1TWWA

Dihydropteroate synthetase, with bound substrate analogue ptpp, from bacillus anthracis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
273
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords DHPS, Dihydropteroate synthase
total genus 97
structure length 266
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1twwA00
2YCJA 1AD4A 4MWAB 3H2MA 3H2EA 3TYCA 4S3DA 4MWAC 4HB7A 3H21A 1TWZA 4C1NB 4D9PA 3H2NA 1EYEA 4DJDD 3MCOA 4NILA 3H24A 3H23A 2VEGA 1Q85A 4S3AA 2Y5JA 3TYDA 3TYUA 1F6YA 3K13A 3MCMA 2VP8A 3V5OA 2VEFA 4DAFA 1TX0A 2H9AB 3H22A 1Q7ZA 4O0QA 3H26A 1AJ0A 4MWAE 4DJED 4D8AA 1Q8AA 4MWAD 4S3EA 4DJEA 4C1NA 4DJEC 2Y0FA 4O1FA 3TZNA 3TYBA 3TZFA 4DB7A 5JQ9A 3TYEA 2H9AA 2Y5SA 3H2AA 4DJDC 2YCKX 2E7FA 1AD1A 1AJZA 2YCIX 1Q7MA 3TR9A 3BOFA 4S23A 4CCZA 2DZBA 4DJFC 4S3BA 1TWWA 2YCLA 1AJ2A 4D8ZA 1TWSA 2DZAA 1Q8JA 4S38A 4MWAA 3TYZA 4O1EA 4S3FA 3H2CA 1TX2A 4NIRA 4DJFD 3TYAA 3H2OA 2DQWA 4S3CA 4DJFA 3NOYA 2YCLB 4DAIA 3BOLA 4NHVA 3H2FA 1Q7QA 2OGYA 4S39A 4PZVA 4G9PA 3MCNA 4DJDA 2BMBA 4NL1A
chains in the Genus database with same CATH superfamily
1ML1A 2D3NA 4RZ5A 2E3ZA 1H0IA 4PUEA 6TIMA 3MTWA 1J93A 3EKZA 4QLKA 1X98A 1SR0A 4W8BA 3JRKA 3KBJA 4IMCA 1RSCA 3GDKA 3PULA 1K6WA 3TV8A 2YL8A 1ISXA 4HU0A 3WLIA 1XRFA 3SSZA 3QTGA 3KHJA 1D3HA 2HPIA 4YYCA 1FWEC 3OZYA 2INFA 2BY2A 4F40A 3M1ZA 1UH2A 3BLFA 4D6JA 3L2LA 1W1B1 1UG6A 1FCQA 3WBAA 5AC6A 2WPGA 3TK7A 3CJPA 3NZ1A 2V5KA 1TJ1A 5D8WA 3IJ8A 5K2ZA 3NA8A 2E09A 1XIMA 4Y7EA 4GKTA 3UF9A 4JHOA 3PJXA 2AQVA 2PWUA 3WEZA 5K9CA 4C7FA 3BJSA 3WEOA 3D6NA 1EHNA 3DZ1A 1CZ1A 3FJ6A 4JIRA 1OK4A 2HK0A 3ZVIA 3BW3A 3C8NA 4FB7A 4TV5A 2ZX6A 3AALA 3U3HA 3C0JA 1LT8A 3CL7A 2DQWA 2ON3A 4NF7A 4S3KA 3RR1A 1CXHA 4JNYA 3ARYA 4PCFA 3UW6A 2D0GA 3OQ8A 3TN5A 2FHBA 4H04A 5A6LA 4EPKA 2YZ5A 4X63A 5LNUA 3QV9A 4HTBA 4FLSA 3E12A 1E6RA 4S2CA 2X0HA 1VFTA 3UG3A 3WK3A 1MEIA 3A4WA 3K4AA 3W2KA 3ZR6A 3UCCA 4UC5A 3LPFA 4DXKA 2VNCA 4FF5A 3WO8A 1F3TA 4L4MA 1XGEA 3TC7A 1YXDA 2RDWA 4LX4A 3TONA 2NV9A 1VF8A 5CPNA 5D05A 5D37A 5C7HA 2XN1A 4JX5A 3H26A 4QDPA 3NDOA 5C8BB 3UJFA 3O9NA 4A2SA 2FH8A 4Z1CA 4CQAA 4NZCA 3KWXA 2R1MA 1A0CA 5E09A 2OYKA 4LEQA 4QISA 1QNSA 2PCEA 1NWUA 5REQB 3D47A 4FMVA 3TTYA 3TC3A 4JNZA 5I3HA 5A2AA 1FP8A 2XHYA 1XYFA 3GYEA 2FZBA 1LQ0A 2H8XA 4ZO9A 1JPIA 3EDJA 2OELA 3WL1A 3A12A 3NGFA 3V1HA 1KGUA 5A6KA 3RU8X 3QSTA 1Z69A 1IXOA 1Y8BA 2CKRA 4MJ4A 5C9WA 2IPJA 1WZKA 4DBEA 3ZT6A 4J3ZA 1FBAA 4P5UA 2AL2B 2VX4A 1TE6A 5CPLA 3C0SA 4HYVA 2D73A 2GL5A 3MCNA 2A3HA 3VZYA 1RQEA 3WJSA 4GZJA 3W81A 2BODX 4D6IA 3GH5A 1G01A 4DPQA 4S3DA 1DJNA 3SCUA 1JXJA 1WXYA 3CTTA 1ICPA 1QFEA 1XLKA 3GFZA 1JGMA 5BOOA 1MDRA 4XTDA 1ZNNA 3PP7A 2J8TA 3DN5A 5G1TA 1X6NA 5E0FA 1NP2A 1UWAA 3W85A 1XI3A 1EO7A 5M5DA 1AVAA 3S5ZA 3T8LA 4HYWA 2JF7A 5MKGB 4YIWA 3W74A 3ZZ1A 3HFTA 1M7XA 2QV5A 2YJQA 3GG1A 1G69A 4P7LA 4NQ1A 4C60A 5FA5A 4PTWA 3T42A 2R6OA 2IQDA 4TVUA 3RO6A 2QJJA 4U3CA 2GUYA 4WDTA 1U30A 5I07A 1ADSA 3MHUA 2CWNA 5C9ZA 2WB5A 1EEPA 3W76A 4HU8A 1IIHA 1L8PA 1OQFA 3QPYA 4LF1A 4XKMA 5E0KA 5ENLA 5AFDA 1KRAC 2GJXA 2I57A 4IX2A 1XFCA 2P8CA 2QGHA 4JPGA 3BVJA 1N82A 3QPEA 4M6QA 1T6MA 2V2HA 2CIPA 3HPXA 4GNKB 1T41A 4MIMA 3OZPA 3IANA 4CQ8A 2NUYA 4IIDA 3W00A 4EACA 1OYAA 1GEQA 2VI0A 3TW9A 4F66A 1DE6A 4K8EA 3XISA 1E0XA 1DJQA 4UQCA 1YYAA 3OLDA 4GJIA 4XAFA 3QC0A 1DOSA 2VC6A 4NU7A 4RV3A 3K4WA 2AL2A 1MMFA 5DRCA 4NP7A 3TLQA 2PGRA 3ICJA 2WANA 3LNMA 1H5VA 4UNKA 4LAKA 1RJQA 3VNZA 3J7HA 4OT7A 2NWRA 3FFSA 1F6YA 1TMLA 4AMCA 2EPOA 5EFDA 3GNPA 4O53A 4OHQA 3LB0A 4F0HA 1H49A 4F0RA 3H4XA 2NLYA 1XIBA 4IL0A 4DJEC 3UETA 3OIHA 5C9XA 2HS8A 1U83A 5KZEA 4DJDC 4QJ4B 4A4AA 4WKHA 2GDQA 3B9DA 3VZXA 2IKIA 3K2GA 5CC7A 3QF0A 3N2OA 1E40A 3QY6A 1KM0A 3QV6A 1R6WA 3MUXA 2W91A 3BSGA 1WA3A 3SRKA 1GKRA 1BWVA 2PDGA 1UR0A 1RY8A 5A8MA 2ZX9A 1SMAA 3H2OA 3OLGA 3GRIA 1EPXA 5HAOA 4HN4A 4H6EA 1S1RA 2J47A 4GWEA 3REQB 4KESA 1W37A 4NJKA 3SY1A 3EWUA 2FMOA 1FXPA 3W6MA 1V93A 1KWGA 2BG5A 2QDDA 5T26A 1IZCA 1OFQA 3VTRA 1XLLA 1S46A 3V5CA 2IKJA 3ES7A 2C14A 1JVNA 3S5OA 4WJ8A 3RMJA 3VAVA 1TVPA 4FXSA 3OGVA 2VRJA 3CIWA 3T6CA 4LY8A 4J7RA 2Z2UA 3B9OA 1VJSA 4JTQA 4MNJA 3GXFA 2ONEA 1R5YA 2P3ZA 1XXXA 3K1DA 2GJNA 4PN2A 1R47A 2CBUA 4GMEA 5HK4A 4B16A 4C7GA 3MP4A 3O0KA 2AQOA 3PVFA 4JIQA 5XINA 3H7VA 3B8UA 3HF3A 2OXNA 2AKZA 1PHWA 1JCLA 1KFCA 3ZYZA 5DANA 3QHNA 3BQ6A 5FACA 1UP0A 4LWWA 3LGDA 4PL1A 1P6CA 2TPSA 3W2UA 4J3VA 3R5EA 4G1KA 4MYAA 1C92A 1MRAA 1KGWA 5D2WA 2Y7EA 4RE3A 4MAZA 4KEZA 4DUWA 1MNSA 3I3EA 4DM1A 1QW8A 3LCXA 5CGTA 3REQA 3NURA 1TV2A 4LEFA 3E2SA 2QCLA 1ISZA 4W93A 1XD0A 3USZA 2B7QA 4D6HA 4PMZA 4NIRA 1KD0A 2HROA 3V36A 4AYGA 2E5BA 3A9BA 3LX9A 2PWFA 1O6IA 3WQEA 1RCXB 3GVWA 3HA1A 3VIPA 3W7KA 2QCFA 5BWFA 2OWCA 5E1QA 2GVEA 3OHMB 1SU5A 2FTPA 3VO0A 2E1WA 1VHNA 1FWNA 3W1RA 4NAEA 4PFHA 2QF8A 3S83A 5CSRA 3LCIA 3HQNA 2WYSA 4XD6A 2YFOA 4G5DA 2D0HA 1EUNA 4HK5A 3BV7A 3W4RA 1H4PA 1V6VA 1E6PA 3V5OA 1DXFA 1ZBWA 3PTQA 1TTPA 2ZRWA 3W82A 1F76A 3S2NA 4AYSA 1QPOA 3HV8A 4J3TA 1JCMP 2BVDA 3DDMA 1C93A 2Y1HA 2FZNA 3AHZA 1IR2A 4YCOA 3B8WA 3DGBA 2H8ZA 4J2PA 3IV8A 2GVYA 3R1ZA 2FZMA 3W7MA 2XFYA 3LY0A 4JGDA 1OGGA 4JYFA 4QQUA 2OSYA 4EF9A 5HR6A 2IQTA 1V4YA 1JPDX 1V3IA 3EPNA 2OVLA 2X30A 1GJPA 2ZICA 1ZBCA 3TYAA 2QCGA 4XO6A 3URBA 4IGSA 4D2JA 3M6YA 3C2YA 3V0SA 3O7UA 1OADA 4AXNA 4PSRA 2P1FA 1EZWA 3Q2DA 2WZMA 2GQ3A 5AY7A 4LS2A 3WUEA 2C8NA 3AOFA 3L5LA 1E9YB 3L21A 3LD5A 5EMYA 5JBDA 1GQIA 5GNXA 3OP2A 4PSPA 2NXIA 1VYSX 3FAXA 3HQOA 3RLHA 3M47A 3W88A 4AIUA 1DTUA 5I77A 3DHDA 1TA3B 2HBXA 3R0DA 4MFDA 3IEBA 4MB3A 1Y5XA 4GIEA 4QNWA 3O0FA 2RDUA 1O5QA 3VDGA 3C0QA 8TIMA 2D2OA 1KV8A 3O06A 4B4FA 3WDIA 1UKTA 4F3HA 2Z6JA 2R1KA 3RMEA 3UCQA 2E7FA 2OWXA 3NQEA 3RRAA 1X7FA 4FALA 2R24A 3BTNA 3THCA 2AAMA 1F3EA 3JW7A 4TTUA 2CLEA 3ARZA 3BUVA 4UQAA 3P0XA 4V27A 2NV2A 1UR1A 1VBRA 3CYJA 3IJLA 4LV9A 2CESA 4INFA 1GW9A 1TZZA 4XK2A 3MI3A 4IUGA 3UA3A 3VKKA 3BGGA 4H6RA 4LY4A 1F74A 4Q8MA 3WDRA 1CXFA 5DXYA 4H19A 4H9XA 4X9SA 3QR0A 3UZZA 2I9EA 4XD3A 3NQGA 1S5TA 1OZMA 2HDJA 4X2PA 1QOQA 5D30A 1E6SM 1DV7A 5IM51 4FNTA 5AHNA 3C52A 1S3TC 1FWJC 2WBKA 3MUY1 3E5BA 4HYRA 4A3UA 1A5AA 2A2IA 4Q6XA 4PB4A 4UOJA 3H4WA 3M46A 1Q6CA 3KVKA 2O9RA 3HPFA 1FRBA 2EBNA 1MO0A 1I2NA 4AX6A 2XH4A 5HMSA 4O0QA 3JUGA 4DXVA 4GPNA 3WMSA 5AHMA 1PZ1A 2PF0A 3KBVA 1E4IA 4TQTA 2C0HA 2VYOA 2YDRA 1EC9A 1PSCA 3HJZA 4NZ4A 4PR4A 4A3YA 3EX6A 4WX2A 2FFIA 1G4EA 1F7BA 3AU2A 4P7RA 1P0KA 1Q3NA 3W87A 1DIDA 3HIJA 2E9BA 2WVSA 2ATMA 4MDOA 5F1VA 1HP4A 2GLKA 4IXXA 3VFCA 4QS6A 3TTQA 3EXSA 2ZRUA 5BNKA 3KE0A 3GWQA 4QX4A 4WRHA 4PUKA 1JPMA 2FVLA 5ABHA 5CG7A 2YFNA 1VFUA 3APGA 5DCBA 6ALDA 3LCHA 4NL1A 1E3ZA 4JN7A 3A5VA 2Q3RA 4DY1A 4X61A 2FIQA 4B5SA 4PMXA 3AC0A 1E9IA 3AYRA 1Q6DA 3DX5A 4DZAA 1UD6A 4PCSA 5A8OA 5AHLA 4L9ZA 4H7VA 4QP0A 1M68A 3S6TA 1L0PA 4XX6A 5HNUA 2IS7A 3UBPC 3KOXA 1JYVA 3NL3A 4LNCA 3VDHA 4PRWA 2HXTA 1QI0A 4C1KA 2DUAA 4OBTA 4XZHA 3CV7A 4N4PA 1DXEA 2Y62A 4I8DA 1XLMA 4UR7A 1E51A 4HOWA 2VZUA 1BLIA 1XLCA 3EX4A 1GOXA 1PTGA 3VIKA 3MJYA 1AQMA 1XIDA 4OVXA 4JTUA 2C0AA 4JFSA 3NQFA 1DPMA 1LOQA 4GYFA 3RLGA 7A3HA 1AJZA 1E70M 1PTDA 4JCLA 2E8ZA 1ZBVA 3FHAA 2NXHA 1ADDA 3FGCB 1UB3A 3TQKA 2PTDA 2HVNA 2JFEX 1FX6A 4E2DA 3S42A 5IRPA 3VOJA 3ATYA 1QWKA 5JU6A 3E2RA 3FXGA 3UJ2A 4IQLA 5HUOA 3FOKA 4ZQNA 2WWDA 1JFHA 1NOWA 1FWFC 2GSHA 3T9PA 1Q66A 1SO5A 5CCZA 4G9PA 1QK2A 3E0FA 3LHYA 1XFBA 4UFHA 5FJPA 1FHVA 2HISA 2CXEA 1EL3A 2B7NA 2PLKA 1O5KA 1V0NA 3PZQA 2I16A 3WNMA 4BS0A 1UZHA 2G8ZA 4GQQA 3QH2A 1O4UA 3GO2A 1E4MM 2X1UA 4AZBA 3L5MA 5H8PA 1FP9A 1TV5A 3SI9A 1W9PA 1WKFA 1G67A 2VEFA 4O57A 1VYPX 3N18A 1YKWA 4E3VA 3WLQA 2FHCA 2Y85A 3NO3A 2GVGA 4BQ3A 1ISWA 2Y8KA 1AL8A 2B31A 2W67A 1HP5A 2XUCA 3EMQA 4JTLA 1JCYA 4LUYA 4S3EA 4IJRA 4IGNA 4XAZA 7ODCA 2I5GA 1XX1A 3URQA 4UBPC 4ZOCA 3Q45A 2EG7A 3AS1A 2DPEA 3HU7A 4A21A 4XZWA 3ES8A 3NCOA 1L2QA 2VFEA 1RV8A 2CZ5A 5M17A 3CQIA 2NQ9A 5FIPA 3SUVA 1V02A 4BWLA 4FR1A 3CPGA 2D20A 1YW1A 1QNOA 2PFHA 3OTRA 3NQVA 2HE5A 3BAJA 2E5DA 7REQA 1C7SA 4K8HA 3GXDA 1K9FA 3B9EA 2XVKA 1KR1A 3H2FA 5BROA 1RLCL 1SJBA 3GE7A 3BLKA 3BC9A 1R30A 3HMJG 4M0XA 2OX1A 1T0OA 3VZZA 1OYCA 3R11A 1V3MA 3UNTA 4K1GA 2A0NA 3MZ2A 3W72A 4RZ4A 4H8HA 4B5TA 3THQA 2FVKA 1VFLA 1HIZA 2L5HA 4GKLA 2WHJA 1QOXA 3PZIA 3PWGA 1DJIA 3DBPA 3ME3A 4O10A 3UNDA 4AWUA 2WM0A 4DAFA 1WUFA 4MKVA 3FA4A 1T99A 1TA3A 2VURA 4GABA 1R7AA 1MW2A 3N6JA 1PIIA 4HJFA 2ZUUA 2GPTA 2JKPA 3DIPA 3WN6A 2R1PA 1JZ5A 3K1GA 5DMYA 3PZGA 3EGJA 4D1IA 3CHCA 3UA4A 2O7SA 3V16A 3W02A 3TFCA 2OZ3A 3CLWA 1UROA 4UR8A 2WLYA 2OODA 5I79A 4LUTB 4A8IA 4YLWA 1TPWA 2WXDM 4O13A 1ZJBA 1S5NA 1JULA 4Q8NA 5AC5A 3T0DA 3W70A 3TEVA 3PZVA 3HG4A 4O15A 5AYXA 3GTIA 2YB4A 1F3WA 4MWAB 3STEA 2CZVA 3IAQA 4Y8EA 3V0UA 2V6AA 4F9DA 4GISA 4Z1YA 3K8LA 4GBUA 1NDYA 1E0WA 2C18A 4LJ3A 1J2BA 3C61A 3W1PA 2WCSA 3NAVA 3CV1A 4MY9A 1D8CA 4HZ8A 4DIAA 2XIJA 5HWJA 5DLCA 1J0KA 2NSOA 4QITA 1UZ4A 2WSRA 3MUCA 1MRQA 5D8ZA 1SZGA 2D0FA 4WK9A 4B2DD 3GG8A 4HNCA 2W61A 1KB3A 4GY0A 3KZPA 1DORA 2FYMA 4XZLX 3U7VA 1XCXA 1KFEA 5A6BD 1QXLA 1P48A 3UT0A 3M44A 2RGLA 3BK0A 2DORA 3AQUA 1OX4B 4LRTA 3GSMA 2GUBA 3C2OA 5CGQA 4EXBA 3UQNA 3E74A 3NZGA 2DW7A 3GC4A 2I7GA 2CLHA 3PNUA 1VQTA 4HNUA 3VGBA 1RVGA 1MDLA 1PUDA 1XD1A 2DT0A 5FJUA 3VCNA 4O4VA 5DELA 4NAEB 1XLIA 4WLCA 1NH6A 1HGYA 4GUFA 4E8CA 1X97A 2Y88A 1FH7A 1SGJA 2E67A 3F5LA 1WBJA 1OCBA 3W01A 4PC8A 4AIOA 1HVXA 4M6VA 2F6UA 1P1XA 1EB3A 2E5CA 2WMIA 1OD8A 1UMYA 3S47A 3B0VC 4US6A 3W1XA 1PIGA 4PH6A 4UQEA 6CGTA 3AXKA 3B04A 1V3HA 4ZTXA 2J66A 1CGWA 1GHRA 5AYIA 4HMDA 4JAWA 1DYSA 3DCPA 3WF3A 1N2VA 2BVYA 2QIIA 4BKNA 3EDFA 3M5ZA 1BWLA 3LERA 2OG9A 2RGMA 3PY2A 4AWSA 2UY2A 1JIBA 1GW1A 1Z9AA 3W7LA 1DQXA 2WHMA 4E8DA 5M03A 4Q4RA 2BX7A 3AICA 4HCHA 4FO4A 2WJZA 2WMGA 3LV6A 2TYSA 1S39A 2GDUA 3GC2A 4X0NA 1PDYA 3G2GA 1YBQA 3RPMA 3KLLA 1CB2A 4YTQA 4QHRA 3GZAA 5I3KA 5I3DA 2VENA 4HN8A 4J3UA 2DZUA 1XDMA 3M0MA 1GONA 3DAQA 5FJOA 3QRHA 2YCLB 4LTSA 2OKTA 3GU9A 3V4BA 3BLPX 2Y89A 3TJ4A 2OGJA 3GXNA 3CMFA 1Y5WA 4IPNB 9XIAA 3QY7A 1QT1A 6REQB 3PZNA 1GKQA 2ZIDA 1J5SA 3WQOA 3GUGA 3DYPA 2CITA 5DQPA 2W27A 1GOQA 2WJDA 4HMCA 2V3EA 3IGUA 3L67A 2R91A 2ZXDA 1UD8A 1BF2A 5I24A 2FMNA 1Z41A 3CQKA 2G3NA 2DEPA 1PE1A 1OHLA 4MNKA 3T2OA 3LCGA 1XC4A 2YYUA 4ATLA 1QJWA 3G24A 2F9RA 3QMSA 1OX6A 4GD0A 2XISA 3P0WA 3BH4A 4GINA 5JQ9A 3W24A 3LRMA 2ACUA 4A22A 5JBEA 3I6EA 1IV8A 4O12A 3SGZA 4MVAA 3QKZA 4NXKA 4ZQRA 1JPKA 1VCFA 2X2GA 3ERPA 2A7NA 4HSHA 4GFIA 1NQ6A 4OE7A 2ZUWA 4POCA 4NZ3A 3ZMRA 2P10A 3GNNA 1V6YA 4ZGYA 1M53A 3KZSA 3W6LA 1FTXA 2A5HA 1AH4A 1ZPTA 2WMIB 4GVFA 1T5AA 5TNVA 3W1MA 2PMQA 3WEMA 3MP3A 4A6GA 3LI0A 3VIOA 1GPWA 2QHAA 3QR1A 3HMCA 1D3GA 1H0GA 3VNIA 1REQB 4FX8A 1KM1A 1LG2A 2YCJA 1FUYA 1H41A 2CCRA 3IPWA 3I4EA 3BURA 2XN2A 3GHUA 3ONBA 2W4XA 2GGGA 1ONXA 2GK1A 1B90A 1P0NA 2KAUC 3G1SA 5K9XA 1EJUC 3VNMA 3ABSA 1XDLA 2WVTA 1K70A 3CAQA 2YXGA 3AJ7A 1V51A 3EEGA 5TF0A 1RD6A 4RXGA 5HJXA 3W25A 4ZXLA 2XIIA 1A5NC 3O8AA 5BRQA 3NUKA 1VIZA 4RNHA 1DWJM 3IK2A 3VABA 2H9AB 1VHCA 4XZMX 1PO9A 1SYTA 2BOEX 4MKNA 1SO3A 3FHQA 1GOIA 1XGDA 4MWAD 3S1GA 4HNTA 1WBHA 1ITXA 2WO5A 1CXLA 4L56A 4KCTA 1JR1A 1GOOA 2J7CA 1H5YA 4EAMA 1NU5A 2PDKA 2WMFA 1DWHM 3PBYA 3EX3A 4PMNA 1JI2A 1JI1A 3G0UA 3UXLA 3P5YA 4KEUA 4F2TA 3L66A 1FCVA 1BEUA 1R9YA 1H11A 3NQBA 2DJLA 4XBJA 2VR2A 3CEUA 4DZIA 4AEFA 2ZUSA 5HJLA 2A79A 5T91A 1EOMA 1WDPA 2JBMA 1CGYA 1KLZA 3CTLA 2VEPA 3KVMA 4S3JA 1BG9A 3S1XA 1KXTA 3QBUA 5BWAA 3KM8A 2KZHA 4EWND 1YTDA 3VE9A 2WC7A 4RX0A 5G1YA 4ZL1A 3UYIA 1B5TA 4H9ZA 2I14A 3TXVA 1JDDA 3WF4A 1OG0A 3G1AA 3FSTA 4OQVA 5HDRA 1C8YA 1E0VA 4GK8A 4EKJA 2VX5A 2INEA 1EZ2A 3UZ5A 1HTIA 2OT0A 1E5NA 5HMDA 3DH7A 1VKFA 4XO7A 2BHUA 2A85A 4IIBA 4D8LA 3CASA 3VI2A 3N4AA 3ALGA 3BMVA 1LQ2A 3UJRA 3QFEA 3OW1A 4US5D 3TOYA 3ITGA 4JTDA 1TVNA 1C29A 3TTOA 3W37A 2FGZA 3BL3A 1NFPA 5C6MA 3QOMA 2I56A 3HURA 3A4AA 4MGGA 2PEVA 1OVDA 2XSXA 2VZVA 2OQHA 2C3ZA 3DFPA 1ZJAA 2VTFA 3WQ5A 4UXDA 1OM0A 3WLJA 3W1NA 1K7EA 3VD7A 4QCFA 3SN0A 1R3TA 2GQAA 1UWSA 3GDTA 4FHAA 2ESCA 3AHXA 3AS3A 4DJFA 3SUUA 4YHEA 2NQZA 3FLUA 3FJLA 3MHFA 1TWDA 4JQ2A 1KQYA 3OVRA 3EWYA 5KMYA 4UCGA 3DI1A 2ISDA 4UFJA 4R33A 3PTMA 3P3BA 2WPBA 1UC4A 3AHYA 4CD8A 1GG1A 3S3GA 1CIUA 4DUXA 5ABEA 3A24A 1A4LA 1X8CA 4IF2A 5HJYA 1S1PA 1ZALA 3MCOA 4IICA 4BI5A 4LVFA 5BW6A 4E4PA 3FNDA 1KFWA 4C1LA 2VC9A 2QF7A 1ELSA 2ZUVA 3QGAC 2V0TA 3HB9A 3M16A 2DFAA 2PSNA 4KRUA 4K6AA 3PJUA 3MPGA 3VDAA 3VCRA 2VFDA 3HBLA 3UY8A 1N7KA 5CGMA 3R25A 1BHGA 1A49A 1O7AA 4AY8A 1XSJA 1EX5A 4GQGA 1THFD 4TU1A 2VX6A 3TU9A 3HGRA 2INZA 1XBZA 4UR9A 3B05A 1TQJA 4EPBC 1Y5VA 3P74A 1LLZA 3T78A 4E2VA 1YIXA 1H62A 1FQ0A 3E96A 4X60A 3AHVA 2OWWA 1SW7A 4M3PA 4S39A 1A5SA 2J9XA 3N6HA 3N04A 1C3FA 1C8VA 3LMZA 1CDGA 2J75A 1TJRA 4L9YA 3L4VA 3MDWA 4I5RA 2V5BA 1YXYA 4ZQMA 3PANA 1PZ2A 3HZ3A 3PTDA 4AZCB 4HKPA 1I1WA 5CSSA 1JZ7A 2P8BA 5DEZA 2GOUA 3EXTA 1OEPA 1GEHA 1S2TA 4H1ZA 5FAGA 2Q71A 1RA0A 4FNSA 4A2RA 4BQ5A 1ZCCA 5LIWX 1X1NA 4GI9A 4J3SA 3DFOA 1LM1A 4I9TA 1W8SA 5BU9A 3AMGA 4W8LA 3G3MA 3ZFHA 1ZTVA 1KM2A 3EWDA 4N6EA 4R85A 3MP5A 4JYDA 2VWTA 4V2XA 2HTMA 3IVUA 7REQB 4DM2A 2XSBA 5IFPA 3WK2A 5JH1A 1JYXA 4XKYB 3B06A 4DZ5A 4IFKA 4JFVA 4O8RA 4CNOA 1VCVA 1MUWA 1LQAA 1NARA 2GYIA 1SPQA 2J77A 3GX9A 2PB1A 1VGAA 1UIOA 1A5OC 5FD0A 4CKQA 3BMXA 3C2VA 1RBAA 4HA4A 1V02E 3WQ4A 4KWSA 1UR3M 1E1CA 4HA3A 2V5CA 3UWUA 4LVGA 3M41A 1UQZA 1DP0A 2BVTA 3GC5A 1KBKA 1N55A 3V5FA 3ZQ9A 1P0EA 1GQJA 1K8CA 3BAKA 1EFZA 4FIQA 3WD2A 2PBGA 1O5XA 3H2MA 3ARWA 3QYQA 4YWIA 2WM1A 3R8GA 2AKMA 3IWPA 1XWYA 3ZR4A 3WQCA 3F5KA 4KWVA 1KW1A 1LL6A 2VT0A 1XUUA 3FA3A 3FIGA 4C6DA 4KGLA 3ARXA 1QBAA 4N7QA 4UQBA 3B03A 3WF0A 1M6JA 3FYYA 1TUFA 2C6QA 2QVNA 4LSBA 3CZJA 3W1UA 3AROA 5KTLA 3GH4A 1X8FA 3QKEA 2F6KA 3EPOA 1V7YA 3NDYA 4RKAA 1EP1A 3L0GA 1QHZA 1X6UA 1H7WA 5FOOA 2CFFA 4Q8OA 3PFMA 3BGAA 2ZZ1A 3U2ZA 5CZTA 3L7RA 2PC8A 3RPDA 2PP3A 2WNZA 2D69A 1X39A 4GH3A 3FXYA 3QJAA 3LA4A 1UYQA 5F1UA 4LB4A 4O1BA 4IGMA 4PTNA 4KW2A 1CGXA 2EXOA 2PLCA 4GIYA 1J0HA 2FZDA 2BVWA 3PWAA 2I1OA 1E6XM 2QCDB 1UUQA 3USBA 3NSNA 2VELA 5IDZA 1BYCA 3IUHA 3N73A 4ZQPA 1VEPA 4QJ5B 1QR7A 1M3UA 1DIOA 1EPVA 1RCQA 3EWCA 3KFTA 4LVBA 4HPHA 5CXPA 1UD2A 2BY0A 2BS9A 2FLIA 3O1NA 1NDZA 1JNDA 2GQ8A 1EBGA 3GAKA 2PDJA 4JQAA 2EO7A 3OEXA 1SZFA 1UUOA 4N9DA 3QHMA 4NSBA 5TQLA 3NEVA 4N9BA 3WUFA 1GORA 1VD6A 4YTRA 1VRXA 2VEGA 3GXTA 3V75A 3O6YX 3SCSA 2OLSA 3GXPA 1GVQA 1W1YA 1OFEA 1FHUA 5BXSA 1PKMA 2B7PA 1S2AA 4L7ZA 3STFA 3S1UA 4F0LA 3MUZ1 1XYCA 4IQJA 4U10A 4OZOA 2ASHA 3ZJ8A 1E43A 3AIUA 3FJNA 3L4XA 1D7KA 1Z7AA 3I6TA 2C7FA 1UR9A 3VPLA 1K3UA 1E1EA 1MQRA 3QZAA 1V8EA 4D8ZA 1YHTA 1RD5A 2WKGA 2RAGA 4UNLA 3WNLA 1RBOB 1S38A 1XC6A 1GYMA 1GOMA 4C6LA 2WNNA 1J0YA 4C6KA 1EGZA 4F8XA 4P2VA 3CZKA 5GJMA 4HA1A 4ZR8A 1GZGA 2CBVA 1EJXC 4XZBA 4IGHA 1XYMA 1TPVA 4NRSA 3QC3A 2POTA 1E1CB 3ITVA 2OJPA 5T9BG 1IXNA 3W28A 1OIFA 4H7ZA 2GGHA 3HG3A 1KGXA 4MFEA 2C16A 1HL2A 1NDVA 3EA2A 3EEZA 1ZP3A 4ACZA 1TJ0A 4EOUA 3LSBA 2HRWA 1DQWA 1LG1A 1E9ZB 1LTDA 2VM8A 4O1CA 3UR5A 3SSJA 4XSLA 1I0BA 1F6KA 4Q7NA 1B4KA 5EMKA 3R2GA 5EMUA 5C2GA 3ABZA 1AUSL 1XLEA 3B4YA 2FPVA 3W7IA 1UWIA 1EBHA 4X2RA 2PAJA 1KCZA 2RFGA 3GVGA 2XFFA 5ABTA 3F2BA 1I45A 3FAWA 3T2QA 1VPXA 3EWWA 3IAPA 4ACYA 1U5JA 4W9TA 1XSKA 1WYIA 3TXZA 1R3QA 1Z42A 1FWGC 3TWBA 2D3LA 3AU6A 4RW3A 1PKLA 3P61A 4AUBA 4XG1A 3PTKA 4HK7A 4CN6A 5FEPA 1H09A 4YNGA 3TSDA 3K8MA 3LPGA 4ZODA 3PAOA 4CQDA 5I6SA 3AIRA 4MMWA 4E3TA 2YZRA 1V79A 1PX3A 4RV8A 3OZOA 1WB0A 2V5JA 2XIMA 3WJYA 2CHNA 4Z2JA 2G4FA 3AZRA 1AD4A 3GIYA 3R43A 4IIEA 4R34A 3C4UA 4LYKA 1OFBA 3W7NA 2C91A 3C8FA 3KS6A 4JZ5A 3SCOA 3EOSA 4GI8A 1RXOB 3SGGA 4QNEA 3CUIA 1I8JA 4DUOA 2R9RA 1KTBA 3AIQA 4KWWA 2AGTA 3U8GA 3SCRA 5A3HA 4FNUA 4C90A 1MQPA 4K38A 4M80A 1Q6FA 4OV4A 3CO8A 4QIUA 1GQNA 4PMRA 4XTIA 3CHDA 1YADA 1OFPA 3TCSA 3GR7A 4I9MA 4MWAE 2Z26A 3QM3A 2XWEA 3H4GA 1CW2A 3NO1A 3WQVA 4YWSA 3WD1A 4F2UA 2OO0A 3NQCA 2J8GA 4PB3A 2E6FA 3O05A 4R9XA 3P81A 5FL0A 1K03A 2OOFA 1WUEA 1R3YA 1SO4A 4QGCA 2PF8A 4NVTA 4NJJA 1PX4A 3G1XA 4EPDC 2HPMA 4Q22A 3U57A 4GHRA 4EPEC 4QCEA 3GTNA 4EXAA 2DZWA 4M7TA 3RNDA 3F03K 4UQ9A 1M01A 4CU8A 4H2CA 1XIHA 5CJNA 4EVZA 3W75A 1W3JA 3DYMA 2QJMA 3MSGA 4N6FA 3IVSA 4I9AA 1ZBKA 2ZZ7A 1WDDA 2CLKA 3DFQA 1BKHA 1UMLA 1JZ8A 4RDYA 4XZNX 3M7SA 1MXSA 2ABAA 4PBFA 3MMDA 4ZA0A 5FJTA 3GNOA 2ZX8A 4C6NA 4QAWA 6XIMA 3SEPA 2V3FA 3UXKA 4WJXA 4JCMA 1REQA 1ZFJA 2J88A 3CK5A 1I1XA 5T9CE 5I02A 2Y8VA 2JIEA 3PK7A 4FI4A 4JTIA 4AD4A 1A5LC 1E0UA 5HULA 2DIKA 1W1VA 4GQBA 1W9UA 2YCKX 2ISVA 3F4CA 4L4OA 4GO8A 3O3RA 4WGHA 1E4NA 5F2LA 4RLIA 1TKKA 2B0MA 1AODA 4L80A 1ESWA 2YCEA 2VCCA 4HPJA 1T96A 3R0UA 4HNVA 1AW1A 2D24A 4QG9A 3W2JA 2DSZA 3IJ9A 3VNDA 1R46A 4IT1A 2IMRA 3CAKA 3M5VA 3RF9A 2QXWA 2VEKA 3MSDA 1W5PA 4C6JA 5HNNA 1UPMB 4LW7A 3TNOA 5DO8A 4ZOEA 1SFSA 3NQ8A 3IJ7A 3UWWA 1IEVA 1BYDA 4PMJA 5C9RA 1EP2A 4U2YA 3CV6A 5AHIA 5AHFA 5U7SA 3UJEA 5HWMA 2EG6A 3DENA 3W27A 4YPJA 3SCQA 2IPGA 3SY8A 2VUYA 2YB1A 2UBPC 3HQPA 4O8AA 4KGJA 1XS2A 1DJWA 3W1QA 1G7UA 3BLLA 4FP1A 3IK4A 5D2TA 3WBEA 4A8LA 1K7FA 1C8QA 4WIWA 4EAYA 4OOZA 3PM6A 3IGHX 4CNNA 1HKWA 3VFLA 4JQ1A 3WQDA 1O1ZA 1PIFA 4KPLA 4RJEA 2Y6ZA 1GYNA 1I60A 4TO8A 4ACZB 1AMYA 4NZ5A 3ZVHA 3VOHA 4NXSA 4XBKA 3G8EA 4IFRA 3I3BA 5K3VA 2Q8LA 4KETA 5C2XA 2OB3A 1PV8A 3VGHA 2XH2A 5EGRA 1M65A 2VL4A 4O1EA 2RKXA 4M6UA 1Q5MA 1EGVA 5I2UA 3WQPA 3GR4A 1L6YA 1QI5A 4JFTA 1IT0A 3NR0A 4NHVA 3PF3A 5CSUA 3CAVA 2UY5A 5D02A 2W63A 1LF1A 5CBJA 2XG9A 3AWNA 1F05A 3RJXA 3KBNA 2PTWA 2PP1A 1FWHC 5A6BA 2PWHA 4H6QA 3I4KA 1ZCOA 1KM3A 2DH2A 3B4UA 1DWFM 3HQ1A 2O7QA 3V35A 2BXYA 3W23A 3MUAA 5EKYA 2WOQA 3G1HA 4ZENA 1FWBC 4PBGA 1C90A 4DO6A 2BASA 2WZIA 2ZA1A 1F07A 3KRZA 3KW3A 2VZOA 2WBGA 3GDMA 5BXRA 1Y7VA 3A13A 4Q4QA 1W56A 5K4XA 3LU2A 4Z2LA 1HJXA 5CPTA 3VU2A 1F9CA 4GE8A 3BZJA 3TR9A 3RM4A 4ADUA 3B8IA 1AL7A 3C2RA 1PKNA 7CGTA 1EYWA 3NEHA 3S1VA 1NAL1 3ARPA 1CI1A 4GC4A 4HMEA 5T8GA 4JTAA 4A05A 4RXFA 3M0XA 3LG3A 4CVWA 3L9CA 3BJTA 2WW5A 4R3UA 1BSIA 3MDUA 1YDVA 3GAYA 3WNKA 4E4FA 2WC3A 1R2SA 1HL8A 4TMBA 4C6PA 2WJFA 4QQ3A 1TYGA 4ZOBA 1R87A 3NPWA 4IOTA 2X1RA 5LA2A 3CUXA 5CSYA 4ZSTA 5HQEA 4UQDA 5C54A 4NI8A 4UTWC 1YX1A 2X16A 3EOLA 5CJMA 3BCDA 2HVOA 2W66A 3CB3A 3FYPA 4PUNA 4QTGA 1XRTA 2ZRVA 3T7VA 3W0KA 1UR4A 4WJEA 5CLTA 4P7OA 2POZA 5EY5A 3OBEA 1JCXA 1HJSA 3NSMA 4MKSA 3W83A 1HNYA 4ERIA 2QAPA 5JIWA 3FY1A 2PTYA 4Q8QA 4CNUA 2XYLA 4MAVA 4O18A 1HT6A 1MXGA 4N9EA 1Z48A 5D9MA 3EOEA 4KCVA 2NT1A 3SO7A 4Q4SA 8RUCA 5GPRA 1F8IA 1ECQA 3P93A 3CHEA 3F5JA 3WD0A 2DSUA 2OEKA 1DIEA 3KOFA 3G0SA 4HCLA 4AC7C 3AWOA 2AOSA 4TTGA 1QTWA 4DXXA 3S2JA 3SR7A 4DWSA 1VIWA 3TTEA 4AY7A 5EMLA 2J8FA 1SVDA 2VGIA 2QDGA 5A8NA 5E6ZA 3T4CA 4FOKA 1TE1A 3H6OA 2RDXA 3LZ3A 1ITQA 1TX2A 4I9JA 1RPXA 4HIBA 1Z32X 2DVUA 1TMHA 3BLDA 2DZVA 2VOTA 1I2OA 2YGYA 3MB9A 2H6RA 4HMNA 1VBUA 1UA7A 4NYYA 4FZIA 4PMYA 4DRSA 3O16A 2WK2A 2YDQA 3CEPA 1Z3NA 5KZ6A 1OCNA 4RE2A 1FDJA 4HNNA 3II1A 4AZ5A 1DJZA 3S5SA 1RZMA 4I5XA 4E38A 1H51A 2GQ9A 2J6VA 3UVAA 1JZ6A 1HW6A 4H9YA 1VFMA 1XDJA 4IP4A 4HT3A 4AX7A 1UC5A 6TAAA 3PPHA 1I2QA 3JR2A 4B5WA 4LAOA 4X22A 1J6PA 1DHKA 1RJPA 4CU6A 2A3CA 3PBMA 1CXKA 2Z00A 4CNTA 4DPPA 4IJCA 1X7IA 2FZ8A 4A29A 4IMGA 1KLYA 1CNVA 2D2GA 4L6HA 4OOUA 4Q4OA 3E2QA 3R6IA 1JZ4A 2DT1A 1JCTA 4LOCA 1UBSA 1ECEA 3TZFA 3VD4A 3FKRA 4AD1A 1TRDA 2OSXA 5BXPA 1VH7A 1EIXA 1NM9A 3TMQA 3VMNA 4JD4A 5DY3A 5FJIA 3DHPA 5IHSA 3SZ8A 3R7MA 3HGOA 4GJJA 5GNYA 4E2OA 1PPIA 3QEZA 4QLJA 3UZXA 2Z1KA 4BCEA 3E5PA 1P7TA 4NY2A 4OU1A 2ZZ5A 4AG0A 5H8UA 4Q33A 1WQ5A 5EB8A 1FH8A 3VILA 4RL3A 3KOYA 1TPDA 3GHSA 3G1DA 3FV9A 1AZ2A 3FCPA 4HHLA 4LCRA 1HO4A 2CLOA 3PSVA 2ICSA 4PE8A 5AN7A 3M0IA 4YMZA 4N9CA 4DYEA 4GOAA 4MZYA 3NQMA 3SGUA 4HSNA 3G5EA 1H1NA 2P0IA 3PPGA 1FWDC 5E6YA 4NZ1A 2PU0A 3RX3A 3TP4A 2A4AA 2ZX7A 5EU9A 5HNRA 2FFCA 5IOBA 1GT8A 7TAAA 3WLLA 5AC4A 1H61A 3FSUA 2A6NA 2X1SA 4S2BA 4BF5A 3LGGA 3VA8A 3IGXA 1JZ2A 1JFXA 2CU0A 3VOFA 3WENA 2YR1A 2PI6A 1YE4A 1K9TA 3K13A 4WUIA 2FHFA 3DECA 1NOFA 2E6AA 3H22A 5CG0A 5KZMA 3PN8A 4ERAA 4IXHA 1XKJA 3VK5A 3PUGA 1YXCA 2WLZA 5A2CA 3T09A 1GTHA 3T40A 2A7RA 2H9AA 5FESA 4OFCA 3IACA 3VX1A 3I3DA 1WX0A 3D3AA 4WY0A 4UOQA 1YPFA 4PL2A 1JL8A 4XB3A 4H9UA 4D1JA 3LCFA 1WP6A 1UWQA 4RE4A 1JDFA 2QUMA 4P7NA 2ZXAA 1W3TA 4IMDA 4MSSA 4DBWA 2Q3OA 2ZWZA 5GVJA 1EWEA 2ZDRA 2J79A 2OGYA 3BQ5A 2DUZA 4G7EA 1IR1A 1YDOA 1VEMA 1XQLA 1ZUAX 2QVHA 5IDIA 4M1BA 3GFXA 4MOZA 5FF7A 3AFBA 3OGSA 2G3FA 4G1NA 2RHGA 1KFBA 4IUOA 3GVRA 3OA5A 1WDSA 3G1VA 3TOPA 4DBUA 3UWEA 3VIMA 4DNMA 3WMCA 5JH2A 1FWWA 1H63A 4Z42C 5C9UA 2YL5A 3K8KA 1RQBA 1L8NA 1G4PA 1E6QM 1KC7A 1F5ZA 1ZSXA 3W7CA 4K39A 1OIMA 3H23A 3LS9A 5C55A 1I2PA 1LRNA 1OINA 4ZE4A 3SCPA 2VR4A 5BRBA 5FAJA 3WH6A 2PWGA 3L12A 1HJVA 4QSFA 3WF1A 2OMAA 3T4WA 3R4IA 4J3XA 1M9HA 1TZ7A 3MANA 3QVQA 5LHFA 3THDA 2F7FA 4UFLA 3TVAA 2CBJA 2XH7A 1RCOB 5D2XA 4ZQCA 2E9LA 5JMUA 1KTNA 3U6WA 4B9YA 1AW2A 3ITXA 3R79A 3RX2A 1NIUA 3MKVA 2WQDA 4CN4A 3ONCA 4UTWA 1R7OA 1E6ZA 1JYNA 1ME9A 3ZVHB 5A8PA 4O19A 1M03A 1PKYA 3OLEA 3DGRA 2FKPA 5FSEC 4F4RA 2ISSA 2RJHA 3CQJA 3DHUA 3NOYA 3QGVA 4UTIA 2AGKA 3WJWA 1J79A 1Q7QA 3GW0A 2CERA 2DW6A 4C5ZA 3QQWA 4LU0A 4Q7BA 3R8HA 1ITCA 2ZKMX 3SRHA 1I2RA 2WJEA 1ZQ5A 1C9DA 3MY9A 4Q4KA 3RAOA 3GH7A 1OK6A 4WEVX 1XLHA 3ISIX 1O94A 2GWNA 3HN3A 2YX0A 1KKOA 4WXYA 2ZC8A 4ZMGA 3UP8A 3AI0A 4PODA 3CPRA 2WHLA 1WPCA 1NWSA 4IHCA 4GYJA 5CBBA 4JIIX 1FOBA 2PE4A 4YCPA 4ICMA 1IGWA 1HO1A 3OOQA 1Q8AA 9XIMA 3S2CA 1BSLA 1DWAM 1UJQA 3T55A 4Y96A 3V18A 5LA1A 1SMDA 5F7UA 4XQ6A 3W38A 2JKAA 2VGGA 2WVUA 1G7VA 4EIVA 4A35A 3PR2A 1XLGA 3HFYA 3AMLA 5L6UA 4WDUA 2DZAA 5EMMA 2YYTA 1B9BA 3WSUA 3FW6A 4JOMA 2BSLA 4LYRA 3O6DA 1KA9F 3P2VA 2BBFA 1JRCA 5D9PA 2QJGA 3OB8A 1KCLA 1EJWC 3CZ8A 3AS0A 2Z1SA 2VQUA 1P6WA 3CUJA 4ECLA 1EC8A 2RDTA 1TIWA 1EQCA 4WGXA 4I6KA 4V28A 3EKLA 4GZIA 4XZ9A 4FLRA 5J8LA 3H2EA 1S2UA 4J3WA 2PRLA 5ABFA 1WE5A 1UW9A 1E9LA 4AXKA 4MLJA 3P6LA 3DFSA 1A80A 1WV2A 4IMAA 4LYQA 4K8GA 4HOXA 5CZKA 4ASTA 3MKCA 4DJDD 2TSYA 1GCYA 1NSJA 2J9YA 1M1BA 2DU2A 4MADA 1GVRA 3VKAA 3PZOA 2E1DA 2HWGA 4IX0A 3I7SA 1HZYA 1XLBA 3RPTA 4Z08A 1JZ3A 4TVDA 1W9XA 1G4SA 5C2CA 4LALA 4FX6M 4HBKA 1JDCA 6A3HA 4BI7A 3UWYA 3KCLA 1W5OA 3KCOA 1I0DA 2XIBA 2O9PA 3BCFA 4DO4A 2HEJA 2HNHA 2PDYA 3H2AA 3HPSA 5KINA 2YBTA 1EC7A 3RGTA 3B9NA 1QMLA 1MW3A 2NQLA 5CZJA 3FEQA 1GZJA 1KWKA 1LWIA 4H6KA 2FTYA 2YA1A 2V2CA 2QCEA 1NEYA 2VFGA 4DVOA 4DLMA 4H7CA 3OVPA 3WYZA 2NZLA 1OF6A 5IHRA 4S3GA 3GS6A 3Q37A 2YW3A 1VPYA 2NUWA 3Q67A 4JKLA 3HGSA 1EJVC 3QTPA 4FF7A 5M3WA 1WZLA 3B0UX 1O5RA 4OKDA 4GRSA 4LB3A 1CENA 1EJTC 3SUTA 1A5UA 2PRHA 1E71M 3AJXA 1S2CA 2QT3A 3O6CA 3UPMA 4LAUA 4Y2WA 3WDPP 3HPAA 5I00A 1AMKA 2BGNE 4BI6A 4B5VA 3EX1A 1MEWA 3LGEA 3PB0A 1A3HA 1D3CA 1IT8A 5XIMA 2XPKA 1HKJA 1TWZA 5EBUA 3JZUA 5D09A 3ZO9A 1VLWA 1CB7B 4NAFB 2NXGA 4NASA 5G2HA 2VP8A 3HTWA 1YDYA 4AZ7A 3CUZA 1QHOA 3LV5A 1GG0A 4P8VA 1RP9A 2X40A 2SFPA 1K4GA 4RDVA 1LBFA 1H7XA 1I75A 2J74A 1K9EA 1TCMA 3FKKA 1TUXA 5H2ZA 3G1YA 3RX4A 4LBRA 4FS9A 3VE7A 1W3KA 3FS2A 1PZ3A 2P88A 3AZTA 1TWWA 1B30A 4C65A 1HN1A 5CBIA 1PCWA 3BANA 1OFAA 4PMVA 1X1OA 3EYPA 1GPFA 2WKLA 3N2TA 4XSMA 3ZSTA 3U2CA 4ML4A 4OUIA 3TMLA 3OG2A 1QOPA 3LBOA 3NXFA 3P7YA 4DWDA 3MWCA 1E3XA 5EL1A 1MW1A 3EMCA 1PAMA 5CAKA 2Z25A 2EPNA 1WO2A 4BHYA 1TV4A 1GVEA 5CQ1A 1U1UA 4PFMA 1ZENA 1DKWA 4NAFA 4MWAC 1WKEA 1J0IA 1AH0A 4H9VA 3QFWA 3WK1A 2PDMA 1V6XA 4XIAA 3AMKA 4LPCA 4UTKA 2QGYA 3CWHA 3PS7A 1GOKA 2HBVA 3A23A 3WUBA 4DI8A 4IIFA 4GY7A 1EO5A 4CQ9A 4YTUA 4UOZA 4U31A 5HMEA 3QW3A 3T1GA 3I7QA 4I7WA 4Y9PA 1ZP4A 3W29A 4JTJA 1QW9A 1W9DM 4KMQA 4GUIA 4PRTA 2R8WA 1BVZA 1VPQA 4C6CA 3GKAA 2QDHA 4QEEA 3B0PA 1V6WA 1IYXA 2UWFA 4ZE5A 4AIEA 2YDAA 4EF8A 5B7ZA 2PWVA 4FNPA 4ZB5A 2Z7KA 1XLJA 4CQBA 4Z2GA 4LQ1A 4WKFA 2G3IA 2GGJA 2DQXA 1HJQA 4JEJA 1N8IA 2AL1A 1DBTA 3B9AA 4W5UA 2IKHA 3H2CA 4DELA 4B9ZA 4B4HA 1ZGDA 1FXQA 3ABXA 3PFRA 4LYPA 1LDCA 2HS6A 5DBTA 1QBBA 1JQXA 5HMFA 5LZLA 3WH7A 3WH5A 2XGZA 4UUIA 4B5UA 1QPRA 3M7WA 3PUOA 2EJAA 3POCA 4WOZA 4B5NA 2ZE0A 4KT2A 3CXOA 1SUXA 3TN6A 2V3GA 3H2NA 5GNZA 1Z8AA 1QPNA 2FDMA 4CNSA 1DEDA 2CHOA 2BY3A 1CECA 1VB9A 1KM5A 3GW3A 5K9DA 4BJHA 3WDHA 3MSRA 2OX4A 2B81A 1GJUA 4QE1A 4E0CA 5FF0A 4O16A 1FCBA 1QCWA 1W3LA 2ISFA 3SQSA 4B90A 3N2XA 1LBLA 3N2CA 3ZWSA 4NX5A 5A5WA 1UZDA 4JTKA 1CTNA 4MYXA 3BLOA 3GKFA 2TMDA 1I4NA 2DH3A 3UCDA 4IPIA 5EMJA 1J12A 3OO2A 4ROQA 1QI4A 2NWSA 3R10A 2B7OA 4ATDA 2ZBTA 1ONRA 1UR8A 3KXQA 4PMQA 3WG6A 1OX4A 1B3VA 1JCJA 2XVPA 3V1PA 3F2DA 1TO3A 1OSEA 1GTEA 4IPJA 5FCZA 4MJZA 1JD9A 3GNRA 1CXIA 2EPLX 1VFHA 2W62A 1IWBA 3QOKA 2E6YA 3BG9A 3SBFA 3TQ0A 1NY1A 1UH4A 3M5YA 2QLYA 3DESA 1EH9A 3KBWA 3S1WA 1E72M 1XH1A 3AIBA 2EQDA 5MKGA 3NM3A 4HTYA 1XH2A 1RPKA 3M0ZA 1XW8A 3IJQA 1F8MA 4C6BA 1US2A 4L5ZA 3DG6A 3PNZA 3VVGA 4LS0A 3N12A 4PTVA 2ZA2A 1LRQA 2V2DA 1KRCC 4LAZA 3TYEA 1KRMA 2G4JA 3F4DA 1JAKA 3UR8A 4JDYA 3WLOA 5HPCA 4JKMA 1FDZA 2QPSA 4UTMA 6PTDA 3IARA 2JF6A 4GGHA 3EA1A 2QDEA 5E93A 1FKWA 3CC1A 4GYPA 1W1PA 1NFGA 1J2WA 5IXEA 2JKEA 2VHLA 4W8AA 4PYSA 3ZJ7A 5HATA 3KDOA 4PRRA 5G1MA 2XFRA 5AZ0A 3HJEA 5ABFB 1PHQA 3WBWA 4DHGA 5DX7A 3GR8A 3KL0A 4DI9A 2E77A 2WMKA 4RDWA 2YA0A 3L2IA 4AW7A 3CIXA 4JIPA 2E28A 3TR2A 1SW3A 4F0MA 1XIEA 5BOFA 2NUXA 3MSYA 2P0OA 2ZA3A 2ZE3A 2GWGA 1EUAA 3FJ4A 3BPWA 1K1DA 3W7GA 4D6CA 3S5YA 1J9YA 1H1YA 4A3QA 2XM2A 3P82A 5U4NA 3ZWTA 4D9PA 4XBSA 5AB3A 3UG8A 4Z0SA 3O2LA 4Y9OA 3DUGA 3H24A 2Y5JA 1ME8A 2ZUNA 4L1GA 4E8GA 3RDKA 2VFIA 1QNVA 4IQEA 2C79A 3M43A 4HZMA 4L1XA 5CZSA 1RK6A 4ZSUA 3LBCA 1EJ7L 1HKVA 5C71A 3CZEA 3TFXA 4MZ1A 3SCTA 2TAAA 4C1NA 3R58A 2F8QA 2V38A 3LDVA 3CNYA 5LIYX 3ZM8A 3VUPA 2FGBA 5CJ5A 4JBRA 2G3MA 4D6GA 2FQIA 2ZXQA 3M0VA 1W1ZA 3E0WA 1Q63A 1H7PA 4N2YA 2G41A 1CGUA 3NVDA 4Z1DA 3T0AA 3EWZA 1MYRA 4HJWA 4JQ4A 2VJXA 4Q8PA 4XAYA 3WCZA 3AHTA 3GBEA 3MV01 3N15A 5F4WA 1PB0A 2WC4A 3N9SA 4EXQA 2PDQA 4ZO8A 5LXXA 1BAGA 1MZRA 1HUVA 4DF2A 2F6XA 5FF2A 3SY5A 5I3GA 5I0DA 4UMCA 4AAJA 4ML9A 3LXBA 3DFNA 4D6FA 2ZTJA 4XWUA 5JBFA 3CM4A 1XBYA 2G0WA 3SRFA 2VZTA 1J0ZA 2CWXA 3VGDA 2A6LA 4W87A 2CLMA 3RXZA 1V08A 5A95A 4H83A 3LPPA 3EOOA 3HG5A 1OC7A 4ZVJA 2WSPA 2GDVA 2HNEA 3P80A 5DF0A 2VMFA 3VNKA 2ZRZA 1LLOA 4IFKB 5DMNA 1XYZA 2BB0A 1OD0A 2CHRA 4JTEA 3SADA 5LIUX 1JGIA 4ORMA 1TX0A 5HINA 4ES4A 2MUCA 4IP5A 1BD0A 1Q45A 3QY8A 4YYFA 5LXEA 2J9ZA 1UKPA 2QIWA 3DG7A 1ZS2A 4HPNA 3WLHA 2XU2A 4HOZA 2UY3A 4L65A 3C6CA 3VC6A 1KCKA 3A3XA 1XP3A 4YVVA 3UXIA 4Z2HA 3E2VA 4QE5A 1PEZA 4I7VA 3UG5A 1SJAA 2YL6A 2XVNA 5SWUA 1RA5A 3PB2A 2A3LA 5E9AA 5BRPA 4ALDA 3KWSA 4YXGA 5LNWA 1W2VA 1LROA 3FGCA 2QCHA 4LVAA 3EPMA 1LORA 4MNLA 3EKGA 5A6JA 3PG9A 1W3NA 3GDLA 1DL3A 1YPIA 4KBXA 2DT3A 3R94A 2ZUMA 3UZWA 2PDPA 2J25A 5AZ1A 3QHOA 2Y7DA 5AOUA 4GLEA 1BKSA 3IJDA 1AFSA 4WSKA 2VR5A 3UU0A 3PJWA 3NL6A 4NG3A 2ALRA 4Q8TA 2IW0A 3RUBL 1XIJA 3N1AA 2E4TA 1PTAA 1SJDA 3U5UA 5I3JA 4BQ2A 4CLMA 4IQDA 1B3OA 5FI8A 2QUTA 2BFGA 3LEPA 3N9KA 3N25A 4HHMA 2YPIA 3LOTA 2NVAA 1WOAA 4BQ4A 3R0KA 2Z29A 1W5QA 2A3AA 1G9HA 4MY8A 1OT1A 3L5AA 4N42A 5IBXA 3GHRA 3WIJA 4IP7A 1OFOA 3BSHA 4HQVA 5DCEA 4PUWA 2BLEA 4KEMA 4GY1A 1LL7A 5L9FA 3NJ3A 1CLVA 4OJYA 1WOBA 5DN1A 1IXPA 2G3JA 1QNQA 4ILSA 3R13A 4REQA 3KP0A 2FPYA 2QCMA 3ITTA 1KNWA 3U2EA 3GM8A 5E5CA 1LUCA 3M07A 2YA2A 4FSAA 2V69A 1T8QA 4DAIA 3ABOA 2GSEA 3NQDA 4MPKA 2ZC1A 1BVNP 4NNBA 2QJHA 4CQCA 3V7PA 3ZT5A 3ARVA 1FY6A 3AXXA 3N2MA 3ELFA 1UOZA 1KQZA 2J62A 1V7AA 3POHA 4Z1AA 8XIMA 4C5YA 3TA9A 2X1TA 1SFJA 4JL2A 4HB7A 3KTCA 1VLIA 4W86A 4LH8A 2PP0A 3PBWA 5LA0A 1QPKA 1P7TB 1EYEA 3CMGA 1A47A 1S5WA 1FVPA 4WQ6A 3GVQA 1HGWA 4K68A 3PBGA 4XUYA 1XINA 3SURA 2ACSA 3LXCA 1B3YA 1VJIA 1B9ZA 1O95A 3C2EA 4UWMA 3I68A 1O66A 1J5TA 4RZ6A 4PTXA 3TCEA 3G18A 3VIIA 1TELA 1L2UA 2UZ9A 4JTFA 1L6WA 3NOEA 2VZSA 2J7FA 3BE7A 3G77A 3PPFA 1XYLA 1V6UA 4KCUA 3HO8A 3F2CA 5HPOA 4M5PA 3OQEA 3QYSA 5EBAA 2WVVA 3MUIA 1QNPA 1W9VA 3LSCA 4GQ0A 1JCNA 5CPOA 3GDRA 1F4AA 2G50A 1TJPA 3DG3A 3DFHA 9RUBA 2W6RA 3SN4A 4CD6A 1QPQA 2XFWA 1Q6EA 4HP5A 4UTTA 5BU6A 1MFVA 3W2LA 4GI6A 1QDSA 1W91A 3AXHA 1YDNA 4ZB2A 4V15A 4QBXA 3BWWA 3VYLA 2C1HA 2GK1B 4Y8FA 4RPQA 5H1WA 3FN9A 2PWDA 4QJ3B 4BF7A 3A3HA 2PDHA 3U9IA 1OGSA 2WKJA 4GH1A 1F2JA 4AEEA 3FVDA 3TE9A 1DTNA 1IEXA 5HQLA 5J5DA 1B3XA 4V33A 4YHGA 1MVYA 5DFAA 1FH9A 3WQ8A 5D32A 4YN5A 1V3JA 4WDXA 3VOCA 5A8QA 1EIBA 3AUOA 2X7WA 1R86A 1BRLB 4WY0F 1Q4WA 1TV7A 2NSXA 1RVKA 3EB3A 3LHWA 1VC4A 3LCLA 1UASA 4XD5A 2X8RA 4K1WA 4F79A 4W84A 2Y0FA 3WL0A 1XKYA 4ICNA 3TYBA 3BDKA 4U28A 3T0CA 1DHPA 3S2MA 2Y5SA 2BP1A 1UUMA 1V3LA 3U4FA 4RR4A 2JEQA 4PMUA 3UWZA 1YBQB 2DSWA 4M8UA 1ZRQA 1BF6A 3DC0A 3LHZA 1TB3A 3M0HA 4GUGA 4TOQA 3GNXA 4X0VA 3WDQA 2C71A 3CZLA 1KFKA 3TSBA 3B8TA 3UR2A 4F0KA 4KQNA 4MLRA 1US0A 2QMJA 3SFKA 4A8NA 1B1YA 1GVFA 4Q6JA 4PZVA 2YBUA 2H3DA 3VMOA 3L4WA 4L9XA 1P6BA 5I06A 2YSWA 4AF0B 4NI3A 1BGAA 1A5MC 4JTSA 1B54A 4J35A 4ZO6A 1NFBA 1BRLA 1FWTA 2YXOA 2HQAA 4X3ZA 3H21A 3CS2A 3QLLA 3MI2A 3ZIZA 1Q85A 3A47A 4O4WA 2PGFA 3VMPA 3VM5A 2DSKA 2Y5EA 3HOJA 4I8YA 1XCFA 4E5TA 3PWIA 2O92A 4PCTA 1TR1A 3E0VA 2C1IA 3KHDA 3CL8A 3TUUA 1PWMA 2PODA 2XWDA 3QV7A 4B3ZA 4L61A 1SR9A 1KKRA 5HNTA 1V0KA 5F2GA 4BF9A 4UZSA 2Z7GA 5TD4A 2O9TA 2J7HA 3CYVA 3IS4A 3U5YA 3LLXA 4ZCWA 1FFRA 3STPA 3LTPA 1H50A 3D5HA 5FSDC 3A4XA 4JX6A 4M19A 3WY1A 1SFLA 2YKKA 1LT7A 3IJ6A 4WOQA 1VR6A 5H6HA 3GB6A 1RR2A 1TFVA 3BW2A 3V3WA 1R9ZA 4LUJA 3CV2A 4CUCA 1FHLA 2EG8A 5I78A 3I7RA 3OJGA 3CMJA 3VC5A 4Y6GA 5LNVA 3E0IA 4W4QA 2BZNA 3RITA 4ATWA 1OCQA 1YQ2A 2D2HA 1QO2A 4PGLA 3BLEA 2ZRXA 3RR4A 2TODA 3IGSA 5CLWA 1CPUA 3H12A 3O63A 1ENUA 1FDYA 3PZTA 1UKOA 2ZYFA 4WSHA 1YMYA 1G94A 4GXPA 3ABQA 3RO8A 4AMAA 4B92A 4KKXA 3VM7A 1ME7A 4GNJA 5AYZA 4PCPA 1EXPA 1VRDA 7TIMA 2NT0A 4JX4A 4U3AA 1DJYA 1CLXA 4IWWA 2XDFA 3JS3A 3N34A 3MV11 2EKCA 3WFAA 1R3VA 1E73M 2GJLA 1LL4A 3IIPA 2HSAA 1Q8JA 1GHSA 3NWRA 3LLFA 4WHBA 5IFTA 2NX9A 3GXIA 1TJ2A 4ENLA 3WD4A 1TIMA 3M5XA 3URNA 3SDOA 2QR6A 3AUJA 1JNEA 1RBLA 3ZJKA 1E56A 1A50A 1F6PA 2NVDA 4AVOA 3DOPA 2ZQ0A 1YLVA 4H01A 4EE9A 2R1LA 4YL2A 1UBPC 2GUUA 3L23A 2HV5A 1OFRA 3HM7A 3W71A 1WDWA 4BK9A 4DUVA 4LNYA 4R53A 4CCEA 3DKLA 3GUWA 2ZVRA 3CUHA 1CLKA 1W5MA 2CZDA 3CUFA 5LHEA 3H55A 4GCXA 1S5VA 4U5KA 4YJ5A 2OZ8A 3LM7A 2CLPA 2OO6A 4MJMA 1NOUA 1SZEA 1DWGM 4AHQA 4DNHA 2DIEA 3MVTA 2FJUB 3L4ZA 3MC5A 2CC0A 4OUEA 2BGQA 4KEVA 1XLDA 1AH3A 3OYXA 4QLLA 5J04A 5CPQA 3MYOA 3UVIA 5LNSA 4IL2A 3DHFA 4KRTA 2XIQA 2NW0A 4EWJA 4L64A 2QCDA 2GGIA 1VYRA 2OT1A 1XL9A 3TYZA 5JIPA 3NVTA 4WZHA 3WLNA 1QU4A 2WNQA 6ENLA 2VKZG 4K7YA 2V3DA 4CNPA 1LUCB 1RQHA 4Q8UA 2YL9A 1UCWA 2P76A 5CAHA 3VD9A 1J4EA 2XIOA 4PEEA 4NT0A 3TQPA 3EDKA 1ZAJA 4LRSA 2YLLA 3IRDA 4ONVA 3N6QA 4M51A 3RLVA 3B0YA 2BXZA 3EX2A 3CBWA 4L4LA 4GXWA 1F4HA 4ADTA 4BY3A 5TAOA 1WXJA 1XUZA 5FEZA 1FKXA 1H3GA 2PDXA 4ZTYA 4XUGA 4DN1A 3G1RA 3QQ0A 2PURA 2ATSA 4OV9A 4REQB 1GVIA 2C15A 2DIJA 4L1WA 3KVJA 2IKGA 1YE6A 3QMTA 1AW5A 4KERA 3Q58A 3NTYA 1UP3A 1M04A 4NZFA 4PTMA 3WQ6A 1KR0A 4J9JA 4DBSA 2QUNA 4YU1A 1EDTA 1G5AA 3W2MA 3D3FA 4JFUA 2WQPA 1ZJIA 1XICA 2D22A 3CWOX 4N4QA 1A5BA 1XIIA 2ODOA 4MPQA 3IV3A 5AVHA 3CWNA 5DXXA 3ARTA 3BARA 1RH9A 1G0CA 3SQLA 3UXDA 3VDBA 1L6GA 3S0CA 3H7RA 3I6RA 1TWSA 4S38A 3P67A 1R9XA 4J1OA 4Z1BA 3T0TA 4GNVA 5A6MA 5IBXC 2ZCGA 1ONWA 2OKOA 3MMUA 2E25A 3P8IA 3GTHA 3GTXA 1JDEA 3BAWA 3WMBA 1EKOA 5PTDA 3THUA 4C6MA 4EX4A 4XKYA 3E6EA 4XAPA 4G6CA 4EP8C 3ZLHA 1PS9A 2BMBA 1KM6A 2QJIA 3GLCA 3CT7A 2PDBA 1EA9C 1XG3A 1MFUA 3RU6A 1TG7A 3WD3A 3W7DA 1MUCA 2BWGA 3S9IA 1A3XA 4Q8WA 3NNTA 4MDPA 3SIZA 2WZHA 3P5ZA 3WH9A 1HX0A 1IWAA 1J10A 3GQYA 4U2ZA 4AVNA 4CEUC 1K8XA 1WXZA 4K3ZA 1QATA 4B5XA 3GDBA 3PJTA 1TPB1 3ORWA 1XLFA 3ARRA 3A64A 2WV8A 1SW0A 5CC5A 3KVLA 2NQJA 2O9OA 4HK6A 4JIEA 2VVSA 1BWKA 2I9UA 2QAFA 4LVDA 3CB8A 4XIMA 4W85A 4OTKA 1I9CB 1JQVA 5DY2A 3U7BA 1F61A 1Q7ZA 4NRRA 4FXJA 2VX7A 3CU2A 5JUVA 4GBDA 3W26A 1ICQA 3M6DA 3BG5A 4ZOAA 3BLIA 2FJKA 1MQQA 3GBDA 2XH0A 3MWAA 4PMDA 2FH6A 3HV9A 3CZGA 5CEWA 3ZJ6A 2Z28A 1A5CA 2H90A 3ITYA 4OWGA 5DBUA 1US3A 4UTJA 3E0LA 1GJWA 3NZQA 1KBJA 1KBIA 2FDSA 3WH8A 1L6SA 2CLIA 4CD4A 2PPGA 2ZTKA 3B8SA 4MF4A 3S8HA 1CGVA 3ZR5A 4JYEA 4Y9NA 2E0PA 3ATZA 4RPPA 3SUWA 2QPXA 3PZ9A 5H8MA 4GC3A 3UG4A 4U5IA 5H91A 1SFTA 4QXIA 3TWAA 4WY0B 4CGTA 2VDIA 4QR6A 3RM9A 3NQ2A 1U5HA 1PYFA 3F4WA 1G1YA 1R8LA 1NJJA 2V81A 4PUUA 1TPEA 4XAGA 1U2YA 2KX9A 3GFYA 5C5YA 3B8VA 4LXFA 4IH3A 5EYWA 3OVQA 4GYPC 3TC6A 4OBRA 4CD5A 4C1NB 4K7VA 2PA6A 4DWSC 2G97A 4R9OA 2JGYA 3AZSA 5F2MA 3OU8A 3G8RA 3G6MA 4MZ8A 4KFNA 1UPPA 4HNOA 1O1HA 1OJXA 2YBVA 3BAIA 1J0JA 1W54A 4N02A 2Y63A 8XIAA 4KIRA 3IUIA 3IRSA 3W07A 2YXXA 3KP1A 4FA3A 2NQ5A 3LRLA 3BCJA 2JGQA 3CQHA 4LGXA 1P0DA 1F73A 1BGGA 1HXJA 2OYMA 4LUSA 2HE8A 1FWCC 2UV8G 2REQB 3KOWA 3G0XA 1K9DA 4LBSA 1TRIA 2Y24A 2Z24A 4J5NA 5A1AA 4FLQA 2X05A 4JN8A 1LZOA 4QDWA 1W9BM 1QAPA 1GGOA 3TAKA 4NNCA 3VDCA 1IWPA 3H7UA 1EDGA 4RNIA 5I5RA 1U22A 2IXVA 3AIWA 5D2YA 3F7JA 1CT5A 3GHTA 3TLLA 1T8XA 2VQTA 3IIVA 4H41A 1XISA 3ITCA 1WKYA 2IPWA 2Z1BA 1YNYA 4F2BA 1UWTA 1C91A 1NWRA 5D9OA 5FF3A 1XSIA 2DUXA 2PDLA 4NJIA 1UD3A 4QE4A 3V0TA 1UOKA 4FR6A 2ZUTA 3PUEA 1JD7A 4NKCA 2QJNA 2EGZA 4GVGA 3W3OA 1KFLA 3ENLA 3NL2A 1IEQA 4AHOA 1AQFA 2OEMA 1XPYA 1Q6GA 2ANUA 4TX9A 1H7OA 5FEXA 2VC7A 1K8ZA 5LGXA 1KXQA 5A6SA 1AQ0A 2CBIA 3UGRA 3T8QA 4D8AA 1DVJA 1PJ9A 2AMGA 1LJYA 1RHCA 2HJPA 4QM1A 2PDCA 3GYCA 4M82A 1UKSA 4ZEPA 3W7EA 3VIGA 2YCIX 5CC3A 3ARUA 1G6CA 3UD6A 1K02A 4UTFA 3B97A 1UD4A 4MJ2A 3QMRA 2A3BA 3T81A 4E6MA 5C0QA 1GVSA 1RAKA 1UWUA 1PX8A 4FNRA 1VP5A 4A3HA 4UFKA 4LS1A 4QAIA 3A4JA 2WWCA 1W6TA 3ZOAA 1OYBA 5G5IA 1P43A 5FJJA 3STGA 3D46A 4DWSB 1PBGA 1BG4A 2PD9A 4IG2B 3DXIA 3QSRA 2XGIA 5KZDA 1JF6A 3S6DA 4AZCA 1V3KA 4GX8A 3MS8A 3EA3A 3LLDA 3N11A 3KAOA 3JU2A 2D23A 2HMCA 3QXBA 4HNLA 3KCJA 3W86A 3MMTA 1OB0A 4TXEA 2WNWA 5C7VA 5AYBA 1R3SA 1H1ZA 2PBOA 4F0SA 2MANA 2LLEA 1TTJA 4O28A 2CPUA 3NFUA 5K4ZA 5F4SA 3TAOA 3AYTA 3BXWA 1WNOA 2Y4SA 1Q6QA 3TNBA 1O60A 4JS3A 4Z0JA 2VDGA 2JQXA 4JKKA 3LYEA 3UZJA 4UNIA 5J5RA 2X7VA 2C19A 3N17A 2VO5A 2CKSA 2WSYA 2GJPA 1GQKA 1SM9A 1PZ0A 4O1DA 5TBOA 1NELA 1TSIA 3QZ6A 1EOKA 1NDWA 2NX1A 2E68A 1KBBA 1DJHA 2PWEA 2PDNA 3O07A 3OLIA 1NQKA 3CUGA 1LOLA 1XIFA 3C5QA 4QDMA 1JXKA 1PL9A 4AD5A 4ZB0A 3WNPA 4Y90A 2PDIA 3M0KA 5F4XA 3T07A 4AEOA 3S9ZA 2Z2BA 4M1RA 3BV4A 3TIMA 4DYJA 4ERGA 4DWSD 3RCNA 5ABGA 3UERA 4TX8A 3CAWA 4GIRA 4DJDA 3BO9A 2JIWA 1J18A 1V77A 1Q2RA 1A5KC 1V5XA 4GG9A 1CWYA 4Q4PA 5HXMA 4JDBA 4AZ6A 4CCDA 1SSGA 1AG1O 4RDZA 1H60A 1K77A 2BOGX 3C3UA 4WR3A 3EBVA 2VVNA 3M9YA 1HQTA 3SFWA 4JQ3A 4GACA 2V5DA 1TV8A 1W1TA 3GIPA 1IEWA 3VIFA 4NZJA 1HF6A 3VNLA 1VS1A 3A9IA 2Z0IA 4UTHA 4G2DA 2DSVA 3Q4DA 4G7FA 3EOUA 4XZIA 5DCDA 5I3IA 4F9JA 1VFOA 2JE8A 3QGKC 2GSJA 2PCQA 3WZ0E 4DJEA 1EEXA 4O1FA 3MHGA 1LP6A 2OQYA 1X1ZA 1HJUA 1K8YA 1XIGA 5LGZA 2DP3A 2G37A 4PUMA 2YCLA 3AS2A 2QEZA 5BXTA 3I10A 1B3ZA 4FEZA 1DXIA 4FLOA 1W1A1 4MWAA 2HZGA 4WD0A 2QNEA 4L6OA 4QFUA 2QULA 3LUTA 2YLAA 1E0TA 2Y7FA 3PAJA 2Q8XA 3OVGA 3UPBA 1AA1B 2PS2A 4DJFD 2F61A 5D38A 2I5QA 1KXVA 4MUZA 3AISA 2ZADA 4PULA 1CCWB 2V30A 4QG8A 1TPUA 3UZYA 1A0EA 2GJRA 1XLAA 1IQ8A 4QSHA 4FK9A 4IFOA 3YPIA 1OGBA 5I09A 1EQPA 4I90A 5LKYA 2QZRA 1RALA 1B0IA 2QYGA 1E4LA 3VKCA 1PYMA 3WFLA 2V5LA 4J2MA 1MEHA 2DV0A 7XIMA 2Z2AA 4E2BA 5HR7A 3UFYA 1OBAA 1UP2A 4KWUA 2A21A 3W1AA 2PGEA 5KEZA 2VFHA 2CXGA 4GZ7A 1OC6A 2HCVA 4ROPA 3CIVA 1ZHAA 3IJIA 3L2MA 3TW7A 3PG8A 3NPXA 1WZMA 2XM1A 4KS0A 3KL3A 4GCAA 1PWLA 3QV8A 2OLHA 1X6LA 1CBGA 1Q7MA 3L0NA 1QNRA 4H8VA 3W7PA 3B3DA 2QMKA 4AHPA 4DZHA 2OFJA 5MF5A 3PC0A 1ISYA 5JXQA 1EX1A 4P8XA 1HVQA 4EANA 3G6LA 4K37A 1EXBA 3WLSA 4O11A 3UGVA 1MSSA 4LC8A 4H2HA 3DFTA 3OHIA 4HGXA 1IE7C 3NIYA 3RCYA 3ZT7A 4H9TA 2E6DA 4B91A 1L9WA 1UA3A 1T40A 4Q32A 3H70A 2PRMA 2GFTA 1AQHA 4IPLA 2EEXA 3BAYA 1MUMA 4H8NA 1SZNA 1JUKA 3EWBX 1JRBA 3VKDA 4K2SA 3G3DA 2VCAA 2GOKA 3FX4A 3LHTA 3QZEA 2WAGA 3Q94A 1TR9A 5KETA 1Q65A 4IMEA 2VD9A 1FFQA 3WLRA 2XINA 3N2BA 5EPDA 3NZPA 2Z1VA 2VCBA 2BHYA 4RW5A 1MWOA 3MJMA 3PBUA 5AYYA 1IXQA 1JG9A 2Y70A 3MT1A 3SCNA 1T7LA 2OLAA 4Z2IA 4PUJA 1TQXA 1YNQA 4I3GA 1XBXA 1ISVA 5BCAA 2GVLA 4I6VA 2IUZA 3BOFA 4S23A 1L6FA 3U0HA 3GVVA 5CH9A 3AYVA 3LMYA 1G4TA 2ZFAA 2CZFA 2NLIA 3NQ6A 3L0KA 1YTKA 3WQWA 3P62A 3RM8A 4KRZA 2A1YA 2ZZ4A 3LBMA 4AZIA 2DGAA 1BQCA 2MNRA 5I7GA 1LYXA 3BW4A 3ANUA 1M7OA 4J28A 1D9EA 1EA0A 1AK5A 1TV3A 1Q6RA 1TMQA 3W53A 5LNRA 2J24A 1OT2A 3TA6A 4C6OA 2VGBA 1WAWA 5GQBA 2WSQA 4MB4A 1XBVA 2BNJA 5A2BA 3TYCA 4B3KA 3ANVA 4PCNA 6XIAA 4OBSA 2GZXA 3VOGA 2BXVA 4Q8VA 3T0BA 4I7UA 2ACRA 1XPGA 4JY9A 3NZRA 5DT7A 3SIMA 1P0BA 4LAMA 2VRKA 3IIXA 2J27A 1BYBA 2DVTA 2WVVB 5CKSA 3APYA 4J27A 4AF0A 5G4EA 4HZ7A 2ADAA 1MXDA 1EWDA 2CEQA 1X38A 2DVXA 5AC7A 2RJGA 1GK8A 3GY1A 2WMHA 1EDQA 1KTCA 1S3HA 1YTEA 3ARSA 4HU3A 5GJPA 5C70A 1WDRA 3KUMA 1D2KA 4AIBA 1ITUA 4P61A 4TIMA 2BDQA 1XM3A 5FJRA 4CU7A 3VGEA 1B4EA 2VWSA 5A94A 4JNMA 2IXUA 4QJ1A 1W31A 2OTDA 4LFYA 2EPMX 1VCGA 4NJGA 1Q13A 5D04C 3LTSA 5FEWA 3W9ZA 6REQA 1RJRA 2OQLA 1U33A 5HQMA 4URIA 4HZ6A 1QHPA 1FWRA 3QN3A 3MYPA 3K4DA 1NF7A 1S5MA 4KH2A 4TR9A 1K7XA 4DBDA 2OU4A 3CHFA 1FCUA 4L6DA 4TX6A 2XJ7A 1M5WA 3CH9A 4RE0A 4Y9MA 1KV5A 2HK1A 3A21A 2V68A 3N13A 4UTUA 4CVUA 4GVIA 1KFJA 2B4GA 4W89A 4JTHA 3LQGA 2Q09A 1NWTA 1M41A 1EF3A 3N4FA 1V0MA 4D71A 3T05A 4IZGA 3PHAA 3VNJA 4C91A 1XYAA 4NX0A 4ZXOA 3INPA 2F84A 3GD6A 7ENLA 2D1ZA 4JN6A 2QCNA 1AD1A 3DERA 4A8RA 3ANYA 4IPPA 2WCGA 2YOCA 4Y9AA 1HFBA 3GXMA 5B7YA 4G7EB 5CPMA 2E8YA 3WUGA 4KF1A 2QQ6A 1E5JA 2O4QA 1FWIC 3TQVA 4PBEA 2ABBA 4G56A 5G2WA 2ZRYA 3GG7A 1N8WA 4ADSA 1VFFA 3WFZA 3W7QA 3WBXA 2PD5A 2TRSA 4P7QA 4GIAA 3VKJA 2W92A 4H8UA 1TZ9A 3F1QA 4JHZA 3W2NA 1OX5A 1RP8A 3LQLA 4W7VA 1UIPA 2QV4A 2Y61A 3O6AA 3SQMA 4IIHA 2PLJA 5BMXA 4ZQOA 3S2LA 1LWHA 3W7JA 4JXCA 3CGTA 3E38A 2OSWA 3RK8A 1IZJA 3MQTA 1PVNA 4CN1A 3N14A 4P8WA 3ZLFA 2RH9A 2ZWYA 1FA2A 2Z1WA 3VXGA 2VFFA 3RJYA 3SCVA 2ZX5A 3GU1A 3W1LA 2J6XA 3THAA 4CD7A 4Q7IA 4WVXA 4JIHA 2X2YA 3BG3A 2VXNA 3HPZA 1E55A 1UHVA 3DKJA 1JPHA 2GGEA 1VENA 1P5BA 4FOUA 2EAWA 2UY4A 2PU1A 3RHGA 4YVXA 3P60A 4R7WA 5G2IA 3LI1A 1MI3A 2V8ZA 3RLUA 1W2PA 5HOSA 3TSMA 3WQFA 3GG0A 1M7JA 5D03A 3L65A 3ITLA 3LPOA 2FVMA 3E02A 3SUSA 3NG3A 3NSXA 1Z44A 3TROA 3NM1A 4QS5A 3WNOA 4TMCA 3AYSA 3TW6A 4O52A 2PDFA 2G5WA 4BEQA 4ZO7A 2H3BA 2PTXA 5RUBA 5BYWA 1GNXA 5EA9A 1EGMA 3CL6A 2O4MA 2ZZ3A 2WZEA 1HJWA 2XVLA 4UFMA 4V1XA 3RIKA 1TVLA 4IIGA 1XCWA 2Z27A 1O12A 2IPFA 4MNMA 2Z1XA 4L4PA 4KFOA 4RUBA 3BOXA 4MB1A 4HVXA 3KTXA 4LCQA 2DT2A 5E0CA 3APTA 2Z6IA 4MHBA 2CW6A 2VRQA 3AAMA 2QPUA 3F4VA 3RRXA 4YTTA 5DMMA 2OPJA 1FWSA 7PTDA 4O0KA 3MO7A 4H3DA 3UY7A 2A3EA 4Q3MA 1R2RA 1MZHA 1VAHA 4WKAA 3WK0A 5DMLA 2OZTA 2Q01A 3TN3A 3XINA 2W0UA 4DO5A 3UESA 3M0JA 3RN6A 4GUHA 3T08A 1W3HA 2REQA 3JZEA 4BWLC 4OGZA 3DC8A 2Y7GA 4GGBA 1RUSA 3EB2A 5HA7A 3WJZA 3DI0A 4W88A 3SJ3A 2FB3A 3KTSA 1HKIA 4AD3A 2XZ7A 3SCWA 1Q2SA 4BZYA 3G22A 3K30A 3GZ3A 4GA8A 2JALA 3WQGA 4KIEA 2ALDA 4QRNA 1C8XA 3QW4B 3L4TA 1JUEA 2J7BA 3TN4A 2XN0A 4JTGA 2E9MA 2XSAA 4HPXA 2QW5A 3E9AA 3WKZA 5K7JA 3VD5A 5FL1A 2J7EA 3AIVA 3DFYA 3AMCA 3R89A 2Q6ZA 3EDDA 1HL9A 2R1NA 4EK7A 4UTTC 2QKFA 3TTSA 2WSKA 2BV9A 3CO4A 3G1FA 3WMLA 3RG6A 1NTHA 1VZWA 3ID7A 3TYUA 2E40A 1W17A 2ZZ2A 2XGBA 3NQAA 3LK6A 4GVHA 3FK4A 3VIHA 3DBNA 3ALFA 4Z17A 3AO0A 3LXAA 4UCFA 1ZAHA 3IIZA 4M6PA 1BTCA 3CT2A 1XG4A 1Y0EA 4FIRA 2BOFX 3TH6A 2W3ZA 1QW7A 4U33A 3BMWA 3KEHA 3BZGA 2WZTA 4IISA 1XQKA 2J78A 4O0ZA 3XIMA 3MMWA 1H2JA 3WJXA 3M64A 4BR1A 3S9YA 3KBMA 3W7RA 3K46A 4FOJA 4AFYA 2VEMA 2PC4A 2DZPA 4HHHA 1C9WA 5I3FA 1TCDA 4C6QA 1OC5A 3KBSA 4GO9A 2PGWA 5A8GA 3TDFA 4PEKA 4J40A 4R5EA 5B80A 2VOMA 4M7SA 3SN1A 3UYCA 2IQ0A 5LYRA 4MTVA 3E1F1 2DZXA 3UR7A 1A0DA 1TWIA 2EJ1A 5BZAA 1B3WA 2VD8A 4NILA 2FGLA 2P50A 3P8JA 3PPCA 3LRKA 1R2TA 1KM4A 1JYWA 5AKQA 3MCMA 5CC6A 4MM1A 3ITOA 5KSWA 3QQ1A 1A53A 1BQGA 1IZKA 3KRSA 3SJNA 4ICCX 1EHAA 1WAUA 4BEUA 3OG3A 3WLTA 1LWJA 1X96A 1BXCA 1JAEA 1OG6A 4LF2A 4A3RA 3KOZA 1BYAA 1XR2A 3WNNA 1IHIA 1GUVA 3NXLA 2VGFA 4PA8A 4PTDA 1MW0A 2CLLA 1GZ1A 4R27A 1YEYA 2W9MA 2J4GA 3LZ5A 1Q4NX 5TIMA 5GJNA 1JUBA 1IIGA 4TUFA 1QVBA 1ZJHA 4Q4MA 3KX6A 2X0SA 3M0YA 4S3FA 3ZSSA 5F2IA 1ALDA 1D7FA 5LSMA 1A3WA 1XGZA 3PSWA 3W1TA 3VKBA 2CZEA 2ZXBA 3T44A 3NPVA 4GYKA 2X1IA 1VBJA 4UMAA 4AZGA 3PUDA 4JHMA 1OFDA 2NVCA 4J4KA 5D2VA 4I5UA 4BFAA 1QK0A 1KBLA 5I03A 4GFSA 1IGSA 1XF0A 3AXMA 1J01A 3VOIA 1I6NA 4ZFMA 4AVFA 3TKFA 3LHUA 3NYZA 5ECVA 3FA5A 1TREA 3BGJA 2V82A 4D6DA 1Z6KA 1JDAA 4AD0A 2G96A 3OA3A 1FHDA 1LLWA 2DY3A 2CETA 4DJED 1KCXA 4KFPA 3MBFA 2R14A 4C7DA 5ECUA 4HU4A 3U48A 3MVIA 3MBDA 1TPFA 3ABRA 4AWEA 3GIQA 4DJFC 1BFNA 2O0TA 2V67A 4S3BA 4X9YA 2EKGA 4GQRA 3VGFA 4AU0A 4AD2A 1B57A 2QS8A 1POKA 1JJKA 4V1YA 4B2DA 4P8UA 3ZLGA 4UMBA 4KCWA 3E3HA 1QRQA 4O1AA 1XJBA 3UPWA 1LOSA 3UWQA 1OY0A 2OEJA 3H54A 3Q65A 1KRBC 2X0YA 5HWNA 3F4NA 1WZAA 2R94A 4JFWA 1IEIA 4N0RA 4AWTA 5FF4A 4WSJA 2PDWA 1D8WA 2PUZA 1DJXA 4DF0A 4W5ZA 2J13A 3KRUA 1BTMA 3OGRA 4DQWA 4U4MA 4MY1A 4LUTA 2XVGA 5REQA 5JVLA 1SJCA 8CGTA 4JTRA 2XTKA 1S2VA 1ODZA 1SO6A 2PZ0A 3C0LA 2ZVIA 1CGTA 2EF9A 1UZ1A 3VINA