3DOPA

Crystal structure of 5beta-reductase (akr1d1) in complex with nadp+ and 5beta-dihydrotestosterone, resolution 2.00a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Structure and catalytic mechanism of human steroid 5beta-reductase (AKR1D1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 111
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3dopA00
3N2TA 3LZ5A 3R7MA 1SM9A 1R38A 3BCJA 3O0KA 3CAQA 3UG8A 4OTKA 1VBJA 1EL3A 3R58A 2PDNA 4XZLX 4NKCA 4G5DA 4QBXA 3RX3A 3UZWA 4YVPA 4PMJA 5KETA 3EB3A 3LNMA 4DBUA 3EAUA 4DZ5A 3BV7A 4L1XA 4ASTA 3WBXA 3UGRA 4LAZA 4LBRA 4YU1A 3MB9A 3H7RA 2IKIA 2VDGA 2NVCA 3LUTA 3GHUA 5AZ0A 3FJNA 2FZ9A 3EB4A 1J96A 3O3RA 2NVDA 2PDQA 5LIUX 2I17A 1Z9AA 4AUBA 1C9WA 1MRQA 2IKGA 4GCAA 1HW6A 4GQ0A 2ACQA 3UP8A 3LZ3A 3RX2A 2IPGA 5JH2A 1Q13A 1UR3M 3R8HA 4R9OA 1VP5A 3LQGA 4ZFCA 1T40A 3R8GA 1XF0A 1IEIA 1Z89A 2R24A 2BGSA 2PEVA 3LEPA 3GHSA 2PDLA 3V0UA 4FAMA 2FVLA 1OG6A 1RY0A 3QKZA 1T41A 4WDWA 3R43A 3COTA 4I5XA 1M9HA 3CV6A 4JTCA 1YNPA 3H4GA 4XAPA 1ZQ5A 2IKHA 3V35A 3ONCA 2PDYA 2F2KA 3GHRA 2FZ8A 4FALA 2BGQA 5HA7A 2PFHA 3WG6A 4JQ1A 4IGSA 5HNTA 3LENA 3BUVA 4H8NA 3M0IA 4EXBA 2IPWA 4JTAA 3M4HA 2HV5A 1AFSA 5AZ1A 4PRTA 1LWIA 4YS1A 4FA3A 1ADSA 3B3DA 1A80A 3R94A 1ZSXA 5LIYX 2PDXA 1S2AA 4GQGA 1AZ1A 4XK2A 1PWLA 4L1WA 1EXBA 1YE6A 1JEZA 2AGTA 4PR4A 3V0TA 2PDGA 3CASA 3T42A 1K8CA 3CMFA 4JIRA 1PYFA 2P5NA 4JQ4A 3V36A 3MC5A 4XO7A 4RPQA 1X96A 1ZGDA 3NTYA 2PF8A 3P2VA 2BP1A 2HE8A 3U2CA 2PDKA 3S3GA 4QXIA 4YVXA 1Q5MA 1QRQA 2HEJA 4XZMX 3GUGA 1S1PA 3UZXA 4HMNA 5C7HA 2PDBA 2PDMA 1HQTA 3LQLA 5JH1A 1IHIA 4XVEA 2WZTA 3FX4A 2IQ0A 4JQ2A 2I16A 2R9RA 3LD5A 3Q67A 4XZIA 4WDXA 4XVDA 4ICCX 4PUUA 4QR6A 2PDIA 4DBSA 1LQAA 3UZYA 2ACSA 4WGHA 4WDUA 2FGBA 1EF3A 1S2CA 4JQAA 3M64A 1MZRA 2INEA 2PD5A 3DN5A 3H7UA 3R6IA 3WCZA 2IPJA 1Z3NA 2PDWA 2HVOA 3ONBA 2PDHA 3ERPA 4WEVX 4QX4A 3G5EA 2PDCA 5LIXX 4LB3A 2DUZA 2PDPA 2QXWA 4LB4A 4HBKA 2ALRA 4JTDA 3UYIA 2F38A 3UZZA 1AH0A 3V0SA 5M2FX 3CAVA 2FZBA 2IPFA 4IJCA 3WBWA 3LBOA 2IKJA 2PDUA 4JTQA 2IS7A 3GHTA 3UFYA 1AH4A 4GACA 1RALA 1QWKA 2INZA 4JIHA 4XO6A 3G1RA 2IQDA 2DUXA 4YVVA 2HE5A 1MI3A 4IJRA 2WZMA 4PRRA 2A79A 4GIEA 4WRHA 4Q7BA 1S1RA 3DOPA 2ACRA 4XZHA 4JIIX 2PD9A 4H7CA 2HDJA 1XGDA 3KRBA 3LN3A 4MHBA 1GVEA 1PZ0A 4JQ3A 2PZNA 3C3UA 4EXAA 5HNUA 2PDJA 4Q3MA 4PUWA 4DBWA 1RY8A 3N6QA 1ZUAX 3VXGA 1XJBA 1X98A 1Z8AA 1FRBA 1X97A 4LBSA 2PDFA 3BURA 2ISFA 3F7JA 1AZ2A 4JTRA 2C91A 4FZIA 2ACUA 2HVNA 4GA8A 4XZNX 3UWEA 4GABA 4LAUA 1PWMA 4F40A 4WDTA 3RX4A 1US0A 3Q65A 1AH3A 1YNQA 5LIWX 5DANA 5LIKX 1YE4A 1EKOA 2DV0A 3WBYA 3CV7A 2J8TA 2CLPA 1PZ1A 3D3FA 2FZDA
chains in the Genus database with same CATH superfamily
3LU2A 2VGGA 1RJQA 4MSSA 2E4TA 3BLLA 4PSRA 2PCQA 2E8ZA 5AB3A 2ZZ2A 1PB0A 4K68A 2NSXA 3AJXA 2YFNA 3RX3A 2WMHA 1FWNA 4JCMA 1J0IA 1V3JA 1H1ZA 4OOZA 3MSRA 3EYPA 1W8GA 4XD4A 3EAUA 1TSIA 1VF8A 2NUXA 4JCLA 1EIBA 5LNVA 2AGKA 1GOOA 3VOHA 3MB9A 4FOUA 2FB3A 2ZRXA 4W93A 1UWAA 1VFTA 2WZIA 4M81A 1XIHA 1LRNA 4GUGA 3VC5A 4S3AA 3W75A 3U48A 4A35A 3MCOA 3CWNA 4DO4A 1KFEA 2GL5A 4S3DA 3VI2A 4MOZA 5HNNA 1L6FA 2EXOA 1TPVA 3A4XA 3CEPA 2Y62A 1WXYA 5CC3A 5C8BB 4NI8A 4K8HA 4YTSA 4I6VA 1JI1A 3WUBA 1GZ1A 3WJZA 4M6PA 4O12A 2ZFAA 1DV7A 3FGCB 3KVKA 2WLYA 2R1PA 4Q8UA 4A05A 1TA3A 3VIHA 3C86A 3E0FA 5LNRA 3CYVA 3B9DA 3SM0A 4R34A 4WK9A 4OOUA 3QQ1A 5SWUA 2QJHA 2Z26A 5CG7A 3T40A 1ZBCA 1LUCA 4UQ9A 1R8LA 3FYYA 4XX6A 3STGA 1VZWA 1O94A 2QPXA 2YL9A 3TEVA 5AHEA 1EJXC 1WYIA 4LS1A 4WY0A 1BD0A 1GKQA 2EJAA 2W5FA 1OX6A 3T78A 4KMQA 2WZHA 4IH3A 2IPWA 4EXBA 4GH3A 1MEWA 1AFSA 1DPMA 2ABBA 4DB7A 1F73A 2VCCA 1FHDA 4AD5A 2FH8A 1O7AA 3FAWA 2PDXA 5CJ5A 4NASA 1XUZA 3CUJA 4A8LA 3CASA 1V3HA 1KRCC 1BWKA 3WLNA 2D1ZA 1VR6A 1W1ZA 2NXGA 2ZXDA 1WZKA 1XIEA 3THCA 1RBOB 2ZZ3A 1G69A 1LTDA 3QJAA 1A5UA 2PLJA 1R7OA 3NTYA 1IZJA 3NM3A 1T0OA 1DHPA 4MVAA 4ZODA 3WQPA 4HA4A 3GZAA 1XW8A 2YDAA 5C7HA 3KEHA 1FDJA 3BMVA 2PDMA 1BVNP 4FSAA 1NVMA 1PTAA 1Y0EA 1JPKA 4JZ5A 1AJ0A 3N4AA 4JN8A 1DKWA 1BGGA 4EE9A 2J9XA 3U7VA 4J3SA 1X7IA 2WBGA 1GOIA 4Z1BA 2IW0A 1JUKA 3H2NA 5KZ6A 1R3TA 3N17A 4PYSA 3TN3A 4CEXC 3UWUA 3I3BA 4LAKA 1IR2A 2VL4A 3T0BA 2JF6A 3W2KA 3PJTA 4MWAC 4DWSA 2EO7A 5C9RA 1EDQA 1KXQA 2A5HA 4UNKA 3NQEA 2VC7A 3LCIA 2ZQ0A 5IFPA 3TTEA 4KBXA 4HA3A 1G1YA 2B0MA 2F38A 3S2MA 4XUGA 3E12A 3UZZA 1ZJHA 1ESWA 3MANA 3VGFA 5C7VA 1NF7A 3UXKA 2A2IA 4AD2A 3W87A 4EANA 2DEPA 3WQCA 1RXOB 4GRSA 1FWAC 4Q8OA 2DVTA 4EF8A 4B5WA 3K30A 2CBIA 1TR9A 5E0FA 2NQHA 2XHYA 5FD0A 3FHAA 2DJXA 3NQVA 2R82A 4G7EA 1V3KA 2E9MA 4PRRA 2F84A 2Y8VA 1EFZA 1ZALA 3RRAA 3LXCA 4J3VA 1K7XA 1XPYA 3JZUA 1V7AA 2V2DA 4DM1A 2BHZA 4U5KA 2Q8LA 4OBTA 3S9YA 3HPZA 4X2PA 3WDRA 3L4YA 3KWSA 2WC7A 4JN6A 4H6KA 2R1LA 3QQ0A 3VDCA 3VE9A 1A5MC 5A2CA 4NRSA 1VD6A 4OHQA 2DSKA 1PV8A 2V2HA 3NVDA 2R8WA 3NPWA 4PEKA 1F8MA 3H2EA 1SW7A 1QPOA 3MSDA 2CZEA 4JKKA 3C61A 4FXJA 3PM6A 2OYLA 2YCLA 5AC5A 2PBOA 1ZCCA 3I3DA 4DHGA 1JNEA 2QQ6A 1LLOA 4H83A 4HIBA 2ZUWA 4CD6A 2YBTA 3QV6A 3EOOA 1EYWA 2VR5A 3CIWA 1GVFA 4EWND 2XPKA 4Q4KA 1RCOB 1SPQA 5F1UA 3VA8A 3LRLA 3ZJ8A 2FGZA 2WNZA 1GCYA 3VCNA 5LIKX 3NEHA 3DERA 3WBYA 5FF7A 1VEMA 2O4MA 3AUOA 4XAGA 5BRQA 5CG0A 1JZ8A 2C71A 1V6UA 2R1KA 4GIRA 1KWKA 1V79A 3EDFA 4GX9A 1VCFA 2OYMA 3U5YA 3ZQ9A 4M6QA 4QBXA 3D6NA 2HISA 3BJSA 2QCDB 1GYMA 4LY8A 4S3EA 2VURA 3AHXA 3VKCA 1GHSA 4NZ5A 3KXQA 2PF0A 1IIGA 1HKJA 1K6AA 8XIAA 1K4HA 2PP3A 3SN4A 3G0UA 3LHVA 2OOFA 1TTPA 4KIRA 4BQ5A 1XLMA 1GPWA 1TJ0A 3ANYA 3PBYA 5CGQA 1SZGA 1YTKA 4O17A 3LPPA 2AQVA 1WPCA 1U5VA 4LUIA 4AZGA 5J04A 1IF2A 2G37A 2IPGA 1SJDA 4ATWA 4IGMA 3WJWA 3ZT7A 2VENA 3EWDA 3RHGA 5D30A 4H9ZA 4LNYA 3ARZA 2WKJA 1T40A 2E5CA 1BQGA 6XIAA 5JUVA 3AMGA 4KERA 3ZR4A 1TV7A 4DF1A 4Z0SA 2XSBA 2VC9A 2NQJA 1LOLA 4RLIA 4XG1A 4Q8NA 1RY0A 1UZDA 3W1NA 3THAA 3VPLA 3GIPA 2O9OA 2QGHA 3UVAA 3COTA 4I5XA 3CPUA 2GVLA 3WFZA 1GEQA 1WV2A 3EXRA 3GFZA 4J9JA 1ME8A 2GWNA 4URIA 3DHPA 3SO7A 3PN8A 1QK2A 3DFQA 4JR5A 4ENLA 4NT0A 2V63A 4A8IA 3QRHA 2FDSA 2FZ8A 4LUSB 1H0GA 1OFPA 2BGQA 3TDFA 2RDUA 4ZVJA 3MZNA 4JQ1A 1ALDA 1B3WA 5C9WA 3BUVA 1CIUA 2O4QA 5EFDA 1J6PA 4M6UA 1H50A 2CLMA 1VRDA 2PE4A 4YHEA 4N2YA 3NQGA 1AW5A 4ZB0A 2WKGA 4AC7C 1H41A 3ZYZA 3TAOA 3VD4A 1DIDA 1EH9A 3CHCA 2FZNA 1HJXA 5TNVA 5A6KA 2UY3A 1N8IA 3CK5A 4H00A 4H6EA 1MQQA 1TTIA 3VYLA 2VGIA 2OSXA 2CXGA 3LHUA 3WMSA 4BI7A 5IHSA 1V6YA 5F4SA 3UEQA 4XO7A 4ACZA 4DUVA 4P7LA 1QW9A 1J79A 2DIJA 3WQ8A 5D03A 1PKMA 3IJ6A 4CQBA 4IFKA 5LXEA 2ZWYA 2PDKA 4RX0A 2V6AA 3N1AA 1WKFA 4N02A 1UPPA 3DAQA 2QV5A 1QRQA 1UH2A 4BZYA 3IEBA 4MJZA 1CLXA 4HSHA 3VKAA 2Z7KA 4LXFA 3UXAA 5DT7A 2B81A 1ZP4A 2Z6IA 3G1SA 4YIWA 1NWUA 4L6DA 1BGAA 3W7CA 4UFHA 1MXGA 1JGIA 1GVOA 4I9TA 1S2UA 3MMTA 5BRPA 4AU0A 4C7DA 4B5SA 2ATMA 1UUOA 1KO0A 3C2OA 3DYPA 1XKYA 5DRIA 2H8XA 1EBHA 1KBLA 4LVAA 2UWFA 1DWJM 1QAPA 3PZIA 3F03K 4ADUA 3MHGA 3WX7A 1QHPA 1OT1A 3GNNA 1FWWA 3BQ5A 4GJIA 2BG5A 4YL2A 1Z44A 3T09A 2V82A 3MBDA 4LB3A 4QFUA 1LRQA 4QJ1A 3LHZA 5AECA 3PSVA 1OC7A 4C6LA 2EKGA 3LCXA 2Y85A 3PUEA 2PP1A 3V5OA 2TSYA 1RH9A 3A22A 4BWLC 3SCTA 1Y5VA 4LCQA 1J5SA 4D8ZA 2CHRA 2E6FA 1HGYA 3VKBA 4LTSA 3GG1A 4CN4A 1B2YA 1KBIA 2Y7FA 4JTQA 2VR2A 2ZBTA 2V69A 3WLLA 1UJPA 3H2MA 1VHCA 3CYJA 3BMXA 1E1EA 4XZWA 4CGTA 4AD4A 4Q7BA 5AHMA 1HL9A 3LB0A 1XIGA 3CMJA 5BOFA 3TAKA 3S1WA 4UC5A 1WOBA 2W67A 1JCYA 3II1A 2HDJA 3WQWA 3D46A 1V6TA 5I07A 1RBLA 3DCPA 5F2MA 8XIMA 5D05A 3CH9A 5DQPA 2VFHA 1LBMA 4YMZA 5C55A 4IG2A 3EB2A 4PUEA 1A5CA 1VAHA 1VEOA 2DW6A 3R4IA 2VR4A 2J7EA 3C56A 4QG8A 3EEGA 4UQAA 2BV9A 3UCDA 2QF8A 3UR2A 1GWJA 2WHLA 2X1SA 2F6KA 3GG0A 4S2CA 1Z8AA 1S5TA 1E56A 1R2TA 1HUVA 3IIZA 3WLJA 4IFOA 3BSGA 3DHDA 4FR6A 3FVDA 3F7JA 1Q2SA 1REQB 1RD6A 1G0CA 3LXBA 1B9BA 5HWJA 3UWEA 4GA8A 2QPUA 4E3TA 2Z1VA 5CLWA 4GGHA 3V5FA 2DZBA 3SEPA 4A29A 2G3FA 3V3WA 3CL7A 5LYRA 4NYUA 1KBJA 7ENLA 2D2HA 3WH9A 1QU4A 3GBDA 3NQCA 4HNCA 1YE4A 3TK7A 5FEPA 5IM51 2A3BA 3F2CA 3BWWA 3T2PA 1B1YA 3SQMA 3W2MA 1E1CB 4G2DA 3DU0A 3KDOA 4PL2A 4OTKA 5RUBA 1IR1A 1UBSA 3SIMA 4OU1A 3GTIA 1O1HA 4NUWA 1H7OA 4K7VA 2OX1A 3UZWA 4Y6GA 4GY0A 3P82A 4AX6A 1HJUA 3GWQA 4GLEA 3EOEA 3KL3A 4WD0A 4JL1A 4O18A 3DEQA 1GW1A 2PZ0A 2FTYA 4B16A 2RDTA 3FJ4A 1YXDA 3ZLHA 2YXXA 2PWHA 5I3JA 2DSUA 5HNRA 5CPSA 3UNTA 5M5DA 2CPUA 3IUIA 2C7FA 1UW9A 1WKDA 4X0NA 3OQEA 5B7YA 2QF7A 3OBEA 5D8ZA 3AWNA 1XBYA 1IZKA 3ENLA 4F48A 5A6MA 1KM2A 1CI1A 5K2ZA 3D47A 3GXIA 1RCXB 1XLJA 2E6AA 3M0HA 3R8GA 1N8FA 4M24A 4GUFA 3WFAA 4IIDA 5MF5A 3ZT6A 1I2RA 3SRHA 4UR8A 1TWIA 2X16A 2GVJA 3KBWA 4Q7IA 1OY0A 4IL2A 1ISVA 2IMRA 4BY3A 3WK3A 3LEPA 4UQDA 5G1TA 3QOMA 4OQVA 4PTXA 4B4FA 3UY8A 3AXMA 3EOUA 2W61A 3GQYA 3IIOA 3WYZA 4ORIA 4HCHA 1JRBA 4AFYA 2J9YA 4DZAA 3DFNA 3GG8A 4UZSA 3SCOA 3FVMA 3T7VA 1C92A 2DVUA 3R2GA 5I09A 4MNMA 4FI4A 1FFQA 3WLKX 4CNOA 3BANA 2WCGA 3K1GA 3QZAA 2PDYA 2W27A 1KFBA 5DXYA 1MXSA 1PDZA 3R12A 3OQ8A 2PFHA 3WO8A 1ICPA 5KZDA 5HNTA 3W71A 5D2TA 4UCFA 4XBJA 4BQ4A 1UWQA 3FYPA 1UOZA 3L4XA 1RK5A 3L2MA 3R94A 1VPQA 2QMKA 1MYRA 4S3BA 2DSVA 2GUUA 1U22A 5F1VA 3M9YA 3SGGA 4HB7A 1U1JA 3WZ0E 2WPBA 3NQ2A 5A95A 3CHEA 1DXFA 3QGAC 2V38A 2OSYA 3M0KA 1XIDA 4P7OA 3U0HA 3L66A 4MKVA 3ANVA 5TQLA 5TF0A 2D0GA 1JYVA 3S3GA 4MDOA 1S2VA 4ZOAA 1V03A 1UPMB 1TV5A 3VVGA 1I45A 4S3KA 3A12A 2QEZA 3HB9A 1HQTA 2FIQA 1DE5A 3WK2A 3S9IA 1PTGA 1TA3B 1QPQA 3MO4A 2Z00A 4OUIA 3WJXA 1CLVA 4XVDA 4R7OA 3UR8A 1H7PA 4AC1X 4ZXOA 4XBKA 3KBNA 2OZ8A 4DXVA 3KOWA 1H4PA 4ROPA 5D38A 1VPYA 5CKSA 4DYEA 4HOWA 3CQIA 2FPVA 4DZIA 1LUCB 2EG7A 4AISA 1XRFA 5HMDA 3VNIA 5A1AA 4IP7A 1V3MA 3ZR6A 6REQA 1EDGA 3K4AA 1BXNA 3KFTA 3S5YA 1ZL1A 4WSJA 5I77A 1BF2A 1G4TA 2G5WA 1POJA 2OQLA 3F5KA 1FTXA 1GPFA 2JFEX 2V5DA 3H53A 2GVGA 1XHGA 1X1ZA 2QAPA 2D2JA 1SGJA 2J27A 3CAVA 1JCMP 1TREA 1T96A 3I68A 4GK8A 3WFLA 1Q6RA 2RKXA 1EJWC 3BOLA 2F9RA 4S3CA 5C9XA 4QJ3B 3ALGA 4E8DA 4O1AA 4ZO6A 1EUNA 4P7RA 1PO9A 3MKCA 2HRWA 3KZPA 1EPXA 4CCZA 3RM9A 1RZMA 4AH7A 5AKQA 4AZHA 4OKDA 1EC7A 1FP8A 3AROA 2BZNA 2VKZG 2OCZA 4PMVA 2CKSA 3VFLA 4AIEA 5A2BA 4ZR8A 5EMYA 1ME7A 4XAFA 4EKJA 1G4EA 2PDJA 1B0IA 5LSMA 2QYGA 4AWTA 2CESA 1TG7A 3UU0A 5CPLA 3GS6A 5A8GA 2BHUA 2F6XA 4QDMA 4AEOA 4LUYA 4L4LA 1JNDA 1EJRC 2X1RA 3G0SA 1D7KA 3GR7A 3BURA 1I6NA 4J3UA 4XBSA 3QMRA 4WVXA 3STCA 3H2AA 5EL1A 1OFQA 3IRSA 1GUVA 3K46A 4DWSB 4LOCA 4LWWA 5D9OA 3WBAA 3SFKA 1W17A 4H1ZA 1BYBA 1X7FA 3B9EA 1XI3A 3AU2A 1O95A 3SCQA 4TTUA 5HAOA 2OTDA 1BSLA 3B0XA 3IUDA 2ZICA 4TVUA 4JIPA 4LF2A 5DANA 3W1MA 2ZVRA 1FUYA 4CKQA 1W1YA 1DIKA 4OV9A 1KRAC 3AC0A 3NZPA 3BAKA 3BAXA 3KTCA 3GUWA 3S2CA 3O0KA 3T08A 4I7VA 3T1GA 2F8QA 1HJQA 3TWBA 4L9ZA 4B90A 3GVRA 1GQJA 4U4MA 2EJ1A 5BXTA 3IVTA 1KM3A 4BK9A 3OG2A 4IL0A 3W86A 3DBNA 4OBSA 2Z2AA 5D9PA 3N2BA 3T4CA 4KW2A 2AOSA 1GJUA 2CW6A 4HYRA 2H3DA 4ASTA 4HMCA 4YLWA 5FJTA 1VPXA 4I9MA 4C91A 2J7FA 4G7FA 3GAYA 1U5HA 2XIQA 1NM9A 3S47A 4V28A 4HCDA 3GHUA 1EDTA 2FZ9A 2E5DA 4PE8A 1IIHA 2XZ7A 5CAHA 1E0WA 4K39A 3NXLA 4RE3A 3OW1A 1S38A 1OABA 2ON3A 1K70A 3NAVA 1WKYA 1UKOA 2D20A 2JKEA 5JH2A 2XGBA 3MKKA 4JX4A 3VDAA 1F5ZA 1O6IA 1SJAA 3WJYA 3VGBA 4IQDA 1LOQA 2NQZA 3W83A 2YCLB 4YHGA 5AC8A 3T44A 3UCQA 1UR2A 3LMZA 4C7FA 3W4RA 1KM6A 1SFTA 3LK6A 4MUZA 3V0UA 3LG3A 4ROQA 3LGDA 3RM4A 4PMQA 3W7OA 4GX8A 3VKJA 1B4KA 3M0MA 4R85A 1F8IA 4LC6A 1VYRA 1DJQA 5CSYA 1HKMA 3LHWA 1RQEA 1RP8A 3B05A 4KRUA 4YWSA 3WIJA 3ONCA 3SI9A 3N2XA 4W7WA 5IFTA 3G24A 1GVRA 3VGHA 3M0XA 3CC1A 4JTHA 4ZA0A 2GOKA 3NXFA 1DQXA 3AMDA 1QW8A 4I5UA 3BQ6A 2DDXA 4FA3A 2HVMA 3ARWA 1UP0A 5I78A 1E0TA 4GQGA 4FS9A 4F2UA 1I2NA 1PWLA 3WQGA 3IAPA 2WSYA 3CXOA 3QHNA 3VUPA 4D72A 4RXGA 1XUUA 2WMIB 2WAGA 3CHDA 3HF3A 3KHDA 5DXXA 5MKGA 1RAKA 1JVNA 3AZRA 1XFCA 1I60A 3KOFA 2VEPA 5FJOA 3UERA 1M01A 4QG9A 4RNFA 1OJXA 4Z1CA 1WAWA 3I3EA 1C8VA 2VFGA 3E74A 3PTKA 3TR9A 1W9DM 1MFUA 1SYTA 5HQMA 2XIMA 3C0QA 2DW7A 1XIJA 3MUZ1 1PXGA 4LQ1A 3B04A 5IBXC 1LOSA 2JIEA 2WHJA 1UWIA 5DF0A 3WNMA 3MSYA 1NDZA 1PCWA 3CQKA 5DY2A 3W25A 4DN1A 3RCNA 3P61A 3A47A 2G0WA 5ABHA 4PCFA 5T8GA 3WY1A 1TE1A 4BQ2A 1MMFA 3LI1A 1BVWA 5C70A 4K1GA 1NDWA 4WF7A 4BF7A 3WCZA 3RGTA 1TTQA 1PL9A 3JRKA 2PGWA 2PS2A 4DUOA 2QCGA 1ICQA 2PGEA 4QX4A 1XGEA 2OMAA 3QY6A 2WBKA 2QXWA 1XISA 2QJJA 3HJZA 2YDQA 1XYLA 3OZPA 2NSOA 1PIIA 3W53A 1QO2A 1C7SA 1XBVA 3UR7A 2QDHA 3KWXA 4O1DA 5GJNA 1MUCA 2J66A 3UF9A 3NOYA 1L8PA 1XKJA 4Z2KA 1SZFA 1XLGA 2A6NA 2BVWA 5M1TA 1QI5A 4XSMA 2PDUA 2BLEA 3P0WA 4D9PA 3NO3A 3GHTA 1ZY9A 1ONXA 2YX0A 3PFMA 1JRCA 2IQDA 4H9UA 2DUXA 4GFIA 1TELA 1XG3A 3A5FA 3W1AA 2C14A 4Z42C 3PG9A 3L21A 2TPSA 4WRHA 3EXSA 4RL3A 4FNPA 4IFKB 3GDKA 2ZC1A 2J74A 4JIIX 4MDPA 2YPIA 4ZEPA 3AWOA 4HSNA 1EWEA 3HTWA 3A9BA 2KZHA 2EPOA 1L2QA 1TPDA 4Y96A 4LU0A 2VELA 2QW5A 2OG9A 3G6LA 4NIRA 1Q7QA 4PMOA 3JU2A 2ZX9A 4Q3MA 1S5MA 1R30A 3QW3A 4NU7A 1UD3A 2DZPA 4NX0A 1XWYA 4L56A 3Q37A 3NWRA 3W7JA 2X42A 2HXTA 2XINA 4CD8A 3S5ZA 4A3RA 2PWUA 4B2DA 2ZUUA 1UD6A 1E0VA 2C91A 2RGLA 1E3XA 3NZ1A 4JKLA 2ZX7A 3TW9A 3W81A 4H01A 1ISYA 2AL2B 1MQPA 1H11A 4LAUA 2WZEA 2OB3A 4DPPA 1KGXA 2CLOA 2NXHA 5EB8A 3LCWA 4MJ4A 3EKLA 1XM3A 1UKQA 3TSMA 1KCXA 1LT8A 2I56A 3A64A 1EB3A 3TMQA 2OT1A 1H2JA 4GI4A 2J13A 1GONA 3WD2A 4MWAA 1K7FA 5HUPA 1PCKA 3GXMA 1G6CA 1PZ1A 1EXPA 2VO5A 3P60A 2VFDA 5A6JA 6ALDA 3QV9A 3SBFA 1GEHA 1OFDA 5FA5A 1PTDA 2EQDA 4FXSA 4WY0F 3AOFA 5E93A 3SRFA 1BRLA 3UG3A 5TD4A 4DPQA 3B4UA 4PBGA 4FOKA 3A4JA 2FVKA 2E77A 2XN0A 4JXCA 3EPMA 3G1HA 2UY2A 1GNXA 1NELA 4B5XA 4OZOA 4TX9A 4UTKA 3ARVA 1FWSA 1QJWA 4F2BA 1C8XA 3G0XA 1EWDA 1ZHAA 4Q6XA 4Q8PA 1KFWA 5H91A 2FFIA 2I14A 3VX0A 3FA3A 1OYAA 4IMAA 5I3FA 4IPLA 5DY3A 2XIBA 1MDRA 3E0VA 3SN1A 2BS9A 3OTRA 4XIMA 2NVDA 5LIUX 4IG2B 3C52A 2I17A 5JXQA 4HPHA 1GOXA 1T8QA 1GJPA 2CETA 1QO5A 4FP1A 3WMCA 2QJGA 1U30A 3H26A 2WVSA 4QRNA 3SRKA 2BMBA 1D3HA 4R9OA 3WLPA 3B06A 4US5D 3DYOA 3QBUA 2QR6A 3P0XA 1QMLA 1YPFA 4IMGA 3UWYA 2ZWZA 3LRMA 2R24A 4TO8A 3RXZA 4IMCA 4G1NA 3Q2DA 5LNUA 1UKPA 1UUQA 4LJ3A 3ITYA 4DJFA 1I0DA 1HJWA 1RLCL 3QKZA 2QJMA 5CPQA 1TWSA 3R43A 5A6BA 3AHYA 1S5VA 7CGTA 1JCTA 1TJ1A 3N2MA 2VOMA 3WD3A 1YNPA 1EA0A 3RLVA 2XWEA 3NPVA 3GE7A 4TQTA 1E3ZA 2GJRA 3W7KA 2CWNA 4O10A 2JEQA 3GHRA 4A3YA 3NSXA 4DNMA 3ME3A 5DMLA 1D7FA 3UWVA 4IGSA 3LERA 4BFAA 3WNLA 2CHOA 2X40A 3M5ZA 4HMEA 3AISA 3WF0A 3VX1A 1KM1A 3UQNA 7XIMA 5L9FA 3W1RA 3I4KA 4XAYA 4GBDA 2E1DA 4MWAE 3MI2A 4FX8A 3LPGA 3WNKA 2G95A 1W1B1 1YE6A 3I6EA 4PR4A 3PAJA 2ZX5A 3BLKA 4R88A 4BI6A 3NQ6A 1E9ZB 3L0NA 4PRWA 4XD3A 1JZ7A 3BLFA 4J4KA 4JHOA 2I5GA 2VRJA 2OSWA 1TMQA 4WUIA 3MBFA 2OEJA 1TIWA 1NH6A 2BP1A 4MYAA 4LFYA 1YBQA 3PHAA 2V5CA 1UZ4A 4NAEA 1LL7A 4HU0A 5CGMA 4XQ6A 4F4RA 4UR7A 1KCKA 4XSLA 1E6XM 2HEJA 4ICMA 2RUSA 4F0LA 4C6DA 4H41A 3VTRA 3JUGA 3VD5A 1F6YA 2W0UA 1UC4A 4P8XA 3EDJA 3S6OA 2IQ0A 4AZCA 4NJGA 3BGAA 4JTEA 1L6WA 3LGEA 2J7GA 3O2LA 2YDRA 3GNXA 4U3CA 1PBGA 4ZENA 3BZJA 3GC4A 4CNNA 4YN5A 2Y1HA 1NSJA 4LY4A 1Q3NA 4E2OA 5JQ9A 1TJ2A 4I6KA 3DN5A 1BYDA 1VBHA 2FMNA 4V27A 3W7QA 1EGZA 3G8RA 2RFGA 1V8EA 4KCWA 4DO6A 1ICSA 1QNVA 1DBTA 3G22A 2OO6A 3S83A 3UG4A 4IIFA 2HXUA 2PDPA 3AXKA 3QYQA 5T9CE 4IIEA 3L0KA 2YXGA 2PTDA 3CU2A 4B91A 1UR4A 4DXKA 1E9LA 1ZTVA 2ZUMA 4PGLA 1NIUA 1P0BA 2X7WA 4CCEA 4PUNA 4MB3A 4W8LA 2YA1A 2Y6ZA 1R46A 1L8NA 3RJYA 4Q22A 3P62A 2QCCA 1LF1A 4DBEA 5D2XA 1MFVA 4D1IA 2VQUA 2PTWA 1XC6A 3WBWA 1AW2A 3H23A 1B3XA 3I6RA 1TB3A 1UG6A 3ZXWA 3C2VA 2IKJA 2CLFA 1RPXA 2IS7A 4N4PA 3O6CA 4GVIA 3NDZA 1QWKA 3G1RA 3UT0A 4KCTA 4O8RA 5E0CA 2XGIA 4YVVA 1V6WA 1Z32X 4F0HA 4H9YA 5AOUA 3WJSA 5K3VA 2VRQA 4PMUA 3M16A 4YTQA 3NG3A 4AAJA 4JIEA 4AY8A 3R1ZA 2GJNA 1QNOA 3PB0A 4I8DA 1ZENA 2P3EA 3PWIA 2YA2A 3KRBA 2HQAA 1EOMA 1F76A 3E6EA 4JHZA 3MU7A 5CC7A 5BU6A 4QJ4B 4XB3A 4EXAA 5BOEA 3ES8A 1KQYA 3NJ3A 4O8AA 1JPDX 3TUUA 4TIMA 3AICA 4KEMA 3YPIA 3KVMA 5I3IA 1Q6QA 1G9HA 2ATSA 1TMHA 5BWAA 4C6IA 4G1KA 1NARA 7A3HA 1XD1A 4J3WA 1MW2A 1LCOA 5FJJA 3C2YA 1W5PA 1X97A 3CWOX 4X9YA 1FWIC 1GT8A 3N15A 2BXZA 4BS0A 3LSBA 4FZIA 1FWFC 4ZXLA 2ZZ5A 5HOSA 3SUUA 3U2OA 4AY7A 3JVAA 1PWMA 3TSBA 3ZLFA 4HOXA 2OPJA 1TPWA 4HJWA 3MUY1 1AW1A 4QLJA 2DT2A 1CXEA 3TOYA 3DFTA 2B7QA 1KTNA 4RE2A 1RBAA 3ZWTA 3W23A 3UXLA 4Y7EA 3L4TA 5G2HA 1AQMA 1YNQA 1MW1A 5ECVA 4HZ6A 4D8AA 4E6MA 4W7VA 1FH8A 1CENA 3V5CA 4LANA 4WJXA 5XINA 2NVAA 2CZDA 3CAQA 4H9VA 3GNOA 4HNNA 1UWUA 2X1IA 1EL3A 1OFRA 4MNJA 1G67A 1J2WA 5FIPA 1F3XA 5GQBA 3DFOA 1G94A 3PZOA 3ITGA 1OIFA 1C8QA 4HU3A 4A6GA 1YXCA 2X0HA 5CEWA 4JBRA 4IJBA 2XFWA 4GNJA 3EKZA 4D8LA 1I8JA 5HR7A 3UA4A 3BV7A 5AYZA 1MSSA 4LBRA 4YU1A 1V4YA 3MCMA 3GY1A 3KCLA 3H7RA 1OFOA 2PLCA 3Q4DA 1H62A 4CCCA 2PWEA 4MMWA 4P5UA 1CWYA 1PKNA 3I65A 5HANA 4DNHA 1VFOA 2O9RA 2Y70A 4IM4A 2XDFA 2WMGA 3QH2A 1TZ7A 1C9WA 5J5RA 2Y88A 2YL6A 1KV8A 4AQLA 4KT2A 4DWSD 1QOXA 2QCNA 1JAKA 3ITLA 4EAYA 4BF5A 1UBPC 2W79A 3KW3A 5M3WA 4MZ8A 1DWAM 5HPOA 5A8PA 4ACYA 2HCVA 4MM1A 1OB0A 4IX0A 3PZMA 5JBFA 3NCOA 3PPHA 2FH6A 1D8WA 2VX6A 3BGJA 2JGYA 3DDMA 1MW0A 3DGRA 2PEVA 1HO4A 1X38A 1AQFA 4O13A 3TIMA 4O53A 5ABFA 2R1MA 3WEOA 4DYKA 4AZ5A 2WSQA 3L65A 1J4EA 3GIYA 4I7WA 2C0AA 3IGSA 4UB9A 2NZLA 3NPXA 1XRSA 4NZ3A 3AHZA 3H4GA 4UOQA 4DO7A 4O0QA 1KC7A 3STEA 1M68A 3OO2A 3V35A 1XFBA 1Q85A 3OHIA 4JTGA 5CXPA 4Q8TA 3VIIA 3LENA 3W24A 3TC7A 1R3WA 4JTIA 1NY1A 3NZQA 4JTAA 5HATA 4C1LA 3DUGA 4PRTA 1V77A 4LUTA 2VJXA 1UB3A 2TYSA 1DHKA 2O55A 4DO5A 3UETA 1KV5A 3GK0A 4UTLA 3PG8A 1J18A 2KAUC 4L1WA 2FYMA 2ZRWA 3EEZA 2E1WA 2OKOA 3A9IA 1O5XA 2B4GA 3LCGA 4W85A 1GZJA 1CDGA 3L67A 2A6LA 5FL0A 3BL3A 4QJ5B 4K8GA 2NT1A 2BASA 2CZFA 3HV8A 4EPEC 2DSWA 1QCWA 3HQOA 4XWUA 1DQWA 2WPGA 3VNMA 1XBZA 5BOOA 4DRSA 3MUIA 2V3DA 3QY8A 4YVXA 4HK6A 2OEMA 1EHAA 2D3NA 1EX5A 3JS3A 4ZE4A 4QP0A 1ZAJA 2DORA 4PMRA 4QITA 5JH1A 2RJHA 2BY3A 3PZQA 3SCRA 1P0NA 4CQAA 1FY6A 3LD5A 1JDDA 4KESA 3F5LA 1R3QA 2BODX 4W4QA 4EK7A 1FA2A 1QUMA 4A3HA 2WKLA 3BZGA 1JZ4A 1IT7A 4TTGA 3T2QA 2Q09A 5HJLA 1Q6FA 4C1NB 3A3HA 1CXHA 2MNRA 1EJSC 3ARRA 4HZ7A 2HSAA 3QZ6A 4LAOA 3W2LA 2Q02A 1PX4A 1ITQA 2YLAA 2V8ZA 4MYXA 1H0IA 4RZ4A 1OCNA 1JDCA 3UNDA 3N3MA 2Z1BA 3OLEA 3R0UA 3TXZA 1XYMA 3ALFA 1E4LA 1I1XA 5D04C 5BW6A 4GI9A 4HBKA 2I5IA 1JAEA 8RUCA 2Z1WA 3WSUA 2O7SA 1W1VA 4JDBA 2VOTA 1TZZA 3KLKA 3HJEA 3VFCA 2PRHA 1Q6CA 1OT2A 3V0SA 1GQIA 3L4WA 4UTJA 1UC5A 1MW3A 4PULA 5FACA 4M51A 2POTA 3LM7A 3BLDA 4RJEA 4FOJA 1LZOA 2QMJA 5GJMA 2VZOA 3OLIA 3CZEA 5DBUA 2Q8XA 1AH4A 4AZBA 3VDHA 1R3SA 2INZA 1B4EA 1UR0A 5MKGB 3TNBA 4JAWA 1ADOA 3OU8A 3IANA 2P76A 5BMXA 1FWEC 2ALDA 3EGJA 3SN0A 4GNKB 5K9XA 3NIYA 2AQWA 2CNCA 1UR8A 3M0VA 3GLCA 5CAKA 4GQRA 4H7CA 5H8MA 4AW7A 3VDGA 5A94A 3S46A 3U3HA 3LM3A 3C0LA 3QFWA 3NSMA 1W6TA 3VIFA 5HNUA 4DVOA 2DIKA 3W84A 1PEZA 4J27A 4WXYA 3QPYA 1XYCA 3GD6A 3OGRA 1E0UA 4V15A 2VZTA 4AEFA 4P61A 3OVRA 2WLZA 6CGTA 4DIAA 3IK2A 2Q01A 1Q6DA 3K8MA 3GYEA 4MFDA 3GDTA 3NZGA 3PZGA 1D8CA 4F0KA 3W0KA 1THFD 4D6GA 1W3LA 4M8UA 3LHTA 2MUCA 4MY8A 2QPSA 3LCHA 1CPUA 3LTSA 3BLPX 3SZ8A 2CZ5A 4JTUA 2VGFA 1UA3A 2DZXA 2MANA 2ZUVA 3M5XA 3HU7A 5A8MA 1S3TC 3A13A 3FEQA 3MTWA 3PY2A 5GPRA 4S38A 2QVHA 2ZDRA 4QSFA 4C6OA 4LV9A 3AQUA 2FDMA 1Q4WA 1MRAA 3CL6A 4GXPA 3GKFA 3AALA 3E0LA 1V0MA 3PWGA 3GU9A 3QLLA 4IGNA 3PNZA 2FPYA 4XTIA 1UZ1A 4DZHA 1P0EA 1XLDA 4M7TA 1XYZA 1SW3A 2BWGA 4ZQNA 4NHVA 2Y7DA 3TA6A 2PDQA 3HBLA 2J24A 4GWEA 3WQ6A 2YFOA 4GQ0A 4HZMA 1KR1A 4HHLA 4KWOA 3N9RA 1OC5A 1FWCC 2UZ9A 3RX2A 2RHGA 4M3PA 3SY5A 2NLYA 1E4IA 4XKMA 5AFDA 3MY9A 1W0MA 4AX7A 3APTA 3BSHA 4DYJA 1QOQA 2GQ8A 2FHFA 3EDDA 4WSHA 1FWTA 3EDKA 1HKWA 3E2QA 3APGA 1FVPA 4KWVA 4DF0A 3S42A 3LV6A 3H4XA 3ITTA 3QR1A 3SJ3A 4WXZA 3E2VA 2HPMA 5A2AA 3ZVHB 4A8NA 5BXRA 5KINA 4JNMA 4WIWA 2JGQA 4MJMA 4WR3A 3K4WA 5AHIA 1TKKA 2J88A 4E2VA 3AIVA 1M9HA 1H49A 2VCBA 4BEUA 3SUVA 4F0SA 1A3XA 3PANA 4I3GA 1YDVA 2HWGA 2PLMA 3F4CA 3ABQA 3WNOA 5G2IA 4NJKA 1XDLA 3LYEA 1RQHA 1A47A 7PTDA 1W9XA 1MUMA 1TR1A 1ONWA 4QLLA 2O0TA 2GQ3A 1BRLB 4R7JA 7ODCA 4NJJA 3BG5A 3CAWA 1UR9A 2GUBA 1ADDA 1ITXA 3ABXA 1CXIA 1W56A 2E9BA 3PBMA 3TZNA 2C1GA 4NILA 1IT8A 3AU6A 1KGUA 1RLDA 4GZJA 3A3WA 2WMJA 1TX2A 4CNUA 3PBGA 3O16A 1NOWA 4CEUC 3V36A 2GQ9A 3NURA 1VFFA 1MXDA 4JKMA 1RA0A 8A3HA 1UCWA 4WOZA 4RDWA 1Q6OA 4C6PA 3OEXA 4PZVA 1OCJA 1OSEA 1QTWA 1PVNA 1L0PA 3EWXA 1Y5XA 1K7EA 3C2RA 4ZCWA 2WM1A 1S1PA 1GOQA 4J3XA 2WCAA 2WQPA 1GQLA 3DX5A 3AIWA 3EXTA 3B8SA 3NUKA 3OIHA 3FX4A 2H90A 5LGXA 3CHVA 1NQKA 3NR0A 3N12A 4LEFA 5ABGA 2Z2BA 4QR6A 3CGTA 2VD9A 1XIIA 1DTUA 4NZ4A 3WELA 1W5QA 1GVQA 4WGHA 3NQ7A 4PODA 1CCWB 4Y9AA 2ZE0A 4KGLA 4DWSC 4KCUA 3MS8A 1ZS2A 1KRMA 2JEPA 2Y8KA 3EOLA 2ZZ6A 3LGGA 1FHUA 2ISVA 2PMQA 1P7TA 7TAAA 1EBGA 1HXJA 3AIUA 4WEVX 2WO5A 3WQOA 1ME9A 2GVYA 4RDVA 3W00A 3ATYA 4KWUA 3QC3A 2EPNA 2Y7GA 1F2JA 1QHOA 4AIUA 4MY9A 2XH2A 3UESA 3LTYA 3N19B 3GZ3A 4P7QA 2JE8A 4JTDA 2TMDA 2OO0A 3TNOA 4IQLA 3RN6A 4GVFA 3T55A 4DLMA 4QDWA 4LUJA 2HNHA 4O28A 2J8FA 4QE4A 1WE5A 1B5TA 4AZ7A 1LLWA 2XH7A 1FP9A 3I6TA 1J0YA 4H8UA 4S23A 3ZS4A 5XIMA 4UTTC 1F61A 3AAMA 3W88A 1VEPA 4HD5A 5DT5A 4QS5A 5KTLA 4WX2A 4BR1A 1M7JA 3GVGA 4JL2A 3N9SA 4C7GA 4IJRA 2VEMA 3IPWA 3K8KA 2WYSA 3B8IA 1WZAA 3H8AA 4YXGA 2F7FA 4HT3A 1YBQB 2PWGA 2VXNA 4JIQA 4FPSA 4NAEB 3U4FA 3EDEA 4X22A 2P3ZA 4UFKA 4ZO8A 3LN3A 2ZA2A 4H7VA 3F4NA 2OQYA 1XXXA 3TTSA 3WDJA 4QS6A 4IIBA 2W6RA 3UJEA 1V5XA 4Q4QA 1C7TA 1K8ZA 1QK0A 2BB0A 4AZCB 5HXMA 1R9YA 2OT0A 9CGTA 3VMOA 4GXMA 4IMEA 4NP7A 2H6RA 4RK8A 1HJVA 2WSRA 3VIGA 5ENLA 1EP2A 4HNLA 3NYDA 4KRTA 4FLRA 4W88A 4QEEA 1FQ0A 4CNTA 4LW7A 3MWAA 5LHFA 5CSSA 3KOXA 5A6LA 3MMWA 1KKRA 2PB1A 3VNDA 2OELA 1Y8BA 2YCIX 2A7PA 3JZEA 4MGGA 2CEQA 4JTRA 3TCEA 2C0HA 4N6FA 1OF8A 4DWDA 5F4WA 4QAWA 2D0HA 1Q6LA 2QIWA 2UY5A 5BWFA 1OGBA 4KFPA 2D0FA 1WXZA 4IUOA 3QM3A 2GJLA 5D37A 2ICSA 4CD5A 4YCOA 1SO5A 4UTFA 1MWOA 2SFPA 4CNSA 3BPWA 3WLSA 3VD3A 1J9YA 2QNEA 3TR2A 1VGAA 3R11A 3HQNA 3QHOA 1EX1A 3NL6A 1KFKA 1HNYA 6TAAA 3B40A 4E2BA 3TJ4A 4L65A 2CBVA 4J3ZA 2HPIA 3ECQA 3SCNA 5I00A 3ARPA 4TR9A 2VEGA 2XYLA 3DECA 1R86A 1HKVA 3QR0A 4QQ3A 2AL1A 2XSXA 3CB8A 2P88A 2ZKMX 2C19A 3BV4A 1ZBVA 3BLOA 1UA7A 1NFBA 1BG4A 3T0CA 1Q45A 2CLKA 1AUSL 2NVCA 4QNWA 4DM2A 3IIVA 3GBEA 5AZ0A 4Q8VA 3N4EA 3VOJA 3OVPA 1VH7A 5I24A 1B3YA 3IV8A 2Y8UA 2WM0A 4O1EA 3BAYA 3UYCA 2WNNA 1W54A 4GCAA 3QTGA 2WOQA 1I0BA 2I7GA 3BTNA 1KB3A 3WNNA 2D73A 3SRDA 3O05A 3W7HA 3GC2A 1TJPA 3LQGA 1UIPA 4K36A 3UJRA 4NY2A 2X30A 5F7UA 1DORA 1KBKA 3S2LA 2HMCA 3SB0A 3C8NA 1IEIA 1E6SM 4LX4A 1H7RA 2DT1A 3G1FA 1UWSA 3FGCA 4AF0A 1VIWA 4GKLA 1E15A 2ZZ4A 2GSHA 3DH7A 3FN9A 2FTWA 1UH4A 2DZWA 1R85A 3CPRA 1ML1A 5FJRA 3N2CA 1K6WA 4WDWA 4NXKA 5EKYA 4CD7A 3CV6A 4C60A 4W5UA 4KEUA 3WD4A 7REQA 3DFSA 4EF9A 3E38A 3MI6A 3GXDA 1HL2A 1OX4A 1VLIA 3BVJA 1T7LA 1D3GA 4E4FA 5JBDA 2E68A 4Z1YA 4OBRA 1C91A 4O15A 1P43A 4FALA 1OADA 4IOTA 3W7IA 1QHZA 5C6MA 4RCXA 2DZVA 2E3ZA 3VKDA 4WJ8A 1XSIA 4PUMA 3F1QA 2CFFA 4KFNA 4JFVA 4NI3A 1A80A 3W6LA 4D1JA 3O07A 3SQLA 3WQ4A 2VD8A 1XCFA 4BF9A 4QEHA 1OHLA 5IOBA 4RPPA 1EIXA 4RZBA 3M7SA 5AYXA 4C6JA 4J2PA 3MDUA 3W01A 1F07A 1HO1A 3RO8A 3GH7A 3T0AA 2HBXA 4IWWA 3RPMA 1LJYA 4QE1A 4RDZA 5FSDC 4RV8A 1SJCA 4KKXA 1T6MA 1GGOA 3EMCA 4ORMA 1U1UA 3USZA 4KFOA 4PA8A 1E73M 4P8WA 2ZC8A 2WJFA 1ZAHA 3WEMA 3HG4A 3MP4A 1VBGA 4XKYA 2WZTA 1BXBA 3WL1A 1C29A 4M1RA 4HOZA 3B9AA 2AAAA 3TSDA 4B9ZA 5I23A 5ABFB 3U5UA 2PWDA 4Y8EA 1VBUA 4ZQOA 5BYWA 2P8BA 1KGWA 3TYBA 2ESCA 4O19A 1UROA 3MCNA 5KZEA 2PODA 1L9WA 4LAMA 1JGMA 4GUJA 4HMDA 2PDWA 3VU2A 4AIOA 1P6CA 1EHNA 4EVZA 4NZFA 1H5VA 4LALA 1OK4A 2BXVA 4L4OA 4X3ZA 4E38A 4LB4A 5LNWA 4L6OA 3GB6A 3RPTA 4NAFA 3VNZA 1QXLA 1WDWA 3E1F1 3FV9A 2ZXAA 2DZTA 3UYIA 3WQFA 4N9EA 4NJIA 2QVNA 3CJPA 1QNSA 4LUTB 4PMXA 2BY1A 3OB8A 3CEUA 5E6YA 3HA1A 4LYQA 5EA9A 3FJ6A 4W5ZA 3PAOA 3P74A 1ZU8A 2WV8A 3QFEA 1V7YA 4FHAA 4KQNA 1V02A 2VVSA 4YYFA 2Z28A 4F2TA 1FKXA 2NXIA 3ID7A 3W2NA 3VO0A 3UWQA 1ECEA 2WJZA 3M0LA 1Y7VA 4NL1A 3AXXA 3AUJA 3B97A 1EGVA 4B5NA 2DQXA 3S6DA 2DZSA 1QI2A 1GHRA 2EPMX 3URNA 3AS2A 4NX5A 1FXQA 1IYXA 2I5QA 3UXDA 1CZ1A 4IISA 3TFCA 3NOEA 3HG5A 2EG6A 3BG9A 3SCUA 1WCGA 3NSNA 2UV8G 1GVEA 4X9SA 3M5VA 2IQTA 3C3UA 2FB2A 3F2DA 4DI9A 3VOFA 1Y65A 3WQEA 1XH1A 3KDNA 1E4MM 1TPH1 3CB3A 3GU1A 3M1ZA 2X1TA 1XLEA 4Q32A 1UYQA 1EGMA 1BQCA 4NZCA 2Z2UA 3EWCA 1K02A 5EMLA 4Q8MA 1KFJA 3S1VA 1JCNA 1XCXA 4NNAA 1JUBA 4GD0A 4IF2A 3DG7A 1H09A 3EWUA 2V5LA 3SJNA 2BFGA 2XVLA 3KUMA 3IJDA 3ARQA 1XYFA 3CLMA 4DXXA 4B3LA 3DHFA 4X60A 1AH3A 3CZGA 2YCEA 2X41A 1KA9F 2WC4A 1E6ZA 2OGYA 1GOKA 3O06A 2W9MA 1X6LA 4Y90A 1TWWA 3SW6A 5ABTA 2CLPA 1EJ7L 1P1XA 4ZSUA 6TIMA 2E6DA 3R7MA 1KQZA 1HG3A 3CUIA 5IDZA 5EMKA 1R2RA 1CECA 5AYIA 4K2SA 5D2YA 1EOKA 1W3IA 3C4UA 3ABZA 3V1HA 2ZTJA 1XQKA 2BVDA 4F3HA 4PMJA 2R6OA 1DJGA 5KETA 2YJQA 5FJUA 1HVQA 1V3LA 4YNGA 4DZ5A 2B7PA 4L61A 2QS8A 2UY4A 3M41A 4Z17A 2KX9A 2E8YA 3DGBA 5DCBA 1XGZA 1M3UA 3SUWA 4OFCA 1JYWA 3AIRA 3W29A 3L5AA 1AG1O 1W3NA 1C8YA 3WH6A 1V02E 3A6OA 1MZHA 1WUEA 1F6PA 1HT6A 1LWJA 4JS3A 3QHMA 2Z4GA 4LRTA 3WF3A 1HW6A 2ACQA 2YR1A 3UP8A 1CX9A 1OCBA 4JTSA 1KWGA 3WD0A 5AN7A 2XIOA 4ZQMA 1LBLA 3VINA 4AZIA 5EGRA 1PE1A 2ZA1A 3TTOA 3O7UA 3L4UA 1E70M 1FWHC 4UFLA 2PP0A 3S1UA 1FCBA 2DU2A 4DJDA 3KTXA 3MSGA 1O5QA 2PTZA 4WKAA 4EIVA 4AYSA 4OV4A 3GDBA 2W4XA 1LLZA 1RA5A 3M47A 3QF0A 3S9ZA 4O57A 4R5EA 3E5BA 1CLKA 1J6OA 1BEUA 1WDSA 3W72A 3OYZA 3OA3A 4XAPA 4CUCA 1XINA 2EBNA 3ZOAA 4V33A 1YQ2A 3QSTA 2A3AA 1GJWA 3PFRA 4HN4A 4JTFA 4DUXA 3VILA 4TX6A 4PEEA 3WLMA 2VMFA 1Q8JA 1NU5A 3LLDA 3Q45A 1PSCA 3EBVA 1J11A 1NEYA 3CBWA 1SZRA 1VRXA 5AY7A 3DESA 5I3DA 3OG3A 1I2PA 3NL2A 1VB9A 4WCJA 1XL9A 1VLWA 2XTKA 5EY5A 1TZ9A 1L6GA 3TYAA 1IXNA 2EAWA 1VFMA 2QUVA 2WANA 1LQ2A 4FX7A 4H2HA 3DC8A 3WD1A 1DP0A 4B9YA 1XDJA 4OUEA 5DMYA 3CMFA 3AZSA 2YDSA 2PAJA 4B2DD 5D2VA 4UTHA 3H24A 5I3HA 1NOFA 4WKHA 1G01A 3MYOA 1OYBA 2PF8A 4ZL1A 3PVFA 3UD6A 3LX9A 2C6QA 3P5YA 1DQUA 3PTQA 2R1NA 4N42A 2WNQA 4HHMA 4KGJA 3I7RA 3LNPA 4JX6A 4TMCA 3KRUA 3UY7A 3S2NA 3VCCA 3N34A 2GGEA 1V3IA 4FF7A 4N9BA 3W7PA 2OQHA 3DIPA 4UTMA 1OK6A 4WDXA 3JW7A 1VS1A 4WHBA 3BGGA 1EF2A 3FKKA 3MT1A 1HP5A 1A3HA 3XIMA 1EF3A 1HJSA 2VYOA 4JYFA 1KTCA 2PD5A 2V3EA 3HQ1A 1R9XA 1XV8A 5G2WA 1J01A 1JUEA 4XUYA 1TQXA 4ES4A 2WHMA 1BVZA 3THDA 5AYBA 5E70A 4C6FA 1E51A 4Q8QA 4E4PA 2YGYA 4C1KA 1O4UA 1AJ2A 1KXVA 4U28A 4J40A 1W1TA 3GNRA 4DUWA 3FXYA 1AH0A 6A3HA 3NNTA 4YTRA 1KNWA 5GNYA 5FI8A 2X2YA 4GQQA 1T8XA 4EX4A 4GQBA 3NQ8A 2GSJA 1KM4A 4GYFA 1CGYA 3U57A 3IVUA 1ZLPA 4PBEA 2WSKA 5I3KA 2WVTA 1IQ8A 4Z08A 3WENA 1US2A 4JIHA 2NV2A 2X0YA 1OM0A 2WNWA 1F3EA 3GX9A 3MVTA 1JCXA 1QNQA 2A3HA 4EWJA 4ZOEA 4E3VA 1Z48A 5T91A 3FY1A 1TV4A 2E6YA 5C9UA 1HX0A 4DJFD 1NTHA 1S2WA 1XIMA 4Y9PA 4MJ2A 3I4EA 1Y5WA 4LCRA 1PHWA 3NQAA 1JPHA 1A5BA 3LV5A 3M6DA 4HTYA 2ZUNA 3ITXA 3LS9A 4PBFA 4L6HA 3HN3A 8TIMA 2QUUA 3NZRA 3N6QA 4UMAA 1PKYA 2WWCA 1TRIA 1UMLA 3G2GA 4ECLA 5K4XA 4QAIA 3GSMA 2HTMA 3BCFA 2J25A 4K1WA 3IIXA 4GYJA 3IJQA 3N4FA 3A21A 4LC8A 1WQ5A 3KBSA 5I2UA 2GDUA 1P7TB 3TN6A 3W1QA 4R7WA 1JDFA 2PWFA 2D69A 4AY1A 5C2XA 1IEVA 4ML4A 2YB4A 3FOKA 3VGGA 1QT1A 4F40A 4MAVA 3W82A 1V6XA 2G4JA 4WDTA 3RX4A 4DJED 3DKJA 3M44A 3ZSSA 4RZ6A 3STFA 3T0TA 2BOFX 2FLIA 3H2OA 4RXFA 4GG9A 1UKTA 4US5A 4Q33A 3BK0A 4QHRA 1YDYA 3WLRA 2CLLA 1OINA 2FZDA 1RCQA 3C0JA 4ZQCA 2C16A 4GMEA 3UG8A 1UASA 3HQPA 1LL6A 2FMOA 1E1CA 1POKA 3EA3A 3CH0A 1VBJA 1YTDA 3R25A 2QCLA 2XFFA 4XZLX 3TN4A 1O5KA 3T4WA 4PB5A 2J7BA 5BCAA 1IEWA 3EB3A 4DBUA 4DEFA 5EBAA 5G1YA 2WXDM 1LP6A 1V0LA 3BH4A 4LAZA 5FJPA 1XLKA 1TPC1 1GVIA 1TCMA 3VIJA 3WLQA 3GDMA 2H9AA 2CLIA 3S1GA 3RLHA 2QGYA 1EPVA 1XLIA 1A5SA 4GC4A 4MKNA 3PZVA 1B54A 1F7BA 4HNUA 4PTWA 1K9TA 4GGBA 4GXWA 2YXOA 1E72M 3R0DA 1TCDA 4PN2A 4O1FA 1JULA 1JZ6A 1HGWA 1H1YA 2VX5A 1QR7A 3R8HA 1NDVA 2WJEA 2IXUA 2A4AA 1T5AA 4MB1A 4BEQA 1DEDA 1WDRA 4JYEA 3OPSA 1H61A 1WX0A 1ZZMA 1I2OA 3B8TA 4E4UA 1F9CA 3AI0A 3QPZA 2VZUA 3H2CA 1F3WA 4PUDA 1EP3A 1F4AA 2W63A 3T81A 1ONRA 1W2VA 4B5TA 4I7UA 2R94A 5I03A 3BAJA 5BXPA 4M7SA 1W1A1 4JTCA 1MNZA 2TODA 4GIYA 1F3TA 2IKHA 1PYMA 1M04A 3QZEA 2YYTA 1XBXA 4WY0B 1QW7A 2R14A 4BJHA 5AC6A 4Z2HA 1GVSA 4MFEA 1JZ3A 3O0FA 1IXPA 1YADA 1UJQA 3GXPA 5DELA 2P1FA 3A4AA 4MNLA 3H70A 1JFHA 3GFXA 3M4HA 3BICA 5HJXA 2XJ7A 5GVJA 2WWDA 3IGUA 3QSRA 1E9YB 1TVLA 3URBA 2VEIA 3KOYA 1UH3A 5BZAA 1V0NA 1AZ1A 2GQAA 3RR4A 5CC6A 4ZTYA 1V93A 1AA1B 3T9PA 2PDGA 2XIJA 1K8CA 3UZJA 4IIGA 4RE0A 4D2JA 3SCVA 2EPLX 3LMYA 2REQA 1IWAA 5CZ0A 3VNLA 4H9MA 5I3GA 4M0XA 2BY2A 1TV2A 3CAKA 3H22A 2QIIA 1EJVC 1BWVA 1EO7A 3R10A 4QXIA 4CQCA 8CGTA 3KS6A 2RH9A 1LL4A 2J6XA 3PPGA 2J62A 4MPKA 5FAJA 4LH8A 1XSJA 2VUYA 3O15A 1YIXA 3IARA 2HS8A 3ZVIA 2XSAA 5M17A 2B7OA 3Q58A 4XVEA 3D0CA 3E96A 4Q4RA 3FSTA 3EX2A 3WDIA 1RJRA 4AWUA 2I16A 1I1WA 4AF0B 3W1TA 3PZUA 5IHRA 3GM8A 4F0RA 1QNPA 1ZBKA 3URQA 1D2KA 1IGWA 3W7NA 3HIJA 2V9DA 3TTYA 3WUGA 2F61A 5E9XA 1ZJBA 1JPMA 4JQAA 2Z27A 3KE0A 1UKSA 4IP4A 3CO4A 7REQB 3W27A 3PZ9A 3MI3A 4LF1A 1OF6A 3RMJA 5FESA 2EG8A 1OX4B 3NA8A 4PTMA 4BHYA 4AB4A 3C3NA 2NQLA 2W62A 1XLAA 5HDRA 5LA1A 5B7ZA 1TFVA 1JR1A 5JVLA 1BKHA 4GPNA 4C6NA 4U2YA 3QV8A 3LCFA 2I9UA 1P5BA 1OQFA 3CZ8A 4GHRA 3V16A 1S5NA 3UR5A 3NPUA 1R9ZA 4GI8A 2ISDA 1W5MA 3KAOA 4JY8A 4CVWA 5F2LA 2C18A 4UNIA 4IJCA 3IS4A 3KCOA 3LBOA 4B3KA 3V7PA 1XP3A 3ITOA 1SR9A 4CLMA 4PMZA 2QAFA 3S0CA 4PFMA 2PGFA 2WVUA 1VFLA 4GYKA 1ZAIA 3GR4A 4GIAA 3AS3A 4O54A 4JTJA 1P6BA 3K1DA 3O1NA 4G7EB 3MVIA 4REQA 4QCEA 3FDGA 4K38A 2VGBA 2AMGA 4XZHA 3HG2A 4KETA 1LYXA 1LG2A 3CUGA 5A8QA 5I5RA 1IE7C 2UBPC 4B5UA 1UZHA 3BLEA 1YRRA 3VUSA 2DVXA 2XH0A 4XKYB 1O68A 2QCHA 4PL1A 3BW4A 1PDYA 3CHFA 5CJMA 5KITA 2CLHA 1EC8A 1BFNA 5LGZA 5GJPA 3N14A 3EX6A 1FWGC 3EMQA 1GYNA 3KM8A 3GVWA 3MWCA 3EKGA 4JICA 4NVTA 4CN1A 5J5DA 2PUZA 3TYCA 5EFFA 1X98A 1UD5A 3WUEA 1VENA 4HYWA 2PDFA 2VRKA 4N6EA 3CZKA 3W76A 1SO3A 4KF1A 3QTPA 4XZNX 3AMLA 1FWBC 2YCJA 3QPEA 1I75A 4NAFB 4IQEA 3MUXA 1N55A 2WSPA 1T99A 1YEYA 3KZSA 1KCLA 1OC6A 4C5ZA 2PBGA 1J0ZA 2NX9A 2F2HA 3SDOA 3D3FA 3KVLA 4Y2WA 4OVXA 1XH0A 1R38A 1W3TA 1VIZA 2BBFA 4MF4A 1PIFA 2VC6A 1A5AA 1KTBA 3OBKA 3VIMA 1MDLA 3TKFA 3AFBA 1SVDA 4HHPA 2ZRYA 1OD0A 4I5RA 3QEZA 5LKYA 3IJ7A 1RV8A 2G8ZA 2PA6A 4DELA 1AQ0A 3W1UA 4UTTA 2INFA 3L4ZA 1NOUA 4FXFA 3LPFA 2DH2A 3QVQA 4OGZA 1A0DA 3FK4A 2VDGA 3TZFA 1ZBWA 5DRCA 4KCVA 3EB4A 2GDVA 4GO8A 1HKIA 4UNLA 1NF0A 3TXVA 2WK2A 1J93A 1UHVA 1O12A 2J75A 2YCKX 1EUAA 4FNRA 2GPTA 2OZ3A 2OKTA 2V2CA 3FAXA 1LT7A 3GXTA 4LPCA 4LBUA 3GR8A 4IXXA 1UR3M 4Y9OA 1SMAA 4JFUA 4CQ9A 4CU8A 3ARTA 4LSBA 4DJFC 2BX7A 4WOQA 1A49A 4JTLA 1Q2RA 1IWPA 4XD5A 2Y24A 2YA0A 1B57A 3THUA 1UQYA 2JKAA 3BAWA 3H4WA 4AHOA 3CZJA 1JDEA 3GHSA 3HV9A 4WGXA 4DAFA 1M53A 4J2MA 4YTTA 3VZYA 5LA0A 1ZQ5A 3DG6A 2AKZA 3W7GA 1SMDA 3ES7A 3WBEA 3BOFA 1FCUA 4MADA 4K8EA 4MZ1A 4Y8FA 4X2RA 5HA7A 4W8AA 3ZO9A 2ZADA 3LBMA 4GI6A 5F4XA 2VFFA 3M0IA 1QPNA 1O1ZA 4ATDA 4YS1A 4H8HA 5CZJA 2WC3A 3NYZA 1W37A 4DJEC 1E6RA 5LIYX 5DBTA 1Z6KA 1EXBA 4WJEA 1KFCA 1U1HA 1VCVA 3V0TA 1ENUA 3W7MA 4EPDC 1SU5A 3RCMA 3RUBL 2P5NA 4U33A 4O0KA 1ZPTA 4ACZB 1JQXA 4GFSA 2CERA 1XX1A 2WMIA 4HN8A 5T9BG 5FOOA 4LS2A 3AZTA 4C6EA 1XCWA 4JDYA 1LWHA 3PBWA 1PUDA 1WZMA 4UIOA 4US6A 5JIWA 1HIZA 3P8IA 1MUWA 3KS5A 2A3CA 3GYCA 3OYXA 2BHYA 1PZ2A 1VHNA 2QCFA 3GUGA 3H54A 3IJIA 2PU1A 4KEZA 3M43A 3LQLA 5CQ1A 5LXXA 4H4IA 3RMEA 1DWGM 1Q4NX 4AVOA 4N4QA 3ZMRA 3AIEA 2VDHA 2ISWA 2RDWA 4ICCX 3AMCA 4YTUA 3LLXA 4JNYA 3CS2A 3B8DA 2PDIA 1GK8A 1PKLA 2NQ5A 1V51A 3LCLA 1LDCA 3U9IA 4WDUA 2FGBA 1MZRA 2INEA 4LYKA 3MUCA 3OLDA 4H3DA 3H7UA 1JD7A 2O9PA 4POCA 3ABRA 3W74A 4WZHA 2HVOA 4J3TA 3K4DA 1YLVA 4CCDA 2CXEA 3G5EA 4AD1A 1ONEA 1W9PA 5DFAA 1G7VA 3FCPA 1YTEA 4X61A 3MO7A 4TVDA 3TA9A 4RNJA 1KM0A 3OZYA 4GC3A 2PRMA 2VWSA 3FS2A 1CEOA 1ODZA 3TP4A 5D09A 2DT3A 4UOZA 4YPJA 1BHGA 1FCVA 2QUNA 1R0MA 2QCMA 1CXKA 1K9DA 3POCA 2FZBA 1YKWA 1DJNA 4EOUA 1XDMA 3AIBA 3E2RA 3RPDA 3LHYA 3RU6A 3CM4A 1KCZA 2NWSA 3HPAA 3W85A 4JHMA 3G6MA 4A21A 2YL8A 5ABEA 1TVPA 4M6VA 4H04A 4C6QA 2XVKA 4UMBA 2XM1A 3LXAA 5I06A 3DHUA 3EOSA 3EWBX 2WZMA 4GO9A 3AHTA 3ISIX 3QR3A 2DGAA 1KXHA 2E7FA 2X1UA 3FXGA 3W7RA 4L64A 4OE7A 3W7LA 3H2FA 2PURA 4R33A 2W92A 2IUZA 4CN6A 4PCPA 1PZ0A 3OJGA 1FOBA 5G1MA 3AYVA 1M7OA 1DVJA 4NNBA 1CGTA 3UXIA 3EWYA 4XV0A 2E0PA 3GDRA 3OLGA 1GW9A 1ZUAX 1HP4A 2VQTA 1QBBA 2Y7EA 2O92A 2PU0A 3A3XA 4C6CA 2C3ZA 1TVNA 1LQ0A 3VOGA 2ANUA 4RV3A 1WBJA 1SFLA 3W22A 3P14A 5DN1A 1XLFA 1ZRQA 2Y5EA 3PPCA 5FJIA 3V18A 4B3ZA 1I2QA 1XYAA 3P6LA 1F6KA 4LRSA 3ORWA 1ZCOA 4A22A 2C1HA 1MVYA 4UUIA 3NGFA 1Q63A 3SGUA 3M5YA 5B80A 5H2ZA 4PSPA 3SY1A 2CBUA 2GYIA 1SW0A 4C65A 1BYCA 2AL2A 2DFAA 1QDSA 2A85A 1UOKA 4A3UA 4GUIA 3VGEA 1XPGA 3MJMA 3VOCA 4M5PA 1Z7AA 4Q6JA 3GFYA 2DV0A 3N9KA 3DFYA 1OD8A 3L5MA 2I9EA 3T0DA 3BLIA 3UJSA 1E0XA 2BY0A 3UBPC 3N13A 4QTGA 3HFYA 1H7WA 4JN7A 1E55A 1L2UA 4MB4A 2XZ9A 3R58A 4GZEA 2XH4A 1O60A 2G96A 3THQA 3GIQA 4QQUA 3NO1A 4LVBA 1JYNA 4YCPA 1W9BM 3CPGA 4PB3A 3O6AA 1JXKA 3FKRA 4TMBA 3MP5A 1NWSA 2CWXA 3PULA 1FWRA 1Q7ZA 2ADAA 2DZUA 2Y63A 3O8AA 4AMCA 3TVAA 3UGVA 2E25A 2Z1XA 3R79A 5AVHA 3WLHA 3N25A 3SGZA 1FDYA 2QCEA 1QPKA 4D6HA 4MPQA 1BTCA 1QOPA 1GG1A 3ZJKA 1EJUC 2IKGA 3TOPA 4AXNA 4LCSA 4G8TA 3LZ3A 3ANUA 1RUSA 4DQWA 4O1CA 1UP3A 3ARXA 3G18A 1A5LC 1TPB1 3A24A 1W32A 2AQOA 3L2IA 4ZFCA 2V81A 4KEVA 1QNRA 2GGGA 4ILSA 1A50A 3CT7A 3ARUA 2X8RA 2V3FA 4FB7A 4BQ3A 2D22A 5G4HC 3TQPA 4J28A 3C5QA 2HZGA 3OBAA 3MJYA 4JFSA 2P8CA 1DWFM 4Q4PA 1U33A 1LROA 4L80A 6ENLA 1FXPA 1GTHA 1PJ9A 1OG6A 4AYGA 5CPOA 4QG6A 5DCEA 4UQEA 1P48A 6PTDA 2Z6JA 4GYPC 5I7GA 4QM1A 4IP5A 3HGRA 1QBAA 2F2KA 3S1XA 4IMFA 5AVNA 2JBMA 3CQJA 4XTDA 1LG1A 4MZYA 3TQ0A 2ZXQA 4UFMA 1BWLA 3URAA 3R0KA 3AHVA 2YBVA 1TPFA 4H8NA 1AMYA 1AVAA 7TIMA 3OZMA 2ZIDA 1AD4A 2HV5A 2DP3A 4DAIA 1LWIA 2EKCA 2YLLA 1SO4A 3GG7A 4I90A 4H2CA 2F6UA 4F0MA 3DKLA 4EXQA 4A2SA 1A0EA 4ERGA 1IT0A 1Q8AA 2O56A 3VD9A 1BF6A 5BMWA 3A4WA 1YDNA 2QJIA 2AKMA 3VCRA 4GZIA 2PTXA 4PTVA 2H9AB 5K4ZA 2OOGA 4P8UA 5CPNA 4WQ6A 3PZNA 4AXKA 1DJYA 2ZZ7A 1H60A 1UD4A 3TROA 5DMMA 4BCEA 4TV5A 3KRSA 5REQA 2OWWA 3CQHA 4LYPA 1E9IA 2HE8A 4AD0A 4C6MA 5CCZA 1DXIA 1YW1A 2OODA 3GTXA 1R3YA 2EEXA 2G41A 3BAIA 3TW7A 1OGSA 4GOAA 4ML9A 2BOEX 2G50A 1B3OA 2Q3OA 2H3BA 1IEXA 3TONA 4PMYA 1TUFA 3T2OA 3N11A 2PLKA 1IHIA 2YW4A 2WJDA 2C79A 3ITCA 1CNVA 4U2ZA 3WN6A 3GTFA 1K03A 4JQ2A 2CHNA 6XIMA 2VFIA 2GSEA 4KWWA 2CBJA 4KRZA 2WCSA 4DBSA 1LQAA 3B8VA 2G4FA 3S4TA 2ACSA 2QDGA 3WH8A 3T05A 1NP0A 3ZR5A 1DE6A 1XRVA 1PIGA 2XFRA 3WEZA 1J2BA 3FHQA 1SUXA 1EQPA 6REQB 3MA8A 2P0OA 2XU2A 3TJXA 4PFHA 1R3RA 2PDCA 5LIXX 5TIMA 2X0SA 4AWEA 4IXHA 3G3DA 2FKPA 1JG9A 4H6RA 4Z0JA 3TQVA 1S39A 4N0RA 5LA2A 1TWZA 3AXHA 4V1YA 1JXJA 4B5VA 5EYWA 3BMWA 4ZGYA 2HK1A 3BE7A 3ZT5A 1WDQA 2XISA 3U7BA 1H7NA 4BWLA 2REQB 3KVJA 3QXBA 2OX4A 2GFTA 5KSWA 1AD1A 1DJWA 1H63A 4UR9A 4CVUA 4LVGA 4OJYA 1FKWA 3QMTA 1WB0A 3FW6A 4MKSA 5I02A 2YYUA 3W28A 4MTVA 2GK1A 3KP0A 1G7UA 3B0UX 3PK7A 4O4VA 1VBRA 3H6OA 4G6CA 4RNIA 5I6SA 5H6HA 3NL3A 2ZUTA 1NQ6A 1G4SA 1B30A 4PCSA 4CU6A 3IJ8A 3HPSA 3RILA 3REQA 1XYBA 3GTHA 5CJNA 1W5NA 3LRKA 4FO4A 2A1YA 3PC0A 1UR1A 4GINA 2V3GA 1ECQA 5FKYA 1OFBA 1U83A 4QISA 9RUBA 4W86A 1D3CA 3HMJG 2QUMA 3GW0A 2O7QA 3MYPA 4CNPA 3BDKA 2GJXA 1DIOA 1WXJA 4XZBA 3E2SA 3GO2A 4P2VA 2OFJA 5HWMA 3M0JA 3PUOA 3WDPP 2ISFA 1DOSA 5IRPA 3GVVA 1TPUA 5AYYA 2HVNA 2XVGA 4K3ZA 4JNZA 2PTYA 2TAAA 1FBAA 3WF4A 4RR4A 3L12A 3WDHA 4UXDA 5LIWX 4NF7A 4DY1A 5CH9A 4IICA 3ARYA 4L9YA 1EA9C 3GW3A 2FHBA 1R6WA 1OGGA 3ZIZA 2BTMA 2C8NA 3POHA 4JD4A 1ISWA 3U8GA 5E6ZA 4OECA 4R9XA 3VIPA 2PDNA 4NKCA 3CL8A 5CPTA 4PH6A 5D33A 4GISA 4UTWC 1BKSA 3G1VA 3VNKA 2POZA 4REQB 3GDLA 3LNMA 5HQEA 3IIPA 3WBXA 4ICNA 2Y61A 3IVSA 4LYRA 2YSWA 3GC5A 4NYYA 4QNEA 4NJHA 1DJIA 4GVGA 3E0IA 1X1NA 3TC6A 4AVNA 3HOJA 2ZA3A 4H19A 1S46A 4K7YA 1QWGA 3L9CA 4Q7NA 3W07A 5E1QA 2XM2A 4O14A 3QGVA 2WQDA 4TUFA 1S5WA 3A23A 4CD4A 3KCJA 4I9AA 3CIXA 5A8NA 4FEZA 3O3RA 4AVFA 5LHEA 2V5BA 2VEFA 1Z9AA 3I7QA 1E6QM 3WQDA 1MRQA 2OLSA 3OVQA 5C71A 3K13A 2XFYA 4JY9A 3RNDA 1F74A 3ZFHA 3UWWA 4PMNA 3ZLGA 2J47A 3SFWA 3ZM8A 3MP3A 3H21A 3N04A 3TV8A 1Q6GA 3DC0A 4JPGA 4GE8A 1WZLA 3B0VC 2CCRA 3NQFA 2E5BA 2DY3A 1SQ7A 3AJ7A 4RUBA 3W2UA 3ZZ1A 3VK5A 4N9DA 5HMEA 3EWWA 3B0PA 3LLFA 3WLIA 3IJLA 1S3HA 2PDLA 4FAMA 2VX4A 4NZ1A 1EEPA 4ATLA 4KIEA 3NVTA 3VDBA 2JF7A 1H7XA 3FNDA 4W84A 5D02A 3DI1A 3H7VA 3W3OA 3W70A 3QOKA 1TQJA 2RGMA 5CZSA 1G5AA 4JGDA 4D6FA 3L68A 3INPA 4C6BA 4F66A 3EPOA 3W26A 3V4BA 5KEZA 2TRSA 2QHAA 1VCGA 1IZCA 3W6YA 1ELSA 4R53A 3V1PA 3B3DA 1JJKA 2NV1A 3C6CA 2Y2WA 2VFEA 1JDAA 2O9TA 5FF0A 2VT0A 4MB5A 1GQKA 3SSZA 1N82A 4GUHA 3N6JA 2E40A 1HF6A 2AGTA 1JPIA 2XUCA 4GVHA 4WSKA 5CSRA 5LNSA 2ZTKA 1PYFA 4HCLA 5FL1A 4UWMA 4E2DA 5D9NA 3GXNA 4ZE5A 3AXIA 3GTNA 1W31A 1DJHA 4F9JA 2G3NA 2XWDA 3P2VA 1ITUA 4GJJA 1DXEA 1D9EA 1E1FA 2XN1A 4UMCA 1X8CA 2QV4A 2V68A 3TYZA 1H51A 2V5KA 3QN3A 5U7SA 4BI5A 1JZ5A 1Q5MA 4FLOA 3L7RA 1XLHA 5C0QA 2YOCA 4MIMA 4P8VA 3XINA 3W1PA 1PPIA 3LOTA 1KLYA 5A8OA 3FLUA 3UJ2A 4UTIA 1DL3A 1N8WA 4ZBCA 2P53A 3EZ4A 2B31A 4RKAA 3OOQA 2WW5A 1KBBA 3RAOA 3UZYA 4NSBA 1VFUA 2AAMA 3SAZA 1SZNA 3UWZA 5HPCA 3IACA 5FEZA 4ZB5A 3VD7A 4U5IA 3FIGA 4ERAA 2Z7GA 1GZGA 2J79A 4HGXA 3VM7A 4C1NA 3VNJA 4ONVA 2G3IA 4AZ6A 1Z3NA 3B8WA 3P3BA 4NNCA 4O50A 2PDHA 3RU8X 2I57A 5K7JA 2DUZA 5HQLA 1DIEA 4Q4OA 2XVPA 1CYGA 4FF5A 5C54A 2DH3A 5IDIA 4GCXA 3GU2A 2ZUSA 4L7ZA 2X09A 4MY1A 4K37A 3N6HA 3QC0A 2P50A 3WMBA 3W38A 1EC9A 4JFWA 2W91A 2ZRUA 3TYDA 3WLTA 2BGNE 4HNVA 3RDKA 1GVYA 2A7RA 2VC5A 1CXFA 3CTTA 4Z1AA 1XS2A 3GAKA 1E5JA 3UFYA 5E0KA 1RALA 4W8BA 3KHJA 3QV7A 1XLLA 4HYVA 2Q71A 1XRTA 1K3UA 5JBEA 5CBIA 4DJDD 1NP2A 3SSJA 2A79A 4CQDA 5BU9A 1KW1A 3UZ5A 2QLYA 1PHQA 3AYSA 3ZSTA 4UOJA 3K5XA 4GJ1A 1P4CA 1SSGA 5BRBA 3B9OA 3SIZA 2YL5A 3OGSA 3VIOA 3HO8A 2QKFA 3B9NA 3NDYA 4C6KA 5F2GA 2HBVA 3PTDA 1A53A 4HSOA 1KM5A 4PUWA 1WKEA 2WHKA 1RQBA 3VM5A 5I0DA 3NQDA 2IXVA 1VJSA 1S2TA 5DLCA 3VXGA 1SSDA 1FRBA 5H8PA 2A3EA 4FMVA 5E9AA 3PF3A 4W9TA 3TLQA 1OZQA 3T6CA 3I10A 1AZ2A 4JTTA 4U10A 2ACUA 3ABOA 5G4WA 3KLLA 1PX3A 2BDQA 2D23A 4GABA 3UW6A 2WVVA 1CB7B 5G4EA 3STPA 5BXSA 1XLBA 4XIAA 3EX1A 3AS1A 1NFPA 2Z1SA 2J78A 4MWAB 3GNDA 3LSCA 3KTSA 4W7UA 3M46A 4ZOCA 4D6JA 3N2TA 3LZ5A 2FFCA 5M03A 5FF2A 3BCJA 2WMKA 2J7DA 1SZEA 2VM8A 3MMDA 2NQ9A 4YYCA 1ZFJA 2ASHA 5AC4A 4D71A 1QFEA 2JK2A 2V0TA 2G3JA 1W3KA 4JEJA 4YVPA 2W3ZA 2XG9A 5BNKA 3E49A 4FNSA 2CKRA 4QLKA 2BVYA 3DENA 3HFTA 4J5NA 2Q3RA 2V5JA 2Z0IA 4S3GA 3WK0A 4HPGA 1HN1A 3FJNA 3QGKC 4Z2IA 3T07A 2GGIA 1W3HA 2GLKA 5A69A 3FA5A 1GORA 3C2EA 4HU4A 4AUBA 3L4VA 3VZZA 1Q6EA 4HK7A 1WP6A 2ISSA 4AIBA 2Z25A 2VTFA 2G3MA 4QE5A 4GY1A 4JYDA 2R91A 4IIHA 1NWTA 4C5YA 4MLRA 5BROA 5E09A 4PC8A 1H1NA 3SCWA 3CV1A 3QLDA 2YBUA 1H3GA 3PUDA 2J9ZA 4HJFA 2FGLA 4FIQA 3FFSA 1Z89A 3SADA 3R13A 2A3LA 3HZ3A 1I9CB 2BGSA 4GNVA 2CU0A 1H5YA 1EJTC 1E5NA 4N9CA 4HTBA 4S3FA 5FEXA 2ZE3A 1I4NA 1R3VA 5JMUA 2WMFA 2J6VA 1O5RA 2GWGA 2NX1A 4UBPC 3CQ0A 1K8YA 3ZVHA 5FCZA 1AMKA 1QI0A 3PNUA 3PSWA 3PZTA 4P7NA 3MPGA 1CGXA 4AWSA 2C1IA 3GH4A 1UD8A 2DIEA 1BAGA 1GYLA 2YB1A 2CC0A 4HA0A 3WQ5A 3DFPA 3U2EA 3EX3A 3G3MA 1FWDC 1QI3A 5U4NA 3AMKA 3PTMA 1JF5A 3O6YX 1JF6A 1OFAA 4U3AA 3W73A 1OWQA 1HVXA 3QMSA 1KFLA 5AZ1A 3K8LA 4L4PA 2FPTA 3TE9A 1ADSA 1KD0A 2BNJA 2E9LA 1KKOA 1J5TA 2ZRVA 1VJIA 5AC7A 3G1YA 4MUPA 3TTQA 5KZMA 1ZB5A 1EZ2A 4UTUA 4HA1A 3GRIA 3QW4B 1LBFA 1K1DA 4AHPA 1K4GA 4ZFMA 5KMYA 2YKKA 3MUAA 2GVEA 3QKEA 1ZP3A 4BKNA 3MC5A 1W9VA 2PC8A 1K9FA 3U6WA 2D24A 4Q4MA 4RPQA 1HZYA 3R89A 3OODA 1RJPA 1DYSA 3IWPA 3LTPA 4QGCA 5EPDA 3W7EA 5L6UA 3NGJA 3W9ZA 3CUXA 3VAVA 1GKPA 1FHLA 3RR1A 2X05A 1X6UA 2OZTA 4R3UA 3R8RA 2PDBA 4D6DA 4Z2JA 3BOXA 4TV6A 2HS6A 3WK1A 1K8XA 4KS0A 1YDOA 3L5LA 3IAQA 2QJNA 3H12A 4LEQA 4XZIA 3KBMA 4PUUA 1OZMA 4LV4A 1WOAA 4TU1A 4WLCA 2Y5JA 4JTKA 2VHLA 2PWVA 1SFJA 3ATZA 5IBXA 1JZ2A 1QI4A 1S2CA 2AMXA 2J4GA 3P8JA 4XISA 1GTEA 4FK9A 2ONEA 1LM1A 4L1GA 2XN2A 1ZJAA 5A6SA 1IEQA 4RW5A 3P84A 2VUNA 3TQKA 1AK5A 1CT5A 3B0YA 4WKFA 3TN5A 1OX5A 3TMLA 3RM8A 5CPMA 1F05A 3IJ9A 2B7NA 4ZQRA 2CIPA 1JCLA 2CYGA 1BPLB 5AHLA 4H7ZA 4M19A 1TTJA 5CZTA 3P93A 4HPJA 1AL8A 4PTDA 3NEVA 3SCPA 3F4VA 1FWJC 1RSCA 1E43A 5CC5A 5EMMA 3TCSA 3WH7A 3CTLA 3W2JA 2OXNA 3VMPA 2E09A 5CGTA 1M1BA 3BSMA 2VP8A 1JYXA 3F4WA 3GXFA 3RO6A 1AJZA 2J7HA 3V75A 4DJEA 2ZX8A 4HP5A 4XO6A 5HJYA 1BSIA 2A21A 3UJFA 4Y9MA 5JU6A 3E9AA 3CV2A 1E40A 3S5SA 1TMLA 2DPEA 5REQB 4HQVA 4RZ5A 2GDQA 5E5CA 3QQWA 5FF4A 1VJZA 2RDXA 2ACRA 4IQJA 3P5ZA 4UFJA 3LI0A 3B8UA 1VYSX 4RE4A 1TUXA 3DBPA 5T26A 3CT2A 4NZJA 1L6SA 4S39A 3RFAA 5HR6A 1OG0A 3QY7A 1YPXA 2PZNA 1ISXA 1CXLA 3F5JA 4J1OA 2J8GA 4RNHA 5GNZA 1RY8A 1E4NA 1XG4A 1JIBA 4JX5A 4LT9A 1UD2A 2PRLA 3D3AA 1XLCA 2CLEA 3HPFA 5HK4A 4O4WA 1VFHA 1EQCA 4EPBC 2VI0A 2NX3A 1W1PA 1GOMA 1CGWA 2ZZ1A 3DFHA 1AQHA 3FJLA 5HULA 1YMYA 3MHUA 1XIBA 3N73A 4GZ7A 5D9MA 4ERIA 3PP7A 3VE7A 3MV11 4GBUA 4O52A 3VOIA 1J8VA 1KR0A 2CZVA 5HMSA 1KLZA 1R2SA 5GNXA 1J12A 3Q65A 3EPNA 2BVTA 4AD3A 3P67A 1XIFA 2OWCA 3CV7A 1C3FA 2A0NA 3ZJ7A 2J8TA 3L23A 2OWXA 9XIAA 1TWDA 1TPEA 4GY7A 1TX0A 2NT0A 2YIHA 1SM9A 4HPXA 4HHHA 3PWAA 3CLWA 2GJPA 1SJBA 4HZ8A 3RIKA 4YJ5A 2FVMA 4G5DA 1Q66A 5CZKA 2PGRA 2Z29A 5JIPA 2OLAA 2Y0FA 1M65A 4C90A 1RD5A 3S5OA 2DQWA 3S6TA 4CQ8A 2Z24A 4PUJA 1NJJA 3BW3A 4L1XA 1GG0A 2YZ5A