4XO7A

Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
322
structure length
322
Chain Sequence
DSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human 3 alpha-hydroxysteroid dehydrogenase type 3: structural clues of 5 alpha-DHT reverse binding and enzyme down-regulation decreasing MCF7 cell growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
total genus 119
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xo7A00
1EL3A 4WGHA 4LBSA 1Z89A 3Q67A 1QRQA 2FZDA 1PYFA 4GQ0A 3FJNA 4JQAA 4FALA 1R38A 3U2CA 2PDKA 3NTYA 4G5DA 2IQDA 2PDIA 4ZFCA 3BUVA 3CMFA 3P2VA 3WG6A 3UFYA 2HDJA 2HE5A 2P5NA 4WDTA 2PDWA 2IS7A 1J96A 3F7JA 5JH2A 2INEA 3ONBA 2PD5A 3DOPA 2ACSA 3CV6A 4HBKA 4DBSA 1EXBA 1MRQA 4GACA 1X98A 5HNTA 4WDWA 1MZRA 1Q5MA 2WZMA 4WDXA 2DUXA 3R58A 3BURA 2IKJA 3UZXA 1XJBA 1PZ0A 1S1RA 4JIIX 4JTQA 3RX2A 4JTCA 3UYIA 2I16A 4JQ2A 2PDBA 4GCAA 4JQ4A 3ERPA 3UZWA 1XF0A 2BP1A 2IQ0A 4AUBA 1IEIA 2HE8A 3V0TA 2PDYA 3LZ5A 3V36A 4YVXA 1K8CA 3GHTA 1UR3M 3O3RA 2ALRA 3CAQA 3GHSA 3UGRA 3GHRA 4PRRA 2PDHA 2NVCA 3R94A 4QR6A 2FZ8A 2F2KA 4XAPA 2HEJA 4XO6A 4WEVX 4LB4A 4PRTA 2A79A 2R24A 4DBWA 2PDPA 4Q3MA 2IPFA 2IKIA 3V35A 1LQAA 4XZLX 1YNPA 1PZ1A 4JTAA 3WBWA 4LAZA 4NKCA 2IPGA 3CASA 3RX3A 4XVDA 2PD9A 3G5EA 3DN5A 4IJCA 4FAMA 3M64A 2FGBA 3H7UA 1VP5A 1Z8AA 3V0UA 1Z3NA 5LIWX 1PWMA 4PUWA 2BGQA 5HNUA 1EF3A 3WCZA 4XO7A 4XZNX 4XZIA 4JTRA 4EXAA 4IGSA 3Q65A 1YE4A 2HVNA 1MI3A 2F38A 3UZYA 2VDGA 2PF8A 2ISFA 4PR4A 3UG8A 2HV5A 4YU1A 4LB3A 5HA7A 3O0KA 3B3DA 3BCJA 2DUZA 2INZA 2IKHA 3H7RA 4PUUA 1LWIA 4LAUA 3R8HA 2J8TA 4H8NA 3EB3A 2PDNA 2ACUA 4F40A 1S2CA 1AH4A 3V0SA 4QXIA 5LIXX 2NVDA 3LQGA 3D3FA 5AZ0A 2FZ9A 4JQ3A 4IJRA 1AH3A 2DV0A 5LIUX 1M9HA 4QBXA 1ZUAX 3LBOA 4GA8A 4YVPA 3UP8A 1Z9AA 4JIRA 1FRBA 4PMJA 5C7HA 3KRBA 3M4HA 1ZSXA 2ACRA 1VBJA 3G1RA 4GABA 4L1WA 3RX4A 4EXBA 1XGDA 3LENA 3ONCA 4H7CA 5M2FX 3R6IA 5LIKX 2PDFA 5AZ1A 2FVLA 4L1XA 1S2AA 1PWLA 3UWEA 1C9WA 2PDUA 3MC5A 2PFHA 3VXGA 2IKGA 3N6QA 1EKOA 3LD5A 3COTA 4ASTA 3R8GA 2HVOA 1ZQ5A 3N2TA 4MHBA 5DANA 3LUTA 2PDQA 1AH0A 1Q13A 1T41A 2PDLA 4I5XA 4YS1A 1SM9A 1RALA 1T40A 4JIHA 4ICCX 1ZGDA 3M0IA 5JH1A 1US0A 2AGTA 1QWKA 1IHIA 2ACQA 4DBUA 1S1PA 2WZTA 1GVEA 4LBRA 1RY8A 3EB4A 3C3UA 3H4GA 1AZ2A 3BV7A 1X96A 1YNQA 3EAUA 4JQ1A 3LQLA 4Q7BA 2PDGA 4QX4A 3WBXA 3CV7A 4YVVA 3R43A 2PEVA 4WRHA 4RPQA 3LEPA 2IPJA 4OTKA 3CAVA 3LZ3A 2IPWA 3S3GA 4GQGA 3T42A 4FZIA 2PZNA 4HMNA 1A80A 3FX4A 4XZHA 1YE6A 4GIEA 2PDXA 3QKZA 3UZZA 2QXWA 4R9OA 1OG6A 1HQTA 3MB9A 3GUGA 4WDUA 1HW6A 3LN3A 4DZ5A 2PDCA 4XVEA 2BGSA 2C91A 1AFSA 2PDMA 4JTDA 1ADSA 1RY0A 3R7MA 3WBYA 2FZBA 4FA3A 1JEZA 3LNMA 1AZ1A 1X97A 2CLPA 2I17A 5LIYX 4XK2A 5KETA 3GHUA 2PDJA 4XZMX 2R9RA
chains in the Genus database with same CATH superfamily
2O4QA 3KRZA 4TQTA 5CKSA 2DZWA 2QVHA 2POZA 3GSMA 2VNCA 3DIPA 1ZZMA 3GFYA 3U9IA 2WXDM 1W5OA 1E9YB 3QM3A 4D6HA 3O1NA 3IJ6A 4GYPA 3UY8A 3GG1A 3SY8A 5HBFA 4DRSA 4QSFA 3MWAA 4HNCA 4K37A 1ZPTA 2AL2A 4UTTA 4IFRA 4A6GA 3EPNA 4OECA 3VC6A 3K13A 4J7RA 2WCSA 2UZ9A 3LCIA 3EX4A 4Y96A 3L66A 1ZNNA 2ADAA 4X61A 1XC4A 2D20A 1M41A 3FYPA 3RG6A 4LU0A 5D9OA 4AEEA 1XDMA 4GQRA 4ZQRA 2GJRA 2J9XA 3PAJA 3C86A 3BSGA 4AIOA 3PBUA 5E6YA 4WDWA 1KCZA 3ZLHA 3GTFA 3RRAA 3W86A 1GUVA 2R82A 3R89A 3AXXA 1K4GA 3IK4A 3R25A 5F2MA 2VUYA 4NXSA 2X8RA 4JR5A 4KIEA 3LGEA 1M1BA 4IFKA 3MT1A 3DX5A 1H41A 4Q4PA 4AVOA 4B5TA 4LBUA 3BOXA 3S1XA 3DU0A 1TPUA 3KX6A 4P8WA 1UG6A 2CYGA 1HP4A 5AECA 4BZYA 4JTLA 3WEMA 3UCCA 2VWSA 2WJEA 1TPDA 2QPSA 3LHWA 5I0DA 4JHMA 3LZ5A 3QGKC 5DF0A 3QQ1A 1NQKA 2FIQA 2PAJA 3FVMA 4L6OA 4HK6A 4IIGA 5I00A 4PRRA 2OOFA 3QQ0A 1EHNA 2AL2B 5D09A 5G1YA 1TVLA 3WEZA 5AYXA 2RDXA 2DT3A 3QH2A 3WQFA 3SUSA 4TMCA 2GUYA 2XH2A 1SSDA 4GCXA 1GEQA 1R7AA 3EWWA 1KM3A 3AISA 5AC4A 1W1TA 1PUDA 2H9AA 3HGOA 1F2JA 5F2GA 4EPEC 1PZ1A 1ODUA 4LAZA 1C29A 4NU7A 3CK5A 3B8SA 1HGYA 2HS6A 1N8FA 3CC1A 4IJCA 1TMQA 2WMHA 4FAMA 5A69A 1CLXA 4CQ9A 4M7SA 3E5PA 4Z08A 5C9ZA 4US5A 4CGTA 3BZJA 5GQBA 1PWMA 1KRBC 1K3UA 1PS9A 2XSBA 4GC4A 5JVLA 5FL1A 3OIHA 2J9YA 3GYCA 1DE5A 4ZFMA 2G8ZA 1KLZA 3KCJA 3S5YA 8XIAA 4PFHA 1E6NA 1EX1A 1CGVA 4EXAA 3WJZA 3G1XA 1GOIA 3K8KA 4P61A 1OYBA 3TTQA 2VDGA 3LHTA 4E6MA 3F5KA 3QLDA 4JN7A 1XFCA 4HCHA 1GOXA 1IEWA 4Z2JA 4UTJA 4DUXA 4LRTA 1K9DA 1YTDA 3IIPA 1KTCA 4H8NA 3V7PA 2XVNA 5CZSA 4GKTA 3A5VA 3HG2A 3MO7A 4GIYA 3HPSA 3NXLA 1TV3A 2HNEA 2JGYA 2CZFA 3OVPA 4DEFA 3ABXA 1KXHA 1M9HA 1NWUA 2HROA 4LNYA 2V30A 2XIBA 4PUEA 3CBWA 4JTIA 4JGDA 5HDRA 4IMFA 2FB3A 1KV8A 3G24A 2AQOA 2TODA 3ITCA 3KFTA 3A24A 4CD8A 3L0GA 4DY1A 2EG6A 1CXIA 3ONCA 4H7CA 4H01A 5AYBA 7PTDA 1M03A 1ZLPA 3R6IA 2ZTKA 3L68A 5IFTA 4MJ4A 2J24A 1UD5A 2Z00A 2J7HA 4MPKA 5FF2A 1BRLB 4Z1BA 1TR9A 2PTZA 4JKKA 2X42A 1C8QA 3NO3A 3CLMA 1GYNA 3N6QA 4QJ5B 4ERAA 2GJNA 2QCNA 1OD0A 1DWJM 1OD8A 1N2VA 3QZEA 5KSWA 3GVGA 4P8XA 4U31A 3L2IA 4KCTA 5L9FA 2PBGA 3DZ1A 2FFIA 2PDLA 4IX0A 3NL3A 1XFBA 1OQFA 1ZGDA 5JH1A 2I5GA 1IR2A 3BLFA 6XIMA 5EMUA 3H6OA 5A6SA 1RY8A 3I65A 2BVDA 3G1DA 1GOOA 3BICA 3NQDA 4JXCA 2WV8A 3P7YA 3B0YA 2WHLA 5IM51 4GY7A 3OZMA 4LUIA 4H83A 1OINA 5TQLA 1PO9A 2XWEA 1MNSA 4G7EB 2BOFX 2PEVA 3AS0A 4N4QA 2J75A 1TPFA 4FNTA 2YDAA 2Q6ZA 1CXEA 4LY8A 3QSTA 4RV3A 1MW2A 4QCFA 3EBVA 1A47A 3CAVA 3URQA 1GQNA 3FA4A 4QRNA 2A3BA 4CD6A 4AG0A 4RV8A 4KFPA 4CKQA 3QR1A 3WQWA 4R34A 2A6LA 3PG9A 3RNDA 2PA6A 4PC8A 4XZHA 1YTKA 4AXNA 1H1YA 1FCBA 2Y24A 2YB4A 4LX4A 4YXGA 2CWNA 2V82A 3VFCA 1UH4A 2CITA 1X6NA 1TTPA 4S38A 3LN3A 3TLQA 3ANUA 3GVVA 4XZWA 4Y9MA 1XWYA 4I7UA 2E09A 3NOYA 2E6AA 1MEWA 3EWCA 4C6OA 2YCKX 1P5BA 1NTHA 1Q6DA 2XIOA 2OWCA 3DECA 4MFDA 4DWSD 4E0CA 5G4EA 3L0KA 4PCNA 2PURA 4HNUA 2VZOA 2OT1A 4C7GA 2NZLA 2ZTJA 1YXDA 2JKAA 4I9TA 4AD3A 1VPXA 4ZBCA 1HKKA 1FH9A 4KWVA 4FALA 4PODA 3HPXA 1EFZA 3NTYA 4IGHA 5BOEA 3USZA 4LUJA 4ATDA 4MG4A 3OVGA 1W54A 3P74A 1LM1A 3UFYA 2GVEA 3WENA 3E9AA 3BMWA 4YMZA 2C1HA 4JYDA 3M5XA 5A3HA 1WOAA 5DQPA 3PZGA 3LMZA 4MWAA 1AQMA 1RBAA 3KZPA 3NQ2A 5TAOA 3BG3A 4WOQA 1UR8A 1TV8A 2EPOA 3FIGA 1A0EA 3UQNA 1DIEA 2XM1A 2P50A 3P93A 3P8JA 1Q2RA 3MI6A 4JPGA 3UWZA 1E0XA 2VX4A 3GLCA 4NRSA 4O1BA 1ONRA 2CC0A 1WUEA 1NWRA 1Q8AA 3CHEA 3WL0A 1DTUA 4I6VA 4K38A 4AYSA 4H41A 4DM2A 2V5KA 2XG9A 3MS8A 2Z1SA 5GJMA 1E9IA 1QNVA 1K9FA 5EMKA 2RGMA 2AQVA 1Q4NX 1DJIA 4Z2LA 2BP1A 1PYMA 2R94A 6A3HA 3M0JA 4FXJA 2DT0A 4O1EA 1UKQA 4GYKA 7CGTA 2J4GA 2XPKA 1VRDA 4YVXA 1M7PA 1FWBC 3LPFA 2V9DA 3UGRA 3PZOA 3GK0A 1LDCA 4JTGA 3ZQ9A 4O12A 4HA3A 3NDYA 2R24A 5LXEA 4MB1A 1XYBA 2F6UA 4HCDA 1W3HA 1XIEA 3M0ZA 1XSKA 4E5TA 4XZLX 4JTAA 4JS3A 1V3LA 1ZBVA 4M5PA 5K3VA 1H0IA 2WZHA 2B7PA 4XVDA 1HP5A 3DN5A 4KW2A 3ZFHA 2FGBA 3APTA 4I7VA 4RNJA 5GVJA 3KOFA 4IIFA 4JBRA 5KZMA 3TN5A 1PPIA 1CZ1A 1U1UA 2WC4A 3TYUA 4W7WA 3N17A 4B90A 1M7XA 3SEPA 3RILA 4Y7EA 1CGTA 5HJYA 4YTSA 4GI9A 3ZT6A 5C0QA 3ZIZA 1TREA 1CDGA 5ABHA 1E6SM 3ABSA 3M5VA 3GXMA 1RJPA 3B4UA 3RF9A 3ZVHB 3KAOA 1A49A 2TAAA 3R8HA 4P8UA 3O16A 3SN0A 4N0RA 3AALA 1LRTA 3VVGA 1BWKA 1AVAA 1J9YA 3D3FA 4JICA 3V18A 2PWUA 1Q2SA 3UPMA 3W29A 4TOQA 3RO6A 2A85A 4MIMA 4RLIA 3E02A 2FPVA 3U5YA 2WM1A 3QPZA 2PCEA 1VBJA 2A2IA 3BW2A 2J6VA 4B4FA 4X3ZA 1THFD 5I3IA 3DFOA 1CGYA 2WMFA 3G6LA 3LCGA 4FXFA 2UY4A 1O60A 1UQYA 1UD8A 3TSDA 4K2SA 2DZBA 4S3DA 2VOMA 3NZGA 5CSYA 4GY1A 1BXCA 2F2HA 5GJPA 1PCKA 2LLEA 1WDWA 3A9BA 1MRAA 5CC6A 4XV0A 2ZX7A 2R1PA 4V28A 5REQB 3CUIA 3TIMA 5JQ9A 4LYRA 1YLVA 4HNOA 1JF6A 1QXLA 8TIMA 1TE6A 3L2LA 3NQMA 1FOBA 4H00A 3TP4A 1AW2A 2PSNA 1G67A 3NUKA 1XGZA 1OG0A 1IHIA 1QR7A 3VKJA 4QM1A 1E6PA 1OFEA 3VIJA 1T96A 4HOZA 1RCXB 1UB3A 3I7QA 3A9IA 4H8HA 2V2CA 4F2BA 4WSJA 2OLHA 4PBFA 4JTHA 3NZ1A 2H9AB 4ECLA 1WP6A 3K4AA 1HG3A 2DZUA 4V1YA 4XIAA 3HURA 1B4KA 1GJWA 1ME7A 3VPLA 2E5BA 1SU5A 3AI0A 3T0DA 1SFJA 2WLZA 1TZ7A 1O66A 1S5VA 3LLXA 1PIFA 3E0VA 1IIHA 4GJIA 1JPKA 4GQBA 1DP0A 2XFFA 4E8GA 3UWQA 5HWJA 1MW1A 4R9OA 1RCQA 2E68A 1Q4WA 2Y63A 1Y65A 4OU1A 1SR9A 3PJXA 1TX0A 1GK8A 2IXUA 3PY2A 2QLYA 4NNAA 4X60A 5E0FA 3K4DA 4HN8A 3GU9A 3AXIA 3DENA 5EFDA 3VCNA 3MSYA 3BAJA 1EDTA 1CXLA 1FWFC 5LNSA 2ZC1A 1HJUA 5IDIA 3GXPA 4RW5A 3RFAA 2A3AA 3NQFA 3HGRA 2WCAA 1E3ZA 2R9RA 1EL3A 3KTXA 4Q7NA 1W56A 1A5SA 4RNFA 2D73A 1K77A 4GYPC 1E9LA 1XKYA 3RLUA 4TVCA 3KTCA 2Z7KA 1FHVA 4Q4QA 3WELA 4YCOA 4RZ6A 2OOGA 1YX1A 1EUAA 4R27A 2ZZ4A 4W8BA 5TF0A 1DJNA 2J66A 5HMSA 3ZR6A 1QOPA 1TJ1A 3TJ4A 5I02A 4IQJA 3U2ZA 1W5NA 4RNHA 2ZA3A 4CNNA 1VLWA 2V5CA 1KCXA 2BX7A 1OSEA 3MHUA 5HANA 1VBUA 1ALDA 1GYLA 4RNIA 3EOEA 4V33A 3GDKA 4JHZA 4NZCA 4AISA 4UTIA 5H2ZA 1CB7B 4H9TA 4BI5A 3SO7A 4DBSA 3QVQA 4ZGYA 3CB8A 3CEUA 5BRBA 3PTQA 4MNLA 1DORA 3SUVA 1EJWC 2V5JA 2YCEA 4DBEA 3DBPA 1NIUA 2EPKX 3UYCA 1GW1A 4AVFA 4J27A 3WFLA 1QT1A 4KMQA 2NV1A 1CENA 2ZX5A 1XPYA 2E6FA 1WXJA 2RJGA 3P8IA 2WHKA 2X1RA 5D2YA 4O0ZA 2IMRA 4UOZA 2E9LA 3W27A 4XAYA 3SRKA 2WVTA 1PKMA 5EYWA 4RX0A 6REQB 1TFVA 3QXBA 1KBIA 2O7QA 3H21A 1DJXA 4GCAA 4PB4A 1C8XA 3ES8A 4AC1X 5BXRA 1XF0A 3KBVA 3WF3A 1WKFA 3VINA 3WUGA 1V08A 3QV9A 1UMYA 1TMLA 1GHRA 2DU2A 3VX1A 1CPUA 3SCRA 1GZJA 4MSSA 3CH9A 3DC0A 1K8CA 3GHTA 1ZBKA 2QCDA 3UETA 1WOBA 3WN6A 3UNTA 3TE9A 4DYJA 3DXIA 1M53A 2DFAA 1W91A 3AHZA 3NOEA 5HNRA 1KTNA 1V6TA 2PGWA 3WH5A 1FTXA 2WWCA 1MQRA 4HSOA 2G4JA 2A79A 4FX8A 4UBPC 1JCJA 4XUGA 4NJHA 1W5MA 2VD9A 4Z1AA 3S1VA 1ZBCA 2BDQA 3M44A 4BA0A 4MZ1A 3MYOA 4RZBA 1EGMA 2Z1WA 4CD5A 3CASA 3TOYA 2C18A 4GX8A 1E1FA 1H2JA 3DFPA 4OV9A 2I56A 3MCMA 3T81A 2ZWZA 4GMEA 2GDQA 4BCEA 5L6UA 2AMGA 3WD2A 2BGQA 2AMXA 3L4VA 4FXRA 1R8LA 3W72A 3POCA 1TUXA 3IIOA 4H4IA 1WDPA 1I2NA 3MUIA 1OFOA 4JEQA 4GI8A 1TWSA 4GI6A 1GG1A 1HO1A 4MYAA 1UR0A 1DXIA 2H8XA 1KQZA 1GJUA 4FNSA 3HQNA 1ZJHA 2HV5A 4YU1A 1DTNA 1UD2A 4Q4RA 1VFSA 3BC9A 3GXFA 3BV4A 1I2RA 1NDVA 3BCJA 3W70A 1RBOB 1YDYA 4DQWA 4L9XA 5HINA 4IWWA 2VQUA 1S2CA 2UY5A 3T4WA 3VM7A 4LJ3A 4GPNA 3V5CA 3M07A 1EEXA 1QI4A 3RGTA 5CJ5A 4C6PA 3GNNA 3WD1A 3SY1A 3L12A 4QQUA 3MUCA 5LIUX 3E3HA 4RL3A 1TJPA 4GA8A 1Z9AA 3EDDA 1T8XA 4KEUA 4PMJA 3CTLA 4Q6JA 3PSVA 1XLAA 2ACRA 3G1RA 4L1WA 5RUBA 4EXBA 1VCVA 4ZQOA 4EX4A 3FKRA 4OBSA 4GXWA 1EC7A 4DX3A 1XR2A 1GORA 2X0HA 2D24A 3IGUA 1Q45A 2YLAA 2PBOA 2PTDA 4IX2A 1JI1A 2BY2A 3KWXA 5M1TA 5D37A 1Z7AA 5EMLA 2GQ9A 5LKYA 5CJMA 5B80A 1Z42A 2FB2A 4MNMA 4S3FA 4JN6A 4XAGA 2GZXA 3GG8A 2CXEA 3R8GA 3TK7A 4F0HA 1H7NA 4JZ5A 2WWDA 5HXMA 2XVPA 3VNDA 3CWHA 4GUFA 3VZZA 1A5OC 5HR7A 4Q4SA 1Q13A 1JGMA 4PSPA 4A29A 1G7UA 2YZRA 4HHMA 3W38A 5B7YA 3O0FA 4LYQA 2AGTA 1QWKA 2XHYA 3QV8A 4O18A 3VGEA 4DM1A 1YQ2A 5CG7A 4NAEB 2D2OA 3DC8A 1NH6A 3GRIA 2JQXA 1QI0A 4BI6A 4NJJA 3LTSA 1XISA 3HM7A 1TZ9A 3BTNA 3R0DA 1PJ9A 1Q7MA 3O05A 5U7SA 1IXNA 3CWOX 4QAWA 3HMJG 4PMRA 4TUFA 3UBPC 4QX4A 4QROA 2HZGA 3UERA 4CCZA 1NFGA 1Q85A 3WNOA 5LHEA 2HBXA 3DGRA 4CQAA 1Q63A 3LZ3A 2PTWA 1KA9F 3K46A 2VCCA 2OKOA 4UMBA 3UCDA 2OSYA 1RD6A 2BV9A 1GTEA 1JNEA 2VDIA 3EXSA 3GFZA 1KM2A 1X8CA 2VC7A 2YW4A 1XYLA 4BQ2A 1J12A 1LG1A 2RUSA 3OA3A 3DHPA 4LAKA 4PB5A 3E2QA 3VD4A 4AD2A 1O12A 4CN4A 1O5KA 4DIAA 1ZAHA 4XVEA 2W5FA 3KL5A 4MUPA 2GGGA 1DHKA 1WDSA 3W7KA 2XSXA 4LOCA 1HKIA 1NF0A 1PX8A 3GZ3A 3ZLGA 3TFCA 4ZE5A 2FVKA 1ITXA 2XH0A 2VUNA 4CN6A 3B8IA 3N2CA 2VFGA 1LZOA 2WPBA 1XSIA 2OR2A 3GDRA 5HMDA 1NEYA 3SI9A 5XIMA 4JOMA 1XIDA 3G0XA 1J11A 4GVHA 4LH8A 3MUZ1 2I57A 3UPWA 1WB0A 3W7RA 3UESA 8RUCA 3DG3A 4DI9A 4LC6A 3EOLA 4W84A 1SO3A 4QP0A 5BWAA 1E4IA 2PC4A 5DXYA 4PRWA 4A35A 1TPH1 1OIFA 4HVXA 1NOUA 1S38A 3RITA 4Z0JA 1OFPA 2Y62A 4PB3A 2JF6A 1UZDA 4NUWA 2PP1A 1EXBA 1MFUA 3R0UA 3VOJA 4O11A 5IBXC 3FLUA 4HB7A 3N4FA 4CNSA 4F9JA 5AHFA 5D30A 4UWMA 3UR5A 3NQ7A 3TC7A 2ZX9A 3D0CA 1P1MA 2NUYA 3MANA 2UY3A 4MJMA 3BLLA 3BLOA 4TVDA 1WKEA 3W7JA 1VYRA 4BF9A 4KF1A 1TVPA 3Q94A 2YCLB 1SFTA 4W7VA 5IHRA 2NXGA 3PK7A 1UKSA 2CXGA 3C8FA 4ZOEA 3TC3A 3W1UA 3N2MA 3ZMRA 2WKGA 3BQ5A 5IHSA 1Q6GA 4UTWA 3AQUA 1Q65A 1EQPA 3QHMA 3FVDA 2C71A 1ZU8A 3AXKA 3UWWA 4LUSB 1SJCA 1HO4A 4N4PA 3MBDA 1C8YA 1EIXA 1OJXA 3BAWA 4S3CA 1SPQA 3VNJA 5MHBA 3BAIA 1XH2A 4CNTA 1TV7A 1V7YA 3R5EA 2IQTA 4HNLA 4MKVA 2GQ8A 3PZVA 5A6AA 4I5UA 4MZYA 4JTEA 3NSNA 3ABQA 2PWDA 1PX4A 2V3DA 3OHIA 2V67A 1Y5XA 2JGQA 2QJNA 2AKZA 4GZEA 4MOZA 3UZ5A 1XLKA 4LGXA 4QDWA 3WBWA 2G4FA 2TPSA 4NZJA 3BH4A 2ALDA 2PD9A 1QNQA 3T78A 3M64A 4W8LA 5BRQA 3UR2A 1I1XA 4LUSA 3TYAA 2JF7A 2O56A 3CYVA 2GSHA 1TV5A 4TO8A 4UQAA 2OODA 3E5BA 3VIHA 1QHPA 3VNKA 5HMFA 1BGGA 2W0UA 4JTRA 1VYSX 3QY6A 3FW6A 2HVNA 2D22A 2YBTA 3OVRA 1A5AA 3T1GA 4CU8A 3B9NA 1BYAA 1IEVA 5HQEA 3PFMA 2VFIA 1KFLA 3W7QA 1TJ2A 1AA1B 2WANA 2X1IA 4FI4A 3H7RA 3SCSA 1GQIA 1PIIA 4OOZA 3FDKA 1XIHA 1J18A 3SCTA 3TSMA 1LRNA 4C6QA 3AUOA 3NDZA 3SSZA 3AAMA 3F4WA 5K2ZA 3LXAA 4U3CA 4JIPA 5JUVA 1VPQA 3W23A 3H2MA 3STGA 2FYMA 1BG9A 1EYEA 3EDEA 4QG6A 4NYUA 1E3XA 3PWAA 2QJGA 5FL0A 6ALDA 1W3NA 1XRFA 1KM0A 4GXPA 1QOXA 3DFHA 1ZJAA 4IIEA 1LTDA 1I75A 1C8VA 1E6XM 3CT7A 3VNLA 5CLWA 4WKHA 1BQCA 4NX0A 3MSDA 2Q02A 4M0XA 1VIZA 3S42A 2I9EA 4KERA 2QUUA 3BW3A 1FDZA 1J01A 1GVQA 4XUYA 1KXTA 2YJQA 3FAWA 3P81A 4DXKA 1OADA 3VGFA 2VFHA 4NIRA 4N02A 2W79A 3LD5A 3M0XA 5CZTA 1XX1A 1RA0A 4JTUA 4AC7C 2HVOA 1KD0A 3BWWA 2DQXA 2PDQA 3WQGA 3PTDA 4Z2HA 3KZSA 4IPJA 2CETA 4MYXA 4K8EA 3UXAA 4ZQMA 1F4HA 1YADA 3GU2A 1US0A 2WBGA 1AMKA 4GQQA 1IT0A 4XKMA 3S9IA 5KEZA 2RHGA 1AZ2A 2R6OA 3MDWA 3AIEA 1A5UA 3CZGA 3TTOA 3QQWA 4D6IA 3P60A 2HMCA 3EAUA 2PDGA 3MUAA 5AVNA 3S5SA 2E5CA 2WJZA 2Z28A 1K9EA 3RR4A 4M19A 3MWCA 4QEHA 4RJEA 4TMBA 3QYQA 1M01A 3B06A 3T8LA 4ES4A 4GBUA 3N1AA 3WH9A 5E0CA 2F6KA 2L5HA 5M03A 3WQ5A 3UWVA 2CW6A 3M47A 1JPIA 3W1XA 1UUQA 2PP0A 3EMZA 2V38A 3WF0A 3VD7A 1HQTA 3AS1A 1R3VA 4GHRA 3UA4A 3C61A 3EKLA 1TSIA 1ZHAA 3MHFA 3L0NA 5G2IA 4UTHA 1L8NA 5DCBA 4NJKA 5FJRA 4MNJA 2ATMA 1XLGA 1VF8A 2NQLA 1LT7A 5IFPA 1UIOA 4HSNA 3BXWA 1UYQA 3LS9A 3T0CA 1XD0A 2CCRA 3TEVA 4BF7A 3OLEA 1GZ1A 1MO0A 2PDJA 5LGZA 1KGWA 4GJ1A 2A7NA 4ZE4A 1S5NA 1J0YA 4AMAA 3LNPA 7ODCA 3M9YA 3C2RA 4R9XA 1V02A 3P2VA 4UFHA 3ARXA 1OVDA 3KLLA 1A53A 2QCDB 5HWNA 3KP0A 3L4YA 1TYGA 1V6WA 1CYGA 3JS3A 2ZZ5A 4XSMA 2Q71A 2BTMA 2A7RA 3AU2A 4IIHA 4CVUA 3S83A 4ZXLA 3W76A 3CNYA 4RDYA 3RJXA 1RJQA 3ARPA 3VUSA 3EWBX 1VRXA 4J1OA 1GKRA 2W92A 3O6YX 2HSAA 4M81A 5M3WA 2RH9A 1OYAA 4U2YA 3GUWA 4PTWA 3E2SA 3R58A 1UWTA 3CO4A 3EEZA 4GVGA 4DUOA 3EA2A 3ZYZA 1GKPA 3CJPA 4DVOA 3W7LA 4HA4A 3W6MA 4JYFA 3W1TA 3RX2A 3C2OA 5I3HA 9XIAA 2DVUA 1XUUA 4LS1A 3BPWA 4O4VA 5AC5A 4JQ2A 1K7FA 4REQA 1D7KA 2Y1HA 2E77A 3GTHA 4QTGA 2FDSA 1JG9A 1UWRA 2C8NA 4RDWA 1PX3A 4IZGA 4EOUA 4NG3A 4KGJA 4O8RA 2ALRA 1Q66A 4NX5A 4RE4A 5AHMA 1N55A 1TPWA 2ZRUA 5AKQA 1FHUA 4AWTA 1GG0A 3G1HA 4MM1A 3QFEA 2QW5A 5HUOA 1PHWA 2FJKA 1GPFA 2QCEA 4K39A 1DQXA 4GYJA 3CZEA 3WD0A 1V79A 1SGJA 5U4NA 2ZZ6A 1ONWA 3P0WA 3WNKA 2ABAA 4EE9A 3PULA 3NCOA 5D2TA 3KRUA 2YA1A 1HKMA 3EDFA 4CQCA 4B5UA 4R33A 2XM2A 4IFOA 1YBQA 1KCKA 4W85A 4F0SA 3S1UA 3FK4A 3QY7A 1X7FA 3LV6A 1OGSA 1VBRA 3TLLA 4E3VA 1G69A 3BOLA 3DH7A 3RM9A 4UFJA 2PWGA 2HJPA 5I03A 4WIWA 3VDAA 3CZKA 1YE4A 3VKAA 2AGKA 4H6RA 5AB3A 2GDVA 1J8VA 4B16A 4UOJA 4W9TA 1TV2A 4U5KA 4Z2KA 3TUUA 1NY1A 3ZJ6A 1S39A 4D8ZA 2RJHA 3O6AA 2AQWA 2Y8KA 2Z25A 2XIJA 3KRSA 1I0BA 3AC0A 7REQB 4NJIA 3GB6A 5F1UA 4RK8A 1CXHA 3N9SA 1EJRC 4CLMA 4GH1A 1O1ZA 1FWIC 1UJQA 4KIRA 1PXGA 2QJHA 3WUFA 3GDMA 2VZSA 2VX6A 5IXEA 2BG5A 4GO8A 4Q6XA 4IM4A 1UOZA 3THCA 2NXIA 1OC5A 3S6TA 1FCQA 4PTVA 2ZUSA 3AZSA 4TX6A 5D33A 3B9DA 3WDJA 4UC5A 1JYXA 2VJXA 4HZMA 1EJTC 3UVIA 4J3XA 4FK9A 2DH3A 4L1XA 1SZGA 1Q3NA 3MKVA 3OZOA 3P82A 4J3SA 3RRXA 3VOHA 3UWEA 3PWIA 3RHGA 5FESA 1EGVA 3EOOA 4DUVA 1PKNA 1R3RA 5AOUA 1OF6A 3VXGA 2VDHA 2XWDA 4K1GA 1HT6A 4R5EA 1E4LA 3MCNA 1W3LA 1XIGA 1XC6A 4A3HA 2VGGA 4L1GA 2DORA 1GVOA 3VMNA 1IXPA 1XLDA 1AJ2A 1UH2A 1PSCA 1T8QA 4DF2A 1WCGA 5CAKA 4RDZA 4HNTA 4DBUA 3SUUA 3N19B 3NPXA 3VX0A 4DO4A 1H7WA 3LCLA 4MLRA 2XISA 4JCLA 2D2JA 1V6VA 4HHHA 4IG2B 5FJIA 3KVLA 4N9CA 2ZZ2A 3U6WA 1LLWA 3IK2A 1K4HA 1IT7A 4Z17A 1SUXA 1PTDA 2Y2WA 3G18A 5T9BG 3M7WA 1EX5A 2WZIA 3SCPA 5LA0A 2CZ5A 2VEIA 3AFBA 1OFAA 3NL6A 1OB0A 3BGAA 3AS3A 4FX6M 1RQHA 2CHRA 3MUY1 1KQYA 2FTYA 3MSRA 3UNDA 5DEZA 1XDJA 1XYMA 5A6KA 4ZOBA 5C54A 3BJFA 1V02E 2YL6A 1AD4A 5FKYA 2R1LA 1LUCB 2VC9A 3HIJA 3FY1A 2X1UA 4LEQA 3GUGA 1PTGA 1QNRA 4L4LA 1H1NA 5H1WA 1B3VA 2BXYA 3B05A 1XSJA 3H4WA 3IV3A 3WLRA 3MMDA 3W74A 1AFSA 1CBGA 1RY0A 5FSEC 3TW7A 3OB8A 2XIMA 1UPMB 2FZBA 3DI0A 5CZJA 4FA3A 1RA5A 1IWPA 4PMYA 1FWDC 4GH3A 1W2VA 4XK2A 1E5JA 5KETA 2I7GA 3R1ZA 7XIMA 3W88A 2B31A 4ORIA 5I5RA 1QI5A 3SIMA 3FJNA 2ZE0A 1H51A 2GUUA 4AHPA 3ARSA 5HAOA 2XFYA 2J62A 2O9TA 2ZRYA 3NPUA 2CU0A 3WUBA 5BU6A 2HDJA 2VX5A 3GQYA 4L5ZA 1F3EA 4WJ8A 3AZTA 5JBDA 2W4XA 2VENA 1L6WA 4AZHA 1OX5A 2A6NA 3RU6A 2FZNA 4O0KA 2J27A 2P3EA 2DSVA 4UIOA 2YR1A 4R53A 2FZMA 1GW9A 2OWXA 4JX5A 3OGSA 5IBXA 2OT0A 4D8AA 1XIMA 4ADUA 2BY3A 4AWSA 4B5SA 1AL7A 3AICA 2NLIA 3CL8A 1KWKA 4K3ZA 1KWGA 4DO7A 4IGNA 3TXZA 5HULA 1EOKA 4O0QA 2VR2A 2VELA 1V0KA 1NWSA 2GK1B 2NQHA 4W5UA 3CUXA 2WSPA 4AB4A 4EK7A 1SO6A 2DT2A 4YPJA 3N9KA 4LCQA 4CCDA 2DJXA 1OYCA 5D03A 5DRCA 2QQ6A 4BWLC 3VOCA 3DKJA 5FEXA 4HA0A 2EJAA 1U22A 2NWSA 2YIHA 3L5LA 4Q8NA 5E93A 7A3HA 5CBJA 4DLFA 1POJA 4AVNA 4OJYA 3LHYA 4B2DD 2PDYA 3O6CA 2G95A 1KLYA 3S2CA 2VC6A 3R4IA 5C5YA 1NF7A 1G4EA 3C2YA 3DESA 3KHJA 2GSEA 1CB2A 3CQ0A 4XO6A 1DOSA 1F5ZA 2Y0FA 2HRWA 3E0LA 5LSMA 2XU2A 4IPIA 4DJED 1QUMA 4GG9A 3GZAA 3IARA 4NHVA 4E8DA 4PCTA 1E0WA 4KWSA 1HL2A 1SW0A 1BG4A 4HPHA 3RX3A 3AYRA 2ODOA 1H4PA 3MTWA 2ZDRA 3PPGA 5AC7A 5A2CA 1E51A 3T6CA 2R1NA 1ZL1A 4L6DA 2P8BA 1FFQA 2VGBA 1EBGA 3AMGA 5K9DA 5J8LA 3T2OA 3S46A 5I79A 4Z42C 5DELA 1OC7A 4HPJA 3SY5A 1R7OA 2YPIA 3NM3A 4KT2A 2V69A 1ICQA 2TMDA 3FXGA 1Z48A 3A4JA 4XZIA 2Z1XA 4FIRA 1GZGA 2RGLA 4IGSA 1RK5A 5AC8A 5GNYA 1QW7A 1W17A 3WLSA 4HIBA 1E73M 3OHMB 2ZVIA 1XLMA 3B9EA 1JZ3A 2VGFA 1W3KA 1BQGA 4QG8A 2PS2A 2GOUA 2OQLA 3C2FA 3VDGA 4HYWA 3NQ8A 4JTSA 1GTHA 2HNHA 4HN4A 1WKDA 2PI6A 5BMWA 4DNMA 2FFCA 2BHUA 1AH4A 1SZFA 3P84A 1QCWA 4R85A 1LQ0A 2WM0A 4P7QA 3WJXA 4P7LA 1M7JA 4CU6A 4OUIA 3UG4A 4F2TA 4IICA 3VM5A 1ZUAX 2YXOA 1HL9A 4I9AA 3GX9A 3USBA 2E67A 2DP3A 2Y4SA 1LG2A 3VIMA 4NXKA 5HQLA 4CU7A 1EBHA 4PEKA 1JUEA 3KHDA 3RX4A 3MCOA 1XIBA 1QBAA 1OY0A 3M46A 4ZQCA 4DWSC 1B31A 2HPMA 5AHLA 1MDLA 4LC8A 1V8EA 2FVLA 3GNOA 1YTEA 3CU2A 3OBEA 3EZ4A 4QAIA 3WBEA 1RP9A 4FF7A 4HGXA 1NAL1 3EX3A 3CIXA 3IV8A 4FNPA 4KH2A 1P7TB 4B4HA 4ZSUA 1PL9A 3H70A 1J5TA 1V03A 2AKMA 4L61A 4MVAA 4LVAA 4ZSTA 3N2BA 5XINA 3PUDA 1MW0A 1AH0A 3LRMA 1S2WA 5AYZA 5D2WA 1KFJA 4ATLA 3DKLA 4XSLA 4ICCX 2GGIA 5CBIA 3BGGA 1S1PA 1JUBA 1ZJIA 3IEBA 1UW9A 3H4GA 5D4YA 2A3HA 3SAZA 4NILA 4V2XA 4O16A 4ZZ9A 3AMLA 4IXXA 2XSAA 1TWZA 2DQWA 3V5FA 3TN4A 1QPQA 5A8OA 4Q7BA 1OX4A 2XINA 2FHFA 3GBDA 3E49A 2CHOA 4Q8VA 1DL3A 3U7BA 3BOFA 5TNVA 2CZDA 1CIUA 2NV2A 2D0FA 1T6MA 5HPOA 3AWNA 1JZ2A 1JQXA 1ISZA 1H60A 5C71A 5CXPA 4UFLA 4DZAA 2PLMA 2V63A 1KB3A 4HU3A 3LG3A 5HMEA 1A0DA 2JE8A 1F73A 3E0WA 2QXWA 1KO0A 3PR2A 3B40A 2PP3A 2RDTA 4HTYA 3OBAA 1B3OA 4BQ4A 2WSRA 1U1HA 3UXLA 3WQ8A 4DYEA 2J78A 1IEQA 3F4DA 1I8JA 1QPNA 2G97A 2WBKA 1RCOB 2C16A 5BRPA 4FSAA 3WMSA 1X97A 2CLPA 2I17A 3CUFA 5LIYX 3GIQA 1LBMA 4FR6A 3ATZA 2QDEA 4LCRA 2X05A 4AD4A 3TROA 1BSLA 3DDMA 4J9JA 4M6UA 4LW7A 4WGHA 2QCLA 5LYRA 2A4AA 3OGRA 1OABA 3H53A 1L6YA 8CGTA 5M17A 3GC2A 3O7UA 3PUOA 4ROPA 5LGXA 3TSBA 4GX9A 2CHNA 4GWEA 1UZ4A 1XG4A 1WPCA 1UR9A 1QNPA 1PBGA 3N25A 1BYBA 1KRMA 4NYYA 4NAEA 3WF4A 1TPVA 3AIUA 3BDKA 3TJXA 4D1IA 2RDUA 2DIEA 5E6ZA 1J96A 2PTYA 4QE1A 4UQDA 4A8NA 2O7SA 4GUHA 4BR1A 3LPPA 2J7EA 1FUYA 2W27A 4HHLA 4AXKA 2V2DA 3KL3A 2OXNA 9XIMA 5EU9A 4CNOA 3L67A 1EZWA 4HA1A 4RZ5A 1OCQA 4N7QA 3FN9A 3DERA 1AODA 2GWNA 3G1SA 3RIKA 1NP2A 1OT1A 4EXQA 2YL9A 1BYCA 4WDXA 3QHNA 1XDLA 1K1DA 4DO5A 4YTRA 3LPOA 1W9VA 4U4MA 4Y8EA 3ITTA 4JIIX 4L6HA 1R9XA 3AHVA 3IS4A 1A3HA 2QUTA 4JTQA 2A1YA 2XIQA 2J77A 3LI1A 4LEFA 1TO3A 1D3CA 1B9ZA 4LV4A 4V15A 1FH8A 2QR6A 4CEXC 4FO4A 1Q6CA 2IQ0A 3K1DA 4Q8QA 4IUGA 1SMAA 3CS2A 2PMQA 1KM1A 4UTUA 1CW2A 1WZMA 2OYLA 4ONVA 3U0HA 1HJVA 1JR1A 3GHRA 3RLGA 1UROA 1SW7A 3RN6A 2BVTA 2I14A 3LBMA 2ZADA 3SBFA 3TU9A 1JVNA 2HISA 5I6SA 3PBMA 5T91A 2Z1BA 3ITXA 3PSWA 2BY0A 4Q3MA 3RDKA 4AZCA 2QEZA 4I6KA 3ATYA 4ATWA 1ITUA 1GVSA 5FJOA 3VNYA 4D6GA 1ENUA 2EPMX 5A6BA 4AHQA 4YIWA 3E12A 3EXRA 1VQTA 3FXYA 1TV4A 2DJLA 3H7UA 1D8CA 2FKPA 3SR7A 1M04A 4NAFB 4E8CA 3NQCA 2X16A 1YKWA 2WMJA 1Q7ZA 1JCYA 2YLLA 1AJZA 3JUGA 3WCZA 1YXCA 3A47A 4KPLA 2VL4A 1NDWA 1D3GA 2E25A 5C9RA 3CMGA 1QPOA 4JN8A 2ISFA 4GD0A 4DJFC 1IZKA 2ZZ3A 3EWDA 5HA7A 2B7QA 4NNBA 3MY9A 1TVNA 5JIPA 1US2A 1M65A 2QGHA 3ZR5A 4IP5A 2Q01A 3JR2A 1ZP3A 3MP5A 2XN0A 1WBHA 2P0IA 3MPGA 3V0SA 4A3YA 1D8WA 3GY1A 2QUMA 4DZHA 4Z1CA 1X39A 2WAGA 3VMPA 4NSBA 1NARA 1R2RA 4KS0A 1V0LA 2ZOXA 3ARWA 2VT0A 3GKFA 3K4WA 2NT0A 3UJEA 5C7VA 1ZSXA 4TX9A 2JBMA 2HPIA 3R12A 5JIWA 1K8YA 4IMAA 4GUJA 3FHAA 3W6LA 5D9NA 2E9MA 1GVFA 1TTIA 1AW1A 1S2AA 3LHUA 2X2YA 3TJLA 3R2GA 4LVBA 1PWLA 1BFNA 4UR8A 5CZ0A 3K8LA 5DT5A 2VEFA 4AZ5A 4DJDA 1ICPA 2UY2A 4AZBA 4YN5A 2VI0A 4GI4A 4QE4A 2IKGA 3IJQA 1Z41A 1GGOA 1DE6A 5KZ6A 1A5NC 1HVQA 1EXPA 2ZRZA 2NQ9A 1M5WA 4H6EA 3GH7A 4IHCA 3QLLA 3T2PA 3W1PA 1DHPA 1U5JA 4AZIA 4L65A 1RALA 4S3AA 3GYEA 2A3LA 3GNXA 3S9YA 3SECA 4W88A 1VFFA 1L2QA 4O1FA 2ACQA 1K7EA 3DHFA 3EA3A 2ZRXA 3CL7A 2Y5SA 3EB4A 2KZHA 1TMHA 2WJFA 4HYVA 3THUA 1W32A 3UWYA 1XM3A 2Y8UA 4FX7A 3K8MA 1MXGA 2DH2A 2AOSA 1O5XA 3CV7A 4AIBA 2Y85A 4KCVA 1SO5A 1TRDA 3N2OA 4QLKA 2VEGA 1PZ2A 2ASHA 3WDHA 2G37A 3KS5A 4AZGA 3A23A 1SQ7A 2XN1A 3T2QA 4HMNA 3W75A 4B2DA 4ZB0A 4WKAA 2Q8XA 4P5UA 2PDXA 4S3JA 1WV2A 3U3HA 1MQPA 5JMUA 3VMOA 3FGCB 1P6BA 3H23A 1OG6A 2QJJA 2ZUMA 1DQWA 1UBPC 4UTWC 4QJ1A 1GT8A 1D9EA 1OZQA 4FHAA 3DYOA 3EDKA 3W1LA 4TV5A 3G3MA 4DN1A 3QR3A 3F2CA 2PDMA 4J35A 1FCVA 2H3BA 2YA2A 3AHYA 5G4HC 3WBYA 3BLIA 4TR9A 1JNDA 3TDFA 1EH9A 4IMEA 3HGJA 8XIMA 2RAGA 1OM0A 4XZMX 1JRBA 3EPOA 4QDMA 2PRMA 4LBSA 3ES7A 3P61A 3W2NA 3Q67A 1SW3A 2X40A 4LS0A 3VKKA 1QW9A 2FDMA 5JU6A 1H63A 1TA3A 1US3A 4XD5A 1VEOA 4NY2A 5F2IA 2D0GA 1FWEC 4LCSA 1E0TA 1ZJBA 4BS0A 4J3TA 1RVGA 4NQ1A 2J7GA 1FY6A 1UCWA 4FLOA 4RKAA 1FWGC 3NSXA 2CLHA 4WDTA 1S5WA 4H19A 1O68A 3G3DA 1D7FA 4XAZA 2C1GA 3CL6A 3UZJA 3EB2A 3ONBA 1GQKA 4AX7A 2BGNE 1BD0A 5TD4A 3DOPA 2CEQA 1Z69A 8A3HA 3HJZA 1QNSA 5F4XA 2WW5A 3N11A 4E4FA 4TIMA 3MKCA 1J79A 1X98A 2VGIA 1KW1A 1J4EA 3PZMA 3U2OA 1IQ8A 3LSBA 1IIGA 2OCZA 3TMLA 3WMBA 4CVWA 4CQDA 2O4MA 1B3WA 4BWLA 4LUTB 1PZ0A 3NFUA 1YIXA 4BI7A 2P8CA 1QHOA 1C93A 4XWUA 1GOKA 5AFDA 1QASA 4WOZA 1XV8A 2D2GA 1GPWA 4HPGA 3WDPP 4N9DA 5DN1A 3A6OA 2QJIA 4ZOCA 3S5ZA 4UR9A 1IXQA 3B9OA 5K4XA 3W7DA 2YA0A 2JEQA 2XVLA 4A2SA 2XVKA 3W2LA 4KEVA 1RJRA 5E5CA 2O9RA 4AY8A 2E9BA 2BXVA 1EB3A 4PN2A 4G2DA 4QR6A 4Y90A 2FZ8A 2W67A 4F8XA 2OYKA 1AQFA 4UFMA 4AF0B 3WK0A 1HJWA 1XBZA 6TIMA 1JZ7A 3WYZA 3IAQA 3VIPA 2CNCA 3S6DA 3CAWA 1OWQA 4ALDA 4C1NB 2SFPA 4KGLA 1Q7QA 2J88A 4GZJA 1X7IA 3VOIA 4HNVA 3V0UA 2ESCA 3WD4A 1Z3NA 3TKFA 1XXXA 4WXZA 3UXIA 5HK4A 3L5AA 4M8UA 5I3KA 1C7TA 2XDFA 2R91A 4AFYA 1V3MA 1XLEA 1AQ0A 1A5KC 4LVGA 3CGTA 1L6SA 2EPLX 3ORWA 5AY7A 5I77A 3WF2A 4YNGA 3W0KA 3VIFA 3QPEA 2JEPA 2FHBA 7TAAA 2C79A 4GLEA 2YYUA 3WLIA 5GNXA 1C90A 3O0KA 3WLLA 3B3DA 1E43A 2Q8ZA 1JD9A 2UV8G 3ZO9A 6XIAA 1R9ZA 4BHYA 1W1VA 5GNZA 1WDRA 4LVFA 5F4SA 4B3ZA 3I3DA 1P6WA 2ZZ1A 4UMCA 3WO8A 5ECUA 3CPRA 4IGMA 4QBXA 5D32A 3S4TA 3LBOA 4ICMA 5ABFA 4Z1YA 5FAGA 5C7HA 4GXMA 2ZA2A 1RAKA 5TIMA 4HMDA 1ODZA 4MUZA 1DWGM 3T4CA 3PC0A 5ECVA 4JY9A 3NZPA 2WC3A 1FX6A 3ZJ8A 2BOEX 1ZB5A 3AYVA 4DPPA 5A8GA 1C9DA 5I06A 3MZ2A 4RXGA 1I45A 5D02A 1LF1A 3A21A 4R88A 3LY0A 3NVDA 4GY0A 1W37A 1GVYA 4AZ7A 2PFHA 1VHNA 2WSYA 3W6YA 3QW4B 1EKOA 4MAZA 1VD6A 3W7OA 3RMJA 3MBFA 3N29A 5A6TC 1ZQ5A 2YDRA 4CCCA 3AIWA 3BCDA 2HTMA 3QY8A 3RO8A 4BF5A 1N8IA 1GQJA 3FFSA 2ZUWA 4LPCA 4C6CA 2ZRWA 5C6MA 1FWRA 1SJAA 3WBAA 2ZUVA 3UR8A 2AAAA 3VU2A 4D6FA 3L4WA 2AL1A 3GS6A 1T5AA 3NQVA 3M43A 1MVYA 3KBNA 4XTDA 1ZFJA 1NFPA 2E6DA 4UR7A 1J10A 5CH9A 1YNQA 1JD7A 1QAPA 1BWLA 1XLJA 4WRHA 2PLKA 4PMNA 5JBEA 4ADTA 1FDYA 3LEPA 3W2JA 3NVTA 3P6LA 5BYWA 1BLIA 1SFLA 1ONEA 1UR2A 2DZAA 3OPSA 4GIAA 3LGDA 1W1B1 4GQGA 5DMLA 2H3DA 4Z2GA 1XHGA 4O14A 3E0FA 1DJHA 1DWFM 4ROQA 1YE6A 1FWTA 3M5YA 4ZCWA 3UVAA 3ARZA 3WK2A 3TCEA 3UZZA 2O9PA 3PM6A 3NEHA 1EWEA 4ACZB 1PDZA 4CD7A 2CLOA 1DJGA 3GXNA 3WH8A 2INFA 2VTFA 1J6OA 3KM8A 1TCMA 1UR4A 5ENLA 2QCFA 3VO0A 4PUKA 2ZXBA 5BXPA 4D6DA 2GYIA 4S2BA 3TYEA 3W84A 4LAOA 3WNNA 1HGWA 3W7CA 2VXNA 3AXHA 1V93A 1Y5WA 3UXDA 1EJUC 3PBGA 1A5CA 1H7PA 1V6YA 4J3WA 4W7UA 4PSRA 3UF9A 3C4UA 3YPIA 4HNNA 4PH6A 4MDPA 4K1WA 1QRQA 4B5VA 1PYFA 3EKGA 3LHZA 2VR4A 3DI1A 3AXMA 1TPC1 3RUBL 1Y0EA 3FDGA 3W1QA 4IMDA 2X7VA 3W2UA 1XH1A 1MW3A 4A4AA 4ERIA 2WCGA 3LA4A 2ZE3A 4RDVA 1PIGA 2GGHA 2QDHA 3VGHA 3U4AA 3F2DA 4FOUA 3F7JA 2VQTA 1DBTA 3N4AA 5D2XA 2EEXA 3PN8A 3IPWA 4G1KA 4J3VA 4U10A 2R8WA 1GVRA 1XYZA 1R3TA 3CTTA 1DWAM 1MNZA 1CX9A 3VD3A 1ME8A 4KCUA 2ZXAA 4GACA 1DQUA 3ITVA 7ENLA 3C56A 3QOKA 2DZPA 1TTJA 2PE4A 1MEIA 2DSZA 3WQEA 3WLPA 4W87A 1LT8A 2OG9A 1I0DA 1SVDA 3GXTA 2E8YA 4XBKA 4X9SA 4OGZA 1FQ0A 4MY8A 4UB9A 4EPBC 1IEXA 3ZVIA 3SDOA 4GJJA 2OPJA 1CGUA 5C2CA 4BK9A 1UKTA 1F07A 3CQKA 1PEZA 1QHZA 1JRCA 1IEIA 2H90A 4RUBA 1JPMA 2EKGA 3T0BA 4GUGA 3W7IA 3W81A 2G96A 3GG7A 4Y9NA 4BQ5A 3SGGA 3TXVA 4JNZA 2FMOA 3ZLFA 4KFNA 3CQIA 3RM8A 1OT2A 4L9ZA 2FTPA 2GFTA 3TQPA 2V2HA 4AZ6A 1E6ZA 2D2HA 3PZ9A 3ALGA 4M29A 3STPA 2I9UA 2IPFA 2IKIA 1VEMA 5CPTA 3V35A 1L0PA 4R3UA 1G4PA 1UP0A 1Q6LA 4O54A 3W37A 2OEJA 3CEPA 3G5EA 4O57A 4ZB2A 1RK6A 3W53A 3VGBA 4GZIA 1PKYA 4AH7A 1JZ8A 3RPMA 3W85A 5A5WA 3OZPA 1SMDA 4PYSA 5H8UA 2NX3A 1U5VA 1V3KA 3IIZA 1S46A 2C13A 1FKWA 2CZVA 2PF8A 4RZ4A 1YHTA 5I78A 3ZXWA 2YL8A 4G9PA 3NWRA 3N13A 4H6KA 3E38A 4O17A 1ECQA 1W3JA 4M7TA 3GNRA 4LXFA 4JTKA 2DUZA 2G3FA 4I3GA 3O9NA 4PUUA 5EGRA 3V3WA 2BOGX 2PDNA 2H6RA 1W0MA 3B0XA 4D72A 3QHOA 2ACUA 3S6OA 1E5NA 3M0YA 3ABRA 3FAXA 1NDZA 4S3GA 1P0EA 5XIAA 3B9AA 1E71M 1I60A 3NQAA 1EEPA 4UMAA 3VNIA 4ZQNA 4YL2A 4OT7A 1TQXA 2HVMA 4XBJA 1D2KA 1L9WA 4XAFA 2A3CA 3RYSA 2V5DA 2PF0A 1VYPX 2ZRVA 5CZKA 3PJWA 3SJ3A 5HJLA 4F9DA 2CBIA 2Y5EA 1EOMA 1FWCC 2OELA 2QV5A 1CGXA 4GOAA 3RXZA 3DBNA 2ZBTA 1WKYA 4YTQA 2OTDA 5F4WA 1X6UA 4PMDA 3ANVA 1LL7A 2QF8A 3DHDA 3MJMA 3SQMA 4GC3A 4H9XA 4QHRA 3M5ZA 3BLPX 4EWJA 3RCMA 2QVNA 1WZLA 1MMFA 4MHBA 5E70A 5CPNA 5DFAA 3CQJA 1GVIA 1O94A 3CZLA 4JDBA 4NVTA 3AMDA 3D47A 1E4NA 3FA5A 1EYWA 9CGTA 4I5XA 2BWGA 1SM9A 3A12A 2D1ZA 5G2HA 1T40A 4JIHA 2YYTA 3U5UA 4HZ8A 3G1YA 4QEEA 1XIIA 4Y9PA 5J5DA 2YBUA 1U33A 4UXDA 3SUTA 1BPLB 4D6CA 4FR1A 4C6MA 3P62A 3NPWA 2OQHA 3KOXA 1VC4A 3PHAA 1HVXA 4W5ZA 3KXQA 5ABTA 3PP7A 4WD0A 1X96A 1VJIA 5FF3A 3R8RA 1YPXA 1KV5A 3LQLA 5CC7A 4J4KA 4JTTA 3NSMA 2VOTA 1IZJA 3VIOA 4IF2A 1GJPA 1UMLA 2ZCGA 2WKLA 1KKRA 3SJNA 3EMCA 4PE8A 3B8VA 3ENLA 1BGAA 2Z2BA 2PZNA 3OG2A 3FYYA 4AD0A 3KUMA 4GK8A 1XYCA 1EPVA 3HTWA 1HJXA 2XZ9A 5HQMA 3BE7A 1R46A 4INFA 3HPAA 1B0IA 1XIFA 2V3GA 3B8DA 3PPCA 4EPDC 3NPVA 4U33A 5FAJA 3DFYA 1K7XA 3EXTA 2OFJA 3NGJA 5DMNA 4JTDA 4UQEA 3UPBA 3TC6A 2QDGA 2Z24A 4C6FA 1IF2A 3KBWA 1BVWA 4O1AA 3GR8A 2A0NA 4L56A 1EA0A 1UZHA 4KBXA 1W9DM 3WFZA 2YW3A 2ZQ0A 4O28A 3N14A 3VZYA 2O0TA 1R3YA 1XW8A 4KESA 4Y2WA 3OLIA 2GQ3A 3VIIA 5F1VA 4JFUA 3F4NA 3RPTA 2PDKA 5DBTA 2GVYA 1HF6A 1EUNA 3BSHA 2ON3A 2IQDA 1JDDA 3OJGA 2J8FA 3KTSA 4N9BA 1XBVA 4UNIA 5D9PA 2P5NA 3UA3A 1NFBA 2GDUA 3URAA 2QUNA 2C1IA 3QW3A 5HR6A 1H3GA 4AQLA 3N34A 2INEA 1CNVA 3WLKX 4E4PA 3H54A 2E5DA 1FWHC 2QCCA 4KEZA 4MJZA 5EY5A 3CV6A 3NR0A 2BFGA 3KW3A 1OFQA 2FH6A 4QITA 4F0RA 4YJ5A 3P67A 2J7BA 2PLJA 1V51A 1H5YA 1W6TA 2ISSA 2OQYA 3ZJ7A 4KWWA 1DXEA 2CIPA 1UH3A 2Z1KA 4XD3A 2ZUTA 5HNTA 3L7RA 1MZRA 1RR2A 3LCHA 4NI3A 3EA1A 2G3IA 4GRSA 4M6PA 1A5BA 2DUXA 4ZTXA 1DWIM 3K1GA 3L21A 1FWWA 5C9UA 1FKXA 2EXOA 3NA8A 4H3DA 4LYPA 4E3TA 2NLYA 3WQOA 3CUJA 4MDOA 2W6RA 1DJZA 3SRDA 3WLHA 3OIXA 5IDZA 2OX1A 4Q8PA 2Z7GA 3VUPA 1NOFA 3HFYA 3IAPA 3V0TA 4PBEA 2Y89A 2OZ0A 2NT1A 3LB0A 3E96A 4HYRA 2P1FA 3GC4A 2NVCA 5EMMA 1PHQA 3VD5A 3E1F1 4CQBA 1UIPA 4AD1A 3WMLA 3VDCA 1BF2A 4AIEA 4CN1A 3WDRA 4I90A 2PDPA 5CPLA 1V6UA 2R14A 4PMVA 3CB3A 1K70A 3BG9A 1LQAA 3E0IA 2Z29A 4BQ3A 1S2UA 3MV11 4OIFA 3SUWA 4REQB 4NKCA 2OLAA 2OGJA 3LM3A 4PUJA 4LSBA 4S3KA 3KOWA 4NNCA 4WHBA 4J2PA 2YXXA 1XQKA 3LCFA 5E1QA 3WLQA 3TFXA 2DDXA 5HNUA 2ISDA 3OQEA 4NZ1A 4MF4A 3UJSA 5AC6A 4UQBA 1TWDA 4XO7A 2OJPA 2QZRA 2REQB 4KETA 1Q6RA 1XPGA 2F38A 4K7VA 1G1YA 3PPFA 1WAUA 1XLBA 3UG8A 1W1A1 5A1AA 3NQEA 3TW6A 1BTMA 1XINA 1K6WA 3KBSA 2VHLA 1JZ6A 4QDPA 1JYVA 2I5QA 3XIMA 3ZT5A 2XFWA 1UWQA 4LAUA 1VB9A 4C5YA 3HQOA 1YBQB 4N6FA 2WPGA 4CEUC 4JX6A 3AUJA 1J6PA 3EWZA 3B0UX 4F40A 1TQJA 5BCAA 4O15A 3L4UA 4O13A 3B97A 3TA6A 1DYSA 3BMVA 4I7WA 3QZAA 2VWTA 5AHEA 1EJVC 2P88A 2CFFA 1QPRA 2F9RA 4IQEA 4ZEPA 2V3EA 3N3MA 3ME3A 2BVYA 4TTUA 3T8QA 4C65A 1ZBWA 1UUMA 3C8NA 3PNZA 1LRQA 3VAVA 2P10A 1W2PA 2UBPC 2DIJA 3WQ4A 3ARTA 3IGSA 2WMIA 1BXNA 3CZJA 5LIKX 3CV2A 2VYOA 4C90A 3KLKA 1CXFA 2G3NA 1YNYA 3Q4DA 5LZLA 3H8AA 3N6HA 5PTDA 3GW0A 3IVTA 1KFKA 1C9WA 1NP0A 1R85A 5CGMA 1WX0A 4ZQPA 4H9UA 2OLSA 1UKPA 2W9MA 1J0ZA 3KOZA 2OO6A 3O6DA 2X30A 3N2TA 3QMTA 4AHOA 3C6CA 3W87A 1F76A 1VFOA 2EKCA 5CJNA 4K6AA 2WNWA 1LCOA 3U4FA 1B54A 1T41A 3V16A 3BANA 1QO2A 1GOQA 1E0UA 2YCLA 1QJWA 3HA1A 4IL0A 2X0YA 2W61A 1OFRA 3QSRA 2B4GA 3KP1A 1T7LA 2PU0A 2QMJA 1PVNA 3MJYA 3EOSA 1E1CA 2JFEX 2OZ3A 1TIMA 3LERA 3H22A 3RLVA 3Q2DA 4RPQA 1X1OA 4DWDA 3FJLA 4DLMA 1FDJA 3IVUA 3QFWA 4PEEA 1QDSA 1SSGA 3CWNA 1S3TC 1R6WA 3I68A 3AMKA 3W3OA 1DPMA 2JK2A 3H55A 3U8GA 3HF3A 3ZOAA 1WDQA 5B7ZA 4DHGA 5LNWA 4PMZA 2NV9A 3VIGA 4JY8A 1KC7A 4ZODA 4NF7A 4LTSA 1LOLA 3GFXA 3V5OA 1V5XA 3GG0A 5REQA 1TELA 3RPDA 1EGZA 3IWPA 2BZNA 3ARVA 1REQB 4MTVA 2G3MA 4IPNB 3TWBA 3R7MA 1B3ZA 2VURA 1PE1A 2PTXA 1PB0A 4L80A 2ATSA 3LU2A 1EO7A 2J47A 2PGEA 3ALFA 4ZO9A 3TV8A 2EG7A 2YZ5A 3WX7A 5I23A 1L6FA 1Z89A 1M68A 3NEVA 2W63A 4HJFA 1QVBA 5CG0A 3KVMA 5FACA 4H8VA 3WDIA 1MYRA 3DFTA 5EFFA 1BTCA 1E6RA 3GVRA 5FF7A 2WOQA 2HE5A 4Q4MA 3UD6A 1FXPA 2E8ZA 2VFDA 5I3FA 3B8UA 2PDWA 2ZC8A 1PTAA 3TN6A 1P7TA 1DIKA 1OFDA 3MHGA 3STFA 3BARA 5D04C 5JH2A 1LQ2A 4PTMA 2VZTA 4ZA0A 3UT0A 3Q37A 2PD5A 5CLTA 1CCWB 1BHGA 3PS7A 3GWQA 3KE0A 4HBKA 3W22A 4KWUA 4EACA 3CYJA 1HTIA 5BXTA 1I2PA 4YTUA 1A5LC 1CXKA 4J3ZA 4JD4A 1MRQA 3I6RA 2ZFAA 3C52A 4ZVJA 4LVDA 3P3BA 1XP3A 2OGYA 4FS9A 1JAEA 1Q5MA 1VAHA 3IUDA 3H2AA 2PODA 3BL3A 2VVSA 1UP2A 1G94A 1KM6A 1F3TA 3SN1A 3B03A 1FVPA 4F0KA 3UCQA 5J04A 1S1RA 1QTWA 5A6MA 4X2PA 1FCUA 1O1HA 2POTA 4PL1A 3WKZA 3CPGA 5CQ1A 3B0PA 1RUSA 1PCWA 3VCRA 3NL2A 4MZ8A 4NP7A 1NU5A 3UR7A 3UZWA 1LWHA 1E1CB 3H2NA 3M1ZA 3ARUA 3BLDA 3UXKA 3Q58A 1S3HA 2ZX6A 3UG5A 4XQ6A 3WL1A 1ADDA 3L4XA 3OZYA 2HE8A 2JKEA 6CGTA 3O3RA 3CAQA 2PDHA 4Q4KA 3T40A 3R94A 1TRIA 2QNEA 3KWSA 4MB3A 4LRSA 2F2KA 3GM8A 2JIWA 4P8VA 4PRTA 1UJPA 3B4YA 1F7BA 1F8IA 4LANA 4DJDC 3EPMA 4C6IA 3F5LA 4GIRA 6TAAA 1VCFA 3CUGA 4C5ZA 1JAKA 4D71A 3WNMA 3KL0A 1RSCA 1GKQA 1TUFA 3VC5A 4Z0SA 4OFCA 2VEKA 2PGRA 1JZ4A 3DAQA 3WDQA 4JHOA 4C6DA 4W4QA 3WH7A 2QYGA 3V4BA 4YLWA 2EBNA 4PUWA 4K8HA 1EF3A 2DSUA 1VFTA 3HZ3A 4IPPA 1UR1A 4J5NA 3PF3A 3G77A 1KBLA 2ANUA 4MY9A 4WUIA 3H26A 3ABZA 4B3LA 4LT9A 4PR4A 1C91A 3BJSA 2DZSA 1XLHA 2E7FA 2X1SA 4LB3A 3HMCA 3POHA 1ITCA 4PUDA 4OWGA 3T0AA 2OEKA 2CKSA 2NQZA 3MA8A 5K7JA 2OZTA 3QGVA 1M6JA 3T44A 3BLKA 4IPLA 2CLEA 2D3LA 4I5RA 2Y5JA 4DO6A 5HNNA 1K9TA 2DVTA 4O4WA 3VNZA 3EGJA 4JQ3A 1OF8A 1FH7A 3TTSA 1REQA 1X1NA 5DMYA 5AHNA 4YCPA 2W66A 1V77A 3LXCA 2WLYA 3F4VA 1FFRA 3W1RA 3LRKA 1XRSA 3CIVA 3QTGA 3M4HA 1S5TA 5LHFA 5DO8A 1FBAA 2VRQA 2C6QA 4G7EA 4U28A 3GNPA 2J9ZA 2XH4A 3HV8A 2VO5A 5KMYA 4WY0F 1W1ZA 4LQ1A 5M2FX 1QBBA 3ZWTA 3DFSA 1DKWA 5FJUA 3MMUA 3WIJA 2OB3A 5A2AA 1DWHM 1S5MA 3WQCA 2CZEA 4WSHA 2VFFA 3SFKA 3T07A 5FSDC 2JKPA 1UUOA 5KITA 3NQ6A 4C6JA 1BVZA 4ZO8A 2J7DA 1KFCA 3AMCA 1UA7A 4F79A 2G41A 2QGYA 3II1A 1G5AA 3NO5A 4WX2A 3L5MA 4B9ZA 4QISA 1P1XA 1LJYA 1Q8JA 3P80A 1R47A 2VM8A 3CLWA 3EMQA 1UP3A 4YS1A 2CPUA 1FWAC 3GTNA 3SW6A 1LLZA 4O8AA 2E40A 4MWAC 2G50A 3IJ8A 3EKZA 3SQSA 3MVIA 2TRSA 1CECA 3PAOA 3TYDA 3LCXA 2XIIA 4RCXA 3GIPA 1KR0A 4FPSA 3M41A 3RAOA 4JQ1A 4JCMA 4UTKA 4MAVA 4AEOA 4H8UA 2Z27A 4Q22A 2XZ7A 4C6EA 1YDVA 1B4EA 3UEQA 3IGHX 2Q3RA 4ZTYA 3WK1A 2OYMA 5JBFA 4LWWA 4FXSA 2Y7DA 4U5IA 2V6AA 1U30A 4UTMA 3LRLA 3VNMA 4WSKA 3TA9A 4GISA 3H24A 1CEOA 3ISIX 4ACYA 5FJJA 4ZL1A 3ZM8A 3LI0A 3QR0A 3MYPA 5CBBA 4A3QA 4GIEA 5FIPA 3ECQA 1PAMA 3M16A 4AMCA 4EWND 2BODX 3OGVA 4DBDA 5A6JA 1Q6FA 1MDRA 3HFTA 4J28A 1EP2A 3GKAA 1XRVA 2VR5A 2J6XA 4ML9A 4XKYB 1YPFA 3OLDA 1GCYA 4O1DA 4HOWA 4HHPA 1VR6A 3S2LA 3NZRA 1P0KA 2YDQA 3S9ZA 5A8NA 4QS5A 3LNMA 1AZ1A 3BZGA 5J5RA 3G0SA 4DXXA 2GJXA 4OVXA 5DY2A 2GVLA 4DJEC 3AWOA 4HK5A 2XGIA 2CLMA 1TKKA 5G4WA 3I4KA 4IIBA 3CM4A 1ZAIA 2GPTA 2FZDA 3QJAA 3MV01 4GQ0A 1H5VA 4PFMA 5KTLA 4R7OA 3CUHA 3S5OA 3BAKA 4JAWA 1SR0A 3W00A 2C0HA 1OCJA 4ZFCA 3W2KA 3WG6A 3S1WA 2OO0A 3ARYA 4JIEA 1VBHA 1JCXA 4Q4OA 4Y6GA 1IGSA 1E9ZB 1SZNA 2WVVA 2BVWA 3URBA 4AWUA 2Y70A 4M24A 2PLCA 4AY1A 1RXOB 3WLNA 4S2CA 4CNPA 3UJFA 3UJRA 4AW7A 2HWGA 4QSHA 4YYFA 4O53A 2IUZA 3NNTA 4B5WA 1GHSA 3C5QA 2BASA 4RE0A 2RKXA 2RFGA 1E15A 1G01A 2DSKA 5CPQA 5I24A 3W24A 3KCLA 5DBUA 1DIOA 3PTKA 2W3ZA 3DYPA 1UPPA 2WZMA 3S0CA 4QNWA 1JL8A 3EEGA 2BY1A 3UZXA 1XJBA 4MNKA 5T26A 4X9YA 1YXYA 1IWBA 3A3XA 1L2UA 2JIEA 4NT0A 3C0SA 4PCPA 3VIKA 3GE7A 2Z4GA 3VYLA 1ZALA 1P0BA 1X8FA 1OZMA 4ERGA 4LY4A 3ARRA 1FP8A 3C2EA 4KRTA 2NX9A 1JCMP 2Z2AA 3U2EA 3WH6A 4AUBA 2OVLA 4AEFA 4PCFA 2DGAA 1XD1A 3BQ6A 2NQJA 4KRUA 4H1ZA 1B1YA 4A8LA 1SZRA 2ZXQA 2EJ1A 3GXIA 1BKSA 4H7ZA 1WO2A 3SGZA 1M7OA 1KFBA 4H9MA 3TYZA 2YXGA 1QFEA 3A13A 2CBVA 2C19A 2V8ZA 4K7YA 1A3XA 1UASA 1P0NA 3F5JA 2X0SA 2Z1VA 4JTJA 4NAFA 3QYSA 3IRSA 2ZVRA 1OIMA 4D2JA 1YNPA 2DEPA 4HMCA 2HBVA 3AJ7A 1R2TA 3QGAC 1CLKA 3MVTA 1B3YA 1CLVA 3MQTA 4HMEA 3AZRA 3CHDA 1RHCA 3EX6A 1Z8AA 3HG3A 4IFKB 5T8GA 1JPHA 2P76A 3QN3A 4QG9A 3T0TA 4IG2A 4YHEA 3TYBA 3RM4A 3PBWA 4C6KA 5AYYA 4C1KA 1QATA 3CV1A 2FTWA 4OV4A 2Y7FA 4C7FA 1MI3A 3LLFA 1JGIA 5H6HA 1TX2A 1VLIA 4UTFA 4B91A 1GNXA 2P53A 3JZEA 3P0XA 1DIDA 5EB8A 1I1WA 4DELA 3PWGA 2FH8A 1JFXA 1JIBA 1QK0A 1TA3B 3PVFA 1KM4A 3LV5A 1LLOA 4G7FA 2WZEA 2YCJA 1BKHA 1NM9A 1MWOA 2MUCA 3W82A 3UWUA 1VGAA 6ENLA 3AIBA 4I9MA 1N82A 5DCEA 1B5TA 2FVMA 2B81A 3LQGA 2J25A 4N2YA 3EOUA 2XYLA 1B2YA 3LMYA 3V75A 1AH3A 2DV0A 4HTBA 4AZCB 1XLIA 1AMYA 1JXKA 5HUPA 3ZR4A 3QRHA 3FV9A 3IGXA 3TYCA 2E0PA 3RU8X 4KRZA 2EPHA 1QI2A 4C1LA 2WVVB 3LSCA 1RVKA 4WJEA 2D0HA 2GGJA 3LENA 3W1MA 3GDLA 4NI8A 3WF1A 1XYAA 3STCA 1I2OA 5AZ1A 2E1WA 4UUIA 4HSHA 3LTYA 3M0HA 4E2BA 1LROA 3N6JA 1D3HA 2W91A 4X63A 1TJRA 1XCWA 2ZUUA 4F0LA 2Y6ZA 3CIWA 1KGUA 4HU0A 4MJ2A 2J7CA 2OSXA 4ASTA 3VTRA 1DXFA 1ONXA 3CQHA 3W1AA 3WNPA 3BAXA 1VCGA 3DYMA 4AX6A 4JFVA 4D6JA 4TX8A 4K8GA 1KTBA 5A8PA 2D23A 3LOTA 1HJSA 3DFNA 5A8QA 1VH7A 3PB2A 1UD4A 3P5YA 3LPGA 4V27A 3I3EA 3G1AA 3I4EA 1RQEA 1OGBA 3N3TA 4B3KA 1LOQA 1KXQA 3CPUA 3NURA 5BU9A 3NIYA 3THQA 4C6NA 4IXHA 1NDYA 3R43A 1JULA 1QOQA 1B3XA 3W01A 3OP2A 4GE8A 3G2GA 3N12A 1Q6EA 4MWAD 2NW0A 5EBAA 3URNA 4KEMA 1H7OA 4FZIA 5D38A 4ADSA 2O9OA 1ZRQA 1A80A 3DFQA 1OCBA 3QKZA 1KGXA 4ENLA 5LNUA 2BB0A 4DF1A 4X22A 3UW6A 2ZIDA 2P0OA 3A4XA 2ZA1A 7TIMA 4WDUA 1LORA 3E2RA 3GH4A 2GLKA 2BGSA 2ISWA 3BJTA 1X38A 5FJTA 3T55A 1ISYA 2VCAA 4IQDA 5CC3A 4RE2A 1HIZA 3AIVA 3OYZA 2ZICA 3LCWA 4DWSA 3H2EA 4PTXA 1DEDA 1EC9A 2G3JA 1XL9A 1LP6A 4GNKB 1XYFA 4CCEA 3A64A 1V3JA 1BAGA 1R3QA 2WB5A 5C55A 1OCNA 3B8WA 2XGBA 3NQGA 4B5NA 1XRTA 1NOWA 4W93A 3O06A 4GZ7A 4JQAA 4DB7A 3I7RA 3MSGA 1RQBA 4C6LA 4IP7A 1FXQA 3MP4A 4XB3A 3N9RA 2PDIA 1KNWA 4AU0A 3THAA 4UQCA 1A0CA 1HN1A 1J2BA 2WHJA 1JJKA 4PTNA 2IS7A 3N18A 1J0KA 1H0GA 1OHLA 3TONA 2GUBA 3K5XA 4LS2A 3H2CA 1R3SA 1B57A 1EHAA 3E74A 1BVNP 5G1TA 3SN4A 1WZAA 5HOSA 1A4LA 2ACSA 1JDAA 2QULA 3F2BA 4LNCA 1XLCA 1G4SA 2H8ZA 2BBFA 1KKOA 1ZP4A 3ANYA 1V4YA 1U2YA 2NXHA 3GAKA 2OEMA 3TJIA 4BEQA 3PZQA 5I7GA 4P7OA 1W9XA 1V7AA 3PPHA 3S2NA 1C92A 3ZJKA 1POKA 1TG7A 4ML4A 1H11A 4EKJA 1G4TA 2I16A 3SQLA 4N6EA 1IE7C 1QK2A 3NAVA 5K4ZA 1CTNA 3ERPA 2DZXA 4NASA 4GGHA 4US5D 1HKJA 4TVUA 1EQCA 3R11A 3GDBA 4WY0B 1FWSA 3IJLA 1DVJA 3O2LA 1TJ0A 3QC3A 1VEPA 1NQ6A 1F9CA 3JZUA 2X09A 1QMLA 2XUCA 3V36A 1UR3M 5CPOA 4Q8UA 4UQ9A 4IOTA 3CH0A 4I8DA 4GNJA 2W62A 3I7SA 4GKLA 1EJXC 3G6MA 5AN7A 4GFIA 2WQPA 2ZKMX 2DT1A 4WEVX 4E38A 3NDOA 1JQVA 1Z6KA 4A8RA 3N15A 1IV8A 1H7RA 1EDGA 1L8PA 3L65A 4G1NA 4WGXA 4HJWA 1W9PA 1TB3A 4D1JA 4WKFA 2QPXA 2WHMA 2DW7A 5CAHA 3W1NA 3O07A 3SSJA 3HPZA 2CBJA 4DI8A 5CGQA 5F2LA 9RUBA 2NQ5A 2O92A 3FCPA 1NJJA 5DY3A 4M6QA 4WF7A 1VP5A 2YBVA 2FMNA 3GIYA 5LIWX 3R79A 2WMGA 4Y9AA 1UWIA 5M5DA 4B15A 3KEHA 1XBXA 3EWUA 3QV6A 3MI2A 4XZNX 4DJFA 4CNUA 2FPYA 1GWJA 1YYAA 3ZS4A 5CGTA 2J13A 3Q65A 2PGFA 3NO1A 3QPYA 4DUWA 3HQ1A 4DJDD 3W7MA 1KRCC 4GBDA 3TR2A 3L23A 2EF9A 2D69A 2XH7A 3TZFA 1CT5A 2CLFA 2CERA 3WSUA 2J8GA 2QAPA 1ICSA 3FKKA 3TQVA 4RXFA 3STEA 3N04A 1YPIA 1F8MA 3RJYA 3L2MA 1IZCA 5I3JA 3VOGA 2XJ7A 1VFUA 4MPQA 1OX4B 1MQQA 5FD0A 3GNDA 1XLLA 3G8RA 4RPPA 2NVDA 2GK1A 5AZ0A 3OO2A 4PMQA 3EDJA 4IJRA 4IL2A 3AHXA 1K02A 4DAFA 3GU1A 4FLQA 5HJXA 3UP8A 1E72M 3OA5A 3VFLA 1RBLA 4JFWA 4WY0A 3WZ0E 3AJXA 4ACZA 1PZ3A 2WNNA 3AYTA 1KXVA 1CWYA 3I6TA 3ZT7A 3VKBA 2ZDSA 3VOFA 1XGDA 3M7SA 4EAYA 1LBFA 1HL8A 1EWDA 1HNYA 3M0LA 2PDFA 4M3PA 3PTMA 1WBJA 3GTXA 4FIQA 5A95A 4GO9A 3F4CA 4OE7A 4Q8WA 1V6XA 3GH5A 3HOJA 1PDYA 1QNOA 1KRAC 2VVNA 4WLCA 2VP8A 4B92A 2QCGA 1ZENA 5C9XA 3OG3A 4Q33A 1GONA 2E1DA 3LUTA 2E6YA 3TW9A 5D8ZA 1XKJA 1H50A 3C0QA 4UNKA 1KBBA 4NJGA 4PUNA 2D3NA 3IJIA 3W71A 4D6EA 1TIWA 3VABA 1GVEA 3LHVA 2BMBA 1VIWA 3BK0A 3SCQA 4KKXA 1EC8A 2CESA 2ZUNA 5DRIA 1LWJA 4DAIA 3W83A 1SYTA 3GDTA 5HATA 1F61A 3F1QA 1ELSA 2FPTA 1W1IE 3AYSA 1F74A 2PWHA 1BSIA 1KBKA 4LAMA 1J0IA 3WBXA 2VEMA 4AWEA 1MXSA 3A3HA 1RD5A 1W31A 4IJBA 1SO4A 1EJSC 1SZEA 5EKYA 2NVAA 4BKNA 4HU4A 3PANA 3WJSA 3HGSA 2DSWA 2VC5A 1RLCL 3TZNA 4UCGA 1JF5A 3XINA 3FX4A 3OEXA 1EPXA 4MLJA 3M6DA 3MUXA 5ABEA 2C7FA 4HPXA 4UFIA 1PV8A 2PB1A 3T09A 3ID7A 3R0KA 2QS8A 2R1KA 4Q8OA 5HPCA 3KCOA 3QF0A 3B04A 4B9YA 2WKJA 2EGZA 4XBSA 1E70M 2GJPA 3ELFA 1ME9A 3UU0A 3HBLA 3TOPA 5MF5A 4UTLA 1ZY9A 2QHAA 5EL1A 2DW6A 4O52A 1QI3A 2NUXA 3D6NA 1H09A 4DPQA 4WXYA 3PFRA 2E3ZA 1YDNA 5A6BD 3GHUA 4H9ZA 5BMXA 1JYNA 3UGVA 2QCMA 1S2TA 1K8ZA 3SCVA 2CWXA 4BFAA 4IP4A 4PL2A 3UJ2A 4H04A 1AK5A 4QJ4B 3N4EA 2Q09A 4LYKA 2PUZA 1OBAA 3THDA 3H2OA 1QO5A 1VJZA 4A2RA 3N73A 1G0CA 2E4TA 5D8WA 1ML1A 2A7PA 1AUSL 3WJYA 5FF4A 1XCFA 1YMYA 2CKRA 1XH0A 4EANA 4XIMA 2GVGA 1FA2A 4PMUA 1R3WA 4PUMA 2DIKA 1O4UA 3JRKA 2HK1A 1EZ2A 3HG5A 3ITGA 2V81A 4WCJA 3REQB 2ZWYA 4N9EA 4O19A 4DWSB 4DF0A 5EA9A 1X1ZA 4H2CA 4JL1A 1OGGA 1YW1A 1AJ0A 3QOMA 1HKVA 3QMSA 1EP1A 1MUWA 3T08A 5T9CE 3GAYA 4TTGA 4FLSA 4OBRA 2EHHA 1VPYA 5E0KA 5F7UA 4IISA 1W9BM 1UZ1A 1MUCA 4GVIA 4LUYA 6REQA 1O5RA 3VD9A 3WQDA 3MMWA 1QWGA 3QEZA 4MY1A 5IOBA 1MEHA 2GGEA 4FNRA 3F03K 1JDEA 2VKZG 1E55A 1R87A 2V5LA 4LF2A 3W02A 4MGGA 5G5IA 5JXQA 3AIQA 4JDYA 4A22A 1CGWA 1XIJA 3LYEA 2PWEA 5A2BA 5I07A 4URIA 3SIZA 3GHSA 3SB0A 4IUOA 4L4PA 1UWAA 1W3TA 1MFVA 3ITOA 1IGWA 3FGCA 2HEJA 1W8GA 4GGBA 1FWJC 1KFWA 4S3EA 1QPKA 3AU6A 3PZTA 4E2VA 4XG1A 3NZQA 2YGYA 1E0VA 3TAOA 3HPFA 4OHQA 3G1FA 3QV7A 1VBGA 3MU7A 5K9CA 2PU1A 3KVKA 3G8EA 3HJEA 1Q6QA 1I6NA 3NGFA 3W25A 1ZAJA 1IXOA 4DJFD 3W2MA 3C0JA 4JIQA 2Z0IA 4X0VA 1LL4A 4UZUA 3OU8A 1LUCA 4ORMA 2EG8A 3IJ7A 2ZZ7A 3IUHA 5EPDA 3APGA 5AYIA 3BO9A 4EAMA 5TBOA 1O6IA 3MZNA 2V0TA 2I1OA 1JCLA 2HXTA 3IIXA 3O8AA 4M1RA 4W89A 4ZO6A 2IKHA 1HUVA 4O50A 2QF7A 2J8TA 4XZ9A 2HQAA 4ILSA 4LF1A 4QE5A 3CHVA 1KCLA 4PCSA 1DJYA 4H9VA 3AIRA 1QW8A 5BW6A 3A5FA 3OODA 1K6AA 5H91A 2I5IA 4G56A 4YVPA 4H7VA 3KRBA 1P4CA 2NSXA 2WVSA 4GINA 2YKKA 4HOXA 4A8IA 1KBJA 3CMJA 2WYSA 3S5NA 4NL1A 3LBCA 2PRLA 1W1YA 1EP3A 4QJ3B 2O55A 1ISXA 1YDOA 4QS6A 4UFKA 3WLOA 1BF6A 3TNOA 1UA3A 3MC5A 5KZEA 3WQPA 3BVJA 3MMTA 1RV8A 2QKFA 3EX1A 5H8MA 3BLEA 3T9PA 1BWVA 1J0HA 1VFLA 3PUEA 3TTEA 4CD4A 5FI8A 1WNOA 7REQA 1M3UA 2GWGA 1H7XA 2BS9A 1UBSA 2V5BA 4DYKA 4L9YA 2VCBA 2JALA 5FEWA 2ZYFA 1F6KA 2V68A 4WJXA 1N8WA 3W4RA 2F61A 5I09A 4JNYA 2DUAA 3RMEA 2B7OA 3T05A 3G22A 1OX6A 1WE5A 2WZTA 3BGJA 4LBRA 4AYGA 4WR3A 3VKDA 4EPKA 3C3UA 2Y88A 2BHZA 1GYMA 4IMGA 3GR7A 1Y7VA 3BV7A 4HD5A 1JZ5A 6PTDA 2WC7A 5DLCA 4S39A 1WXYA 3NQBA 1TE1A 4RW3A 2PWVA 3AROA 4M80A 5BOOA 3S47A 4AY7A 4AAJA 3KVJA 4R7JA 1V0NA 1F3WA 2B7NA 1X6LA 2C3ZA 4JL2A 3SADA 1JCTA 2CLLA 2IPWA 4CQ8A 3S3GA 1UC5A 2V3FA 5BWFA 2XN2A 3PZIA 1WA3A 4Q8TA 3OBKA 3RR1A 3TWAA 1HFBA 4WQ6A 3A22A 4HCLA 3MB9A 4C6BA 1HJQA 1G9HA 4X2RA 1HW6A 3W7PA 4FP1A 2J79A 4L4OA 1I9CB 4F4RA 4OKDA 4S3BA 2WJDA 3AOFA 3CUZA 2C91A 3LM7A 3NJ3A 3VKCA 3DUGA 1JFHA 3EWYA 1F3XA 1EDQA 2G5WA 4JTFA 3JW7A 4Z2IA 1JPDX 3LK6A 2VRJA 3OLGA 3UY7A 3LLDA 1XUZA 3GO2A 1VS1A 2PCQA 1UD3A 2Q8LA 4Q8MA 1GOWA 3OQ8A 2HS8A 4I8YA 3VE9A 4YTTA 1C3FA 1VZWA 3GBEA 3APYA 1R38A 3U2CA 3PJUA 3BG5A 4G5DA 3B0VC 1RPKA 2Z2UA 4F48A 3BUVA 3WJWA 1WZKA 3FEMA 3U48A 3VE7A 4Q7IA 1XQLA 1TWIA 3V1PA 4E4UA 4V1XA 3WLTA 2VRKA 1MZHA 1O7AA 2DY3A 4TU1A 1NVMA 1NSJA 3GD6A 4E2DA 2QMKA 5CEWA 1A3WA 3FA3A