1TWWA

Dihydropteroate synthetase, with bound substrate analogue ptpp, from bacillus anthracis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
273
structure length
266
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHPS, Dihydropteroate synthase
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 97
structure length 266
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1twwA00
3TZNA 4CCZA 3MCOA 4NL1A 4O1FA 4MWAD 2H9AA 2VEGA 1AD1A 4DJED 4S3DA 4DJDA 3TYCA 3TYZA 4NILA 4NHVA 4DJFC 4D8ZA 3H2MA 4DAIA 4DJEC 2VEFA 4O1EA 2Y5SA 3TYDA 3TYUA 1AD4A 1Q85A 4NIRA 4DAFA 2DZAA 2VP8A 4HB7A 4S3BA 3TYEA 3NOYA 3H24A 3TYBA 3TR9A 1AJ0A 3H2OA 2DQWA 2OGYA 4S39A 1EYEA 4MWAC 4C1NB 3H21A 4MWAE 3TYAA 2BMBA 3K13A 2Y5JA 4PZVA 4S3EA 1Q7ZA 4DJFA 1TWWA 4O0QA 2YCJA 4S3AA 4S3FA 4DJEA 3H2AA 4DB7A 1Q7QA 2YCIX 1TWSA 4D8AA 3BOLA 3H2FA 4S3CA 4DJDD 4S23A 3BOFA 3H2EA 1Q8JA 2E7FA 1TX2A 1Q8AA 4C1NA 1TWZA 4DJDC 4G9PA 5JQ9A 4D9PA 1AJZA 3H23A 4DJFD 1TX0A 3MCNA 4MWAA 2H9AB 4MWAB 3H2CA 4S38A 3V5OA 3H26A 3H22A 3H2NA 2Y0FA 3MCMA 2DZBA 1F6YA 1AJ2A 2YCLA 2YCLB 2YCKX 3TZFA 1Q7MA
chains in the Genus database with same CATH superfamily
1VCVA 4DWSA 3VIPA 4AU0A 2P88A 3GW0A 4W85A 3QF0A 2ZOXA 1UH4A 3BJFA 4PA8A 2Z29A 4G8TA 2XFYA 3W1MA 2W62A 1LM1A 3H55A 3MP3A 5AB3A 4B92A 5K4ZA 3WQ6A 1H0GA 3UXDA 4GNKB 3O6YX 1ZBCA 3C8NA 3OA3A 1UJQA 4KEZA 3OVQA 1FH8A 3CYVA 1SJBA 1TPC1 5HK4A 4D1IA 3ZFHA 3N3MA 1VENA 2YXXA 3WYZA 1V6YA 4HPGA 4F79A 2G3JA 2R1LA 1L6FA 1M53A 3JRKA 2YW4A 2OR2A 4NZCA 4S3EA 2IQDA 3WFAA 4DLFA 3W1TA 3OHMB 3RPTA 2I14A 3BWWA 3WDPP 3NEHA 4S3CA 2Z7GA 1KM1A 4AEEA 3PBUA 3GHSA 5JQ9A 1XKJA 2VVNA 2C91A 1I2RA 1KGXA 4Q8MA 1X6UA 4DJFD 3NR0A 4HCHA 3TC7A 1B4EA 3VZZA 4J2MA 3GKAA 1QVBA 3UR7A 2PRMA 3RLUA 4IL0A 1W5NA 2BHUA 4GI4A 3N2BA 4DNMA 5CEWA 3DI0A 5IHSA 1WA3A 3VINA 1N2VA 3LSCA 4DUVA 1B0IA 1WPCA 1IEIA 1R9ZA 3CEPA 3ARWA 3H2MA 3KCJA 1ZCCA 3GNOA 2IKGA 3EWYA 1TYGA 4M6UA 2AL2A 3VOCA 1GKQA 1V4YA 5FL1A 1K7EA 1A3XA 2DZXA 4MM1A 5FCZA 4DNHA 4Q7IA 4HZ8A 2J27A 1PZ3A 2O9OA 2AAMA 2OTDA 3TSBA 1GVYA 4IUOA 1EGZA 1EDGA 4A22A 1W37A 4GFSA 1UA3A 3O0KA 3ZZ1A 1A5KC 3W27A 1BKSA 1W91A 3L4UA 2OSYA 6CGTA 4DZAA 3THAA 4CCEA 2CHRA 3VKDA 1H61A 1XBZA 1POJA 2VZUA 3OYZA 1L9WA 4PSRA 1TJ0A 2OWXA 4ZO6A 2PDYA 3U7BA 2EPLX 4H9TA 3WY1A 3P8IA 2I5QA 4A3QA 1UASA 1AW2A 3HM7A 3TNBA 4TOQA 4JTFA 4RE0A 2YKKA 1JDCA 3FYYA 3VOHA 1IT0A 2EQDA 4LPCA 1QI2A 1MQRA 5LHFA 4NZJA 1YYAA 5A8OA 3B9EA 1GQNA 1E43A 4HYVA 3EA2A 3W86A 1PE1A 1QK2A 2ZZ3A 2CHNA 4HOWA 1NOWA 4JIHA 3USBA 3WLKX 5LIXX 1GWJA 3LHTA 1PIFA 2YLLA 2EPHA 3UEQA 3LI0A 3CWNA 3FJ4A 3WDIA 1ICSA 5U4NA 4DF1A 2GUBA 1JF6A 3MBFA 1LP6A 1H62A 4LY8A 4GQQA 3HFTA 1W17A 2NQ9A 5A6JA 1EJTC 1YMYA 1TZZA 1DJHA 4RNIA 1F6KA 1IF2A 4HK6A 4UTIA 1RPXA 3UCDA 4S2BA 3CAVA 5I07A 1XQLA 2QGHA 3IGHX 2Y5SA 5BOFA 4JN7A 3ZSTA 1RQHA 2DH3A 3M1ZA 1MEHA 2DZAA 1W5PA 2WNQA 4M7TA 3TSMA 5CBJA 2BOFX 5LA1A 3OODA 3SCQA 1DOSA 3ZVHA 4G5DA 2ZCGA 5BOEA 4DUXA 3D5HA 4QROA 1VPYA 5MKGA 4F48A 2OWWA 3ZT7A 3BPWA 3OBAA 1RQBA 2PLJA 2QXWA 1J93A 2Y4SA 1IXOA 3MHGA 4QEEA 5LGZA 4RK8A 3C2YA 1QATA 3UFYA 1EIBA 4ZQMA 2DIEA 4LYQA 1A5LC 3II1A 5HDRA 3BANA 4NZ1A 2XG9A 1QNPA 2BTMA 2DGAA 2ALDA 4Z1AA 1YDYA 3F4NA 4O0KA 1B30A 1PUDA 1E1CB 1AW5A 2POTA 3GX9A 3U48A 4FX6M 1RAKA 4F0HA 2ZFAA 2A3BA 1EZWA 4R7WA 1YNPA 3VKBA 1TPH1 3ARUA 1NP2A 4JTCA 1MZHA 1KB3A 3GDKA 3MKKA 5AVHA 3FYPA 4R9OA 1WDDA 1YHTA 1VQTA 3TEVA 1XH2A 4IOTA 2J79A 1LG1A 1UP3A 4F0KA 3W81A 1RALA 3BCFA 2BGNE 1FP8A 2A7PA 2PDNA 1KC7A 4H01A 3POHA 4D6DA 3AIRA 3H12A 4DAFA 3N11A 1RY0A 2FPVA 5IBXA 3TQVA 2CZVA 5EMKA 1IWPA 1K3UA 2Y5EA 5C2XA 2Y24A 4P7RA 3USZA 5LNVA 3R58A 4WF7A 3WNOA 4FIRA 4PUEA 3QMTA 2XINA 4MWAE 5EMLA 3TYAA 5A6TC 1RVKA 1TB3A 3SRHA 1UPPA 1H63A 4L4MA 3V0TA 3E3HA 3H7RA 4M6QA 3CPRA 5BWAA 4DBSA 3WJSA 5FIPA 2PTZA 3T08A 3SQLA 4L7ZA 4ADSA 3WNPA 3PBYA 1WZAA 1HL9A 3LV5A 1NOFA 4LCRA 4ERIA 3V35A 2CFFA 3H22A 5K9DA 3HMJG 1P0BA 2OEMA 1OEPA 4WDXA 1IWBA 2PS2A 3CZJA 3W7OA 3TP4A 1CLVA 4Q8PA 4J3XA 1BPLB 1ZBWA 1RBAA 3I3DA 4B15A 4PUJA 3S5OA 2YBTA 4NZFA 2IPGA 3W7GA 4F0MA 3W1LA 3OJGA 1Q6QA 4LVAA 5CSUA 2UWFA 3SM0A 1VCFA 2AKZA 1QOQA 1RK5A 4IF2A 3T0DA 4I7WA 1GQLA 4IQJA 4G6CA 1Q45A 2GQ8A 1YXCA 1KGWA 1OFPA 7REQB 2IMRA 1Q6FA 1TCDA 3GXMA 1HL2A 1I0DA 4EIVA 3AMDA 1EP3A 2QUVA 2ZA3A 3UCQA 2QGYA 1D3GA 2PURA 4JEJA 4B5VA 3G8EA 3NNTA 3L2LA 4NAEA 3G1DA 3IAPA 5FF4A 3NL3A 2YCIX 1W9UA 1MNSA 1E1EA 4V27A 4L6HA 1KRBC 1IYXA 5LKYA 5CBBA 1ZGDA 2UY3A 1H1ZA 1EUAA 1UIOA 4Q4OA 2BFGA 1V6UA 1EX1A 2C16A 1MNZA 4HPHA 1R3QA 4HNCA 2BY3A 2V67A 4J2PA 4PYSA 2QPUA 1YXYA 3HJZA 4CQBA 4AX6A 1PZ2A 3P5YA 4GYPC 1W2PA 4RJEA 4DIAA 1VFSA 3NAVA 2YCKX 3V7PA 1UQZA 1EOMA 5AHEA 4J5NA 4GIAA 2WSPA 2R8WA 2NSXA 3W73A 2ZA1A 4MNMA 2QNEA 3LRKA 4UQBA 4U31A 1VEMA 2VFIA 3KOWA 2VYOA 1XLBA 3VGGA 5REQA 3W00A 1F7BA 3ZMRA 3EKGA 1XFCA 2Y6ZA 2RDXA 1QOPA 3N4AA 3MMTA 3KX6A 4ZQCA 2D3LA 1GOMA 3RRXA 2X30A 1DWGM 3D47A 4RLIA 4XKMA 4HVXA 2CW6A 4RE3A 1YX1A 3UGVA 3W07A 1XGEA 3VNDA 4CEUC 1ZJHA 1OSEA 4HSHA 3QFEA 4ICNA 2GL5A 3VXGA 2XN1A 3M0HA 3VKAA 4DJDD 1JDAA 3CQHA 1A3WA 1JFXA 2NXIA 1BEUA 4QJ4B 5CPLA 2X0YA 1XLKA 3JZUA 2QCDA 5TNVA 4S1FA 1CT5A 3WEZA 4PTDA 2GGJA 3N2TA 4P7QA 5M17A 1H09A 3LYEA 1UYQA 2C6QA 2CLEA 4BEUA 4QG9A 4JTQA 3VABA 4YWSA 4UQ9A 1US3A 3C0QA 1GG0A 3WDHA 4H6RA 1ZAJA 2WB5A 4UQCA 1EHNA 4UMBA 4H1ZA 3I7SA 3TQ0A 4JDYA 4F2UA 2W27A 4FIQA 3NZRA 4DVOA 2WLYA 3VMNA 2AL2B 1G0CA 1AH4A 1AQ0A 2D24A 4DO5A 2DZWA 1UHVA 4S3BA 1O7AA 3OLIA 2V5JA 1IIGA 4H7VA 1XPGA 1R9YA 1AH0A 1JNEA 2E8ZA 4CD6A 1E6SM 4JQ1A 1KW1A 4A3HA 3GSMA 3BCJA 4L80A 5A6BA 1DJYA 5L9FA 3FN9A 4NNAA 1PYMA 4CNSA 3F4VA 7PTDA 4PMYA 1DTUA 1KFBA 5SWUA 2NUYA 4D72A 3VTRA 1GQKA 2PDIA 2B7OA 4K36A 5CPOA 1XF0A 5DY3A 1BG4A 3VFCA 4O12A 5I3KA 1IE7C 3GO2A 3T4WA 3B0VC 1F3XA 3C2OA 2FFCA 1H49A 3ES8A 2VVSA 1UD2A 2YCEA 3PTDA 4J3UA 3ES7A 1FWGC 1JG9A 2AQVA 4BI6A 1HTIA 3DUGA 3IJIA 3NZPA 1DXFA 2QF7A 3S9YA 4KRZA 3A21A 3AXMA 3RX3A 1R2RA 5DBUA 3V1HA 1KFEA 4WHBA 4OU1A 3SN0A 2YLAA 1DP0A 3JU2A 1U5JA 4RV8A 1CXFA 3QR3A 3MCOA 3AIQA 2WBGA 2DUXA 3RJXA 2FZ9A 1BXBA 1XCXA 1A5OC 1R7AA 1UC4A 1QTWA 5HR6A 4GINA 4M6PA 1YE6A 1GONA 1J0JA 1GZGA 1E0XA 4W7WA 1NELA 4BWLC 3LNMA 1S39A 3PBGA 2D23A 4JTUA 3E02A 4NJHA 5K3VA 2VQUA 3ZVHB 5FEXA 4HNOA 4GKTA 1QPKA 1OVDA 5MKGB 3WD0A 1RSCA 3AC0A 1DJNA 1AVAA 5HQMA 2YA0A 4R5EA 2WMKA 3F5LA 4P8VA 4B5NA 4GIYA 1REQA 2W4XA 4UTFA 1MEIA 2XTKA 4CQDA 3SRDA 1YPFA 3PPFA 2DVTA 1ITUA 2Z25A 4UTJA 2VO5A 4R3UA 3PBWA 2GWNA 2FJKA 3GB6A 1P6CA 3RU6A 4DPQA 5HNTA 3KW3A 4K7YA 4KCUA 3VA8A 1XJBA 4D8LA 1L2UA 2EG8A 3AMCA 4U3CA 3WH5A 1IZKA 1DJGA 1OK4A 1NFBA 2VR4A 4TUFA 4IFKA 2WSKA 5D8WA 4Q8WA 5CC3A 2XDFA 1DWJM 1ALDA 4OIFA 2YIHA 2Y63A 3T81A 2NQLA 4UCGA 1Z9AA 3CQKA 4JX5A 4JQ3A 3W1QA 1KWGA 1HXJA 1D3CA 1WKDA 4V2XA 2Y8UA 3VMOA 5JIPA 4GUGA 4Y6GA 4O8RA 3GU2A 1XLLA 1UOKA 1QNQA 3ZJKA 3A4JA 3MUZ1 1QO5A 2DZPA 1UWAA 1M41A 4I5RA 4ZB0A 2H90A 4LRSA 4QS5A 3BJTA 3EOLA 1M7PA 2EO7A 2J7GA 1R3WA 3UJSA 3GFYA 5A8MA 3IUDA 4R34A 4C1NA 2F6UA 4Q33A 2X0SA 4DWSC 2E5CA 3BAWA 4X3ZA 3FA5A 1F8MA 1KXHA 3EEGA 3SSZA 2W63A 1ECEA 5D04C 3U6WA 1O5RA 2ONEA 2DT1A 2QR6A 3IGUA 3GTNA 3KOYA 1MEWA 1XIJA 1IEXA 1E55A 4HU3A 5D4YA 1FUYA 4B90A 4NVTA 3MSDA 2QEZA 3MYPA 2ZYFA 1QMLA 2WO5A 2G50A 3TN3A 1KKRA 1O6IA 2P50A 2H8XA 1S2AA 1EDTA 1FP9A 2ACSA 3E6EA 1FCQA 4AX7A 4DI8A 2VX6A 3G1RA 2DUAA 4GWEA 3FFSA 3TQKA 3LLXA 3CZGA 3F03K 3Q45A 1E5NA 1F07A 1RJRA 1W3JA 2ZRUA 1XGDA 4TX6A 1B90A 2XH0A 3C2FA 3N4FA 3HJEA 2WHKA 1P43A 3CV7A 5ABEA 1TQJA 3M0MA 4HN8A 2YR1A 2CLKA 3QOKA 3GVQA 1NEYA 4X22A 1GPWA 5A8PA 3AICA 1VYRA 1VZWA 1WDRA 3F2CA 3TDFA 4NAEB 5C9XA 4FF7A 3WNKA 3EKZA 4KWWA 2V68A 4HHPA 4I9JA 3L4VA 4KFNA 4CD8A 1JAEA 4FP1A 4JN6A 4QTGA 2WK2A 3GLCA 1TX2A 2YDSA 3GW3A 3W71A 2OZ8A 1P6WA 1PO9A 4RZ5A 2JQXA 2OZTA 3TAOA 2NWSA 1W32A 3F4WA 3P80A 1E0VA 3L4YA 1HUVA 4QAIA 8XIMA 3TTQA 2NV2A 3VPLA 5HJLA 2PWEA 1VBGA 2C1IA 3G24A 4LBRA 1ITXA 1XLGA 3CHEA 1ME8A 1ISWA 2HXTA 3G6MA 2DW7A 4CNTA 2SFPA 4IFRA 2QDEA 2ZXDA 4DJED 4JHOA 4S3DA 4ERGA 4EPDC 3OB8A 2PDHA 3F4DA 5DXYA 2Y7GA 4JTKA 4FSAA 3HU7A 3MWCA 2CERA 4JIIX 4GBDA 1HO4A 1Q85A 3BG5A 2VP8A 2FGBA 1J5TA 5I3IA 1VP5A 3BC9A 1W6TA 2ANUA 3AS2A 3U57A 3PZ9A 3G1HA 2DQWA 4H9XA 2WC3A 1P1XA 3FHAA 1C7TA 2XVNA 2BXVA 3AXHA 3BLKA 5AYIA 4DJFA 1VCGA 2YBUA 3B0UX 1UD4A 4RUBA 4HA4A 4O28A 5TD4A 1A0EA 4K8GA 3NGFA 4NF7A 2R94A 3GG7A 4LYKA 1FWNA 1NH6A 1LUCA 2XU2A 3I68A 4A4AA 4A29A 1UROA 3SURA 2R6OA 1VLWA 4D9PA 4ZFMA 4UFHA 4Z1DA 3U2CA 3RYSA 3AIEA 2QCDB 4QSFA 1T96A 3TW7A 3WF3A 3H2NA 3KLKA 4LU0A 4EAMA 3QMRA 1XIBA 4Q6JA 1E6PA 2JBMA 3ATYA 3LCIA 3ARSA 1DTNA 4UNLA 3AIWA 2TSYA 2FPTA 3VD4A 3FVDA 1TMHA 3KVJA 2AMGA 4JTDA 5C2GA 3HQOA 4ZXOA 1JGMA 3S6TA 2J9XA 3CMJA 3SY8A 3BE7A 2HNEA 4LVBA 3TCEA 4FS9A 4OE7A 1JCTA 4Z17A 2OELA 4AISA 3QJAA 3OZMA 5HANA 1GW1A 4MB5A 1UR3M 1A50A 5DCEA 5FD0A 3O05A 4M81A 3CT2A 1X8FA 5LIYX 2H6RA 1B3VA 3QTPA 3LV6A 2IPJA 4XZHA 3U2ZA 2VMFA 3E5PA 3LTPA 4M6VA 4IWWA 4PTWA 3P60A 4P61A 3O07A 3VM7A 2WXDM 2GDVA 2ZIDA 1J12A 4ZQRA 3W7NA 5E6YA 1HN1A 3G77A 5DQPA 4J3SA 4DYKA 3NQDA 3QBUA 5G2IA 1EXPA 2I9EA 3E2QA 3DIPA 3MVIA 3WFLA 3SIZA 3ZJ6A 5LXXA 2P5NA 4UTMA 1EUNA 1XL9A 2E9BA 3H70A 4JNZA 1ZUAX 1OGGA 4JIQA 1XCFA 2BXYA 1J2BA 2O9TA 4XD3A 3GU1A 2XIMA 1TX0A 3ANUA 5F2IA 3LU2A 3M6YA 2GGEA 3DFNA 3LCLA 4B2DD 5IBXC 3DFHA 3PTMA 4XD6A 2TYSA 1ZRQA 2QAPA 3CZ8A 4C6PA 3MTWA 1RPKA 1GNXA 3OEXA 4CUCA 2I9UA 3W7MA 2WSQA 4TXEA 1Q2SA 3UWZA 4E2VA 2X1RA 2DSZA 4JTHA 5CZ0A 2FIQA 1JNDA 3I6EA 2GJNA 3WF2A 1QXLA 1ZP3A 2WMGA 3STFA 1RA0A 2INEA 1MVYA 4M7SA 3R25A 2WQDA 3U0HA 1MQQA 3W2LA 1B4KA 1GW9A 4LGXA 4ROPA 3WH9A 3WLJA 2CZEA 3QQWA 5D02A 1E9LA 1S46A 1A4MA 3BSHA 1XRVA 1FWDC 4DPPA 3M46A 3ZLFA 3GZAA 5FL0A 5HNNA 3IUIA 3O06A 2YL9A 1T40A 1ZY9A 1UR1A 4US6A 1WNOA 1REQB 4QEHA 4AF0B 1OBAA 4J3VA 2D2JA 4H4IA 1WDWA 3U4FA 4H8HA 5XINA 5HJYA 3NWRA 3B8UA 1A5CA 4ES4A 1BYCA 1SVDA 4DXXA 1QW7A 4JTLA 5G1YA 2WKLA 2CYGA 2O7QA 3C2VA 3WLIA 3QYQA 4W7VA 3HMCA 2YX0A 4JNYA 1OHLA 2JEQA 3G6LA 4Y96A 1KM3A 4F2BA 5E6ZA 2ZTKA 1V0LA 3GVRA 2QJJA 1YTDA 5EL1A 3E9AA 5CKSA 3E38A 3WK3A 1QW9A 1K7FA 4NZ5A 2NLIA 5J8LA 1O94A 3QHNA 1QHOA 5TQLA 3AYVA 1R3VA 2J6VA 4O57A 4LVFA 4YLWA 4AZBA 3GR8A 5AYBA 3DFYA 2X8RA 2GK1B 1SZRA 1G6CA 4ASTA 2ZX5A 4MDOA 1UUQA 4CU8A 2NQJA 3C61A 3V18A 2CU0A 5CC6A 3EX3A 3LLDA 3IJ7A 3YPIA 1A5NC 2OXNA 4AMAA 2FQIA 5M2FX 5HQEA 2ZUWA 1OC7A 3GR7A 4H8VA 4B16A 1DJWA 3HF3A 3G5EA 1RP8A 3WQ5A 3PB2A 2PDFA 2W5FA 2EKGA 4JHMA 1E6NA 3SB0A 3KZSA 3HGOA 2Y8KA 1MRQA 2AGKA 2VWTA 4M3PA 4UQAA 3W37A 1W8SA 4C1KA 3ITYA 3H23A 3UJEA 1XUUA 1RVGA 2UZ9A 3HOJA 3TXZA 4PH6A 3C0JA 4TTGA 1KTNA 1LTDA 1F61A 2Z2BA 3W7JA 3C3NA 3RM8A 4UZSA 3TMLA 3KRZA 1T99A 4DUWA 1V5XA 4RXGA 4M51A 2JGQA 4MY9A 4LS1A 1W1TA 1RLCL 2E6FA 2VJXA 3ITOA 1KXTA 3PG9A 1XLIA 1FKXA 1PIIA 3RF9A 4PUUA 2Y1HA 3IAQA 3DYPA 5FACA 3DFSA 2C19A 4K6AA 1JDFA 3SAZA 3UZYA 1UR2A 1ZHAA 3SN4A 3N2MA 4O52A 3NQCA 1ITCA 3ARQA 4CQAA 4IPJA 4O17A 1A47A 5D30A 3LEPA 4GUHA 4IIGA 2BB0A 2E1DA 4X2PA 4PTNA 3VDGA 5HOSA 3M4HA 2PU0A 4ORIA 4MB1A 1GJWA 3DBNA 4C6EA 1S2CA 4LBUA 4LS2A 1SQ7A 1LLOA 1WP6A 2VFEA 4XZMX 3W38A 5G1MA 4TMCA 3FSUA 3O6CA 3D6NA 3S6DA 4G9PA 3RR1A 2WOQA 2IUZA 5C9UA 2WKGA 3UXAA 2AQWA 1BWVA 1H7OA 1HFBA 1S2WA 2X1UA 1GOQA 3B8DA 1PEZA 2ISFA 2C7FA 1Q6GA 2FZDA 3CO8A 1B2YA 1S2VA 2D20A 1AJ2A 5KZMA 1XS2A 2TAAA 1OGSA 1YBQB 2BOEX 3AHTA 3CJPA 5LNUA 3EX1A 4H19A 4TMBA 3VGDA 4KRUA 2PA6A 1DBTA 3A24A 3VD9A 3PP7A 1LRNA 2ZX6A 2ZZ5A 4XZNX 1HKWA 3L9CA 1FWFC 4W88A 3PZVA 3SUUA 3CQJA 4AEFA 3K4AA 4QCFA 4XTIA 1GOOA 2CWNA 3QZ6A 3IWPA 4DO6A 1GYMA 1ITQA 4NZ4A 2PTYA 3NTYA 3AISA 5K2ZA 1QPQA 1QW8A 2J88A 1G4SA 2X7WA 5GNYA 3OO2A 1F3TA 3GY1A 1D7KA 5FESA 3P2VA 1W9BM 4YVXA 4HK7A 4A21A 1XINA 4V15A 4HPNA 4WKHA 2TMDA 1VJIA 3SQSA 3C86A 1ISVA 4TQTA 4ZSUA 4X63A 1NDVA 3C0SA 2PCQA 1KRCC 3AYRA 3CQIA 3MANA 1LUCB 4PRRA 1EEPA 2CBIA 2J6XA 3E74A 4ZOCA 1J0YA 1WXZA 4NU7A 4XQ6A 3PS7A 1E6ZA 1O1HA 1HG3A 2ZDSA 5E0CA 1MWOA 1BG9A 1EWEA 1FH7A 3H2CA 3SRKA 1JUEA 2AGTA 2V38A 4IXHA 4AUBA 1NAL1 3DZ1A 1HIZA 3DHPA 3FA3A 4ONVA 3BLFA 2EHHA 3FAXA 1US2A 2VEKA 2CLLA 4FXRA 4RR4A 3LHVA 5E93A 3SCOA 3VNMA 2WPGA 2G4FA 3WK1A 1N8IA 3QEZA 5HATA 3W3OA 2DU2A 3HPAA 1VFTA 2C3ZA 3VNKA 2YZ5A 2FH8A 4B4FA 1Q6CA 3NYZA 1S3TC 1OZMA 2YL5A 3BAIA 3NO5A 4ALDA 3W23A 1W9XA 2PU1A 1V7YA 1VD6A 4PFHA 4IPPA 3TAKA 4MLRA 1EF2A 2VZOA 4A6GA 3KCLA 3E2VA 4ATLA 2PD5A 4WQ6A 1HKKA 1PB0A 5D38A 4DBUA 3P5ZA 5CZKA 2PBOA 1DWHM 3S4TA 1HJUA 2C15A 2ACRA 1ISZA 3A5VA 5JUVA 1JYVA 1H11A 5A2CA 5D9MA 3FGCA 3W84A 4AWSA 3NVTA 3DG3A 4Z0JA 1BTMA 4H7CA 1XICA 4Z2LA 2DVUA 1EJSC 5K9CA 4FX7A 1NQKA 4MJMA 1G4TA 5CG7A 4OUIA 4PMZA 4WOQA 3MW7A 3BW3A 4O16A 3ZR5A 4ZO9A 3LZ3A 3GDTA 3WLOA 3PZUA 3OIXA 1I1WA 2W61A 4A2SA 4NY2A 4ATDA 2X16A 2WMIB 3T78A 3Q37A 1F6YA 1H7XA 4HQVA 5AVNA 4Z1YA 3VDHA 9CGTA 1CGTA 1C7SA 1LYXA 3GKFA 4JQ4A 2FTPA 4MKNA 1POKA 2ZZ7A 1JPHA 4KF1A 1DV7A 4Q4QA 1E3XA 4S3GA 4F0LA 1GT8A 2JE8A 4D8ZA 3NQ7A 3VKKA 2WHMA 3GG8A 2W66A 3H4XA 4M19A 4CQ8A 1KBKA 1Z41A 2B7PA 3VKCA 5A6KA 4IX0A 1B9ZA 4AYGA 3WQEA 1UD6A 2I1OA 3KE0A 1K6WA 3UERA 3AUJA 2HE5A 2Z1XA 3IRDA 1BVZA 1SM9A 3S47A 2Z1BA 4XB3A 2GVJA 3R6IA 2WVTA 3ZOAA 3DYOA 4GX9A 3OHIA 2WNWA 3DHUA 1NF7A 1K8YA 3UBPC 4D6IA 3EOUA 2H8ZA 4GZEA 3IIZA 2FMNA 2X05A 2OEKA 2PRLA 3PJXA 5I5RA 5I79A 1EC7A 4KERA 5MF5A 1XH1A 3EDKA 4D6GA 3RCNA 4QQUA 1L0PA 3CUFA 4ZQNA 1A53A 3CIXA 2QAFA 1K7XA 3AZTA 3WH7A 4PFMA 3TN4A 1R87A 1XI3A 4GCXA 3MSGA 1K4HA 4L65A 3ENLA 4JL1A 5DT5A 2DQXA 3AAMA 3A3XA 1DVJA 4WLCA 3SRFA 1V51A 2FZNA 1HGWA 1EP2A 1BKHA 2Q02A 3MI2A 1F6PA 2E5DA 4KGJA 3JUGA 1M7JA 3OIHA 3L4XA 2YA1A 2AKMA 2VUYA 3GXTA 2J75A 2P0IA 3PG8A 3S9ZA 4AIUA 2BS9A 1B57A 2J74A 4UFLA 2NUWA 2D1ZA 3MVTA 3TFCA 4UR8A 1I0BA 2E77A 2GGIA 4UOQA 3EMQA 1GVRA 4QM1A 4URIA 3WJYA 3HA1A 3E0LA 1EYEA 4NP7A 4RE4A 5HINA 2J8FA 3M6DA 2HROA 1E40A 1FWCC 2BVTA 1OK6A 3LERA 4MJ4A 4AHQA 2CLPA 3NURA 3SSJA 1CTNA 3DAQA 1VHCA 4C5YA 4GD0A 2HXUA 5CLWA 1O12A 4FLRA 3UJFA 4RPQA 4MKSA 1K9TA 3QRHA 3G1XA 1B1YA 5I24A 1TVNA 3K2GA 2VCAA 1EPXA 2F9RA 3BURA 1TFVA 3S5ZA 3VOGA 1BF6A 1EJUC 2WWDA 1EEXA 2E6AA 4D6EA 1GEHA 3ABZA 5LSMA 4CVUA 4AEOA 2XIBA 3MCNA 4GYJA 4CVWA 1BXNA 3CZKA 3R13A 1CI1A 6ENLA 5CGMA 4AD0A 3P93A 4LSBA 3VMPA 4LUIA 4JTIA 2X1IA 3AXIA 1ELSA 1OCNA 1Y65A 3UZXA 1I2PA 3CT7A 1E9YB 2E28A 5HUOA 1XRFA 4P7LA 3CMFA 3N4EA 1XG3A 1GOXA 2C18A 4GPNA 4A8RA 4REQA 4AB4A 1G4EA 1K77A 1L6GA 1I60A 3UPMA 4DJFC 3CTLA 2PI6A 4O54A 3P74A 4GG9A 2OQYA 2ICSA 3KBWA 3T9PA 4W84A 4WR3A 1T8XA 4NIRA 3NM1A 2JIWA 3HG5A 3GFZA 1RR2A 3IANA 2OGJA 3TOPA 4HOZA 4PCPA 4AC7C 4GQRA 3K8KA 2OGYA 5FKYA 1W5QA 3QFWA 3PFMA 3THQA 4U5KA 2W91A 3GXNA 5G4WA 4Z42C 1W1B1 4WSJA 1E4LA 5C70A 3K8LA 1X98A 2HE8A 3OVGA 4H8UA 1MYRA 3M47A 4DBWA 5I06A 5KETA 3B0YA 4ZCWA 4YTQA 3DCPA 2E09A 3TTYA 1OM0A 3LXBA 3LHWA 1KRMA 1FKWA 1CX9A 3CBWA 2RDWA 3GS6A 1V3LA 2WV8A 4OBSA 2GVYA 2MUCA 1SZEA 1DEDA 1Q6DA 2DZBA 5HPOA 3UYCA 1S38A 1HJQA 2ZX9A 1OD8A 2HVNA 3AJ7A 1LL6A 1DJIA 3OVPA 3N1AA 3B4UA 1E4NA 1OFOA 1JRBA 3UWVA 4C7GA 1PAMA 2BDQA 2HZGA 3WG6A 1LT8A 4Q4PA 3C3UA 3UZ5A 4Y90A 3QOMA 1DIDA 2QUNA 2CBVA 2Z4GA 3TXVA 1VIZA 3KL3A 5I00A 3MT1A 3EWBX 1ZENA 1U33A 1YW1A 5C0QA 3BLIA 3IUHA 4UWMA 3TTSA 2NQHA 2QMJA 3W25A 1B3YA 4FNRA 1UKQA 2GGGA 1WO2A 4GGBA 4LNCA 3N17A 3V36A 3EDFA 1LWJA 3WQFA 1W56A 3B8WA 2Z27A 3KL0A 4FA3A 3I65A 1XLCA 3BAYA 4O4WA 1YDOA 2XJ7A 4W93A 4EVZA 2J77A 1ZQ5A 3HFYA 3FEQA 2DZTA 2C13A 3A5FA 3AQUA 5T9CE 4HZ7A 4ML9A 3UZWA 1KM5A 4ZVJA 1R7OA 1T0OA 1L8NA 5A2AA 3NQ6A 3W26A 1YNQA 2A85A 1OX4A 3P81A 3AFBA 1KXVA 2Q71A 4HK5A 4IMAA 6TAAA 1TELA 1E73M 3A6OA 4M80A 3AMKA 5KZ6A 1GKPA 3KS6A 3GRIA 4YPJA 4LEFA 4XSLA 5A94A 1BTCA 1W3HA 1J2WA 3TONA 2J66A 1ZBVA 5AZ0A 3LTSA 4KETA 4QQ3A 3W29A 4M1RA 4CCCA 4WSKA 5H2ZA 1Y7VA 2GWGA 2XM2A 1G7UA 3TKFA 1E9ZB 3EEZA 2HJPA 1R47A 4U4MA 3AUOA 1FWEC 4JNMA 1W8GA 2NZLA 2VEPA 4O0ZA 4EK7A 3BMXA 3S83A 4BI7A 4ZBCA 3T1GA 5F4WA 3HV8A 2E9MA 3BLEA 3VDBA 3MP4A 4MB4A 3RM4A 1XLEA 4WJEA 3NO3A 3PZQA 3H7VA 1I4NA 4DEFA 4Q4MA 3U3HA 3CB3A 3VNLA 2C0AA 4C6IA 4XIAA 2QJHA 1Q2RA 1MW2A 2QHAA 3A64A 3U9IA 2X40A 4FMVA 4GJJA 2EXOA 3RXZA 4XWUA 3ZSSA 3T2PA 1YKWA 3FGCB 1S5WA 4B2DA 3P0WA 4QG6A 4JX6A 2WNZA 2BBFA 1LQAA 3XIMA 3I7QA 5I78A 4IX2A 4L1XA 3EA3A 3QW3A 4DBEA 2Z26A 1UWSA 3T2QA 4WKFA 1GVEA 1VC4A 2BG5A 1RCQA 1IEWA 3OGSA 3IARA 3UA3A 3IPWA 1OFQA 2OKTA 3WLMA 3CUHA 2VFFA 1ZJIA 1YQ2A 4QNWA 2PFHA 4GO8A 2QDDA 3C56A 4A8IA 1BVWA 2X0HA 3LPOA 3IVTA 1JUKA 3D3AA 3NQGA 1HKJA 3FIGA 3MS8A 3WNNA 1ZAHA 2QJGA 3LZ5A 3ZYZA 2IPWA 4L4PA 1OINA 1LZOA 2DZVA 3GVWA 1UUMA 4PC8A 4LRTA 5HA7A 1UG6A 3R0KA 1NF0A 1CGUA 2C71A 5CZSA 1LLZA 2V3FA 5G2WA 4L9YA 1KR0A 1ODZA 3H2OA 3NL2A 1NU5A 4DRSA 5DMYA 2PMQA 2I57A 3CNYA 3KRUA 1QI3A 4PUMA 2QUMA 4FX8A 1E4MM 3M0XA 5PTDA 2ISWA 2W6RA 3KBVA 1EB3A 1CXKA 5FF2A 3ABOA 2O4MA 4KMQA 4NAFA 4NNBA 3KBMA 3CHVA 1XIIA 1YPIA 2JIEA 3BAXA 1JFHA 3MP5A 4LT9A 3QZEA 5H91A 4AQLA 2RKXA 1ONWA 3FLUA 5F2LA 1C9DA 4RNJA 1UOZA 4WDWA 1QPOA 3FXGA 1VYSX 1JD7A 2A6LA 1OB0A 3SECA 3N2OA 3TJLA 1A4LA 4CQ9A 4CD7A 4K1GA 3AHYA 2PDUA 4LANA 1VBHA 3WF1A 4AD3A 1UMLA 1X38A 3UF9A 4YCPA 1GVIA 1WCGA 1UQYA 1QBAA 2QCHA 1EIXA 3QSTA 3WZ0E 3ZXWA 2DSUA 3LA4A 4H6KA 4UIOA 3KLLA 4JEQA 1C8VA 4IIBA 4OUEA 5C54A 3P61A 3VGHA 3ABSA 4G2DA 3L4ZA 4HPXA 1RLDA 3N6JA 2CNCA 4XBKA 3G1VA 3UG8A 1E0TA 3WLQA 3SO7A 5EGRA 4BQ4A 3HB9A 3I6TA 1A0CA 5DFAA 4YTSA 4Q22A 3M0VA 3NDOA 1FVPA 1KWKA 2ABBA 3N73A 4IPIA 1JZ6A 2CEQA 2IS7A 2OOFA 3AIVA 1XSIA 1AA1B 1VBRA 2ISDA 3TOYA 1QNSA 1JPMA 3H2FA 4LUSB 5CCZA 3AYTA 3H2EA 4GX8A 3WIJA 2QV5A 2WC7A 3E2SA 4D6HA 3BCDA 1G67A 1G5AA 1PCWA 3W6LA 2OLAA 4MGGA 2E9LA 2VNCA 5DANA 3HV9A 2HS6A 1IGWA 1JRCA 4WGHA 2YJQA 3T40A 4LH8A 2KX9A 4KEVA 5HPCA 1A0DA 3SY5A 2R1KA 1EFZA 4HYWA 1JDEA 3CV2A 4IGSA 1YNYA 2Q3RA 5JXQA 4TVUA 4UBPC 1EO5A 3HO8A 1MW1A 1UWIA 1FHDA 4MWAD 1NOUA 2HPIA 4ZGYA 4REQB 2YSWA 5JVLA 1JCYA 1L6SA 2ACQA 4KIEA 3R4IA 1E51A 4N6FA 2WSYA 4Y9NA 4PBEA 1TTIA 3NPXA 4U3AA 4AWTA 1AMKA 1GVSA 3TYEA 3NOYA 4AG0A 2PF8A 4O1DA 4NASA 4ZOEA 3C52A 3NJ3A 4Y2WA 3QLDA 4C7FA 5G2HA 4RNHA 1C92A 1UW9A 5FJOA 1CB7B 1SFLA 1CXEA 4N9DA 4AIBA 4EPKA 3LMYA 4PTXA 4H8NA 2VC9A 3WBAA 3M5ZA 3GNPA 2I5IA 1XWYA 4BKNA 1XQKA 4P8WA 3NQVA 1EWDA 3BOLA 4PL1A 4Y9OA 3URAA 5DXXA 4AD1A 2OO6A 3WO8A 3ZM8A 1V79A 3EWCA 1Q65A 1OCBA 3IJQA 1S3HA 4AY8A 4GACA 1CYGA 3PTKA 4JDBA 4MB3A 2TPSA 2PF0A 1JD9A 3HGJA 1FXPA 1OFRA 3RLGA 2P1FA 3H26A 1OCJA 3ORWA 1HW6A 1SPQA 1OZQA 3DHDA 3NEVA 1LOLA 3NL6A 4KESA 3UR2A 1Y5XA 5A6LA 1V93A 4E4FA 1DHPA 2PODA 1SFTA 2X2YA 4GE8A 1XV8A 3NQFA 1N7KA 4B9YA 4L4OA 3W7PA 2VD9A 2C8NA 3OVRA 4L5ZA 3AROA 2Z00A 1M65A 4GZIA 1U5VA 4A8LA 2ZE0A 1W1YA 5KZEA 1SO4A 3T7VA 3T2OA 1X96A 5BNKA 3WUBA 4DQWA 2NX3A 3AZSA 4O18A 4MPQA 4UTLA 1ZPTA 2O7SA 3MO4A 1OWQA 3ONBA 2HNHA 1NSJA 2D0HA 4GZ7A 1K8XA 2FGZA 2QIIA 2WCSA 4LV9A 7ODCA 2GOKA 2PDKA 3DG7A 3QV6A 2Y2WA 4W87A 3O1NA 3HTWA 3R5EA 2O9RA 2WAGA 4MIMA 1CBGA 1K8ZA 1Z6KA 3QYSA 5D2YA 3WDRA 3GIPA 3GNRA 2BGQA 3WJXA 4IQDA 4QXIA 1M68A 3RM9A 1JGIA 1OX4B 2WCAA 2OSWA 4G7EB 1GVQA 2XSAA 1JL8A 1WE5A 5CPSA 3R2GA 5LIKX 1GORA 1AG1O 2WSRA 4B4HA 3UD6A 1R8LA 2OU4A 3CLMA 2PEVA 3NSNA 1A3HA 2XIQA 3N19B 3LY0A 2ZUSA 3TTOA 2IPFA 3HBLA 3M7SA 4XAFA 3N2CA 1V02E 4Z2KA 3NUKA 3DXIA 4CQCA 1A80A 4LUTA 3Q2DA 1KCXA 4GH3A 4LFYA 3U2OA 4CEXC 3CUJA 4Q7NA 2CKRA 2XZ7A 4N4PA 5BXRA 3WUFA 3GXIA 1GQJA 1QNOA 4F0SA 2WZMA 5ABGA 6A3HA 2H3BA 1TV4A 1XP3A 1KTCA 1MSSA 3PY2A 2OMAA 1GQIA 3GR4A 1Z89A 4NRRA 3BG9A 3EAUA 3GUGA 3FJ6A 3WBWA 4AH7A 3DECA 4QE4A 4YVVA 3B3DA 1MXDA 4EXBA 2QQ6A 1GVOA 2X41A 3TN6A 4O10A 5BRQA 2OQHA 4HGXA 1P0KA 4JQAA 1MDLA 2E7FA 4IMFA 3LSBA 1FH9A 5U7SA 1L6WA 4GC4A 4MNLA 1K02A 1E1FA 1SZFA 3K1DA 2J13A 3GVGA 3DC0A 3S1UA 3AHVA 3QTGA 5G4EA 4OFCA 4Q32A 1QI4A 3QPYA 3SADA 1FBAA 5HXMA 4G1NA 4FEZA 3UWQA 1EL3A 2FLIA 2ON3A 2WJZA 1VH7A 3CL6A 2PWVA 2BGSA 1AL7A 4E8CA 1IZJA 3GZ3A 3MI3A 3WH8A 4LQ1A 4HNVA 4LXFA 4C6DA 3AIBA 1WAUA 3LQLA 3BICA 3M7WA 3O0FA 1XDLA 4ZOBA 3SCSA 1XD1A 1VS1A 3AMLA 2VXNA 3UPWA 5AN7A 2J9YA 4J35A 3CPGA 4AWEA 2ATMA 4GXWA 2ZUTA 4LAZA 4HT3A 1H1NA 5HWMA 1XRSA 4WDUA 4YMZA 9XIAA 4HA1A 3UPBA 2IKIA 1E72M 5AC7A 2PZ0A 5JMUA 1VIWA 3W6YA 2NQ5A 3MMWA 3VD7A 1N55A 2J4GA 4ZO8A 4UTWA 5G4HC 4BF5A 4TR9A 4JYDA 1IZCA 4R88A 6XIMA 4UTKA 4HHLA 5HBFA 2P8CA 4NAFB 4MYXA 1R46A 1KFJA 5B7ZA 4GISA 4PMUA 3VCNA 3ZR4A 1BVNP 4J3TA 2OT1A 2G3FA 4A3YA 3EB3A 4LUYA 1QI5A 2GGHA 2NUXA 1XIDA 5CQ1A 2VC7A 1PTDA 2O4QA 3QZAA 4QFUA 3O6DA 2VFGA 5C5YA 1UR0A 2PWUA 4MKVA 4C5ZA 1KCLA 5ABTA 5D2TA 2VDHA 4FOUA 4B9ZA 2C1GA 1X6NA 4RZBA 4GJIA 4WY0F 4XZBA 4I6KA 4IGNA 3W24A 4WK9A 1J0IA 4IHCA 5I03A 2Z6JA 1X1ZA 2D22A 4O4VA 1DWFM 1ZNNA 1TTPA 3PHAA 2FGLA 4I6VA 3WJWA 4AY1A 4YVPA 1KTBA 4EWND 3OW1A 4KEUA 4N4QA 3BQ5A 4M1BA 2C14A 4KQNA 4HA0A 3VD5A 3THDA 3CH0A 5IFPA 4TVDA 4ZTYA 2VR5A 1ME9A 1FDZA 5D37A 3KWXA 2Y8VA 1AL8A 4OTKA 4FK9A 3V1PA 1KQZA 3TSDA 5CPTA 2GDUA 4E2BA 3PF3A 3W7CA 1M5WA 4IP5A 1FWHC 1M04A 3FXYA 1TZ9A 3LUTA 5DN1A 1LBLA 1I2QA 4U5IA 1HL8A 4M29A 3CTTA 3MKVA 2GYIA 4GH1A 3G1SA 4O14A 3W22A 2FVLA 4LB3A 4I8DA 1XBVA 3JS3A 3L0KA 2BVYA 3BO9A 3KVLA 4WXZA 4CNNA 2H9AB 1O68A 3WD3A 4AZGA 2FFIA 4LALA 3DI1A 4U2ZA 2DP3A 3KHJA 1RA5A 5CGQA 2F38A 3REQA 2DSWA 4S3KA 1KBIA 3WF4A 4DWDA 4Y7EA 4JGDA 3WBXA 2OZ3A 1YIXA 4MPKA 1TPWA 4Y9PA 2A4AA 4NL1A 5K4XA 2PUZA 1JXKA 3PNZA 1LLWA 4F9JA 2J62A 5J5DA 4MFEA 4NYYA 1A5MC 2PE4A 2DIKA 3MC5A 3HQPA 4FALA 5E0KA 3ARXA 3ITTA 5F2GA 1MI3A 3NPVA 2VD8A 2NV9A 4NXSA 1VR6A 2Y85A 4WCJA 5IHRA 1AODA 3MUCA 2JKPA 3W85A 2FDMA 4IL2A 4JR5A 4PULA 1UH2A 4IIDA 2PPGA 2HCVA 1Q8JA 1O5XA 3B04A 7A3HA 1XLDA 1VPQA 3SUSA 3V75A 3PULA 1Q13A 2WYSA 3KS5A 2A7RA 1D7FA 3WQGA 2Z1KA 1UC5A 3F5KA 1V08A 3ZR6A 4IIHA 3IRSA 2Y88A 1F5ZA 3H4GA 2Q8ZA 4QSHA 4OQVA 2BODX 1A5BA 1YLVA 2QCCA 3NFUA 1XLAA 2JKEA 3APYA 1F4AA 4W9TA 1FWSA 5TIMA 4PMXA 2HDJA 1WXYA 3HN3A 3POCA 2BHZA 1PWMA 4Q4KA 4RDVA 1R38A 1X1NA 4GIEA 4Q8VA 2YL6A 3H24A 5AC6A 3TH6A 3ZS4A 3WD4A 3VE9A 2MANA 3WLNA 1JR1A 2OYMA 2ACUA 1YADA 4HSNA 3CPUA 3UNTA 3OZOA 2VZSA 4PRTA 2GFTA 3UESA 1JYWA 3KAOA 5C9ZA 3FCPA 4HCDA 4E2OA 3IIPA 1VAHA 1Z44A 2J24A 4Q8NA 4HPJA 5HMSA 1IR1A 1RK6A 2JK2A 2AL1A 2ZBTA 4H04A 3MO7A 3N34A 4BQ5A 3URNA 2A6NA 2G41A 3L5AA 1E5JA 3IVSA 4L6DA 3KWSA 1XR2A 3PPHA 4DELA 3M64A 3MDUA 4H6EA 1XLJA 4EKJA 3TU9A 2Z1WA 1P5BA 3BG3A 1WKEA 3K5XA 1SW0A 4XVEA 4QS6A 1LRQA 3CHCA 2R14A 1V3MA 4POCA 4XKYA 1IHIA 5GPRA 3D46A 3FS2A 4AD5A 1QNRA 4WXYA 3R1ZA 2NT1A 4XBJA 4XUYA 1NJJA 4RX0A 1R3RA 1FDYA 1E6QM 1OT1A 3NOEA 2ZZ2A 2XGBA 2REQA 5FSEC 5DCBA 2YL8A 4LUTB 1F3WA 2V0TA 3BGAA 2VCCA 1FXQA 1AD4A 1H50A 1PS9A 3APTA 3RX2A 1Y8BA 4YU1A 3V5CA 3ZJ7A 3L4WA 4FLOA 4I7UA 1IEVA 4TX8A 3TYBA 1Q63A 1LQ0A 3DN5A 4QDPA 3JW7A 4LOCA 5DO8A 4I90A 4S39A 2CITA 4PB3A 4QIUA 4KFOA 3EOSA 4JOMA 5H8MA 1TJRA 1GVFA 3A12A 4GMEA 2CZFA 5G1TA 2ZRZA 1JI2A 3NZQA 3TLLA 5FEWA 3PUOA 3LENA 1ZL1A 2W3ZA 1TPEA 4IG2A 3VCCA 3LQGA 4D2JA 1BD0A 4JFSA 4CU7A 2FPYA 2NVAA 3COTA 1VRDA 5DY2A 4DWSB 1KA9F 4IT1A 5EMMA 3DBPA 5FEZA 2YFNA 4UCFA 2Z2UA 4UZUA 2VZTA 2XIJA 4GVIA 1HJWA 3NL5A 3PB0A 4GYFA 2HMCA 2CLHA 3QW4B 4XAZA 4MNJA 1ZAIA 4PE8A 4BY3A 2GSJA 1KFLA 4H9VA 1PKMA 1OD0A 4Z0SA 3K30A 1J10A 4MLJA 3W28A 3SGZA 5A6MA 3K4DA 5F4XA 1M9HA 5M5DA 3WBYA 3GTHA 1DPMA 4V28A 3VIJA 1LF1A 4EF9A 2YOCA 6PTDA 1D8WA 1KCKA 1MZRA 4MG4A 4PGLA 3CUGA 4HIBA 3HGRA 4GJ1A 3QY6A 3VE7A 5J5RA 5AYXA 3GHRA 3SBFA 1KRAC 3LCFA 2AOSA 1CXLA 3QMSA 4HJWA 2WWCA 2VX7A 2VX4A 3CIVA 2A1YA 1TIWA 1TWSA 4YHGA 5AHIA 1DXIA 3RMEA 1CGXA 2O92A 3QV8A 1V6WA 3W82A 2FTYA 3UJRA 1DQXA 5C55A 3RIKA 4X0VA 3PZIA 1VFMA 1JYXA 2V82A 4B5XA 1TWDA 5A2BA 1J4EA 3OZPA 4S38A 1WUEA 2XH4A 2WLZA 1IXQA 4ZTXA 3GHUA 1JCMP 1CXIA 3LNPA 5H8PA 1RZMA 3UG4A 3MHUA 3N15A 3CAKA 5KTLA 3EXRA 4MZ1A 5HJXA 4KWSA 1X7FA 5GNXA 5BU9A 6REQA 3CU2A 1M7XA 3QHMA 5A1AA 2WHLA 5CXPA 3W88A 5EKYA 3RGTA 4BQ2A 1HKMA 5BXPA 1V0NA 4JYFA 4O13A 1OFBA 4PSPA 1SR9A 4UUIA 3AYSA 3BMVA 2OX4A 4YS1A 2P76A 4BFAA 1HKIA 3FW6A 2V81A 2F2HA 1XX1A 4WUIA 5LIWX 3LDVA 2VCBA 1JCLA 2DFAA 4W86A 3N04A 3VAVA 3VO0A 3TR9A 2QV4A 1IR2A 4RZ4A 1A5SA 3CYJA 2VL4A 4QLJA 4JY8A 3TE9A 4U33A 5BCAA 3QR0A 4RDYA 2BHYA 4R33A 4LWWA 2RUSA 3L2IA 3URQA 3L0NA 3EDEA 4W7UA 2PDXA 1OY0A 2V5CA 1F2JA 1SW7A 3W2UA 2QULA 3BARA 2CPUA 1Q8AA 4UB9A 1PCKA 2JEPA 2OT0A 1JPDX 1PTAA 1WAWA 1AJZA 1ADSA 2CHOA 3BH4A 4RPPA 4PUWA 4MWAA 5KZDA 2OLHA 1O4UA 3LM3A 3MU7A 2DW6A 4XX6A 4ZZ9A 2DH2A 3EDJA 4JTEA 5I3JA 1BXCA 1B3OA 4HNLA 1OF6A 4GA8A 4S3JA 4IP4A 2RH9A 1EX5A 1QWGA 3ATZA 2B7NA 1OFEA 3A9BA 2QT3A 1XRTA 4JPGA 4E38A 1K9FA 2OG9A 3T05A 3TV8A 4F3HA 2EPOA 5AC4A 3KZPA 1G1YA 1ZBKA 3CAQA 1R6WA 2QCEA 1QT1A 2IKJA 2XSXA 2B4GA 4LCQA 3SCNA 4X9YA 3GDLA 1HVQA 4NJKA 5BRPA 3QN3A 1BYDA 4G56A 1PZ0A 4WKAA 3TC6A 2VDIA 2NT0A 1OADA 4UOZA 4GO9A 1E6RA 3VYLA 3ZIZA 1FHVA 1OQFA 4PODA 5BMWA 4HZ6A 3NDZA 2GJRA 4NNCA 2YCJA 3B4YA 2YYUA 4EANA 3E2RA 1VLIA 4UTUA 4DN1A 4QJ3B 3WBEA 4UMCA 2VUNA 4EXQA 4ZE4A 2BV9A 3LM7A 2QIWA 3SCVA 4HNUA 3GYEA 3RUBL 3SN1A 3ZO9A 2V6AA 1KM0A 2RJHA 3RCMA 3RRAA 1NP0A 1CPUA 5D03A 2V63A 5BU6A 4AZIA 1KFWA 2PZNA 3VDCA 1XIGA 2ZDRA 3TN5A 2ZC1A 3KOXA 2GSHA 3G0SA 3M0KA 1W9DM 2AQOA 4RZ6A 1B9BA 3HPFA 4GI8A 2Q3OA 3QGVA 3RO8A 3T8QA 4GIRA 5EMYA 1E0UA 1B31A 1VBUA 4DZ5A 4K7VA 4LC6A 4C6KA 1E1CA 2DEPA 2W92A 3O8AA 1PXGA 4J40A 1EC9A 4P7OA 4UTTA 4CD4A 2A5HA 3L23A 1XIFA 3G2GA 3L0GA 1K9DA 2EJ1A 5I3FA 4IICA 4JTSA 1T41A 3QKEA 5E9AA 4XG1A 3HPZA 2V69A 5H1WA 2QUTA 3FVMA 4GUIA 3UWWA 2ZXQA 5FF7A 1MUMA 4E6MA 2WANA 1PKLA 1M1BA 4NT0A 1JZ5A 1EA9C 1ECQA 3MSRA 2J78A 4O0QA 5LZLA 4KEMA 5A6SA 2D2HA 4S3FA 1BWLA 3R0UA 1P7TA 1ZB5A 3GE7A 3NGJA 2E6YA 4AXKA 2VFHA 4A3RA 4LTSA 3RDKA 1XFBA 3AMGA 5HNRA 3B8IA 6TIMA 3FJLA 1PBGA 3E0FA 3ITVA 4PL2A 1R5YA 1OFAA 1FOBA 3I3EA 5AY7A 4LEQA 1OF8A 4GY1A 2PWFA 3RLVA 2P53A 4NI8A 2PGWA 4JTJA 4PN2A 2WNNA 3TWAA 5EMUA 1RV8A 4XISA 5C9WA 1C8QA 5FEPA 1UUOA 4XKYB 3L5MA 3R0DA 4E4PA 2GZXA 1M7OA 1EJRC 5IM51 3TK7A 4US5A 4UTWC 1MO0A 5D2WA 5CG0A 1H60A 2G8ZA 3BSMA 3LBOA 4C91A 4JTRA 3IK4A 1JCXA 4WEVX 1TVPA 2QJMA 3TIMA 4NRSA 1OIMA 2ZUMA 5KINA 2ZWYA 2ZVIA 1DE6A 3CO4A 3ARVA 1TE1A 3PWAA 3CUZA 4LCSA 5L6UA 1YDNA 1CGWA 1G01A 3RCYA 1QK0A 1EO7A 5BOOA 3NA8A 4JKMA 1TKKA 5C9RA 1LROA 2KZHA 3B97A 2VC5A 4Y9AA 1Z32X 4HA3A 3W2NA 2EG7A 3EX4A 4UQEA 4NYUA 3LGEA 4P5UA 3PN8A 1C91A 2Q09A 4N9CA 3WLTA 2OB3A 4PB5A 4C6MA 4RCXA 2ZADA 4PMQA 2DSVA 1YRRA 5F1UA 3V4BA 3BLPX 3UYIA 4QE1A 4DYEA 3ZLHA 3BOXA 4OOUA 2NX9A 3SFKA 1JEZA 4K8HA 1Y5VA 5I3HA 2GJPA 4FXSA 1SJCA 1XYFA 4ACYA 1TV2A 2G3NA 1G94A 1AFSA 3TA9A 2VRJA 4HHMA 3C8FA 3TWBA 4PCNA 3CWHA 2E3ZA 4YN5A 4RNFA 2HS8A 4J3WA 3IIXA 4MNKA 3NSXA 5DMLA 2QW5A 5D2XA 2VHLA 3FYOA 5REQB 3ZQ9A 4FLSA 1QNVA 3G22A 1TO3A 2CKSA 1BLIA 3KOFA 1SUXA 2W9MA 4L1GA 2G4JA 3G1FA 3L67A 4K39A 4JD4A 1LBMA 3VNZA 4O1EA 1RHCA 5CPMA 1PIGA 3BZGA 3LD5A 1KD0A 1P1MA 2ZZ6A 4FXFA 3VGBA 4QISA 3ID7A 3N9RA 5CJNA 2RDUA 3AIUA 4N02A 3SCPA 4EF8A 2P10A 3DG6A 3GWQA 5HMFA 4AZ5A 2BASA 1WKYA 3QGAC 2PLKA 4LB4A 1L6YA 4H2HA 1TWIA 1GHSA 4AZCA 3LGGA 3R89A 4E3VA 3L21A 3UZZA 4A2RA 1NY1A 2PDGA 3PBVA 3EX6A 4JFTA 5RUBA 3A9IA 4D6JA 4LY4A 4XV0A 1YTKA 4G7FA 2NQZA 3OOQA 2F6XA 2HBXA 2FHBA 2VGGA 1SJDA 3UR8A 4J7RA 1V3JA 1LWIA 2CWXA 1WV2A 3SFWA 4HTYA 5IDZA 5D2VA 1UD5A 3AS3A 5C7HA 2PB1A 4O50A 4BJHA 2J8GA 4KT2A 4LV4A 4H9YA 1CEOA 4EX4A 1TIMA 2YCLA 1C90A 1GG1A 2HRWA 2F84A 1K03A 1UR4A 1YXDA 1OYCA 6REQB 4KH2A 3UXLA 8A3HA 2G3MA 3UG5A 3BV4A 3QGKC 3SEPA 2WM0A 3CL7A 5DRCA 1UWRA 3LRMA 4R53A 2VEIA 3P84A 3RU8X 3WD2A 4MADA 3RLHA 3W6MA 2VGFA 1XIEA 3RG6A 5FJUA 1S2TA 3EPOA 5FF0A 3CS2A 5I77A 3P0XA 3KUMA 1ZP4A 1LORA 1P6BA 4H2CA 1KV5A 2ZRXA 4ADTA 5K7JA 3CHDA 3IV8A 3LHUA 4PMRA 2PBGA 2QZRA 1W3LA 2BVDA 4O1CA 3I4EA 1UIPA 3AXKA 1GOWA 4GVGA 5HULA 1AMYA 3GDMA 2VX5A 4CGTA 4BEQA 3HGSA 1DWAM 2DJXA 1XXXA 3MHFA 4HMEA 3ABXA 9RUBA 1U1JA 1NDWA 1VB9A 3IJLA 4BF9A 4PBGA 2BNJA 5LNWA 3FOKA 3CLWA 4M5PA 1O95A 1JCJA 4MWAB 3VIOA 2QPXA 3AO0A 2GJXA 3OTRA 2H3DA 3VIHA 4HZMA 4GXPA 4KBXA 3PTQA 4W8AA 4MYAA 3QHOA 1CNVA 3TUUA 1C8XA 1QPNA 1XYBA 2BLEA 4HMNA 1GJPA 4TIMA 5AYZA 1ADOA 4RL3A 3MSYA 3TR2A 3VX1A 1UP2A 1H7WA 4IMGA 3M0YA 1Z48A 2G3IA 4IXXA 1JVNA 1GOKA 4E2DA 3SZ8A 4ZSTA 3TJ4A 1BQGA 3FAWA 5H8UA 3O63A 2NX1A 1N82A 5EFFA 4H00A 5A3HA 2Y61A 4MY1A 1FCBA 3NQBA 4M8UA 4J27A 2W67A 3WDJA 3GIYA 3FX4A 4QR6A 2E6DA 2WZHA 4AZ7A 4J28A 1XYMA 5JBFA 1YDVA 1AQMA 2BVWA 2WJEA 3EMCA 4QNEA 4KKXA 4AZHA 1RP9A 2LLEA 3N29A 4IPLA 3IJ9A 5LNSA 2WM1A 3PFRA 3GU9A 5IOBA 4NXKA 3ITGA 3ARRA 4Q8QA 2HK0A 1LRTA 1NFGA 3VUSA 4GC3A 2VI0A 3S5YA 4IFKB 2OZ0A 3VGEA 1BRLA 2EAWA 1QHZA 1AZ2A 2J7FA 1SSDA 1KO0A 4JICA 3P82A 1EA0A 1MRAA 4YHEA 3PZGA 4L4LA 1Z3NA 4EWJA 1KBBA 2VURA 4GLEA 3OP2A 2FZ8A 4CCZA 3GH7A 4X60A 4UFMA 1AD1A 1NTHA 4ZQOA 1H7PA 3LOTA 1EQCA 1J96A 3W53A 1W3KA 4JAWA 1U1UA 2EPNA 4QG8A 2WW5A 1VRXA 1CW2A 3WFZA 3APGA 1DORA 1UWQA 3MUAA 7TIMA 1DIOA 2UY5A 1H4PA 3G3MA 3W7DA 3JVAA 4PCFA 4ZB2A 4C1NB 5KMYA 3W76A 3WQCA 4HNTA 4GNVA 4MFDA 4H9ZA 1FA2A 3D0CA 3B0XA 1ZZMA 3TROA 1TV7A 4W5ZA 1P4CA 2A21A 1EXBA 3VU2A 2ZRVA 2V2DA 1I75A 4INFA 2HV5A 4TV6A 1Q4NX 1P7TB 3QQ0A 3KEHA 3EGJA 4XAYA 2QJIA 4XTDA 3UNDA 1JI1A 3W1PA 3PSVA 1FWJC 4WZHA 1V3IA 5LHEA 4XVDA 3UQNA 2NVCA 4JBRA 1KNWA 4V1XA 1ZALA 3QXBA 3B0PA 2FYMA 1XLMA 1Z69A 4EXAA 3N9KA 1H0IA 3RJYA 2WZIA 4JY9A 3DESA 1R2TA 2PDWA 3MI6A 3BSGA 1IXNA 1EP1A 3CASA 3NDYA 2XPKA 1HQTA 1CXHA 4AZ6A 4L9XA 4BS0A 2YW3A 4GUFA 2C79A 4X2RA 1HZYA 3SJNA 1EJWC 3GH4A 1JULA 5CSYA 1DE5A 1TTQA 3F4CA 2XH2A 1PHQA 1T5AA 4Q6XA 1UKSA 3RILA 3VFLA 4B3KA 1XLHA 1ONRA 5DBTA 4K68A 3EPNA 3SY1A 4QP0A 2WKJA 4GUJA 2E40A 3OLEA 4IJCA 1RQEA 1C8YA 2VWSA 2D0GA 4D1JA 3STPA 2OKOA 3NPUA 5JH1A 2BMBA 1WX0A 4NJJA 3N9SA 3PBMA 2NXGA 3A13A 1AUSL 3LB0A 3Q94A 4IPNB 2CCRA 4ICMA 3IJ6A 1J18A 4QHRA 3UU0A 4PTMA 3BGJA 4YWIA 3GNXA 3AWOA 2X7VA 1ZU8A 4U2YA 1I6NA 4DLMA 1X8CA 3HURA 1GYNA 4LF1A 3A4AA 2RDTA 4GVHA 3BZJA 1UB3A 3VIGA 4U10A 1FWBC 3WK0A 3RFAA 2E0PA 1XM3A 4TX9A 4QE5A 2O9PA 5GJNA 3MWAA 2ABAA 4M0XA 2BY0A 4AXNA 3WNMA 4MY8A 2EBNA 1AK5A 2CLIA 3CV1A 4DO4A 1PKYA 1BAGA 4DJDA 3B06A 3VX0A 1K8CA 2ZX7A 3GNNA 1QFEA 4DZHA 4PMDA 4LVGA 1G69A 2XVKA 5CZJA 1XBYA 2Z24A 5EY5A 3ICJA 4OBTA 1W3TA 4LAOA 4MUPA 2XFFA 5A8GA 5F4SA 4LVDA 2R24A 1IEQA 5E1QA 1C29A 1K4GA 4JCMA 4KS0A 1JAKA 2VRKA 1TV5A 3ITXA 3LG3A 2G96A 3AS0A 3LGDA 2ISVA 4FOKA 3VGFA 4YTUA 4MWAC 3E0IA 1JQXA 3E0VA 5CAKA 5FJIA 5ECVA 3B8TA 2OYLA 3P6LA 2Y5JA 1J0KA 4AZCB 2YB4A 2PGFA 3R8RA 3LX9A 3W4RA 3W72A 4JTGA 2A2IA 1UKPA 2VR2A 3BQ6A 3NG3A 1UKTA 1WZMA 1BQCA 2OEJA 3QV7A 3PPCA 1TWZA 3CV6A 1LCOA 3BGGA 1GGOA 1N8FA 4MZ8A 1DL3A 3TFXA 3FJNA 2Y62A 4E0CA 1R3SA 2A3AA 1G9HA 1XG4A 2BOGX 1XW8A 3WLHA 1SU5A 2Z6IA 2UV8G 5GJPA 4BQ3A 4AC1X 2HWGA 1Z42A 2PP1A 3O2LA 3G8RA 3O15A 4IQLA 5CLTA 1ISXA 4DY1A 2FHFA 1XYLA 3GDBA 1CLXA 1XCWA 3KFTA 1S2UA 5D8ZA 5FA5A 3S1XA 4N42A 5HMDA 2YCLB 5XIMA 5HAOA 3L2MA 1PTGA 1MUWA 3TA6A 1KR1A 3MYOA 4KFPA 3WL0A 3KCOA 4OGZA 3EPMA 2DZSA 3LI1A 4FNPA 1TCMA 2FB2A 3S1WA 3I3BA 3KXQA 4BF7A 4GXMA 4WRHA 3FDGA 4YIWA 3GH5A 1SW3A 3PZOA 4ZFCA 3SCTA 2B81A 3C6CA 2PP0A 3GC2A 3ITCA 1QASA 1GYLA 3Q58A 1W1ZA 5M1TA 2PLCA 1XC6A 1HO1A 3WEOA 1GJUA 2PTDA 2QPSA 1TTJA 4RKAA 3BL3A 4ZA0A 1TRDA 4AHOA 3CIWA 2X2GA 4GQ0A 3WUEA 5A5WA 4GY0A 2OSXA 3RHGA 4AMCA 5EBAA 1HVXA 3EA1A 4PUKA 2RGMA 3KBJA 1EQPA 5E09A 1KM2A 1UZ1A 3ELFA 3N13A 2IQ0A 3R7MA 3H2AA 1XYCA 4D8AA 1AQHA 1IV8A 1DIEA 3IACA 4GKLA 1CLKA 4R27A 2PC4A 1T6MA 3FEMA 3EOEA 3AI0A 4WDTA 5FJTA 1F9CA 4UTTC 2JF7A 5I09A 2XIIA 1P0EA 1GCYA 1JZ7A 3UCCA 2A79A 3WH6A 2D2GA 2GJXB 3VM5A 1LL4A 1R2SA 1W5MA 1TPFA 3L65A 4FNQA 3O16A 1JCNA 4UTHA 5HWNA 5LNRA 2WHJA 1FHLA 1RUSA 4XAPA 1K1DA 2VRQA 4DF0A 3MPGA 3TW9A 2OO0A 3CHFA 4TTUA 3ZLGA 1KM6A 2F61A 2FB3A 3R11A 4HCLA 2WBKA 3LCGA 5I7GA 1ZJBA 1OG6A 4LAKA 2PP3A 1W2VA 3ZVIA 5FOOA 3SUWA 3LLFA 5FJJA 5EFDA 1AW1A 2A3EA 1UBPC 3J7HA 7TAAA 1R0MA 1RBOB 1CGYA 3MDWA 4GFIA 5EPDA 4K1WA 3WNLA 1EZ2A 1FWIC 3EOOA 4RDWA 3VI2A 1SMAA 3STCA 1H1YA 3ISIX 3BTNA 3WF0A 4DXVA 3RPMA 2Z7KA 3NCOA 1NWSA 4BI5A 2GQ3A 3PANA 5FI8A 4V33A 1KLZA 3KDOA 4A05A 4ZL1A 1WDSA 3PUGA 1AH3A 3CZLA 1T7LA 3I10A 3WD1A 4XZIA 2WMFA 3U8GA 2CXGA 5CJ5A 3ARPA 4J9JA 3VNIA 3S2MA 3UW6A 2JFEX 1BRLB 3V5OA 4XD4A 4AF0A 4IGHA 3VZXA 2PD9A 5JBDA 3M44A 3HG4A 5A95A 3HQ1A 3S46A 1FFQA 3WLRA 4XZWA 4I9AA 4UMAA 3MY9A 5C8BB 2XVLA 1RJQA 4O15A 5I23A 5GJMA 5I2UA 3HPXA 4DUOA 2IW0A 2QCFA 8XIAA 4F8XA 3T55A 2E1WA 3TYDA 5G5IA 4L56A 3O9NA 1M01A 4HMDA 1XDJA 5KITA 4C6QA 3LPPA 2WQPA 3QM3A 4Q3MA 1FWAC 4IIEA 1CECA 3A3WA 1FTXA 2CLOA 4OVXA 4WOZA 4DM1A 3P67A 1BF2A 1V7AA 4IMCA 3DGBA 3OQEA 1RJPA 3M9YA 1EH9A 1S5TA 2GK1A 4R9XA 2W0UA 5H6HA 3R8GA 3C2RA 3CXOA 4D6FA 1UZ4A 3DFQA 3LBCA 4PMVA 1HJXA 3H54A 4HYRA 3CM4A 2PWHA 1HP4A 3VC5A 3LRLA 5LXEA 4NSBA 2FVKA 4IJRA 2XWDA 3G1AA 1TV3A 3T0BA 3WSUA 2J7DA 1DYSA 4I3GA 4IJBA 2WZTA 1R86A 2RJGA 1J79A 2ZA2A 3WKZA 3HQNA 3T0TA 2GUYA 4QDMA 5HMEA 1O5KA 3SW6A 4JXCA 1EJVC 4NZ3A 8TIMA 3GQYA 4PEEA 5LA2A 2VM8A 4YYFA 1PJ9A 3QLLA 3GBEA 3SJ3A 3E12A 5CSSA 5DEZA 5GQBA 2P0OA 3ONCA 2G97A 1EPVA 1W1A1 1IGSA 5BWFA 1ZFJA 3KBNA 2ADAA 4JCLA 2C0HA 3UT0A 2PDJA 5EU9A 3RMJA 3MZNA 1RH9A 3VIKA 1PWLA 1EC8A 3PZMA 1IWAA 3MJMA 4LNYA 3WQ4A 1WQ5A 3W7HA 1XD0A 3RITA 4Y9MA 2ZRYA 4WIWA 4MF4A 1WZLA 2X42A 3A3HA 4I9MA 1TREA 4FI4A 3WJZA 5AC5A 1UP0A 4W4QA 4C6BA 4DJEA 5HQLA 2PTXA 2ESCA 2XFRA 1T8QA 2ZRWA 3PM6A 4GQBA 4CD5A 3VOJA 1MW0A 1QBBA 3M16A 3H7UA 1I2NA 1RBLA 1JDDA 1HT6A 1H3GA 4LJ3A 5MHBA 2GQ9A 3H8AA 1FQ0A 4L61A 4DYJA 1VGAA 2DV0A 1TR1A 4QJ1A 2BP1A 4F40A 1I45A 1OYAA 1XUZA 4UQDA 2FH6A 3WENA 4IIFA 3G3DA 3RAOA 3UXKA 3BLLA 3S6OA 4HOXA 1C93A 4EP8C 3ALGA 2QDGA 1NARA 4ZQPA 5BRBA 4H9MA 2XGZA 4LS0A 2FKPA 2ZUUA 4MOZA 1THFD 3OBKA 3F1QA 1H51A 4FR1A 2F8QA 1TMLA 4WY0A 4ILSA 3DFOA 1LL7A 4OZOA 1YBQA 3S2CA 5DRIA 3QQ1A 2A3LA 4N0RA 3A4XA 1TPUA 4C7DA 5AC8A 2GVGA 2NWRA 1OX5A 4OECA 3IVUA 2IQTA 2XYLA 2PDPA 2VT0A 3E5BA 3WLSA 3M0ZA 2PGRA 1KBLA 5LGXA 5LYRA 3W83A 4FR6A 1K9EA 1R85A 1TA3A 1JZ3A 3PNUA 3U5UA 4PMOA 3DENA 1K70A 3DC8A 4JX4A 5CPNA 3QPZA 3OPSA 3VNYA 2RFGA 1EHAA 1H5YA 3UZJA 4J3ZA 3S3GA 5E5CA 3MMDA 1YPXA 1HNYA 1SSGA 5CSRA 3PJWA 1IQ8A 5D09A 1GUVA 1XC4A 3FSTA 3OLGA 4W8BA 4AFYA 3VKJA 3W02A 1AZ1A 3M43A 3W2MA 1H7RA 4KW2A 2XM1A 4EE9A 1GOIA 3UVIA 7CGTA 6XIAA 5AHMA 2XIOA 1E9IA 4NKCA 3G0UA 1MDRA 4RW3A 1TUXA 1M3UA 1Q6OA 5BXSA 4PBFA 3IEBA 4P2VA 3GBDA 2VELA 2Y7EA 4HSOA 3TYUA 2FTWA 4RE2A 1UMYA 4MJ2A 3TVAA 1WXJA 4MHBA 1CENA 4NX5A 1DWIM 1H5VA 1BGGA 3FY1A 5A6AA 1I2OA 3L68A 1L8PA 1NDYA 2Y89A 5FF3A 1WBHA 2IKHA 2XSBA 4OT7A 4JZ5A 1OGBA 3WQDA 1TPDA 2CLMA 3W7QA 4PRWA 2I16A 5TF0A 4PZVA 2YFOA 3M0IA 4XD5A 2PCEA 3N6HA 1Q7QA 4ZENA 4KPLA 3AU6A 1O5QA 2WVVA 4ATWA 2HK1A 1SMDA 4C6NA 3BK0A 4ENLA 4HTBA 5E0FA 4Y8EA 2E5BA 2NLYA 2WMJA 2CETA 1B54A 1HJSA 1NVMA 3N2XA 4J4KA 4O53A 4YYCA 4UOJA 1V03A 5IXEA 3G1YA 1XYZA 1Q66A 3G0XA 3RPDA 2XGIA 3KBSA 3T0CA 1XBXA 4GK8A 2HTMA 4DBDA 1Q5MA 1BWKA 2P8BA 3FA4A 4A35A 4AVOA 1GK8A 3GG0A 4ZXLA 4NHVA 2YDQA 1IT7A 4C6FA 2X1TA 1FHUA 2WMIA 2WPBA 3QC3A 3ERPA 1NFPA 4UC5A 3UXIA 1QAPA 2CIPA 1V6TA 1SJAA 1JPIA 3Q65A 1WYIA 3ZJ8A 2CZDA 2GSEA 3SCWA 4F4RA 1JZ8A 4BA0A 5DCDA 1ZJAA 2ASHA 3C5QA 2JF6A 3WQWA 1KKOA 5ABFA 3R94A 3E0WA 1B3XA 4KWVA 1Q6EA 1Q7ZA 3PAOA 4AW7A 4O11A 3CEUA 3NSMA 1DJZA 1U2YA 4Q8OA 3LK6A 5B7YA 4C65A 3KTCA 1OIFA 2PDCA 2Z28A 2Z1VA 2E4TA 3IV3A 4FB7A 2NVDA 3ANYA 1EGVA 3WLPA 2J7HA 1VKFA 5CAHA 1UKOA 3GAKA 4CN6A 4XZ9A 2B31A 4BHYA 4TVCA 5AHLA 3QY7A 5M3WA 1E4IA 3MZ2A 1NQ6A 4KCTA 4YJ5A 3WMBA 4WSHA 3VIFA 5AYYA 4PTVA 3FDKA 2VEGA 4WD0A 4Z1BA 3IGXA 1XLFA 1RD6A 3QSRA 3W1XA 2PSNA 5JU6A 3O3RA 1V3HA 1SR0A 2BSLA 2JKAA 3S9IA 1XGZA 2VFDA 2VQTA 1XSKA 2QF8A 2OPJA 2I17A 2OX1A 5F2MA 3KOZA 3W9ZA 5T91A 2J8TA 1GZ1A 4XSMA 2KAUC 3ARZA 1XSJA 3RX4A 1ENUA 2VGIA 3WELA 1TPVA 3A4WA 2PLMA 2YDAA 3ARTA 3VUPA 3IK2A 3CUXA 1UJPA 1TPB1 4E8GA 5DT7A 3KP1A 4UFJA 1NDZA 3UETA 1OC5A 1U1HA 4AVNA 3ABQA 2J7CA 3R12A 3S2NA 5IRPA 2DY3A 5GVJA 2G0WA 3W0KA 1J0ZA 4GGHA 4DJDC 3O7UA 4XO7A 2GPTA 3VIIA 1ZCOA 4RW5A 1JZ2A 1GHRA 2VENA 1V0MA 4KWUA 4U28A 4L6OA 4GQGA 3H53A 2Z1SA 3BW4A 4XAGA 3JR2A 1U83A 4OV9A 1XIMA 1QO2A 5K9XA 1V8EA 3FK4A 2CXEA 3IS4A 5BMXA 3C0LA 3VILA 3TZNA 3QR1A 4OHQA 4LYRA 3M5VA 3VIMA 2WJDA 3EB2A 2X1SA 2ZE3A 3C4UA 3W7LA 1RCXB 1ZLPA 3M5XA 1UPMB 1UA7A 3KL5A 3VZYA 3WN6A 2UBPC 3THCA 1CZ1A 3VNJA 4AVFA 4I8YA 4HU8A 5FSDC 4BR1A 1V77A 4L9ZA 1FWRA 1NWRA 2O55A 1MFUA 1JPKA 2V2CA 1SZNA 3NXFA 4GZJA 3MBDA 1J11A 1SO5A 2QMKA 4DX3A 2Q01A 3DHFA 1EBHA 1NWUA 3DKJA 1U22A 1PV8A 3U5YA 1EOKA 3V16A 2FJUB 3G18A 3AHZA 2FHCA 4NQ1A 3SQMA 1XYAA 1LOSA 1Q3NA 2QKFA 3ZT6A 3PUDA 2V3EA 4NX0A 3N18A 2GVLA 3AALA 1PYFA 5EB8A 5C6MA 4EPBC 1F74A 5FJPA 3GTXA 3H4WA 3PPGA 5AFDA 2ZXAA 5DF0A 5I0DA 3IIVA 4XBSA 2VZVA 4R7OA 3WDQA 3RO6A 4EAYA 3K4WA 3N6QA 2V5KA 4FOJA 3WCZA 1KBJA 2YXOA 5GNZA 4ZEPA 3FHQA 4C6JA 2AAAA 3DFPA 2C1HA 2QJNA 4DM2A 4JQ2A 4I5XA 1ICQA 3QKZA 5D05A 1BSLA 3L4TA 1Q7MA 4F2TA 5EBUA 1U5HA 5CBIA 3PZNA 1PPIA 1TZ7A 1GEQA 1EYWA 1TMQA 3LS9A 2EG6A 4WY0B 1I8JA 1YEYA 9XIMA 3OLDA 1WOAA 4N6EA 5BROA 1J8VA 2V30A 3LCHA 2BXZA 3TX9A 3S2JA 3T44A 4CN4A 4IM4A 4P8UA 4H6QA 2V3GA 3TTEA 3W70A 4ECLA 2X09A 3K8MA 3VVGA 2NSOA 4PUDA 3HG3A 5CGTA 1OCQA 1SGJA 4JFWA 3NVDA 3LN3A 4H9UA 5CC5A 2D2OA 3PWGA 1F3EA 3HG2A 2YDRA 1EBGA 1TA3B 5ABHA 2ZZ1A 4NJGA 1W0MA 4FZIA 3CC1A 1SZGA 1VFUA 3OQ8A 4FF5A 3I7RA 3M5YA 6ALDA 3CB8A 3UVAA 3MB9A 1RY8A 3CZEA 3ZWSA 1S5NA 1LQ2A 3B8SA 3WK2A 3CGTA 1KGUA 4JTAA 4Q8TA 5E9XA 1R9XA 1UBSA 3NXLA 2UY2A 1VF8A 4HMCA 1CGVA 2PWGA 1Y5WA 3EWZA 2WCGA 1GKRA 4QBXA 2QS8A 4KWOA 1JIBA 3M41A 3WQVA 4P8XA 3DFTA 3NQAA 2DVXA 5A69A 1P48A 1DHKA 1ONXA 1S5MA 2V3DA 3T07A 3I4KA 4ICCX 2EPKX 4IFOA 3UJ2A 3CAWA 1HP5A 5TBOA 2HSAA 1VFHA 1V0KA 3W7RA 2ISSA 3AWNA 1OT2A 4I9TA 4JIEA 3RNDA 3ZT5A 4TO8A 4K37A 3PWIA 1OYBA 2PAJA 1SO3A 2Q8LA 4CNPA 2I56A 4E4UA 1FCVA 4H7ZA 1H7NA 1ESWA 4JN8A 4B91A 1CDGA 1J6OA 2A0NA 3P62A 4UNIA 2VOTA 4LW7A 3OG3A 3DU0A 2WVVB 1LG2A 1W9PA 4MUZA 3EWDA 4EOUA 3CMGA 2PTWA 1O66A 1ADDA 3W7EA 1K6AA 1WDPA 4HU0A 3B40A 1OC6A 1Q6LA 2R1NA 3WQPA 5JH2A 5F1VA 3RK8A 5BZAA 3W75A 1W31A 3OGRA 3UY8A 2JALA 3XINA 1PX8A 3PVFA 2TRSA 2J47A 3SCRA 3WMCA 3GDRA 1BHGA 1QUMA 4OBRA 1E0WA 2DDXA 2WZEA 3B9OA 5T8GA 1RCOB 1JXJA 2DJLA 1D9EA 3VK5A 4JHZA 3UA4A 2D73A 3NQMA 1VFFA 1NWTA 5AZ1A 4QITA 2VKZG 4RDZA 4UFIA 3PAJA 1SO6A 3DERA 5EA9A 3H6OA 1CIUA 4DWSD 5A8NA 1GPFA 1RD5A 3OZYA 1ISYA 1P0DA 2P3EA 3W1NA 3GYCA 2DUZA 1OABA 2CBUA 5F7UA 2V5LA 4PMJA 4FNSA 1ME7A 4QDWA 4Z2HA 3K13A 4MAVA 5ABFB 3GFXA 4V1YA 3F2DA 4NI3A 2ZICA 1FDJA 5T9BG 4KCWA 4ZB5A 5AOUA 4AD4A 3BOFA 2OODA 4Z2JA 2EEXA 1C3FA 3HIJA 2WMHA 2PRHA 1X97A 3GXDA 4A8NA 2QCMA 3UGRA 1O60A 3GNDA 5ECUA 4D71A 3LCXA 3NZGA 3TCSA 4GNJA 4ERAA 4PUNA 2E8YA 3E96A 1X6LA 4CU6A 3MKCA 4PCSA 3T0AA 2INFA 4AY7A 1D3HA 3NQ8A 1UWUA 2CBJA 3KHDA 5M03A 4PEKA 3TYCA 3IJDA 4O1AA 3TMQA 2OQLA 4Q4SA 4ZO7A 3P3BA 1G4PA 4DJEC 4AYSA 1Q6RA 1MMFA 3UY7A 3N3TA 4H83A 1ZTVA 1QRQA 4B5SA 4HB7A 4BCEA 1KCZA 3EZ4A 1F73A 2XFWA 1AJ0A 3HZ3A 1V3KA 1PKNA 1D2KA 5J04A 2OFJA 4R7JA 4QGCA 4BK9A 4DXKA 3D3FA 3TJIA 4AHPA 3EB4A 2YGYA 4W5UA 7XIMA 4I7VA 4O8AA 3S0CA 3BDKA 4EACA 4ZR8A 1GTEA 4K2SA 1ONEA 3SCUA 4CN1A 1OG0A 3T09A 4DHGA 2J25A 3QPEA 2OVLA 1DQUA 4ACZA 5B80A 1MXSA 5AKQA 4TV5A 2QUUA 2YZRA 2W79A 2OWCA 4JKKA 3BMWA 3ME3A 3BUVA 3KTSA 4E5TA 3TQPA 1PVNA 1US0A 4LUSA 2F2KA 4B5WA 1CWYA 3WQ8A 3FNDA 1IXPA 2WVSA 2ZZ4A 4X0NA 1WBJA 3E49A 3U4AA 4Z2IA 4JFUA 3R79A 4N2YA 5KSWA 3DGRA 1JJKA 2WC4A 4LAUA 2FDSA 2XH7A 3PK7A 1W3NA 4K38A 5I3DA 3GTIA 2XN2A 4IMDA 3PR2A 1XKYA 2OYKA 5D9PA 3MQTA 4K3ZA 2IXVA 4FNUA 4AIEA 2DSKA 1PDYA 3BLOA 3BV7A 1LDCA 2I7GA 3N25A 3WEMA 1E6XM 4FLQA 1V02A 4F66A 2Y7FA 4IQEA 1EKOA 4MVAA 1UZDA 1QOXA 2A7NA 2YB1A 1E3ZA 1KV8A 3E1F1 3N14A 4X9SA 1HGYA 3RR4A 4YXGA 4B3ZA 4IZGA 2YYTA 4F9DA 3W74A 2R91A 2ZTJA 1E70M 2QVNA 1PX3A 3EKLA 3LTYA 3W2JA 4HNNA 2AMXA 4HKPA 5BW6A 2ALRA 5CZTA 3VD3A 1Y0EA 4L64A 3OBEA 3EYPA 2QCLA 1I1XA 2XISA 3ITLA 3T42A 4Q7BA 3GXPA 3UR5A 4FHAA 4H3DA 2ATSA 4Q8UA 4LF2A 1PZ1A 4GI6A 1AQFA 4JTTA 1W1VA 4ORMA 3SDOA 4F0RA 4PCTA 3B05A 4Q4RA 3ZWTA 2BX7A 1M03A 5AHFA 3W1RA 1X1OA 5JIWA 1B3ZA 4EPEC 3CWOX 1V6XA 3OU8A 3OYXA 3P14A 1HJVA 2FZMA 3WX7A 4L1WA 2MNRA 3B9NA 3F7JA 1TV8A 3VDAA 4O1BA 4AD2A 3SGUA 2PC8A 3MMUA 2QDHA 1IT8A 4CCDA 1VBJA 2HEJA 3EWUA 2E25A 4S3AA 5TAOA 1OFDA 2EPMX 3WQOA 4JYEA 4ADUA 1EF3A 3B9DA 3TLQA 3LHZA 3PSWA 1YTEA 2DT3A 2DT2A 2ODOA 1KFCA 1J9YA 3DH7A 4P7NA 1F76A 4OV4A 3MUIA 1TVLA 1GTHA 5D9OA 1M6JA 1XDMA 1PHWA 4TU1A 4C90A 5CH9A 5BXTA 3NO1A 3OGVA 4DF2A 5KEZA 4YNGA 3NQ2A 1H41A 3GXFA 3U2EA 3WL1A 1LJYA 3R43A 1PL9A 4UXDA 2QLYA 2DORA 3Q67A 5C71A 3V3WA 3IIOA 2FVMA 2QYGA 1J0HA 4G7EA 3LHYA 2HISA 4KGLA 3DYMA 5AECA 2ZUNA 4B5TA 4UR7A 1U30A 1DQWA 3KTXA 3IGSA 3M0LA 4XIMA 3AOFA 3MA8A 4CLMA 1A5AA 4KIRA 1HF6A 3EDDA 1XISA 4DZIA 4QJ5B 1KXQA 1UZHA 2J7EA 3DX5A 5EMJA 1QI0A 1PSCA 2PGEA 3QC0A 2VTFA 2D3NA 3F5JA 1R3TA 3MUXA 2HPMA 4AAJA 5I3GA 1KFKA 2XVGA 4YTTA 1DKWA 2GDQA 3W87A 1EGMA 3VOIA 4NG3A 2Q8XA 5JBEA 1TSIA 1SFJA 3OA5A 4JS3A 4DB7A 3EXTA 3SI9A 2OCZA 3W01A 3W7KA 2F7FA 4WVXA 2L5HA 1HX0A 2GUUA 5LA0A 7ENLA 1W1PA 5DX7A 2QCGA 4CKQA 3NZ1A 4GRSA 2XVPA 4HD5A 4K8EA 2R82A 3S1VA 4D6CA 4C