4DELA

Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. tuberculosis
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Active site loop dynamics of a class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 138
structure length 345
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4delA00
3A5VA 3W71A 5HJLA 1ICSA 1NF0A 2YXGA 1X8FA 2YFOA 1TTJA 1ZALA 3DU0A 2EKCA 3NQDA 5DBUA 3MUXA 4IOTA 3O63A 1TPDA 5D2XA 3W73A 2YFNA 3WK3A 5HWMA 4ADSA 3JS3A 3LERA 4GUGA 1VCVA 1G4TA 1KM3A 3T4CA 5KTLA 1T96A 2GVGA 3M44A 4O17A 2C16A 5CSRA 4JGDA 3T7VA 1OYCA 3VKJA 4UNLA 3MP5A 1AW2A 2E1DA 4LS0A 2VEPA 4XWUA 2C15A 3QPYA 1UUMA 2Y89A 2DZXA 3B4UA 3ANYA 3PBVA 1FDYA 5K2ZA 1GYNA 1UBSA 5F4XA 5HR6A 4RZ5A 3S1VA 3RLUA 3M43A 3PBYA 1BEUA 4X22A 2OT1A 1VS1A 2Y61A 3SSJA 2H6RA 4ZL1A 2QCDA 2FPTA 2EHHA 3P8JA 5L6UA 4MIMA 4JR5A 5FESA 3MHFA 3VE7A 2ATSA 1F7BA 4EF8A 3GVGA 1GYLA 1WXJA 2QAPA 4UTJA 3HGRA 2Y85A 3WK0A 1K7EA 1Z44A 1DBTA 4LY8A 3DGRA 5C2XA 5SWUA 2VEMA 3O05A 1ZCOA 5KZMA 3N2XA 1KW1A 4MOZA 1KTBA 2V30A 3M5VA 3RU6A 4RJEA 4Y96A 4DBDA 1RD5A 3ZFHA 5U4NA 1A5SA 5E93A 1F6PA 2UV8G 1CW2A 5AHEA 3NNTA 4I7VA 4FXRA 4GUJA 4ZQMA 2QJHA 3RFAA 2ZDRA 3ELFA 3LB0A 4CCDA 2OJPA 4JXCA 1FCUA 3FEMA 4HSNA 3M16A 1VGAA 4CQ9A 3LCHA 2A1YA 1J5TA 1VLIA 2WPBA 3IEBA 2P0OA 3BG3A 4XTIA 5L9FA 3LLDA 1B4EA 2HSAA 1I2RA 1RV8A 1QO5A 3RNDA 3CLMA 1TYGA 3QC3A 3NQGA 1AW1A 4WXZA 3HIJA 3HF3A 2R8WA 1I4NA 1LOQA 2H8ZA 1TCDA 2ZZ5A 4PODA 3SIZA 2AAMA 1FWWA 3O06A 5D38A 3LCIA 3TA6A 3W6YA 4DO4A 3KHJA 1H7PA 1RVGA 4N02A 1KFKA 4JIPA 1FWTA 4PH6A 2OT0A 1DVJA 3BLEA 1IGSA 3KFTA 4HKPA 2Z6JA 3A9IA 3HPZA 4FB7A 3QZEA 3PWAA 3E0IA 3V75A 2V0TA 1GVSA 2PURA 4PC8A 4N2YA 5EL1A 1A5CA 4R34A 4DPQA 3W84A 3G1VA 1JUEA 4O4VA 5HMSA 2NV2A 4EOUA 1KM2A 3FOKA 3MP3A 2B0MA 3OVPA 1ZENA 2JBMA 4I9AA 3CEPA 2NX9A 1H1YA 2QCHA 2Y7FA 1DORA 3L0KA 4NX5A 2VENA 4QIUA 2C1HA 4L4MA 1V5XA 3M47A 2X16A 3KRUA 5D03A 3W9ZA 1ME7A 1H60A 1VRDA 2RKXA 2J88A 1OABA 3W7PA 3TSBA 1MEHA 4JY9A 3QPZA 4WQ6A 3W2UA 5LNRA 3MBFA 4XKYA 5LNUA 5LSMA 2FDSA 4O53A 4P61A 5MHBA 2ZZ3A 3FYOA 1XUUA 3G1FA 5I3JA 4K8EA 4DELA 1LLZA 2VFDA 4HNTA 3QEZA 3NL5A 3NO5A 5EKYA 3BGJA 2RDUA 1G7UA 1H7OA 3NQFA 4JTFA 4ORIA 5G2HA 1SW7A 1X7FA 4JS3A 5DBTA 3SR7A 5IBXA 3EWWA 5EY5A 4K39A 4JYDA 4RV8A 1CX9A 1EEPA 1SR9A 3DBPA 2E5DA 3E49A 2VFFA 4Q32A 2XFWA 1OYAA 1LOSA 1GTHA 1IIGA 7TIMA 3DFQA 4FX6M 4K7YA 4Z1AA 5D2VA 4AF0B 3NM1A 1G69A 2CZFA 5FEPA 5K9CA 2YYUA 1H1ZA 1LORA 3GB6A 4UTTA 4ZQOA 4OWGA 1JCYA 3A23A 4IX0A 3SGZA 3KX6A 5G4WA 1TRDA 4JDYA 5D02A 1ADOA 3EWXA 3U8GA 3R89A 4JTJA 1D9EA 4HNUA 1OVDA 2A6NA 3OVRA 1MO0A 3GYEA 1GWJA 1XBXA 2B7QA 2DP3A 1LZOA 3CWNA 4DF2A 2NXHA 4O1AA 4AWUA 1QOPA 3L68A 3E96A 1JQVA 6TIMA 1W54A 3CHVA 4Z1DA 1H7XA 1WA3A 4MPQA 1SUXA 1EX5A 2BXVA 4LC8A 2WNQA 1TTQA 3B0UX 3G0UA 4M19A 4H6KA 1IXPA 1KV5A 1VYRA 4O57A 1YPFA 3W2NA 3NQ8A 5KMYA 2WSRA 1SSDA 2V5BA 4K36A 3U2OA 3SW6A 3MWAA 3LTSA 3NEVA 1W3TA 2FJKA 3WK1A 3NQCA 4YL2A 1SZEA 4RR4A 4GNJA 2ZA2A 3C2FA 3KVLA 2YR1A 4LC6A 3YPIA 2V9DA 2X2GA 2X1TA 4GUIA 1XUZA 1YDVA 4EWND 3PR2A 3QRHA 2BSLA 4OT7A 3MJYA 3UY7A 1YXYA 4ICNA 5K3VA 4MFEA 4U4MA 2CLFA 2DZUA 2RDWA 5I3KA 2YDAA 3N9SA 2CLEA 3W7EA 3B06A 3W7GA 4WY0A 3GAKA 3WFAA 1SSGA 1LP6A 3UWQA 5CPNA 5CZSA 1FWRA 2Z1BA 1HTIA 3I68A 3MMTA 1BWKA 3P74A 2PRMA 4QJ1A 3H54A 4LUJA 3BW3A 1ME9A 2ISVA 3G3MA 1R46A 4UNKA 4O8RA 5D30A 2Y7EA 3PG8A 5I3FA 5LZLA 3NQ6A 4MLJA 4K7VA 1W1ZA 5CSSA 1YDNA 1OK6A 4P2VA 3PBWA 1F5ZA 3LHTA 4NU7A 4ZQNA 4H3DA 1OF8A 3LOTA 3P5YA 4WJEA 1DJNA 1ICPA 1XC4A 3DAQA 2ZRZA 1VC4A 3HG3A 2Y6ZA 8TIMA 5F2IA 1N55A 1NEYA 1HG3A 4O0KA 3TR2A 5D2WA 1KFJA 5LHEA 2JKAA 2WV8A 3O15A 3Q2DA 4M6PA 5H91A 3C52A 3W23A 2NV1A 2HS8A 1OX4B 1J2WA 1KLZA 1W5PA 2X1SA 1LRQA 1UJPA 2PRHA 5F4WA 1QWGA 3R2GA 3UWVA 3TJLA 2X1UA 3W22A 3W7MA 1R2TA 2E09A 2Y88A 1VHNA 3EWZA 4FX7A 1SO5A 1RPXA 3LV5A 5FF2A 3LI1A 3PSWA 4BWLA 4UC5A 3HPSA 2QCLA 1KFBA 3TE9A 3TMLA 4O50A 5DCDA 3MHUA 4ZMGA 2JK2A 4MVAA 5DXYA 1GVRA 1S5VA 4HIBA 2ZRXA 2QJIA 3BV4A 3HB9A 2NUYA 4NVTA 4UUIA 3JR2A 4LVAA 1GT8A 5HULA 1B4KA 2P10A 5FF3A 1QOQA 3A5FA 5BW6A 3GKFA 2C18A 1P5BA 3A24A 3W7HA 3AO0A 4JX6A 5AYZA 5C5YA 1WAUA 3TX9A 4Y9AA 1ZAJA 2CLIA 4OHQA 3G1HA 2GVLA 1G4SA 1X1OA 1M6JA 4GBUA 4YLWA 1HL2A 3P7YA 4X2RA 3PAJA 2J9ZA 3P82A 5DY2A 2VOMA 2WNNA 3O07A 3IIXA 5BMXA 4NJKA 3G22A 3PULA 3F4NA 3STGA 3TV8A 2Q8LA 2DORA 2R91A 4MZ1A 4UMCA 1TV8A 2J27A 2GUUA 4MY8A 3ZR4A 4UFMA 1JCLA 2H90A 5TIMA 2NX1A 3EKZA 1KA9F 3H53A 4Z1CA 1P0NA 3KXQA 3PM6A 3I65A 1BTMA 5G1TA 4UFIA 1LRTA 4A3UA 4NXSA 3W86A 3UXDA 3P62A 1PS9A 3W1PA 2DU2A 4LS2A 3QSTA 1XBZA 5CZJA 4QNWA 1SQ7A 2CZEA 3UNDA 3HMJG 3EXTA 4O54A 1L6YA 1PHWA 4G1KA 4AHQA 3M5XA 4QAIA 1UB3A 4N4QA 3DI0A 1ALDA 3W1UA 5HINA 4OV9A 2ZFAA 3W74A 4GXMA 1JJKA 5FF4A 3TQVA 2A7RA 4NJJA 3TIMA 3M6YA 3GDMA 2CWNA 3UXAA 1R47A 4NNAA 1ZFJA 3IIPA 5DN1A 1OFOA 5J5DA 4YMZA 1EB3A 1OF6A 5BMWA 1LRNA 2V2CA 2Z0IA 1XL9A 3RLVA 1TO3A 3W1NA 3TXZA 1QMLA 4NUWA 4NZFA 3O1NA 5J5RA 1YTKA 3W7RA 5KINA 4LOCA 1DHPA 4YWIA 3GR8A 2RHGA 4JTLA 3R5EA 3IRDA 4QSHA 1QDSA 4ADUA 3B05A 5AC6A 1T8XA 3W1XA 3NGJA 3G8EA 3WJSA 2CZDA 5G1YA 3LCLA 4UTHA 3MP4A 3L65A 1OFAA 4OU1A 3NL2A 4PFMA 1LROA 3TCEA 1WBJA 3TFXA 3W1MA 1LTDA 4MZYA 3MBDA 1KM6A 3NM3A 1A5AA 4JD4A 1WQ5A 1VLWA 4UFJA 4TR9A 4AXKA 3N14A 4Q33A 3ZWTA 2OMAA 1HUVA 3BO9A 2X30A 3C2OA 1FXQA 3PF3A 3TW6A 1JUKA 1Q6OA 3SJ3A 3B04A 4ONVA 1M5WA 4W9TA 1C8VA 1LM1A 1AL7A 2IQTA 3RF9A 1N8FA 4QITA 4M7TA 1MEWA 4AVFA 1XBYA 2C3ZA 4NQ1A 4I7UA 3TQ0A 3BVJA 3HGSA 2PE4A 4FHAA 3D0CA 4BI5A 3L9CA 4O14A 2ABBA 4N6FA 4ZZ9A 4UR8A 3N9RA 5E0KA 4LT9A 1KLYA 4X3ZA 4S2BA 2JGYA 4AWSA 3Q58A 4XBSA 5DXXA 1YTDA 2O7QA 1SZFA 3GXPA 3KRSA 4LVGA 2NLIA 4MFDA 5D2TA 3HG5A 1ZNNA 3TKFA 1TSIA 3W7NA 1LLWA 1ML1A 1PV8A 2KZHA 1C9DA 4LNYA 5AHFA 4CNPA 4CLMA 3QQ1A 1TREA 3LXCA 3GXNA 1TPEA 1GG0A 1B9BA 4RKAA 4QM1A 4RK8A 4UTIA 4OBTA 4UR7A 2A4AA 4GUFA 3IIOA 2ZTKA 2C19A 2G96A 4E2BA 1O5KA 1RQEA 3OBKA 4AWTA 4UTLA 3W7IA 4GE8A 5E1QA 1LDCA 4PL1A 3NQEA 5KZDA 3UD6A 4FNUA 2FFCA 3LRMA 3B0VC 2CLOA 1OX5A 5AHNA 3GDTA 2A5HA 1FY6A 3PVFA 3NQ2A 3UWWA 3W7QA 1BWLA 4A29A 2HMCA 3EXRA 4K38A 2FQIA 1GEQA 4UTWC 1L6SA 4O13A 1LCOA 1EP3A 2FLIA 2J9YA 3FIGA 3NYZA 3W70A 1Q6RA 3M0ZA 1JCNA 1TB3A 1TTIA 4ORMA 4TMCA 4RXGA 3LXBA 4HNVA 4DPPA 3PY2A 3O8AA 2QCNA 2E6YA 1MXSA 1K7XA 3N2MA 3L21A 1VPXA 3GZ3A 1TPB1 2YCEA 2FPYA 2XN2A 3F4WA 2YW3A 3IVSA 5F1VA 5D05A 5CZ0A 4IXXA 2A7NA 3C2RA 5EBUA 4Y90A 2XN1A 1LBFA 1G67A 4O1CA 1PL9A 5AHIA 5EMUA 5LNSA 3BW4A 1HO1A 3L2IA 2YX0A 5F1UA 4UFLA 3G3DA 4R53A 3R8RA 1TJRA 3STCA 3HO8A 4HSOA 3DFPA 5HUOA 3EX6A 4UCGA 2CLHA 3EX1A 2Y7DA 1VR6A 5D09A 1HFBA 1I45A 3F03K 4JTIA 4GRSA 3QQ0A 1VH7A 3O6YX 1ZAIA 4JICA 2GQ8A 2NZLA 4O12A 1AL8A 2W0UA 1WX0A 4RCXA 3IVTA 3B0PA 3PG9A 3LHVA 5D04C 3W1TA 1XM3A 1B57A 5AN7A 1QPRA 4K6AA 3ABQA 2E5BA 3NR0A 4I7WA 3GDRA 2BLEA 4IJBA 2HTMA 1G4PA 1QPOA 1KV8A 3LV6A 3G1YA 2ISWA 4PL2A 4KWVA 3HG4A 1T0OA 1QR7A 1B3OA 2FTPA 4DF0A 1OFBA 1W8SA 3QJAA 2DJXA 4S1FA 3R13A 4HPXA 3TQKA 3PB2A 2OCZA 2EF9A 3I7QA 2VXNA 4OE7A 2QDGA 4O52A 1WV2A 3JRKA 4MJZA 1FWSA 3G1AA 1OFDA 1DJQA 3NAVA 4WX2A 4JTEA 3KRZA 3TNOA 2NWSA 1L2UA 4UTUA 1ZJIA 1D3GA 1I8JA 3LBCA 2VEKA 2AQWA 5AYYA 1VYPX 2ZYFA 1T99A 4E2DA 3MW7A 2QDHA 3VFLA 3DFSA 3FKRA 3NPVA 1W3NA 1JUBA 3U6WA 4AHOA 4N4PA 2CZ5A 3KVMA 4RXFA 4IMFA 3GDKA 3S5NA 4GFSA 1OFRA 3BW2A 4UMBA 1PHQA 3MHGA 5F4SA 4FXSA 2VKZG 1KM1A 2D73A 3QSRA 2CU0A 2QCFA 4AMAA 2BZNA 2VFEA 3GKAA 1W37A 2ZRUA 1EUAA 1X6UA 4DEFA 1A50A 3OIXA 1F05A 4M6VA 2VFHA 1OG0A 5DCEA 2ZRWA 1K03A 3M7WA 3EEGA 3I7SA 1O60A 3P84A 3GIYA 1DKWA 2GJNA 2BWGA 1VJIA 1G7VA 3SI9A 4HN4A 3BARA 2GQAA 3HBLA 3W7JA 1H63A 3ZWSA 4CCCA 1SO6A 2B4GA 1C29A 3MI3A 2FB2A 3W75A 2QCEA 1EP1A 3W7OA 5HQEA 3E12A 3P5ZA 2BTMA 2R94A 1W3IA 3UWZA 3LTPA 4OQVA 3DFOA 1PIIA 3PBUA 4TX9A 3L5LA 4NNCA 1IXNA 1W56A 1Q6QA 3TROA 4GUHA 3BLIA 1GTEA 4DBEA 1FQ0A 2I14A 3NZRA 4WUIA 3PUEA 1AG1O 1NF7A 2V81A 3TMQA 4KFNA 4YXGA 4KKXA 3FA5A 3USBA 2I1OA 3DENA 4LW7A 3LHWA 2HS6A 3OA3A 1O5XA 3K30A 2Z6IA 3TW7A 1W5NA 4WOQA 2NXGA 3W7CA 1GVQA 1SFJA 5AYXA 2CLKA 4JYFA 1RQBA 3P80A 1QAPA 4CQAA 3UZ5A 3NDOA 5K4XA 1AMKA 1VZWA 3C2VA 3UQNA 1AK5A 3SECA 2ZZ4A 2ZA1A 1Z41A 4LVDA 5ABTA 1SU5A 1F76A 1R30A 2WO5A 5A8GA 4MYXA 2CFFA 3G0XA 3WJZA 4AB4A 5HWJA 4E0CA 4UFHA 2R14A 3G8RA 4TMBA 1XXXA 1W5OA 2V5LA 3M1ZA 3TK7A 3LTYA 2G5WA 4PCFA 1Y0EA 1JCXA 3BPWA 3UPWA 1ZAHA 2DZVA 4RZ6A 3UZJA 2A21A 1QPQA 5AHMA 5G5IA 3IIZA 2E6DA 3G1SA 3VE9A 5EYWA 3T44A 1TV7A 4LRSA 1CI1A 1KTCA 2EGZA 2ALDA 2G97A 4AEOA 3ATYA 2Y62A 2ZZ1A 3GR7A 4A22A 5KSWA 3HGJA 4UTTC 1KM4A 1O95A 1V7YA 5HR7A 3DFNA 4AF0A 5GVJA 1OFQA 2QCDB 4MJMA 3ABOA 1FCQA 4KWWA 1I2NA 1TV5A 5K9XA 3HPXA 3S5YA 3S6DA 1YADA 3LRLA 5TBOA 3FS2A 5F2LA 2EAWA 4EIVA 1IF2A 1NVMA 1MZHA 1FX6A 5LGXA 4TO8A 4Y6GA 3S8HA 4JTHA 2QCCA 4DXVA 4CQ8A 3OG3A 3NPUA 4FNSA 5CPOA 3QW4B 4R7JA 2DZPA 2A0NA 1PVNA 2XN0A 4EVZA 4C1LA 1RR2A 3EKLA 2G95A 1K8ZA 3WJXA 2TYSA 2NUWA 3CPRA 5AOUA 1TIMA 1R2SA 1XDLA 5CPMA 2GVJA 4RLIA 3L66A 3EXSA 2GOUA 1IIHA 2C0AA 3W72A 2I9EA 3CEUA 1NAL1 4JTTA 3DFTA 3CT7A 3CQ0A 3STFA 4FX8A 3ATZA 4LTSA 5K9DA 1W31A 1KFLA 3LCFA 3W1LA 5A5WA 5T26A 1G6CA 1GVOA 3BLFA 4Q4KA 1XKYA 2V82A 4UIOA 4FIRA 3UWYA 2F84A 3EX3A 1M7OA 2GPTA 1JR1A 5IM51 5D2YA 3P8IA 1G4EA 2QF7A 4E38A 5CG7A 2PCQA 5BRBA 3DHDA 1JCMP 4X9SA 3BGGA 3S5ZA 5FI8A 3NQVA 1SPQA 1XCFA 1YPIA 4UXDA 2E77A 1H51A 3DZ1A 4UTKA 1LBLA 2V2DA 2QUTA 4DF1A 1TQXA 1SZNA 3G24A 2B7NA 3NPWA 3TAOA 3W1RA 1A53A 4NJIA 3TC7A 2QCGA 2A2IA 5KZEA 5F2GA 4IQLA 3SZ8A 1QFEA 2VELA 4BK9A 4CNOA 4GJ1A 3TFCA 1PCKA 3S1XA 4CNNA 1IXOA 1VYSX 4ZVJA 3QFEA 1H7NA 4M5PA 4XUGA 1W0MA 1P0KA 4N9BA 2LLEA 4PTNA 4ML9A 3WK2A 4BI6A 2Q3OA 1KBIA 1QO2A 3NZ1A 3IVUA 2ZRYA 3W1QA 5FEZA 1S5TA 1SW3A 3LCGA 3UPBA 3DHFA 2NX3A 4L4LA 3GDLA 1PE1A 3QW3A 4XBKA 4ZQRA 1ZY9A 4XKYB 5AFDA 1DOSA 3CWOX 1EIXA 2TSYA 1K8YA 4AHPA 2QJGA 4BR1A 1OX4A 3PC0A 3LM7A 1H62A 5K4ZA 5U7SA 4IMDA 1ZHAA 3GNDA 3P67A 3TC6A 5DY3A 4BWLC 1W5MA 3CM4A 1X1ZA 2YZRA 2NWRA 3B03A 4RZ4A 3C3NA 4O28A 2TRSA 2WSQA 1UCWA 5AC7A 3Q37A 1W5QA 4EF9A 3LXAA 2C13A 3LBMA 4Z1BA 1O94A 2RDTA 4R33A 1H5YA 3E02A 1FCVA 4LVBA 2H3BA 1TRIA 3IIVA 4JX4A 3G1XA 3CIWA 2VEIA 1VCFA 4NJGA 2H8XA 1E51A 3TXVA 3I6RA 1KTNA 2TPSA 3PSVA 2ZA3A 1SO3A 3RK8A 1SO4A 1XI3A 3LCWA 2OZ0A 4UMAA 2E6AA 4LS1A 1BKSA 2VFGA 3G18A 1TQJA 1A5BA 3MI6A 5FEXA 4O15A 4A2SA 3R12A 1OK4A 2F7FA 1KBJA 4BFAA 4LV4A 5D33A 3V1PA 3P61A 1TPVA 1QPNA 2B7PA 4K8HA 5DLCA 1H7RA 3TH6A 3WJWA 2Y70A 2QUUA 3S1UA 3TAKA 1I2OA 4A21A 1VHCA 2QKFA 5LHFA 4IMCA 2WQPA 4ADTA 4DO6A 1EWEA 3AJXA 2Q8ZA 4K37A 3W7DA 4MUZA 2X1RA 2WKJA 1PCWA 3H55A 5G2IA 2Y7GA 3W85A 5BNKA 5C54A 2VC6A 3S5OA 3PB0A 4MLRA 3C56A 3QF0A 4O0ZA 3O16A 4JEQA 1RQHA 2YYTA 4HPJA 1KFEA 1YLVA 3NVTA 2E6FA 4XTDA 3TDFA 1FWNA 1GQNA 3MO7A 3TJXA 2CLMA 4IMEA 6ALDA 3C61A 1K8XA 3LCXA 2YPIA 4IPJA 1F73A 3C4UA 3HOJA 5CPLA 4JTUA 2JKEA 3EB2A 4LVFA 1LYXA 4IPIA 1S3HA 3W83A 3L0GA 2WSYA 1FDZA 3A22A 4U28A 3I7RA 5CKSA 4HNNA 2OX1A 3UY8A 1L9WA 1XDMA 3S9YA 1JRCA 3N19B 4WY0B 1DL3A 3QMRA 2ABAA 1F74A 1JVNA 3DI1A 3IV3A 3HGOA 1WOBA 1SZGA 1FXPA 5CGQA 5KITA 2YW4A 4IX2A 1THFD 1FDJA 3CTLA 2QUVA 4S2CA 2ATMA 2ZBTA 2GJLA 3EWYA 3GXTA 1SFLA 4A2RA 3CB8A 4FEZA 5DCBA 3DKJA 5C6MA 5FF7A 1VCGA 1GOXA 1S5WA 3QH2A 3SGUA 4JX5A 1K02A 3NOEA 1YXCA 4NJHA 4LRTA 1QCWA 1DQXA 1JQXA 3KVKA 2QR6A 4KFOA 1LBMA 4WXYA 3L5MA 1EPXA 3RMJA 3CC1A 3TUUA 4XZ9A 1XBVA 2DZWA 3W2KA 3FKKA 4M6QA 1GPWA 3L5AA 1TPC1 3W88A 1EUNA 4IMGA 1H50A 4LUIA 4FO4A 4O19A 3QMTA 1QNVA 4XQ6A 1YXDA 1WDWA 3OHIA 2O7SA 1GG1A 3LHZA 3S42A 4O4WA 1HO4A 2PRLA 2YSWA 3ABSA 4LU0A 4JIQA 5FF0A 3W76A 1Q3NA 3SFKA 1GZGA 1I2PA 5HUPA 3EWUA 1MEIA 4CCEA 1P1XA 3CIXA 2V8ZA 3IGSA 4N6EA 4BI7A 1ME8A 4QNEA 1OFEA 3W7KA 3M5ZA 1TPH1 2DZTA 3LX9A 4IGHA 4O1DA 5EPDA 2E5CA 5I3GA 4O10A 4JTKA 5TQLA 2W79A 3EWBX 3EX2A 1Z42A 2ZZ6A 3G0SA 5AHLA 2B7OA 4FNQA 3TSMA 2ISSA 4WOZA 3F1QA 1H61A 5DELA 3N3MA 2J6XA 3LHYA 3T78A 5CZTA 2RH9A 1O4UA 5F2MA 3TU9A 1ONRA 1WOAA 2E68A 3M9YA 1IXQA 3OVQA 3NG3A 1OFPA 4NX0A 4PEKA 4ALDA 4NXKA 4BF9A 1MSSA 3KVJA 3BG9A 5BOOA 2ZTJA 1P4CA 3B8DA 2P1FA 4WZHA 1U5JA 1KM5A 3EX4A 3THAA 2WNZA 3FYPA 3INPA 1GJPA 3P60A 3GLCA 1FCBA 3MYOA 4IUOA 2ZQ0A 3T40A 4ZQPA 1FUYA 1TJPA 4POCA 3P81A 3G1DA 5LNWA 1WBHA 3DKLA 4GWEA 3LRKA 2VFIA 5LKYA 1EP2A 2CW6A 3KAOA 4AH7A 2NUXA 1F6KA 3HQ1A 4KFPA 4MKNA 2A6LA 4FF7A 1Q6LA 4JDBA 2QCMA 1YYAA 3W7LA 3C8FA 2WOQA 3O6DA 5D37A 3UYCA 3C6CA 1TPWA 3SY5A 4GC4A 3T55A 4LWWA 3HG2A 1FBAA 4JNMA 1OYBA 1D3HA 3L67A 5G2WA 1K7FA 3NPXA 1DQWA 4J9JA 3NA8A 3NXFA 3STEA 1R2RA 4Y8FA 3W87A 2Z2UA 3NQ7A 3LGEA 3W2MA 2DJLA 5LNVA 3HJZA 3VNDA 1OHLA 3NQAA 2QEZA 4NNBA 3FLUA 1VQTA 2ZZ7A 4O1BA 5LGZA 3CU2A 1H7WA 4PA8A 3E9AA 1Z48A 2V2HA 4OGZA 1TTPA 4ZQCA 1NSJA 5FEWA 3W2LA 5IBXC 3M5YA 4LV9A 1XFBA 2Y63A 4FNPA 3NL6A 3W2JA 1TPUA 2ZCGA 4D2JA 3MYPA 3VI2A 1M7PA 2FIQA 3LLFA 2A85A 3MI2A 1OJXA 1L6WA 2A7PA 5HNRA 3C0JA 3ZS4A 1EWDA 5HWNA 4JYEA 1J4EA 4O18A 3N34A 4RX0A 4N9CA 1WYIA 1JULA 3QMSA 4H4IA 4Z0JA 4DQWA 5K7JA 4M7SA 3WJYA 1F2JA 1RZMA 1U83A 1LOLA 1YTEA 4Z0SA 3QM3A 3LDVA 1N7KA 1TMHA 4IXHA 4YCOA 2W6RA 3GAYA 2FB3A 5H2ZA 3DXIA 4MZ8A 4NT0A 2C6QA 3L0NA 4YCPA 3S0CA 4IWWA 2PC4A 4JTGA 2ZZ2A 3C2EA 3M41A 2ZRVA 4O11A 1SW0A 3PUDA 1YDOA 3Q94A 4MY1A 2H3DA 5I3IA 3NQMA 5AC8A 4JN6A 3LI0A 2BX7A 5G4EA 3O6CA 2TMDA 1NFBA 4MY9A 1KFCA 4HT3A 1JCJA 5C55A 4TU1A 4N9EA 3TSDA 3W1AA 4UTMA 2GQ9A 3N73A 2EPHA 4NZJA 3W3OA 3GNNA 3PS7A 5I3HA 4HHPA 2QAFA 1JRBA 2WJZA 5AB3A 1TPFA 3LHUA 3A21A 4DO5A 1ICQA 3KOFA 5D32A 2RFGA 1UUOA 2JKPA 4TIMA 4FNTA 4B5NA 3FJ6A 4WY0F 3IGXA 3ABRA 2NXIA 1EA0A 4O16A 2CLLA 1UASA 3NL3A 2J24A 1AW5A 4WD0A 4QQ3A 4UTWA 3BG5A 3THQA 4FIQA 3UWUA 4Z08A 3S1WA 2J9XA 1Q45A 3GK0A 3IGUA 4JTSA 3BK0A 3QYQA 3W07A 1KM0A 4MYAA 4AAJA 3PUOA 5EA9A 4UFKA 4FNRA 1GVFA 2AGKA 2DZSA 4C1KA 1I2QA 3DH7A 1OX6A 2C14A 1DV7A 4QISA 3FJLA 4OV4A 2JGQA 3GX9A 1K3UA 4JY8A 4N9DA 2YGYA 2Q3RA 2FPVA 3OEXA 3VCRA 3FFSA
chains in the Genus database with same CATH superfamily
3A5VA 3W71A 2F2HA 1V8EA 3Q65A 1NF0A 4QR6A 1QNPA 1X8FA 2GGIA 1UD6A 1ZALA 1XQKA 4HK6A 3MUXA 1TPDA 1JD9A 4ZCWA 2RJHA 3JS3A 1M3UA 3LERA 3KWSA 1G4TA 1CXLA 2OFJA 3VIOA 5KTLA 4KCWA 1T96A 2GVGA 3M44A 1EOMA 3WQVA 1ZB5A 3VKJA 3MP5A 1HKVA 2E1DA 1VAHA 2BHZA 1XLEA 1EDTA 1S2TA 2C15A 5B80A 5HQMA 1TUXA 1J6OA 3VA8A 1MUMA 4QE1A 3N2CA 3WQ4A 4GYFA 1WXYA 1UR1A 2BXZA 1UBSA 3U2ZA 1HJUA 1E0UA 3SCPA 4DYEA 3MANA 4JFWA 2Z24A 3MKCA 3KCJA 2Y61A 3REQB 4JHOA 5JBDA 2H6RA 4ZL1A 2QCDA 2DUAA 2EHHA 2FPTA 9CGTA 4JR5A 4YVPA 3WLNA 4JKMA 4QAWA 2ATSA 1F7BA 2QAPA 3EOOA 3ITLA 3DYOA 1WPCA 5J04A 3UW6A 4S38A 1KR0A 3JUGA 4LAZA 1W1B1 2VEMA 1LT8A 3O05A 2VRJA 3F4DA 4MOZA 2V30A 5E6YA 3K5XA 3RU6A 4RJEA 2QDEA 4Y96A 3DC8A 5DQPA 1A5SA 2OPJA 2QVNA 3M0YA 4G2DA 1V08A 2FH8A 4F2BA 2YBUA 3WYZA 4FXRA 1FA2A 4GUJA 1E70M 1XYZA 3BC9A 2ISDA 5FL1A 3LPPA 1VBUA 4HU4A 3CZEA 4EPBC 3FEMA 1E4MM 6ENLA 4HSNA 3M16A 2PDPA 1F3TA 1VGAA 5LXEA 1N2VA 4ZFCA 2PPGA 4H2HA 4F0RA 2ZUSA 4ATLA 3LLDA 1B4EA 3KLLA 4CU8A 1TELA 1QO5A 3HMCA 3IWPA 2HNHA 3CLMA 1LWIA 1AW1A 3B97A 4C5YA 4KWUA 3N12A 4PMXA 3SIZA 1FWWA 3O06A 5D38A 1RVGA 1YNYA 1GKPA 3S2JA 4YHGA 1BXNA 4D6CA 2PDXA 1DVJA 3BLEA 4YTSA 3KFTA 4FXJA 2F8QA 4FB7A 3VIPA 4CN4A 3QZEA 3KRBA 3IK2A 3V75A 4N0RA 4PC8A 4AUBA 4AX6A 1A5CA 3RYSA 3G1VA 1JUEA 3XINA 5HMSA 5CZKA 1R6WA 1OGGA 3OVPA 2VEGA 1ZENA 5DEZA 2DUZA 5CCZA 3R4IA 3U9IA 1H1YA 2QCHA 5M3WA 4BA0A 1F9CA 1YE4A 1V5XA 1PKNA 2RUSA 4GCXA 2GJPA 2NLYA 4C7DA 1TZZA 4QLJA 1G01A 2G3IA 2DW6A 9RUBA 3VNMA 1KO0A 2HVOA 3W7PA 1Y7VA 3TSBA 2C71A 2VGGA 1RBOB 4KIEA 2PF0A 1Q65A 4RW3A 5LNRA 3MBFA 1P1MA 1C90A 2DSUA 4XKYA 3CTTA 5LSMA 1FWGC 2CYGA 5GNXA 4P61A 1XUUA 4DJED 5BWAA 3MZ2A 1VF8A 1LUCB 4K8EA 3GUWA 1GONA 3NTYA 3QEZA 3NL5A 3NO5A 4DJDD 4S3GA 2I57A 1NJJA 5G2HA 4CU7A 3NQFA 2GJXB 2QGHA 5IBXA 1C9WA 3AXXA 2HNEA 3FYYA 2EKGA 1WB0A 4Q32A 2BVTA 4DHGA 2XFWA 1N8WA 4UCFA 3DFQA 4HZ6A 2PWEA 3AHZA 5AYIA 2YYUA 2GGHA 3B3DA 3A23A 3VD5A 4IX0A 1PSCA 1K9FA 5CPSA 3DUGA 3KX6A 3GH7A 1UWQA 2CIPA 3M64A 4QDWA 3EWXA 4ZTXA 2B7QA 4MF4A 2Z7GA 4DF2A 2NXHA 2ZE0A 3WQGA 3M0LA 4ZA0A 2UY5A 4XD5A 6TIMA 1K8CA 3P6LA 2XJ7A 3PTQA 4IIHA 4E4UA 4ENLA 1SUXA 4H9MA 1TTQA 2ZWZA 3F5LA 4M19A 1FHUA 1H0GA 1VYRA 4HMDA 1YPFA 5KMYA 3R0DA 1SSDA 2V5BA 3CHCA 2A3HA 3SW6A 3CUFA 1AMYA 1Y5XA 3NQCA 3B8UA 4RR4A 4E8CA 2ZA2A 5A8QA 5ABGA 3KVLA 2EJ1A 4O1FA 4LC6A 2X1TA 1XP3A 2FMOA 1UUQA 3PR2A 3JVAA 1ONXA 2ASHA 4RW5A 3MJYA 5K3VA 2XFRA 3N13A 2O0TA 4U4MA 1ZTVA 5FJTA 2DZUA 4IFRA 3N9SA 2DZBA 3W7GA 2GOKA 3MTWA 2PLCA 1RBLA 5CZSA 2CKSA 1BWKA 5BOEA 2PRMA 3H54A 1NFGA 5C2GA 1BYBA 3BW3A 3MY9A 1ME9A 2ISVA 1VEPA 1UH2A 4UNKA 4O8RA 5D30A 2CHOA 2Y7EA 3ANVA 3FX4A 3E2SA 3H4GA 1TX2A 4MLJA 9XIMA 1AJZA 1JD7A 1T40A 2EO7A 4XZBA 3URQA 3LHTA 4ZQNA 4H3DA 1WDRA 3LOTA 4HZMA 2GVYA 1ICPA 3T08A 1MNZA 2ZRZA 3VNKA 3IV8A 2Y6ZA 3JU2A 3R25A 8TIMA 3BSGA 1HG3A 3ES7A 1KFJA 3II1A 4M6PA 5H91A 2NV1A 4UQBA 4HSHA 1J2WA 2X1SA 1XLAA 3TEVA 3UWVA 1UH3A 1VFSA 2PDBA 1P0EA 2WJEA 3GTIA 1L6GA 3W22A 1R2TA 2DVXA 3B9NA 4R9OA 3E0VA 4H19A 4QXIA 1DJYA 3C0LA 4GH1A 3WH7A 3O2LA 4H83A 3HPSA 4JPGA 4UZUA 2JK2A 4MVAA 5DXYA 1GVRA 3LPOA 2QJIA 4MMWA 4NVTA 2YL8A 4RL3A 5FF3A 9XIAA 3M4HA 3W02A 3A5FA 3WQ5A 2BOEX 3LQLA 3VDBA 3W7HA 4B91A 2ZXBA 5C5YA 1WAUA 3TX9A 3V35A 4WVXA 4B5TA 2E8YA 4W85A 4OHQA 3H26A 8RUCA 4EXAA 3A4WA 4YLWA 1U1UA 3P82A 4RUBA 2VOMA 1QW8A 3I3BA 2D24A 3SAZA 3K8LA 4R7WA 4GCAA 4PTVA 3UJFA 3TYEA 1NELA 2EPMX 3ERPA 1XIJA 3NGFA 2J27A 3CLWA 4MY8A 1TVPA 2BY0A 3PWIA 1EGVA 1JCLA 6REQA 1KA9F 2R82A 1P0NA 3I65A 4UFIA 1LRTA 3W86A 3P62A 5LIKX 2G3FA 1GHSA 2QQ6A 2P53A 4NAFA 4QNWA 1SQ7A 2CZEA 3RJYA 4O54A 4G1KA 1BQCA 1ALDA 4OV9A 3W74A 3V0SA 2GK1B 3MMUA 4DZAA 2EG8A 3GDMA 3CPUA 4NNAA 1T5AA 2QLYA 5J5DA 3N6JA 1M7JA 1UWRA 4JQ1A 3AFBA 1ONWA 1LRNA 1MDRA 1J0JA 2FFIA 1DJZA 1CXKA 2PGWA 4F9JA 3IJ8A 3W7RA 4LOCA 3DERA 5FACA 1EBHA 4G5DA 2FZNA 1QBAA 1N82A 3GG8A 3L4YA 4LUSB 1QDSA 4QSHA 4QRNA 1T8XA 3W1XA 3G8EA 2HZGA 1GZ1A 5G1YA 2PC8A 3IJ7A 1OFAA 1W2VA 1LROA 8XIMA 4GXWA 2OEKA 3W1MA 3O0KA 3NM3A 3APGA 2CHRA 2PD9A 2A3BA 3TQPA 5A6MA 5BZAA 1RBAA 4G7EB 1FXQA 3B04A 4ONVA 1LM1A 4MADA 4Q8TA 1AL7A 4HMNA 3RF9A 4RE4A 4QITA 3MKVA 2PWUA 3UGRA 2C3ZA 4L1XA 3HGSA 2RJGA 4UR8A 1ADSA 1KLYA 2JGYA 4MNJA 4FALA 4XBSA 1TG7A 3GVWA 3P0XA 2AKMA 5HJXA 1GEHA 3WD4A 4PMQA 4S3BA 4F9DA 3VCCA 3TKFA 1ZNNA 2PUZA 1R9XA 1GZJA 1LLWA 3OP2A 3T2QA 1XCWA 3UZWA 4CNPA 4CLMA 3QQ1A 1TREA 2HJPA 3EDFA 3GXNA 3LU2A 2VR2A 2OWCA 1B9BA 1TJ1A 4W8LA 3GBEA 4AZGA 4Q4PA 4DNMA 3IIOA 2ZTKA 3E5BA 3QR3A 1HQTA 4HMCA 1CPUA 1XFCA 4AWTA 4XB3A 4GYJA 4PL1A 1B3YA 2FFCA 3LRMA 4LEQA 3B0VC 2WVVB 3TTYA 2CLOA 4XK2A 3CL8A 1M1BA 1F4AA 3PVFA 3QLDA 2DW7A 4A29A 3H23A 3UVIA 5FL0A 3PBMA 2FQIA 4TOQA 4K3ZA 5HANA 4O13A 5J8LA 3WD1A 1EP3A 3NYZA 2FGBA 3WLQA 1TTIA 4TMCA 1VIZA 3CBWA 3LXBA 3PY2A 4KWOA 4I90A 3G2GA 2E6YA 2VRKA 3VOGA 1TPB1 4WIWA 2XN2A 2YW3A 1BGGA 4I3GA 1PEZA 4AFYA 3WDJA 2O9RA 1REQA 1WUFA 4B5SA 1EDGA 4C6EA 3AQUA 4HVXA 1JZ7A 3D5HA 4UFLA 3G3DA 1C8QA 3ZLFA 1JFXA 2W4XA 2JF7A 3KOYA 3HO8A 3FSTA 1XHGA 3DFPA 3EX6A 2QGYA 4C6OA 1NARA 2CLHA 1JDFA 1MMFA 2Y7DA 3IK4A 1VR6A 3CASA 3W26A 3F03K 2IPWA 1PUDA 3U57A 4IFKB 4PCNA 5GJMA 4RCXA 3B0PA 3W1TA 2XWDA 1B57A 2WVUA 3NSMA 5AN7A 2FZDA 3S4TA 3ICJA 3GDRA 2PDKA 3GDBA 4IJBA 3V4BA 3VZXA 1KV8A 3G1YA 1K9TA 2YIHA 1RK5A 5BU9A 1FWCC 2FTPA 1Q63A 3C8NA 3PB2A 2OCZA 4OE7A 2QULA 3SM0A 4O52A 5GJNA 2VX7A 1V7AA 3EKGA 1ODUA 3REQA 3T0AA 2D22A 2HXTA 1D3GA 3CQIA 3QVQA 4PMUA 2AQWA 1K6AA 4A35A 2HPIA 2ZYFA 1BYAA 3FXYA 4NASA 4W87A 4E2DA 2QDHA 3VFLA 1R3SA 2JQXA 4MAZA 3KS5A 3FKRA 2OYLA 4GVGA 1RK6A 3OA5A 2CZ5A 3HV9A 4RXFA 3B9OA 4XVDA 2VL4A 1VFMA 4GFSA 1RJQA 1W2PA 5F4SA 3RUBL 2OEJA 4FXSA 1P6CA 3BJFA 5FJJA 1KXVA 4A3RA 2CU0A 4BEUA 3GU2A 2O55A 2E7FA 2YA2A 3GKAA 2ZRUA 1BVZA 1XIEA 4IFOA 2R1LA 1A50A 4P7RA 1H3GA 4K8GA 2VFHA 4LSBA 5DCEA 4XD6A 2QMJA 3IJ9A 3I7SA 1RUSA 1DKWA 2GJNA 4J27A 1VPQA 1S2WA 1VJIA 1G7VA 5HQLA 1XF0A 1EJ7L 3M0JA 1YIXA 2DT3A 4CCCA 1SO6A 2B4GA 3LENA 2C7FA 1XLKA 1OM0A 2QCEA 3ITTA 1BPLB 1OGBA 1MW1A 2ONEA 4K2SA 3E12A 5HQEA 2BTMA 5FA5A 2IKIA 3LTPA 4O1EA 2E8ZA 1U2YA 3NDYA 1W56A 3MPGA 4EX4A 2EG7A 3TROA 3S46A 3VOJA 4H9VA 2C8NA 3HQOA 2ICSA 4DBEA 5IHSA 3OBEA 4ZO7A 3PJXA 4GA8A 2OOFA 3UJSA 3SUWA 4WUIA 3PUEA 1ITUA 1OGSA 3USBA 4AC1X 3DENA 1R5YA 1UR8A 1IWPA 2HS6A 4X2PA 2ZVRA 1MW2A 2HVMA 5DANA 3L12A 3GC2A 2J47A 3M0VA 4AYSA 4GGBA 4JYFA 4AX7A 3P80A 1QAPA 4CQAA 3NDOA 3MSRA 3C2VA 2AQOA 1AK5A 2BVDA 4DVOA 4LVDA 3L4WA 1R30A 2WO5A 3N3TA 3ITOA 3Q4DA 2PLJA 4MYXA 1GQLA 2XUCA 2WZIA 2J8TA 1XYBA 3WJZA 1DE6A 3WIJA 2PF8A 2PWDA 1PIFA 2G37A 1LUCA 2R14A 1AH4A 1V6TA 1EQPA 3M1ZA 3H7RA 3TK7A 1V93A 1JFHA 5H1WA 1Y0EA 3EPNA 3UPWA 2A21A 3RX2A 1QPQA 4NI3A 2YCLB 2PODA 2PP1A 4HTBA 2GJXA 5G5IA 1FOBA 5XINA 2E6DA 3VNZA 3U3HA 3G1SA 2QIWA 3T44A 2HROA 3IAPA 3EOUA 1CI1A 2ALDA 2Y62A 3H2MA 3GR7A 1CGXA 5KSWA 2QHAA 4C90A 1RPKA 3PP7A 4KWWA 1NWRA 1OIFA 4J4KA 2ZADA 1R7AA 1YADA 1POKA 3BAIA 2G4JA 2WYSA 1IF2A 1FX6A 3S8HA 4KESA 1KCXA 2QCCA 4NF7A 4LB3A 5HXMA 1M41A 3CV6A 2E28A 2DZPA 3L23A 4C1LA 1RR2A 2G95A 1Z3NA 3WJXA 2TYSA 2G50A 3AXKA 2PZ0A 3CPRA 3OGRA 4FF5A 1R2SA 3VGFA 1XDLA 4GVIA 4DJFC 2V38A 2X42A 3L66A 2GOUA 4ZB0A 1EC7A 5FJIA 1JDEA 3STFA 3QGAC 4LTSA 2FGLA 1W3KA 1G6CA 3BLFA 4BQ2A 1XKYA 2V82A 3UWYA 2ISFA 1US0A 4DXKA 4C6DA 1V03A 4D9PA 2X0SA 1G4EA 4E38A 3ZR5A 1QOXA 4D6GA 4CUCA 2VZSA 2POZA 4U2YA 5BRBA 5JBFA 2VDGA 3TOYA 1JCMP 5FI8A 1XCFA 3QR0A 3BJSA 1YPIA 3VIGA 1H51A 1CWYA 4UTKA 2DFAA 4DF1A 1BWVA 1PKLA 2G0WA 4CEXC 5I00A 4D6JA 1A53A 2IKGA 6CGTA 1J8VA 3TC7A 4C6JA 3R11A 2V5JA 4GJ1A 4NZCA 2QJMA 3DC0A 3QV6A 1XIIA 4U5KA 4HU8A 3BMXA 4ZVJA 3BLOA 3UXKA 3AMGA 1XRFA 4W88A 4PTNA 1WKYA 4INFA 4JEJA 1V77A 3AMCA 5E5CA 2Y24A 1J96A 1EEXA 1A0EA 2ZRYA 5GNYA 5FEZA 1S5TA 1SW3A 3C5QA 3UPBA 3DHFA 3SCSA 1MFVA 1SM9A 3GDLA 3ID7A 4ZQRA 1KGXA 3VGGA 2TSYA 3B0YA 4KIRA 4BR1A 2QV5A 4WDUA 3PC0A 1Q2RA 5U7SA 3QOKA 1ZHAA 2WW5A 3GNDA 3P67A 4PR4A 3TC6A 5DY3A 4BWLC 1W5MA 3CM4A 2YZRA 4YIWA 1LG1A 3ABXA 4O28A 2TRSA 4RE3A 4H04A 2D0HA 4Z1BA 4DM2A 4KEVA 4U31A 3MUCA 3W01A 1H5YA 1MUCA 4WKAA 3IJDA 2DT1A 3KOXA 3K13A 3O6AA 2OODA 1J0YA 2PZNA 1FCVA 2GJRA 1OD8A 3IIVA 3V3WA 4NJGA 1E51A 3PSVA 4PMOA 3LCWA 3UPMA 4GJJA 4I6VA 3EZ4A 3LGGA 4LS1A 2WAGA 3VX0A 2VFGA 1A5BA 3MI6A 1GOWA 3UBPC 3R12A 1OK4A 4LH8A 4LV4A 2VDIA 5I24A 4L4PA 1WDSA 1QPNA 2B7PA 4K8HA 3HN3A 4CNUA 3TH6A 5I7GA 3T9PA 3TAKA 4A21A 1D3CA 1JYVA 1KRCC 4H8VA 2Q6ZA 4L9YA 4ADTA 1RSCA 1TZ9A 3S5SA 1QI2A 4XUYA 3W85A 4FLRA 3UCQA 4QS6A 3WLJA 4QROA 3VNLA 4OOUA 2V3EA 1FWNA 4GYKA 1NWSA 2NV9A 3SCWA 4IMEA 3AZSA 4L64A 3EBVA 2W3ZA 4ES4A 2WKLA 3TYBA 3HOJA 5CPLA 2PWVA 1RXOB 3SO7A 1XKJA 3W38A 1GGOA 4LVFA 4IPIA 4QP0A 1S3HA 1XGZA 2GK1A 2G3JA 3LA4A 2WQDA 1B5TA 4WSHA 1FRBA 4HNNA 2F9RA 1E73M 1XDMA 3VU2A 3QGKC 2ZC1A 1EBGA 1F74A 1XW8A 1A47A 4GZ7A 1FDJA 3CTLA 2QUVA 4HPNA 1QK2A 4D72A 3GXTA 4PBFA 1SFLA 4CQBA 3LSCA 3WQFA 2WHJA 4LUSA 3ITVA 5DMMA 3UR2A 2TAAA 3R94A 5C6MA 1YDYA 3QH2A 4EAYA 1DQXA 1JQXA 2QR6A 4ZEPA 3VO0A 4M0XA 1L8NA 1IT8A 3GU9A 3AIWA 3B8IA 1JZ3A 1XBVA 2DZWA 2X05A 1UZ1A 3HJEA 2CC0A 4M6QA 2Z1WA 3PJUA 4M82A 1UD2A 1TPC1 2VWSA 5A2BA 1EUNA 1KCLA 4G7EA 1H50A 4O19A 2BOFX 3K4AA 2O7SA 2A3AA 1GCYA 1SR0A 4P8XA 3BICA 1HO4A 1DJWA 4C6CA 4RNJA 3BJTA 5C9ZA 3DIPA 4JBRA 5CJNA 4H7ZA 2ZUMA 3N29A 5HPOA 3EWUA 1P1XA 2BY1A 4N6EA 1DJHA 4QNEA 3EDKA 3W7KA 4KETA 1TPH1 2DZTA 2XH4A 1RCXB 1JZ2A 2E5CA 3CZJA 4JTKA 4F4RA 3T81A 4A05A 4YYFA 4Z42C 4V15A 3K1GA 4KT2A 3BMWA 2W79A 3EWBX 3NFUA 5AHLA 4GQ0A 2B7OA 4FNQA 2XVKA 3TSMA 3QZAA 1XICA 4QG8A 3N3MA 4F8XA 5CZTA 1UR3M 1MQPA 4LQ1A 3RGTA 4H9ZA 5EU9A 5F2MA 1ONRA 2E68A 3VMPA 3OVQA 2HEJA 2VUYA 3PNZA 2WVVA 2BHYA 4NXKA 2WZMA 1MSSA 3TN4A 3B8DA 4WZHA 1U5JA 3U5UA 4F66A 1IEIA 2GUBA 5XIAA 1DWGM 2PDHA 3ARPA 3FYPA 2I7GA 4DJFA 1IV8A 1GJPA 3GH4A 3GLCA 4XIMA 3PZMA 4GMEA 5CBJA 5G1MA 1FCBA 3I4EA 4C7FA 3T40A 1W3JA 3G1DA 4HPGA 3LRKA 4K1GA 1EP2A 1R3TA 2NUXA 3F4VA 4MKNA 1HT6A 1FHLA 2A6LA 2JIEA 3GU1A 4JDBA 1L6FA 1YYAA 1E40A 4Z17A 4PE8A 3UYCA 1EPVA 5DMNA 4FR6A 3C6CA 4AY1A 3SY5A 5I77A 2CNCA 2Q09A 1Y65A 4LWWA 3HG2A 3PANA 5E6ZA 4W5ZA 1OYBA 3L67A 5G2WA 3ZJ7A 3NPXA 3KEHA 3ZZ1A 2JEQA 2OSXA 4J9JA 3DECA 3WEMA 1RVKA 2DJLA 4LAOA 4AVOA 2DGAA 4IFKA 4Z2IA 1OHLA 1S3TC 4HU3A 1EQCA 5ABEA 4MWAB 2EBNA 3VNIA 3VC5A 2XDFA 4HOXA 5DT7A 3S2LA 3E9AA 3F7JA 1TTPA 1NSJA 3H12A 5AY7A 3M5YA 4OZOA 1IR2A 4DWSD 2GGGA 5CPTA 4AZCB 1XFBA 3AS0A 4M6UA 4B2DD 3FAWA 4FOJA 4D2JA 2J8GA 3H21A 3LLFA 3VGBA 1SJDA 4KEZA 2A85A 4GG9A 1B90A 4JYEA 4O18A 4N9CA 4TX6A 3AS2A 3NURA 4DQWA 3VGEA 2PEVA 4JNYA 3AIQA 1U83A 1J0HA 3KOWA 1N7KA 2YL6A 3GG1A 1W9UA 4NT0A 4B92A 1V0LA 3S0CA 4QG9A 4JTGA 2ZZ2A 3R0KA 3PFMA 1R0MA 2ON3A 2YZ5A 2ZRVA 2IXVA 5BRPA 4HA4A 1SW0A 3I4KA 4L7ZA 1O7AA 3PUDA 1YDOA 3BAJA 4MY1A 3R79A 1X6LA 3GNPA 5EMMA 4U3AA 3GVVA 3QBUA 5AC8A 4JN6A 2HDJA 3LI0A 2VURA 1QBBA 2BX7A 2ZXQA 1XLHA 1TJ0A 4KEMA 2JF6A 2WKGA 3GR4A 3CB3A 1YX1A 4NY2A 1TWSA 1K9DA 3W1AA 4UTMA 4DIAA 1E6PA 2EPHA 4LAKA 4GISA 1EL3A 3ARTA 4EPDC 2QAFA 5AB3A 4DUVA 2AMXA 3PZQA 5B7ZA 1UUOA 1F8MA 2JKPA 1A5UA 1JXJA 1PPIA 4FNTA 1S1RA 3ABRA 2XYLA 1OSEA 1EA0A 4W5UA 1V51A 3HQNA 4JFUA 4J3TA 3KZSA 4WD0A 4L1WA 1CNVA 4UTWA 2ACRA 1RA5A 4FIQA 4Z08A 3GK0A 4JTSA 4FLQA 3W07A 1KXHA 4QJ4B 5CGTA 4H00A 4FNRA 1WO2A 2DZSA 1I2QA 4DXXA 3APTA 3CMFA 3EA3A 2WZEA 4QISA 4B90A 4HN8A 4GIYA 5IRPA 2INEA 1B54A 2PTZA 1G94A 2WC7A 3TYAA 4OECA 2QYGA 3VCRA 3IARA 3FFSA 1H41A 5AC4A 4HCHA 1UPMB 3A12A 3VDAA 1TR1A 8XIAA 2YXGA 2PDGA 4MSSA 5LIXX 1TTJA 4LFYA 3QKZA 4IOTA 3O63A 3WK3A 2YFNA 5HWMA 4ADSA 1E4NA 4QTGA 4R3UA 1A3XA 4D6DA 3B9EA 4Z2JA 1FWIC 4FR1A 4PMDA 4IICA 2XH2A 1RJPA 2Y4SA 2C91A 4LS0A 4LF1A 4XWUA 5A95A 1V0KA 4JQAA 4MHBA 2YCLA 1IWAA 3OIHA 1GYNA 1W9BM 3ZLHA 5FJOA 1Q13A 3G6LA 4RZ5A 1UKPA 3M43A 1W32A 3U4FA 4IQEA 3NO1A 1A3HA 4XZWA 1B3WA 3SSJA 4ZB2A 4KCTA 1KRBC 3P8JA 5L6UA 3H2NA 1E6XM 3WFLA 4MIMA 3MHFA 3VE7A 1HKKA 4ZSTA 1GYLA 3WK0A 1Z44A 4LY8A 2AKZA 3DGRA 4DWDA 1XRTA 1DWFM 3KL5A 1ZCOA 3UA3A 3N2XA 1KTBA 3GE7A 4KGJA 4OUEA 3OGVA 5E93A 3CV7A 3ENLA 2UV8G 2HWGA 4GOAA 4I7VA 3V16A 3A9BA 1AODA 4L1GA 4QCFA 1BAGA 4IP7A 2WMGA 3H4WA 1JG9A 4CQ9A 2P3EA 1VLIA 3IEBA 2P0OA 3BG3A 2OELA 1RV8A 2NQZA 1V02A 4DI8A 1TYGA 6A3HA 3FNDA 4ATWA 2FDMA 2V3DA 2H8ZA 2ZZ5A 4PODA 2OGYA 1WDPA 3TA6A 1W6TA 4DO4A 1KFKA 5M17A 3M0KA 1SGJA 1FWTA 2EXOA 1ISZA 4NRSA 3UG3A 2VTFA 3QV7A 1GVSA 1XIMA 2OEMA 2OLAA 3G5EA 5EL1A 4LGXA 2RGMA 2IQ0A 3I6TA 1NTHA 3TNBA 4TUFA 1CZ1A 2WCSA 2NV2A 4V2XA 2Y2WA 1ESWA 4AZHA 2B0MA 1U22A 1K6WA 3CEPA 2YBTA 3IJ6A 3POHA 4H9XA 5I06A 2AOSA 3IRSA 2Y7FA 3L7RA 4BZYA 1XSJA 4BHYA 2VENA 1S2UA 1KXTA 2PGEA 3M47A 5D03A 1XYAA 4JQ4A 4KPLA 1ME7A 3OLDA 2J88A 4H7VA 1TVNA 3VKAA 2PDYA 4KEUA 3VD9A 4PUNA 4JY9A 4A6GA 3QPZA 1U1JA 5LNUA 1L0PA 1BSLA 3VILA 2Z1SA 2FDSA 3GHSA 1DYSA 5MHBA 5FIPA 1RHCA 3LZ5A 2XZ9A 4ILSA 2Z2BA 3SCVA 3TTSA 3G1FA 2GL5A 1VENA 1W3LA 1A49A 1LLZA 4H8HA 1I0BA 5EKYA 4ORIA 1G7UA 5EMKA 1OINA 1SW7A 4PFHA 5DBTA 3SUTA 3SR7A 3EWWA 3CMGA 5EY5A 2DY3A 4K39A 3H6OA 4JYDA 4RV8A 1EEPA 3DBPA 3E49A 3QQWA 3BV7A 1LOSA 3RAOA 3UVAA 4B5UA 5DFAA 1V3HA 4Z1AA 5D2VA 1I75A 4AF0B 3NM1A 3UU0A 1G69A 3ALGA 4WHBA 7ODCA 5FEPA 4FOUA 4RDVA 3LMZA 3UESA 2J6VA 3TN3A 3GS6A 4NZ4A 1V3IA 4Q8PA 4W93A 4JDYA 1LWJA 1UKSA 5I5RA 3R89A 4JTJA 1D9EA 1AFSA 4HNUA 3GYEA 1X8CA 2VNCA 1Y5WA 1LZOA 3CWNA 2KAUC 2V68A 5AKQA 2W92A 5BOFA 5HA7A 5A6KA 4JIHA 2D2OA 2P76A 4Z1DA 1H7XA 1WA3A 2MNRA 1EX5A 4QE5A 2X09A 4QJ3B 5C0QA 4M56A 4H6KA 2DIKA 1I60A 3W2NA 5BXRA 1RH9A 5CLWA 1D2KA 3D6NA 4K36A 3MWAA 3LTSA 3NEVA 2YXXA 3WK1A 4GNJA 4QHRA 2HRWA 3KP1A 1KC7A 2V9DA 2IPJA 3HPFA 1AQMA 4QFUA 3W82A 3QRHA 1F8IA 4OT7A 2NQ5A 3WQDA 4Y9OA 3OHMB 1YXYA 4ICNA 3UZXA 3R43A 3UCDA 2CLFA 4DZHA 2H9AB 2YDAA 2CLEA 3BZJA 3GAKA 4MG4A 3N9KA 1XH1A 5CPNA 2JFEX 1JZ4A 1JI1A 1HTIA 3P74A 2DVUA 1S46A 4QJ1A 4OUIA 2ZUVA 3N2OA 4LUJA 3NIYA 2XSAA 2G41A 5LZLA 4GQRA 4IGNA 3VXGA 3ZVHB 1PTAA 2WHLA 1OK6A 3PBWA 1F5ZA 4NU7A 1W9XA 2VCAA 2V5CA 2W27A 1CGVA 3P5YA 4I9MA 2VT0A 2OXNA 5CPQA 1C92A 3GIQA 1XC4A 3BOFA 3DAQA 4AQLA 1NEYA 3IJIA 4O0KA 3TR2A 5D2WA 2VGIA 3Q2DA 3GG7A 3C52A 1WDDA 3QY6A 3W0KA 1KLZA 3AUOA 1EO7A 1LRQA 2PRHA 1OY0A 1UKOA 5CEWA 5XIMA 3UGVA 3OG2A 3W7MA 3WEOA 2Y88A 3EWZA 4H9UA 1SO5A 4AXNA 5FF2A 1HGYA 3FA4A 4HYWA 1KFBA 3TE9A 3TMLA 5DCDA 4QE4A 3MHUA 4GC3A 2OGJA 1BLIA 1S5VA 4HIBA 3HB9A 1J12A 2NUYA 3T1GA 1S2VA 4RE2A 1PTDA 2P10A 1QOQA 2R1MA 3LK6A 3E5PA 5BW6A 1G0CA 3A24A 5AYZA 3NVDA 1MI3A 4JZ5A 4R9XA 1E43A 2Z28A 2CLIA 3G1HA 4JQ2A 5DRIA 3P7YA 4S39A 3JW7A 4X2RA 3PAJA 2J9ZA 2QMKA 4LCQA 5DY2A 2WNNA 2OQLA 5BMXA 4NJKA 4MM1A 2EPOA 3PULA 5A3HA 1TCMA 2V67A 2Q8LA 1MUWA 3VM5A 2DORA 4DAFA 1HVXA 1E6SM 1TV8A 3ZR4A 1W1IE 4PUMA 3KTSA 1J01A 2H90A 3BAKA 2NX1A 4ZB5A 1R3RA 3H53A 4Z1CA 3KXQA 3B40A 1S5MA 1BTMA 4N7QA 4GNKB 1EJRC 3LYEA 5C9RA 3UXDA 3W1PA 4LS2A 2PTXA 1OADA 1XBZA 3MQTA 3EXTA 4C65A 1F07A 3P14A 2YLLA 4N4QA 3DI0A 4UQCA 2XM2A 2ZFAA 1AD4A 3WLIA 4S3JA 1AVAA 4GNVA 5ENLA 2A7RA 3TIMA 2WHMA 3M6YA 3QHOA 3UXAA 1R86A 5BRQA 5C7VA 2CETA 2Q02A 3IIPA 3LMYA 1ZJBA 1OF6A 3AI0A 1B3XA 1K70A 3RLVA 3OZOA 3UFYA 2OTDA 2EQDA 4NUWA 2VCCA 3O1NA 4D8ZA 5J5RA 1DHPA 2WHKA 1CBGA 3TN5A 4YWIA 3GR8A 2RHGA 4L56A 2J62A 4JTLA 3B05A 4LBUA 4L6DA 4MWAA 3GNXA 2CZDA 4DO7A 3CGTA 2XISA 4HK7A 3L65A 4OU1A 3TCEA 1WBJA 4HZ8A 1KM6A 2QPUA 1T41A 4AZCA 4LUTB 3GG0A 4UFJA 2R1PA 1HUVA 1ZP4A 2X30A 5AVNA 1QWKA 2XGBA 4MAVA 3TW6A 1JUKA 1Q6OA 1M5WA 2X7VA 4A8RA 1O68A 3EPOA 4IP5A 1MEWA 4CD4A 1KBKA 4J5NA 3ALFA 4NQ1A 3ITXA 4EP8C 1EIBA 7PTDA 4U3CA 4ZXOA 2ADAA 3D0CA 2ABBA 3DG7A 5E0KA 4LT9A 4AWSA 2Z29A 5DXXA 1SZFA 2OVLA 3KRSA 4B16A 5D2TA 1TSIA 4GZIA 1ML1A 4WEVX 4PUWA 3AYRA 3ZOAA 3LXCA 3B8VA 4YYCA 2JALA 4RKAA 4S3KA 3H7UA 3PZUA 1Y8BA 3CL7A 4GUFA 4GH3A 5RUBA 4E2OA 3GWQA 2G96A 4TV5A 4DJEA 1O5KA 4G56A 4UTLA 5E9XA 2XTKA 3ZO9A 4GE8A 5E1QA 4HPHA 3GTHA 5E70A 3EMCA 5KZDA 4FNUA 4AEFA 3MDWA 4DJDA 4AZIA 5GPRA 1CIUA 4XZHA 1OX5A 1JL8A 1K9EA 3V5FA 3UG5A 3CZKA 3NQ2A 1UD4A 1BWLA 4UOJA 2HMCA 2HPMA 1EA9C 3EXRA 2WM1A 4MB1A 1J2BA 3U2CA 2F6XA 4GQGA 1TB3A 4ORMA 1A5OC 1CCWB 4W4QA 5HAOA 1Z8AA 2ESCA 2X8RA 3O8AA 1AD1A 4H6RA 4XZMX 2W62A 1K7XA 3QXBA 1U33A 2ZX7A 2PAJA 5D05A 4PUKA 4AZ5A 2E40A 3WDHA 3C2RA 5EBUA 4CCZA 3ISIX 1G67A 1PL9A 4ROQA 5EMUA 2XFYA 3GW0A 1V6VA 4PZVA 4C5ZA 4LPCA 1HKJA 4JHMA 2ZICA 3WDPP 4HSOA 5HUOA 5IDZA 4UCGA 4BY3A 5C71A 3UCCA 3VTRA 1HFBA 1HF6A 2J8FA 1HN1A 3QQ0A 1VH7A 2FGZA 1ZAIA 1IEVA 4JICA 2GQ8A 1ODZA 2NZLA 4O12A 1TWDA 2IW0A 4JNZA 3D3FA 5D04C 5D9NA 4A3HA 3CL6A 2ALRA 4K6AA 2PDFA 2E5BA 4NI8A 2OZ3A 3NR0A 5CXPA 2VWTA 1G4PA 3MJMA 5T8GA 4WJXA 1PZ0A 4KCVA 4PL2A 4PB4A 3HG4A 1T0OA 3S1GA 1OFBA 1W8SA 4M8UA 1UR2A 4F0KA 3R13A 4HPXA 3TQKA 4GYPA 4MB3A 2DQXA 3W27A 4ECLA 4MJZA 4C6MA 1OFDA 3NAVA 3SCOA 3GM8A 4MPKA 4M51A 2NWSA 5JH2A 4IJRA 2WSPA 2YDSA 3WZ0E 1T99A 3DFSA 3PFRA 5CSUA 2WM0A 1W3NA 3U6WA 2DH2A 4AHOA 1EH9A 1KNWA 3KVMA 3AHXA 3GDKA 3WN6A 4EWJA 4UMBA 4PYSA 2BZNA 2DPEA 2VFEA 4WLCA 3CAVA 3KWXA 1QI0A 3VC6A 1F05A 3R10A 1VFOA 1CLKA 1HX0A 4NZ3A 2ZRWA 4S3AA 4F0MA 2BFGA 3Q67A 4LY4A 4IG2B 4M3PA 3WMSA 4MGGA 3SI9A 3ZWSA 1UR4A 1C29A 2WC3A 3PPFA 4IISA 1EP1A 1BRLB 3RCMA 1UQYA 3B9AA 3KBMA 3UWZA 2FHBA 2VDHA 4AD5A 1E0TA 1PIIA 1GJWA 3KTCA 3WQ6A 3BLIA 1GTEA 1ZJAA 1TWWA 2J75A 1VEMA 4CN6A 3NZRA 1IWBA 4HYRA 1AG1O 3BCJA 4YXGA 1A5NC 2C1GA 3BAYA 1DTNA 2Z1XA 1E0WA 2Z6IA 1W5NA 3FVDA 4LCRA 2NXGA 3W7CA 3AU2A 4ZE4A 3GXDA 2VX6A 3VKCA 1ECEA 1HJQA 5K4XA 1AMKA 1R85A 4NYUA 3UQNA 4FLOA 1F3XA 2ZZ4A 2ZA1A 2OZTA 5ABTA 3WUFA 1RD6A 2CFFA 3G0XA 1X97A 2XH0A 2Y8KA 4E0CA 4UFHA 4DLFA 1Q6EA 2G5WA 2IS7A 4MDOA 5IFTA 4UR9A 3BPWA 1QJWA 4GVHA 3UZJA 4Q8OA 1W91A 5AHMA 2Q8XA 3XISA 4AY8A 2ZX8A 4QLLA 1TV7A 4LRSA 1VD6A 1O6IA 2G97A 2ZZ1A 1XCXA 4NAEB 4MKSA 1QVBA 1KM4A 4AU0A 4ACZB 2ACSA 3DFNA 4AF0A 1TUFA 1FCQA 2Z00A 1RLCL 1RAKA 3LRLA 3FS2A 1NP2A 1XSIA 2PDWA 4D6HA 1BSIA 2P5NA 2HCVA 4FNSA 4TX8A 2L5HA 4R7JA 2A0NA 3T0DA 1PVNA 1EFZA 4PN2A 5LA0A 4EVZA 1XV8A 3H7VA 2D3LA 3ITGA 5D9PA 4PBEA 4US5A 4GZJA 1A80A 4KRTA 3CYJA 2E0PA 5CPMA 3WD3A 3BUVA 1WUEA 1JNDA 1PZ2A 4IPNB 3W72A 3OLEA 1Q5MA 4QDMA 1SJBA 4JTTA 4HHLA 1E55A 3DFTA 3ATZA 2A79A 1XLCA 2CLPA 3ZJ6A 3KCOA 1KFLA 5EGRA 3SRHA 5A5WA 5T26A 2WCGA 1VRXA 1B31A 1BG9A 2NQJA 1JR1A 2EPLX 5D2YA 1EZ2A 3MZNA 5D4YA 4CD6A 3RRAA 1E5JA 2GZXA 1JCTA 2XWEA 1E0XA 3DHDA 4B9ZA 4C6BA 3BL3A 4NZ5A 2H9AA 2E77A 2QUTA 1TQXA 3O7UA 1VBHA 2B7NA 3NPWA 3TAOA 3W1RA 4HA0A 4AC7C 1JXKA 2DSZA 2QCGA 4WSJA 1CGTA 5KZEA 4DM1A 3SZ8A 3SB0A 4PMNA 4CNOA 1C7SA 2DT0A 4XSMA 3ME3A 1PCKA 3S1XA 1F4HA 2O4QA 1GOQA 3VDHA 1IXOA 4WRHA 3ZVHA 4JL2A 3QFEA 1E4IA 1H7NA 3L4ZA 4Q4SA 2WPGA 2Y1HA 4XUGA 3QV9A 5JIPA 4ML9A 2ZIDA 3N17A 1VFUA 1QO2A 1TFVA 4ZXLA 3ARZA 3NZ1A 2HQAA 4O0QA 4UB9A 3LCGA 1M01A 1SVDA 2WSKA 3QW3A 4CNSA 2INFA 1XS2A 3CWOX 1EIXA 1XPGA 2CCRA 2QJGA 2XINA 5AVHA 4CNTA 2NWRA 2Z26A 3ZJ8A 3DESA 1UCWA 1I6NA 5TNVA 1IYXA 1W5QA 1NDZA 3LBMA 2NVAA 1O94A 2WCAA 1LQ2A 5PTDA 4R33A 4W86A 4HK5A 4P8VA 1HIZA 3AHTA 3G1XA 1DXIA 3CIWA 4B4HA 4GO8A 1YEYA 2OZ8A 1KTNA 3F5JA 2ZA3A 1SO3A 1XI3A 4DBUA 2G3MA 1SMAA 3AS3A 1IQ8A 5FAGA 5FEXA 4A2SA 5H6HA 1BF6A 1TPVA 5ECVA 1W17A 2V3FA 2VR5A 3WJWA 1CGYA 1VHCA 1V79A 4IMCA 3AOFA 4IIBA 4C1NB 4DWSB 2WWCA 1EWEA 3AJXA 1QUMA 2Q8ZA 1QI3A 3OYZA 2WKJA 1PCWA 4H41A 3H55A 5C54A 1UR9A 3AICA 4MLRA 2J7GA 1UWTA 2R6OA 4O0ZA 3O16A 3PPGA 3WENA 3RM8A 3NVTA 3MO7A 3POCA 4RNHA 2CLMA 3GXIA 4ATDA 2V69A 1WNOA 3W25A 5FCZA 3TP4A 3C61A 5CQ1A 1DXFA 2VJXA 1SFTA 2PGRA 3C4UA 3NUKA 4H6QA 4JTUA 5DO8A 3QZ6A 3G6MA 4HHMA 4KWSA 1ITXA 1XYCA 4U28A 3ZSTA 3ZQ9A 1L9WA 3WLTA 3N19B 4WY0B 2XU2A 1DL3A 2BS9A 4QG6A 2F2KA 1JVNA 3WBXA 2VR4A 3VFCA 3E2QA 5CGQA 5DT5A 2OLHA 2ATMA 2ZBTA 3U5YA 1EHAA 4L5ZA 3CAKA 1R8LA 4H9TA 4FEZA 5DCBA 3WQPA 3MCNA 1C8XA 3OTRA 3RDKA 5FF7A 1VCGA 1S5WA 3NOEA 4NJHA 1CXEA 3ONBA 3RCNA 1XRVA 5CAKA 1A3WA 1ISYA 4E2VA 3CIVA 1LBMA 4WXYA 1PWLA 3VGDA 1BYDA 3RMJA 5FKYA 4XZ9A 4FP1A 3W2KA 1OIMA 4LUTA 1ISVA 3TZNA 1GPWA 3W6LA 1JGMA 2E25A 4YNGA 1CXIA 3I10A 3SCRA 4ICCX 3KP0A 4XQ6A 1YXDA 2GVEA 2V5KA 1E1EA 4H01A 3MVTA 3LHZA 4O4WA 3DGBA 1XIBA 1W1VA 1PAMA 3DFYA 7ENLA 4QEHA 4BI7A 1PWMA 4X0NA 2PWFA 3M07A 3N15A 4IGHA 4IH3A 5CG0A 5I2UA 4PMVA 5TQLA 3CWHA 3AISA 5E9AA 4H9YA 3EX2A 1Z42A 2ZZ6A 1OZMA 1HJSA 2I5QA 3G0SA 3OB8A 4QDPA 4XD3A 1P7TB 2ISSA 3N2BA 3M6DA 3CAWA 1H61A 2AL2B 4RNFA 3LHYA 2VD8A 2Z25A 5A2AA 1Z89A 1S2AA 3VOCA 1FVPA 3ABZA 1XLBA 3NG3A 4NX0A 4XSLA 4IQJA 3BG9A 2E67A 2QIIA 1KCZA 4H2CA 3KBNA 4F2TA 2DIEA 3EX4A 3THAA 2B31A 1UPPA 3M0IA 1TE1A 3INPA 4CD8A 3ZLGA 4DUWA 3AYTA 4IJCA 4B3LA 3MYOA 3MKKA 2XFFA 4IMAA 1WBHA 3DKLA 4FXFA 4AG0A 4GWEA 1Q2SA 1JZ6A 1PYFA 2XGIA 4FI4A 4AH7A 4LEFA 1BFNA 2CEQA 3CK5A 5D37A 5CAHA 5I23A 3DN5A 1AZ1A 1JEZA 1PYMA 4GC4A 1Z9AA 5C9UA 1Q7ZA 5AZ0A 4HU0A 2YCJA 1NP0A 3WNLA 4LX4A 1QHPA 5C2CA 3XIMA 1DQWA 1F61A 3NXFA 2Z2UA 2ZXDA 3OGSA 3NQ7A 3WNMA 4J3UA 1WXZA 3W2MA 5LNVA 4Z1YA 3E2VA 1U1HA 2QEZA 4NNBA 4WSKA 3FLUA 1S5NA 2ZZ7A 3N6HA 4IT1A 4S3FA 3IJLA 1UP3A 1H7WA 2CITA 1VPYA 5FEWA 3W2LA 1ZZMA 4LF2A 1VJZA 3NL6A 4WDTA 1FH9A 1TPUA 4CEUC 1MW0A 1O12A 2D2JA 1ZBKA 3VI2A 1M7PA 2FIQA 4G7FA 2VRQA 1OJXA 2OG9A 5HNRA 3ZS4A 2DZAA 2CBVA 1WYIA 4DJFD 2HVNA 1XINA 3TYUA 3WBEA 3WJYA 1RZMA 3EDJA 3LS9A 2PTWA 4M80A 2VC7A 1YTEA 1LOLA 1UZDA 3BLLA 1EGZA 1TMHA 2GDQA 1V3MA 1ONEA 5H2ZA 4S3DA 2C6QA 3KL3A 3CAQA 3RPDA 1PDZA 3KHDA 5FOOA 3ZR6A 3Q94A 5I3IA 3T05A 1IZCA 3NQMA 2NSOA 2XVNA 4OVXA 1A4LA 4MY9A 4GY7A 3WX7A 3T09A 4IIFA 1RLDA 4HT3A 3RMEA 2GSJA 3BLPX 3GZAA 1V6YA 2GQ9A 1D7FA 3N73A 1B3VA 3VMOA 4IG2A 3MSGA 4P7QA 3LBOA 4HHPA 4PMYA 3CPGA 4L61A 4D8LA 1JRBA 1TPFA 3M0HA 3Q45A 3LHUA 3LNMA 4JN7A 1OB0A 5D32A 1IE7C 2ZUUA 1OQFA 4TIMA 2WBKA 4B5NA 3FJ6A 3NZPA 3ZM8A 3T07A 3W24A 1BRLA 3VVGA 1ZSXA 1Q4WA 2J24A 3AWOA 1QATA 2BODX 2VGBA 4JKLA 3IGUA 2A3LA 3QYQA 4UBPC 1PJ9A 4MYAA 4UOQA 3PUOA 5EA9A 4I8DA 2XIOA 4KCUA 4AYGA 2AGKA 4NHVA 3DH7A 2C14A 1GYMA 1KRAC 3SCUA 3FJLA 3GNOA 2VZTA 4N9DA 3WBAA 1NWTA 3GH5A 4UQAA 3WH5A 4DAIA 1B2YA 4HNOA 2WNWA 2ZOXA 2F6UA 2P50A 2YFOA 2Q71A 3DU0A 1HZYA 2EKCA 5DBUA 2W91A 5D2XA 3OZMA 1HXJA 1NDVA 4PMJA 3D47A 3WF4A 3RLHA 5CSRA 2W5FA 4RDZA 1OYCA 3WH6A 3BLKA 4UNLA 3AIVA 2VEPA 2DZXA 3PWGA 4IPPA 1FTXA 4E4PA 3ANYA 5EMYA 1G5AA 1V4YA 2BNJA 2B81A 2F61A 3RLUA 3PBYA 4X22A 2OT1A 1V02E 1VS1A 4NAEA 4ACZA 2XPKA 4PCSA 1C93A 4JCLA 1SMDA 5FESA 4Z2GA 5TD4A 1OWQA 3GVGA 2GDVA 3R0UA 1WKDA 4UTJA 1ISXA 1CENA 4M1BA 1K7EA 3NJ3A 1IZKA 3ANUA 2PP3A 1DBTA 1TVLA 5C2XA 5SWUA 3TLLA 2ZE3A 4YTTA 3M5VA 2ZC8A 1RD5A 1P43A 5U4NA 3ZFHA 2CXGA 3AZRA 1F6PA 1CW2A 4V27A 4WGXA 2VP8A 5AHEA 1JYXA 3NNTA 4DN1A 4HA1A 4I5XA 4F0HA 4ZQMA 3RFAA 3LB0A 4CCDA 4WDWA 2OJPA 3A47A 1UMYA 4AVNA 3ORWA 4R7OA 4TVDA 1XD0A 1TE6A 3LCHA 2XH7A 1J5TA 2WPBA 5D9MA 5L9FA 4XTIA 1EXBA 1TMQA 1I2RA 4GJIA 3T6CA 2ANUA 4IL2A 3GY1A 3NQGA 3T0CA 3HF3A 4HCDA 5AECA 2J4GA 2AAMA 3FXGA 4HD5A 3FEQA 1CXHA 2I5IA 3HURA 4PH6A 2ZUNA 1IEWA 4XAPA 3FHAA 3DOPA 1XLIA 4DB7A 2G3NA 4HKPA 1DWHM 3A9IA 4ASTA 5DRCA 3E0IA 2V0TA 4FA3A 2PURA 4N2YA 5AC5A 5CGMA 4A8LA 3RU8X 4FOKA 4DPQA 3W84A 1IZJA 4O4VA 1KM2A 3FOKA 4E8GA 1TA3B 2WLZA 1HJVA 3MUZ1 2BVYA 5JBEA 2QXWA 4DX3A 2J79A 4P8WA 4YHEA 2P88A 4NX5A 2E3ZA 4QIUA 2C1HA 3KRUA 4R88A 6PTDA 1S39A 1H60A 1VRDA 2RKXA 1I0DA 1OABA 3BCDA 3ARSA 4D6IA 1MEHA 4JFVA 4X9YA 3GXFA 2D69A 4O8AA 1TX0A 4LANA 2F38A 4ZOEA 3FYOA 2AL1A 4IHCA 1LG2A 2OX4A 2GLKA 1J6PA 1GQKA 1DIKA 1HNYA 4GINA 4HNTA 3WF2A 1U30A 3ZXWA 2MANA 5E0FA 2RDUA 3EOSA 3A13A 3PZOA 2QF8A 1WCGA 4JS3A 3CUGA 4XO7A 2PDJA 1PDYA 1UIPA 3MMWA 1RP9A 2E5DA 3GHRA 3NQBA 2VFFA 3VOIA 1VFHA 2PDIA 4C60A 1X98A 4OBSA 4YTQA 1AUSL 3FAXA 4JIEA 4QCEA 4TV6A 5HMDA 1LORA 4UTTA 1UZHA 3SDOA 4ZQOA 4OWGA 3WDIA 2BP1A 1TRDA 1ENUA 3LLXA 5C70A 1ADOA 2DIJA 4DBSA 1QK0A 1OVDA 2A6NA 3OVRA 2O92A 2FHFA 2DP3A 1KXQA 2IMRA 4C1NA 4E8DA 4R27A 4DWSA 4AWUA 3FK4A 1QOPA 3WBYA 3H2CA 3P0WA 3AXHA 4JTQA 2PS2A 5HNTA 4MPQA 1VFTA 3PZGA 4LC8A 3DHPA 5LIWX 1K4GA 2IKHA 4GX8A 1XDJA 3J7HA 3NQ8A 4ML4A 1KKOA 1N8IA 3WLRA 3TZFA 3U2OA 3VIMA 2FVKA 4TVUA 3N6QA 4Q8UA 1W3TA 2FJKA 1JPIA 4YL2A 1SZEA 1S38A 3C2FA 2YR1A 5REQB 3YPIA 2X2GA 7XIMA 4GUIA 1YDVA 4MB5A 2X0HA 1QXLA 4LALA 4MFEA 4GVFA 4C6FA 2RDWA 3W7EA 2SFPA 1WZAA 1T7LA 4WY0A 3QY7A 3WFAA 4YVXA 2BGQA 3UWQA 4WR3A 1FWRA 2BASA 2Z1BA 3KE0A 1E1CB 3M0MA 3MMDA 3RN6A 1CGWA 3WDRA 4Y8EA 3HZ3A 3G3MA 1R46A 3KBJA 5B7YA 1JAKA 4JAWA 3MWCA 3NQ6A 3AIRA 4K7VA 1YDNA 4US6A 1NDYA 4P2VA 5E09A 4XBJA 4HYVA 1B1YA 4M29A 2FZBA 4WJEA 1E6QM 1VC4A 1RP8A 4MKVA 2JKAA 2WV8A 3WLHA 3NDZA 1OX4B 4RPQA 4RV3A 3AWNA 1W5PA 1UJPA 3TJLA 2X1UA 3TWBA 2E09A 2GFTA 3ZSSA 4FX7A 4J2MA 5BXSA 1GOMA 3L4XA 2ZX9A 3K8KA 2QV4A 4UC5A 2NW0A 4FPSA 2NQHA 1BVWA 4XAFA 3FDGA 4O50A 1X96A 5KZ6A 3ARXA 5A2CA 4ZMGA 5A1AA 2KX9A 2Y0FA 1V0NA 1ZU8A 2YB1A 2ZRXA 1JNEA 3BV4A 1ZUAX 1HJWA 2BXYA 4XO6A 5C9XA 2E1WA 1B4KA 1R7OA 3U7BA 3MCMA 1P0DA 3ZT6A 2C18A 2XGZA 3AO0A 4JX6A 1AZ2A 1P7TA 4BCEA 2O9TA 1UD5A 1GOOA 3SRDA 2AL2A 4FAMA 2GVLA 5IDIA 1M6JA 2OYKA 4GBUA 4XAGA 4GZEA 3W00A 3MU7A 2W63A 2YCIX 3DHUA 3O07A 1LL6A 4DYJA 1Q6FA 2NT0A 3G22A 2CBJA 2PP0A 2Y5JA 3F4NA 3STGA 3PJWA 1UC4A 2XHYA 3EA1A 3V5OA 3B8SA 3B8TA 3T0BA 4UMCA 2D0FA 3WNKA 1ZL1A 2GUUA 4FSAA 4FZIA 3WUBA 4MWAE 2BV9A 4MUPA 5TIMA 4IF2A 2X1IA 3AIBA 3PN8A 1BXBA 3PM6A 3SBFA 5G1TA 2YA1A 1T6MA 3VIHA 3OW1A 1O5QA 2DU2A 1LJYA 5CC6A 1NOWA 1DJGA 5CZJA 3KUMA 3UNDA 1L6YA 1YMYA 1UB3A 3W1UA 2V63A 2C1IA 5HINA 1W8GA 4GXMA 1QASA 3TQVA 1QTWA 3BAXA 4NJJA 4L80A 2WJDA 2HK1A 4CGTA 4JIIX 2CWNA 1R47A 1ZFJA 5DN1A 5M2FX 1W9VA 2Z0IA 4R5EA 1GK8A 1TO3A 3W1NA 4Q8NA 5KINA 1IGWA 3WLLA 2J66A 4ZR8A 3R1ZA 3DFHA 1M03A 5CSYA 5KEZA 3IRDA 3DX5A 5AC6A 1KBBA 4U10A 4OKDA 3MP4A 3NL2A 3TFXA 1HJXA 3W81A 4MZYA 5JU6A 3MBDA 3JZUA 1A5AA 1OEPA 4XZNX 1YNPA 4MNLA 1WQ5A 1XIDA 3S3GA 3UZYA 3VCNA 2WWDA 2P0IA 3KLKA 3BO9A 1EZWA 3PF3A 3SJ3A 1ZLPA 1CB2A 3RO8A 1CDGA 5LIYX 3FJNA 1N8FA 3E0FA 3LZ3A 4M7TA 4X63A 1XBYA 3V18A 2X40A 1EJVC 7REQB 3TQ0A 1UIOA 3BVJA 3QTGA 3DBNA 4NILA 4URIA 4FHAA 4BI5A 4OIFA 4O14A 1XH0A 4N6FA 4ZZ9A 3N9RA 3FV9A 2DT2A 1GQIA 1SYTA 4X3ZA 4S2BA 5A6SA 1W1PA 4LVGA 3GXPA 2NLIA 4LBSA 5HBFA 4P8UA 3SN1A 1FWJC 1NM9A 1UP0A 4ZOBA 3G1RA 3UR7A 3H2AA 2DSKA 1YQ2A 5AHFA 4LNYA 1TPEA 1GG0A 4UNIA 2UY3A 4QM1A 4RK8A 1UD8A 4UTIA 4OBTA 4UR7A 3PTKA 2A4AA 2C19A 1PX4A 1YW1A 3K2GA 1RQEA 3FA3A 1LDCA 1OC5A 3K1DA 3CJPA 4CU6A 1M04A 3DDMA 2WMFA 3BQ5A 3K4DA 4MWAD 5AHNA 4TTUA 3GDTA 2NQ9A 5HNNA 1FY6A 1WZKA 3OO2A 3EWCA 4PSPA 2X2YA 4UTWC 1DIEA 3SADA 3W70A 5FAJA 1Q6RA 1JCNA 5JXQA 3E0WA 4XD4A 3B0XA 2PFHA 3ARVA 4YTRA 1UWSA 4HNVA 3MUIA 2QVHA 2QCNA 4UZSA 1MXSA 3N2MA 1VPXA 2BY2A 1XYLA 1FH8A 4Z2KA 5ABHA 4QEEA 1OCNA 3UNTA 3IVSA 5CZ0A 1XD1A 5JIWA 4Y90A 4ZE5A 3KW3A 1US2A 2XN1A 1KFWA 4O1CA 5AHIA 3H2EA 5LNSA 1J18A 1MNSA 3BW4A 1X7IA 1HO1A 2J7DA 3L2IA 5F1UA 2ACUA 4GIRA 3L2LA 3TONA 3STCA 1TJRA 3KL0A 1E4LA 3WD2A 2DDXA 3EX1A 1JZ5A 4HA3A 4I8YA 2XVPA 5D09A 4H6EA 4JQ3A 4JTIA 4GRSA 3WF0A 3O6YX 1RJRA 4LAMA 4L4OA 1AL8A 2W0UA 2FVMA 1JPMA 3BOLA 3PG9A 1XM3A 3WMCA 3TA9A 1QPRA 2BY3A 3ABQA 1CGUA 2VMFA 4I7WA 4LYQA 1XLJA