3CJPA

Crystal structure of an uncharacterized amidohydrolase cac3332 from clostridium acetobutylicum
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
262
structure length
262
Chain Sequence
LIIDGHTHVILPVEKHIKIMDEAGVDKTILFSTSIHPETAVNLRDVKKEMKKLNDVVNGKTNSMIDVRRNSIKELTNVIQAYPSRYVGFGNVPVGLSENDTNSYIEENIVNNKLVGIGELTPASGQIKSLKPIFKYSMDSGSLPIWIHAFNPLVLQDIKEIAELCKAFPKVPVILGHMGGSNWMTAVELAKEIQNLYLDTSAYFSTFVLKIVINELPLKCIFGTDMPFGDLQLSIEAIKKMSNDSYVANAVLGDNISRLLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized amidohydrolase CAC3332 from Clostridium acetobutylicum.
rcsb
source organism Clostridium acetobutylicum atcc 824
molecule tags Hydrolase
molecule keywords Predicted amidohydrolase, dihydroorotase family
total genus 103
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3cjpA00
2D2JA 4XAYA 4H9VA 4LH8A 3EWDA 3GUWA 3TN3A 1RJQA 4UB9A 4IQJA 1J79A 3RCMA 4LCSA 1ONWA 2O4QA 4CEXC 1UBPC 1UIOA 1UIPA 3LS9A 5HMFA 5AKQA 1YMYA 3LNPA 1A4LA 4CNTA 2YB1A 4C6EA 1RK5A 1FKWA 5HMEA 4GC3A 4C5YA 1A5LC 4L9XA 4HK6A 4GY1A 4H9YA 3IPWA 1FWGC 1JGMA 3E0FA 1V7AA 3EGJA 4INFA 3TN5A 5FSEC 4GX8A 4BJHA 4J5NA 3K4WA 4NI8A 1EJUC 4PBEA 1EJTC 3BE7A 2UBPC 2Q01A 2Z24A 1RJPA 4ZSTA 3NEHA 3GRIA 1KRAC 4G7EB 3LSCA 4ERAA 3HTWA 3SFWA 1ITUA 1HZYA 4C5ZA 1IE7C 1E9ZB 3T81A 3QY7A 3MDWA 1EZ2A 4V1XA 4EP8C 4GZ7A 1A5OC 1KRMA 4KEZA 1NFGA 4DYKA 1W1IE 4RDWA 3URQA 3E38A 4GYFA 1K70A 2BB0A 3RYSA 4R7WA 4C6KA 3E74A 4IG2A 4G2DA 4LAKA 1XRTA 4EPDC 2P50A 3URBA 4KETA 2FTWA 4JOMA 2EG7A 4C60A 1FWHC 3PBMA 3QY8A 1O5RA 4IF2A 1RJRA 4IFOA 4C6LA 4QROA 1E9YB 4H9TA 2GWGA 1PO9A 2QVNA 4C6JA 3F4DA 2VR2A 2WJFA 3TN4A 4B92A 2VM8A 1A5MC 3OOQA 3E3HA 4DNMA 2D2HA 1GKRA 4RE0A 3T1GA 3CAKA 2R1PA 3URAA 3B0XA 5CH9A 2R1LA 2GOKA 4WHBA 3F2BA 1VFLA 4H9UA 4PCNA 3F2CA 2AQVA 2R1NA 4G7EA 4RDZA 3O0FA 2QT3A 3E0LA 2DVUA 4AQLA 1R9XA 2Z27A 3N2CA 4DZIA 1FWEC 2AQOA 4B91A 1PSCA 3NURA 3MSRA 3URNA 3R0DA 2Z26A 3QY6A 1EJWC 3MTWA 4QSFA 4IFRA 1KRCC 1FWDC 3QGAC 2WM1A 4ERGA 3MVIA 4IFKB 3UBPC 2Y1HA 4KIRA 2I9UA 4C6CA 3ID7A 2E1WA 2FTYA 4GY0A 5LXXA 2GZXA 2GWNA 2VC7A 2BGNE 4AC7C 2P53A 2A3LA 5E5CA 3WYZA 1XGEA 2D2GA 3UR5A 3HPAA 4CNUA 4XD4A 3GTHA 1ZZMA 2I5GA 5G4HC 2O4MA 4M51A 4ERIA 4B90A 4TQTA 3UPMA 1KCXA 4IH3A 3E2VA 4KEUA 4C65A 3LU2A 4BKNA 3FDGA 2Z7GA 4F0LA 2HNHA 3GTIA 2OQLA 2Z2AA 2Z25A 3IJ6A 3RHGA 1J6PA 1EJVC 3GU1A 1EJXC 4KQNA 3FEQA 2PGRA 2YZ5A 1DPMA 1YBQA 3OU8A 3OVGA 4NP7A 3QGKC 4QS6A 3LGDA 3IACA 2Z28A 1XRFA 3ISIX 4QTGA 4KEVA 2DVXA 1V51A 3WMLA 1EYWA 3C86A 3OJGA 4RZBA 1V79A 4DLFA 4R88A 3GG7A 3GIQA 1S3TC 3K2GA 4PCPA 1RA0A 3IRSA 1R9ZA 2PUZA 3TNBA 4DI9A 3IARA 4EPBC 1P6CA 2XIOA 3S4TA 3G77A 1NDZA 4H01A 1I0DA 3GTXA 1M7JA 2Q09A 1ADDA 2HBVA 4Z42C 4LALA 3IGHX 4XAGA 4IGNA 4WGXA 3D6NA 4H9MA 1EF2A 3LY0A 2EG8A 3K5XA 1YNYA 4I6VA 3JZEA 1R9YA 2WJDA 4C6FA 3SO7A 2ADAA 3GU2A 3PAOA 3A4JA 1EJRC 4GK8A 3OQEA 4J35A 3DUGA 4BY3A 1RA5A 3F4CA 1M65A 3TN6A 5A6TC 2DVTA 1P1MA 2PAJA 3UF9A 4XD5A 4CNSA 4OFCA 3FDKA 4C6QA 3IV8A 3WZ0E 3A3XA 4KF1A 4PE8A 4F0RA 3V7PA 3DCPA 2PLMA 2ICSA 1YBQB 3HM7A 4C6DA 4LCQA 4YIWA 3AU6A 4P5UA 2OODA 4LEFA 2PGFA 4CQDA 1POKA 3NQBA 3AU2A 1FWCC 1PB0A 1J6OA 3ICJA 4DIAA 4DI8A 4GXWA 4EPKA 2ANUA 1FWJC 4LAOA 3PNUA 2FFIA 2FVKA 1EJSC 4IFKA 4HK7A 2W9MA 4CEUC 2OOFA 4C6NA 4NG3A 3OODA 3CJPA 1FWFC 4C6BA 2VUNA 1WXZA 4LANA 3F2DA 4E3TA 4HK5A 4DZHA 3A3WA 4DO7A 1FKXA 4XAZA 2UZ9A 1V4YA 4C6IA 4GY7A 3MVTA 3GIPA 2FVMA 1FWAC 4KESA 1UMLA 2HBXA 2G3FA 1ITQA 1J5SA 1I0BA 4RDYA 1GKQA 2ZC1A 3LA4A 4ZSUA 4CQCA 1A5NC 3B0YA 3EWCA 4DLMA 3CS2A 1QW7A 1QXLA 1YIXA 4QRNA 1POJA 2Z29A 4HJWA 1XWYA 4KERA 2HPMA 3MJMA 2Z00A 2E25A 4C6MA 3GTFA 1M68A 4D8LA 4L6DA 2R1KA 2RAGA 4C6PA 4LAMA 4XAFA 5HMDA 3DC8A 3MKVA 1P6BA 4J2MA 4UBPC 1O12A 4V1YA 1K6WA 4CQBA 4RDVA 1YRRA 3MPGA 2QPXA 1A4MA 1WXYA 2CZVA 1GKPA 4LCRA 3LSBA 1V77A 4IG2B 3GU9A 4GX9A 1BF6A 2OB3A 2F6KA 4XD6A 3B40A 3PANA 2HPIA 3T8LA 2R1MA 2VC5A 1KRBC 4B3ZA 2YXOA 1FWIC 3AUOA 3O7UA 3UR2A 2QS8A 1NDWA 3PNZA 4H00A 2EG6A 3ITCA 1K1DA 2KAUC 3S2MA 3KM8A 3LGGA 4GOAA 4PBFA 1ONXA 2HQAA 4R85A 4WVXA 4H9ZA 3MDUA 1A5KC 4LFYA 4GBDA 3S2NA 1NDYA 4EPEC 1NDVA 2Z2BA 3S2JA 1RK6A 3ORWA 3RN6A 4I6KA 4XD3A 4QS5A 2VHLA 2OGJA 3S2LA 2IMRA 2WJEA 1FWBC 2AMXA 4C6OA 4H9XA 4MUPA 2Z4GA 4ICMA 4HA0A 5FSDC 2GSEA 4IGMA 1PTAA 2YB4A 1RAKA 4F0SA
chains in the Genus database with same CATH superfamily
3M9YA 3SCRA 4C7FA 3F03K 3OVPA 1FOBA 1Z41A 2OX4A 5ABFA 2J7GA 2XN0A 3ABSA 3WH6A 4D6JA 4UB9A 1QI3A 5H8PA 4GJIA 3XINA 1E1FA 1Y5VA 2FKPA 2HEJA 3BLFA 2VEKA 3LRLA 3TU9A 2Y8UA 3WQ8A 3OP2A 1LRTA 3VD7A 3CAWA 1V6WA 3OZYA 3ITTA 3CB8A 4UQEA 3UWUA 2YX0A 1M41A 3G1YA 4ZQMA 1WKEA 1G01A 1SU5A 3ZVHA 4OKDA 2C15A 5KETA 3DGRA 2IKGA 3O0KA 3NUKA 2UBPC 4AZHA 1ODUA 3TLQA 2VRQA 4G7EB 3FYOA 1H5VA 2CHOA 1XYMA 3ARSA 1ITUA 1OWQA 2D3LA 3Q58A 3H7UA 3GZAA 4MPQA 3TOYA 1XCFA 1BVWA 1W1IE 2YL8A 1UC4A 2XFYA 1RLDA 4QHRA 2BB0A 1HKJA 4ECLA 4K3ZA 4ZO8A 4GO8A 4WSKA 2WJZA 1H63A 3L0GA 1E6ZA 4TV5A 5LA2A 2OKOA 3IJQA 2NLIA 3VA8A 5I2UA 4I7VA 5LNVA 1UA7A 2OGYA 3EXSA 1QMLA 1LDCA 4HA3A 2PWUA 4BA0A 1MW2A 4IF2A 3R89A 4LVAA 4C6LA 2OEMA 2W67A 2E6YA 3VE9A 2OKTA 1QW9A 2BVDA 3LBOA 3VOFA 1S39A 2QULA 1TV8A 4B92A 3HURA 3IANA 4TR9A 3OOQA 1XDLA 4DZ5A 3CK5A 3EWWA 4ZZ9A 3M46A 4KEMA 1VS1A 3IIXA 2P0IA 5EBAA 3NJ3A 1TVPA 1S3HA 2CLMA 5BZAA 2DVUA 1TA3B 5DMNA 2ZRUA 2TMDA 1B31A 5KZMA 2WSRA 1FWSA 3BQ6A 3MHUA 1VFMA 3H4GA 3GC5A 1H41A 1Y65A 3VVGA 3PY2A 2BY2A 1EUNA 2PDQA 2VD8A 3N1AA 3U8GA 3S9ZA 1FDJA 2DSKA 3AHYA 3N19B 5CG7A 2CZ5A 3F1QA 5IDZA 1VBUA 1ZP3A 5C9RA 1VF8A 3VINA 3N4FA 1DIEA 3PUEA 4CNUA 4M0XA 1HP5A 3W6YA 3R2GA 5IFPA 1KCXA 3OPSA 2J13A 3UCQA 3GVVA 2E5DA 3CIWA 5D8ZA 1HL2A 3A9BA 1V7YA 1OQFA 1XLEA 3FJNA 3N2TA 1P0BA 1XBVA 4K8GA 4S1FA 5CPQA 1XH1A 1PIFA 4UQAA 1FWNA 5BU9A 4LOCA 2FH6A 2PGRA 2BODX 3QV9A 1U83A 3W84A 4YMZA 4AD4A 3NDZA 3OVQA 2XIQA 3BPWA 4C90A 2DGAA 4QE5A 3W88A 2E68A 4HU4A 3M0KA 1JAKA 3VYLA 1RP8A 3OJGA 1V79A 4UNLA 4KCVA 1Q6RA 1S3TC 1GWJA 1RVKA 4Z1CA 2VCCA 3LTSA 4GWEA 1JYNA 4AY1A 3IGHX 4KGJA 3AXKA 4WGXA 4H9MA 3HG5A 4C6FA 1I2NA 2D0GA 2YDQA 4E4FA 2OG9A 4FLSA 2CHNA 5AYYA 3UF9A 5CCZA 1HVXA 2OLSA 2E0PA 3E0WA 4C6QA 2PDCA 3EOUA 4AW7A 3A3XA 1J8VA 3V7PA 5FI8A 1KFJA 1R3TA 1EWDA 1YLVA 2PEVA 1EHAA 1LL4A 3W7RA 2WMGA 2MNRA 3H54A 1DWHM 1DE6A 4Q8QA 1UZ4A 2ZZ5A 4YCPA 2F2KA 5A6LA 1XGDA 2XYLA 1JYVA 1ZBVA 4JZ5A 3PPGA 4PTMA 2ZXDA 7A3HA 1OFPA 1Z32X 4H7VA 4AX6A 2PODA 1TV4A 3N12A 1XRSA 3DG6A 3MBDA 4LY8A 4AWTA 4YTSA 2FVMA 1LQ0A 4M6UA 2G3FA 3WD1A 3TQVA 2OX1A 1I0BA 3MKCA 1RHCA 4UR7A 1V93A 1W5PA 5A5WA 2Y5EA 3RITA 3L0KA 1LUCA 1H7RA 2ZZ7A 4KERA 2HPMA 4H4IA 4TX6A 4ZTXA 3S5OA 2PCQA 1W56A 3E12A 1W17A 1LT8A 3DG7A 2OQHA 1QK2A 4RK8A 4ZQCA 3MKVA 3PTMA 4O1EA 1PYMA 4V1YA 4ALDA 4DBDA 4YTRA 2ZZ1A 3GDLA 1TX2A 2DEPA 1RVGA 2WMJA 1BF6A 4MNMA 1PBGA 4CVUA 2VMFA 4AIOA 1KRBC 1HJXA 3W27A 1YDVA 1QNPA 1EQPA 4ZQNA 4MWAA 4GISA 4RW5A 3PNZA 3G1SA 2J79A 1FHVA 2QDHA 1M03A 1ZENA 2B0MA 1MDRA 3I68A 3W53A 4G8TA 1C3FA 3M5VA 4AVOA 5D37A 5C9WA 2EO7A 1JYXA 5CJ5A 4FNSA 1JGIA 3V0UA 5GQBA 2QCGA 2XH0A 1EH9A 4IM4A 2OGJA 2B81A 4FPSA 4H9XA 2ZXQA 3GR8A 4NILA 1UB3A 3BQ5A 3VNIA 2BY3A 2A3BA 2Z4GA 1T41A 2GGGA 4L1WA 1NAL1 2QF8A 2VURA 2XU2A 3RF9A 3OBAA 3T42A 4FX6M 4AVFA 2V9DA 3TH6A 3TW7A 2CYGA 3EKLA 3M5YA 3M07A 4ADSA 5CZ0A 2CKSA 2GDUA 2JF6A 4A3HA 3VMNA 1KC7A 4YJ5A 5L6UA 4O8RA 2XG9A 3G1DA 3UVAA 2NXGA 1CECA 1FH8A 2GJRA 2I5IA 2CLPA 2WMFA 4P7RA 4ZQPA 2BZNA 3TCSA 3QV7A 4Z08A 2TPSA 5FOOA 3R12A 2W66A 4A21A 1L0PA 3G6LA 1UHVA 3C0JA 3WK0A 1A5CA 4GUFA 1X8FA 2BHUA 3BSGA 4LWWA 1EJUC 3IK4A 1EJTC 3MB9A 1B9BA 1F73A 4GVGA 3TC7A 6ENLA 4IMEA 2C0AA 2RJGA 3FJLA 3KVKA 4IMFA 4U33A 1JUEA 5K4XA 2G8ZA 1BYDA 1IE7C 2ZA1A 1N82A 3EDDA 2F84A 4B4FA 3N04A 4XTDA 3S5YA 5C71A 5K7JA 4HMNA 1ISZA 1ICPA 3IIVA 3I3BA 3KBWA 1XICA 3S46A 2P50A 3CH0A 4QIUA 1E3ZA 2FTWA 4BI5A 1KCKA 1BKHA 5DEZA 2GJXB 1W9UA 3PBMA 4PMUA 5AYZA 1DTUA 3B9OA 5F1UA 3E96A 2BWGA 3IRDA 2V2HA 1EC9A 3UY7A 1XUUA 3CBWA 3LCLA 3ZLFA 1GVIA 2DZXA 2NLYA 1GKRA 3W2MA 3FY1A 2PDXA 3B0XA 3IGSA 4MKNA 5CH9A 1OVDA 1XSKA 2E5BA 1XLGA 4B5WA 3AHZA 4ZB0A 3AIUA 3C3NA 1XLCA 4Q8WA 2DZWA 4NAFB 1T8XA 2W0UA 1H7XA 2DT3A 1HJVA 4AQLA 4UTMA 1R9XA 4ROPA 3NM1A 3U2EA 3H4WA 3TAKA 4MLRA 3O3RA 4L80A 1GEHA 5KZEA 2PZNA 3V75A 3KTSA 3QGAC 3KDNA 4JNYA 3D47A 4GKLA 1UJPA 2ALDA 4S38A 2D24A 4CLMA 3JS3A 1HJWA 4XZHA 1KA9F 3HJEA 5E5CA 4EWJA 2YYUA 6XIAA 4PMRA 3G3DA 1SFTA 3KHDA 2NQHA 2Y63A 3CMFA 4NZ1A 3IVSA 1BF2A 4F8XA 4V28A 4IPNB 1W2VA 4KEUA 3WD2A 3FDGA 4OOZA 2NSOA 3W1LA 1DE5A 4EXBA 2ISVA 3SW6A 2VX5A 1KR1A 2W6RA 3REQB 2RDTA 3AYRA 4PUKA 3OHMB 1XLDA 3VOIA 2VL4A 1IQ8A 1M1BA 2B7NA 5L9FA 4G9PA 2PFHA 2FH8A 3KCOA 3ZS4A 2C91A 1JPIA 4JTDA 3M7WA 5M5DA 4B5NA 4XZ9A 1NOFA 3UWQA 1ZU8A 2PP1A 1FY6A 4W7UA 3OLDA 3W2LA 4DLFA 2XH2A 2PD5A 5AC4A 5C9ZA 1HO4A 1OGBA 3K2GA 1EZWA 1XRVA 2PUZA 4GA8A 1P6CA 4GLEA 1R7AA 2XIOA 3BLEA 2Y0FA 4BWLC 4LALA 4IGNA 4D72A 1F8MA 3NOEA 3BG5A 4R5EA 3KOYA 5HPCA 3TQPA 3G1HA 3PUGA 1AQMA 3ES7A 2P8CA 2ASHA 4F40A 4PL2A 1MEIA 3QSTA 5J04A 2ZZ4A 3WF4A 4XV0A 5TQLA 1OYAA 1BTMA 4Y6GA 5E9AA 4LQ1A 2V82A 2PGFA 2VEMA 3NQBA 2BOEX 1M01A 4O52A 3Q65A 3UR8A 6XIMA 1KFLA 1LLOA 1G0CA 4GXWA 4EPKA 1H61A 4X9SA 2FFIA 2HVOA 4LTSA 4DO4A 2X0HA 4CEUC 1VEOA 2VC6A 4RE3A 1F61A 9XIMA 1RUSA 2OO0A 1TMHA 5JH1A 1XC6A 4ZVJA 1DJGA 1YE6A 1UD5A 4MWAB 3KL5A 3NPUA 1BYAA 1DXEA 1GYLA 3OLEA 1JZ4A 5I02A 3WQ5A 1GOQA 1AW5A 5CGQA 1B3WA 4IIHA 3WK2A 2IXUA 2NQZA 1FX6A 4E4UA 4XO7A 4QRNA 1BWLA 2X05A 3PSWA 3H55A 1IZKA 3E0VA 3W7QA 4PA8A 1J01A 3K30A 2R1KA 1TV3A 4GMEA 2WCAA 3VDCA 1PKLA 1GOXA 3SRFA 3WH7A 4KCUA 2ZE3A 1SFLA 2ZCGA 1XH2A 1H09A 2CZVA 4W89A 4X3ZA 3SADA 3MCMA 1T7LA 3ZVIA 3BTNA 1Q45A 3AIRA 3IUIA 3NPWA 2R1MA 4OV9A 4I5XA 4AY8A 3CUIA 5H8UA 5RUBA 4JIQA 2P3ZA 4AZCB 1SZEA 4FI4A 2DPEA 1Q4WA 3MI6A 4LFYA 1AK5A 2GFTA 4NI3A 2E7FA 2PDNA 3GWQA 3LHZA 1S5MA 3QFWA 2VD9A 4UIOA 4FLQA 4WXZA 2V5KA 3LYEA 3BURA 2VRJA 4O15A 3WJZA 4H19A 3P60A 4HA0A 1EO7A 3LCXA 5C2XA 4X2PA 1QU4A 3PZTA 1LCOA 1SJCA 3AZRA 4QLJA 4MNJA 1VHNA 5DFAA 2HJPA 3CWOX 3CZKA 2FJUB 3LG3A 3NYZA 4M24A 4NSBA 1VFOA 1E6RA 1YW1A 2Y8KA 2YR1A 5KINA 2GJXA 7REQB 2WVVB 1B90A 4JQ3A 4JKLA 5D38A 1X6NA 4QEHA 5GNYA 4AIEA 2FDSA 4WOZA 4QG6A 4JFUA 1B57A 4V33A 2HCVA 1LG2A 2VX4A 1S2TA 1JUBA 3HGRA 4QGCA 3MZNA 2PRLA 2VTFA 4TUFA 5C9UA 2EJAA 4NAFA 1BAGA 4R27A 4U10A 3E0IA 3L68A 5TAOA 3RXZA 4V1XA 4H7CA 4R53A 4X0NA 2DU2A 4J9JA 5KTLA 3AMLA 5DF0A 1KWGA 3SAZA 1KBBA 3QC3A 4IG2A 2WC3A 4R34A 4Y90A 3KBSA 4C60A 3PZIA 4GI6A 3STCA 3NVDA 3AXIA 1SW0A 3IGUA 4DJDA 1QCWA 4ZB2A 4RZ4A 1UQZA 4UTHA 3T09A 2WC7A 1GVQA 4CCDA 7CGTA 3KP0A 2O9PA 2I5QA 1EX5A 1VJIA 3T9PA 4AHOA 4FZIA 3DX5A 4CCCA 3ITGA 3F2CA 3ZQ9A 2EKCA 2FZMA 1WCGA 3P93A 3PZGA 5TF0A 3N6HA 5LHFA 3FAXA 2YGYA 3G22A 3OTRA 5IM51 2PWHA 3B06A 3SM0A 1VGAA 2IPJA 4ES4A 3ZR5A 4GXMA 3QKZA 4GKTA 4DELA 4GE8A 1ONEA 2O0TA 3S83A 4DBEA 1TPUA 3BO9A 1VBHA 3SCPA 5I3GA 2DJXA 3GW0A 2GQ9A 4PRRA 2VWTA 3GXTA 3UGRA 2F6UA 2GWNA 1SR9A 4F2UA 2DSZA 3P62A 3SY8A 2D2GA 1EOMA 3BMXA 3T0AA 1O68A 1EXBA 3GXNA 2I5GA 4DPPA 1OM0A 4WKAA 2GVEA 4DUVA 2VP8A 2RGMA 2PDGA 4JIRA 1GHRA 3E2VA 3UETA 3NO1A 3NSNA 2E28A 5CGMA 2QUVA 3TTOA 1WNOA 3IJLA 1VC4A 4DO5A 1OT2A 1E4LA 3SCQA 2YA2A 1MI3A 4KRUA 3I3DA 4ZOEA 1OX5A 3BGGA 3TC3A 2FB3A 1DPMA 3W1PA 3ARYA 4F0KA 2QCCA 1EP2A 1ZP4A 2QCFA 3L2MA 3J7HA 4IX0A 4NXKA 3SUWA 3A4WA 1CXKA 5BMXA 3A12A 4R88A 1TPB1 4Z1BA 1VRXA 1M9HA 4AH7A 3R94A 1RA0A 3TQKA 3CQHA 4MY9A 4W9TA 1VCVA 4HCHA 2Q09A 2ZZ3A 1VLWA 4A8NA 4Z1YA 1LOLA 3B0UX 3OGSA 1HT6A 2VELA 3Q2DA 4DJFD 1ICQA 3PAOA 5CSYA 1GZ1A 3FYYA 5CBBA 3UVIA 4JCLA 5A1AA 3Q4DA 3I65A 4GC4A 4RV8A 1W0MA 4S3GA 1OC5A 2ABAA 3MMDA 1YPFA 3W0KA 3WQGA 3HPZA 3PJXA 4DBSA 4A3UA 1TA3A 4KFNA 4YIWA 1S2VA 5LNRA 3VNLA 2Z6IA 3U4FA 1C92A 2CLOA 2FVKA 1MUMA 3GM8A 4E8GA 1AA1B 2Y2WA 4LANA 3B9AA 3PZQA 3VOJA 4ZXLA 4EXAA 4DO7A 3CV6A 4E8CA 1V4YA 3MYOA 2CBVA 3O07A 2J7FA 4PCSA 1GQNA 5A8OA 4WY0B 4CQCA 3KE0A 4WR3A 3B0YA 5HWJA 3BAKA 3SEPA 4Q4SA 3L12A 4AWSA 2IKIA 3M0HA 1VD6A 3TKFA 5AYBA 4Q8VA 1JZ2A 2YFOA 3VK5A 4DPQA 3VC6A 2DT2A 3IUHA 3KWSA 4PUDA 4ATDA 3GX9A 1R86A 2BVWA 3RRXA 4N02A 3LSBA 1KV5A 1V6VA 4H8UA 1UWSA 3OGRA 2F6KA 3MO7A 3VKBA 3T8LA 2DP3A 1TMLA 4HHLA 4FOUA 2UY2A 1ALDA 4ZTYA 5CSUA 2A5HA 1WA3A 3RLVA 4H00A 4ZFCA 3ZYZA 4AZ6A 2OU4A 4A2RA 4GOAA 3P81A 1ONXA 7REQA 2D2OA 4QFUA 1TCMA 2WZHA 1CB7B 2V68A 3QM3A 3S2NA 3SJNA 2J4GA 2FZDA 3BCFA 4HPGA 3RRAA 3QV6A 1MUCA 2QUTA 3FA3A 3NQ6A 4EKJA 1NWUA 2FPVA 4I7UA 3ZT5A 2VX7A 4D6DA 2QKFA 3AIWA 2PDKA 4WRHA 3LENA 2E77A 4I8YA 1KW1A 1RQBA 3GNNA 4HPNA 5AZ1A 4JHOA 2QVHA 5T9BG 4YVVA 3UJEA 1AW2A 1QWGA 4LVFA 2PBGA 4JCMA 5BXTA 1BWVA 2Y7GA 2ZRWA 1OFOA 1EIXA 3APYA 3TN3A 1VENA 3BLPX 3TSDA 4AVNA 4W8LA 1FCUA 2CC0A 1V3MA 3UU0A 1F3XA 2VDHA 5D05A 3GG0A 2VI0A 4NY2A 1EBHA 4DYEA 4L9XA 2QJIA 4GIAA 1V7AA 4INFA 1Q6OA 3PK7A 4BJHA 5H6HA 3BZGA 3MW7A 3SGUA 4RW3A 3ABQA 3UZZA 3A23A 2A3EA 3B3DA 3LQGA 3WL1A 2GJNA 3ANVA 3ANUA 3NEHA 4FA3A 3SECA 3WMSA 3ALFA 5AOUA 3SFWA 3N4AA 1HZYA 3W1QA 3ZXWA 3T81A 5I23A 2CFFA 3COTA 3O15A 2QAFA 5D8WA 3LHTA 2H8ZA 2BMBA 1D9EA 1Z89A 4E2BA 4DXXA 3CXOA 5CC3A 4C6KA 1TB3A 3RCNA 1G7UA 2GLKA 4MYXA 2DORA 4TO8A 4JKMA 3O2LA 4Q6JA 5BNKA 3WBYA 1B0IA 4XO6A 1WDSA 3DYPA 5BRQA 3LDVA 1AH4A 3B9DA 3B8TA 1QPQA 2CPUA 4WOQA 2Z1SA 3ZO9A 1NWTA 1L6GA 4DNMA 4HNCA 4E5TA 1WOBA 2BOFX 4NAEA 1EX1A 1ELSA 2QT3A 5TIMA 4G7FA 3PB0A 2IPGA 1AMYA 2DH3A 4W4QA 1SJAA 2AQOA 4B91A 2IQ0A 4IICA 1BQCA 4FNRA 3WY1A 3NXFA 3E5BA 5ABEA 1F8IA 4IFRA 1JPDX 3WFZA 4JFWA 2BXZA 2PDWA 1ZPTA 4FB7A 5M3WA 4DUXA 2ZVRA 5E93A 4JTAA 1EFZA 3QTGA 2QCDB 2EPOA 2W5FA 1A3WA 1E0TA 1OD0A 3NZ1A 2D0FA 3AMKA 5A2AA 1S1PA 3GFZA 1QASA 1J2BA 1Q85A 4QG8A 1MO0A 3GC2A 5GJNA 3GDBA 2QV5A 5IBXA 4PCTA 2WPGA 3GTHA 1XW8A 1ZZMA 3SY5A 4K38A 4M51A 4PFHA 7TAAA 4UOQA 3USBA 4HTBA 2CBIA 4YWSA 2XIIA 1LOQA 3TJ4A 2Z7GA 2OMAA 1P43A 5M1TA 4WDUA 3OHIA 5AHNA 5C6MA 2PF8A 3C61A 1H1YA 1TO3A 3IJ6A 4Q32A 3RHGA 3T55A 1EJVC 3CT2A 2ZE0A 3GFYA 3HV9A 3A4XA 4UUIA 4YYCA 1YBQA 3OU8A 2ALRA 1RCXB 4QS6A 1X6LA 4C91A 3ISIX 2KX9A 1P0DA 1BQGA 4BHYA 1VCFA 2DVXA 2XFFA 3WG6A 1BEUA 1UD4A 2QJJA 4IT1A 2BSLA 4FSAA 5C5YA 5A2CA 4KH2A 3GIQA 4PH6A 1XDMA 3EMQA 2NSXA 2GSHA 3ARPA 3PP7A 4DI9A 1EF3A 2IPFA 2IKJA 3GTXA 3H23A 2YSWA 1EF2A 2EG8A 4I6VA 5T91A 5HJLA 3TP4A 5U4NA 1H51A 1MYRA 3BWWA 3A4JA 1EJRC 4GK8A 4Z0SA 3BV4A 4S3DA 4BR1A 1A5UA 3DUGA 3CPUA 1C93A 2VVNA 5A6TC 2Q8XA 1E4NA 2NX3A 3T78A 3DERA 3QPZA 1A50A 3PBYA 3QLDA 1QI2A 3IV8A 4KF1A 4F0RA 1QOQA 2ICSA 2G3NA 4GH3A 4E6MA 4RL3A 1GYMA 4O1FA 5EMJA 1JQVA 3AXHA 3LHUA 1AQHA 4DQWA 3GH5A 3P67A 1IEWA 4Q4KA 1TPC1 3UERA 1B4KA 4XUYA 1LQ2A 3GNDA 4N9CA 4YPJA 4NG3A 1EYEA 2VUNA 3PBGA 3W6LA 4O54A 4Q6XA 5D4YA 3LCHA 3LEPA 3QFEA 4E3TA 5AC5A 4L65A 1CYGA 2PP0A 1ISYA 4DZHA 4LBSA 4GY7A 3HGOA 4GZIA 2X30A 1ITQA 1FXQA 5CSRA 4V27A 4WCJA 3WLRA 2QV4A 1J5SA 1AW1A 4P8WA 1GKQA 3NYDA 3M0MA 3NVTA 1G67A 2NQ9A 2B4GA 2VGBA 4HTYA 3MO4A 3QZAA 1JFXA 5LIUX 1UR8A 3GTFA 2OTDA 1XKJA 2XHYA 1YTKA 4C6PA 3B97A 2TSYA 3NGJA 4J27A 3D0CA 4AEFA 3L4UA 1Q6EA 4NVTA 4US5A 1U33A 3U3HA 4PUWA 3S42A 1BGAA 3VFCA 1PL9A 4RE4A 4A2SA 3PBWA 3ONCA 3MSGA 1NVMA 1UPMB 3QSRA 3W2NA 5HQMA 1XIMA 3AUOA 3MQTA 3WNPA 4POCA 4Q4RA 3WBAA 1K1DA 3EOEA 4IIBA 3GNRA 3KM8A 5I77A 1JCMP 4PMXA 3W2KA 4WVXA 4H9ZA 1ZCCA 5AC6A 1A5SA 1UR0A 2BHZA 2HK0A 4JYEA 1TCDA 3S1UA 2EPHA 3VOCA 2XN2A 5CBJA 2YCLA 1F7BA 5DY3A 4BZYA 3VAVA 2JKPA 3ZVHB 2OWWA 5I0DA 3DYOA 1ZALA 3B4YA 2ZRXA 1V6XA 4O10A 2TODA 4NRSA 1U1UA 4IP7A 3WDIA 1TPFA 1T0OA 4N6FA 3RJXA 1W1B1 4AISA 2NQJA 2F9RA 2WLZA 5I3FA 3F5LA 1E55A 1AZ2A 1ONWA 3PPFA 3K8LA 3LM7A 2ZX6A 4M1BA 1YMYA 3MUXA 3N3MA 3BAYA 3EBVA 3IJ9A 2VEPA 4H6QA 3ARZA 4HZ7A 3WJSA 2A3AA 3HPSA 2DZBA 1A5LC 3QQ0A 1D8WA 3RU6A 1JI2A 4HCDA 3GDKA 5G1TA 1LYXA 4DO6A 4NZCA 1BWKA 3FJ4A 5D09A 1SPQA 3QMRA 4UTLA 3JR2A 4NJGA 4Q4PA 2Q01A 3ARTA 4FNQA 2C3ZA 3EOLA 3N73A 5AB3A 4IMCA 2J24A 2BP1A 2XUCA 3ARVA 1E9ZB 3A24A 3W72A 3DYMA 3GS6A 1RY8A 1K70A 4B5UA 3UCCA 4GINA 3IS4A 2WZIA 3C0LA 4ML9A 1LORA 3WFAA 3QY8A 6REQA 1C9WA 3E49A 1S2AA 1OGSA 3NQFA 4H9TA 5HWNA 1PHWA 1SVDA 4UQ9A 4CD5A 2SFPA 2VDGA 3RFAA 4D1JA 3GYCA 3IWPA 3MP5A 2OWCA 3UXAA 3LV5A 1TIMA 4HMEA 2YW4A 4XBSA 3B8WA 4BCEA 2V3GA 2CERA 3RPMA 4LUSB 1GVEA 3BLDA 4O4WA 1F4AA 3F2BA 1W1ZA 4HA4A 3AS2A 2AQVA 4B2DA 5G1MA 1V02A 3UWEA 4JN7A 4TTGA 4Z0JA 4ICCX 2ZOXA 3HG2A 3M6YA 3W7IA 1C8XA 2REQB 3G8RA 1XLAA 3CUJA 3MSYA 4DRSA 2AAAA 1Q2RA 4IFKB 4UFHA 3CUFA 2I9UA 1RQEA 2CWNA 3QPYA 3U5UA 1UUMA 3CMGA 1H7NA 3ZOAA 2POZA 5EFFA 1KWKA 1CBGA 3VMPA 4H3DA 1PKYA 2ZUTA 2VZSA 3WQVA 4M3PA 1NF7A 1ZFJA 2CLHA 1F76A 4JEQA 4KWSA 3WIJA 1HKWA 1A80A 3NZRA 2QQ6A 3WQOA 3P82A 3FLUA 4XK2A 5G4WA 2QR6A 3PG9A 2J88A 2Q8LA 4XX6A 3N25A 4J3VA 3M5XA 4MOZA 2C13A 3W1RA 5I07A 3FEQA 3S9YA 4UFKA 3U57A 3NDOA 1FQ0A 1H7PA 4TU1A 1SSDA 2ZADA 5I3JA 1ISVA 2JK2A 2HMCA 2X1UA 1J0HA 4QTGA 3POHA 3O6AA 2VXNA 3VM5A 1QW8A 5JXQA 4OBTA 3ES8A 4AD0A 1JZ3A 1KFWA 2ZC8A 3D5HA 5E6YA 4CCZA 3S9IA 4JQ4A 2E6DA 4GI8A 1UOZA 3G77A 1XYAA 3NCOA 3M41A 4FOKA 1CLXA 4FIRA 1BRLA 1JD7A 3W02A 4W8AA 1S5VA 1EEPA 1QATA 4PTXA 3DEQA 3ZWTA 3N18A 1IEIA 1PXGA 4UOJA 2ATMA 3GXFA 1W3NA 1RA5A 2EPKX 2ODOA 3RM8A 5B80A 1P1XA 3CM4A 1U2YA 2C0HA 3MJYA 3ABRA 4FOJA 2PAJA 1QWKA 3PAJA 4BEUA 1EQCA 1NOUA 4LCQA 3SQMA 1Q7MA 4P5UA 2OODA 4LRTA 1PHQA 3OEXA 4ILSA 1RCQA 4LAOA 5AZ0A 1OGGA 3W07A 3OB8A 2PTYA 6A3HA 1PE1A 1W1A1 1JPMA 4W5ZA 3PJTA 4BF5A 3GKFA 3GVWA 4N6EA 4N9DA 4AWEA 5EPDA 2HSAA 3UG8A 4DWSA 3VXGA 2UZ9A 1UWAA 4CVWA 2WW5A 5JH2A 2DZVA 3RLUA 3KRUA 4A3RA 3LA4A 4PULA 2J7EA 1F6PA 5D04C 2A0NA 3R25A 1POJA 1G4SA 3MV11 4H7ZA 1OT1A 1FP8A 4PMYA 5FEWA 3KOZA 1Q6FA 3SCSA 3E5PA 4UTWA 2E8YA 2WPBA 4LAMA 4O14A 1P6BA 1HXJA 1W5QA 4RUBA 4KFOA 2J6XA 1IF2A 3VCNA 1AL8A 3MI2A 1S5NA 1OK4A 1GKPA 1V77A 1RBLA 1REQB 5E1QA 3I6RA 2G5WA 2OJPA 4N9BA 4MM1A 1VFSA 3FEMA 1KO0A 3JU2A 4QISA 4YU1A 4I8DA 2VCAA 4M8UA 3HGJA 2KAUC 1CXIA 1SYTA 3DFNA 3W7EA 4K8HA 1L8PA 4J28A 4QG9A 3ARRA 1XUZA 3RPDA 3BXWA 1NTHA 3DFOA 5CLWA 1D3CA 4HIBA 1O5KA 3KEHA 2VHLA 4D6HA 4S2BA 3V18A 3S2LA 1LZOA 1U1JA 1UCWA 3DGBA 5CXPA 4WGHA 4ICMA 3EMCA 3MU7A 2QGHA 1VQTA 2CXGA 1XIHA 3VTRA 4HBKA 1ICSA 4TV6A 4XZWA 1CW2A 1VFUA 1C7TA 1E72M 1MSSA 1J10A 1TKKA 1X7FA 4LCSA 3QR0A 3VNZA 1W1YA 1IIGA 2FZBA 3WMCA 4FNTA 1LBFA 4XSMA 1ZB5A 4DF0A 2ZXAA 3FW6A 1DXIA 2WMHA 3PN8A 4QDWA 4H2CA 3AHXA 1Z42A 3MV01 1VR6A 1CXLA 3PZOA 4M6VA 1PPIA 4AEOA 4JL2A 3RDKA 5FCZA 1XL9A 6TIMA 1Z44A 3K4WA 5DLCA 3C56A 3GUGA 1ONRA 3VM7A 3BE7A 4B16A 4NYUA 4ZSTA 4UOZA 1UWUA 3VZXA 4OWGA 2ZDRA 4C5ZA 4UC5A 4U2ZA 3P0XA 3GXPA 1XSJA 2ZTJA 1CGTA 4GZ7A 4KT2A 3EX1A 1XG3A 4A8LA 1V0MA 3URQA 4KWUA 3LB0A 3W7DA 3W2JA 4EAMA 4HZ6A 4NU7A 4AEEA 3F7JA 2DZSA 1TREA 4G2DA 3EXRA 1V0NA 1XLLA 5FEPA 4U2YA 3T8QA 3WLSA 1R0MA 4YTUA 2NUWA 3VOGA 3DC0A 3WDRA 5A95A 4RZ5A 4C1NA 3W00A 2R94A 3A64A 3EB2A 3PTDA 3CQIA 1DYSA 3CB3A 1TWWA 3B0VC 2BLEA 2P8BA 3R4IA 1NP2A 3R43A 1HQTA 3V16A 3EXTA 1FRBA 3A6OA 3LCWA 4ZCWA 5DXXA 4QJ5B 4QEEA 3LN3A 5C55A 3WQPA 4MF4A 2YJQA 1LM1A 3O6CA 3K1GA 1J96A 3N9KA 4GUHA 3WDQA 1VYSX 1XF0A 4NASA 3S3GA 3SCUA 2PGEA 3MVIA 2C14A 3CUZA 1KFCA 2E1WA 2EPMX 4DZAA 2FJKA 4GY0A 4Y9AA 1EUAA 2Y7FA 1NARA 4F4RA 5FESA 4GYPC 4GYKA 3WELA 3CZJA 4IJRA 1UR9A 4JEJA 1FHLA 1CCWB 1BRLB 5G4HC 1SMDA 4C65A 2OO6A 1VPXA 3BW4A 3MYPA 2O9TA 4JHZA 5FF0A 1GTEA 3GTIA 3FNDA 2WKJA 4DHGA 1KQZA 3PZMA 4DM2A 1P5BA 4UR8A 2GVGA 2FMNA 1KM4A 3N11A 4O12A 1V51A 2OSYA 4E4PA 4PCPA 2XIBA 3TNBA 4UTJA 4EPBC 4WSJA 4Q7IA 1B1YA 2E4TA 3N13A 3U5YA 4W7WA 2J25A 1N8FA 5GNXA 2VKZG 1OHLA 1I2OA 1YNYA 3T0DA 3VGEA 4Q4QA 5C2GA 4TTUA 4HOZA 3WQDA 3OQEA 1H11A 4M19A 5DXYA 1KFEA 4H6KA 3B04A 1QTWA 3NPXA 4AC1X 1M65A 1B2YA 5I3KA 2DFAA 1DWGM 1LBLA 2WB5A 1OFDA 3BAXA 3NQ7A 4JBRA 1Q2SA 4HHHA 3B8UA 3FDKA 4EOUA 2DUXA 2JE8A 1W1VA 1BG4A 4WJEA 4IMAA 3NWRA 1OF6A 3LD5A 1XXXA 3MUY1 1IXQA 4FXJA 4O19A 4WDWA 3C2RA 3AYVA 4BI7A 3PJUA 3PNUA 3TUUA 5CBIA 2G37A 1HUVA 1EC7A 3TV8A 3LMYA 4HU0A 4XWUA 3HFTA 2I1OA 5F4WA 4CGTA 3UCDA 4DXKA 2V3EA 3WLJA 3F2DA 4LPCA 3EX6A 4JN6A 1U1HA 1HFBA 4NNAA 1VEMA 4O8AA 4KESA 3O8AA 2HBXA 3BV7A 2WNQA 1A47A 1BXBA 1X7IA 1QUMA 3PUOA 1FWRA 5E6ZA 3WNKA 1XWYA 4Q4MA 1V0LA 1XQLA 4MZ1A 2ZDSA 3UJFA 1NIUA 1AL7A 1UWIA 3MA8A 5DO8A 7TIMA 1JCNA 4UBPC 4LW7A 5LIKX 1KM0A 5CPOA 4O0KA 5XIAA 4ZB5A 2YXGA 3LGEA 1AVAA 4PBGA 1WXYA 2QZRA 1KR0A 4GX9A 4CD6A 2ZVIA 1DJNA 1FCVA 1O5QA 3S47A 2QF7A 3VIIA 2QS8A 1NDWA 3V5OA 1QR7A 4EIVA 1BSIA 3TZNA 2WVVA 1A3HA 4R7JA 2CLKA 1S2CA 4E0CA 5I3HA 3W7MA 2NUXA 5TNVA 1YADA 4YYFA 2ACSA 3EZ4A 3Q45A 4L4LA 4O57A 3MHGA 3ORWA 3PVFA 4BQ3A 4Z2JA 1VRDA 4CQ8A 4KFPA 1SZNA 5GJPA 3RG6A 2AMXA 3T08A 3EX4A 2XWDA 2X2GA 1SW7A 3DENA 1VB9A 1L2UA 2DZTA 4L61A 2INFA 3EKZA 3NQ8A 4MPKA 1V03A 2O9OA 4LH8A 1QPRA 3H21A 2Z1BA 1E71M 1OCBA 3MMWA 1EDTA 2V5CA 2DZAA 4DUOA 1MFVA 1O4UA 5A6JA 4I9TA 3FN9A 1V8EA 1TJ2A 3BICA 3D46A 4ORMA 5HAOA 1JI1A 3HQNA 1TJRA 1H50A 3PTQA 4RE2A 1E4MM 4ZEPA 4QLKA 4LYKA 1GOIA 2B31A 1B30A 4CKQA 4PUEA 1TTPA 4HN8A 4GX8A 1OIMA 2WKLA 4DVOA 4DNHA 3WD4A 4A35A 2R6OA 3W76A 5LZLA 3T44A 1B3OA 4LV9A 1LUCB 3WUGA 1P0EA 2FPYA 1XYLA 2PC8A 4FX7A 4ERAA 4CD4A 1OYCA 3WLLA 5A6BA 1FDZA 5GNZA 1BXNA 4LB4A 3AFBA 2CLFA 1KRMA 4IXXA 1WDPA 4RDWA 1FA2A 3I6EA 3HV8A 5DMYA 4GO9A 2VO5A 4G56A 2E9MA 5JIWA 1FH7A 4MDPA 1OFBA 4UTFA 4GQGA 4JOMA 1C9DA 2CZFA 4UWMA 2W91A 3ECQA 4ZO7A 3NTYA 3QZ6A 4M80A 1T8QA 3W1AA 3CEPA 1KGUA 2F6XA 4JYFA 2VGGA 4IJCA 4ACYA 3EKGA 1PO9A 3GKAA 2VR2A 5CEWA 3PFRA 5AVHA 5BW6A 4YXGA 2FGZA 3K4DA 1XFCA 3A3HA 3V1PA 2R1PA 3VC5A 1MRQA 3P8IA 3E2SA 5HXMA 1K7FA 2OLAA 2R1NA 1PWLA 1UJQA 3JRKA 1NWRA 2DUZA 4UZUA 2VZOA 1IGSA 3NM3A 2PWDA 5HMSA 4IXHA 1ZNNA 1GQJA 3UG5A 1VHCA 2XVLA 2VGFA 5CPTA 3JUGA 1IT0A 4ERGA 3F4WA 4AXNA 1ISXA 2ISSA 5EFDA 2C16A 4LS1A 3V3WA 4IHCA 5EYWA 2FTYA 3A13A 3GTNA 1DJYA 2VOTA 5AHFA 1CEOA 1R46A 4TVUA 1HKMA 5HPOA 3LZ5A 4Z2KA 1A0CA 5CKSA 2KZHA 4B5SA 3AYSA 2V5DA 2PTWA 5HNUA 4H8NA 4RPQA 4GUGA 2VDIA 2XZ7A 4MGGA 1O60A 1ADOA 3CL7A 2YBTA 2F8QA 4GVFA 5JQ9A 2HVNA 4ZXOA 2V81A 1KCLA 4QE4A 4FK9A 4LNCA 1J6PA 4N2YA 3QW3A 3RO8A 1PX4A 1E40A 3RX3A 4HOWA 4HKPA 4C7DA 3USZA 2PWGA 4WD0A 4PRTA 4XZBA 2DQXA 5EMMA 1V3KA 3N9SA 3NXLA 1YDOA 2UY3A 2GQAA 3UD6A 3TYBA 1GQIA 3RLHA 4HQVA 4FF5A 3UQNA 4Z42C 4XAGA 4PC8A 3L5AA 1N8IA 1C90A 2C71A 4QNEA 3QHOA 3SO7A 2YA0A 3GU2A 1WB0A 3UESA 4WY0A 3LQLA 3T7VA 3TIMA 3MWCA 3LX9A 1ZUAX 4PB4A 1TTJA 2H9AA 4TX9A 1RPKA 1I9CB 4QCEA 3FV9A 1H1ZA 4FS9A 2PWEA 2PLMA 4A8RA 3I4KA 3RUBL 4UMBA 3QZEA 1IT7A 5D9PA 5HULA 3NQDA 2WO5A 5A8MA 1FWCC 1PB0A 4GACA 3P5ZA 4DIAA 4UQBA 1IEVA 4AY7A 7ENLA 3KFTA 5HNRA 1JCYA 3UG3A 1TRIA 1HKIA 2Q3OA 1WYIA 1RY0A 4D6EA 1TR9A 4CU6A 3W26A 4K1GA 4AZGA 3AIQA 3LPPA 1FKXA 1DJZA 2QXWA 1UMLA 1W3JA 4I7WA 4S3AA 4J1OA 2HZGA 1GPFA 2D22A 3VGBA 5C70A 1JL8A 3UFYA 4LS0A 3W83A 4MWAE 4PTNA 2OZ0A 3MJMA 4CNOA 4UNIA 5PTDA 1YYAA 3EWUA 4L7ZA 1FCQA 3D3AA 3WLOA 3ATYA 4WK9A 4B5XA 1QNQA 3RAOA 5I03A 3BUVA 3MPGA 4D6FA 1LBMA 2GVJA 2Y70A 1RP9A 5LIXX 4UQCA 2OB3A 3W24A 3WK3A 3RX4A 5AHEA 4Y9MA 2VZUA 3APTA 3PANA 3BAWA 1RBAA 3PULA 2VC5A 3PBUA 4HYWA 5AN7A 3QMSA 3UNTA 4LUJA 4WDXA 3H70A 1WUEA 1WE5A 3ZJ6A 4CCEA 1Z48A 1NF0A 3WO8A 1S5TA 4F0HA 2CHRA 3EB3A 3UXDA 3TWAA 2QW5A 4RZ6A 1A5KC 3SFKA 3I10A 1RPXA 2QJGA 2ZUVA 4O1DA 4F2TA 4N4QA 4MB1A 5MKGB 3KBJA 5DRIA 3GW3A 4JYDA 3EA3A 4OHQA 2JALA 2C1GA 4J3XA 5FF7A 2E6FA 2GGIA 3PWIA 2ZRVA 3M44A 3K1DA 3R8HA 3PC0A 2GVLA 2EAWA 3C6CA 3IJ8A 3GLCA 1KKRA 4MKVA 3CZEA 3T2QA 4TX8A 4NZ4A 1IWPA 2GSEA 4HPJA 4Q8UA 1PTAA 5G1YA 4IL0A 4F0SA 1TFVA 3TJLA 3DESA 3VKCA 2OVLA 3WNLA 1DORA 3POCA 2Q02A 5DT5A 2V8ZA 4LAUA 3VPLA 1GQLA 5CPSA 3AALA 3TFXA 5HMFA 4HP5A 1K8YA 5HR7A 1TIWA 4GJ1A 1FKWA 1DL3A 3C8FA 4DWSB 1UUQA 1BD0A 4GD0A 2YDAA 1ZJAA 3KVLA 3U7BA 1HW6A 3AS3A 4MYAA 4G5DA 3BG9A 1GTHA 1UMYA 3DU0A 4HNVA 1ZBCA 3W25A 4IMGA 3INPA 3NZPA 2Z24A 2OEKA 3M5ZA 2WVSA 3OZMA 1CZ1A 1J0YA 3EWZA 1W37A 1W8GA 3H53A 5D2VA 2CLLA 3RLGA 4AIUA 5M2FX 2GGEA 5CC5A 2V2CA 1C8QA 1JRCA 4FO4A 3TLLA 4P2VA 3RYSA 3EX3A 3V0TA 1G4PA 5ENLA 5HUOA 2PDMA 1VJZA 1H62A 1REQA 4CU8A 2W79A 1H0GA 2YIHA 4IIGA 4KBXA 2QCDA 3MKKA 1EWEA 1L6FA 1HL8A 2HK1A 4JIEA 3R0KA 1SGJA 4ATLA 4HD5A 2VENA 1K8CA 3K13A 3RMEA 4AD1A 5A6SA 1L9WA 1U5VA 4MSSA 3WUBA 1E9IA 2EEXA 1TV7A 1GOMA 2X1RA 2DH2A 1EXPA 2RH9A 3WFLA 4WHBA 2RDUA 2MANA 3W1XA 2I7GA 2Y61A 5FJIA 2QYGA 3O0FA 4RXFA 4GYJA 5F1VA 5BCAA 4PL1A 3GE7A 5HNTA 3CMJA 5AHIA 3ERPA 2XM2A 3VDBA 5CZJA 2GK1B 2QPUA 5K9DA 2ACQA 3L4TA 4Y9NA 1U30A 1LWJA 3ZZ1A 3AIVA 2WM1A 2EKGA 4GNJA 3UBPC 3BLLA 3BSHA 4S3BA 3PWAA 2UY4A 3CUGA 5T26A 3GO2A 1TQJA 2GZXA 5LXXA 3I6TA 1XS2A 2VC7A 1I6NA 3UXIA 2PZ0A 3WNOA 1L6SA 1PKMA 2XM1A 4J2PA 2Y89A 4XVEA 2E40A 2FGLA 1GVSA 3FS2A 3IV3A 4UFIA 2R91A 3GFXA 4QP0A 2QJNA 2VC9A 1YPXA 2NV1A 3A47A 3UPMA 4I9AA 1Q5MA 1VCGA 4DF2A 3G24A 4BKNA 4AMCA 4F0LA 2NUYA 4FEZA 4GIEA 3IJIA 4GNKB 3TR2A 3FAWA 1L6YA 3BVJA 1DIOA 5BROA 1OG0A 2G3MA 3VE7A 4K6AA 3WF0A 3NA8A 1AQFA 2FPTA 1NQ6A 3KW3A 4AYSA 3AO0A 1MEHA 1O7AA 4JS3A 4U31A 2WVTA 4N9EA 2WQDA 4GQRA 4MLJA 5D2WA 1I2PA 3BH4A 1T99A 3AXMA 2EXOA 4O53A 1YTEA 4O0QA 4K39A 2PP3A 3U9IA 1CDGA 1FWTA 4HPHA 5CG0A 1Z8AA 8RUCA 3W86A 3SUUA 4C1NB 4X22A 1PDYA 3GIYA 1VFFA 2NZLA 1ZAHA 3EWBX 1RD6A 1YDYA 3V4BA 5DY2A 2WZMA 5DQPA 1QPOA 3LRKA 3OVRA 4LEQA 1X1NA 2DVTA 4A29A 1P1MA 3N6JA 2ZFAA 4M5PA 1RCOB 4OFCA 4N7QA 1QHOA 2JKAA 3WZ0E 1R3WA 3DCPA 2BBFA 3HM7A 2QCMA 5EU9A 1UA3A 5BXPA 4EX4A 4I5UA 1VYPX 1M6JA 1POKA 1NEYA 4NRRA 3AU2A 3WENA 3LLXA 2NT1A 3SRKA 2D23A 5DT7A 1TUFA 3A5VA 1VBGA 3DXIA 1LF1A 4IUGA 5E70A 1L6WA 3LTYA 3W37A 2X8RA 3ZT6A 1RALA 5D2XA 2CZDA 3AJXA 1WAWA 4UXDA 2PDHA 1W3LA 4MNLA 4X9YA 4JTIA 3NQVA 4FNPA 1W6TA 1TR1A 2Y7DA 1K7XA 4DLMA 4H2HA 4DJDD 2NV9A 3W82A 1OFEA 2HS6A 1LG1A 3V1HA 4PB5A 2YCLB 5IDIA 1G1YA 3QVQA 2Z00A 3TSBA 3SSJA 4YVPA 1KXVA 4F79A 4RNHA 2RAGA 1IR2A 2PDIA 4HNNA 5IHRA 4K8EA 3M0YA 1K6WA 3M47A 4AF0A 3WBWA 3WLNA 1O94A 3THQA 2QPXA 3VOHA 3DI1A 2O7QA 2HXUA 5IOBA 1V6UA 4U3AA 1TPVA 3TTQA 4JTEA 4JTQA 3BCJA 5D9OA 4IP4A 4N0RA 2L5HA 2OPJA 3RMJA 2CITA 3O7UA 2ESCA 4WJXA 3BCDA 1TWDA 2XSBA 4NKCA 2FHCA 1LLZA 4XISA 4DF1A 4IP5A 4PMVA 3W4RA 3DFTA 5A8NA 3OBEA 3W70A 1D3GA 2ONEA 3L4WA 3TC6A 4XD3A 3KOWA 5TD4A 4S39A 2A7RA 3VGHA 3UY8A 1XC4A 3LZ3A 4IQDA 4UMCA 4MUPA 4H8HA 1VZWA 5M17A 5E0FA 2IS7A 4LRSA 5FSDC 4EAYA 2DSUA 3HF3A 2WM0A 1I60A 4AHPA 3ARWA 3W75A 2FHFA 4U5KA 3GK0A 4OUIA 4IQJA 3WDPP 3VABA 3U2ZA 1W3KA 1KGWA 1VBRA 4W84A 5EMYA 5XINA 1UBPC 1OEPA 3EDKA 1BFNA 3STPA 4CNTA 1AMKA 2YB1A 3LNMA 3W22A 1RK5A 2A85A 3KLLA 6REQB 4R9OA 3VNJA 4JTUA 2FYMA 4WX2A 5DCDA 2D69A 3L4VA 2EPLX 3EGJA 3GVRA 5FSEC 4KGLA 3NL3A 1TV5A 4LUSA 2WMIA 2YCIX 3QN3A 1SFSA 1E70M 2V67A 4A3YA 3SCNA 2O7SA 1DV7A 2NW0A 3GBEA 1KRAC 3SRHA 4U3CA 4FX8A 1W3IA 1OABA 2GK1A 3DZ1A 1H7WA 1WO2A 4AG0A 3OYZA 3AZSA 4K68A 3HPXA 4CQ9A 2OYKA 2ZZ6A 3HG3A 3AJ7A 4L1XA 3QTPA 1XJBA 5EMLA 2AGKA 4K7YA 1JXJA 1DIDA 2UV8G 1XLMA 5AC7A 3W73A 3M0VA 4V15A 5JMUA 4QROA 3WQFA 1S1RA 2VJXA 4C6JA 1W9PA 1ZJBA 2OZ8A 4BEQA 2VX6A 3S5NA 2BFGA 4MDOA 3L5LA 4U28A 2OELA 4JL1A 1FWEC 4NF7A 1TJ1A 2R8WA 4Z1AA 4PEKA 2PA6A 3URNA 4E3VA 1SSGA 4XIAA 3NO3A 3PR2A 3SUTA 1Q63A 1IYXA 4YVXA 4HPXA 1WQ5A 4NZ5A 3ARQA 5HATA 3LXAA 4Q8PA 4C1KA 1XFBA 4LSBA 4L6OA 3G1FA 1UH3A 4O16A 1JPHA 4L6HA 1PZ2A 2BGNE 4M1RA 5HQLA 2TRSA 3TAOA 5AC8A 2WCSA 1GUVA 3W7OA 1JCTA 4JX4A 1F3WA 4JX6A 2XN1A 4MVAA 4FNUA 1G7VA 3GH4A 3HJZA 1T5AA 1W9DM 5FIPA 3WQEA 4LUTA 5HR6A 2YCJA 2Z2AA 3K8KA 1JQXA 1DQUA 2PF0A 3SSZA 2Q3RA 4Z2LA 3QRHA 2V5BA 3LHWA 3WF1A 1GK8A 3KCLA 2VVSA 4PUMA 3PTKA 4LXFA 3V36A 1EPVA 3L7RA 1XIIA 4WKHA 3R79A 3RJYA 4L4OA 3LM3A 1U22A 3R58A 3KVMA 1G5AA 2ZUSA 4QM1A 4HU8A 5AY7A 3DBNA 4PSPA 3I7RA 3CEUA 3W7NA 1YNPA 5AHLA 2FVLA 3TXVA 3UNDA 3L65A 4JDBA 3MT1A 2O92A 4O50A 1NWSA 1H49A 2A6LA 1PDZA 5A94A 3BW3A 1M7PA 5KZ6A 2I9EA 3HZ3A 5EL1A 3ARUA 3UW6A 1AFSA 1GVRA 2NVCA 3FJ6A 1DHPA 1QNRA 2PLKA 1EKOA 2GDVA 3C4UA 2A79A 2E6AA 4NAEB 3FSTA 4OBSA 1MXSA 1RZMA 5FAJA 4HMCA 1P0KA 3BOLA 5DCEA 2ZX8A 4PE8A 4ZO6A 1DJQA 1K8XA 4REQA 3VGGA 3OZOA 1HL9A 3QGVA 3S1GA 1J6OA 1XYZA 3LMZA 3DFHA 4JD4A 3N9RA 4MAZA 4JX5A 1WDRA 4JTLA 5BWFA 4C7GA 1GOOA 3B8IA 4GH1A 1D7FA 1XPYA 1OC7A 4LYQA 1JEZA 3W7CA 3JZUA 4QE1A 4WDTA 3RGTA 3MVTA 2BXVA 2VCBA 2QUMA 5DX7A 3THDA 1OYBA 4DBWA 3K46A 3UZYA 1K4GA 4QJ3B 1A5NC 3C2OA 2YFNA 2PDBA 2JIWA 1BLIA 1QXLA 5JBFA 4DJEC 2Z29A 3W7JA 4HJWA 5H1WA 1JNEA 4O17A 4GNVA 3WK1A 3N15A 3E1F1 4C6MA 2X1SA 1P4CA 1XQKA 2R9RA 3NZGA 1RD5A 3DECA 2GQ8A 2YL6A 1LTDA 4XAFA 3SR7A 3TYCA 1IEQA 3H2OA 3VIOA 3WEZA 1UWTA 3WCZA 1IIHA 1TYGA 3LPGA 2IXVA 3HFYA 3TYAA 1PVNA 1JZ5A 4CNPA 1FHDA 4X2RA 2YCKX 2Z1VA 2WV8A 2YBVA 3RR1A 1KM1A 1B5TA 4JQAA 1LLWA 1JCJA 1KGXA 3BARA 4LF1A 1G94A 2HQAA 4NJJA 5E0CA 3WUEA 2J77A 1MUWA 4AX7A 1XD0A 3MDUA 1JNDA 1XIBA 4D8AA 4GBDA 3OA3A 1WOAA 3NG3A 2J6VA 3VD4A 1ZTVA 3MUZ1 4O18A 3SY1A 3S2JA 3CH9A 3KWXA 3QXBA 5D9NA 1QNVA 1MDLA 4B2DD 3GB6A 2H9AB 3NQEA 3VX1A 1HP4A 2VEFA 2V6AA 4QLLA 4X0VA 1H2JA 3GG1A 4F66A 3PUDA 3G1AA 4B3KA 5F4XA 4GJJA 4PTDA 2EF9A 1NELA 4AZIA 2A6NA 1P0NA 1Y7VA 3TTYA 1KCZA 3EWDA 4AMAA 1HJUA 4HNLA 4HHPA 5A6MA 3AISA 4MJ2A 4PTWA 5HANA 4YLWA 2QCEA 2NT0A 4LVBA 3VUSA 2ZA3A 4ORIA 2RDXA 2HDJA 2PWVA 3NEVA 3LI0A 3EYPA 2XSAA 1A4LA 4AU0A 1FXPA 3W29A 3SCTA 3WJXA 3GH7A 1SO5A 3L23A 3E0FA 2JFEX 2YA1A 4UR9A 4NI8A 4PMOA 1JRBA 1V5XA 2PLCA 3HMJG 4QQUA 2V38A 3G0SA 1PS9A 3H7RA 1E9LA 3GRIA 3EB4A 4NUWA 3OG3A 3EA1A 5KZDA 1JFHA 1VH7A 1E73M 2FFCA 3F5JA 3UZXA 2XVPA 4QITA 1A5OC 4PYSA 4KEZA 4MG4A 1MRAA 4DYKA 1UUOA 4RNIA 1KB3A 2XTKA 2WK2A 4TIMA 3TXZA 5LSMA 3NPVA 4R33A 4DAFA 3L4ZA 4R7WA 1PX8A 2HRWA 3FOKA 1G4EA 2C6QA 3W87A 5LNWA 3ATZA 3B03A 4HOXA 1SW3A 2OCZA 1YKWA 3SUVA 4AWUA 5SWUA 2QMJA 2X1TA 1DHKA 4DYJA 2XGZA 1O5RA 3KUMA 4NIRA 4KKXA 1R38A 1PCKA 4GVHA 4BF9A 4D6CA 4UZSA 1H1NA 1QHZA 2GOKA 2NVAA 2BASA 1HJSA 3H2AA 1E1CB 4NX5A 3W7HA 3FA4A 1F4HA 1GVOA 2PTXA 4LUTB 3SN1A 7PTDA 3EWYA 4JXCA 1BVNP 3A5FA 4ZE4A 1DWIM 4HN4A 4G1KA 3T0TA 1QO5A 1FVPA 3XISA 3OIXA 2EBNA 4EANA 3IAPA 4W5UA 4QSFA 3FYPA 4PEEA 1SZFA 3FHQA 3M43A 3UWZA 1Q6QA 3H2MA 4KIRA 2PS2A 3NZQA 1GJUA 3E9AA 3M1ZA 4S2CA 1RV8A 2B7OA 2V30A 3F4NA 4NX0A 4DM1A 1KKOA 4LUYA 2DDXA 3CAVA 4P7NA 6TAAA 4O0ZA 4NZFA 2ZUUA 4IGHA 4P61A 3UPBA 4GGBA 2JEPA 4QCFA 4ERIA 3N29A 3GNPA 3KHJA 1E3XA 4M6PA 7XIMA 1K9DA 2WWCA 3LU2A 1Z3NA 1OC6A 2VZVA 4BQ5A 2OQLA 1TMQA 1XKYA 3C2FA 3S1VA 5LIWX 2HS8A 1MVYA 2Z25A 1J2WA 1VKFA 2Y5JA 4YTTA 1EJXC 3KRSA 3DIPA 4L5ZA 1L2QA 1QNSA 3EDFA 2PU0A 4JAWA 4HYRA 5D2YA 1EPXA 3LGDA 2CIPA 3Q67A 1J5TA 4KEVA 1RQHA 1KXHA 3MC5A 9RUBA 3VDAA 2OSXA 2DJLA 1OY0A 1K8ZA 3ABZA 1W9BM 2Y6ZA 1T96A 3AQUA 4PMNA 2NX1A 3MUAA 3RPTA 1QVBA 3AROA 2FHBA 2PTDA 1FP9A 3BGJA 3P7YA 3L2LA 2ZA2A 3TK7A 3OYXA 3AWOA 3LY0A 3K5XA 5CLTA 1QK0A 1O6IA 1PIIA 1VFHA 1EL3A 5A8PA 3NL6A 3CTTA 1QI0A 1DBTA 4M56A 5CJMA 3DHPA 3BLOA 3DN5A 4KS0A 1C7SA 3UYCA 1T40A 2WZTA 1E6QM 4IZGA 2X09A 5REQB 1E1EA 1Z6KA 1IHIA 1J18A 1UKPA 4BK9A 1OINA 2REQA 4DI8A 1OX4A 1UG6A 2D73A 2D3NA 4ENLA 3S1WA 4ZOAA 4IFKA 3NSXA 3O6DA 3KRZA 4C6NA 1R5YA 3WH8A 1UP0A 3W1NA 2VEIA 5ECVA 3TYUA 5FJJA 1CB2A 4HGXA 3ABOA 4UCGA 2ZUWA 3ABXA 1QO2A 3CU2A 5BXRA 5FF4A 1GG0A 1FWAC 1KBKA 1SO3A 3NR0A 1GQKA 2E8ZA 4KRTA 4HNTA 4QJ4B 1CGUA 4RDYA 6CGTA 3W3OA 3E6EA 4QXIA 4EWND 3VCRA 1VJSA 3CS2A 2BTMA 1YIXA 3WNMA 3IAQA 4AHQA 4KPLA 2RJHA 5GPRA 1F74A 1I1XA 3BAJA 1EP3A 4O1AA 4R7OA 3DKLA 1OFAA 3HQ1A 1ZBWA 2YCEA 3Q94A 4NL1A 1NOWA 2A7PA 4Q8OA 1LL6A 2X1IA 4ZQRA 3VMOA 4B3LA 3SI9A 4S3JA 1Y5XA 2YOCA 4B5VA 3UT0A 3GQYA 1VP5A 4H8VA 1WPCA 1B54A 1TELA 1GZJA 4HVXA 1Q8JA 1FFRA 4XZLX 3UR2A 2QDDA 1H5YA 1OIFA 2EG6A 1XD1A 1WBJA 3FGCB 1DQWA 3UGVA 1FBAA 4FP1A 4DJEA 1E0VA 4YL2A 4EE9A 3TR9A 3SQSA 1MNZA 3BGAA 4HT3A 1XIJA 1IGWA 5DRCA 1XBYA 2AL1A 4GFIA 4N4PA 3PSVA 1IZCA 3VIMA 3UYIA 2WSYA 4Z1DA 1N8WA 4FXRA 3EPOA 1M3UA 4WUIA 5C7HA 1TPEA 4ICNA 2PC4A 5DELA 1HNYA 1GJWA 3PF3A 3TMLA 5FL1A 2ZUNA 1RAKA 1WZKA 2AL2A 1Q66A 1E4IA 6ALDA 3WMBA 1WDWA 2Z7KA 5I78A 1OJXA 3T40A 4IIEA 3ZSSA 1UIPA 3BDKA 2J27A 1CXEA 5HDRA 1CT5A 3M0XA 3PPHA 4C6EA 3CV1A 1B3VA 2JGYA 4GC3A 4C5YA 1M53A 1ESWA 5M03A 3WH5A 3LK6A 3VZYA 3BAIA 1ZBKA 4L9ZA 3C2EA 3NNTA 3NQCA 5FF3A 3LCGA 3A4AA 2XZ9A 4ZA0A 3UXKA 1LT7A 3VFLA 1RJPA 4IIFA 1Y5WA 1W5NA 1IZJA 2OOGA 1KD0A 2D20A 4ZGYA 2ISWA 5DANA 2PDPA 4DB7A 2WBGA 3MUIA 2HXTA 2ZWZA 1NFGA 1K02A 4XVDA 2ZIDA 1S46A 3T0CA 4OECA 1GEQA 1GOWA 1XRTA 3TROA 3URBA 5CSSA 4UTTA 3B0PA 2NXIA 4XKMA 4HYVA 2OT1A 1NFBA 1YXYA 3QYQA 3WF2A 3WDHA 4KWWA 4IUOA 3CV7A 5IHSA 1CGVA 4GUJA 1EJ7L 1PCWA 5LKYA 2VM8A 4RE0A 2YPIA 5D03A 1MW1A 1VFLA 8A3HA 1LWIA 3DFQA 1JCXA 2VYOA 3IVUA 3OGVA 5EB8A 1P7TA 1W1TA 1XV8A 3MS8A 5D30A 2CXEA 3E0LA 3THAA 2V63A 4MZ8A 3H2EA 2DSWA 3MUCA 4IWWA 4ZMGA 1IEXA 2JGQA 2Z26A 1E6NA 4JTCA 2VOMA 3LXBA 2NQLA 1KRCC 1FWDC 1E43A 2Y4SA 2F38A 1WZLA 2DW6A 4AYGA 1UASA 1UQYA 4C6CA 1GW1A 4P7QA 4UTWC 1W9VA 1EA9C 4K1WA 2X40A 4WKFA 3CWNA 1XIGA 3LLDA 1GGOA 1KQYA 3K8MA 5BRBA 4QR6A 3R8RA 2P53A 2J7HA 1ME7A 3HPAA 5EGRA 2PDUA 2AKZA 4WF7A 3B9NA 1C29A 5TBOA 2FQIA 1R7OA 1V08A 2Y85A 2AKMA 2AQWA 2PE4A 3WF3A 2R24A 1UROA 3TA9A 3TW6A 4JFVA 3W7PA 3QQWA 1I4NA 2AOSA 3GHRA 2JEQA 3HB9A 4D6IA 4QAIA 1YPIA 3P3BA 2P1FA 4MY8A 2QJMA 4KCWA 3MZ2A 1WX0A 4LS2A 3TQ0A 1JVNA 3CL8A 2ZZ2A 1N55A 4CU7A 1NH6A 4DBUA 1SMAA 3A9IA 3ENLA 3L67A 1I45A 1XRFA 4RCXA 3K4AA 2V2DA 4B5TA 2J7DA 3IK2A 4P8XA 4RZBA 3SUSA 4JIPA 3ONBA 4TXEA 4KW2A 1OSEA 2VEGA 5G2IA 1I0DA 1ADDA 4ADTA 2XVGA 3TE9A 1US2A 3BLKA 3JZEA 1R9YA 3CZ8A 3CC1A 2CW6A 2PDYA 2WSPA 1LWHA 2J7CA 2V3FA 2ZICA 2I14A 5BOEA 3TONA 4JTRA 4EVZA 3F4CA 2V69A 3WBXA 3A21A 2ZRZA 1GVYA 2FB2A 3W23A 4Y2WA 3EMZA 4UTTC 1C8YA 2WQPA 1IWAA 1W54A 2V3DA 5C0QA 1UZHA 1V3LA 2G95A 4C6DA 3P5YA 2JIEA 1ZGDA 1UZDA 1OFQA 4HSHA 3ICJA 4WEVX 1BKSA 1GYNA 3KTXA 2J78A 3M0ZA 1OBAA 1Q65A 2Y8VA 2YDSA 5HJXA 4HZMA 2XISA 4MFDA 3AIBA 1BYBA 2DT1A 5D9MA 5FJPA 3NQGA 5H8MA 3H26A 4E2VA 4I5RA 3ZLHA 4CN4A 2V0TA 3UP8A 3QYSA 4HK5A 1K9FA 4EF9A 3H12A 3NL5A 3W7LA 2J8GA 2EJ1A 4HHMA 3W6MA 2E3ZA 2OQYA 2F2HA 4IPIA 1DWJM 4J4KA 3T4WA 5DCBA 1W5OA 1MMFA 3QF0A 2ZXBA 4NZ3A 2P88A 2A2IA 3G1VA 2E25A 5LGXA 3CNYA 1EHNA 5E09A 2G3IA 3R13A 3HGSA 2FZ9A 2RHGA 3MCNA 3DC8A 3B05A 1TWSA 1CX9A 3IIOA 3BK0A 5CQ1A 3UZJA 4ZENA 4GPNA 3GU9A 4XD6A 4JPGA 4ZOBA 3NFUA 1AJ2A 4P8VA 3AC0A 3BJFA 3KOXA 4TOQA 3SCVA 1JUKA 1W3HA 3M4HA 2NXHA 4R85A 4JY8A 3EWXA 3EX2A 3SBFA 1OCJA 3OW1A 1K03A 1NDYA 3CASA 4EPEC 1TTIA 1ZCOA 4MUZA 2C1IA 1EP1A 1UR3M 4CD8A 5HWMA 2PDJA 3E2QA 5EA9A 3FKRA 3KCJA 4XSLA 1F07A 1WDQA 1M7OA 1MQQA 2D2JA 2CEQA 1RJQA 3QJAA 1SO4A 4L1GA 4DJDC 1MZHA 1J79A 2P10A 4ZBCA 3WLIA 4MKSA 1V02E 3SCOA 2O55A 2QUNA 3DG3A 4O11A 1KBJA 2OLHA 4IOTA 3ALGA 4ZFMA 3DHDA 4OGZA 4GBUA 4HZ8A 1BPLB 4A8IA 1YNQA 3I7QA 4H9YA 3IPWA 1WZAA 4GZJA 4DAIA 2PDFA 4DN1A 3BC9A 3SCWA 4JY9A 5C8BB 2HVMA 5A3HA 2ON3A 3TEVA 4PBEA 4JICA 5GVJA 3DOPA 3FFSA 3UWYA 2F61A 3SN4A 1YQ2A 3VD5A 1DXFA 1JDEA 1P7TB 1SZRA 3LSCA 3O9NA 1ITCA 2MUCA 1F3EA 1NSJA 5FJOA 3CT7A 2ZTKA 4EP8C 2PLJA 3UG4A 3PBVA 1XINA 3E38A 5I5RA 4URIA 1ISWA 4HNOA 4MWAD 3RILA 4O1CA 4EPDC 4R3UA 3WX7A 5F7UA 2EG7A 2HROA 1N7KA 4FXFA 5FACA 1EGZA 2WBKA 2PMQA 3C8NA 1K4HA 3TYZA 2CBUA 5G2HA 2D1ZA 1HGWA 3QKEA 2WJFA 1B3YA 4F9JA 1DJXA 3AHVA 3TN4A 1A5MC 1ME9A 1H7OA 4J40A 1DQXA 3MCOA 1V6YA 1O5XA 3SIZA 2R1LA 1IT8A 1ZS2A 5JBEA 4OZOA 3AYTA 4HCLA 1XYCA 2WSKA 1XCWA 2WOQA 3GXDA 1EDGA 4LVGA 1PIGA 2E67A 2Z27A 3MWAA 1YEYA 5I6SA 1TVNA 3PZVA 4RX0A 3MHFA 3PZNA 2E9BA 1A49A 3MTWA 3LHVA 4O1BA 3S0CA 1A0DA 8CGTA 1UKTA 1EIBA 1RXOB 1ODZA 1TSIA 2Z1XA 3LPOA 5KMYA 3ID7A 4MNKA 3FXGA 4BS0A 1A5AA 3CHEA 1FDYA 3TDFA 5HBFA 3KZSA 3W01A 1IXPA 1VIZA 1GPWA 4XD4A 4Y96A 3OBKA 4FR1A 2CCRA 5H2ZA 1KFBA 3GY1A 4DXVA 3UR7A 2QJHA 2WSQA 5T8GA 4IL2A 1I1WA 5BYWA 3G6MA 3FA5A 1B9ZA 4HSNA 1OD8A 3C3UA 4F2BA 3UA3A 5LXEA 3AZTA 1P48A 1XPGA 1UH2A 5LA0A 2YZ5A 2GUYA 5B7ZA 1EB3A 3YPIA 3IACA 2VR5A 1UW9A 4U4MA 1IR1A 1EYWA 3WH9A 3MY9A 3TYEA 4M7TA 4GCAA 3WQ6A 4ADUA 4BQ2A 3GG8A 3L4YA 4MTVA 1DEDA 1GG1A 4OTKA 1M5WA 3QPEA 3GD6A 1IWBA 4TMBA 3D6NA 4GQQA 2H90A 4B4HA 1WZMA 3EPNA 4Y9PA 1UD6A 1CPUA 2TAAA 5C9XA 1C8VA 3DHFA 2XDFA 4LYPA 4PCFA 5FJUA 3ZFHA 5MHBA 3BL3A 3RK8A 4QQ3A 4UFMA 2W63A 2G50A 3G0UA 1PUDA 3HA1A 3ZJKA 3T4CA 1Q13A 3KS5A 5HINA 2WHKA 2A3CA 3AU6A 5I06A 5GJMA 2X0SA 1TZZA 3B8VA 3TW9A 5FKYA 4AF0B 1PKNA 4GQ0A 1R3SA 2C8NA 4ONVA 1MZRA 3OODA 4C6BA 2DZPA 1R2RA 2BDQA 1W5MA 3GHUA 1PWMA 5E9XA 3AAMA 5IFTA 5K4ZA 3A3WA 3UWVA 3M0IA 1Y0EA 4JIHA 2C19A 4K37A 3CPRA 2J7BA 2ACRA 3KAOA 4QX4A 1GHSA 4Q33A 2ZC1A 1L8NA 1VYRA 3EWCA 3KVJA 1MQRA 3NAVA 2DIKA 2EHHA 5ECUA 4RLIA 3DFPA 2UWFA 1HF6A 1XLIA 2BOGX 2Y88A 1KFKA 1K7EA 1R8LA 3CV2A 2BX7A 3R5EA 2J9YA 2VZTA 2ZQ0A 3STEA 4D6GA 4CQBA 4K36A 1OX6A 4IX2A 2YKKA 5IXEA 3QOKA 3G1RA 1GOKA 1GW9A 4PN2A 1IV8A 1QOXA 3L9CA 2CBJA 2X7VA 1ZHAA 2QIWA 4UMAA 1M04A 1FWIC 5A2BA 3KZPA 4DWDA 5LNUA 1W1PA 4YWIA 1A0EA 2PSNA 4D1IA 3CHFA 3MI3A 4QNWA 1R3RA 4M81A 3VKDA 4F9DA 4L64A 5C2CA 2DIJA 4XZIA 1TPDA 2UY5A 1OFRA 1KM6A 3QMTA 4XZMX 4DWSC 1R2SA 2RDWA 3KLKA 3NIYA 3RN6A 2I57A 4QS5A 1BVZA 2C79A 4DJFC 1RH9A 1FWBC 2Z6JA 4ZO9A 3WLMA 3UPWA 8XIMA 1CGXA 2LLEA 4Q8TA 3TVAA 2HWGA 1UZ1A 1I2QA 1QDSA 1CLVA 4WQ6A 1H60A 1OCQA 4IGMA 1OADA 4HB7A 3LXCA 4RNFA 1UH4A 1YX1A 1GVFA 3H22A 1TUXA 3RCMA 3LCFA 1XIFA 1R85A 3RM9A 3KTCA 3VKAA 1UIOA 5EBUA 5I7GA 4M82A 3U6WA 4ZE5A 1WAUA 5B7YA 3WUFA 1FFQA 3FVDA 1AZ1A 1TWZA 4XBJA 3IJ7A 4M29A 2WANA 3VUPA 1WBHA 1QT1A 3W1MA 1OF8A 5LIYX 5HNNA 2QDGA 1FHUA 1UD3A 2HTMA 4J5NA 2EGZA 2YLLA 1GT8A 3G1XA 2GL5A 4E2OA 1IXOA 4GYPA 3CZLA 5MF5A 1UKSA 4LC6A 3REQA 3CUXA 3U2CA 1A3XA 2DSVA 2X41A 4MJZA 4TVDA 3P84A 3UWWA 3DI0A 2BVTA 3U7VA 3UZWA 1FUYA 5J5RA 3NSMA 3B8SA 5BMWA 3M0LA 1ZJHA 2ZWYA 4JTTA 3QY7A 2VFIA 3LLFA 2PB1A 3KBMA 3BG3A 4UCFA 4GUIA 3EA2A 3LTPA 3BOXA 3TYDA 2BY1A 5CPNA 2PBOA 1WXJA 4JN8A 1QNOA 4ML4A 1XLJA 3F5KA 4KWVA 5D32A 3PS7A 1EGVA 1OZQA 2XWEA 2CESA 3G2GA 3N34A 3WNNA 4XAPA 2WZEA 1FWHC 3SGGA 2VFHA 1LL7A 2RFGA 3TSMA 4AUBA 3GNOA 4IPJA 4IFOA 1E9YB 3CGTA 1QPKA 3FGCA 3SJ3A 2IW0A 1S38A 1R87A 4FAMA 5HJYA 1QI4A 3URAA 5MKGA 3W74A 1QHPA 2BGQA 4JQ1A 5JUVA 2HV5A 1UP2A 3QR1A 4PMZA 4G7EA 1ZLPA 3LOTA 1TJ0A 2QAPA 1TZ9A 4XUGA 1AQ0A 2NVDA 3N2CA 2WLYA 3IGXA 4LY4A 2PRHA 3ITVA 1Q6CA 4XB3A 3MSRA 2GDQA 3H2NA 1MW0A 3W1TA 1AJ0A 3UZ5A 2AL2B 2ZKMX 4CN1A 3VIPA 4LT9A 3O63A 4IGSA 1H3GA 5I3IA 1HG3A 3S2CA 3ITYA 5H91A 4PMDA 4XZNX 2VQUA 1CLKA 1X96A 5G2WA 2A3LA 3UXLA 5A6KA 2VGIA 1SJDA 4G6CA 3BJSA 1X97A 3LPFA 3PZ9A 2WNNA 2FGBA 3VIHA 4Z17A 3QLLA 3V5CA 4PB3A 5KITA 1K3UA 3EOOA 3QQ1A 4ATWA 1E5NA 3ANYA 2H3DA 1V3JA 4W93A 1B3XA 1Q6DA 1J9YA 3VO0A 3AOFA 4QSHA 1G6CA 3WLTA 4KQNA 3OVGA 4Y8EA 4CUCA 4JFSA 3ZR4A 2Y5SA 3JVAA 3HOJA 1PYFA 3RIKA 3NQ2A 1MW3A 3TZFA 2GUBA 3C86A 4E8DA 4PFMA 4CD7A 3P14A 3HN3A 3GG7A 4UNKA 1CENA 3IRSA 4B9YA 1R9ZA 5BWAA 3IARA 4NJKA 1KTBA 3S4TA 2GVYA 3VKJA 1M7JA 2ABBA 5I79A 3KS6A 1HN1A 3I7SA 5BU6A 4NJHA 2WJDA 4HJFA 3PHAA 4KRZA 3OO2A 4J35A 1J93A 4BY3A 1MWOA 3V0SA 1JULA 4XD5A 2WC4A 2INEA 2B7PA 1YDNA 3CPGA 3EEZA 3HBLA 1XYFA 3WQCA 2IUZA 2GGHA 2W62A 4AD3A 1YHTA 3VNKA 3C2VA 4PTVA 2FLIA 4EF8A 1ECQA 2PU1A 4L56A 1UWQA 3THCA 4HK7A 4EACA 4MHBA 3CJPA 1DJWA 2XINA 3CLWA 3EAUA 3N14A 3VIJA 4BQ4A 1DKWA 1MQPA 2Z1WA 1PZ1A 2Q8ZA 2FTPA 4H6EA 4MB4A 4DJFA 3AUJA 1HKVA 4KMQA 3WSUA 1XBZA 2CU0A 3I4EA 5HQEA 1YE4A 2IKHA 3RM4A 1X1ZA 2BS9A 3KL3A 3XIMA 1XSIA 1W2PA 4D8LA 4L6DA 3RNDA 1NQKA 3RX2A 1US3A 4Q3MA 3VDHA 2V5LA 5CPMA 1VLIA 4J2MA 1O12A 1HJQA 2BXYA 4BI6A 1O66A 1G9HA 4UFLA 4RDVA 5F2GA 1HGYA 1A4MA 2BV9A 2QNEA 2OYLA 3OQ8A 2Y7EA 4OUEA 1AODA 4AZ7A 3BW2A 5KEZA 5JU6A 3CUHA 1SZGA 4S3CA 1Q7ZA 1KM2A 3GR7A 3STFA 1QBBA 3G5EA 3P0WA 3GSMA 3S2MA 2ISFA 4NJIA 3TCEA 3P61A 1FCBA 4JTGA 1AD4A 4D2JA 3DHUA 5LGZA 3VCCA 1RK6A 1PEZA 4MY1A 3I3EA 4I6KA 1J0ZA 4J3TA 5G4EA 3G8EA 1ZAJA 4UFJA 1BTCA 5CZKA 3ZR6A 2ZX7A 4LVDA 2H6RA 4PMJA 2QEZA 1PZ0A 3TOPA 2VR4A 3N2MA 3N6QA 3TNOA 1KTCA 3NOYA 4J3UA 3GUWA 2GYIA 1HTIA 3TMQA 3P8JA 4I3GA 1CGYA 5CJNA 5AYXA 1AG1O 1UD8A 1R30A 3ZWSA 3GYEA 4X60A 4TVCA 1JDFA 3VD9A 4NNBA 1Z69A 4C1LA 2FDMA 5D33A 5CGTA 1XX1A 3PJWA 1NFPA 3TTEA 3T2OA 4HK6A 4NQ1A 4GY1A 3ZJ7A 4LBRA 1JGMA 3U2OA 4UTIA 3HG4A 2G96A 3FK4A 3T07A 2GSJA 3NDYA 1VPQA 4IIDA 3AS0A 1YXCA 3NL2A 3P80A 2DT0A 1DP0A 1JPKA 3VX0A 3M0JA 1K9EA 3CLMA 1MEWA 1O1ZA 1VBJA 1BGGA 3H4XA 4PMQA 1CWYA 2A21A 4LAKA 3MMUA 3QH2A 3DFYA 4P7LA 1NM9A 3C52A 4MWAC 5KSWA 3MSDA 4W85A 4LC8A 4YTQA 1RJRA 3GVGA 3CQ0A 4WSHA 4YHGA 2QLYA 1ENUA 2I16A 1AH0A 1WUFA 3GXIA 3E2RA 5K9XA 3E3HA 1TWIA 1XLKA 4ACZB 5BOOA 3R0UA 4H9UA 4PCNA 4A6GA 2ZX5A 3BANA 2CETA 2A3HA 2X7WA 1XGZA 1OCNA 4W87A 3FSUA 1OB0A 4DZIA 1ZRQA 1CXHA 1FH9A 1PSCA 3AMCA 3ZM8A 1DJIA 2DV0A 5LYRA 1TJPA 3QY6A 5FL0A 1TTQA 4OU1A 3UEQA 3GDMA 5F2LA 2Y1HA 2XJ7A 2NX9A 4JFTA 1KV8A 4R9XA 4HMDA 4QAWA 4W8BA 1GNXA 5HA7A 4DY1A 2DUAA 3AIEA 3S6DA 3WYZA 3GHTA 2AAMA 1R6WA 3CQKA 4Q7NA 3C0SA 2PDLA 2PRMA 4CN6A 3P74A 3VDGA 2C7FA 4US5D 5EKYA 4B90A 2P76A 3N17A 1UKQA 3SZ8A 4XBKA 3S8HA 4UQDA 2ZX9A 4F48A 4LF2A 4DJED 1EC8A 1SUXA 3IJDA 3WKZA 1TPWA 2PWFA 2XH7A 1X98A 4PODA 2X0YA 2HNHA 2WMIB 3DH7A 3SRDA 2G0WA 4ZL1A 1KM3A 3AXXA 4L4MA 5BRPA 3L4XA 3AI0A 4X61A 3SB0A 1E6XM 5REQA 1DJHA 3IIPA 1TX0A 3OLIA 3OA5A 2Z0IA 1UC5A 1JAEA 2XSXA 1EDQA 4NXSA 3VZZA 4J3WA 1NP0A 4GZEA 3T05A 1R47A 3CYJA 3P2VA 1OX4B 1KXQA 3LV6A 3C0QA 4LBUA 4M7SA 1JXKA 3LCIA 2QIIA 4JTFA 5E0KA 1RBOB 4H04A 2G4FA 1A53A 5AECA 2XGIA 1TZ7A 3BMWA 4PUUA 4OQVA 1UR1A 5FAGA 1B3ZA 3PFMA 3MMTA 2I56A 4IISA 3GDRA 3U48A 1JIBA 2CKRA 2VQTA 2RUSA 2P3EA 3L2IA 2GPTA 3FVMA 1V3IA 1EA0A 4OBRA 2ISDA 2XGBA 3VU2A 1ECEA 1WKYA 4LEFA 1UP3A 4CQDA 1F2JA 4GIYA 5ABFB 4LYRA