4XO7A

Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
322
structure length
322
Chain Sequence
DSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3 alpha-hydroxysteroid dehydrogenase type 3: structural clues of 5 alpha-DHT reverse binding and enzyme down-regulation decreasing MCF7 cell growth.
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xo7A00
2IPWA 2PDMA 1FRBA 4PRRA 4YVPA 3F7JA 3WG6A 1T40A 4YS1A 2PDIA 2C91A 4PR4A 4WDUA 4WDWA 3BUVA 3H7UA 2HE5A 1MRQA 3P2VA 4R9OA 4FAMA 3EAUA 4G5DA 3UYIA 1VP5A 4GQGA 3U2CA 2PDYA 1EKOA 1RY8A 3DOPA 4YVXA 3MC5A 2PDCA 2PDKA 4XZIA 4JIHA 4JQ2A 1YNPA 4QXIA 5LIKX 3LNMA 4DBWA 1OG6A 3UG8A 3LQGA 1S2CA 4LBSA 2DUXA 2PEVA 3WBYA 2PDFA 1LWIA 1YE4A 1IEIA 4Q3MA 2DUZA 4JQ1A 3VXGA 1AH4A 4GACA 2CLPA 1ZSXA 2F38A 3R94A 2J8TA 3UWEA 2IKIA 1Q13A 2WZTA 4JIIX 3CMFA 1Z3NA 2ACRA 3H4GA 2PD5A 4XZNX 4WGHA 3GUGA 4EXBA 4ASTA 3M64A 2HDJA 2BGQA 2PDGA 3ONCA 5LIUX 1XJBA 1J96A 2FZ9A 1R38A 3CV6A 5M2FX 3UZXA 1LQAA 3O0KA 1AH0A 4I5XA 4FA3A 1PWMA 3GHUA 4ICCX 4JIRA 4GIEA 3V36A 4GQ0A 4IJCA 1PWLA 4PMJA 3R7MA 4QX4A 4JTQA 4XVEA 4JQ4A 2P5NA 2IQDA 3LUTA 2FZDA 4XAPA 2PDBA 4DBSA 4FZIA 3UP8A 3UZYA 1SM9A 1EL3A 2PZNA 1EF3A 1C9WA 3UFYA 2PDUA 2R24A 3H7RA 2IKGA 5LIWX 2PDWA 3LENA 2PDLA 1AH3A 3R58A 3FJNA 1AZ2A 3GHSA 4F40A 2R9RA 4ZFCA 1A80A 3CV7A 3DN5A 4XO7A 3LEPA 2PFHA 1PZ1A 2HEJA 4XZHA 1ZUAX 2QXWA 3LZ5A 1YNQA 1QWKA 3V0TA 5C7HA 1AZ1A 4MHBA 3R8GA 1K8CA 4LB4A 3G1RA 3LZ3A 5AZ1A 1US0A 2FGBA 3S3GA 5KETA 5JH2A 4WDXA 5HNUA 5AZ0A 4L1WA 3RX4A 3N6QA 3COTA 1X96A 4XVDA 2AGTA 1T41A 1ZGDA 3LN3A 2IQ0A 3N2TA 3LD5A 2NVCA 3GHTA 4JTDA 3WBWA 4QR6A 2PDJA 1XGDA 3BCJA 3B3DA 1UR3M 3NTYA 2WZMA 2ALRA 4JTAA 4Q7BA 3LBOA 3UZZA 4QBXA 3CAQA 2PD9A 4YU1A 4YVVA 2PDXA 3C3UA 4FALA 1RY0A 2PF8A 1HQTA 4LAZA 2VDGA 3UGRA 4JTRA 2INEA 4LB3A 4H7CA 1M9HA 2FZBA 4XK2A 4L1XA 2HV5A 3LQLA 5HNTA 3V0SA 3BV7A 1Z89A 5LIYX 2A79A 4RPQA 3FX4A 4AUBA 4PUUA 3MB9A 5LIXX 4HBKA 1AFSA 2IPJA 4PRTA 2PDQA 4EXAA 5DANA 5JH1A 1ZQ5A 2DV0A 2ACUA 2ISFA 2FZ8A 4H8NA 1YE6A 2I17A 4GA8A 4LBRA 1Z9AA 3QKZA 2IS7A 3D3FA 1QRQA 3M4HA 3RX3A 1S1RA 3Q65A 2BP1A 2I16A 4GABA 3R6IA 1PZ0A 3Q67A 2F2KA 4JTCA 4DZ5A 1MI3A 3UZWA 4GCAA 3BURA 4WEVX 3EB4A 1Q5MA 4WRHA 3R43A 3M0IA 1VBJA 4NKCA 1RALA 1X98A 2BGSA 3O3RA 3V35A 2FVLA 5HA7A 4JQAA 3CAVA 2HE8A 4HMNA 4XZLX 3T42A 2PDNA 3CASA 2IPFA 2HVOA 4WDTA 4LAUA 3R8HA 3V0UA 3EB3A 2PDPA 2IKJA 1IHIA 1XF0A 3RX2A 3ERPA 3WCZA 1HW6A 1Z8AA 1JEZA 1PYFA 1MZRA 1X97A 2IKHA 3G5EA 4DBUA 1EXBA 4XZMX 2INZA 1ADSA 4PUWA 4IGSA 3WBXA 4IJRA 2ACSA 2PDHA 2HVNA 2IPGA 2NVDA 3GHRA 3ONBA 2ACQA 1S2AA 4JQ3A 4OTKA 4XO6A 1GVEA 1S1PA 3KRBA
chains in the Genus database with same CATH superfamily
3MT1A 4ZQOA 5HPCA 1K6AA 3UZJA 1HT6A 3CHDA 4KCWA 3W28A 3AFBA 3PB0A 2BWGA 1I2RA 4EVZA 2OZ8A 2ZIDA 5D8ZA 1HP4A 2WB5A 3MUXA 2XHYA 1TA3A 2JE8A 1I45A 3MP5A 1XX1A 3QV9A 1UH3A 1QBAA 5GVJA 1YXDA 2NLIA 2JGYA 4PULA 2BY1A 3TN5A 4WSJA 2ZDRA 3HQNA 3QQ0A 2ISWA 3PPFA 7PTDA 2C1IA 3BAJA 4NIRA 3WJSA 2PRHA 2YDAA 2C19A 4DBWA 3T2OA 3QH2A 3G6MA 3W74A 1NELA 5HJYA 1CIUA 3MI2A 4D8ZA 1E5JA 2AKZA 1R2RA 3LV5A 1SVDA 2A0NA 3KBVA 3T4WA 4F9DA 5DY3A 4IMDA 3KRZA 3W7CA 2GJNA 3V75A 2OCZA 3LTPA 4DBEA 4MYAA 2JF7A 3W1TA 4LAMA 3T6CA 1KFJA 3A24A 3PWGA 2X0HA 2GJRA 3TFXA 3O2LA 5BW6A 3HBLA 1EO7A 3QHOA 1XIEA 4NP7A 4LS1A 4J4KA 4H2HA 2E5DA 2J6VA 1E9YB 1W1IE 5DMLA 1FHLA 1J96A 4K7YA 1JZ4A 3SO7A 4B9YA 1GKPA 2FIQA 3FHQA 1T8QA 2NUXA 3S2LA 2R94A 2HISA 2ZRWA 3LA4A 5DX7A 4JZ5A 3CXOA 4CQ8A 4CNNA 4Z42C 3KTSA 5IFPA 1JCTA 3TCEA 1UP2A 4NXKA 2ISSA 3IUDA 3KBSA 1SO5A 4UR8A 1R46A 4S2CA 1A3XA 3I10A 1Q4NX 4NJHA 4QP0A 1H60A 3VA8A 2BDQA 1KRMA 4P8XA 4G1KA 3NO1A 2FFIA 1R3TA 1W5MA 1EX5A 4B3ZA 3N19B 3OEXA 4JIQA 1XISA 2OKOA 5I3IA 3QTGA 2YBVA 4QQ3A 4G2DA 3HPSA 3P5YA 3SBFA 1ADOA 4H41A 1LOQA 2PDUA 5FAJA 2DSVA 1XYMA 3MDUA 3RIKA 1AH3A 4JDBA 4Z08A 2CZ5A 2Z0IA 3M0HA 1Z69A 3TLLA 2PUZA 2YCLB 3W7DA 4R9XA 4ZFCA 2WJEA 2Z28A 3SGZA 2D3LA 2QMJA 1E6PA 3F4CA 1A4LA 1EC9A 4WVXA 5BRQA 4R7JA 1U2YA 3GVGA 1ECQA 5LNRA 4LC6A 2J7FA 3DI1A 1PS9A 2WMIB 1U5VA 1VH7A 4FI4A 3W87A 1KXQA 4JYFA 5H8PA 2H90A 4NRRA 4YXGA 2XVLA 3NURA 1IGWA 4KF1A 3EWWA 2ZZ7A 2VOTA 3P6LA 4DUVA 3QPZA 3SGUA 4S3GA 4WDXA 1G5AA 4BA0A 2WHMA 3TK7A 3N6QA 3GZ3A 4AD4A 4P8UA 4XVDA 3CUZA 1A5NC 4KCUA 3TA6A 4RK8A 5BU6A 1J5SA 3HPAA 3L2MA 1E0VA 3LK6A 4IT1A 3VIPA 1CXEA 3MSYA 4LXFA 1XBZA 4JTAA 5D2XA 1R3SA 3KBMA 2TODA 3WQ5A 4DJDD 3QMSA 4P7RA 3WLJA 3DFHA 4X60A 1W37A 4NHVA 2D2HA 3GG0A 3KCLA 1GOWA 2KAUC 3I4KA 1HKKA 1OZQA 3EKGA 4O0QA 2UZ9A 2DSZA 2V5KA 2GK1A 3VDAA 3AYSA 4QITA 3UR8A 2VCAA 4TVUA 2HVMA 5G2IA 3UPBA 4HPJA 5DFAA 2FZBA 5E0CA 1FWCC 1V6VA 4K2SA 3E96A 4GISA 4S3KA 2V81A 1VPXA 1CLXA 2PRLA 4AUBA 2P8BA 2DVTA 4HMCA 3WD0A 2QGYA 3T4CA 4AZHA 4GJIA 2YR1A 4MJ2A 2VX5A 2PLKA 3OBAA 1CZ1A 4H8NA 1YE6A 3DYOA 4KWVA 1XL9A 1UA3A 2WLZA 2QEZA 1UMYA 4NJKA 1UUOA 1WO2A 4LPCA 3OOQA 2WVVA 2ZUWA 3PTKA 1RR2A 3C86A 4R7WA 5CCZA 3MWAA 3KDOA 4XG1A 1WKFA 4WRHA 1J79A 1LT8A 1RALA 2D22A 2HXUA 1UG6A 5L9FA 3QEZA 3K8LA 2ZKMX 4KIEA 3IAPA 1JQVA 1JFXA 3CWHA 5DRCA 3SI9A 5A95A 3CASA 4QG8A 2VHLA 4B15A 4WDTA 4RE3A 4LAUA 3ID7A 4ATLA 3K4AA 3NFUA 4N4PA 3TOYA 1K6WA 1SZNA 4FOUA 1JCXA 1MUWA 4D6CA 2VD9A 1PTDA 3U5YA 1EYWA 1POKA 1VBHA 1GVYA 3H2AA 1T96A 1O95A 1TELA 4NILA 4CNTA 1TPDA 1FTXA 4O14A 3W38A 5EL1A 3RM4A 1FXQA 1ME7A 2GGIA 9RUBA 4W88A 1DWHM 2WV8A 5A6TC 2WPBA 3T40A 5HJXA 4EAYA 4UTUA 7TIMA 1KRAC 3BE7A 3N6HA 5BOFA 3I68A 3I3EA 3P8JA 4WD0A 3WG6A 1T40A 4KPLA 3RJXA 1ZJBA 2DQXA 2BTMA 1OFQA 1XIBA 4JCMA 3EWDA 3DYMA 3TX9A 1IXPA 4C5ZA 1WXZA 2CU0A 3SADA 3TMLA 4G5DA 3W1LA 1DBTA 1VBRA 3KCJA 4L61A 2PDYA 5ENLA 1LL4A 1A50A 1XI3A 1QFEA 2QCGA 3MC5A 4IZGA 3RMJA 5JBEA 3CV1A 1JNDA 5I00A 1YYAA 4F0KA 4DVOA 3TJLA 4CQCA 2A4AA 4LRSA 2HRWA 2ADAA 1ISXA 3AROA 2ZWYA 4B9ZA 2Y70A 3L5LA 4Z2HA 5K9CA 4POCA 1WZKA 2V3GA 1I0BA 3OA3A 2DUZA 3ITLA 4KWWA 4UQ9A 1WNOA 2J9ZA 4GACA 3AHXA 3LMZA 4PUJA 2WMIA 4LVBA 4KEVA 4MZ8A 3OBKA 4Q8TA 1EHAA 2OYKA 3S46A 3GNXA 3N73A 3HG3A 1Z3NA 3CWOX 1LL7A 2J74A 1RJPA 5A5WA 1S5MA 4HJFA 1US2A 3IV3A 5A94A 3OU8A 3IIOA 1MZHA 2VR2A 3EDJA 3KBJA 2FZ9A 3UVAA 4J9JA 3PK7A 4LJ3A 3WNMA 2Z1VA 1W9XA 2D0HA 3PUGA 1RJQA 3W6LA 3S5NA 2PCEA 1BEUA 5FESA 5K4XA 3VVGA 1NWTA 1DE6A 4GIEA 3SCNA 3U3HA 4IJCA 4QIUA 3BOFA 5LXXA 2GJXB 3R7MA 4NSBA 2XM1A 3ATZA 2AAMA 3CMGA 4JDYA 1EEXA 4YYCA 5U7SA 1XLGA 3CL7A 3TW9A 4UQBA 3H2CA 4XAPA 5D05A 1NF0A 3CM4A 2XVPA 4C6OA 2ZZ4A 7A3HA 4XZ9A 1ITQA 2PDLA 3ZT7A 3CL8A 2X8RA 3RF9A 3WEOA 4IISA 4EPBC 3P7YA 2XH2A 2JFEX 2CCRA 4B2DD 3H2FA 1YIXA 1I6NA 3O05A 4XX6A 1LLZA 1A80A 3CV7A 4I8DA 3SN0A 2E6AA 3C56A 4DJFA 3KE0A 2C8NA 3FOKA 4NNBA 3CZJA 1L0PA 5XIMA 4CVWA 3AJ7A 3QW3A 3QLLA 2WMKA 3TQKA 3AAMA 1PEZA 5CSRA 3W01A 3EGJA 1JCLA 1FHDA 3ES7A 1OF6A 3KLLA 3AJXA 2EPNA 3F1QA 2J7CA 3UNTA 1OB0A 1ZP4A 3W07A 2Y5JA 4DIAA 3WJWA 1H0IA 5FD0A 1W3KA 3KP1A 3S3GA 1W3NA 1DQWA 4WX2A 2YDRA 1VLWA 5D37A 1MW3A 2ISDA 1AA1B 2WZEA 4G7FA 4IIEA 3HU7A 5HNUA 3UJSA 1P48A 4Z2KA 4F2UA 1MQQA 3GNDA 3UXDA 5LA0A 1NSJA 1LZOA 2O9PA 3TC7A 3LMYA 2WKLA 1JPKA 3ENLA 1RD6A 1D2KA 3DFYA 4JTDA 1MEIA 4JX5A 4ZR8A 2OQHA 4BFAA 3VOHA 1RZMA 1SO6A 1ALDA 4ZTXA 1EEPA 4GWEA 5G1MA 3GG8A 3RM9A 4FNUA 4O17A 4CD8A 3UXLA 1XPYA 2ZYFA 2QNEA 2C79A 5T26A 2CZVA 4ZOBA 4EPEC 1HQTA 4RDYA 2INEA 2VQTA 1RPKA 4CVUA 3QMRA 4WR3A 4N02A 2F8QA 1H7WA 1XIGA 4L4PA 3NNTA 5J5DA 3SUWA 3DCPA 3IJ7A 2IPJA 1EWDA 1DORA 4UOJA 1ZQ5A 4L80A 4IX2A 2I17A 4Q4QA 1JCMP 1LQ2A 1TKKA 1KFEA 3M4HA 3OO2A 1JQXA 3NQMA 3UYCA 1FDYA 3PBVA 4JS3A 3IJDA 3VGFA 2J9XA 3C2YA 3AHZA 4R5EA 1ISWA 3WKZA 2HZGA 2OYMA 4QISA 4IPJA 3JS3A 2DH3A 3IUIA 3IJQA 1QHZA 1OGSA 3CAVA 3CYVA 2E6YA 4U10A 4ZL1A 2H3BA 3USBA 1I2PA 2VEGA 2X05A 5JBFA 2B7QA 1JCNA 3GNRA 3WL0A 4L56A 3ZVIA 1P1MA 2CYGA 1B4EA 2YL6A 1W1TA 4AXKA 3QZAA 1NQ6A 3EA2A 3W7JA 3WUBA 3W6YA 3ZWTA 2PSNA 1EXBA 1PHWA 1J12A 4MY8A 5EBUA 1Z48A 4FNTA 1VR6A 1UBPC 2Y89A 4JFWA 1ZS2A 1BVNP 4IGSA 3WQ8A 4K8HA 1UMLA 1M7PA 3KEHA 3W6MA 3NQGA 1MQRA 3W86A 3DKLA 3HQOA 2WZHA 2HVNA 3VUSA 3U0HA 3DI0A 2QV4A 3BSGA 3SQMA 4MSSA 1D8CA 3T1GA 2CBVA 3ITVA 4AVFA 3F7JA 1E6QM 3WH5A 1OFEA 4Q8VA 2YA1A 2GJXA 3APGA 4JHOA 3JUGA 6PTDA 4H04A 1Q45A 5AOUA 3GXIA 4HPXA 3RHGA 4NQ1A 4XIMA 2OX4A 3R89A 1VD6A 3VCCA 4W86A 2RHGA 1VP5A 3ABOA 5JUVA 1G4PA 5HXMA 4GI4A 1CGWA 3RAOA 4GNKB 2EPHA 2RFGA 4OWGA 1GNXA 4DJEC 1WYIA 3TFCA 3GZAA 4OZOA 4BCEA 1DWJM 3OLDA 2OT1A 1FWHC 4HTBA 3GVQA 5E0KA 3R10A 2CWNA 4QHRA 2GQ9A 3M6DA 1SW3A 5T91A 2D2OA 1US3A 1YNPA 4MZ1A 1KXTA 5L6UA 1T0OA 1R3WA 1W3JA 3ZMRA 4D9PA 4UTKA 3TU9A 3RITA 4IF2A 1M7JA 3NZ1A 1WKEA 1YPFA 2CXEA 3W71A 3EDEA 3CJPA 1GHRA 1GK8A 3SUUA 3U9IA 3A4XA 4MNMA 2PS2A 3S6TA 1F4AA 2G0WA 1A0DA 3OG3A 3M44A 3NL2A 2W67A 2VC6A 4NAEB 1NOWA 3W1XA 2G3NA 3WLIA 4DQWA 2XZ7A 1H7XA 2FH6A 3MSRA 4M6UA 3M64A 3N12A 1MYRA 3F4NA 2OSWA 1B54A 1E0TA 1EFZA 3OODA 4RNJA 2CWXA 3N9RA 1D3HA 4PMZA 3W7QA 3MVTA 3WQGA 4ZFMA 4XSLA 5HOSA 3PC0A 1R0MA 3ECQA 2RH9A 3SQLA 5KMYA 2VGBA 4A3RA 3NZQA 2ZUTA 5AHMA 2OOFA 2GQAA 3H7VA 3ZLHA 3POHA 4HA3A 3LBMA 1Q8JA 3NEVA 1Y8BA 4NJJA 5KITA 2NXHA 3NXFA 4LEQA 1KBIA 3M0VA 4D2JA 1WE5A 1SR0A 1XIHA 4PMOA 1PKNA 1MQPA 1Q8AA 1R30A 1PXGA 4D1JA 4DBSA 5HWMA 3VTRA 4HZ6A 3VMNA 4W4QA 4ADTA 4L64A 1EF3A 1C9WA 2O7QA 1V7AA 3W7RA 2FMOA 2QJGA 2CESA 4M6VA 1FOBA 2Z4GA 3NQVA 4HNLA 4AD5A 3IEBA 5FI8A 2J77A 4XAYA 3RCMA 2CIPA 5FJJA 1N8IA 4MY1A 3LLXA 4J3UA 1DL3A 4I9AA 3H54A 2A7NA 3GB6A 1KD0A 3LEPA 3UJ2A 3WNLA 3BC9A 4AAJA 2NX1A 1W3TA 4ZB2A 4UZSA 3A64A 1ZAHA 3EDDA 3EPOA 4UFMA 5C7HA 5I2UA 2VZUA 1BKSA 1VLIA 3ARWA 2CPUA 3S2JA 2W0UA 4LUYA 3BW3A 1IEWA 1UC5A 2JKPA 4DF0A 5LYRA 3NPUA 4Q8OA 2W66A 4DPPA 1LUCA 3STPA 2VC5A 2FJUB 3PB2A 3TYCA 1SUXA 2V0TA 3WIJA 1E6ZA 3OB8A 1RQHA 3ZT5A 2OWCA 3IAQA 3Q45A 3LD5A 3WK1A 2WSRA 2NVCA 4FNPA 2HJPA 4PB5A 3IGSA 1YBQB 3OLGA 1AQFA 3BCJA 3B3DA 3M43A 4AD3A 3FYOA 3GAYA 1H11A 4PFHA 2ALRA 4W7UA 2AQVA 4W9TA 4JTFA 4PFMA 4EE9A 1C8QA 1E4IA 4KMQA 3V7PA 4U33A 1Q6QA 1I1XA 4FF5A 2WMJA 1XLCA 2WJZA 3C3UA 1RY0A 1QUMA 1V0KA 4LEFA 3NYDA 3FYPA 1MW2A 3WD1A 3AALA 5DXYA 4QEHA 2BVDA 1LTDA 1LBFA 3W84A 1F3WA 2YZRA 3WDPP 2ZZ6A 3V0SA 2ZC1A 2A79A 5M1TA 2NSOA 4UXDA 1SJAA 4Q8QA 2XN1A 3CHEA 4W8LA 3FGCB 3KOFA 5D9PA 1UPPA 3VGGA 1R9XA 2NQLA 3O06A 3W23A 1N8WA 5DANA 1UKOA 2GYIA 5F4SA 1Z9AA 3NQ7A 2IS7A 1XYCA 4GFIA 5IBXC 5AYIA 3MJMA 1W3LA 2ZRZA 1B1YA 1GVSA 4NYUA 3BLOA 3SY5A 1X39A 5C70A 2F2KA 4HZMA 4AWEA 2ISVA 4GCAA 4GXPA 3F4DA 4M80A 4HNVA 4OBSA 2GGEA 3W2UA 2PTDA 5A6LA 2C18A 1R87A 1IZKA 4A35A 3V3WA 2E25A 1DTUA 1KKRA 2OEJA 1ONWA 3QOMA 5D09A 1YTEA 1B4KA 4V2XA 3AUJA 1TZZA 3WY1A 4Z1YA 2WMGA 4QROA 2DZVA 1MMFA 1LQ0A 1YDVA 1UUMA 2E9MA 2EGZA 2HNEA 2P0IA 2DZUA 3HOJA 4F2TA 3ABQA 4V1YA 2Y7DA 4FEZA 1GG0A 4I6VA 3PBUA 3CPUA 1J9YA 4NAEA 4RV8A 2OOGA 2Y5EA 3L5AA 3H2EA 3TTYA 1CXLA 3GLCA 2JALA 1U5HA 1WAWA 3NVDA 4LUTB 1FP8A 3LHTA 4Y7EA 4TUFA 4L4OA 5BXPA 2P3ZA 1M41A 3DC8A 1IT8A 1TYGA 3OHIA 4LAOA 4OTKA 3EKZA 5GNZA 1RBOB 4NYYA 2CKRA 4GI6A 4O11A 5AVHA 3NEHA 3A9BA 4N7QA 5FCZA 4MOZA 2D73A 4PRRA 3UR7A 3OVQA 1G9HA 3ZWSA 2HMCA 2YW4A 4KEMA 1EZ2A 4JPGA 2XGBA 4AU0A 3P2VA 3SRFA 4S3BA 3ARYA 4FAMA 1ZJIA 2QCDA 3UERA 3VOJA 3G22A 3EBVA 3P67A 4HK5A 1EKOA 3FLUA 2OGYA 3E12A 2ZRUA 3ARUA 2ZX6A 3CT7A 4LYPA 3CU2A 4XZIA 4OQVA 1TUFA 1JUBA 1SZEA 2NX3A 2G95A 2HCVA 4HA1A 1K8ZA 1PIFA 1DJNA 4MFDA 2YFNA 3F2CA 1CGVA 2VELA 3RDKA 2W63A 4P5UA 1SSGA 4PUKA 4IL0A 4K7VA 1G67A 1SO4A 4DF1A 3C52A 2VX7A 4HOXA 2VFFA 3PPCA 4I7WA 4R27A 3E2QA 1QK0A 2B7NA 4GQRA 3NR0A 1M53A 3WUEA 4PBGA 4LY8A 5D4YA 4NY2A 4JIIX 1B31A 3GVVA 3DEQA 4S1FA 5I07A 1C29A 3AXIA 5EMKA 4CD7A 4NNAA 2HDJA 1EPVA 2PLCA 3WLRA 3HPZA 4OT7A 2XVGA 3W2KA 2O0TA 3UESA 4ZO7A 2QDDA 1ZU8A 2PGWA 3ES8A 3UZXA 4DF2A 1NFBA 1ZP3A 3UBPC 1ZFJA 1JZ7A 1E71M 4GY7A 1YBQA 2G8ZA 1OHLA 3ZQ9A 3DZ1A 3N04A 4EF9A 1GORA 1E70M 3VOIA 1L6YA 1B2YA 1VFSA 2BY3A 2HNHA 3SB0A 1DJQA 1OF8A 4DYKA 3VNDA 1HJQA 1T8XA 4WLCA 2IQDA 4X0NA 4ZVJA 1GHSA 5E1QA 4GYKA 4ZQNA 3WNOA 5GJNA 2J78A 2DJXA 1EC8A 4OE7A 1EUAA 1OG0A 2ALDA 3B8DA 1SGJA 1FH9A 2R24A 3HGSA 1OK6A 1WDDA 4CQDA 4F0SA 1WAUA 2DZPA 2Q01A 3FGCA 4F40A 2PB1A 3NOYA 4TIMA 1OT1A 2ZA1A 1OD0A 1UWUA 3VOFA 3R0UA 3CWNA 4GYFA 4YLWA 3FS2A 5FL0A 5ABHA 3N25A 3R8GA 1DIOA 1L2UA 1JPIA 1VQTA 2XVNA 4MM1A 5D2YA 4NT0A 1BVWA 4HKPA 3QJAA 3MUIA 1US0A 1OABA 1UR8A 1TE1A 3RU6A 4R3UA 2C6QA 1FUYA 3RRAA 5AZ0A 1F76A 2W61A 3NQAA 4KS0A 1P7TB 3WLOA 1KRBC 2OXNA 1ONXA 3A3HA 1BLIA 1WBHA 2VXNA 1R3RA 1BTCA 3VGDA 1DVJA 4HU0A 3W3OA 4U2YA 4N0RA 1UR3M 2E28A 3FA5A 2XFWA 2VEKA 3KLKA 3O63A 4INFA 4M56A 1TJRA 1QT1A 2GGGA 1OYCA 1CTNA 5XINA 3S83A 1Q6GA 3TUUA 5TBOA 3KL5A 3T2PA 1JUKA 3KOZA 3AIEA 3BG9A 1FDJA 3B9DA 3H24A 4MLJA 3SCOA 4HCLA 3ARSA 2YDQA 3MUY1 2DVXA 2WVSA 4D6JA 3FYYA 1HF6A 1I9CB 1PO9A 3B4UA 4WSKA 2WBKA 2WAGA 4I7UA 2XSAA 3LTYA 2JBMA 3KL3A 2PWUA 4YMZA 3T78A 1SU5A 4GJ1A 3L0NA 1UR4A 1QTWA 1XGEA 4L6HA 3W1NA 2D2GA 1QI0A 4Q7IA 3Q58A 2A21A 5MF5A 3H22A 3L23A 3AMGA 5E5CA 1THFD 2PGEA 2WYSA 2D0FA 3HFTA 2G4JA 4AY7A 3K2GA 4W85A 1CGYA 1JJKA 3CAKA 1UROA 2NX9A 4RZ5A 2X0YA 3RPTA 3RX3A 3CLMA 3AQUA 4IPIA 1J18A 3FK4A 4MB3A 2ZVRA 1F61A 2VFEA 3CTLA 3IVTA 4DZ5A 3UWVA 1Q6FA 4LALA 4LSBA 5ABTA 4WK9A 1XINA 3CAWA 1VFTA 3KWSA 1KCLA 1X98A 1H1NA 5KEZA 4NZ5A 4O1BA 2XN0A 1UZDA 5HNNA 1PKYA 4G56A 3QZ6A 1EWEA 2J27A 2O4QA 3F4VA 3AMKA 5REQB 3KWXA 4LX4A 4PMQA 4DM2A 4FR6A 5MKGB 1I75A 2VCBA 1E3XA 3BOXA 3DFQA 5G1TA 3TYZA 2E68A 1HGYA 4IFRA 1KCZA 4CCCA 4L1GA 3FXYA 3VIFA 3UT0A 4L9YA 5JVLA 4GUHA 4DBUA 5FAGA 1O6IA 3VILA 4GO8A 3GIQA 3WLNA 3H12A 4REQB 4WOQA 2XIIA 2ZZ5A 3LX9A 1J6PA 4PE8A 5C9RA 4OOUA 1QNPA 2ZZ3A 4MUZA 1RCQA 1H1ZA 3JW7A 2G37A 4NZFA 4MWAB 1TZ9A 4A3YA 4IJRA 3VD9A 4QAIA 2X42A 3LGEA 5HQEA 4GINA 4K6AA 3Q2DA 1X6LA 4XTDA 4HJWA 1TV4A 1QW8A 3QVQA 3T0DA 3WK2A 4Z2JA 1XRTA 5XIAA 4PMNA 4JY9A 2C1HA 4YS1A 1FXPA 4W84A 3TP4A 3N34A 3W75A 1TVPA 2FB3A 4WDWA 5FF7A 3O6DA 3WQ4A 5I3JA 5ABGA 1AD4A 2YA0A 4R53A 4GVGA 5T8GA 3EDKA 1OZMA 3VE9A 1C92A 4BJHA 1E6XM 3MDWA 4EF8A 2NXGA 4ZODA 4YVXA 4JL2A 2VDHA 3TJIA 4AXNA 3TW6A 1LG1A 4MB1A 3LXCA 3GTXA 4PMUA 1FWTA 4WGXA 2VGGA 1Q6RA 7CGTA 2PI6A 4AVNA 4W7WA 1OG6A 4S3FA 3U8GA 4M7SA 1EH9A 1OADA 2B4GA 3ITGA 1QATA 2XIMA 1MNZA 2PBOA 2CLPA 4B5SA 2YBTA 2ZADA 4IFKA 1H41A 3DHUA 4IPLA 4US6A 5LNWA 1G4SA 2XTKA 1R3VA 2R1MA 3CO4A 3B0PA 3TQ0A 5EA9A 4Z1CA 4ZB0A 1UKSA 4XZNX 3P8IA 4B3LA 4W7VA 1E40A 3W9ZA 3V5OA 3GUWA 4JEJA 1W56A 4Y9NA 5LIUX 2J7DA 1E3ZA 1P7TA 3LGDA 3W82A 3AYTA 2VR5A 3B8IA 3WFAA 1M7OA 1C7TA 5TIMA 4I5XA 3UWYA 3C3NA 1X8CA 4BR1A 1PWMA 2XIBA 3LV6A 4ONVA 1TPVA 3GTIA 3FN9A 4M1BA 3W7EA 3ZR6A 1SZRA 4GQ0A 3MMWA 3RO6A 3WNPA 1A0EA 3ARVA 1PWLA 4D8AA 4Y90A 4GLEA 3NAVA 3H8AA 2GQ3A 3B03A 1XC4A 4C6FA 1WOAA 3M0YA 5DBTA 1TTJA 4GXWA 5DQPA 1DXFA 1QO5A 4WXZA 3UR2A 1OGGA 2Y8KA 2J79A 1Z7AA 2NV1A 5K7JA 2FZDA 2PDBA 4JYEA 3W1RA 5CZSA 2C15A 2E67A 1K7XA 3IK4A 3DFOA 1G7VA 2UY2A 2WNZA 5G4WA 3HM7A 4UTWA 1RA5A 1UR2A 3W88A 1PAMA 2A3AA 1RBLA 1A5MC 1KXVA 1ELSA 4A8NA 3T8LA 1CI1A 3LCGA 3LDVA 1PKLA 3GR7A 1AUSL 2PZ0A 4Z1DA 4GIAA 1QNRA 5H8UA 1PE1A 2BASA 3UJRA 3WF3A 4AVOA 2Z2BA 3BLIA 3LB0A 4QGCA 3BCDA 4UBPC 1E1EA 4BF5A 2ZTJA 2DDXA 1KV8A 2PTZA 2C13A 4RW3A 2XDFA 1AJZA 3W72A 2QCHA 3DU0A 3U6WA 2FGBA 4ZBCA 1EJTC 3DFTA 3IJ8A 1B57A 3EMZA 4BQ5A 2D23A 3TVAA 1TO3A 1TPH1 1NDWA 3KTCA 2G3FA 4XD5A 1TPFA 2XISA 3EOEA 3P60A 5C9UA 3LI1A 3RR4A 1R3YA 1FWFC 1IIHA 3CHVA 5DLCA 2A3EA 2XSBA 3WBWA 1DIEA 4TTUA 1OCBA 1XGDA 1B30A 2BBFA 2YBUA 1RQBA 2A85A 2V3EA 1DQUA 2HS8A 1NWRA 4JTGA 3RN6A 5HWJA 2QPUA 4REQA 3WD3A 4XKYB 1JZ8A 2KZHA 1F74A 3VNIA 2DZSA 4KKXA 4F9JA 4X9SA 1UIPA 3BLPX 4MWAA 3F5LA 1MDLA 3NSNA 2ABAA 1MFUA 3LHZA 3S1GA 2H3DA 2J7GA 2ZUNA 2G4FA 3ELFA 1SO3A 4P8VA 4GUJA 3TN4A 3PZQA 2BOGX 3BV7A 4HPNA 4GVIA 3T05A 2OB3A 3KW3A 1OCJA 4D72A 2QF7A 4CD4A 4GNJA 5CLTA 3ZLFA 5F2LA 4MNKA 2VDIA 4XD6A 4Q32A 4HBKA 1CXFA 3W1MA 1U30A 1JL8A 1XG4A 3AIUA 5A8QA 1WUEA 4ZMGA 2Z6JA 3T0BA 3SY1A 2GVJA 4UIOA 3CPRA 5M17A 3L4UA 4DLFA 4UUIA 1KTBA 1TWSA 1F6KA 4WY0A 2WMHA 1MWOA 3EZ4A 1KW1A 3UZWA 4TXEA 3IK2A 4IMGA 2X30A 4DAFA 5CGTA 1VBJA 1TJ2A 3O3RA 4ZQMA 3VMPA 4N4QA 3BAWA 3SCRA 1VCFA 4IIDA 3A3XA 4XZLX 1UD3A 3BLFA 1W31A 4W5ZA 2ZA2A 1IWAA 3E2VA 1XSIA 3CEUA 3ZSTA 4MKNA 3K8MA 1VYPX 1E51A 2VD8A 1HW6A 5LA2A 2E1DA 1PYFA 1FWJC 4ZSTA 5IOBA 1RSCA 2OWXA 5IHSA 4OV4A 1E9ZB 2RGLA 1O5QA 1C8YA 2WHKA 5FJIA 3G1YA 3U2OA 2WKJA 4WOZA 4KBXA 3S1WA 4H9MA 2QCNA 3M41A 3W26A 1U1UA 4O1EA 2HTMA 3GNOA 1NH6A 5AYXA 2VM8A 3VDHA 3U57A 3NJ3A 2WCSA 1KB3A 4HZ8A 1GVEA 3VK5A 2F61A 3W25A 1W9UA 2PDMA 1FKWA 3QFEA 1TV8A 3FAXA 5A69A 1Z32X 3HPFA 4LCQA 3M5YA 4RZ6A 1RXOB 4QSHA 1FWDC 5AHNA 2Z1BA 2ZX7A 3HIJA 2DORA 4MTVA 4B4HA 3FHAA 1JI1A 1GYLA 3G8EA 3BPWA 2WHLA 5E09A 2FTPA 3CQKA 1HKVA 4BHYA 2CZEA 3EYPA 4E38A 1W17A 3E0VA 1RLDA 5CZJA 5E9AA 1YDNA 4DHGA 1SJBA 3UR5A 1HL9A 3WLSA 3W1PA 4LVAA 3LLDA 4JTIA 3STCA 1KCXA 3QV6A 2DW6A 4JTUA 4MPKA 4OKDA 1NWUA 3HGJA 1YEYA 1E56A 1V6TA 3A4AA 1ZLPA 4QLLA 4BZYA 5I24A 2OTDA 3VABA 2PEVA 1AVAA 1NM9A 3T08A 1XSKA 2YL5A 4ZSUA 3W1QA 2DZBA 4N9EA 2OSYA 3PN8A 2PWDA 1BYDA 1JULA 1UWRA 3R8RA 2HS6A 4RUBA 1HG3A 5BWFA 1SW0A 2F38A 6ALDA 4ACZB 2J6XA 7ENLA 2ZXQA 3LHUA 4A8LA 1ME8A 4LQ1A 1XKYA 3OGSA 1VFFA 3A22A 3FVDA 1D3CA 2V5CA 4QFUA 2EO7A 5LA1A 3QV8A 4WZHA 1FH7A 1YQ2A 5AN7A 3MTWA 1F6PA 4IJBA 2P3EA 4F0MA 3AC0A 1N82A 2A3HA 2DJLA 4CD5A 4JKLA 1NFGA 3AISA 3KX6A 3SCWA 3WQ6A 4JIRA 5CBIA 1OX4B 3VKBA 2G3JA 1JYVA 4GC4A 4PODA 5D38A 3K13A 3FKRA 1ADDA 4PMJA 4FNRA 4JTQA 3MS8A 3GR4A 4Y9OA 1XDLA 1I1WA 2V6AA 1BVZA 1UWAA 1JGMA 3FDGA 4B5WA 4Z1BA 3NQFA 2QUUA 4GZJA 4HU3A 1X1NA 4CN6A 3H2NA 5FF4A 1TR1A 1BYBA 3P62A 1L6GA 2BOFX 1E6NA 3SM0A 3H7RA 1AQMA 4Y96A 4LY4A 3OG2A 1V6XA 3LENA 5HMEA 2A7RA 1JG9A 2POTA 3NQEA 2PMQA 3NSMA 2DVUA 4V28A 1FWWA 4C6PA 3B0UX 4E3TA 5TD4A 2ZA3A 5KTLA 5BNKA 4CN1A 1UKTA 4EIVA 2YA2A 1SZGA 3N9KA 3PZGA 4R7OA 4MHBA 3SQSA 2C16A 4I7VA 1JZ3A 2OPJA 4A29A 4J27A 1RH9A 4O19A 3THUA 1AQHA 1YKWA 4EWJA 2X1UA 2ZUVA 5FEXA 3SN4A 1CYGA 1CGUA 2YKKA 4DLMA 2VMFA 4TMCA 4IUOA 4UTMA 3COTA 1X96A 4JTSA 3RK8A 3KBNA 5AC6A 1E15A 1EZWA 3T07A 3LPFA 4HN8A 3HA1A 2GLKA 1TVNA 1WDPA 1LRTA 3ATYA 3PBWA 4KIRA 1CXIA 3MBFA 4TVDA 3K1DA 3E02A 1UP3A 3CAQA 3WEZA 2Z2UA 3Q4DA 4ROPA 1KTNA 3MHFA 4YVVA 4I5RA 4UTJA 1NVMA 2PDXA 4B3KA 2J9YA 1NWSA 4XB3A 4PC8A 1AMYA 5H8MA 4UR9A 2ONEA 4H6EA 1LM1A 4LB3A 4C91A 1W3IA 3BL3A 4C65A 4Q4OA 2DZAA 4HK6A 1V93A 4RNFA 5GNXA 5G4HC 1TJPA 2DU2A 1YDOA 1S2WA 4CNSA 1E43A 3L4TA 1GKRA 3FEQA 1H0GA 3QPYA 1RP8A 1ZJHA 1I0DA 1XUUA 2DFAA 5JH1A 2FFCA 3FA3A 3TLQA 4NZCA 1S1RA 1M5WA 3BOLA 5IBXA 2R6OA 4FPSA 4I8YA 4MJ4A 3MMUA 3VOCA 3FW6A 3BW2A 2CHNA 1F3XA 4WEVX 1GOQA 2XH7A 1WA3A 4JN8A 2CLKA 2XVKA 3A5FA 1T99A 2BGSA 1QI4A 4O4VA 1D7KA 2ZZ2A 4IXXA 4P7QA 2ZVIA 1OD8A 1XH2A 1TMLA 3EA3A 2Y88A 2WOQA 4IL2A 3LSCA 1NP0A 4OIFA 5A6JA 1ZZMA 1VCVA 4HHHA 1WPCA 1VC4A 1AW5A 4TX8A 1ENUA 1IHIA 3SCPA 3TYEA 4ACZA 1P4CA 1Z8AA 1JEZA 1X97A 4GK8A 2DQWA 4XZMX 3WEMA 4E6MA 3PF3A 1EA0A 1AW2A 1ADSA 3HURA 3B0XA 3GVWA 4UZUA 1EDGA 1D9EA 3GDKA 4GYJA 5F7UA 3FVMA 2ZE0A 3BGAA 1R3QA 2AL1A 2JQXA 3A5VA 2HXTA 3TV8A 2VGIA 4NZ1A 1MW1A 1FBAA 1M68A 1V51A 1VRXA 3KDNA 2V2DA 4QJ1A 1S2AA 1DWIM 3HV8A 4AEOA 3GU9A 1E72M 1OX4A 2Z00A 1BRLB 4HSOA 4HNUA 2ZX5A 4LS2A 5GQBA 4JIEA 2UWFA 2WCGA 1H63A 1MRQA 3KFTA 2BVTA 5FSDC 2CLLA 4QJ4B 1VPYA 3S6DA 3UYIA 5IM51 1HN1A 2X2YA 3PUEA 2WW5A 3E2RA 1OX6A 3MMDA 3S2NA 4LW7A 2OLHA 3G3DA 5KZ6A 1Y65A 2FDMA 4O15A 5MHBA 2YLLA 2DSWA 3PTQA 3VKAA 3NZPA 3H26A 1QMLA 1F3EA 2VURA 1WKDA 1H61A 1AJ0A 1FCVA 3WBYA 4HQVA 2NQZA 1LWIA 1YE4A 2Y7FA 1KRCC 4JQ1A 4I5UA 3BSMA 1W9PA 1EXPA 4HOWA 3VI2A 1X1OA 4IXHA 2WZIA 3S9YA 2WPGA 3EWCA 4A3UA 3MSDA 3R2GA 3BSHA 4KEUA 4IHCA 5A6BD 1FY6A 2P76A 5CC6A 2XIOA 3NQDA 1T5AA 2VZVA 4Z17A 1GONA 3KVMA 2VYOA 1G69A 1HXJA 3E0LA 9XIMA 1G94A 3F03K 2BY0A 3ALFA 2BS9A 1UOKA 5CSUA 1ONRA 5I3FA 2VC7A 4ICCX 3DG3A 4HVXA 2QCCA 1BWLA 4P2VA 1L8PA 2GSHA 4PCPA 4J3TA 2BB0A 4ES4A 1VPQA 2O92A 2P5NA 3NYZA 1V3HA 4LV9A 5BZAA 3VIOA 1QAPA 3SRDA 3KXQA 4X63A 1H51A 3WMLA 1XD0A 1VBUA 1X1ZA 4H6QA 2C0AA 1OGBA 5C0QA 1J0KA 4AX7A 1JUEA 1NIUA 3MWCA 5CXPA 4I9MA 2I56A 2EXOA 2XPKA 4E4FA 3IVSA 3L4ZA 4FK9A 3NQBA 1BGGA 1R86A 1SPQA 3LY0A 2TPSA 3GG1A 5HINA 1ZNNA 1GOXA 2QUTA 2FYMA 2GWGA 1LP6A 3P74A 3JR2A 3ANUA 3EX4A 1R2TA 2F9RA 3ANYA 3NG3A 1UD8A 1PZ1A 3VOGA 3TONA 1TQJA 4RL3A 1Q6EA 1OYAA 1YADA 3E0FA 1NQKA 1XYBA 3FNDA 3N3TA 1K3UA 3G8RA 3JZEA 1JPHA 1RPXA 1TMHA 1RP9A 3K1GA 1XLBA 3ZLGA 4PTNA 5AZ1A 2QCLA 1K4HA 5JQ9A 1WZLA 2O9RA 3M47A 4MF4A 3M0JA 1J8VA 5D32A 1A47A 4O1DA 1EBHA 3PZUA 3KL0A 3HJZA 3V16A 1UC4A 2J75A 1BF6A 4LVDA 3T0AA 4X0VA 1MW0A 5AC4A 7ODCA 5HQMA 3LSBA 4CNPA 3GR8A 1TWDA 2OT0A 4K38A 4L5ZA 1XDMA 4YTUA 1GYMA 2FVMA 1XRSA 3DUGA 3LCXA 1XUZA 2GJLA 3TYDA 8XIAA 4AYGA 3WZ0E 2H9AA 4GJJA 1A4MA 1TJ0A 3N4AA 3THAA 3IANA 3FIGA 5D30A 1VHCA 2VVNA 4GH3A 3C0LA 3IGHX 4FX7A 1UQYA 3S9ZA 5CJ5A 4LC8A 5FF2A 1UKPA 3SGGA 5U4NA 4YTRA 4V1XA 4WSHA 4AFYA 1DJZA 1VIZA 3D0CA 1F3TA 2PTYA 5BRBA 2QPXA 3EMCA 1E4LA 1EIBA 4AB4A 3S47A 4J3XA 1ITUA 2VC9A 4EXQA 1FVPA 5AY7A 4PRTA 4GVHA 1CGTA 4AZBA 4IWWA 4ERGA 4JD4A 1EDQA 1MRAA 5BRPA 4FOKA 5CSSA 5C7VA 1IIGA 4GOAA 2NT1A 1MVYA 1W1VA 3EDFA 1QR7A 4JTCA 4NG3A 1WOBA 1V3IA 4ZENA 2A5HA 1TWZA 2QUNA 1NOUA 1Q4WA 2WSPA 5IHRA 4AD2A 2FB2A 1A3WA 1VBGA 4Z0JA 2WNWA 1VFUA 2GVYA 3AYRA 3VFLA 3PTDA 4PZVA 3ZJ6A 3GDRA 1SJCA 1KBLA 2V63A 5FA5A 1UWQA 1PX3A 4UQDA 1IEVA 1P0KA 5DBUA 3QMTA 4HT3A 2JF6A 4AWSA 4V27A 3R0DA 2F84A 1V03A 4IQLA 1PCKA 3UWUA 3VD3A 2V82A 3QGKC 4W93A 4QEEA 1FWIC 5CG0A 5FEWA 4IPNB 4M82A 4FHAA 1B3XA 2ZDSA 2WXDM 4ZGYA 2IKHA 2WSQA 4D6GA 1UD6A 3H6OA 2IXVA 3PJXA 4IP5A 1DKWA 1NF7A 5M3WA 1FCUA 1K8YA 1H7PA 4DEFA 5PTDA 5BMWA 4PEKA 4M1RA 4OFCA 4FMVA 3PR2A 2FGZA 3W7NA 1JI2A 1OFOA 1V7YA 1AG1O 4UWMA 2Q02A 1P0NA 1W1B1 1QVBA 2CETA 5CC7A 2FJKA 3R12A 4AEFA 3MU7A 4B5NA 1I4NA 4BI7A 3S4TA 1FRBA 1G1YA 3BZJA 5DELA 3P82A 4FLRA 1TG7A 2PTWA 3M9YA 4GKTA 3SW6A 3HV9A 4L65A 5DCBA 5I06A 4Y9PA 4M19A 4N6FA 3WENA 3B8TA 3WFZA 1Q66A 3ITTA 2NUYA 3WNNA 2BXVA 3WUGA 4IIFA 1GKQA 4AH7A 3MUAA 2DZWA 4KGLA 4US5D 2BG5A 2PDKA 4LNYA 3SUVA 3MZ2A 2GJPA 1S5TA 3MHUA 4H9VA 1TTPA 5ECVA 5LIKX 4LNCA 1F8MA 1J0IA 1AL8A 1DXEA 3V18A 5A8GA 2ZCGA 1S2CA 4Q4MA 4QG6A 1VKFA 1DWGM 4F8XA 1IEIA 3CZ8A 1XICA 2DH2A 3TCSA 2W79A 2GUBA 2F6XA 3TYUA 1R2SA 3GXDA 3DH7A 4HNTA 3UWEA 2DZXA 3USZA 4BI5A 1M6JA 4WKHA 2Y4SA 3IJ9A 3H70A 1UYQA 3H4GA 2PD5A 3GFZA 3E5PA 3ME3A 4AG0A 2UBPC 3CZLA 2YDSA 1XLDA 3ORWA 3S8HA 3VCRA 3CQIA 4MADA 3JZUA 4LVGA 3L67A 4PUEA 4DO6A 5M2FX 5EY5A 4HIBA 1LQAA 2G50A 4FA3A 4B92A 4WJEA 2YCJA 5E70A 4CKQA 4MYXA 1RVGA 4AC7C 3VNLA 3KVLA 2X2GA 2WVUA 3M7SA 3EKLA 3F5JA 2BZNA 1P0DA 5G5IA 1VYRA 2D20A 3PPHA 5C9XA 5FACA 1SMAA 1GQNA 1LYXA 1WKYA 5HR6A 2A6NA 1H2JA 4RE0A 3B40A 1UASA 2HPIA 4A2SA 2ZE3A 4J3WA 2CBUA 4MIMA 4KESA 2Q6ZA 2RDXA 1KGWA 2ATMA 3WF1A 4YPJA 4UMCA 2IKGA 2V5LA 4DJDA 1I60A 5LSMA 2DIKA 3T44A 2YYTA 4UMBA 3V1HA 1EJXC 1ZBCA 3GW3A 5EBAA 2A3LA 4WJXA 1PSCA 2OELA 1JFHA 2VENA 3CIVA 4WF7A 2AQOA 4FLSA 3EX1A 3M5ZA 2NQ5A 3DN5A 3NQ6A 2BODX 5AKQA 3M5XA 5H6HA 3EXSA 1B90A 3KBWA 1W9DM 4RXFA 4PA8A 3SN1A 3G1VA 5CPMA 4BI6A 4DNHA 1FCBA 2R8WA 5B80A 1RA0A 3PZNA 3N2OA 4HD5A 1CB2A 3CV2A 3N9SA 3IARA 1MSSA 4JIPA 4DZHA 2FH8A 3PAJA 4UB9A 3U48A 4H9XA 1HFBA 5JXQA 4S39A 4L1WA 3IV8A 5I3GA 1TQXA 2Z24A 1VEOA 4GIYA 1BTMA 1UIOA 2AGTA 5FJTA 1EGVA 1K03A 4C60A 1IXOA 3VC6A 2IQ0A 4OV9A 5A6AA 3PJTA 2O9TA 3IJLA 1KA9F 2QIIA 1FHUA 3XISA 1LBMA 4PCFA 2WZMA 4DJED 1M1BA 3LTSA 4CCZA 4QBXA 4NI8A 3ABRA 1L8NA 4EACA 2OEMA 2ICSA 5EMYA 4IMEA 3CO8A 4O57A 1JDEA 1PX4A 3LG3A 3WH7A 3UGRA 3HO8A 1IZCA 4O1AA 1AQ0A 1QI2A 1TUXA 1J0HA 3UCCA 1SFLA 3A6OA 2O4MA 3R79A 1H7RA 4QCFA 1SSDA 2A1YA 3PBMA 5LIYX 4XV0A 4NJGA 2TAAA 3HQ1A 1ZPTA 1KM5A 2Y1HA 1KR1A 2A7PA 4EXAA 2ISFA 2UY4A 3W83A 4E8DA 3IJ6A 1REQB 4O12A 1WV2A 1Y5VA 5C5YA 4HU8A 1MXGA 1DXIA 1KQYA 1FWBC 2INFA 3NDOA 4L9ZA 2YCLA 2BV9A 5CKSA 1ZCCA 4XD4A 1QNQA 2VX4A 4E2OA 2YOCA 4EP8C 5A2BA 1VJIA 2FZMA 2PWEA 3GY1A 5G4EA 1BPLB 3V5CA 2C0HA 4ZOAA 3U7VA 4GPNA 3T42A 2OLSA 4Y8FA 3SCSA 2IPFA 4QAWA 4QNEA 2J8FA 3T8QA 2IKJA 3WD4A 1XF0A 2X16A 4UNLA 1XYLA 1HJVA 5HK4A 1KNWA 3C2VA 1IEXA 4BS0A 2GOKA 5LKYA 3KOYA 2GGHA 1PTAA 3G5EA 3NPWA 2OQYA 1XRFA 2NWSA 3W7IA 4LCSA 2PA6A 2REQB 1TTQA 1V6YA 3IUHA 4Q4PA 4QE1A 1VZWA 4K8EA 3MCOA 4IQEA 1EP1A 4GBDA 1E9LA 4JKMA 4LWWA 2XH0A 4YN5A 3GDLA 4JQ3A 4K39A 4AF0B 3GH7A 2CLFA 1S1PA 4F66A 3KRBA 4LANA 5CPOA 4CQAA 3WELA 4TV5A 4YVPA 3GG7A 3ITOA 3MCMA 5I03A 3OGVA 4F4RA 1KM6A 2WHJA 2ZRYA 3TMQA 4EPDC 3THQA 4H1ZA 5LGXA 5K9XA 4OHQA 1N2VA 1TPB1 4UTWC 2WM1A 3T9PA 5AYZA 2YSWA 3DOPA 1JIBA 1C8VA 1HJSA 4L4LA 4M5PA 3ZSSA 1EDTA 3OP2A 1O68A 3HGRA 3R11A 3HG5A 2BHUA 1GGOA 4V33A 2H6RA 3LNMA 3LCLA 1DPMA 3OIXA 3QPEA 1KBKA 2DUXA 3TZFA 1J93A 1UB3A 4PMXA 4KWSA 5KINA 2XN2A 4NL1A 4O1CA 3SCUA 3VXGA 1AH4A 1OWQA 6REQB 3KVKA 1W91A 2AQWA 3W7GA 1A5LC 5HBFA 3BW4A 3M07A 3ITXA 1ML1A 2CNCA 3VIMA 1EF2A 4LTSA 4MJZA 1BSIA 4B2DA 3AIQA 3BGGA 2CHRA 3SUSA 1KFWA 1VCGA 3QHMA 2VCCA 3PSVA 4W5UA 3EB2A 2FHBA 4WGHA 3PZMA 3WDIA 1C7SA 5EU9A 4FP1A 1ME9A 2PRMA 3WLHA 2OFJA 3ONCA 2VZOA 5CC3A 4IIHA 4C1NB 1V8EA 3NQ2A 3CUXA 4BQ2A 2NQ9A 2OG9A 1E1FA 1H09A 4IIBA 3SJNA 1JR1A 1Z44A 1OVDA 3P80A 1V79A 3CUIA 1IR1A 4MG4A 5KZDA 2DUAA 4MWAC 2EAWA 4W8AA 1W5NA 3I7SA 3E0WA 3OW1A 3G0SA 3LUTA 2JIEA 1G01A 4EOUA 5DMYA 1BHGA 2GFTA 3BVJA 3ZO9A 1A5KC 1FFRA 3HQPA 3EX3A 3VNZA 1W1YA 4CLMA 4MFEA 2PZNA 2E5BA 1YXYA 3DGBA 5K2ZA 4S23A 3GNPA 1R6WA 1U33A 1V3MA 5BOEA 1M65A 2E6FA 4I9TA 3LI0A 4L7ZA 3IJIA 5HPOA 4N42A 3L4XA 4AD0A 5DMMA 1MDRA 1RUSA 1F5ZA 1QJWA 5FL1A 1W8SA 4H9UA 3K4DA 1X6NA 3CB3A 4DZIA 1GOKA 1REQA 2I5IA 1Q3NA 3VAVA 2A2IA 4KETA 1B3WA 4QDWA 4RW5A 2QVHA 4QCEA 3GXPA 3NIYA 4H83A 1XWYA 4WY0F 4JTTA 3AXXA 1Q7QA 3N18A 4EANA 2OSXA 3NDZA 2Q09A 1SYTA 1TX0A 1Y7VA 5AC5A 3BTNA 5DCDA 5GNYA 4YTTA 3NUKA 2XWDA 4UCGA 1L6SA 5BOOA 4LVFA 3D46A 1K9DA 4CCEA 4RXGA 4NRSA 3OLEA 2GSJA 2QAFA 4UFJA 5EMLA 1E55A 2F6KA 3A13A 5DY2A 1K9FA 2MANA 2RGMA 1FWRA 1X8FA 3APYA 3AZTA 1DHKA 1E9IA 1XYFA 1VHNA 2YW3A 1ISVA 1QOXA 2OQLA 3NDYA 3VYLA 1JXJA 1GG1A 4IPPA 3W27A 3ZOAA 4H00A 1V0LA 2PF8A 4IGHA 4IGMA 3WF0A 5IXEA 1RV8A 4HA4A 2QR6A 1GZ1A 2PP3A 4TX6A 4X61A 3MUCA 1DIKA 1ODZA 3LBCA 3URBA 3LQLA 3HMJG 5A2CA 2P1FA 4LU0A 2YL8A 4AQLA 1K8XA 3G1SA 3ARRA 3TTOA 1TRIA 5LGZA 1KXHA 4DO4A 3HFYA 4UTTA 3RCNA 1W32A 3GNNA 3GSMA 3UCDA 3R13A 4FLOA 4P8WA 3W53A 2Q8XA 4XAFA 1GQLA 5K9DA 3TN3A 1BXBA 2CZDA 2H8ZA 2RJHA 3DG7A 3NM3A 4UTIA 1RQEA 3GTHA 2PU0A 1POJA 2QDHA 3WMSA 3M1ZA 1E0WA 4PUDA 2J7HA 5HANA 2I16A 1UH4A 1XCXA 4X3ZA 3W2MA 4WKFA 3VU2A 1S46A 1UZHA 1QI5A 4H6RA 4AX6A 3L66A 1CEOA 3FJLA 4AMCA 3TQPA 3QY8A 3LOTA 3F2DA 2D0GA 2RAGA 4U3CA 2QIWA 1LF1A 2ZBTA 4HZ7A 4D8LA 2FVLA 3UWWA 3IIZA 4HK7A 3L7RA 1JDFA 3G77A 2Y63A 3S1XA 3WBEA 6REQA 1I2NA 2GDVA 2HVOA 1J11A 3W02A 3EB3A 3PVFA 2PDPA 3ERPA 3MKKA 4YHEA 3MANA 1XD1A 3TYBA 3AS2A 4C6MA 4H6KA 2DSUA 1ESWA 4JL1A 3BMVA 3BMWA 3SCTA 4IICA 2QJHA 1NJJA 4MB5A 3G0XA 4W8BA 2X7VA 1DHPA 1ZJAA 4A8IA 4EX4A 3WBXA 2V3DA 1BQCA 4FIQA 1HKIA 3A9IA 3BK0A 3B8SA 3GYCA 1KKOA 4DO7A 1F73A 3CUFA 1NP2A 1SMDA 3WQEA 4NZ3A 3NZRA 2HPMA 2WSYA 2IPWA 2WJDA 3OLIA 1GT8A 4E2BA 4X2PA 4GQQA 4XWUA 1R47A 1W9BM 1YPXA 3ICJA 3QBUA 4OBRA 1QASA 2VKZG 1VENA 2C3ZA 1P6CA 4O16A 3QRHA 3QGAC 2DIJA 1EJVC 2OODA 4J3SA 5I3HA 3TSBA 2ZTKA 1U1JA 1VEMA 1QCWA 3FFSA 3NOEA 4Z2IA 4MGGA 1RY8A 3L21A 3O16A 4JFVA 1MUMA 4A05A 1WXYA 4PCNA 2Z27A 4UQEA 3S9IA 2FZNA 2QVNA 4HB7A 2OO6A 4X9YA 5EFDA 2YJQA 3PZOA 3HMCA 1H3GA 3TJ4A 3IVUA 3DESA 3VIIA 3LQGA 4LBSA 4LYQA 4RR4A 1AJ2A 3A12A 4H8UA 3M7WA 3PJUA 4Q3MA 3GBEA 4CEXC 3GFYA 1DP0A 4AZGA 4OU1A 2CZFA 3GU1A 3VDBA 1Q13A 1LG2A 2ZC8A 2QYGA 3CMFA 3FSUA 4JY8A 4RZBA 1S5WA 1OY0A 3BXWA 5M03A 3RG6A 3P14A 1UOZA 4GE8A 2O55A 3FKKA 4LH8A 1A0CA 4LAKA 3TKFA 4D6DA 1VEPA 1PYMA 5F2GA 2D69A 3S42A 1R38A 5BXTA 4GY1A 5HDRA 3BJFA 1OINA 1S2UA 1AH0A 3ABSA 5ABEA 2GK1B 3LLFA 4CNOA 4H3DA 1C9DA 5DMNA 2XSXA 3OYZA 3URNA 4C5YA 4HPGA 1EA9C 2V68A 3AS3A 1QOPA 3KCOA 4C6DA 5GJMA 2ZUUA 4QM1A 2NV2A 3OZPA 1FP9A 1PPIA 4JICA 3KS5A 4O18A 2ZX9A 4PGLA 3U5UA 3VGBA 3W2LA 4J1OA 2DT1A 4P61A 4M7TA 3KZPA 1O12A 1SM9A 4I9JA 5A1AA 2E9LA 1YPIA 2X1SA 4JNYA 2BHYA 2AAAA 3RMEA 1EC7A 2WVVB 3DBNA 1O1HA 5CC5A 2QJIA 4YIWA 3TZNA 2BFGA 5IDZA 1XIIA 3LNPA 4GD0A 2IMRA 4RNIA 1JPDX 4OBTA 2WCAA 9XIAA 1I2OA 3BLKA 2QXWA 3G3MA 3UU0A 1ITCA 2WO5A 5KZEA 4JHZA 3UVIA 1D7FA 4DB7A 1WZAA 1VAHA 4N9BA 4C6CA 6CGTA 1K7EA 3QZEA 2ZUMA 3LRLA 2R1PA 3S6OA 3V5FA 1H62A 1GZGA 3K8KA 3PG8A 3HTWA 3ZIZA 3DX5A 3BLLA 3VX1A 1UJQA 4Y9AA 3C4UA 1KFKA 3GW0A 3GVRA 3RLVA 3BG3A 1ODUA 2CBJA 2ODOA 3BZGA 4TOQA 4K68A 1CCWB 2OZ3A 1CXKA 5T9BG 4UQCA 2VUNA 3C8NA 3WJZA 4ADSA 3N2TA 1MO0A 1XQLA 4O8RA 3STGA 4O8AA 3VIGA 1GVOA 3UNDA 3UZZA 3SEPA 1S5VA 1GPFA 3ARQA 4IIGA 4XZWA 5FKYA 4S3CA 1NDVA 3WUFA 2OR2A 3XINA 1HVXA 3AS1A 4LCRA 2PP0A 4G6CA 4JKKA 3VUPA 3UY7A 1V6WA 3WQVA 1X7FA 2POZA 2GDUA 4PB3A 3OPSA 2OLAA 4A21A 3KTXA 1Z89A 3BG5A 1XYAA 3NQCA 3WDJA 3GDMA 4K36A 1PVNA 4OUIA 1H5VA 2OJPA 5F2IA 5LIXX 2ZXBA 1XSJA 2WJFA 1FWNA 3G1AA 4PSPA 2CLIA 4Q4KA 1MEHA 3A3WA 1H4PA 1E6RA 3BAYA 4GA8A 1OFAA 1VFHA 3N11A 1JZ2A 4ZO9A 1S2VA 3ZJKA 5EB8A 3NM1A 5E93A 1XFCA 2I57A 1H5YA 1OEPA 3ARPA 3M6YA 1QNVA 3U2ZA 4H8HA 3NO3A 1Q5MA 1HGWA 4GC3A 4H2CA 1EQCA 3PM6A 3O6YX 1J2BA 2QHAA 4R33A 1BFNA 2DGAA 4CD6A 3PNUA 1H1YA 3GYEA 3EMQA 4BEUA 5HWNA 4EKJA 1OFPA 4K3ZA 1J5TA 1UR9A 3MI6A 3O15A 3NCOA 2EPMX 2E5CA 2FHFA 1HIZA 1C91A 2ZWZA 4ERAA 2INZA 4Z1AA 2VRJA 1B5TA 2XIQA 4PUWA 5CZTA 4XAGA 1QI3A 5H91A 3WSUA 3OIHA 2V3FA 4OUEA 1AL7A 3UF9A 4BF9A 1JDDA 5CGMA 3AXHA 3S5YA 3LHYA 4S3DA 1JAEA 2J62A 4CEUC 3UJEA 3NWRA 2QS8A 3W81A 4XO6A 3NL3A 1AODA 4ATDA 2J4GA 3CEPA 4KT2A 3PZ9A 4TTGA 1X38A 3LHWA 3WDRA 3LCHA 1B9BA 3RNDA 5RUBA 3VKKA 2UV8G 2PDIA 1ZAIA 1GPWA 2FTYA 2VEIA 2GZXA 3BUVA 3GO2A 3G1DA 2QQ6A 1DOSA 5A8NA 5K3VA 4C1KA 1YTKA 2V30A 4CUCA 4PMRA 1WP6A 5I02A 3UXAA 5I09A 3U2CA 2FPYA 2Z1KA 5A3HA 1HL2A 3N3MA 4QDPA 4Z2LA 4Q22A 4KCVA 3D6NA 4MAVA 5F2MA 3QM3A 4TO8A 3OJGA 3EXTA 2J7EA 4JAWA 1IZJA 4F2BA 2TMDA 4ML9A 3I3BA 2YB4A 5EGRA 3KHDA 5DCEA 5J8LA 4FNQA 2B31A 3PUDA 1R7OA 1WXJA 3AU6A 3ITYA 1GJWA 2I14A 3UG8A 3RJYA 3ALGA 2RJGA 5EMMA 3B4YA 2QT3A 2PLMA 4HNNA 1YTDA 3QSRA 5C54A 3EWBX 1N7KA 1UCWA 3PWIA 4Q8PA 2HWGA 1D8WA 4R88A 1U5JA 3PPGA 1B9ZA 3L65A 2NT0A 1VGAA 3WFLA 4M81A 4DI8A 4WXYA 5CLWA 1XW8A 3O8AA 2OKTA 3CH0A 2Y0FA 4PYSA 4EXBA 1DE5A 5IRPA 1OJXA 1VJSA 2Q3RA 4GQBA 3RR1A 5CJMA 2ASHA 4A3QA 4HA0A 1TV7A 1TE6A 1XCFA 2HROA 1S39A 2LLEA 4NNCA 1SFSA 3D47A 3SRHA 3MKCA 4KWUA 1ICPA 3UPMA 3MVIA 1GYNA 2DIEA 1TX2A 3N2MA 3CL6A 5ECUA 3MMTA 4LUTA 3O9NA 2EKCA 3PSWA 3SECA 3NGJA 4HNCA 1V6UA 3BMXA 1E0UA 7XIMA 2XUCA 4H9YA 3HPXA 2BXZA 2E0PA 3UP8A 1A5BA 3HG4A 1Q65A 1CENA 4V15A 4PMYA 4PUMA 5T9CE 3OQ8A 2ZRXA 2Z1WA 4N6EA 1EHNA 4ORIA 5LIWX 3W70A 5D2VA 4F0HA 3BAKA 2ON3A 4Q8UA 1NEYA 4UOZA 1JVNA 4CN4A 3VO0A 3EPNA 4C6LA 3II1A 1P5BA 4BEQA 1K1DA 2A3BA 3IPWA 2QPSA 1XS2A 3LPGA 2ABBA 3KHJA 1TZ7A 3FJ4A 4R34A 5C8BB 4B5XA 2YCIX 3AIWA 1K02A 1YNQA 3S5OA 3KOWA 3QQWA 2WNQA 2XFYA 4Z2GA 1XLJA 4LYKA 1K8CA 2Q3OA 4LB4A 4N9DA 1E4NA 1MFVA 4MKVA 3ANVA 2RDUA 5JIPA 1Y5XA 2XYLA 1C8XA 3WLLA 2G96A 4O52A 3F2BA 1HTIA 3K5XA 4AWUA 1GJPA 1R85A 2CBIA 2HK0A 3GH4A 1TJ1A 3E2SA 4DN1A 3UZ5A 1LRNA 5AC7A 2A3CA 4ADUA 3VMOA 1CX9A 3N2CA 1XCWA 2DT2A 3WQDA 2FQIA 2PTXA 2PWFA 4M6PA 3BQ5A 2AGKA 3NTYA 1V3LA 3AWOA 2NVAA 4IP7A 1RD5A 2BOEX 2BHZA 4OOZA 3AOFA 3E0IA 3SURA 3W1AA 3CH9A 4H8VA 2C14A 2BY2A 3OYXA 4DJFD 4XBJA 2PAJA 4LAZA 5LZLA 4GG9A 1CLVA 3R1ZA 4H7CA 3TNBA 2DY3A 4L1XA 2HV5A 1GEHA 1UR0A 1V02E 1K70A 1SR9A 2Q8LA 3EWUA 2PWGA 3OBEA 1CNVA 1DJIA 1S3HA 4AZIA 2B7OA 3LERA 4XKMA 5CBBA 1W54A 3OVRA 4DYEA 5BMXA 3GBDA 3GDBA 1FHVA 2X0SA 1KWKA 3GKAA 3N2BA 3TTQA 1Z6KA 5HMSA 2YGYA 3KRUA 4L6DA 3RYSA 1V0MA 2OYLA 4GCXA 1WUFA 1QWGA 3ZJ8A 2XFRA 4BWLC 5BXRA 1OCNA 4OGZA 3H55A 1TIWA 2R1NA 3P93A 3WJXA 1IE7C 1QPNA 4PBFA 1NTHA 3NSXA 2OWWA 3T09A 4RJEA 5A6SA 3N15A 1EP2A 2ZXAA 1XIFA 4GYPC 1XM3A 4O4WA 4AWTA 5CPNA 2FTWA 3CC1A 1GOMA 4JXCA 4B16A 3PJWA 1MXDA 1O94A 1XC6A 4JQAA 1R7AA 1TPUA 1I8JA 4UTLA 6XIAA 3MCNA 2PBGA 4NI3A 4HMNA 3HN3A 2EPLX 4XISA 4MWAE 4LGXA 4Z0SA 4XAZA 1ZBVA 3CQHA 3V0UA 2FHCA 1VS1A 8XIMA 2DSKA 1F6YA 3SZ8A 5B7YA 1MZRA 3C2OA 3B9EA 3GTFA 1EPXA 5J04A 1EUNA 4Q6XA 4DWDA 3B0YA 2WC4A 4NZJA 4NASA 2E77A 4O13A 2D3NA 1TWWA 5HR7A 3KZSA 3EOLA 3AIBA 3AIVA 1FKXA 2IW0A 5I78A 4O0ZA 4W89A 3BV4A 4Q33A 3L9CA 2QGHA 3H23A 1CECA 1DTNA 1UBSA 1WCGA 3ONBA 4RDWA 1UD5A 4QJ5B 4DI9A 4D6HA 2QDGA 2DT3A 1LT7A 4KFPA 2QAPA 4HU4A 2FLIA 4UTHA 2E09A 1UH2A 4B5VA 4IMAA 4UC5A 1LWJA 3L5MA 2WANA 2HE5A 1HJXA 2W3ZA 2VQUA 3LHVA 1YXCA 4HHMA 4RE2A 1EJUC 1K77A 2GUYA 2QMKA 2V69A 3WLMA 1LOSA 1GTEA 3WQFA 2QLYA 2E7FA 4DAIA 4JN7A 4DJDC 1FWSA 9CGTA 4H19A 3UXIA 8RUCA 3G1FA 3P81A 4CQBA 5DEZA 1XBVA 1PUDA 4AIOA 1DIDA 1LLWA 3EX6A 3N29A 3NGFA 1S38A 4MMWA 3AIRA 1BF2A 3W7KA 1JZ6A 2VJXA 1UZ1A 4IMCA 3L0GA 4GX9A 3QR1A 3RXZA 1W0MA 3ABZA 2P50A 1V02A 1ITXA 1LUCB 3TQVA 3CPGA 3SJ3A 1A5AA 4A8RA 2V2CA 4ZXLA 1XDJA 2E1WA 3ZT6A 2PGFA 2A6LA 1W1A1 3OVPA 4ECLA 3HGOA 3P5ZA 3C0SA 2WZTA 4ICMA 2XZ9A 2P53A 2QW5A 1RJRA 1IQ8A 4NX5A 4BKNA 1BXNA 3PG9A 4ROQA 5JBDA 4JTJA 1Q7MA 1KLZA 3CQJA 5REQA 4S2BA 5D2WA 1PTGA 1OSEA 5BROA 5MKGA 1M03A 2NZLA 3RGTA 3TEVA 2SFPA 4KRUA 5KSWA 4FX8A 1RCOB 3QQ1A 1EJRC 1R5YA 1TFVA 3TSDA 4DELA 3VZZA 2Y62A 4FXRA 5CZ0A 4ZXOA 4BY3A 2XM2A 2GPTA 3A47A 3NVTA 3V36A 1GW9A 4H7VA 1JAKA 3VDCA 4LOCA 4OVXA 3TDFA 3IIPA 2YFOA 4RCXA 4ZE4A 1J0JA 4HHLA 4DUXA 3AXMA 4Y8EA 5C2GA 4G8TA 1W1ZA 4WUIA 3TAOA 1GQJA 2X1IA 4PUNA 2WSKA 4C6IA 3D5HA 3L2LA 4FLQA 2I5QA 2E6DA 2W4XA 3WDHA 3UZYA 1EL3A 5I5RA 3RUBL 4LFYA 3PZTA 4ATWA 1IWPA 4PN2A 4F3HA 1GUVA 3EOUA 3OGRA 3N6JA 5EPDA 3R58A 4Q4RA 2JK2A 2Z25A 2QF8A 4E8CA 3UY8A 2R9RA 3WQPA 1QHPA 4ZO6A 4YJ5A 2CERA 2WM0A 3MO7A 4WCJA 4M29A 2Y8VA 2HEJA 4TMBA 4B5TA 1RVKA 2BVYA 2PODA 1QHOA 1IEQA 1ZENA 1CBGA 2HBVA 5HUPA 1AZ1A 3QXBA 1VF8A 4PTXA 3MBDA 2NXIA 3WDQA 3B9AA 2VFGA 3N14A 2CLOA 4O28A 4DWSB 2WC7A 5H1WA 3N1AA 3OQEA 2FPTA 3DC0A 2VUYA 3IWPA 1YW1A 3B06A 4XZBA 3ZXWA 5AB3A 2JEQA 1WDWA 1IT0A 3G6LA 4HHPA 1LDCA 2WQDA 2JIWA 2TSYA 2L5HA 3GHTA 4E3VA 1HL8A 1M7XA 3QKEA 2RDWA 3Q94A 2PDJA 3ARTA 3DHDA 1SJDA 3PTMA 4NUWA 1EO5A 1LWHA 2C1GA 2J25A 1L6FA 4Q7BA 1IXNA 3UETA 4MB4A 3LXBA 5C9ZA 1JF6A 2AL2B 4KWOA 4KH2A 4FALA 4KEZA 2VWTA 1JGIA 2IXUA 3KM8A 3UCQA 5I23A 2PLJA 5FF0A 1X6UA 3G18A 5LXEA 2XINA 1S5NA 1UR1A 2QCDB 1M9HA 4DXKA 3EWZA 1GVFA 3VNJA 3UQNA 1LORA 4J5NA 4TX9A 3UWQA 3A23A 2H8XA 2QCFA 4JGDA 4M51A 3FX4A 3T55A 4GRSA 1G7UA 4J3VA 5TAOA 4CU7A 3QSTA 4DRSA 4QLKA 3QC3A 1LJYA 1AK5A 3BARA 2ACUA 2DV0A 3DKJA 1PL9A 3OHMB 3AMCA 1QRQA 4AIEA 2PU1A 2O7SA 2V8ZA 5CH9A 4JTLA 2HQAA 1GTHA 2IQTA 3R6IA 1PZ0A 1A5UA 1BGAA 1BXCA 4PH6A 3N2XA 4U3AA 3PZIA 4JTEA 4AZ5A 6ENLA 3OZYA 3BURA 3AHVA 3EB4A 1ONEA 4BF7A 4MY9A 3MJYA 2I5GA 1EB3A 1PIIA 5HA7A 4GI9A 1RK5A 2VEFA 5D9MA 2EF9A 3TXVA 1ZB5A 5CQ1A 2PDNA 3GH5A 2QZRA 5FF3A 1KR0A 2WQPA 3N17A 3DDMA 1O66A 3W85A 5TF0A 1L9WA 4B5UA 3NXLA 2GQ8A 4F48A 1OX5A 3DG6A 1UPMB 3PBYA 1PDYA 1GJUA 4HSHA 3UA3A 1KFLA 1K9TA 4LUJA 3U2EA 1JCJA 1GW1A 1C93A 2PGRA 1ECEA 4NF7A 2HSAA 2ACSA 2WMFA 3TIMA 2PDHA 4ZQPA 1HVQA 1IGSA 1UZ4A 2OU4A 3PFMA 2XGZA 1O7AA 3QHNA 3EWYA 1XFBA 3MA8A 6A3HA 1JXKA 4M3PA 3PP7A 4XBKA 1DJHA 3VM5A 2IUZA 4XKYA 4QNWA 1FDZA 3H4XA 2C91A 4PR4A 4WDUA 3S2MA 4LUSB 4CU8A 4I3GA 1QPOA 4R9OA 4AHOA 3K4WA 1A5SA 5A8OA 2OGJA 1A53A 3IIVA 3B8WA 2BGNE 3VKDA 2PCQA 3DAQA 3TNOA 2J47A 5F1VA 2VRKA 3G0UA 5HMFA 4WKAA 4GUFA 2YB1A 1QNOA 3TTEA 3W2NA 4J2MA 3LCIA 3KS6A 1S3TC 4JIHA 5FSEC 3W37A 4DWSD 1V4YA 3ZZ1A 1UWTA 3W7LA 3TC6A 1UHVA 1ICSA 1AW1A 3AU2A 3E6EA 3GXFA 3MUZ1 2E40A 1TCDA 3W4RA 4GX8A 4JCLA 3E1F1 4MAZA 3AZRA 2OEKA 1TPWA 2XWEA 2GGJA 2GL5A 3AI0A 4ALDA 1HKWA 2J24A 3A4WA 5CEWA 1XIMA 3MY9A 3E3HA 2Y6ZA 4ZEPA 3SUTA 1ZSXA 2BX7A 3SY8A 3ZM8A 4C90A 4H7ZA 4FOJA 4O50A 1HO1A 4U2ZA 3W1UA 2ACRA 4DWSA 3CUHA 3UEQA 2YPIA 3RFAA 1FA2A 3M16A 1EQPA 3CB8A 3PWAA 4KGJA 1RLCL 3WH9A 2D24A 4MJMA 1JYNA 2ATSA 1RBAA 1SFTA 4GMEA 4XBSA 5FJPA 3CV6A 1FH8A 3VIKA 3R4IA 3T7VA 4XUYA 3VZXA 3ZR5A 2NLYA 1YMYA 1QOQA 4YTSA 3THCA 2VOMA 5D9OA 4LBUA 4CGTA 4FB7A 2QULA 3S2CA 2FPVA 4NU7A 3EOSA 4IG2B 1PJ9A 1DJGA 3M0XA 3WMCA 4QX4A 4N9CA 1F8IA 4JQ4A 2AL2A 1I2QA 4KFOA 2Y61A 3DBPA 4AZCB 2R91A 3RPDA 1L6WA 4CQ9A 3PY2A 3ZR4A 3I4EA 3GM8A 1CDGA 1XP3A 3GTNA 4FZIA 3W29A 4LF2A 5G2HA 3QC0A 5JMUA 3LM3A 4PB4A 1CGXA 3EPMA 3GXMA 1EOKA 4UTTC 1RCXB 3YPIA 4ZQCA 4DXXA 1OC5A 3FJNA 1X7IA 1Q2SA 3GHSA 4JR5A 3W7PA 3Q37A 1ZHAA 3C6CA 5DT7A 2QUVA 5D8WA 1ZRQA 3TA9A 3WL1A 4C6QA 3BLEA 1LCOA 3ISIX 4HP5A 1V77A 3SIZA 4H4IA 1WDQA 4Y9MA 3NA8A 2VNCA 1KGXA 3CQ0A 4UFIA 4E2VA 4RKAA 2WLYA 1KC7A 4O10A 3GIYA 1J0YA 1Q6OA 4H9TA 5CBJA 2Z29A 3GFXA 3E38A 3KOXA 4C6EA 1J4EA 3RLHA 5SWUA 1JPMA 3F5KA 4ZOEA 8CGTA 4MVAA 5EMUA 5IDIA 2ZX8A 3LRKA 3D3AA 3E49A 5FJRA 1ZAJA 2AMGA 4AIUA 3TR2A 3AS0A 4IUGA 1L2QA 2Y7GA 5E6ZA 4FNSA 4C7DA 3TWAA 5FJOA 3CIWA 4Q4SA 4PL2A 2NQHA 2UY3A 3ABXA 1SW7A 2B81A 1UKQA 4YL2A 2F2HA 1F7BA 4K8GA 2KX9A 2Q8ZA 4F0RA 2E9BA 4ORMA 4J3ZA 4Q8WA 1Z41A 1DJXA 5A2AA 1G4EA 5CAHA 1UQZA 5I3KA 3W0KA 4TVCA 3VGHA 1NFPA 5A8MA 1Q6CA 3BDKA 3CK5A 4YCPA 4C6KA 4JX4A 5I7GA 1CXHA 1Q7ZA 1UJPA 3WLKX 4RE4A 2P10A 4XK2A 3MO4A 4IQDA 4FXJA 4D6EA 4QG9A 4IX0A 4UFHA 3CUJA 5AC8A 3CUGA 1J2WA 4GUGA 5CSYA 4P7NA 3DXIA 1O4UA 1KWGA 3LXAA 1ZCOA 1VJZA 1QPQA 2XU2A 1JDCA 5HULA 1N8FA 4LUSA 3TYAA 1AFSA 2JKAA 1F4HA 2R14A 3G24A 3NPXA 3JU2A 2V2HA 1DEDA 4LBRA 3W7MA 4PTDA 3TR9A 3DFNA 1FX6A 1M3UA 3Q65A 4MKSA 3LRMA 2BP1A 2I1OA 2X40A 2Z7GA 1W8GA 4DYJA 4LV4A 3NL6A 1XLMA 4IFKB 3BGJA 3AICA 3HZ3A 3P3BA 1R9ZA 3THDA 4DO5A 1KCKA 1BWVA 4DY1A 3LCWA 3DECA 3GX9A 4Q8NA 3AYVA 3U4AA 7REQB 1G0CA 4RNHA 8TIMA 1QU4A 2FGLA 3S5ZA 2HE8A 3QF0A 2JEPA 2W5FA 1W3HA 1OM0A 1P6BA 3BWWA 3SAZA 1EJ7L 4OJYA 3R8HA 1U83A 1KM2A 4KFNA 3O6AA 3I65A 5C55A 3RX2A 1QK2A 2OO0A 1XLEA 4GGHA 1TIMA 3GK0A 4FSAA 5D33A 4TV6A 1TCMA 1XH1A 4AMAA 3I7RA 1QW9A 3QR0A 5AVNA 1J0ZA 3CHCA 3GS6A 4JFTA 2OMAA 5LHEA 3EOOA 1U22A 2Z1XA 3L2IA 1QNSA 3PFRA 2RUSA 1SZFA 3CNYA 4S3EA 2WC3A 2CW6A 5BU9A 5LHFA 4DXVA 1C3FA 5A6BA 2VT0A 4UCFA 2DP3A 5D03A 2PC4A 2VX6A 1AD1A 3FY1A 2EJAA 3DGRA 3MV11 4IG2A 3V1PA 3WH8A 1ZBWA 1NY1A 3UWZA 3DFPA 1NOFA 4KQNA 5F4XA 4G9PA 2DEPA 4AZCA 1VFMA 2C7FA 1O60A 3UA4A 2P0OA 1KO0A 4UTFA 1H7OA 3WN6A 1T6MA 2YZ5A 4AEEA 4GQGA 3KP0A 4A2RA 5DRIA 1YDYA 3MYPA 2YXOA 3O1NA 3WLTA 3CMJA 1PCWA 3AMLA 4AZ7A 1UD4A 4D6IA 1JD9A 1K7FA 3GC5A 4YWIA 2PURA 5F4WA 4DPQA 4JHMA 3B9NA 2W92A 4YWSA 2OVLA 2TYSA 3BICA 1JD7A 2R1KA 2PDFA 4F79A 5GJPA 1JYXA 3GC2A 2J7BA 3OVGA 2OZTA 4PMDA 3SSZA 3TXZA 4LF1A 2GSEA 2CLHA 1GOIA 3QTPA 3I6TA 4U31A 2WNNA 3ZFHA 2WVTA 1EYEA 2MUCA 4DUOA 4EAMA 5DN1A 1K4GA 2X1TA 4FXFA 3BAIA 2ZFAA 1OQFA 4GUIA 3WLQA 1WB0A 1H50A 3VINA 3UG3A 4A22A 1OC7A 3O0KA 2FVKA 1Y5WA 1OT2A 3FV9A 5JIWA 3WH6A 2YCEA 2Y24A 2F6UA 1XLIA 1WBJA 5LNUA 3WNKA 4D6FA 4ML4A 3MHGA 4ERIA 3C2FA 3G1XA 1TR9A 5FOOA 3L4WA 1XXXA 2Z7KA 1Q63A 3SIMA 3WMBA 4J40A 4XVEA 4M6QA 1V3JA 5A6MA 3DERA 2W62A 5AHLA 5HATA 3AHTA 4RPPA 2J88A 3REQB 5EYWA 1QPRA 1YNYA 2O56A 1O1ZA 1ZBKA 3LCFA 1LBLA 4E4UA 1BRLA 3UJFA 2QJMA 3G2GA 3K30A 1EJWC 2QV5A 3N4EA 3CLWA 3R25A 5TQLA 4LS0A 4WY0B 3GDTA 3VIHA 1AZ2A 3UG5A 3ZYZA 4EPKA 5ABFB 4BK9A 5CG7A 1TMQA 1WX0A 1KGUA 2PPGA 3QY7A 1OK4A 3GXNA 3HB9A 3M0KA 3WD2A 4IH3A 3BH4A 1A5OC 4HCDA 4UOQA 4RDVA 2R82A 5C9WA 4S38A 1O5KA 3VKCA 3V4BA 2G3IA 3G1RA 4GHRA 4IP4A 1BKHA 1OFDA 4TU1A 1IR2A 1O5RA 1GQIA 5KETA 4QJ3B 3CYJA 1Z42A 3P61A 7REQA 4K1GA 1K9EA 3EWXA 4PMVA 4ZE5A 4E4PA 5BXSA 3JRKA 4IM4A 1XH0A 1W2PA 5IFTA 3QYSA 4ZOCA 3URAA 1M01A 1UUQA 1T41A 3LN3A 5E0FA 2NW0A 3O0FA 5FJUA 4WIWA 3J7HA 3QFWA 1NDYA 3C2EA 2WWDA 4YCOA 4QR6A 2PP1A 2QDEA 1XV8A 4GI8A 1CW2A 2P88A 4LRTA 4FXSA 3RLGA 2CFFA 2XJ7A 3I3DA 3PZVA 2UY5A 4L4MA 4OECA 1YHTA 1NARA 4YU1A 1TPEA 5AFDA 3B9OA 2PC8A 4WHBA 2CEQA 1GQKA 3EEZA 5CZKA 5K4ZA 1FWEC 2VDGA 4RDZA 3FSTA 3P0XA 4HYWA 3FEMA 3W24A 4CU6A 1IF2A 4HTYA 3WX7A 2X1RA 2BVWA 3ZVHB 5JU6A 1LL6A 4B91A 5HNTA 4GZIA 2EG6A 1J6OA 3H2OA 2VR4A 1Q6DA 4L9XA 3VNYA 4JFSA 4RPQA 3S5SA 1W2VA 2EJ1A 4HNOA 2ANUA 2I9UA 4RV3A 3M0ZA 4NJIA 2E8YA 4GO9A 2PDQA 4Q8MA 1QW7A 2WBGA 3URQA 3B97A 3RILA 1BD0A 1QPKA 3WYZA 3SCVA 3C5QA 3VIJA 4AW7A 1XKJA 5AYYA 4BWLA 3AHYA 4GABA 3GKFA 4GVFA 3N13A 3B05A 4XQ6A 2P8CA 3VKJA 3VGEA 1MI3A 2C71A 2O9OA 3PNZA 3IACA 4GYPA 4JNZA 3M0IA 3HF3A 2NUWA 4F0LA 1YLVA 2CC0A 3QYQA 4P7OA 2GUUA 5H2ZA 2AMXA 4MWAD 2EPOA 1A5CA 4BQ3A 1GEQA 4PRWA 4US5A 1PIGA 4A6GA 3EXRA 3FJ6A 1IT7A 5F1UA 2GWNA 2YXXA 4S3JA 3VNKA 2GOUA 1QXLA 1MEWA 3GC4A 1XBYA 2V38A 1ISZA 4P7LA 4DM1A 1MUCA 3L0KA 4JNMA 5BCAA 2VWSA 4LUIA 1IV8A 4NX0A 1TPC1 1V08A 4PBEA 3NZGA 1V3KA 2NVDA 2Z6IA 1W1PA 3GHRA 3UW6A 4YHGA 3A21A 4GH1A 6TIMA 4PSRA 3QN3A 2Q71A 5CPLA 1BQGA 4QTGA 1BAGA 2V5BA 3CIXA 3CZEA 1FWAC 1PKMA 2PWHA 3GIPA 3NL5A 4R85A 3JVAA 3R0KA 3EA1A 3GU2A 4A4AA 4MDOA 4JN6A 1U1HA 1MNSA 2CHOA 2NWRA 3H7UA 4J2PA 2QCMA 3P0WA 1VB9A 3RO8A 8A3HA 2VEMA 2JGQA 3EAUA 4KW2A 4CCDA 3AXKA 4AY1A 3REQA 3MQTA 4K37A 2W6RA 4XIAA 1AMKA