4DELA

Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. tuberculosis
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
publication title Active site loop dynamics of a class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 138
structure length 345
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4delA00
3S5NA 1W0MA 1PS9A 4DPPA 1XDMA 4WY0F 3T4CA 2Z0IA 1XC4A 3C2VA 3ZFHA 3V1PA 1JQXA 3KVMA 1ZAHA 4QNWA 4AWSA 1VS1A 3HGJA 4PCFA 1ME8A 3DZ1A 3NQFA 1O5XA 4RJEA 2AAMA 2FQIA 4UUIA 3ATYA 4AHOA 5KTLA 3G3MA 1SW3A 4P2VA 4AWUA 4JTLA 3WK1A 2OMAA 1DL3A 1XM3A 2DJXA 1T8XA 2G97A 7TIMA 3UWYA 2VEMA 2P1FA 2CLLA 4FNUA 4PC8A 2FDSA 1LP6A 3OHIA 3TK7A 4UTMA 4L4LA 1OX5A 4FX8A 1ZAJA 4DO6A 5HMSA 6TIMA 2QUTA 4GC4A 2R91A 5DELA 3EWZA 2VFFA 3OBKA 2B7QA 4JTTA 4DF1A 1SO4A 1TIMA 3W2UA 1X7FA 3UWUA 2ZRYA 3W88A 1QDSA 1YDOA 2XFWA 4OHQA 1W37A 3UPWA 2J88A 2YFNA 2QUVA 4OBTA 1O94A 4XKYB 5J5RA 1QPOA 1QPNA 4UMAA 1G4TA 1M6JA 2NWSA 3CLMA 2HS6A 1F7BA 1W56A 4JGDA 3W72A 1THFD 4O11A 3NQCA 4WY0A 1KM4A 3USBA 4O1AA 5FEWA 1J4EA 1FQ0A 4OQVA 2CU0A 4ZMGA 1Q6OA 2RHGA 5J5DA 2O7QA 3P7YA 2A7PA 3VE9A 2C0AA 3W70A 3FEMA 1B4KA 4K6AA 3TJXA 5DY3A 3LRMA 4JTUA 5AC7A 4M5PA 1SSDA 2X1TA 3EXRA 3TDFA 2QJHA 3C61A 4MYXA 4MVAA 5AHFA 5CSSA 1YPIA 4O1DA 3OG3A 4ORIA 3G3DA 3O6CA 3R5EA 1K3UA 2VFGA 1B57A 2ZRVA 4EWND 1NVMA 2VFDA 5DY2A 3QZEA 4LVFA 5CPLA 3P5ZA 1YXDA 3W7OA 1FCUA 1I2PA 5D02A 3C2EA 4FNPA 1QPRA 3FOKA 1ZFJA 1ICQA 3CIXA 1GYNA 3L68A 2ZZ4A 2H6RA 3NEVA 3QEZA 4JS3A 4RK8A 4KFOA 5LNRA 3NXFA 3LBCA 1QO5A 3STCA 3L9CA 2WO5A 2YYTA 3THQA 4MJZA 5D05A 1XI3A 4CNPA 3QJAA 1SU5A 4XZ9A 1SZNA 2Z6JA 3NG3A 2XN1A 4S1FA 3Q94A 3O6YX 1K02A 1A50A 1A5AA 5AC8A 3MHUA 3GNNA 3LHYA 1VJIA 2BLEA 1MSSA 1F73A 1UASA 4A3UA 3NQEA 2E5BA 3MMTA 4G1KA 3NM1A 5F1UA 1OYCA 3TR2A 4UTLA 2I14A 2C6QA 3GAYA 1DV7A 2Q8ZA 1DQXA 3LCHA 2B7NA 2NLIA 1VCVA 1L2UA 4CNNA 3TU9A 3B4UA 3P74A 2QCNA 4O15A 4LVBA 3UPBA 1AL8A 1FXQA 4K7VA 3F03K 5G2WA 2OX1A 3E0IA 5D32A 4AB4A 3KAOA 1DKWA 5AYXA 4JTGA 3ABRA 2H3DA 3UWZA 2P0OA 4RXFA 3TV8A 1Z48A 3LGEA 4O16A 2TPSA 3W1PA 3DI1A 1LZOA 1AG1O 2ZZ1A 3WK2A 3B03A 2O7SA 4E38A 3CB8A 1VRDA 4K36A 4HN4A 3GR7A 1PCWA 2E68A 4O1CA 1NFBA 1WDWA 3IV3A 1RV8A 5AHEA 2BX7A 4Y8FA 4DO5A 3W6YA 3QQ0A 4MY9A 5I3IA 3PG8A 4UTTC 3NL6A 1RQHA 2ZRUA 2A2IA 2CZ5A 3LV6A 3A21A 3NL2A 1TV8A 3IIPA 3ABSA 1QMLA 3W1LA 4PEKA 4IXXA 2PRMA 1KLYA 3N9SA 1K8YA 2C13A 2Y63A 3G1AA 2AQWA 3PUDA 1G4SA 1YTKA 1G69A 2DP3A 3QMRA 3M5YA 4L4MA 1TB3A 2V2HA 1MZHA 4GRSA 5LSMA 3UZ5A 2ZZ6A 3LTPA 3N9RA 3NQ6A 2VC6A 3LXAA 4IPIA 4E2DA 4PFMA 3QYQA 5EKYA 2A21A 5HR7A 5E1QA 3SY5A 2QEZA 2YR1A 3THAA 4O0KA 4IMFA 3TW7A 3GNDA 1W5OA 2ZZ7A 1W3TA 2VEIA 2OZ0A 3RNDA 2ABAA 5AYZA 1GTHA 2J9XA 4CLMA 4LC8A 3UD6A 1H1YA 1OFOA 4ZZ9A 1C8VA 3NQ7A 2NUYA 3L67A 4DXVA 1JUKA 3MWAA 4Q4KA 1YADA 2GQ9A 4RZ5A 5CG7A 2CLKA 4AMAA 1K8XA 1OG0A 3A22A 3AO0A 2VFIA 4DF2A 4UTTA 4I7WA 3KX6A 5AYYA 2QDGA 3S1VA 1R2SA 4FNTA 4MLRA 4JX6A 3S5ZA 1IXNA 5I3FA 1OX6A 2V81A 4RZ4A 1GOXA 3L0GA 2J27A 3UWQA 1IGSA 3IGUA 1LOLA 1EIXA 1XUZA 2UV8G 4CNOA 1K7XA 3W75A 3DI0A 3E02A 3QMSA 1TPWA 1FDZA 3W2KA 4WXYA 5AOUA 4OT7A 5A8GA 1AW2A 3EEGA 1OK6A 5SWUA 3LHWA 4JTHA 5DBTA 2EKCA 4UTHA 2C19A 2GPTA 1TPUA 2WSYA 3BV4A 1CW2A 1TRDA 5CPNA 5FF0A 4D2JA 2X1UA 3W7HA 1TPFA 4QJ1A 4XTDA 4LU0A 4NJIA 3W3OA 3W7EA 1GEQA 3BW4A 4XKYA 2ISSA 3W7GA 4NNBA 3L5LA 3IGXA 5D33A 5GVJA 3HMJG 3LXCA 3NPUA 3TCEA 3S1XA 3W74A 6ALDA 2NV1A 3L65A 2NV2A 2TYSA 4NJGA 4WOQA 1QOPA 3LOTA 4MPQA 3NQGA 3PBVA 2E6FA 3MI3A 3QF0A 3W2NA 3C56A 3OVRA 2E5DA 4O28A 4LRTA 2ATSA 4FNSA 2E6DA 1AK5A 4UNLA 3ZS4A 2GJLA 3TIMA 3UQNA 2IQTA 3HPXA 3W7DA 4GFSA 4A2RA 5IBXC 3QPZA 2WSRA 1MXSA 5D37A 2ZCGA 4JX5A 1SFJA 1TPB1 4Z1BA 3MI2A 4NU7A 4GUIA 2Y88A 4LUJA 1UJPA 1YYAA 3QW4B 3MO7A 3ZWSA 3BVJA 3L5AA 4LT9A 1O60A 2JKAA 1P0KA 3A5FA 3HPZA 3I7SA 3O63A 1A5SA 1WX0A 2CZFA 3GDTA 5AFDA 4IOTA 3QSTA 3S1UA 3GDRA 4MJMA 3PG9A 4LS2A 3G1SA 3PAJA 1Z42A 2RKXA 3NAVA 3PB2A 3PSWA 4N9BA 3WFAA 4YCOA 1KFEA 2Q3OA 1P4CA 5EL1A 1YTDA 4Y90A 2DZTA 4GE8A 3P67A 1B9BA 3NOEA 3NVTA 3A5VA 1NEYA 3NQ8A 4IMDA 1LRNA 2RFGA 3W1UA 1LDCA 4DBEA 2V0TA 4A29A 3FIGA 1P0NA 4GJ1A 2QDHA 3LCXA 4LVDA 5LZLA 3FJLA 1J5TA 2V9DA 1FWSA 4TU1A 5IBXA 2R94A 4JN6A 4OU1A 3TXZA 3ABOA 1LOSA 3W22A 3LHZA 3N34A 4BI6A 4IMEA 1TV7A 4PL2A 1KM6A 1JUBA 1H7RA 2ZZ3A 4YL2A 2WJZA 2NUWA 3KVLA 1OFQA 3W83A 5KITA 3F1QA 1LBLA 4LV9A 5FEXA 5AHLA 3KVJA 1H60A 4DELA 4Z0JA 4MY1A 3O6DA 5K4ZA 4FNQA 3BLFA 3LLDA 3HJZA 5BNKA 2V5LA 4FEZA 5LKYA 2J9YA 4UTIA 3B05A 4I7VA 4ZQCA 1Q6QA 1LOQA 3DENA 1ME7A 2QCCA 4KFNA 4UTKA 5HULA 1YXYA 5DXYA 4DO4A 4YXGA 2NUXA 3SSJA 1YLVA 2QCLA 1LRQA 2QF7A 3LDVA 5LNVA 3BG5A 1Q6RA 1QFEA 1VZWA 1VLIA 4ADTA 4HIBA 1V5XA 4O0ZA 1EPXA 3GR8A 3L5MA 1W5PA 1M7OA 4TR9A 3NL5A 1TYGA 4NX0A 1VHNA 3B0VC 1WV2A 1GYLA 3BW2A 4AAJA 1OYAA 3LTSA 4UFLA 5MHBA 3HG2A 4XUGA 2CLIA 1GPWA 4PTNA 4GBUA 3SGZA 3BG9A 2ZRXA 5LGXA 3QSRA 1YPFA 2QKFA 4OV4A 3W84A 2FB3A 1ONRA 3C3NA 3O07A 3UY8A 3BG3A 3LHVA 1VR6A 3W7LA 1JRBA 3S5YA 4M6PA 2ISWA 1F2JA 1C29A 2VEKA 3P8JA 4MZ8A 4PODA 5K2ZA 3ELFA 2VKZG 1WBHA 4A21A 4O13A 3VE7A 2A7RA 3G8RA 4HNTA 2OJPA 5EPDA 4IXHA 3LCLA 1VYSX 4ALDA 3BGJA 1VQTA 3W1NA 1CI1A 3DHDA 2YGYA 4LS0A 5U4NA 1YDVA 3N2MA 1YDNA 3FA5A 5KINA 1FX6A 1IXPA 3IVTA 1TO3A 3GXPA 2ZRWA 5DCBA 3W2LA 2CLHA 2CZDA 3W7RA 1ADOA 1UCWA 3ZWTA 2QUUA 4DBDA 1I2OA 3S1WA 4TO8A 4Y96A 2DZSA 1TJPA 3NQMA 2R14A 3G0UA 1GTEA 3GB6A 4GXMA 3EKLA 1RR2A 1O95A 1Q6LA 4HSOA 3TA6A 2RDTA 3HF3A 1B3OA 1EWEA 3MP3A 2B7PA 3CIWA 3GDMA 4JXCA 1QAPA 4IX0A 1I2NA 2OCZA 3LBMA 5CPOA 1SW7A 1TV5A 4IMCA 5C5YA 1VHCA 1VYRA 4OWGA 2Y6ZA 3IGSA 3B06A 1OX4A 3DU0A 1FXPA 1MEIA 3ABQA 1H5YA 2NXGA 2CLEA 4JIQA 1OHLA 3DBPA 4MYAA 4HHPA 1Z41A 4UFHA 1NF7A 1LYXA 2WKJA 4P61A 4LVAA 1F74A 3W9ZA 1LM1A 3RLUA 3T40A 4YCPA 1H51A 1QCWA 2DORA 2G5WA 5HWJA 1AL7A 1GVSA 4LS1A 2DU2A 3W2JA 2QCMA 1TSIA 4S2BA 5H91A 5TQLA 4FHAA 2WNQA 4FIQA 2JKPA 2Y7EA 3GDKA 2RDWA 3A24A 4PL1A 3IIXA 2QCDB 3W7NA 1P1XA 1ZJIA 3WJWA 3O1NA 4JNMA 4UMCA 1TQXA 3W7IA 3C8FA 2B4GA 4JX4A 1GVRA 1XCFA 3TFCA 3KOFA 4JY8A 4A22A 2Z1BA 5DBUA 4LTSA 2ABBA 4NZFA 1HL2A 1BTMA 5LHEA 3DKLA 5BOOA 3E96A 4LWWA 2VELA 2ZA3A 4EOUA 3LXBA 3GLCA 1ME9A 3UYCA 2BWGA 2VFEA 5F2MA 3SECA 3TKFA 4Z1CA 5D30A 3W2MA 1L6YA 2QCHA 3KFTA 4ML9A 3GVGA 3LI0A 4IUOA 3TMLA 5CZTA 2AGKA 2A4AA 5HINA 3U8GA 2PE4A 1T0OA 1ZCOA 5U7SA 3NQAA 1W3IA 3I6RA 1TPVA 5K3VA 4M7SA 4JTEA 1RQEA 3UZJA 3HGRA 1H7PA 1SUXA 1MO0A 4S2CA 3DHFA 1R2TA 1S5VA 3SW6A 2FFCA 3U6WA 3CEPA 3M7WA 4YLWA 4H4IA 3TFXA 1I45A 1SPQA 1OF8A 5BW6A 4N6EA 1DHPA 2VOMA 3TC6A 3FLUA 3N19B 2ZZ5A 3DFTA 4FO4A 4UFKA 1AW5A 3DFOA 4BR1A 1FCBA 1W8SA 2EPHA 3C2OA 1RQBA 4GUJA 2Y62A 1FUYA 1ZHAA 1A5CA 3NZ1A 1SZFA 1JRCA 2GOUA 3TNOA 4TIMA 1JCXA 3NDOA 3NYZA 3O06A 3OVQA 2ZTJA 4WQ6A 5G1YA 3FYPA 4POCA 3LI1A 1U83A 3QRHA 2EHHA 3NNTA 3IIVA 1SO5A 5DCEA 1DORA 1L9WA 4NNAA 3PB0A 1WBJA 1H7WA 3BPWA 5F2GA 3GAKA 3TQ0A 1GT8A 1LLZA 3PBWA 3TROA 3KRSA 3H55A 3QPYA 1K03A 2FPVA 3HB9A 3LRKA 1KV8A 3IVUA 1G7UA 4CCCA 1OJXA 2WQPA 2GQ8A 3W7MA 1N8FA 4HNUA 3M1ZA 1A53A 1SO6A 4UR7A 3LCWA 3LRLA 4O8RA 1XFBA 4WX2A 3T78A 3JR2A 3LB0A 3M0ZA 1P5BA 1Z44A 2ZZ2A 3T7VA 2YDAA 4IWWA 4JY9A 3W1QA 3LX9A 2NZLA 1R2RA 3EWUA 2PCQA 1I2QA 3IEBA 4WJEA 2HSAA 1GVQA 5D04C 3NPVA 2W0UA 1G7VA 4KKXA 3P81A 4NJJA 4XQ6A 3MW7A 2YSWA 4QM1A 4EF9A 4N4PA 5FF3A 4QIUA 3PULA 1H61A 3ATZA 2CFFA 4QAIA 3HO8A 3WJXA 3BK0A 4QSHA 1HO1A 2NWRA 4UNKA 1FY6A 4DPQA 1FCQA 1S3HA 2C1HA 5HNRA 3WK0A 3BGGA 1T99A 1F76A 3WK3A 4LOCA 2G96A 3W1TA 4HSNA 1ZNNA 4BWLC 3QFEA 2HS8A 3CC1A 3P5YA 4Z1AA 3B0UX 2OT0A 3CTLA 1LLWA 1WA3A 4Z08A 1DJNA 3SGUA 5LHFA 3P84A 2H90A 2WV8A 1IIGA 4M6VA 2ZFAA 2YXGA 2QCFA 5DXXA 1U5JA 4UMBA 3TH6A 1K7EA 1X1OA 3TX9A 3UY7A 2XN0A 3N3MA 3F4WA 2WPBA 4KWVA 4NZJA 3PY2A 3M6YA 4O14A 5LGZA 2DJLA 4FNRA 3YPIA 3S8HA 5IM51 1NAL1 2WOQA 5D38A 1TTJA 3FKRA 3NPWA 3UWVA 2G95A 1W54A 3MBFA 1QOQA 3G8EA 4O19A 3T55A 4B5NA 2J24A 1TMHA 2JGYA 1TPEA 1ML1A 3IVSA 1HG3A 4HPXA 1F05A 3E49A 2TSYA 2HTMA 2Z6IA 1GG0A 4LNYA 2Y7DA 5CZSA 1DQWA 1KM3A 1VCFA 3MUXA 1L6SA 2TMDA 2TRSA 1ZALA 4LV4A 1CX9A 3EX4A 4MUZA 5E0KA 3L0KA 4BWLA 1D3GA 1LCOA 4X2RA 4BF9A 3SFKA 4U4MA 2FIQA 4NJKA 4WZHA 5K7JA 1JVNA 5HUPA 4JTFA 4O52A 2ISVA 4OE7A 2E09A 4O50A 4JYDA 4NJHA 1GWJA 1IXQA 4FIRA 1JULA 2E6AA 4MFEA 4MZ1A 4KWWA 4NT0A 3RFAA 1SSGA 4HT3A 2PRHA 3HIJA 4LC6A 4K39A 4MZYA 4M6QA 4N2YA 2QCDA 2DZPA 5G4WA 2CZEA 3OVPA 1QPQA 2ZA2A 1DVJA 2A5HA 4YWIA 4CQ9A 2V2DA 5G2IA 1KLZA 3W1AA 4LRSA 4Q33A 3W71A 1C9DA 2D73A 4DQWA 1KBJA 1TTIA 3G1FA 1IF2A 3G24A 1PE1A 4UC5A 3CHVA 3NL3A 3SJ3A 2Y61A 1LBMA 1I2RA 1W1ZA 4CCDA 2Y89A 4LY8A 1E51A 3NQDA 3C2FA 4N6FA 1DBTA 3NZRA 4UTUA 1EB3A 2A6LA 3MP5A 4OV9A 3MBDA 3NM3A 2RDUA 3MI6A 1HO4A 4JTJA 4WXZA 3PWAA 4FF7A 4I7UA 3STGA 3D0CA 3L66A 1KFJA 1QO2A 3LCGA 3EB2A 3M16A 1W3NA 2ZTKA 1XKYA 1TRIA 1M7PA 3NQ2A 4QISA 4K8EA 3W23A 2PRLA 1JCYA 2C3ZA 5D2TA 2NXHA 1ZY9A 5HUOA 4DF0A 1D3HA 3H53A 1ZENA 5EYWA 5F4SA 3G1HA 1UUMA 2BZNA 2A6NA 4UIOA 3CWNA 1YXCA 3IIOA 1KFKA 2GQAA 3KRZA 1RVGA 1V7YA 1PV8A 5G4EA 1TPH1 3PBUA 1WAUA 1XXXA 2Y7FA 3WJSA 2YYUA 2VENA 4MFDA 3EXTA 4R34A 5FEPA 3AJXA 3N2XA 1VYPX 3BARA 4C1KA 5E93A 4JDBA 1KFLA 2NX3A 3S42A 2YW3A 3Q2DA 4NVTA 4IX2A 4N9DA 3TMQA 2YPIA 1EUNA 4Q32A 3G18A 1FCVA 2Y85A 3KHJA 1FBAA 1PIIA 3NA8A 3N73A 4JTSA 2Q8LA 4E0CA 2DZWA 3FYOA 3I68A 3PF3A 1X1ZA 1JR1A 3S6DA 4H6KA 3QMTA 2X16A 4ZQPA 3RF9A 3P62A 4Y9AA 5T26A 3DKJA 3UNDA 3R13A 2C15A 3PC0A 2X1RA 3TQVA 3TXVA 1KM0A 3DFQA 5KZDA 1VLWA 1ALDA 1IIHA 4UR8A 3Q58A 5I3JA 5KZEA 1FWNA 3Q37A 2JBMA 1YTEA 3G22A 4JEQA 5D2XA 4O54A 4UXDA 2F7FA 5D09A 4A2SA 1BWLA 1B4EA 5L9FA 2ALDA 5G5IA 1XBVA 4ADUA 4JD4A 5HQEA 2X2GA 1TREA 1XBXA 3IRDA 4JDYA 4MIMA 1JQVA 4IGHA 1X8FA 1K7FA 2E77A 2GUUA 2NX1A 5EY5A 3STEA 2R8WA 3W76A 4BI7A 3R8RA 4ZVJA 3KXQA 3DGRA 2W6RA 4EIVA 5G1TA 1AW1A 4JICA 5LNSA 2J6XA 5H2ZA 3MP4A 1F6KA 3GYEA 4MOZA 3M5VA 4DEFA 5F4WA 3QM3A 4K7YA 3CEUA 1VH7A 3M43A 4WUIA 1GQNA 5K4XA 2YZRA 4PH6A 4ICNA 3WJYA 1OFDA 3BLEA 1HFBA 3TQKA 3PS7A 3TUUA 4W9TA 4MKNA 1VGAA 2XN2A 5C55A 3W7JA 1H7NA 2FPTA 3LCIA 5K9XA 3TSDA 5BRBA 1I4NA 1W5MA 3CU2A 2A1YA 4NQ1A 3I7RA 4KFPA 3G0SA 3HGSA 1EA0A 3EX3A 3CPRA 5F2IA 3JS3A 2H3BA 4AXKA 5FF4A 1UUOA 1WQ5A 2V8ZA 5K9DA 3TSMA 4O18A 3NPXA 4AWTA 3PUEA 2Y70A 1OK4A 3LTYA 3CT7A 2GVLA 1SQ7A 4ZQNA 4AH7A 3PVFA 5LNWA 2ZRZA 1X6UA 4O4WA 3WJZA 2YFOA 1GJPA 1PVNA 4UFMA 4JIPA 3DFSA 1SZGA 4X22A 1KTNA 2FPYA 3OA3A 3UWWA 3P8IA 1Q45A 3C6CA 1T96A 1FWRA 2NXIA 1RZMA 4IQLA 4XTIA 3K30A 5EMUA 4OGZA 3B0PA 3EWWA 4FXSA 1TPC1 1KW1A 2V5BA 4RLIA 2QJIA 1EP2A 3EWXA 2GVJA 5AB3A 2HMCA 1L6WA 4JTKA 1VPXA 5FESA 2OT1A 1PL9A 1LTDA 2H8XA 4UFIA 3NO5A 3G1YA 3TC7A 1VCGA 2I1OA 5F2LA 5DN1A 3PUOA 4O17A 2FTPA 1H50A 3QC3A 4O1BA 5HWNA 1RPXA 3P61A 3VCRA 3E12A 3U2OA 1BEUA 2DZXA 3HGOA 5AHNA 4R53A 3W85A 3P80A 3W07A 3H54A 5DCDA 2ZQ0A 1EUAA 1JUEA 2CLFA 2FLIA 2Z2UA 1FDYA 1A5BA 1IXOA 3EKZA 3G1VA 1ICSA 4O12A 2A85A 4MLJA 4WD0A 1R47A 4WOZA 5CZ0A 1XL9A 3HPSA 2JK2A 4CQAA 3FFSA 3W1MA 3B04A 1SFLA 1WYIA 5KZMA 2ATMA 4QNEA 5L6UA 4RKAA 1TQJA 2GJNA 3HBLA 3V75A 5C2XA 3S9YA 2E6YA 3NGJA 2WNZA 5ABTA 4AF0B 2QCEA 2QJGA 1RD5A 4K37A 2QCGA 3GIYA 4O57A 1BWKA 3STFA 1OVDA 4GWEA 3C4UA 5AHMA 5I3GA 2PC4A 1PHQA 4UTWC 1MEWA 4MY8A 3PSVA 4EVZA 1G67A 3GXNA 3A9IA 3DAQA 1GG1A 1W5NA 4ONVA 1LBFA 5AC6A 1EX5A 3UXDA 1BKSA 3F4NA 3NR0A 4JR5A 1SO3A 1Y0EA 1OFBA 2C16A 4GUHA 3O05A 4N4QA 3EX2A 5KSWA 5FEZA 4RX0A 4NX5A 1PHWA 1EP1A 1N55A 4LW7A 2ZDRA 2H8ZA 2GVGA 3LLFA 4UCGA 3W7PA 3W1RA 1M5WA 1TTPA 1WOBA 3EWBX 3OEXA 3TE9A 5FF2A 3S0CA 4ZL1A 3ANYA 3PBYA 5C54A 3NQVA 1DJQA 1KM1A 2J9ZA 5G2HA 3BW3A 3MHFA 4PA8A 1H7OA 3MYOA 3I65A 3VFLA 4O10A 4K38A 4FB7A 1XDLA 3W7QA 5TIMA 1AMKA 5FF7A 3C52A 3DH7A 5F1VA 2C14A 1KBIA 3LERA 1GZGA 4M7TA 4FXRA 2B7OA 4R33A 1JCJA 1K8ZA 4QITA 3QW3A 4XBSA 1KM2A 3TAKA 2QR6A 3VKJA 1HUVA 2ZYFA 4UTWA 2Q3RA 3DFPA 4GUGA 2W79A 3E9AA 3LHTA 4N9CA 1LRTA 3W87A 3MYPA 2A7NA 3A23A 1XUUA 5HJLA 1LROA 5BMXA 5CGQA 4EF8A 3BO9A 3S5OA 4LUIA 2EF9A 3C0JA 1DOSA 1FWWA 2EAWA 3HQ1A 3L21A 3TJLA 1R30A 3SI9A 2QAFA 3LCFA 4CCEA 1XBYA 3M5XA 1KM5A 1NSJA 3FJ6A 4RR4A 3SIZA 2NX9A 4NUWA 2I9EA 4AVFA 4IMGA 4WY0B 3M41A 3FKKA 5D2VA 1JCMP 2YW4A 4O4VA 2FB2A 3SZ8A 2WSQA 5FI8A 2X30A 4TX9A 4JTIA 3M9YA 2DZUA 2BTMA 4BFAA 1KFCA 1H7XA 4AEOA 1EP3A 1G4EA 4M19A 4K8HA 1MEHA 1OX4B 4ZQMA 5EBUA 4BI5A 4RCXA 4GNJA 4ADSA 3L0NA 4XWUA 4ZQOA 3W7KA 2CLOA 1KA9F 2KZHA 3B8DA 1F5ZA 1WXJA 5EA9A 2E1DA 3N14A 1KV5A 4NXKA 4Z1DA 5TBOA 4HPJA 4HNNA 4BK9A 3CM4A 1D9EA 2CW6A 2ZBTA 4IPJA 3GKAA 4HNVA 3BLIA 2DZVA 3GZ3A 4JYFA 1S5TA 5D03A 3VI2A 4RV8A 1S5WA 3O15A 2VFHA 1QWGA 3UXAA 1FWTA 4RXGA 1VC4A 2RH9A 4YMZA 4C1LA 4IJBA 2EGZA 1W5QA 3EX1A 3G1DA 3G0XA 2BSLA 3VNDA 1N7KA 3GX9A 2E5CA 2Y7GA 5CKSA 4Z0SA 3W1XA 3RMJA 3TSBA 1NF0A 2ZA1A 1OFAA 1ICPA 1TPDA 2P10A 3LHUA 5BMWA 1O5KA 2CWNA 1OFPA 2WNNA 4X9SA 3W7CA 3W86A 5C6MA 2YX0A 4O53A 5I3KA 1UBSA 5K9CA 1G6CA 4NNCA 4RZ6A 8TIMA 3HOJA 1TCDA 1WOAA 3JRKA 1SW0A 5CZJA 3P82A 5LNUA 3SR7A 3MJYA 4FX7A 3RK8A 3T44A 2QAPA 4X3ZA 3OIXA 3INPA 4XBKA 1H1ZA 3DFNA 1JJKA 3GXTA 5AHIA 3EWYA 2C18A 4TMBA 3IIZA 4CQ8A 1FDJA 1J2WA 1JCNA 3DXIA 1LORA 3R89A 1HTIA 3R12A 2VEPA 4E2BA 3G1XA 2A0NA 1JCLA 3LM7A 2BXVA 1QR7A 4U28A 1GVFA 3FS2A 4HKPA 4JYEA 1F6PA 4ORMA 1G4PA 3C2RA 2V2CA 4N02A 4Y6GA 2YCEA 5DLCA 1OFRA 1O4UA 1OYBA 1OFEA 3GKFA 3TAOA 1KFBA 4UTJA 5I3HA 2VXNA 4R7JA 1OF6A 4J9JA 3HG4A 3L2IA 3HG3A 5A5WA 4LVGA 1H63A 4H3DA 1SR9A 3M5ZA 4N9EA 1ZAIA 2V30A 2LLEA 5D2WA 4AHPA 3RU6A 3GK0A 3CWOX 3LV5A 3ZR4A 1OABA 1SZEA 1I8JA 4I9AA 5KMYA 4FX6M 2PURA 3P60A 1Q3NA 1PCKA 3O8AA 2CLMA 3KRUA 1TTQA 1QNVA 2JKEA 4ZQRA 5D2YA 1KTCA 2X1SA 4UFJA 3MHGA 5HR6A 2JGQA 2V82A 1EEPA 3KVKA 4AF0A 5AN7A 1KTBA 3PR2A 4GUFA 3O16A 3QQ1A 4NXSA 3CQ0A 1R46A 3EXSA 1XBZA 5CPMA 3I7QA 4AHQA 3M47A 5HWMA 4TMCA 1UB3A 1H62A 2B0MA 3TW6A 3W73A 2F84A 5CSRA 3PM6A 4QQ3A 1GVOA 1TJRA 3HG5A 3RLVA 1W31A 3M44A 2FJKA 1EWDA 3GDLA 3EX6A 3R2GA 5F4XA 3QH2A
chains in the Genus database with same CATH superfamily
2VRJA 3QZAA 1PS9A 2GYIA 4WY0F 3OOQA 3CL7A 3C2VA 3ZFHA 1EF2A 1JQXA 1XLDA 4GQGA 1FWGC 2CITA 3K8KA 3TTEA 1O5XA 4RJEA 3BXWA 3T42A 3KTSA 2R6OA 4AWUA 2OGYA 1UG6A 2DJXA 5JBFA 4L65A 2P1FA 2GVEA 4AIBA 3VDHA 1LP6A 3OHIA 1HN1A 4KESA 4UTMA 1CGVA 1OX5A 4FX8A 4R88A 1ZAJA 4DO6A 1EHNA 2A3LA 3WNKA 1XLFA 3W82A 3R79A 1RLCL 3GNPA 2UY5A 1OT2A 4DBSA 2VFFA 3VNZA 4S38A 5EMYA 1QDSA 1YDOA 2XFWA 4DZAA 3AIQA 3K4AA 2J88A 5I23A 4J40A 2G37A 2XFRA 4XKYB 2XIJA 1UZDA 2NWSA 4E2OA 4GVHA 3BLOA 5CCZA 1W56A 1TWDA 4F2UA 3W6LA 2I16A 2X0HA 1EZWA 4WY0A 5FL1A 3PNUA 3WFLA 1W91A 1FQ0A 4OQVA 2CU0A 3MCMA 3BDKA 3VE9A 3W70A 1V3MA 4P7QA 1I60A 3LRMA 5AC7A 3LNMA 5BRPA 3MUCA 3O6CA 2VFGA 1B57A 1KBLA 1RK5A 5DY2A 5DMNA 3BOLA 3QZEA 3REQA 4C6DA 4G9PA 1R9XA 3NQBA 1LQAA 5D02A 4NI8A 1QPRA 3FOKA 1OADA 3GUGA 2ZUWA 1ICQA 3CIXA 3L68A 4E6MA 4W7UA 2DQWA 2NVDA 4V15A 4RK8A 1AMYA 4JIIX 5LNRA 1V93A 2WO5A 2BVYA 5D9PA 1Y8BA 3M4HA 1SU5A 4XZ9A 2BS9A 4DJDD 3NG3A 2ZXDA 2BOEX 3Q94A 4HU8A 2ZX9A 1FWDC 2V67A 1S5MA 1ESWA 1A5AA 3PPCA 4YYFA 5EMMA 3LHYA 3BUVA 3AHYA 1EX1A 1NP0A 1UASA 4A3UA 3NQEA 3MMTA 6XIMA 5A2CA 3AU6A 3FGCB 3GAYA 1DTNA 2Q8ZA 3LCHA 1VCVA 4EAYA 4LVBA 1M03A 4GOAA 1FXQA 5D32A 3MT1A 4IJCA 1J0HA 4JTGA 4XO6A 3OZOA 4XVDA 3TV8A 1Z48A 4RNHA 2WAGA 4XZLX 4O16A 3GG8A 3SN1A 3ARQA 1LL6A 5HDRA 2DSWA 5IXEA 3GHUA 4S3JA 4QCEA 2JIEA 1SYTA 1PCWA 1WDWA 1RV8A 3ZSTA 3UG5A 3WLIA 2J7GA 4HMDA 2ZOXA 5I3IA 3CV6A 1UOZA 2X40A 1RQHA 2CXGA 2ZRUA 3WBXA 2A2IA 2CZ5A 2DSZA 3LV6A 3NL2A 4IZGA 4W7VA 4PZVA 1QMLA 1US3A 1LL4A 5CGMA 4GYPC 3PUDA 1YTKA 3BCDA 4KCVA 3QMRA 4NAFB 5LSMA 3WLOA 3CZLA 3LTPA 1IQ8A 4I90A 4KETA 4BEUA 3VNMA 2NQLA 1ITCA 3SM0A 2HRWA 5CLWA 1Q8AA 4JN8A 4C90A 3GNDA 3QFWA 1KB3A 4PGLA 3RNDA 2ABAA 1XIDA 1GTHA 2EPMX 1CIUA 3V5CA 1IE7C 2VO5A 1W2PA 3NVDA 1QI3A 2WSPA 5CG7A 4Q4KA 1JIBA 1JF6A 2GQ9A 2CLKA 1F9CA 1OG0A 5G4HC 3A22A 4LUSB 3M0XA 2GSJA 3C0SA 2XZ7A 2I5GA 2GZXA 4MB3A 2D2GA 4RZ4A 4PMQA 1H5VA 3AXXA 1GOXA 2EKGA 1JAEA 3UWQA 3MU7A 4BZYA 4TTUA 3F5JA 3RYSA 1WDSA 1FDZA 3W2KA 4NAEB 5A8GA 4GYJA 3UU0A 3T0DA 4W5UA 1JPDX 3EEGA 1XYZA 4HNCA 5DBTA 4YS1A 2EKCA 2QPSA 4UTHA 1TPUA 2Y2WA 4F0KA 1TRDA 1XHGA 3AS2A 2X1UA 3W7HA 3AI0A 1TPFA 2QXWA 2W62A 1GEQA 4XKYA 2CLPA 2P3EA 1AZ1A 2F61A 3D5HA 5AC5A 3IGXA 1B5TA 3CNYA 5JIWA 2NV1A 3L65A 2NV2A 5AKQA 3U2EA 1C93A 2TYSA 5C9WA 4C7GA 1QOPA 4H9YA 3NQGA 2IKIA 1MDRA 4RPQA 4FNSA 1LG2A 2F9RA 1AK5A 2GJLA 1FKXA 3H4WA 3T0TA 3HPXA 3QPZA 2WSRA 5FJOA 1MXSA 4JX5A 3WEMA 3U9IA 2D2HA 1QWKA 2NV9A 2OLSA 5DT7A 3MI2A 3N4EA 2Y88A 4LUJA 4IF2A 2G0WA 4W8AA 3OYXA 2CYGA 3QPEA 3L5AA 1P0KA 4H9UA 3HPZA 1VKFA 2YCJA 1A5SA 4Q4OA 1KCXA 3S1UA 2VQUA 4QG6A 3V1HA 4KEUA 3KS6A 4LS2A 4MGGA 5CJNA 3NAVA 3PB2A 2RJGA 5T9BG 4GVGA 3WZ0E 4YCOA 1KFEA 2OEKA 1Q85A 1P4CA 3GVVA 1O5RA 3G6MA 1BRLB 4A6GA 1BD0A 4CD7A 2WCSA 3AYTA 3W1UA 3DHUA 3UETA 3AZSA 1P0NA 4F0LA 4QDWA 4LVDA 2ESCA 1J5TA 1HZYA 3TXZA 7ODCA 3FGCA 1MRQA 3DFHA 2V5DA 3NSXA 3QN3A 1I9CB 3VFCA 2WJZA 3SURA 3CPUA 5KITA 1LBLA 3GNXA 2OQYA 3KVJA 1JD7A 1SFTA 4MY1A 3BL3A 3HJZA 5BNKA 2F6XA 2BGSA 4DVOA 2J9YA 4LAOA 4UTIA 3B05A 4I7VA 1Q6QA 3VABA 1ME7A 2QCCA 5HULA 1JI2A 4H6RA 4ZO6A 4L4PA 1YXYA 5DXYA 2WVUA 2NUXA 1CEOA 3PZQA 1IZKA 1PKNA 1Q13A 4GI8A 1NQ6A 3WCZA 1BQCA 4QE4A 1V5XA 4O0ZA 1M7OA 2OR2A 1HT6A 4TR9A 4NX0A 4GKTA 4X60A 1VHNA 1CTNA 2P8BA 1GYLA 1MW0A 4AAJA 1OYAA 2G50A 4NAFA 5MHBA 1ZBKA 4M6UA 2PDXA 2PA6A 2PGFA 4PTNA 5JIPA 4GBUA 3QSRA 1GQKA 1PTGA 5JBEA 1T40A 3O07A 3BG3A 3S5YA 3RIKA 2WZTA 1F2JA 4D6FA 4AUBA 1JZ4A 4PODA 5K2ZA 3ELFA 5CAKA 4B16A 1WBHA 3ARZA 2W4XA 2NSXA 4O13A 1RP9A 2A7RA 4MPKA 4PMRA 5EPDA 1Q6DA 2BY3A 3EA1A 2BP1A 1BAGA 2OKTA 4LUSA 3BGJA 4OECA 4W93A 1CI1A 4JQ2A 4ZENA 2WJDA 5U4NA 1YDVA 3N2MA 3FA5A 2WHJA 4PCNA 4XD4A 2XGZA 1RP8A 3W7RA 3KWSA 4HB7A 1UCWA 3BTNA 2DIEA 1UOKA 4AMCA 2G3NA 3PZMA 2QUUA 1W9UA 4RNFA 4X9YA 4Q8OA 3KWXA 4Y96A 3QY7A 2GUYA 1GTEA 1R7AA 3EKLA 4HSOA 4NAEA 4Q4PA 1DWAM 1QNRA 1EWEA 3MP3A 3GDMA 3A4AA 1QAPA 4NZCA 5A8PA 4IX0A 2OCZA 5BU9A 3LBMA 3L4VA 4MWAD 3KP0A 2BHZA 3S1GA 1TV5A 2RGLA 4FLQA 1B54A 2O56A 3MMWA 1VHCA 4QLKA 4E8GA 4QDPA 3SUTA 2E8ZA 4HTYA 1OX4A 1SGJA 3GE7A 1FXPA 3SRHA 9XIAA 3HPFA 3DC8A 4S3CA 2CLEA 4ZODA 1XGEA 4JIQA 4CN6A 2XGIA 1EKOA 3TN3A 1LYXA 1GOQA 1F74A 1DP0A 3RLUA 1J18A 4EPKA 1LQ0A 1CXIA 4XAGA 1O5QA 4FR1A 1QCWA 1N2VA 4ZGYA 1GVSA 2DU2A 1A5OC 3ONCA 3KBNA 1TSIA 1KXHA 3EA2A 5H91A 5TQLA 4JKLA 2OYLA 4HBKA 2QCDB 1ZJIA 2C8NA 3W7IA 1SJBA 4RE2A 1T8QA 2A79A 1GVRA 3TFCA 1A5KC 3KOFA 1GVIA 4OUIA 3IJLA 2ABBA 3SRKA 2OGJA 4DUXA 4C6CA 4D6HA 3WQ4A 1HKIA 1RY8A 1XYMA 1ME9A 1TKKA 2VFEA 2GWGA 2WW5A 2ZE3A 3SECA 2ASHA 5D30A 3VOCA 4L80A 3W2MA 1L6YA 4ML9A 3WDIA 1G01A 3IJQA 3EPOA 4DUOA 3VK5A 5CZTA 2VYOA 1D8WA 2A4AA 2PE4A 3N15A 3CV1A 1N8IA 4B3ZA 1ZCOA 5U7SA 3VGEA 1W3IA 3I6RA 5DO8A 3H2FA 3W27A 5ECUA 1MQQA 1H7PA 1BPLB 3VPLA 1F8IA 2EPKX 4GX9A 3CEPA 1BRLA 3MO4A 4H4IA 3TFXA 4AZCB 2WLYA 4PB3A 1SPQA 4N6EA 3ZYZA 1EDQA 2XIOA 4I5UA 1DHPA 2VOMA 3TC6A 5A8MA 4KMQA 5E6YA 1A47A 4US5A 2GVYA 1AW5A 1EJ7L 1W8SA 2EPHA 3C2OA 3VIPA 2Y62A 5I24A 1A5CA 4V1XA 2EPOA 4AZIA 3TNOA 3I6TA 3T4WA 4UNIA 3R94A 5CPQA 4XAYA 4LALA 1IWBA 3OVQA 4HNOA 4UQ9A 3QRHA 1U83A 3Q45A 3IIVA 1U22A 4J7RA 1H7WA 4M29A 1R3RA 3DYMA 1GT8A 3WSUA 2GGIA 1JZ7A 3PBWA 4DM2A 1K6WA 3H55A 1AJ2A 2ZKMX 2WMHA 5CBIA 4L9XA 1C8YA 3DX5A 4TVUA 3VZXA 1N8FA 2WBKA 2YCKX 3WH8A 1UW9A 4UR7A 5D8ZA 2QIIA 3DESA 2W92A 3WD1A 3BC9A 4C6BA 4EE9A 3CAVA 4RE0A 4WX2A 4XSLA 3LB0A 4HYWA 3WF0A 3MSRA 5FAGA 1Z44A 1ONXA 2YDAA 4JY9A 4KCUA 4KRUA 1IT8A 2VTFA 3ZO9A 4WJEA 1NTHA 4ZR8A 1JPKA 1XSJA 4XB3A 4KKXA 3ARPA 1UD2A 3JZUA 3MW7A 3LPFA 2YSWA 3OODA 6TAAA 4N7QA 4DWSB 3ATZA 3F4DA 4H7ZA 3BK0A 3GHTA 2E67A 1TUXA 3TQPA 3BGGA 1HJQA 1T99A 4DB7A 1WZLA 1E3ZA 2G96A 3E0WA 1B3YA 1B2YA 5BXRA 4BWLC 3QFEA 2HNHA 1WA3A 3SGUA 4AC7C 1U5HA 4EPDC 2PWDA 3UERA 2YXGA 2JF7A 5DXXA 1U5JA 4HMNA 4JTCA 1B31A 2NVCA 3BCFA 4DYKA 1FH9A 3L4ZA 3EOEA 4QP0A 1V8EA 1GKQA 1S46A 4D1IA 2INEA 4U31A 4TVDA 3ZVHB 2Y1HA 2E9BA 1DYSA 1W9XA 2WC4A 3CQIA 3SGGA 2P76A 3UWVA 4YHEA 3CV2A 1E55A 4PUDA 1XDJA 1GKPA 2XSAA 3L4YA 2JGYA 4DWDA 1XCWA 3LN3A 4H41A 1VCFA 3MUXA 2TMDA 1T6MA 5E0KA 3IK4A 1RCQA 4BWLA 1D3GA 2FGLA 2FIQA 3MY9A 2VZOA 4WZHA 3MDUA 1K6AA 1FVPA 3WQ5A 4OE7A 4O50A 3N6JA 3EKGA 1POJA 1GWJA 1ADDA 2PDPA 3DERA 1R3YA 4R5EA 4WRHA 3N4FA 4KWWA 3RRAA 4DX3A 4LSBA 1UD6A 3EMCA 1JYNA 1F6YA 3PFRA 3QGVA 1KD0A 3WQ6A 4M6QA 2J7HA 2QCDA 2DZPA 3GU1A 3H2EA 5G4WA 4NY2A 4UOJA 4GVIA 1QPQA 2ZA2A 3PWIA 1ZS2A 3Q67A 3UT0A 3W1AA 4BQ4A 2P88A 4Q33A 2H9AB 2D73A 2J66A 1DIKA 3N2TA 1DEDA 1IF2A 3G24A 3TYAA 3VIFA 4M1RA 4LAUA 3UXLA 4UQEA 3CUZA 3SJ3A 3WLQA 3FJ4A 3TONA 3WF4A 4EK7A 6CGTA 4CCDA 4UR9A 2VJXA 4MF4A 4LY8A 1NH6A 1XV8A 2X0SA 2DV0A 4QAWA 1AJ0A 4H9MA 1DBTA 4KERA 2AQOA 4GIAA 1EB3A 4OV9A 1NIUA 4JFWA 1ITQA 2RDUA 4EACA 3K5XA 4FF7A 3STGA 1RSCA 4M51A 5LXEA 4AZCA 3M16A 4GH3A 1XKYA 2Q8XA 2X7VA 2Z4GA 1F3EA 3H2AA 4XAFA 2OQHA 3TYZA 3M0IA 5M3WA 2NXHA 1QI4A 4I9TA 1D3HA 2XSBA 3AS3A 5CXPA 7ENLA 2BZNA 2VM8A 2GUBA 4HZ6A 4CQDA 1CGTA 3EPNA 3WY1A 2A6NA 4UIOA 4JKMA 3IIOA 1UR3M 4P7OA 2OX4A 1DJHA 3TLLA 1TMQA 3PBUA 1FP8A 3ES8A 4X0NA 1VFSA 4LGXA 4R34A 4LNCA 3NZGA 2YW3A 2JQXA 1BKHA 4IX2A 4N9DA 3TMQA 1EUNA 3T07A 1EC8A 1HXJA 1FCVA 4LEFA 3KHJA 3S9ZA 1FBAA 2PF0A 2OWXA 3NA8A 2VCCA 3QMTA 1V4YA 2OODA 4ZQPA 4BEQA 2YJQA 5T26A 3VOJA 2C15A 2X1RA 1EZ2A 1E4LA 1Q6CA 2AQVA 3GVRA 3FJNA 1VLWA 5KZDA 4WGXA 1ALDA 1IIHA 1XG4A 9CGTA 1FWNA 3Q37A 4LY4A 4J3SA 5HOSA 2OYKA 1US2A 5D09A 1B4EA 4Y8EA 5L9FA 4GPNA 2ALDA 2PZNA 2D69A 3WLRA 3EGJA 4DWSA 4JTAA 2CPUA 2PFHA 4AC1X 2GLKA 2R8WA 3F4VA 4JKKA 1M41A 4BI7A 4ZVJA 3KXQA 2W6RA 4MSSA 4JICA 5LNSA 2A3AA 3RGTA 1B3WA 2BY2A 1NP2A 1BLIA 1F6KA 3D47A 3M5VA 1ONWA 3AAMA 3UR5A 3RPDA 3QM3A 2DT0A 1EJRC 1GQNA 3M43A 1TV2A 4PH6A 4ICNA 1OFDA 3TUUA 3WDPP 1Q7MA 1IT0A 4ZBCA 1I4NA 3ZVHA 4XZNX 3EX3A 3CPRA 5F2IA 2H3BA 4AXKA 2QMKA 1UUOA 1D7FA 1BF2A 2P0IA 3TSMA 4O18A 3PUEA 2Y70A 1OK4A 3PN8A 3LTYA 4LF1A 3CUHA 2PC8A 4GC3A 2WXDM 3QLLA 3UJ2A 1OIFA 2JEPA 1SQ7A 2BOFX 1GOKA 4AH7A 2ZX7A 4X2PA 2VUNA 1GJPA 2VUYA 4UFMA 3SCVA 4AU0A 3DFSA 8XIMA 2ICSA 1KTNA 4G7EB 5FJIA 3WLNA 1RZMA 4IQLA 2Q09A 4LAMA 4GACA 2UBPC 1HKWA 1W1TA 4WSKA 4P8VA 3WNMA 1TX2A 1OZQA 3B0PA 2QLYA 4GIRA 1KW1A 4FR6A 5FOOA 3EWXA 1HJUA 1EEXA 2AMGA 2HMCA 3NUKA 5M17A 2YDSA 4GX8A 3GHRA 4ATDA 1RD6A 8XIAA 2H8XA 2WC7A 3G1YA 3GRIA 5HA7A 1VCGA 5BOEA 5F2LA 1E0TA 3O7UA 2WCGA 1EJUC 4O17A 2FTPA 1RA0A 4M3PA 1DJWA 3P61A 3U2OA 1QNOA 3PZTA 1K9DA 2DEPA 5DT5A 1ZZMA 2H9AA 4ZSTA 5I79A 3WH7A 3H54A 1EUAA 3GU2A 3SCNA 1OY0A 1WE5A 1JAKA 2FLIA 5I6SA 3MKVA 3SSZA 1XINA 4MLJA 3KDOA 3CZKA 1KRMA 4XX6A 2BMBA 2JK2A 3MSGA 3UG4A 5KZMA 4BY3A 3T1GA 4IT1A 2ZUSA 4FLOA 3GIYA 1E71M 2PDGA 5I3GA 3C4UA 4C6JA 3P3BA 1PHQA 1MEWA 2YDQA 2PDIA 2VD9A 3DAQA 4DZ5A 1O66A 4L64A 1W5NA 4DNMA 4ONVA 1LBFA 3UXDA 3D46A 1BKSA 2VRKA 3NR0A 1SO3A 3EOSA 1HP5A 3O05A 1X96A 1EYEA 3WQDA 3EX2A 5LA1A 1JFXA 4GXWA 1N55A 1PKMA 2ZDRA 4HCHA 4IIGA 2GVGA 4UCGA 3W7PA 1F4HA 3FV9A 4HP5A 1M5WA 4NYYA 1WOBA 2WB5A 3EWBX 3ANYA 2WC3A 5T91A 4AZ5A 4HK5A 3A12A 4M1BA 1W3KA 1MVYA 1XIFA 4B90A 5FF7A 3DH7A 3TOPA 3II1A 1HKKA 1KBIA 2XYLA 1YBQB 3B4YA 1GZGA 4JAWA 4QITA 3UG3A 4XBSA 3TAKA 2XZ9A 3UVIA 3M6DA 4IQDA 4GUGA 3B9AA 5FSDC 4AY7A 5AVHA 4N9CA 3MYPA 2QW5A 1IWPA 4GMEA 5BMXA 5CGQA 1WDQA 4Y2WA 1VFMA 4O8AA 2PDKA 4LB3A 3TN5A 4CCEA 2XHYA 4IP4A 1KCZA 1KM5A 2VWTA 4RR4A 1E6RA 2NX9A 3HQPA 3CQJA 4QS5A 4IMGA 3VIKA 1UD5A 3SCPA 5D2VA 1CNVA 1EDTA 5JU6A 2CXEA 2BG5A 2G4FA 4W88A 4A8LA 5BWAA 3THUA 1KFCA 5LIUX 3VKDA 1H7XA 2O4QA 1J93A 1EP3A 1G4EA 4MDPA 4DYEA 1MEHA 1QU4A 1RALA 5EBUA 1EDGA 1WKYA 1DTUA 8CGTA 1TMLA 4NASA 1OGSA 1KA9F 2WVVB 5EBAA 3UZYA 3IJDA 2DW7A 3VD7A 2VD8A 4HPJA 4HNNA 4BK9A 3CM4A 1D9EA 2ZBTA 3LEPA 3QV6A 4M82A 5DANA 3H4GA 2EEXA 3CUXA 2ZDSA 4JYFA 3UGRA 4FSAA 4HU3A 5D03A 2VRQA 4RV8A 5A69A 1J0YA 4RXGA 4KEMA 2XVNA 3M7SA 3RG6A 2RH9A 2FZMA 4IJBA 1BFNA 3G1DA 1D8CA 2E5CA 2Y7GA 1V08A 3TSBA 3VZZA 4FI4A 1OFAA 1A49A 3SCTA 4D6GA 3LHUA 1O5KA 5TAOA 3CIVA 3U0HA 5I3KA 5PTDA 4Q22A 1G0CA 1UBSA 1H4PA 4RZ6A 3PZNA 1WOAA 3JRKA 4K8GA 1BG9A 4C6OA 4HHLA 4G7EA 4FX7A 3T44A 5EMKA 3VOGA 4AVOA 3CL6A 4MAZA 5AHIA 1KCKA 1C91A 2V6AA 3PJUA 3VU2A 5BOFA 1JCNA 1LORA 1HTIA 2VEPA 3G1XA 2A0NA 5A95A 3LM7A 4UB9A 2BXVA 2ZUVA 3RILA 3FS2A 4JYEA 1F6PA 2YL5A 1OFRA 1OYBA 1OFEA 3HV8A 1FWCC 4FPSA 1KFBA 8RUCA 2VXNA 4G6CA 2EXOA 1DIDA 3U7BA 2WZHA 3HG4A 1BGAA 3KM8A 4LVGA 5JH2A 3LYEA 3M5ZA 4N9EA 1H3GA 4J28A 2LLEA 4QXIA 4AHPA 3GK0A 3CWOX 3UZXA 3W38A 5EGRA 5KMYA 2VVSA 4NZ5A 4GNVA 3BJSA 3N1AA 4XD6A 3UFYA 4BKNA 1XH1A 4ZO9A 1NARA 3KRUA 4ZQRA 1XH2A 3C0QA 3DOPA 3LZ5A 3H2OA 1TV4A 4C7DA 4WKAA 3R7MA 3FK4A 1EEPA 3W53A 2UY4A 3WLJA 1VP5A 2IUZA 1OSEA 5JUVA 3EXSA 5CPMA 3LU2A 2POZA 5HWMA 2B0MA 1H62A 3W73A 3DG3A 5CSRA 1J12A 3RLVA 1TJRA 3M44A 4PB4A 3U2ZA 1VBUA 5AZ0A 2O9OA 3EX6A 4HSHA 2HPMA 3LGDA 3RUBL 4DPPA 4DZIA 3GTIA 3T4CA 1XC4A 3V1PA 3WD0A 3NO3A 4QNWA 4AWSA 4PCFA 3L4TA 3DZ1A 1TELA 3VIIA 1DWJM 3Q4DA 4AHOA 3BICA 4AEFA 2OMAA 3K1DA 3ZT7A 1XM3A 5BXSA 4G1NA 2HXTA 4JFTA 2G97A 3HFYA 7TIMA 4GZJA 7XIMA 2VEMA 3ZOAA 1OINA 3S9IA 2FDSA 3BZJA 4XIMA 1YBQA 2DVUA 4JNZA 2O9PA 3UWEA 1O68A 3AC0A 1P0DA 1VAHA 5E6ZA 3MCNA 3CO4A 3OBKA 2IKHA 3N04A 1SO4A 3W2UA 3UWUA 1AVAA 2GJPA 1UPMB 3UW6A 3UPWA 3H12A 3DYOA 3AYSA 2QJMA 3UR2A 3ITVA 2HS6A 1F7BA 4F0HA 2QJNA 4JGDA 2HROA 3K8LA 3MKCA 3SQLA 3RO6A 1THFD 4S3BA 1KM4A 3USBA 3B9DA 4YTUA 1TVLA 4M0XA 2RHGA 5DX7A 4AWEA 2WHMA 3P7YA 4PN2A 2A7PA 3RJXA 3W81A 2C0AA 4GA8A 4K6AA 3AIBA 4WKFA 4GIEA 5C7HA 1I1XA 5AHFA 3UJFA 5I78A 1AD1A 3OG3A 3R5EA 2FTWA 3DHPA 2ZRVA 3GU9A 2WVVA 4I3GA 1UA3A 2YBTA 5AYIA 1TJ1A 4GG9A 5CPLA 4E2VA 4GI9A 1A3WA 4AX6A 2OZ8A 5A6TC 4HOWA 4E8CA 2VX7A 3KOWA 3K4WA 1FWIC 2X2YA 2FHFA 2W91A 1M04A 1JDDA 4HHMA 4A3YA 4ROPA 3GXFA 3WENA 3ERPA 3MANA 3APTA 1ISYA 3ZSSA 2YYTA 3THQA 1BXNA 1TV3A 5D05A 2V3DA 1B1YA 4NRRA 3QJAA 4QBXA 1SZNA 4C7FA 2HE8A 2PF8A 3S2JA 4S1FA 5EB8A 4KRTA 1C7TA 2CNCA 3S6OA 4KT2A 2J47A 1K02A 1UR2A 5AC8A 3H6OA 3MHUA 3GNNA 3CH0A 3PHAA 4BQ5A 1CENA 2PDWA 3NM1A 2HZGA 5F1UA 1UKTA 2Z1XA 3QOKA 1WZMA 2FTYA 3URQA 3WQEA 4UTLA 3CAKA 2WQDA 4JL1A 2I14A 1JGIA 3RLGA 1DV7A 1DQXA 1AFSA 2B7NA 3TU9A 2QCNA 1K1DA 4WJ8A 4PUWA 3THCA 2OX1A 3O3RA 3EOUA 3UWZA 2P0OA 4JCMA 4C5YA 3U4FA 3DI1A 1W1PA 1CCWB 1YNPA 4I6VA 5JBDA 3B03A 1RY0A 3CB8A 1VRDA 3NJ3A 3UR8A 3IV3A 4Y8FA 3WBEA 2CCRA 2Z1KA 2I5QA 1VBJA 3QQ0A 3FDKA 3LA4A 4F0MA 4ZE4A 1EJWC 1VIWA 3BZGA 2VGFA 4DBUA 5BZAA 2FKPA 2CWXA 5HQLA 4IXXA 2PRMA 1KLYA 2Q02A 1K8YA 1S2AA 2C13A 4Y9PA 3PPGA 3G1AA 2AQWA 3TWBA 3E5PA 3M5YA 1TB3A 3ANVA 1LWJA 5C0QA 4B5XA 1BG4A 3GXIA 4MJ4A 2VC6A 3VKAA 1B3XA 2PLCA 3WQOA 4LBUA 3QKZA 1KXVA 2YR1A 4QHRA 5IHRA 4TV5A 4IMFA 1W5OA 4XG1A 2VEIA 2P5NA 3UD6A 1H1YA 2XFFA 4LUTB 3NQ7A 3SCSA 2NUYA 2INZA 3FHAA 3M64A 1H2JA 4AMAA 1DXEA 4BF5A 5A6BA 3KX6A 3HQOA 3A9BA 1VFTA 5I3FA 4GZIA 2IQDA 2V81A 2OXNA 2QDEA 3L0GA 2D3NA 1IGSA 3VO0A 5E09A 2UV8G 1K7XA 4RW5A 5ABEA 3DI0A 3E02A 4R3UA 4V2XA 3QMSA 3QKEA 1TPWA 2HEJA 3VX1A 4WXYA 5AOUA 3EB3A 5LXXA 4S3DA 1AW2A 4GVFA 3SAZA 2YA0A 3R0KA 3V5OA 4JTHA 2PP3A 2HJPA 2C19A 1X97A 2WSKA 3TYUA 1QOXA 3C0LA 3KW3A 1CW2A 5CPNA 2WVSA 4GO8A 2BXZA 1A5LC 3LZ3A 3P2VA 4HGXA 4XTDA 1ZUAX 2FVLA 2GWNA 1AODA 3WNNA 2VOTA 4B5WA 1GK8A 4V28A 2J75A 3LSBA 2PCEA 3TCEA 3W74A 6ALDA 4YPJA 4NJGA 1NOUA 2E40A 1XYFA 3SEPA 2E6FA 3MI3A 4RE4A 3OVRA 2ATSA 1P1MA 3TIMA 2IQTA 3R0UA 1NOFA 3EAUA 3H22A 1J79A 4DLMA 4M8UA 2Z1WA 1RK6A 1GOOA 1Q66A 1DE5A 2GGJA 1SFJA 1JL8A 2XIIA 2QS8A 4GUIA 3QW4B 1YYAA 4JFSA 3ALFA 4LT9A 3AIRA 3BAYA 4KS0A 3I7SA 2GOKA 5AFDA 1XC6A 4QSFA 3PG9A 3QTPA 3E2VA 4DXXA 4H8NA 5REQB 3G1SA 4TQTA 1Z42A 2RKXA 4H00A 3AMLA 1YX1A 2FZDA 4KIEA 2C71A 1YTDA 3MUAA 2DZTA 1EO7A 3P67A 1O1ZA 4GY1A 3IJ9A 4B5UA 3A5VA 3NXLA 3NQ8A 4IMDA 1LRNA 1HQTA 3SADA 2VWSA 5LZLA 3FJLA 4NZ4A 3OW1A 4A3HA 4NI3A 3N34A 4Q8VA 4BI6A 1Q6FA 3JVAA 3BJFA 1VJZA 1UR1A 5ABFB 1JUBA 2AGTA 1H7RA 4J1OA 4AEEA 4RDYA 3ARVA 2NUWA 1KCLA 3F1QA 4H6EA 2ACSA 1UZ1A 5HJXA 3O6DA 3QYSA 5LKYA 5GNXA 1K9EA 1K70A 3S2LA 4ZQCA 4MG4A 3DENA 3HU7A 1Z89A 4LCSA 1VENA 1CXKA 4DO4A 4YXGA 3U5YA 3AXHA 1BYCA 3LDVA 3BG5A 3WNLA 1Q6RA 2G8ZA 1VLIA 3K4DA 4ZO8A 3L5MA 3ZZ1A 3LG3A 4IM4A 1JYXA 1QHZA 1F3XA 1WV2A 1O6IA 1AQFA 4XUGA 2CLIA 5IFTA 4U5IA 3BG9A 4M56A 4PMNA 5LGXA 4KW2A 4PEEA 2QKFA 4OV4A 3W84A 5IRPA 1OGBA 5EMLA 2ISWA 3WMSA 3VIOA 4JNYA 2CKSA 4RW3A 3ARTA 2HWGA 3VE7A 4UOZA 3PANA 4KCWA 4PUEA 4ALDA 1VQTA 2KAUC 3WYZA 3DHDA 1OD8A 5KINA 1DQUA 1FX6A 3IVTA 1ZU8A 3GXPA 3SIMA 3ZLFA 2HK1A 5I09A 1KWGA 1UWUA 5LA2A 1I2OA 2E1WA 3S1WA 1NWRA 4B2DA 3U3HA 1M3UA 2R14A 4GXMA 1RR2A 1Q6LA 2RDTA 1TX0A 1Y5WA 2B7PA 3CIWA 4JXCA 5D9OA 3VUPA 1VEOA 5H8UA 1TVNA 2PDNA 5CPOA 4IMCA 3EDJA 2YBVA 1J96A 1WZKA 1VYRA 3TJ4A 1VPYA 2OO6A 2QUMA 4OWGA 1MFUA 1VFLA 2Y6ZA 4PBFA 4EXBA 4F2BA 1L6GA 2NXGA 2BVWA 4X61A 1NF7A 3QHNA 1ZPTA 3WLKX 2EG6A 3W9ZA 2QHAA 1WKEA 1K77A 1T41A 4XD3A 2R9RA 1E43A 1H51A 1KC7A 1A0EA 3GC2A 4DJED 4LS1A 3AMCA 2W5FA 3CXOA 2QCMA 4HHHA 2WMIA 3W2JA 5KZ6A 1RUSA 4FHAA 2WNQA 1XD0A 2Y7EA 3I3DA 2RDWA 3A24A 1QK2A 3ARUA 3WJWA 3O1NA 4PB5A 1CLKA 1GHSA 3C8FA 2B4GA 3EZ4A 1XCFA 4QEEA 4JY8A 5LA0A 2NSOA 1KRAC 2Z1BA 5DBUA 4LTSA 4IP7A 1RHCA 1UKPA 1HL2A 2VR5A 2EG8A 5FD0A 5BOOA 1TCMA 4GZ7A 3GLCA 1W9DM 1M1BA 3UYCA 5TF0A 1R85A 5F2MA 3OO2A 3TKFA 4Z1CA 2PU0A 2I57A 3HTWA 3AS0A 2BFGA 3OA5A 4D8AA 4PTVA 3GVGA 3EOLA 5AYBA 3TMLA 1Q5MA 3U8GA 1E4MM 5REQA 3NQAA 1TPVA 5K3VA 2F8QA 2J4GA 2QGYA 5CC6A 1SUXA 1MO0A 2W66A 3BJTA 3CMFA 3NDYA 4DJFC 3KOZA 3U6WA 1GQIA 1QNSA 3FVDA 1I45A 4K3ZA 1OF8A 1RCOB 1GJUA 5AECA 1EJSC 1XRVA 3FSUA 3FLUA 3QOMA 1XX1A 4FO4A 4IFKB 4UFKA 4EWJA 3UGVA 1ZRQA 1FUYA 1JRCA 2GOUA 5H8MA 1R3TA 1A5NC 3O06A 3KCOA 4WQ6A 5A94A 5ABFA 3NNTA 2DIKA 3S83A 1SO5A 5DCEA 1L9WA 1AUSL 1UJQA 4E3TA 1GVEA 1AD4A 3KBMA 4J27A 2JE8A 3TROA 2I5IA 3KRSA 3E2SA 3QPYA 3QZ6A 3IACA 3FN9A 1FH7A 4GCXA 3RM4A 3LRKA 1KV8A 1TE6A 4Q7IA 1BVNP 2GQ8A 4V27A 3M1ZA 1SO6A 4DJFA 3LCWA 3LRLA 5TD4A 2O4MA 3T78A 3JR2A 5A6KA 4JIEA 1SJAA 3M0ZA 4IWWA 3W1QA 3LX9A 4DAIA 3EWUA 3WDRA 1J0ZA 1XIEA 3CUGA 2VQTA 5D04C 3RX2A 3MJMA 3P81A 1GOWA 3UZZA 4EF9A 4GY0A 2XTKA 3DGBA 4N4PA 4B4FA 3VIMA 1PWMA 4IIBA 4V33A 1H61A 4QAIA 3WJXA 2NWRA 4UNKA 1GPFA 1S3HA 2C1HA 4A8IA 3WK0A 4GINA 2JEQA 4GHRA 4XUYA 1TJ2A 4L6DA 2BBFA 3BQ5A 4HMCA 1ZNNA 4HSNA 4D6DA 4KWOA 3VGDA 3O2LA 1ZBVA 5HXMA 4Z1AA 2OT0A 3CTLA 1LLWA 3AXMA 2WM1A 1E9YB 4Z08A 1DJNA 4GIYA 5LHFA 3P84A 3W28A 2ZFAA 1Q2RA 2QCFA 2W61A 2F38A 4UMBA 1EQCA 5TNVA 1X1OA 1S3TC 4LXFA 1R8LA 4NZJA 3WQPA 2QZRA 4N0RA 1XLIA 1PKLA 5AZ1A 2DJLA 4FNRA 3FY1A 4FOKA 1B9ZA 3BLPX 3RXZA 3NFUA 3TYDA 5A3HA 5D38A 1JGMA 1HJXA 4JIHA 2PWUA 4O19A 3T55A 4B5NA 2J24A 1CXFA 3ZJ6A 4QX4A 2PGWA 3M0HA 4U3AA 2Y5SA 3OP2A 1G1YA 3HN3A 3VAVA 1UHVA 4B15A 3ITLA 5CZSA 2X09A 3ARWA 1PKYA 2EG7A 1ZALA 1D2KA 1SR0A 2L5HA 2V3GA 1LG1A 3VKCA 3L0KA 1PYMA 2ZWZA 2VT0A 1WUFA 4X2RA 3MB9A 5FA5A 4U4MA 3H7VA 2YIHA 4NJKA 2QV5A 5K7JA 1JVNA 1E0UA 4JTFA 5FACA 3UNTA 3BGAA 4JOMA 2VI0A 4INFA 2E09A 3VNJA 3AIEA 2PPGA 4H8HA 4J3UA 1P6BA 4FIRA 2VCAA 4CNUA 4UZSA 4MZ1A 1RBAA 5H1WA 2EJAA 2WBGA 4IISA 4NT0A 1MW1A 3FXGA 3BWWA 3MTWA 4HT3A 3HIJA 4LC6A 4N2YA 3TYEA 3OVPA 6REQB 2A5HA 4CQ9A 5EFFA 5G2IA 4LRSA 3W71A 4DQWA 3SN4A 4UC5A 3CHVA 5CEWA 2Z2AA 1BQGA 2Y61A 1LBMA 1NDWA 1I2RA 1W1ZA 4DJDC 4HOXA 3C2FA 4ZB2A 4UTFA 5ECVA 2Z1SA 4UBPC 1OC5A 3WLPA 1U1UA 4ZE5A 4S3AA 1HO4A 3WDHA 4PTXA 3D0CA 3L66A 3LPPA 3LCGA 4PRTA 3EDDA 3W23A 5IDZA 3CYJA 1JCYA 3S46A 4BJHA 2C3ZA 4GQQA 4BCEA 3H53A 4IFKA 1UUMA 4H7CA 7CGTA 5I7GA 4Q4SA 2BASA 4AZ6A 3G5EA 4MDOA 3GG0A 4CD6A 1V7YA 1Y5VA 3VVGA 1QPKA 8A3HA 2YZ5A 1XXXA 3QC0A 3RR4A 2Y7FA 3W24A 3BARA 5E93A 2VDHA 4JDBA 1ENUA 1KFLA 3TJIA 1GZ1A 3IV8A 2YCLB 3KTXA 3WLLA 3LM3A 3DN5A 3XIMA 1PIIA 4E0CA 2FH8A 1E1EA 3PF3A 2AL2B 3S6DA 2X16A 2PWHA 1RJPA 7REQB 4WDWA 1CXEA 2R82A 3GTFA 3VD5A 3TQVA 4K2SA 4E3VA 3HA1A 3T08A 1C9WA 5CQ1A 1UKSA 2C79A 2BHYA 2NQ9A 3TN6A 4WDXA 1SM9A 1YTEA 3AMKA 1XLAA 4UXDA 1BWLA 4MB5A 4RL3A 1XBVA 3CZGA 3WUBA 3V7PA 2Q01A 5HQEA 2X2GA 4MIMA 1CGUA 4Q4RA 1CXLA 3GIPA 5EY5A 4HOZA 1N82A 1TG7A 4EIVA 3SCWA 2PDFA 5G1TA 1VF8A 1AW1A 5BROA 4C6QA 2J6XA 1Q65A 4HJFA 3T9PA 3TYBA 4DEFA 1B3ZA 2YL9A 2E25A 3CEUA 4FMVA 1BWVA 4WUIA 3CUFA 3WF2A 3BLEA 1HFBA 3TQKA 5HMDA 4MKNA 5A2AA 2XN2A 4NILA 3VZYA 1H7NA 3LCIA 1GONA 3QV7A 3WBAA 5CJ5A 3T8LA 4NQ1A 4C6IA 1EA0A 2GDQA 4LBSA 1QI0A 5FF4A 3NZPA 1QW9A 2V8ZA 1HJSA 2A3HA 1W32A 1E0XA 2OQLA 3EDKA 3LS9A 2OTDA 4H83A 2FFIA 2D2OA 1E5NA 4ZQNA 5LNWA 1X6UA 4O4WA 2VL4A 4PE8A 3N17A 5CSYA 2GQ3A 1VEMA 4ZCWA 1SZGA 1BYDA 2WJEA 3KL0A 3C6CA 3CK5A 1T96A 2NXIA 1EYWA 2OYMA 4XTIA 4F2TA 3IANA 2CESA 5EMUA 1VFOA 2YXXA 1OD0A 1WKDA 4FXSA 3TOYA 1LT8A 1EP2A 3P0XA 4MNMA 4MTVA 3HV9A 5FESA 1E4NA 4KPLA 3PWGA 1OQFA 4J5NA 2PDLA 4B3KA 4X0VA 4L6OA 3TC7A 2I1OA 3ENLA 3U7VA 5DN1A 1V6VA 4PYSA 4RZBA 2YL6A 3PUOA 2R1MA 4MWAB 4O1BA 6REQA 4C5ZA 3VCRA 4ATWA 3VILA 2OEMA 3ITYA 3LD5A 3UCDA 3W07A 4C6NA 4RNIA 4IPPA 4GFIA 5DCDA 1DIEA 1XYLA 1UROA 1JUEA 2CLFA 1GVYA 4Q6JA 1FDYA 1IXOA 2ZX6A 3E0LA 1GYMA 1MW2A 1PTDA 3ISIX 3HPSA 4CQAA 4GLEA 4Y7EA 1IGWA 3W1MA 1SFLA 5L6UA 1TQJA 2DT3A 4CQBA 4P7NA 2WWDA 3NGJA 3H8AA 2WNZA 4B3LA 2QJGA 2QCGA 3FDGA 3UJRA 1BF6A 1BWKA 2J74A 3VOHA 1F61A 1UQZA 4EVZA 4HZ7A 1G67A 4G2DA 3A6OA 4MAVA 1CXHA 1MWOA 5AC6A 4OTKA 4JR5A 3F4NA 2C16A 1L0PA 4UQDA 4N4QA 2YOCA 5DMYA 1KWKA 3H24A 1ISVA 3AYRA 3V0UA 2W67A 4TX8A 3M46A 3LLFA 1EJVC 3PZOA 3UP8A 2ANUA 1TTPA 2J78A 5A8OA 3TE9A 3WBYA 2BY1A 4ZL1A 3PBYA 1AQHA 3FX4A 2ZIDA 5C54A 1NELA 3RM9A 2PD5A 3W6MA 5G2HA 3SFWA 4H9ZA 4ICCX 3AZTA 5I02A 4ZSUA 3MHFA 3EDEA 4PA8A 3ID7A 1LQ2A 3MYOA 3I65A 1E9ZB 2XVGA 4CU6A 4K38A 2YCLA 4QR6A 2TODA 5ENLA 1V6WA 2Y5JA 3L23A 2HNEA 3QW3A 3CZ8A 1FHUA 2QR6A 3VKJA 2ZYFA 2AL2A 2Q3RA 4CEUC 1PZ1A 2W79A 4GXPA 3E9AA 1VBHA 7REQA 2PWVA 4OBRA 4PUMA 1Q6GA 2ZUNA 1XWYA 2WLZA 3BO9A 3UR7A 4LUIA 2EF9A 3DC0A 1UBPC 1FOBA 3L21A 3HQ1A 3TJLA 3NCOA 2PDHA 2REQB 4CKQA 3LCFA 1XBYA 4HCLA 3M5XA 3SIZA 1CBGA 3RMEA 1DWFM 2OSYA 1L8NA 3R8HA 1JCTA 1XP3A 4AD5A 5I0DA 2X30A 4YNGA 2A3BA 4JTIA 4BFAA 2DZUA 2BTMA 3KE0A 1BYBA 4YTSA 1E6PA 4M19A 1OX4B 1JYWA 4RCXA 4ADSA 4QTGA 1UWSA 3L0NA 4XWUA 4ZQOA 3W7KA 2CLOA 1F5ZA 3N14A 1EGVA 4XZMX 4NXKA 1XQLA 5LIWX 1RJRA 4CNTA 1E6QM 4HNLA 3NSMA 1PDZA 4IPJA 3UVAA 2FMOA 4HNVA 1POKA 2BVTA 4L1XA 2PWEA 2XM1A 3GZ3A 1A5UA 4ACZB 2SFPA 1S5TA 5AVNA 3PTDA 1V0KA 1S5WA 3RM8A 3AS1A 2VFHA 3O15A 4WHBA 2PTYA 2OLHA 3VXGA 1J0IA 4OJYA 4C1LA 1TZ9A 4IIDA 3EX1A 1DJIA 1GGOA 4E4FA 3EWCA 3VNDA 4MWAC 3GX9A 2WPGA 5CKSA 4Z0SA 3AUJA 4YJ5A 5KEZA 3VNIA 2WNNA 4X9SA 3A64A 2EQDA 3WFZA 3W7CA 3W86A 3MA8A 2YX0A 3CAWA 2CC0A 4O53A 3Q65A 5K9CA 3SRDA 1G6CA 3OPSA 4NNCA 2YA2A 3NEHA 4KBXA 2VVNA 1GCYA 3C8NA 5KETA 1QVBA 3GC4A 3ECQA 3FCPA 5LNUA 3P82A 5B7YA 3ITGA 3SJNA 1P43A 1V3IA 2QAPA 4X3ZA 1MQRA 1XG3A 4XBKA 3DFNA 3EWYA 1EPVA 4YWSA 1VFFA 1JYVA 4PMYA 3IIZA 1FDJA 2DZBA 3R89A 1C90A 2GGEA 4E2BA 1JCLA 2E9LA 4H2HA 1GVFA 3NGFA 2HBVA 3BMXA 1VJSA 2PDYA 3GC5A 4MWAA 3ES7A 3GH7A 4UTJA 1K4HA 5HNNA 3KLLA 1WCGA 2INFA 4R7JA 4J9JA 5CBJA 4R9XA 4FS9A 4WK9A 3V5FA 1M68A 3A47A 1LJYA 3TTQA 1H63A 5FIPA 3MKKA 1ZAIA 2V30A 2QULA 1H09A 1JD9A 3LQGA 3LV5A 1OABA 1BSIA 1UUQA 1I8JA 1XLLA 1CB7B 1O1HA 5H6HA 1FKWA 1PCKA 1JZ3A 1EBGA 2JKEA 4GABA 2J77A 1E6NA 5HR6A 2JGQA 5IDIA 3VCCA 1M53A 1DXIA 2D0FA 4C65A 3POHA 1KTBA 2YB4A 1CZ1A 2WMKA 3O16A 1BVZA 3QQ1A 4NXSA 3H2NA 1E1CB 1XBZA 2BB0A 1UIPA 4GGHA 3QTGA 3I7QA 4OBSA 5FJRA 2PEVA 2F84A 4QQ3A 3HG5A 5FJTA 4RDVA 3GDLA 4HA4A 4MUPA 2FHCA 5F4XA 4FXFA 2Z25A 3S5NA 3WMBA 1XDMA 4P8WA 3TYCA 3CZEA 2Z0IA 1XGZA 1GKRA 4ERGA 3TTOA 1X39A 1VS1A 2PU1A 1ME8A 3NQFA 1EBHA 1MDLA 5A8NA 3MQTA 3DEQA 3ATYA 4UUIA 3G3MA 1SW3A 1GOMA 4P2VA 3TLQA 3WK1A 1DL3A 1RBOB 1OIMA 1GW9A 3F2DA 1T8XA 2ISDA 1GW1A 1F07A 4TTGA 2CLLA 2XVPA 3E2QA 2PDCA 5C2GA 1I1WA 3K1GA 4PC8A 2O92A 3ARXA 3N3TA 3K13A 4L4LA 3NYDA 5HMSA 1UD4A 3PP7A 4QGCA 4G5DA 4AD0A 2QUTA 1PX4A 1H11A 2R91A 5DELA 2WHLA 2WANA 3EWZA 4PSPA 4DF1A 4ZTYA 1TIMA 2D3LA 3WQFA 3GUWA 1X7FA 4DYJA 2IQ0A 1W37A 2YFNA 2QUVA 3G2GA 4OBTA 1PDYA 2HISA 1O94A 5J5RA 3UA3A 4UMAA 2YB1A 1CYGA 4HZ8A 1G4TA 1M6JA 4R85A 2REQA 4Z2HA 1TR9A 3B97A 2PTXA 3ARYA 4QE1A 3OLIA 5E9AA 3ICJA 1V3LA 2BGNE 5J5DA 2O7QA 4MNKA 1NWSA 1B4KA 5DY3A 1V51A 2QPXA 3EDFA 3WDQA 2HVNA 4F4RA 3PZVA 4M5PA 3EXRA 3C61A 4MYXA 4UQBA 5CSSA 1YPIA 3OLGA 4O1DA 4IL2A 3AIVA 3OZYA 4EWND 1NVMA 1EHAA 2VFDA 4OZOA 2DZAA 1CGYA 3KP1A 3T05A 3WUEA 4LVFA 4QQUA 3P5ZA 3W7OA 4U2ZA 7A3HA 3QV8A 1L8PA 1KXTA 3W02A 5D9MA 4FNPA 3ITTA 2X8RA 5GNZA 2WYSA 3WD2A 1ZFJA 4ACZA 3P0WA 3NEVA 1Z6KA 1DJGA 4JS3A 2O0TA 1MNSA 4KFOA 1HF6A 5XINA 3LBCA 3STCA 4MJZA 1XI3A 2ISFA 4UOQA 1ADSA 2Z6JA 3ABZA 3ORWA 2XN1A 3GVWA 2DSUA 1F3WA 2TAAA 2DVXA 3FAWA 2QIWA 3O6YX 1IEVA 1RLDA 3RU8X 2OWWA 4GISA 1VJIA 2BLEA 4D9PA 1F73A 3HMCA 2V3FA 3KZSA 2E5BA 2HQAA 4G1KA 3GWQA 4Q8NA 3VDCA 1S39A 1OEPA 2C6QA 2NLIA 1L2UA 2J7CA 3B4UA 1ODUA 1W8GA 1KBKA 1AL8A 1ODZA 2E7FA 3MUZ1 1XCXA 4K7VA 5G2WA 4AB4A 1UD3A 4NRSA 3ABRA 2PDBA 2H3DA 4RXFA 3N18A 1V7AA 1V02A 2O9RA 2TPSA 3W1PA 3GH5A 1LZOA 2O7SA 4E38A 4K36A 3GR7A 2E68A 4O1CA 2J79A 1NFBA 2NT0A 5AHEA 2BX7A 1TZ7A 4A8NA 9RUBA 3I3EA 2J25A 3IAQA 4UTTC 5T8GA 2YDRA 3L12A 4YHGA 3MV11 3EPMA 3A21A 1TV8A 3IIPA 3ABSA 3XISA 3W1LA 1XIJA 5FL0A 2Y63A 5JH1A 1A3HA 1G4SA 2I9UA 1G69A 2DP3A 4L4MA 2V2HA 1MZHA 4GRSA 4S3KA 2ZZ6A 4OOZA 3R10A 3N9RA 3LXAA 3GSMA 4PFMA 4AD1A 3QYQA 5E1QA 3SY5A 1GZJA 3MUY1 5FJPA 2QEZA 3KBJA 3KS5A 4O0KA 1UR9A 1E1CA 3TW7A 2CIPA 2ZZ7A 1W3TA 1XYCA 1XR2A 1E40A 1VIZA 2J9XA 4CLMA 4LC8A 5IHSA 2WKLA 1OFOA 4ZZ9A 1C8VA 3D6NA 4IQJA 4DXVA 1ZJHA 1JUKA 3IUIA 3MWAA 1YADA 2D0GA 3W0KA 3AO0A 5HANA 1V6XA 4DF2A 4UTTA 2PTZA 3CPGA 5AYYA 5M5DA 1R2SA 1IXNA 5MKGB 1MXDA 4PMVA 3W00A 1XH0A 1UR0A 2J27A 1V6YA 4AQLA 1WDDA 1KQYA 2DUZA 3UJEA 3URNA 1EIXA 1XUZA 3W75A 2WCAA 5J8LA 4WR3A 1YE4A 2YLAA 2Z7GA 3LHWA 3R43A 2DUAA 3VGHA 2WSYA 2EBNA 2F2HA 4ZEPA 4LYQA 4OIFA 5FF0A 3I3BA 4WLCA 6XIAA 4QJ1A 4WF7A 1DPMA 4NJIA 1UQYA 3W3OA 2GFTA 4JEJA 2PTDA 2DY3A 2ISSA 3IARA 3W7GA 4IICA 4W8LA 1E70M 7PTDA 3TN4A 1XQKA 3HMJG 3E1F1 3GYCA 4JQAA 4WOQA 3LOTA 3MCOA 2DDXA 1PBGA 4IGSA 2DGAA 3B0YA 4PMJA 3QR0A 3T2OA 3QF0A 3C56A 1VBRA 3E0FA 2BGQA 4LRTA 4CUCA 3F7JA 1YNQA 2VX5A 3R8GA 2PD9A 3VD9A 4JFUA 3ZXWA 3W7DA 4GFSA 1DWIM 3DYPA 4A2RA 1IEQA 1PJ9A 1XFCA 4EXQA 4F9DA 2PP1A 3KRBA 2D1ZA 2ZCGA 1FP9A 1TPB1 2G3MA 5CLTA 4PRRA 5D8WA 4NU7A 4H6QA 3OB8A 1JF5A 1W2VA 3SUUA 3MO7A 2W9MA 2OZ3A 2WZMA 3L4XA 3M0VA 2ZUMA 1RA5A 2X1IA 2JKAA 1WDPA 1TWWA 1N8WA 1WX0A 1BXBA 3GDTA 1O7AA 4IOTA 3WQGA 1ELSA 4MJMA 2GL5A 3T2QA 1US0A 1CDGA 1OZMA 3VCNA 3URAA 5DRCA 3PSWA 4N9BA 5G1MA 1EFZA 1UA7A 2Q3OA 3B9OA 1W6TA 1V6UA 4AVNA 3NSNA 3NOEA 3SY8A 3TA9A 1LDCA 4DBEA 2V0TA 4A29A 3FIGA 1V0MA 3QBUA 1PYFA 3LCXA 1S2WA 4K68A 2NT1A 2V9DA 4TU1A 2POTA 4HA3A 2R94A 3ABOA 2J8TA 4XZWA 1QW7A 3W22A 3LHZA 3WQCA 4IMEA 3R1ZA 1K8CA 3AWNA 1B90A 1XLJA 2CEQA 1TV7A 3S4TA 3VC6A 4PL2A 3WG6A 5C2CA 2ZZ3A 1I0DA 1PWLA 2Z28A 3SN0A 4LV9A 5FEXA 5AHLA 3FSTA 3QR3A 4FNQA 3BLFA 3LLDA 2GJRA 4ES4A 4FEZA 1WXYA 4HQVA 3GTHA 4LH8A 1R5YA 4LANA 3WLSA 4XD5A 2A3EA 4UTKA 3QQWA 2GJXB 4GKLA 2RAGA 1HNYA 1KQZA 1K9FA 2IXUA 2FZ8A 4PMOA 3LMYA 4JIRA 1BTCA 3SSJA 2GSHA 1YLVA 1OB0A 4NG3A 3CHFA 1HVQA 1LRQA 2QF7A 1E5JA 3AUOA 1VZWA 3A4WA 4DWSC 1SMDA 1EPXA 4K1GA 1W5PA 4B9ZA 4FLRA 4NYUA 1ECQA 3CB3A 3NL5A 1TYGA 1VEPA 1M65A 3LTSA 2DSVA 1UWRA 1OG6A 1GPWA 1LL7A 4Y9OA 1XLKA 4WDTA 3GQYA 2ZRXA 1YPFA 1ONRA 4XZHA 3TR9A 1R86A 1JRBA 4EPBC 4M6PA 1P6WA 4G7FA 3B3DA 1C29A 1GORA 2VEKA 3CMJA 3P8JA 4IPNB 4Q4QA 2QF8A 4A21A 3VINA 2V5JA 1U1HA 3G8RA 4HNTA 1UC5A 3BMWA 3OHMB 1EC7A 2HCVA 5FAJA 3GG1A 4LS0A 4C6EA 5MKGA 1YDNA 1TO3A 3W2LA 1B3VA 1KGXA 2ZRWA 1Y7VA 1EO5A 1ADOA 4PBGA 5HNTA 3ZWTA 4DBDA 3PBMA 4A4AA 1E56A 3GH4A 1XYAA 2UZ9A 1XRTA 2VR2A 1Z3NA 2DZSA 4AW7A 4E8DA 1O95A 4RV3A 3AIWA 3TA6A 3HF3A 4LCRA 4AXNA 1UH3A 1E0VA 2OOFA 5GJNA 1NDZA 5J04A 4ML4A 5C5YA 1IYXA 3DG6A 3QV9A 5BU6A 1TR1A 3DU0A 2R1NA 3LQLA 3VOFA 3BOFA 2VCBA 2OELA 1TE1A 3DBPA 4MYAA 1Z41A 4IIEA 1PZ2A 2WKJA 4P61A 4XSMA 4UQAA 1LM1A 3T40A 3MVTA 1SJCA 3APYA 4YCPA 2DORA 4J2MA 5DQPA 2HVOA 5HWJA 4C91A 3O0FA 3PZUA 4S2BA 1C8QA 1W17A 4WDUA 1QHPA 2JKPA 1J01A 1GQJA 3GDKA 1Y5XA 4PL1A 3AFBA 3T0BA 3KUMA 1CECA 4JNMA 4UMCA 1TQXA 1JEZA 3OTRA 1TWZA 4XKMA 5CJMA 1DE6A 5B7ZA 4A22A 2BDQA 1XKJA 4AZ7A 2WVTA 3E96A 4LWWA 2VELA 4EOUA 3FA3A 4Z2LA 4NHVA 3TC3A 1UWTA 2BWGA 1FHDA 1RVKA 3ABXA 3K46A 2X0YA 3ZLHA 1E73M 3LI0A 4IUOA 3BAIA 4JHOA 2AGKA 5HINA 5A6AA 3TW9A 3VD4A 1T0OA 2ZE0A 1LF1A 1UC4A 4C6PA 1IEXA 4JTEA 1AQ0A 4CVWA 3UZJA 4S2CA 4H19A 1R2TA 1S5VA 3SW6A 2FFCA 2CHOA 3M7WA 4YLWA 1J10A 2I17A 4Z2IA 1LLOA 3OZMA 3H70A 2FVMA 3T09A 3GBEA 2HPIA 1FFRA 3R25A 3N19B 4JQ1A 4PUKA 3G77A 3DFTA 1XLCA 3I4EA 4BR1A 1FCBA 2XU2A 4GUJA 4P7LA 2V63A 3OJGA 4EP8C 1SZFA 4F0SA 4TIMA 3SUSA 2B31A 4BS0A 4XK2A 2PZ0A 1UMYA 1XJBA 4US6A 2ZTJA 5G1YA 4POCA 4ERAA 4AX7A 3H26A 3W37A 2ZC8A 3IJ7A 4XAZA 4NNAA 3PB0A 1WBJA 3BPWA 4CD8A 5DFAA 2XIQA 4X63A 3N2BA 5CH9A 3EWDA 1LLZA 5A6LA 3KDNA