1TWWA

Dihydropteroate synthetase, with bound substrate analogue ptpp, from bacillus anthracis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
273
structure length
266
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHPS, Dihydropteroate synthase
molecule tags Transferase
source organism Bacillus anthracis
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
total genus 97
structure length 266
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1twwA00
2E7FA 1Q7MA 2VP8A 2YCJA 1AJ0A 4S3CA 4DJDA 4S23A 3TYZA 4HB7A 3V5OA 3TZNA 3H23A 3H26A 4D8AA 1AJ2A 3TYDA 4NIRA 1AD1A 4CCZA 3K13A 4MWAE 2H9AA 3H2OA 1TX0A 2DZBA 1Q7ZA 3NOYA 4DJED 2VEGA 3MCNA 2VEFA 2YCKX 4S3AA 3H2MA 3TYEA 4G9PA 4DJDC 1Q8AA 1Q8JA 3H24A 3TZFA 1Q7QA 4DJEC 1TWSA 2BMBA 4NL1A 4MWAC 4O1EA 4S38A 3TR9A 4NHVA 4DB7A 4O1FA 3TYCA 1EYEA 3H2FA 4PZVA 1AD4A 2Y5SA 4S3BA 4C1NA 3H2EA 3H2NA 4S3EA 4MWAB 2Y5JA 4D9PA 1TX2A 1Q85A 4D8ZA 1AJZA 2YCLA 1F6YA 5JQ9A 4DAIA 2DZAA 1TWZA 3TYAA 4S3DA 3TYBA 3MCOA 4DJEA 2OGYA 4O0QA 4DJFD 4DJFA 3H21A 3MCMA 3BOFA 3TYUA 4S3FA 2DQWA 4MWAA 3H22A 4MWAD 2H9AB 2YCIX 4DAFA 4C1NB 4NILA 2Y0FA 3BOLA 4DJDD 3H2CA 2YCLB 3H2AA 1TWWA 4S39A 4DJFC
chains in the Genus database with same CATH superfamily
1R7OA 1JI2A 3EEZA 5SWUA 4C6MA 4RR4A 3I68A 3BJFA 2EG7A 3R8RA 3CU2A 1TV2A 3M0XA 4FIRA 1PEZA 4FF7A 2FKPA 2E4TA 3W7OA 4H6RA 1O5QA 4L4LA 3LNPA 4LJ3A 1EZWA 3VOCA 1XD1A 1JZ3A 1TPEA 1XCWA 1M41A 1UD6A 4LU0A 1CBGA 3W75A 4ZSUA 5TF0A 3ZR6A 3WNPA 1Q6LA 3ARYA 5AHMA 1TWSA 4LUTB 4Q6XA 1JCTA 1V93A 2R9RA 4HZ7A 3N15A 4YL2A 2WNZA 1BEUA 3RU8X 3GKAA 3EEGA 4PUJA 3LA4A 5KMYA 5BOOA 2TPSA 1PWMA 1W1TA 5I23A 2VC6A 3CQJA 1UASA 2YCLA 2NX1A 2RGLA 1CNVA 5LNUA 1SUXA 3M5YA 3EOLA 2FGBA 2O9OA 3IIPA 1XLJA 1JVNA 1W9XA 1MUCA 5CZSA 1XFCA 4AD5A 3WBXA 4U4MA 3TW6A 4JBRA 3NQVA 4GXPA 1ADOA 4L1GA 1XLGA 2CHNA 3IEBA 1YIXA 4CUCA 4TUFA 1HVXA 5IOBA 3A3WA 1O94A 1Q13A 4L1WA 1SU5A 3O06A 2HVNA 3D46A 1YRRA 4MDPA 3UGVA 5JUVA 3Q58A 1FWGC 4QITA 1ZB5A 3P5ZA 1TX0A 3SGGA 3DIPA 4LCQA 1HJXA 3C0SA 1HF6A 4X9SA 2VJXA 4LUTA 1XYFA 1FDJA 5D30A 4EAYA 1FWAC 1ZBVA 2WK2A 2WV8A 4IL2A 2D1ZA 4D6HA 5CC7A 1JAKA 2XM1A 2NV9A 4O28A 5K4ZA 3BCJA 1UKOA 4NNAA 4XISA 4NQ1A 5FCZA 2WC4A 2XH7A 6ALDA 4GOAA 5DY2A 3OGVA 1P5BA 5EA9A 4L6DA 2XSAA 1NFBA 3VTRA 2UY3A 1NEYA 1IT8A 3VUPA 4AVOA 3OB8A 4F0KA 2Z0IA 3B9EA 3LRMA 3MTWA 3GXMA 3HTWA 3K4WA 3VE7A 1WXJA 5A8QA 3VMNA 4XG1A 3WDHA 3LQGA 4GLEA 2IKIA 4AWTA 3AZTA 1GQLA 5D2VA 2Z00A 1YPXA 1KCLA 2WNNA 3WQ8A 1XSIA 3H23A 4QJ5B 2RUSA 4PSRA 2W6RA 2ISVA 1E51A 2E25A 3GDKA 4EXQA 1UJQA 3DU0A 4GIEA 3TAOA 2VEGA 3ZFHA 2QCDA 2VKZG 2OX1A 2OO0A 1VP5A 5CCZA 2HVMA 2R1MA 1W31A 3QGKC 4B92A 2FFIA 2Y6ZA 4CU6A 4IX2A 3FS2A 2Z6JA 1FWRA 3M6YA 3QYQA 3MA8A 4EF9A 4HZ8A 3K4AA 3WMLA 3VGBA 2X09A 3TFCA 3KM8A 3P6LA 4BJHA 1DBTA 1BXCA 1E6XM 1HO1A 3GE7A 1TPDA 1B0IA 3W81A 2FPYA 2ZX8A 3USBA 2VT0A 1ZCCA 5CGTA 4PTXA 1NY1A 1S1PA 1I60A 5D38A 4RZ4A 2OYKA 2HK1A 5DLCA 1IZJA 1OSEA 3T55A 4RX0A 3K8MA 4JX4A 4QP0A 4S3JA 5LSMA 1Q2SA 1TPFA 3WQPA 3RM4A 3GIQA 4GXWA 1E9LA 2ZXBA 3VNYA 4LV9A 3N12A 1WUEA 1TCMA 3H4WA 2PDIA 3NQBA 3BK0A 4LF1A 3U2EA 3TYZA 1WKDA 3QZ6A 4GCXA 3UJSA 4EPDC 4LRTA 4FXFA 4CCZA 1XYCA 1JL8A 1F2JA 1Q7ZA 2CEQA 2J7EA 4XTDA 5CG7A 1YBQB 1EO5A 5CLWA 1M7JA 2XWDA 4PC8A 3OZMA 1E9YB 3WF1A 1GW1A 4AMCA 1SZNA 3G18A 1Z6KA 3M0ZA 1GZJA 1O1ZA 5EFDA 5IFPA 1DVJA 5BW6A 3LBOA 5MKGB 1N8FA 4QAIA 4A22A 1TJRA 3N3TA 3TYCA 4DF2A 1DIKA 2V30A 3MMWA 4QDPA 1RBLA 3QOMA 1J96A 2C71A 4D9PA 4V1YA 3W01A 4BK9A 1GJUA 3M1ZA 3LG3A 1KRAC 4C7GA 5E1QA 1HJQA 5IFTA 3W1AA 5F2LA 1TVLA 2J8TA 3LLFA 4I9MA 3NXFA 2ISDA 3PN8A 3IACA 3SJNA 1EJRC 1KBIA 4FX7A 2DDXA 2HWGA 1UUMA 2E8ZA 5C2CA 2VX4A 4PL1A 5KZ6A 4O0ZA 2BBFA 4GE8A 3VKKA 3C2VA 2XTKA 2VO5A 4ICMA 1H49A 4CD6A 1XIFA 2PWUA 2C0AA 5I5RA 1B5TA 1IGWA 3OHIA 3P2VA 3WK0A 5BU9A 3WJYA 3O05A 1M7XA 3T09A 3G22A 2V2DA 3KWXA 4RZ6A 1ZJIA 4YMZA 3EOOA 4B5WA 3ORWA 3SRHA 1UQYA 1ISYA 3NQ2A 3NYDA 1ZALA 1KXVA 4N4QA 3PUDA 5BOEA 4CN1A 4IFRA 1XIMA 1ZNNA 3N29A 3D3AA 1E70M 3PWAA 4IQDA 1R3WA 2XHYA 3NZGA 1EGVA 3GKFA 1QI4A 1J0IA 5BZAA 4Q8TA 4IMFA 3LMYA 3IPWA 4PGLA 3LPFA 4AZ5A 2PLKA 3W6YA 4LALA 4O10A 5FJTA 3V5FA 3GLCA 3OYXA 3LLDA 1Z48A 3BSGA 4KBXA 4CEXC 3W2MA 1LRQA 3KEHA 3FJLA 4G2DA 1F5ZA 5JMUA 3AU2A 4DO7A 1DXFA 5JH2A 1F3TA 1AL8A 1GOKA 2ZRWA 4W89A 1U5VA 1WKEA 1KFJA 1BGAA 2QUTA 4HPGA 1X6UA 1LT8A 3HQPA 1FDZA 4S1FA 3G24A 3IIZA 3G0SA 3H2OA 1G4SA 2QS8A 2PDYA 5FJIA 3CQIA 3CTTA 3LHTA 4DYEA 4K2SA 3LDVA 3RU6A 1LRNA 2DZXA 1EF2A 4RXFA 3E3HA 4LCSA 3NUKA 3VGGA 2PDKA 2XVKA 5FL0A 4GBUA 2ODOA 3H2FA 1T41A 4AF0B 1E6RA 5ABFA 2WQPA 1GVIA 3BZJA 2E9LA 2OOGA 2Y89A 4HOWA 2NX9A 3S0CA 3CM4A 4P7QA 2GVEA 4GQGA 2ZIDA 3P8IA 4LB3A 4I3GA 4DBEA 3IWPA 1LUCA 2FTPA 4JIIX 4CD7A 3ALFA 3CMFA 5A94A 3PF3A 2Z2UA 2GK1B 3WLLA 3QPEA 3H22A 1JXKA 5TD4A 4H7VA 4NILA 3C2RA 1MYRA 3AHVA 2OODA 3H2CA 4QG9A 1SGJA 5DBTA 3UEQA 1FDYA 4TVUA 2PTXA 5HNRA 4DQWA 4XV0A 3PSVA 1XBVA 4QEHA 4V33A 4FX6M 2CBJA 4UWMA 1CB2A 2Y7FA 4DUVA 4LUSA 5FL1A 2XGBA 1Z32X 3C2EA 2OO6A 3QF0A 3VDAA 4J40A 2E9BA 3A24A 5MF5A 4UFHA 1YDYA 3DC0A 3P93A 1KNWA 4EPEC 4ZQCA 3M43A 1VCFA 3W28A 1GKQA 2BB0A 3W23A 2GQ9A 4LTSA 3L0NA 3ITVA 2PDPA 3TXZA 1POJA 3PNZA 4I5XA 3SFWA 4BZYA 5AECA 1QXLA 3UPBA 3LCHA 2I1OA 1F05A 2PDMA 4I5UA 3H2NA 4AYGA 4MHBA 1PV8A 2O7QA 3QQWA 2B31A 3WQCA 4Y9MA 1Q2RA 3UT0A 3RCMA 3ABZA 3N4EA 1KTNA 2F61A 3KL3A 1DEDA 5LIKX 4P7RA 4R27A 2OU4A 2ABBA 3NA8A 3TMLA 3O07A 1K9TA 1S2CA 2TODA 3ZZ1A 2PWHA 1PKYA 1BWKA 1XUUA 1JDDA 2V5LA 1KGUA 3UBPC 3WQEA 1CZ1A 1A5UA 4TVDA 1F7BA 1PL9A 1TRDA 1B4EA 1GWJA 3Q2DA 3A47A 1WXYA 5EMKA 1PKLA 3WJXA 4S39A 3CUFA 3CV6A 3QKZA 2VVSA 4H6EA 2YCJA 1SZFA 5HNTA 1S38A 3WNLA 1OGSA 2HS6A 3L5LA 1XYAA 3AMLA 3GNXA 5LIXX 3A4JA 2CITA 1TTPA 5LA0A 1LOLA 4Q22A 3MKCA 3UW6A 2H9AA 3OZYA 3QHOA 4ORMA 3AFBA 1YE4A 4GVFA 1I2QA 4ICCX 1UP0A 3WENA 3A4AA 3V16A 4DZHA 1ADDA 1TO3A 2YB4A 1J5TA 3UZJA 2IMRA 4GYKA 3EA2A 4C65A 1MVYA 1UWUA 2C18A 2PRHA 3WH5A 4C1NA 3FVMA 1QUMA 4LAOA 1E3XA 4AIOA 2ZUSA 2VGBA 3RITA 5LGXA 5DCDA 2NXHA 1VFUA 3WK1A 1BHGA 4PRWA 3TNBA 1DOSA 1GNXA 2QDGA 3TH6A 2ZRUA 3U2CA 3Q4DA 3QM3A 2OT1A 3BOFA 4JS3A 3NQCA 4WRHA 1JDCA 1TIMA 5EMUA 2WSPA 1CXLA 3ZJ8A 2PA6A 1TV3A 2WBGA 5J5DA 3EWUA 1ZS2A 4PMUA 3GFZA 1TWWA 3EX3A 3FSTA 5I79A 4LPCA 1DXIA 4RUBA 4UTIA 2PD9A 2ZADA 3E0WA 2ZA2A 5LA1A 3F2DA 4FOJA 4R7WA 3KTSA 3VOIA 2ZTKA 4PUMA 3N18A 3STFA 4DWSB 3N73A 3WNOA 3H12A 3O8AA 2PP1A 4HA4A 1XINA 3AJXA 3C2YA 4PUUA 2PP0A 3BQ6A 3RMJA 3OEXA 4LUJA 3ARQA 3GSMA 2CU0A 1UH3A 1V0NA 4JTCA 3GRIA 1EJWC 1NDYA 1BQCA 4F3HA 4JDYA 5D8ZA 2WZTA 4MUZA 4NHVA 3SCQA 2XVPA 5CQ1A 3W2LA 2E28A 2YLAA 3AIBA 2E0PA 5K4XA 2A6NA 1K8CA 1HGYA 1YXDA 2QV5A 3HG5A 4J9JA 3VDBA 3XIMA 4FOKA 4PA8A 1JQVA 3E9AA 1TIWA 2WYSA 1VCGA 2P8CA 3DI1A 3NQFA 4O50A 3B8DA 4O11A 2V3DA 4DN1A 2PDUA 2ZX6A 4YLWA 4RDYA 4MLRA 1KGWA 3QH2A 5CKSA 3U8GA 3V7PA 3W83A 3QW3A 4XZWA 2YCIX 4BI5A 5I00A 2EPMX 5HR7A 1XSKA 1R3RA 3SCSA 3TEVA 1KM4A 3KLLA 3UZZA 3MB9A 5GQBA 1TYGA 1DJIA 3WMSA 1GW9A 1PBGA 4ERAA 3OU8A 1HKVA 4NRRA 1TUFA 1XDLA 4LRSA 3RX3A 4BI6A 4K1GA 4AMAA 1J0ZA 3QGVA 3HPAA 3UXAA 4LAZA 1Z42A 4L64A 4CQBA 4QS6A 2EGZA 3ISIX 3PPFA 5ABFB 5DBUA 4XZ9A 3NZQA 4H9XA 4GVGA 5EBUA 1JDFA 2DEPA 1JF6A 3EDEA 2X0SA 3KLKA 1CGYA 4TX8A 3LTYA 3FXYA 4MY9A 4FHAA 1KV5A 2C6QA 1B3ZA 4AXKA 1RD6A 5I6SA 4RDWA 4I7WA 1TV5A 3L12A 1SW3A 3WMBA 1WAUA 3WSUA 4DRSA 4MWAB 3H70A 1QI2A 4NXSA 3KZSA 4PMYA 3N14A 2WSQA 1J2BA 4OWGA 3ZVHB 2UWFA 1HL8A 1T6MA 1MEIA 4AY1A 2J6VA 2FVLA 1E0WA 2CXGA 1P0NA 1RUSA 5HJXA 4G6CA 1IT7A 2VCAA 3IVUA 4BQ3A 4IMAA 1JPKA 5EY5A 1UD3A 5BOFA 1PKMA 3QFEA 2G4JA 3E2SA 2ZKMX 1TR9A 4QX4A 1J6PA 3OPSA 1N8IA 1P0BA 3AIQA 5C6MA 2LLEA 3MBFA 4GMEA 2WMGA 5DXYA 3PZIA 1MNSA 3PZQA 2P10A 2WVUA 1ICQA 4HU3A 4UUIA 1RQEA 1KM0A 1NARA 5AVHA 3NPXA 2FPVA 4EANA 5HBFA 1EUNA 3M16A 3C2FA 3VX1A 2DZBA 4Q4OA 4Y90A 5HPOA 4DEFA 3POHA 3VUSA 1CENA 4M7TA 4GG9A 4LCRA 1G94A 3VOHA 1T8XA 1VFFA 1JYWA 1G5AA 4PBFA 1LTDA 2J7BA 4PMJA 1A5CA 1VLIA 3WLOA 1SPQA 4PFHA 2YXGA 4IIBA 5FJRA 1J79A 4D8LA 1U5JA 1GKPA 4JFTA 2OZTA 4HN4A 2FQIA 2PC4A 3Q45A 3ARWA 1UR4A 2G3IA 4ROQA 3OA3A 4O4VA 1UD8A 1B3WA 3UR8A 3CZGA 2ZZ5A 2XJ7A 4GNJA 2GDUA 1YYAA 2AAAA 4J3SA 1A3HA 4X3ZA 5RUBA 2PZ0A 2CZFA 2GJRA 4GJIA 3EDKA 1VRXA 5EPDA 1YNPA 3CH9A 5AC5A 3IUIA 1EH9A 3HA1A 3OZPA 4RCXA 1EDGA 4FALA 2FYMA 3QHMA 4FK9A 1ZJHA 2IS7A 4D8AA 2P0IA 4NIRA 5I06A 2ZZ6A 1ZBWA 4AHOA 4D6DA 3R0KA 3AMDA 2OXNA 2POZA 5GNZA 4M6UA 1R5YA 1I1WA 1E73M 4PCSA 4F0MA 4QCEA 3OQEA 4Y6GA 5C9ZA 4KQNA 5JU6A 1WKYA 4ZB2A 4NZJA 3OYZA 1JF5A 4Q7IA 4GINA 3ABQA 3WDJA 2CXEA 2ZFAA 2E1DA 3MDWA 1G4TA 3VNIA 4O1DA 3HPFA 1XGDA 3S1VA 3IIVA 4P61A 3AJ7A 4RDZA 1E5JA 1GOQA 1EBGA 1BQGA 1BRLB 4F0HA 3WLKX 2A21A 3BV4A 3MZ2A 1AW2A 3OLEA 3W85A 1F8IA 1AQ0A 3QSRA 3B0UX 5J04A 2ON3A 3QC0A 3FJNA 4HSNA 3W7QA 2F2HA 2WC3A 3IJ9A 5ECUA 3UZXA 4ZOAA 5I24A 2VDGA 3WCZA 1RK6A 4Z2KA 2PDJA 4A3UA 3T0AA 1K9EA 4L80A 3PJWA 3WQ6A 3E49A 3N9KA 1K4GA 2R1KA 5CJMA 2VRJA 4U33A 3WLJA 1C90A 4U10A 2C15A 1C7SA 3RPTA 3S5NA 5HMFA 4IJRA 1MW0A 5B7YA 1NWTA 1NH6A 1BWVA 3PZMA 3T8LA 4AHPA 4W8LA 1XLIA 5T8GA 1UG6A 3COTA 2WW5A 2BVWA 4KEMA 4PMDA 3C0QA 5AHEA 3TYEA 4JZ5A 1BYBA 1W9DM 1XYZA 2Z2BA 3C56A 4D6CA 3L65A 4IOTA 1OT1A 3B0XA 2GSHA 2VX7A 3TN3A 1JRCA 2JALA 2KX9A 4RZ5A 5HQMA 5A6MA 3TN5A 3TLLA 1ODUA 2MUCA 1SSDA 5E6YA 4GJ1A 3PBWA 2BXYA 2J9ZA 4LYRA 3LMZA 3PFRA 1GOMA 4JCLA 3PHAA 1PX3A 3MHUA 4LY4A 3QTPA 2A3BA 3RCYA 3TQVA 4O18A 4DAIA 2QJMA 2NXGA 4LY8A 1JXJA 3GU1A 3RN6A 4AQLA 1VHCA 4DXKA 3QZAA 2CZDA 3CZ8A 5AYBA 1UMYA 4NJGA 3PZOA 4WY0A 3GDRA 4IFKB 1OFAA 4XUYA 5B80A 2J13A 4TTGA 3F5JA 4FF5A 2CLPA 2Z26A 3E02A 2H6RA 1VC4A 4J3UA 1VLWA 2BY0A 4C7FA 3KDOA 1RCQA 2WLZA 5L9FA 1MSSA 3W7IA 3NL3A 4MDOA 1HP4A 1OF6A 3H4GA 3AIRA 1VFMA 4MFEA 1TSIA 2I14A 1V3KA 1RJRA 2PDQA 1A0DA 3NEVA 4ACYA 2FHFA 2OEKA 4MZ8A 5A6LA 2VD9A 1FXQA 4UCFA 1U1JA 3IVSA 4NAEB 4Z1BA 1VIZA 1FY6A 5HDRA 3W1TA 4DJDC 1FHDA 3BGGA 4A8LA 1GHRA 1CGWA 2WVVA 4YNGA 3LV5A 2VR5A 5GNXA 5KTLA 5BXTA 5DX7A 4Z1YA 3OJGA 5JH1A 2PDGA 1EYWA 3MI6A 4NJIA 3IJIA 1W37A 4DYKA 4N4PA 4L6HA 2IKHA 1ZSXA 2G4FA 2DT3A 1AZ2A 2ZRVA 5CPMA 2D0HA 1YEYA 2INZA 1IQ8A 3H2EA 1QO2A 1OEPA 2DVUA 3S5SA 1BVWA 4U31A 1CXFA 1RD5A 2ZA1A 1LJYA 4HPHA 2J75A 1RSCA 4MMWA 5DCEA 3MHFA 1LDCA 3G1FA 4A4AA 3DXIA 5KZMA 4ONVA 4PMRA 2QZRA 3ES8A 4DWSD 4DYJA 4ZO7A 2AGTA 4B9ZA 1KCKA 1MO0A 3S2JA 1EXBA 3O6AA 3EXSA 4WY0B 3GZ3A 1DL3A 4QNWA 4F0LA 3ABRA 1DE6A 3QGAC 3GBDA 4EWND 3UXKA 2DSKA 4CNOA 3FGCB 3R1ZA 1SJBA 1XPYA 1UD2A 2HTMA 3QJAA 1M6JA 3CV2A 2YFNA 4AF0A 4XO7A 1KR0A 3K4DA 3RR1A 2RHGA 2VURA 3VPLA 3UZYA 3HM7A 5CPQA 1EJXC 2ZX9A 3FKRA 3WH7A 4UZSA 3POCA 1S2AA 1UPMB 2GUBA 2X8RA 3IV3A 4O1EA 4GI4A 5PTDA 4LYQA 3PZTA 1V3JA 1V3MA 2PLMA 3M6DA 3DHFA 1YPFA 4M6VA 2ICSA 4H8NA 1W3NA 4HZ6A 4BS0A 3ZWSA 2Y1HA 1G4PA 4IFOA 3W7KA 2X1UA 3VIIA 2PDXA 1TX2A 3CJPA 1G7VA 4DBUA 3DDMA 1HKIA 4QE1A 3OTRA 4ES4A 4Y2WA 1ZLPA 1SJDA 2QIIA 4MADA 1KD0A 3CV1A 1KBBA 3MUAA 3R0UA 3IK4A 1E6PA 3G3MA 5AHNA 2DVXA 1Q6OA 4H4IA 4UTWC 1Q6FA 1GHSA 1OZMA 2NQHA 4PTNA 3SIZA 2X7WA 5T26A 3N34A 4M29A 4R53A 3QOKA 3FAXA 3CO8A 1SSGA 3RLGA 2QCMA 4RDVA 3S6DA 2GOUA 3E2VA 2QJHA 3LXCA 1QOXA 2NUYA 4RW3A 3LCIA 3AUJA 3UWUA 4DNHA 4DWSC 4GO9A 2YW4A 1SFTA 1TE1A 4J3TA 1ALDA 1A4LA 4JHOA 2JK2A 2HE8A 4GQQA 3WX7A 5D9OA 3UPMA 4ZENA 4O16A 5CBIA 5KEZA 3DG3A 4GFSA 4HYVA 4S3AA 3W26A 3MSRA 4C1KA 3CZJA 4AISA 4RL3A 3ZWTA 1H7XA 1KRBC 4WK9A 4QROA 4B5UA 1NQ6A 1YTDA 2OT0A 3ELFA 2GWGA 5AYYA 2BDQA 3EKZA 1ME7A 2YZ5A 4MJMA 3KL5A 4ADSA 4P8VA 4AVFA 1GTEA 2WOQA 4AUBA 1YX1A 3BLDA 4NG3A 3GTIA 1R3QA 3PPGA 3GYCA 1JUKA 2RAGA 2FZNA 4FMVA 5A8GA 1O66A 5HQLA 2DFAA 2VDHA 4DJFD 1XR2A 4IP5A 3VOGA 1FA2A 3CPUA 4PMZA 1D3HA 1IF2A 3GNRA 1MZHA 4ZO9A 1F4HA 1N82A 3WNKA 5A2BA 5CAHA 3HPZA 3G3DA 1YBQA 4PL2A 2EPHA 1MZRA 3NJ3A 3QLDA 4ORIA 2E09A 1XPGA 4LS2A 4AWSA 2PLCA 1SZEA 3GIPA 2V68A 3W7NA 3VNJA 4JYFA 1H3GA 4JHMA 5CEWA 1EC8A 3LI1A 4IGMA 3OODA 3LX9A 2XIBA 3HOJA 3WN6A 4AZBA 4E3VA 3VD3A 2B81A 3AQUA 4HPJA 5H8PA 3JUGA 1B4KA 3K46A 3URAA 1LORA 2AL2B 2J9YA 3F4NA 3I3EA 3S2MA 5HWNA 1B9ZA 1PIFA 1XC6A 1PCWA 1E0TA 2G37A 1AW5A 4FLRA 1D3GA 3BAYA 4AG0A 1RY8A 1CDGA 1K4HA 4YTRA 3KBMA 5H8UA 4N6FA 5FI8A 4X0VA 4HSHA 1Y0EA 2PDCA 5LYRA 1XIGA 5DF0A 1XLLA 3SJ3A 4IP7A 3CHDA 1EFZA 1YXCA 2XVLA 4Z2IA 5HMSA 4PTDA 4EVZA 3WFLA 3WQFA 3SW6A 4GUIA 4O12A 5H91A 3WD4A 2PLJA 1S46A 1BG9A 3ZSSA 3IRDA 2GVJA 3VD5A 3GNDA 2V5BA 4AAJA 3T1GA 2PF0A 3W1MA 3BO9A 4FLQA 1J18A 1KKRA 4MAZA 3P0XA 3BJSA 1Q6QA 4PRTA 1KBJA 3NGFA 1W8SA 4DJFC 2CC0A 1RJPA 2E8YA 4WF7A 5CJ5A 3KUMA 1XQLA 4KCWA 2VR4A 4PMXA 1HP5A 5CZ0A 4D2JA 4Y96A 4PRRA 2BVDA 1GQKA 1R85A 1KQZA 4GX8A 4PR4A 6PTDA 3WK2A 3QR0A 3A12A 5LIWX 1QNRA 4QEEA 4IZGA 2VEKA 4CKQA 2DUZA 4E0CA 3WO8A 3AMKA 5J5RA 3EOEA 1KCZA 4RE0A 4S2CA 3ERPA 4B3LA 3A3HA 3SUSA 2VGGA 1N2VA 4OZOA 1G4EA 4MNJA 3RXZA 2AGKA 3AYSA 3IJ7A 1X1ZA 3HU7A 1GVFA 5FF7A 3GUWA 4KIRA 3TIMA 4CQDA 4JQ1A 2NLYA 3P8JA 2O92A 4IGHA 3HV8A 3RO8A 4MTVA 2INFA 2OOFA 3BAJA 3GXDA 4HNOA 4OHQA 3ARZA 3AO0A 2QJIA 2OYMA 4GZEA 1K9DA 1NFPA 4YYFA 1F6YA 4IIGA 4WDWA 5LNWA 3L0GA 1UZHA 3BGAA 4UQDA 2DY3A 4L4MA 3KW3A 3Q67A 4AIUA 1W3LA 3RX4A 4UTLA 3FIGA 4AZ6A 2GJPA 4GYPC 3PBVA 2OG9A 2BZNA 4FP1A 4NYUA 1A5LC 4IFKA 5A6BA 5M1TA 2R24A 2V8ZA 4US6A 1X6LA 4ZQPA 3MUCA 4UQAA 1J0KA 6ENLA 3P14A 3WJZA 2CESA 2EKCA 2C1IA 3MI3A 2O7SA 4TX9A 1SR0A 3SUVA 1ECQA 3N13A 3NG3A 3W73A 4F79A 3EPMA 2Y8UA 4A3HA 1M3UA 2GUYA 2IPGA 3OLGA 3PWGA 5F2IA 2UY4A 3ZJ6A 3GXFA 3N1AA 5GPRA 3S9YA 3V75A 5J8LA 1AK5A 4JFSA 5BYWA 1GK8A 4R9OA 2TAAA 2DP3A 2HPMA 3S5ZA 2PUZA 4K38A 5HJLA 2I7GA 4H19A 3CQKA 2BMBA 1RLDA 3EX1A 3S9ZA 2UV8G 4QIUA 5D9NA 5H6HA 4BI7A 1B90A 4QQUA 3LCFA 5K9DA 3FJ6A 3ZYZA 3F2CA 2HS8A 1GYMA 5A2AA 4Z2JA 3EWBX 4C6CA 5C5YA 2JEPA 2QDDA 3R12A 1FKWA 1GJWA 3BLPX 3B40A 5F4WA 3MMDA 4GI9A 1A80A 4ZL1A 3MSYA 3SUWA 2ZWZA 4B3ZA 1K03A 1AW1A 3CAVA 4XBSA 4O0QA 1US3A 3BMWA 3W1NA 4Q8UA 3PPHA 2X2YA 1DIEA 2VZVA 4MG4A 2EPKX 1EJVC 4Q8OA 3G1YA 3K1DA 1SZGA 3ANYA 4GGHA 2PB1A 1O4UA 4AZ7A 2W91A 1XIDA 1P1XA 5HATA 1YDOA 2IXUA 2H3BA 4IPIA 1ZQ5A 4HMNA 2G3MA 1DXEA 2OYLA 3K1GA 1W9VA 4YIWA 4QJ3B 4GIAA 2P1FA 3G0XA 1TTQA 1FKXA 4WKHA 1VR6A 1EHAA 1IXPA 3E5BA 2JF6A 2AMGA 1KLYA 1H51A 2FZ8A 2QF7A 5HAOA 2OEJA 2Z7KA 4XAYA 4LANA 1OYAA 3N11A 3SADA 1PZ1A 2XDFA 3L4VA 4IX0A 2CLMA 1DQUA 1W1B1 5I3IA 1LM1A 3PZVA 3VNMA 2WHKA 4XQ6A 3S47A 2DZWA 5ABGA 2YCEA 4J35A 4ZQMA 3QV7A 1Z3NA 1PKNA 1QRQA 2OKOA 3BG5A 1XBZA 4QLKA 3T0TA 3G1VA 4WLCA 2RFGA 3MP3A 3MV11 2WQDA 4EX4A 1VEOA 3W87A 1M53A 4H9YA 1NF0A 3STPA 4ACZB 3IS4A 4ASTA 3W07A 2OELA 3CUXA 1ESWA 2XINA 4M19A 4GXMA 3WFAA 1LOQA 2UBPC 2G97A 3CV7A 3GWQA 4CN4A 1GORA 4P7OA 1W2PA 4K37A 3EXRA 3WD0A 1U5HA 1IWPA 4WDUA 1GG1A 3LLXA 1TVNA 4I9JA 1JPMA 4LC6A 4GUGA 2FFCA 3GFXA 1TPC1 2QYGA 3LNMA 1SO4A 4LFYA 3TJ4A 3FW6A 2CWNA 1GT8A 3ONCA 4H2CA 1GZGA 2ZTJA 4MFDA 3MCNA 4XX6A 1A5SA 2REQB 4J3XA 5A3HA 3OQ8A 3O6DA 4OOUA 1B3VA 5G1YA 4XUGA 1Q7QA 3F5LA 2DQXA 3S4TA 2Z27A 3TAKA 3LHWA 3GIYA 1V02E 4Z1AA 1ZCOA 4QTGA 3PWIA 1I45A 3W72A 2GK1A 4N0RA 3I7SA 3GY1A 1FFRA 4IPJA 3R43A 2J7DA 3WJSA 4AW7A 4W8BA 2QULA 4B90A 2GWNA 5CSYA 3LPPA 2CLOA 4HP5A 3WH9A 1GCYA 2QCLA 2V3EA 4EWJA 1V0KA 4WDTA 1XKYA 2NQZA 4GZ7A 2CLEA 4GUHA 1C8QA 1NWUA 2YGYA 3OG2A 2WBKA 1MRAA 1V79A 3AICA 3DENA 3QFWA 3LHVA 1B30A 5EL1A 4YVPA 3SCOA 3B06A 4XKYB 1KXQA 1H5YA 2ISWA 4YTQA 2F38A 1T99A 1WB0A 2FZBA 2O4MA 3KTXA 3ATZA 3RLUA 4MZ1A 1P7TA 2PTDA 1S5MA 1VEMA 4NZFA 2DW7A 5FA5A 5CXPA 4YS1A 4CVWA 4HIBA 5EU9A 3LGGA 3IK2A 2ZRYA 3P80A 4K68A 3IRSA 4IP4A 1BXBA 1E6SM 3SY5A 4ZE4A 2RDUA 1HKWA 2NQJA 3A9BA 1E6ZA 1HNYA 2DH3A 1VRDA 3TSBA 2PDLA 3R7MA 3STEA 3O6YX 1B2YA 2ACRA 3GUGA 4GVHA 3TQPA 1BWLA 4O54A 4S3BA 3OO2A 3GS6A 1L6YA 1PYFA 2D2JA 4GGBA 2VDIA 3UJEA 3A13A 3MVTA 4UMBA 1XIIA 3NFUA 2VOMA 4AD2A 2CZVA 2QAFA 3T78A 3OVGA 4DX3A 1NSJA 1YQ2A 1OFRA 1VH7A 4A3QA 4JEJA 1XG4A 2W92A 3TC3A 1H7OA 1A3WA 5I03A 2ZE3A 1EC7A 5C7VA 1UJPA 3DAQA 4Q4PA 4WD0A 3CAWA 3CHVA 3ZXWA 1PS9A 3PZGA 3T0DA 1FHUA 4PTMA 4MVAA 1CXHA 1LP6A 4XZHA 1ITUA 2OZ8A 4C5ZA 1K7XA 2W79A 4LVFA 2YPIA 2HISA 3S3GA 2QGHA 2ZICA 2ABAA 3PZNA 4XKMA 3EKGA 3AWOA 2A1YA 2OSXA 4XAGA 4Z2HA 4N9DA 1C8VA 2EEXA 1V7AA 3QY6A 3E0FA 5DELA 3V18A 2DUXA 3VYLA 4LEQA 4YYCA 3PTQA 3QPYA 4QE4A 1JDAA 1FQ0A 3P74A 2J66A 3FSUA 4WX2A 4NL1A 2CLFA 3GDTA 2H90A 3H6OA 1UP2A 4C6NA 3UYCA 3UZ5A 1I2RA 5JBDA 3JZUA 4WCJA 2Y5SA 4QLLA 4WSKA 2OWWA 1U22A 4G1KA 3KBVA 3ONBA 3ENLA 4BQ5A 2V3FA 1GYNA 3UA4A 1H63A 3B0YA 1XLDA 3A9IA 1LG1A 2XGZA 1PTAA 2GQ3A 4UNIA 3T07A 1MXDA 3L4YA 4MY8A 3PAJA 2DGAA 1OX4A 1FCVA 3H7VA 2VZUA 3TTYA 2NUXA 4OU1A 1Y7VA 2DT0A 1TZZA 2J78A 4HN8A 3KVJA 5AC4A 1K3UA 3SN1A 1XG3A 5HMDA 1XLKA 4C91A 3CWNA 5CGQA 4ZEPA 1OX6A 3RCNA 3TZNA 4ZO8A 3T0BA 4NYYA 3WDQA 3D47A 1KKOA 5K9XA 3N6QA 5A6AA 3A5VA 4UTMA 1LQ2A 4BEUA 4OIFA 2PDBA 3ECQA 2R91A 1V3IA 3DGRA 4N9BA 1SVDA 3LCXA 1F76A 2HCVA 1JDEA 5I02A 5KZDA 3ZJKA 3G1AA 1FXPA 2YDRA 1Z7AA 3TTOA 3R8GA 4W5ZA 1V4YA 3GNNA 2B7PA 2NWSA 2VRKA 1W56A 2NUWA 2EQDA 4M6PA 4P7LA 4H7ZA 2DUAA 1R2SA 3R11A 4V2XA 2WC7A 4D6EA 4M24A 4MSSA 1OT2A 3HN3A 1DWGM 1CGVA 4OUIA 4PEEA 4XSLA 4XAZA 4H8HA 2BXZA 1XRTA 3GG1A 3TJLA 3MBDA 1R9ZA 5HPCA 5FF4A 4UOQA 2NVDA 3LERA 2FHCA 1ITQA 4UTUA 1SR9A 1NOUA 3N4FA 2WZIA 5FSEC 1JPDX 1X8CA 4Z1CA 1TR1A 3L23A 3ABSA 3P67A 4KH2A 7CGTA 3BLOA 1OGBA 3NL5A 1UWSA 3PG9A 4L56A 3O7UA 3RYSA 5D8WA 5LIUX 4QSFA 2IPWA 1PCKA 4E8GA 4DI9A 2PTZA 4PEKA 1RA5A 4GQBA 3BW4A 3TDFA 3WQGA 3HO8A 4HK5A 4J2MA 3S5OA 3NWRA 1DJHA 3LHUA 4YXGA 1UOZA 1XXXA 3BTNA 2X16A 1WDDA 2QMJA 3TZFA 2EJAA 2QKFA 3OHMB 2P8BA 2WKLA 1PYMA 3SCPA 5TBOA 3OVRA 1F4AA 4G1NA 3ARSA 1F8MA 1XYBA 2QJNA 5TAOA 1V7YA 3VD7A 9RUBA 3OP2A 4W85A 4R85A 2PDWA 3GVGA 3W37A 1HJVA 3RGTA 3G1DA 1DWFM 1XRFA 4HGXA 2J74A 3VKBA 4PCTA 2DIJA 2ZUVA 2VOTA 4IF2A 4WEVX 1XLMA 3UCQA 1MQPA 5F2MA 3VA8A 1D7FA 1A0CA 3SZ8A 4IUGA 4HNUA 3KRBA 2YA2A 1IXQA 3ZLFA 1QBAA 2W61A 1FWIC 2QF8A 2NSOA 2QCFA 3NOEA 2HBVA 3UWQA 1LWHA 1XKJA 3RNDA 1OINA 3HFYA 3GC2A 3N25A 3PZUA 3BV7A 1TV8A 5G2HA 4A05A 1E4NA 3NOYA 5CPNA 4CNSA 1NIUA 2J62A 3GH4A 3ABXA 2VC5A 2Y61A 5AC6A 3FYPA 1X7IA 4DLFA 4Y9PA 2Q3OA 3H55A 4Z1DA 2PTWA 1LQ0A 3UG8A 3BLLA 3BAXA 4A21A 3EBVA 3ARXA 2W62A 3I4KA 1TRIA 2BY3A 2XIQA 4RW5A 1L2UA 1EUAA 1D8WA 4YN5A 3L67A 4KFNA 1QBBA 3ARRA 3VKDA 4EF8A 2Y85A 1TZ9A 1ISWA 4M0XA 2OSWA 3F1QA 5IHSA 4TR9A 2P3ZA 1K9FA 3EA1A 5DANA 3EB4A 1MEWA 3PC0A 2QCHA 3WFZA 2WAGA 3N9SA 5LIYX 2PI6A 1KFEA 1JQXA 4ROPA 1MDLA 4AC7C 3FA4A 1A47A 4AZIA 4Z08A 1TJ0A 4J4KA 3W88A 3N2OA 2B7OA 5HOSA 3NZRA 2J4GA 3K5XA 3CH0A 2CETA 4CNTA 1LLWA 4ZOEA 3GR8A 5K7JA 2MNRA 3TC6A 5I3HA 2Z1VA 6XIMA 4IGNA 1ML1A 3LYEA 5EFFA 3NDZA 2FZMA 4MOZA 4DVOA 4JCMA 4HT3A 4B16A 1JZ5A 2IQDA 1HW6A 4OUEA 2YCKX 3GD6A 2QT3A 1XDMA 4G9PA 3U6WA 3GM8A 4Z2LA 5C7HA 2YR1A 3A5FA 3B8VA 1P6CA 1E6NA 3G1XA 4KS0A 4AHQA 1XCFA 3I65A 3MT1A 4NXKA 3W1RA 4BWLA 5CBJA 4JYEA 1LBFA 1XCXA 4JTSA 3TA9A 3EAUA 2QVNA 1T8QA 4KCTA 4MYAA 3WLRA 1R3YA 4QE5A 4FEZA 4XB3A 5HWMA 1R9XA 2A7NA 2C79A 3T2QA 2DZAA 3S1XA 3AS1A 2D0FA 3KX6A 1IIGA 1K8ZA 3LBMA 3IGUA 3P3BA 5A6TC 3BURA 3W7HA 4B15A 1IXOA 2GJXA 3EPNA 3GVRA 4GCAA 1MMFA 4ERIA 3BE7A 1PWLA 4C1NB 3QKEA 3VGEA 2WKGA 2HEJA 3QLLA 1QNPA 1H0GA 4P8UA 5JBFA 2VP8A 2J7FA 4NX5A 3FAWA 4JICA 2WMKA 4L7ZA 1XLCA 2VUYA 1FX6A 4MJZA 1SQ7A 1XICA 1EX5A 3IAQA 1QMLA 3URQA 2CCRA 3W7EA 2D3LA 4AFYA 3W0KA 2NZLA 3UXLA 3V1HA 3WF3A 2GL5A 5GVJA 1PTGA 2PU1A 4MNMA 3HG3A 1ONWA 4ZXOA 1VPYA 4W7WA 1NJJA 3W7DA 1TMLA 5CPLA 5IXEA 2DSVA 2E68A 3THDA 4JOMA 4Q8WA 3BG3A 1A5KC 2OGJA 4B2DA 1IT0A 4HTYA 1UYQA 2GZXA 5XIMA 3VIPA 1CT5A 3W82A 1TREA 4R33A 1VGAA 3S1UA 2G41A 3LRKA 2YL6A 3TV8A 4J2PA 4JFWA 3AXMA 4HJWA 1K7EA 1CI1A 4LNYA 3TR2A 1AODA 4IJBA 1D7KA 5E70A 4Q8PA 3NO5A 1M68A 1KC7A 1GG0A 3N2TA 4IM4A 4LAUA 4P2VA 2AMXA 4JDBA 5D9MA 4E5TA 3HV9A 4A2RA 4ECLA 3UVIA 4K3ZA 2V5DA 4DJDA 4GA8A 1XP3A 3TOYA 4JY9A 3RIKA 4AD1A 3A22A 2ACSA 1CTNA 3HMCA 1V0LA 1H41A 3NEHA 5A8OA 1QWKA 4E8DA 3KVKA 3V35A 1EF3A 4UBPC 4HU8A 4JEQA 1L8PA 4QNEA 5FEPA 2DV0A 5T91A 2EO7A 3ARTA 3PJXA 1J0HA 1UB3A 2BY1A 3E6EA 1VZWA 4JN8A 1PE1A 4V28A 3NR0A 2V6AA 4LGXA 3M5XA 1V5XA 3OVQA 1T5AA 4M81A 3SRFA 1PSCA 2OR2A 4IL0A 4J3VA 4JQAA 2A79A 4QR6A 3RJYA 2BOEX 2I5GA 2NV1A 3GHRA 4KFOA 3T05A 3V0SA 2YBTA 3F4DA 2PC8A 1PO9A 4M6QA 4IMGA 2I9EA 3VNLA 4YWIA 2D69A 3EWCA 2CZ5A 4X2RA 4MB4A 3G1SA 2JKPA 2G3NA 3GQYA 4IQJA 2QPUA 1UIPA 1P7TB 3FA3A 1EA0A 2FZDA 4FSAA 2ZVRA 1GQJA 4HKPA 2YCLB 2V0TA 5C9UA 3T42A 2NQLA 1CPUA 2YOCA 4KCVA 4JL2A 4PULA 2PTYA 1NOFA 1JPIA 1I0DA 1OWQA 1DJWA 1WBHA 3CIXA 5EYWA 4LVAA 2O9RA 4LT9A 3BLEA 4HNVA 4C1LA 3VGHA 3ITYA 3D3FA 4REQA 2HK0A 2WJDA 1WDQA 3ARUA 1RVGA 4I8YA 3WQDA 5FD0A 5H8MA 1KM6A 5CSRA 4A8IA 4KRTA 1XQKA 3E0VA 4A3YA 1JD9A 2X7VA 1Q45A 4F8XA 3PANA 2VX6A 2V2CA 7ENLA 2BXVA 4RNJA 3R2GA 4ACZA 1IR2A 5D32A 1EP3A 2WM1A 4IIEA 3VC5A 3LTPA 1YDVA 2QCCA 4DXVA 4B5VA 3T8QA 4G7FA 6REQA 1R30A 1AZ1A 4TOQA 2QW5A 5FKYA 3IGSA 2W27A 2WHMA 5C0QA 2W3ZA 1JFXA 3RJXA 3CMGA 2A3LA 1VPQA 2VUNA 3ZJ7A 2VMFA 2NQ9A 5LHEA 1A5NC 5FEZA 5LNSA 4LYPA 1KR1A 2BX7A 2H8XA 2X30A 3I10A 4U2ZA 3GTFA 2XM2A 1V6UA 4HHPA 2JIWA 3IV8A 2G3FA 4L1XA 3NQGA 1XD0A 1RPXA 3AIWA 7ODCA 1LWJA 2D2GA 2XSXA 4IPNB 3SGUA 3AAMA 4V15A 3CC1A 3WD1A 2XH4A 1C92A 2Y62A 1HKMA 3W6LA 3KRZA 1K1DA 1UBPC 2DSUA 2WVSA 2ZRZA 4B5XA 4H6KA 2V38A 4UFIA 3UJRA 3O3RA 5D02A 1R46A 2NSXA 4HCDA 4DIAA 3BCDA 2EG6A 3EMCA 2QNEA 5CPOA 3UWYA 5CSSA 3DFYA 4NNBA 1E9ZB 2CPUA 3GHTA 1AMKA 2QPXA 4JQ3A 3HQOA 2VRQA 4KESA 2IPJA 4KEVA 2DZVA 4OKDA 3AHYA 2E1WA 4HOZA 3SB0A 3UZWA 5I3FA 1XFBA 4LVDA 3WQVA 5G2WA 1A5MC 3PULA 2OTDA 3DGBA 1QPQA 2ZBTA 5BNKA 1KWKA 3A64A 2FDSA 4O1BA 3UQNA 3LZ5A 3RF9A 4QLJA 4RZBA 3BUVA 4JPGA 5AC7A 1BAGA 3LB0A 1OC5A 2AOSA 1HZYA 1SJCA 2X41A 3DCPA 2AQVA 4Z0SA 3M9YA 5LNRA 3VO0A 1GVSA 4KWWA 2A85A 2DSWA 1VIWA 2QEZA 3UXDA 1O5KA 5A95A 4JIRA 4OBSA 3WUGA 3AXXA 1HFBA 4W7VA 3TCEA 1KFLA 4FI4A 1S3HA 4Q33A 1LRTA 2H8ZA 4QBXA 3TA6A 2FMOA 1J0YA 1BVNP 2DSZA 1YHTA 4MWAE 2VELA 1OFOA 3WD3A 3FLUA 4IT1A 4C6JA 3V5CA 3MU7A 1KA9F 1X7FA 4IQLA 1Q8AA 1XLHA 2I57A 3IARA 2EPLX 1WZAA 4C7DA 3WELA 3FNDA 2PGRA 3C52A 4HHMA 1F3WA 3FGCA 2D2HA 3ZVIA 1OGGA 3ZT7A 3TTSA 5GJMA 1PZ3A 3VILA 4TTUA 1J0JA 2GJNA 1I8JA 3LCGA 3MW7A 4UNKA 7TAAA 5JQ9A 1CWYA 3M41A 3C6CA 1D9EA 3N2CA 4Q7BA 4CCEA 2PURA 4JX6A 1UWTA 2IXVA 4GI6A 1KBLA 1XGZA 1CIUA 1EGZA 4IXHA 2WCAA 2AKZA 2X1TA 3HG2A 2DQWA 4MWAA 3L7RA 1QNOA 1ZU8A 3L2IA 2PDHA 2ASHA 2XFRA 1NP0A 4AEOA 3R89A 4OFCA 3V36A 4X63A 3ITGA 1B3XA 3CPRA 5G5IA 6XIAA 4S3CA 1XWYA 3M07A 4ZTXA 2CKRA 4B5TA 3XINA 4QCFA 3Q94A 2QV4A 3CZEA 3W1QA 4US5D 3THUA 3T4WA 1H0IA 2QDHA 2C91A 5REQB 3UNDA 1DQXA 1CYGA 2BODX 3NTYA 1O95A 3NIYA 1TE6A 4QGCA 3HQ1A 3M0VA 8TIMA 5ABHA 3PUGA 1E1CA 5U4NA 3FN9A 3LSBA 3VDGA 4HYWA 3AUOA 1UHVA 1L2QA 4OBTA 4UTKA 3NSNA 5DMNA 3SI9A 1E71M 3C8NA 4JN6A 2ANUA 3WH8A 3ES7A 5HNNA 2CNCA 5F1UA 4JTAA 3N04A 3AROA 1HXJA 4CNNA 4C6QA 3WQ5A 1QTWA 3GC5A 1F07A 3LUTA 3H8AA 1ZY9A 2PMQA 1T96A 3APTA 3N19B 1TCDA 3G0UA 1NELA 1FWWA 3BLIA 1W3IA 1BKSA 3WBYA 1JIBA 1P6BA 1C7TA 4RE2A 2P53A 3TXVA 4AX6A 1CGTA 1OHLA 1HJUA 1JAEA 3S1GA 5E0FA 2F9RA 2V5CA 3LENA 1W8GA 1IEWA 2OLHA 4AU0A 3CEPA 3I6TA 5CLTA 4UQBA 4TQTA 2QPSA 2VD8A 4I8DA 3HGSA 2ZUTA 1U83A 4FLSA 4YWSA 2GGIA 2QLYA 1EHNA 4QSHA 3W86A 3BOLA 3N3MA 2J79A 1NVMA 3AXKA 4IIHA 1CXKA 3AC0A 4LAMA 1VCVA 4UTHA 2B0MA 3EOSA 1F6KA 4LBUA 3W6MA 1B57A 2F7FA 3F7JA 2PAJA 2OWXA 2JBMA 4DM2A 2Y88A 1EB3A 3DEQA 4HNLA 4H01A 1DPMA 1H50A 1RBAA 4AZCB 1WNOA 1P0DA 5FEXA 2RDTA 5C2XA 4K6AA 1IHIA 3ZS4A 4G7EA 1I2OA 3O6CA 1GYLA 3SCVA 3UG4A 4FXJA 4KMQA 3GG0A 1KLZA 4W84A 4WKFA 5FACA 5EMMA 5ABEA 1FWJC 4RV3A 1J5SA 3KVLA 5BU6A 1UR0A 4MB3A 3HZ3A 1BPLB 3B8IA 1X8FA 2J88A 2WJEA 3GXPA 4YJ5A 1XYMA 4C6BA 4UR9A 2YLLA 3OGRA 2XVNA 1FWEC 5AHFA 2C13A 2J27A 2GQ8A 1S1RA 1NDVA 3DX5A 1P4CA 2ZWYA 3SEPA 4V27A 1XV8A 3HGOA 2C0HA 2RH9A 2YL9A 1WCGA 2ZDRA 1GZ1A 3LOTA 5CPTA 4PFMA 1REQB 4TV6A 1BLIA 3OLDA 1YPIA 3SUUA 1MFUA 2IQ0A 3L4WA 2Z29A 1JGIA 4H3DA 2JIEA 4QFUA 1Y65A 3CQ0A 1XLAA 1AJ0A 2SFPA 1VBRA 5AN7A 1P1MA 2JGQA 4LOCA 2OQLA 3NPWA 2VZSA 3VIKA 1YE6A 1BGGA 4F2BA 1YXYA 1UWRA 3VAVA 1JG9A 3VXGA 1XRSA 4CU8A 4G7EB 4JIHA 2NW0A 2C16A 1FVPA 1W1IE 4U3AA 5D2TA 5AHIA 2XU2A 4UC5A 1UWAA 3CAQA 4H2HA 4DPPA 3O0FA 2WKJA 4GO8A 3B9AA 1BF2A 5D05A 3CNYA 1Q66A 3DFOA 1TJ1A 5LKYA 3CEUA 4PSPA 2Z1SA 1X98A 1KFKA 3S2LA 1MQQA 3WLTA 2R6OA 1UUQA 5LA2A 1ITXA 1J2WA 4S3GA 4MZYA 4MKVA 3BH4A 3MUY1 1KB3A 4H9TA 3VNZA 4EK7A 2Y70A 1A0EA 2O0TA 4HK7A 1BVZA 1EP1A 4XK2A 3LBCA 4JFVA 4W93A 3RR4A 1Z41A 2J8FA 3I7QA 1G9HA 2TSYA 3NURA 3CO4A 4IPPA 3L21A 4DO5A 2E40A 1H7WA 4GYJA 1XW8A 4EAMA 1EX1A 3C3UA 3AMGA 1E56A 1GEQA 4HHLA 3BGJA 4OV4A 2VFHA 3FOKA 1DJYA 5CZJA 1RCOB 2EBNA 1UMLA 3GTHA 4LF2A 1XSJA 1QR7A 3NO1A 2YYUA 3HB9A 4ZO6A 4AH7A 1E9IA 3L2LA 4Z17A 2PEVA 5DMMA 3SUTA 4L65A 2VEIA 3B4UA 4ML9A 2PFHA 3BAIA 3L68A 2E6AA 3B9DA 1YNQA 4RNIA 1VFTA 3I6RA 1XX1A 2G8ZA 2DT2A 1J8VA 1QPRA 1XI3A 1S2VA 3F03K 1DV7A 2WMIA 3DYMA 4UTWA 4Q4SA 1EL3A 3EGJA 4GX9A 2R82A 4E4UA 1PPIA 4CNPA 2BASA 2X40A 2QUVA 4HCHA 2GQAA 4UTTA 5CH9A 3WNNA 4XKYA 1VFSA 4WVXA 4Q8MA 4ML4A 3WH6A 1OFPA 2IPFA 5BRQA 4H41A 3GTXA 3ID7A 1F6PA 2I17A 3CYJA 1VJZA 1OBAA 1FOBA 3OA5A 1YDNA 2V9DA 2OQYA 3W1PA 3VDCA 1TV4A 2BWGA 3ZVHA 1XRVA 3STCA 2WPGA 4ZCWA 1RHCA 2XIOA 1RJQA 4KWUA 3BW2A 4HMCA 4EXBA 3NAVA 1R7AA 1ZRQA 4US5A 1IE7C 1RK5A 3TROA 1DJNA 3LSCA 5HULA 3W71A 2R14A 2A4AA 1TA3B 1VBJA 2VXNA 4O17A 3BLKA 2FVKA 4EE9A 3WF0A 1WX0A 3BMVA 1OK6A 1V51A 1DE5A 1TQXA 3EDDA 1FWFC 2NVAA 3SN4A 3SECA 1UKTA 4R7JA 5CBBA 1I6NA 3G2GA 4MJ2A 3PVFA 2P3EA 3M0IA 1FH9A 4RE3A 1HKKA 1WO2A 2FJKA 3EX4A 2OEMA 1Q3NA 2PU0A 3BWWA 1OG6A 3LY0A 1G01A 2FZ9A 1KBKA 4E8CA 2P76A 1Q5MA 3HGJA 1QOPA 1BG4A 2J9XA 3CT7A 1C8YA 3QV8A 5BXRA 2FLIA 4B5SA 1VB9A 4PTVA 3OG3A 1KTCA 4R7OA 4ZOBA 3OLIA 1W91A 4YHEA 1KM3A 3B05A 2J7CA 4XAPA 2OLSA 3WYZA 1R3VA 4UIOA 4ZFCA 3S2CA 4UQ9A 2Z28A 2O9PA 4MWAD 3MPGA 1GPFA 1BSIA 4TVCA 2VVNA 4B5NA 1A49A 1IEIA 4QJ4B 1OY0A 5AY7A 2XYLA 2Y24A 3RX2A 5DRIA 2DZSA 4GY0A 4E4PA 3ZOAA 3ATYA 1W3JA 3MDUA 4CQAA 2ONEA 3CHFA 4WOQA 4CQ9A 2VTFA 2F84A 3KRUA 3LXBA 3SQSA 4DLMA 3WQWA 1GVRA 4KKXA 2ZUNA 2WSKA 1ELSA 1LQAA 2QXWA 3R8HA 3EX6A 1FWCC 4WSHA 5C54A 5C9WA 1S5VA 1MFVA 4OE7A 4UNLA 4RNFA 3DERA 5B7ZA 4LAKA 1UR2A 3GVVA 1ZENA 1JCXA 4LX4A 4XZLX 1HKJA 4GFIA 5A8MA 2VGIA 1RR2A 4RNHA 3SRDA 1XUZA 4Z42C 2WNWA 2XSBA 1LCOA 3IVTA 4YTUA 2DT1A 4PODA 3WF4A 3BSMA 2Q8XA 4O15A 6TIMA 2RJGA 5DXXA 2VFIA 1M9HA 5DQPA 1P6WA 2DZPA 4BA0A 3H7RA 1O5XA 2XN2A 3JS3A 3GB6A 3KHJA 5IDZA 4ZR8A 4DM1A 2QQ6A 4ZBCA 1VF8A 4FO4A 4HQVA 3GZAA 3C0LA 4IWWA 3NQ7A 3BOXA 4QDMA 1RLCL 2OKTA 3QZEA 1I2PA 2RKXA 4HMDA 2Q71A 3N2MA 4NKCA 1R87A 3GNOA 4N9CA 2Y7DA 3DH7A 3P84A 1SFJA 3WLSA 4IPLA 4OTKA 5CGMA 1LWIA 2YZRA 1HO4A 3U48A 5I0DA 1E72M 4MYXA 3VIMA 3DFTA 2Z1WA 2HMCA 2VEPA 1OX5A 2QUMA 4WKAA 1TZ7A 3MWCA 4JKLA 2HQAA 3U2ZA 3JZEA 4JY8A 3REQB 4CGTA 3CPGA 1L0PA 4TO8A 2PWEA 1E43A 5AZ0A 1FWTA 3G77A 1KFBA 1ME9A 1R8LA 1DKWA 1H1ZA 1ZFJA 3TVAA 4GC3A 3EDFA 3E0IA 4I7UA 3TWBA 3AHTA 1IWBA 1SW0A 1JJKA 1CW2A 2EXOA 1K77A 4PH6A 5FOOA 1H62A 3V1PA 4KCUA 1RPKA 4HOXA 4WUIA 1V0MA 3P82A 1UH4A 4BWLC 3E1F1 4GRSA 1RALA 1EJUC 4JTQA 3F4VA 1AH3A 5H2ZA 4X0NA 3R79A 1U30A 2PF8A 3R4IA 3W29A 1M5WA 3C61A 1DTNA 4D71A 4QAWA 2E5DA 1XH2A 4F4RA 3RG6A 5A1AA 3TYDA 1NFGA 1UP3A 1EBHA 1UW9A 4TXEA 1DHPA 3W2KA 4FNRA 2VGFA 3CL6A 4S3KA 4J1OA 3R0DA 3CIWA 1R0MA 1Z8AA 2CFFA 4DXXA 3BXWA 5U7SA 1F61A 2YYTA 2RJHA 3UF9A 3PBUA 4CCDA 1W9PA 4B4FA 2OLAA 4HK6A 3S83A 3W00A 1I9CB 1KV8A 1OD0A 3EYPA 3VABA 2EJ1A 4WQ6A 1F74A 1UKSA 5BWFA 2YX0A 4WOZA 1B3OA 4HSOA 1VHNA 4PTWA 4AIBA 2ZXDA 3REQA 5HUPA 5FF3A 1Q85A 2TRSA 2I16A 3E5PA 3GW0A 3AOFA 2D20A 3RAOA 2Z7GA 4C6KA 4MUPA 3RRXA 1MUWA 4YTSA 1B3YA 2ZC8A 4NT0A 3CUHA 1W3HA 3DBPA 1XIBA 1AH4A 2F6UA 3SY1A 1E55A 3CAKA 4BF5A 4DAFA 5IBXA 4WGXA 4ZOCA 4JIQA 4HA0A 3UY7A 3TNOA 1QPNA 5CSUA 1O1HA 3SIMA 5K2ZA 3THAA 2V82A 3B8TA 3OIXA 1CLKA 5C55A 1OFEA 1S5TA 3E2QA 1GPWA 1I75A 4INFA 1JUEA 3YPIA 3WY1A 3GH7A 5E0KA 2BGNE 1EC9A 2HJPA 5CZTA 3VVGA 4CCCA 5D03A 1D3CA 2V5KA 4AC1X 3MS8A 3CL8A 3PB0A 4FAMA 2QJJA 1JI1A 1HUVA 1ITCA 3H2MA 2H3DA 1QHOA 4WGHA 3W25A 1W3KA 1P43A 3SURA 3WUEA 2XG9A 1FP8A 3N6JA 1PZ2A 1PIIA 4XZMX 4N7QA 2ZZ7A 1I4NA 6A3HA 5D09A 3XISA 4LW7A 2VZTA 1RCXB 4JKMA 3RHGA 2FHBA 1LBLA 1W54A 2X42A 3NDOA 1MW2A 4BF7A 5C71A 4LQ1A 2XVGA 3AZRA 3GH5A 4D6IA 1NWRA 1ENUA 1PJ9A 4HU0A 3VIJA 3N2BA 1WAWA 3EKLA 3UXIA 3ZO9A 3M5VA 4HYRA 1QPKA 4NI8A 2L5HA 3G8RA 2G0WA 3EPOA 3LTSA 1YW1A 3MCMA 3QQ1A 4AXNA 3W74A 1RH9A 4AZHA 1NP2A 3S8HA 4DBWA 3C3NA 3KOZA 2PWVA 5I7GA 3MP5A 3RDKA 4AIEA 2A7PA 2VFFA 4GH1A 1JYVA 2O55A 4WJ8A 2VC7A 2X0YA 4MNKA 5F7UA 3D5HA 4A29A 1CGXA 2GDQA 1OC6A 3CLMA 4UB9A 4XVEA 1OFBA 4H9UA 4NSBA 3VOJA 2VEMA 1FH8A 3PTDA 4UOZA 2V69A 1KM2A 3RPDA 4GUJA 2I5QA 4W87A 4D6FA 1GEHA 1DJQA 2F2KA 1KXHA 4ZXLA 2WJFA 4IJCA 1VEPA 1H1YA 1WZKA 3CWHA 3V0TA 1JYNA 3H53A 3P5YA 2ZUUA 1X6NA 2GSEA 1FTXA 1EXPA 4HBKA 1Q63A 1M03A 3L5AA 3B4YA 4H7CA 1ZL1A 1XLBA 2ZQ0A 5I3JA 1GQIA 3M0HA 4S2BA 4NP7A 4UQCA 1KXTA 4D6GA 1VJSA 4GC4A 1XBXA 4U28A 1UC5A 4RKAA 5HWJA 3PJTA 1AJZA 1FWDC 1PDZA 4XVDA 1WQ5A 3M7SA 2OPJA 2WSYA 2PE4A 4GVIA 3QXBA 1UZ1A 2X2GA 2WHLA 2EPOA 5G4EA 3W7GA 1NWSA 3NPVA 1RA0A 3U2OA 1WPCA 3S5YA 3GNPA 2OX4A 1EJTC 1E1EA 4D1JA 1W5PA 1E5NA 3BVJA 4KIEA 5C70A 4GUFA 3PUOA 3S6TA 1R3TA 3NXLA 4TMCA 5HINA 1A5AA 4C6LA 3C2OA 3UWZA 1IIHA 5GJNA 1TJPA 3HBLA 2D22A 1L6GA 3R5EA 3W3OA 3A4XA 4QISA 2VEFA 4DY1A 2QUNA 1EIBA 1F9CA 2NWRA 3T44A 3LQLA 8A3HA 1VFLA 2NXIA 4JIEA 5F4SA 1M01A 2BGQA 4F0SA 4NNCA 5D37A 2HXUA 3B9NA 3GXTA 5FJPA 3WJWA 5KZEA 2EPNA 3D6NA 3P61A 4JTGA 4J3WA 1W5NA 3KAOA 4X2PA 3W1LA 2PRMA 3NYZA 4U3CA 1DORA 1EDQA 1XH0A 1QI3A 2BFGA 1W5QA 3S42A 1D8CA 4NUWA 4JD4A 4HNNA 2QCGA 3LS9A 3MV01 3ICJA 5FF0A 4EXAA 1U33A 1UD5A 1R2TA 1R47A 3NQAA 2F6KA 4K8HA 1X97A 3ZIZA 3G1HA 4FNQA 3R10A 1RY0A 4UXDA 1PUDA 4FX8A 1HIZA 2PCQA 2AL1A 1XYLA 5LNVA 2GGEA 2O4QA 4I6VA 4PUNA 1YLVA 2P88A 3TOPA 3T40A 3FCPA 3OVPA 2XFYA 3G5EA 3ANUA 4MNLA 3MHGA 3AHZA 2NT1A 1UD4A 3K30A 4JGDA 3GR4A 2VI0A 1OK4A 5K9CA 1IV8A 3VI2A 4GYFA 5TNVA 1O12A 2RGMA 3WDIA 4L4PA 4C60A 2R94A 3E12A 2OQHA 1ICPA 3WDRA 1XBYA 4RPQA 3L0KA 4UQEA 3ITLA 1ADSA 4C6EA 1HT6A 3VZYA 5HMEA 3M5ZA 1TQJA 4B4HA 4UR8A 1XJBA 5CG0A 3GR7A 3IGHX 2CYGA 1LOSA 4KEUA 1EO7A 3LPOA 1VD6A 1KTBA 3EB2A 1AQFA 3L66A 4ICNA 4ADUA 3U4FA 4M80A 1W5MA 3W7LA 2BS9A 3RK8A 3PPCA 3UU0A 3KTCA 1SO6A 4CD8A 5EKYA 5C2GA 3W7CA 3MJYA 2HVOA 4JQ4A 4S38A 2HZGA 3T2PA 3T81A 3UJ2A 3ZQ9A 4JTKA 1K7FA 3GFYA 4F40A 5A69A 3MUZ1 4FPSA 1B1YA 5FAJA 1R2RA 1IEXA 3NQMA 5IHRA 3K8LA 3P62A 1QK0A 1Q65A 4B91A 1WDWA 5I07A 1M65A 1M7OA 2QCEA 3N4AA 3PTKA 1EJ7L 1ZP4A 4EP8C 3UVAA 2HXTA 3LHZA 3L4XA 3B8SA 3UGRA 1GKRA 4DWSA 2XZ7A 2Z1KA 2OWCA 1XIHA 3IJDA 2HPIA 1KQYA 2ISFA 1Q6GA 3U7VA 3EDJA 1QT1A 3C0JA 2WMHA 4BKNA 1DYSA 2PBGA 3BARA 2QHAA 4S23A 5FAGA 2ZZ4A 2CIPA 3TN4A 3FY1A 5D04C 3WEMA 1CX9A 1DQWA 4JTDA 3S9IA 2ACQA 1EOKA 3QHNA 2P5NA 4YVVA 3CB8A 1WZLA 3PUEA 4JL1A 5FJUA 3II1A 3T0CA 3VC6A 2G5WA 4KF1A 2ZCGA 2PCEA 3WD2A 1WXZA 3HJZA 2C14A 2CLLA 4PMVA 1CECA 1OADA 2GFTA 3R6IA 5FIPA 2F8QA 1IYXA 3SY8A 4JR5A 2WZMA 4Q6JA 1L6SA 2DJXA 1LLZA 3QY7A 3EWXA 3VM5A 3JU2A 4MY1A 4UR7A 1JZ4A 3W53A 1J11A 2XGIA 3RLVA 2W66A 4Q4QA 4U2YA 3AIVA 4XO6A 4S3EA 3WLMA 4O4WA 2PWFA 3HMJG 1UH2A 3W2JA 3IJ8A 1J01A 2HROA 4RXGA 2GGJA 2C3ZA 4UOJA 4KEZA 2GUUA 1NTHA 1SO5A 3LK6A 3WF2A 2ZX5A 5HR6A 4XD5A 1PX4A 3T7VA 4AY8A 3HGRA 1POKA 4M5PA 3UP8A 3DC8A 1H7PA 4M51A 4LS1A 5T9BG 1MWOA 4AEEA 2ZE0A 1KM5A 3F2BA 1XH1A 3BANA 1BYDA 3E0LA 1PXGA 4ILSA 4L61A 3J7HA 4HA3A 4HMEA 5G4WA 3M0MA 3ITOA 1E1FA 2VCCA 4MKSA 3GX9A 4XSMA 3OOQA 2OB3A 5HANA 1O7AA 4CN6A 2PD5A 3OZOA 2ZYFA 4Y8EA 1AVAA 5LXEA 3FEQA 4O8RA 3LM3A 9XIMA 4QHRA 4HD5A 3BL3A 2WWCA 1OABA 4WXZA 1DWHM 4D6JA 1BD0A 2WZEA 1E3ZA 2C19A 1WOAA 1I2NA 1AL7A 4KWOA 5DMYA 4K7VA 1K8XA 5BXSA 2YXXA 4JTHA 3D0CA 2ZOXA 2VCBA 3IUDA 1E1CB 1J6OA 3CK5A 4IUOA 5LHFA 1ZAHA 3PK7A 3M0JA 4XBKA 1IXNA 1OCQA 1U1HA 1EIXA 3OBKA 1NDWA 3EMQA 4F66A 5A6JA 4S3DA 3WL0A 2OGYA 3VIHA 5DT7A 2ATMA 1NOWA 3EA3A 4OBRA 1ZZMA 2Y8KA 3TCSA 3RM8A 1QPOA 1JGMA 3QW4B 5DRCA 5F1VA 1S3TC 3MUIA 3DKJA 4KETA 3USZA 3VCCA 2NX3A 1GVOA 4IICA 5FF2A 5BMWA 3INPA 3K2GA 4GKTA 3CB3A 4NJKA 2GLKA 4TMBA 2PP3A 3CLWA 3KS6A 1E40A 2VQUA 5A8PA 4R3UA 3H26A 2G95A 7REQA 1OX4B 3BMXA 2PBOA 3AHXA 3M4HA 1GOXA 3PS7A 1WUFA 2BHUA 5FEWA 2WVVB 1VFOA 3KZPA 4GABA 4O19A 3MKKA 4GJJA 3JW7A 3LEPA 1SJAA 2CLIA 4XD6A 3CQHA 4GNKB 3TJIA 4X22A 2J77A 5E9AA 4Y9AA 2DVTA 4G8TA 1XIJA 3I3BA 3PAOA 2FGZA 3G8EA 4M56A 4LC8A 4QG6A 3R94A 1GJPA 3SCTA 2QJGA 1QDSA 2FH8A 1B9BA 5A6KA 1A53A 1WDSA 2Q01A 3GDBA 1J4EA 3WZ0E 3ARVA 3QV9A 4LEFA 4Q8QA 3W76A 3W9ZA 1QI0A 1ZTVA 2R1NA 1V6VA 3HJEA 3BZGA 3P60A 3PM6A 2HBXA 2XISA 1ZHAA 3L4ZA 4KFPA 4AD0A 1L8NA 1H4PA 2YDAA 1NM9A 1E0XA 1QAPA 3UWEA 5BRBA 1W9BM 1G0CA 3KFTA 4UTTC 3WKZA 3HIJA 4JTTA 4J7RA 3WUFA 2WCGA 3NNTA 3EMZA 4X9YA 3FVDA 3W7JA 2VQTA 1GOIA 2TYSA 1UCWA 3KCOA 2WNQA 3V5OA 2W5FA 3DG6A 3PFMA 1K70A 1P0EA 4NASA 2ZZ3A 3JVAA 2D23A 3KCLA 3ME3A 4G5DA 5JBEA 1BTMA 2A6LA 4LSBA 1ZJAA 1EEPA 4FXSA 4XIAA 2OJPA 3VKAA 3MQTA 5GJPA 3MY9A 2FB2A 3SRKA 3DZ1A 2Y2WA 4E2BA 3PSWA 2WB5A 4QRNA 1UA3A 1QW9A 2WVTA 3CZKA 3CL7A 4U5KA 1FWHC 5E93A 3RMEA 3FHQA 3URNA 4LVBA 3C4UA 3DHPA 3PBGA 2YL8A 5D2XA 5D9PA 3A23A 3NVDA 5D4YA 3UR2A 4GNVA 1VYRA 4ZE5A 2VFEA 4QDWA 4KGJA 3I6EA 1WP6A 2P0OA 1X1OA 4KRZA 2ZUWA 3HQNA 3W7PA 3ARPA 1EWEA 4Q32A 3UPWA 4CQ8A 1TMQA 3QMRA 3ITTA 1G69A 2W67A 1JNEA 2NQ5A 1GOOA 3PG8A 1VFHA 3BDKA 5KETA 2D73A 1V6XA 2GVLA 1OB0A 1MW3A 4Q4MA 3UCDA 4DJEA 1HJWA 2BVYA 4UMCA 3W2NA 4JTRA 2A3AA 3U57A 5ENLA 3M44A 4I6KA 4DUWA 3SSJA 2A2IA 3B8UA 2B4GA 5IBXC 1M1BA 1Q7MA 1YTEA 3KVMA 3KOFA 4JHZA 2PRLA 1ONRA 3LCLA 4GY1A 2J47A 3NVTA 5JIWA 4CD5A 4PN2A 2Y8VA 3TFXA 1OVDA 3ZT6A 3E2RA 2WMIB 1FFQA 1C29A 1J12A 1Y5XA 1GONA 2HE5A 3TKFA 3W27A 5FJOA 2A3CA 4C6PA 2WHJA 1MXSA 2V67A 2GDVA 3VINA 3S2NA 5K3VA 1H11A 5CAKA 3TMQA 1KWGA 3NL6A 3FYYA 1EEXA 2MANA 3R25A 4NVTA 4H6QA 3TR9A 4ZA0A 1TPWA 3FXGA 2DIEA 1T0OA 1OIMA 4NZ4A 1TB3A 3MSGA 3UA3A 2ISSA 2REQA 2VNCA 4R5EA 3C8FA 4KW2A 1W5OA 4XAFA 1E0UA 3H7UA 3B3DA 1SMAA 1W6TA 2UZ9A 5BMXA 5I77A 1H2JA 4W7UA 5CZKA 3FYOA 3SQMA 2D0GA 2WZHA 1CB7B 1H1NA 3DFSA 3W1XA 4NAFB 4PUEA 4ZQOA 3VKCA 4L4OA 3KCJA 4ADTA 4Y8FA 2X1RA 3AS0A 3IUHA 2ADAA 4UCGA 3VK5A 4DWDA 1IZCA 2ZXAA 1VAHA 3TC7A 7TIMA 1XL9A 2VHLA 4C6OA 4B3KA 3GU2A 4FLOA 3QEZA 3M64A 1DWAM 4HVXA 2V81A 1Q6EA 6REQB 3OW1A 2E5BA 2VL4A 4DJED 3SM0A 1XLEA 4HJFA 1SFSA 1LL6A 5HQEA 4OVXA 4M3PA 3T08A 1QNVA 2PPGA 4L9YA 3NZ1A 4UTJA 1PDYA 3AISA 3AMCA 1OCBA 1QW7A 3ANVA 4C6IA 5IM51 4ATDA 3DFNA 1X1NA 4ENLA 3T9PA 5XINA 3RO6A 2PGFA 2YL5A 3EOUA 3IIXA 4JTIA 1FHLA 4KPLA 4UFJA 4DELA 4H8VA 3TW7A 3I7RA 1SO3A 1VQTA 3QMSA 2P50A 3TK7A 1JCNA 1G1YA 1EQPA 3PB2A 3LRLA 2ZDSA 1QK2A 1TA3A 4GZIA 2VWSA 4WR3A 1R86A 2O56A 1BSLA 3WDPP 1A5OC 3GAYA 4LS0A 3CUJA 5DY3A 1ISVA 5BROA 2YW3A 3WQOA 2XFWA 4DJDD 2X1SA 3MMUA 2PGWA 1JPHA 3WG6A 3CUIA 1V77A 3N2XA 3AXHA 1P48A 3SN0A 4CNUA 1JZ6A 1W1VA 3ZR4A 1CLVA 3MC5A 4D72A 3CWOX 3KOYA 3NQEA 3O2LA 1OC7A 4RV8A 3EX2A 1V02A 1EA9C 2ATSA 3R58A 5JIPA 3GU9A 2A7RA 2QDEA 4H83A 2J6XA 3O9NA 4J28A 3KE0A 4N42A 1FWBC 3DHDA 2BGSA 2ZVIA 4GY7A 3KP1A 1W1ZA 1Y5WA 4NRSA 1LBMA 2XFFA 4W5UA 4PCNA 1SW7A 4AY7A 2J24A 2HNHA 3H4XA 8RUCA 3GXNA 1VBGA 4AZCA 1LUCB 2QUUA 1PHWA 4L6OA 4B2DD 1TJ2A 4IHCA 4NZ5A 1RBOB 2VYOA 4K8EA 4NJHA 3M0KA 1MQRA 5AFDA 3W2UA 3VCNA 3MP4A 5LZLA 2A3EA 2QIWA 4NX0A 1DIOA 1VBHA 2X1IA 4URIA 4MF4A 1JCJA 2WLYA 3VM7A 1WDRA 1L9WA 2CHRA 2W63A 2TMDA 1Q6RA 3GTNA 3QN3A 2WM0A 3Q37A 4OJYA 2VZOA 5CC5A 1EKOA 5M3WA 1L6WA 4OOZA 4XZNX 1JZ8A 3VIFA 1W1PA 2XUCA 4K39A 5G1MA 1VENA 1UBSA 3TE9A 3WBAA 4DBDA 4GKLA 4LNCA 1H60A 4K1WA 4ALDA 3MJMA 4XTIA 1E0VA 4QS5A 4DPQA 2ZX7A 3N9RA 1QHZA 3OBAA 2WWDA 2FGLA 3SR7A 3TJXA 1HN1A 2D3NA 1PX8A 1FBAA 1T7LA 2IW0A 1JULA 4H04A 1JEZA 4EPKA 2WANA 1ONEA 1MDRA 2FB3A 2E6DA 3K13A 4XD4A 4I90A 3VKJA 4X61A 5G1TA 3M46A 3QTGA 4AYSA 2Y4SA 4ATLA 4YCPA 4W86A 3QC3A 2Q8LA 1E15A 2FVMA 1XLFA 1GUVA 4O57A 1FWNA 1QHPA 4CLMA 4JX5A 1E4LA 1BRLA 3RM9A 5JXQA 3LV6A 2HNEA 1W3TA 4LUSB 4D1IA 4IQEA 1R9YA 1KRCC 1TVPA 4CVUA 5G4HC 3M47A 3KS5A 3RUBL 3GAKA 4EKJA 1BYCA 1EP2A 3Q65A 1WV2A 3AS2A 2WXDM 1JRBA 2DPEA 1EZ2A 3GHSA 2B7QA 2YB1A 3CT2A 3UD6A 1V3LA 5EBAA 1O6IA 4HZMA 3GYEA 4QQ3A 1UC4A 3GG7A 1TG7A 3NZPA 1WKFA 4E38A 4DJFA 1WA3A 2QAPA 3A3XA 3RILA 2EF9A 2Z25A 4DUOA 3U9IA 1JUBA 3B0PA 1XGEA 3P0WA 4WIWA 1BKHA 4M8UA 3FK4A 4Q4RA 4BCEA 2IUZA 4IG2B 2YKKA 3SSZA 2QVHA 4PBEA 4PMNA 3DYPA 4AWEA 1OFDA 1DJZA 4MPQA 5EMJA 5CC3A 3WUBA 4LXFA 1Q6CA 1RP9A 4X60A 3T6CA 2DZTA 2CWXA 4XZBA 4IIFA 1VBUA 3LD5A 1ZGDA 3MANA 5D33A 3PNUA 1NF7A 3DG7A 3K8KA 5A2CA 3THCA 3VMPA 2Q02A 3GXIA 1JZ2A 5GNYA 3SCUA 2A0NA 5ECVA 3GW3A 1W17A 3H24A 3KXQA 5A8NA 4YTTA 3EZ4A 3N6HA 4JIPA 1PAMA 1EQCA 3QSTA 1RQBA 4JTJA 2Z24A 2GVYA 1EPXA 1LROA 4DUXA 1XF0A 3UWWA 4H9VA 3ZT5A 4W9TA 4JNMA 2RDXA 2EAWA 4TV5A 3KBNA 5C9XA 2PWGA 1FCBA 2BG5A 1OM0A 4LVGA 5T9CE 2DJLA 3IIOA 4KERA 4GH3A 2WJZA 2Z1BA 1S2WA 3A6OA 1AQHA 5HK4A 4FA3A 1V6WA 3NQDA 1U1UA 4FXRA 3CHEA 4WZHA 3KBJA 2PDNA 3FV9A 4Q3MA 5C8BB 4BQ2A 3VNDA 2PSNA 2UY5A 1JFHA 4PUDA 3VGDA 3LI0A 4PB3A 2OVLA 1OFQA 4GK8A 4UMAA 3WLIA 2Y63A 1IZKA 1OF8A 3VIOA 4MJ4A 2WCSA 2YA0A 4O14A 2WSRA 1F3XA 1TELA 2BLEA 4I7VA 4TU1A 4YPJA 3LXAA 1OZQA 2CKSA 1L6FA 3WLQA 3VZZA 3DBNA 2C1GA 1QW8A 5L6UA 3EWZA 3FA5A 2ACUA 4L9ZA 5MHBA 2BOGX 4LB4A 4MAVA 1THFD 2GSJA 1QNSA 2OZ0A 2QCNA 1OJXA 3MO4A 4ZQNA 5D2YA 1AUSL 1C9WA 1Y5VA 2GJLA 3NM1A 1MXGA 5A6SA 3WEZA 5FSDC 1V8EA 3SAZA 1Z89A 4FB7A 1GGOA 4W88A 5E09A 3HPXA 2Y5JA 1IEVA 1QJWA 4IMDA 4I9TA 2CW6A 3UCCA 1RZMA 3OGSA 5F2GA 3IJQA 4MIMA 3CIVA 1ZJBA 2Z1XA 4DBSA 2DH2A 2JE8A 1QASA 1C9DA 4ZSTA 2G3JA 2VC9A 1EPVA 1OCJA 1FP9A 2QGYA 4RJEA 1RQHA 4P5UA 1H61A 2Z6IA 4LV4A 1OYBA 1PHQA 1M04A 1CXEA 1MW1A 3RLHA 1FCUA 4JN7A 3DFPA 4K36A 2E7FA 4NAFA 5JVLA 2ZRXA 2ZZ2A 3V4BA 3DI0A 1WZMA 1ZBCA 3B0VC 2YFOA 1BXNA 1A4MA 1E4IA 5CC6A 3JRKA 4NF7A 3TLQA 5I09A 3CBWA 3T2OA 2OSYA 3BC9A 3UG3A 3NSMA 1X39A 1UOKA 4PB5A 4WY0F 1KM1A 3QYSA 4FOUA 3EB3A 1XHGA 2CLKA 3FEMA 4Y9OA 1O60A 5BCAA 3HF3A 5I3DA 3UWVA 3CXOA 3U5UA 3BJTA 1JCMP 2J7GA 4MGGA 1WBJA 3WLPA 3O16A 3SO7A 3H54A 3SCNA 5LGZA 3VU2A 3DOPA 3BPWA 3NO3A 4Q8NA 4IH3A 5M5DA 3G1RA 3LU2A 3AWNA 1WDPA 3WMCA 5AVNA 3G6LA 4YVXA 1KO0A 4AD4A 1SMDA 3A21A 3GC4A 3KRSA 4JTEA 2J8GA 1GOWA 1GVYA 4O52A 5I2UA 3QY8A 4POCA 1BF6A 3I4EA 2ZXQA 2F6XA 2JQXA 3PJUA 4F9JA 3ZM8A 1C3FA 4XD3A 2IKJA 2GYIA 4Z0JA 1LZOA 1X96A 1JNDA 5HXMA 4GISA 1TUXA 3L9CA 3LCWA 3TW9A 2Q8ZA 1TTJA 3EWYA 3WQ4A 1C8XA 1Y8BA 4WHBA 3O63A 1QO5A 3AI0A 3NDYA 4PMQA 2DORA 4O1AA 5DEZA 3BSHA 5BRPA 3PBYA 3IJLA 4CQCA 2HSAA 3GG8A 3DFQA 5DFAA 4F0RA 1WYIA 3SCRA 4NY2A 3VFCA 5ABTA 5KITA 4TIMA 1JCYA 4RK8A 3B9OA 5TIMA 1HVQA 2WO5A 1DIDA 1UWIA 4HA1A 2VENA 5DMLA 3VOFA 2FMNA 3B03A 1MEHA 4OT7A 4H9MA 3MUXA 1N8WA 2WMJA 4PBGA 6CGTA 2JF7A 4ZQRA 1XC4A 1JYXA 2BNJA 2XIIA 1H5VA 5AYIA 1ICSA 4IISA 4JNYA 4AD3A 2W9MA 2R1PA 2XPKA 4PE8A 2XN1A 3CYVA 4A6GA 4O53A 2EKGA 2YJQA 6TAAA 2D2OA 2EG8A 3KBSA 3UJFA 4DB7A 4O1FA 4BFAA 4DNMA 2CBUA 4P7NA 4H8UA 3CASA 7PTDA 1VJIA 3THQA 1E4MM 1AD4A 2R1LA 4F9DA 3AS3A 3AZSA 5G2IA 4R88A 1R3SA 4DF1A 3VCRA 1TPVA 1UR3M 1US0A 4ZTYA 3LHYA 1LF1A 1NQKA 1AQMA 2Q3RA 3FFSA 1ZP3A 4YHGA 1FHVA 3UYIA 1FH7A 1K6AA 3CMJA 2Z2AA 5AKQA 3TQ0A 1G7UA 3NQ6A 4IGSA 3LM7A 4MM1A 1BTCA 3BG9A 3M0YA 1US2A 3OIHA 2AQOA 1OCNA 5EB8A 3TSDA 3LN3A 1CLXA 4IIDA 3QRHA 2FH6A 4RE4A 3W84A 3SBFA 3I3DA 3L4UA 1RXOB 1VYPX 4A2SA 1JZ7A 2ALDA 2AL2A 1I0BA 1OYCA 3W24A 2V2HA 4G56A 3WBEA 3W22A 2BTMA 2G96A 5AYXA 3TU9A 4H00A 3VGFA 4DO4A 4Q4KA 3WNMA 1QNQA 4GYPA 5BXPA 2JFEX 1RP8A 4LYKA 4XZIA 3N17A 8XIMA 2FTWA 4N2YA 4DZAA 4JNZA 2C1HA 4ZMGA 1UKQA 1DHKA 4N6EA 1DWIM 1DWJM 4KWSA 4C6FA 1NDZA 1EYEA 2Y7GA 3UNTA 2QCDB 1GVQA 2W4XA 4J5NA 2GVGA 1TPUA 2Y7EA 1TV7A 3QR1A 4N02A 1W0MA 3TP4A 4BEQA 1AMYA 3APGA 1UPPA 2V3GA 2YDQA 1NAL1 2GPTA 3W02A 1IGSA 1W2VA 2E77A 3GDMA 3TYAA 4GI8A 5E5CA 3AIEA 1S2TA 1H09A 1YTKA 3H21A 1HQTA 3U7BA 4IG2A 4O0KA 2OMAA 3FHAA 1HG3A 3S6OA 4ZGYA 3TSMA 1KGXA 2VR2A 3W70A 3DUGA 3V0UA 2DU2A 4FNTA 1LL7A 2POTA 1LT7A 2I9UA 3MI2A 4JFUA 3WIJA 3M7WA 4DHGA 3DN5A 3ZMRA 1TKKA 2FPTA 3DYOA 1AA1B 1G67A 1Z69A 3ALGA 4HB7A 3KOXA 3VX0A 2OZ3A 1AJ2A 1C91A 5AB3A 5F4XA 3ZR5A 4OGZA 9CGTA 4RLIA 3U4AA 1K6WA 2QR6A 3QR3A 1VPXA 3E38A 7XIMA 2VWTA 3UG5A 1V08A 3OBEA 4O13A 3AXIA 2J25A 2E5CA 1W1YA 4H1ZA 4GIYA 4BQ4A 4GWEA 4MWAC 4GIRA 3HURA 4LUYA 2XZ9A 5KINA 1ME8A 4DZIA 3AALA 1QOQA 4Z2GA 3HPSA 1F3EA 4H9ZA 4BR1A 3U3HA 1KCXA 4AB4A 3TX9A 3CGTA 4E2DA 1WE5A 3R13A 2AKMA 1OQFA 1WOBA 1EDTA 1QVBA 5MKGA 1ONXA 3TWAA 1W1A1 3AIUA 1CCWB 3EXTA 2VX5A 4HCLA 4N9EA 4AEFA 2H9AB 3PZ9A 3RFAA 3UESA 5A5WA 2CERA 3EWDA 2O9TA 2I56A 3LGDA 1UA7A 3O15A 1OIFA 1RVKA 1FCQA 3GBEA 4FS9A 3C86A 4UFMA 4U5IA 5FJJA 3TUUA 4KWVA 2I5IA 3VZXA 4M7SA 4EOUA 4FR1A 1J10A 4PCPA 1Q4WA 3UR5A 2Q6ZA 1GVEA 3AU6A 1V6TA 3GVWA 4AWUA 4XBJA 4NU7A 2VFDA 1FWSA 2YBUA 3KHDA 5E0CA 1UQZA 4AX7A 2DIKA 2PS2A 3O1NA 3URBA 1B54A 4LBSA 1DP0A 3BAWA 4PYSA 3F5KA 4MKNA 3NL2A 2DW6A 1S5NA 3NQ8A 1ZUAX 1HJSA