4XO7A

Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
322
structure length
322
Chain Sequence
b'DSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Human 3 alpha-hydroxysteroid dehydrogenase type 3: structural clues of 5 alpha-DHT reverse binding and enzyme down-regulation decreasing MCF7 cell growth.
pubmed doi rcsb
total genus 119
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xo7A00
3R7MA 1AH0A 1PYFA 4GACA 1LQAA 2DUXA 2PDXA 4XZMX 4XO7A 4Q3MA 2PD9A 2PDKA 1HQTA 3R43A 3RX4A 3ONBA 4LB3A 3GHTA 5KETA 2WZMA 2PDJA 1T40A 2PDQA 4JQ3A 2PDHA 2BGSA 2FZ8A 1A80A 1RY0A 2INZA 4GABA 4AUBA 2NVDA 2IQDA 4MHBA 1OG6A 1HW6A 1ADSA 3FX4A 4JIIX 1S2AA 3GUGA 3EB3A 4WDXA 4DBSA 3F7JA 2AGTA 1XGDA 4L1WA 3UZYA 4GQGA 4F40A 3UZXA 3O3RA 5LIUX 3H7RA 3KRBA 3BV7A 4IGSA 4JTCA 2INEA 2IKIA 2P5NA 2PD5A 3U2CA 4JIRA 3EB4A 1AH3A 3D3FA 3GHRA 3R58A 5JH2A 3P2VA 3CV6A 3V0SA 3DOPA 2FZDA 1ZQ5A 3CASA 3V36A 3G5EA 2PDNA 1ZSXA 1EXBA 4QX4A 4ASTA 1XF0A 2J8TA 2PDBA 3LZ3A 4PRRA 2ACSA 3T42A 1ZUAX 4Q7BA 4ZFCA 2I17A 3CMFA 4IJRA 1LWIA 3LENA 2DUZA 2IPWA 3EAUA 2IKJA 2PEVA 1MRQA 4HBKA 4LBSA 1X97A 1YE4A 2FVLA 3WCZA 2VDGA 2ACRA 2HDJA 5C7HA 4QXIA 1UR3M 3R8HA 1PWMA 1Z9AA 3ERPA 2PDFA 3WG6A 5M2FX 2PDMA 3G1RA 4IJCA 4L1XA 1ZGDA 2F2KA 1VP5A 3LQLA 3Q67A 2IS7A 2PF8A 3CAVA 1RY8A 4DBUA 3UZZA 3MC5A 2I16A 2R24A 4JTDA 4YVVA 4LAZA 2BP1A 2IKGA 1QWKA 2IQ0A 3C3UA 3UZWA 4JTQA 2ALRA 3H4GA 4H7CA 3QKZA 3GHSA 1Z89A 3UYIA 4JQAA 4HMNA 3V0UA 2HV5A 4R9OA 4WDUA 1SM9A 3UG8A 3S3GA 3NTYA 2HVNA 4ICCX 1GVEA 2IKHA 1PZ0A 4WDWA 1RALA 1S1PA 4G5DA 3RX2A 2R9RA 4XO6A 1Q5MA 4XAPA 4JTAA 4NKCA 5LIKX 1Z3NA 4EXBA 4JTRA 1S1RA 5HNUA 1PZ1A 3FJNA 4FA3A 2PDWA 4PUWA 1IEIA 2IPGA 4GQ0A 4QBXA 3LQGA 4YU1A 1AZ1A 3COTA 1QRQA 3N6QA 1US0A 2C91A 5HA7A 2BGQA 2PDPA 1S2CA 3BURA 3LBOA 4WGHA 2ISFA 4JIHA 5HNTA 2PDIA 5DANA 2CLPA 1MI3A 5JH1A 2PDYA 1AH4A 1IHIA 5AZ0A 4OTKA 3M0IA 3LZ5A 2PZNA 3UFYA 4JQ4A 3CV7A 1M9HA 4LB4A 1T41A 4DBWA 1EKOA 1J96A 4FALA 3M4HA 4XVEA 3N2TA 1VBJA 1AZ2A 2ACQA 4GIEA 4WEVX 4XZHA 2F38A 4JQ2A 1C9WA 3DN5A 4YS1A 3WBWA 4QR6A 1YNPA 1AFSA 1PWLA 3LD5A 4GCAA 3VXGA 4PR4A 3O0KA 2A79A 3GHUA 3UGRA 4RPQA 2FZBA 4PMJA 4YVXA 2HVOA 1K8CA 3UWEA 3BCJA 3BUVA 3R6IA 4XVDA 4WRHA 2PDCA 4H8NA 2PDUA 3V0TA 3WBXA 3H7UA 5LIWX 2PDLA 3R94A 2PFHA 3RX3A 4EXAA 5LIYX 3ONCA 4XZNX 2HE5A 3M64A 4GA8A 3Q65A 1Z8AA 4LAUA 1Q13A 3V35A 3LNMA 2HE8A 1EL3A 1X98A 2PDGA 1XJBA 1X96A 2FGBA 3MB9A 4PUUA 3LEPA 2HEJA 3B3DA 1FRBA 1JEZA 2IPFA 4XZIA 3UP8A 3CAQA 1YE6A 4DZ5A 1R38A 1YNQA 2WZTA 4FZIA 2QXWA 2ACUA 4I5XA 4JQ1A 4PRTA 4LBRA 3R8GA 4FAMA 3LN3A 3WBYA 4WDTA 3LUTA 2DV0A 5LIXX 2IPJA 4XZLX 4YVPA 4XK2A 5AZ1A 1MZRA 2FZ9A 1EF3A 2NVCA
chains in the Genus database with same CATH superfamily
4I8DA 2E28A 5DCBA 2JE8A 5G5IA 1S5WA 2RGLA 1EGMA 4LVFA 1E6RA 4KRUA 3TCSA 1EUAA 4C5YA 1UKSA 3PPCA 1JGMA 4XZWA 4XAYA 4RL3A 3ABZA 4PMQA 2OZ0A 1KBJA 1RY0A 1QPQA 4Q32A 3WD3A 3VDBA 5AYXA 4UTUA 3TLQA 1QOXA 5LA2A 1NWSA 3BLOA 1NWUA 2YA0A 1S2AA 3CM4A 3T7VA 3MUY1 3TJIA 1XYAA 2VNCA 4KWSA 2ZXBA 3MI6A 4L4OA 2D2JA 2ANUA 3U2EA 2CLMA 3SRHA 4BCEA 1KO0A 2J62A 1RBLA 4B5UA 1JJKA 1V0NA 1G4EA 4ORMA 4PCSA 5EY5A 4A8RA 5CJMA 3TXVA 3FJ4A 3DCPA 5D4YA 3NAVA 4IICA 2J7HA 3U3HA 3SFWA 3PTQA 2EPLX 3RLHA 3T1GA 3AU2A 2WVVA 1NWTA 1F8IA 3DHFA 1VJSA 3S83A 3STGA 1QI4A 2PU1A 1H1ZA 3HF3A 3WLKX 3RLVA 4S2BA 4GKTA 2IUZA 1JQVA 2A7NA 1YEYA 2OR2A 3KBWA 3N18A 2W3ZA 4GVIA 5A95A 4L9YA 1QVBA 2VFEA 1E1EA 3UG3A 2A6NA 4IFOA 5G1TA 2FVLA 1WDDA 2ACRA 4K37A 2Z0IA 3JW7A 2OYKA 3OB8A 1B5TA 2ALDA 3UNDA 2XUCA 3LBCA 1M03A 1FP8A 1Q6OA 1KM2A 4OVXA 1YTEA 4GI4A 4ZGYA 1TR9A 4DO4A 1Q7QA 1VFOA 2JBMA 1VLIA 5XINA 4PCNA 4MPKA 1WBHA 4JTDA 1SJBA 1PHQA 1TZZA 1QWKA 2Y2WA 1EQCA 2DT3A 2G4JA 3BWWA 4JN7A 5EMUA 3GR8A 4M24A 4O17A 2XFWA 1UMYA 1UG6A 4DAIA 2BY0A 3A9BA 3L4YA 1CWYA 3KTXA 1CGWA 1U5JA 2E67A 3CLMA 4KWWA 1B57A 4Q8OA 1B90A 3S3GA 4QJ4B 2O7SA 3UA4A 3LV6A 2Z27A 1XH2A 1BLIA 2C6QA 4JYDA 2R9RA 1NDZA 7TIMA 1LJYA 2HZGA 1F9CA 1H5YA 4QCFA 4EXBA 1VYPX 1SUXA 1S1RA 5AHIA 4IIDA 3ZT7A 3WSUA 2VX4A 3R0KA 3W25A 1H49A 4TTGA 1AA1B 3CIVA 3E0WA 4E8GA 3MHGA 1WUEA 1P1MA 2OX1A 3LRMA 3VIKA 1HL9A 3AS0A 3W1TA 4ZO8A 2BGNE 3IIPA 1S2CA 2PWDA 4JYFA 4FNUA 2XSXA 5AN7A 3RCMA 3C56A 4JY8A 4PUKA 3MDUA 1N7KA 4AU0A 5FL1A 2PDIA 1RVKA 4DUXA 2XIOA 2J79A 4J3VA 3WD2A 4MPQA 2NX9A 4OTKA 3NQCA 3SUVA 5DMMA 5RUBA 4J3UA 4L4MA 3IIZA 3W7IA 4ES4A 1FQ0A 3W7RA 3STPA 4NL1A 3TFCA 4PB3A 4Z1BA 3FKRA 3MTWA 1QI2A 2W67A 4S3KA 3WO8A 4BF9A 4D1JA 2VURA 4R7OA 1DJXA 3L0GA 4P2VA 4HCLA 1UB3A 4FLQA 3LPPA 3OZMA 2Z2AA 4EF8A 4TV6A 4YS1A 2GVYA 1F3EA 4BF7A 1UP0A 1XYBA 3FYPA 5D9MA 3UYCA 4Z0JA 2W79A 4CN4A 2C15A 3K46A 4H6QA 4KS0A 3ARWA 4MM1A 5E93A 5AHNA 3UG4A 2QNEA 4N9DA 3BUVA 2J7DA 2FQIA 3FSTA 4JX5A 1AW5A 3ZT6A 1MUCA 2DDXA 2D0FA 2G8ZA 3IVSA 4J27A 1CXIA 1B9ZA 1W32A 4YTRA 3UR2A 3EWDA 3NURA 3GFXA 3IWPA 4O11A 2D0HA 2ZCGA 3MW7A 3W6MA 1L8PA 2V3EA 1U33A 1BEUA 4WOZA 2VXNA 3JVAA 3VIOA 2HPIA 3GU9A 4CQCA 4GA8A 2WLYA 1TJPA 1S46A 4HSNA 4N9EA 4IL0A 2QEZA 5G4HC 1UR1A 1SFJA 1W31A 4BKNA 2F6XA 3BLDA 2E3ZA 1R3QA 5FJRA 3GUWA 2X1TA 4EAMA 1TMLA 3BDKA 1VBRA 3GLCA 5J5DA 1REQB 4HZ8A 5IBXA 2IPFA 1G69A 4HU4A 3STCA 4O10A 3TYEA 4F9DA 1R38A 3E5BA 3H2NA 4YTQA 3PR2A 2D3NA 1OK6A 3ID7A 5C9WA 2VZOA 3ZQ9A 4LBRA 2ATMA 3OHMB 2OOFA 5JIPA 1WZKA 4F2TA 1DJIA 4GY0A 3CUZA 1S5TA 4M81A 5JMUA 4JIPA 2HROA 4NT0A 4LJ3A 2A6LA 2JALA 4DJDD 1MZRA 3S9ZA 2QLYA 3OP2A 1NELA 4JTEA 5FA5A 5K4XA 5FD0A 3S0CA 3HZ3A 3W81A 4TX6A 2GOUA 5G1MA 4UQAA 3W00A 4UQEA 3MYOA 1KLYA 1FWGC 1FCUA 4FR1A 3TTOA 5KETA 4BEUA 2WZMA 3CUXA 1NQKA 3QMTA 2XIMA 3PZGA 2XG9A 3BAIA 3BARA 3KX6A 1A80A 4GABA 3KHJA 4IX0A 1EJUC 1LP6A 5TNVA 3HJZA 3ZLGA 1JUKA 4M29A 5HMFA 1XBVA 4B15A 1YXYA 3QRHA 4GYPC 4M56A 3VD3A 4L1GA 1RK5A 3MHUA 4Q7NA 1CT5A 3KDNA 1ISVA 1RK6A 3AMDA 1TTIA 1MXGA 4L1WA 2VMFA 1XH0A 2D2OA 3UZXA 4IL2A 4BR1A 1Z41A 1I2PA 3SIMA 3BV7A 4HTYA 5EFFA 3O6YX 3AMCA 4QE4A 2D69A 3O1NA 2AQWA 2WVUA 4R9XA 1JDAA 1AH3A 4XQ6A 3BG9A 5JH2A 5AHMA 1FWAC 2ZIDA 2TYSA 4J9JA 1H61A 2J8FA 2VJXA 1GOIA 1J0ZA 3W1NA 1YDYA 2F7FA 1SW3A 2VKZG 3ZYZA 4B9ZA 5E09A 4XTIA 1JCJA 2ACSA 1FDZA 1EP1A 1EF2A 3WZ0E 4FXFA 1ZP3A 3B8VA 3UXDA 1HXJA 1K77A 1TO3A 2YCIX 1J01A 3B9DA 1PX8A 3G1XA 1DQXA 2C1IA 3VMOA 5CAKA 4KWOA 2OB3A 1QOQA 4UCFA 2OFJA 3SQLA 4MKNA 3T08A 1KGUA 3H12A 1FKXA 5IDIA 3GDRA 1AD4A 7ODCA 4J1OA 3EWBX 4KF1A 3R12A 1G7VA 3G1RA 4C6OA 4Y7EA 2QCNA 3PTDA 3WLNA 5K2ZA 2B7OA 6XIAA 2W61A 3MSGA 1N2VA 4O0QA 1ZJBA 1VFUA 4HA0A 4O0KA 1UUMA 2FH6A 4DBUA 4O52A 4L4PA 4RNIA 1J0KA 1PE1A 4OUIA 4DUOA 1LOSA 1M53A 3GH4A 2GYIA 5BWFA 3ARTA 3DG6A 3H2EA 3LHTA 4PMUA 1KRMA 3DIPA 3GW3A 3POHA 4EF9A 3K8MA 3NQAA 1RJRA 5D2WA 1SM9A 4MJMA 1OY0A 1C91A 3OVRA 2HVNA 3FCPA 1S3HA 2DZTA 3AWNA 4PFHA 1UYQA 1PZ0A 4OUEA 3CPUA 1OX5A 4GIRA 3IJDA 4ZOAA 3H6OA 1QPKA 3VOJA 1IYXA 5FF2A 1QI0A 2HNEA 3ELFA 4YHEA 1OFQA 2YBVA 4IIEA 2Y62A 2NV2A 4XX6A 1AD1A 3DH7A 3T8QA 2QCEA 3TMLA 3Q2DA 4P7LA 4QSHA 3SZ8A 1Y0EA 4ZTXA 2Z2BA 1NWRA 2CLFA 4FNPA 3QV9A 3QLLA 2YCKX 3A4AA 3RJXA 4EK7A 5CGTA 5LGZA 2PRMA 4BQ3A 3RR1A 4WKAA 1YHTA 1BFNA 2J8GA 4GZIA 4UOZA 3EWZA 4PN2A 3W2JA 5CSSA 3PBWA 3UFYA 1ENUA 4A3HA 3RO6A 4EPEC 3WLPA 1J5SA 2NWRA 4DJDA 2Z1KA 3O7UA 2ZX6A 4QTGA 4AY7A 1A5CA 4GNVA 1B4EA 1E9ZB 3GB6A 5CPMA 5G2HA 4ERIA 1E5NA 1TV5A 3G24A 3ITOA 1YNPA 3GDMA 2GQ9A 3GDBA 1EIXA 2WVSA 4LWWA 1XGZA 2CLOA 1NIUA 4QDPA 4ZL1A 3SR7A 4HP5A 4D2JA 3CGTA 4LXFA 1EWDA 3UWEA 2HXUA 3CS2A 3LGGA 4M7TA 4P5UA 4XAFA 5KMYA 3JS3A 4DLFA 4D6HA 3E3HA 1H2JA 4B5TA 1S5NA 2YYUA 1SZEA 3WMLA 4XBJA 3QXBA 2H9AA 2ZTKA 4YL2A 4TR9A 1SYTA 5D9OA 4AZCB 2J27A 3TONA 3S5SA 4HK7A 2RKXA 2WC7A 1K6AA 3HU7A 3PUOA 5A6BD 4L6DA 3M5VA 2BY1A 2IW0A 1EDGA 4HSOA 1R2TA 1SSDA 3QZEA 4KGJA 1G1YA 4A29A 2DUAA 3LXAA 5K9CA 2H8ZA 4ZQOA 4UR7A 2QW5A 1JRBA 4MDPA 3M46A 4NYYA 2NX1A 3M6YA 4PZVA 2VDIA 3ARYA 3VA8A 1YRRA 4FZIA 5EFDA 4L5ZA 4RPPA 1IZKA 1Q6LA 3QY7A 1UR0A 4DAFA 3AC0A 1VFSA 2ZQ0A 3H2MA 3EX2A 5H91A 2YLAA 3U7BA 3QR0A 3HQPA 1SU5A 1OWQA 2WNWA 4HPJA 2FIQA 1VYSX 3EOSA 4ZB5A 2VD9A 1KRBC 3IGSA 3DEQA 2FH8A 4FF5A 3QMSA 4MG4A 2G96A 2ZWZA 1PYFA 1O6IA 4PBEA 1KWGA 3IS4A 1JUBA 3RN6A 4AF0A 3LHWA 3K4WA 5AVHA 4YWSA 2WMIB 1E6SM 4ACYA 1XRSA 2Y5EA 3BK0A 1W8SA 4UFLA 1XV8A 4WHBA 3AIUA 4TU1A 5DBTA 1XLCA 3H2FA 2XTKA 3MBDA 3AICA 4A6GA 3A4WA 3BZJA 4MHBA 3OBKA 3ZZ1A 3O2LA 4NRSA 4GI8A 3WL0A 4GYKA 3TW7A 1B3OA 1QAPA 1UJQA 2OMAA 4LRSA 4BQ5A 1HGYA 4L61A 4MWAB 1WKEA 3CAWA 3QYQA 4XKYB 4FF7A 2D23A 5C2GA 3LU2A 4PC8A 1P0BA 1IT0A 2G95A 3BW3A 4NZ4A 2QVNA 2A4AA 2A1YA 1TIWA 3P67A 3HMJG 2DW6A 4IGSA 4S38A 4HOXA 3W7CA 3MCMA 1JYXA 2J9YA 1UP2A 1KV8A 2IKIA 4JICA 4DO7A 5DMYA 2GJNA 1TELA 4JIRA 5BXTA 4UFMA 5ABHA 3AAMA 2GGHA 5AHEA 1KTCA 3CYJA 1RAKA 3I3EA 1A5UA 1M7PA 1ZBKA 3EOEA 1G5AA 1H62A 1IE7C 1PEZA 1CBGA 2Z1SA 1BRLB 3NNTA 3WD0A 3UF9A 1EXBA 5ABFB 1LBFA 2CLIA 2J8TA 3Q58A 2CBUA 3DHPA 5CLTA 1VHNA 1BYCA 2PBOA 1QU4A 3CMFA 5K9XA 4EPDC 4JX4A 3L5AA 1KXHA 3NCOA 2OT1A 3O15A 3FV9A 1RJQA 3O07A 3L4WA 3GIPA 3MMUA 2CLEA 3UWYA 2VDGA 5L6UA 1PSCA 3W82A 1TCMA 1TUFA 3L2MA 2EG6A 1UWAA 3S5YA 3CHFA 1GORA 3W3OA 1HP4A 4GXMA 4Q33A 1HVQA 2CXEA 5I00A 4Q4QA 2VR2A 3MKKA 4EOUA 1H09A 3WG6A 3FNDA 5GJNA 4MY9A 4LUYA 1KLZA 2E9MA 2ATSA 1E1FA 1O12A 1XH1A 4KFPA 3OJGA 1JXKA 2GVGA 4GH1A 4ZO7A 3PWIA 4IJBA 3ITVA 3VNKA 4HOZA 3I65A 5DMNA 2OWCA 1ZY9A 1J0IA 3LNPA 2W6RA 1Z89A 1JYNA 3LHZA 4M7SA 1QW8A 3WLIA 1H1YA 3EWWA 4GUIA 3R13A 3UERA 1TIMA 4IPNB 3CXOA 2ZUNA 1W1VA 3KWXA 2RDTA 4WCJA 3E1F1 1TA3B 4I7VA 3IJ7A 4JFSA 3AMGA 3IVTA 4NX5A 2DW7A 4I7UA 3B9EA 1H63A 4QITA 2VQUA 4S3DA 4F0HA 1NSJA 2I9EA 2WHKA 3ANYA 4L4LA 3AU6A 1UWUA 3RPTA 2A2IA 1UPPA 1UC4A 1E5JA 3GR4A 4D8ZA 4PODA 5FJPA 1CECA 4ZQMA 2VC5A 2PDWA 2AL1A 1J8VA 2VX7A 1VD6A 2NXGA 2WZIA 3USZA 1DKWA 2ISVA 1VGAA 3QPEA 4H01A 3OBEA 5FF4A 5T8GA 3WQWA 2EPMX 4GHRA 3WJZA 2FDMA 3VI2A 3WLTA 1VFFA 1Z7AA 3CUGA 3BQ6A 4QSFA 3URAA 3ALFA 3TZNA 5U7SA 2OODA 4IFKB 5CPSA 1V7AA 5E0KA 7A3HA 1KGXA 1EA0A 4HOWA 2NQ9A 4EP8C 3NQEA 1KM0A 3IUHA 3NDZA 2VDHA 3T9PA 3EA3A 1UBPC 3GXMA 5F1VA 2PLKA 1E3XA 3STEA 1VKFA 1OFDA 4N7QA 4LH8A 5HBFA 2A3HA 3I4KA 1ONWA 4DBWA 3AROA 5AHFA 3A13A 4C1NA 3N2TA 4O19A 1OZMA 3REQA 3SECA 3ARZA 1X6NA 1WXYA 1JZ6A 3QR1A 2TRSA 3C2RA 4KERA 4GY1A 2VEPA 3UESA 1CZ1A 3TROA 4F2UA 4RZ4A 5BOFA 1MSSA 3TSMA 3VKDA 2DZXA 3SCTA 2XGBA 1W1PA 1TMQA 2DZAA 4Q4RA 1E15A 1IV8A 1KXQA 4PMXA 5C71A 1FWNA 4DJEA 2NT1A 2D0GA 3ARVA 4GH3A 3QN3A 3N15A 4CD6A 1R46A 1W5PA 5LIYX 3E02A 1IZCA 3C8FA 2VVNA 3ITXA 3TYBA 1LG2A 2ZC8A 1I6NA 4GQRA 3T2PA 1LLWA 3TFXA 3PSVA 5BU6A 3RNDA 2DT0A 2Z4GA 5A6SA 1XBXA 4K7YA 1X96A 1UBSA 2I56A 3QW3A 4Z2JA 3KL0A 3GSMA 3WK3A 4D6EA 5DY3A 4L6OA 3UP8A 2BS9A 4LVGA 3NSMA 4HU3A 1YNQA 5A8PA 4IIFA 2AL2B 4HPXA 3VGGA 2QGHA 1KD0A 5MHBA 3PPFA 4H4IA 2Y8KA 1DV7A 1T0OA 2G37A 3QYSA 4I5RA 2ICSA 3C3NA 3QTPA 4AVOA 5K4ZA 4I6VA 2EGZA 4AX7A 3SJNA 2GVJA 3BLEA 1NFPA 2DZUA 4YVPA 1ME7A 1XCWA 2AOSA 3R8RA 3AZSA 1Q65A 2XVGA 2CZDA 3DFHA 3VGFA 2WMFA 4GACA 3F4NA 4J3XA 3A3HA 2I7GA 2YLLA 4KESA 4GC3A 1Q7MA 1ZS2A 3I7RA 4Q3MA 4N0RA 2PE4A 2O4MA 1HQTA 4BK9A 1Q63A 3ONBA 1BSIA 4DBEA 1OFAA 5CSRA 1GEQA 1UHVA 3T05A 1JCLA 1E4MM 3K4DA 3W6LA 4E4FA 3LYEA 1VRDA 2XN1A 3TAOA 3SI9A 3HBLA 4MZ1A 4JEJA 4QG9A 4QS5A 2VEKA 1GOOA 1GYLA 3N9RA 3GVGA 4ZVJA 3VUPA 3WF0A 4ZZ9A 3NZRA 1LL4A 4C6PA 2J7BA 3OGVA 1T6MA 5I02A 4DRSA 2AAAA 4FSAA 3CWHA 5FJTA 1UR4A 3M0YA 2PRHA 4Q4MA 4E2BA 4LYRA 4M80A 1F74A 4JKMA 1QUMA 1J2WA 3W7KA 4H41A 3V7PA 4B9YA 3MCNA 4NJJA 2PU0A 2W0UA 1M65A 4LC6A 1KFBA 4LTSA 4YLWA 1Y5XA 4E2DA 4O1BA 4C65A 4HCDA 4JTLA 2NUWA 3R58A 3VINA 1VEPA 4M6QA 3V0SA 3S2MA 3TEVA 1JZ2A 1L6WA 3KM8A 2ZRVA 2PDBA 3KRUA 4LCQA 2OLSA 4AZ5A 1K8XA 5J04A 3BAXA 4DJFA 4L64A 2QYGA 3TC3A 1AUSL 1W1YA 1VZWA 3SRDA 4LALA 4GNKB 3GZ3A 3VC6A 3ZSSA 2PEVA 3HFTA 4LBSA 3U8GA 1CGXA 4K2SA 1XD0A 3MV11 5AC7A 1JDFA 1GOKA 2ESCA 2RDUA 3APGA 1TG7A 1XFBA 1M7JA 1Z9AA 3DFQA 4FR6A 4YPJA 5C54A 4F0RA 1JXJA 1FWJC 2OSYA 1HZYA 3OQEA 2PDMA 1B9BA 3LX9A 2Y7EA 3GIQA 5LNRA 3WLQA 1BF6A 4D9PA 1MQQA 3NR0A 2J88A 2WSPA 3QBUA 1ZJIA 3W37A 4S3CA 3HO8A 2IQ0A 3WQFA 1IXQA 4H7CA 3WNMA 1J79A 1E6XM 2J9XA 3NZ1A 3SBFA 1QATA 1H50A 3S47A 2PC4A 4I3GA 2WHJA 3UD6A 4D6DA 5FSEC 1FDJA 2ZZ3A 2Y5JA 2IKHA 3UBPC 3GRIA 3BGAA 4GE8A 3R79A 3DI1A 1UUQA 2WZHA 4AFYA 2NZLA 2REQA 5LIKX 3LCHA 1Z48A 1GOWA 1K6WA 3EYPA 3M0VA 3FAWA 2DZPA 2VGIA 3G18A 4HPHA 2AGKA 3TYDA 4W7UA 1W3KA 4YU1A 4G1NA 3SRFA 2ADAA 4GUGA 3QV8A 4WKHA 4W87A 2SFPA 4IX2A 5E6ZA 4K39A 4N9CA 4S2CA 3TJ4A 5TD4A 4MB4A 1OX4A 3ZOAA 3BURA 5A6BA 3CUHA 3TDFA 2FJKA 4FNRA 1XUZA 3FA4A 2XGZA 3O05A 2DP3A 4PTDA 5FCZA 3WQEA 3A22A 4JIHA 1FCVA 3MJYA 1DL3A 4K3ZA 3TA9A 3CQJA 1QJWA 3DC0A 4QP0A 5CPLA 3F2BA 1POJA 4MNMA 3ZIZA 4MKSA 3E5PA 4A8NA 3NEVA 4W93A 4H1ZA 4LB4A 1ZBVA 3S1VA 1QXLA 1DBTA 3XINA 3W2UA 1DPMA 5D03A 2DJLA 1AMYA 4ZMGA 1F6KA 1M6JA 3C0LA 3H2AA 2QPSA 1DJNA 2VWTA 1XYFA 2EO7A 5E1QA 2QQ6A 3VNIA 4UQ9A 4AD2A 4GMEA 4S3JA 1CX9A 4GVGA 3G1HA 1TPUA 2A79A 3B0PA 1QNPA 2VENA 4GFSA 5G4EA 3OOQA 1UQZA 3QY8A 3RUBL 4P7RA 3W88A 2X41A 2A5HA 4CVWA 4QJ5B 2GL5A 4RCXA 4HNLA 1QPRA 3QPYA 2PPGA 3QV6A 2E7FA 1BAGA 3KDOA 2QF8A 4E2OA 4YTUA 5LIWX 3UJEA 2VZUA 1WX0A 3Q65A 1W17A 4LAUA 2QUMA 1JZ5A 1WCGA 2UV8G 3KLLA 3H26A 3L4UA 1NFGA 1X98A 4NYUA 1XJBA 4V2XA 1E40A 2E0PA 1EGVA 3VD9A 3GTFA 3W7GA 3DXIA 4GD0A 1PKLA 4UNKA 3R0UA 4QROA 1UMLA 2DZSA 4AVNA 3I6RA 1ALDA 1OB0A 4C6CA 4Z2GA 4LUSB 4UXDA 3JRKA 4KCWA 2BHYA 4JQ1A 4PRTA 1H7PA 3W71A 4RV3A 1VCFA 3O16A 1QBAA 1J93A 3BG3A 1GOQA 1GYMA 2OZ8A 4HU8A 4NAEB 5D8ZA 4WDTA 3EDJA 4RZ6A 1OCJA 4LQ1A 3WD4A 4AWSA 1C8VA 5M17A 4XZLX 3BICA 2UY3A 3IIXA 4PCTA 3NSXA 4GXWA 2XIJA 4ZO9A 8XIAA 3U2OA 2ISWA 3MY9A 2DUXA 2QJGA 5D37A 3WD1A 1K9DA 4N42A 3S2LA 2WYSA 1DVJA 2PA6A 3FYYA 2FB2A 4PGLA 3OW1A 2J7EA 4IMDA 5C70A 3VD5A 3P3BA 5FJUA 4W5ZA 5HR7A 4I6KA 2X30A 2IQTA 3VDHA 2WVVB 4Q6XA 3CHVA 3KBVA 3OZOA 3LA4A 3MP5A 5LGXA 4AX6A 1UD8A 4NAFB 4JIIX 1VEMA 4Q4OA 4I8YA 1JAEA 2NWSA 1A3WA 1GVRA 4ZFMA 3PK7A 2OLHA 3TJXA 5C5YA 2JGQA 2OEKA 3UZYA 4JTTA 4KWUA 4QS6A 3VX1A 4MNLA 2XIQA 3CPGA 5MF5A 2FPVA 4LY8A 3GVQA 3AIBA 3WF4A 2DJXA 3QJAA 1XDJA 2R94A 1W3JA 1VFHA 2WBKA 3WH8A 1E4IA 3TCEA 4NHVA 1O1ZA 3CASA 2V5BA 4I7WA 5HUOA 4B5VA 3P0WA 1GVYA 3NEHA 8A3HA 2CBJA 5A6KA 3VOFA 1V03A 5CXPA 3T42A 1W5MA 1RZMA 3P6LA 3TYZA 2V8ZA 4KEUA 1RP8A 5A2CA 4P8XA 1O7AA 5J8LA 3FA3A 1P0DA 3FLUA 8TIMA 1E0XA 3NQFA 7REQB 3DGBA 1PV8A 3R8HA 2FMNA 3HPZA 4Q7IA 4AMAA 1E0UA 2BY3A 4P8UA 1HL2A 1DYSA 2Y6ZA 3KBMA 2PDFA 3MVIA 1UASA 1TTQA 4H3DA 1I2QA 3DYOA 2F2KA 1E4LA 1E6QM 2VFFA 4AWEA 1Q6QA 3LXCA 3WNNA 4YVVA 1W5QA 3T0CA 4C6QA 3UQNA 4JTQA 1TUXA 1QNOA 3ARUA 5JUVA 4V27A 3UYIA 1GONA 2OYLA 2CFFA 5L9FA 4IQJA 3BANA 1V5XA 3L2LA 4OBRA 4DM1A 5A2BA 4IPLA 3CO4A 2GDVA 5D30A 4C7FA 1D8CA 4UTWC 3VIIA 5DO8A 1S1PA 4JAWA 3E0LA 1MEWA 4IP5A 5FEPA 4NASA 3C4UA 1M04A 1LYXA 4IMAA 5AKQA 4D6FA 1JFXA 4MZ8A 5I23A 3NQGA 1ZFJA 1QHPA 1CGTA 2QUNA 4D1IA 2OELA 5D2XA 4EANA 4A4AA 4C1LA 2WLZA 3IPWA 3N9SA 2OSXA 4S3FA 3B9OA 4DJEC 3ARXA 3FSUA 4L9XA 4OBSA 3O6CA 3WLLA 3VKCA 2QIWA 3OGSA 1MI3A 3KXQA 1V6VA 2PDYA 2OZ3A 4WSKA 1AH4A 2XWEA 2BXZA 3L9CA 4P8WA 1EHNA 3AYSA 4K6AA 2FTYA 1XLIA 3CLWA 3THAA 4NZFA 2HNHA 2EKCA 1O5XA 4PB5A 3GTIA 1QR7A 4ATWA 4GIAA 4Y96A 2V67A 1C8QA 4JTJA 2A21A 4FS9A 2JKPA 1TYGA 5IRPA 1BG4A 1BPLB 4J3WA 1Y7VA 3SCNA 5REQB 4XIMA 1D3HA 2DY3A 4DX3A 3K8KA 5I79A 2R14A 3A21A 4PMJA 4RNFA 4YVXA 4QE5A 4AZ7A 3TYAA 2W66A 1GNXA 4QISA 3P8JA 3PJUA 5U4NA 2WMIA 1MRAA 1XUUA 2ISDA 5HJLA 1XW8A 1EJTC 3WEOA 1QI5A 5CBBA 3N13A 3ZJ8A 1IGSA 2DVXA 2VT0A 5I3HA 3W7PA 2VUYA 3L66A 1ISWA 1OC7A 1GK8A 2G3MA 4JDBA 5MKGB 1OD0A 3GYCA 1EHAA 3MKVA 3RJYA 1GCYA 2Z26A 1E43A 3DC8A 3V1PA 1OSEA 2CU0A 4C6BA 4O1FA 2XDFA 3GYEA 4MKVA 4FI4A 4JNYA 2GWGA 4E8CA 4OT7A 2YA2A 3LPFA 4J2MA 1DWGM 5HJXA 4LS1A 4H9XA 3SM0A 3LDVA 4Q8UA 2O56A 4C7DA 3OLGA 4G7FA 2YL8A 2BOEX 5A8MA 3AIVA 4UUIA 4DWDA 3PUEA 4G6CA 3E2QA 4IWWA 5A6JA 3DI0A 3NYZA 5EL1A 3GXDA 3VE9A 4LNCA 3AQUA 2X05A 1HFBA 2E5DA 5ENLA 1ZAHA 1FUYA 2VOTA 3AJXA 1TSIA 4NI3A 4RLIA 4KW2A 1UR8A 3VD7A 5AC4A 3BOXA 1CDGA 3KVJA 5HMDA 3BOLA 5DRIA 2V5KA 2FZNA 1E0WA 1GVQA 4CNOA 4IMEA 1WKYA 2HQAA 3BW2A 1UW9A 4ZBCA 4PMNA 4DBDA 1UZ4A 2PDKA 2EPHA 1OF6A 3HQ1A 1HVXA 3R43A 1J5TA 3FJLA 3FFSA 3CO8A 4JCMA 3W01A 3LGDA 4JNMA 3B04A 5LXXA 4REQB 2FZ8A 4PTNA 1XG3A 3VAVA 2XH0A 4H6RA 3VZXA 2VEFA 1R2RA 2NQJA 1I45A 1KKRA 1WBJA 1XYCA 3STFA 1W9XA 1EPVA 4HA3A 3CUFA 4ZQNA 3VKBA 2AGTA 3ABRA 3GIYA 1PAMA 1SJAA 1M1BA 3MO4A 1S38A 3VNLA 1FHLA 4Z1YA 2R91A 2ZZ2A 2CERA 1E9LA 2VZTA 2GK1A 4MJ4A 1HO1A 5ABEA 1ZRQA 3W73A 1BHGA 2XIIA 2V9DA 3URNA 1L6YA 1C29A 3LS9A 3VDCA 2YA1A 1D3GA 1W5OA 1AVAA 3MUAA 3LI0A 3W72A 3VK5A 1TWSA 1ICQA 4GLEA 2C0AA 1TV8A 3AXXA 4HHMA 4K36A 2UZ9A 1NP0A 4HT3A 4JTKA 4ZFCA 4M5PA 4FNSA 1JYWA 3PS7A 2QF7A 2FHBA 1ONRA 3AJ7A 2FTWA 3F5JA 2QCFA 3CWOX 4IUOA 4AHQA 3GH7A 5FF0A 3EOLA 2W91A 5TBOA 4JHOA 3KAOA 1F07A 2JEPA 3RG6A 2J25A 1XCXA 1W1ZA 3AHZA 3S1WA 1BQCA 2CLKA 2WMHA 3MSRA 3RCYA 5BU9A 5FAGA 3TQPA 5BYWA 1EJ7L 4I9AA 4IJCA 4CU8A 3RXZA 2B7PA 4ZENA 1VP5A 2VM8A 2WJZA 3CHEA 4DI9A 1QW9A 5CPNA 3N12A 2J74A 2YFNA 1FH8A 1R3TA 2IKGA 4PUEA 3QZAA 5BMWA 2HWGA 3QF0A 3SGGA 2QV4A 1ZLPA 5AY7A 5H6HA 4R7JA 5EMKA 1H4PA 1A5NC 4HMNA 3L4TA 2HV5A 1QT1A 4KFOA 2FVMA 4LV9A 3C52A 1FCQA 4U5KA 3EB2A 1VIWA 4G5DA 1Q6EA 3VGDA 2GFTA 1ITUA 4NXSA 1JRCA 2PI6A 4CVUA 3PBUA 1PZ1A 4OFCA 5GNYA 2DH2A 1TREA 3BE7A 3SFKA 1R3VA 1VS1A 4KKXA 1FWBC 4H83A 3WMBA 3CIXA 3W38A 3N6QA 4J3ZA 3NDOA 3M0ZA 4NNBA 4C91A 1VPYA 1UR9A 4TO8A 1FWHC 4JS3A 2C71A 1IEVA 1KR1A 3EKGA 3HG5A 1MQRA 2ZFAA 2WO5A 4B3LA 4AZGA 2WXDM 3WDHA 4PFMA 1EIBA 1SFLA 3L4VA 3MSYA 3W70A 5F2IA 4A35A 4CD4A 1EBGA 2HS8A 1O4UA 3HV9A 4MUZA 5BWAA 2G41A 2WKLA 3W74A 2X40A 3A5FA 3UU0A 3NWRA 4GBDA 1QHOA 3TQ0A 2Y24A 3GK0A 2WBGA 3OA3A 4AC1X 3N4FA 2XSBA 3TSBA 3OLIA 3AYRA 3QH2A 3WJXA 1F2JA 4CCDA 3PN8A 4GZEA 2X0HA 4GZ7A 2C18A 1K8ZA 3ZWSA 2WAGA 1IGWA 4JX6A 2PURA 1KM6A 3OBAA 2WJDA 3LM7A 5HATA 4RPQA 2WHLA 3PZMA 3FYOA 4PE8A 1ML1A 1OHLA 4MAVA 3A24A 3W02A 4CLMA 1WDSA 5BNKA 4BA0A 2YW4A 1CXEA 4MLJA 1XLHA 4W86A 3SGZA 1V0KA 3CZ8A 2FGLA 3OO2A 1J6OA 5CCZA 3VGBA 4JPGA 3WMCA 1KW1A 3DFNA 4CUCA 3GG0A 1GPWA 2DZVA 4CNPA 2DH3A 4X9SA 1Q13A 1JYVA 1H7NA 4DWSD 3BGJA 4QM1A 3C0QA 4IXHA 2IXVA 4GVFA 5T91A 1J9YA 4HZ6A 1DXIA 4A21A 4AQLA 3OIXA 2GJPA 2CKSA 2ODOA 2E4TA 2X0YA 1W0MA 1B3YA 3BJTA 1DQWA 1K9FA 4RXFA 4OQVA 2PTZA 2XGIA 4W88A 3IGHX 4U4MA 4GCXA 4UIOA 5G2WA 2WQDA 4FHAA 4HHLA 3BJFA 1KCXA 1V08A 3KL3A 2JF7A 4IP7A 4RE4A 4Y9PA 3O63A 1N8IA 3LN3A 2PAJA 2TAAA 2WQPA 4G8TA 3WBYA 1N8FA 3GH5A 4WXZA 5H1WA 4CD7A 4IFRA 2GJXB 3UEQA 3W7JA 4I9MA 4BEQA 5JVLA 2FMOA 4LEQA 2RGMA 3PJTA 2Z7GA 1GEHA 5BXPA 1CNVA 3WENA 5FEZA 1G4TA 1G01A 4QQUA 3DERA 3S6OA 3MP3A 3PFMA 1TPC1 2VO5A 4FOKA 4AZCA 2CZFA 5TF0A 3D3AA 4XZMX 1EZWA 1EX1A 5I78A 3DAQA 3BLIA 1M7XA 2PDJA 4QLJA 2D22A 1TWWA 1LG1A 4Y6GA 3MT1A 2CYGA 4WY0B 5PTDA 2QJHA 1J2BA 2GDQA 3EMQA 7XIMA 1E55A 3EX4A 2PP3A 2QCMA 5HMEA 2ZYFA 1BKHA 1K9TA 3FX4A 3PHAA 3B0YA 2XFFA 4IG2A 3QC3A 3GUGA 2O9PA 4ECLA 3TR2A 3ZVIA 3OPSA 1EZ2A 1HJSA 3W28A 3RU6A 1QPOA 2Z29A 3TK7A 1V51A 4Z1AA 4HN8A 2V38A 4PB4A 3EPNA 4F8XA 4JTGA 1TR1A 4MIMA 3BH4A 4JTCA 3I6TA 4AD0A 3HQNA 2G3IA 1EDTA 4CN6A 4POCA 3H23A 2WJFA 1KQZA 4KPLA 5HWNA 2E1WA 1NDYA 2XM1A 4ZQCA 4UTIA 3THCA 3PZ9A 3VGEA 3ZJ7A 3TR9A 2G5WA 3OZYA 4AD3A 1WAUA 4IMCA 3LZ3A 2O4QA 2CKRA 1BXNA 1CI1A 1ZUAX 3VOHA 2P10A 2I17A 1E70M 1YBQB 3TIMA 1O66A 4IJRA 2ON3A 5EMYA 2ZUWA 2EJAA 4UTWA 3WYZA 1XISA 3ITLA 2CBIA 5M5DA 2E68A 2P3EA 3TN4A 2QCCA 4ZXOA 2ZX7A 1XP3A 5BCAA 4QXIA 3KTSA 3W7MA 4QLLA 1D8WA 2P50A 3G0XA 4PMVA 3TX9A 5IM51 2CZEA 4W84A 2GQ8A 3S1XA 1I9CB 1QCWA 2QZRA 3CZJA 1GJWA 2I9UA 3EMZA 2X1RA 3TYCA 1SO6A 4H7VA 4UTKA 1XCFA 3WLRA 3NGJA 2DQWA 1S2TA 1XIFA 2EPOA 4LUTB 4D8AA 3SSZA 4A3QA 4YJ5A 1T99A 1EFZA 1T5AA 4FLOA 5I07A 4MJZA 1M7OA 2GGIA 3GVVA 2HK0A 4HJWA 1GQKA 2B31A 2VCBA 1KTNA 3HN3A 3QQ1A 4ADUA 1HTIA 1O5RA 3GXIA 2F2HA 1QDSA 3UG8A 2XVLA 3GU1A 3NTYA 5T9CE 4OV4A 3PPGA 4B90A 4B5WA 2YKKA 1Y8BA 3RX2A 3NPWA 4XO6A 4JTSA 4UZSA 3T6CA 2QKFA 3NM1A 5HAOA 1C9DA 4U5IA 1JCMP 3BXWA 5GJMA 3I6EA 1HKVA 5EYWA 3T81A 3SEPA 1EOMA 3APYA 4W8LA 1B3ZA 5I06A 3F03K 4K38A 2V3FA 3M5YA 3OGRA 4LF1A 4LW7A 2O9TA 1SO3A 4HK5A 1XQLA 5I3KA 1XLBA 4HIBA 5TQLA 1ZHAA 4QG8A 2P0OA 5IDZA 3C2VA 4M6PA 5LYRA 4NX0A 3AXIA 3KS5A 5E9XA 3ANUA 4RDZA 4JHMA 3RLUA 1LLOA 3DFSA 1IHIA 4LCSA 2ZDRA 1GVSA 3B03A 3P8IA 1TMHA 2PZNA 2WNQA 3PAJA 1HUVA 4TMCA 3OU8A 2PB1A 3MV01 1EUNA 5HNRA 5I3FA 4O0ZA 3B0UX 4LGXA 3GNRA 1E71M 2C14A 3ZLHA 5IHSA 1V6WA 4MLRA 1DWAM 2ZRZA 3CU2A 2EJ1A 2BODX 1F61A 3CQKA 1B2YA 3EDKA 2QAFA 3LCFA 3IJ9A 3GXPA 4FK9A 4ACZB 1OK4A 4E3VA 4PR4A 3P7YA 4H8HA 4Y9OA 1MXDA 2CLHA 4EPBC 1UR2A 3I7QA 5AYBA 2QCDB 2QUVA 2DGAA 5D8WA 3N3MA 4OECA 4NZ3A 3NVTA 3P82A 2YFOA 4U2ZA 2ZZ5A 1FXQA 2TODA 5E6YA 4JN8A 5GJPA 1QTWA 2JFEX 1V02A 3WQ5A 4NXKA 1WYIA 1I2OA 3NL6A 5EKYA 5ABGA 4H9TA 3VKKA 1XD1A 1AODA 4F2BA 4A2SA 3CT2A 1W9VA 3THQA 2VI0A 1ITXA 3G22A 1GTEA 3V5OA 1KKOA 3NFUA 4GPNA 8RUCA 2HSAA 3BW4A 3B8DA 4DXKA 2V68A 3P81A 4LS0A 1WO2A 4DF0A 3RU8X 4XZIA 3ZR4A 4LEFA 5EPDA 4G7EB 4S3AA 2DT1A 1DXFA 3SCVA 1Q66A 1OGGA 4A8LA 4TXEA 3Q45A 1SR9A 3TYUA 3ALGA 3MYPA 4EIVA 4H8UA 5JU6A 6A3HA 3T2QA 3LSCA 7PTDA 2HVMA 3GNNA 2J47A 4LRTA 3LUTA 2DV0A 1SFTA 1XPYA 3S8HA 2IPJA 4ERAA 3A64A 3TW6A 4FPSA 1UA3A 4PA8A 3MZ2A 2NVCA 1VAHA 1AH0A 3LCGA 3P74A 4FMVA 4FXJA 2PCEA 1Z42A 5H8MA 5DBUA 4R5EA 3T0DA 5KTLA 1OIMA 1JFHA 1GGOA 1FX6A 1XSKA 3BMXA 2Y7DA 3SGUA 1QNSA 4LB3A 2P3ZA 2BHUA 3B97A 1CW2A 5BXRA 2WKGA 4M0XA 4X0VA 2PDHA 4GO9A 5HR6A 3TZFA 1HKWA 1RUSA 2Q02A 4LX4A 4FXSA 4JBRA 2NVDA 4DO5A 1DE6A 5D32A 4AISA 3PTKA 4DVOA 1C92A 1XM3A 3GFYA 3EOUA 1O68A 3NZGA 2J9ZA 3HPSA 4JR5A 1FH9A 4KIRA 1VCVA 3F7JA 3UJ2A 1ICPA 1IWAA 2YR1A 3G0SA 2BX7A 1E1CB 3GNPA 2C1HA 4YIWA 3DBNA 4M8UA 2ZXQA 4UBPC 5LIUX 2JF6A 2IMRA 3KOFA 3LY0A 3E38A 3QOMA 4HNTA 1PCWA 2V63A 5CGQA 1QK2A 3WF2A 1TV3A 3GTHA 1OEPA 3C5QA 1A3XA 3OLEA 3GDTA 1TPDA 2FFCA 3EB4A 3UCDA 4PTVA 4IM4A 3AS2A 1TV7A 1XSJA 2J7GA 3S4TA 1WB0A 2DFAA 4RJEA 2V5DA 4E8DA 1DTNA 1UZ1A 2J66A 2OCZA 1XIEA 4D71A 1XF0A 1R7OA 4ZO6A 2C0HA 3N6HA 5I3JA 3DBPA 1TCDA 5HQEA 4Z1CA 2IPWA 3LOTA 2R1KA 1F4HA 1NDVA 3TA6A 3KOYA 3WCZA 2DIJA 4US6A 1HKKA 5LNUA 4K8EA 3VABA 3ERPA 1DXEA 4GK8A 4MOZA 4WIWA 1JZ4A 5AC8A 2ONEA 1GWJA 5M2FX 4O53A 3IIVA 3V75A 5JIWA 3VIPA 4L1XA 4OBTA 4K8GA 4ZTYA 3WQVA 2XH4A 3L23A 2VR5A 3UJRA 3VD4A 2PGFA 2PBGA 2WNNA 2OLAA 1M41A 2GGJA 4MDOA 5AVNA 1XRVA 1P6WA 5C7VA 3FS2A 3VMPA 2BG5A 3O06A 1P1XA 5AECA 4TVUA 1J4EA 3UCCA 1GJUA 1TTPA 3WDJA 1XYMA 3ZVHB 2ISSA 3LI1A 4LAOA 3HB9A 1JR1A 4TMBA 3CYVA 6PTDA 1LL7A 1TQXA 5IXEA 5XIMA 1VC4A 2QDGA 1SZGA 4X9YA 1H7WA 1VFTA 2YOCA 2PGEA 2JIWA 4AYGA 1I60A 3ATYA 2WW5A 3OLDA 1A53A 3KTCA 3G1YA 4XSMA 3W1PA 2ZOXA 4QIUA 5IFPA 3SCPA 4X61A 1RH9A 4J35A 4FLSA 3DYMA 1XLEA 2Z00A 3U9IA 3GW0A 3LCLA 4NIRA 1US0A 2V5CA 2W62A 3S2CA 4LV4A 3FIGA 1YDNA 4O1AA 1V0LA 3F2DA 1GQIA 3PF3A 4ZB2A 2INFA 4DWSA 4AMCA 4H00A 1T96A 2B81A 3BAYA 3U48A 3NSNA 1HF6A 4O1CA 4FEZA 3OA5A 3CEUA 4QHRA 2D24A 4Q4SA 4RDWA 2FPTA 4AXNA 4X0NA 2Q3OA 3SSJA 2CCRA 5D2VA 4ZB0A 3ZO9A 2MNRA 1EKOA 1HL8A 2HS6A 1ECEA 3W7QA 2OGJA 3FGCB 3ZFHA 1SW7A 4UOJA 1SZRA 2XN0A 1ODZA 4GIEA 4MAZA 3POCA 4EX4A 4ZR8A 4JQ2A 2UWFA 3P5ZA 1C9WA 4MFEA 4JTUA 3B8IA 3SQMA 4WY0F 3VIHA 1RR2A 3GY1A 3R2GA 4CEUC 1YKWA 2Y85A 4GC4A 4EPKA 3VFCA 1TPFA 4PBFA 5DY2A 2FZBA 1EJRC 5CZSA 4RXGA 3NXFA 1SQ7A 4R53A 3SCRA 1UKPA 4DUVA 5BOOA 4QRNA 2WMKA 3MQTA 4H8NA 1XHGA 5HUPA 2VR4A 3SCQA 2R6OA 1E0TA 2BY2A 3MA8A 4MFDA 3B06A 4LUIA 2AKMA 2ZKMX 4WQ6A 2VGFA 3KL5A 2PFHA 3RX3A 1DJYA 1AQ0A 3AHVA 3S2JA 1B1YA 4XZNX 1QNQA 1UKQA 5C9ZA 1Z8AA 4JFWA 1OIFA 1TJ0A 2R1NA 2OQYA 3HA1A 1Q2SA 3ATZA 1YDOA 1HGWA 3EXSA 2PWVA 4M1RA 4RK8A 5KZDA 3HPFA 2Z7KA 3HGSA 4MWAA 2DSZA 1WOAA 2BLEA 5DLCA 1KCKA 3VIGA 2PRLA 2Y61A 2GUUA 3KRSA 1WNOA 3RAOA 3ZLFA 4IQDA 3KEHA 1PO9A 1GQJA 5ABTA 5GPRA 4HSHA 4Q8NA 3W7DA 4FXRA 4OOUA 2DU2A 4XZ9A 3GWQA 4IMFA 3LTPA 2WSKA 4O1DA 1GZ1A 2OO0A 4G9PA 2ZX5A 2G3JA 3SB0A 1WXJA 3KUMA 5CJ5A 1OM0A 4HN4A 1TKKA 3IVUA 1JVNA 4NVTA 3UXKA 2OGYA 2RAGA 1OYBA 2R82A 5FAJA 1A3HA 2VCAA 2WCAA 1K02A 2Q3RA 3K1GA 4NNCA 1JDCA 4PSPA 1X38A 4AWUA 1MW1A 3CL6A 5A69A 4ONVA 3GNDA 3K1DA 3W29A 2QPXA 3FXYA 3OTRA 1L6GA 3PBYA 3OHIA 1OT1A 1J11A 1C7TA 1GPFA 1G94A 1K8YA 3B8TA 4IIBA 1QW7A 4LYKA 2WNZA 3G1DA 4FNQA 4QG6A 2P8CA 3BTNA 2QJNA 3LG3A 4HGXA 1L2UA 1KFLA 3RPMA 4RV8A 2YDRA 2IQDA 1B54A 3E2VA 1OG6A 2QR6A 4QGCA 3IRDA 3H53A 4BJHA 2VOMA 4DF1A 2ZZ4A 1EGZA 1SR0A 1SPQA 1XC6A 3C61A 5DCDA 1IQ8A 4N9BA 3JR2A 4ZA0A 1W56A 5EMLA 3NQMA 2JIEA 2UY4A 1IEWA 3O3RA 1R2SA 2VRKA 5HULA 3C2EA 2CZ5A 4UC5A 2EF9A 3KCLA 3WL1A 1R47A 2W4XA 3UCQA 3E74A 2YX0A 3P61A 5T9BG 1LUCB 1OCNA 2FZDA 1ZQ5A 3F4DA 1OBAA 2AKZA 2FKPA 1M5WA 2RUSA 5CBIA 2XN2A 2OYMA 1O5KA 4Z0SA 2X0SA 1OC5A 2XYLA 3QHNA 1V0MA 1PHWA 1OX6A 3UXAA 1N8WA 5AC5A 3ES8A 4A3YA 3GXTA 3L4ZA 4B4HA 3CK5A 2J7CA 3LENA 4FNTA 2AL2A 4GOAA 3M1ZA 4H9MA 1WKDA 5FKYA 3I4EA 4CCZA 5D33A 2CHOA 2PODA 4JDYA 4JY9A 2PMQA 4IFKA 3TAKA 4UCGA 1QK0A 3U7VA 3NQ8A 3DECA 3EX3A 4E5TA 1IT8A 3W1RA 3BJSA 1AL7A 4FOJA 1FWIC 4OWGA 4P61A 3PZQA 2WSQA 1JIBA 1Q4WA 3NXLA 4AIOA 3TWAA 4Z2HA 1TVLA 4CU6A 4C6JA 3LQLA 5CZKA 5LNSA 4JD4A 1CGYA 4Y9AA 3WQ4A 1RY8A 2L5HA 3UZZA 2BOGX 4MY8A 4DY1A 3CAKA 4LNYA 3AIEA 4Z2KA 5M3WA 3W7HA 3C3UA 3L5LA 3QKZA 3KW3A 3OVQA 4IIGA 1GG0A 1NF7A 1MUWA 1VBHA 4CGTA 4BI7A 4Z2LA 1BTCA 4WXYA 3VNJA 4JQAA 2BVDA 2WMJA 1J6PA 4ZOCA 2EEXA 1LT8A 3TVAA 4GI9A 1OJXA 2QJMA 3W23A 2EG7A 4B5XA 1SZNA 3IACA 4FB7A 3CWNA 4XAPA 4GNJA 3NVDA 3PBVA 3PG9A 2EQDA 1NQ6A 1BF2A 4DYEA 2XISA 3A23A 1H7OA 3MANA 3B8UA 3SUUA 3WBEA 1Q6FA 2IPGA 2BV9A 4L6HA 4AHOA 1MNZA 3E49A 4QAWA 2C7FA 3VM5A 2EPKX 4DUWA 4TUFA 1G7UA 1L8NA 3TQVA 1F73A 2BGQA 3A4JA 3IJ8A 5K9DA 1RV8A 4BWLC 3Q37A 4O57A 4WKFA 1OD8A 4E3TA 2Z24A 4UTTA 1XLKA 4S3EA 3N73A 4H9UA 4FO4A 3RMEA 1IXPA 3L2IA 1A4MA 3FHQA 5F2GA 4NI8A 4PTMA 2PWHA 2X2YA 5DANA 1S3TC 4BS0A 1VYRA 5HNNA 1NDWA 3AZRA 3W27A 3W2KA 3M44A 5KZ6A 4K8HA 2XFYA 1TB3A 3O6AA 1JNEA 2D73A 4U33A 2H9AB 3NA8A 1J96A 4MB5A 3M4HA 3W24A 1J0HA 3DZ1A 1E6ZA 4DN1A 1KGWA 5D9PA 3G6MA 2ACQA 2AQOA 3IK2A 5DXYA 4WEVX 4XZHA 4UTJA 1NM9A 1A5LC 1RCOB 1DWJM 1JZ8A 1UH2A 3WLSA 1Y65A 4GQBA 1EEPA 3XISA 4QR6A 1RA0A 3BGGA 3TC7A 1PWLA 2YCLB 1TJ2A 2OWXA 2B0MA 3UGRA 1DJQA 4LPCA 1CEOA 2CWXA 2HVOA 2BXYA 4UQDA 2ABBA 5A94A 3R6IA 2FTPA 2PDCA 3LGEA 2VFIA 1TX2A 3AYTA 3DUGA 1A5SA 4O54A 5HMSA 2J6VA 1RLCL 3HGOA 3MS8A 4AY1A 1WKFA 1SZFA 1OQFA 9CGTA 4XB3A 1E51A 2D2HA 1P7TA 2QCLA 2NX3A 3F4CA 3NOYA 2HE5A 4CCCA 4TVDA 1F76A 5D9NA 3TKFA 4EE9A 4UNIA 1PX4A 2V2DA 2FGBA 3MB9A 4LBUA 1E56A 5HDRA 4MUPA 1J18A 2C13A 4JIQA 3GDKA 2YZ5A 4R7WA 1BYBA 4RDYA 4AF0B 1XRTA 4HVXA 3CMJA 5CZ0A 2VEMA 1B30A 2RDXA 4Y9NA 4O15A 3MUXA 3DFPA 4EXQA 3DU0A 1EO5A 5EGRA 3NQ2A 3PB0A 2GUBA 2A85A 3R8GA 4NJIA 1OYAA 1ZALA 1QMLA 4D72A 2WKJA 3ABXA 4O50A 4F66A 3PZNA 2CESA 1F05A 3OEXA 2V2HA 3RM9A 1QPNA 1V3LA 4B4FA 4AEOA 4XK2A 1JQXA 2EAWA 3W76A 2ASHA 3ARSA 4GG9A 5I03A 3TH6A 5DT7A 4MMWA 4R85A 1TX0A 4JYEA 3L68A 3T0AA 4PMRA 3LCWA 2Z1XA 2J6XA 5E9AA 1QNRA 5MKGA 1W3IA 3VZYA 4B16A 4Q6JA 1K9EA 1OFPA 3WMSA 4MB1A 1H51A 2J78A 3GM8A 1WZMA 1TV2A 3CTTA 2QHAA 1W9UA 2BHZA 4AUBA 1R30A 3DENA 1YADA 2DVUA 3B8SA 4JL1A 3IV3A 4ZXLA 3EZ4A 3TSDA 1HW6A 1A0DA 1GTHA 1FKWA 1ADSA 4HMCA 1O1HA 1QFEA 3CQ0A 5LHFA 1GYNA 3PZTA 4EWJA 1KV5A 4HHHA 4WDXA 3OVPA 5EBAA 1B3XA 2EKGA 4UMAA 3CZKA 4GQGA 4AH7A 2NXIA 1O5QA 1W3HA 1EJVC 2E9LA 2X2GA 1UOZA 1RSCA 2HK1A 3LB0A 5DRCA 3WY1A 3UWZA 1S39A 3KP1A 1TPEA 1DIOA 2GSJA 2WWDA 2YSWA 3KRZA 2OKTA 3U2CA 5A6LA 3D3FA 3BSMA 3GHRA 3P2VA 2REQB 3IJ6A 5IFTA 4JKLA 3QQ0A 1ZPTA 1GKRA 1FHVA 3N25A 1BG9A 3N9KA 4NUWA 4PTXA 3JZUA 3U6WA 1JUEA 3WQGA 6TAAA 5IBXC 1KRAC 2GGEA 3N6JA 4JKKA 4Q7BA 2WHMA 2DUZA 4X2PA 1F8MA 3VOIA 2JGYA 1H11A 2ZICA 4LFYA 3H2OA 2E25A 3EBVA 2QJJA 3GAYA 1X6UA 2IXUA 5CC5A 1LQ2A 3WK1A 4L56A 1R3SA 1WOBA 2NVAA 1Q6RA 1HJQA 4IP4A 2BOFX 1JPDX 1NEYA 1RD5A 1RQBA 3CH0A 1FWDC 2F6KA 2PTDA 3W1XA 3RM4A 3JU2A 1LOLA 1HKJA 3CUIA 1ZGDA 4JL2A 1D2KA 1U83A 2QVHA 4F0MA 4TX8A 2BP1A 1XBZA 4ILSA 3T07A 3CUJA 1TE6A 3S1UA 3IANA 5I6SA 3QFEA 3GHSA 1IR2A 1C7SA 1EWEA 3F2CA 2NQHA 3WLMA 4F3HA 4R33A 1UWQA 3V0UA 2ZC1A 5CG0A 4R9OA 1V6UA 3AFBA 3QKEA 5A6AA 1BRLA 1YTKA 4A3UA 2NLIA 2R8WA 1ZNNA 3AYVA 1DHPA 4WDWA 3UZ5A 4O28A 1PZ2A 4TX9A 4MNKA 3AISA 3MMTA 4PEEA 5KITA 4RR4A 2OVLA 3HMCA 1I2NA 1MFUA 4GYFA 5FJJA 3R5EA 4IUGA 4PUDA 1YNYA 4H9YA 3SN1A 2YDQA 3SURA 3FN9A 1KM4A 3KCJA 4F48A 2Q8LA 2ZRWA 3QVQA 1R9XA 4JCLA 2PZ0A 2POZA 4HKPA 3WF1A 3W07A 3SN0A 1Z44A 4GGBA 4KEZA 4PBGA 2PDPA 3OQ8A 3ZT5A 1KFJA 3PP7A 1H7RA 5TAOA 4RNHA 1XXXA 1NOUA 2EBNA 3GVRA 4AG0A 4J3SA 3TP4A 4K7VA 4AD1A 4KCUA 3ARPA 2DZWA 1P5BA 4WJ8A 1R86A 3EPOA 5FJIA 3D6NA 3N11A 2X7VA 3RPDA 3UA3A 4NSBA 2O9RA 1U5VA 4PULA 1TFVA 1TV4A 5I2UA 3NPXA 3VIMA 2A0NA 4YYFA 1M68A 2XH2A 3SCOA 5G4WA 4HB7A 1BVNP 5DF0A 3HG2A 4FALA 5KINA 4CNUA 3GG8A 1TA3A 3UW6A 3WQPA 1ICSA 4Y8FA 4WX2A 4ML4A 1AZ2A 1A5OC 4Z42C 3WJWA 2VHLA 3E0FA 2F38A 4AW7A 5AB3A 1X6LA 4GYPA 2OXNA 3WUEA 1I8JA 3KVMA 5C2XA 3PWGA 3QY6A 2DIKA 1FOBA 2QAPA 4C90A 3L7RA 3VNZA 5F4SA 2VFGA 2GQ3A 1BGGA 1R0MA 1VEOA 3BPWA 3R0DA 4FP1A 3KVLA 1G9HA 1GVOA 4HD5A 1QO2A 1WQ5A 3T4CA 4XG1A 6ENLA 4XVDA 4KEVA 3K2GA 1R87A 3UVIA 1NH6A 5GQBA 3NZPA 2CBVA 3L65A 3AXKA 1EEXA 2YYTA 2PDLA 4CQAA 4O4WA 5CAHA 3PC0A 2ZRXA 4EXAA 2X16A 3QOKA 1MUMA 4IQLA 2VUNA 2Z25A 3GXNA 4IT1A 3V35A 4J40A 3ZM8A 2BWGA 4KH2A 4NAFA 1SJCA 1HJXA 2EHHA 1UC5A 1HKMA 3A6OA 5HOSA 1F7BA 4TOQA 3ZR6A 3B3DA 2VWSA 1FRBA 4HU0A 1LT7A 1JPHA 1DJGA 3VNYA 2NW0A 3REQB 4RDVA 4GXPA 1IXNA 2FZMA 2V5JA 2WSRA 4C6KA 4OGZA 1LRNA 3UJFA 1HJWA 5KZMA 4GQQA 2C3ZA 4WOQA 4ZOBA 3G6LA 1HNYA 2YXOA 3LTSA 3NJ3A 1EO7A 4P7QA 4OJYA 1UH4A 4FIRA 4HCHA 4XIAA 1OADA 4RE2A 4H2CA 5LIXX 4PUJA 4LYQA 4CD8A 1ZB5A 2FZ9A 4NZ5A 4WSHA 4V33A 2OJPA 3A5VA 4L80A 4UFJA 5I7GA 2DSVA 3T55A 1E3ZA 3H4XA 6ALDA 1LQAA 5CG7A 1VJZA 2E6AA 2DSUA 3RDKA 1V6TA 4XO7A 7REQA 1CGVA 4FX8A 4GJIA 3B8WA 3C6CA 3RX4A 3GHTA 1XKJA 3WQOA 4JQ3A 4XISA 2JEQA 3ARQA 4AEFA 1S5MA 3BCDA 3FJ6A 1MYRA 3R11A 3W7EA 1OFEA 2A3BA 4WLCA 3APTA 3V5FA 1FH7A 2PSNA 1KBIA 3R10A 2BNJA 1U5HA 5C2CA 3WNLA 3KHDA 4IZGA 1DIDA 4AIEA 4A8IA 4DBSA 2FVKA 4CKQA 1XGDA 1XPGA 2FGZA 3TN6A 3K30A 4QE1A 3T0TA 3JZEA 1L6FA 2F84A 3G3MA 1G0CA 4UNLA 4BZYA 3SUSA 4NP7A 3T09A 1XFCA 2KZHA 3W4RA 3N2XA 4HZ7A 1U1UA 3UZJA 2X42A 4XWUA 1A5KC 1OZQA 5I3DA 1LTDA 2FJUB 3D47A 3VO0A 3PJXA 4AIUA 2HRWA 3NPUA 5XIAA 2QV5A 2BVTA 4ASTA 1U22A 4LUTA 4LY4A 1RQHA 2D1ZA 1XLAA 3O9NA 2CZVA 4G56A 2E9BA 3D0CA 3VYLA 2YL6A 3WK0A 3FHAA 1SO5A 2TPSA 4AY8A 4YHGA 1GKQA 3R4IA 1UD3A 2JKAA 3CZEA 1YE4A 1ZTVA 3VNDA 1A4LA 5A8GA 5FESA 2VFDA 2XHYA 1QBBA 1S2WA 1W3TA 1KA9F 4IG2B 2OOGA 1PB0A 3WH7A 3LERA 4UFHA 1E4NA 3BLKA 6CGTA 2ZVIA 4WVXA 2GJRA 1X39A 3OG3A 2NXHA 4NZJA 1W1B1 3TTEA 5CJNA 3QFWA 4F0LA 2IS7A 4W89A 3H22A 3QPZA 4DYJA 4ICMA 1B4KA 4C5ZA 3GR7A 1NOFA 2BZNA 2F6UA 3QSRA 1F4AA 2ZUSA 3P93A 3H21A 1R6WA 1R9YA 2WB5A 3BQ5A 1RBAA 3PY2A 1MDRA 2ZXAA 1YXDA 4LVDA 3QC0A 1MO0A 3IRSA 2P53A 3U5YA 4KFNA 3LMZA 1KFKA 1OX4B 1EC7A 3E96A 4TTUA 2P1FA 4WF7A 2ZE0A 5CPTA 2CW6A 1XIMA 4UMBA 3A4XA 4QNEA 1PIIA 3MO7A 4CU7A 3DHUA 5EA9A 4Y9MA 3EOOA 4LSBA 4M1BA 4CEXC 4IOTA 9RUBA 5H8PA 3UPMA 3G1SA 1FWEC 1IEIA 3E0VA 3SUTA 2PWFA 4RUBA 1AZ1A 4RE3A 4OZOA 1BKSA 1RPKA 4PMOA 1QHZA 5H2ZA 3THDA 3K13A 2Q09A 4GRSA 1KWKA 1QI3A 3L21A 1FFQA 3CZGA 1FHDA 1TTJA 4CD5A 1FVPA 2GGGA 3UNTA 2C16A 3SIZA 2WWCA 3HOJA 4JFVA 3ZR5A 1R9ZA 3ME3A 3LBOA 1LF1A 2HCVA 4EAYA 2Y8VA 3QHOA 1JL8A 3SN4A 3HQOA 5HNTA 3IJIA 1XDLA 1GOMA 1R3WA 3BLPX 5AZ0A 4HYRA 3M0IA 1YDVA 2V3GA 1K7XA 3SDOA 3NQDA 2NT0A 2BVWA 2FHFA 2NUXA 3SJ3A 2I57A 4KCTA 4PL2A 2YXXA 5I3GA 1W6TA 1F3TA 1R3RA 4JNZA 4TQTA 1M3UA 2WC4A 2YB1A 1MFVA 3DFYA 3N14A 5CGMA 3TXZA 5AYYA 4OIFA 5G2IA 3KWSA 2G3NA 1MW2A 2GQAA 4HZMA 4GKLA 1J0YA 3CQIA 2P8BA 1Q7ZA 5HWJA 2Y63A 1HN1A 4GUHA 1U1JA 1K8CA 3UT0A 2QUTA 2KAUC 4MTVA 3TWBA 5C9XA 3RRXA 1BWKA 3F5LA 4H8VA 4F4RA 1FCBA 3CV2A 3WBXA 4LYPA 1WDQA 1B3WA 4IISA 4AYSA 4I5UA 3SADA 1QASA 4MNJA 3B0XA 4EVZA 2A3CA 3I3BA 1EA9C 1UWSA 1ZJAA 5A8NA 3TN3A 3HJEA 3LNMA 4YXGA 3LCIA 2PCQA 3ZMRA 4GX9A 4ENLA 2E8ZA 3AZTA 2V30A 1JULA 2XJ7A 1UD4A 2WK2A 1EC8A 3LLXA 4D6GA 1JEZA 1VF8A 1R8LA 2XH7A 4QEHA 5JBFA 4AIBA 3NUKA 1UD6A 1UIPA 2GK1B 5ECUA 3LCXA 4DZ5A 1LWHA 2Z6JA 4ERGA 3AS1A 4UQCA 3CL7A 3WIJA 5CC7A 1W8GA 3E2RA 4Q4PA 4HJFA 3ZXWA 1IWPA 3AXMA 3DGRA 4GIYA 4FAMA 3RK8A 3IUIA 1GZGA 1XIGA 4CCEA 2PLMA 3CPRA 7ENLA 3KVKA 1OCBA 3C86A 1OF8A 1KBKA 3W85A 4Y8EA 3KOZA 2RJGA 3Q4DA 3DESA 5AHLA 1X8FA 2D2GA 3SY1A 1GOXA 3FAXA 2Y70A 5AZ1A 4OHQA 1DTUA 3PZUA 4O18A 2ZA2A 3T0BA 1EF3A 1WV2A 1WAWA 1WUFA 2QMJA 3G8EA 5A3HA 1I4NA 3GZAA 4CN1A 4N4PA 4Q8VA 2I14A 3KBSA 3T4WA 4IMGA 5AOUA 1XG4A 1H60A 5DT5A 3M0XA 3VVGA 2QCHA 4UFIA 2V5LA 1BTMA 1PYMA 3VILA 4C6IA 1VR6A 5A6MA 4F0SA 3DG3A 4MWAC 1RHCA 3FDKA 4LVBA 2E5BA 5HPCA 4MVAA 3AIRA 3RGTA 3INPA 4JGDA 3MUCA 3TJLA 3FDGA 1SSGA 4FX7A 3NGFA 4U28A 5CPQA 3K4AA 3GBDA 1JG9A 1LCOA 1ADDA 1DIEA 3F4WA 3ZS4A 4F40A 3VIJA 2NQLA 3PM6A 2OO6A 1T8QA 1IIHA 3IARA 4ALDA 1MW0A 2ZDSA 3BAJA 3MKCA 3WEMA 3VDGA 5LNVA 4LOCA 3NQBA 2ZWYA 2QS8A 3DDMA 4NNAA 3AUOA 2UBPC 3E0IA 3VPLA 5FJOA 4DXVA 4S3GA 3GNOA 4YTTA 1DHKA 1ITQA 3NQ6A 2NSXA 3KS6A 2C1GA 2UY2A 4A3RA 3TOYA 5D05A 4HMDA 4O8AA 5CQ1A 1J12A 2OT0A 5A6TC 2V82A 3TC6A 1XLJA 4PRRA 1UKTA 4G2DA 4O1EA 3HPXA 5CLWA 2RH9A 3B9NA 4JOMA 3UR8A 3CV1A 4PL1A 1XI3A 4PUMA 4GZJA 1RJPA 4OV9A 4GX8A 2F61A 3IV8A 1PXGA 5A1AA 1XKYA 5C7HA 4DJFD 2VRQA 3WQ8A 1OG0A 1TJ1A 4C6DA 3A9IA 3GTNA 3LRLA 1I2RA 1XQKA 4UB9A 4UTFA 2EXOA 3M0JA 3SCSA 5HQMA 4UTLA 5HINA 1Q6GA 1C3FA 3WDPP 5CEWA 4TV5A 4GO8A 3QLDA 3CAVA 3NL5A 4QNWA 3CMGA 3T40A 2VEGA 2XZ7A 4NJHA 2XVPA 4H6KA 1JCNA 4DPPA 3B0VC 1UPMB 4AB4A 1CXKA 3NQVA 5BMXA 2GSEA 4AZBA 2YPIA 2H90A 4MADA 4B5SA 3FXGA 4UZUA 1C8XA 3U4FA 3M7WA 4ICCX 3UR7A 3DKLA 1FTXA 3N4AA 1AMKA 5BROA 7CGTA 5D09A 4NKCA 2OWWA 4HNCA 1KM5A 5E70A 2ABAA 1DJHA 2VELA 4IGHA 3T44A 4GQ0A 4J4KA 4QBXA 3H4WA 2PF0A 4S39A 1XS2A 3LPOA 1H41A 3GE7A 3COTA 3VCRA 2O7QA 1QRQA 4UTTC 3N17A 1CENA 4F79A 4EKJA 1GHRA 3I68A 1XLLA 3VM7A 3TV8A 3VDAA 4PH6A 1TQJA 3ES7A 1XR2A 3P0XA 3LV5A 1OABA 1QOPA 2ZZ6A 1V8EA 4RW5A 3I3DA 4HA1A 4K68A 4X63A 4PTWA 3K8LA 5A5WA 4MYXA 3ENLA 4PMZA 2CETA 3BMWA 2ZE3A 2ZBTA 3RRAA 1JD9A 1YBQA 5DMLA 2P76A 3H54A 1V4YA 3W1UA 1FWRA 4CNNA 1UD2A 2W92A 5AYIA 3AI0A 3TOPA 4XUYA 4D6CA 5F4WA 3L0NA 4MSSA 3UWWA 2V2CA 1RPXA 4GCAA 5HJYA 1F3WA 4C6MA 3GHUA 3L0KA 4DZIA 4XKMA 3WNOA 1C93A 3PZVA 3H70A 2ZVRA 1RD6A 3BCJA 4N4QA 2D3LA 4GISA 3UXIA 2G4FA 2W5FA 3GX9A 5AFDA 1J0JA 4O14A 3FEMA 1FWFC 4LAKA 1JDDA 1VQTA 1T8XA 4KBXA 1C8YA 2YCJA 4H04A 5EBUA 1AJZA 3O8AA 3WUGA 4GJ1A 4ATLA 4YMZA 1JPKA 1SFSA 1ESWA 4WY0A 2F9RA 3B4YA 2XSAA 2G50A 4BHYA 1SGJA 2J77A 5I3IA 1LDCA 3WKZA 4L9ZA 1P6CA 3EMCA 2GJLA 4M6UA 4AEEA 3UG5A 1E6NA 3L67A 1DIKA 4MWAE 3PG8A 2PLJA 1W3NA 3RLGA 3LEPA 3DFTA 1HX0A 4GUJA 1W9PA 1VPQA 5LHEA 3U4AA 5DX7A 4NILA 2ZRYA 4PSRA 1BGAA 3MUIA 3EEGA 2I1OA 5D04C 2VZSA 2QXWA 3HTWA 1BQGA 1THFD 2ACUA 2YB4A 4I5XA 1IEXA 3M16A 4B3KA 1W2VA 1TPVA 3KP0A 1GW1A 3AMKA 2ZRUA 1POKA 3I7SA 4DELA 1XIBA 3M7SA 3WJYA 1R3YA 3PULA 2AMXA 2VZVA 1AQMA 3WDQA 3ZWTA 3I10A 3UXLA 2WMGA 4MZYA 4W85A 5K7JA 3BVJA 1OFBA 1BWLA 1PUDA 4J2PA 1JGIA 1US2A 3W9ZA 3OZPA 3R7MA 1YPXA 4AZIA 3VU2A 5BOEA 3GD6A 5DEZA 4YYCA 4NRRA 3ABSA 1G4PA 1HJVA 3M0HA 2XIBA 1FXPA 1YYAA 5LZLA 5AC6A 2E6DA 3WNPA 2PDQA 1PKMA 3QGVA 3CJPA 4PMDA 5JXQA 3WFLA 3AO0A 2CXGA 1YXCA 4FLRA 2CEQA 5EMJA 3PFRA 3PSWA 1LLZA 1O94A 3M9YA 3B9AA 1TPB1 1M01A 3HGRA 2J75A 5JBEA 4DQWA 4LU0A 3MSDA 4DJFC 1NARA 1OC6A 4Q22A 2QDHA 4ROPA 2CITA 4U3AA 3OODA 1ZBWA 3VZZA 1Z69A 3BAKA 4RNJA 3KRBA 1ISXA 4AHPA 5H8UA 3THUA 1L6SA 2DIEA 3EWUA 4ZCWA 4AVFA 3NM3A 4Z08A 2FHCA 2GZXA 1VH7A 4LCRA 5C8BB 3KZSA 1NP2A 2PDNA 3ITCA 2GDUA 1I1XA 3J7HA 4C6NA 5CZTA 1B0IA 3W2LA 3R25A 2YXGA 3M07A 2HTMA 3BL3A 4M82A 1ZENA 3EXRA 3UWVA 1N82A 2OEJA 1OFOA 1Q4NX 2IKJA 5K3VA 2Y5SA 4AD5A 1CXHA 1GHSA 3LSBA 2X8RA 5LXEA 1EJSC 4YCPA 4HNOA 3OG2A 1ITCA 4HK6A 5GVJA 3V4BA 3G2GA 1V77A 1Q6CA 2O92A 2CHRA 1UA7A 5G1YA 3G77A 5CH9A 1V3MA 3SCWA 1FY6A 3BV4A 3MPGA 5CSUA 2E09A 4H7ZA 1NF0A 1TZ9A 1AJ0A 4DI8A 3MP4A 4JZ5A 4H9ZA 1PIFA 1G4SA 3Q67A 1KTBA 4GI6A 3MC5A 2VC9A 4KWVA 3FK4A 4KETA 1K4GA 3VGHA 4O4VA 2X1IA 3GXFA 3P14A 1E73M 4XKYA 5FF7A 2ALRA 4B92A 2UY5A 4DF2A 5EMMA 4IPPA 4TVCA 5KSWA 2XU2A 3PBMA 4GUFA 1XL9A 4MJ2A 4LAMA 2R1LA 4DNMA 2H3BA 4RX0A 3MHFA 4J3TA 1SVDA 4D6JA 4H6EA 1VFMA 4CQBA 1EOKA 4W8AA 4RKAA 2XFRA 1GJPA 4DLMA 2VQTA 1Q5MA 1PBGA 2JQXA 3QMRA 5D02A 3CHDA 3HG3A 3CZLA 3FJNA 3EDEA 3W1QA 1PKNA 1X8CA 1RLDA 4PUWA 3TTYA 2GWNA 1SO4A 4UFKA 4Y90A 2WANA 2PWEA 1NJJA 4J7RA 4INFA 4GINA 5C0QA 4ZQRA 1BYDA 1PTGA 2C91A 1JF5A 1WDPA 4WJEA 2WPGA 3USBA 2VRJA 2ZXDA 3M43A 4GVHA 3R89A 3O0FA 1LZOA 1EP2A 4HMEA 3S9IA 2CIPA 3GFZA 4H19A 3WF3A 1D9EA 3A12A 3FEQA 2I5QA 1KFCA 5F7UA 1I75A 3AIWA 3ORWA 1LRTA 4DWSC 2OPJA 1RCQA 2Y8UA 4Q8TA 3IJLA 1CXLA 1D7FA 2WJEA 2VVSA 1U30A 2WVTA 3LZ5A 4E4PA 1X7FA 3CB3A 2CPUA 3VX0A 4GWEA 3SAZA 2V0TA 2OX4A 2NLYA 1EX5A 2ZUUA 4GBUA 4K1WA 5C6MA 4XSLA 2J4GA 1L2QA 3KFTA 5I0DA 3MVTA 3WFZA 2X09A 3VNMA 1GVFA 4BQ4A 2J13A 4GYJA 2X1UA 1CPUA 3VXGA 3NL3A 3O0KA 2XVNA 4US5D 1UH3A 4KGLA 3S1GA 3M47A 1V3KA 3M0KA 3MJMA 1JD7A 2ZA3A 3BMVA 3NYDA 4WRHA 2EG8A 2PDUA 2GSHA 1U2YA 1BD0A 4C7GA 3LRKA 4XD4A 3LPGA 3V0TA 3A47A 3C2OA 4QJ1A 3SW6A 1NVMA 1FDYA 3S5ZA 3P5YA 3RHGA 2HBXA 5M03A 1YIXA 2C79A 1AG1O 3G1FA 1YMYA 5E0FA 1RP9A 3QGAC 2QT3A 5I24A 3S46A 1MW3A 4LVAA 1RQEA 1RXOB 4DJDC 3HPAA 4HPNA 1EL3A 3EKZA 5LA1A 3JUGA 3CNYA 1A0EA 1FBAA 4XAZA 1JZ3A 3W86A 1JCYA 1AW1A 4WR3A 5LA0A 2WPBA 1CLXA 3BZGA 1S2UA 2VFHA 3B40A 1XLDA 3BSHA 3MI2A 1KBBA 3CAQA 1CXFA 2WZTA 4W9TA 2TMDA 2ZZ7A 3IUDA 3HV8A 1TVNA 1HT6A 4N2YA 2OEMA 4UQBA 3PNZA 1GQLA 4L7ZA 4PRWA 3HFYA 1VPXA 3M5ZA 3O6DA 3VKJA 2DEPA 3S6DA 1LQ0A 4NZ1A 5TIMA 1XINA 1WDRA 1VB9A 3EDFA 2V6AA 1Q6DA 3QHMA 2DVTA 1EC9A 1REQA 2QMKA 3W87A 4F0KA 2FYMA 3AXHA 4WK9A 1H7XA 3V5CA 1P7TB 2PDXA 1KNWA 4G1KA 1I1WA 4A05A 3WUBA 1R5YA 3WEZA 3UPWA 3YPIA 3GQYA 3FGCA 2Y4SA 3WH9A 3GBEA 1BYAA 3M6DA 2FDSA 3W2MA 4XD5A 3N2OA 2QDDA 4XBKA 4C1KA 3C8NA 1T40A 3ICJA 1V3JA 2BGSA 5HQLA 2O0TA 5BW6A 2NQZA 5I09A 2VC6A 2D20A 3W7LA 4X22A 5REQA 3S5NA 3G1VA 2I5IA 1FA2A 5DCEA 3ZJ6A 1EYWA 4ZQPA 5D38A 1HJUA 4DXXA 3N29A 1XWYA 1PCKA 1CB2A 3VKAA 1F6PA 3TTSA 3IIOA 3WUFA 4JFUA 4MB3A 1X1OA 3EWCA 3L4XA 3VCCA 4M51A 3WNKA 6REQB 3IAPA 5FI8A 4FX6M 1SMDA 2VTFA 1IIGA 3AWOA 3SO7A 3GS6A 1W37A 1J10A 1ZCOA 2PTXA 3ZVHA 4ADTA 1MMFA 4E38A 1CB7B 2VL4A 3LHVA 1TVPA 2PD5A 2DSWA 1LWJA 1FWWA 3EA2A 3UY7A 3CV6A 1XGEA 3DOPA 4Q8MA 3V36A 2B7QA 4U31A 1EPXA 2AAMA 3KOXA 4YCOA 4W4QA 4QX4A 1GT8A 2PP1A 2YDAA 1ZL1A 4ATDA 3SQSA 2BSLA 1HG3A 1BXBA 4DPQA 1WDWA 4HNVA 3DG7A 3EXTA 1GG1A 4DJED 2RFGA 1C90A 1XSIA 4IQEA 5A8OA 4AXKA 5D2YA 4KT2A 1RCXB 4B91A 1IEQA 2XM2A 3M0LA 1R7AA 3SY8A 1A49A 3TE9A 3TU9A 5BRPA 3A3WA 2A3EA 1YQ2A 2YW3A 3ANVA 3U0HA 3CHCA 2EPNA 3ISIX 1VIZA 1LOQA 5LKYA 3B05A 4FIQA 4FOUA 3QQWA 4H2HA 4KIEA 4Z1DA 3UWUA 2CNCA 1BVZA 1H5VA 1ME9A 5GNXA 3V1HA 2XINA 2TSYA 1UP3A 2G3FA 2R24A 3FOKA 1SJDA 4GFIA 3W84A 1E0VA 3E9AA 1JI1A 4I90A 4DNHA 1K03A 1I0DA 3BC9A 4HYWA 4RZBA 3WDIA 4MYAA 3PB2A 5BRQA 4WDUA 4UTMA 3GU2A 2Q71A 2NV1A 2F8QA 1N55A 1GVEA 1Y5VA 1UQYA 3S6TA 5CPOA 1B3VA 1UWTA 4NJGA 1EBHA 3VC5A 1A47A 1Z3NA 2VGBA 3AHYA 3H7VA 2O9OA 3LHUA 4KRTA 4FA3A 2Q8XA 1OGBA 2Q01A 2QCGA 2YCEA 2WZEA 4XTDA 1WZLA 5GNZA 1V93A 4S3BA 5E5CA 1IZJA 2XVKA 3ARRA 5HA7A 4ICNA 1SMAA 4AZHA 1UWRA 1DJZA 4U3CA 4UOQA 5DXXA 1PJ9A 3PUGA 2Y1HA 1MXSA 3D46A 3T8LA 3KZPA 4MF4A 2ISFA 1GUVA 3N19B 3E6EA 1VBGA 4YWIA 3N2BA 2WM0A 5SWUA 3DHDA 1NY1A 3CQHA 4HQVA 3N1AA 1KXTA 2E6YA 1Q8AA 4IF2A 2BDQA 1HIZA 1DOSA 3QGKC 2BASA 4V28A 4A2RA 3UVAA 4UMCA 2E5CA 4OE7A 3H55A 1EDQA 3LHYA 1UCWA 3UGVA 1UD5A 1FWTA 1PS9A 3DN5A 4K1GA 1NU5A 4P8VA 4LUJA 3V18A 3LD5A 3W2NA 4WZHA 1H0IA 1TPWA 2Q8ZA 4W8BA 1TWZA 2FB3A 1P43A 4XBSA 4F9JA 3KBNA 2GOKA 4C6EA 3CIWA 5C9RA 3F5KA 3MI3A 3S5OA 2P0IA 5FEXA 3ECQA 3TNOA 5T26A 4XD6A 3M5XA 1GKPA 3WK2A 4KCVA 1ELSA 1KQYA 3Q94A 1MEIA 3AIQA 4V15A 1MVYA 1AJ2A 1ONXA 3MU7A 2G97A 4UTHA 3GAKA 3EKLA 1E9IA 1X1ZA 3E12A 4I9JA 1IR1A 1Q3NA 4XV0A 3IGXA 4AAJA 1P0NA 2PDGA 5CSYA 2FFIA 3TMQA 1W9DM 1XYLA 1ISYA 4M3PA 3LTYA 4NZCA 3U57A 1Q2RA 2ZX8A 4JEQA 2HJPA 4PEKA 5HK4A 3S9YA 2PGWA 5HPOA 2YIHA 4PCPA 4UWMA 1O95A 4NG3A 1MWOA 3OYXA 4JTFA 1V79A 1QWGA 1Y5WA 4H9VA 4XD3A 5BZAA 3IEBA 3EDDA 1OT2A 2VP8A 3BLFA 3OVGA 2CWNA 1DQUA 1WXZA 3ABQA 3CBWA 1XX1A 1F3XA 3DX5A 2Z28A 4ZODA 4KQNA 1ME8A 4M19A 4RE0A 3HGJA 3G3DA 9XIMA 1PPIA 3K5XA 3LM3A 3PANA 4Q8QA 1BXCA 4BY3A 1FWCC 2DT2A 4HPGA 1PIGA 2RHGA 3GC4A 4Q8PA 3GTXA 1TPH1 1DWFM 4CNSA 1IXOA 1NOWA 2NUYA 1WP6A 4UR9A 4GJJA 2NQ5A 3C0SA 4GY7A 3FVMA 2OQLA 3G1AA 3U5UA 2PD9A 1ZAJA 1TE1A 1D3CA 3RFAA 2BTMA 3CH9A 1KR0A 1PVNA 4O12A 3ABOA 3SCUA 4WD0A 3H24A 3QTGA 4ZE4A 2INZA 5FACA 4KRZA 1V6YA 4NQ1A 2ZX9A 3ITTA 2WCSA 4DB7A 1XBYA 3GKAA 1UJPA 4ZSTA 1OVDA 3T78A 4J5NA 5CZJA 3AOFA 5DN1A 1I0BA 4X2RA 3RCNA