3DOPA

Crystal structure of 5beta-reductase (akr1d1) in complex with nadp+ and 5beta-dihydrotestosterone, resolution 2.00a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Structure and catalytic mechanism of human steroid 5beta-reductase (AKR1D1)
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3dopA00
4XZMX 3KRBA 4FA3A 1X97A 4GQGA 1K8CA 4PUUA 4Q7BA 3MC5A 3DN5A 3R7MA 1S2AA 4PUWA 4IJCA 3VXGA 3CV6A 3GHUA 4GCAA 3LZ5A 3GHRA 4WDUA 3O0KA 2PDHA 5AZ0A 2PDLA 4JIHA 4XZHA 4ZFCA 4DBSA 4PRTA 4XK2A 4IGSA 4JIIX 2IKJA 4NKCA 3WG6A 1MI3A 3UGRA 3EB4A 2PDQA 4JTDA 5JH1A 3ERPA 4DBUA 1EL3A 4JTAA 1AZ1A 2A79A 3V35A 4L1WA 2DV0A 1AH3A 3O3RA 3CASA 3M0IA 3Q65A 3UFYA 4GACA 2C91A 4GABA 1X96A 4XO6A 3UP8A 1T41A 4PMJA 5LIYX 3N6QA 2ACQA 3R8HA 2IKIA 2I16A 2IPJA 4QXIA 1AH0A 5HNTA 2PD5A 2R9RA 4WDWA 4H8NA 1PZ1A 4QBXA 2PDXA 1YNQA 3R58A 2PDPA 3U2CA 3ONBA 3CV7A 4DZ5A 4WDXA 3UZZA 3GUGA 5HA7A 2FZDA 4WRHA 4I5XA 3UZXA 4JTRA 4JTCA 2ALRA 2IS7A 1YE4A 2PDFA 1A80A 4HMNA 4WDTA 2HEJA 1VP5A 2PFHA 1GVEA 4JTQA 1S1RA 2PDKA 2CLPA 2F38A 1FRBA 4HBKA 1PWLA 1PZ0A 3RX2A 1UR3M 2HE8A 2PDCA 4JQAA 4H7CA 1AZ2A 3V0TA 2I17A 2PDUA 3M4HA 3UZWA 2DUZA 1Z9AA 2BGSA 5LIUX 2ISFA 2FZBA 3EB3A 5DANA 2QXWA 3C3UA 2IKGA 4JQ1A 4FAMA 3F7JA 4EXAA 1J96A 4ASTA 4JIRA 2PEVA 4IJRA 3B3DA 2HVOA 4G5DA 3LENA 1HW6A 2AGTA 3ONCA 3LBOA 4OTKA 5M2FX 1LWIA 4FALA 4WEVX 3R6IA 2IPFA 3H7UA 5HNUA 4L1XA 2PDWA 5KETA 4JQ3A 1ADSA 2HE5A 1HQTA 5LIWX 3N2TA 3CMFA 3P2VA 1Q13A 1MZRA 4XVDA 2INEA 1PWMA 4YVXA 4ICCX 1XGDA 3NTYA 1RALA 4QR6A 3RX3A 3MB9A 4JQ2A 4XZLX 3T42A 2FGBA 2PDJA 4LAUA 3WBWA 3LZ3A 1AH4A 1JEZA 3BV7A 3R94A 3UWEA 1OG6A 1RY0A 2HDJA 3G5EA 1PYFA 3UYIA 1ZSXA 4XAPA 2PF8A 2ACRA 2FZ8A 3R8GA 3LQGA 3RX4A 3WCZA 3V0SA 3CAVA 3LQLA 3CAQA 4FZIA 1US0A 2IQDA 1Z3NA 4PR4A 3H4GA 4GIEA 4MHBA 4YS1A 5LIKX 3G1RA 4DBWA 1ZGDA 2BP1A 2HV5A 1IHIA 4RPQA 3DOPA 3R43A 2WZTA 4AUBA 5C7HA 1RY8A 1IEIA 2R24A 3BCJA 2P5NA 2ACSA 3QKZA 1R38A 1S2CA 1T40A 4LB4A 4XO7A 4YVVA 2PD9A 1YNPA 4YU1A 2IQ0A 3WBYA 3LEPA 2F2KA 2PDBA 2ACUA 2IPGA 4LAZA 1LQAA 3BUVA 1QWKA 4XVEA 2FVLA 1YE6A 4XZIA 3LD5A 1S1PA 2PDNA 3COTA 3D3FA 1SM9A 3H7RA 2INZA 1AFSA 2PDYA 2IKHA 4F40A 4R9OA 1ZUAX 4YVPA 1MRQA 4GQ0A 3EAUA 4PRRA 3BURA 1ZQ5A 1EXBA 1Z8AA 4LBSA 1C9WA 1Q5MA 3UZYA 3V0UA 1EKOA 4XZNX 3S3GA 4WGHA 4LBRA 3FX4A 2NVCA 4Q3MA 3WBXA 5LIXX 2PDMA 2PZNA 4QX4A 1Z89A 2NVDA 1VBJA 3FJNA 2VDGA 4LB3A 2WZMA 2PDGA 3UG8A 4GA8A 3LUTA 2PDIA 2DUXA 1XF0A 2FZ9A 3LNMA 3M64A 2IPWA 4EXBA 1EF3A 3LN3A 5JH2A 1XJBA 5AZ1A 1QRQA 2HVNA 3Q67A 4JQ4A 3V36A 3GHTA 3GHSA 1X98A 2BGQA 2J8TA 1M9HA
chains in the Genus database with same CATH superfamily
1QK0A 3RRAA 2CZDA 3PBWA 3HV8A 1JDEA 1OCBA 4JY8A 4PMXA 4FA3A 2GK1A 1CNVA 3TWAA 4A21A 2Z1BA 4D6HA 4QDPA 3DEQA 4NI8A 2XISA 4OOZA 5A8GA 4NUWA 2OT0A 5ABEA 2I5GA 4PMQA 1DE5A 2F6UA 2P3EA 3HJZA 3SCUA 4NYYA 1UKQA 4I6VA 4KH2A 3WNKA 4RLIA 2QW5A 3RO8A 3TN5A 4GCAA 3BLDA 3PPGA 3G1AA 1CYGA 1I75A 1YTKA 3B0VC 1VQTA 1WQ5A 3RK8A 3G1DA 3O0KA 4JDBA 3TR9A 1R9XA 5BOFA 5LZLA 3LLFA 5D9OA 2H3BA 3DX5A 1DXFA 2Y5EA 4KWOA 3F4VA 4JOMA 4FO4A 4BK9A 3SFKA 3U7VA 1KFJA 1YRRA 1XIEA 1JNDA 3MKKA 4GX9A 2BDQA 3H4XA 1TYGA 1SJAA 3R11A 4UQCA 1XSIA 2VX5A 1UKOA 1Y65A 3O63A 5CGMA 4XKYA 4QS5A 1BQCA 1IEQA 1V5XA 4IFKA 4RE4A 4GXWA 2BGNE 3OOQA 1J6PA 4JFUA 3TN3A 3WK0A 2VHLA 1JRCA 4J9JA 1Q65A 2YCIX 3H24A 1A4LA 3K1DA 4REQB 4YHGA 1PZ1A 1L6GA 2CBJA 4KCVA 4R85A 4DY1A 1CLXA 1K4HA 9CGTA 2VGIA 1W5OA 5A1AA 4WKFA 3U2CA 1R6WA 4O8AA 3G8RA 3T0AA 4CCDA 3CEUA 1G9HA 4DZ5A 5FI8A 4K8GA 2DH2A 3GH7A 3BICA 3P61A 2G3FA 2C0AA 3L7RA 1RD5A 2Y4SA 1GWJA 3SIMA 4LCRA 4LUIA 3IK2A 4Y6GA 4JTRA 6PTDA 3KS5A 2FJKA 2PFHA 3KTSA 4QJ3B 1IZJA 3WH7A 2Z0IA 4GUJA 2PI6A 4HBKA 2BHZA 2OR2A 4EK7A 1VGAA 3AIUA 4PN2A 5M1TA 3VMPA 2BTMA 1WNOA 1BLIA 4JQAA 5M03A 4Z2JA 6REQB 3G0XA 2BGSA 1HVQA 1MDRA 3A4JA 4Y8FA 3URNA 3WEOA 1P1XA 2XVGA 2WC4A 5DANA 1IF2A 4EWJA 2TMDA 1G7UA 2V81A 4OE7A 3HQOA 3PF3A 3ZR6A 4IPIA 3HGOA 4LEFA 4GI4A 4QROA 4AH7A 4NT0A 1KFCA 4CD6A 3W70A 4F0RA 4XBSA 1UR0A 2XGZA 3QTPA 2VEFA 2VYOA 4P7NA 2HROA 1BEUA 3L66A 4A29A 1NWSA 4GY0A 4RZBA 3PSWA 4E8GA 3B8UA 4RDYA 3F5JA 4ADSA 1VCFA 3O0FA 1TVLA 2NQ5A 4HTYA 4DLFA 2VZUA 1HXJA 4JYEA 1TMHA 1IT0A 4Z42C 4HHLA 4G56A 1VFOA 2BVWA 1H2JA 4OT7A 4LOCA 4L9YA 1G5AA 4B90A 3W2MA 3GG8A 3QPZA 1LUCB 3ARRA 1QAPA 2JFEX 1A47A 3E0WA 4DZIA 4QGCA 1EJWC 3NQCA 2EAWA 2DORA 1YDYA 2CLOA 4PE8A 3PBMA 4AWSA 1EJ7L 4QLLA 4DJFD 3ZOAA 1Z32X 3UYIA 1DJGA 1X39A 2YXGA 1E43A 3STCA 2Y2WA 4PMNA 2ACRA 1R3SA 2A3EA 3LA4A 3MUXA 5CC6A 4IIDA 3V0SA 3NDZA 4CU8A 2PP1A 4Z1YA 4L64A 1MWOA 2PBOA 4JX4A 5ABGA 1OYCA 3KZPA 4H9ZA 2VJXA 1JR1A 3CYJA 1TCDA 3DOPA 3E12A 4P61A 2ON3A 3N13A 2FGLA 5M5DA 4WCJA 1RQBA 1SUXA 5D37A 1LDCA 2EO7A 2X09A 3RLUA 1VFTA 1IXPA 1REQA 3U6WA 4UR9A 2VFEA 2EG6A 3L4YA 5TNVA 2AOSA 1MQPA 4CQBA 2WSKA 3S0CA 3FAWA 2J6XA 2FH6A 1IGSA 2XVLA 5EFFA 5AYZA 4YXGA 2CU0A 1MRAA 2F61A 5C9ZA 1JZ4A 3W2LA 3CHVA 2ZX9A 3QN3A 4URIA 3CLWA 4BWLA 2CC0A 4JPGA 1XINA 3T0BA 1OF6A 4ZTYA 2TODA 4S1FA 1YQ2A 3BE7A 2G37A 4LF1A 1VYPX 4LAKA 3T8LA 5A2BA 4AIEA 2Z2UA 2ZX8A 5DQPA 4WIWA 2J27A 1W8SA 3KCOA 3VCCA 2PDMA 4WKAA 3QV8A 2BG5A 1YMYA 2HRWA 3TH6A 2NVAA 3GYCA 3KW3A 1I45A 1QU4A 2EGZA 4O18A 4XB3A 8TIMA 1RK6A 4FOKA 5ABFB 4OUEA 5J8LA 1OY0A 3ZYZA 3G1VA 3OZYA 3RCYA 2VFFA 3DFYA 4JQ4A 1X98A 3PBGA 2WJEA 1QXLA 1XBVA 3GNXA 4GUFA 5HMSA 1UBPC 3R8RA 1ZENA 2XWEA 4Q7BA 2WMGA 2CKSA 1S2AA 3TSDA 5IXEA 4JL1A 1IV8A 4B91A 3KAOA 5HUPA 1SO6A 3E0VA 3IANA 2VRJA 2X05A 3THDA 4AX6A 4ECLA 4I8YA 3MSDA 2J47A 3KTCA 2I56A 3PWAA 4H04A 4IGNA 5F2LA 4JTIA 3QR0A 1LT7A 4MJZA 3NQGA 4S3AA 1HT6A 3G6LA 2IKJA 5A6JA 1I2PA 1MI3A 3I6TA 4JTHA 1E1CB 3UW6A 1ICSA 1C91A 1IXQA 3APYA 1AMYA 1DIKA 3DYPA 1XFCA 3MS8A 3OPSA 1PS9A 2E09A 4QDWA 1B3VA 1VBGA 2AKMA 2BLEA 3CTTA 4Q8PA 1ZNNA 3DFPA 3UFYA 3VUPA 2R6OA 1T6MA 3O8AA 3TSBA 3H7VA 2AKZA 2I7GA 3FA3A 4KPLA 1ME7A 3C0LA 4QCEA 2BY1A 4ZBCA 2ZTJA 3TQVA 1V7YA 1J5SA 3KBVA 2WNQA 1OFPA 3R8HA 4KMQA 1G01A 2J6VA 1AH0A 4B9ZA 1UWAA 4PMDA 1GTHA 4YLWA 4LUJA 4NAEA 3T09A 1V6UA 2V2DA 4MB5A 1ZCOA 2R8WA 2PZ0A 1DWHM 2PDPA 1VFFA 1T99A 2GDVA 1L2UA 2J9YA 4EANA 4AWUA 3WYZA 2XFFA 5GJMA 2VD8A 3QTGA 3G3DA 2QJMA 1O1ZA 1F2JA 4JKMA 1ICPA 1S5MA 1Q7ZA 3HGRA 1UP2A 1YXYA 4I5RA 1FRBA 4HZ8A 1W17A 1YEYA 3FY1A 1ZP3A 4L4OA 4PMZA 5I78A 5D38A 2QPSA 3KOYA 3O6DA 3OLGA 4TVDA 5DO8A 2FPTA 1J0HA 1JYNA 1UKTA 4GIRA 4J1OA 4J27A 1JNEA 3HQPA 2J7FA 4OZOA 3C3UA 4MUPA 2KZHA 7REQB 2GJNA 3MSGA 3WNOA 3PB2A 4JEJA 1HJVA 4EAMA 4B5SA 4C6IA 7TAAA 4QJ5B 1TO3A 1P6BA 1AW5A 2PRHA 4PMVA 2XWDA 1W5PA 4OQVA 2B7PA 1SZFA 3GNPA 1E0TA 1XIJA 3B97A 3P14A 4MKVA 2V3FA 3HZ3A 1ZU8A 1NDWA 4CNPA 4ATLA 3SEPA 3PB0A 3L2MA 3L0KA 1QOXA 5I24A 1I2QA 3W7OA 3XINA 2ZDRA 3HN3A 2XIOA 4JCLA 5HOSA 2ONEA 4EF8A 3NOEA 3BDKA 2Z24A 3H26A 4KESA 1NF7A 3QQWA 4ZTXA 4S3JA 2TAAA 3BPWA 4DIAA 3VE7A 4O15A 5K9DA 2VENA 3PC0A 3F1QA 3ABXA 3INPA 2BHYA 2QQ6A 1I4NA 1TV2A 4WJXA 2I9EA 1UW9A 1GOOA 1W1IE 3B8IA 3URQA 2RGMA 1CGUA 1VR6A 1WDRA 2HDJA 3G5EA 4OECA 4JTSA 4I9MA 1J0IA 3IK4A 1TIMA 2E77A 4CCCA 3N2MA 1XIMA 2E7FA 2QJHA 4GNJA 2PTWA 3NZGA 1DQWA 1DWAM 1VFMA 2XUCA 1MZHA 3LCWA 2GDUA 2SFPA 2WW5A 4H8HA 1X1OA 5E09A 4QITA 2YGYA 2BY3A 1KBJA 1ZGDA 3LHUA 1U1UA 3BG3A 2C8NA 1B9BA 2WZTA 1DL3A 2GSEA 4Q4QA 3ISIX 2JF7A 1YBQA 1DOSA 3IJ8A 4V27A 4LYKA 4S3FA 3THUA 2XZ7A 2QCGA 2PC4A 3HQ1A 5A6TC 4MLJA 5ECUA 2QF8A 3GXIA 1U33A 1MVYA 2QDDA 1KTCA 2YYTA 1LM1A 3WBYA 4HNCA 1W5QA 2E5DA 1NDZA 1Q2RA 1KXHA 4LAZA 5D9PA 2X1RA 1ZBCA 4XZIA 4PTWA 3LTYA 1XQKA 1PX3A 3SURA 2YDQA 2D0FA 3UPMA 1CB2A 1Y8BA 3UR7A 1M6JA 4FHAA 1KQZA 4TX8A 1XGZA 2G50A 1A5NC 4QE4A 4O1AA 3WMCA 1E15A 2CFFA 4G6CA 3IUHA 3UNTA 1C9WA 4D72A 4N7QA 2VEKA 3ITLA 1RD6A 3TJLA 3DI0A 4G1NA 3KTXA 4FIRA 2XJ7A 3VKCA 4IHCA 1AL8A 1RAKA 1JULA 5A3HA 5E0CA 2Q01A 1LROA 4N9BA 2WZMA 3HG2A 3N9RA 4JX6A 2ZZ3A 4AZCB 3W22A 3W7RA 1OWQA 4B5NA 5BU6A 3UPBA 3EA1A 3LNMA 2J77A 1GPFA 4PODA 1CENA 5FIPA 5JH2A 4FF5A 4I3GA 1E40A 3UR5A 5LA2A 3Q67A 3OHIA 4O52A 4TR9A 2VCAA 3NDOA 5I0DA 3KLLA 3MSRA 4GE8A 1YYAA 3MPGA 1GQKA 1E9LA 1M9HA 4JN6A 3OIHA 3EPMA 5KZ6A 1V3MA 2XM2A 1W9UA 4I5UA 5EMLA 2WCGA 4GYFA 3FN9A 1UUMA 1DTUA 3BTNA 4P8VA 2O7QA 4PUEA 2ZUUA 2E6DA 2FZMA 4J7RA 1NVMA 3OZOA 4LV9A 3TN6A 1V51A 4BKNA 1HP5A 1ZHAA 2CBVA 3FXYA 4R5EA 5C7VA 1EP3A 3KBMA 4G7EB 1UQZA 4DXXA 2Y6ZA 2YW4A 1Y5WA 2V68A 2RDWA 2DY3A 2AL2B 1ZPTA 3MMDA 4ACZA 5H91A 1ME8A 3V16A 1DJZA 3W38A 1W5MA 1VEMA 4C90A 3CIXA 4EXQA 1BXBA 4WKHA 4K38A 4KBXA 3GH4A 3C0JA 4Q33A 3ELFA 3W7IA 4N4QA 4UOQA 1UWUA 2F6XA 3ANVA 1Q6DA 2QCHA 4MGGA 2OYKA 2G3IA 3CM4A 2WPBA 2PDQA 2FB2A 5AHFA 2WZIA 1TRDA 1EZWA 3KWXA 3V35A 4YHEA 1AH3A 3WDIA 4I7VA 1XIIA 4B15A 3Q65A 1J11A 1NP2A 4GI8A 1L6WA 1UR2A 3F2CA 3CYVA 5I00A 3E02A 4GABA 1UYQA 3QGKC 3HB9A 2G3JA 4IMEA 2V5KA 1UHVA 1JZ2A 1O94A 5HR6A 3FKRA 4HIBA 5LIYX 1TPB1 1T5AA 4YTTA 1XUZA 4HN4A 1LLWA 3WQVA 3C86A 4C91A 1O5QA 1ZJAA 4G2DA 3SCQA 4UTFA 1YXDA 4UNIA 3CAWA 1JPMA 5CPNA 1FY6A 2CPUA 4AIUA 3MP5A 3R0DA 1FVPA 4I5XA 1W5NA 4GYJA 4Z2LA 3GBEA 1EYWA 5FF4A 3SO7A 2GGEA 1F61A 3QYSA 3WQWA 2IXVA 4W88A 3DGBA 1Q6EA 1UJPA 2IS7A 1YE4A 3BC9A 3WQCA 4HMNA 1LLZA 3W3OA 3ID7A 2ZYFA 2NXGA 3MMWA 4MB4A 4Y96A 4QCFA 2CZFA 1B9ZA 3A12A 4CUCA 1POJA 1WZMA 3VIKA 3GFZA 2QHAA 3S6DA 4I9AA 3B06A 4HYRA 4H7CA 4AD3A 2VFIA 4DWSD 3BOFA 4CVWA 3M1ZA 3PM6A 3OGVA 1B4KA 3ZR4A 3CHEA 5KZEA 3G18A 4KF1A 2ISSA 4DO5A 4D6GA 4FS9A 4R7OA 4MFDA 1E6SM 3VO0A 3NSXA 3W88A 3K8KA 2WQDA 1XM3A 1NOUA 1XSJA 3DESA 3N15A 1EP1A 1FWFC 3W82A 1HW6A 4RZ6A 3FYYA 4BI6A 2PWFA 1LWIA 1V3HA 4WEVX 5CQ1A 4Z2KA 1VPXA 2CESA 3E0IA 1OCJA 4L1XA 3RGTA 2PDWA 3VNMA 3MI3A 2E40A 3OW1A 4DYJA 2E6FA 3H2AA 4BS0A 2C79A 1IYXA 1OCNA 2ATMA 5KEZA 2EHHA 2W9MA 3GDLA 2VUYA 3S9IA 4BJHA 3LCGA 3K46A 4QEHA 4PULA 2XSAA 3GU2A 4AIOA 4ATWA 1SZGA 3SW6A 4P5UA 2YCJA 1Z42A 1Z44A 3OLEA 2IW0A 4U5IA 4EX4A 1PHQA 5MHBA 5DCBA 2C71A 1H11A 4Q6XA 3AHTA 3QHNA 3CV1A 9RUBA 4PUDA 1I60A 1Q8JA 4IT1A 3YPIA 2WZHA 1LG1A 2JEQA 4P7OA 2YKKA 2VL4A 1JPIA 5F4XA 3EXRA 3QQ1A 1A50A 1W9BM 2FFIA 1KRCC 1IQ8A 3RX4A 3CAVA 4GJ1A 5EKYA 5BOOA 3L0NA 4LXFA 3CAQA 4TMBA 2BXYA 3ARPA 3WLJA 1A3HA 4JFWA 1XIGA 2V82A 1L2QA 4LTSA 3GX9A 2ZZ2A 3CPRA 3QM3A 1K9EA 5LGXA 3WDHA 2G3MA 2BOGX 5F4WA 3RM9A 1QOPA 2BP1A 3GUWA 4IWWA 3R43A 3DECA 5KSWA 1QPOA 1O95A 4H7ZA 3ORWA 4FR1A 1JCTA 4E2OA 5DMLA 2YDSA 4J3VA 2RDTA 3TYZA 4QG9A 1DPMA 5T9BG 1TWZA 2OOGA 1BRLB 2PAJA 5EA9A 4Q4SA 4M1RA 4O4WA 1UWRA 1C7SA 1RBOB 2P50A 1W3KA 4NNCA 1UASA 1OHLA 2P1FA 1E56A 3CUIA 4XAFA 4WSKA 1J2WA 2R1NA 4JNMA 1RV8A 4KGJA 5LNVA 2GVLA 1OM0A 2DVUA 4U3AA 1ZUAX 4YTQA 1LLOA 3O15A 1XYFA 1UD2A 3QPYA 1QTWA 3I6RA 2B7NA 4XIAA 3BK0A 2ICSA 3VOGA 3SQMA 4D6FA 4C6MA 4XZNX 2VP8A 4O54A 3UJSA 4GNKB 4PUJA 3TOPA 4Q3MA 1UA7A 4C6PA 4M19A 4P7LA 4V33A 5AYXA 4YYFA 1ODZA 9XIMA 3L4XA 4YCPA 4GA8A 2A3LA 3LUTA 1CB7B 3FS2A 3OA3A 3KCJA 4W8LA 4E38A 3OJGA 2C1HA 2FTWA 2Y62A 5BRQA 1H50A 5TF0A 4CQ9A 5AYIA 8RUCA 2QUVA 4CQ8A 3NZQA 1XS2A 4B16A 4C6JA 3PZOA 2HBVA 3CQJA 3U0HA 4PBGA 3QR1A 4HCHA 5GVJA 4DO4A 1L6FA 3JRKA 3VVGA 1EQPA 2WQPA 3P82A 4W4QA 2RJGA 4NG3A 2VFHA 3RCMA 2XVNA 4D9PA 1UD3A 3NG3A 1E70M 1QBAA 2WCAA 5LNUA 5D33A 1VRDA 2PGRA 4XAGA 3SI9A 1XBZA 4I7UA 4KWVA 2OLHA 1LWHA 2ZUVA 3LZ5A 3W6LA 2H90A 5BROA 4OOUA 4WDUA 4F0LA 4GIYA 1MEHA 1SJDA 3UCCA 1N7KA 3RYSA 3FW6A 4Q8OA 2RH9A 4A2SA 5I3IA 5GNXA 2QAFA 4QNWA 5CPOA 2D1ZA 3M6YA 3N17A 2Z28A 2XHYA 4K1GA 4JIIX 2WO5A 1ONXA 3DHDA 1R3WA 5FESA 3EBVA 1EL3A 5G4HC 4JTAA 1AZ1A 1V02A 2CWNA 3IV3A 2P0OA 3FEMA 3UCQA 3T08A 3GDTA 3M0IA 1MNSA 4PBFA 2FPYA 5IDIA 3GRIA 1HP4A 1FWHC 5DF0A 6ALDA 3T0DA 3IIOA 1TA3A 3OLDA 2XZ9A 3UP8A 5C2GA 3EA3A 3L5MA 3EOEA 4HHPA 1F6KA 1OGBA 5G1YA 1VFUA 4W7VA 2I16A 4DAIA 5K3VA 1C8XA 3W72A 3T2OA 1FWGC 4KIRA 4PFHA 4QE1A 1UB3A 4NVTA 3SZ8A 3ZJ8A 4CD4A 1JDCA 4K7VA 4DJDD 3T2QA 1AMKA 1V08A 1JD7A 2XIQA 3G6MA 4CD5A 5IM51 1FHLA 4JD4A 2OZTA 1KKOA 3SR7A 3VABA 3UWUA 4AD0A 5FKYA 1T7LA 1UA3A 5EMUA 2HEJA 1DIEA 2YX0A 4QQ3A 1F3TA 1TPH1 4DF2A 3DFOA 4DVOA 3R2GA 4LSBA 3CV2A 3BCDA 3VINA 1PIIA 6XIMA 2J9ZA 1EHAA 2XPKA 1ZCCA 3LM3A 4O28A 5AVHA 3MVTA 3S2CA 1F3XA 1V0NA 2HK0A 1MO0A 2HS8A 1VHNA 1ECQA 1XYZA 5AYYA 3EX1A 4H9UA 1U22A 4RW5A 3PZ9A 3B3DA 2OKTA 4L4MA 3VAVA 4PCPA 1FKXA 1WKFA 1QHPA 3UG5A 6TIMA 2ZVRA 2WKLA 4NAFA 5J04A 3QXBA 4MWAA 5AC7A 1D3GA 1X8CA 3LPFA 4B3KA 1XL9A 3DHPA 2PUZA 1B3YA 4DWSB 4U3CA 1M65A 2R14A 2REQB 3W29A 2VQTA 2QULA 2O9TA 1Y5XA 2OWWA 2DZXA 3DFHA 1DJNA 3PTQA 5CC5A 3SCOA 4J3SA 1DP0A 1ICQA 4GC4A 4B2DD 2VZSA 5A8NA 1IZCA 4WX2A 2NXIA 3MMTA 4RE0A 3EKGA 3FSTA 5AOUA 4LGXA 4F0MA 3NFUA 1XBYA 3RIKA 2QJIA 4AC1X 2VELA 3E2SA 5AHEA 1B0IA 3CQKA 4INFA 4Z2IA 1E73M 4KRTA 1UWSA 4Z1CA 4JIEA 3R0KA 4PBEA 1JVNA 1P0DA 1VH7A 3W84A 2BS9A 3VYLA 3ZWSA 2DSKA 4FLQA 1YDNA 3LQGA 2VR4A 1RXOB 2DZBA 1JCJA 3BZGA 1W1B1 3BSGA 1QNQA 4H8UA 3EDJA 4C65A 1SFSA 4AEOA 4YS1A 1R2SA 5C55A 1AVAA 1XW8A 3KLKA 1FUYA 1W1VA 5DRIA 4AUBA 3EA2A 1EUAA 3BV4A 3WUEA 1W32A 1OC6A 2OO6A 1X6LA 1ITUA 2WC3A 4BHYA 2Y8UA 1S3TC 4XZWA 3SCSA 1QNOA 2PD9A 1OZMA 4FXFA 4FNSA 2WJFA 5D03A 5XIAA 4PFMA 3W24A 2GJXA 3AMLA 2GJLA 2DSVA 4C6NA 1IWAA 2P8BA 3TLLA 1AQ0A 4NJKA 3W73A 3F5LA 1OABA 2JF6A 4RDZA 3N18A 2PDYA 3WK3A 1A5LC 5E0FA 2HJPA 4E4PA 1Q6RA 1JDAA 1MQRA 2DSWA 1RP8A 4IXHA 2JKEA 1RK5A 3K1GA 3GE7A 1R3YA 4CNUA 3ZLHA 1F5ZA 1VPQA 2D0GA 1XV8A 5JMUA 4LVAA 3IVSA 1ADDA 1TWSA 5J5DA 3N4FA 4TXEA 3AYSA 3EWZA 3S3GA 1KBIA 1YDVA 2GGIA 4OU1A 3FA4A 4TQTA 5KZMA 3U5UA 3A9IA 3L21A 3GVWA 1QI4A 3ZIZA 1LQ2A 1E3XA 2O9RA 3NYDA 3CH9A 3AHVA 2V3DA 4C6FA 1I8JA 2X2YA 3MO4A 2YXXA 3QC0A 2V0TA 4XTDA 3CL7A 1ZL1A 1KFWA 1JL8A 1E6XM 4M56A 3SJNA 3NPVA 3V36A 2E9MA 2CLHA 3PBUA 3PP7A 4TMCA 2CXGA 2OQLA 2QIWA 2WBGA 4DF1A 4U4MA 1KTNA 3M0MA 4QSHA 1TFVA 3QR3A 1SPQA 4PUUA 1R8LA 3W1QA 2QCDB 2YZRA 3RJXA 3S6TA 3QJAA 3UA4A 4KWUA 5DELA 4C7GA 1PDYA 2YB4A 3QFWA 4DI8A 3VDHA 1UKPA 1ONWA 4GK8A 2WM0A 3BLIA 2DJXA 3SRFA 3VNDA 4GUGA 8XIAA 3LRKA 1M53A 5A6MA 4BEUA 5BYWA 3VC6A 2PWHA 2BVTA 4NRSA 1AW2A 4DNHA 4XK2A 4FOJA 3I4KA 3RNDA 5FF0A 5E6ZA 2AQOA 2V5DA 3AU2A 3UGRA 4HMEA 1KW1A 4HGXA 2NT0A 1GPWA 4UBPC 3SECA 1B90A 3A47A 4S2BA 4LS0A 5A94A 1DWIM 1OYAA 2W66A 1SVDA 3B0XA 2C91A 2WXDM 4DJED 2HISA 3ARWA 1GONA 2HBXA 3RXZA 3U2EA 3VD5A 1GHRA 3MSYA 4KS0A 3NM3A 3GDRA 1K02A 2CNCA 4WDWA 4IFRA 2X2GA 2D2JA 1EBGA 2P88A 4IIEA 5CPMA 2R91A 2Y0FA 3CV7A 2I1OA 3PTDA 4HT3A 2Z25A 3IARA 3TP4A 1WAUA 3L23A 2DQWA 2GJRA 2QDGA 2PLCA 4M7TA 3WDPP 3W9ZA 4AMAA 4FNQA 3WLHA 3M0XA 4OKDA 4F9DA 4LUTA 4EE9A 1HF6A 1UZ1A 3GKFA 2VWTA 2A85A 3IWPA 3IVTA 3NAVA 1WDSA 1S1RA 1D7FA 1Q8AA 5FJPA 4H9YA 4H7VA 1H7XA 1NELA 3QMSA 3G24A 4Y7EA 1HL9A 4OWGA 4GD0A 1XRSA 3WFLA 4V1YA 2HE8A 3H2FA 2PDUA 4GH3A 5CZTA 3G1YA 2ZC8A 2ASHA 2YLLA 4N6EA 1DXIA 2WSYA 3DXIA 4C6QA 3EB3A 3L67A 1FFRA 3U4AA 4A3UA 3PZIA 2IKGA 3KUMA 1F4AA 1FWDC 1MDLA 3MBFA 3HF3A 3APGA 3OVQA 1QHOA 3PAJA 2JQXA 1RP9A 2F6KA 4AQLA 5CC3A 1UD4A 3AIEA 2B0MA 4FNUA 4AY7A 3UA3A 2QR6A 1JI2A 3R6IA 3GW3A 4WZHA 4ZMGA 1XG3A 4FX7A 1K03A 7ODCA 2QUUA 1DJQA 3BW3A 4AD4A 1B3ZA 3MCMA 4D8ZA 4RKAA 3EGJA 4Q8UA 3P74A 3DHUA 1UKSA 1EBHA 4A35A 2YL5A 2G97A 3CZKA 4QJ1A 1RBLA 1W1A1 1FWBC 1XYBA 3RN6A 4R33A 1Q2SA 1B3WA 4TTUA 2V5CA 2V9DA 1R86A 2OLSA 1RHCA 3MI2A 1RA0A 2POZA 4J4KA 5HANA 3VD4A 3MVIA 4HSNA 5HINA 3RCNA 3K2GA 5BXSA 1WKYA 3PY2A 4R88A 3VCRA 4REQA 3GQYA 1LT8A 2P0IA 4UCFA 4HCLA 2HXUA 2H9AB 4AVOA 3L5AA 5C2CA 4YCOA 4L7ZA 4XBJA 1GTEA 4KCTA 3T78A 2IQDA 3V18A 4DB7A 2CETA 1PCWA 2GUUA 4O0ZA 1IEWA 4H6KA 3RM8A 1JZ8A 2A7RA 4D1IA 4YTSA 2XYLA 1V6TA 4X0VA 3M5ZA 1VFSA 3QH2A 2O56A 3TR2A 4OFCA 1SW7A 1ALDA 4GFSA 2W79A 2DSZA 4BI5A 1JJKA 1RUSA 3G0SA 4Q6JA 6REQA 2PU0A 3BQ5A 3W0KA 5D32A 4YVVA 5C9UA 1SZRA 4AZ5A 2BV9A 3HURA 3LI0A 2OSXA 4NJGA 2CERA 3H22A 3LI1A 1R2TA 4MPKA 1T8XA 4EWND 4R3UA 4NJHA 2ACUA 2IPGA 5T26A 4E0CA 1GT8A 1QVBA 3UJ2A 1K8XA 1V0KA 3AS1A 4FXSA 5CSUA 3GXMA 3GG1A 3LD5A 2PDNA 3G22A 2F9RA 4DM2A 1XISA 3TTSA 7ENLA 2GUYA 3PG8A 4F40A 2VTFA 5KTLA 4HPGA 1VFHA 2NSXA 3T6CA 3IV8A 1KM1A 1YX1A 5E93A 4CQDA 3W2KA 7XIMA 2DIEA 2J66A 1UH4A 3P80A 4AU0A 2G41A 3K4AA 4J2PA 1EDQA 3FKKA 3N19B 5CAHA 1DBTA 1OJXA 4LVGA 3C3NA 4LFYA 2EG7A 1RJQA 1LUCA 2CWXA 1M04A 4Y90A 1AG1O 2GSHA 3BL3A 1IXOA 1IIHA 2D2GA 4RK8A 1WX0A 3VIHA 1G69A 4FX6M 3GNRA 2XGIA 1E4IA 3R4IA 2ZUMA 3ZQ9A 3BAJA 5IDZA 4M6UA 3KEHA 1IEXA 2OPJA 3PANA 3HO8A 4QEEA 1B4EA 3WK1A 3T05A 5HPCA 1VFLA 5AC5A 2J8TA 3FIGA 4AISA 3TQ0A 4UR7A 4MY1A 2ZRUA 4QTGA 3GIPA 2HWGA 3MDUA 3NO5A 3UWYA 3VFLA 3A4AA 4EPEC 2ZDSA 1XR2A 4HNNA 4UXDA 5DN1A 5I23A 4WD0A 1IR1A 1UUQA 4IGHA 3CQ0A 3KL3A 4B5TA 1F6PA 2HS6A 3L12A 2X1UA 2E6YA 1QT1A 3EX2A 1BGGA 2QVHA 3EWDA 3CUGA 4ZCWA 1UJQA 4GJIA 4OV4A 1PL9A 4ZENA 1E3ZA 3NPWA 4MVAA 1K9FA 3VOHA 4F48A 3UWQA 3PNUA 5I3KA 1TTJA 4P8UA 4A8NA 1YNYA 3ITVA 1EF2A 4CQCA 3F03K 1OBAA 3PAOA 1ONRA 4MY9A 1MW3A 4GZEA 4ZGYA 3NZPA 2GVEA 4ATDA 1VAHA 1U30A 4ERIA 2PBGA 4RXFA 2C14A 2R9RA 2YFOA 3FXGA 4UTJA 4AZ6A 3M5XA 2HNHA 3R58A 5FJIA 3PHAA 3UJRA 4UTWA 4D6EA 1RPKA 3DBPA 5HQLA 1TTQA 3RPTA 2GWNA 3C2VA 1KWGA 1UD6A 1FDJA 2WANA 3HGJA 1E1EA 3PZVA 5DBTA 5ABTA 3QOKA 3EPOA 4LY4A 4MM1A 4POCA 3TK7A 2J79A 2ZFAA 3E6EA 5GNZA 4M1BA 3HQNA 4HCDA 4JKKA 3ZT6A 4H1ZA 2CLKA 5ABFA 2WLZA 3AI0A 4P7QA 4TVUA 4NY2A 3GDKA 5AHLA 1JUEA 1EWEA 2O7SA 3C2OA 1XIHA 4IMGA 1SZEA 4P2VA 1P0KA 3TA9A 4Q8TA 3OGRA 3TAOA 4I6KA 1GJPA 4DBDA 3TWBA 2PTDA 2QYGA 1D9EA 4AY1A 3EWCA 1E6NA 3BAIA 2NV9A 3FHQA 3SDOA 2Z6JA 1ISVA 1FXQA 3DFNA 3BAXA 2JEPA 1N55A 4O0QA 3AXHA 1XG4A 3WLMA 2Z6IA 1GW1A 1N2VA 4RW3A 4C6OA 2HMCA 3GY1A 4XG1A 4GVHA 2DZTA 3QKEA 2TSYA 4XISA 1JF5A 5EYWA 1A5AA 1ADOA 3V1HA 2IPFA 2PWDA 3UVIA 2YCLA 4A3RA 1FWIC 1JZ3A 1E0WA 4CU6A 1E1CA 1EJUC 1I6NA 4PUKA 2INEA 4KRUA 4LC6A 2JGQA 2D2HA 1P7TB 1VKFA 2CLMA 1CWYA 1LG2A 1XGDA 3EMZA 2Z7GA 4QR6A 3MWAA 2J7CA 4CNNA 2HPIA 8XIMA 1A5SA 3VMNA 1VF8A 2NWRA 1IZKA 3LCXA 1GQNA 1THFD 3D0CA 1LL4A 2Z1SA 1KLYA 3N25A 3H8AA 1V0MA 1R9YA 5T9CE 2OZ3A 2G3NA 3EMQA 1BTCA 3VD7A 1RY0A 1ZSXA 4MOZA 3TONA 1BSLA 3S42A 2PF8A 4FLSA 5F4SA 4IXXA 1ITCA 1V3LA 3R8GA 5AHNA 1JFHA 1XCXA 2NZLA 1JAKA 4US5D 2OWXA 4ORIA 1US0A 1W9VA 4PR4A 1SMAA 2DFAA 3QW3A 3GTFA 3WJWA 1VIZA 3DFTA 1P6WA 3C2EA 1NY1A 1ZLPA 5D8ZA 4X3ZA 3UZJA 2FHCA 3WUFA 3K5XA 3ZLFA 4WOQA 3H2EA 1OINA 3ES7A 1JCXA 1KRMA 2VX6A 1R5YA 3KHDA 4RNJA 4AZBA 1Q6LA 4FK9A 1WAWA 1XDMA 2OEJA 3W7QA 1W1YA 7REQA 1UC4A 4UTMA 4GFIA 2FYMA 3GG0A 5K4XA 5KZDA 4H8VA 2LLEA 2OX4A 1XLJA 3DDMA 1W6TA 5MKGB 3GAKA 2R1LA 1XYMA 3CB8A 4QJ4B 2PRLA 4DO6A 2A5HA 4H41A 2INZA 4XV0A 4O1CA 2Z1VA 5LXXA 4DO7A 2E3ZA 1NF0A 4QM1A 1RSCA 4A3YA 3BMVA 4GUIA 2PF0A 2VXNA 2AAMA 1VBHA 1NWTA 1EC9A 3A21A 4PMYA 5E0KA 3ZWTA 2RKXA 1FWEC 4XUGA 3MUY1 5A8OA 1FWWA 3RFAA 4IG2B 2BXVA 1GZJA 1LL6A 3BAKA 3IGUA 4FXJA 4QX4A 2FMNA 1U2YA 3OZPA 4U2ZA 2VDGA 4HOWA 3UG8A 4Q7IA 5CLTA 1MNZA 4FLOA 2PDIA 4Q7NA 3WD3A 1TPDA 4YPJA 1X1ZA 4AXNA 2DUXA 1BPLB 2CHRA 3LXCA 4HJFA 3RHGA 3M64A 5A8MA 1QPQA 3OHMB 3WY1A 2W63A 3M7WA 3BARA 3MYPA 3W00A 2Y70A 1EOMA 2XFRA 2W61A 3AUOA 1GEHA 1R3TA 1MXDA 1V02E 1V79A 5EBAA 1FWTA 5D2VA 2ESCA 3KBNA 3EPNA 5G2WA 4F0SA 3WH8A 3LMYA 2EKCA 3MTWA 1XFBA 5AB3A 4LVFA 4O1DA 3R7MA 3WMBA 3LPGA 4PUWA 3SAZA 1HO1A 3UF9A 3FV9A 5CG0A 3P93A 5BXTA 4O4VA 2NV2A 1JRBA 4DJFA 3DG3A 7PTDA 1A5OC 3IIVA 4FF7A 3W28A 3IRSA 3NPUA 1O1HA 4R27A 4R9XA 2ZA1A 4DRSA 1JZ7A 3DI1A 4NKCA 3HMCA 4MJ4A 1UROA 3RPMA 1FCUA 3EB4A 3K30A 3SJ3A 3WEMA 3A22A 3L5LA 1QW8A 1V8EA 1H51A 1EX5A 1NP0A 4O8RA 3E96A 3GG7A 1GVOA 3KOXA 2ZKMX 3AU6A 4P8XA 1R3QA 3E5PA 2W0UA 4DZHA 4LYPA 3ANYA 3UG3A 2HTMA 1O12A 4ZB0A 3WLTA 2WVSA 3C5QA 4E2DA 4GYPC 2DU2A 1VPYA 2OSWA 3A64A 3VUSA 4E6MA 2JKAA 3T4CA 1M68A 3TZNA 3XISA 2GQ9A 2XSBA 2YLAA 3BOLA 3GM8A 4BEQA 1OK6A 5JU6A 3WQFA 1YLVA 3CQIA 1I2RA 2PWGA 4AZCA 1LP6A 2Q02A 1TV4A 3G8EA 4WY0B 1P1MA 5HBFA 3FFSA 4Z1BA 4L9ZA 4MWAE 1XX1A 1GYLA 1F8IA 5C6MA 3SN0A 1TV5A 2Q6ZA 3NGFA 1C29A 3SADA 3IJDA 3R89A 1MFVA 3JW7A 3RMJA 4WUIA 1GKQA 1EGMA 1JPKA 3SBFA 1TVPA 1XD0A 2VVSA 3E1F1 1TTIA 1K4GA 4OUIA 3V0TA 4B3ZA 3LXBA 5LIUX 1C8QA 4BQ2A 2CHNA 4NQ1A 4S38A 2QCNA 1S2TA 4JQ1A 3Q45A 2FHFA 5C2XA 5AKQA 1BYCA 2DVXA 1GVYA 3TV8A 1NARA 4G7EA 4JTLA 1NOWA 1C93A 2HVOA 2XINA 2AL2A 1F76A 3H2MA 1LBLA 4M51A 3LENA 4O0KA 2AGTA 3SRHA 3VGDA 1TX2A 1E6RA 2D23A 2UY5A 2Z1KA 2G5WA 4OBSA 4HK7A 4HQVA 4JQ3A 3PN8A 3E5BA 3WQ4A 4PCTA 1H0GA 2HE5A 3N2TA 1H7PA 1BWVA 3AHYA 2V63A 1PAMA 3VGFA 5BZAA 2RDXA 5C9RA 2OELA 4NI3A 1LYXA 4KRZA 1BG9A 2EPLX 4C6CA 1E1FA 2VEMA 4J3ZA 3IJIA 1VCVA 1U5HA 2EPMX 1OC7A 2EJAA 2GDQA 5F2MA 1EJRC 4AC7C 1TELA 4TUFA 3QY8A 2Z26A 2XN1A 5JBFA 3IEBA 3MP3A 1ZS2A 1PYFA 3HG5A 2V30A 3VOCA 5JIWA 4UTKA 5FA5A 4D1JA 2WM1A 2YFNA 1XUUA 4PRWA 2J7GA 3HPZA 1ITQA 2ZE0A 3WD1A 3AFBA 3W7CA 3LDVA 3WZ0E 1XH1A 4MUZA 4LUSB 3GAYA 2FZNA 2WZEA 1EPXA 2E68A 1WKDA 4FP1A 3LHVA 1IR2A 1KM5A 1OGSA 3S5YA 4DYKA 2GZXA 4ILSA 4XD4A 1MEWA 2BOFX 1GG1A 3WNNA 1EJTC 3UXKA 5G4EA 2JIEA 3BJTA 2HVMA 4CCZA 3MQTA 2P5NA 1OFEA 2CLIA 4L5ZA 4XO7A 1MW2A 3TQPA 2YA2A 3UBPC 1YNPA 1PSCA 1DWGM 1E9ZB 1QCWA 3WJXA 3ARUA 5CJ5A 3V1PA 1UCWA 2Y1HA 2PGFA 1BXNA 2QS8A 3BXWA 4FLRA 3BUVA 8CGTA 3NEVA 4EACA 4HMCA 2NQZA 3LHZA 3HV9A 1VZWA 2ATSA 3AMGA 1TR1A 3ZVHB 5I07A 3VX1A 5ECVA 3CIWA 4WK9A 1IEVA 3F4WA 1CGXA 3NCOA 2OX1A 3UG4A 1VEOA 3MMUA 4NP7A 3U4FA 1E51A 3DCPA 5T8GA 1HGWA 1KFBA 4TVCA 1PYMA 4HSHA 1EXBA 1VBUA 3CPUA 2ZX7A 1Q5MA 3F4NA 4I8DA 4PTNA 2CKRA 4S39A 4AHQA 3V0UA 2Z00A 4YTRA 2G8ZA 1XC4A 2WVVB 4WGHA 4LBRA 2NX3A 2NVCA 1ISWA 2E28A 2Q71A 3USBA 2BMBA 5BRPA 4GO8A 1VBJA 3MCNA 1NH6A 4LB3A 4MMWA 1FDYA 1H09A 1P6CA 2PDGA 1E72M 3THAA 3UNDA 1WXJA 3OBEA 5F1VA 5FD0A 4HNOA 1KRBC 3SGZA 4WJ8A 4GINA 5I3JA 1W9PA 4ZE4A 1IT7A 4AF0B 1KV5A 1CGVA 2E5BA 5F1UA 3AICA 1G4SA 1OADA 5HMFA 3B0YA 1MEIA 4O13A 2PRMA 3B9OA 1LF1A 2P76A 1CGYA 3ZXWA 1XGEA 2DGAA 3WUGA 3KRBA 2RDUA 2W5FA 5HULA 3ALGA 3W7EA 1D3CA 3DN5A 3W7MA 3SUVA 3MU7A 1OG0A 1ISXA 1XCFA 5H6HA 3U2OA 4W5ZA 4QISA 1E4MM 2ZXAA 5G2HA 5GJNA 1KGWA 1H60A 4MYAA 4GYKA 2W67A 4ZSTA 3H55A 3G3MA 2E5CA 1POKA 3TUUA 2NUXA 3BJFA 1SFTA 3CZJA 5CZ0A 3TNBA 3QV7A 4NRRA 5C9XA 3JZEA 4BI7A 3BANA 2BVYA 1EQCA 1BRLA 2PC8A 3KL0A 1SGJA 1OF8A 1KNWA 3U9IA 4GXMA 4UMCA 2O9OA 2XN0A 4FEZA 3WF0A 3IAPA 3W1UA 3H2NA 4LYQA 1NAL1 3UQNA 4JBRA 4UTWC 4ORMA 2PP0A 1A0DA 1H7RA 3GXTA 3TMLA 1IE7C 1G6CA 4DBEA 1PXGA 3KDNA 4J3TA 5FF3A 4PMJA 1VRXA 1W0MA 3N6QA 2D0HA 2FVMA 2IKIA 2NQHA 5A6AA 5HNTA 2PD5A 2RUSA 4G7FA 1ZAJA 2YL9A 3F5KA 4TU1A 3LGDA 5HQEA 2VZVA 2YZ5A 3K8LA 5K9CA 1ECEA 3GIQA 3QRHA 3ONBA 5HQMA 6CGTA 3DBNA 2ZRYA 3TJ4A 1V3IA 2X1SA 4GISA 3TW7A 1WXYA 2ABAA 3S6OA 3WBEA 4IPNB 4MWAD 4JTCA 4OHQA 3OQ8A 2NUWA 3RLGA 2L5HA 3PTMA 3SRKA 1KM4A 3W23A 3HPAA 4B4HA 2OCZA 4K8EA 3NQFA 3O05A 1JCMP 3IUIA 4V1XA 2E6AA 3QV9A 4MAZA 2C6QA 4IIFA 3RX2A 3QYQA 4O53A 4LF2A 1XH2A 2QPXA 2WB5A 4ZR8A 4AB4A 2VRQA 5CXPA 3RITA 3UPWA 3HA1A 4UTTC 4EXAA 2XH2A 3EDEA 1OGGA 4A22A 4H2HA 4E8DA 4ZOCA 5I7GA 1WB0A 3ABQA 1R7OA 4YIWA 2GVGA 3DKLA 2PPGA 3WMLA 2B4GA 1BXCA 3VCNA 3LBOA 3H53A 2H3DA 3T81A 4FALA 1QDSA 4GO9A 1BTMA 5HNUA 3TU9A 1WDQA 2WC7A 2FJUB 2PTZA 1E9YB 5JXQA 3M0LA 1C7TA 1CXKA 1JCNA 4BQ4A 3W76A 5LIWX 1A3XA 3T55A 4XVDA 3SGUA 2NQLA 1Y5VA 4AW7A 1V6WA 4EVZA 3UCDA 2X1IA 2ZXQA 3NTYA 1GOIA 2CZVA 2XDFA 3MB9A 4G1KA 4DELA 3DG7A 3ATYA 4HPHA 2NUYA 3NXFA 1MUCA 3NL3A 3N73A 4LAUA 4JFVA 4W85A 5A6LA 3C8FA 3C2YA 1C90A 2PLKA 3LCIA 3R94A 1D8CA 2E0PA 1AK5A 2WLYA 4B5VA 1PB0A 1SW0A 3ENLA 4RV8A 5CLWA 3M0HA 4LUYA 4F0HA 1FWNA 3MJYA 3QV6A 3N9SA 4H19A 4KWWA 2AQWA 5CBIA 3AWOA 3VKBA 4A4AA 1JGIA 1UR8A 1E9IA 1XLFA 2VFDA 3LCFA 1G4EA 1P0BA 1BGAA 4HTBA 1QK2A 3W7HA 3TYCA 1TJ2A 2TYSA 2UY3A 3VDAA 1FHVA 2FFCA 1A5CA 3PK7A 1OIFA 3RRXA 3NL5A 3HIJA 1MXSA 5K9XA 1H7OA 4IISA 4LPCA 5CC7A 4JIPA 2POTA 3BW2A 4UZUA 4Q8VA 5H8MA 3GVVA 1UWTA 4Z1AA 3Q94A 3CO8A 2X16A 3NDYA 4JDYA 4IP5A 1OFQA 4YU1A 3OO2A 1KCLA 2ODOA 1L6SA 2WVTA 3SSZA 2DP3A 4PMRA 4PA8A 1FP9A 1QWKA 3ARYA 4XVEA 4Z2GA 3I3EA 3U48A 4JY9A 1N8FA 3ALFA 3MZNA 3EB2A 3UYCA 1LRTA 4PZVA 1WDWA 4IICA 4Z08A 1Z7AA 2DQXA 3ABSA 4QRNA 5CH9A 1O5KA 1UD8A 4RNIA 1TB3A 4DWSA 4C1LA 4O12A 1NDYA 3B4UA 3PS7A 3HPSA 1A5KC 2PWEA 2REQA 1W8GA 3OVRA 3QF0A 4KFOA 9XIAA 1K8YA 1E4NA 3LGGA 2B7OA 4BR1A 5C8BB 2FGZA 3QLDA 5DT7A 3LNPA 4CCEA 1O68A 2CZEA 4XTIA 3O06A 3B8WA 2XFWA 2CLFA 2WV8A 2NVDA 3FJNA 1DHKA 5TBOA 3LYEA 4L6DA 3BAYA 1SU5A 1PKYA 1NQKA 1SJBA 4NJIA 1XDJA 3W07A 2ZUSA 3S5ZA 2ISWA 1LRNA 3B04A 1ZJIA 1E55A 2AQVA 5AZ1A 3ZJ6A 4HKPA 1XWYA 2O4QA 5AC6A 2PS2A 4IP4A 4NYUA 3D6NA 4IH3A 1GQIA 1QW9A 3KBJA 1KO0A 1SO5A 4XZMX 4DJFC 3ZJKA 3BMWA 1Q6FA 2ABBA 5CGQA 1FDZA 1W56A 4MSSA 4H6RA 3O07A 1VD6A 2FTPA 4M29A 4IZGA 5BOEA 5E5CA 4GX8A 4J3XA 1TZZA 5CG7A 3IAQA 4GVGA 4E2BA 1KBLA 2YSWA 3VNKA 3WH9A 2YDRA 1F7BA 1E0XA 4IOTA 1GCYA 2VDHA 2AL1A 1CXEA 2VGBA 2ZA2A 2QZRA 5HNNA 2XVPA 2PDHA 1KM6A 4Q4KA 4XZBA 3LLXA 3DKJA 5D02A 4DBSA 1V3JA 5E70A 5T91A 2QUNA 3WF3A 3OQEA 3M5YA 5D2WA 1NWRA 3WQGA 2J13A 2AMGA 4NHVA 1TE1A 1HJUA 1U1HA 2PTXA 2A3HA 3W81A 5ENLA 1S3HA 1AODA 1FOBA 3VE9A 1Q7QA 3LU2A 3NQDA 3GVGA 3CZGA 1ZRQA 3WN6A 5D8WA 7TIMA 3E38A 5DMYA 3FYPA 4GHRA 3H6OA 4RL3A 3NQAA 4HSOA 5AY7A 3Q37A 5FEWA 1GJUA 1BQGA 1PZ3A 3KRZA 1X1NA 2W92A 4HP5A 2Y5JA 3ECQA 3WDRA 2DZSA 4LYRA 4RV3A 3H12A 4J5NA 5CSRA 2VO5A 2DZPA 1CXIA 1YTDA 5A69A 3IIZA 1G4TA 4H2CA 3GD6A 1ZJHA 4GMEA 1QNRA 4ZQMA 4WDTA 4OBRA 4IQEA 3NUKA 1AUSL 2V5BA 5BRBA 2EF9A 4LBUA 3VIMA 2V38A 2OKOA 2J8FA 5I2UA 1UR9A 1RPXA 4AX7A 2R94A 4H4IA 2QUMA 4MNMA 3E2RA 3M4HA 3UZWA 1F6YA 5AHMA 4DUOA 3W2NA 1RLCL 5I3GA 2QCDA 2ZWYA 2XSXA 4X2RA 3U5YA 1WO2A 3F7JA 1CLVA 1FH8A 1OQFA 3CWHA 3UWWA 1XIBA 2VEIA 4M82A 1Q4NX 2VC5A 1M3UA 3TXZA 2BY0A 4UFHA 1KQYA 4HD5A 4NZJA 2CBUA 4B9YA 3T7VA 3W2UA 4HK6A 4H6QA 5LSMA 4QE5A 1CZ1A 1G94A 3WJSA 1W9DM 2WMJA 5TQLA 3E49A 4S3KA 1I1WA 3TCSA 4PGLA 2BVDA 2ZCGA 4O17A 4KKXA 3VGHA 3AYVA 4PMUA 1HQTA 3AS2A 1D7KA 1KCXA 1GG0A 1PBGA 1WE5A 1YW1A 2DJLA 1HO4A 3S5SA 1UWQA 1EH9A 4RE3A 3WD0A 4ZQNA 2FMOA 2OG9A 5I5RA 4WY0F 1TVNA 2OMAA 5EY5A 5FJUA 1J8VA 1JCLA 2XGBA 1EZ2A 1EIXA 2BXZA 3KZSA 3QVQA 3QGAC 3WL0A 2A3AA 2UV8G 1EIBA 1JEZA 1S38A 3PFRA 3QOMA 1S5WA 3T4WA 3Q58A 3WENA 2QCFA 3WK2A 2W27A 1XIFA 2EJ1A 3VI2A 4RNFA 4HZMA 3LRMA 4PYSA 4XAPA 4YYCA 4DN1A 1HGYA 1IWBA 3FNDA 1EDGA 1EX1A 1CEOA 3LQLA 3NEHA 2IMRA 2OZ0A 4EIVA 4MKSA 4LS1A 3DYMA 1R0MA 3AIBA 1R87A 3OG2A 4IMDA 2WMIB 3N3MA 2WSRA 5DY2A 1WP6A 4PL2A 1EWDA 3SQSA 3IJQA 1MFUA 1MYRA 3BLFA 5D04C 5GPRA 4LCSA 3WMSA 4W89A 4IF2A 1TZ9A 3L4ZA 4MZ1A 2ACSA 2A3BA 1T40A 4DJDA 3CL8A 1ZFJA 4CN4A 2ZUNA 1IXNA 1J2BA 3FHAA 4MADA 3SY8A 1OIMA 3DZ1A 4CNTA 4NXSA 3OBAA 2FVLA 1K3UA 1SW3A 4DXVA 3HMJG 4JNZA 3L2IA 2F2HA 3H7RA 2ZZ5A 2VM8A 4D71A 1DORA 1AFSA 3KOWA 3UY8A 3P0XA 3OODA 1ISYA 4ZQPA 3PZQA 4CN6A 1ZJBA 4ZOEA 1JUBA 4IX2A 2YJQA 3XIMA 5HJYA 2VOMA 4HU8A 1K7FA 3WDQA 3ME3A 4DHGA 2D3NA 2GVJA 4NZ1A 2QIIA 1WOBA 4DI9A 2YDAA 2A1YA 3FOKA 1JXKA 3WFAA 4ALDA 2DIKA 1XSKA 2WHMA 1NDVA 3A6OA 2GGHA 3W86A 4UFLA 4GJJA 2VOTA 4CEXC 1HKWA 2PU1A 3W01A 4UZSA 4WLCA 4O1EA 3GHSA 2Q8ZA 3W7NA 2QMKA 4GH1A 2H9AA 2BGQA 4WGXA 2X0YA 3OYZA 2DW7A 4RPPA 3TTQA 5I79A 2GFTA 2GQ3A 1F07A 3ABRA 4FNPA 3AMDA 3WL1A 3S1UA 3OVPA 4WSHA 1HJXA 4IQJA 4B2DA 3S1VA 4RE2A 4JHOA 2XFYA 4ZQCA 3RG6A 3H54A 1GNXA 1YKWA 4F2TA 4EOUA 4DWDA 5CEWA 2OZ8A 4Y9NA 3W7GA 3R1ZA 4IGMA 2JIWA 1LL7A 3MA8A 5CPSA 3SCTA 4TOQA 2X42A 4MNLA 1QNPA 3LG3A 1A5BA 2RAGA 3DHFA 4XQ6A 4PRTA 5FOOA 3AJ7A 5C9WA 1QBBA 3VIJA 3EEGA 1V93A 4ML4A 1BWLA 2F7FA 3DFQA 2G4FA 3BLLA 3AS0A 4WJEA 4JTDA 1DWJM 1EHNA 4JHZA 3HGSA 3MZ2A 2GVYA 1O60A 3W1TA 3MT1A 1FWAC 3OVGA 4BZYA 3UWZA 2A3CA 3FJLA 3K4DA 3P0WA 4GACA 2MNRA 5L9FA 4RXGA 4PTVA 1XLDA 3P81A 4MY8A 3CS2A 3ABOA 2IQTA 2ZICA 4ENLA 4HJWA 5E6YA 4IMCA 5RUBA 1UIOA 1FKWA 3LCLA 5AHIA 3OGSA 1SYTA 3E2QA 2XIJA 3KVLA 1OCQA 3EKZA 2PDXA 1QASA 2BX7A 2C1IA 2Z1WA 3H23A 3K4WA 4GLEA 3VOIA 2WNWA 1B57A 3D3AA 3NL6A 3W85A 3NURA 1KFKA 4FB7A 1TSIA 3PNZA 5I6SA 4AG0A 1E0UA 5IHRA 3VM7A 3E0LA 4ERGA 3NSNA 5HJLA 1N8WA 3KS6A 3ZM8A 2A2IA 4D8LA 3PPHA 2PDKA 3NZ1A 4F3HA 3TVAA 3GH5A 1XLLA 3HPFA 5F2IA 4ROPA 1ZZMA 1PX4A 2VCBA 1AW1A 1U5VA 1E6PA 2H8XA 3TN4A 3AUJA 5BMWA 3QZEA 2PCEA 4Q8WA 1JZ6A 2ISFA 3WUBA 3VOJA 3LXAA 3S9YA 2FZBA 1QUMA 5H2ZA 2QXWA 3GIYA 3LV6A 3IJ7A 3BSHA 4MPQA 1KXTA 1J96A 2CHOA 3VM5A 4ZO9A 3EEZA 2ZZ1A 3CH0A 2EG8A 1ZBWA 1DJIA 3Q4DA 3CWOX 4IM4A 1BKSA 4M80A 1U83A 2HNEA 1KRAC 3KBWA 3WF1A 1TUXA 5I09A 3AXMA 5FJOA 5CPLA 3TW9A 1KFLA 3CU2A 4BY3A 4ERAA 2ZRZA 4M24A 3STFA 1ADSA 1R3RA 1VIWA 3KP0A 3T0CA 5I77A 2ZUWA 2OWCA 3TQKA 1H1ZA 1V6VA 2E8YA 3KX6A 5HMDA 3MANA 4GVIA 3HFYA 2BNJA 1OB0A 1JYXA 3VGGA 3ITGA 4Z0JA 4AYGA 5FF7A 4X9YA 4L56A 4OV9A 2OJPA 4S3GA 5HWJA 2GOUA 3NNTA 1E4LA 4E5TA 5AECA 1H0IA 2Y7GA 3BV7A 5U4NA 4DYEA 3SCNA 4Z1DA 3JU2A 3MI6A 1O6IA 5DMNA 3ARVA 3TKFA 5IBXC 4N02A 4P7RA 3II1A 3HG3A 4UOJA 1T8QA 4FZIA 3SCRA 2OYLA 2WHLA 4DUVA 2BHUA 5BU9A 2WYSA 5JQ9A 4BF9A 3P8IA 1J12A 4MHBA 2XH7A 4DJEA 5LNSA 1SSGA 3F2BA 1H62A 1A53A 1UMYA 4DBWA 5C5YA 1W31A 2RHGA 5ABHA 3DU0A 2PTYA 5C7HA 4JAWA 3TJXA 3S5OA 3A13A 3M0ZA 2NW0A 5IFTA 1OD8A 4B4FA 3QQ0A 4AEEA 1LOSA 2B31A 3A5FA 4O11A 1R38A 3PUDA 1H7WA 1FH7A 4TO8A 2A4AA 3CNYA 3HTWA 3RF9A 3O6CA 3GZAA 3A5VA 2C19A 1IWPA 3UWVA 4DWSC 2F2KA 6TAAA 3QC3A 2ZXBA 3VD3A 1LQAA 2GYIA 2VGFA 3EZ4A 3M46A 1GJWA 3VNZA 1QMLA 3D3FA 1EEXA 2VFGA 3F4CA 4AMCA 1IGWA 3C4UA 4WR3A 2QKFA 3NQBA 4GC3A 4HA3A 2V8ZA 3H70A 2WAGA 4PB3A 2WVUA 4GUHA 3M0KA 2EPHA 2UY4A 2QCLA 3LTSA 4I90A 1DJYA 3MHFA 1OFBA 2OEKA 4K7YA 1VB9A 3KE0A 4IUOA 3BCFA 1P7TA 1JAEA 2ZZ7A 5A2CA 2YIHA 3KDOA 1ME9A 1TREA 4RNHA 4UIOA 3RAOA 3W1XA 5CCZA 1GVIA 1SFLA 1L8NA 1DTNA 3DG6A 3KHJA 4WSJA 1DXEA 1FBAA 4OJYA 2IPWA 1BF6A 3BJSA 1XJBA 1KA9F 1K1DA 4FNRA 3OIXA 3QHOA 1BAGA 4ZA0A 1LCOA 1TRIA 2J9XA 3CQHA 2NX1A 5FJJA 3P7YA 3TCEA 3AYTA 3S2MA 3L2LA 1GVRA 5I06A 1PTGA 2V2HA 1JCYA 2DT3A 5DT5A 1W2VA 5G2IA 1J4EA 2OTDA 4NNAA 1X7IA 4UQAA 3NM1A 4MJMA 2BBFA 3E3HA 1Z41A 3VXGA 5TIMA 4CD8A 3EOUA 3NR0A 3I7SA 4TX6A 2D2OA 5HR7A 1FWSA 3HM7A 3KM8A 1EGVA 4CNSA 4LH8A 3W74A 4GGHA 3SRDA 4OIFA 3VFCA 4UFJA 1BF2A 2GUBA 1ONEA 3VZZA 1E6QM 2FVKA 3M7SA 4UUIA 4BQ3A 1VJIA 3VKAA 2NLYA 1I0DA 1O7AA 3EX6A 5BWFA 1TPWA 2PLMA 4QLKA 1ZAIA 4UB9A 4IPPA 2YA0A 3USZA 2DPEA 4RX0A 1EC7A 4DBUA 1TMLA 1W1TA 7A3HA 5MKGA 1R47A 2A79A 1S5VA 4KIEA 4E4UA 3BLKA 3LCHA 3T0TA 3SUWA 3CASA 1GQLA 4IMFA 5LKYA 3NPXA 2W91A 4HN8A 4MB1A 4A6GA 3QY7A 3GR8A 4AVNA 3CUHA 3O9NA 1T41A 1YIXA 2FQIA 3THCA 4J40A 4NJJA 2J25A 4JKLA 5H8PA 1P0NA 2BZNA 3QEZA 1O5XA 1UPMB 2UBPC 4JTTA 2Y8VA 3AWNA 1XPYA 5C71A 5EBUA 3MP4A 3GXFA 2O0TA 1H3GA 1RJPA 1LOQA 3GO2A 3A24A 4IG2A 4PB4A 4RJEA 1KV8A 4Q4PA 4C5YA 2R1PA 3S2JA 3ITCA 1GOKA 5F2GA 2NX9A 3UR8A 3B8VA 5K7JA 3I7QA 3PBYA 2PDFA 5DXXA 4ZXOA 3WFZA 1KBKA 1A49A 4NXKA 5A6BD 3VIFA 1KXQA 1OSEA 4JHMA 2YA1A 1W3LA 5LNWA 4KFPA 1PWLA 1VC4A 3CUZA 1H5VA 1XQLA 1LBFA 1XRFA 4UCGA 3MY9A 1UOKA 4HNLA 1H5YA 4R53A 2EKGA 1MXGA 3A4XA 1US3A 5IFPA 2PLJA 3S2NA 3QMRA 3CC1A 1CT5A 1EUNA 3PBVA 3B03A 1UZDA 4ASTA 1VCGA 3U3HA 1K7EA 2FTYA 3IACA 2YCLB 4AFYA 4W5UA 1AD4A 4BF5A 4G5DA 1FCVA 3AS3A 3WLIA 3SCPA 2DZAA 4J3UA 2FDMA 5M2FX 1EB3A 1LRQA 1R85A 2PMQA 1W91A 1E6ZA 3NL2A 3V7PA 4AAJA 1OD0A 2PWVA 4JTUA 5EMMA 4OVXA 2IUZA 2XTKA 2Q3RA 3UXLA 1HJSA 2Y7DA 2H6RA 3TAKA 3T9PA 3N6HA 4KEUA 4F66A 1D3HA 1JI1A 4JEQA 5FSEC 4LV4A 3AIVA 1SR0A 1F3EA 5LNRA 1SR9A 4XBKA 1W54A 4ZO6A 1RALA 5H1WA 3WQPA 4LT9A 4Q8NA 3SUTA 3EOSA 1EFZA 3GK0A 4EP8C 2WK2A 3WBWA 2ZOXA 2WMKA 4MLRA 4C1KA 3N3TA 1TR9A 1TV7A 3WQ8A 5FEPA 2J7DA 2FZ8A 3ARQA 1GKPA 1W9XA 3QHMA 1BYBA 1C9DA 4U28A 1JDDA 4XD6A 5REQB 5JBEA 2FHBA 2X30A 3WCZA 1SQ7A 4N9EA 1FCBA 3L4UA 2BASA 1JZ5A 3V75A 4DJDC 2OOFA 4WY0A 3VKJA 3M5VA 4MZYA 5A5WA 1PE1A 5EGRA 7CGTA 3GS6A 1H1YA 3N11A 2XIMA 3M47A 3WD4A 1TPUA 2HV5A 1YADA 3N2BA 2OLAA 1A0EA 3ICJA 1K70A 1R7AA 4HA4A 5D9NA 3UU0A 1HL8A 1EO7A 4UNLA 1VYRA 2EXOA 3T2PA 1D8WA 3BQ6A 4ZQOA 3QKZA 1S2VA 4E2VA 3C56A 4QAIA 2I9UA 4H01A 1O66A 3WNLA 4QHRA 1L0PA 2Z7KA 2ANUA 4L9XA 4MG4A 4NZCA 1AQFA 1I2OA 1XXXA 2CIPA 3GU9A 3NXLA 3TLQA 3RU8X 1JQVA 1V7AA 3BG5A 3C61A 3VKDA 2PDBA 5I3FA 4F9JA 4MZ8A 5FL0A 1YE6A 1W3TA 4GNVA 3U57A 4B3LA 3REQB 5B80A 1FFQA 3B40A 2DT2A 1P43A 3PZUA 1GVFA 1PTAA 4Z2HA 3VILA 1OFRA 3UT0A 3APTA 4X9SA 4YNGA 5A2AA 1E5JA 2AMXA 1ZQ5A 1VJSA 3FGCB 3SSJA 1JD9A 3WD2A 1IT8A 1SJCA 2FIQA 1QNVA 3W1PA 4M7SA 2PODA 5TD4A 1QPRA 4GZIA 2YR1A 4Y8EA 2A7NA 3W7KA 1TWIA 4UR8A 1H49A 3TIMA 2Z2AA 5EL1A 3DAQA 3POCA 2XVKA 4X63A 3B0PA 3M0JA 4JGDA 1HVXA 1VJZA 1JF6A 4MDPA 2PCQA 2XU2A 1OVDA 3I68A 5G4WA 5JIPA 1K77A 3CLMA 1EF3A 4D6CA 1QRQA 2Y8KA 1HKJA 4W84A 2ALDA 3CT2A 1K8ZA 3UETA 4GYPA 3TYAA 4GI9A 1A5UA 1WXZA 3IS4A 3WH5A 1RCOB 3LMZA 3PJUA 4LUSA 3H4WA 1TMQA 4KERA 4B5WA 1CXHA 3F2DA 2DUAA 3MUAA 1PKMA 2D73A 5EU9A 1XLAA 4IJCA 1RBAA 4GPNA 2J7BA 1WBJA 1WZLA 1EPVA 1NJJA 3P67A 2CITA 3LERA 1FP8A 1J10A 2G95A 3BG9A 4KFNA 2Q3OA 1TCMA 3NO3A 4AVFA 3GR4A 3WEZA 4HPNA 4XZHA 2XN2A 5AFDA 4FSAA 1OX4B 4CLMA 4ZO8A 3VTRA 2C18A 4IPJA 2QCEA 4KW2A 2VDIA 3UXDA 4US5A 5C54A 4Z0SA 1W1ZA 1Z6KA 4W9TA 3HFTA 2EPNA 4R34A 2NWSA 3TW6A 5K4ZA 3PFMA 3UEQA 3IGSA 2Y24A 1W1PA 3M9YA 2P10A 1R46A 1FWRA 1XLGA 1JYWA 3KCLA 1PKNA 2DV0A 1AQMA 2X40A 4MKNA 1WCGA 3ZVHA 4PTDA 5LHFA 3VMOA 3VNLA 2G0WA 3WQDA 2Y61A 4V2XA 2VWSA 1PKLA 4XO6A 4NL1A 3CUXA 3ATZA 3NQ6A 3N4EA 2GPTA 3LB0A 1NQ6A 3W37A 2QGYA 2IPJA 3WELA 4ZZ9A 1X7FA 4AWTA 4QXIA 4OBTA 2OFJA 4NZ3A 1Q63A 4H8NA 4AZ7A 4GZJA 1K6AA 5DCEA 2WVVA 3TYDA 3CMGA 5IRPA 4HOZA 4FI4A 2EPKX 1FTXA 4J35A 3LK6A 3WLPA 3UESA 2FLIA 5C70A 1N82A 1KLZA 4FX8A 1PHWA 1GVSA 5M3WA 4AF0A 1US2A 3PUGA 1C92A 2Q8LA 2Y7EA 1VS1A 2F38A 3W53A 3MO7A 1GW9A 4JXCA 1JPDX 3STGA 1RR2A 1Q85A 1UR3M 4LNYA 3NO1A 1EA0A 5D30A 2RFGA 4Q4OA 4C7FA 5AN7A 5U7SA 1E5NA 1R3VA 1UC5A 1ML1A 3CUJA 4F2BA 1ZB5A 4UOZA 1I2NA 1XYCA 3UJEA 3G2GA 2Y7FA 3URAA 3W25A 3ZO9A 4CU7A 4W86A 4RR4A 5CPTA 3BW4A 1FQ0A 4IJRA 3BO9A 1EDTA 1W37A 3POHA 2BY2A 4F79A 4LY8A 3O6YX 1OFDA 3KP1A 5D2YA 3U7BA 1TPVA 3FYOA 2V5JA 3A4WA 4J2MA 4C1NB 1OEPA 3TA6A 4JTKA 5LGZA 2ZZ6A 1MZRA 1PWMA 4XSMA 4LCQA 4ICCX 2O92A 3AYRA 5EMYA 1QI3A 3N6JA 4HU0A 3EWXA 1SO3A 1TJ0A 3DIPA 3JR2A 3GKAA 4JQ2A 4LVBA 4XZLX 1Z69A 2FGBA 1A5MC 2EBNA 1UBSA 4MNKA 1WOAA 3M0VA 4BF7A 3OTRA 5M17A 1I9CB 4DJEC 3W1MA 1E0VA 1XLIA 2WOQA 2OQYA 3IRDA 1J01A 1ODUA 1OFOA 4LEQA 3LSCA 5CZKA 2CLLA 4IX0A 3B9EA 1KR1A 4B92A 2NXHA 3V5CA 5BWAA 3S5NA 3I65A 4AIBA 4PSPA 2GK1B 4JN8A 1F05A 4S2CA 1FWCC 3EWYA 3PZMA 4XZ9A 1IHIA 4PEEA 3W6YA 3TFXA 5PTDA 1N8IA 3LOTA 2FH8A 5HMEA 1M7PA 2QT3A 5DFAA 2DSUA 4IFOA 1XLHA 1IEIA 3ARXA 5DBUA 4N42A 1QPNA 1QPKA 3BLEA 3GTIA 2PE4A 1GYNA 2XIIA 3MV11 3BVJA 4ADTA 1BVWA 4JS3A 4GG9A 2QPUA 2VD9A 4UC5A 3DENA 3R25A 2QV4A 3BOXA 3CK5A 3TROA 3ITYA 4N9DA 4ZOBA 3GVQA 1Q4WA 4JN7A 1GEQA 4XKYB 2WBKA 3DC8A 4M6VA 3SN1A 1Z48A 4IFKB 1SM9A 3VGEA 3B9DA 3TTOA 4DX3A 2IKHA 1P4CA 4CKQA 4GQRA 3AALA 3G1SA 3AJXA 3VIGA 1UWIA 1HFBA 1NOFA 1O4UA 3UR2A 1PPIA 3EWUA 2CXEA 1J9YA 1S2WA 3TC3A 3CL6A 4S3BA 2ZWZA 3DUGA 4GVFA 1M01A 2XH4A 2DT0A 5F7UA 3TYUA 3QFEA 1L6YA 4LS2A 3ITOA 4QG8A 5LIXX 2PB1A 2F8QA 4K8HA 3EOLA 3PPCA 2CLEA 2OVLA 1XI3A 3A3XA 1JYVA 3NSMA 4HHMA 2GJPA 5LYRA 1ITXA 3N04A 2PP3A 1WYIA 4C6EA 1PO9A 1PX8A 1S46A 4EXBA 1KC7A 3CJPA 3VD9A 1FCQA 4M8UA 3KOZA 3UJFA 4MB3A 3OBKA 2DEPA 4L61A 1FA2A 1T0OA 3G77A 5HJXA 5A6SA 4K39A 2YYUA 3W1NA 3TXVA 5FF2A 3RM4A 4HZ7A 3HOJA 3F4DA 4BFAA 4GQGA 2VNCA 1K8CA 3QZAA 4YMZA 2DZUA 1KFEA 3NVDA 4MDOA 4QNEA 1SO4A 1DJXA 1M7JA 2X7WA 3GXDA 4IJBA 3V4BA 2D24A 3V3WA 4L6HA 3NIYA 1YPIA 1Y7VA 1K9TA 1TV3A 3FDKA 4H9VA 2JKPA 1NIUA 3B9NA 2R1KA 5CSYA 1XPGA 3GHRA 1F74A 4BWLC 4F4RA 4UFKA 5DEZA 3AQUA 3QSRA 3GYEA 3PWIA 4FMVA 1QR7A 5AZ0A 1KCKA 4JIHA 5A8QA 1M7XA 2GSJA 3R13A 1ZBVA 3KVMA 3W7DA 4IQLA 3DYOA 1PCKA 2QEZA 3WG6A 3WLQA 5HWNA 3FVDA 3I6EA 3URBA 3ERPA 1Q45A 4L1WA 1WDPA 5BXPA 4MYXA 4UTTA 4UQDA 1F8MA 2NT1A 5HUOA 4WOZA 3RMEA 3VA8A 3ARZA 3BWWA 3SFWA 4X22A 1X96A 3GFXA 1DJWA 2CZ5A 4QG6A 3P84A 3PZGA 2Z29A 1NFGA 3GZ3A 1G1YA 1LZOA 1XLMA 4YTUA 4YL2A 3JZUA 1HZYA 4FNTA 2D22A 5CKSA 1B2YA 3B4YA 4PSRA 3H2OA 1BYAA 1PIGA 2YCKX 3UZZA 3QZ6A 3WLRA 4Y9MA 1S5NA 4GRSA 3NVTA 4UWMA 2ISVA 2A21A 4W7UA 2WHKA 2V6AA 4HVXA 5BMXA 3W2JA 1JG9A 1A80A 1M41A 4QP0A 4YN5A 3S1GA 1VP5A 3SY5A 2ZZ4A 5BW6A 3PR2A 3K13A 3AC0A 1Y0EA 2ZADA 3STEA 4JTGA 3JVAA 2PDCA 3WSUA 1AZ2A 2I17A 3E0FA 1HX0A 3WF4A 1U1JA 3JS3A 1JGMA 1REQB 4D8AA 2W62A 1LOLA 3BAWA 3QY6A 4CEUC 1TJRA 3FA5A 2ZX5A 4JIRA 3CWNA 2VQUA 3B8SA 1H4PA 2PEVA 4KGLA 2O9PA 5FEXA 3HPXA 2YL6A 1WZKA 3OA5A 3U2ZA 3RUBL 1TPC1 4HA0A 4JFSA 4IIGA 4ZB2A 4NX0A 4ZXLA 1QJWA 4A05A 2WNNA 2V5LA 1CBGA 1YDOA 3AHZA 5MF5A 3TDFA 4JYDA 1WUEA 3NQ7A 4L4LA 3ZZ1A 1KTBA 3GXPA 3H2CA 1CDGA 1FH9A 4D6JA 4YVXA 3ABZA 4C7DA 2QNEA 4UTHA 3PUEA 4AY8A 4MFEA 4E3VA 1IIGA 4E8CA 1VYSX 2I57A 2W6RA 1RQEA 3S9ZA 3AXXA 5J5RA 3RX3A 1XLBA 1QOQA 3W27A 1LORA 2VCCA 2ZRVA 3GLCA 3SUUA 2UWFA 4Q4MA 3VIIA 1UZ4A 3GBDA 1NFPA 5E9AA 1W3JA 1P48A 4E4FA 1XYAA 3HBLA 3DGRA 3CMJA 1PZ2A 4H3DA 1FX6A 4RZ5A 3UWEA 1OG6A 3TX9A 4W93A 1BKHA 3WIJA 3E2VA 4U2YA 3VKKA 3TYEA 3I4EA 1LJYA 4ZOAA 1EYEA 1SFJA 3EX3A 1S5TA 1XKYA 2VT0A 4UTIA 3T07A 4GIEA 2X0HA 3J7HA 4Q8MA 1E71M 1TUFA 3SQLA 4GWEA 1KM3A 5DX7A 3JUGA 3QLLA 1GYMA 4AYSA 1Q6OA 2GQAA 4N4PA 1A3WA 4MTVA 3DERA 4RPQA 5CZJA 2WJZA 2FB3A 1RCXB 1XBXA 3HG4A 3N12A 3M43A 1PUDA 3OZMA 1H61A 2V67A 4TX9A 5IHSA 2C7FA 3RLVA 4W87A 3C6CA 2R24A 2VC7A 3PUOA 1S2CA 4LB4A 1DE6A 3A3HA 3GXNA 4KCUA 3NYZA 3LPPA 5CPQA 4IIHA 3LEPA 3OYXA 4PB5A 2OODA 3SIZA 2YL8A 1TV8A 5JUVA 1L9WA 1SSDA 1UZHA 1H41A 3GC5A 3M07A 3WX7A 4HU4A 4J3WA 3KFTA 2QJGA 1OX6A 1CTNA 2VVNA 2JALA 4M6QA 2JGYA 4IUGA 4NX5A 4PRRA 3AAMA 4GBDA 1BVZA 1V0LA 5CJNA 1HG3A 3UY7A 2OQHA 4CVUA 3LBMA 2VKZG 1TQJA 4LBSA 2VZOA 3N14A 3R79A 2J88A 3G0UA 1GK8A 4NAEB 3MDWA 2J62A 3L65A 4RDVA 3GWQA 1KBBA 5EB8A 3MW7A 6A3HA 4AHPA 1WBHA 2PZNA 2PSNA 1B1YA 5EPDA 1B5TA 4G8TA 2B7QA 5HK4A 1XC6A 1MUMA 3G1XA 1PIFA 3WLSA 2Y5SA 4DQWA 2BODX 1F4HA 4LU0A 1J0YA 3P62A 4PC8A 3FK4A 3B0UX 2I14A 3PJWA 2QMJA 1X38A 3GHTA 4ZO7A 2NLIA 4H6EA 5BCAA 1RZMA 2GOKA 5AC4A 3KBSA 1W3HA 1UP0A 1TE6A 2DH3A 2MUCA 1NWUA 4NZ4A 3WJZA 5CAKA 2WMIA 3C8NA 4DLMA 5B7YA 3CV6A 1V03A 4HZ6A 1J79A 3GHUA 4NZFA 2J7EA 3IIXA 5FL1A 3ZT7A 4JYFA 5GQBA 4G9PA 4NF7A 2G4JA 1BVNP 1PVNA 1X6UA 1KGUA 4LWWA 4DF0A 3R10A 4YWSA 4IL0A 3ITTA 4IGSA 1WUFA 3NQ8A 1F3WA 4E3TA 3AZTA 2ISDA 4LVDA 2ZE3A 3SUSA 2VC9A 1Q6GA 3S8HA 3CGTA 1TIWA 2WNZA 3NWRA 1O5RA 3W4RA 1KM0A 3LSBA 4KT2A 2OB3A 1GHSA 4N9CA 3LRLA 2OO0A 1GOMA 3AHXA 4ACYA 1VEPA 3NQVA 1GORA 4GI6A 2X0SA 1UUOA 4GOAA 5CJMA 4D6IA 3O6AA 3UXIA 1UP3A 3EDKA 2NSOA 2WSPA 2OYMA 2WWDA 1J5TA 4GIAA 4A3QA 2Z27A 1J0ZA 4A8RA 3N1AA 1LTDA 1A4MA 1UMLA 3P60A 3QPEA 3N4AA 3GUGA 4WRHA 3PG9A 4HNTA 1B54A 1GUVA 1U5JA 5XIMA 4H00A 3A23A 5CZSA 5HAOA 3S1WA 3RPDA 4Y9AA 1UPPA 1YXCA 3S46A 3EWBX 2E9BA 3UD6A 4DEFA 1GOXA 3V5OA 1J0JA 3W7LA 3MUCA 4TIMA 3TTEA 1KGXA 4S23A 1W3NA 2C13A 1R30A 3WQ5A 2TRSA 4RUBA 3ZMRA 4CNOA 1YPFA 1YBQB 4PH6A 2CBIA 5AC8A 1R9ZA 4NZ5A 3R0UA 3FCPA 3SGGA 2BB0A 1MW0A 4ADUA 5LA0A 1CX9A 2DUZA 3W02A 4A3HA 4BQ5A 3CZ8A 3IJ9A 4Q32A 4DAFA 1Q3NA 2VEGA 3LY0A 2UZ9A 1EO5A 1OFAA 1ZALA 2J78A 3HU7A 2ZTKA 3CIVA 2DDXA 2IXUA 1EXPA 3CBWA 1QW7A 3B05A 3ZLGA 4C6BA 3O7UA 2X1TA 3FEQA 3WKZA 2P8CA 4IP7A 4PTXA 2YPIA 3C0QA 1W3IA 3ONCA 3GTXA 4WHBA 2XG9A 3AIQA 3M6DA 3W1RA 3H7UA 2VI0A 3AZRA 2Z2BA 1A0CA 2D3LA 3CMFA 4UFIA 1ZP4A 4JCMA 4PCFA 1JFXA 1F73A 1HIZA 3VNJA 5K2ZA 4FXRA 4C6DA 4HOXA 3IJ6A 2H8ZA 2YBUA 3STPA 3I3DA 4GKLA 1RVKA 4DPQA 3T42A 2PDJA 4KWSA 4L1GA 3LM7A 1AH4A 1M03A 4EKJA 4C60A 2EQDA 3NQ2A 2DZWA 3ZSTA 2QUTA 3ZT5A 5A95A 4L65A 4X60A 4UNKA 4C6KA 2Y85A 4HPXA 3ARSA 4N2YA 4H9XA 3SM0A 4ZFMA 1X8FA 3NA8A 1G67A 4ROQA 5DMMA 1VLWA 2QVNA 1Z3NA 2QCMA 3I10A 5JBDA 3P5ZA 5C0QA 2HZGA 2WKJA 3BLPX 1H63A 3MJMA 2J4GA 5I02A 2GWGA 4KETA 1NEYA 1DKWA 4UMBA 3G1RA 1BWKA 2KAUC 1GOQA 4JTJA 1OZQA 4JFTA 2I5IA 3QSTA 4AD5A 1RY8A 1AJ2A 2ZX6A 5BXRA 4K68A 4ACZB 3BCJA 3AZSA 1RH9A 2A0NA 5D4YA 3ZVIA 3DFSA 1RQHA 3GFYA 1TWDA 2IQ0A 2OU4A 4NU7A 2YCEA 3NZRA 4GQQA 1MW1A 4RZ4A 3LV5A 1KD0A 3PJXA 2OXNA 3W83A 2KX9A 1S1PA 2Z1XA 3S47A 3AIRA 3KVKA 2VGGA 4O19A 2RGLA 1KCZA 1Q6CA 3LTPA 2CCRA 4HHHA 3VIOA 1MRQA 3DC0A 3VZYA 3KOFA 4B5UA 1QFEA 1EGZA 2WWCA 1XDLA 1OT2A 2WCSA 2NQJA 3BURA 5G1MA 3WJYA 1JIBA 3OB8A 1UQYA 5EFDA 3M0YA 3FJ4A 1EEPA 1RA5A 1DIDA 1C8VA 1XICA 3ARTA 1UH2A 1Z89A 1CGTA 1CXLA 2E8ZA 2D20A 3VNIA 5LA1A 4Q4RA 3WQOA 3AISA 3M41A 1GZ1A 1P0EA 5L6UA 1DEDA 4AXKA 3CEPA 1XF0A 4ONVA 3IJLA 5I3HA 1XLCA 3DH7A 3LN3A 2VMFA 4NIRA 2DIJA 2P3ZA 2HVNA 4HB7A 2OT1A 4QAWA 4GQBA 1QI5A 3UZ5A 2HXTA 3D5HA 1ZY9A 4RDWA 3E9AA 4O10A 2HSAA 3GDMA 2PWUA 4IMAA 3QMTA 4GBUA 1Q66A 1XYLA 4TV6A 5HDRA 4AWEA 5DCDA 3EYPA 3TMQA 1PTDA 3G1HA 1JUKA 4S3EA 1DQXA 5D09A 4BCEA 1MQQA 1X6NA 3MCOA 2PDLA 3GTHA 3CHCA 4ZFCA 2VEPA 3TZFA 4WQ6A 5BNKA 4O16A 2Y63A 3PPFA 1EJSC 1HJWA 1TKKA 2Y89A 4WF7A 2QV5A 4L6OA 3MV01 1J6OA 4L4PA 5JH1A 1WA3A 3BZJA 3U8GA 3K8MA 3EX4A 1DVJA 2B81A 3KRSA 3O3RA 4W8BA 2DZVA 3NJ3A 3AXIA 3OLIA 2ZA3A 4XKMA 3WLOA 5CBJA 3KVJA 2ZBTA 3FLUA 1OT1A 2OSYA 3WNMA 1AA1B 2ACQA 1D2KA 2VX7A 5DLCA 5KINA 1NSJA 2G96A 1HTIA 2C0HA 2ZIDA