4DELA

Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. tuberculosis
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Active site loop dynamics of a class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 138
structure length 345
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4delA00
3CM4A 5LZLA 2CWNA 3G8RA 4UTKA 1CI1A 1F76A 1Q6OA 4D2JA 4MIMA 1WQ5A 1AW1A 3C2FA 4EIVA 1TQXA 5D2XA 4YLWA 4BWLA 2BTMA 4FNTA 3D0CA 1ZAHA 2WNNA 2Q3OA 1H7NA 3DI1A 1JQVA 4HIBA 3S1VA 3RMJA 3UWQA 2J24A 2DZPA 4RLIA 2OX1A 5D33A 5D2YA 2B7OA 3NQ8A 2DORA 1VRDA 5LNRA 4HPJA 2V5BA 1F6PA 4FX8A 1PV8A 1JCJA 5E1QA 2QJIA 1AW2A 3R12A 1IXOA 4K37A 1EP2A 3FA5A 5HWJA 1KTBA 4RV8A 4GC4A 4MY1A 4JX4A 2ZZ6A 2J88A 2H8ZA 1FCQA 2JGQA 1IF2A 1R30A 3CLMA 2ZYFA 3OBKA 5HNRA 5K2ZA 4MZ8A 2WPBA 3LCGA 1TPC1 2E1DA 3IEBA 2ALDA 2CZ5A 2HS6A 3SZ8A 3T7VA 1MXSA 1KTNA 1D3HA 2YYTA 3PULA 1G4PA 4LUIA 4IJBA 3B05A 2Y61A 3FLUA 3PG9A 4WXZA 4ZZ9A 4GUJA 5K9XA 4UTJA 4MKNA 3NEVA 2V2DA 4HSOA 4E0CA 1TSIA 2CLKA 2CLFA 1F74A 1B57A 3W7HA 1SZEA 2VELA 3HGJA 2V8ZA 5I3HA 3FJ6A 5D2TA 3TC7A 4HKPA 3NO5A 1JUEA 2PRHA 3KVKA 3L9CA 4NT0A 5I3IA 2DZWA 1V5XA 1LZOA 2JKAA 3W7RA 1AL7A 4HNNA 4RK8A 1TTIA 2PRLA 1C29A 1TQJA 1XCFA 3W2UA 2J9ZA 3QZEA 1YDVA 3GXNA 1VGAA 5K3VA 2QCNA 1WXJA 2GQ9A 1EUNA 4NXKA 1R2RA 1KLYA 2WOQA 2OMAA 4JYDA 3AO0A 3B06A 3G1DA 3TW6A 1W56A 3DI0A 3TSDA 2ZZ4A 1VJIA 1LROA 1YYAA 2ABBA 4WOZA 3M5XA 3W1RA 2VEIA 4DO5A 4IPIA 1HG3A 1MZHA 2XN0A 3MW7A 1SQ7A 5CGQA 1KM2A 2YW3A 3KOFA 4GWEA 3UXAA 3GVGA 4RCXA 5I3FA 3EX6A 3C2VA 5AHMA 4ONVA 5HQEA 4A29A 2ZA3A 3PB0A 3G1VA 2NZLA 2ATSA 4HSNA 4K39A 3W23A 1LORA 2QCMA 3E96A 3NR0A 5AOUA 4IWWA 1LYXA 3W7JA 1QWGA 3W07A 4UTMA 4XWUA 1OFOA 1VCFA 1W3NA 4JTJA 4RXFA 4XKYA 3UY7A 5K9DA 3ZFHA 1PS9A 1HFBA 1TRDA 5I3GA 2W79A 3KRUA 3G8EA 2Q3RA 1KM1A 1YXYA 4M7SA 3INPA 2GVJA 3NL2A 2RHGA 1TPWA 3W2MA 4ZQRA 3S1UA 3H53A 4NJIA 3BLIA 1LCOA 3A24A 1S5TA 3W7CA 4WZHA 2ZCGA 2W6RA 1S5WA 3WFAA 5IM51 4FEZA 1TPUA 1LDCA 3W71A 3GZ3A 1VS1A 3TE9A 3I7SA 3EWXA 1EP1A 4MZ1A 5FEWA 3SY5A 3R8RA 3ABRA 1W37A 2QCEA 3EWYA 4OQVA 1OYBA 4NJKA 3TUUA 2E6DA 2CLLA 1S3HA 4Z0SA 4Z1DA 3DFSA 3MJYA 4LRTA 1TIMA 3QRHA 4ORIA 3G24A 1NF0A 3SR7A 5DLCA 2RH9A 2RKXA 3C4UA 1OYAA 4LT9A 3SGUA 2Y89A 3EXRA 3LOTA 3C6CA 3EWZA 3PVFA 2QR6A 4N4PA 1XXXA 4UMCA 4AF0B 1JQXA 2X16A 1FWSA 5F4WA 2FDSA 3T55A 1EUAA 1C8VA 3DHDA 3G3DA 4IX0A 4OE7A 4QAIA 3MP4A 2TPSA 1J2WA 3SECA 1O4UA 1T8XA 2IQTA 3OVQA 1SW7A 2GVGA 3NPWA 2RDUA 1K8ZA 3PUEA 4DBEA 4OV9A 1MO0A 4EF9A 2RDWA 4ZL1A 3FS2A 3LLDA 1W0MA 3CT7A 1QNVA 3IVSA 4QIUA 1TRIA 4WJEA 3BLFA 1I2PA 4GFSA 4N2YA 4N4QA 2YFNA 4Z08A 3QEZA 2WSYA 4PC8A 4EVZA 4QNWA 5LHEA 1M7OA 1N55A 4JTKA 4NX5A 4UUIA 3H55A 1GG1A 3HGRA 3KXQA 2AGKA 4O11A 4ZQPA 3NG3A 4ZQOA 3TX9A 3PS7A 1QO5A 1ZCOA 5G5IA 3F1QA 3E02A 3QQ1A 1UJPA 2AQWA 3W86A 4CCCA 1FXQA 3O8AA 3MO7A 3M1ZA 2FJKA 2NXGA 2QCDB 4GUIA 5LGZA 2XFWA 4AHQA 1GTEA 1MSSA 1NEYA 2QCGA 2ZRWA 1OFAA 1ZENA 5AHNA 4XTIA 2BLEA 1QO2A 1QDSA 4E38A 4YCOA 4WX2A 2BZNA 4LWWA 4ZQMA 1VYPX 3TROA 1DQWA 2QF7A 4LY8A 3STCA 3BG5A 1K8XA 3EX3A 1O5XA 2B4GA 2VFGA 4OHQA 3NYZA 3HPXA 2LLEA 1H50A 1VHCA 2EKCA 2P10A 3EXSA 4K8HA 3W84A 2ZZ7A 5AB3A 2VXNA 3SFKA 1Z44A 1KFBA 3UWWA 1FY6A 5D30A 3GB6A 3QMTA 2VEKA 1DKWA 1KFLA 1R46A 2J9XA 2H8XA 5HWNA 3MI6A 3N19B 2RDTA 1OF8A 3DFTA 1BEUA 2VOMA 1YDOA 3W1MA 4MJMA 1K8YA 3ABOA 4J9JA 4LOCA 3M5YA 1SO4A 1FQ0A 1VC4A 3IIOA 1YLVA 3GAKA 2ZRVA 1W5PA 5F4SA 5LNUA 3QMRA 2EPHA 4WY0B 2NUYA 5AYYA 1IXPA 3MHUA 3LCIA 3LI1A 4UTIA 5FEXA 4UTTA 2A7NA 2Z2UA 3U6WA 4TMCA 3QYQA 1P0NA 2X1SA 3HO8A 3L65A 2XN1A 3Q58A 4QSHA 4DELA 1VCVA 5LNVA 1QPNA 2WV8A 3P74A 4UNKA 2GQ8A 1TV7A 2R91A 1RR2A 3BGGA 1OX4A 2A5HA 3TXZA 2FLIA 5L9FA 4AB4A 1VLWA 5AHEA 1KM6A 2TSYA 4TIMA 4O13A 1QPQA 2VFDA 4ADUA 2CZDA 3TAKA 1W3TA 3NA8A 2CZEA 1J5TA 3TA6A 2NX9A 5F2LA 2PRMA 2A0NA 3BLEA 4JR5A 3V1PA 4AWUA 3LHWA 5F2GA 1VCGA 5DY2A 4GUHA 4WOQA 2QCCA 4LS0A 3TC6A 5KZMA 1N8FA 3ABQA 2G96A 3Q2DA 1YXCA 2OZ0A 3TFXA 4BI7A 1JCYA 4O1CA 3W6YA 3UWVA 1QMLA 3TJXA 3W7PA 2EAWA 2QUTA 1K7FA 4N9CA 2H3DA 4CNNA 3P60A 4IMEA 4PL2A 3FIGA 3LDVA 5G1TA 5CZ0A 1EIXA 3TR2A 2QCFA 2C3ZA 1XBVA 1XBYA 6TIMA 1H61A 1DJQA 2PCQA 1ZAIA 3TK7A 2NXIA 1TJRA 5KMYA 4GUGA 1ME8A 3CEUA 4AWTA 3HPSA 5F1VA 4NJHA 3DZ1A 1X7FA 1IXNA 5G4EA 1AL8A 4UFKA 1KFKA 4IMCA 3G0UA 3T78A 2I9EA 1W1ZA 3PF3A 1TCDA 2NXHA 2FPTA 1FDZA 5C55A 2DJXA 4NNCA 5KZDA 4YWIA 4RZ5A 3FKRA 3GDTA 3DKLA 1ZNNA 4A2RA 5CZJA 4PFMA 2A7PA 1FX6A 4ML9A 1L6YA 3B0VC 3PY2A 4QITA 2NV1A 3Q37A 3W1TA 3B0PA 3W73A 2NV2A 3BG9A 5BRBA 1OFQA 2FB3A 3UWZA 3PC0A 4WUIA 3QSTA 4ZQCA 3W88A 4CNPA 2ZTJA 2G97A 1GVOA 3ZWTA 5D05A 1OVDA 5G2WA 2DZXA 2P1FA 1A5AA 3LHVA 4BI5A 2VFHA 5D38A 1QCWA 3OG3A 3S5OA 2QEZA 3Q94A 2F84A 2CLEA 4AVFA 2Y7DA 2ZZ5A 1JCNA 4JYFA 4HNUA 4N6EA 4A2SA 3P8IA 3KFTA 4JS3A 3ZWSA 3GX9A 3DFQA 3NQMA 1GVQA 5EY5A 3HOJA 3O6YX 3LHTA 4DO6A 5EYWA 4GNJA 1SUXA 3WJZA 1LOQA 3R89A 3DFNA 3P67A 3P82A 2VFFA 3JS3A 4S2CA 4ADSA 3LB0A 1YDNA 4TO8A 3TSBA 2ZQ0A 3CHVA 4LS2A 3OA3A 5G4WA 1PIIA 1WBJA 4A21A 3WK1A 3PUDA 3EXTA 2D73A 2FB2A 3FEMA 3V75A 5LHFA 4AHOA 5EA9A 2ZA1A 1FXPA 5L6UA 4JDBA 2YGYA 3W7IA 1ONRA 3N9RA 3N9SA 3KRZA 3I7RA 4O4WA 4FNSA 4EOUA 5E0KA 1TPDA 1FCVA 4XBSA 2ZBTA 1TJPA 5KTLA 4LNYA 3FKKA 3NQVA 3TQKA 1JR1A 4NUWA 4YXGA 4JX5A 3E9AA 1HO4A 3TMQA 3W22A 1L9WA 3DH7A 3ABSA 4AMAA 5FF3A 5K7JA 1WX0A 1OJXA 1Y0EA 4AXKA 3O06A 3HF3A 4UC5A 1O5KA 3QQ0A 3UQNA 3NXFA 4XQ6A 4UR8A 5DBTA 4O19A 4DQWA 1W8SA 2O7QA 3R13A 5D03A 4FNRA 1DVJA 4MLRA 5A5WA 2YW4A 3K30A 1I45A 4Z1CA 4DF0A 1FUYA 2B7QA 2VKZG 2ZTKA 3G1HA 1PE1A 4ORMA 1OFPA 4RZ6A 4XZ9A 1ICPA 1Q6LA 3LV6A 4NU7A 3TFCA 2WJZA 3WJSA 3PB2A 3PUOA 1K03A 3C61A 4BR1A 1BKSA 1SPQA 3GR7A 3PSWA 5C54A 3QJAA 1TO3A 3MI2A 3NQDA 5EKYA 3NDOA 1GVSA 1EB3A 1KFJA 3W2JA 7TIMA 3G0SA 3DAQA 5C2XA 1FWWA 5KZEA 1OFDA 1H7XA 5BW6A 1HTIA 2YFOA 1THFD 3GKFA 3WK2A 3G3MA 5H2ZA 5FEZA 1MEWA 4TR9A 1KM3A 3HG3A 1X8FA 3W1UA 4UFMA 1OHLA 2E6FA 5MHBA 1SFJA 5AYZA 1SZNA 3P62A 3W72A 3FYOA 4IGHA 4RR4A 5DXYA 3VKJA 4BK9A 5CPMA 2ZRZA 1FWTA 3LXAA 3LXCA 1I2OA 5F4XA 1PHQA 3A5VA 4JDYA 3W1AA 1K3UA 4OBTA 3ZS4A 1SO5A 1SR9A 5KSWA 2E5BA 2CZFA 3S5ZA 3NPUA 4UXDA 3U8GA 1D3GA 3KVMA 5AC7A 2YR1A 3EKLA 3U2OA 3WJWA 1OF6A 1KM0A 1UUOA 4O1BA 5T26A 4PA8A 3VFLA 2FPVA 3EWWA 3QM3A 1H1ZA 4X22A 3IVUA 4FXRA 4RZ4A 3ATYA 3EB2A 1VHNA 3L66A 1FBAA 2GJLA 4O52A 3LCWA 3VE7A 2CLHA 1DV7A 4UTTC 2GPTA 2VFIA 2NUXA 1KM4A 1H60A 1ICQA 4XKYB 3MMTA 3G18A 1HO1A 3FJLA 3TQVA 2CLOA 1XDLA 4WD0A 4Y6GA 1YADA 2EGZA 3WK3A 1JULA 1TPB1 4LVBA 3S5YA 3R2GA 1K02A 3NQ7A 2G5WA 3A5FA 4IPJA 3CPRA 3NZRA 5CSRA 2TMDA 3STEA 3TW7A 1V7YA 4NJJA 3LX9A 3KX6A 3A23A 1IXQA 1GT8A 1VH7A 1P4CA 1YXDA 3M43A 5AC8A 1LP6A 1T96A 3AJXA 4LW7A 3TXVA 4GRSA 3DU0A 4MZYA 3T44A 1JUKA 2C1HA 1F05A 2C16A 2DP3A 2DJLA 2DZVA 5F2IA 1XUUA 3WK0A 3DKJA 1OX5A 2ZFAA 4PCFA 3IIXA 2V2CA 3TH6A 3LERA 1UCWA 4NXSA 1K7XA 3S9YA 1NF7A 5DY3A 3RLVA 3M47A 2C0AA 3PWAA 4O12A 1W54A 4M6PA 4O8RA 1I2RA 1ZJIA 1LOSA 1WDWA 4QNEA 1VLIA 3NAVA 2KZHA 3C56A 1LBFA 5DN1A 4M7TA 4Y8FA 1LRQA 1KLZA 3M5ZA 3HPZA 3W1QA 2OCZA 3LCXA 3A9IA 3HIJA 5D09A 1NFBA 4OU1A 5FF4A 4CCDA 4Q4KA 3GDLA 4FO4A 4UCGA 1SO3A 2OT1A 1GQNA 4O0KA 3FOKA 3LM7A 1Q6RA 1GYLA 3GR8A 4FIRA 1DL3A 4UFJA 3NM1A 2G95A 1SZGA 4MFEA 3C2OA 3GLCA 1O94A 1SO6A 4IX2A 3N34A 4WQ6A 3R5EA 4PEKA 5HINA 1YTEA 4A22A 1H7WA 1XI3A 4Y9AA 3SI9A 1I8JA 4O1AA 1JCXA 2DZUA 4S1FA 4DXVA 2R94A 3GDRA 4UTWA 1GOXA 1VYRA 2NWSA 1W5MA 2H3BA 2YYUA 2JKEA 4LVFA 3MWAA 1AK5A 3O63A 2R8WA 5LNSA 1H63A 4FIQA 1OABA 3C0JA 4FX7A 5FF0A 2X2GA 1LRNA 4I9AA 3W2NA 1QPRA 2V82A 4JTHA 4P61A 3O6DA 3O1NA 5TIMA 2DZTA 3M6YA 3BVJA 1OFRA 1MEHA 3DHFA 3TDFA 2Y7FA 4H6KA 2UV8G 3PBWA 4O28A 5CPOA 1ML1A 4MYAA 5EL1A 4OGZA 2YCEA 2B7PA 2EF9A 5KITA 1O95A 4WY0A 3CWOX 1TB3A 3UZJA 3KVLA 2E5DA 4N9EA 2C13A 3IIZA 1HL2A 4OWGA 3GDKA 2EHHA 1G69A 3TV8A 4O50A 5E93A 4UNLA 3E0IA 1YPIA 1H5YA 3CQ0A 1OK6A 3LTPA 4P2VA 2ZRYA 2O7SA 5CPNA 5HR6A 3W87A 1N7KA 3NVTA 3GAYA 1B9BA 1PCWA 3W9ZA 2QUVA 3LHUA 1I2NA 5FF7A 2GVLA 3QPYA 1QFEA 3HG2A 4IOTA 4M6QA 5FEPA 5AYXA 3NQFA 4WY0F 3IGUA 1CX9A 4GXMA 2V81A 5KINA 4K8EA 5F1UA 4K6AA 5HMSA 3P80A 3F4NA 1R47A 2A2IA 3ELFA 1ADOA 3LCLA 3P81A 4R53A 3MYPA 4ALDA 2AAMA 3W7GA 1RPXA 2WQPA 3EWUA 3N2XA 1BTMA 3SGZA 1G7UA 2V5LA 1E51A 2ISWA 4HN4A 4N02A 3O05A 3BPWA 4PTNA 2FIQA 5EBUA 4A3UA 3OHIA 1SW0A 3GYEA 5ABTA 3I65A 4JTIA 3EX1A 1EWEA 3NPVA 3B8DA 1WOBA 5D04C 3WJXA 4MVAA 1LOLA 3GNNA 3LRMA 4RXGA 3NQGA 2V2HA 3EX2A 2HMCA 3W74A 4MYXA 4O14A 1Q45A 4FNUA 1ME9A 1QR7A 4HNVA 4N6FA 4Z1AA 3GXTA 2V9DA 2WO5A 5CPLA 3G0XA 3IGXA 2Y85A 4LRSA 3L0KA 5HUPA 1UASA 3M41A 5D2WA 3UPWA 3IIVA 4DPQA 4GE8A 2YDAA 1UBSA 1LM1A 3C52A 1EEPA 4X2RA 5DCDA 3TAOA 2X1UA 2PURA 1I2QA 1F73A 3DFOA 1XL9A 2GJNA 3DBPA 3CC1A 1LTDA 3QW4B 2WSRA 4S2BA 1X6UA 3NM3A 3QF0A 4NX0A 1JUBA 4NVTA 3GDMA 4DEFA 5IBXC 3LLFA 1KV5A 3TQ0A 2BXVA 5FF2A 3DGRA 1OX6A 3C2RA 1LBLA 1RD5A 3HMJG 1G6CA 3MP5A 2Z6IA 1TMHA 1GG0A 4FNQA 5FI8A 3PG8A 1DJNA 1C9DA 4Y96A 1IGSA 3S6DA 3PR2A 4YL2A 4PODA 4LVGA 4UTLA 1WV2A 4KFOA 1JCMP 2CW6A 4KWWA 1Z42A 2F7FA 2PE4A 4TMBA 5U7SA 2YZRA 3GNDA 4W9TA 1R2SA 3E49A 4DBDA 2WSQA 3NL5A 2VENA 1P1XA 3NQEA 1DORA 2QKFA 4UTHA 4PH6A 3QH2A 3RNDA 3FFSA 4O10A 3WJYA 5J5RA 1SFLA 2ATMA 3P7YA 1XM3A 1T0OA 1Z48A 2FPYA 3O07A 1WBHA 3A21A 2YSWA 3G1SA 1RQHA 3M0ZA 4QJ1A 3B0UX 1GPWA 3HBLA 2PC4A 1KV8A 1SU5A 3N2MA 4H4IA 1WYIA 1YPFA 3M44A 3M9YA 5F2MA 2BSLA 3NGJA 2BX7A 1FWRA 3PM6A 1TV8A 2ISSA 1IIHA 3S8HA 5DBUA 3I7QA 2Y7GA 3THQA 1TTPA 3QFEA 4O17A 4HNTA 2X1TA 4IQLA 2A1YA 4MY9A 4JTLA 4O4VA 1GVRA 4JIQA 5C6MA 1VPXA 4L4LA 3CIXA 2QJHA 1XC4A 4O16A 3STFA 3VCRA 1FCUA 4K7VA 4JTUA 4MPQA 4IXXA 3SIZA 4C1LA 1W3IA 3MUXA 1Q3NA 3DXIA 1QOQA 4M19A 3NL6A 2B7NA 2V0TA 3LCHA 4K7YA 1UUMA 3RFAA 1U83A 1PVNA 4L4MA 2C6QA 3O16A 5AC6A 3LBCA 5D2VA 1LLZA 1LLWA 1W5NA 1JRCA 3DENA 4XBKA 1JJKA 1OG0A 3HG5A 2C14A 1ALDA 1FCBA 3M5VA 4JTGA 3EX4A 2NUWA 3NQ6A 1EPXA 4TU1A 4JTFA 1ICSA 4G1KA 3TMLA 3W7QA 2QUUA 4QQ3A 5H91A 2QJGA 2Q8ZA 3NZ1A 4GUFA 2I14A 5HUOA 1A50A 5DELA 2JK2A 3N14A 5D32A 3P61A 3L2IA 4EWND 3CB8A 2E68A 5BMXA 1G4TA 3GKAA 1WOAA 2QCLA 4K36A 4YCPA 1VYSX 2Z0IA 3HB9A 3PBUA 1GEQA 3BARA 5BNKA 1EA0A 4HPXA 1F7BA 1RV8A 2JGYA 1H7RA 5TQLA 4UTWC 3IV3A 3BW2A 4I7VA 1DHPA 3EKZA 3CWNA 3P5ZA 3HGOA 4DO4A 2Y6ZA 3BW4A 3QW3A 4UTUA 3W7OA 2J6XA 4JIPA 4Y90A 3B03A 1VQTA 3W2LA 1KA9F 1SSDA 3RF9A 1GYNA 3W7MA 2GUUA 3TSMA 2VFEA 1XBXA 4DPPA 2NWRA 3W1LA 1FDYA 3L5MA 1CW2A 5IBXA 4MFDA 1F6KA 4MY8A 3UPBA 2E5CA 1QOPA 4KWVA 3TU9A 1TPEA 3LGEA 1M5WA 1GTHA 1RQEA 2Y63A 3C2EA 3LCFA 3MHFA 3NNTA 1W5OA 3LHYA 3RU6A 1M7PA 4OV4A 3W1PA 2Z1BA 3UNDA 3H54A 2QDHA 5DCBA 2WNQA 4NNAA 4AH7A 3CIWA 3CTLA 4LV9A 4ZMGA 2ISVA 3IVTA 4I7UA 4U28A 5LKYA 2YX0A 5D37A 4JTSA 5AN7A 1XDMA 5FESA 5G2IA 1G7VA 3S5NA 1ZALA 3LRKA 3L67A 2A4AA 2DU2A 3BV4A 4POCA 4EF8A 4NJGA 1SZFA 1AMKA 5LGXA 4C1KA 3OVRA 3W2KA 3QC3A 3CEPA 1ZAJA 3KHJA 2C18A 5I3KA 1B4KA 3NPXA 4UFIA 2QAPA 3MBDA 3W76A 4I7WA 3LRLA 5DXXA 4O15A 1W31A 4LVDA 4JGDA 4LC6A 2WNZA 3S0CA 3G1FA 3TKFA 4O1DA 4AF0A 1UB3A 1LBMA 5C5YA 2ZZ2A 3OIXA 4ZQNA 3W7KA 1QAPA 4JNMA 3VE9A 3JR2A 2HSAA 4IMGA 4N9BA 1JCLA 1WA3A 3W7LA 4MUZA 3LHZA 3T4CA 5G2HA 3F03K 1H62A 3I6RA 1VZWA 4M5PA 5EMUA 4DF2A 1GWJA 4QISA 1B4EA 2ZDRA 4TX9A 1B3OA 1XFBA 1L6SA 3SW6A 1HUVA 2B0MA 2NX1A 3BO9A 4UR7A 3SJ3A 3T40A 1XKYA 3I68A 3PBVA 3ANYA 4FF7A 1TPFA 4KFNA 1DQXA 5I3JA 2FFCA 4KKXA 1A5BA 5LSMA 5TBOA 2NX3A 2V30A 4JN6A 4RX0A 4UFHA 4ADTA 5AHLA 3L0GA 1EWDA 3MBFA 3KAOA 4JYEA 3A22A 3KVJA 5J5DA 1XBZA 1RVGA 4UMAA 2FTPA 2Y62A 1WAUA 3BK0A 2TYSA 4R34A 1P5BA 4CQAA 5CG7A 4X9SA 4IMDA 5CKSA 4FHAA 1VR6A 1G4EA 4WXYA 2QCDA 3TCEA 1L6WA 3S1XA 1KW1A 1LRTA 2ZA2A 2JKPA 3BG3A 5K9CA 3LI0A 4MOZA 3P5YA 1KBJA 1TTJA 4JTTA 3MHGA 3STGA 3PSVA 5CZSA 3NQAA 3B4UA 3L68A 3M7WA 3W1XA 4U4MA 2YPIA 1QPOA 1DOSA 3C8FA 4AAJA 1OFEA 2ABAA 4LUJA 3L5AA 4OT7A 4K38A 2A21A 1O60A 2VEPA 3PAJA 4LU0A 1TV5A 2JBMA 2NLIA 4CNOA 5LNWA 4FNPA 3CU2A 2X30A 2A7RA 4IXHA 1EP3A 2H90A 1GZGA 4ICNA 3G22A 3F4WA 5A8GA 3N73A 4AWSA 4JX6A 1ME7A 2E6AA 1M6JA 3P84A 3W75A 1P0KA 5AFDA 1GVFA 4E2DA 5DCEA 4BI6A 3KRSA 2R14A 4B5NA 2I1OA 5AHIA 8TIMA 1J4EA 1PCKA 3P8JA 1OK4A 5K4ZA 2YXGA 3W7EA 3ATZA 4NZFA 3B04A 4BFAA 1Q6QA 2VC6A 3EWBX 3LTYA 4LC8A 1NAL1 3USBA 4LS1A 4KFPA 1TTQA 3BGJA 4GJ1A 3W3OA 3S42A 4N9DA 3GXPA 1I4NA 3G1YA 3HJZA 3JRKA 1AG1O 4R33A 4BWLC 4MJZA 4Z1BA 3VI2A 2CLMA 3HGSA 1W5QA 4DF1A 1ZFJA 3UD6A 4CQ8A 2CLIA 1X1ZA 2QAFA 5AHFA 1YTKA 2E6YA 1JRBA 1ZHAA 3HQ1A 1YTDA 4JICA 3PBYA 4Z0JA 2C19A 5CZTA 3W70A 4O57A 4XTDA 5K4XA 3SSJA 2WKJA 1F5ZA 1FDJA 4UFLA 1TREA 5HJLA 5HULA 3QMSA 4O18A 1DBTA 1A5CA 4JTEA 1D9EA 3M16A 3MI3A 1Z41A 2A85A 1KFCA 2E09A 3LXBA 1AW5A 1TPVA 1A5SA 1NSJA 3IIPA 1RQBA 4NNBA 1T99A 4QM1A 4JY9A 4YMZA 4JD4A 2P0OA 4X3ZA 2HTMA 1IIGA 1OYCA 3LTSA 1H51A 2OT0A 4Q33A 1L2UA 1KM5A 1KTCA 1H7PA 4LVAA 1G4SA 4FX6M 1FWNA 2J27A 3L0NA 2XN2A 2OJPA 3GIYA 2FQIA 4GBUA 3IRDA 3GK0A 3E12A 5BOOA 6ALDA 1S5VA 1OX4B 2GOUA 3UWUA 5BMWA 3HG4A 4R7JA 4CLMA 1R2TA 3FYPA 4Q32A 3W7DA 4AHPA 1X1OA 2W0UA 3NOEA 2ZRUA 2TRSA 4FXSA 3S1WA 3OEXA 1K7EA 1BWLA 3ZR4A 2J9YA 4CQ9A 3TNOA 3UWYA 2ZZ1A 4UMBA 1F2JA 2A6LA 4IMFA 5SWUA 1RZMA 1SSGA 4NQ1A 5HR7A 2ZZ3A 3BW3A 3YPIA 4RKAA 4MLJA 3UY8A 2A6NA 3RLUA 1KFEA 5G1YA 4O54A 5U4NA 3EEGA 3RK8A 4O53A 3N3MA 4BF9A 1BWKA 4ZVJA 1PHWA 3QSRA 4PL1A 1PL9A 3NL3A 2QCHA 2QDGA 3W1NA 4LTSA 3LBMA 1A53A 4CCEA 1TYGA 3W85A 1NVMA 2DZSA 3TJLA 5CSSA 2Y70A 4IUOA 1ZY9A 1EX5A 1MEIA 4FB7A 3DFPA 3LV5A 1OFBA 1H1YA 2Y88A 4JY8A 2E77A 4O0ZA 4HHPA 4E2BA 4LV4A 3C3NA 3QPZA 4AEOA 3MP3A 1U5JA 5D02A 2GQAA 1H7OA 4M6VA 5GVJA 1JVNA 4UIOA 2H6RA 1SW3A 2BWGA 1XUZA 3G1AA 4H3DA 3L21A 2HS8A 2CFFA 1GJPA 1KBIA 3O15A 4JXCA 3VNDA 1G67A 3IGSA 4HT3A 3THAA 3O6CA 2X1RA 3L5LA 2Y7EA 3OVPA 3UZ5A 2ZRXA 3G1XA 3MYOA 4JEQA 3UYCA 2VEMA 3UXDA 3NQ2A 2Z6JA 3TIMA 4NZJA 5EPDA 3NQCA 2C15A 1TPH1 4XUGA 2CU0A 3W83A 3W7NA 4RJEA 2Q8LA 5HWMA 2RFGA
chains in the Genus database with same CATH superfamily
5LZLA 1FKWA 3IJ8A 3A9BA 2Z26A 3S83A 3C2FA 1TQXA 2PU1A 2WNNA 2Q3OA 1H7NA 4ATWA 1J0ZA 3UWQA 1QHPA 2DZPA 4RLIA 2OX1A 7REQB 4QSFA 1HJQA 3BAIA 2DORA 3R25A 1F6YA 2ZWYA 4XD4A 4A35A 1XGZA 3WF1A 5E1QA 1BSLA 3AZRA 2WMHA 3PANA 1CGWA 1UD8A 3R12A 4J28A 4K37A 1UJQA 2XGZA 4RV8A 4PRTA 4AZGA 2QUNA 4MJ2A 3ZVHA 5CSUA 2RGLA 1TV3A 2ZKMX 2PDBA 1JDDA 1TIWA 3E6EA 1F3WA 1TVPA 3OLIA 4PUMA 5HNTA 3QZAA 2R1NA 1RA0A 5HJYA 5HNRA 5K2ZA 2VVSA 2E1DA 2ALDA 1XV8A 3T7VA 3ITXA 3B8SA 5M17A 1KTNA 1ZLPA 1D3HA 2YYTA 5HNNA 5FCZA 2NVAA 3AXHA 5AVHA 1G4PA 5TAOA 3LPFA 4Q4OA 2GLKA 3B05A 2BBFA 4WXZA 5A2BA 4CN6A 4UTJA 3UYIA 4MKNA 5I00A 2V2DA 4E0CA 1ZGDA 2V38A 5DO8A 4IIHA 1Z32X 1B57A 3ZQ9A 3W7HA 2QULA 4MKSA 1QPKA 1H49A 2WHLA 3VKAA 3PJUA 1A4MA 1E6ZA 4F66A 4HNNA 1FWDC 1TTIA 3LK6A 3MZ2A 3A3HA 1QI0A 1GVEA 1XPYA 5IXEA 2ZUTA 3DGBA 3PNZA 3N2OA 1WXJA 3HU7A 1SJBA 1XG4A 1U5VA 1R2RA 3LN3A 2OMAA 1SJCA 3AO0A 3DEQA 1DPMA 3KBJA 1EYEA 1W56A 2ZZ4A 1YYAA 4GCAA 2ABBA 1CYGA 2OKOA 3M5XA 4IPIA 2OPJA 1U2YA 2XN0A 3A3XA 4G56A 2YW3A 2PF8A 4LXFA 4GWEA 3GVGA 2IPWA 3WBYA 3GNOA 1JGIA 1TZZA 5HPOA 3NZGA 4HSNA 3W23A 3ICJA 2EO7A 5AOUA 4IWWA 1LYXA 2QW5A 3W7JA 4KWUA 4FLRA 2C1GA 1V4YA 1NARA 4XKYA 2WMIB 3UY7A 5K9DA 4URIA 5JVLA 3WX7A 3LSBA 1CXLA 1HFBA 4EWJA 3TA9A 1QHZA 2Q3RA 1ZU8A 3CV2A 4KF1A 4E4PA 2GVJA 3NL2A 4J7RA 1YMYA 4ZQRA 3S1UA 3BLKA 1LCOA 3W7CA 2W6RA 1S5WA 5IM51 3L2LA 4FEZA 1ZL1A 1V3JA 3GZ3A 1ZZMA 4LSBA 1Q6FA 1J0KA 5IDIA 2DW6A 4U5KA 3H12A 1ZB5A 4NJKA 2FGBA 1UA7A 2CLLA 1S3HA 3GG0A 4Z0SA 3AWNA 2EBNA 3DFSA 4DYEA 2ZX8A 2XVGA 4M1BA 3VCCA 3MO4A 3HFTA 2NT0A 1PYFA 4LT9A 4DJEC 2Y89A 3PZGA 2WMFA 4UMCA 4QRNA 1YQ2A 2FDSA 4X0NA 1Y65A 3T55A 3H7VA 3DHDA 4OE7A 4AMCA 1T8XA 2IQTA 3OVQA 4LUSB 1H0IA 2BOGX 1XW8A 3N15A 4ZFMA 3PUEA 1YDYA 4LAKA 1AQMA 1EEXA 3WD2A 2PDUA 4ZOAA 1ZUAX 4ZL1A 3LLDA 5EMMA 4GXWA 5C9XA 4QIUA 1TRIA 4HJFA 3R8GA 3BLFA 4GFSA 5CXPA 3F4DA 3JUGA 4WKHA 3ZR6A 4N4QA 1X96A 4QNWA 1E5NA 1M7OA 1N55A 1P0BA 5CEWA 4LUYA 1Q8AA 4NX5A 4UUIA 3V0UA 4B2DD 1G94A 1GG1A 2PDJA 2AGKA 1XQLA 4C6NA 1E1EA 3QQ1A 2AQWA 3CBWA 1I1WA 5HANA 1FH8A 2QQ6A 1FHVA 2W27A 3MUZ1 4ZO6A 2NXGA 4P7QA 2VDHA 1UG6A 2D0HA 1IR1A 2XFWA 3IJLA 4JIRA 4AHQA 5AYBA 4XD6A 1E1FA 5C0QA 2OEKA 4Z2LA 2OWCA 2GVEA 5AHNA 4XTIA 5LIYX 4YCOA 1AUSL 3WLRA 3AS3A 1F3XA 4LWWA 4XAZA 2I17A 7XIMA 4YIWA 2QF7A 4GC3A 3BG5A 3UCQA 3M0MA 2XVPA 4OHQA 1XLEA 2XPKA 3NYZA 2P10A 4H6RA 4J4KA 3SFKA 1PTGA 1FY6A 2EJAA 3DYMA 1DKWA 2PD5A 3WLIA 4ENLA 1OBAA 2BV9A 3E0FA 3VK5A 4CVWA 3MI6A 1MRAA 1OF8A 4GMEA 2VOMA 3W1MA 1OQFA 1EGVA 2PU0A 4ZO9A 2GJRA 3MTWA 3COTA 3VKDA 1NQ6A 1NU5A 4JEJA 3FV9A 2CYGA 4QROA 3SGGA 4PUKA 3UR5A 4I6KA 1O5RA 1IXPA 4HU8A 3LCIA 2CITA 1S38A 4FALA 1FWJC 1P0NA 3HO8A 4QDMA 4A6GA 2XN1A 3Q58A 4ROPA 4UR9A 1GUVA 4UNKA 2YBTA 2GQ8A 4WKFA 3NO1A 4H1ZA 4PMNA 1QTWA 1VLWA 2WC3A 7CGTA 4Q7BA 1CECA 1M68A 4KEVA 4LBRA 1XWYA 4Q8PA 5FSDC 3ZJ8A 1WXYA 5EGRA 4MHBA 4KEUA 2PRMA 4WEVX 4JR5A 2PTXA 1PKLA 3ZVIA 1JNDA 3H2FA 4GUHA 5FAJA 3ABQA 1QW8A 3GW0A 5LA0A 2G96A 3Q2DA 1MFUA 3MUIA 3CTTA 3W6YA 2VQTA 1O66A 2VRKA 4B3ZA 1CXKA 1K7FA 1TJ1A 1XHGA 5AVNA 3FIGA 1TWSA 2OR2A 2GK1B 1HJSA 3LPPA 1R8LA 2FZ8A 2WVVB 2VZUA 2B81A 1EHNA 1TX2A 3SM0A 1DJQA 3KL5A 3GG8A 4DRSA 1ZAIA 3ITOA 1ME8A 2P76A 2Z1SA 4AWTA 3HPSA 2DQWA 3S47A 3AXIA 9XIAA 3UJRA 3FA3A 3B9NA 1AL8A 3WDIA 1EKOA 4XX6A 3T78A 3RRXA 3WQOA 3T05A 1W1ZA 3PF3A 3V36A 3QLLA 2DJXA 4PB5A 3T08A 4YWIA 4RZ5A 5CGTA 1A0DA 2YCLA 3ITCA 3N2TA 1AVAA 4Z17A 5DQPA 4G7FA 1RJPA 1L6YA 3B0VC 2PWDA 3CHCA 4MMWA 3TJIA 4LYKA 2NV2A 2A3AA 3UWZA 1NOWA 3PC0A 3TZNA 3ZWTA 3N25A 5D05A 4JL2A 3WQ6A 1BHGA 1X6LA 2FZMA 5D38A 3S5OA 1YHTA 1AJZA 2F84A 4HNUA 5H8UA 4IIDA 4H9YA 4N6EA 3P8IA 4GISA 1GVQA 1XSJA 4RNHA 4BZYA 1OEPA 2XIOA 3DFNA 3P82A 3PBMA 2VFFA 3JS3A 1YDNA 5I02A 3FN9A 3CHVA 1OGSA 4PRRA 1UMLA 5LHFA 5KZ6A 5L6UA 1FXPA 2YGYA 3C0QA 3OBEA 4C6CA 2BB0A 2ZXDA 5CAHA 3I7RA 4EOUA 5E0KA 1TPDA 5H8PA 3FGCB 1FCVA 4FLOA 2OFJA 6CGTA 2ZBTA 3WQEA 4TXEA 2GDQA 3TQKA 3SCUA 3E9AA 1HO4A 3WUEA 1K9FA 5JQ9A 3W22A 5DRIA 5FF3A 1OJXA 1Y0EA 3O06A 5IHRA 5DBTA 4HHHA 2H9AB 3JZUA 3UT0A 3MKVA 4XKMA 3VOFA 1V03A 4IIEA 1FUYA 4KH2A 2ZTKA 1XRFA 3G1HA 1HGYA 4RZ6A 4L6DA 4Q8UA 3SUTA 5LIXX 2WJZA 2Y8VA 4Q8MA 4KT2A 4FF5A 3LNMA 4BR1A 1SPQA 4MPKA 5LYRA 2F2KA 4DYJA 1EQPA 2PODA 3WDPP 3MI2A 2VURA 3QHNA 5CAKA 3NGFA 1EB3A 3UEQA 1KFJA 4OIFA 1X38A 1OC6A 5BW6A 3WK2A 5H2ZA 4MWAE 4JTRA 4OZOA 1MEWA 4QG8A 3B9OA 4PEEA 1NIUA 4UFMA 4FA3A 5AYZA 4FXJA 4ZE4A 5DXYA 1FWTA 1EZ2A 3KBVA 2DZAA 1GGOA 4JDYA 3VDBA 1SZRA 2HZGA 4NAEB 1V3MA 1JPMA 5CGMA 1D3GA 4DI9A 2YR1A 4AYSA 3U2OA 5AC5A 2FYMA 3M0VA 3VFLA 4WGHA 3SRHA 2PDLA 1VIWA 1JDCA 2OGYA 1VBUA 3IVUA 4QE5A 3ATYA 4PBFA 2P8BA 3LCWA 1DV7A 1TJ2A 2GPTA 4G8TA 1XYAA 2JF6A 4PMOA 1HO1A 1ITQA 3TQVA 3T8QA 3DHUA 3WK3A 2ZC1A 3S5YA 3R2GA 2ZICA 1TG7A 3NQ7A 3CPRA 5CSRA 4DB7A 4ACYA 3TW7A 1ECEA 4HK5A 3A23A 4ATDA 2P53A 5CC7A 1GT8A 3TYEA 1P4CA 5BXRA 3WUBA 4L9XA 1BF2A 4FLQA 4LW7A 1K9EA 3NCOA 4W88A 4OOZA 4XSMA 2DP3A 4BQ4A 2D2OA 1XUUA 1DJXA 1G01A 1TELA 2ZFAA 3GZAA 2E9MA 4PCFA 1H1NA 3IIXA 1XYBA 4HNOA 1UC5A 3TH6A 1HVQA 2ACSA 5DY3A 3RLVA 4PUEA 4OJYA 3LENA 3PWGA 1I2RA 4B3KA 1MUWA 4HZ7A 2VC7A 5A8QA 1LOSA 3VKKA 3DECA 1LBFA 1UKSA 3GHRA 1LRQA 3HPZA 3S6OA 4DJED 1W1TA 5DMYA 3BSMA 3QV7A 3PZNA 4B4FA 5REQB 2A3HA 4FIRA 1DL3A 3NM1A 3OHMB 2G95A 1E0WA 3GVVA 2XG9A 2BS9A 3N34A 1V3LA 4H9VA 1WNOA 5A8OA 1H7WA 1XI3A 1QW9A 3B8VA 1I8JA 3OO2A 5I78A 4UTWA 1L6FA 4NAFA 2NQ5A 4ERGA 2NV9A 3DC8A 2YYUA 2JKEA 2GJPA 2F8QA 4Q3MA 1AK5A 3B3DA 3ITLA 2R8WA 2P88A 5LNSA 4FIQA 1OABA 1QT1A 1UP2A 2C1IA 5FF0A 2YJQA 1ZBCA 4ES4A 4GVIA 4FSAA 1QPRA 3STPA 3THCA 2DZTA 3M7SA 3M6YA 4HPGA 4CGTA 1KCLA 1MEHA 3DHFA 3TDFA 2GGJA 2Y7FA 4H6KA 1J0IA 5CPOA 1R87A 1TE6A 2B7PA 1TB3A 2AQVA 1UR0A 3IIZA 3BSHA 3AIVA 1RBLA 2GJXA 1G69A 4G7EB 1AZ2A 4N42A 2NT1A 1OT2A 2PLKA 4KCTA 1B30A 1FH7A 3NVTA 3GAYA 2FGZA 2CHOA 4Q7IA 5ECUA 3SRDA 4IOTA 4WY0F 1QU4A 2WVSA 5KINA 1Q4NX 4L80A 4K6AA 3F4NA 1YIXA 1R47A 2A2IA 4H8UA 4LUTB 4XAGA 4R9OA 1RPXA 4IQJA 2INFA 2O55A 3ARYA 4GINA 1E51A 3O05A 5EBUA 4GYPA 4A3UA 5CJNA 1I60A 3VX1A 3EX1A 4WJXA 3B8DA 1QXLA 3CUFA 2Y8UA 4MVAA 1LOLA 3GHUA 5FAGA 3NFUA 2DZBA 1I6NA 4Z1AA 3NTYA 2P5NA 3GXTA 4AD2A 5FJIA 4PYSA 3CZEA 5HUPA 3H21A 3FAWA 1HZYA 3G5EA 1MDLA 3FA4A 2E3ZA 4RDYA 3E2QA 5A94A 2YDAA 3V4BA 4IPNB 1AJ2A 4X2RA 4GYFA 4RZBA 1UR4A 2FVKA 1NFPA 1UUQA 1XL9A 2GJNA 4LYQA 4MWAC 4AY7A 4K3ZA 5E9AA 4PCPA 1M01A 1LTDA 4ML4A 4QEHA 1ITUA 1JUBA 1T40A 1K70A 3QY6A 2WMKA 2D20A 2BXVA 3VD9A 1EX1A 4J3VA 1UKPA 4QCEA 3WF0A 3HMJG 1G6CA 2G4FA 3MP5A 3NJ3A 1GG0A 2OQYA 3PG8A 4F79A 2E28A 4Y96A 4HJWA 2OXNA 4QXIA 5JBEA 2QYGA 4YL2A 4UTLA 1VEOA 2I57A 4DBWA 3I4EA 3F2CA 4BY3A 5HJXA 2PE4A 5U7SA 2YZRA 4GBDA 1EA9C 3R79A 2WSQA 2VENA 2E4TA 1RK5A 3QH2A 3RNDA 3FFSA 2DW7A 4F0SA 4S23A 5E0CA 3JVAA 2G3MA 4D8ZA 1UD3A 4F0LA 1WBHA 3MMWA 1D7KA 3VPLA 3M0ZA 4XZHA 4MDOA 3HBLA 4W7UA 3RAOA 3JU2A 1KV8A 2CBJA 1WDSA 2G3FA 3M9YA 5F2MA 2Z00A 1IT7A 4NZ3A 1JZ2A 2BX7A 1F8IA 3PM6A 5C8BB 2ISSA 1RHCA 5DBUA 4RDWA 1JD7A 1WDRA 4HNTA 2X1TA 4C65A 4JTLA 2O4MA 1GVRA 4YHEA 3LY0A 5C6MA 1VPXA 2QJHA 5ABHA 1GOOA 3E2SA 2BGSA 3STFA 3DG7A 1K1DA 4K7VA 3WKZA 3SQSA 4MPQA 6A3HA 5FSEC 1W3IA 4HOXA 2D2GA 1Q3NA 4TUFA 4CU7A 5CBBA 1KB3A 3R4IA 3WBEA 4K7YA 3H23A 2P0IA 1U83A 3VNJA 4L4MA 4Y2WA 4C6DA 5D2VA 1W5NA 8CGTA 1JRCA 4AY8A 3MDWA 1FKXA 3K1GA 4PBEA 5KETA 1E6SM 3EX4A 3NQ6A 4S39A 2D23A 3CH0A 4QQ3A 3WEOA 2OKTA 1EXPA 3OZYA 3H4XA 1G1YA 3CAWA 2I14A 5D4YA 5BRPA 3N14A 4MUPA 4UB9A 3KZPA 3L2IA 4ZGYA 5C9WA 4EWND 3CB8A 2E68A 4CNTA 1GEQA 1RJRA 5BNKA 2I56A 1UZ1A 1EJVC 5I03A 4HPXA 1PXGA 4TX8A 1QHOA 4I9JA 3VIPA 1VEPA 2JGYA 1H7RA 3QGKC 4M81A 1RUSA 3DN5A 3K4AA 2D2HA 2Y0FA 2J6XA 4JIPA 3B03A 3RF9A 3TSMA 4H8VA 1FFQA 1XSKA 2VFEA 3K13A 2OYKA 3AUOA 2DIJA 1TMLA 2WMIA 3L5MA 2ACUA 5IBXA 3QOKA 4MFDA 4PTDA 3MU7A 3LZ3A 2NVDA 5CG0A 3TU9A 1TPEA 1LL4A 2OWWA 3NNTA 4ZO8A 3U5UA 1CXIA 4DZIA 4MWAB 3VMPA 2QDHA 1IE7C 3NO3A 4AH7A 3IVTA 3SCTA 2YX0A 1W1VA 1A0CA 3KL3A 1CENA 1M03A 3PK7A 5BOFA 1GZJA 4JTSA 2V69A 4QEEA 1PO9A 5G2IA 1HXJA 1UWIA 4POCA 3TYBA 1SZFA 1AMKA 1W1B1 3QC3A 3CEPA 2GVYA 3NPXA 3CQHA 1CEOA 3MBDA 4S3EA 4KERA 4XD5A 4O15A 3E5BA 4IM4A 1W31A 4EXAA 4A8RA 3TKFA 2WLZA 3EDJA 3FDKA 4R27A 4JNYA 1NOUA 3CGTA 2DUZA 1B3VA 1KXQA 2QV4A 3CV7A 1E56A 4JNMA 4W5ZA 2OLHA 3WY1A 3CUGA 4LUSA 4CU8A 2HSAA 3QR3A 2WVTA 1PZ1A 3LHZA 3T4CA 5I09A 2G3JA 3F03K 2ZWZA 4OBRA 1GWJA 3O0FA 3UNTA 4TX9A 1B3OA 4MJ4A 2NX1A 3T40A 3VIIA 3BUVA 3N4AA 1HJUA 3PBVA 1FWBC 2FFCA 2VDGA 4Q4QA 1A5BA 1LUCB 3RPTA 3W29A 1UBPC 2CPUA 3FCPA 3QGAC 4JN6A 2Z29A 3MV01 5E6ZA 4JYEA 1JAKA 3A22A 1BLIA 1R85A 1AQFA 1AJ0A 2ZUMA 3R43A 1XBZA 5A8MA 4K8GA 5CG7A 4HA1A 5H8MA 1E6XM 1FWFC 2X7VA 1KKRA 1KW1A 4C6MA 3BG3A 3KM8A 4GQRA 1S1PA 3ZJ7A 2ESCA 4CN1A 1PKMA 3STGA 5CZSA 3QY8A 5EB8A 5E5CA 1QPOA 1DOSA 3APGA 3OGVA 1XIHA 2A21A 4HA3A 1O60A 2VR4A 2PWHA 2OSYA 3I6EA 2VEPA 4LU0A 2YL9A 2YB4A 1TV5A 4AISA 2QDEA 4CVUA 1EDGA 4P7OA 4Z1YA 4IXHA 1HL9A 4TX6A 3F4WA 3UA3A 1LG1A 4H19A 5A8GA 2PP3A 4W85A 1ME7A 1DYSA 2Y5JA 2ODOA 4ACZB 1PKYA 2FTWA 4BI6A 1ZJAA 3OYZA 2R1PA 2J47A 2WXDM 3MCOA 5BWAA 2OX4A 1IYXA 2YXGA 4Q8VA 4NZFA 2O9TA 3EWBX 3MUY1 4LC8A 1RP8A 3CL8A 3BGJA 3W3OA 2PBGA 3WEZA 4BQ5A 3NEHA 3GXPA 3G1YA 1AG1O 3DHPA 1Y5XA 4RE3A 3MMUA 9CGTA 3MV11 2CLMA 4H9XA 3BICA 3HGSA 4BHYA 3L4ZA 2CLIA 4TV6A 2ZVIA 5AHFA 4CNUA 1ZHAA 1Q6GA 3FYYA 4E2OA 1GVIA 3PBYA 4Z0JA 5CZTA 3ZT6A 4F9DA 2BG5A 2WKJA 1F5ZA 2G0WA 1WKEA 1TREA 4GKLA 4M3PA 4O18A 1A5CA 4JTEA 3M16A 1KQZA 3LXBA 2FVMA 3IJDA 1A5SA 1NSJA 1R9ZA 4ERAA 1P7TB 4S3KA 4YTSA 2OYLA 3OZMA 2QXWA 4JD4A 3CHDA 5IRPA 3I3EA 2OT0A 4J3SA 1KTCA 5JMUA 3WLHA 4LVAA 1G4SA 3LD5A 2XWEA 2J27A 5T9BG 3GIYA 4W89A 4GBUA 2XIMA 2YDQA 4B5VA 1YRRA 3E12A 1TV4A 1G0CA 4B4HA 3FJNA 5BMWA 3HG4A 4G5DA 4E4UA 2W0UA 3NOEA 2ZRUA 4FXSA 3S1WA 2R24A 3E0VA 1K7EA 3ZR4A 2HCVA 1QATA 3HZ3A 2ZZ1A 1MUCA 3BE7A 4UMBA 2A6LA 4IMFA 1MW1A 2PDMA 1SSGA 4NQ1A 2FJUB 4FZIA 3BW3A 4RKAA 4Y8EA 3UY8A 3GXMA 4MDPA 3RK8A 2Y2WA 2J8FA 4PUUA 1PL9A 2DSVA 2QDGA 1ZBKA 3NL3A 1PDYA 1PIFA 1BVWA 3LGGA 4CCEA 1TYGA 3ALFA 3KEHA 1RCOB 1NVMA 2DZSA 3TJLA 1DJWA 2Y70A 2XUCA 3SIMA 1LL7A 2E1WA 1ZY9A 1EX5A 1OFBA 1H1YA 2EQDA 4JY8A 1XH1A 3RO8A 2PUZA 3E0WA 2I7GA 1ITCA 4L65A 2ONEA 2GQAA 2F61A 3S2JA 5GVJA 4KWOA 1PWLA 4UIOA 5TF0A 4LCSA 1SW3A 5GJPA 2J7FA 1X97A 1XUZA 2HS8A 1CNVA 2CFFA 4HYVA 1QNSA 4W8BA 3VNDA 4Q8TA 3IGSA 4M8UA 1YKWA 2Y7EA 3UR7A 3M0HA 4QFUA 4NZJA 2F6XA 2VL4A 3NQCA 4DM2A 4IIGA 1V02E 2Q8LA 3T42A 4MM1A 5C2CA 2CWNA 3AIRA 2UBPC 4UTKA 1CI1A 1W9UA 1F76A 5M1TA 1Q6OA 4ICCX 1WQ5A 4EIVA 4BWLA 2BTMA 3K4WA 1JQVA 3S1VA 1V0LA 3MKCA 3RMJA 1FWCC 5B7YA 3SQMA 1MQQA 3LA4A 5FJOA 5D33A 5D2YA 1BYAA 2B7OA 4PB3A 3DC0A 3FGCA 1OD0A 3CO8A 2XU2A 1PV8A 1R3YA 3C2YA 2J7EA 4LCQA 4U2ZA 1EP2A 4DAIA 4GC4A 1ODUA 1ONEA 4JX4A 2ZZ6A 1K8CA 3WQ8A 2DH3A 3UFYA 1E9YB 3OZPA 3ZT5A 1UH3A 1UZ4A 3UA4A 1QUMA 4LBSA 1JI2A 1ISWA 2ZYFA 4JTDA 3VNIA 2POTA 4MZ8A 4P8UA 2QGYA 4DLMA 9XIMA 3IEBA 2VD8A 3SZ8A 1MXSA 3ID7A 4DJDD 4IJBA 3RPMA 1HNYA 3HFYA 2Y61A 3FLUA 3PG9A 2YL5A 1XLGA 4GUJA 5K9XA 4IIBA 4YVPA 2QIIA 1M7JA 1SZEA 2I5QA 2VELA 1L8PA 4NRRA 3FJ6A 4QLJA 5D2TA 2A3LA 4F48A 3WENA 5I3IA 1PX4A 1V5XA 1LZOA 3VFCA 1QRQA 3N1AA 4KEMA 2WW5A 2EPLX 2ZUUA 3W7RA 4IG2B 4NI3A 4REQB 3FEQA 4ZSUA 2PRLA 4DBSA 5C9RA 3T2QA 1C29A 4EACA 2D0GA 3TTSA 1HKIA 4QS5A 3P0XA 3F2BA 4NXKA 1KLYA 2DFAA 3CZLA 3ABZA 1VJIA 1BWVA 3W1RA 4NAEA 4FOKA 4EAMA 1E4MM 1EC7A 1SQ7A 3PZTA 1KM2A 4S3FA 3UXAA 3ARUA 5I3FA 3EX6A 5IFPA 1P6BA 3GNXA 2ZA3A 4GYJA 1R3SA 2AL2B 2J7DA 2PAJA 4TQTA 3WNKA 2ATSA 3V0TA 3E96A 3NR0A 3K1DA 2ZX5A 1U22A 4F9JA 1QWGA 3K8KA 4HK7A 3N6HA 3WD4A 1W3NA 2WHMA 1PAMA 4JTJA 3CH9A 4DXKA 1EDQA 2VVNA 1TRDA 3G8EA 4ZSTA 1BVNP 1T6MA 2I16A 1KM1A 1FH9A 4H04A 4XZLX 1K6WA 1WZAA 1XCWA 1TPWA 3W2MA 3H53A 1IHIA 1RH9A 3BLIA 3VOGA 2FDMA 4LX4A 3W71A 4MZ1A 4PFHA 3WELA 4L9ZA 3WFZA 3SY5A 2VOTA 5CBJA 4HMEA 2IW0A 5C9ZA 3V3WA 4OQVA 4CEUC 1RPKA 1ZCCA 5FA5A 1OYBA 2E6DA 5IHSA 3MJYA 1TIMA 3GHSA 2RH9A 2IQDA 2R1LA 1ECQA 1FVPA 2P3EA 2X8RA 3LOTA 3EOEA 4N4PA 4QP0A 1XXXA 2XIIA 3EOLA 1JQXA 1UIOA 2X16A 3AROA 5F4WA 1DIDA 1Q2SA 2OLAA 1EUAA 3CB3A 3L4UA 4IFKB 3U2CA 2TPSA 1J2WA 3CMGA 4UOJA 3ARQA 2BVYA 3A12A 4JQ4A 1K8ZA 3ES7A 1FOBA 4WHBA 4DBEA 2WPGA 3RM9A 1MO0A 3AYSA 2W92A 3R11A 3AWOA 3FS2A 3UG8A 1W0MA 5FOOA 2RUSA 1QNVA 4C91A 2UY4A 1I2PA 4N2YA 1HJVA 5REQA 4E3TA 4JCMA 3GTIA 1GOQA 1AODA 4PC8A 3CV6A 3CZ8A 2VHLA 3N04A 1EF3A 2V6AA 4JTKA 1W1A1 3H55A 1F07A 1LQ0A 2CLPA 1IT8A 4O11A 1FWEC 2GGGA 3NG3A 3RPDA 4ZQOA 4IISA 1ZCOA 3ISIX 5JU6A 3W86A 5FJTA 2FJKA 3KWSA 4IQEA 4QHRA 2D1ZA 5LGZA 1H2JA 3RX3A 1XDJA 1DXFA 1GTEA 1MSSA 1NEYA 4WDUA 1WP6A 2JE8A 1VBRA 2QCGA 1OFAA 3VUSA 4Q6JA 4JN7A 4HU3A 5H1WA 4E38A 1IV8A 2ZIDA 3AS1A 1V93A 4LY8A 4JAWA 4XAPA 2PDIA 3EX3A 1O5XA 2DIKA 1XCXA 5ABFB 2CKSA 3NVDA 3HPXA 1H50A 1VHCA 3M0YA 9RUBA 1F4HA 4JKLA 4X9YA 1BYCA 4BF5A 3UWWA 1KD0A 3GB6A 3WEMA 2HJPA 3QMTA 2VEKA 4G7EA 3MDUA 2R1KA 1XKJA 1DIKA 1V7AA 1D8WA 2H8XA 1GQLA 6XIAA 1J9YA 2ANUA 1UOZA 2GSHA 3WLTA 1Q5MA 1K8YA 4ZBCA 3ABOA 1PZ3A 4J9JA 3V18A 2YDSA 1SO4A 3PTQA 1FQ0A 1VFSA 1IQ8A 3GAKA 3GHTA 3QVQA 3VXGA 1GOMA 4TVDA 5F4SA 5LNUA 3QMRA 4WY0B 4H8HA 2NUYA 3MHUA 4LUTA 2WKGA 5A3HA 1NTHA 2A7NA 4F3HA 1ZP3A 2BHZA 4NRSA 3QYQA 3RN6A 3VNLA 1JD9A 1IWBA 3SN1A 2IKHA 4PMDA 3SCWA 2CESA 3TXZA 2XIBA 5L9FA 4GA8A 4AB4A 4O13A 5AYIA 4UTFA 2VFDA 3RXZA 3M0IA 1XLCA 1J5TA 3R10A 2PMQA 1BG9A 2A0NA 3V1PA 2VM8A 3RCYA 3BAJA 1VCGA 1Q66A 4WOQA 4LS0A 3TC6A 1MVYA 3E1F1 3FNDA 4BI7A 5A6JA 1E5JA 3DDMA 5BU6A 1PJ9A 2EPNA 1QMLA 1KCKA 5I6SA 2QUTA 2FH6A 4CNNA 4GZ7A 4ZOEA 4PL2A 3LDVA 5G1TA 4B9YA 4C7GA 5CZ0A 4HCHA 3SO7A 3TR2A 4EPEC 3QLDA 2C3ZA 4WDTA 1XBVA 1XBYA 3T2PA 3KHDA 2G4JA 2C7FA 5A6MA 1TJRA 5KMYA 4GUGA 5F1VA 2ZVRA 4WSJA 4KMQA 3BC9A 2VNCA 3KCJA 1VPYA 4U33A 1K4GA 1JNEA 3G0UA 3SADA 3ZSSA 2XZ9A 2I9EA 4D72A 2DGAA 3EMZA 3M0JA 1NELA 2FPTA 1FDZA 2L5HA 5GJNA 5KZDA 3RDKA 2IPFA 4A2RA 2XIJA 1VFOA 1TA3B 4ML9A 3PY2A 4QITA 2BVDA 2NV1A 3Q37A 4XIAA 3B0PA 3W1TA 3W73A 2HXUA 3BG9A 5BRBA 2FB3A 4ZQCA 1UYQA 1EGZA 4V15A 3R8HA 3E0LA 3WNOA 1CXHA 1OVDA 5G2WA 2DZXA 2P1FA 1A5AA 1CIUA 4IP5A 1RY0A 4NZ4A 3Q94A 5CLTA 1S46A 5J8LA 2Y7DA 2ZZ5A 3BAYA 4JS3A 1ZBVA 2E9BA 2PDYA 3NQMA 5EY5A 4CQCA 1Z9AA 4GZJA 3LHTA 3G6LA 1K77A 3CHEA 3R89A 1KWGA 1UWQA 3BCDA 1JPIA 4S2CA 4I8YA 1V3IA 3OG2A 2GGHA 2Z28A 1WBJA 3UP8A 4A21A 3WK1A 1US0A 2D73A 2V3DA 1VFHA 4Y9NA 5MKGB 1XRTA 2PDXA 3TOPA 3N9RA 4XG1A 2MNRA 4FNSA 1BQGA 4XBSA 3OW1A 3MCNA 3LUTA 2AQOA 5HNUA 3ARZA 3LQLA 3S4TA 4LNYA 3ONCA 1JR1A 1MUMA 4P8VA 3VD4A 4E2VA 2BY0A 4HYRA 4BQ3A 3WD0A 3APYA 4AMAA 5K7JA 1RA5A 4UC5A 3QQ0A 3HPAA 3UQNA 1E43A 5JUVA 4O19A 4AVOA 3LBOA 4RW3A 3DG6A 3R13A 1J6OA 1QK0A 4FNRA 3RCMA 3W0KA 4HA4A 4Z1CA 4DF0A 1FHDA 1ZQ5A 1OFPA 4XZ9A 3THUA 4NU7A 4UQEA 3TFCA 4US6A 2WCAA 3M46A 3PB2A 3PUOA 4RW5A 1AA1B 3C61A 1BRLB 4C6JA 3GR7A 1HF6A 3QJAA 8XIMA 3NQDA 2X05A 1DXEA 4C60A 3WBXA 1DXIA 4E5TA 4LGXA 3W2JA 4BS0A 3DAQA 5C2XA 1FWWA 1KRBC 1BD0A 2PGWA 3ES8A 1T41A 4A3HA 1HTIA 2YFOA 1THFD 3GKFA 1PKNA 3G3MA 1KGUA 3S2LA 5FEZA 4MADA 3S46A 4Q7NA 5A95A 4MWAA 4H00A 5CPSA 3ORWA 3W1UA 1OHLA 5MHBA 3P62A 4RR4A 2Z1VA 3NYDA 4QE1A 5CPMA 2X42A 1PHQA 3SN4A 3W1AA 1BXCA 1B9ZA 1UZHA 4OBTA 5BZAA 1WDPA 4DN1A 2Q71A 2CZFA 1RCQA 1N82A 3KVMA 3N29A 5AC7A 3IK4A 3EKLA 5CPQA 4M82A 1E6QM 5T26A 4PA8A 1DTUA 5I79A 4AZ5A 3EWWA 1NDYA 4GI9A 4NKCA 4X22A 1BTCA 4FXRA 2XFRA 4V1XA 3I6TA 1REQB 5AKQA 3G1RA 4QLKA 5FL1A 4BEUA 4LF1A 3GG1A 2J74A 2NUXA 3GYCA 1YPXA 1H60A 1ICQA 2YXOA 3MMTA 3G18A 3FJLA 1BXNA 1XDLA 3SURA 2FZBA 3VKCA 2EGZA 3VCNA 4MB1A 4IPJA 2PTDA 1V7YA 4AD0A 3KX6A 3HQNA 1P48A 1IXQA 1CCWB 2GSEA 1YXDA 1LUCA 5AC8A 2V5CA 4H7ZA 3TXVA 4GRSA 3GUGA 3T44A 3ZOAA 1F05A 2DJLA 5AY7A 5F2IA 1MMFA 4UZSA 2XIQA 3WK0A 3DKJA 1V08A 3TN4A 4DWSC 3AFBA 1BG4A 4YVXA 2PDCA 2V2CA 1Q2RA 1QJWA 4NXSA 1KR1A 1K7XA 1TV2A 3S9YA 2EXOA 3P0WA 3U2ZA 4ASTA 3QBUA 4F40A 2C0AA 4M6PA 3QV6A 3VD3A 1J8VA 1C93A 4O0QA 4L1XA 4PSRA 3K46A 4WR3A 1VLIA 3NAVA 3MY9A 5ECVA 3CIVA 3C56A 5I07A 1AFSA 5C70A 5DN1A 4Y8FA 1KLZA 3M5ZA 3QR1A 5EFDA 2BVWA 3W1QA 1O7AA 1OIMA 1Q63A 3OODA 4OU1A 5FF4A 4CCDA 4Q4KA 1BYDA 3GDLA 4O0KA 4A8NA 3WH7A 1VBHA 2X40A 3AQUA 4AX7A 3FOKA 4V27A 3LM7A 2YCJA 4ACZA 1Q6RA 1CWYA 2VI0A 4MFEA 1E55A 1XYCA 5FJJA 1CGUA 3GLCA 1O94A 3T81A 2WNWA 3VMNA 3K2GA 4FS9A 2WMGA 4FLSA 4JN8A 1J18A 3B9EA 1W3LA 1JCXA 4S1FA 2R94A 3E2RA 2EPOA 3GDRA 4DHGA 1S2UA 1VYRA 2INEA 2NWSA 4D6CA 4L6HA 1UPMB 1T7LA 1UR2A 1QNOA 1GEHA 4JL1A 3C0JA 3FHAA 4FX7A 2X2GA 1OCBA 3W2NA 4KCUA 2V82A 4JTHA 3O6DA 2C71A 5TIMA 1YNQA 3BVJA 2HNEA 4F2UA 4J3UA 3A6OA 1R7AA 4MYAA 2YCEA 4TV5A 2QMJA 5XINA 3CWOX 4L1WA 1M04A 3F4VA 4LQ1A 4N9EA 1EQCA 4TTUA 4OWGA 3GDKA 2EHHA 1ZPTA 4A3YA 1PSCA 3TWAA 3S1GA 4GH1A 4UNLA 2BY2A 3E0IA 1H5YA 3WQVA 2I9UA 3CQ0A 4AWEA 3LTPA 3GU1A 2BODX 3Q45A 3S2CA 4DZ5A 3TLLA 2HXTA 4H7CA 5HR6A 2CBVA 1B9BA 4UBPC 1PCWA 3W9ZA 2QUVA 2VGFA 1I2NA 5TNVA 4WCJA 1B3YA 3QPYA 3HG2A 2ZUVA 3NQFA 1EGMA 4LANA 4IGSA 1TWDA 2Y4SA 2GFTA 2V81A 2OWXA 4PBGA 4K8EA 4L61A 5F1UA 2WANA 1OT1A 1O5QA 5HMSA 3WH5A 2X0SA 3P80A 3KLKA 3ELFA 4PUJA 3W53A 1TVLA 3V5OA 2AL1A 1DIEA 3B9AA 4AD5A 4W5UA 1G7UA 3AISA 3U57A 2V5LA 3PZUA 3N11A 1E0XA 2FIQA 3RR1A 3T09A 3GYEA 1JAEA 4JTIA 4XZWA 1EWEA 3NPVA 3AYVA 3GNNA 2AKMA 1IWPA 3LRMA 3LMZA 2HMCA 1P0DA 5M5DA 4MYXA 4O14A 1QWKA 2IKIA 4NIRA 3ZIZA 1ENUA 5CPLA 3WQGA 1S1RA 3IGXA 3PN8A 1UASA 1BPLB 2VQUA 3M41A 1JDEA 1GONA 1C8XA 1AQ0A 1GHRA 4GE8A 1JG9A 1XLIA 3UVAA 1UBSA 1WE5A 5DCDA 3WQ4A 5KEZA 1NP0A 2PURA 3ZLGA 3FAXA 3UZXA 4IF2A 4C6FA 2CERA 2VYOA 5BROA 1TZ9A 4G1NA 5IBXC 5FF2A 1OX6A 3M4HA 4ZB2A 4BF7A 2V3GA 2PBOA 1E9ZB 1TCMA 1TMHA 1XFCA 3LSCA 4RV3A 5DRCA 1C9DA 1IGSA 3AIEA 1A3XA 3PZQA 1ESWA 4MNMA 3R1ZA 1UKOA 4PRWA 2J7BA 3GWQA 4DUVA 4PODA 4H9TA 3MWCA 3V1HA 3QOMA 1JCMP 3VNYA 3ARWA 4DJFA 1EF2A 4OKDA 4Z2IA 1Z42A 2F7FA 3BMVA 1R2SA 3II1A 3U9IA 1U1UA 3E49A 3ME3A 1UZDA 4DBDA 4GZIA 4NSBA 3R58A 2YBVA 2YDRA 4NASA 3WJYA 3P7YA 3LPOA 1T0OA 4J5NA 4AG0A 1RLDA 4ZOBA 2FPYA 4JQ2A 2CXGA 3EGJA 2OU4A 1UP0A 3G1SA 1GK8A 1RQHA 2IMRA 3MSRA 2Y5SA 3B0UX 1GPWA 1UWTA 2PC4A 3GTXA 2BVTA 5I7GA 3SCOA 1C3FA 1SU5A 1TVNA 3M44A 3WLKX 3NGJA 1FWRA 5HA7A 4P7NA 4NL1A 1TV8A 1C8QA 3CT2A 3S8HA 3BV7A 2Y7GA 3GU9A 3THQA 3VU2A 3EA2A 3XISA 2Z1XA 2A1YA 2WKLA 1TE1A 1DWAM 1K6AA 4O4VA 4HCLA 4GIYA 1DWIM 1XC4A 1CXEA 1MW2A 2PDKA 5XIMA 3S3GA 2X2YA 4C1LA 3PJTA 4H9ZA 1V51A 1EJSC 1QOQA 4M19A 1ZRQA 3KTSA 5FD0A 3UJ2A 2V0TA 4IG2A 4M80A 4REQA 4WJ8A 1LF1A 1XGDA 2Q6ZA 4H8NA 3LMYA 2X0HA 5AC6A 1LLZA 3WLQA 4J3ZA 4XBKA 1JJKA 4JTGA 1W3JA 3T9PA 3IPWA 1ICSA 4G1KA 3TMLA 2Q8ZA 3E3HA 3TEVA 3WLPA 3KOZA 5D32A 3P61A 2OTDA 4G6CA 1WOAA 4A8LA 3ZT7A 5C7VA 2QCLA 4K36A 4YCPA 1VYSX 4GD0A 3CUZA 4ZOCA 3ARVA 1JZ8A 1HX0A 4AU0A 2AL2A 4HOWA 1KGWA 1EL3A 1DHPA 3HTWA 3P5ZA 4A4AA 1V6TA 3AMKA 4IL2A 3QW3A 4Y90A 1XINA 2TAAA 3LU2A 3VD5A 3CNYA 3W2LA 1SSDA 1XYFA 3WO8A 4M29A 4KBXA 4NZ5A 2VC5A 3HPFA 4MY8A 2E5CA 4JPGA 3IK2A 1M5WA 1RQEA 2Y63A 3C2EA 3WD1A 3LHYA 3RU6A 3BXWA 5HMFA 4JHZA 2HROA 1M7PA 2EPMX 1X98A 4GXPA 3VIOA 4S3BA 3XIMA 2Z1BA 4GJJA 1AH3A 3RITA 5CZKA 2YCIX 3LEPA 4UCFA 5E9XA 4XZMX 1DWFM 4K68A 3EEZA 2Y24A 3N4FA 2G41A 1XDMA 3UR8A 3QC0A 3F5LA 1XLBA 2DH2A 2DSWA 3AIWA 4EF8A 2XYLA 4GHRA 5EMLA 4C1KA 3OVRA 3I3BA 2HVMA 2C18A 3DIPA 4CCZA 2QAPA 2WLYA 5A1AA 3WQ5A 3W76A 3R94A 3DOPA 3LRLA 4J40A 4LC6A 2WNZA 5A6LA 1A49A 1GKRA 1UB3A 3ONBA 3EZ4A 5C5YA 1HN1A 4IFKA 3NSMA 3BCJA 3WH6A 2CBUA 3JR2A 5A8NA 4AD4A 4U2YA 4MUZA 3GR4A 4C6PA 3C5QA 4NILA 2VGIA 2IS7A 2ZDRA 3FSTA 4CQDA 3EWCA 2B0MA 1BVZA 3BO9A 4ICMA 5DX7A 3SJ3A 4PB4A 3FY1A 3I68A 1TPFA 5I3JA 4KKXA 4LF2A 3VGFA 2NX3A 4RX0A 1XIDA 4UFHA 1OINA 1EWDA 3GTNA 3MBFA 1FWGC 3KAOA 3NIYA 1JFHA 4QTGA 1NH6A 5GNXA 4KGLA 1RVGA 4UMAA 1A3HA 2FTPA 2Y62A 3QXBA 2TYSA 1F3EA 5CKSA 1HKKA 2P8CA 3ANVA 2OODA 3S1XA 4W7WA 1P6WA 3REQA 5HMDA 1Z69A 1VBGA 3T1GA 4IGNA 4MOZA 4GZEA 4IHCA 1FRBA 2QVHA 3P5YA 3MMDA 4GI8A 3CUJA 1PUDA 4R9XA 3M7WA 3OTRA 4U4MA 4HMNA 4YN5A 2YA2A 1OFEA 2ABAA 5HXMA 2D69A 3L5AA 4HNCA 2DSUA 1ADDA 2PFHA 2INZA 3WF3A 3ARRA 3WBAA 3A64A 4AQLA 5ABFA 2WSPA 4IH3A 3ZO9A 1L0PA 1GZGA 4ICNA 4OVXA 1UKQA 4JX6A 3UETA 4EPKA 1M6JA 3V7PA 4C6EA 4B5NA 3R7MA 2I1OA 8TIMA 1J4EA 1PCKA 1OK4A 3EYPA 4YTTA 4XIMA 3RM4A 3ATZA 1EDTA 3B04A 1YBQB 4BFAA 4NYUA 1EIBA 1B5TA 3USBA 1NAL1 1TTQA 1MW0A 4GJ1A 2VP8A 5B80A 4R33A 4BWLC 3GC4A 4JBRA 2VZOA 3NSNA 2WCGA 2QT3A 4DF1A 3UD6A 1IZKA 3SDOA 3THDA 1YTKA 4GX9A 1IEVA 1MZRA 1XJBA 1YTDA 4JICA 1JZ3A 1UMYA 4O57A 1GKQA 4XTDA 3PPFA 2CCRA 2XVLA 4Q8OA 3BJFA 4PMYA 5HJLA 3VIHA 4ZTYA 3K8LA 3VTRA 1DBTA 3MI3A 4CKQA 3BOLA 3WQDA 1AW5A 3IIPA 2GQ3A 3MZNA 4JY9A 4H01A 1DJHA 1IIGA 4CEXC 1OYCA 1HL8A 2Z2AA 1H51A 3W6LA 1E0UA 1KM5A 5AZ1A 3EA1A 3LM3A 4H9UA 2PLJA 4WSKA 4Y7EA 1FTXA 4H2CA 1DWJM 3BTNA 3GK0A 1S5VA 2GOUA 5EFFA 1ZS2A 1VBJA 4R7JA 4Y9OA 4CLMA 1R2TA 2QV5A 3AHTA 5RUBA 4AHPA 2DIEA 3NWRA 3OEXA 1Z6KA 4I5RA 1JZ6A 3CL6A 3KOWA 4JHMA 2ZZ3A 2FZ9A 2A6NA 3DBNA 3BSGA 4GY0A 5U4NA 3EEGA 4O53A 3N3MA 4ILSA 3CAQA 4BF9A 1BWKA 1NWTA 4K1GA 4LTSA 2HRWA 3LBMA 4WF7A 3BOFA 1A53A 2PDPA 2Z24A 3WSUA 4TVCA 3OGRA 3VDCA 3UW6A 3W85A 4IUOA 4EKJA 3T4WA 3VNMA 3DFPA 2Y88A 4WRHA 3WQWA 1R0MA 4O0ZA 4LV4A 3C3NA 3QPZA 4AEOA 2NQHA 3EPMA 3UCDA 2CHRA 4M6VA 4W84A 4RDZA 1EFZA 1JVNA 2PWUA 2BWGA 1UH4A 4HU0A 4H3DA 3ITGA 3L21A 3PP7A 4E3VA 3VILA 2E8YA 3OPSA 2VX6A 3O15A 1RSCA 2Z7GA 3MUCA 3SUVA 4HT3A 1O12A 3PHAA 1M65A 3THAA 5JBDA 1OY0A 2IPJA 2ZRXA 4JEQA 4AC7C 2VEMA 3UXDA 2WQDA 2WBGA 1A4LA 2VCBA 1R5YA 2I5GA 4B5SA 1KRMA 5F7UA 3W83A 3M07A 5HWMA 3CM4A 3G8RA 1V02A 2QPUA 2ICSA 1AW1A 4XO7A 3GH4A 5D2XA 1JYNA 4DWDA 4KQNA 2PWGA 3T6CA 2F9RA 3K8MA 1TUFA 3BLLA 3FVDA 3NQ8A 2YL8A 5LNRA 4FX8A 2BGNE 1W9DM 1V77A 3K4DA 1JZ5A 1AW2A 4GY7A 3I3DA 4INFA 4S3AA 5HWJA 1KTBA 1M3UA 4MY1A 3W81A 2J13A 3WMCA 1DQUA 1Q13A 1FCQA 1SM9A 3XINA 3PTKA 3H4GA 5CQ1A 4KEZA 1IEWA 1R30A 2J62A 1DJZA 1OD8A 3A4JA 3OBKA 4NI8A 5A8PA 2CZ5A 3D46A 3WQCA 4JCLA 5CC5A 3ITTA 4LUIA 3SJNA 3T0DA 4IP4A 1Y7VA 3PJWA 2PSNA 4ZZ9A 3R0DA 3POHA 3NEVA 4HSOA 5D9NA 3VDAA 2CLFA 3PAOA 1F74A 1BRLA 1EBHA 5I3HA 2V8ZA 3MVTA 1XQKA 1JUEA 3AHVA 3L9CA 1JYXA 2DZWA 1PIGA 2FMNA 2JKAA 4X63A 1AL7A 1PDZA 4XZNX 4RK8A 1TQJA 2MANA 1XCFA 4QE4A 3QZEA 3GTHA 1YDVA 2DY3A 3GXNA 1BXBA 4W8AA 2GQ9A 2WC7A 4J2MA 5I0DA 1EUNA 3WLOA 5GPRA 6XIMA 2WOQA 2UY5A 4DXXA 3G1DA 3TW6A 3GC5A 3VYLA 1H41A 4D6JA 3AIUA 3VM5A 2VEIA 2O0TA 3DX5A 5CPTA 4CNSA 3AOFA 5LA1A 5CGQA 3S2NA 3V5FA 3C0SA 4XAYA 4ONVA 5HQEA 4A29A 4QG9A 4QLLA 2XH4A 3VIFA 3AI0A 1REQA 1BYBA 4AZBA 4JTQA 4PCSA 2DEPA 3GXFA 3W07A 3QPEA 4UTMA 2BY1A 1XLMA 2WC4A 1OFOA 4M24A 2MUCA 2ACRA 4RXFA 4AEFA 4GFIA 3KBWA 5I3GA 2W79A 2G3IA 3CQIA 4WK9A 3OGSA 1LQAA 3RR4A 3NZPA 3KRUA 4U3AA 4GYKA 1V6VA 3WMSA 1YXYA 1NDVA 3AZTA 4M7SA 3INPA 3UERA 2RHGA 1QBAA 4PCTA 4NJIA 3A24A 3BCFA 1ZBWA 2WHKA 2QUMA 4WZHA 1SYTA 3QR0A 1F61A 1TPUA 1LDCA 2XM1A 1RBAA 1VS1A 2RAGA 3I7SA 3PPCA 3EWXA 5FEWA 5BYWA 3R8RA 1W1YA 1LT7A 3ABRA 3IJIA 5BWFA 1W37A 2QCEA 3MA8A 3EWYA 4PN2A 1W9VA 4S3JA 4Z1DA 1HP4A 4LRTA 1YNPA 3EPNA 4V33A 3G24A 1NF0A 3D3FA 5DLCA 2VDIA 1K4HA 2O4QA 2RKXA 2ZX6A 3C4UA 3WMLA 3SGUA 2QR6A 4AF0B 4HZ6A 4PTMA 4X2PA 3TN6A 3P6LA 3B8WA 5G1MA 1C8VA 3G3DA 1CGYA 2HQAA 2Z27A 1O4UA 4H6EA 1C91A 1SW7A 2GVGA 3NPWA 2RDUA 1C8YA 4OV9A 4EF9A 3QGVA 5FJPA 3IAPA 4PUDA 2E25A 1RAKA 3IVSA 5EMJA 4WJEA 1DIOA 3OIHA 1W32A 3AJ7A 2SFPA 3PZOA 2QS8A 4O8AA 3VABA 3IANA 1EO5A 2NW0A 2PTYA 5LHEA 2JALA 3HGRA 1V0NA 1KBLA 1IGWA 4ZXLA 4QGCA 3TX9A 1UJPA 2ACQA 3MO7A 3M1ZA 4P8XA 3AYRA 2QCDB 4GUIA 4UQBA 1S2CA 2EJ1A 1MNSA 3AAMA 2ZRWA 1F8MA 4F0MA 3K5XA 1I0DA 4CD6A 1QO2A 1M9HA 2J7HA 1QDSA 3VD7A 1VYPX 4B5TA 1V3KA 3STCA 4RE0A 3CZJA 3DFHA 2B4GA 2VFGA 1U1HA 3EXSA 3W84A 4K8HA 2ZZ7A 2FHCA 1Z44A 1F4AA 1KFBA 4OBSA 4XK2A 1KFLA 2J9XA 5HWNA 1IT0A 3N19B 3M64A 4AIBA 2G8ZA 3DFTA 4RNFA 4BQ2A 1OG6A 2VGBA 3VZZA 3UZWA 1YDOA 4MJMA 1SJAA 4L5ZA 2AMXA 1E15A 3GXIA 4TOQA 3AHYA 1S2TA 1R6WA 1VC4A 1XLFA 1JFXA 1YLVA 4J3XA 4PGLA 1W5PA 4F0HA 7ODCA 3GIPA 1EPVA 3EOOA 2W61A 1GORA 1IEIA 4CN4A 4XAFA 3LI1A 4UTIA 2A3BA 2DT1A 3D6NA 2PA6A 4TMCA 4M51A 2ISFA 2X1SA 4I5XA 3L65A 4DELA 1VCVA 3DYPA 5LNVA 2WV8A 3P74A 4RE2A 3BURA 1F3TA 4IICA 3HQPA 1OX4A 2FLIA 2GYIA 5AHEA 3TVAA 3W37A 1LG2A 1WKDA 2TSYA 4TIMA 4JKMA 4ADUA 3IWPA 2CZDA 1V6WA 2QHAA 4XB3A 3NA8A 2NX9A 4L4PA 5F2LA 4PCNA 3BLEA 3UVIA 4AWUA 5KZMA 1N8FA 1YXCA 1OC5A 2OZ0A 3TFXA 4R5EA 4HZMA 4DWSA 1WDQA 1JCYA 4GIAA 4O1CA 3UWVA 2DT2A 2XISA 1WKYA 4MAZA 3TJXA 4QX4A 1C7TA 3OVGA 3EB4A 4N9CA 3TTYA 3P60A 3HA1A 2B31A 5AECA 1EIXA 1VFMA 5CSYA 1FP8A 3BOXA 2OQHA 6TIMA 1OCQA 4OOUA 3A47A 5BU9A 1E0VA 4GQGA 4D6DA 3TQPA 2PCQA 3TK7A 2NXIA 1RBOB 6REQA 3CEUA 5A6BA 1HKJA 4NJHA 1NJJA 2I5IA 4AXNA 1X7FA 5G4EA 1E6RA 3WL0A 1HKMA 3H26A 5HQLA 1WPCA 4IMCA 3WF4A 1E72M 2HISA 4HBKA 1TCDA 4AD3A 3M0LA 1TWZA 4NNCA 2OO6A 3GDTA 5A2CA 1TJ0A 5CZJA 4FXFA 2A7PA 4HYWA 3GW3A 3URQA 2PWVA 2X41A 2BXZA 1S39A 2FKPA 3U48A 5M3WA 3PFMA 3GH7A 4WUIA 3QSTA 4GH3A 2PDHA 4O1EA 3W88A 2ZTJA 2G97A 2E40A 4NZ1A 4BI5A 2VFHA 1PX3A 2OZTA 2QEZA 7REQA 2CLEA 4AVFA 1LQ2A 3QHOA 3ZWSA 3H4WA 1KR0A 3DFQA 3AHZA 4I5UA 5GNZA 4AW7A 3HOJA 3O6YX 3EDDA 4DO6A 1SFTA 2CIPA 3Q67A 2WB5A 1FP9A 1UQZA 1ODZA 3EAUA 4W4QA 4JHOA 3TSBA 1A5MC 2ZQ0A 3U2EA 2V63A 2EG7A 5G4WA 2XWDA 4FR6A 5T8GA 2PTZA 1HKWA 1XH0A 3EXTA 4GJIA 1H3GA 2WZIA 2FB2A 3FEMA 3V75A 4AHOA 2WK2A 2ZA1A 4JDBA 3W7IA 1ONRA 1CLVA 1U1JA 3N9SA 1EO7A 1XIGA 4KWSA 2IUZA 2BY3A 1UWSA 5A6KA 4R3UA 1SMDA 2QZRA 1QI5A 2DVXA 5KTLA 2V3FA 2J66A 3NQVA 3LQGA 3Q65A 3HURA 4A8IA 5LA2A 1FHUA 1VAHA 1LWJA 5HATA 3TMQA 2VEGA 4YTRA 2V5KA 4PTVA 4C1NB 4AXKA 3GO2A 1O68A 3FW6A 4UR8A 3U0HA 4UZUA 2O7QA 5D03A 1FHLA 5A5WA 3WQPA 3K30A 1I45A 1XG3A 2B7QA 2PDNA 2VKZG 4ORMA 3MVIA 1ICPA 1Q6LA 2X1IA 5EMKA 1S5MA 1UOKA 3PZ9A 5EU9A 1OM0A 3RU8X 1K03A 1HW6A 1Q8JA 4KW2A 4C7FA 1BKSA 5C54A 3CS2A 3KOXA 2XSXA 2X0YA 1MFVA 3ZJKA 1GVSA 3BQ5A 1MI3A 3S5SA 1UD2A 3G0SA 4AIEA 3BWWA 2VR2A 4IPPA 4PMQA 1B54A 2FMOA 4P7LA 3B8TA 2O56A 1KM3A 3TNBA 1X8FA 2FGLA 5I5RA 3CZGA 1SFJA 4QAWA 2PWFA 1ISZA 3W72A 1W2PA 4CD4A 1W6TA 3VKJA 1S2AA 1I2OA 1H11A 5F4XA 1LWIA 1W9PA 1E6PA 3SUWA 4GO9A 3SCRA 1RY8A 1SR9A 3TP4A 3S9ZA 1XLHA 3NPUA 1C92A 3BZJA 1DJGA 1NFGA 3WJWA 1BGGA 2A79A 1OF6A 1KM0A 4CD5A 2FPVA 1H1ZA 4AEEA 3BJSA 1Y5VA 3VGHA 3PTDA 4JFVA 3QFWA 1RP9A 1FBAA 2Q8XA 4O52A 3TYCA 3VE7A 2CLHA 4GIEA 3U7BA 4UTTC 2VFIA 1KGXA 3T0CA 1J93A 1KM4A 3OLDA 3UWEA 1UWAA 4JFUA 1JDFA 2CLOA 4XSLA 3ZM8A 4WD0A 4GABA 4Y6GA 4GQQA 3MSYA 4LAOA 1JULA 1TPB1 1JZ4A 4O1FA 1MNZA 1K02A 2G5WA 3A5FA 4D8AA 4A3QA 2TMDA 4NJJA 4OUIA 1EXBA 2DDXA 4TTGA 3LX9A 1PZ2A 1T5AA 1GNXA 5JH2A 3W27A 3DU0A 1EC8A 2C16A 2DZVA 1PZ0A 3EB3A 4X61A 1EHAA 4MG4A 3VGBA 3B8UA 3PZVA 2G3NA 4H83A 1X7IA 3LERA 3VC5A 4AYGA 3EDEA 2VWSA 1NF7A 3AS2A 1X1NA 4B3LA 4CUCA 3CUXA 1OC7A 1HQTA 3T07A 1W54A 3N4EA 3KWXA 4N0RA 1WDWA 4QNEA 2PWEA 2VZTA 3N2BA 2KZHA 1M7XA 3KTCA 4LEFA 3S6TA 2FTYA 4QBXA 5CBIA 4XO6A 4M7TA 1VIZA 4U3CA 4GGBA 3FXYA 1OCNA 5D09A 3HIJA 1C7SA 1NFBA 3QQWA 1DWGM 3FHQA