OZTA 3GAYA 3OA3A 1HNYA 4X2RA 4K7YA 3T7VA 1XS2A 4PRTA 3CZKA 1FWSA 2EAWA 3P81A 2VMFA 3ITYA 5TQLA 4J3UA 3AJ7A 5MHBA 1WKDA 1AD1A 3FFSA 1G7UA 2WMFA 1EA9C 4UFLA 4HYRA 3U2CA 4JHMA 3F7JA 5HQMA 3BOLA 1OGGA 4D2JA 1I2NA 3AWOA 4HOZA 4ZXOA 4AYSA 5HK4A 3INPA 5IHRA 5ABTA 1D2KA 4RV8A 1J0YA 3L67A 4WK9A 2BG5A 4XD5A 1AODA 2VX4A 4EWND 1ITXA 4DQWA 1RBOB 4HNUA 1O94A 3NO1A 1VGAA 1EB3A 2P0OA 1KGWA 1J0KA 4WDUA 4WD0A 2WLZA 3RCMA 4HU8A 3W7GA 4K8EA 3BE7A 4WY0B 3AMKA 2DT0A 2DZWA 3DYMA 1E9IA 3TYCA 5K7JA 1SO3A 3GE7A 4E3TA 2J7FA 2CBJA 4ZO6A 3GC4A 4GI8A 4IQLA 4YWIA 2O92A 3LU2A 4E0CA 1ZGDA 5D30A 1DE6A 3HV9A 4KWOA 4Z1YA 4HPJA 5LHFA 1V0MA 3DU0A 1FWNA 2WVTA 1VF8A 4PUEA 3H54A 1LG2A 1RUSA 2CEQA 4ML9A 4Q8TA 4BF9A 3WDIA 4LEFA 3GTNA 2XFRA 1OIFA 3CK5A 4M6QA 1QPKA 2PLKA 2XZ9A 2J9XA 1U5VA 4BQ5A 1QRQA 2OVLA 4DUVA 1JULA 1C7TA 1JR1A 4EX4A 1XIGA 4H6KA 5C9ZA 4MZ1A 4UQEA 1TZ7A 1DYSA 1J01A 3DC0A 4S39A 4FLRA 5F7UA 3RRAA 1W6TA 3OZYA 1SR9A 4CD4A 3W38A 3CC1A 3UWUA 2C1IA 3JZEA 1EWDA 1F7BA 3OVQA 4NJHA 4QDWA 1NIUA 3FK4A 1R9ZA 1UUOA 3WLRA 3TZFA 1Q4WA 3WH6A 2CZFA 2FZNA 2WV8A 1AW5A 4KCTA 1N7KA 2VP8A 3VM5A 1AH4A 1SSGA 4KEVA 2V5LA 3H7VA 4JFVA 3BUVA 3GDKA 4ML4A 2AGTA 4K39A 1ISVA 3MO7A 4C6PA 4LYPA 3OW1A 1TTPA 4PMRA 3M0IA 4GC3A 2ZX7A 5TBOA 5KITA 3S5YA 3N14A 2RUSA 3O05A 4RX0A 2D2JA 5G5IA 2QKFA 3NNTA 2DEPA 3EYPA 2GUYA 1XHGA 4X9YA 3BJFA 3TJXA 4JTAA 5DCBA 3N29A 4KMQA 3QGVA 4KERA 1XM3A 1YX1A 3ICJA 2CETA 3NVTA 3E02A 4ZEPA 3PFMA 4QIUA 1OFOA 4LUIA 2ALRA 1JGIA 4Q4MA 3GLCA 4UFJA 2FZDA 2DZPA 7TAAA 2ZE0A 3WD4A 2XVLA 1W3LA 5C2CA 4TMBA 4UQCA 2KX9A 3RLUA 3CV6A 2PAJA 2HZGA 5C8BB 4NNCA 2JIEA 2VC9A 4HIBA 3OGRA 4J40A 3AMCA 3GFYA 1NDZA 5JBFA 1UKQA 3WQFA 4AC1X 3NSXA 3VGDA 2BHYA 1NEYA 3WQCA 2XN1A 4AG0A 2WWDA 2Z1WA 4W84A 4MJMA 4MLRA 3MYOA 3NIYA 1LLOA 3C2OA 3I6RA 1NY1A 3AS3A 3NR0A 3KLLA 4NILA 3G8EA 2HXUA 3EWYA 2X0HA 2PGFA 4GQQA 3QJAA 3DFHA 1EFZA 3EWBX 3ZWSA 1PCWA 1PZ2A 3LPOA 4J3WA 3PPFA 2YCLB 3GDRA 1NFBA 1BPLB 4XSMA 5BNKA 2Z6IA 2OG9A 4XKMA 2WM0A 4UR9A 1RJQA 2V6AA 4HA1A 5KINA 1RJPA 1F3TA 3AHXA 1JZ8A 3T0DA 3S5SA 1XKJA 1KBLA 1OX4B 1EZWA 4RE2A 1WAWA 5FF3A 3NZRA 2Q8LA 3EDFA 1SJBA 1PKNA 2L5HA 4AY8A 1Z44A 2QCEA 4B5TA 3L2IA 1XSJA 3T9PA 4IPLA 3N15A 4D1JA 4BI7A 2Q6ZA 3VCRA 2XM2A 5H6HA 3WBXA 1TTQA 2PDNA 4ZR8A 2G3JA 2Y24A 4L64A 3W1MA 2E28A 2HBXA 1P5BA 5A6SA 3A4JA 2DZSA 3EA1A 1TQXA 4O4VA 3W7JA 1W2VA 4UOJA 4PZVA 3PJUA 3ATZA 4BF5A 2A4AA 3W24A 3P7YA 5C9WA 4JL1A 4NNAA 1GOIA 1R3QA 2PU1A 1VBGA 4OJYA 3P61A 1WUFA 1D8WA 1EGMA 4HCHA 3VGFA 3VNIA 3RX3A 4I7VA 4NZJA 1MXDA 5DCEA 4K8HA 3FIGA 4AD4A 1TA3A 3DFPA 3IJDA 3F4NA 3C0LA 1G4PA 1ISYA 2OCZA 3BAJA 2OELA 3GW0A 4Q32A 3N9RA 8XIMA 5GQBA 4FXFA 3T55A 4JIHA 4I6VA 3FJ6A 2VEGA 3TE9A 4MM1A 3PJXA 3OQEA 4MMWA 2AL2B 2PE4A 1SYTA 3UJSA 3DC8A 3GRIA 2QQ6A 1YDOA 4D6JA 5LNWA 2J7DA 3QZAA 3H55A 7REQB 3FA3A 2X1IA 5F1VA 4GZIA 4A8NA 4E6MA 1EYWA 4W5UA 2X30A 5A6LA 3VE7A 4GFIA 2X42A 5EA9A 2BLEA 4S3KA 1K7EA 4UUIA 2Q8ZA 5G1YA 2EGZA 3WF3A 1Q6LA 2Y4SA 1VS1A 3A64A 2YPIA 3QSTA 5KSWA 3KCLA 3DKLA 1CGTA 1UJPA 5EU9A 1P7TA 3CLWA 2OYMA 3ELFA 4UFIA 2DW7A 3M0KA 2G3FA 2X7VA 2E68A 3HGRA 3DFYA 2VEPA 5HJYA 3DI0A 4B5VA 2Y63A 3UJRA 3STCA 1XRSA 5BOOA 4GUHA 4C6CA 1GEQA 2JFEX 3TONA 3PWGA 3HMJG 4KEMA 3ZVHB 1VFUA 2FHFA 2VEKA 2FFIA 4B2DA 2G3MA 2YDSA 5BMWA 3TZNA 2W3ZA 3W1RA 1HF6A 1IEQA 4FOUA 3BG5A 4IGSA 4UQDA 4PUMA 2PF8A 4RJEA 3BXWA 4WIWA 4WJ8A 1BXCA 3KBJA 1AVAA 1E0XA 3FJ4A 2Q71A 4Z1DA 4HU3A 5AYZA 2A3HA 4QE4A 4ILSA 1LT7A 4QQUA 1O1HA 3MHGA 1LRNA 1FDJA 1K7FA 3B8IA 1UWRA 3UT0A 1F3XA 1VBUA 2QF7A 2QVHA 3QHMA 2F2KA 1AFSA 3UWVA 3NG3A 7ODCA 5PTDA 1GONA 1ELSA 2ZUMA 5A6BD 4AMAA 3OHIA 3S6OA 4GJJA 4JTHA 3ES8A 1TO3A 4U33A 5JUVA 1DXIA 5I0DA 3AFBA 2YFOA 2YCIX 4EE9A 1GVRA 2GOKA 1KBJA 3B40A 3C5QA 3B0VC 3C8NA 2VRQA 1RCQA 1XCFA 1BD0A 1A5KC 3I3EA 2YA0A 1UZ4A 1RBAA 4CU6A 4J3VA 1I2OA 2INFA 1HJUA 4CLMA 4FLQA 4P61A 4I9TA 4GIYA 3LNMA 1AQHA 3RO6A 3T8QA 1K8XA 1M7PA 1YBQB 2BZNA 1TWIA 1A0CA 4G7FA 4KS0A 1EIXA 3TN6A 1X8CA 1XIIA 3TP4A 4HD5A 3H26A 1A53A 4M7SA 2BY3A 4JHOA 5E6ZA 2O56A 4X3ZA 4PB3A 3BGGA 2DDXA 3VDBA 2Q3OA 3EDEA 4H7ZA 4JDBA 4J3TA 3AYRA 5E0KA 3ONBA 1QAPA 1HJSA 1KKOA 3U7BA 2WJFA 1FWGC 2HTMA 4DXKA 4HHPA 4DO6A 1XJBA 3SN1A 3NO3A 2ALDA 2ZDRA 4BHYA 1RZMA 2YW4A 1CB7B 2C16A 4ZOAA 2G95A 3TTSA 3ZT7A 3GH7A 4LNCA 4US5D 4N4QA 4LUTB 3UZZA 3SFKA 4GZJA 4BR1A 3BWWA 4AD5A 3WBWA 5HINA 3IWPA 2EEXA 2SFPA 4RUBA 3RO8A 3CV1A 4IH3A 3MZ2A 3CB8A 3CIVA 2I7GA 2J78A 3OA5A 4AF0B 4JTKA 5C7VA 1ZUAX 3H2MA 2V8ZA 4JBRA 1YTDA 1R7AA 1J0ZA 4LUSA 2XWDA 3W25A 2E77A 1XLAA 1YPXA 1CXFA 3SGGA 1CXKA 2ZX6A 4RW5A 3ABXA 1DBTA 3W2JA 3NQFA 4PMOA 1NOFA 3VX1A 2Z25A 1WKFA 3PPGA 5G1TA 3VIJA 5K4XA 4K1GA 3HJEA 3L4YA 3NGFA 5D09A 3C56A 3EXRA 1FKWA 2VEMA 3M47A 4LB3A 2VUNA 3M6DA 2O4MA 4GZ7A 3CL6A 3GZAA 2WPGA 3VA8A 3NWRA 1SFTA 3DERA 3W2KA 5DT5A 3NXLA 1OY0A 3T2OA 1JCJA 3FLUA 4O1AA 1G4SA 4QJ5B 4UTUA 1T0OA 1GVIA 4WEVX 4C6NA 5FF7A 3MO4A 3EX6A 4P7QA 4UBPC 1MW3A 5F4WA 1ZRQA 4HOWA 4PL1A 3KTXA 1VPXA 2OXNA 2HXTA 1VD6A 1XH1A 1OHLA 3LCWA 5GJPA 6XIAA 5LA0A 3WEZA 1TR9A 5SWUA 1KGXA 1I2QA 2C14A 3LTPA 4NZ4A 2VI0A 4W86A 3M0VA 3G8RA 3H2FA 1F73A 1DXFA 3NPUA 1OD8A 1DP0A 3UGRA 1VP5A 1UWTA 3O2LA 2IPGA 2WMGA 1OG0A 4DJDD 1OFRA 1TCDA 4O0QA 3DENA 3GDMA 2EJ1A 2EG7A 5CSRA 4OKDA 3M0JA 3H4WA 3AYSA 3L0KA 4H3DA 2PTXA 5A8GA 3GTFA 3WMLA 4WSKA 1XLDA 1NTHA 1ZSXA 3R11A 4ZO7A 1S2VA 3O1NA 3TW9A 6ENLA 4LF1A 4F9JA 4ATLA 1BWLA 4C6JA 5FJPA 4NT0A 3R12A 2OEJA 3VDAA 1NARA 4L1XA 2EPKX 1BG4A 1ZB5A 1XGDA 3FW6A 3MI2A 5AHIA 2VFHA 4RNIA 1H60A 3OGSA 4QR6A 5D2VA 1B1YA 2QW5A 4M5PA 1KFLA 3WLOA 4UOZA 1X97A 4IIGA 2QJMA 3WUEA 3NL5A 3MKCA 3BVJA 4UTWC 1GZGA 5AZ0A 1U1UA 1V02A 3C61A 1UD4A 3H2CA 3UVIA 4QCEA 4RR4A 4M81A 4P2VA 2V3DA 3BOXA 1CW2A 4TUFA 5MKGA 1BSIA 1RP9A 4NNBA 3W4RA 3ZLHA 8CGTA 2ACRA 3A3XA 2JK2A 2WC7A 3MKKA 4GNVA 3GXFA 1TPH1 2WSYA 3N18A 3UESA 1FWCC 2PC4A 4ZZ9A 2VOMA 3O6AA 4C60A 2GDVA 3FJLA 4DN1A 2YW3A 4GLEA 2WQDA 5LNRA 3G6MA 4H4IA 4O17A 2QDGA 5CQ1A 2OT1A 4B4HA 3OJGA 2C15A 1OZMA 3GK0A 4Z17A 1CGYA 3GVGA 1R9XA 3VABA 1O95A 4DJDA 4G2DA 4GGBA 3BMVA 4NF7A 1LL7A 4S1FA 3HPSA 1KFJA 2GVGA 3WLSA 4IFOA 1PZ1A 5FKYA 2ZZ1A 4GC4A 2PODA 3TVAA 3KVJA 3OEXA 4IIDA 4YYCA 1OX5A 3LERA 1LBLA 4LTSA 3QTPA 2YZ5A 1O12A 1XLBA 1FXQA 1ZAHA 4RDYA 3CQ0A 1JFHA 2ZZ3A 1JFXA 3GIQA 4LCSA 3PZNA 3ABRA 5C5YA 4TVDA 3N4EA 3ZR6A 3WBYA 4RXGA 5HJLA 3UZXA 1K8ZA 3WCZA 5FEWA 5CGQA 2DP3A 2EXOA 2W4XA 1PO9A 1B3YA 3BSMA 3G1RA 4GBDA 5I06A 4QBXA 2B7NA 5CXPA 1OFDA 4LQ1A 1MO0A 4LAOA 1DQXA 4IQJA 3T6CA 4AEEA 1MEHA 2QCFA 3W7NA 4QS5A 5CBJA 3ZSSA 1MWOA 3B9AA 4QAWA 1A0EA 2QXWA 1V5XA 5D03A 1B3WA 3R2GA 3DHPA 3ITVA 4HA4A 3B8TA 3PHAA 3OVRA 1WXJA 2JBMA 2PGWA 4HGXA 5REQA 2MUCA 1E6XM 1GVYA 2GGJA 2FPYA 3G22A 4JQ3A 3E0VA 1SFSA 2BODX 4ZQRA 4JGDA 3ARTA 3TFXA 1JPIA 4EP8C 2Y85A 1R3RA 4X0NA 1EX1A 3NDOA 1XYLA 1H5VA 2YDRA 1EZ2A 4PFHA 4F0MA 4W85A 2XH7A 4CNNA 2Q01A 2XSXA 2O4QA 3DESA 1OCQA 4IX0A 4PMYA 2ESCA 1TV5A 4WGXA 3ITGA 4D8LA 1GNXA 4B5WA 4J1OA 4WKAA 3WQWA 5HMSA 4QX4A 2Z1KA 1ADDA 3WD2A 3ERPA 5FOOA 3PP7A 1K02A 1B3XA 2ZX9A 1OF6A 1L6YA 5HDRA 3HF3A 4CNPA 1UR1A 1JRBA 4ADSA 1QNSA 1Z6KA 1KTBA 5EMLA 2ICSA 3BLFA 1Q66A 2IXVA 3VD3A 4FZIA 1WBJA 3NQBA 1LL6A 1FWFC 5KZDA 1KBKA 3W6MA 2VGFA 3IACA 1KD0A 1OYBA 4UCFA 2UY3A 5D9PA 4LH8A 3EEZA 3AS2A 2WOQA 3RJYA 3WH7A 4XKYA 2E5CA 1JZ6A 1UWSA 3UYIA 3CQKA 1YIXA 4GUIA 3NQGA 4MY1A 4AFYA 5I24A 3SN0A 1W2PA 2CLHA 2FQIA 2ZQ0A 1XYCA 1FDYA 1E40A 1JRCA 2GVEA 3NJ3A 3AUJA 2RDWA 3FX4A 3MP4A 4MY9A 4FX8A 5L6UA 1BRLA 4JIRA 3EX2A 5BMXA 3VDCA 4XO6A 3LXAA 1JD9A 1XIMA 3KRUA 1VFMA 2VZVA 4JCLA 1DPMA 4UZUA 4JTSA 1GW9A 1POJA 1GVOA 2ZZ4A 5D8ZA 1DJGA 2BOFX 1JUKA 4MKNA 3ZR4A 3LI1A 3WL1A 2IS7A 3CEUA 5HJXA 2NT1A 4YS1A 4HNVA 5D04C 2WMKA 1JPMA 3UA4A 1TSIA 3ITTA 4JQ4A 1ZBCA 4ZQCA 2R1NA 2D24A 1QI3A 2VC5A 4H2CA 3GU2A 3UWYA 1S46A 4C1LA 3EX4A 3PUGA 3N2TA 2R9RA 1JL8A 2WSRA 2XIOA 3C52A 2ZVRA 4PCFA 2PBGA 3WMCA 4JEJA 5D2YA 4DYKA 4NZFA 1XR2A 4QP0A 5C71A 1VFSA 3T09A 3QOMA 4DJED 4O1DA 2D1ZA 4GNKB 1KNWA 1ZP3A 2DH3A 4DJEC 3JVAA 3TWAA 1XLJA 3AICA 3L23A 3VUPA 2E6FA 2XM1A 3U2OA 2INZA 1W31A 1TPVA 3A47A 4MWAA 2EPNA 1Q7QA 3ZJ7A 5A3HA 1RD5A 5B7YA 4NUWA 3SQSA 1NP2A 3LBOA 4AMCA 4DM1A 2D3LA 2CNCA 1NFGA 1XXXA 2PZ0A 2ON3A 1XGZA 4Q22A 3AS0A 1WAUA 4Y9NA 1BF2A 3MHFA 4L6DA 1Q4NX 1R0MA 1ZBWA 3N11A 1YXYA 3QGKC 4GUJA 1XYMA 2DUXA 1MUWA 1L6WA 3W2LA 3P93A 3QY7A 3N3TA 4TTGA 1M7OA 3SEPA 4H9MA 1ESWA 4XTDA 1LBMA 2OKTA 4IIBA 6CGTA 2HWGA 4AHPA 3W1TA 1NDYA 1SW0A 2ZC8A 2QPSA 2VYOA 4HTYA 4O4WA 3FVDA 4O1EA 3HG5A 4YTSA 3VZYA 4CUCA 1VBJA 3G1XA 4JTLA 1WDSA 5H2ZA 4AHQA 1GQLA 3HFTA 1WOBA 1MXGA 1G67A 1CDGA 1M6JA 4J27A 2QCLA 4D6EA 1A5AA 1U5JA 4KCVA 2BMBA 2QGYA 4XD6A 4FHAA 4C6QA 2VCCA 1R85A 2XIMA 3HB9A 4KW2A 3SFWA 3N6JA 5E0FA 1ZCOA 4CD5A 4R7WA 1OB0A 3STFA 3LDVA 3UZYA 3I3DA 2WHKA 4NVTA 2PI6A 3RAOA 2YGYA 1FCUA 1ZFJA 3HMCA 4UMCA 2PPGA 2JGYA 3CHDA 2EQDA 4RDWA 3MC5A 3TW7A 3MZNA 5EMJA 5F1UA 5I00A 1QNVA 2V30A 2EPOA 5BOEA 1AH3A 2GFTA 3IIVA 2OGYA 4X22A 3U9IA 1K9TA 3B9NA 2CHRA 3WNPA 3MBDA 4CGTA 1Z89A 2VFDA 4UTHA 1A5SA 1W91A 2RDXA 1YW1A 2NWSA 3W7RA 3W7QA 5A8PA 4OT7A 4JIEA 1RV8A 1QR7A 4GXMA 3COTA 4U3AA 4MB5A 1JI2A 1FCVA 3FXYA 3R25A 3AIEA 3L4XA 2A2IA 1QK2A 3PJWA 1MW0A 2ZTKA 4KRUA 1REQA 2JEPA 2H90A 3KP1A 4F66A 4PC8A 3PZQA 3VIOA 5LSMA 2POTA 3RR1A 3VM7A 3MUY1 4UQBA 2QUMA 1LG1A 1OD0A 4L9YA 4B3LA 1RVGA 4U28A 3A24A 5LIWX 1FWAC 3F5KA 3TW6A 1V3JA 3IK4A 3PZ9A 3WX7A 1YNPA 3M64A 3B06A 4C6BA 1R7OA 5ABEA 3H12A 1ZL1A 2G4JA 1QFEA 4LYQA 2QCCA 2ZWYA 1XLHA 3RLVA 5CSYA 3T78A 1C7SA 3PULA 2RGMA 1F4HA 3GDLA 4I5XA 3AYTA 4WX2A 4NHVA 3GVRA 2X2GA 5A6MA 1TMQA 1XUZA 4LXFA 5CCZA 3MV01 4FX7A 3HA1A 4Y96A 1XLMA 3E6EA 3MUCA 4F2BA 3CH9A 1S5WA 1DEDA 1PDYA 3M6YA 3FAWA 3WFLA 4AY7A 3KOZA 3EB3A 3EB4A 2QEZA 4PB5A 1P0EA 2PDIA 2P88A 1TPDA 2BHZA 4DJFA 1IF2A 4CQ9A 3DDMA 1J0HA 2XN0A 5HMFA 4PMZA 1N55A 3SJ3A 3REQA 5G2IA 3U5YA 3E5PA 4KKXA 5E6YA 5HMEA 1A0DA 4O19A 3SADA 4RE3A 3CBWA 4FIQA 4URIA 1W5QA 5FJRA 3B9OA 3WELA 4JTQA 5HR6A 4ZB0A 1FWWA 6A3HA 5AB3A 3LEPA 1ONXA 2CCRA 3C6CA 1SW3A 5DO8A 4M80A 3G1SA 3WDQA 2A7RA 2W79A 4GYJA 4ROPA 2CZVA 1QWKA 2FPVA 1XG3A 3MCNA 4ERIA 2DT3A 5LZLA 4J9JA 4L7ZA 3QZ6A 4C7FA 1XLCA 3SQMA 4GVIA 3N9SA 2ZIDA 1F3EA 2C1GA 1R47A 2AKZA 4J3SA 4AWUA 2HISA 2YZRA 2PWEA 3C2YA 1WZAA 2IKHA 1TPFA 2ZZ7A 3W7IA 1C92A 5I2UA 2Z1BA 4L5ZA 3S1GA 4LC8A 3P67A 2VFFA 2QJGA 2VFGA 2JKAA 2YX0A 3PBGA 1H7RA 4XSLA 4HBKA 4D72A 4IMDA 3ABZA 1QBAA 3VKDA 3TAOA 1NWRA 3H21A 1H4PA 3FYYA 5JVLA 3W26A 4YLWA 2ATMA 3U8GA 1YDVA 4O10A 3PBYA 1S5MA 2CZDA 4GXPA 1C9DA 2OZ0A 4HA0A 1EP3A 1POKA 3CASA 2BGSA 4DRSA 3UA3A 3IGXA 4IMFA 2AQWA 2BXVA 3ZLGA 5KEZA 1XL9A 1HO4A 2BXZA 4R88A 4Q4RA 4AIBA 3B03A 4O50A 1PZ0A 1W56A 1XIFA 1OT2A 1LQAA 3IUHA 1VYRA 1GOKA 4A21A 5T8GA 4A3UA 3TYBA 2CWXA 2BVYA 2YLAA 1CI1A 1IHIA 3V16A 4LV4A 4MJ4A 1E1FA 3VIFA 3VKKA 1K3UA 2F38A 3EMQA 4JYFA 4G7EB 1P0BA 1UH2A 5JIWA 3UCQA 2JF7A 3HN3A 1B9BA 1L8PA 3BURA 2G41A 3SB0A 1VFLA 4LAKA 5JMUA 4N4PA 3SM0A 1OGSA 3L5MA 3RM8A 1OFPA 3AS1A 4RXFA 2B7QA 4Q7BA 3OVGA 2UY4A 2VQUA 1MI3A 1SZEA 3WLLA 1I45A 4V15A 3TYDA 5CLTA 4R53A 4G6CA 2BFGA 4Z2JA 5J5DA 5IOBA 3M7SA 2BY0A 1KTCA 2Y88A 1UZDA 3OYXA 4R9XA 3MANA 2J13A 4MKVA 4MNKA 3O06A 4J2MA 4HZ8A 3M07A 2OGJA 3KL0A 4D6HA 4YXGA 1LZOA 3GVWA 1KQYA 5K9DA 1QW8A 5EGRA 3NZ1A 3BGJA 3JS3A 3U57A 3WKZA 1M68A 2PWGA 4AIUA 1O4UA 3BCDA 1CZ1A 1HJQA 2O0TA 2X1TA 3BCJA 2CHNA 3EMCA 3WJXA 3V7PA 4G5DA 3WLTA 1W1ZA 3GNDA 3C8FA 2W5FA 4JS3A 2RAGA 1HQTA 1KV5A 4HK5A 2E7FA 4OBRA 1GQNA 4KWVA 1JCLA 4EAYA 2W27A 1OFBA 1V08A 3D3FA 2D3NA 2E6YA 3M5ZA 1PWMA 5M1TA 4MFDA 1I0DA 3ZOAA 1KV8A 2XPKA 3QC3A 4J28A 1CNVA 3N34A 3AIRA 3H4XA 5EMMA 5H8UA 1AMKA 4E3VA 4M6PA 3LHWA 1EBGA 3QHNA 3LPFA 4CEUC 2POZA 5D2TA 4YWSA 2REQB 4CNUA 1PX4A 1Q6FA 3ZYZA 1NP0A 4PH6A 3GH4A 4UNKA 4NAEA 1DWAM 1G7VA 1E0VA 2HQAA 3UY8A 4W5ZA 3ZSTA 4PBEA 1TV8A 3UWWA 1A4LA 3V0SA 2PDHA 2Z4GA 3A3WA 3C2VA 3SW6A 2P5NA 3GKAA 1VPYA 5C6MA 4ZSTA 1GYMA 4HN4A 4H6RA 1QO2A 2OU4A 2ZKMX 1HJXA 3NQ7A 3LZ3A 4LU0A 1KRAC 1XCWA 4JPGA 5HULA 3TN4A 1YXDA 1FH9A 4BWLC 1OWQA 2A0NA 1GCYA 1A5UA 4GBUA 2VZUA 2J8GA 3WZ0E 1XC6A 5IBXA 1OABA 1FWJC 3W84A 1ISXA 3VOCA 4X0VA 1PEZA 3Q45A 1EEXA 2OLSA 2XGIA 1I9CB 4HNTA 4X60A 1I6NA 1W3KA 3KXQA 1P4CA 4LYRA 4RZ6A 2V69A 4BJHA 3OODA 1CLVA 2WAGA 1SMDA 3QEZA 4GZEA 1GZ1A 3V5OA 4C6KA 3N04A 1FXPA 4C5ZA 3L4UA 1NOWA 2X16A 5LKYA 1GG1A 4HNOA 5C2GA 4YVPA 1QT1A 2ZC1A 3VINA 3G77A 1VFTA 3S2LA 3VXGA 5DELA 2D2OA 1ZY9A 1H7XA 4CCZA 1FKXA 1VH7A 1ZJBA 5ECVA 4XZHA 2ISVA 5G2WA 4BS0A 3L4WA 3K4AA 4JEQA 2OO6A 1VENA 1H7NA 4RZ4A 3U2ZA 3FOKA 2VUYA 3FDGA 5IDIA 4W7WA 4LS2A 1D9EA 3LQGA 1JD7A 1UP2A 3NEVA 1W8GA 3MS8A 2OQHA 1N8WA 2V81A 4HU0A 4EK7A 2DORA 3MW7A 1Q6RA 1QPRA 1YLVA 4PCNA 4HZMA 3ARZA 4MUPA 3EDKA 2W92A 2I9EA 2AAMA 3UPWA 1XC4A 4ZFMA 4L4OA 1Z69A 4C6IA 2GL5A 3SUUA 2O9OA 1IEWA 3LK6A 4GI6A 4UWMA 4XZLX 2QAPA 1TRDA 3VMPA 3EKGA 3P60A 4D6GA 1CLXA 4DX3A 5EY5A 2FTYA 1J10A 1AA1B 4KFOA 3FYOA 4O0KA 2PDJA 5BXSA 4Q4SA 1CENA 1X98A 4RCXA 1XH0A 2P1FA 3CHCA 3K1GA 3W7OA 3QV7A 3S0CA 2GK1A 1XDMA 3PANA 2PDCA 4NI8A 5DANA 4MLJA 1A49A 3O07A 3URAA 4M29A 2VC6A 1FFQA 3VKCA 5A6JA 1LOLA 3VNKA 1TJ1A 2ZOXA 1CXEA 4D9PA 3PY2A 2PP3A 1C91A 1PX3A 3EOOA 3SCVA 3QBUA 3GXNA 4S3JA 3F4DA 2GUUA 4AQLA 4GNJA 3W7CA 1QW7A 3S1VA 2WC3A 1OFQA 5CC7A 3PUOA 1R9YA 3CPRA 5H1WA 3NQAA 2YL6A 3L5AA 1W32A 2JQXA 4K37A 4FOKA 4ZTYA 1GQJA 2YLLA 1MQPA 1GQKA 3FHQA 1HKWA 3M43A 3CUGA 2PDWA 4JOMA 1NVMA 5JIPA 4YPJA 3MDWA 1EJRC 1W9PA 4B91A 1YKWA 4YN5A 4DO7A 3IS4A 5IRPA 2OZ8A 4FB7A 4EKJA 4XD4A 1QNOA 1AJ0A 1TREA 3ZT6A 5C54A 2JKPA 2V67A 3MVIA 5G1MA 1M01A 3O7UA 2H9AA 1VRDA 1GKRA 1XIHA 2ZXQA 1M7JA 4A3YA 2PDKA 2OMAA 3BLKA 1OC7A 1GT8A 2F6KA 2V68A 1ODUA 2ZRVA 1CWYA 3LCXA 3ZVIA 1O1ZA 3A13A 3EOUA 4DF0A 3W73A 3BJSA 2CW6A 1NQKA 4HPNA 2E9BA 3A5FA 1AH0A 3MJYA 4AZGA 1QHZA 1W54A 1M9HA 2V3FA 3E5BA 4GVHA 4WOQA 4MADA 4O8RA 4BQ3A 2NLYA 1TTJA 1UROA 4C6FA 4MB1A 3UZWA 1ME8A 3CAKA 2XVKA 2GVYA 3PS7A 1RY0A 4WLCA 3UR8A 1UOKA 2QPXA 4H00A 7ENLA 4QE1A 2FZ9A 4YCOA 5AC6A 2ACQA 2WB5A 4A3HA 3G1DA 3C0QA 3CAQA 4JN6A 3KHDA 4DBEA 1YNQA 3MI6A 3VGEA 5DCDA 1X1ZA 3ARQA 2Z2BA 1GJPA 2NX9A 2UZ9A 2G0WA 3UG5A 3GHSA 4UIOA 4Z08A 3DYPA 1E71M 1Q45A 3P8JA 2GQ3A 2HK1A 4Q8OA 5BYWA 1J5TA 1Z7AA 4FEZA 3HQNA 3AOFA 4Y7EA 5TAOA 4FR6A 4AW7A 2PRMA 4LT9A 1V3HA 3R8HA 2D2GA 1XI3A 1E0UA 5DBTA 4TVCA 4HK7A 3TMLA 3CO4A 4KCWA 1PV8A 4FNUA 4CQAA 4Z0JA 1E9ZB 3UP8A 3RLHA 3T07A 3BPWA 4MWAE 4PUWA 3SUSA 1OSEA 4MY8A 4UTKA 3LY0A 1LQ2A 3SUTA 1WUEA 1W3JA 1Q7MA 3WLNA 2FJKA 1V6VA 1R38A 2X09A 3F4VA 3QQWA 4GE8A 3B8DA 2QIIA 3RHGA 2WNNA 1L6GA 3G1AA 1OIMA 4O1FA 5LGXA 3I3BA 3RITA 3WN6A 3BL3A 1G9HA 1JVNA 1R30A 1MZRA 1JZ3A 1KM3A 3WO8A 3MPGA 4WQ6A 3PZMA 5ENLA 3ITLA 2VTFA 3TJ4A 1ZALA 3TTQA 1P6BA 1WDRA 1W0MA 3G0XA 5FA5A 2XHYA 2ABAA 1B30A 3LV5A 2QUUA 2XIJA 5D8WA 1K9FA 1MEWA 3LHZA 3WF2A 1HFBA 1XYAA 4GIAA 5LIYX 3R94A 5AN7A 4IFKA 3USZA 1H62A 4IJCA 3UBPC 2R1MA 2BVWA 2QCGA 3NQ6A 1EJVC 3NFUA 4D8AA 4P8WA 1AMYA 3T44A 1C8QA 2J7EA 4X9SA 1XX1A 1ZAIA 2VX6A 3TYUA 1VJIA 4KWWA 3THAA 2BOGX 1ZAJA 2WO5A 6REQB 3KDNA 1JCMP 1MDLA 4HCDA 4Q6JA 1B31A 3VGBA 5I02A 3AXIA 1W17A 2IKIA 1TWDA 3QY8A 5GNYA 1EXPA 2YOCA 3C0JA 3S83A 1CGXA 2X41A 4ICMA 3WENA 2ZWZA 2R82A 2XU2A 1TIMA 4HN8A 1DKWA 2WHMA 1CX9A 2C71A 2GWGA 2GUBA 1EQPA 4LBRA 3AJXA 1UYQA 2CWNA 3KVMA 2Y8UA 3ID7A 3KOWA 3WJYA 2V3GA 4FI4A 4OZOA 4PA8A 2EBNA 5DX7A 3QN3A 5JXQA 1MSSA 3NQ2A 3OHMB 4JNMA 4RDVA 5FJJA 2IPFA 4NL1A 3A22A 3K8LA 3CQJA 3VIMA 2NQZA 4UFHA 1V93A 1A80A 1T7LA 4NRRA 2NV9A 3VIPA 3LLFA 4PMVA 1EYEA 3MMDA 1OCJA 1TX0A 1LROA 2WMIA 1JZ2A 2CXGA 2J77A 4MYXA 3S2CA 4H7VA 2FZMA 1ADSA 5LNUA 3W86A 4HJWA 2VURA 2PEVA 1JPDX 4JXCA 4A3QA 4RPPA 1JXKA 2PDQA 4NX5A 4M56A 2J27A 4LYKA 1FDZA 4U5KA 2PDMA 4KIRA 4HKPA 4A35A 3NL3A 4GYPA 4DB7A 1KM5A 5HUOA 1JQXA 3RILA 4GX8A 4HNNA 1IEVA 1VCGA 4Z2KA 1LJYA 5CSUA 1WQ5A 4GPNA 2P3EA 3DN5A 4ZCWA 3UWQA 2YBTA 4M24A 3FCPA 2O55A 1B4KA 2O9RA 4C6EA 5A2BA 3PBWA 1V7AA 1XFCA 3O15A 2J66A 3AQUA 4TX9A 2DSWA 1JI1A 1FUYA 3BARA 2WBKA 1RLDA 3CJPA 3V0TA 3LM3A 1VYSX 1TRIA 1XBXA 1WA3A 3ABQA 2YBVA 3PZGA 4LUSB 4JY9A 2GJXA 5LNSA 2C18A 3GR8A 1E5JA 1IEXA 3KAOA 7CGTA 1KFCA 5H8MA 3GHUA 4B5SA 3WLQA 5DT7A 4H83A 3WFZA 1DQWA 5D2WA 5RUBA 3GTHA 3MSRA 1UC4A 1NQ6A 2Z2AA 3CAWA 1KM2A 2BASA 4LANA 4AX7A 1O66A 1UD8A 3N2XA 2R14A 1W1YA 4L65A 1NWSA 4ZB2A 2EJAA 1MXSA 1WDDA 2J7HA 4JZ5A 1FQ0A 2XFFA 3QLDA 4XB3A 3VPLA 3IARA 3KTSA 5FF4A 1Q2SA 2E9LA 4KGJA 2F7FA 4JHZA 5G4HC 2ATSA 4UQ9A 5AHNA 3WUFA 3MMTA 5M2FX 4AVOA 1BKHA 2VX7A 3KDOA 3OZMA 1PPIA 2WVSA 3APTA 1VZWA 4C1NB 4ZQPA 3CUFA 5AFDA 9CGTA 4Z1BA 1IXNA 1RALA 2HS8A 4FNPA 4AWSA 1XLKA 2CLFA 1E0TA 3AHTA 4UCGA 3QKZA 5A1AA 2Z1VA 3Q67A 5H91A 3T4CA 3OZOA 1CGVA 1J11A 1O7AA 2DIJA 1ITCA 3NQVA 2ACUA 1ZJHA 4C90A 1EJWC 5HWNA 3TYZA 1GGOA 4HOXA 3WIJA 2WHLA 4ZOBA 2W91A 3V36A 1MYRA 1NU5A 4Q4QA 2GGIA 4CCEA 1ZNNA 1BYDA 4Q8MA 4MDPA 4B9ZA 2QUNA 3GXPA 1GOWA 5CC6A 3PAJA 1JXJA 1W9UA 4UTTA 4OUIA 1RBLA 5IXEA 3KWXA 3TOYA 4F0SA 5KMYA 4AU0A 1O6IA 2WYSA 3F1QA 3BAYA 1TWZA 3W02A 3M5VA 1E4MM 2V2HA 3PBVA 3AMDA 2QNEA 3ABSA 4WGHA 5IDZA 3E3HA 4GY0A 5EFDA 4GVGA 3HQOA 2DIKA 3E2RA 3OGVA 1EX5A 5E09A 2Z26A 2PWDA 4EPBC 4DM2A 4WF7A 3N13A 4GD0A 1VFHA 2WXDM 3CZGA 4XWUA 1BYBA 4PMDA 1EC8A 4AZCA 5BRQA 2BOEX 5MKGB 1JQVA 3LI0A 4QLLA 1CLKA 4LCRA 2D23A 1XLGA 2E5BA 4QJ3B 5D9NA 4C7DA 5TIMA 4KFNA 4LC6A 3P62A 1GVQA 3MYPA 1WBHA 4U5IA 3R5EA 1HL8A 3NQMA 1US2A 3L66A 3UCCA 2XWEA 5LHEA 4PB4A 4L9XA 1V3KA 3ZJ8A 1EO5A 1S2AA 2QJNA 1ZS2A 3UR2A 3G3DA 1ZP4A 3SCSA 4GCXA 4W8AA 1UIPA 4UOQA 3W81A 4JTTA 1Y0EA 2ZX5A 3VNJA 2DV0A 3SI9A 3UGVA 1OK4A 5BWAA 4CN4A 2AKMA 2V5BA 2BS9A 1UP3A 3DYOA 4PN2A 2AAAA 2VO5A 2FIQA 3CUXA 1TYGA 2IUZA 3IJLA 3F2DA 1EPVA 3BLOA 2GVJA 1QBBA 3WNMA 1WXZA 4DI8A 4E5TA 2XISA 4MPKA 4RNJA 1E0WA 1R5YA 2PU0A 1DTUA 1MW1A 5FEZA 1SPQA 4DUOA 1UZHA 3CH0A 3PSWA 3E74A 3WQVA 3KP0A 2NXIA 1Q8AA 4MF4A 4N02A 2HPMA 5CKSA 4IX2A 3LRMA 4HT3A 1KFBA 3T1GA 1VAHA 1I2RA 4UTFA 3MUXA 3R6IA 4P7OA 4I90A 5J04A 4H6QA 4ZFCA 3I6EA 2EO7A 4L1WA 3ES7A 4JNYA 2V38A 1GVSA 4H04A 1ALDA 2YDAA 2A85A 1NOUA 1XW8A 4OHQA 1VBRA 2GDUA 1R3VA 4MOZA 6TIMA 4YNGA 4S3AA 1DJIA 3KBWA 3RLGA 1H5YA 3O8AA 8A3HA 4B3KA 2BTMA 4E2VA 3IAPA 1JCXA 2C79A 3AIVA 4M82A 1HGWA 3UJEA 3MMWA 2XTKA 3N19B 4W7UA 4GI4A 2EKCA 5F2MA 1DJQA 4JTGA 3TDFA 3I7SA 2PDBA 5FJTA 3YPIA 3MUIA 5JU6A 5E9AA 3BOFA 1HO1A 1ML1A 4AZ6A 5REQB 5FACA 4M3PA 1W9XA 2BNJA 4ACYA 4GIRA 1XG4A 1X8FA 2X0YA 3IUDA 1E6NA 4QISA 4Y9PA 2CLPA 2C6QA 1LWIA 1MNSA 1IT7A 1SFLA 4UNLA 3QMSA 1KFEA 2OX1A 4FIRA 1DJYA 4FX6M 2ISWA 4JIQA 1QPOA 4PUKA 1TZZA 1WDQA 3DH7A 2C3ZA 2VDHA 4OV9A 4JTIA 3IAQA 4RL3A 3IJ7A 3IIXA 4XZBA 1WOAA 2BSLA 5HQLA 2PRLA 2Z6JA 1OJXA 5EYWA 1ZZMA 5CPTA 1MUMA 4F0HA 1H11A 3CUJA 5T26A 1RHCA 1XD0A 3M46A 3EOEA 2O7SA 4DO5A 1KBIA 4HMEA 3TSMA 2VC7A 5G2HA 4FXJA 1FFRA 1TWSA 2FZBA 4I9AA 1UG6A 4V33A 3CHFA 3WQPA 2XIQA 4YTTA 4GOAA 5GNZA 1MFUA 2HV5A 2BDQA 4XUGA 1LM1A 1AW1A 3MHUA 3LGEA 3Q37A 4XUYA 1D7FA 3NURA 3G1YA 2ZUUA 3B8VA 2GQ8A 4MIMA 3W85A 2YYUA 9XIMA 3GR7A 2PWHA 2WNWA 4XKYB 2ASHA 4UR8A 3FGCB 5FJIA 3TQVA 5A8QA 3GTXA 3PZTA 3VVGA 3AIQA 4ORIA 4Q7NA 4XZ9A 4IUOA 1C8YA 4PSRA 3IGSA 5HNUA 3THCA 4ZL1A 1R86A 3CYJA 3W70A 5HBFA 4M7TA 3OB8A 3W37A 1SZGA 4U2ZA 5D37A 2A6LA 1QWGA 7TIMA 4PMJA 4YL2A 4DXVA 4UTLA 5BZAA 4QLKA 4HK6A 3GNPA 3JRKA 1I1WA 3ONCA 3AC0A 4WOZA 4NG3A 3W2MA 1PJ9A 1XBYA 3R8GA 2Z7KA 1BRLB 3IV3A 1UD3A 2B81A 2BV9A 2QPUA 1DJHA 1EJXC 3CXOA 3NQEA 2Y0FA 5TNVA 4HPGA 3VO0A 4M8UA 1MQQA 3TV8A 1R8LA 3IANA 3V75A 3PF3A 3UNTA 4O52A 2ZRWA 3K30A 3LCLA 3RU6A 4GUFA 3TSBA 2ZDSA 1XSIA 4KRTA 3G2GA 1ZENA 3SY1A 1C90A 4BQ2A 2E6AA 3BQ5A 4Q4OA 3MBFA 1ZTVA 3CZLA 1O5KA 3ME3A 1QI0A 3T2QA 3VMNA 3WQDA 1UUMA 2QMJA 1DJNA 1NWTA 3AYVA 3STEA 3MU7A 4JNZA 3NZQA 2PC8A 2VQTA 3CWOX 1I0BA 4O15A 4Y6GA 1IV8A 1TUFA 1A3HA 4LF2A 4N9BA 4LAMA 2OOFA 5D9OA 2WVUA 4ZODA 3P2VA 4DAIA 3QSRA 2VEIA 2R1PA 4NAFA 3SUWA 4MWAB 3RR4A 1X6NA 2NLIA 4KH2A 4EIVA 1UWAA 3WLIA 1LL4A 2WVVA 4LVAA 3ITOA 1W1IE 4IP5A 2DY3A 1V6YA 2E4TA 3FSUA 2OT0A 2J62A 3KRSA 4Y9MA 5T9BG 1VPQA 5HA7A 1RQBA 4A29A 4DWSD 3W0KA 2HMCA 4XISA 4CU8A 5ABGA 3B9EA 4IM4A 4A8IA 3BG9A 1GUVA 1V6TA 4P8VA 1EJSC 3WH5A 2FMOA 1HGYA 1XD1A 2DJLA 4PBGA 1ME7A 5TF0A 3UF9A 4L1GA 4C5YA 2HNHA 2MNRA 2XGBA 3URNA 4ES4A 2V0TA 2F8QA 1ZLPA 3VCCA 1E43A 1FWRA 2PLJA 1M03A 1Q6CA 3W07A 1JAEA 1SZFA 2OYLA 4ATDA 2UY2A 3THUA 3R10A 1L6SA 1WDPA 3W00A 3CMGA 3FJNA 4GACA 4H01A 2PWVA 4KQNA 1V3MA 1L8NA 2QUTA 5I78A 4LS1A 1SZRA 1JDEA 2OSYA 3LCHA 3TXZA 2IQDA 5C70A 1H51A 1V0LA 2ABBA 5FESA 3GO2A 1OYCA 1LLWA 3UZ5A 3SSZA 1TIWA 1JNDA 3HPAA 1J9YA 1WZLA 3SIZA 4QDMA 3T05A 1F6YA 2HBVA 4QTGA 4B2DD 4OOUA 3M4HA 2VELA 3DFOA 2BGQA 4BEQA 1SJAA 1XKYA 3L2MA 2P10A 3CM4A 3OU8A 2W0UA 3LUTA 5FJOA 3HPZA 5AHEA 4INFA 2YSWA 2ZRUA 4DBDA 2YXXA 1B5TA 4RV3A 4O28A 4DELA 1OT1A 3CIXA 4QSFA 1QHPA 3ARYA 3DEQA 1KLZA 5J5RA 1N2VA 3GVQA 2GOUA 3QHOA 2FYMA 4H8VA 5A8MA 3WQ6A 3R4IA 4ZE4A 5C7HA 3GYEA 4AC7C 1RPXA 4QEEA 4M6VA 1RAKA 2G37A 4BA0A 2VDGA 4NZ5A 3UR5A 1V6XA 1DIDA 3AMGA 3CZEA 2QGHA 1GJWA 2UBPC 3KOXA 1PWLA 4DWSA 1FHDA 1PHWA 4H7CA 3G1VA 3PB2A 1WKEA 4C6MA 3EBVA 1REQB 4OGZA 3BAKA 4PMNA 4LVDA 3MSGA 4FA3A 4BK9A 3SCPA 4GUGA 2X2YA 1YPFA 5F2LA 4I9MA 4E4PA 1K9EA 3QPZA 3C3UA 1UASA 4HSOA 3B8SA 1FWDC 2ZUVA 4HNLA 1GTEA 3OIXA 1UCWA 5CAKA 2PLMA 4Z42C 2J79A 1LWHA 4DPPA 4KFPA 4REQB 3L4TA 4RK8A 4MVAA 4GMEA 2CBVA 3TWBA 4EOUA 1QO5A 3VCNA 1A3WA 2OX4A 2XIIA 3T4WA 1FY6A 4W4QA 3QFWA 1DWJM 2OSXA 4XK2A 4RLIA 4E2OA 4H9YA 4JTJA 3BLEA 4HSHA 2Y5SA 3ITCA 1AQMA 3UPMA 3CUZA 3DFTA 2Y6ZA 3F5LA 1F6KA 5U7SA 1RD6A 1OBAA 4AHOA 2HS6A 2R1KA 2QJIA 2OEMA 3KBSA 2E8ZA 3PJTA 2DUAA 3OZPA 4R5EA 4AH7A 1FRBA 1CBGA 4Y2WA 4XZMX 1E72M 3R43A 1R3WA 1OX6A 3GFZA 3HZ3A 4MG4A 2I5GA 8TIMA 1WCGA 3D5HA 4H1ZA 2DQWA 4F3HA 1E6ZA 4FP1A 1SMAA 1KGUA 3LV6A 3L0NA 4F0RA 2XYLA 4DO4A 4CQCA 3O63A 2QZRA 3REQB 4E8GA 3OVPA 1V7YA 4ORMA 2CZ5A 2WZTA 2A5HA 1M04A 4IGMA 3EA2A 3VMOA 2VWSA 1NELA 4IMAA 3HG3A 1UA3A 2OO0A 4P8UA 1GKQA 4C7GA 3RMJA 2FVMA 3B97A 2X1UA 3HGOA 3QQ0A 1ISZA 2QMKA 3SCNA 3JW7A 3OBKA 3KVLA 1GYLA 3GG0A 4MJ2A 2FH8A 2D20A 1SUXA 3M44A 5ECUA 2DT1A 3QKEA 3M0LA 2JIWA 3NAVA 4G1KA 4H9VA 1UH4A 3CS2A 1IZJA 2FGBA 3KM8A 3B0PA 3KRZA 2PTYA 5FCZA 5C9RA 4EPDC 1Q13A 2XFWA 3IK2A 2VZTA 4YHGA 3RRXA 3UCDA 4LEQA 2J4GA 1W1VA 1PL9A 1GK8A 2GGHA 1JDFA 2ODOA 3VNYA 1KRMA 5XIMA 4B92A 2ZRXA 1QATA 3N73A 3TYEA 4Z0SA 1QNQA 3TA9A 1KM6A 2BY2A 2DIEA 4M1RA 2B31A 5A8NA 3NPVA 1ONEA 1FWIC 3UEQA 2CPUA 2CHOA 3WQEA 2RDTA 3ZR5A 3PR2A 1J96A 2I57A 1QI4A 2J9YA 2EPMX 4M1BA 1TVLA 1E55A 3AZRA 4JTEA 1EGZA 4XAZA 1LRTA 3LB0A 3H7UA 2J8FA 2G3IA 2BGNE 2PDPA 5D2XA 5M3WA 2OLHA 1GHSA 1KTNA 4DY1A 3JU2A 4C6DA 1X1OA 1RY8A 2GJRA 3ZS4A 1AJ2A 2DZAA 2Z27A 1FWTA 3WQ5A 3AZSA 5LA1A 5FSDC 4H8NA 2NX1A 1VHCA 1IQ8A 1GOOA 3STGA 1BTCA 1B0IA 2J7GA 2HK0A 3W53A 4WDTA 5FJUA 1KXHA 2NSOA 4Q8WA 3KVKA 1E3ZA 3CB3A 1HL9A 3KS5A 1TE6A 3E0WA 2RDUA 3M9YA 4R9OA 3UXKA 2PBOA 3ALGA 1BVZA 3E1F1 2IPWA 4ZQNA 4WDWA 4NXKA 2YCKX 5IFTA 1EL3A 2GJNA 1EJ7L 3PG8A 3W1AA 2DZXA 3VAVA 1FBAA 3ZMRA 4AWEA 3WF4A 3WUBA 3H6OA 1X38A 3DZ1A 2YB4A 1LUCA 3BSHA 4XO7A 3SAZA 1E4LA 5CG0A 5CPLA 1TVPA 5K9CA 4N6FA 3I65A 1AUSL 3W74A 2E5DA 4FLSA 2BHUA 4AD3A 3MCOA 2G5WA 4WSHA 4R3UA 4QLJA 4DJDC 4GY7A 4GYFA 1KXTA 2WJEA 4J5NA 1VBHA 5DMMA 4U31A 1U33A 1AQFA 3SECA 3IGUA 2UWFA 1PIIA 3GS6A 5HQEA 1CGWA 2HE5A 1H50A 1N8FA 4AZIA 1ZBKA 3G5EA 4H9UA 1C8XA 4UZSA 3QPYA 2CBUA 1FHVA 2ZE3A 2PUZA 1JZ7A 1OC6A 1LQ0A 4M51A 4YHEA 1BYCA 4IJRA 4S3GA 5DN1A 4PCSA 3ARVA 3SO7A 2PTWA 3RK8A 1A5LC 1DIOA 3P80A 1BQCA 5M03A 1ZJIA 4JFWA 3VGHA 1AZ1A 4FMVA 1KM4A 2VR5A 2E0PA 2GQ9A 2Y7FA 3M16A 4NAEB 6TAAA 4E4UA 4KPLA 2OEKA 1RPKA 3TUUA 3O6DA 3VNMA 2QULA 2NVCA 1GOXA 2DQXA 4TU1A 2PCQA 1PVNA 2QCMA 2XH4A 1G5AA 3H23A 4CQDA 3AXMA 4RPQA 2WM1A 3UPBA 1NSJA 3M5XA 4FNRA 3AXHA 1PS9A 1UR2A 1RR2A 4XBSA 1H49A 1UR8A 3DHDA 4IIHA 4LAZA 4G8TA 3P3BA 1HTIA 3SCQA 1XLFA 4F8XA 1XFBA 3E96A 1KW1A 2MANA 3WD0A 4S2BA 3T0CA 2XIBA 2NV2A 1TPC1 5FEPA 1D8CA 4QG9A 3BICA 4UFKA 1EPXA 3SRDA 3C2FA 4LV9A 3GBEA 3CNYA 1KBBA 4U3CA 3MB9A 1MEIA 1TG7A 1OVDA 1LORA 4DBSA 3CPUA 1G69A 1FA2A 1QK0A 2AMXA 4W88A 3N2CA 4IGNA 1ITQA 3NO5A 2W9MA 2E67A 1V51A 4P7LA 1CGUA 2WLYA 3U7VA 4LVGA 2I14A 3QR1A 4O57A 5CSSA 3OLDA 4Q33A 1J0IA 4GWEA 3VD4A 1XQKA 2ZFAA 1EP2A 3B0UX 2YL8A 4OOZA 4XG1A 3VD5A 4DXXA 4IJBA 3H4GA 5KZMA 2R91A 1E56A 1MDRA 1TV3A 1T40A 4Z1AA 3NPXA 2VKZG 1A5NC 4ZGYA 1E4IA 2NX3A 2NZLA 1JYXA 4Q8NA 5DBUA 3MP5A 3TC6A 1PYMA 1W9DM 3PPHA 4GABA 4QFUA 4QITA 1TKKA 4HPXA 4DAFA 1EDGA 3M7WA 1A4MA 4I3GA 5BWFA 1H1ZA 2FB3A 1EDTA 2AL1A 1L2UA 1ZJAA 4O0ZA 3PBMA 4DWDA 1QMLA 1DIKA 3DG3A 3DFSA 5I23A 1OQFA 1FWEC 5CZJA 4CQBA 4L56A 3KCJA 3GIPA 1UWUA 5LXEA 1TWWA 1MQRA 3CGTA 4IQDA 4PSPA 4LVFA 3FEMA 2OYKA 3EOLA 3S5OA 2NQ9A 1Q6EA 2Z7GA 3KBMA 3TC3A 3XISA 4R27A 1BG9A 5ABHA 1BSLA 3W7DA 3P6LA 4CU7A 1XUUA 4XD3A 4QCFA 2TSYA 4B3ZA 1H41A 3WLKX 4NSBA 1XINA 4Q8QA 3KLKA 4RNHA 4RE4A 1YTKA 2DZUA 4AX6A 4O14A 5AHLA 1EHAA 2NUWA 3CIWA 4N42A 5XIAA 3MVTA 4AVFA 3NQCA 2NT0A 2R94A 3NQDA 1HKIA 3F2CA 3NM1A 1KCZA 3T0BA 2PSNA 1QPNA 1R6WA 4MWAD 2VL4A 2WZHA 4MWAC 1J6PA 2P53A 3RN6A 2D2HA 4LFYA 1F61A 3PN8A 4F2TA 3VU2A 2YA1A 4DVOA 4NJGA 3ZJKA 3W1LA 2REQA 3NEHA 1HIZA 4US6A 3DOPA 1HKKA 2P8BA 4PTXA 5CZKA 2XVPA 1TV4A 2H9AB 3OG2A 5I7GA 1QCWA 3CV2A 1A5CA 3LXBA 3ARUA 3G24A 3NOEA 1PCKA 4GXWA 3GNRA 2XFYA 4Y8EA 3WMBA 4AWTA 2NUYA 5CZ0A 3W1PA 1GWJA 1XYFA 3LZ5A 3SUVA 3PC0A 4IGHA 5HNTA 1BXBA 4IUGA 1EUAA 1JF5A 4JFSA 3N2BA 2PFHA 5AY7A 1SVDA 2CFFA 2YA2A 2UY5A 1Y7VA 4GISA 3WLMA 4MDOA 3D47A 5IHSA 1C29A 3ARPA 1W5OA 3PTMA 3S2MA 3CL7A 4NYYA 2VGBA 3S9IA 3K8MA 4JQ2A 2VCAA 1T8XA 5U4NA 2WPBA 2G8ZA 1FCQA 1PIGA 3II1A 1BQGA 3VNLA 3EXSA 1IXOA 4JYEA 4XQ6A 3VGGA 4QE5A 3VOIA 2CXEA 1DWIM 4ZO9A 1JUBA 4ASTA 2XVNA 2YCEA 3C2RA 4H2HA 4PYSA 3NTYA 1KQZA 2OWXA 4DPQA 4PUJA 2DH2A 2OFJA 3GBDA 4LUJA 5CH9A 3USBA 4ENLA 1JYNA 2PF0A 1HXJA 5FAGA 2WSKA 4LS0A 4EPKA 2HSAA 2PURA 3UJFA 3L68A 3BLPX 4Y9OA 3KW3A 1XRFA 5I3GA 1JUEA 1AQ0A 3IVSA 1S1PA 3H53A 4IT1A 4Q4KA 4QG8A 2WHJA 2H3DA 3V1HA 4LX4A 2VVNA 2XUCA 2QF8A 3FNDA 3PNZA 2ZUWA 4C65A 2ZXDA 1JDCA 3QR3A 5F2IA 4GK8A 1UIOA 3WNLA 1DWFM 1YYAA 4ALDA 3HPXA 4TIMA 3U4FA 1KFWA 3BK0A 3G18A 3QZEA 4H6EA 1S2TA 4HU4A 3UERA 1HKMA 3BC9A 3N9KA 1NDVA 1TMLA 4WJEA 4GJIA 1YPIA 3G1FA 4UFMA 5IFPA 4AD0A 1S5VA 1F2JA 3W7LA 2GZXA 2QS8A 3EKLA 3LNPA 4LALA 2RHGA 1THFD 4B9YA 4TO8A 4IG2B 2INEA 1S5TA 4IPNB 3TC7A 4A3RA 3GD6A 1JGMA 4RKAA 3LGDA 1Y65A 3S3GA 1EOKA 2QCDA 4UMBA 3NSNA 2GGGA 4W7VA 1W3TA 4HB7A 5DMLA 5BU9A 4Q7IA 5HPOA 5D4YA 1F4AA 3DFNA 3L0GA 2ZA3A 5DQPA 1CTNA 1OCBA 1W8SA 1HN1A 1ZBVA 3M0MA 3MA8A 5CPQA 2VXNA 3P84A 4KGLA 5E93A 3P74A 3W3OA 3GU9A 3EZ4A 1HUVA 2G3NA 2ZUSA 3EB2A 3OBAA 3I7RA 1Q8JA 4DZHA 4LCQA 1X1NA 1SM9A 1VLIA 4UTIA 3KZSA 1W1A1 4IP7A 4CEXC 4WR3A 1WPCA 2WNQA 1TV2A 4EACA 4IFKB 1K8YA 2PS2A 1BHGA 5HWMA 5HUPA 2A3BA 2FMNA 2DU2A 3WD3A 1GG0A 4UMAA 1PDZA 4DF1A 3WUGA 3S1WA 4CCCA 1XQLA 1LT8A 4AEFA 1Y5VA 4S3DA 3BW2A 4RZ5A 4UNIA 3WDHA 3K8KA 3I10A 3OTRA 3TLLA 1EJUC 1SSDA 4DJFD 3FA4A 4DJFC 4NIRA 1T41A 5DLCA 1EF2A 4NU7A 3VDHA 4O16A 2I5QA 4H9XA 4DHGA 5CZTA 4AY1A 3AISA 3LTSA 3LD5A 1IT8A 3S5ZA 3SDOA 5FSEC 3QRHA 2FVLA 3JUGA 4JQ1A 1A50A 3LBCA 4CQ8A 1NWUA 3HJZA 3R13A 1T8QA 3Q94A 1H1NA 1R87A 2FHBA 2PP1A 4PUNA 4EWJA 3OBEA 5JBEA 2GWNA 3GY1A 5AVHA 3R79A 5ABFA 3TQPA 3LCFA 5DRIA 2D0GA 4N9EA 4RW3A 2E6DA 3OP2A 5BW6A 4HPHA 1JF6A 1DVJA 2RFGA 2LLEA 4F0LA 3KOFA 4V1XA 5A94A 1GHRA 1JZ5A 3APYA 4ICNA 1W5NA 2WMIB 2XGZA 4XVDA 5AC7A 4ATWA 3WEMA 2ANUA 1TQJA 2WZEA 5BRBA 4LJ3A 1GW1A 3LSCA 3WQ8A 1TPEA 4I7WA 2B7OA 2O7QA 2XVGA 3TIMA 5BOFA 2VENA 3PTQA 5HATA 1RCOB 3DGRA 2NXHA 2R6OA 2Y7DA 3QF0A 4HHMA 3UXDA 1W1B1 1RVKA 4UB9A 4F0KA 4HYWA 5LIKX 1PKYA 1XYBA 3SCUA 1FOBA 3RFAA 1F5ZA 1S3TC 2B7PA 2FGLA 3MTWA 4PL2A 4XIMA 1R2RA 2OTDA 3H8AA 2W66A 1Q63A 4QXIA 5G4EA 3L21A 3EWZA 1DV7A 3SSJA 2JGQA 2BVDA 2PD5A 5BXPA 3DG7A 4D71A 3WG6A 1YDYA 2A7NA 4OIFA 3K2GA 1FP9A 3VIKA 4ZQOA 2R8WA 5LGZA 1V3LA 2Q02A 4AZ7A 1E1EA 5EFFA 1T99A 3S47A 1GPWA 5CLWA 4V1YA 5JQ9A 2GJXB 2C91A 4PR4A 1VEPA 3VK5A 3EGJA 4G1NA 1JJKA 1BTMA 5CPOA 4GO8A 3A3HA 3PZUA 2CLEA 2C7FA 4ZOCA 2WANA 1UZ1A 1E1CA 3LMZA 3T81A 4QAIA 3DUGA 3WY1A 1DHKA 3QFEA 3DAQA 3R0KA 1UKPA 5LA2A 4IL0A 3PSVA 1LRQA 1V8EA 3L12A 3XIMA 3TNOA 3H24A 2JKEA 3ZIZA 1EGVA 1VQTA 4JAWA 2WQPA 1P43A 1L9WA 3UJ2A 3QQ1A 5CG7A 1LWJA 1SR0A 3BAWA 3ORWA 9RUBA 3S9ZA 3CPGA 3VTRA 3LYEA 2F2HA 1KCXA 1WZMA 1H3GA 3GQYA 3MV11 1B3VA 1ME9A 3MMUA 2QLYA 1R3SA 3DG6A 3WDJA 3LA4A 3THQA 3GG7A 3S4TA 1Q6QA 4TX8A 4MTVA 4PE8A 4JX5A 2V82A 4ZA0A 2Y2WA 2FH6A 2J6VA 3U2EA 3IV8A 5LIUX 1US3A 3GXTA 1V6WA 4S3FA 4PMUA 2FVKA 3DGBA 2AGKA 1C9WA 2EG8A 1TPWA 5CPMA 1VEOA 5CGTA 3LN3A 1PKMA 2JEQA 2EPHA 4JIIX 2OWCA 3DECA 4HYVA 2J47A 4XAPA 3AUOA 1XRTA 3VC6A 1TTIA 3QVQA 5DFAA 4JKMA 3FSTA 3Q4DA 1BVWA 1YNYA 1EWEA 3N6HA 2Z0IA 4JTFA 5E5CA 4PUUA 2DZVA 2F6XA 2WW5A 4KETA 4PRRA 1CCWB 1EOMA 1EEPA 4P7RA 3BCFA 3C4UA 3CEPA 4WRHA 3IPWA 3W75A 3TSDA 3KRBA 1X6LA 1K8CA 4MB3A 2VR4A 3PNUA 6REQA 1N8IA 2DVUA 3S46A 1J2BA 4HMDA 1T5AA 3BGAA 4PULA 4Z2LA 1XICA 3LHVA 1YQ2A 3N25A 4PBFA 1FH7A 4CN6A 1UA7A 3MUZ1 1KB3A 5A2CA 4QG6A 4X2PA 4IMCA 4OU1A 4CD6A 3B9DA 1KM0A 4OVXA 2CLLA 2PDLA 4KEUA 3IIPA 4M0XA 2H8XA 1D7KA 3N4AA 5JH2A 2OWWA 2RGLA 3RM9A 1CYGA 2TYSA 1XIBA 2KZHA 2EF9A 4W8BA 2VRKA 3WH9A 1FTXA 4AZCB 1B3ZA 4BI6A 4PTNA 4A4AA 3GW3A 4L9ZA 4GO9A 1V79A 1CIUA 3PM6A 1VC4A 1OYAA 3MSYA 7PTDA 3GG8A 4KEZA 2GPTA 3ZQ9A 1U22A 1UC5A 1XIJA 2V5JA 2F61A 5I03A 3W87A 5IBXC 2ZTJA 4AXKA 1WNOA 2YBUA 2TRSA 4C6LA 3A4XA 1LOQA 4U4MA 3LQLA 1UD6A 3LRLA 4PTMA 2AOSA 4J3ZA 1OEPA 1S3HA 2J24A 3GHTA 3WK3A 3TROA 4B90A 2DSZA 4V27A 1EJTC 1P1MA 1IGWA 4K38A 4S3CA 3VFCA 4TQTA 4XAFA 2A3CA 3HBLA 2XZ7A 1EH9A 3O6CA 4IIFA 4IPIA 3TR2A 3BLIA 4HP5A 5K2ZA 4UC5A 3VDGA 2IXUA 5AYYA 1YDNA 2W6RA 4XVEA 1HVQA 5A6BA 1PE1A 1BEUA 1OM0A 3BLDA 1H7PA 2I16A 3PWIA 1OFEA 1OC5A 3RIKA 3R58A 1FHLA 1XYZA 1E3XA 3ZZ1A 3W71A 4F79A 1WB0A 4IMEA 3UZJA 4BQ4A 3UG4A 3Q65A 3BMWA 5K3VA 5HNRA 2VEFA 2NVDA 2C8NA 1BF6A 4QHRA 1EQCA 1Z41A 1B2YA 3W72A 2Y70A 1ICQA 3T8LA 4AEOA 3ARXA 3QYSA 1JCNA 2DT2A 5K4ZA 1IEIA 5AC5A 3FA5A 1UBSA 3TTEA 1P48A 1DORA 4L4LA 2BX7A 5DEZA 3MKVA 1XBZA 1DXEA 4GI9A 1DHPA 4O18A 3I4EA 1OCNA 3TNBA 3GDTA 3SQLA 2VJXA 2YXOA 4DUXA 3C0SA 4TX6A 3XINA 2RJGA 3GXDA 3ARSA 1XP3A 4AUBA 2HE8A 5AC4A 3MP3A 4NZ3A 1NJJA 3UXIA 1H7WA 3E12A 4DUWA 2NSXA 4GGHA 2BWGA 3GHRA 2YL9A 3DCPA 4C1NA 3MUAA 1YE6A 1K03A 2FJUB 2YB1A 3RPTA 2E8YA 5G4WA 1HL2A 3GNXA 3A9BA 1YRRA 3AAMA 3SBFA 1UPPA 3HQPA 3RGTA 2J8TA 4WUIA 3L4ZA 4US5A 2V3EA 3QOKA 4U10A 1DOSA 2YIHA 5DY3A 4G56A 4NXSA 1D3CA 3TEVA 3K4DA 5I6SA 1M5WA 3BW4A 3VUSA 1U30A 4ACZA 4AAJA 1UD2A 3ZT5A 2HJPA 1LLZA 4KWSA 1FVPA 4PTDA 3WSUA 1ENUA 3GXIA 1WO2A 3GC5A 2QCNA 4DF2A 1QUMA 4GH3A 4ERAA 1UQYA 2IKJA 1X7IA 3T08A 3W22A 1LYXA 2DUZA 3UY7A 3FYPA 1NFPA 1K70A 5I3IA 1O5QA 1BAGA 2NQJA 4GQBA 1C93A 2WMHA 4N7QA 2XG9A 3ARWA 2IKGA 1G6CA 5FD0A 2WWCA 4MNLA 2WKJA 4PUDA 4JD4A 1SO4A 3QV8A 1EA0A 2HPIA 3SCOA 4PTWA 1TPUA 1XGEA 2P76A 4HVXA 1QPQA 4POCA 3B4UA 3PG9A 3N1AA 4EF9A 3GC2A 1BLIA 1OADA 4H19A 4E2DA 1F76A 1Z9AA 3EXTA 3IRDA 4JTDA 3K5XA 3L4VA 4JTCA 1VIWA 2E9MA 2WCGA 2E1DA 2YYTA 2VFIA 1JAKA 3JZUA 4QQ3A 3SCWA 1GTHA 3GIYA 2IW0A 3UG8A 3F4CA 3L2LA 3E0FA 5B7ZA 1P1XA 1B9ZA 5GPRA 4U2YA 1KM1A 3HV8A 1CECA 2FB2A 4HNCA 1DTNA 1MNZA 1MFVA 2VZOA 3AI0A 2QAFA 1K6WA 1CPUA 4B4FA 2TPSA 3K1DA 2B0MA 3IEBA 1V03A 4UTJA 4R85A 2D73A 1ZCCA 1PKLA 2X05A 3KEHA 1VFFA 4NZCA 3TH6A 1UKTA 1DIEA 1F8IA 4LSBA 4RE0A 1HP5A 5D38A 1SFJA 3CQIA 4DBUA 1W37A 1IIHA 2ZA1A 1YTEA 2V5CA 3M0XA 4NRSA 5A8OA 3N12A 4WVXA 5A6AA 1EKOA 2Y8KA 4PGLA 2W61A 1DWHM 4NAFB 2DFAA 3IVTA 2Z29A 2Y7EA 2NQ5A 1XPGA 3S8HA 4IL2A 4J2PA 2WKLA 3BV7A 3WD1A 4EANA 3F2BA 2HROA 2WVVB 1I4NA 5AYIA 4LPCA 4WXYA 4FNSA 2Y89A 3IJ6A 1MVYA 2CZEA 3PBUA 5D32A 5F4XA 4WHBA 4WXZA 4OBSA 4UTWA 3W82A 2J25A 1XBVA 1TJPA 3U6WA 4TTUA 1RK6A 5KZ6A 4O53A 1J5SA 1WYIA 3E2VA 3S1UA 1E6RA 1XF0A 2JALA 4J4KA 1U1HA 4IXXA 2W63A 2FPTA 1K77A 1LF1A 2VCBA 3AROA 1YMYA 1S1RA 2VRJA 3UFYA 4N2YA 1D3GA 3DI1A 1IZKA 3J7HA 3OLEA 3PFRA 1GVFA 4GQGA 4CN1A 1HKVA 5E9XA 3RCNA 2GLKA 3VX0A 3BW3A 3SN4A 1HJWA 2FGZA 1SJDA 5FL0A 3KOYA 3A9IA 1QNRA 4IPPA 4WY0A 4X61A 4WJXA 4KIEA 2E09A 1KFKA 1X39A 2E40A 1R2SA 2VWTA 2PTDA 3RMEA 4NYUA 2PLCA 1PTAA 2GVLA 3N2OA 3QV6A 4ZO8A 2OQYA 2VFEA 1CXIA 3BV4A 5I3FA 1U1JA 3W76A 4A05A 4RZBA 4HHHA 3W29A 4XBJA 4K6AA 4WY0F 5LXXA 3EAUA 2VGIA 1XSKA 2CKSA 4OE7A 3TQ0A 4ICCX 3KUMA 1YEYA 1PIFA 3CHVA 4HCLA 3GB6A 3OQ8A 1TA3B 5LIXX 3A5VA 4V28A 3NL6A 4P7NA 4YJ5A 4IMGA 4IFRA 2A1YA 2Z00A 3M0YA 1QHOA 2J7CA 3WNKA 3EWDA 3RPMA 1A47A 4QNWA 1EF3A 3W7HA 3WNNA 3WQ4A 2WBGA 2WJZA 2ZZ6A 2YXGA 3W1UA 1H0GA 4OV4A 3ECQA 2G50A 3LM7A 3FGCA 4DWSB 2X0SA 4S2CA 3B3DA 3LGGA 1GORA 1Y5WA 3SGZA 4OFCA 3WLPA 4L80A 1XCXA 3IJIA 1I2PA 4TMCA 4MSSA 3W01A 3HGSA 3WJZA 3LX9A 4GX9A 2HVNA 4LB4A 3DBNA 2XDFA 2ZYFA 4B5NA 1FH8A 3VILA 4FO4A 3EOSA 1ODZA 1G4EA 4CNSA 3NYZA 3S1XA 4TVUA 3PVFA 4F9DA 1P7TB 5J8LA 1GEHA 4L6OA 1WXYA 2J88A 1F07A 2PGRA 4N9CA 2DZBA 4AZ5A 4D6DA 5EMUA 2F9RA 3GUWA 3T0TA 2HCVA 3P8IA 1ITUA 4YTRA 4B5XA 4BF7A 3R8RA 3SRKA 4K1WA 3LOTA 1LDCA 5HANA 5C9XA 2Y8VA 1F6PA 4AZBA 3B0XA 4D6FA 2BB0A 4CD8A 1VIZA 3UG3A 2HDJA 3HURA 4WZHA 3VOFA 2XN2A 4HSNA 3W7PA 4MAVA 3NDYA 1MUCA 3W1XA 3TTYA 4LBUA 2ZRYA 3E2QA 5BXRA 3HIJA 3HFYA 4GYPC 1KCKA 1NH6A 2V63A 1HKJA 4GRSA 3WEOA 4LWWA 3WJSA 1I1XA 1JDAA 3RG6A 4WCJA 1O5XA 1K7XA 4ZOEA 4FF5A 3CUHA 2IPJA 2ISDA 1SW7A 1TPB1 3CMJA 1V0NA 5BCAA 3AZTA 4K2SA 4GQ0A 4ONVA 2JE8A 4MAZA 1WX0A 4JTRA 2XINA 4MYAA 1XRVA 1EIBA 1UH3A 2OKOA 1Y5XA 2PA6A 3A6OA 1ZQ5A 2CLMA 4XIAA 4Y9AA 4KBXA 4IXHA 1FX6A 3KFTA 1UB3A 2YCLA 2UV8G 4KF1A 5MF5A 2DSVA 2WSQA 5I5RA 4IIEA 1QOQA 1Q5MA 1DJWA 5LYRA 3ARRA 5LNVA 4FNQA 2OJPA 1BGGA 4CCDA 3VZZA 1OX4A 2P3ZA 4ZVJA 3D3AA 2J7BA 1QOPA 1MRAA 3WLJA 1Q3NA 5F4SA 5A6KA 5FAJA 1E5NA 4Z2IA 3EX1A 4FXRA 2RH9A 1RQEA 3G0SA 4PMQA 2PDUA 3PZVA 5T9CE 3AU2A 4BKNA 3C2EA 2HVOA 4AXNA 4GH1A 3EPOA 2GJPA 4O54A 4UQAA 4W9TA 2PDFA 3H70A 5JBDA 3GTIA 3AU6A 4MB4A 3LBMA 5GJMA 4A6GA 1CXHA 4BCEA 4NX0A 2C13A 5AZ1A 1ISWA 2GSJA 2VOTA 3GSMA 4DZIA 2QV4A 3TJLA 3OYZA 2WJDA 2WMJA 4NQ1A 1ECQA 2ZADA 3GNOA 4AB4A 3VFLA 3CTLA 3KX6A 4JYDA 2TAAA 2A79A 3N17A 1JYWA 4Y90A 4FAMA 3KS6A 1UD5A 3EDJA 3V18A 3E49A 2NXGA 3FHAA 4K36A 4LBSA 4C91A 6ALDA 2ZCGA 2YKKA 4DJEA 3GUGA 1H63A 2FTPA 4A8LA 3V0UA 1TZ9A 2VD8A 4LW7A 3VI2A 4Q4PA 3IJ8A 5I3HA 3MI3A 3EWXA 2PGEA 4Z2HA 1VFOA 1K1DA 3T40A 4D8ZA 3W1QA 3RNDA 2VNCA 3LENA 2PDXA 4EPEC 2Y7GA 3GXMA 1KXVA 4P8XA 3OOQA 3T2PA 4UTTC 4GQRA 4Z1CA 2AL2A 5FF0A 3M1ZA 3V5FA 3KTCA 3G0UA 4IZGA 3BTNA 4YTUA 2H8ZA 1YHTA 3E0IA 3A4AA 7REQA 1PXGA 4FS9A 4H9ZA 2CKRA 3L7RA 2YCJA 1FCBA 3PPCA 4ZB5A 3RCYA 4PODA 4GY1A 1ONWA 2QCHA 1KO0A 8RUCA 3LCGA 3IUIA 3NCOA 1X7FA 1O60A 3UW6A 3EWUA 2CITA 4IISA 3P82A 3VIGA 2E3ZA 4CVWA 1V6UA 4LY8A 1HG3A 3IVUA 3TK7A 3VYLA 4REQA 5HAOA 1C8VA 3FY1A 3LXCA 1FWHC 1IXPA 4HZ6A 4IPJA 3AWNA 3MWAA 3G6LA 3K46A 1B54A 2C0HA 5F2GA 3I7QA 5C55A 1LUCB 4Q6XA 1TJ2A 1U5HA 3ZVHA 3DXIA 4IHCA 4JIPA 4FOJA 1M3UA 1EUNA 4ROQA 2F84A 2A3EA 3EDDA 4HQVA 3KWSA 4RDZA 4D1IA 1JCTA 4Q8UA 2BXYA 5CJMA 3PWAA 3OIHA 2Y62A 1GKPA 3FV9A 4R7OA 1VB9A 5HXMA 1TJRA 4F48A 2PDYA 4QJ1A 3WYZA 3F03K 4E4FA 1XIEA 2Y1HA 2OSWA 1GQIA 1UR0A 4DZAA 4DLFA 4ZTXA 5FF2A 1SO5A 3AO0A 5EMYA 1PZ3A 2P50A 4HMCA 2Q09A 1MMFA 5DY2A 4IICA 1EBHA 4B16A 2NQHA 3URBA 5CC5A 4LUYA 3W83A 4AIEA 3WMSA 1U2YA 2J75A 3NVDA 4JN7A 1L6FA 3GYCA 1WKYA 1RXOB 1M41A 4UR7A 1ZU8A 4K68A 2X7WA 4F4RA 4I8YA 2YL5A 4TV6A 3PUEA 3KBVA 3PTKA 3SR7A 3WDPP 4ADTA 1PSCA 3CMFA 1Z32X 2YJQA 5CJ5A 3EPNA 2QJHA 1YBQA 1IYXA 3TX9A 3I4KA 4JTUA 3S6DA 4GG9A 2NVAA 3W6LA 1FP8A 1UPMB 2ZUTA 2ONEA 1KKRA 3B05A 4PEEA 3WF0A 4V2XA 4NZ1A 4LRTA 2QV5A 4ZMGA 1UKOA 5I07A 4DBWA 2O9PA 2PZNA 3NYDA 4JY8A 3GR4A 1V3IA 2Z1XA 1E9YB 3ZO9A 2WC4A 2FHCA 3W6YA 3CZJA 5A2AA 1S38A 3TN3A 4EXBA 1HVXA 3O0FA 1RLCL 3KL5A 9XIAA 4NASA 3H22A 3U0HA 1RA0A 3E38A 4TXEA 3VIIA 3LHTA 4LUTA 3RF9A 3GAKA 2FDMA 1S39A 4HMNA 4MZ8A 1ADOA 2CBIA 1U83A 4MUZA 3WNOA 3C86A 1XDJA 2FDSA 4OUEA 4UTMA 1CXLA 1GJUA 2P0IA 2D0FA 3R89A 1JG9A 3QXBA 3IIOA 1AZ2A 4L4PA 3CHEA 4B15A 4AF0A 2ISFA 1S5NA 3QR0A 1G4TA 5I79A 1PB0A 3G3MA 4EVZA 4BI5A 4EF8A 4NJJA 1WE5A 4YTQA 2PB1A 3FAXA 3ANUA 3RM4A 3AIUA 2C0AA 3FN9A 1EC7A 1Z48A 3L9CA 3TU9A 4AD2A 3FKKA 1QI2A 1J12A 2XH2A 3LMYA 2YR1A 3UWEA 3A23A 3WL0A 5EB8A 1OFAA 3MDUA 2P8CA 3U3HA 2EG6A 3WK0A 4D6IA 5AC8A 5E0CA 4R33A 3AHYA 1YADA 5A69A 2OZ3A 2G96A 3LLDA 4GHRA 3W2NA 2VM8A 1A3XA 7XIMA 5KTLA 1EP1A 3A21A 4W8LA 6XIMA 3R7MA 4F40A 1BFNA 3L65A 5AHFA 1H09A 3BAXA 1HX0A 4C6OA 4MZYA 1EXBA 1UP0A 1VCFA 1US0A 3HO8A 1SJCA 1E6PA 1AG1O 1HJVA 3LPGA 3EWWA 2OPJA 1BGAA 1F9CA 1QU4A 3PZIA 3M0ZA 3P0XA 3SY8A 5E70A 2DVTA 3DHUA 3ATYA 3AIBA 4K8GA 2TMDA 4AVNA 5CJNA 3K4WA 1IWPA 3BZGA 1IXQA 1N82A 1K4HA 1PTGA 2ZVIA 1LTDA 1IIGA 2CLIA 4ERGA 1KCLA 4JFUA 5D05A 3ZWTA 3GWQA 3NOYA 2NQLA 4CKQA 3WDRA 4R7JA 3DHFA 4M6UA 2I5IA 5B80A 3MWCA 3TYAA 3WK1A 3I6TA 1TX2A 1PYFA 2OOGA 3NDZA 4I6KA 3O