1YLVA

Schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with laevulinic acid
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
341
structure length
341
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREKFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHTGFLRAGARLIITYLAPEFLDWLDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (5-AMINOLAEVULINIC ACID DEHYDRATASE)
publication title The Schiff base complex of yeast 5-aminolaevulinic acid dehydratase with laevulinic acid.
pubmed rcsb
total genus 119
structure length 341
sequence length 341
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ylvA00
4QAIA 1UCWA 5EMUA 4BK9A 3L68A 4YLWA 3LB0A 4XBKA 1GTEA 2CW6A 1JCMP 4CLMA 2WJZA 1H51A 3B03A 1T96A 4LVDA 2NUWA 1TPUA 1BTMA 1JCXA 3V75A 4UTJA 3TA6A 1VYPX 3M43A 5FEPA 6TIMA 1I2PA 1C29A 3ABOA 1F6KA 2ALDA 4LY8A 1G7VA 3PVFA 1TTJA 2QAFA 3KFTA 4YCOA 1W1ZA 2I9EA 1MZHA 4MOZA 3O8AA 5F2IA 3LXAA 1DBTA 3OA3A 4MY9A 3HG3A 3QMSA 2KZHA 5AN7A 5CKSA 1LORA 1K7EA 2A6LA 3GDLA 4E2BA 3NPWA 4NZJA 1FDZA 5KINA 1QPNA 4LU0A 5EKYA 1FDYA 1WX0A 3LGEA 3VE9A 5LGZA 1ME8A 1SZFA 2FDSA 3W1PA 4UFKA 3GR8A 1PHWA 3W7NA 2UV8G 3W07A 3IGXA 5HNRA 4NJKA 1KBIA 4L4LA 3U2OA 4X3ZA 3CT7A 4LNYA 3NAVA 1AL7A 3LLDA 1FXPA 4FX6M 2VC6A 4WJEA 4WOZA 4LS0A 1IXQA 2XN0A 3S5YA 3QPZA 4A29A 2ZA1A 1YPFA 3L5AA 1TV5A 5LNSA 1FXQA 5AHEA 4LRSA 3CIWA 4O50A 1EUNA 1N7KA 4GWEA 4BFAA 4HSOA 1I2RA 3FFSA 4UNKA 4UTWA 3G0XA 1KFEA 2QCHA 3HG2A 2JKPA 4N9CA 1R2RA 3HIJA 3UWZA 2X30A 4MY1A 5AOUA 5L9FA 2WQPA 1OHLA 4ALDA 3TCEA 1X7FA 4O4VA 4MKNA 1TQJA 2OT1A 4Z0SA 2V9DA 1LCOA 5AYYA 2NX9A 3S5ZA 3PUEA 3NQVA 4X9SA 5F4XA 3NOEA 3KX6A 1IIGA 1O95A 3N19B 2R14A 5AHNA 4N9DA 5I3HA 3NGJA 4R7JA 1Z42A 1K8XA 3TU9A 1A5SA 2NWRA 2WPBA 2NWSA 3GXPA 3W22A 1XUZA 4Z08A 3QYQA 3B06A 1OYCA 2X1TA 1EX5A 3G0SA 2Q8LA 5D2TA 1H7PA 1NVMA 5AFDA 3MMTA 3T55A 2NXIA 1TB3A 4Q32A 2BTMA 3L5LA 4C1LA 4PL1A 3W1QA 1Q6OA 3NQ8A 4FXSA 3W7GA 1WDWA 1H60A 1KM0A 3W2LA 2JBMA 3C2OA 1VR6A 1W31A 1DJQA 1JQXA 4XBSA 5L6UA 1W8SA 3ANYA 4MLJA 1JCLA 3NQ6A 3UWYA 3OVQA 2E68A 1TJRA 3W7CA 5J5RA 1G69A 4JICA 4JDBA 4LVAA 4OWGA 3O05A 1XL9A 2DZUA 1JUKA 1FUYA 3T7VA 3THQA 1PVNA 3T78A 3PS7A 3MBDA 2V5LA 3W7MA 4JIPA 5H2ZA 3QMTA 1F74A 1I2QA 3IRDA 3HPSA 2E6YA 3W2MA 1VQTA 2GQ9A 1GYNA 4FNRA 2F7FA 2OZ0A 1QR7A 2GJNA 3EWYA 4UTMA 1DKWA 3M16A 4NT0A 2QCLA 5D02A 2RKXA 5E1QA 2Q3OA 3OHIA 2QCCA 1XKYA 1GG0A 5AHFA 3G8EA 1WAUA 2ZZ6A 3NEVA 3ZWSA 1VZWA 2C18A 2I14A 3P80A 1SO5A 1A5AA 2QJHA 3SW6A 3NNTA 2V8ZA 1H7WA 1VJIA 1VGAA 2DZTA 2ABBA 3RFAA 3LX9A 2VFEA 4WX2A 1PCWA 2PRMA 4IJBA 3W7QA 1S5TA 3A22A 4HNTA 3GZ3A 3QRHA 3QMRA 1LP6A 3FYPA 1W3TA 3EX6A 4H4IA 3O06A 2QEZA 2CZFA 2VEKA 4JTFA 3DGRA 4Y9AA 5KZMA 1LBFA 4FO4A 5K4ZA 4I7VA 3BG9A 5CZTA 3WFAA 5FF0A 3PG9A 3TMLA 4O10A 4IQLA 2FTPA 3W7IA 3T44A 3LRKA 5C55A 4YMZA 4IMEA 1DVJA 3KAOA 1IXOA 5I3IA 3CIXA 1ZAIA 1QO5A 2YFOA 1ZNNA 4IMFA 4BI6A 3NL3A 3WK0A 2C6QA 4QQ3A 2CLIA 3LCFA 1FWWA 4HNUA 3C6CA 3HPXA 5EPDA 3S1XA 3MWAA 3AO0A 2GPTA 1X1ZA 1QWGA 1T0OA 3CPRA 5F2MA 4AHOA 3F03K 2NX3A 4IX0A 3GXNA 3N2MA 2QR6A 1YDOA 1YXYA 4LC8A 2V2HA 2YYTA 2ZZ5A 5FEWA 3CHVA 1G7UA 1OFPA 1QPRA 3EB2A 3LHUA 1UJPA 4PEKA 5HWMA 4HPXA 2EHHA 3NQDA 3NVTA 3BLEA 4H6KA 2PRLA 4PODA 5DBUA 3DKJA 5EY5A 4K6AA 2Z6JA 3MP4A 3PR2A 1BWKA 4KFNA 3W6YA 1EEPA 1ME7A 3TIMA 3ABRA 1L2UA 3R5EA 3K30A 2A6NA 3NZ1A 1KW1A 4AHPA 3LV5A 3W7DA 4WY0F 1FY6A 3W85A 3S6DA 5AYXA 3C2FA 4N4QA 3TC7A 1S5VA 5LNWA 4BI7A 2B0MA 3BVJA 3L5MA 3IIOA 5A8GA 4LS1A 3G18A 1KTNA 3BW3A 4KWWA 3EEGA 3NM3A 1SFLA 3IVUA 4OV4A 1FCBA 4MFEA 3O6YX 4R53A 2XFWA 1VLWA 3I7QA 4YCPA 2VXNA 3VI2A 4WXZA 2Y85A 4RXGA 1WOBA 4A21A 3CC1A 3UWWA 4OQVA 1GJPA 5CPNA 4M6PA 3W76A 5G2IA 2FPVA 4O0KA 5I3FA 5AHLA 5IBXA 3W3OA 2ZQ0A 3BARA 3FJLA 4DF0A 3MHGA 2DZXA 4KWVA 1E51A 2GVGA 1X6UA 1J4EA 3W83A 3PB0A 3HG4A 1F7BA 5EBUA 5F4WA 4NVTA 4MJZA 5CZSA 1P0KA 1X1OA 2AQWA 2GQ8A 1H50A 2Y7FA 4K36A 4JTEA 2WSRA 3BG5A 1H63A 1UUOA 5AHIA 5IBXC 5HQEA 3UXAA 4Z1DA 1TPWA 2RDUA 2ZZ2A 1FCQA 1KV8A 1PCKA 1Q6RA 1VS1A 4QNEA 3C61A 3B0UX 1VH7A 2NXHA 3WK1A 4UFIA 3P7YA 2YX0A 4L4MA 2E09A 3DI0A 3MYOA 1D3GA 2EPHA 1XXXA 4HPJA 3RMJA 2CLEA 1FQ0A 2CFFA 1N8FA 4PA8A 4NUWA 1H7NA 3PC0A 2LLEA 5A5WA 7TIMA 3S0CA 3ATYA 4X22A 4JS3A 3PM6A 3C52A 3OVRA 1ONRA 3ABSA 1TRIA 1B3OA 1MEIA 2E6FA 4JX4A 1JRCA 5FF3A 1H1ZA 1Q6LA 4GFSA 3DFPA 4NJHA 4PL2A 4E0CA 3GDTA 4WZHA 5FF4A 5HR6A 3KVJA 1TYGA 2XN2A 4N02A 3BG3A 5BRBA 1XBYA 2ZBTA 2PCQA 4WD0A 3P67A 1Z41A 2R94A 1KV5A 4DO6A 1ZALA 1YYAA 3DFTA 3NQ7A 3EWWA 2QUVA 1FWSA 1WA3A 1DV7A 5DCDA 2OMAA 2CLKA 1I2NA 4K39A 1IIHA 2A4AA 3P5ZA 4FNPA 4O16A 3TFXA 3NA8A 1M6JA 3GB6A 1DL3A 3B8DA 1A50A 2FB3A 2FIQA 3W86A 3W1XA 5D2VA 3STFA 2FFCA 2YFNA 3W1AA 4P2VA 3W2UA 2YW4A 1O5XA 5F1VA 3OEXA 1OG0A 4JTHA 3PSVA 1FCVA 1IF2A 1TCDA 4I7UA 5FI8A 1EIXA 1VPXA 5K3VA 4CCDA 3TK7A 1M5WA 1WV2A 1TPEA 3QH2A 3G3MA 4I7WA 3NZRA 1SW7A 4BWLA 5G5IA 3TXVA 3DH7A 1TIMA 2QJGA 4NQ1A 5HMSA 4NNAA 1LLWA 3FA5A 4O15A 3CQ0A 3G24A 3F4WA 3HGSA 3KOFA 3KRSA 1GVRA 4AHQA 2WV8A 3HGJA 2AGKA 3GNNA 4K8HA 3R13A 2WO5A 1JUEA 5U4NA 3QEZA 3QF0A 1GZGA 5HUOA 4BWLC 1KLYA 3VKJA 5HWNA 2Z2UA 3MHFA 3ZS4A 2WSYA 3TAOA 2DU2A 4IGHA 4NJJA 5EYWA 1U5JA 1K02A 1RR2A 1OFOA 2E5DA 2QDHA 3G1SA 3NYZA 5HUPA 5AHMA 3UY7A 2VFFA 2WNZA 3W72A 4IMCA 1CX9A 2FPYA 4GUIA 2H3DA 4A22A 2Q3RA 4GUJA 4K7YA 4CNNA 4DBDA 2QDGA 3TX9A 1P5BA 1LM1A 3QSTA 3QJAA 5SWUA 1SSDA 1TPFA 1TPDA 2GVLA 4RKAA 4YWIA 2VELA 3BO9A 4LT9A 3M7WA 2X2GA 3CWOX 1LTDA 3M44A 3R12A 3LM7A 4GUFA 3B0VC 3GX9A 1SZEA 4O8RA 4PCFA 1AG1O 3Q58A 4UTHA 4PFMA 3P8JA 4ZQOA 3E96A 3S1UA 1NF7A 1OFDA 1GTHA 1DOSA 1ALDA 4UFHA 3UY8A 1EWEA 4ZMGA 3SI9A 1LRTA 2A7PA 4U4MA 1P4CA 3L21A 2RFGA 3U6WA 2RH9A 1GEQA 3DKLA 3EKZA 4XTIA 1KTCA 3P84A 1UASA 3IIZA 5LNUA 5TIMA 3L9CA 1UBSA 1I4NA 4H3DA 1H61A 2FLIA 3CM4A 2TPSA 1ICQA 4CCCA 3HF3A 1OX5A 4O0ZA 3B0PA 3LCHA 3TROA 4B5NA 4JYDA 3F4NA 3EKLA 1JRBA 3TDFA 4JX5A 5DXXA 5DY3A 3KVLA 2YPIA 4PTNA 4MFDA 2ATMA 4MLRA 3QC3A 1EPXA 3C2RA 3TJLA 1TJPA 5KITA 6ALDA 2YYUA 1IXNA 1ZY9A 1LROA 3AJXA 3E0IA 1TTQA 4LTSA 3NQCA 5G4EA 4JGDA 3STEA 3ABQA 1U83A 2H90A 4ADUA 2B7QA 2FB2A 3TSBA 3BGGA 4KFOA 4NNCA 1Q3NA 3TJXA 4ZVJA 1VYSX 4ZZ9A 1G6CA 2R91A 3KXQA 3DHFA 1B4EA 1XDMA 3P8IA 4TX9A 3KVKA 3W7JA 1TPH1 4RZ5A 3G1DA 1M7PA 3DBPA 5BW6A 4EOUA 4LWWA 3KVMA 1GVFA 5DBTA 1Q6QA 1QOPA 3MYPA 4GJ1A 1KFBA 1EP3A 4UIOA 1G4EA 3W1RA 4UMBA 3LCIA 1TTPA 1OX4A 4AWSA 5ABTA 3NQFA 1HFBA 3NDOA 5HWJA 3LV6A 3M1ZA 3G1AA 2DJXA 5DCEA 3CWNA 2H8ZA 2DZVA 3O07A 2Q8ZA 4Q4KA 8TIMA 4FEZA 1N55A 3LRLA 1ADOA 3SFKA 2V82A 3O15A 4D2JA 4FNTA 1TPVA 1VHCA 4AEOA 3H55A 4JTKA 1MEHA 4JX6A 2PC4A 3W70A 4M7SA 5D38A 2WNNA 3KHJA 4C1KA 2A85A 2ZFAA 4UFJA 2JKEA 4TR9A 1UUMA 4BF9A 2B4GA 3M5ZA 2EF9A 2OJPA 2GJLA 1J5TA 2C14A 3A9IA 2X16A 1JQVA 2QF7A 2NUYA 3INPA 3W2KA 2E77A 4QSHA 3PSWA 2H6RA 1NEYA 3CLMA 4O53A 3S5NA 4FB7A 1KA9F 4EWND 1T99A 2D73A 3P62A 4O14A 4O1DA 4LVFA 2HS8A 5KZEA 2Z0IA 1L6WA 3IVSA 3PAJA 2ATSA 5KMYA 1O5KA 3MBFA 3GK0A 3PG8A 2NXGA 1SZNA 1W56A 1PE1A 4JIQA 3C2VA 2FQIA 4DO4A 3PBYA 4HT3A 3GDKA 4QJ1A 3TH6A 3L0KA 4UTTC 3M0ZA 4Y6GA 1W5OA 3DFQA 3FEMA 3OVPA 1AW2A 2ISWA 1LBLA 4RZ6A 1JULA 2A1YA 1BWLA 1VC4A 4GXMA 1A5BA 1NSJA 3PUOA 1RQEA 1XBXA 4A3UA 1EP2A 1HL2A 1RV8A 1G4SA 2RDTA 1XFBA 5D09A 5LSMA 4O1BA 4DPPA 5KTLA 3LERA 2VENA 1FBAA 2ZDRA 3WK2A 3LHYA 1JCYA 2WNQA 4YL2A 4TMCA 2DJLA 3WJZA 3TFCA 3CEPA 1OABA 3HJZA 1QNVA 3TC6A 2W79A 4HIBA 3UWUA 4MPQA 4K38A 5KZDA 4R33A 3N9SA 1GG1A 3NQEA 3L0NA 5HJLA 4QIUA 2DZPA 3R2GA 4RK8A 3GNDA 4OU1A 3DFSA 3W9ZA 3RNDA 2VFHA 1I2OA 4UTLA 3LXCA 3ZR4A 1WQ5A 3M9YA 3FLUA 1M7OA 1VCVA 1WXJA 3W75A 1GYLA 1TPB1 4FHAA 1Q45A 1OK6A 3VCRA 3DU0A 2VEIA 3NQAA 1H5YA 3EWUA 4GBUA 5MHBA 4O54A 2PURA 3L0GA 2CZ5A 3W7RA 2V81A 2VOMA 3MUXA 2X1SA 3QZEA 5LKYA 1ME9A 1OVDA 4NJGA 3NQGA 4RLIA 3BLIA 5F1UA 4XUGA 3EXTA 1G4TA 4CQAA 2J24A 3RLUA 4JTJA 1TQXA 1SFJA 4QNWA 3SZ8A 1RQHA 1KLZA 1YDNA 3B04A 3TKFA 5CPMA 4S1FA 3TE9A 3ELFA 2QAPA 3IIPA 4CCEA 5F2GA 5LNRA 1RVGA 3RLVA 1OJXA 4KFPA 5CSRA 4O57A 1W5NA 1F2JA 3NPVA 4FNQA 4O13A 4DF2A 3M6YA 2I1OA 1GT8A 4WOQA 4HKPA 3DENA 4MYXA 4WXYA 4AF0B 3W7LA 2QCGA 3TSDA 4OGZA 2TRSA 1Z48A 3NQMA 4FIQA 1F76A 4PC8A 3TUUA 1VRDA 4NZFA 1J2WA 3KRZA 1XUUA 3UZ5A 1B4KA 2RDWA 3M5XA 3EXSA 3SY5A 2ZA3A 3PBVA 4JDYA 1LBMA 2ZZ4A 3TQ0A 3LCLA 3L2IA 3A21A 4RCXA 3GKFA 3N9RA 2NV1A 1ZAHA 1QDSA 1ICSA 3GAKA 1LOQA 2Y88A 4HSNA 3T40A 1MSSA 5FEXA 2EAWA 4NU7A 1RPXA 4LS2A 2CLLA 1FX6A 4JY8A 4RV8A 3LHZA 4HNNA 1KM3A 3HO8A 3GDRA 3Q2DA 4MUZA 5DY2A 3SR7A 1MO0A 1L6YA 2OCZA 3C2EA 4N2YA 3TW6A 2QCEA 2BZNA 4R34A 4N6EA 2G96A 4Y8FA 3G1FA 3A24A 4GRSA 5CZJA 4O18A 4UXDA 3GYEA 3W23A 4UFMA 4Y90A 2BSLA 2A5HA 2CLFA 4AVFA 3MJYA 1SO4A 4AF0A 3IEBA 2B7PA 2V5BA 3O6CA 4X2RA 1OYAA 3BPWA 3DZ1A 2ZRYA 1O94A 1OX6A 1HO4A 2QJIA 3EWBX 5FF2A 5T26A 4XKYB 3S9YA 4LC6A 3E9AA 4GC4A 3NPXA 1QO2A 4UR8A 4IMGA 1W5QA 2NUXA 3I68A 4WY0B 4O17A 3S8HA 3B05A 2G5WA 2A2IA 4O12A 3VE7A 4ADSA 1QCWA 3SGZA 5BMWA 3LI1A 3MW7A 5CZ0A 2Y61A 1G4PA 1Z44A 1JVNA 5K9XA 2QCDB 3UPBA 4UFLA 2V2DA 3P81A 3M41A 3UZJA 1NFBA 5FEZA 3O1NA 3PBWA 1ZCOA 3FIGA 5D37A 4CQ8A 1TMHA 4UC5A 3PWAA 4WUIA 4MYAA 3TV8A 1H62A 3GKAA 4EIVA 1H1YA 5G4WA 2BLEA 4IUOA 4HNVA 3N3MA 3NL6A 1QAPA 1OFQA 2BXVA 4IMDA 3G1HA 3EX1A 4WQ6A 1L6SA 1VCFA 4QM1A 4TMBA 1KM4A 3HB9A 3C8FA 5G1YA 4FNSA 3MI2A 1LOSA 4CNOA 1ZFJA 2ZTJA 2DZWA 1KM1A 3EXRA 2IQTA 4LW7A 1G67A 3QSRA 4O1AA 4ONVA 1W5MA 2YCEA 3W88A 5AC7A 1JR1A 3NL5A 5I3KA 1WYIA 4XKYA 3TSMA 3O16A 2VKZG 1GVQA 2J27A 3LRMA 3FS2A 4ADTA 1K8YA 3N73A 4N6FA 2PE4A 4WY0A 3TAKA 2OT0A 2H8XA 1QMLA 2NX1A 3NR0A 5DCBA 2NV2A 2HTMA 5DELA 2CZDA 3LBCA 1TV8A 5F2LA 5GVJA 5E0KA 3MP3A 2A7NA 5TBOA 2YW3A 4RX0A 2QCDA 3G1VA 3GAYA 2YSWA 1SW0A 4TIMA 4UUIA 1XM3A 5H91A 3S42A 4JTGA 4OE7A 1KM6A 2FPTA 3E02A 3W1MA 2G97A 4IXHA 1T8XA 1TPC1 2A0NA 3FKKA 4ICNA 4Z1CA 4DF1A 4JY9A 3L66A 3G8RA 1VLIA 4UR7A 3WK3A 2WKJA 3I7SA 3PY2A 2DP3A 3BLFA 4O19A 4AWUA 2O7SA 3VNDA 1LDCA 5IM51 4S2CA 3W2JA 2X1UA 3LOTA 3HMJG 1W54A 4FXRA 1QPOA 4UTKA 2P0OA 5FESA 4MY8A 1QFEA 4LVGA 3S1VA 3EX2A 4AB4A 2GVJA 3TQKA 1I8JA 5KSWA 1ZENA 2CLOA 3QW4B 5D04C 1R2SA 1YLVA 4K8EA 3NG3A 2NLIA 1D3HA 1W37A 3QW3A 3UD6A 1SSGA 1OX4B 1IGSA 2ZRUA 3E49A 3STCA 1WBHA 1V5XA 4AAJA 5AYZA 1JUBA 2FJKA 5K4XA 3F1QA 3R89A 5CGQA 3LTYA 1SUXA 2ZRVA 4MZ8A 3HPZA 1GVOA 3W7HA 2C16A 4ZQMA 4N9EA 1HG3A 4LUJA 2B7OA 4LRTA 4OT7A 2E6DA 1CI1A 3NPUA 1DORA 4JN6A 4DELA 4OHQA 3O6DA 2WOQA 1GOXA 3UYCA 2CU0A 1ZAJA 5G1TA 5TQLA 3PULA 4YXGA 3GXTA 5LHFA 2BX7A 3BGJA 2W0UA 4NNBA 3C0JA 3HGRA 2C13A 4UTUA 4IPJA 3ATZA 3IVTA 4LV4A 3BV4A 3A23A 4MJMA 5HINA 1XI3A 1P1XA 2J6XA 1F6PA 1ZJIA 2C15A 2QUUA 3SSJA 4UTWC 2J9YA 5LHEA 4GNJA 1B9BA 2Y7DA 5C5YA 4OV9A 2CZEA 1XC4A 3OIXA 4BR1A 1YADA 3BW4A 3MHUA 4BI5A 4RR4A 3P74A 1WBJA 4K7VA 1BEUA 3N34A 4ORIA 3TNOA 4N9BA 1PL9A 2ZRZA 3WJXA 3UXDA 1SR9A 5K2ZA 3EWZA 3HOJA 2DORA 5D05A 2WSQA 1LYXA 5HR7A 3L65A 4TU1A 3QQ1A 3HG5A 1K7XA 1TSIA 3WJWA 1HUVA 3W1NA 1YXCA 4AH7A 1OK4A 1EB3A 2CLHA 3TW7A 1C9DA 2CWNA 3TR2A 1QOQA 2J88A 3QQ0A 4JEQA 4IWWA 2GUUA 1VCGA 4NX5A 3LDVA 2HS6A 3S5OA 3FKRA 1GPWA 5CPLA 1JJKA 3W7KA 3B4UA 2G95A 4AXKA 2Y62A 1CW2A 5K7JA 3GDMA 3LTSA 3U8GA 3CB8A 4XWUA 3EX3A 4NJIA 1K7FA 4FF7A 3DHDA 3Q94A 2YGYA 1R30A 3G0UA 1XCFA 1KBJA 5LZLA 2BWGA 3LHTA 1OYBA 1TV7A 3CTLA 2YDAA 4LVBA 2YXGA 5LNVA 1LOLA 4E2DA 2ZRWA 1D9EA 3QFEA 4E38A 4M5PA 1S5WA 4UTTA 5C54A 1KM5A 4MVAA 1SO6A 4LOCA 3W1UA 1OF8A 4IXXA 2ZCGA 5CG7A 4XZ9A 2F84A 1AW5A 3KRUA 2RHGA 3P60A 2C19A 3R8RA 4EVZA 4PH6A 3HGOA 1DQWA 3LHWA 3W84A 3SGUA 1FWRA 2GOUA 1LZOA 3PF3A 3M5YA 2B7NA 2V30A 4JYEA 1V7YA 2YR1A 1EWDA 4DPQA 4ML9A 1MXSA 5BMXA 2E5BA 2Y89A 3NM1A 3HQ1A 1H7OA 3UQNA 1RZMA 4XQ6A 3USBA 5I3GA 2QCFA 2DZSA 1DHPA 1OFAA 2A7RA 4JTIA 4UTIA 3W2NA 3MO7A 4QISA 3ZFHA 4JTTA 1IXPA 1OF6A 5BOOA 2ISSA 2GQAA 2CLMA 3IGUA 3GR7A 1TREA 4OBTA 3P61A 3UNDA 1GWJA 3PBUA 2ZYFA 4CNPA 1ZHAA 3D0CA 1JCJA 1O4UA 3OG3A 2VEPA 3DFNA 1I45A 2P10A 2ISVA 3EWXA 3W1LA 1P0NA 3GVGA 5G2HA 3IV3A 1PS9A 3H54A 3S1WA 1EUAA 3WJYA 2E5CA 1H7XA 1L9WA 4G1KA 1SW3A 3EX4A 3DI1A 5DN1A 1A53A 1AMKA 3N14A 3MI3A 1W0MA 1PV8A 3L67A 3W87A 2ZA2A 1KFJA 1VHNA 3LCXA 1KTBA 1SU5A 1R2TA 1PHQA 4NXSA 3T4CA 4UNLA 4NXKA 4FX8A 5EA9A 4ORMA 2TYSA 4Y96A 3IIXA 4DO5A 2OX1A 5BNKA 5K9DA 4GE8A 4M7TA 1O60A 1YTEA 3N2XA 3Q37A 3PUDA 4O28A 2W6RA 1DJNA 2YZRA 1PIIA 4O52A 5AC8A 1W5PA 3LLFA 3NO5A 5D03A 2JGQA 4O11A 1F73A 2Y7EA 2ZRXA 4ZQCA 3FYOA 4U28A 1FDJA 2ABAA 3FOKA 1BKSA 4DXVA 5AB3A 4A2RA 4NX0A 5LGXA 4K37A 1OFBA 3LBMA 2AAMA 2EGZA 1RQBA 2QUTA 5C6MA 1K3UA 1A5CA 2TSYA 2QCNA 4AWTA 5FF7A 4DBEA 1SQ7A 3UWVA 1HO1A 3MI6A 5I3JA 1R47A 2ZZ1A 4JR5A 2TMDA 3PB2A 4W9TA 1K8ZA 4RJEA 2VFDA 5D30A 2Z1BA 3P82A 2ZZ7A 4IX2A 1W3IA 1TTIA 4LUIA 4UMAA 3DAQA 1S3HA 2Y70A 5E93A 3H53A 3I65A 4Z0JA 4JD4A 1FWNA 2JK2A 4ZQPA 5DLCA 3SIZA 3UPWA 2ZZ3A 2Y7GA 3SJ3A 4GUGA 4AMAA 4JXCA 4DQWA 3THAA 2HSAA 3NXFA 1R46A 1OFEA 4M6QA 3W7PA 3C4UA 4DEFA 3W7OA 1SPQA 3RF9A 3GLCA 3VFLA 5DXYA 5J5DA 3G3DA 3JR2A 4MZYA 1KM2A 1AK5A 1YTDA 3QPYA 3CEUA 4GUHA 1TRDA 5CPOA 1F05A 3BK0A 4I9AA 5AC6A 4KKXA 4HN4A 3OBKA 2JKAA 3TXZA 4O4WA 1AW1A 4QITA 5G2WA 3TQVA 4FX7A 5K9CA 1JCNA 3NL2A 2NZLA 4IOTA 3G22A 4UCGA 1QPQA 1XDLA 3I6RA 1EP1A 1RD5A 1NF0A 2ZTKA 3QM3A 1GVSA 2V2CA 4CQ9A 1LRNA 1F5ZA 4MZ1A 3NQ2A 2Z6IA 5D2WA 5U7SA 4J9JA 3DFOA 1W3NA 1SO3A 5D2XA 3W1TA 1H7RA 2PRHA 1YTKA 5EL1A 1EA0A 1ICPA 1YPIA 3GIYA 2JGYA 2X1RA 1ML1A 1KFLA 3LCWA 3RK8A 1DQXA 1THFD 1HTIA 3M47A 4EF8A 4RXFA 3LXBA 5F4SA 3I7RA 1FWTA 1K03A 4IPIA 3LTPA 2A21A 4JTSA 3STGA 2VFIA 1MEWA 4RZ4A 2HMCA 2QCMA 3W73A 2QKFA 4ZQNA 4POCA 2VEMA 3CU2A 3W71A 3W7EA 4TO8A 1OFRA 2XN1A 3G1XA 2E6AA 5C2XA 2J9ZA 3M5VA 1Y0EA 4Q33A 3V1PA 2C0AA 1KFCA 5D32A 4LV9A 3A5VA 3DXIA 1NAL1 4XTDA 2J9XA 1GQNA 3A5FA 2Y6ZA 3RU6A 2R8WA 3HBLA 1UB3A 2VFGA 4N4PA 3TMQA 3P5YA 5HULA 1WOAA 3JRKA 1LLZA 1FCUA 4P61A 4JTUA 3G1YA 4Z1BA 2P1FA 2C1HA 3W74A 1TO3A 4JYFA 3JS3A 4ZQRA 3C56A 3LI0A 4FIRA 3FJ6A 3LHVA 3YPIA 1XBZA 3BW2A 1X8FA 5D33A 1C8VA 1B57A 4JNMA 3WJSA 1YXDA 2E1DA 2V0TA 3IIVA 4EF9A 1SZGA 4S2BA 2C3ZA 1XBVA 3MP5A 4HHPA 4ZL1A 4A2SA 1AL8A 4O1CA 4FNUA 2Y63A 4M19A 3E12A 2H3BA 4Z1AA 1YDVA 3C3NA 3IGSA 3O63A 1LRQA 4JTLA 4UMCA 5CSSA 1VYRA 3UWQA 4M6VA 5D2YA 2EKCA 3ZWTA 3LCGA 2O7QA 3SECA 1KFKA 4MIMA
chains in the Genus database with same CATH superfamily
4QAIA 4EPDC 1P43A 3CQHA 4YLWA 3PFRA 3P93A 2D0HA 5AVNA 1GTEA 2BOEX 2D0GA 4I8YA 4CU7A 1JCMP 1S2AA 4CLMA 1Y5VA 2WJZA 3B03A 1KBKA 3VXGA 3V75A 2CIPA 1XIDA 3WLKX 1UMLA 3M43A 1BQGA 1G7VA 3KFTA 4YCOA 3P0WA 1CLKA 1W1ZA 2I9EA 5F2IA 4IQEA 2D20A 1ELSA 2HXTA 1K7EA 1WKYA 3MKKA 2A6LA 3GDLA 1XCXA 2DW6A 1D8CA 1QPNA 2YL8A 3D3AA 5EKYA 5EMLA 1FDYA 3LPFA 4I5RA 3RJYA 1SZFA 2FDSA 5MKGB 1E4MM 3K13A 1B9ZA 4NJKA 1BF2A 1GJWA 1HQTA 2RGMA 4WJEA 3PTKA 4LS0A 4NYYA 1HT6A 1AUSL 5LNSA 1TV5A 4LPCA 4Q4QA 1WNOA 2I5IA 1VB9A 4BFAA 4GWEA 3QGAC 1KCXA 1I2RA 1YIXA 2Y8VA 1Q6EA 2F9RA 1KXVA 1R2RA 3HIJA 4RDYA 2X30A 4AD1A 3AU2A 3POCA 4ES4A 1GZ1A 2WQPA 3T42A 1X7FA 2YOCA 2YA0A 1TQJA 2OT1A 4PCSA 1SM9A 2V9DA 1KXQA 2NX9A 2OO0A 1DWIM 4J40A 1VFHA 1ITUA 1W2VA 1D2KA 1IIGA 1O95A 5PTDA 5AHNA 4IIBA 3M0HA 5A6AA 1DJZA 4AZIA 1XYZA 5MKGA 3RPMA 3TU9A 1J6OA 4P5UA 2VZVA 1XUZA 4C6JA 3UZZA 2RUSA 3CHCA 4U5IA 1OYCA 5BU9A 4EPBC 1BYBA 5D2TA 2GGJA 3MMTA 5CPTA 4D8ZA 3GY1A 3W1QA 3NQ8A 3C2OA 3SCOA 1DJQA 1W8SA 3WF3A 1HKWA 4Q4SA 1JCLA 3UWYA 3S6OA 2E68A 2ICSA 1G69A 1G01A 3A64A 3TYEA 4JDBA 4OWGA 1CXFA 2DZUA 2EG7A 1FOBA 5EMJA 3TTYA 1FUYA 4HGXA 3MBDA 3OODA 3W7MA 4JIPA 2AMGA 3H12A 1SVDA 1NWRA 1XLGA 3R0KA 1YNYA 4E2OA 1VQTA 2XVLA 1PEZA 5AY7A 4IPLA 1EXPA 4KEUA 3ZT6A 4F9JA 3K8KA 2RGLA 4RE4A 4NI3A 3WD2A 2WBGA 4IIFA 1LQ2A 5CLTA 1PO9A 3PJXA 3KL3A 1K77A 3H7RA 2REQB 4L4OA 2I14A 4GBDA 1SO5A 4BHYA 4S3BA 1WKEA 3K8LA 3LN3A 2PTZA 1REQB 5HQLA 2DZTA 5CC6A 4MJ2A 3N4FA 4WX2A 5DMNA 2PRMA 3CNYA 2XHYA 3GC4A 1U22A 3GZ3A 5DQPA 3WLMA 1QATA 4AZGA 1W3TA 4EWJA 3W4RA 2XINA 3O06A 1Q5MA 5KZMA 3DGRA 1LBFA 4GY0A 4MNMA 5K4ZA 4I7VA 3MKCA 1XR2A 4QG9A 3PG9A 3TMLA 1QNPA 4O10A 2FTPA 3W7IA 5C55A 1NOWA 4IMEA 4W8AA 3T81A 1IXOA 1TIWA 5A69A 4YTUA 3UYIA 4H2CA 2HRWA 3NZQA 4GXPA 4BI6A 1FTXA 2FHCA 4QQ3A 1Z9AA 3A13A 3BMVA 3H6OA 3WF0A 5G1MA 3CPRA 4AHOA 2REQA 2NX3A 2C8NA 2ZUVA 3JZUA 7REQB 4H9XA 3O9NA 2QR6A 3WIJA 4LC8A 2YYTA 1JPDX 5FEWA 3CHVA 4IL2A 3EB2A 2WQDA 3LHUA 3VIHA 3VC6A 4YTTA 1RP8A 5A6BA 1REQA 3NQDA 3R1ZA 3BLEA 4H6KA 3EYPA 4BQ2A 3GW0A 3VKKA 5LA2A 1VEPA 3DN5A 4KIEA 3TNBA 3BGAA 4MB1A 1ME7A 1ZJHA 4QAWA 3VPLA 1L2UA 1NH6A 1KKOA 4GVFA 4AWEA 5A8OA 4R7WA 2Z25A 2VEGA 1VKFA 1Q8JA 1RH9A 1J9YA 4HZ6A 1S5VA 2FZ8A 4BI7A 1JNEA 1PJ9A 2HBXA 3BVJA 1R9ZA 5A8GA 3BW3A 1XSKA 4OV4A 4F40A 1B90A 1FCBA 4AMCA 2OXNA 2A3HA 2GL5A 2IQ0A 2XFWA 1VLWA 4GKTA 1R86A 1Y65A 2JFEX 3QR1A 1M41A 2FVMA 3UWWA 1GJPA 4M6PA 1VFMA 1V6VA 2VCCA 4QLKA 5IBXA 2J7GA 3GHSA 3W3OA 3AUJA 7REQA 3FJLA 4DF0A 4TVCA 1X6UA 4H00A 1RA0A 1VBRA 5CZSA 4GI6A 2WVUA 2AQWA 1H50A 2Y7FA 3IJQA 1DWFM 3W81A 1Z32X 1S5MA 4JKMA 2BBFA 4GY7A 1H63A 3DC8A 3WBEA 1AD1A 1GW1A 3R0UA 3TTEA 1TPWA 1S1PA 4EE9A 1SR0A 1FCQA 1KV8A 1PCKA 3C61A 1VH7A 4QDMA 1EDTA 3H24A 1RY8A 2E09A 2ISFA 3PJUA 3SIMA 2WWDA 2CBVA 2E8ZA 4TTGA 3MYOA 1D3GA 4HYVA 5C2CA 4HPJA 3RMJA 1GNXA 3HURA 3IJ9A 2CFFA 1N8FA 1NDVA 5GJMA 4P8XA 1H7NA 4CU8A 1WZLA 2LLEA 3W82A 5C70A 4TX8A 2FGLA 1UYQA 3WF4A 1HJVA 1ONRA 4XSLA 4CN4A 5FSEC 2E6FA 3DYMA 4QCEA 5FF3A 2DT3A 5I2UA 2DV0A 3RILA 3BDKA 4PL2A 4E0CA 5CG0A 1LT7A 3WH6A 3WLTA 4WZHA 3TYDA 4J4KA 1TYGA 3R10A 4PUEA 1NQ6A 1TR1A 3MSYA 1YYAA 3DC0A 3N12A 1FWSA 1MFVA 1HJUA 1W32A 1I2NA 4K39A 1UR8A 1VFFA 4R85A 1R5YA 4QDWA 1M6JA 3M46A 1A50A 2FB3A 1VFLA 3W86A 2YFNA 1FWIC 2CITA 2PDFA 4HVXA 1EF3A 2YW4A 2EJ1A 3OEXA 3UWEA 4JTHA 3PSVA 3ITLA 3SRFA 2BVTA 5EMYA 4KW2A 5M1TA 1WV2A 1TPEA 2YCLB 3NZRA 1HF6A 5G5IA 3DH7A 4AD0A 1TIMA 4NQ1A 2DIJA 2W63A 4NNAA 2GZXA 3WD3A 4D6GA 3G24A 2O0TA 4QSFA 1TA3B 5A8PA 2FZNA 3KOFA 2WVSA 3R13A 3ICJA 2WK2A 5U4NA 3RX4A 3EOSA 4BWLC 4WDWA 5HWNA 3PUGA 2EXOA 1LLOA 2WSYA 4B4HA 1RUSA 1BSIA 1RR2A 4QBXA 1OFOA 2E5DA 3EOOA 4WGXA 3NYDA 4HZ8A 3UR2A 3W72A 3VMNA 2QMKA 2WHLA 4A22A 4S3GA 4GUJA 4DBDA 3OZPA 3QV7A 3U3HA 2ZADA 1F4AA 1B31A 2G3MA 4H6QA 3CWOX 3R12A 3GE7A 1BYCA 3CZ8A 3GX9A 1AG1O 2YCLA 3E96A 2OQHA 1NF7A 1GJUA 1GTHA 1ALDA 4UFHA 3UY8A 4D8LA 3SI9A 4U10A 3URNA 4U4MA 4ZOBA 3OIHA 2RH9A 2NSXA 4J2MA 3IIZA 5LNUA 4IP4A 2XISA 1I4NA 2UY2A 1H61A 3V3WA 1ZB5A 1EC9A 3CM4A 2TPSA 1ICQA 1Q13A 2PDJA 1N82A 1I0DA 3TROA 1DJIA 3PFMA 3CUXA 3SCUA 3RITA 1XIBA 3EKLA 1JRBA 3W37A 4W5UA 4AG0A 2VT0A 3K4WA 1XRVA 4PTNA 3VGFA 1E15A 3RXZA 1VIZA 4LALA 5D8WA 4L9YA 1EPXA 1TJPA 4LAMA 1CYGA 3WFZA 2YYUA 4LTSA 3NQCA 5CAHA 3U48A 3STEA 3WNKA 2OLHA 4DUXA 2B7QA 4GIRA 2X05A 1VYSX 4ZZ9A 4K68A 1W9PA 2R91A 2ISDA 1ITXA 4I90A 3U7VA 1XDMA 3Q65A 2ASHA 3P8IA 3KVKA 4GZJA 4JTQA 1M7PA 3DBPA 4EOUA 1ZJBA 4GYPC 1WZMA 4LXFA 1Q6QA 2BXZA 4QFUA 1UW9A 3WBYA 5CSYA 4PUJA 1G4EA 3W1RA 4UMBA 3UZXA 2EQDA 4Q8UA 4Z2JA 4GQRA 3WEZA 1R7AA 1TVNA 3M1ZA 2NT1A 2E9LA 4X61A 1V79A 2C1IA 3BCJA 5D9OA 2Z1WA 1KWGA 3SCVA 3BWWA 3THDA 2PLMA 3LRLA 4V28A 3O15A 3FA3A 2PMQA 1EJ7L 4JTKA 4W7WA 1MEHA 4JPGA 3L4XA 5D38A 4EAMA 1XLMA 4OOUA 1ITQA 2A85A 3S46A 3WLQA 2JKEA 1J18A 4TR9A 4JQAA 4UB9A 5ENLA 1Q8AA 2OJPA 4DYKA 2XFRA 3EMCA 1B1YA 3A9IA 1DJWA 2VX6A 3CAVA 3W2KA 1GGOA 4QSHA 4M51A 4OTKA 3S5NA 2VRJA 1R7OA 1W9UA 2W3ZA 2WZMA 4O14A 5FAGA 1V77A 4LVFA 1ESWA 4XAGA 2Z0IA 4AFYA 2ATSA 3EAUA 3MBFA 6TAAA 4RW5A 2NXGA 4PYSA 1SZNA 3OO2A 2J7HA 3K1DA 6CGTA 3C2VA 1Q6GA 3PBYA 1V3LA 2E40A 4BJHA 3UXKA 1LBLA 3B9NA 4Q8QA 2GLKA 1BWLA 2V6AA 1VC4A 3R4IA 1NSJA 1RQEA 3VZYA 1G5AA 3H2OA 2BV9A 3EEZA 2RDTA 4HMNA 2GGEA 4MB4A 1WZKA 1J0ZA 1IEIA 3LERA 3MDWA 2VENA 5EFFA 1CNVA 3OJGA 3S2JA 1JCYA 2EG8A 3GG7A 1QUMA 3TFCA 2Y8KA 1FWHC 1MQQA 1XX1A 3FY1A 3CBWA 4K38A 3SCQA 1XICA 4OFCA 5FJUA 2PDWA 4GA8A 3W9ZA 1CXLA 2G4FA 5ABEA 3LXCA 3ZR4A 1US0A 1M7OA 1WXJA 1HKMA 1TPB1 4FHAA 1P1MA 3D6NA 1GUVA 1XLBA 3KZSA 3VCRA 4XZNX 2VEIA 3NQAA 4J28A 3EWUA 4P7OA 2PURA 3LA4A 2V81A 4PUKA 3G77A 3MUXA 3UESA 4MNKA 2IPJA 1OVDA 3SEPA 5HA7A 5F1UA 3RLGA 2WZTA 3W29A 3SQLA 4CQAA 4IQJA 1KRMA 1QRQA 4JTJA 2V68A 3WX7A 1SFJA 3VDAA 1RQHA 4XB3A 3TKFA 4S1FA 3TE9A 5F2GA 1NARA 1RVGA 3RLVA 4CVWA 3DUGA 4MNLA 4J3WA 2PB1A 3VMOA 3IUHA 5RUBA 4M8UA 2CCRA 1F2JA 4DF2A 3M6YA 1X97A 4GH3A 4E6MA 1H0GA 3O0KA 4C6FA 8CGTA 1UWTA 1KBBA 3W7LA 3A3XA 1WE5A 1TZ9A 1CWYA 1YQ2A 5ECVA 1W17A 3QKEA 3KEHA 4JTRA 3KRZA 3QTGA 4V15A 4Q4RA 4MADA 3VOJA 3PBVA 4CNUA 3TQ0A 3LCLA 4RCXA 4AEFA 1UD5A 1YRRA 3QHMA 3CUGA 2EEXA 4C6BA 4EXBA 4HU8A 1ICSA 3VX0A 3T40A 2ZICA 2R1NA 2XPKA 3ZSSA 2VX4A 2PDIA 1UOKA 1J10A 2CLLA 2HVNA 3TTOA 4F0RA 3WQFA 4JOMA 3UXIA 2WAGA 3GDRA 1TX2A 3SR7A 1VF8A 3VGGA 2BZNA 1VPYA 4R34A 4E4FA 4Y8FA 3G1FA 3A24A 4FA3A 2PLKA 3W23A 4AZ6A 1UP3A 4C1NA 3VILA 4NHVA 2G37A 2V5BA 2W9MA 3DZ1A 2XM2A 3CT2A 1O94A 1OX6A 3A4AA 3IV8A 4GVIA 1UR3M 4E5TA 1H3GA 2C91A 1EGZA 4XKYB 3S9YA 3W6LA 2WCAA 4LC6A 3OPSA 1UD2A 3S2NA 3NDZA 2DFAA 1I60A 3ARWA 4ZOCA 3I68A 4WY0B 4HBKA 3GH5A 3GTNA 1BKHA 3VOGA 2DPEA 3TWAA 3SGZA 4DJED 3HV8A 3MW7A 2Y61A 1NDYA 4AISA 3ZVHB 4G1NA 2QCDB 1A80A 2BHZA 5TF0A 3E2SA 4GZIA 2DSVA 4MGGA 2GFTA 3UZJA 3PHAA 4GIYA 4FXFA 3SBFA 1O6IA 5D37A 2G4JA 1EPVA 4CQ8A 2VGFA 4MYAA 3WMLA 1K9FA 1TWZA 1DE5A 1H1YA 2C1GA 2E67A 1QAPA 1S46A 4WQ6A 1QW9A 1VCFA 4QM1A 5ABGA 1GVEA 1LOSA 2Y1HA 1ZFJA 2ZTJA 4S3JA 1KM1A 5JMUA 3QSRA 4O1AA 3HN3A 1AODA 1W5MA 3IJIA 1W1PA 1AA1B 1V6WA 1BFNA 2UWFA 3QV6A 5I3KA 2PEVA 1WYIA 5AC7A 2Z4GA 4XKYA 3TN3A 3O16A 1JZ5A 3TZFA 2QNEA 4WDTA 4A3YA 1RJQA 3ARVA 3N73A 2QULA 4WY0A 3TAKA 5HATA 1A4LA 4QTGA 4F3HA 3NR0A 5DCBA 4ZTYA 2NV2A 2HTMA 5DELA 1TV8A 2IQDA 3E5BA 5E0KA 3MP3A 2A7NA 5TBOA 3ZVHA 1UH4A 3MVTA 4RX0A 2QCDA 3GAYA 2YSWA 1GPFA 3S42A 4HN8A 2FPTA 3W1MA 4GD0A 2G97A 2A0NA 5TAOA 4Y9NA 1DWJM 1L0PA 4CN1A 1VLIA 3K5XA 3BLFA 5HXMA 3KOZA 2P3EA 4LCRA 5IM51 3L7RA 4FR6A 3W2JA 4OZOA 4BQ3A 4FXRA 1DWAM 4UTKA 1TV2A 2PA6A 4CEUC 4MY8A 4LVGA 4K2SA 1XLDA 1JIBA 2X7WA 2VTFA 4AB4A 1I8JA 1X38A 4GPNA 5KSWA 4ZFCA 1XRTA 1R2SA 3CAQA 1QI0A 1YLVA 4K8EA 5H6HA 1BVZA 3FV9A 4ENLA 4LB3A 3ARQA 2JE8A 1D3HA 1W37A 1SSGA 1OX4B 3AMLA 1MZRA 2ZRUA 3E49A 5BXPA 1VAHA 2X2YA 3UCDA 1OB0A 4AAJA 2CKSA 1JUBA 2FJKA 3GH4A 4XK2A 1SUXA 1OWQA 4JN7A 1GVOA 3ALGA 4N9EA 3RRXA 2OWWA 1UD3A 3CK5A 2B7OA 4U3CA 4OT7A 1V51A 1FWDC 5HPCA 3AJ7A 4DJFA 1UA7A 4CD7A 2P50A 3AHZA 2WOQA 4BF5A 3UVAA 4HU0A 5TQLA 3BGJA 1UJQA 2MUCA 2PDMA 5A6MA 4H7VA 2EBNA 4UTUA 2BFGA 1PB0A 5XIMA 3ATZA 3MY9A 1LF1A 3A23A 1PDZA 2YL6A 1P1XA 1F6PA 2XWDA 4IJRA 4GNJA 2CHOA 2Y7DA 5C5YA 1U30A 1EJXC 2CZEA 4BR1A 3BW4A 3MHUA 2DH2A 2KX9A 3P74A 3N34A 2WMIB 1DEDA 1PDYA 4B9ZA 3WJXA 3UXDA 1MWOA 1E4LA 2PGEA 5GNXA 2GWGA 1S2UA 2NV9A 4Z2LA 2YA2A 5HR7A 3L65A 4TU1A 3VCNA 4RV3A 5C0QA 3KE0A 2CEQA 1QI4A 4E4PA 4AH7A 4F2BA 1EB3A 2CLHA 3VDCA 2GDQA 3ALFA 1C9DA 3RRAA 2J88A 3QQ0A 2OLAA 4JAWA 4NX5A 3LDVA 3GFXA 3WQ8A 2ZVIA 4QHRA 1ZCCA 4C6QA 3AISA 1IT8A 4DI8A 5K7JA 5XINA 3EDKA 3EX3A 4NJIA 5E6ZA 1ZBVA 3W6MA 3AOFA 1XCFA 2OLSA 1NWUA 3LHTA 4F0HA 1TV7A 2J8TA 3RLHA 4CQBA 3SUSA 4NZ1A 9XIAA 4D1IA 1XIMA 1C7TA 1B30A 4UTTA 2I57A 3WQPA 4MWAB 1SO6A 2ZCGA 4GQ0A 3DG3A 3KRUA 3TYAA 3R8RA 4EVZA 1TELA 3ARUA 1W91A 1KR0A 1DQWA 3L4ZA 3W84A 3AS1A 2F2HA 1LZOA 1V7YA 4AZ7A 3WLJA 3FJNA 1MXSA 1ADDA 4GYKA 4MF4A 2Y89A 4KMQA 2HK0A 4X63A 3HQ1A 1RZMA 1OGSA 5A6JA 2QCFA 2DZSA 3IPWA 3KL5A 3MDUA 1DHPA 1XYLA 2YCKX 3GG8A 2YDRA 4DUVA 2WLYA 1CGYA 4IIDA 4H9TA 2R6OA 4PMZA 3MO7A 1JD7A 4LB4A 4UCFA 2PBGA 1OF6A 3BANA 2ISSA 4PMXA 3ZXWA 1Z6KA 3GR4A 3IGUA 1TREA 4NAEA 3UNDA 1B3ZA 1GWJA 3PBUA 4PFHA 3B9AA 2ZYFA 3NCOA 2R24A 3WD4A 2ISVA 1P0NA 3VA8A 1PS9A 2V69A 3KTSA 5BWFA 2E5CA 1H7XA 4GJJA 1PTGA 1XP3A 3MJMA 1SW3A 4MWAA 3DI1A 3URAA 5DN1A 1RAKA 1QU4A 3N14A 1TMLA 3LY0A 1PV8A 2ZA2A 1KFJA 1KTBA 4YVPA 1OSEA 3WN6A 3BLOA 5E0FA 4DM2A 4NXSA 4UNLA 1UC4A 4U2YA 4DO5A 4KETA 1GONA 1QVBA 3Q37A 2YZRA 4XAPA 4O52A 3U0HA 2DVUA 1E1CA 3KUMA 3LLFA 3QY6A 5D03A 2VOTA 3OLIA 1FDJA 2ABAA 4A2RA 3LGGA 4EXQA 4M6UA 1OFBA 4IQDA 4J27A 2QUTA 4M82A 1DQUA 2ZUMA 4PMOA 4CQDA 5I3JA 5T91A 3CQJA 2O4MA 2P88A 4W9TA 2O9PA 2WJFA 2QMJA 3W00A 3AQUA 2FZ9A 4LUIA 4UMAA 3TLLA 4A35A 4XD4A 3DAQA 4ZODA 3I65A 2JK2A 5DLCA 3SIZA 1EJWC 3UPWA 4F2TA 2ZZ3A 3SJ3A 4GUGA 4C6LA 4JXCA 1H11A 3NXFA 1JI1A 4DWSD 3TYZA 2QXWA 4DEFA 3R6IA 2NSOA 4RE0A 4C5ZA 2QF8A 3WUFA 3GLCA 5J5DA 3JR2A 3CZJA 6ENLA 3BSMA 1KM2A 3B40A 4DLMA 2XTKA 4FMVA 4XZIA 3HQNA 5CPOA 2HWGA 1E0XA 1F05A 3E0VA 1F3TA 5AC6A 4IZGA 2OZ3A 4RNHA 5BXTA 5C9XA 1GHSA 4DZHA 1M65A 3J7HA 3G22A 5I3DA 3FSTA 3K1GA 4UCGA 1XDLA 3B0XA 4EPEC 5HDRA 4XG1A 2FKPA 4GC3A 4FLSA 3BV7A 4HJWA 2ANUA 3VVGA 3FEQA 1UR1A 1W1YA 3NQ2A 2OSWA 1E73M 5U7SA 2OEMA 4DXKA 2IKGA 1UWRA 3W1TA 3FN9A 2BASA 3M7SA 2PRHA 1YTKA 3RGTA 1DJXA 4O8AA 2X1RA 4LBSA 2V3GA 5E70A 2DY3A 1DQXA 1THFD 4OVXA 2OGJA 3SCTA 3M47A 2A3AA 2ZC8A 3DG6A 2FZBA 4ZB5A 3I7RA 4IPIA 3STGA 1QI3A 1WDRA 4E8DA 2VFIA 2QCMA 4POCA 2VEMA 1QI5A 3CU2A 3W7EA 5H8PA 3OP2A 3TCSA 2PF0A 3EMQA 4YTQA 5A6TC 1TV3A 1NDWA 1XLIA 2C0AA 5BOEA 3DXIA 3H23A 2QJNA 3DBNA 2OWCA 4MJ4A 1EJUC 4XTDA 5KZ6A 5D9NA 2VGBA 4IL0A 1C7SA 3HBLA 4MAVA 1UB3A 5DEZA 3P5YA 1P6CA 3JRKA 3T08A 2VUNA 4WJXA 3VNYA 3MT1A 3QC0A 2C1HA 1U1UA 3LYEA 2V3EA 1JDFA 1CCWB 3YPIA 1XBZA 3CPGA 3DECA 4JFWA 1EO7A 1H4PA 2PZ0A 2ZXQA 4K1GA 4JNMA 1TVPA 2E1DA 2V0TA 1YNPA 3CO8A 1UROA 3JW7A 3BQ5A 1Y5XA 4X60A 2OEJA 4ZL1A 4ZSTA 2YB1A 1RA5A 3F5JA 4FNUA 4Z1AA 4R27A 1UD4A 3IGSA 3O63A 1LRQA 3TN5A 4UMCA 4DYEA 2QVNA 5D2YA 4B2DA 1QT1A 1SFTA 2O7QA 3SECA 3ZJ7A 1KFKA 1UCWA 4LUSA 2YL9A 3LB0A 5A6KA 2E9MA 2CW6A 3PPGA 3RDKA 1H51A 4LVDA 1T96A 4C7GA 1EJVC 1I2PA 5H8UA 3HJEA 1C29A 3ABOA 1F07A 1GOWA 4LY8A 3PVFA 2QAFA 3TN4A 3NXLA 3LXAA 4MY9A 3QMSA 1V0KA 5CKSA 3WDPP 1LORA 4FLQA 3GHRA 3V0SA 1XIHA 1FDZA 1Q63A 5KINA 5FJJA 3GU9A 5HAOA 4UWMA 4AVOA 3HZ3A 5LGZA 1ME8A 4QROA 4DJDD 4UFKA 4IGMA 1PHWA 4C6CA 1X39A 3IGXA 1KBIA 4L4LA 3EPOA 5IXEA 1NELA 3CT7A 4A8IA 5CC7A 5DX7A 1AL7A 3LLDA 1FXPA 4JL1A 3BMXA 4LF1A 3UA3A 3K8MA 3QPZA 3QBUA 3NTYA 1FXQA 4D6DA 5AHEA 3D47A 8XIAA 2WMKA 4O50A 1EUNA 5JVLA 4EAYA 1PYMA 4YTRA 2J13A 3G0XA 1KFEA 3AALA 2ADAA 3N11A 3HG2A 1UR4A 1YW1A 2JKPA 3ZM8A 4N9CA 2AQVA 2IS7A 4LUTA 4PTWA 3CV2A 2GUYA 4MY1A 4QS5A 5AOUA 4EKJA 2G3JA 3GG1A 5IDZA 3ISIX 1EZWA 1NP0A 4MKNA 1AVAA 3LGDA 3D5HA 1IEQA 3Q45A 3TTQA 3JZEA 1FHUA 3KHDA 2R14A 2WHKA 5I3HA 3MPGA 4D6EA 3NGJA 3TC3A 2Q71A 3CHEA 2NWRA 2WPBA 4UQDA 4Z08A 2V38A 4TX6A 1TJ0A 4NRSA 3B06A 2X1TA 2INEA 4HYWA 4QDPA 1GQKA 2QDDA 2DZAA 3VNMA 4JFTA 3L5LA 4C1LA 4PB4A 4PL1A 4FXSA 3N6QA 2IW0A 1UUQA 4XBSA 5L6UA 1I0BA 2Z1VA 1M03A 5J5RA 4JICA 4LVAA 3QY7A 2DZBA 1FHDA 1UZ4A 3IGHX 2ZUTA 3PBGA 4JQ3A 3PZIA 4HPNA 3EWDA 3THQA 1CECA 5FIPA 1IQ8A 3SAZA 3RMEA 1OY0A 1O1ZA 3AXXA 1F74A 1EFZA 1I2QA 2JF6A 1RY0A 3HPSA 1BHGA 3U9IA 4HSHA 4FNRA 3H21A 1H1NA 1QR7A 4PCNA 3M16A 4NT0A 2QCLA 1K9TA 1WPCA 1IR1A 2PWVA 3MV11 5AHFA 3GTFA 5BCAA 1FWBC 3G8EA 1FWJC 4GVGA 4J3VA 3P80A 2VZOA 3AFBA 4J7RA 2QQ6A 3GO2A 3BLKA 2PSNA 4D6FA 3R94A 3HQOA 1VJIA 3IACA 3WDJA 2ABBA 3TN6A 3RFAA 3LX9A 5A2BA 4E3TA 4KWOA 2G3IA 1PCWA 1WDSA 2WZEA 1ZBCA 1JDAA 1S5TA 1JEZA 1WZAA 2FYMA 3SN0A 3WYZA 3FYPA 4DIAA 1HP4A 1XPYA 4I5UA 1MXDA 4S23A 3VNZA 2QEZA 2CZFA 2AMXA 3BG9A 3OOQA 4JL2A 3WQEA 4LAUA 1ODUA 3T44A 2E4TA 4XV0A 1DVJA 1KXTA 3B97A 2VC7A 1TZZA 3WMBA 1XYCA 4H8HA 2R1KA 3NL3A 3WK0A 1FWWA 1RHCA 4MUPA 4HNUA 1XH2A 3HPXA 1XSJA 4LQ1A 3IS4A 1A3XA 3GXIA 3F03K 1E6ZA 3O3RA 3GXNA 3ZMRA 3N2MA 2ACQA 1LG1A 1OFPA 1LJYA 1RD6A 4JCMA 5HWMA 3V16A 4HPXA 4WHBA 2EHHA 2QV4A 3NVTA 3KCLA 3UR7A 2VGIA 5DBUA 4IUGA 3WQVA 1FWAC 1BWKA 1U33A 3W6YA 1N8WA 3GU1A 3HTWA 4ZOEA 3ABRA 3KBMA 3NSMA 2ZX9A 4AZHA 1J01A 3K30A 5G4HC 2POZA 3W7DA 3M0KA 3S6DA 2ODOA 3C2FA 2XU2A 5I23A 3FGCA 1JDDA 3WNLA 1WP6A 5DRCA 3EEGA 3B4YA 3NM3A 4NIRA 1SFLA 4PULA 2D3LA 4MFEA 4UQ9A 4YCPA 2VXNA 3VI2A 4ICMA 4WXZA 1EBHA 3B8UA 3BJSA 4UR9A 4TV6A 5CJNA 5CPNA 3EGJA 3W76A 1ISWA 5G2IA 4PUDA 5BWAA 3S2MA 1TWSA 3WF1A 1W3HA 4FSAA 3BARA 5EGRA 4KWVA 3FYYA 3H2AA 5C7VA 4ERIA 3FDKA 2QGHA 5EBUA 2UY5A 4NVTA 1KQZA 3G5EA 5CJ5A 1JCTA 3QR0A 4Z2IA 1QTWA 4Y7EA 4ILSA 4JBRA 4JTEA 2QS8A 4RDVA 3ARYA 3SQSA 5AHIA 3GQYA 2ZZ2A 4IFOA 5CGMA 2E1WA 3Q4DA 2X0HA 4B3LA 2QPXA 2HJPA 2OSYA 5FL1A 4L4MA 2D22A 1K8CA 2WCSA 1PX4A 4OUIA 5I0DA 2F38A 1FQ0A 3AS3A 4PA8A 7ENLA 2L5HA 4GH1A 7TIMA 1V6UA 4X22A 4JS3A 2OZTA 2NW0A 3SUVA 3ABSA 3AMKA 3CQKA 3II1A 3GD6A 2F2KA 1DIDA 3LS9A 3KRBA 4PMYA 3S5SA 2NQJA 2RAGA 2ZBTA 4UQAA 4EANA 3H70A 1NDZA 4DO6A 3DFTA 4ZB0A 1BXNA 4N7QA 2DIEA 1WA3A 1XG3A 1RP9A 3EDEA 5DCDA 2R82A 2CLKA 1TWIA 1IIHA 2CXGA 5AZ0A 2PDPA 4MMWA 3P5ZA 3T2OA 1DL3A 1O1HA 1BWVA 3OGRA 3CMJA 1EQCA 4EP8C 3W1XA 3STFA 4V1YA 3BZJA 1FCVA 1U1HA 5LA0A 4A8LA 3BOLA 1VPXA 1AQMA 4CCDA 3QH2A 3N1AA 4I7WA 2AGTA 1SW7A 4GQBA 4BWLA 3I4KA 3RHGA 5HMSA 1CXKA 3FA5A 4O15A 4TVUA 3VDHA 3THCA 4FPSA 4C6KA 3HGSA 4UOJA 4AHQA 2WV8A 3HGJA 3GNNA 3ERPA 4D6HA 2WO5A 1JUEA 2W67A 2YBTA 3QF0A 1GZGA 1PUDA 5CZKA 3VKJA 2J7FA 3RPDA 3VKDA 3S9ZA 2Z2UA 3ZS4A 3EOLA 1UHVA 2DU2A 4NJJA 5EYWA 4IICA 4H9MA 3PZNA 2QDHA 3NYZA 4P7RA 1T40A 5HUPA 1V8EA 4IMCA 3WDQA 3FHAA 2BY0A 3PZMA 4GI8A 2FPYA 1ZPTA 5LYRA 3AIEA 4GUIA 2H3DA 2Q3RA 4CNNA 3TX9A 1PX8A 2PD9A 3QJAA 1SSDA 1H49A 1TPFA 2PLCA 4LT9A 1DIEA 2X2GA 1LTDA 3M44A 1HL8A 3VD3A 3B0VC 4O8RA 4PCFA 4UTHA 3P8JA 1XYFA 3S1UA 5AVHA 3U5UA 1PPIA 1JPHA 2ALRA 1I1XA 2A7PA 1K4GA 1P4CA 3L21A 3U6WA 1GEQA 3DKLA 4M3PA 4XTIA 4GVHA 5C9WA 2DUZA 3P84A 4HPGA 3IWPA 4GFIA 2BG5A 5TIMA 1UBSA 1E70M 2ZUUA 3I6EA 3QVQA 4W84A 3IJ6A 2HV5A 1DXEA 4CCCA 1OX5A 5A3HA 5DT7A 3WZ0E 2HXUA 5J8LA 3L4UA 4B5NA 4Z2GA 3ZZ1A 3TDFA 5BXRA 6XIMA 4P8UA 5DXXA 3GFZA 5J04A 4PSRA 2ATMA 2DSUA 3A4XA 3SY1A 5FOOA 3WNOA 3TJLA 3T0TA 4GYPA 6ALDA 3E0IA 1LROA 1TTQA 3CHFA 1U83A 3SCRA 2H9AB 1BRLB 2H90A 2FB2A 3BGGA 1UR9A 1WDPA 3ZJ6A 1G6CA 1J79A 3KXQA 1R3QA 1B4EA 4G2DA 2ZDSA 1TPH1 2P76A 3AAMA 3NZGA 1H2JA 4ZB2A 4LWWA 5A2CA 1GVFA 5DBTA 3M0MA 1KGXA 1YDYA 2WC7A 3T0CA 4QEHA 4UIOA 3TA9A 1DIKA 3IK4A 2D23A 4AD5A 3NQFA 4YWSA 2CNCA 1HFBA 3NDOA 5HWJA 5ABHA 3S3GA 2PLJA 3UJSA 3RR1A 2DZVA 4JTAA 3KM8A 4LNCA 4Q4KA 2WXDM 3QKZA 2NQHA 3VC5A 1N55A 5D9PA 4YHEA 3VINA 1ADOA 1VJZA 5M17A 4L6DA 4JX6A 5CPQA 4W7UA 4PMJA 4NI8A 1V6YA 3RR4A 2H9AA 4UZSA 1EKOA 2XIBA 1BRLA 4UFJA 3CYJA 4Y2WA 1B3YA 2WYSA 1PKLA 3MO4A 1J5TA 2QUNA 2X16A 1O66A 1W1TA 4M1RA 3KOYA 2WMJA 1S2CA 2V5JA 3PSWA 2H6RA 1E40A 4FB7A 2FTWA 1T99A 3AMCA 5I02A 2WSKA 5BU6A 4DUWA 1GVYA 3GK0A 3QHNA 4ROPA 4AIEA 1IR2A 4HT3A 4FF5A 3GDKA 3TH6A 2C0HA 4UTTC 4FK9A 1W5OA 1GHRA 4UZUA 4XBJA 2PU1A 1K6AA 4JIIX 4RZ6A 4GXMA 2PDGA 4Y9PA 4I8DA 3ITOA 4KH2A 3PUOA 2OG9A 2D1ZA 1M7XA 3ARRA 5CC5A 3QOKA 3VK5A 1G4SA 2BVWA 3PPFA 3PZ9A 5D09A 2R1LA 1J12A 4DPPA 1WO2A 1FBAA 2ZDRA 2Y24A 3LMZA 4KRZA 4L61A 3AIRA 4TMCA 3EB4A 1AQFA 1OABA 3CEPA 3HJZA 2W79A 4MPQA 5KZDA 3TONA 3N9SA 4NG3A 3G2GA 3TLQA 1Q6FA 5JBDA 4NZ5A 1XIFA 3R2GA 4RK8A 2QJMA 2G50A 3PZVA 4J2PA 2I5GA 5M03A 1FVPA 3W75A 1ZL1A 3SCWA 3QYSA 4Q7BA 4GG9A 3DU0A 3OGVA 1H5YA 4O54A 3APGA 3W7RA 4BZYA 4PUMA 5DMLA 1NQKA 4GXWA 2D2HA 1EYEA 4G9PA 4NJGA 4Q6XA 2PWDA 3ZR6A 3BLIA 1W9VA 4JNZA 3MUY1 1FA2A 2Q01A 1TQXA 3GNOA 4GYFA 4WRHA 1POJA 2Z2BA 4QNWA 3RM9A 3M0YA 3E3HA 3W25A 2XVKA 2ZXBA 3B04A 2QAPA 1JDEA 1NU5A 2BY1A 5LNRA 3VMPA 2O56A 1ISZA 4HZ7A 4FNQA 3E1F1 4JHZA 4PMDA 1GT8A 4W7VA 3BICA 4HKPA 4MYXA 1X1NA 1UPMB 2VVSA 4Q6JA 2TRSA 1D8WA 2IUZA 4L65A 3AXKA 1F76A 4DY1A 2Q6ZA 4NZFA 1NTHA 1XUUA 1B4KA 2RDWA 3F7JA 1LBMA 2ZZ4A 2W27A 5I78A 1NOUA 3OZOA 1XIEA 1W1B1 3CUHA 3GBEA 1QDSA 4JHMA 5KETA 1MSSA 3PK7A 2QGYA 2PUZA 2FHFA 4XD5A 3AWNA 2Y2WA 5EU9A 4JY8A 1ZP4A 2DW7A 1EEXA 1J2BA 4MUZA 3UFYA 1MO0A 3AYVA 2OCZA 2QCEA 4WKAA 2VL4A 4GRSA 5DO8A 3LLXA 5DFAA 3KP0A 2FFIA 4U5KA 4PGLA 4WDUA 1WKDA 4O18A 1VENA 4UXDA 2XFFA 1K9DA 4Y9OA 5LXEA 4ZBCA 2CC0A 4Y90A 1V3MA 2A5HA 1UWUA 2CPUA 3PWIA 2CLFA 4WSKA 3MJYA 2D3NA 3O6CA 3W02A 2ZRYA 3AZTA 3PJWA 3OBEA 1MUMA 3WQ5A 3A3HA 4E8GA 3GM8A 3WUBA 4HNCA 4RDWA 3REQB 4H9UA 2W61A 1RCXB 4IF2A 2J74A 4GC4A 3CH9A 3NPXA 4AY7A 3M0LA 3MSGA 2PDYA 1MW2A 4IMGA 3NJ3A 2J66A 3U4AA 3H2CA 4O17A 3VABA 3S8HA 3B05A 4EK7A 4J3TA 2A2IA 3URBA 4YTSA 4O12A 3VE7A 4PE8A 4ZSUA 2J6VA 3W28A 1WDDA 2PGFA 1WXYA 4H7ZA 5K9XA 1JVNA 1XLCA 1KNWA 3RYSA 3P81A 3M41A 3GXMA 4Q8VA 3O1NA 3N2TA 1LWJA 1DHKA 3PBWA 3QGVA 4UC5A 1HKJA 4IH3A 4WUIA 3TV8A 1IEXA 3U57A 1H62A 3BAKA 2BY3A 5G4WA 4HNVA 2BLEA 3N3MA 1EJTC 3VIFA 1GKQA 3NEHA 2BXVA 3G1HA 4XD3A 4A6GA 4TMBA 3WG6A 3LPPA 2WANA 1G94A 5FAJA 3MI2A 1M53A 1ISVA 1B3VA 3EXRA 3S9IA 1E55A 1G67A 2YCEA 3W88A 3BAWA 1XG4A 4R88A 4V33A 4QE1A 1TR9A 1GVQA 3REQA 3WQDA 1LUCB 4N6FA 2PE4A 2OT0A 4BEQA 1QMLA 9RUBA 2WZIA 4M81A 2PBOA 4ECLA 2FVKA 4URIA 5F2LA 4C65A 3BE7A 3H2MA 3G1VA 1ZUAX 2HVMA 4LBUA 4TIMA 4UUIA 2WM1A 8A3HA 4JTGA 2OX4A 3MUIA 1EOKA 4KCWA 3E02A 1T8XA 3FKKA 4ICNA 4HOWA 4JY9A 3L66A 2YDSA 1UOZA 3H22A 3GW3A 1LL7A 3I7SA 5TNVA 4QG8A 3PY2A 2DP3A 5CJMA 2OQYA 2OYMA 4MKSA 2O7SA 3VNDA 1LDCA 2I17A 4E4UA 3VKCA 4DZAA 1W54A 2XFYA 3R8HA 1QFEA 3GXDA 3S1VA 2GVJA 2CLOA 5D04C 1HVQA 4YIWA 3GZAA 1HVXA 1VP5A 4JTDA 2ZWYA 4WKHA 1R3YA 3AIQA 1KR1A 4HA0A 4B3KA 3BJTA 3UD6A 1BXCA 1GOMA 1F9CA 4AD2A 2GK1B 3STCA 2DIKA 3KDOA 1WBHA 5K4XA 3R89A 4H7CA 3HPZA 1ZTVA 1TE1A 3W7HA 3WNPA 1TVLA 4B15A 1A3HA 3QLLA 1VFUA 1TJ2A 1E6NA 4HK5A 4DELA 3MANA 1UR0A 3B8WA 3W0KA 4XO7A 1GOXA 1ZAJA 5G1TA 2WCGA 3PULA 4GOAA 4FS9A 1RLDA 4H6RA 4YVVA 3GXTA 2BX7A 2W0UA 1U5HA 4NNBA 1IZCA 1SJAA 4FXJA 1KGUA 3UR5A 4AW7A 4AZ5A 1XYAA 5HINA 3SJNA 4IM4A 3TJ4A 1MW1A 4AIOA 3AZSA 4ATLA 5CPSA 2ZX5A 3VKBA 1XC4A 1YADA 4RR4A 3M4HA 1WBJA 2VD9A 1XV8A 4K7VA 5HJXA 1PL9A 3PNZA 2ZRZA 3RU8X 4C91A 3NOYA 5K2ZA 2GK1A 4XZWA 5GQBA 3EDDA 2SFPA 3LU2A 3VNKA 2DORA 5D05A 2WSQA 1LYXA 1IV8A 3S6TA 3BLLA 3F4CA 3HG5A 5I09A 4Q4OA 5BXSA 1LL4A 3WH5A 5JIWA 3TZNA 3UGRA 1VFOA 1QOQA 1UIPA 2EPKX 4HK7A 4JEQA 2BP1A 1A4MA 1TCMA 3S5OA 3WH8A 1SJBA 2FGZA 1GPWA 3DYPA 2G95A 4AXKA 2Y62A 3UG4A 3T0AA 1CW2A 5LIKX 5FJTA 4AYGA 4HOXA 1RCOB 4FAMA 1P48A 3C8NA 3A3WA 3SURA 1GOOA 2VMFA 3ITCA 1QW8A 4FF7A 3OB8A 3Q94A 5HJYA 3G0UA 4N42A 3L4TA 4D1JA 3FA4A 3CTLA 4HTYA 1DXIA 2YDAA 3CL8A 4LVBA 1MYRA 2WBKA 3F2BA 3DG7A 1CXEA 1D9EA 3EBVA 2BOGX 1S5WA 2WKGA 1OQFA 5C54A 4MVAA 4IXXA 5CG7A 1U5VA 3P60A 2EO7A 4LSBA 2GGIA 4LEFA 3LHWA 4NL1A 2PF8A 3KWXA 4L9ZA 5H8MA 1M04A 3M5YA 2B7NA 1AJ2A 3CAWA 2YR1A 9CGTA 4ML9A 2GWNA 1MDRA 3UBPC 1FKWA 3ME3A 2PI6A 4PRTA 2E5BA 3NM1A 4D9PA 5CC3A 4M56A 2BODX 1JXJA 4XQ6A 1BTCA 3F5KA 3DYOA 3HA1A 3WSUA 2OKOA 1OFAA 4W93A 1XGEA 2A7RA 4UTIA 2X7VA 1P0DA 3KBVA 3S83A 2OYKA 1HN1A 2FZDA 5BOOA 2J77A 1XDJA 2CHRA 4OBTA 1ZU8A 4CNPA 3D0CA 4K3ZA 1ISXA 1O4UA 2VEPA 3DFNA 4UOQA 4Q8PA 3IV3A 3H54A 4IT1A 3WJYA 4WSHA 1IEVA 5CBBA 4G1KA 1MRAA 2GVYA 3EX4A 3PNUA 1P7TB 1A53A 3GU2A 1AMKA 4BQ4A 4C7DA 1RJRA 3PZUA 1SGJA 1ZSXA 3L67A 3MV01 3W87A 1RPKA 4GCAA 1EOMA 2PPGA 4LUYA 1V6XA 3GUWA 5DMYA 2TYSA 1FFRA 4Y96A 2ESCA 2ZIDA 5BNKA 4ZGYA 4GE8A 2Z28A 1UC5A 3E0WA 1YTEA 3N2XA 5HQMA 1Q2SA 3PUDA 2WVTA 3WBXA 2PWGA 4AC1X 4QR6A 3N29A 4O11A 3I3DA 3KBJA 1J0JA 4U28A 4RE3A 4ZXOA 3FOKA 3W24A 3WF2A 1BKSA 5DT5A 3N6JA 5E5CA 5LGXA 1F8IA 2AAMA 3LBMA 5B80A 5C6MA 3VD9A 2B81A 3CXOA 2PAJA 2TSYA 1FWFC 4TOQA 2QCNA 4O1EA 4B5WA 2YBVA 4AWTA 4DBEA 2GOKA 1SQ7A 3UWVA 1PXGA 1GKPA 1A5MC 3MMUA 3PB2A 1XIJA 1MW0A 4RJEA 5D30A 1TTIA 3M64A 1EZ2A 5ABFB 1S3HA 5E93A 2VURA 3PJTA 3ZT5A 2Y7GA 3BAIA 3WH7A 4DQWA 3T2PA 1XGDA 2XIMA 5CGTA 1OFEA 3W7PA 2XH4A 4GLEA 3E6EA 3C4UA 1EGMA 3V0TA 2ZUNA 2BGSA 3QLDA 2QVHA 1V7AA 3RF9A 3T09A 3EOEA 4W88A 1XC6A 5AYIA 1QXLA 1TRDA 4AIBA 1FRBA 3VTRA 4I9AA 3A12A 1MW3A 4KKXA 2JKAA 4O4WA 2VGGA 2XGBA 4KESA 2ZC1A 4FX7A 2X8RA 4HA1A 3WDIA 4GABA 1KD0A 1UKQA 4HOZA 3VD4A 2OKTA 3I6RA 1TKKA 4LF2A 1XF0A 1E9IA 1KCZA 2ZTKA 1CGWA 1GVSA 2V2CA 4P8WA 1LRNA 4JFUA 3UF9A 4DI9A 5JXQA 3R79A 5D2WA 3DFOA 1JL8A 3QXBA 2VDGA 4ZTXA 1SO3A 2ZE0A 3TOPA 4MG4A 3TR9A 5EL1A 2A79A 1ICPA 4HPHA 2PDQA 4HU4A 2J8FA 1ML1A 1HTIA 2NQZA 1UKOA 3OLEA 4BY3A 4EF8A 3LXBA 4XZMX 1FWTA 1E71M 1VBGA 2A21A 2PWHA 4H8VA 3UA4A 1US2A 1T7LA 4S3AA 3UJEA 4EX4A 2HMCA 2QKFA 4ZQNA 3W71A 2DVTA 3F4VA 1OFRA 2XN1A 2VRQA 2E6AA 3G1XA 3M5VA 4Q33A 1Y0EA 3COTA 1OC6A 4LV9A 3A5VA 2JIEA 1X7IA 3URQA 1WUFA 1ITCA 1Y7VA 1GQNA 2Y6ZA 3RU6A 2R8WA 3DESA 4JN8A 2VFGA 4N4PA 1E4IA 4L56A 2AL2B 3MQTA 3TEVA 2P1FA 4B5UA 4JYFA 1AJ0A 2BMBA 2J7EA 1OM0A 7ODCA 3LHVA 3BW2A 1X98A 1X8FA 3EMZA 3WDHA 4H8UA 2ACRA 3IIVA 2ACSA 1SZGA 3AIBA 4DXXA 3MP5A 4HHPA 5I07A 3VNLA 4A2SA 2PDHA 4O1CA 2Y63A 3AHTA 1A5OC 3VGDA 1CLVA 4CNSA 4IGNA 3UWQA 2AAAA 2DT0A 1VBHA 1H41A 1LWHA 2YLAA 1FFQA 1XISA 4MIMA 1CENA 3LBOA 4Q8WA 2O92A 4FOKA 1CEOA 5F7UA 2MNRA 3U7BA 5EMUA 1JAKA 4AD3A 3TVAA 5AC4A 4GI9A 3AROA 4XBKA 3V5FA 3ZVIA 4W4QA 1YHTA 1MUWA 4GI4A 1R3WA 1BTMA 1J96A 1QHPA 3B9DA 2OR2A 5FEPA 4KEMA 4JKKA 3PAOA 2Y0FA 2ALDA 1TTJA 4CEXC 3O8AA 1E4NA 3OA3A 4PZVA 3HG3A 4I3GA 5AN7A 4TXEA 4YU1A 2PGWA 1CLXA 4E2BA 3V18A 3NPWA 4NZJA 1T8QA 4DJDA 2A3LA 1WX0A 1T41A 3LGEA 1JGMA 1UWSA 3W1PA 4WJ8A 1JFHA 2UV8G 3W07A 3WDRA 3W38A 5HNRA 1KRCC 2WZHA 4AZBA 4X3ZA 3NAVA 3WBWA 3CV6A 4FX6M 1UQZA 1TA3A 4LX4A 3TTSA 1W9DM 3S5YA 4A29A 1C8XA 1YPFA 1L8PA 2W4XA 1Z89A 2XZ9A 4LRSA 3CIWA 3GS6A 1XGZA 3GYCA 3O0FA 3V5OA 1N7KA 1EO5A 1AD4A 3FFSA 3L12A 4UNKA 2HPIA 2QCHA 3K46A 2CBIA 5H1WA 4DJFD 5FL0A 8XIMA 2BGQA 4H2HA 1OHLA 4H41A 4JCLA 4ALDA 3A6OA 3TCEA 2DVXA 3OBAA 2CYGA 4O4VA 1TUFA 1S2TA 4CD5A 5AYYA 1LCOA 1JD9A 1PTAA 3PUEA 3NQVA 4X9SA 2V67A 2GSJA 3NOEA 2F6XA 9XIMA 4EACA 3E2VA 3A9BA 1X6LA 2I5QA 3N13A 5FA5A 1A5SA 4L6OA 3GXPA 2NQLA 3QYQA 1QI2A 4B5XA 3QR3A 3B8VA 3LNPA 3G0SA 1BVWA 2Q8LA 1Q65A 3R25A 3WD1A 3T55A 3VIIA 1CIUA 3CIVA 1QJWA 3LUTA 3VO0A 3JU2A 3H7UA 4XISA 3RUBL 2YXXA 3LZ5A 4U33A 1E0VA 3TWBA 1Q6OA 3W7GA 4XX6A 2JBMA 3TYBA 1W31A 1JQXA 4MLJA 3NQ6A 1I75A 3V5CA 2ACUA 1TJRA 3W7CA 4GO8A 3ZLFA 3TYUA 1RVKA 3O05A 1XL9A 1RALA 1JUKA 4HP5A 2Z1XA 1PVNA 1P6WA 3EPNA 3PS7A 1DPMA 1T5AA 2FDMA 2XGIA 1GOKA 1Q7ZA 3ORWA 1KGWA 1NFGA 2FJUB 4A3HA 4A05A 1R87A 2GQ9A 2F7FA 2OZ0A 4KT2A 4Y9MA 5I5RA 2D69A 5D02A 4YJ5A 2HROA 2PWFA 4LH8A 2PU0A 5E1QA 2Q3OA 3RO6A 5CLWA 1XINA 4XAYA 3OHIA 2QCCA 2XH7A 4J1OA 1GG0A 2YJQA 4B5VA 1TE6A 1FWGC 2PODA 1WAUA 2ZZ6A 3NEVA 3QOMA 3SUTA 3HMCA 3SW6A 3XISA 3K4AA 4NRRA 4WDXA 5IOBA 1WCGA 2UY3A 4AQLA 2FMNA 1NP2A 3OQEA 1PZ1A 3APTA 3LD5A 3W7QA 3QMRA 3CYVA 1LP6A 1FH8A 1O12A 2J7CA 4ICCX 2XH2A 4Y9AA 4FO4A 1ECEA 5FF0A 4IQLA 4OKDA 2GGHA 1E6XM 4YMZA 4IIGA 5IFTA 4UQBA 4S3EA 3EOUA 3KAOA 5I3IA 3CIXA 4PB5A 4WSJA 1K6WA 1QO5A 1ADSA 2YFOA 1WUEA 1ZNNA 3T0BA 3G6MA 1X8CA 2VEFA 2C6QA 1RK5A 1FHVA 2CLIA 4MWAD 4YYFA 2PTYA 5EPDA 3AO0A 3VUSA 3SUUA 1R3SA 1NOFA 1LQAA 1QWGA 1T0OA 5KEZA 3ITVA 3UG8A 4GKLA 4C5YA 2VYOA 1XLJA 4GNKB 2V2HA 2ZZ5A 2HEJA 1QPRA 1UJPA 4PEKA 2JEQA 1QASA 4S3KA 4AUBA 4K6AA 3MP4A 3PR2A 2XYLA 1KQYA 1A47A 1EEPA 4OBSA 4NY2A 4QX4A 4G7FA 2PFHA 1JZ6A 1A0CA 3CTTA 3R5EA 1IYXA 3NZ1A 2VC9A 4AHPA 4WY0F 1FY6A 2DSWA 3EKGA 1RBOB 3L5MA 3IIOA 4W5ZA 4C6PA 4KWWA 3M0XA 2GSEA 4GJIA 4R5EA 4ATDA 3SADA 2IPFA 1O5RA 2AQOA 3MSRA 3V36A 4YNGA 2Y85A 4RXGA 1ZBWA 5FJRA 2QJJA 1WOBA 4A21A 1A49A 4OQVA 2HVOA 1O7AA 2Z1KA 5CEWA 2FPVA 1UMYA 5I3FA 2W91A 2DZXA 2GVGA 3W83A 3HG4A 3MUZ1 2O4QA 4B9YA 4QP0A 1QBBA 1P0KA 1X1OA 1A5KC 1XH1A 2JEPA 4QEEA 2VQUA 1UKPA 3AI0A 3OG2A 3BG5A 1UUOA 2XSAA 4MDPA 3HPAA 4ZA0A 3UXAA 4W8BA 1Q6RA 1VS1A 4QNEA 4G7EB 1QNSA 2NXHA 1DJGA 3WK1A 1B3WA 2PDBA 3P7YA 1OGBA 4KGLA 3TQPA 4DAFA 3I3EA 4IJCA 4H1ZA 3VIKA 2EPHA 3H8AA 1XXXA 4HA3A 5FACA 1FH9A 3WNMA 4DNMA 3WL0A 4NUWA 3DHPA 3PC0A 3GVQA 3QFWA 5A5WA 3S0CA 4BA0A 1L2QA 2XG9A 3PM6A 2V3FA 3H7VA 3C52A 1TRIA 1B3OA 1EX1A 1MEIA 5AC5A 4JX4A 1JRCA 3LM3A 3EA2A 1JZ3A 2J75A 1H1ZA 1Q6LA 4GFSA 4NJHA 3IUDA 2GJRA 2XIOA 3ARTA 4X9YA 3GDTA 3FJ4A 5FF4A 3SN4A 5HR6A 2EG6A 4N02A 3BG3A 5BRBA 1S5NA 3S47A 4JZ5A 4HMCA 4WD0A 1Z41A 2R94A 2CHNA 5E9XA 4DRSA 1ZALA 5CBIA 2XGZA 2QUVA 1CGVA 4A4AA 1DV7A 2OMAA 1V03A 3OW1A 4XIAA 1JYNA 4G7EA 2OO6A 2WJDA 3EA1A 3GB6A 3B8DA 2YB4A 1TV4A 2FIQA 3N4AA 4DJEC 1JGIA 1OZMA 2FFCA 3WLPA 3W1AA 4P2VA 3W2UA 3GIPA 1OG0A 1IF2A 1BGAA 4TTUA 4GINA 4K8GA 3G3MA 1YPXA 1G0CA 2QJGA 1XRSA 3KLLA 4S3FA 3CQ0A 1MFUA 3VM7A 3ZYZA 1AMYA 3KRSA 5CQ1A 4K8HA 3EDJA 4D8AA 4XD6A 1JPMA 3TJIA 5HUOA 4PTVA 3MWCA 4B2DD 4O1FA 3TAOA 4IGHA 3KBWA 3F2CA 1K02A 5I00A 3G1SA 3T6CA 1Z7AA 3UY7A 1CXHA 1CX9A 4W86A 4K7YA 4DZIA 1EDGA 2GYIA 3QSTA 3HFYA 2R1MA 3UW6A 4RKAA 4YWIA 1UD6A 2VELA 1J11A 3M7WA 2PWUA 4KIRA 4R9OA 3LM7A 3BC9A 4WCJA 4C6EA 3Q58A 4PFMA 2VD8A 4F66A 4ACZB 1OFDA 1DOSA 4ZMGA 1LRTA 3OU8A 2NLYA 3UG3A 3AWOA 1OD0A 3T8QA 4BS0A 4HYRA 1UASA 1NFPA 4JIRA 4OUEA 2FLIA 3HV9A 2PWEA 1TWDA 6A3HA 5FCZA 2BY2A 2PGRA 1SZRA 4O0ZA 3B0PA 2DQXA 2D2JA 1WAWA 1LQ0A 3F4NA 2O9OA 1LWIA 5E9AA 4JX5A 3CWHA 4QJ4B 5DY3A 1XD1A 5HBFA 2YPIA 1HXJA 2I9UA 2W66A 3GC5A 1PZ3A 5BOFA 3NUKA 4HNOA 4HTBA 5D4YA 1ZY9A 3AJXA 2P53A 5G4EA 4G5DA 2VP8A 1JYVA 5FKYA 4ADUA 3TSBA 4IPPA 3B8IA 4NNCA 2QPUA 3TJXA 1ECQA 3BXWA 3GC2A 3RPTA 2WB5A 4ACZA 3DHFA 4TX9A 3W7JA 4RZ5A 5C71A 5IDIA 2VM8A 2Z7GA 4GJ1A 1LG2A 1EP3A 3GSMA 3LCIA 1GVIA 1TTPA 1OX4A 1MQRA 3PWGA 4L7ZA 2VNCA 1VD6A 1PWLA 3LV6A 2VO5A 4MPKA 3FAWA 3T2QA 4HHHA 1JXKA 2DJXA 3CWNA 2H8ZA 3AXMA 4MTVA 2Q02A 3KS5A 8TIMA 4S3DA 2V82A 1WXZA 3LNMA 4FNTA 1TPVA 4JFVA 1ONEA 1OT2A 1S38A 4AEOA 1JZ4A 2EPOA 3W70A 2WNNA 3PTQA 4JTCA 4NP7A 5A8MA 4KWSA 4AYSA 1C92A 2WLZA 2B4GA 1TJ1A 5A94A 1MNZA 4GYJA 3AMDA 4GGHA 3RM4A 4F0LA 5JUVA 2E77A 4O53A 3TOYA