3DOPA

Crystal structure of 5beta-reductase (akr1d1) in complex with nadp+ and 5beta-dihydrotestosterone, resolution 2.00a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Structure and catalytic mechanism of human steroid 5beta-reductase (AKR1D1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 111
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3dopA00
4GQGA 4XO6A 1RALA 3EB3A 1T40A 3H7UA 2FZBA 4FA3A 1A80A 3GHUA 3WCZA 2PDGA 4JIRA 2PDMA 3R8HA 3LQLA 1XGDA 4PR4A 3UZXA 3COTA 1RY0A 3MB9A 4LAZA 4JTRA 4I5XA 4DBWA 5LIXX 1EF3A 2HE5A 2WZMA 4XO7A 4DBSA 5AZ1A 2FZ8A 3LD5A 4WDWA 1YNPA 3LZ3A 1XF0A 4QBXA 3R94A 1YE4A 3UWEA 4IJRA 1IHIA 3D3FA 1EL3A 3BV7A 2A79A 2PDUA 1X97A 2BGQA 3CV7A 2IQDA 2ACQA 3V36A 1MRQA 3UZZA 5LIYX 4IJCA 3WBWA 4JQ1A 5HA7A 1AH0A 1QWKA 2ACSA 1Q13A 3LN3A 4ASTA 1JEZA 3LEPA 4EXBA 2IPJA 4JTAA 3M0IA 5LIUX 3GHTA 3WG6A 4MHBA 2FZ9A 3UYIA 3O3RA 4GABA 3WBYA 3UP8A 2DV0A 4NKCA 4WDTA 2PD5A 3LNMA 3M4HA 2IKGA 2ISFA 4JIIX 4YVPA 5LIWX 2VDGA 3DN5A 1LQAA 1ZGDA 1C9WA 3GUGA 2AGTA 4FAMA 3NTYA 4L1XA 2PDPA 1LWIA 4JTCA 1Z9AA 3MC5A 3ONBA 2HDJA 4Q3MA 1GVEA 1SM9A 2F2KA 1VP5A 3R7MA 5HNUA 5JH2A 4H7CA 5C7HA 1T41A 3V0TA 3V0SA 3GHSA 2BGSA 1S1RA 4OTKA 2BP1A 1PWMA 1EXBA 1S2AA 3KRBA 4GACA 2ACUA 2NVCA 4XZLX 1PZ1A 1YNQA 4JQ3A 2IPWA 3U2CA 2PDCA 3O0KA 4L1WA 4WDUA 3ERPA 3RX3A 3WBXA 1EKOA 4IGSA 3CASA 4GQ0A 3CAQA 4YVVA 4RPQA 4GCAA 3GHRA 2INZA 5KETA 4LBRA 4FALA 4PUWA 5LIKX 1ZUAX 3V0UA 4PRTA 2DUZA 4GIEA 1FRBA 1AFSA 2QXWA 1AH3A 3EAUA 3H4GA 1Z8AA 2ACRA 2R9RA 3UG8A 2I17A 4XAPA 1ZQ5A 3C3UA 3R58A 1X98A 1US0A 1ADSA 5AZ0A 4WDXA 3P2VA 3RX2A 1HW6A 2HV5A 3UFYA 4YS1A 4ICCX 2J8TA 2PDLA 1R38A 2HVOA 4EXAA 3BURA 2PDWA 2HVNA 4LB4A 4Q7BA 1S1PA 1AZ2A 3V35A 2PDIA 3G1RA 2PD9A 4JQAA 3CV6A 4WGHA 2P5NA 3CMFA 2INEA 2ALRA 2CLPA 2PDBA 4JTQA 4YU1A 2IKJA 3R6IA 2FGBA 4XZHA 2PZNA 4LAUA 4LB3A 1UR3M 3M64A 2PDXA 4G5DA 2PDYA 2HEJA 3VXGA 2PDFA 3Q67A 4WRHA 2PFHA 1PZ0A 4XZIA 3LBOA 3LENA 1J96A 2PDKA 1K8CA 4R9OA 4ZFCA 3BUVA 3UZYA 2PDHA 2HE8A 1OG6A 4HMNA 3DOPA 2PDJA 4XVDA 2C91A 3G5EA 1IEIA 2WZTA 4JIHA 1MZRA 5HNTA 4H8NA 4YVXA 1HQTA 4JQ2A 1RY8A 3RX4A 3S3GA 1M9HA 4QXIA 1YE6A 3R8GA 4DZ5A 3FJNA 4JQ4A 2R24A 3ONCA 1XJBA 3H7RA 3Q65A 5M2FX 2PF8A 4FZIA 3LZ5A 1Z3NA 2DUXA 4PMJA 4QX4A 4DBUA 3FX4A 2IPFA 3R43A 1S2CA 2IQ0A 2PDNA 3LQGA 3T42A 3BCJA 1AH4A 2IS7A 5DANA 4QR6A 2IPGA 1PYFA 2NVDA 1X96A 3N6QA 4F40A 4HBKA 4PUUA 4PRRA 1VBJA 4XVEA 1AZ1A 4WEVX 4AUBA 1QRQA 2FZDA 3UGRA 3QKZA 2FVLA 1Q5MA 1PWLA 1ZSXA 3N2TA 3EB4A 3B3DA 4GA8A 4JTDA 3UZWA 2PDQA 4XK2A 5JH1A 3F7JA 2PEVA 2IKHA 1MI3A 4XZNX 2I16A 3LUTA 4LBSA 1Z89A 2F38A 4XZMX 3CAVA 2IKIA
chains in the Genus database with same CATH superfamily
4GQGA 3PB2A 2PC4A 1WDQA 2HBXA 1XLFA 1P43A 1SW3A 3WEZA 4N0RA 5D2YA 3HPFA 3P8JA 1EJUC 3RPDA 2C0HA 1VZWA 1VJZA 1K8XA 1FY6A 3SCWA 3UZXA 1TX2A 3GFYA 1T99A 3WH5A 3MO4A 1GJUA 2YZ5A 3ZSSA 3B8DA 4N7QA 3RG6A 3CQJA 3E6EA 4IIFA 5C9WA 3VVGA 5U4NA 2PRLA 5HDRA 2C16A 3PTKA 3ZZ1A 1ZY9A 2G41A 4ECLA 4NZCA 3LZ3A 3WUBA 1VFFA 2X30A 1DPMA 3N14A 4LPCA 1RCXB 4OOZA 1DWJM 1SO5A 2QJGA 1F61A 2QCCA 4YYFA 3BSMA 3FY1A 3T8LA 3DU0A 3ARYA 3SUSA 1IV8A 1E6SM 1YDVA 2WHLA 6ALDA 1IXQA 3WYZA 3E0FA 3QOMA 4OUIA 4F66A 4ZO7A 4N9CA 4M3PA 1WE5A 3D6NA 1LOLA 1JEZA 2OSWA 4W86A 3TOYA 2PBGA 3KOWA 1JCXA 3VOFA 3WJZA 1NDZA 3AXHA 1EHAA 3O15A 4GUHA 3MUCA 4JTIA 2R94A 1C93A 2OZTA 3ITCA 3TJLA 4XBSA 4JD4A 3OP2A 3HFYA 4QG6A 4HHMA 1XLIA 4KRZA 2BHZA 1KM3A 4JY9A 5HNRA 2VYOA 1MEWA 4LYKA 1YBQA 2YB4A 4QNEA 1R6WA 3TH6A 4M6QA 3T0BA 2AGTA 1C7TA 2PGWA 3H4WA 3TNBA 1H11A 1CGVA 1P48A 2P1FA 2EPOA 4ADTA 4NSBA 3W88A 1XKYA 1Y0EA 3WX7A 3P6LA 4JFTA 4US5A 4NXSA 3BW2A 4AVFA 4BFAA 4JTKA 3DAQA 1EP2A 3RLGA 5FL0A 1IYXA 1W8SA 5A6SA 4HGXA 3VNLA 3EWDA 1PWMA 4TIMA 3TTEA 1GVSA 4GC4A 1PYMA 3WIJA 3RYSA 5B7YA 1KFLA 5E9XA 1WZKA 1ZFJA 2I9EA 1W5OA 2Q01A 2IPWA 4YMZA 1RQEA 1J8VA 3N04A 2X8RA 1HGWA 3SECA 1XSIA 1C3FA 1BYCA 2HS6A 4ZVJA 3GS6A 5HOSA 4GCAA 2VFGA 2BXYA 1XIJA 3GHRA 2WM1A 5ECUA 2J25A 4RXGA 3TZNA 1YPFA 5G5IA 2PLJA 3TMQA 3R0KA 1A5OC 1FRBA 4CNOA 4ZCWA 4KQNA 3M0YA 1V79A 4BI5A 3IJ9A 2A4AA 5HBFA 3GDBA 1XLEA 2OZ0A 1G7VA 1HJUA 1K6AA 2GJXB 1GONA 1ZPTA 3OW1A 5ABHA 3BVJA 2ZYFA 3A24A 1R38A 1CZ1A 2A3BA 5FJUA 4H7ZA 3VDGA 3UVIA 1GVIA 4NI8A 1TX0A 2XFWA 3VD4A 3AZTA 3SRDA 1P0BA 1GPFA 5EMKA 2WNQA 1W1ZA 3D5HA 3SGZA 4GISA 3RN6A 4K2SA 4DI9A 4QLJA 2CLOA 1TCDA 3B0YA 3TOPA 2BZNA 3H2FA 2YBVA 3LGGA 3T6CA 3W6MA 2ODOA 4EOUA 1KKOA 4AMCA 3SGGA 4HT3A 5GQBA 4QCEA 4EP8C 4DVOA 1DJWA 2Z6JA 4C6QA 5HULA 1UOKA 4JFUA 1PKYA 4BF7A 3B0VC 1F6KA 3BZGA 2E1DA 1GGOA 1XINA 1X8CA 2C71A 5I3FA 3QGVA 4NX5A 1X7FA 4R7JA 5DF0A 3VYLA 3B05A 5DT7A 5KTLA 4OV9A 2Y5SA 1OT2A 3B04A 3M0KA 5FIPA 1ITCA 3KP0A 3LSCA 1PTDA 1KXHA 1Z44A 3PPHA 5C7VA 2PWVA 5CBIA 1PEZA 3TA9A 4RZBA 3J7HA 1CB2A 3B9AA 3CB8A 3LPOA 3OA3A 1H61A 7A3HA 1LWHA 5ABTA 3L2IA 1UQZA 4PH6A 2VO5A 3DX5A 2V3DA 2YCLB 4JX5A 4F9JA 2XVLA 4IMAA 4DI8A 4TO8A 4QSHA 4PC8A 3N73A 3R43A 4K8GA 4AHQA 1GZ1A 3B8WA 4Q4OA 1OCNA 4B3LA 1J12A 3EXTA 1UASA 4MOZA 1RP8A 4MFEA 4C60A 3BICA 4INFA 2BFGA 2GDUA 1JPKA 3JVAA 4QJ5B 2FHCA 4X60A 1AZ1A 1W9XA 3GXIA 4LY8A 4F0RA 3W29A 3QR0A 3ZT7A 2HS8A 1Q6CA 1Q5MA 1P0DA 3MKCA 1K9FA 2XGIA 1ZSXA 1TVNA 4K1GA 1LCOA 4MJMA 4GYPC 1ADOA 3SURA 4AHOA 1RJPA 1Y7VA 2I5QA 3MZNA 4WCJA 4V27A 4NAFA 4KFNA 1PKMA 4U28A 5JU6A 2IKIA 4UIOA 1VF8A 2WVVA 1IXOA 5C54A 1RALA 3UNTA 1T40A 4F2UA 1NIUA 3H7UA 7ENLA 5AB3A 1GKPA 3WQWA 2RJGA 1CXFA 4MNJA 3F4WA 3FSTA 4AZIA 1FXPA 1K9EA 1ZBKA 5IHRA 4A4AA 5A8GA 4B5WA 1ESWA 2CLHA 1GOOA 3OPSA 4H2CA 3AMKA 2F2HA 2OX4A 2RH9A 4I5XA 1LDCA 4NAEA 1VPYA 1QO2A 1T7LA 1E0WA 1IEXA 4Z2JA 5LGXA 1M7OA 2Z2BA 1FH9A 2J66A 4OU1A 1Q6EA 3MKKA 4UMCA 1M3UA 4ZTXA 2BB0A 2AQWA 4GLEA 3VTRA 3NM3A 2GL5A 4NJGA 1UD2A 3M5ZA 4NRRA 4AZCB 4YXGA 5A8NA 3NDYA 1E9IA 3C2OA 3O63A 1YDYA 1PBGA 3ZQ9A 1M41A 4OBRA 2A79A 1I4NA 1TJ0A 3VOHA 1S2TA 3MI6A 3OEXA 2G4JA 3NZPA 1MRQA 3EDJA 4O8AA 4GMEA 3S0CA 2TPSA 5BYWA 4C6IA 4MB4A 3EPNA 4NNBA 4LANA 4PMNA 1IT8A 1DJNA 1KM2A 5FSEC 4GVGA 5TBOA 1YPXA 1TR1A 3T0DA 4Z1CA 5HUPA 3PUEA 3LGDA 3TR2A 1TPB1 1D7KA 1EJVC 3R10A 3GKFA 3L66A 3CUXA 1W3TA 4JKKA 1IWPA 3BE7A 5AECA 1TPDA 1OWQA 2CZVA 4LBUA 2XN2A 1VCFA 3W6YA 1F74A 3BMWA 1XYMA 2XVGA 1TJ1A 1ELSA 1OVDA 2PC8A 1LQAA 2Y63A 3O16A 4L6DA 4DNHA 4A29A 4R9XA 3EOSA 1MVYA 1EQCA 5G1TA 3LG3A 3AAMA 4ZOCA 3TR9A 4E4FA 4UTKA 1E9ZB 1N8WA 5EL1A 1WOBA 4AMAA 1JCLA 2ZIDA 3AIRA 4LAKA 2FPTA 4HB7A 1ITXA 1US3A 3V0SA 1QO5A 3R0UA 2QCMA 3NNTA 3TWAA 4RE2A 4LEFA 4O4VA 3TMLA 3AICA 3PB0A 2J7FA 2OGJA 2OQLA 4NQ1A 2NUWA 1Q7MA 5DQPA 1E9LA 3WK1A 2C7FA 3FK4A 4Q8MA 3JZEA 2C15A 4MGGA 3LA4A 2JEQA 2ZZ1A 3QLLA 4I6VA 3IRSA 3N3MA 3U2CA 2V5KA 1EBGA 3TJXA 1SYTA 1LT7A 5HXMA 3EWWA 3QW4B 5LA1A 1IZCA 4IGSA 1PB0A 4FK9A 4H4IA 1HKWA 2CZFA 3MMWA 3S2LA 5C9UA 5LXXA 1WXJA 3FKKA 1UD8A 3ARWA 1P6CA 3S5SA 5FJPA 3O9NA 3HV9A 3KM8A 4Q8UA 2JE8A 4ZB2A 1QNOA 4P7QA 9CGTA 1UJPA 3HQOA 3MZ2A 3ISIX 5A8MA 5E09A 2J6XA 5ABFA 4B9ZA 3IJQA 4N6FA 1KV5A 4JR5A 3P82A 4H6EA 1TZ7A 1E6ZA 4OV4A 4DPQA 1K1DA 2DT0A 1KQYA 3EGJA 1R5YA 1UH3A 1WPCA 3NVTA 2PTDA 4LOCA 1QDSA 4JOMA 4J3XA 1K77A 1UWUA 1RPKA 2ALRA 3F4CA 4ZOAA 4LU0A 3CGTA 3GVVA 1H5VA 3GG1A 3M07A 3N29A 4DWSC 1EB3A 4GQQA 4LGXA 4IICA 3MHFA 1PS9A 1KFCA 3VIOA 4WLCA 3RRAA 3W75A 4LAUA 4MM1A 1EA0A 9XIAA 4J35A 3M64A 3G1VA 5FEZA 3W85A 5I6SA 4Y90A 5DEZA 1FDZA 2YXGA 2E7FA 1K03A 3I7QA 1XGEA 1E4NA 1XIMA 3C0SA 3LBOA 2FIQA 1K7XA 4G56A 4WY0A 5BWFA 3QQ1A 2P3EA 4GYKA 4A3HA 4MAZA 3AXKA 2PLCA 4WHBA 3L7RA 3MDWA 3M0VA 1UMYA 1BWVA 3B40A 5CZJA 3CB3A 5EMLA 3THQA 4WGXA 3GQYA 1TV5A 2C14A 4GY0A 3GX9A 1MZRA 1G7UA 4H8NA 4KWVA 1HQTA 4TTGA 1BWKA 1CIUA 3OYZA 4QXIA 1O6IA 3W1RA 1WNOA 1W9BM 4JQ4A 1VKFA 3VKBA 4UB9A 3C8FA 3PSWA 1BG9A 3TYEA 2P53A 1BFNA 2G3MA 4DXXA 3N19B 1EX1A 1S2CA 1EDTA 3RFAA 4FIRA 2QF7A 1B3WA 3KAOA 3RPMA 3FA5A 2VUNA 5REQA 2PURA 3PFRA 2PTYA 3GNDA 2VNCA 1DWHM 1KKRA 5CGMA 4DELA 1QNQA 2D69A 3WF1A 1JZ7A 2BXZA 2PA6A 1LF1A 4JTEA 3ORWA 2ZA1A 4KCUA 4Z2HA 1XD0A 3WNLA 3CV1A 8XIMA 4MTVA 3R13A 1I2RA 1EUAA 1UZHA 5F7UA 4ZOEA 4QS5A 5AYBA 1WAWA 2GK1B 1W0MA 3HTWA 1OX4A 4XO6A 3IJ6A 1JZ2A 4IG2A 4XWUA 4P61A 3M0XA 5LSMA 3NDOA 4A22A 4PN2A 1DTUA 2J7HA 3LSBA 4DO4A 2VWSA 3WDJA 2J4GA 4QNWA 2IXUA 3A4JA 4NF7A 3EEGA 3RM8A 1VFTA 1FDJA 3W84A 3GR4A 2H6RA 5BRPA 1G9HA 1OD8A 2W3ZA 4K36A 2UY5A 1RR2A 3A21A 4JKLA 4CEUC 4L64A 2DW7A 3BAKA 2F7FA 1OGGA 5K4ZA 4O54A 3VIFA 2OPJA 3ZOAA 3DG3A 2WMIA 4NG3A 2PMQA 3W02A 1EZ2A 3T05A 2VR4A 2VGBA 3UWEA 5I77A 4BR1A 1ISVA 4LUYA 2PAJA 2ZRXA 1DVJA 3L68A 1UZ4A 1X97A 4TR9A 1E1FA 3POHA 2IQDA 4FF7A 4F2TA 1UIOA 3IANA 5D38A 1Z69A 5LNWA 1X39A 2GSHA 3W7EA 1YX1A 5JIWA 3R12A 5DMLA 3LEPA 3CM4A 3O07A 2DORA 1TE6A 3TN5A 1KO0A 2WHMA 3EX1A 1E73M 3EA3A 3T55A 2HNHA 4CCCA 3ZJ6A 3GVQA 1E43A 4WVXA 3BLPX 1DQWA 2NXIA 3GG8A 3ABZA 3VA8A 4RJEA 1H7PA 1GVRA 5HMEA 3ARZA 5A2BA 4XD4A 4K8HA 5CAKA 1XISA 3H53A 1J6OA 4Q33A 4A8IA 4XSLA 2ICSA 5DMYA 2XIIA 1TREA 4E0CA 3NTYA 1HNYA 2IMRA 3HGOA 5I07A 5HK4A 2QHAA 4CLMA 4EE9A 2AAAA 3GR7A 4M82A 2QDGA 3BXWA 4AIEA 4KPLA 1QK0A 3AYVA 1V0KA 3LCWA 3DIPA 2YCIX 1OM0A 1H1NA 1KRCC 5EPDA 3QV9A 3UY7A 2EJ1A 2J62A 4G2DA 2DH2A 1R9XA 2WQPA 3KHJA 4GBUA 3NWRA 1B1YA 3WZ0E 2OODA 4P8UA 5DY2A 4DY1A 4MJZA 3W1MA 2HNEA 3XISA 2QJHA 3THUA 4PTXA 2D2GA 2CZ5A 5FJRA 3C4UA 5HPCA 4JKMA 5H91A 3IEBA 1DQUA 3CZJA 1YTDA 4D8ZA 1RH9A 3KWXA 2A6NA 4AD4A 4EF8A 5CKSA 1H3GA 1SFJA 3K4WA 3ZM8A 2J74A 1O95A 4DWDA 4FNTA 3LTYA 4PUWA 3KDNA 3QV6A 3GDRA 3KS5A 2WSPA 4IH3A 5ABEA 3QMTA 1VLIA 3BJSA 4Y9OA 4J3TA 5XINA 1KC7A 1QK2A 1AW2A 1R3YA 1RCQA 3O0FA 2X05A 4QJ3B 3W72A 1US0A 1ADSA 3NQ2A 3T78A 4LUJA 3VD7A 5AHIA 1NOFA 1C92A 3P2VA 3DHUA 2Z1KA 4NI3A 4WY0F 3TYUA 2H3BA 4I6KA 3GVWA 3TROA 1CWYA 1XR2A 4H9VA 3CO8A 1MQQA 4M56A 3E38A 4O1BA 3VZZA 3GVGA 3CV6A 4WGHA 3VCRA 2JBMA 5DCEA 3VZYA 2NQJA 4KW2A 4HOWA 2Z1WA 4GPNA 3UVAA 3DFYA 3AIQA 4QFUA 3AWOA 3DG7A 4NL1A 1OD0A 3ZWSA 2G95A 3DFSA 1BLIA 1IXNA 1U1HA 3OU8A 4HMDA 1W37A 2QMKA 3TN6A 4DB7A 3W1TA 1EP3A 3BTNA 1A3XA 3L4ZA 3AXMA 1GT8A 3ANYA 5HWMA 3TTSA 1BQCA 2FTYA 1UR2A 5CSUA 1TTQA 1E71M 1TCMA 4LNYA 3VIKA 2P76A 4IPJA 2ZXDA 4PBGA 3FV9A 1J5TA 1AQHA 3MHGA 1FVPA 2VDHA 2JF7A 4ATDA 4S2CA 3HURA 3UJEA 1BKHA 3LLFA 3IK4A 1SZGA 4MY9A 2CZEA 2EG7A 2B81A 4JY8A 4P7RA 3H22A 3D0CA 3MS8A 3VNKA 1PV8A 3SN4A 4LYQA 3UYCA 3S5NA 3ZJKA 2V81A 1MNZA 3AHZA 1XYFA 1Q7ZA 3POCA 4IIDA 2MANA 3V7PA 1E3ZA 2DUXA 3R1ZA 3ABSA 4A3QA 1OF8A 1EJTC 2FYMA 4TTUA 1UW9A 3VGHA 1HT6A 4CVWA 4AWTA 2YBTA 3OVQA 2WCAA 3VGDA 2NT0A 3T1GA 1E40A 4BQ3A 4ATWA 4BI6A 2OZ3A 1FDYA 4NNAA 5I5RA 1ZP3A 3ZR5A 3OZYA 3NQAA 4JN8A 2VI0A 1DYSA 1SJAA 3TN3A 2QDHA 5HMDA 2E67A 1HGYA 3EX2A 4MDPA 4DUOA 4CN1A 1XSJA 3BV4A 2ON3A 4ORMA 3F7JA 3IAQA 3WUFA 4AD5A 4JTFA 1OEPA 1I1WA 3NDZA 2R8WA 4Y9AA 1HJVA 2OWXA 4H7VA 4GXMA 4EVZA 2FJKA 1EOKA 2V38A 3EXRA 1TIWA 3GDKA 3MP4A 3P60A 4D6DA 1VYRA 1AD1A 1WX0A 5D2XA 1NFGA 3P3BA 3DKJA 1RHCA 4ZMGA 1N8IA 4IQLA 1JDFA 3CXOA 3SJ3A 7REQA 4GG9A 3H2AA 5LKYA 4PFHA 4RW3A 1FWWA 1XIFA 3W7RA 1TPUA 4O16A 5EBUA 1H51A 3IGHX 3H2CA 3WLIA 2XIOA 2NWSA 1ZS2A 3KTCA 4UQAA 1I45A 3LBMA 1I60A 3UJFA 4ALDA 1WBHA 4O10A 1GVOA 3VI2A 2D1ZA 3EA1A 1X6LA 1DV7A 2X1UA 1UPMB 1MZHA 3QQWA 4L6HA 2DSZA 4V28A 3GK0A 4W4QA 2FHFA 1W1B1 3BANA 3S8HA 4L9XA 4IPPA 2WCGA 1I6NA 3IIVA 3WL0A 1QBBA 2GGIA 1UC5A 3G0UA 3L4XA 3SSJA 2Z4GA 3TW9A 2DVXA 4X2RA 4H9MA 1LRTA 4JGDA 3QC0A 3WLTA 1V6TA 5M1TA 4WSKA 1F4HA 4JTAA 4PUDA 4UBPC 1H7XA 1XYBA 3NSXA 1BGAA 3T2PA 1YEYA 4MNMA 4MY8A 1W3NA 4H8UA 2G3NA 5ECVA 4YWIA 1A5MC 5HR6A 4GVIA 3W53A 1U5HA 3W6LA 3O06A 3KVLA 1ZENA 2J78A 3OBAA 5CGTA 3ZFHA 4N2YA 1FBAA 2QIWA 1R3WA 3OIXA 4L6OA 3QSRA 3FW6A 3G0XA 4H83A 1LWIA 2NV1A 4S3JA 1QBAA 4AISA 2G4FA 4Q8NA 1XFBA 3HIJA 3CK5A 1NM9A 3H4XA 3SUTA 1MW2A 4MFDA 2BVDA 3LLDA 3MP5A 1CW2A 3ZSTA 2W5FA 3QFEA 1UR1A 2AKMA 3OZOA 4EWND 1B3XA 1V3KA 3N4FA 2OYLA 1S2VA 2TRSA 2PB1A 2B7PA 3H7VA 2B0MA 5FACA 4W7VA 5T91A 1UBSA 3NPUA 1U33A 4CNTA 2RJHA 1JJKA 3RDKA 1WBJA 3MMDA 4JDBA 1RVGA 3TLLA 4HOXA 1I75A 1C8YA 1DJIA 3WD1A 2Y7DA 3UBPC 3O0KA 1AMYA 4B5VA 1JRCA 4RW5A 3GC5A 3LTSA 2V5JA 3EX4A 4GQ0A 2KAUC 3B97A 1U5VA 1F3XA 2YOCA 3WK2A 1EDQA 3PJUA 1E0VA 1VBUA 3V5FA 2C0AA 1L8PA 3LI0A 3MUIA 5CC7A 1ISXA 3DC0A 2R1MA 4GOAA 1QHOA 3BC9A 5IM51 4GIEA 1A3HA 2E3ZA 3LU2A 2GJPA 2ZRUA 1DBTA 1AQFA 2QAFA 1RSCA 3NSNA 5DO8A 4EANA 1JUKA 4J3ZA 5HJYA 2WYSA 5IRPA 1D8CA 1US2A 3P5ZA 1Y5WA 3PG8A 1H7NA 3PPGA 1ISWA 2VZUA 3VC6A 2ZRVA 4HIBA 3H70A 3OVRA 3SN0A 4FLQA 3MCNA 2PDIA 3RMJA 3VUPA 2AMGA 5D37A 2WZIA 5E1QA 3KBVA 2NQHA 3VO0A 1ICSA 4PUKA 1CI1A 4R88A 2CLPA 2ZADA 1M5WA 1GOQA 2VZVA 4JTQA 4I9TA 5HJXA 4L4OA 1UMLA 5I7GA 3CZLA 1UR3M 5AKQA 4A2RA 1LLZA 1OCQA 1E6QM 2H9AA 3MVTA 3V3WA 2Y7EA 3EDFA 1HKIA 1JNEA 5AOUA 3SAZA 5D4YA 3JS3A 3EMCA 1XFCA 7PTDA 5E9AA 2A5HA 4D6HA 4J5NA 1UR4A 5F2GA 1XICA 2UV8G 2VQUA 1K8CA 2YYTA 4PE8A 2ZZ3A 4XZ9A 5LA0A 1JF6A 3NO1A 2DY3A 1GJWA 4X9SA 5AC5A 4DN1A 1SPQA 3L0GA 1V51A 4UC5A 3MJYA 4DUWA 3PP7A 4P8WA 1JD9A 2FHBA 5DBUA 3QYSA 2DSWA 3VK5A 2PS2A 4FXFA 3W3OA 1O5XA 2WVSA 4P7OA 3TWBA 2OO6A 1J5SA 2RGLA 1XJBA 5C6MA 3RITA 1QI2A 4DIAA 4OT7A 1YDNA 1NU5A 4ENLA 2QCNA 3QPYA 1M7JA 5C9RA 3WD4A 4H19A 4F4RA 1TZ9A 4E6MA 2VFDA 1Q4NX 4O15A 8XIAA 2CU0A 2EPHA 1DQXA 4WSHA 3VUSA 4ADUA 1XLGA 1WDDA 2V3FA 1X96A 1XH1A 3NOYA 3PUDA 1A53A 3K8LA 1YMYA 3M46A 2XPKA 2PP0A 3L0KA 3DUGA 4U33A 4RNIA 5E93A 2BODX 4B4HA 3N2TA 3CS2A 2I5GA 1S3HA 4GA8A 4O1DA 4ERAA 1XIBA 3UD6A 1KB3A 3C5QA 3P8IA 1AW5A 2CERA 2IKHA 2XH2A 5DCDA 3NG3A 3CO4A 4HU4A 3LUTA 3C2VA 1D3CA 3GZ3A 1Z89A 4DRSA 2NUXA 4XAFA 1IR2A 3CTTA 2SFPA 3O2LA 3W25A 2ANUA 4MF4A 4H8HA 1B3OA 3DZ1A 1DXIA 3CT2A 1Y8BA 4MZYA 1A80A 1HP5A 2DSUA 4JPGA 2D0FA 4V1YA 1LQ2A 3SSZA 2DZSA 2OFJA 1E6PA 2J8GA 3RM9A 3AYTA 4O13A 1CXIA 3K8MA 2ZUNA 3QGAC 4X22A 4LUTA 3MB9A 1B0IA 2PP1A 3KOFA 3U2ZA 4PCFA 1FHVA 5C2GA 1W5QA 1WA3A 2J9XA 1H5YA 5AHMA 2E6DA 4N9DA 1KBJA 4TV5A 1SMDA 2OLAA 3A23A 1V02A 4DJDA 3UW6A 3TYAA 4EPEC 3CPGA 2RDWA 3SY5A 2QVNA 3KX6A 1EWEA 5EGRA 1CTNA 4Z42C 5HINA 3CWOX 1NAL1 2O4QA 4GI9A 4GC3A 4QE4A 2R91A 4Y9PA 4M8UA 1JXKA 1DOSA 1LZOA 4LV9A 3S2JA 3AIBA 1E5JA 4IJCA 4K1WA 2EG6A 3M41A 5HA7A 4NU7A 3UWYA 2GWGA 5LHFA 1VBGA 1SFLA 3WH8A 4EXBA 3UA3A 2OSYA 3LMYA 3WDIA 1K02A 3KUMA 3EB2A 3T44A 1E72M 1H7OA 5CPMA 2EAWA 3GU2A 3LK6A 3WBYA 3U4FA 1A0DA 2DP3A 4X0NA 1E55A 2D3NA 1V5XA 2CBIA 4KERA 4QITA 4YVPA 3T4WA 1XIGA 2ZUVA 2GDQA 1EEXA 1DJYA 4P7NA 3WF2A 3OLDA 2GQ3A 4DM2A 1YIXA 1B9BA 4GYPA 4AD1A 4O53A 2Q6ZA 4N9BA 5MKGB 4C1NA 3LM7A 2C18A 3M9YA 4HJFA 4D2JA 3CH9A 5FOOA 4PSRA 5A2AA 2Z28A 1TRDA 1UWAA 1W56A 1QJWA 3TTYA 3IACA 4MWAE 2A3AA 1O12A 2CBJA 3C3NA 1H2JA 2CLLA 4Q4QA 4PB3A 3VNDA 3IJLA 2DEPA 5C7HA 4HYRA 2YPIA 2VX5A 3PPCA 3CH0A 3N9SA 4LAOA 1YKWA 4JCLA 3CAKA 2BP1A 2VEKA 1XBZA 3G1FA 4AF0B 4UTTC 1REQA 1Q3NA 3CHEA 3R79A 3F2CA 1UD6A 5CPSA 2VCBA 4Z08A 3HPAA 3OLEA 1GG0A 1TPC1 1DJXA 3M44A 2DZUA 2UY3A 3SCPA 4JYEA 4JQ3A 1S39A 4K8EA 3NQ7A 4LJ3A 3IWPA 4IPLA 1A5NC 4HK6A 5C5YA 3RX3A 1A5BA 4XISA 4EF9A 1JG9A 1R87A 1F3WA 1KRMA 1LUCB 1KXTA 3SZ8A 3GH4A 3E5BA 4MG4A 2WJEA 1JPHA 4AC1X 4PTDA 1VS1A 3ARQA 4KEMA 3ECQA 4EK7A 3FSUA 3U8GA 2PE4A 2ZUTA 4A35A 2B7QA 2I17A 3UEQA 4B91A 3HPZA 3KS6A 3M0LA 1J01A 1S2WA 2Y4SA 4QLLA 4I7VA 3R89A 3S9IA 4BA0A 3UPBA 4Q8WA 4CD8A 3NEHA 3B8IA 4MYAA 3B0XA 4DZIA 2QV4A 4ZGYA 3DECA 3LXAA 4C7FA 4YHGA 3OIHA 1XYLA 3G1RA 2AL2B 4B5TA 3LTPA 1I2NA 2BWGA 4G7EA 5HMSA 3VMPA 2INEA 4AQLA 3T40A 3UF9A 3HO8A 4HHPA 2ABAA 1QW8A 2GUYA 1TSIA 2A7NA 5G4HC 3G8EA 3TFXA 4PB5A 4YTTA 1UBPC 4H9TA 2A21A 2VEPA 3H54A 3ATZA 3AHTA 4KCVA 4C1LA 5JVLA 5F4SA 1HFBA 3A3HA 3ARVA 3W87A 2ZXBA 3IRDA 5MF5A 2JK2A 4DNMA 3AHXA 1D9EA 2GOUA 3KBJA 6ENLA 2WNZA 3SGUA 4QHRA 1FWEC 4NJJA 2V69A 1JPMA 2J9YA 3UU0A 4Q8OA 2PDHA 4AVNA 2G5WA 3FYOA 1W1PA 3GE7A 3OODA 1ENUA 5BXSA 2GLKA 2WZHA 4FX8A 5D2VA 1I1XA 4H01A 3C86A 2QJIA 3VGFA 5B80A 1F4AA 3S3GA 2VT0A 1RBOB 1BD0A 1O1HA 1JQVA 2HQAA 2A3CA 5EMUA 3NCOA 4FHAA 2NZLA 2B4GA 2PF8A 4QEHA 1W3JA 4PL2A 1V0MA 5HQEA 2Y8UA 4DBUA 2R1LA 3FLUA 1T96A 4KGJA 5IFPA 2W79A 4XQ6A 1XQLA 1R85A 2ZQ0A 5BMXA 3EX6A 2DIKA 3VAVA 3D3AA 3MW7A 3TQKA 2OYMA 2CW6A 1TR9A 4GYFA 2VGFA 3S47A 3IIXA 2WSRA 4C6EA 1FX6A 1YADA 1AMKA 5M03A 2GSJA 4O52A 1E15A 2EJAA 2VC7A 1MUMA 3EXSA 1OCJA 4L61A 1ALDA 2EKCA 4ZENA 2QCDA 3GW0A 3QHNA 4UFMA 3D47A 5FAGA 3T08A 5DX7A 5BZAA 2ZRWA 3H24A 5DRCA 4XZMX 3UJSA 1V4YA 1Y5XA 4GH3A 4I9MA 3WJXA 1EF2A 4PA8A 4AY8A 1P7TA 4DWSA 1E0UA 4RZ5A 1BRLB 5D9NA 1FTXA 2WZEA 3WCZA 4S23A 1OCBA 1NY1A 1UUQA 3DGBA 2HK0A 5BW6A 2VM8A 2UY4A 4I90A 4Z1BA 3MI2A 3GXFA 4IJBA 2JGYA 2W66A 4HPHA 1BVWA 3UA4A 4F9DA 4M0XA 4FNQA 3H6OA 6A3HA 2EGZA 3PZNA 2F61A 1GQKA 4DBSA 1WQ5A 2B7NA 1GTEA 1YDOA 2Z25A 1UD4A 4U2ZA 2FZ8A 3ARSA 1R30A 4O12A 4QE5A 2C13A 5I0DA 3PZGA 1F76A 3NM1A 4AD2A 1XF0A 4GWEA 4IMFA 2J7CA 2R1KA 3ENLA 5I3DA 3D3FA 5I3JA 2Y61A 3PZTA 4HNUA 1EPVA 2HXTA 3T4CA 1XWYA 3G1XA 2G3FA 5D2TA 2PGEA 1V3MA 3VMNA 4D6IA 3WQ4A 2DT3A 4Q8QA 2HRWA 3DG6A 1LQ0A 3G0SA 3TSBA 1O94A 3T7VA 3CUIA 3GDTA 3GHTA 4JN7A 4AIOA 1CLKA 3P5YA 1LROA 2FZ9A 3HOJA 3UYIA 3EEZA 4DX3A 4F3HA 3N17A 5H8MA 4GABA 2BVTA 4W8LA 3I3DA 3VPLA 3PM6A 1EC7A 4WDTA 3R8RA 3LNMA 1CGXA 2OEMA 4M6VA 4UR8A 3UG5A 4DO5A 4KGLA 3UR5A 4FOUA 4HHLA 2UBPC 1AODA 4JHMA 3SO7A 3E49A 6XIAA 3QBUA 4RX0A 3AMCA 4FAMA 1K8YA 3CZ8A 4P8VA 1W8GA 2CFFA 1GOMA 4S1FA 1M65A 4Q3MA 1JI2A 2Z1VA 1FWGC 3XIMA 3AIEA 1CNVA 2YCJA 3WLHA 1W5MA 2ESCA 4M7SA 1HL8A 3UWQA 5DT5A 1PZ3A 3LRMA 4JX6A 1IIHA 1M68A 3ICJA 1DWGM 2XIMA 3DFOA 2V67A 4TXEA 3TTOA 1ISZA 4JL2A 2DZVA 2Z1BA 4IQJA 3BGJA 1UKTA 5DMMA 1GCYA 3P14A 2REQB 3LHWA 5BU9A 1WV2A 1ONXA 5C8BB 1S46A 3KEHA 3URBA 5JXQA 1FWSA 4L1WA 3VABA 5AY7A 2J88A 4MJ2A 1OGSA 4GUIA 4PMRA 4F0HA 4S3KA 1TTJA 4L4MA 2QGHA 2G96A 4OBTA 3SI9A 3SRHA 4ZQCA 3B0PA 4PRTA 3O7UA 1JYNA 1BTCA 4GE8A 3T09A 3ZVHB 4L4LA 5EA9A 1Z8AA 3HG2A 1TV3A 2QW5A 4H9XA 4JL1A 1OC7A 2BDQA 3RU8X 4LSBA 1X98A 3FNDA 4I7UA 1KNWA 1QNPA 4LXFA 4ORIA 4US5D 4ZE4A 5BWAA 4XD3A 2Z7KA 4YS1A 3WQOA 3W22A 1XBYA 1UWSA 1FXQA 4GKLA 1SW0A 3THDA 3CUFA 1JCNA 1U30A 2E6FA 4WJXA 5I78A 3LDVA 4JZ5A 1B3VA 3A64A 1KD0A 4HCHA 3P80A 2RKXA 4YCPA 3WH7A 3DI1A 1IE7C 3V5OA 3T07A 4TOQA 4WF7A 4LRSA 3UR2A 2E8ZA 3TXVA 3RLVA 2V82A 3PZVA 4M80A 3QN3A 4CU8A 4AZBA 1L0PA 1NOWA 4NZ5A 1GQIA 4HTBA 3AMLA 3VD5A 1J18A 4G5DA 4HK7A 2C79A 2IUZA 3OB8A 3KBWA 4H00A 4FR6A 1UC4A 3GNNA 2Z24A 4YJ5A 1AQMA 1FHUA 4W5ZA 2DZWA 4NYYA 2W92A 1A0CA 4JIQA 1E0TA 3WLLA 4RPPA 1C7SA 3TQ0A 3GTXA 3AOFA 5J8LA 1VR6A 4TX9A 3RCNA 4C6LA 1I8JA 4JIPA 2HE8A 2Z7GA 1ME9A 1RPXA 4ACYA 1TTIA 2DJXA 1X1OA 1V7YA 3MQTA 3BARA 3H23A 4ZA0A 8TIMA 2P50A 4PFMA 1OFEA 1BG4A 3YPIA 3WH9A 2UZ9A 2J7DA 4JIHA 4WUIA 4OFCA 4JQ2A 1RY8A 1ZRQA 4REQA 4GVHA 3I6TA 1HKVA 3REQB 3U5YA 3UR8A 2WHKA 3LBCA 3PWIA 2VOMA 1OC5A 3UERA 5D8WA 1JGMA 2CESA 3R25A 1BXNA 1W3HA 4V1XA 4UCFA 3DFQA 1TELA 1W3LA 1Q6QA 3JW7A 1AH4A 4H9UA 5HAOA 1W1YA 2FB2A 1V93A 1TB3A 2YXOA 4XG1A 4HJWA 5T26A 3B03A 3K4DA 4JEJA 1K6WA 4H41A 4WEVX 1OZMA 4IMEA 1ZAJA 3PBVA 3T0CA 2JKPA 3QKZA 1TA3B 2CLEA 3WNPA 4YCOA 3KZSA 3TTQA 3NURA 1H7WA 4A6GA 3G24A 4AD3A 1O60A 3CNYA 4FF5A 3KWSA 2X1TA 4BEQA 1N2VA 5I2UA 3VCCA 5A5WA 1MI3A 3CLMA 3FAXA 3MT1A 4QRNA 3S6OA 2YA0A 4PULA 1OFAA 5HANA 3AWNA 5F1VA 3VDHA 3S5OA 3BG9A 4GJIA 2HISA 3GFXA 3DI0A 3WLNA 3ITVA 4NP7A 1TKKA 5J5RA 2BY3A 2W91A 2ZE0A 3H2EA 4HK5A 4JNZA 4ZO6A 3M0HA 3E1F1 4IQDA 3IGUA 4K39A 5DELA 3INPA 3PUOA 4UTJA 4JTRA 1HVQA 5F2IA 5I06A 4HA1A 4DBWA 4RDZA 6REQA 3CZGA 2WBKA 3STGA 2XFYA 3NQ8A 4IFKA 6PTDA 4DJEC 1TV4A 3C0JA 3S1GA 1G0CA 5B7ZA 1UQYA 5BNKA 5GJPA 3EYPA 8RUCA 1DWIM 3TP4A 1CECA 4EIVA 3IUIA 1CBGA 4UTHA 1XRTA 1B3YA 1KXVA 3CJPA 3GIYA 4JHOA 2X09A 4L80A 2DSVA 1F5ZA 1EJRC 2YCKX 4U31A 4CN6A 4GJJA 2YLLA 4MB1A 3BH4A 4BQ2A 2BOGX 4FOKA 5H2ZA 3ZR6A 2A3HA 4O18A 3STCA 3BAJA 1O5KA 1ME7A 1ODUA 3K13A 3PS7A 3URAA 3AFBA 2YSWA 3M0IA 5LIUX 4HN8A 3SBFA 5AHLA 2VC5A 1ME8A 2C3ZA 1WOAA 1KTBA 3GXMA 2V0TA 2UWFA 1Q6RA 2V30A 4Y96A 5LNRA 5A8PA 3HMCA 4ZR8A 1JDAA 5F4WA 3WQCA 1Q4WA 3CEUA 4UCGA 3W1NA 3MDUA 4EXQA 3QZAA 3WF4A 2F8QA 2ZDSA 2G0WA 2XUCA 1TRIA 4PGLA 3TSMA 1V6YA 3MI3A 1SSGA 4AZ5A 3HQPA 3UG3A 4K7YA 1XSKA 5JIPA 1NP0A 3I4KA 1VAHA 5K9DA 3OHIA 2Q3RA 3ES8A 4B5XA 1IZKA 3UXLA 2CIPA 3RMEA 3V0TA 1ZP4A 2CEQA 2F9RA 4HVXA 2XHYA 3VD3A 4IIBA 2XGBA 4D1IA 2OELA 4HKPA 3TYZA 3PN8A 2ISWA 2OX1A 1XYZA 3VNIA 2Z1SA 1XIDA 1S5MA 3U7BA 1V6VA 2MUCA 3GAYA 3C61A 4OKDA 4TX8A 1P6WA 2I5IA 2RFGA 2VEMA 4R7WA 4PTNA 1OYBA 4ACZA 3PJXA 3CTLA 4TU1A 2W67A 3OZPA 4CD7A 3BLEA 1SVDA 2GGJA 3FYYA 1B2YA 5C70A 3CBWA 3SY8A 1H60A 5DXXA 1KM1A 1ITQA 1CLVA 4LBRA 3PWAA 5LIKX 4BQ4A 1QWGA 2OT0A 2V5BA 3L9CA 3ABOA 5E5CA 5A3HA 1AH3A 3DFHA 1KCXA 4XKYB 4ZQPA 1FUYA 3FGCA 1IWBA 4B16A 1JFHA 4WZHA 1VD6A 2UY2A 3R58A 1LT8A 5CG0A 3W73A 4BWLA 4CNPA 1TPWA 3VX0A 3MUY1 1T8QA 4KF1A 1L6WA 2RDTA 1QI4A 5AN7A 5IDZA 3KHDA 4EAMA 1CT5A 3LPFA 3PAOA 3VGEA 2DVUA 1PZ2A 1U5JA 4XSMA 3GBDA 5AYYA 1B4EA 4B92A 5A6KA 4LYRA 9XIMA 1G4TA 4A8LA 2Z00A 1W1TA 3APTA 1WB0A 3BDKA 2FGBA 1E51A 5AHNA 1JYVA 1YXYA 3B9EA 2GJLA 4LB3A 4NHVA 4GD0A 4HMCA 4JTHA 2Z29A 3KLKA 3WSUA 3IIPA 4U2YA 2YL6A 4DLMA 2YL5A 1EEPA 4WRHA 4QTGA 1NARA 2X40A 5A2CA 1NJJA 2NW0A 4MSSA 4IGNA 3QW3A 4UFHA 4XTIA 3WNOA 4V15A 1H09A 3O6CA 1OINA 4M6UA 4C6CA 3E2VA 2J77A 1EC8A 1VYSX 3B9NA 4HMEA 3SB0A 1Q7QA 1SO6A 1V3LA 3QXBA 4IFRA 1GTHA 1NQ6A 7TIMA 1E6NA 2R14A 1TUFA 4A21A 3R0DA 2ZA3A 2VTFA 5BXRA 1GK8A 2FZMA 2X0SA 2J79A 3KTSA 2HMCA 3ARRA 1IWAA 2VR5A 3RX4A 3UXKA 2NX3A 4YIWA 2A85A 4XAZA 2Z2UA 2FZNA 2R24A 4K6AA 4YLWA 2P8CA 4MVAA 1G4SA 1FWJC 3ZLGA 1JZ6A 4TVUA 4QX4A 3GDMA 3LCGA 9RUBA 1PHQA 2GZXA 3KVKA 2P8BA 3RJXA 3LQGA 3A3WA 5I3IA 4O8RA 5BMWA 1U1UA 5CC3A 4L9YA 2GJRA 4FNRA 4JCMA 1UKOA 2HZGA 1LOQA 4DAFA 4HNVA 4MZ1A 4JHZA 3OHMB 1LG1A 4N6EA 1EH9A 3NO3A 3W2KA 2Y7FA 2TYSA 3FJLA 1YRRA 3AI0A 1ZZMA 2XFRA 3HF3A 1GQJA 1J2WA 1NWRA 1EJSC 2BSLA 1FWHC 4G6CA 1V8EA 2HCVA 4C91A 2WLZA 4ZTYA 4FI4A 1ZBWA 4GI4A 1K7FA 3MYPA 3FVMA 4HU8A 1EGZA 4A2SA 3VKAA 3DYOA 1XBXA 2XG9A 3KL0A 2NUYA 4HNTA 4LVBA 5F4XA 3AS3A 3ZT5A 1JNDA 2FMNA 3GM8A 3NIYA 5AZ1A 1BSLA 1FA2A 1ZNNA 3RO6A 1TQXA 4KWWA 2NSXA 5H6HA 4GX8A 1OFPA 4IFOA 2PRHA 2HTMA 2NQLA 2NVAA 3HPSA 1YE4A 1FFRA 3W7CA 2FFIA 2WVUA 4KWSA 1L9WA 3AUJA 3V75A 1K70A 4IGMA 3IJIA 3MUXA 3FYPA 3MUZ1 3TK7A 1EDGA 3MCOA 4XBKA 3AU6A 1JDDA 4W8AA 3LHUA 1BQGA 2GVYA 3MA8A 3NQDA 3V18A 2BY0A 1QWKA 2QULA 3VOJA 3G1YA 2VD9A 1R3RA 2B7OA 5IBXC 3CU2A 4XUGA 1SW7A 5H8UA 4GUGA 3PHAA 2Y62A 3BK0A 2CHRA 2J9ZA 1VFLA 2VX6A 3ID7A 2BHUA 3WUGA 3K4AA 4MPQA 4C7GA 3ZMRA 4PSPA 2DV0A 1TJ2A 2Q8LA 2QZRA 1ZJHA 1XL9A 3LOTA 2ZOXA 3WLRA 2AL1A 4O19A 4RZ6A 2BS9A 4ONVA 3SCRA 5FAJA 1F3EA 2WQDA 1LL6A 2TODA 3BAIA 5I79A 2Z6IA 4ZO9A 3TXZA 4WD0A 1RLCL 4L1XA 1R47A 1VP5A 3A3XA 4L7ZA 4S3GA 5JH2A 3MCMA 1W54A 1JGIA 3P7YA 2WANA 4RK8A 4UTWA 5SWUA 4C7DA 1H49A 4LS2A 1S2AA 2J8FA 5T9CE 4JFSA 4W8BA 1FH8A 4CU7A 2DZTA 2NVCA 4AFYA 3MANA 4IMDA 2J27A 3N2CA 4JN6A 5LHEA 4I9JA 3SW6A 4MZ8A 1QASA 3W7PA 3WBXA 1LL7A 3E2QA 3DC8A 3CAQA 4L4PA 4XD5A 1UR8A 1A4LA 1IGWA 4LYPA 4ZFMA 1Z7AA 1RVKA 1E1CB 4DYJA 3L4UA 1TWSA 2GJXA 4RKAA 2CPUA 4BS0A 3URQA 1K9TA 3UG8A 3HG5A 1UA3A 1K4HA 1TZZA 4LRTA 4LVDA 3C52A 2AKZA 1RD6A 1RXOB 1UB3A 3GTIA 3JZUA 2PWGA 4UR9A 3SEPA 3UFYA 2OYKA 7XIMA 1LRQA 1VFUA 4ICCX 3C8NA 1V0LA 4OIFA 1WP6A 1ZJIA 3CIXA 4B3ZA 2YW3A 1BPLB 4UTMA 2V63A 3M5XA 2X16A 5LGZA 3E9AA 4QAIA 1QW9A 3VDBA 2VCAA 3V16A 2YGYA 3NVDA 5GNZA 4C5ZA 3HZ3A 4O1CA 3EWCA 1EXPA 3LI1A 2PDBA 3R6IA 4DXVA 2YA2A 4CNNA 2PWEA 5LNSA 4LUSB 3P61A 4WXYA 1UOZA 3VCNA 1PO9A 2ZTJA 4DYEA 2PDYA 3IARA 3KLLA 4FXSA 1HKJA 1W9UA 1WUEA 1CGYA 3IS4A 3V1HA 4H04A 4LVAA 1VEPA 4B4FA 3LENA 3VC5A 4NRSA 3FN9A 1OADA 2OVLA 1GPWA 1HIZA 4NILA 2WW5A 3EPMA 3S1XA 4C6KA 4UTTA 5KINA 3AJXA 1Q6FA 4X9YA 5AHEA 3PBYA 3DOPA 2PDJA 7TAAA 1H63A 1QTWA 1S38A 1LP6A 4XTDA 3QF0A 5KMYA 2ISSA 2WZTA 4HQVA 1JZ4A 2YCLA 1VBRA 3WQVA 3E0LA 5HNTA 2VHLA 2R1PA 3PULA 4PMXA 2FB3A 4QDPA 4EWJA 3VFCA 4Z17A 5HWNA 2CLMA 1XW8A 4J7RA 3VNMA 3UZJA 5G4EA 3S5ZA 1YTKA 3ARUA 3C2RA 2XH4A 3GG0A 5C55A 4LY4A 4R34A 4M81A 2IQ0A 3EWYA 3Q4DA 3W7DA 4O57A 1FKWA 4PODA 1Q63A 2IS7A 4KFPA 2NXGA 1IIGA 4DJFA 3XINA 4Q4MA 2OEJA 4NNCA 1XG3A 3LHZA 3MSDA 3NEVA 2VX7A 5HUOA 3GZAA 4DHGA 1V0NA 1B9ZA 1SFTA 3L4YA 4FXJA 1X8FA 3SDOA 4IZGA 4AUBA 1Z48A 4IIGA 3T0TA 3UNDA 3VIGA 1CX9A 2QYGA 3EB4A 1A0EA 3UZWA 1GEQA 4R5EA 5JH1A 1UH4A 2PEVA 4HPJA 3IK2A 2H8XA 1UHVA 5FSDC 3IV8A 3VIHA 3AJ7A 4UFKA 3E0WA 3AHVA 1M7XA 2E5DA 1TPFA 4DZAA 3FA3A 4B5SA 2GVEA 4PBFA 3SCOA 3CC1A 4FA3A 2GVJA 5IDIA 4QDMA 2E77A 1Z6KA 4WK9A 4TVDA 4KH2A 1I0DA 1QVBA 3LQLA 2Y8KA 3NR0A 4JYDA 3OBKA 3VD9A 1A5KC 1JR1A 3GC2A 4WIWA 5AYIA 1THFD 3O6AA 2VEGA 1Q8AA 2ZC1A 3OG2A 3Q45A 2GFTA 4UNKA 4ES4A 1YHTA 2W61A 2WZMA 4X63A 3P81A 4XO7A 4DLFA 1R3SA 4GZIA 4AZCA 1J2BA 4LWWA 1E1EA 3AROA 1Q6OA 3VGBA 3Q37A 4IM4A 2OU4A 1POJA 4L56A 1NVMA 4BCEA 1FP8A 3RHGA 1R9ZA 1E4IA 1HG3A 4KEUA 1GW1A 3E0VA 2X7WA 2I56A 2C1HA 3VIJA 1HP4A 3PUGA 4ZL1A 5JUVA 4XX6A 3AIVA 4MAVA 2WWDA 3O05A 1ZCCA 1TJPA 1A5CA 3WLMA 2F84A 3KCLA 2WXDM 4RNJA 1M01A 3GNPA 1H62A 4JQ1A 1AH0A 5DBTA 1QOPA 2XIBA 3AZRA 5F2LA 3AUOA 1PAMA 1J9YA 1LL4A 3AIUA 1TPVA 5BOOA 1Q2RA 5F1UA 3MJMA 2O9PA 2FH8A 4QP0A 2DPEA 1L6GA 3GWQA 3TAKA 4B2DA 1M53A 4LVFA 3UP8A 3L2MA 4AZHA 2CHNA 2A7RA 1IXPA 3M4HA 1SZFA 2VCCA 1E4LA 2NSOA 3JU2A 4CCEA 5BRBA 5LIWX 3B4YA 1ICQA 4GGHA 3TN4A 3V1PA 2CITA 1DJZA 1VHNA 2JGQA 1Z9AA 2QR6A 1RP9A 2QCHA 3TLQA 3U2EA 1JYXA 2FDMA 4YTSA 4F2BA 1DE6A 1ZCOA 1W5PA 3SN1A 1E9YB 4WKAA 1M6JA 3DYMA 2PI6A 5CSYA 3BW3A 4ROPA 2QV5A 1EJXC 4D1JA 5D8ZA 2PF0A 2CLKA 3M0ZA 1P6BA 4GNJA 1R7AA 2ADAA 2DIJA 2VELA 3TQVA 4S3EA 2GGGA 2FPVA 3OQ8A 2RDXA 1JI1A 3G18A 2H90A 2PDCA 1CLXA 4PTMA 2I1OA 1A50A 1H41A 3I6EA 3LY0A 3ERPA 1QATA 3DENA 3G22A 2Y24A 1T5AA 3T2QA 1TV2A 5DRIA 3W00A 5J5DA 3V0UA 1CXEA 5FF7A 1F9CA 2GDVA 5I00A 1TWZA 2ZC8A 3UCQA 1UKQA 5CPOA 3WQ6A 3IV3A 3WLKX 1JIBA 2QJMA 3F03K 2XSAA 4ZBCA 1HVXA 4LF2A 2VGGA 3RX2A 2WHJA 3HFTA 4Y8FA 1P0KA 2WJFA 3EOUA 3NQMA 5A6LA 3WEOA 3ARTA 3NL2A 1N8FA 2V9DA 4BK9A 1ODZA 3FDKA 5FD0A 5KZEA 1AZ2A 1OB0A 2GQ8A 3I68A 5EMJA 4A8RA 4HA4A 1EWDA 1EGVA 4GHRA 1DHKA 3BGAA 1MDLA 3APGA 1RA5A 5CZKA 4GQRA 3S6DA 1XC4A 5K4XA 2CZDA 3GU1A 3W74A 4FXRA 2OKTA 3L4TA 1GYNA 2AOSA 4HZ6A 2YFNA 4JX4A 4B15A 1GOIA 3IJ7A 1MUCA 4H6RA 2ZCGA 4QAWA 2ZZ4A 4KRUA 3Q67A 2PGFA 2XM2A 3M0MA 4H1ZA 5G4WA 1YTEA 4OWGA 3FEQA 1C8VA 3PZ9A 1FCUA 4PEEA 2PDKA 3TV8A 2WPBA 1QR7A 4ZFCA 1OQFA 3CT7A 1OG6A 3UETA 3N11A 3UXAA 4URIA 4HMNA 1RK6A 4KT2A 1EA9C 4QG8A 3TYDA 2VR2A 1GWJA 3WN6A 2XISA 2GOKA 3WK3A 2HWGA 4C6NA 4F8XA 2EPNA 4Q8VA 2CKRA 3WKZA 1WAUA 3H7RA 3RXZA 3VE7A 3Q65A 5EMMA 1UP3A 1VLWA 1XV8A 4Z2KA 4IX2A 3FX4A 1OIFA 2J47A 3A4WA 5DY3A 3DHFA 3F4DA 3NL6A 2GWNA 1JDCA 3EWXA 1JZ3A 4W5UA 4AWUA 3GXDA 5HQLA 3OBEA 4AZGA 3TYBA 2DW6A 2DGAA 4YTQA 4RR4A 2V3GA 3DXIA 4BY3A 1KGUA 3ABRA 2FLIA 2QEZA 1PCWA 5IOBA 1ZALA 1V6WA 1VHCA 3QMSA 3VX1A 3FFSA 3UGRA 1MEHA 2GK1A 1TWDA 2VL4A 4PTVA 3B06A 1ML1A 1Z42A 2DVTA 2LLEA 2VVNA 3ZS4A 2Q3OA 2A6LA 3GNRA 3W1PA 4CQCA 4JEQA 1AK5A 1X1ZA 1C8QA 5JMUA 1BXBA 3HB9A 3LV5A 4ADSA 1D2KA 1CGTA 4I9AA 4ATLA 4S38A 4NX0A 3ZWTA 3WD2A 5CC6A 3N13A 3SQLA 2BOEX 2CXEA 1QW7A 1JUEA 3NGFA 2ZZ2A 2VFFA 1C90A 4LX4A 3ZT6A 2D24A 3F5JA 3UR7A 2YZRA 1XRVA 3HQ1A 1QHPA 2PDMA 1BVNP 3GU9A 1G01A 4WKFA 3DESA 1DIKA 4AIUA 2FQIA 3COTA 1GHRA 1RBLA 1SGJA 3CHVA 5E70A 1ECEA 1EFZA 2HXUA 2EQDA 3T0AA 4HYVA 3GSMA 4UQEA 4IISA 3ALFA 3P0WA 1EOMA 2E9MA 1ZBCA 4UR7A 3VNZA 4Q8TA 6XIMA 3W71A 4N4QA 2VFHA 2V6AA 4E8DA 5HQMA 2L5HA 3VIPA 2VOTA 3TAOA 4OE7A 3GAKA 1LOSA 3QRHA 2GVLA 4M24A 1XYAA 3QVQA 1Q66A 4BI7A 1RQHA 2P88A 3RCMA 3OO2A 2WJZA 1LBMA 2QJNA 4AB4A 4QISA 1A5UA 4GRSA 3BQ6A 3SY1A 2ACQA 2ZTKA 4EPDC 1J0ZA 2E6YA 2GGEA 2XTKA 3QSTA 4UQCA 1AQ0A 3DBNA 1LBLA 1VGAA 4B9YA 4HZ7A 2IW0A 4HSOA 4UQ9A 3VZXA 1KGWA 1PX3A 3KOXA 3AS2A 2WLYA 4MDOA 3ANVA 4RE0A 3N2MA 4MUPA 3CQKA 4CNUA 2QUTA 3H21A 3QV7A 3I3EA 2O56A 1XDLA 2BLEA 2NQ9A 4Y9NA 2OGYA 3O3RA 5T9BG 3M1ZA 4U5KA 3WLQA 4Q8PA 2WMKA 1MNSA 1F07A 1SUXA 3M16A 3GXPA 4F79A 3EPOA 1VFHA 2PWHA 3M5YA 3NXLA 2A3LA 2J7BA 1XLHA 3EX3A 4OGZA 4XIMA 4CCZA 2E68A 2QUNA 4DJDD 3KTXA 4HOZA 1ISYA 1JZ8A 5FEWA 1FFQA 1EIBA 1KFKA 4XV0A 5EKYA 4IUOA 3IIZA 4QLKA 4K37A 1YBQB 2XSBA 2WBGA 2E28A 4NVTA 1POKA 1T41A 4YNGA 1TMLA 3GHSA 5E0KA 1D3HA 2D3LA 5BU6A 2O7SA 4W87A 3NPVA 4OOUA 1L6SA 3A13A 1SR0A 4CD4A 4D6GA 1OFQA 3AQUA 2GUBA 3ES7A 1B30A 2DDXA 3MMTA 1YNQA 3OLGA 1UR0A 4NJIA 3W07A 4ZODA 1EJ7L 1QNSA 3LCIA 4DJEA 2Z27A 4GJ1A 1B4KA 3QJAA 2Y5JA 1AJ2A 5DFAA 1W3IA 1GEHA 2VRJA 3AISA 1DIEA 4MB3A 3BOLA 3OGVA 2JKEA 2CKSA 2QCFA 3BOFA 3RRXA 1HZYA 5CC5A 1Q85A 5KETA 3TNOA 5A8OA 3L0NA 1GVQA 4OJYA 3MHUA 3W7QA 4DEFA 3WBAA 5BXPA 3U0HA 4AD0A 2NV9A 1CDGA 1BXCA 4FO4A 3GLCA 1QCWA 4S2BA 1R3QA 1JXJA 2X2YA 3CV2A 1O5QA 2WC4A 1IQ8A 1S5VA 4GIAA 3TUUA 3M43A 4Q4KA 3RK8A 3FJ4A 3IGXA 1A5AA 3UCCA 3LXCA 4S3FA 3S5YA 3ZYZA 3FS2A 2XVPA 1U83A 5M17A 4C6BA 3HQNA 2YYUA 2HVNA 4H6QA 3V35A 3WQ5A 4TQTA 4G9PA 2A2IA 3OVGA 3E3HA 4MWAD 4YYCA 5AHFA 1PJ9A 5D32A 2OXNA 4IF2A 3PTMA 4H2HA 2IKJA 3NZRA 4DF2A 2QNEA 1V7AA 2DIEA 3PF3A 1KLYA 4X2PA 3C2YA 1VRDA 4E4UA 2WWCA 1W3KA 3W1UA 3OGSA 2XSXA 2Q8ZA 4GZ7A 2YW4A 4FNSA 5IHSA 2O4MA 2EPKX 3HBLA 3MTWA 3N4EA 5GNYA 4MKVA 4YN5A 5FKYA 1JQXA 1E70M 2G97A 1V3IA 3LNPA 3KVMA 1XX1A 2ZVIA 3TDFA 2XN1A 1IR1A 4U3AA 1A3WA 4J3SA 2X42A 3MWCA 4GIYA 3GXNA 1SFSA 3EDEA 1GOXA 1C91A 2QJJA 1ZTVA 3LS9A 4PUMA 4B5NA 2BVYA 3F2DA 1F8MA 4IMCA 2DQXA 4YWSA 4CVUA 5I09A 2E9BA 1KLZA 2CBVA 3N6JA 3ZIZA 3M6DA 4Q22A 2A1YA 2WB5A 4Y9MA 3I4EA 4HNCA 3ONCA 4E2BA 5KZMA 2GVGA 3ZVIA 3FXYA 3R4IA 4HZ8A 2TSYA 3GDLA 3T2OA 2IPFA 1DP0A 3R11A 4GYJA 3K30A 2X0YA 3WF3A 1XQKA 5A6BA 4LH8A 4QR6A 4PUJA 4ZQOA 3N9RA 1YQ2A 1BKSA 2I14A 5CJNA 4HPGA 2FTWA 1FWCC 1M04A 3GW3A 5KZDA 1CXLA 2VUYA 4FP1A 2DZAA 5D03A 3I65A 1XLDA 4ICNA 2QQ6A 1VIWA 2BY2A 2BVWA 1VBHA 2BG5A 3M47A 2QPUA 2EPMX 4ML9A 2PDQA 4ZSTA 5LXEA 1XLKA 1DORA 3A6OA 3BLFA 1V77A 3QFWA 3B0UX 3LRKA 1MXGA 4ZQRA 2CHOA 3OQEA 4CNSA 1MMFA 3UZ5A 3VU2A 2TAAA 4DAIA 2ZVRA 4H3DA 3WQ8A 4MYXA 3B9DA 2YXXA 3AXIA 4EKJA 4YPJA 1TPH1 4NAFB 1U22A 5JBFA 4HCDA 2FJUB 4E3VA 3N34A 3AS1A 2OB3A 2YIHA 2WVVB 4ZXLA 1H4PA 3GC4A 4M1RA 1EHNA 4J28A 1YXDA 2Y70A 4LAZA 3GTNA 2ZUUA 1DWAM 4DQWA 5TAOA 3FA4A 3HG4A 1EIXA 2PU0A 1RQBA 2J6VA 4DJDC 4D6FA 2EG8A 4X3ZA 3VKJA 5EU9A 1W9VA 1QOXA 1NF0A 1XCFA 3V4BA 3AALA 1B5TA 3LCLA 1P4CA 3LD5A 1B90A 2V8ZA 4WDWA 1HO1A 4KWOA 4IX0A 4NAEB 1JCJA 1A5LC 4KIRA 2OKOA 3R94A 1OX5A 3IUHA 5C2XA 2AAMA 5XIAA 2ATSA 1XS2A 3S2MA 4LV4A 3BV7A 4AC7C 1E6XM 3LRLA 4JFWA 4MKNA 4N02A 1Q8JA 1XIHA 2FVMA 1VJIA 1QI5A 3DCPA 3AO0A 4RDYA 2Y8VA 3LLXA 1TWIA 4HA0A 3CUHA 3MO7A 4UFLA 4GXPA 1XLBA 4AX6A 4MKSA 4TUFA 1KRBC 1OYAA 4O1FA 5A1AA 8A3HA 2QDDA 1AL8A 4AAJA 3FEMA 2YLAA 4GXWA 3H55A 1FP9A 4DWSD 1DL3A 3VM5A 4O28A 3U2OA 4HCLA 4ILSA 3CMJA 4I7WA 2G3JA 2FFCA 4GUFA 4JTJA 4RV8A 4CQ9A 1XRFA 1IGSA 3CL7A 1VRXA 2ZX8A 3IVSA 4MNKA 3VINA 3WL1A 3PANA 1K9DA 3N1AA 3VILA 2TMDA 2H3DA 1UWTA 3DN5A 3QZEA 1PDZA 3IJDA 5GJMA 3MU7A 1AJZA 1J0HA 3BG3A 5CLTA 4Q4RA 1J0JA 3TQPA 2BHYA 2VFEA 4GK8A 1W1IE 1UD5A 3MBDA 1EC9A 4S3AA 4MWAC 3HGRA 3T81A 1XGZA 2GYIA 1W91A 2BGSA 4I5UA 2NQ5A 1QPRA 4PCPA 1F73A 1L6FA 1EBHA 3QQ0A 2GSEA 4FSAA 1LBFA 1CB7B 1LG2A 3E5PA 1KV8A 4PCSA 1XIIA 1UH2A 2ACUA 1C9DA 3N18A 5D2WA 4RXFA 2BGNE 4XZLX 1L6YA 2D73A 2P10A 5C9XA 3WLOA 2V2DA 4W85A 2DT1A 2EO7A 1BYDA 3NO5A 2VZSA 5DCBA 1XLLA 5BOFA 4WDUA 4UFJA 5LNVA 1GVYA 4N42A 1Q2SA 4Z1YA 5HJLA 1KGXA 3L67A 1B57A 1HJWA 1ADDA 3OGRA 4JTGA 3OTRA 3S1WA 2YDRA 1TFVA 3KL5A 2QXWA 2OJPA 1TVLA 5FL1A 3H4GA 1UP0A 4XZBA 4P5UA 1OIMA 3W7HA 4KEZA 4XAPA 2BV9A 3FHQA 3C3UA 3LHVA 2POTA 3BMVA 1HW6A 5IBXA 1LJYA 2ZXQA 1L2UA 1V6UA 4N4PA 2PDLA 1RV8A 3CHCA 3KE0A 4PTWA 2ZKMX 4PEKA 4GVFA 5ABFB 2EF9A 3L4WA 1WUFA 2WO5A 3LCFA 2J7EA 3M0JA 1RJQA 3BPWA 1J6PA 3MSRA 2CXGA 1NP2A 1HXJA 1NH6A 3AYSA 2WMFA 4GY1A 1BYAA 2ALDA 4O1AA 1H1YA 4WSJA 4O11A 4UFIA 5KSWA 2QUUA 3W9ZA 4IOTA 4Q7IA 4DUXA 3RGTA 4PMVA 3IPWA 3I7SA 1HTIA 4J40A 4XZWA 3RNDA 1OBAA 3MPGA 1WYIA 4MLRA 1VPXA 1IEWA 4ML4A 1K8ZA 5BROA 2PCQA 3A4XA 2NT1A 1JF5A 1R0MA 3U7VA 4GI6A 1QMLA 2DT2A 2QT3A 2YL9A 3EA2A 3HJZA 1G67A 1V02E 4C6FA 1VCGA 1BVZA 3UZYA 3WELA 4UOQA 1MW1A 3BCFA 2HROA 4WY0B 5K3VA 4RE3A 2C91A 1M7PA 2QF8A 3GNOA 4S3DA 5LZLA 4QCFA 2XU2A 3AU2A 4YVXA 5CH9A 3K8KA 1LTDA 1M9HA 2FTPA 3R8GA 3FJNA 3FHAA 3BQ5A 5E6ZA 2EHHA 5G1MA 5A94A 2VP8A 2BBFA 5HWJA 2PTXA 2VEFA 3K5XA 1Z3NA 3QMRA 4JTTA 3CL8A 3S46A 6TAAA 4L9ZA 2Y89A 4DO7A 1RD5A 5JQ9A 3AXXA 3BCJA 1UA7A 2ZICA 3NQEA 3Q58A 1UKPA 3SCTA 4JNMA 2O9TA 4F0MA 4HYWA 2WKGA 4F40A 3ME3A 4XVEA 4PMOA 3G1SA 5DLCA 4DM1A 5REQB 1LYXA 2WMJA 3VOCA 2OTDA 1PWLA 3ALGA 2W0UA 5FI8A 2C1GA 1G1YA 4XK2A 3SQMA 3EBVA 3WMLA 2JALA 3VNJA 3WQGA 4LALA 2P3ZA 1DKWA 4V2XA 2F38A 3TA6A 3CAVA 1PX4A 4O14A 5EFFA 2BX7A 5CBBA 5TF0A 2VENA 3W2MA 1UCWA 3EB3A 2NLIA 3P84A 4KCWA 4W7UA 4Z0JA 4NZ3A 3GHUA 1VH7A 4XD6A 3GXTA 3WENA 4NZJA 2PDGA 4JIRA 2F6KA 1OX4B 2AMXA 4IG2B 5C9ZA 3TEVA 3STFA 4E2OA 1IT0A 1RY0A 4UMBA 1GHSA 6TIMA 4AWEA 4OVXA 3PZOA 3NGJA 4IXHA 3NQFA 5JBDA 1DEDA 2PLKA 4K68A 4RCXA 3N3TA 2QDEA 5HPOA 1PPIA 4C6DA 4R85A 7ODCA 3F2BA 1DHPA 3P67A 1JUBA 3HU7A 4AH7A 2ZX6A 4QDWA 1YNPA 1QUMA 4CEXC 3F5KA 3NAVA 1QFEA 3DHPA 4IJRA 2DU2A 3S9YA 4ZO8A 3KOZA 3PWGA 1EP1A 2PDUA 3SCQA 3U5UA 3KCOA 1WDRA 3NOEA 2WMIB 1GZGA 1YW1A 2BGQA 2W63A 1SZRA 3A9IA 4A8NA 3WNMA 1QU4A 4UTLA 3KDOA 3MVIA 3W24A 1H50A 3NZ1A 5FEPA 3DKLA 2XIJA 4RLIA 3RCYA 2R6OA 3KBMA 2BTMA 4AU0A 3WBWA 1O5RA 1QAPA 4XIAA 2D2HA 4KRTA 1MEIA 1VFMA 3VNYA 1YNYA 4ASTA 2XWEA 5I3KA 1JAEA 3BW4A 1EYWA 2OSXA 2YBUA 3HPXA 4GZJA 3DFPA 1PDYA 4PYSA 1MRAA 3QY6A 5HR7A 1F7BA 1MFUA 3VFLA 4KWUA 1V03A 1OFRA 2PD5A 5MKGA 3IJ8A 3K2GA 1SSDA 2QS8A 5DXYA 2BASA 3W7JA 4YL2A 1S5TA 1XI3A 1SMAA 3SIMA 4MPKA 4KCTA 2WAGA 4HP5A 4HHHA 4POCA 2Y88A 3GYEA 5AVNA 1D7FA 1AUSL 1XP3A 2OQHA 1C9WA 3HV8A 3AZSA 2HVMA 1QNRA 1KFEA 3L2LA 4JTCA 4LC8A 3MC5A 5KEZA 4E4PA 5LA2A 2VZTA 1EPXA 4PUNA 5MHBA 4KFOA 3OYXA 2PUZA 3R7MA 4AF0A 3DFTA 4PUEA 5HNUA 3SR7A 1MFVA 2ZUMA 4ROQA 1DJQA 3W26A 1W9PA 3U9IA 1SZNA 2ISVA 3SCSA 2V5CA 4B5UA 1KM5A 3BLOA 1UWRA 1CGWA 1PSCA 3KRBA 1F6YA 2RUSA 4A3RA 4U4MA 1DWFM 1QPNA 1W32A 4GFIA 4RL3A 1WXYA 2VRKA 1UROA 3UPMA 1PZ1A 1LUCA 1UR9A 3WMSA 1CXHA 2W9MA 1C29A 4GNKB 4D9PA 4LS0A 1W17A 4Q32A 1BYBA 3APYA 3A5FA 1YYAA 3QKEA 4WJ8A 1LWJA 1P1XA 3CASA 1ONRA 2J7GA 3PTQA 2FDSA 2XIQA 1HL2A 2O0TA 3A12A 4RPQA 2HSAA 3AMDA 4PZVA 1B31A 3SJNA 1TPEA 1FQ0A 4QE1A 2EXOA 4ZB5A 4UOZA 1SO4A 1GG1A 1H1ZA 3II1A 2G8ZA 4DO6A 5PTDA 1OYCA 2R9RA 3W1QA 5AC8A 1CPUA 3ITXA 1PIFA 3USZA 1EO7A 2HV5A 3NQBA 4DYKA 3EMQA 2OO0A 2AL2A 4DXKA 4GH1A 3ITGA 4BF5A 1JCYA 3TJ4A 4LW7A 1S1PA 4NJKA 5L6UA 3L21A 2BOFX 4BEUA 1X38A 4JQAA 3NYZA 1J93A 1NWTA 1KTCA 2VC9A 5G2WA 3ZLFA 3CMFA 3JRKA 2YX0A 5D33A 3WQFA 2POZA 2XH0A 4OHQA 1FHLA 3B8SA 4XBJA 4J9JA 2ATMA 4XZHA 3UG4A 4E2DA 3CEPA 2XVKA 3MUAA 4GO9A 1ZL1A 4KESA 1XLJA 1XIEA 2NX1A 3A5VA 1LORA 1PZ0A 1WZLA 2ABBA 2X2GA 3GFZA 3WJSA 5FESA 3W28A 5CCZA 4R9OA 3WJYA 4G8TA 4UNIA 1X6UA 1XHGA 4J3UA 3BUVA 1F8IA 5D04C 2D2OA 1RK5A 4PMUA 4PBEA 5FJTA 5D02A 3JUGA 3W38A 1Z41A 5CZSA 2RHGA 4PMQA 3UWZA 1FOBA 3CHDA 3CPUA 1OK4A 3FVDA 1N55A 1QPOA 1O4UA 4NIRA 4ZEPA 5CQ1A 3M5VA 1VENA 1NFPA 1NDWA 1XH0A 3BG5A 3LYEA 5AYZA 3SQSA 4IHCA 4FX6M 4HNOA 4H9ZA 1W9DM 4GI8A 4FZIA 1W1A1 3LZ5A 1XRSA 1G4EA 5EMYA 1BTMA 5G2HA 2Z0IA 2Z2AA 3P74A 2CBUA 4E8CA 4DBEA 3RILA 4MLJA 3M6YA 2PZ0A 4GNVA 3VOGA 4J27A 3NYDA 5CSRA 4PB4A 4HSHA 4AY1A 2GQAA 3C2FA 1R3TA 1KA9F 5EB8A 1NWSA 3FXGA 4PUUA 3N9KA 4JXCA 1X6NA 1QRQA 3BLDA 1VJSA 4IT1A 3A47A 4J3VA 1S3TC 4Q4SA 2CCRA 2OR2A 5GPRA 2PODA 3KBSA 3QHMA 3W01A 2ZX7A 4RV3A 1VEMA 2VMFA 1TMHA 1BRLA 1HF6A 4DPPA 4MNLA 5BOEA 3SRFA 3L5MA 4RNHA 4IPIA 3C2EA 3GIPA 3LCHA 1JYWA 4QIUA 1GOKA 3R5EA 4Z1AA 5FF4A 4G1NA 2E5CA 1MXSA 4A05A 1ZHAA 3W7IA 1SR9A 3EDDA 4HU0A 4LC6A 4O4WA 2PP3A 3R8HA 1JDEA 3QPZA 4J3WA 1BAGA 5E0CA 4Q4PA 1I2PA 3K46A 3QY7A 1EJWC 3B9OA 2E9LA 1I9CB 5TIMA 2O55A 4CQBA 4AEOA 3RLUA 3WFLA 3O8AA 5G1YA 2BMBA 1XXXA 7REQB 1DIOA 2JKAA 3PSVA 3AMGA 2WNWA 5CZTA 5XIMA 1A49A 4ZZ9A 4UQDA 4LNCA 2WKJA 3MV11 2Q8XA 2OG9A 1XH2A 4MJ4A 2OZ8A 1PKLA 1OG0A 1FWAC 3WLSA 2G37A 2JF6A 4WJEA 4HSNA 2FPYA 4EPBC 5CGQA 4UQBA 5ABGA 3GNXA 1XUZA 4AW7A 2QCLA 3QOKA 1AL7A 2ZZ6A 5A6AA 3DYPA 4E38A 2IXVA 4C5YA 3UZZA 4B90A 3NUKA 4TMCA 1FHDA 3TIMA 3W86A 2ACSA 2JEPA 3G6MA 3F1QA 3ELFA 3E2SA 3QYQA 1UG6A 2Q02A 4LCQA 1WDSA 4LAMA 2D20A 3WH6A 2YDQA 3WG6A 3JR2A 3NL3A 5GNXA 3QGKC 1KBLA 2PU1A 4KEVA 5M5DA 5FF3A 3FDGA 5EY5A 4NKCA 1K3UA 1R8LA 2IKGA 4JIIX 4M7TA 1SU5A 1ZAHA 2YKKA 4DF0A 2WCSA 4ZQNA 1Q65A 2YDSA 4O1EA 4AEFA 1EX5A 4R27A 4Q6XA 2QVHA 2PDPA 4EX4A 3KXQA 2HDJA 5L9FA 2CYGA 1AA1B 3NZQA 3PNUA 1NOUA 4Z2GA 3C0LA 3S1UA 3KZPA 2REQA 5CPLA 3W2UA 1S1RA 2XN0A 5D30A 3CMGA 1YPIA 5HATA 3W2JA 3WDPP 3PG9A 1MW3A 4IL0A 2ZBTA 1EXBA 5I03A 1T0OA 1TMQA 2WSYA 5IXEA 3C0QA 3GD6A 4CCDA 3BJTA 5CXPA 1IEQA 3OOQA 4R53A 3G77A 3G3MA 4K7VA 4W93A 2GJNA 3WO8A 3VDAA 4WXZA 2D23A 2VD8A 5AVHA 4OQVA 1HJQA 1RCOB 1KFJA 3KBNA 3A9BA 4QGCA 5FEXA 2VGIA 1TWWA 3ZVHA 4O0KA 1WZMA 4HZMA 1FWIC 2ZRYA 4LT9A 4FALA 2Z1XA 1Q6DA 4KBXA 1UUMA 3WD0A 5A95A 1HKKA 5C2CA 4UTUA 4BWLC 1AFSA 2XDFA 2QGYA 3EAUA 4CD6A 2QPXA 3DH7A 4GUJA 4JFVA 3GR8A 3LB0A 2XZ9A 3URNA 1DTNA 4K38A 3W7OA 1H7RA 2RGMA 4FR1A 3USBA 4IL2A 5FA5A 3CQHA 2Y7GA 2QUMA 1G94A 4AZ7A 2WSKA 1EZWA 3N2OA 4G7FA 1R2TA 1FWTA 2FGLA 1KCLA 1UWIA 4C1KA 4Q7BA 1EQPA 3DERA 1Q6LA 4TX6A 3CYVA 1IF2A 1KBBA 3LV6A 2VX4A 1XUUA 3UCDA 1RBAA 3W83A 2E5BA 1UPPA 3GY1A 1KW1A 4ZSUA 4YU1A 3S6TA 1TQJA 4HPXA 3ITYA 4US6A 4JIEA 1UYQA 2PZNA 5C71A 2XYLA 2Y6ZA 1QI3A 2PDXA 5CJMA 4CU6A 2ZZ7A 4J4KA 1FWRA 3GH7A 4FIQA 4WKHA 4AHPA 4AYGA 2B31A 1XM3A 1FCBA 3TJIA 4Y2WA 2H9AB 1R3VA 3ANUA 3S83A 3VM7A 4NUWA 1VFSA 1G6CA 2A7PA 1HJXA 3GO2A 1RAKA 2ZFAA 3TX9A 3WK0A 1G69A 3REQA 3CUGA 1MSSA 1K7EA 1MQPA 4JAWA 4EACA 3GIQA 5FCZA 5I02A 4ERIA 4Z2LA 3BZJA 1YE6A 3AIWA 3W2LA 2V5DA 3FKRA 4F48A 1Q45A 1DXEA 4O0ZA 1TIMA 2PSNA 3PC0A 1BSIA 4CD5A 3SCNA 3AHYA 1EGMA 1QPQA 4RDWA 4Z0SA 3LCXA 5CG7A 4WOQA 2FMOA 3KW3A 5DANA 3RAOA 1TA3A 3PBUA 2NVDA 3UWWA 4XAGA 6CGTA 2VXNA 3N6QA 3SCVA 3Q94A 1HKMA 4HBKA 4U5IA 4XB3A 4Y6GA 2E40A 2OCZA 1YXCA 3LERA 1NELA 2EKGA 5BXTA 3EWUA 3DEQA 1RUSA 4AZ6A 4CGTA 1A47A 1V3JA 1GUVA 5J04A 2VWTA 3LM3A 3WNKA 1OHLA 3SUUA 2WM0A 4GZEA 3THAA 4H9YA 4KS0A 2FH6A 4MUZA 3LHTA 4PCTA 1I2OA 5CPQA 2W6RA 3NL5A 1CXKA 4RZ4A 4GX9A 4C6JA 3GTFA 3CWNA 1OX6A 3F4NA 4DBDA 1J11A 4K3ZA 2WKLA 3CIVA 4C65A 3ABQA 4I8DA 3VKKA 4AX7A 1KBIA 3W76A 3MKVA 3LHYA 2GQ9A 2Y5EA 3I3BA 1VB9A 1C8XA 3U6WA 4NY2A 2NLYA 2VURA 3OZMA 4LUTB 4DJFD 5D9MA 4GFSA 3V5CA 1QPKA 1E3XA 2O92A 5FF0A 3CIWA 1KTNA 3CAWA 3MMUA 3G1AA 3E74A 4XUYA 1XBVA 5I3GA 1FKXA 2EPLX 3KRSA 2V3EA 5HNNA 1AD4A 3L65A 2YR1A 1O7AA 1RJRA 2OWWA 3V36A 4UWMA 4L1GA 4BQ5A 4M19A 3BLKA 4PMDA 2INFA 1ONWA 4UUIA 4LS1A 1A5SA 1BF6A 5TD4A 1XD1A 3TE9A 1Q13A 4C6PA 3E2RA 2W27A 1TV8A 3UWUA 3L4VA 2IPJA 4FB7A 1CEOA 3QM3A 5EFDA 3PZMA 2ISDA 3ABXA 4NXKA 1HJSA 2GGHA 4XKMA 2BNJA 1D3GA 2OT1A 5CBJA 4P2VA 3SADA 4U3CA 5CEWA 4S39A 2VFIA 1CYGA 4NJHA 4IPNB 1SZEA 3QTPA 3E02A 3TZFA 3NPWA 3G1HA 3W70A 1UKSA 1ZGDA 3MBFA 1GW9A 1R2SA 3S9ZA 1OY0A 3PVFA 1A4MA 3QEZA 3QH2A 1B54A 4IXXA 3ONBA 2NX9A 1OFDA 1GVEA 3TSDA 4QSFA 1J4EA 4QJ4B 1XCWA 2WOQA 4UNLA 4UTWC 2CWNA 4C1NB 1R2RA 3BJFA 3D46A 3EKGA 3L12A 4I3GA 2BY1A 4OTKA 3SM0A 2X1SA 3TKFA 4TV6A 5CSSA 2ZWYA 4ZOBA 3STEA 4J2MA 3KOYA 4BHYA 1TJRA 3WF0A 3B4UA 4RUBA 1J0IA 1FWBC 5A6JA 2PRMA 4IIHA 3SUWA 3NFUA 4HD5A 2WVTA 3P0XA 2QAPA 1REQB 1AJ0A 4KETA 4FNPA 3CUZA 4IIEA 4N9EA 3ATYA 2Y0FA 2DJLA 4MWAB 5A6MA 3W7KA 2YCEA 5K7JA 1WKFA 2HPMA 1PUDA 2CNCA 2QLYA 4I5RA 1EKOA 2R82A 3RO8A 3HGJA 1QOQA 1O66A 2E8YA 2J24A 4B2DD 4YVVA 2ZX5A 3CQIA 4L65A 5D05A 2C1IA 4MADA 4XKYA 4FS9A 1IEVA 2PWUA 1Y5VA 3WFAA 4WQ6A 2EEXA 1OT1A 4Q7NA 3BSHA 1GNXA 3TONA 3VIMA 2WK2A 3W37A 1P0NA 5H1WA 1ZQ5A 3EWZA 3DFNA 4H8VA 2ZZ5A 5KZ6A 3PK7A 4HU3A 4S3BA 4WDXA 1F2JA 3NQ6A 3HM7A 3WLPA 1UP2A 1WXZA 4Q6JA 2HVOA 4EPKA 3BURA 4LB4A 4MMWA 4V33A 2XM1A 2AQVA 2YJQA 4MIMA 3SFWA 1R46A 2P5NA 1PX8A 3B8VA 1V3HA 4AIBA 3QTGA 5DMNA 4PL1A 2ZA2A 1P0EA 3WD3A 2DFAA 4G7EB 1S5NA 1KR1A 4TVCA 4LTSA 1JULA 1LRNA 2HEJA 1ZB5A 1MXDA 4FLRA 4D71A 2PFHA 4UOJA 4GINA 1OZQA 3N2XA 2OMAA 2ZWZA 1PL9A 4MWAA 3KRUA 4M51A 4AY7A 3NQGA 2OEKA 1M03A 3GH5A 3STPA 3N12A 3U48A 3FIGA 2I7GA 3VKDA 4UZUA 2MNRA 4XVDA 1QI0A 1IEIA 7CGTA 3TC3A 3CL6A 1O68A 1PVNA 4I8YA 4G1KA 3PY2A 1BHGA 4QG9A 1JCTA 1XPYA 4DZ5A 5EBAA 5K2ZA 1W31A 3CYJA 3LPPA 2CETA 2E1WA 1T8XA 4DJFC 4IWWA 5M3WA 1JFXA 3KL3A 2XFFA 2ZUSA 2VDIA 3MWAA 2PTZA 4CQDA 4JTUA 2IPGA 3FCPA 4CQ8A 1W5NA 1L2QA 2V5LA 1HX0A 2XH7A 2VJXA 1MUWA 4UXDA 2XWDA 2NQZA 3BSGA 4AG0A 4PRRA 4QQUA 1NEYA 1J10A 5AYXA 4GO8A 3IAPA 1UWQA 1X7IA 2WPGA 3TCSA 1F6PA 4PRWA 1KRAC 5A6TC 3GG7A 3QR3A 1DIDA 3FAWA 4RE4A 1I0BA 4ERGA 3A22A 3GBEA 3KFTA 2EBNA 1G4PA 3TW6A 1NF7A 4R7OA 2ASHA 4XZNX 3OA5A 2I16A 3PBGA 2NXHA 3IVUA 4LBSA 3SIZA 3B8UA 4FLOA 2QCDB 1IZJA 3RM4A 1ZBVA 3G1DA 4S3CA 5T8GA 1NFBA 4A3UA 1JPDX 2ZE3A 3H8AA 1SQ7A 2FZBA 3RR1A