3SUWA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with nhac-cas
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
total genus 193
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3suwA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3suwA02
1KQZA 1Q6DA 2J77A 2VTFA 2HVMA 1PAMA 3EMCA 1NWRA 1JYWA 1H4PA 1GQLA 5KZ6A 2OYLA 4UFJA 3GBEA 1V0LA 1J01A 3VIIA 3AHVA 2JEPA 3RCNA 4W8AA 4D1JA 4UFHA 3SCQA 1G9HA 3MUIA 1E5JA 4PMRA 3VDBA 1GUVA 5IFTA 1VFFA 4AZIA 2ZX7A 3RILA 3VIGA 4UQBA 1XH2A 3CHEA 2DT0A 3AZSA 1OB0A 1NOFA 2DGAA 2DT1A 1BYCA 4HOWA 3K4DA 5A2BA 3WD3A 1JD9A 3CIVA 1E6NA 5E0FA 3L4XA 1XSIA 3NIYA 4B9YA 1V3KA 3AXXA 1WZKA 2XIBA 4PMQA 1QHOA 2QF8A 5EBAA 1VJZA 4EANA 1Q4NX 1B3XA 1CYGA 1KBBA 1NWTA 4CVUA 4M24A 1UR1A 2UY4A 2VO5A 4J3VA 4GQRA 4HZ7A 4M81A 4P7QA 2VR4A 5IHSA 2UWFA 2E9MA 2RGLA 1JDDA 1G1YA 4M82A 4V28A 1VFUA 4QP0A 1PEZA 5LYRA 1GZJA 5BCAA 1YHTA 5CQ1A 1VIWA 1R86A 4CN6A 1BG9A 3PZUA 1QHZA 1VAHA 5I3DA 1BHGA 1JF6A 3SUVA 4JCLA 3JUGA 2XVLA 3DC0A 3WN6A 1E1EA 4PMZA 4GZEA 3VIPA 1B1YA 3BH4A 3EDDA 1C91A 1H09A 1XSKA 1JXJA 4AD0A 2DEPA 1ZU8A 2YL5A 3WMSA 3VM7A 1V0NA 4WK9A 1XCWA 3AIUA 5D9OA 3WBAA 1HVXA 2J7FA 3L4ZA 1BYDA 1UYQA 1UD3A 3WBEA 1BFNA 3AMKA 2XSAA 4R5EA 2YDQA 3AS1A 1G94A 1WPCA 4ATWA 4ATDA 4AIOA 2J25A 5CLTA 2YL6A 1B3YA 2O9OA 4E4PA 5A8NA 5A8QA 1HP4A 3WDPP 3WUEA 3WD4A 4MNMA 3TTSA 1CGTA 5I23A 3BXWA 4JFUA 1JNDA 5BXPA 2ZUSA 2X0HA 3FN9A 4AIEA 3CLWA 3B8SA 2DT2A 3EDFA 3WL1A 5ABEA 2WKGA 1HJUA 3U57A 4MB5A 4WJXA 4HZ8A 2A3BA 1ISXA 3F5KA 2XVKA 1MW0A 1HXJA 4U5KA 2BFGA 1AVAA 2WW5A 3VGFA 1JGIA 4CN4A 5BROA 1HJSA 5IHRA 2CCRA 2W91A 3WDJA 1V3HA 1W3KA 2UY3A 1UA7A 3RDKA 1TUXA 2W62A 4UZUA 3F5LA 5A6SA 2J4GA 4OBRA 2DDXA 2V5DA 3PZNA 1E56A 5A69A 4MDPA 1V08A 4TTUA 3VGDA 3VD4A 1CLVA 2DIEA 1RD6A 1UKOA 1WZMA 1W3LA 3CMJA 1UH4A 4QLJA 2YA1A 3GZAA 4P8XA 2E4TA 1XD1A 4WIWA 4TVDA 2C7FA 2D3LA 4AZ5A 2WCSA 3W0KA 4DWSD 1F4HA 1KWGA 1JYNA 1B90A 4W87A 3ZO9A 4U2YA 3ARZA 3SCTA 3TTOA 2Y24A 3WH6A 3WMCA 5A2CA 2C0HA 3PZQA 1C8YA 1UZ1A 5JBDA 3ZOAA 3UETA 4P8WA 5HPOA 4KWUA 1G0CA 1CEOA 8A3HA 1CGUA 5I78A 3W6LA 1UD5A 1QI4A 4WSJA 3ARPA 2CERA 1P6WA 2VCAA 2AOSA 4JL1A 4D6CA 4CD4A 3KEHA 2TAAA 4WSKA 1V6YA 2F2HA 3UG3A 3ARSA 2B31A 3DYOA 2XFYA 3VGBA 4HMDA 3W28A 1JD7A 1LL4A 3ZMRA 4JKLA 4UOJA 3LPPA 5DMYA 2VCCA 4OZOA 3U5YA 1W9UA 1M03A 3K4AA 2CIPA 4HP5A 1CPUA 2XVGA 3WL0A 4ZXOA 3L4YA 2CYGA 3WENA 1UD4A 4KGLA 5A6BA 3VTRA 1J0ZA 4N0RA 1KXQA 4WKHA 2CESA 3PZIA 3BMWA 1NP0A 4NSBA 1KGWA 3VNZA 1Q6CA 5CJ5A 1KCKA 4RE4A 2FHBA 1JI1A 5FIPA 4MB1A 3PZ9A 1HKIA 5A6KA 1UA3A 3CZ8A 4PN2A 3SUUA 3VIHA 1ISWA 3GYCA 2PC8A 1GHRA 4W7WA 2X2YA 3G6LA 2DSKA 3AI0A 3IAQA 2YDRA 2CBVA 4CCCA 2ZX8A 1VENA 1E3ZA 3ZT5A 3S2CA 5CXPA 5HPCA 2BY1A 3L2MA 4LXFA 3CZEA 5E6YA 5A2AA 2VC9A 1PBGA 3NDYA 4J27A 1K9TA 1DP0A 4D6FA 4AEFA 2XSBA 2YL8A 3DHPA 3MSGA 3TTYA 3BAKA 3BAIA 3OA5A 3GXFA 2Y5EA 1IZJA 3CH9A 1EDQA 1W9VA 5I77A 1HJQA 3WD1A 4XZBA 2JF7A 1HKMA 2GJXB 1SR0A 1OT2A 2IXVA 1NWSA 3GNPA 1XYFA 2JIWA 2FHCA 2WWCA 2BS9A 2ZXAA 1CGYA 1YQ2A 2O92A 1UWUA 4A3YA 4AD1A 2VRJA 1QW8A 2NT0A 3TONA 2YOCA 1ZBCA 1KWKA 1NOUA 1UD8A 1HVQA 4AXNA 1H0IA 4QFUA 1VF8A 2DH3A 4CCEA 1GVIA 1W9XA 1GJUA 3FAWA 4B3KA 4BQ5A 3CGTA 4AZHA 1CXLA 1O7AA 2XYLA 3ARQA 4TX6A 1V6WA 2EPKX 3AS0A 2YBTA 3VMOA 4B9ZA 1E4NA 1NP2A 3CZLA 3WH8A 2DQXA 1A47A 4J28A 4PTXA 1QHPA 4B15A 4M80A 1J0KA 4CD8A 1U33A 1GPFA 1DEDA 1J10A 1C90A 1EHAA 3WNMA 1OCQA 4AZ6A 1UR0A 1GOKA 2WC3A 3UR7A 4U3AA 2D0FA 3IJ9A 3AXIA 2CKRA 2OLHA 5ABHA 1C3FA 5GNXA 2E3ZA 3MUZ1 5F7UA 5C70A 1H3GA 2WHLA 3VIMA 3WNKA 3ARWA 4FMVA 2XFRA 1VEMA 3CZKA 2XWEA 1OWQA 3AIRA 3BAJA 2W61A 1WDPA 3BCFA 3W38A 1U2YA 5HBFA 2VX4A 1GW1A 1MW1A 3WEOA 2CEQA 3L4TA 3RJYA 6CGTA 4LYPA 3CUFA 1KXHA 1QI5A 1VJSA 2FH6A 1WZLA 3AIEA 2DSZA 1B9ZA 3AZRA 1PX8A 4HA4A 3W25A 3GXMA 3MS8A 1HJVA 1XRVA 4XV0A 3EDEA 4HOXA 3CZJA 1X1NA 3VIOA 1K9DA 2VURA 1H49A 3G6MA 2D23A 1K9FA 1GORA 1UWSA 1E4MM 4E8CA 1MQPA 2WBKA 4MB4A 1E9LA 4ACYA 1NQ6A 3ZQ9A 3T2OA 4UNIA 2W92A 4V27A 3WDHA 5JUVA 2BY2A 3MSDA 5BXSA 3APGA 2ZIDA 5AYIA 3VO0A 2D20A 4ACZA 4CCDA 3A4XA 4MJ2A 2CPUA 2V3DA 3VD5A 3WFLA 3WKZA 4HPHA 5IXEA 4W85A 4PCTA 4W7VA 3I3EA 4F9JA 4AZBA 1E3XA 4H8UA 4OIFA 1QW9A 3ZR6A 1FOBA 1ESWA 3AHXA 4GKLA 1NARA 2Q8XA 1I1XA 4LGXA 1UR2A 1EH9A 3SIMA 3SCVA 5A8PA 4JL2A 1CLXA 1HKJA 3KL0A 3WUGA 4GZIA 3OLDA 3VDHA 5I6SA 3LMYA 4GI8A 3WQ4A 1X6NA 3N17A 1J0YA 1KXVA 5GNYA 2GDUA 1L8NA 4AD3A 3VIFA 3EMZA 1OGSA 1CGVA 3A6OA 1QI2A 1BYBA 4W7UA 4XB3A 3LPFA 2J7GA 2G3NA 2BVDA 4OOUA 1KXTA 3EDKA 1SFSA 1EDGA 4FLRA 3LPOA 1JG9A 2V38A 1UWQA 1QBAA 2MANA 1JYXA 2XVNA 1UWRA 2PI6A 3WQWA 1JDAA 3EYPA 2NSXA 1I75A 1BVZA 4Z2KA 1DWGM 2Y8KA 3WDIA 4D6HA 4HZ6A 3FHQA 3OB8A 1ZL1A 5D9MA 4JAWA 2X8RA 5D8ZA 2E8YA 1W3JA 5HOSA 3WQ8A 2EPNA 3AOFA 2DH2A 3O9NA 4UTFA 5E9AA 2VX5A 4MAZA 3T2PA 4GIAA 5A8MA 3NDZA 3B9DA 4BQ4A 2D1ZA 4PSRA 2O9RA 1TZ7A 1UKTA 2EJ1A 1CXFA 1JZ6A 1FH9A 3UEQA 4J3UA 4B3LA 4CU6A 2XM1A 4U2ZA 4E8DA 2IUZA 3WF2A 4W8LA 3BLPX 2BHUA 1TCMA 2WLYA 4UOQA 2YLLA 1ODZA 4W5ZA 4BZYA 1UUQA 1VRXA 3AJ7A 1XSJA 1UKQA 4QAWA 1IT0A 4TX8A 1RP9A 4KRTA 2VRQA 3SUWA 3SCOA 4AMCA 3TOPA 4NF7A 1ISZA 3B9AA 2E8ZA 1EGZA 2WANA 2A3CA 1B30A 2J7EA 3PBGA 4ZEPA 1CTNA 1E0VA 3PHAA 1UQZA 1DWIM 1TE1A 2WMHA 2QHAA 5ABFA 3KE0A 1BPLB 3WUBA 2GSJA 4RE3A 3SCWA 4PRWA 4Q22A 4JCMA 5EMYA 4AEEA 3VDCA 3VM5A 1W2PA 3FNDA 2G41A 2ZX6A 4QCFA 4DWSB 1W1TA 3GNRA 3PTQA 1EHNA 3A47A 3MUAA 2ZUVA 4N42A 4CUCA 3ZM8A 2EPMX 1E0XA 1MXDA 2JFEX 4A4AA 1WKYA 4ZFMA 5BWFA 4MDOA 1Q6EA 2CHNA 5JBEA 1FH7A 1BLIA 2D0GA 3SCPA 2CITA 2DSUA 2DIJA 2WCAA 4IPLA 3THCA 2WC7A 3BAWA 4P7NA 1TA3B 1H2JA 4W86A 3W4RA 2JIEA 3KL5A 3ZJ6A 1FHLA 1MQQA 4E2OA 4IISA 1C7TA 1VFOA 3MKKA 5JIPA 1D2KA 1MVYA 1BSIA 2QV4A 4UQAA 3A4AA 2CXGA 3VX0A 2PWFA 2F8QA 1AQ0A 2EXOA 2O9TA 3AMLA 4ATLA 3A4WA 3CMGA 1QPKA 1GOMA 1K9EA 4U5IA 3W81A 2XWDA 2XIIA 1WDRA 3AS3A 3VIJA 4K68A 4AISA 2ZWZA 1MFVA 3PZMA 3AXHA 3VVGA 4C7DA 4AW7A 5HNNA 4NI3A 2ESCA 1EIBA 1UWIA 3QHOA 1ISVA 2O9PA 1EA9C 4UQ9A 1R7AA 1LWHA 5IDIA 5DFAA 1LF1A 2OYMA 4X0VA 4L4PA 1BG4A 4DWSA 6TAAA 1M7XA 1FP8A 1OT1A 1R8LA 5CPTA 2W4XA 2YA0A 2VNCA 4Q7NA 1RPKA 1ZBWA 2V3EA 2PF0A 4P7OA 4BA0A 5M5DA 1PIFA 3WF3A 2XGIA 2W63A 5HDRA 1B0IA 2E40A 2BHZA 4NZCA 4AC1X 2A3AA 3WF0A 1U30A 3RJXA 5E0CA 4OBSA 4AIUA 1B3ZA 4ACZB 1KCLA 4M29A 4NRRA 3SCNA 5I5RA 3T09A 3OLIA 4JFWA 3N13A 2OSWA 2EO7A 4IM4A 3CHDA 3AIQA 3WSUA 3VOCA 1MQRA 1J0IA 1FA2A 3WQ5A 3W24A 1K6AA 3W26A 1C8QA 4URIA 1CGXA 4M56A 1MW3A 3RPMA 5TD4A 1KR1A 4AD5A 5BRQA 4AD2A 2BY3A 4HPGA 1V6VA 1XD0A 4BF7A 3RMEA 1H1NA 1BF2A 7A3HA 1G5AA 2WB5A 2Y2WA 2WHMA 4D1IA 1BVNP 3VD7A 3UR8A 2W66A 1JYVA 5BYWA 4C7FA 3GNOA 2VZSA 1UR4A 3PZGA 2VQUA 3EDJA 1US2A 4B16A 1FFRA 1E4IA 2QPUA 1UD2A 2BNJA 1SMAA 1JZ8A 4GQQA 4TTGA 4D6IA 2J8FA 4PUEA 3MMWA 1TVPA 3QOKA 4CD5A 1E73M 4AZCB 1HIZA 4FK9A 5A1AA 2ZXBA 2BV9A 1OBAA 2ZUWA 3DYPA 3BGAA 2Z1SA 4P7LA 3CBWA 4TOQA 1PIGA 4Y7EA 1HP5A 3N12A 1OD8A 5LA0A 2E9BA 3AICA 4LQ1A 1B3WA 5CSYA 4JZ5A 4CD6A 1JZ4A 4P8UA 3ZSSA 1GCYA 4CU7A 3MV11 4UQDA 5A3HA 1C8XA 2J79A 4PMDA 4CVWA 4NRSA 1C93A 3FHAA 5EB8A 5FL0A 1X6LA 3VGGA 3M6DA 5I2UA 1BAGA 1ZBKA 1QNQA 1MYRA 5CGTA 5CG0A 2HISA 2ZX5A 3VGHA 1UKSA 2WPGA 1JAEA 1DTUA 3IAPA 2WSPA 1MW2A 4WLCA 1H41A 4HMEA 4J3SA 1VEPA 4V2XA 1G01A 5D9NA 4C90A 1W91A 1TVNA 2Z1KA 3BSHA 1H11A 3CPUA 3L4WA 3VILA 5LA1A 2VR5A 2ZUMA 5DO8A 5C8BB 3SUTA 5D4YA 3NYDA 2WVTA 3W29A 4MJ4A 4UFLA 3F4VA 4LYQA 3ZJKA 5HXMA 5FOOA 1XCXA 4CGTA 3GXIA 4AZ7A 1LQ0A 4S3KA 3UERA 1D7FA 4PSPA 1RH9A 3D5HA 1GQKA 4S3JA 1E6RA 2J7BA 4RL3A 3NUKA 4AZCA 1VBUA 1J12A 1E55A 1M01A 1ZBVA 4ML4A 2FDMA 3L2LA 3WQ6A 2YIHA 2YKKA 3IK2A 1CXIA 1B2YA 1W3HA 3AIBA 2ZXQA 2G3JA 3GBDA 4OOZA 4UFKA 3BAYA 3MMUA 1MWOA 1TG7A 4A3HA 5A6JA 2WK2A 4TVCA 1VBRA 4BCEA 1XH1A 2D22A 1V6UA 1W2VA 1E6PA 3BC9A 4MTVA 5FKYA 3T0BA 3T08A 3PZOA 1E0WA 1KR0A 4RE2A 1HL8A 2A3EA 4W8BA 3WH5A 3ARVA 2DPEA 3ARUA 3TA9A 2J8GA 1KB3A 4UQCA 2XPKA 1JDCA 3VKKA 2WC4A 2VZOA 1OIFA 1CZ1A 2VT0A 4H2CA 2QMKA 2WMGA 3FY1A 2WM0A 5A6BD 4MB3A 4H8VA 1Y7VA 4CN1A 3M46A 3N04A 1FHDA 1GNXA 3WD0A 1E15A 2GUYA 3U7BA 3VX1A 1UQYA 1GQIA 4QDMA 5E09A 4M8UA 3QR3A 4F79A 1BGAA 3WMBA 3TP4A 4Z2IA 3WNNA 1GQJA 4Z2JA 5FL1A 2YDSA 2PWGA 5D8WA 2WMIB 3N9KA 2XVPA 2OSXA 2VVNA 3WDRA 2QPSA 2ZX9A 2VZUA 3A3HA 2VX6A 1V3JA 1QNPA 1W9PA 3W82A 3WNOA 3QHNA 3WEZA 2FH8A 2BHYA 3GH4A 2YA2A 1E40A 1TR1A 4JHOA 4J7RA 1WCGA 3T0DA 2WNWA 1V02A 1B3VA 1WDQA 3NJ3A 4FLOA 4PTMA 1XHGA 2X05A 2VRKA 3WFZA 4MNJA 2V3GA 3ZIZA 3BCDA 5JBFA 3UCQA 1LG1A 2VZTA 5E70A 3F5JA 4F8XA 3WELA 3U5UA 3SUSA 3CUJA 4QCEA 1QVBA 5JIWA 3QGVA 3VD3A 1V0MA 2YLAA 2GFTA 1E71M 1OGBA 1E4LA 2WVVB 1MFUA 5A94A 2CNCA 4P7RA 1M04A 1TA3A 3WF1A 1LG2A 3AQUA 1DHKA 2FHFA 1XV8A 2NT1A 4PCSA 4UQEA 2QLYA 3NSXA 2AMGA 2WHKA 2D0HA 2VMFA 4GZJA 3WY1A 3GM8A 1V0KA 2FGLA 4ZXLA 1Z32X 3GTNA 1KFWA 1ZJBA 1EDTA 4JFVA 4Z2HA 4GO8A 3GDBA 2F61A 2G3MA 1GOWA 1UH3A 2WMFA 1J0HA 1OINA 2JF6A 2YJQA 2YBUA 2XG9A 1WDSA 1W1YA 3N1AA 2J78A 2WLZA 3VMPA 4KGJA 1CGWA 3ZT7A 4PMUA 3AISA 4W5UA 1F4AA 1E5NA 1B31A 1WO2A 3ZT6A 4HU8A 4H8HA 3CZGA 4OUEA 1GJWA 1HJXA 3M7SA 4UCFA 4AD4A 5M17A 1TFVA 1DWFM 2JE8A 1FFQA 4XX6A 3I3DA 1M53A 3CHCA 3RM9A 5KEZA 4C7GA 1ECEA 3MO4A 1CIUA 1SYTA 3QOMA 2GVYA 4YPJA 1JIBA 3CHFA 5ABGA 4BS0A 1UG6A 5E6ZA 3KZSA 1WP6A 4KMQA 4FLQA 1QOXA 3IJ8A 3MANA 4D6GA 2J62A 3PTMA 2VOTA 4PMXA 2BY0A 3ARXA 2WSKA 5M3WA 4EAMA 4GPNA 3L4VA 4ZENA 1HJWA 1AQMA 5BXTA 2ZUNA 4LX4A 1DWAM 2WBGA 1V02E 3WD2A 3THDA 1RP8A 4J3WA 1JXKA 4P8VA 3MUY1 2GJRA 3D3AA 3OBAA 5EFDA 4CKQA 2Y8VA 5C71A 5A6LA 4XUYA 2VVSA 1HF6A 3VUPA 3VIKA 4OKDA 5A8OA 3T2QA 4L4OA 4XZWA 3POHA 1GVYA 1JZ3A 1JNEA 3ARRA 2PB1A 3J7HA 5M03A 4U31A 3AIVA 3WUFA 4W89A 2DSVA 3N11A 3KL3A 1ITCA 3MV01 4GO9A 4WF7A 1CXHA 1KGXA 2XJ7A 1LL6A 1XGZA 3WIJA 1R7OA 3WQVA 1DWHM 2X09A 4MPKA 3PTKA 3NSNA 4JFSA 8CGTA 4HMCA 1EQCA 2UY5A 5DF0A 1UZ4A 1XYZA 1XC6A 3AFBA 1ITXA 1CNVA 2WZHA 1FP9A 4KH2A 1PJ9A 3W53A 2GJPA 1N82A 1EQPA 3RO8A 4TVUA 2ZICA 3RM4A 3OGRA 1JFHA 1W9BM 3GXDA 2WVSA 3S6TA 3ARTA 1QBBA 4IUGA 2VI0A 3WNPA 4D71A 1OSEA 7CGTA 3OLGA 2OWWA 2VX7A 2WMKA 5CPQA 1J9YA 1OD0A 5AYBA 1GOOA 2DT3A 4PEEA 4YHGA 1V6XA 1WAWA 4PYSA 5A6MA 2E0PA 3AMDA 1QNRA 1KQYA 2CKSA 4AWEA 2DSWA 2WVVA 3VNYA 1ODUA 1JF5A 1BGGA 3EMQA 3VU2A 1QI0A 1CBGA 4UFMA 2J7HA 1XH0A 4F66A 1WE5A 1E6QM 2JALA 2OYKA 5DEZA 5CZKA 3AMGA 4BQ2A 4PBGA 2X1IA 2W67A 4UFIA 2ZUTA 1LJYA 2ZE0A 2AAAA 3GH5A 3SCSA 2CHOA 1UR8A 2EBNA 1OIMA 1NWUA 3SEPA 3KWXA 1HKKA 2WZEA 3AMCA 1JFXA 4TXEA 2ZOXA 2VZVA 4ZE4A 3VD9A 2Y4SA 4GXPA 2EEXA 4UR9A 3ALFA 3M07A 1L0PA 3WF4A 3K8LA 1EOMA 1R85A 2OWCA 1PZ2A 2FGZA 2G8ZA 3OGSA 2XM2A 4M1RA 3W6MA 1GOQA 1CECA 4AYSA 1MXGA 2WWDA 5A95A 1OGGA 1UD6A 3FAXA 4D6JA 5I0DA 3HN3A 1ISYA 3W37A 4C91A 4AZGA 1J0JA 1QNOA 2E9LA 4QLLA 3U7VA 3AZTA 4PTWA 4TUFA 2J7DA 3O6AA 5I79A 2YL9A 3W27A 7TAAA 4LPCA 5CPSA 3K8MA 5ECUA 3POCA 3ZJ7A 2C8NA 4U33A 3AS2A 4YN5A 1W9DM 1E70M 1UHVA 4BQ3A 3IJ7A 1CXKA 4OJYA 4UOZA 1NM9A 1E1FA 4EE9A 3ECQA 3OZOA 4IPNB 3ZSTA 2WMIA 3WDQA 3AROA 1ZS2A 2GK1A 4Z2GA 1E6ZA 3DYMA 4WKAA 1ZB5A 3CUIA 4MNLA 4KRUA 1C92A 3NSMA 2GK1B 4HTYA 2D2OA 2VUYA 3BMVA 4X0NA 1S46A 4PMNA 5AC4A 3CO4A 2V3FA 4UZSA 5DT5A 2OSYA 3OGVA 1HN1A 3MU7A 5CLWA 5FD0A 3K1DA 1DWJM 4DM1A 4DUXA 5AC5A 3TTQA 1NH6A 1EO7A 5A6AA 1W1VA 1AQHA 2GJXA 1JZ2A 2WVUA 2A3HA 2CBJA 1IV8A 2XTKA 2WHJA 1HX0A 2PWDA 5LA2A 4PUDA 4D6DA 2QMJA 3VDAA 3AHTA 5I24A 1I1WA 2VL4A 1PX4A 1HT6A 4PTVA 1WZAA 3QHMA 1AMYA 5FCZA 4LYRA 3CUHA 1KGUA 3CTTA 5BRPA 2ZWYA 3VGEA 1TMQA 2J75A 2WZIA 1PZ3A 1EO5A 4GINA 3MMDA 2ZXDA 1BTCA 4W93A 1WB0A 3WH9A 3II1A 1GONA 1UH2A 4EK7A 1V03A 3ARYA 3N18A 5CSUA 4J3TA 1EOKA 2J7CA 5GQBA 1E43A 4CD7A 1SMDA 1PX3A 4WKFA 4FLSA 3O2LA 1HL9A 2W5FA 4HA1A 1OM0A 3HMCA 3HJEA 3LPGA 4J3XA 1V3MA 4QLKA 3EBVA 4JKMA 4MADA 2GDVA 4JIEA 2JEQA 1QI3A 4DUVA 2WMJA 2CETA 1Q6GA 1CENA 1A3HA 4Z2LA 1C7SA 3BSGA 4HOZA 3IANA 1JAKA 3B9EA 3RIKA 1GHSA 2J74A 1H0GA 1W32A 4H04A 3AHYA 1JL8A 4GI9A 5IFPA 4R27A 2XUCA 1WNOA 4D72A 1BYAA 3FW6A 4JFTA 3AIWA 3WNLA 5D9PA 4H41A 1UKPA 1VEOA 3PZVA 1J18A 3SURA 2EQDA 2PWEA 3CUGA 2V5CA 4JKKA 3WEMA 5ABFB 1UWTA 1JZ7A 3L4UA 2IXUA 2VCBA 3AHZA 1LWJA 1E6SM 2ZUUA 2BVTA 2G4FA 2RGMA 3BLKA 2XFFA 2PBGA 4H7VA 5GNZA 3K8KA 1E6XM 1QNSA 2OWXA 4YHEA 4JHZA 2CBIA 3NCOA 4HU0A 2EPOA 3GH7A 3FXYA 2PWHA 2XHYA 3K46A 2WYSA 2G3IA 2J47A 4DWSC 5DT7A 3VPLA 2WAGA 1CDGA 3OIHA 3UG4A 3DHUA 1US3A 3ZJ8A 1E72M 3WH7A 2WCGA 4W84A 3T0AA 3BAXA 2EPLX 1W1PA 4PMVA 1HNYA 1VFMA 3N15A 1GOIA 1JZ5A 1ZJAA 3ZR5A 1LLOA 2BVYA 4EKJA 4HA3A 4U3CA 3DECA 2BXYA 3SCUA 4AY1A 1H5VA 1R87A 2D24A 3PZTA 1O6IA 3PN8A 1LL7A 1KBKA 2XGBA 3SCRA 3E1F1 3RM8A 4PMOA 2X0YA 1CXEA 1J11A 1BQCA 3ALGA 2BXZA 1UOKA 1D3CA 2UY2A 1V3IA 1VB9A 2PBOA 3OG2A 3HU7A 2NW0A 4MNKA 3AYRA 3UESA 1PPIA 1CWYA 2D3NA 3OLEA 3VMNA 5GPRA 9CGTA 2WKLA 3UG5A 4MAVA 3I3BA 4W88A 4X9YA 4F9DA 2WXDM 4DM2A 1EXPA 2VJXA 3OZPA 3AYSA 1JI2A 5CGMA 4CU8A 2CBUA 4PMYA 4D6EA 6A3HA 5AY7A 4FF5A 1UR9A 1FH8A 4ZE5A 5EFFA 4DUWA 5BXRA 1NOWA 1V3LA 4GI6A 3VINA 1Q6FA 1IZKA 2VQTA
chains in the Genus database with same CATH superfamily
4O53A 3KBMA 3QJAA 9XIMA 4NAFA 2ZYFA 1H4PA 1QJWA 4UIOA 2SFPA 3LCFA 3UA3A 1TYGA 2VEKA 3AHVA 5G1YA 3RCNA 2GVGA 4D1JA 4UFHA 3MUIA 1FCBA 4PMRA 5REQB 1R3SA 3VDBA 3ZS4A 5FJOA 1GUVA 5IFTA 3MVIA 3FDKA 5HA7A 2HVNA 4JQ3A 2ZX7A 3R13A 4NHVA 3VIGA 1B4EA 2DT0A 2GOKA 4MVAA 1MZHA 2DGAA 3LSCA 1BYCA 3LERA 1AJ0A 3QMSA 3H70A 1FWIC 2RHGA 2YDAA 1WUFA 4QRNA 5C7VA 4RZBA 4PMQA 3P7YA 3IGHX 4DJDD 1DHPA 1YNPA 1KBBA 3QMTA 3R8RA 4GFSA 4CVUA 4GYPA 1WAUA 5CAKA 3KBVA 3AUOA 1LTDA 1JDDA 2VEPA 4QP0A 1GZJA 4ZOBA 4BF9A 5LHEA 3FVMA 4ZTXA 4DX3A 4Q4QA 2OEKA 3EAUA 1JPDX 1EXBA 1BHGA 4WY0B 4TMCA 3S3GA 3JUGA 1PWLA 1QK2A 1BKSA 4NKCA 3AYTA 4IIEA 2HXUA 1YLVA 2ATMA 4L61A 3STPA 2DEPA 4HB7A 1ZU8A 4FB7A 4XBJA 4FIQA 4ZB5A 2QDEA 1SZGA 3BZJA 3WBEA 3PUDA 3FYPA 2RDXA 5TBOA 2YDQA 3AS1A 1G94A 1WPCA 5CLTA 4BEUA 2YL6A 4QE1A 3I10A 4MNMA 3TTSA 4H00A 5BXPA 1JRBA 3FSUA 2ZUSA 4LOCA 2X0HA 4YCOA 2A2IA 4JY8A 3H21A 1GGOA 3U57A 3P81A 4F0SA 2CHRA 1OFAA 4HU3A 4WJXA 3QQWA 4Q3MA 1UC4A 1HXJA 4DAFA 4XD5A 4CN4A 1S38A 4XKYB 5LGZA 1V3HA 1UA7A 1XRSA 1TUXA 3BW4A 3MBDA 3PZNA 1E56A 4MDPA 4TTUA 1EIXA 2BZNA 2J9ZA 2DIEA 1UKOA 1TE6A 3H7UA 1WZMA 4B5WA 3CMJA 4I90A 1TKKA 4P8XA 3WJYA 3KHJA 1XD1A 4K36A 1UBSA 2ZC8A 5C5YA 2QDHA 4AHPA 2WCSA 3LDVA 1F4HA 1TUFA 1Z44A 2PRHA 3ZO9A 4U2YA 2QDDA 3WQPA 4LUTB 4QITA 3WMCA 1JDFA 1C8YA 3COTA 1FDYA 4GXWA 2X30A 3WX7A 3ZOAA 4KWSA 3I6TA 4ERIA 1ZENA 4KFOA 1UD5A 2PDFA 1I2NA 3GU9A 1Z3NA 2OQLA 2VCAA 4RXGA 3BLLA 3UG3A 1S2WA 5FACA 1DL3A 1LQ2A 1Z7AA 4XKMA 3MPGA 3NQDA 3UXKA 2X1TA 5JXQA 1R9ZA 4C5ZA 4G7EA 3TN6A 3W28A 1RK6A 4UOJA 3LPPA 3CV7A 2BGSA 3FEMA 4OZOA 2XH2A 2CC0A 3WL0A 2J24A 3WENA 4EPBC 3W3OA 1LOQA 4KGLA 4FR1A 3W74A 4KF1A 5LIWX 1J0ZA 1KLYA 2WJFA 2CESA 1UP0A 3PZIA 2TMDA 3BMWA 4A22A 1NP0A 2FKPA 2PDYA 3N9SA 3VNZA 3T7VA 1KCKA 2NLYA 1I2OA 5D30A 3PZ9A 4F0RA 1HKIA 2PDQA 1OFQA 3V0TA 3CZ8A 2REQA 3VIHA 3T4CA 2TSYA 1FCVA 3GYCA 3OVGA 3IWPA 1NDZA 4W7WA 3NQBA 1VC4A 1RY0A 1IYXA 1W31A 3WJZA 1LT8A 2CBVA 2X40A 2Z24A 1M7OA 5I3IA 4EACA 5EMMA 4Q4PA 3M1ZA 4PC8A 1DJHA 3NDOA 3ZT5A 3TV8A 5CXPA 5HPCA 5E6YA 5A2AA 3LXCA 2VC9A 3CQJA 1PBGA 2E5BA 4QXIA 4QAIA 2YL8A 3GXFA 3CXOA 2Y5EA 4JTUA 1IZJA 3CH9A 1JQXA 3WD1A 3N6JA 4XZBA 4ZB2A 1DTNA 3DAQA 2ZZ1A 2WSQA 4HNVA 1NWSA 3HGRA 4O17A 1Q3NA 2HS6A 3QV7A 3E2QA 2ACSA 1UP2A 3DESA 3W01A 4WD0A 3H22A 1ZBCA 1NOUA 4UTWA 1FWNA 2FFCA 1HVQA 4AXNA 4CCEA 1VF8A 3BVJA 4QM1A 2YCEA 2G96A 3NPWA 4G56A 4BQ5A 3CGTA 4R3UA 1DJIA 2I57A 1UROA 2B7OA 2QVNA 3GC4A 3DDMA 4H9TA 3QRHA 5HNTA 1FWRA 3H6OA 2PU1A 1YDNA 1E4NA 1A47A 4J28A 2QDGA 2X0SA 5G2IA 4J3ZA 1U33A 1MEHA 3GG8A 4AZ6A 3OZYA 3TLQA 1G4TA 5AVNA 1FWBC 1T6MA 2WPBA 3IJ9A 3K1GA 2Z7GA 4L1XA 4X61A 1IXOA 5C70A 1H3GA 5F7UA 1PV8A 3VIMA 1K1DA 4Q8TA 5JVLA 1OWQA 3W38A 4IZGA 2VX4A 1MW1A 1K7XA 4H6QA 6CGTA 3CUFA 3IVTA 5H8PA 1QI5A 4ENLA 1XW8A 4R9OA 2FH6A 3UCCA 4RNJA 3AZRA 4ERGA 4J2PA 3W25A 3GXMA 4XV0A 3DEQA 1K9DA 4WQ6A 2CFFA 3KAOA 3Q67A 3C6CA 2FPVA 3OEXA 1N8WA 1SFTA 4HTBA 1G4SA 1E4MM 1EP1A 1MQPA 2WBKA 4E8CA 2POZA 4OU1A 1NQ6A 4CNUA 3BICA 3BQ5A 2I1OA 3EXRA 2ASHA 1CX9A 2AMXA 4WDWA 2LLEA 4V27A 3U4FA 1SGJA 2PA6A 2ZIDA 4BR1A 4ACZA 2CPUA 5KZEA 2X41A 3VNKA 4RZ5A 4AZBA 1EBGA 5FF7A 4H8UA 4NNBA 1VH7A 3HG2A 3GDRA 1QW9A 4MKSA 3M47A 1NARA 3U2EA 4LGXA 2F38A 5AHLA 2R1MA 4I9JA 1FWFC 1OC6A 3VDHA 5MHBA 1OY0A 1Q6LA 5I6SA 3WQ4A 3BG3A 3JU2A 3RGTA 3RRAA 2CWNA 2QKFA 4UNLA 1OGSA 1CGVA 2WQDA 4GHRA 3U2CA 4JPGA 2FDSA 5FF0A 1QI2A 1BYBA 4W7UA 4FXRA 2Y63A 1IWBA 2J7GA 4AVNA 1A0EA 3B8VA 3CV2A 3M0KA 4KFNA 3EDKA 1I2QA 1KM4A 2P53A 5HUPA 3EA1A 1UPPA 1TPH1 2ZDSA 2IKIA 5BOFA 3UGRA 3WQWA 1XUUA 2NSXA 1I75A 2AGTA 2X1RA 4D6HA 3O7UA 4HZ6A 3FXGA 1IR2A 4POCA 5TF0A 3RLVA 3JZEA 2V5JA 5D8ZA 4Y2WA 7PTDA 2QEZA 4K3ZA 4GC3A 2B4GA 3B0YA 5K2ZA 2DZSA 2IW0A 2VX5A 4PUWA 3T2PA 1EL3A 4GIAA 2OLAA 3UWYA 4WGHA 2D1ZA 1UZHA 3IJIA 1BTMA 1TZ7A 3B05A 1OCBA 1T40A 4CU6A 4UNKA 2NQJA 4U2ZA 5D02A 3OTRA 4E8DA 4W8LA 3PBVA 3OW1A 4Q8NA 4Q33A 3VNMA 3B97A 2C0AA 4Y9AA 2V8ZA 2OKOA 4NILA 1MMFA 4QAWA 1HGYA 2VR2A 3N29A 2IKJA 3BV4A 3SCOA 4AUBA 4AMCA 4NF7A 1F61A 5HR6A 2E8ZA 3KLLA 2A3CA 1B30A 3VI2A 2J7EA 2GQAA 4ZEPA 3C3NA 1E0VA 3C0QA 2VEFA 3CB8A 2BBFA 3HPSA 4XBSA 3KE0A 1BPLB 3WUBA 3SCWA 4Q22A 3MA8A 3TR2A 3LHTA 4BY3A 2G41A 4QCFA 4R85A 4DWSB 3R8GA 3A47A 2ZUVA 3UA4A 4GIYA 4N42A 4IMEA 1FWEC 3SDOA 4Z42C 1E0XA 1LCOA 1VHCA 1XIHA 2Z28A 4MDOA 4MYXA 5JBEA 1FH7A 4IGNA 1R9XA 3A9IA 3BTNA 1WKEA 2DSUA 4LUYA 2DIJA 3KXQA 3LCLA 2VFHA 4O1AA 1BXBA 3G18A 4NZ4A 1PYMA 1QOQA 3KUMA 6XIMA 1R9YA 1TR9A 1OZQA 4L1GA 4ADUA 2JIEA 3ZJ6A 4M6UA 2G4JA 2HNEA 3WLPA 1C7TA 1VFOA 3MKKA 1Q4WA 1TX0A 3NTYA 4GKTA 3TQKA 5HWMA 3R10A 5KSWA 1EP2A 5GJPA 2QV4A 4HZMA 2CXGA 4HQVA 4ATLA 1OVDA 3A4WA 1GOMA 3OVRA 3W81A 2XWDA 1Q2SA 1NTHA 1WDRA 3SQMA 3ZYZA 4K68A 1PO9A 1J2BA 4C7DA 4DBDA 3G22A 3TNOA 5HNNA 4K1GA 2A7RA 4NI3A 3QF0A 5HR7A 8XIAA 4KERA 4AVFA 1E9YB 1LWHA 4DZIA 5IDIA 4AFYA 4HIBA 2OYMA 4QIUA 4X0VA 4R7JA 4REQA 1V7AA 4TV5A 4LB4A 5CPTA 1KM6A 1T96A 3UJEA 4O16A 2QJIA 4Y9PA 1HO1A 4FNTA 1NEYA 3EEZA 2BWGA 4GRSA 4TU1A 1RPKA 1J93A 4IQJA 4IFKB 1A0CA 4GYKA 2POTA 1XBXA 2OLSA 2A79A 2Z6JA 1V4YA 2W63A 4DYJA 3OP2A 3CTLA 3UJRA 2I9EA 2ALDA 2NVCA 3VZXA 1RQBA 3M64A 3PBUA 4M29A 3UYCA 4UTMA 5C2CA 3UYIA 4K7VA 4MUZA 1MNZA 1UR3M 4JTQA 5I5RA 3VFLA 3CPGA 1J96A 4IM4A 4CNSA 3CHDA 2FTPA 2ABBA 4LC8A 1MQRA 5EGRA 3W24A 1K6AA 1Q5MA 1C8QA 4FXSA 1MUMA 1P7TA 3F4NA 3TIMA 4IOTA 3P8JA 7A3HA 1VYPX 3G1FA 3F03K 3ES8A 1W3IA 3S42A 4D1IA 3WLNA 3HV9A 5BYWA 1P0BA 4C7FA 3GNOA 1EEPA 3IJLA 1LZOA 1M65A 2DZBA 1J6PA 3M5XA 4GQQA 2J8FA 2Q6ZA 3MMWA 5HQMA 3W75A 3QOKA 1HIZA 5A1AA 1YBQA 3M9YA 4L56A 3BGAA 2Z1SA 1XIFA 3N4AA 4JYFA 4Y7EA 2CLFA 3AICA 2DZWA 1JZ4A 3C2VA 4CU7A 3MV11 1W5OA 2J79A 1Z6KA 3S9YA 5KMYA 3SGGA 1XLEA 1C93A 5EB8A 1U1HA 3AC0A 3VGGA 4LS1A 4DZ5A 1QFEA 2O7QA 3DIPA 4G7FA 4IL0A 1YX1A 4FZIA 1M68A 2V63A 3KHDA 1GWJA 1JAEA 3GNDA 4LBRA 3W7MA 1SQ7A 2ZE3A 1H41A 1VEPA 1TVNA 2P0OA 2YPIA 1H11A 1X1OA 4C6BA 4O52A 1Y8BA 5LA1A 2VR5A 2WNQA 5C8BB 1IT7A 1EA0A 3GXPA 4UFLA 3F4VA 2VP8A 1VFLA 4X2RA 4O0KA 1R3WA 1XCXA 4CGTA 1LQ0A 3EOUA 4CNNA 1UOZA 3G2GA 1RH9A 3CHVA 3LNPA 3W02A 3QFEA 2R14A 1D3HA 3JW7A 1GQKA 1H1ZA 1E6RA 2J7BA 2PZ0A 1VBUA 4JICA 4C6QA 3S47A 1XPGA 2FDMA 1XS2A 3AWNA 1TTIA 1B2YA 1W3HA 3AIBA 3CC1A 3E38A 4BKNA 3LOTA 2Y6ZA 1E51A 3UW6A 3BAYA 5T9CE 3MMUA 1F8IA 3SRHA 1MWOA 1QAPA 3NFUA 3BW3A 1HQTA 4XUGA 4JN6A 3BK0A 4WJEA 4GABA 1TPWA 1KO0A 1E6PA 4ICCX 1EPXA 4C6NA 3I4KA 2Q09A 4HHHA 3KP1A 4GVHA 4W8BA 4S3BA 5CKSA 3TA9A 3FVDA 3U0HA 1KB3A 4UQCA 3L66A 1JDCA 2RJGA 1X7FA 2YCLB 3KBNA 4BJHA 1YRRA 2BGNE 5A6BD 1XLDA 4IGSA 1PL9A 4OT7A 4XZMX 3MBFA 3FJNA 1TWSA 3S83A 3N2CA 3NVDA 3VZYA 1GNXA 1E15A 1EF3A 4QG9A 3QTGA 4Q4MA 3LNMA 1KKOA 5E1QA 1BGAA 3S9IA 4CQBA 1Q8AA 4KFPA 3KS5A 4UBPC 2Q3RA 3WNNA 4O1DA 4Z2JA 2AQWA 5FL1A 3JVAA 2WMIB 3EA2A 3PULA 4IP4A 1QT1A 3A5FA 4GVIA 4J1OA 2X16A 1HG3A 3P6LA 2VZUA 4IL2A 3TJXA 1V3JA 1QNPA 3G8RA 1W9PA 4HSHA 1KRMA 2FH8A 4L5ZA 2YA2A 4JHOA 4J7RA 4OFCA 2WNWA 4J40A 3QVQA 3M7WA 2WSYA 3DKJA 4EXBA 1B3VA 1RXOB 4FLOA 4PTMA 3O8AA 1XHGA 7REQA 3UWVA 1ITUA 2VRKA 5XIAA 4JTSA 3ZIZA 2CLEA 1P7TB 1VCGA 4KEZA 2WZTA 3H2MA 4MJMA 2OZ8A 5AOUA 5E70A 4F8XA 2NUXA 3PSWA 2E67A 2Y8UA 1OF6A 1QVBA 4QCEA 3TYCA 1W5QA 3H7RA 4XIAA 2OEJA 1V0MA 4IJBA 4M6QA 3UZWA 4AX6A 3SRFA 5D2TA 1OGBA 3R7MA 3MP4A 3RLHA 4LAMA 3WLSA 1V5XA 4C6EA 3DBPA 4L7ZA 3L0KA 5DX7A 1GOXA 1QW7A 2QLYA 1ADSA 2AMGA 2D0HA 1P4CA 4GMEA 1PHWA 3GM8A 1V0KA 1KFWA 4FHAA 3HB9A 4Z2HA 4GO8A 3GDBA 4YVPA 2AGKA 5FJTA 4JTIA 4EWJA 4C1NA 4ZB0A 4A3QA 1W6TA 2OT0A 2YBUA 4OGZA 1WDSA 3N1AA 3AU2A 3UPBA 2C6QA 3AISA 5FA5A 1VPXA 2REQB 4W5UA 4RCXA 3ZT6A 3ERPA 3UPWA 3CZGA 4OUEA 3CB3A 1J8VA 3R43A 5M17A 1TFVA 2GGHA 2AKZA 1OG0A 4QSFA 3A5VA 1KFEA 3I6RA 3PWGA 2HK1A 3AAMA 5E6ZA 3OQ8A 2A7PA 1WXYA 4M7SA 1LDCA 3UNTA 1S2TA 3IGXA 2C18A 4D6GA 5CSSA 2J62A 3ABSA 2YCKX 4FSAA 1SSDA 4EAMA 3E2SA 3GDMA 1AQMA 2AKMA 3VKAA 1DWAM 5RUBA 3QPZA 1V02E 3PS7A 3FJ4A 2WKJA 4P8VA 2GJRA 3OBAA 4CKQA 5EFDA 1XRFA 3OYXA 4XUYA 4ZQMA 3F2DA 5C6MA 2VVSA 3VUPA 3VIKA 3CASA 2JKAA 5DANA 1SZRA 2P0IA 2ZTKA 4AWTA 3A64A 4L4OA 4S38A 1PCKA 1I6NA 4AY8A 3J7HA 1XIIA 1R47A 2IPGA 1QPRA 4DO7A 4DJDC 1EGVA 1KGXA 1B5TA 1POKA 3W2MA 2XJ7A 4K39A 1FKWA 1XGZA 3W2LA 3EX2A 1JRCA 2WNZA 3U2ZA 3AALA 3KP0A 3FFSA 4R33A 4MPKA 3QQ0A 4KETA 3NSNA 4OECA 1EQCA 1UZ4A 5A5WA 3EWCA 1L6WA 4KH2A 2WZHA 5FJPA 1R3RA 1PB0A 4TVUA 1OCNA 1A5LC 1W9BM 4QBXA 4HMNA 2JKEA 3VNDA 4DF2A 3FX4A 7CGTA 1ZTVA 2OWWA 3VDGA 1MRAA 5CPQA 5AYBA 1DVJA 4PUMA 3RITA 3FKKA 2BOGX 4TO8A 2YXXA 3IJQA 1RR2A 4F2UA 5I3JA 1WAWA 1IQ8A 4NIRA 1KQYA 3W1XA 1ODUA 1QI0A 3GVWA 4UFMA 5K9CA 3NQCA 1YPXA 2VFFA 1WE5A 5DEZA 5CZKA 3V1HA 4BQ2A 2W67A 1KCZA 3Q94A 1S5NA 4FOUA 1OIMA 3UD6A 3APTA 3SEPA 2FJKA 3AMCA 4TXEA 5HUOA 2Y4SA 1J5TA 4KS0A 2HPIA 5AC7A 2WM1A 4XO7A 1R85A 3GKFA 3BLEA 3OGSA 3DFHA 3S5YA 2NXIA 3ORWA 1YE6A 1UD6A 4IQEA 1GKPA 4D6JA 1XLCA 1ISYA 2E09A 2QCCA 4F0LA 5REQA 2NQLA 3IGUA 2NQZA 2GUBA 3U7VA 4OHQA 3HJZA 4JTHA 3MWCA 4YL2A 4TUFA 2KAUC 2YL9A 3W27A 3LBCA 2AAMA 2A7NA 4BEQA 1W9DM 1E70M 1K7EA 4Y9OA 4BQ3A 1OZMA 4PBEA 3SAZA 5ECVA 3WFAA 4EE9A 4DPPA 2DVUA 3ECQA 1RALA 3KRZA 4WY0F 4IPNB 2QCDB 3WDQA 2EAWA 3T0CA 3PSVA 1KFBA 1S5VA 4WKAA 1DKWA 4KWWA 4JIRA 2WNNA 2WV8A 3B9NA 3NSMA 5F2IA 1AJZA 4HTYA 3T8LA 3GU1A 2HE8A 4PMNA 5AC4A 2VFIA 5G2WA 5FD0A 3KBWA 1HGWA 4DM1A 4A8NA 5JH1A 2VD9A 4HNUA 3QGAC 1XXXA 3CQ0A 3GB6A 2GVLA 4KCWA 1TWZA 3GLCA 4JQAA 3DFNA 4PUJA 1VFSA 3AHTA 5I24A 1I1WA 4DXVA 3TLLA 3HM7A 4DJEC 2PU0A 1FCUA 1QRQA 3CUHA 1KGUA 3CTTA 1LBMA 3HQNA 1TMQA 1WOBA 1TRIA 3TFXA 1EO5A 4GIEA 3UT0A 2ZXDA 4XBKA 3T6CA 3SIZA 2RDUA 1V8EA 2HE5A 4W93A 4L9YA 3II1A 4EK7A 2DZXA 1V03A 2ZVIA 3N18A 5G5IA 4FX7A 1JDEA 3IUIA 3PUEA 3C0JA 3HMCA 4ZOCA 4QLKA 3LPGA 4QSHA 4MADA 1BWLA 4DUVA 2CETA 2QCMA 1CENA 1A3HA 4Z1CA 1C7SA 1IWPA 4HOZA 3B9EA 3RIKA 3QR1A 2J74A 3H4XA 1CCWB 1KNWA 4ZODA 1XF0A 1PDYA 5AHIA 4KCTA 1JL8A 5IFPA 4ROQA 4I5XA 4D72A 1VLWA 2PRMA 3AIWA 2PEVA 3WNLA 1ONXA 1NDWA 4ROPA 2DZVA 2HTMA 1UKPA 4LC6A 4MFEA 1VEOA 4K7YA 1Z41A 3SURA 2EQDA 2PWEA 2VFEA 3RX2A 2XIQA 1S2UA 5C9UA 3B4UA 3GU2A 2G97A 3AXMA 3L4UA 3TH6A 3AHZA 1LWJA 3W76A 1Q45A 2BVTA 3BLKA 3L2IA 4D9PA 4AWSA 3N2TA 3QV9A 4YHEA 4JHZA 1DIEA 1ALDA 4HU0A 1P0KA 1ME7A 2PWHA 1IGWA 3STGA 2WYSA 2J47A 3VPLA 2GVEA 2C13A 1I8JA 1B57A 1SU5A 3A12A 3NVTA 1OK6A 3W7RA 4GLEA 3G1SA 4YNGA 2EPLX 3MB9A 4PMVA 3LLDA 3RAOA 3LG3A 2Z27A 1Z48A 1LLOA 2R1LA 1G69A 4HA3A 4INFA 4BHYA 2G50A 1GEHA 3NQ6A 5LIYX 1L6YA 3TYEA 4IGHA 1POJA 1O6IA 1N55A 2QCDA 4U4MA 5FAJA 2XGBA 2E5CA 1RJQA 2PC4A 1AA1B 4HHPA 1P0NA 2X0YA 2BXZA 4DB7A 2BX7A 1V3IA 1O5XA 3HU7A 2NW0A 3EZ4A 4TIMA 4RX0A 3UESA 3DH7A 3IACA 1TPB1 3UP8A 4O11A 3Q45A 5DCEA 3DXIA 5DMMA 3SB0A 1U22A 3CUXA 3WBXA 5BW6A 1EXPA 4RLIA 3H24A 3JS3A 2CBUA 4KWOA 3W85A 3LENA 3PC0A 5JH2A 2RKXA 5BXRA 4IMFA 2ZA2A 3Q65A 1MXSA 4QDPA 2Y5SA 2INZA 1GVOA 3N6QA 3H8AA 4DYKA 1SPQA 4GH3A 3R0DA 3GO2A 1GQLA 3GNNA 2UV8G 5A6TC 1J01A 5AYYA 4I6KA 1TVLA 6ALDA 2W0UA 3SCQA 6REQA 9RUBA 3UXAA 4M1BA 4AZIA 1S3TC 4UQBA 5G4HC 4XVDA 3CHEA 3AZSA 3ONCA 1NOFA 4K8EA 4GACA 2DT1A 1XWYA 3V5CA 3H26A 4DBWA 4UR7A 2BTMA 3L4XA 1XSIA 4EPKA 3IVSA 4CNTA 1DYSA 3GG7A 2UBPC 3MTWA 3S2JA 1YE4A 3TW9A 4DJFD 1CYGA 4PZVA 3Q2DA 1NWTA 2UY4A 4M81A 3FEQA 1GEQA 5IHSA 2ANUA 2UWFA 3A3WA 4Y9NA 3C2RA 1XIJA 1QPOA 3EOSA 5HMDA 1HZYA 2HDJA 1A5UA 1PEZA 5LYRA 4LW7A 1F76A 1VIWA 3IEBA 3MDWA 4JTAA 3PZUA 1QHZA 1WXZA 3DGBA 2Y1HA 4JCLA 4D8LA 2PGEA 1BXNA 3DC0A 3WN6A 1TJ1A 3W72A 1SO3A 4ZBCA 5FJIA 1B1YA 3CJPA 3EDDA 4WXZA 1H09A 1XSKA 3A22A 1XUZA 2YL5A 2PDLA 3WMSA 2DQWA 3VM7A 3AIUA 5CZ0A 1EC7A 1KBIA 1HVXA 4H9ZA 1MUCA 4J5NA 3ZXWA 3L4ZA 1BFNA 4AVOA 4GUFA 4UTJA 2VDGA 4ATDA 3A4JA 2J25A 3G1RA 4NASA 3B8DA 1HP4A 2Z25A 3WD4A 1CGTA 3T9PA 1JNDA 1PDZA 1ME8A 3NNTA 3FN9A 3D47A 1BEUA 1HTIA 3S1GA 1YNQA 2WKGA 1HJUA 3ZVHB 4MB5A 3S6DA 4JXCA 3UF9A 2EJAA 4XZ9A 2OQHA 4N9DA 2WW5A 1P1XA 2CCRA 4GOAA 5A6SA 1G7VA 2V5DA 3W23A 4UTHA 4OWGA 5HQEA 5HK4A 1GYMA 1CLVA 5CPLA 2CLIA 2ZRUA 2YA1A 3VKBA 5FF4A 4TVDA 3W0KA 1JYNA 4W87A 5U7SA 3SCTA 2Y24A 4N6EA 5A2CA 3PJWA 2VHLA 1OX4B 5JBDA 3B4YA 2XH7A 4ONVA 4EPEC 5G4EA 4CCZA 4WGXA 1CEOA 1CGUA 3W7DA 4PBFA 1QI4A 3ARPA 3ITVA 4KWVA 2CERA 3MVTA 1P6WA 2ZBTA 1XYLA 1O95A 3MHFA 4D6CA 4CD4A 3GW3A 3KEHA 3SW6A 4CQDA 4JN8A 5EL1A 4NYUA 4WSKA 4IIFA 3ARSA 2B31A 2PCEA 3DYOA 4BFAA 3P74A 5AB3A 1E1CA 1YPIA 3ZMRA 4JKLA 4ORMA 5DMYA 2VCCA 3WQGA 1W9UA 1CPUA 2XVGA 1TIMA 3L4YA 5CC3A 4O54A 5A6BA 3VTRA 2PP1A 4NZ5A 3G1DA 3K5XA 3MY9A 2Y5JA 3HFYA 4N0RA 4ZO8A 1KXQA 3KVKA 4LEQA 4QE4A 4QISA 3T55A 1UUOA 1RBAA 1ZP4A 1IGSA 4K2SA 1XC4A 2VEMA 4IGMA 1FWSA 3SUUA 3I7SA 2DSKA 3I6EA 2YDRA 1H7NA 4CCCA 2ZX8A 4GQGA 1E3ZA 3GG1A 2BY1A 4LXFA 3CZEA 1A5MC 4HNLA 3NDYA 4QJ1A 1K9TA 5T9BG 3DHPA 4ILSA 1W8SA 1TPUA 3OA5A 3EKZA 1EDQA 4Q7BA 1HJQA 1G6CA 1UP3A 2JF7A 3DFQA 4IP5A 1EUAA 3GNPA 1JCLA 1JCNA 3PUGA 1XYFA 2JIWA 2R9RA 2FHCA 1T5AA 2Z0IA 1V77A 4FXFA 2NT0A 3EWUA 4BI7A 1H5YA 1KWKA 4RNHA 3UZ5A 1GVIA 1W9XA 3H23A 3WMLA 2PDUA 1CXLA 1O7AA 3VAVA 1ZAJA 3ARQA 1SM9A 1X1ZA 4H19A 1V6WA 2OEMA 2YBTA 3P8IA 4W4QA 4B9ZA 4XZLX 1NP2A 2INEA 2DQXA 4PTXA 3HPAA 5U4NA 1J0KA 3QSTA 1EHAA 3MZNA 3Q37A 4X9SA 1J4EA 1EJSC 4U3AA 5EPDA 1Y5VA 2CKRA 1NIUA 3HO8A 5ABHA 1C3FA 4PULA 3MUZ1 3D3FA 5D32A 2WHLA 3WNKA 3ARWA 1WDPA 1YEYA 3IIVA 3RX4A 2CEQA 3RJYA 3CEUA 3N73A 4LYPA 4CLMA 1IEQA 3C86A 3THAA 1YKWA 5LIKX 5EJ1B 3AIEA 2DSZA 4MWAB 3R58A 1PX8A 4LCRA 4HA4A 1ZAHA 2OR2A 1HJVA 1XRVA 3EDEA 3CZJA 3MQTA 3TYBA 5D2VA 1W54A 4WOQA 3TYZA 4RZ4A 2OGJA 1EB3A 1GORA 1UWSA 4JIPA 1LYXA 4ACYA 5I7GA 5F2LA 3VE7A 1EWDA 2PDNA 1GTHA 4O13A 1A5AA 3DBNA 1KFJA 4I5RA 4NAFB 3MSDA 2CXEA 2VC5A 3VO0A 2A6NA 3A4XA 1M41A 1Q85A 3VD5A 1FWHC 1UW9A 7ODCA 1PVNA 4L9XA 1Q2RA 1RVKA 4IX2A 1YXCA 1DE5A 1V79A 2XIJA 3ZR6A 1FOBA 1EH9A 2GSHA 3HGJA 5FSDC 3SCVA 1BSLA 1EC9A 3ZLGA 1X6NA 1KXVA 5GNYA 2FZDA 1KTBA 3M4HA 3VA8A 2OKTA 1XQLA 3VIFA 3CT7A 2B7QA 1TIWA 3QC3A 2WJDA 4IXHA 2QJGA 4B5TA 2P5NA 4US6A 1UC5A 2ZZ4A 2BVDA 3VC6A 4O8RA 1KXTA 4LCQA 4PL2A 1XLLA 2XISA 5F2MA 3WLHA 1JG9A 3NYZA 2FPTA 1QBAA 4IJRA 1NFPA 5T26A 4PCNA 4WRHA 4AIBA 1ZQ5A 1JYXA 2XVNA 1GPWA 5L6UA 1IE7C 3PG8A 3IUDA 3O06A 3LCIA 4GCXA 1BVZA 4WX2A 2Y8KA 1BWVA 3FHQA 3OB8A 4GJJA 3EPNA 5D9MA 1K8CA 1A50A 3L0GA 1GTEA 2E8YA 1W3JA 1P48A 3R11A 3O9NA 4UTFA 2GYIA 1D7KA 3V0UA 5A8MA 3AU6A 4PSRA 1FXPA 2XGZA 1XGEA 1BXCA 2O9RA 1AW1A 2EJ1A 4IIGA 4Q8PA 1FH9A 4DNHA 3W7KA 4B3LA 2OG9A 2XM1A 3CH0A 2EF9A 1EJWC 2IUZA 3NAVA 4X22A 1YYAA 2ISWA 1S5WA 1QPNA 2OOGA 3B40A 4UOQA 3TC7A 2R1KA 5K4XA 1ODZA 1EJTC 4BZYA 1UUQA 1TWWA 1UKQA 4JY9A 1E9IA 1IT0A 4TX8A 3DCPA 3SUWA 4Q4SA 1ZAIA 3QLLA 1G4PA 1XIBA 1RQHA 5AHNA 4KIRA 2PRLA 4EX4A 3PBGA 1A49A 4KKXA 4FAMA 3PHAA 4QS6A 4HCDA 4MFDA 1GZGA 2QZRA 4WDTA 3TZNA 2GSJA 3IIPA 1MNSA 3GAYA 4AEEA 3VM5A 3FNDA 1EYWA 1W1TA 3GNRA 1AW2A 4WY0A 4YWIA 3P93A 4E4FA 1C9DA 3I7RA 3ZM8A 3LRKA 4HYWA 4O0ZA 2EPMX 2JFEX 4A4AA 1WKYA 4MOZA 4HCLA 3VOJA 3O16A 2PDMA 3WLKX 1BLIA 2D0GA 1RAKA 4UXDA 5HNUA 4DZHA 2ACRA 3SCPA 1AL8A 4L65A 2CITA 2D73A 4ECLA 2H3BA 3N2XA 4JEQA 4H83A 4IPLA 3PF3A 3EWBX 3SJNA 3CO8A 2JGQA 3BMXA 3BW2A 4S2BA 4N9BA 1TJPA 2C16A 4E2OA 3LM7A 3IGSA 3L0NA 4QNWA 5LNUA 1D2KA 1MVYA 1RCQA 4CEXC 2HNHA 4OVXA 3A4AA 4EXAA 1GJPA 1N2VA 3K30A 1GVQA 2IQDA 3DHFA 3NPXA 4ZO7A 3M44A 2QULA 4HA0A 2Z4GA 1QPKA 1KRBC 2XN0A 1K9EA 1ONRA 3BE7A 4EF9A 2VC7A 2XIIA 3RX3A 5GJMA 1SFLA 3WLQA 3AS3A 4US5D 3ABRA 4AISA 2PDJA 4KIEA 2V2HA 2ESCA 3ITXA 4LRSA 1OFBA 3NXFA 3F2CA 4UQ9A 3O07A 3CYJA 1R7AA 1YXYA 1FQ0A 4DN1A 1R8LA 1OT1A 8XIMA 2O4MA 2BP1A 3L12A 4K38A 2Z26A 4LCSA 1QOPA 3E49A 4RK8A 3W84A 2NUYA 5I3GA 4ZSUA 3EX4A 4G8TA 2ZRZA 3DU0A 3H53A 4Q6JA 2V2DA 5MKGB 5HDRA 1B0IA 3ITGA 2BHZA 4NZCA 4LF2A 4AC7C 4EOUA 5FJUA 3LQLA 1PSCA 2X7VA 4C6JA 1PKMA 3ABZA 3G77A 3H2AA 1US0A 5E0CA 4ACZB 3KX6A 3HURA 3ANVA 3BGJA 1DE6A 3M0XA 1RA0A 2OSWA 5EBUA 4FA3A 4ZSTA 4LALA 2ZA3A 1FA2A 4I3GA 1CGXA 3WCZA 4M56A 1YDYA 1MW3A 1R5YA 2QJNA 3BJFA 5TD4A 4CEUC 1XDJA 4QEEA 2BY3A 1FKXA 4HPGA 3OQEA 1V6VA 3RMEA 1H1NA 1S5TA 4IG2A 4NAEA 5HINA 3E5PA 2WHMA 2ZRXA 3VD7A 2FTYA 2W66A 5HWJA 1UR4A 1UJQA 3BUVA 1FFRA 2TRSA 3W7EA 2BNJA 3NO1A 1JZ8A 4TTGA 3F1QA 1ADDA 2UZ9A 3FA3A 4PUEA 3KRSA 3U8GA 5IBXA 2ZXBA 1OBAA 2F6XA 2ZUWA 1ZALA 3CBWA 1PIGA 4MY9A 1OABA 4KQNA 4LTSA 3M0ZA 2E9BA 2VYOA 5CSYA 1IEVA 4CD6A 1BWKA 4P8UA 4A8RA 2QR6A 1TWIA 2J9XA 4UQDA 1MEIA 4JYEA 4M3PA 2CZVA 4JIQA 1P1MA 1XKYA 1Q6RA 4TQTA 1HFBA 3P60A 1BAGA 1MYRA 1EC8A 1Q6QA 2PGRA 1KRAC 1JCJA 3TSDA 3P0XA 1DTUA 2ZTJA 1MO0A 1CLKA 1IT8A 1GYNA 4J3SA 1G01A 3TDFA 1W91A 2Z1KA 1UIPA 4ZR8A 3TKFA 3FV9A 4GYPC 2OMAA 5EKYA 3LSBA 4NZFA 3AUJA 3SUTA 3V4BA 5D4YA 1DJWA 4DJDA 3W29A 4MJ4A 3H4WA 5FOOA 3DERA 3W6YA 3MYOA 4H6RA 1R6WA 4JS3A 4O50A 4U28A 1SJBA 4LUSB 4NUWA 3L5AA 4RL3A 2R24A 1PKNA 5CZJA 2XZ9A 2A0NA 1W3NA 3OIXA 1J12A 4H9MA 1ZBVA 5FEWA 4XAPA 1FUYA 3QZEA 1I0BA 3IK2A 2J27A 3G1XA 1CXIA 1YNYA 3G5EA 3NM3A 2G3JA 1M6JA 4GNVA 3GVRA 3QY8A 3S1WA 5EMKA 2QCNA 5CPNA 2PTWA 5A6JA 2A21A 3W7OA 3IIXA 1VBRA 4TVCA 1XH1A 2D22A 3W7GA 4MTVA 3PZOA 4ZQCA 1KR0A 1HL8A 2A3EA 3WH5A 3ARVA 3VNIA 1RVGA 2GZXA 3ARUA 2J8GA 4GCAA 3S4TA 2XPKA 1T41A 2CZEA 5EY5A 3LI0A 1CZ1A 4KESA 2VT0A 3KOYA 2WMGA 3FY1A 1EZWA 2V67A 4QG6A 2YYTA 4H8VA 1Y7VA 3RXZA 4WXYA 1FHDA 1EJXC 4V1YA 3VX1A 5AHMA 3GRIA 1S2AA 4JIIX 3SGUA 5E09A 2WJEA 1XISA 4M8UA 3QR3A 4HBKA 3GDLA 5C2GA 1Z69A 1K02A 2YDSA 2QIIA 3S1XA 3IIOA 3N9KA 2XVPA 2OSXA 1XLMA 3W1MA 1W1A1 2X2GA 5HJXA 4WDXA 1YIXA 1OADA 1XGDA 2VX6A 1X39A 4YTUA 1WDDA 1KLZA 3QHNA 4MMWA 3KOWA 5JQ9A 1E40A 1KBJA 1WCGA 3SJ3A 1RPXA 3CYVA 1DIDA 1OX4A 1UJPA 1WDQA 4V1XA 3MZ2A 1O66A 3TQVA 2X05A 3WFZA 4DXXA 3S9ZA 4PEKA 5JBFA 3BCDA 3TQPA 2CZDA 3BOLA 1IEXA 4M6VA 3GW0A 3FYYA 2BASA 3EWZA 1GK8A 1VJIA 1E4LA 1BQGA 5CBIA 1R46A 5A94A 1QWGA 2CNCA 3PPGA 2XSXA 1TA3A 3MP3A 1XLGA 1DHKA 2FHFA 2OXNA 2NT1A 1FWJC 1QNVA 4HK5A 3WQEA 3BWWA 2WHKA 3TX9A 3V7PA 1A4MA 1XYBA 3CT2A 4DWDA 3O6CA 1GOWA 3TJIA 1J0HA 4RNIA 1F73A 4HYRA 2DZUA 2XG9A 3RU6A 2YR1A 2V6AA 3WLTA 1XQKA 4H9UA 4KGJA 1CGWA 3HG4A 1O68A 1F4AA 2J66A 3EX6A 1LOLA 2O7SA 4H8HA 2A6LA 5H2ZA 2R1PA 4ZOAA 2OPJA 1AH4A 3M7SA 4AD4A 2OT1A 1VBGA 2ZFAA 1DWFM 4UR8A 1FFQA 3I3DA 4L80A 4E2DA 4HCHA 4C7GA 5C9RA 4XD4A 3MO4A 1ELSA 2Z1BA 3N4EA 2NWSA 3QM3A 2OJPA 2Z1VA 3TR9A 2I9UA 4BS0A 1UG6A 1WP6A 3UVAA 4FLQA 3P82A 4IMDA 1SZFA 2P1FA 2WSKA 4GPNA 3V35A 3L4VA 4ZENA 3DG6A 1ZLPA 3DUGA 1GYLA 2DVTA 1RP8A 4GQ0A 3ZLFA 3XISA 2Y8VA 5C71A 1OFPA 4NI8A 3M0VA 1HF6A 2QQ6A 1JPMA 3XINA 2QW5A 5A8OA 3G24A 1S39A 3POHA 4IFKA 2DV0A 1X6UA 3ARRA 1HL2A 2PB1A 2QCFA 3W2KA 3LD5A 1EWEA 4W89A 2MNRA 5I06A 1ITCA 3MV01 5BWAA 4WF7A 3NQVA 4LS0A 4K8GA 4PUKA 5DN1A 4B91A 3KVMA 1LL6A 3WIJA 1R7OA 4GH1A 5DY3A 3NQMA 2X09A 2D2HA 4H8NA 4HN8A 1VFHA 1OJXA 2OO0A 5DF0A 2FZBA 3KCLA 1XC6A 1W5PA 1FRBA 4N6FA 4PE8A 5BOOA 1FP9A 4O57A 3W53A 2GJPA 3WJSA 1N82A 1NFBA 2VM8A 4C1LA 7ENLA 3GSMA 3RM4A 1N7KA 4LNCA 1F3XA 1QBBA 3KBSA 2YGYA 4B92A 3C2OA 2VX7A 1J9YA 1B9BA 1VPYA 3GG0A 4Y90A 4WEVX 2PP3A 3AMDA 1QNRA 4GD0A 3BSMA 2CKSA 4AWEA 4B5SA 2WVVA 5IOBA 3VU2A 4RR4A 1Q8JA 4F66A 1GW9A 2OYKA 3AMGA 1TREA 4Q7IA 2X1IA 3NQFA 4U10A 3UZJA 2CHOA 1EZ2A 1PIIA 4IMAA 1CI1A 3USBA 4ZE4A 1KC7A 3M07A 1L0PA 4IMCA 4XAZA 5FESA 1TTQA 3T07A 3ABQA 3KRUA 5FEXA 1JPKA 1DJXA 3CQIA 3HV8A 3RPDA 1PZ2A 4M1RA 5FJRA 3W6MA 1I2RA 1GOQA 1MEWA 3RR1A 2WWDA 2CZFA 2YX0A 1BKHA 2Q8LA 3FAXA 3UR5A 4H2HA 5I0DA 4NJJA 4AZGA 2PDHA 5F2GA 4DQWA 1TX2A 1XKJA 4DEFA 3G1HA 4M5PA 3RN6A 1NF7A 1QNOA 2ABAA 2E9LA 1UB3A 3AZTA 2J6VA 3O63A 4PTWA 3O6AA 4MZ1A 3UWEA 3QEZA 7TAAA 4LPCA 5CPSA 3K8MA 5ECUA 3POCA 5FAGA 3CAKA 4REQB 2NLIA 3GQYA 4JTGA 3QKEA 1OFEA 1XDMA 3LCHA 1P0EA 4X3ZA 3DYMA 1NVMA 2GK1B 1H7XA 3V18A 4UWMA 1K7FA 2D2OA 2R94A 4X0NA 1S46A 1F05A 2V3FA 5IBXC 2OSYA 3PJUA 5DELA 4AHOA 3MU7A 2YZ5A 5CLWA 2HV5A 2GGIA 3K1DA 3M5YA 3L23A 4DUXA 5AC5A 5AVHA 2FLIA 3PPCA 4Z08A 2GJXA 2WVUA 3BLFA 5B80A 2OFJA 1IV8A 2WHJA 1HX0A 1AMKA 5LA2A 2YZRA 3ZVHA 2QMJA 4H9YA 4A3UA 2DUZA 3ZFHA 3HPZA 4LJ3A 1KA9F 4LT9A 4X2PA 4MLRA 2H8XA 2VEGA 1FVPA 2ZWYA 3TQ0A 3ZVIA 2A5HA 3QGKC 1PZ3A 3THQA 5I3FA 4QE5A 4A35A 1A5SA 2YFOA 4C6FA 1WB0A 1GONA 4OTKA 3N6HA 1ITQA 4J3TA 2J7CA 1F6KA 5GQBA 3NL5A 1SMDA 3DFSA 4WKFA 4JNZA 2QCEA 1OM0A 4M6PA 4GX8A 4ZTYA 1MRQA 3EBVA 4JKMA 4JIEA 5AFDA 2JEQA 1QI3A 3Q58A 2E5DA 3UQNA 1Q6GA 5G2HA 1T7LA 4Z2LA 1H1YA 1JAKA 5H8MA 3W7IA 1W32A 1W0MA 4H04A 3S1VA 1TCDA 4GI9A 1OF8A 4R27A 2XUCA 2V81A 3LU2A 5J5DA 1A3XA 2C79A 2O55A 1SO5A 4UMBA 3LGDA 1U5HA 3C3UA 3PZVA 1DJNA 3EX1A 5BOEA 2V5CA 4IPJA 2YSWA 1FHUA 1XIEA 2VCBA 3DI0A 2XFFA 4MWAE 4IICA 4H7VA 4DLMA 4C6KA 5GNZA 3RCYA 1OYCA 3K8KA 4R88A 1QNSA 2OWXA 5I3HA 2Z6IA 5CZTA 4I9MA 2CBIA 1YDVA 2ZQ0A 1WDWA 2EPOA 4HPXA 3K46A 2G3IA 5KINA 1AH3A 2ZC1A 3QY6A 1H7RA 2PWUA 3WH7A 3T0AA 5TIMA 3W2JA 1A0DA 1VFMA 3N15A 3H2CA 1AFSA 1UMYA 3ME3A 1O4UA 3FJLA 4HD5A 5T8GA 2VXNA 2BXYA 3SCUA 5PTDA 2X1SA 5FSEC 3N2BA 1BD0A 3E0FA 3EWWA 1R87A 4AY1A 2D24A 1KBKA 4Y96A 4XAGA 4DRSA 4X63A 4HSOA 3SCRA 2NQ9A 4PMOA 3TJLA 2I5GA 6TIMA 3GHSA 1PTGA 3WLIA 4RJEA 2UY2A 1PZ0A 4LY4A 4PH6A 4RW3A 1Q7QA 2E1DA 4GFIA 4ZA0A 3O05A 1J6OA 1RCOB 2DP3A 5AN7A 1K77A 3T0TA 1ONWA 4ALDA 1QCWA 3UG5A 3S8HA 4X9YA 3NPVA 2WXDM 1L6SA 2EKGA 1QMLA 2O56A 3AYSA 3GHUA 4D6EA 1A5BA 3HOJA 6A3HA 4FF5A 1FH8A 4ZE5A 2I5IA 4US5A 4C6IA 3R5EA 4S3JA 1Q6FA 3G3MA 2VQTA 5C9ZA 1KQZA 4CNPA 3GTHA 1PAMA 1JCXA 5J04A 1HW6A 4YS1A 1KKRA 2BOFX 3INPA 3W1QA 4O4WA 1NWRA 4HU4A 4YVXA 1L2QA 2OYLA 4Q8WA 3GBEA 2OX1A 2QUUA 3AXKA 1OG6A 3ITLA 3VIIA 2JEPA 2PD5A 5BMXA 3FKRA 1TJ0A 1G9HA 3LEPA 1E5JA 3GIYA 1W17A 1VFFA 2HBXA 1F2JA 4YWSA 4QS5A 1XH2A 3O1NA 1U5JA 1VCVA 4PTNA 4YMZA 3B0PA 4I5UA 4YTTA 4QR6A 2PDKA 4HOWA 5A2BA 3W87A 3LI1A 3WD3A 1JD9A 5I07A 1E6NA 4H6KA 5E0FA 4IPPA 3NIYA 2JBMA 2XIBA 2QF8A 2NV2A 1Q4NX 2RJHA 1B3XA 1TV2A 4YIWA 1UR1A 2VO5A 3ITYA 4J3VA 4HZ7A 4P7QA 3UZZA 3QR0A 3LCWA 5XIMA 1LRQA 3V5OA 2E9MA 4IJCA 1M3UA 5GJNA 1G1YA 1F8MA 4QQUA 4HPNA 2YCLA 3W00A 4DAIA 3LK6A 5AZ0A 2X42A 1R86A 3OJGA 1BG9A 5CC7A 1SZEA 3DKLA 1VAHA 3SUVA 3TZFA 2E6YA 2P76A 3GHRA 4PODA 3G8EA 2XVLA 1AL7A 4HGXA 2OU4A 4UMAA 4GZEA 1MZRA 2NWRA 3U3HA 3BH4A 4AD0A 4YTRA 2GUUA 4DVOA 3LZ3A 1V0NA 1XCWA 1TV3A 2OZ3A 5D9OA 3WBAA 2J7FA 2J9YA 3H12A 1UD3A 3RUBL 1DIOA 3AMKA 2HZGA 2PD9A 5ABTA 4AAJA 1WQ5A 3G0UA 1S1RA 4DHGA 1B3YA 2O9OA 2Y7FA 5A8NA 1Q7ZA 2HK0A 2XN2A 3WUEA 4RDYA 4JFUA 1VGAA 4HJFA 1AG1O 2JQXA 4DJED 4AIEA 3CLWA 3B8SA 2DT2A 4B4HA 3MCNA 5ABEA 2H90A 4HZ8A 3GNXA 2Y85A 4ML9A 1ISXA 1W1IE 3DC8A 1M9HA 5LNVA 1JEZA 2XVKA 5C7HA 1MW0A 1A4LA 5IM51 3T81A 4U5KA 1DBTA 2PMQA 3VGFA 2Y7DA 5F4WA 5BROA 5IHRA 2W91A 4O1BA 1YXDA 2UY3A 2IQ0A 2PSNA 2W62A 2Y88A 4OBRA 1KM5A 4ZZ9A 4TX9A 5A69A 3T4WA 4ICMA 3N2OA 1XYCA 2ZRYA 4WIWA 1RZMA 2C7FA 4DWSD 1KWGA 2CLMA 1B90A 4GA8A 4XO6A 2O0TA 4F48A 3W22A 2C0HA 3PZQA 5E9XA 1UZ1A 2OELA 5AECA 5D37A 3TC3A 5HPOA 3NM1A 4KWUA 2HVOA 2DORA 3OOQA 3REQB 4UTLA 2Z29A 3KBJA 2AOSA 1UWAA 2QCLA 2TAAA 3WK2A 4FP1A 2XFYA 3VGBA 3UWWA 1PCWA 3GR7A 1JD7A 4EPDC 3RG6A 2VKZG 4XSMA 5FF3A 2CIPA 2I14A 4MSSA 3KOXA 1KM2A 4FO4A 2CYGA 4H6EA 4Z1DA 4AF0B 3CU2A 2ISFA 3B8TA 1LBLA 4X60A 1X8CA 1HUVA 1RLCL 4WCJA 4HK7A 1KGWA 1Q6CA 1I45A 3LHYA 2FHBA 1JI1A 2ZKMX 3U9IA 3HQPA 3KTSA 3A13A 4MB1A 5A6KA 3K4WA 1UA3A 3IVUA 5I02A 1UPMB 4PN2A 2PC8A 1GHRA 2H3DA 4I8YA 3IAQA 2J13A 3UGVA 1JGMA 4HSNA 3S2CA 4J27A 4OE7A 3GVVA 1DP0A 4PGLA 1G4EA 4D6FA 4AEFA 2XSBA 3MSGA 2F7FA 3TTYA 4OUIA 3BAKA 3BAIA 3NO5A 5IDZA 1WYIA 1W3TA 2GVJA 3FIGA 4A2SA 2ZADA 1W9VA 5I77A 4YLWA 1HKMA 4G9PA 3VXGA 1OT2A 2IXVA 3KZPA 3A3XA 5LIUX 4E4UA 1XIMA 1XIDA 2WWCA 1YQ2A 2O92A 7TIMA 1UWUA 1QW8A 5AZ1A 3EB2A 3TONA 4RPPA 3QH2A 3GYEA 1UD8A 2XIMA 3P5YA 1EF2A 1GJUA 3FAWA 4H01A 4B5XA 4AZHA 3NXLA 3UXLA 2XYLA 4TX6A 3CQKA 2EPKX 1FX6A 4IQLA 1UMLA 3S5ZA 5CC5A 3CZLA 1ZCOA 3GXTA 1JUBA 1QHPA 4B15A 5B7YA 3D46A 1J10A 1C90A 3SO7A 2CLOA 1UR0A 2A4AA 2P10A 2YXGA 2FQIA 2YW3A 3DI1A 3UR7A 3T44A 3L5MA 2D0FA 3TAKA 2OLHA 1SW3A 2E3ZA 1DPMA 1QO2A 2FJUB 3ANUA 3BAJA 2W61A 3C56A 5HBFA 4QX4A 1PTDA 1VR6A 3BO9A 4Y6GA 3LY0A 3EXTA 1WZLA 1B9ZA 3TFCA 5CH9A 1X1NA 3M5VA 2R8WA 3N19B 4UTTA 4QROA 1H49A 1I0DA 3G6MA 2D23A 2RDWA 3TWAA 1ZHAA 4AF0A 4S3GA 4C6OA 2FVMA 3PANA 4MB4A 1E9LA 3GX9A 3ZQ9A 4V33A 2PTXA 1SSGA 2W92A 2Q8ZA 2Y0FA 4QEHA 3WDHA 5JUVA 2BY2A 3TE9A 3APGA 3TJ4A 2W3ZA 1XM3A 4AG0A 1KM3A 4R7OA 4CCDA 4MJ2A 2YCIX 5HJLA 2DIKA 3WKZA 3WFLA 4HPHA 5IXEA 4W85A 2QGHA 4LAZA 1EX1A 3DZ1A 3C0LA 3UY8A 1NSJA 4OIFA 3HPFA 1Z42A 1ESWA 4GKLA 2HEJA 1I1XA 4PR4A 2AL2A 1UR2A 2NV1A 3SIMA 2PF8A 5A8PA 3KM8A 3OLDA 3LMYA 1KTNA 1RUSA 2Z1WA 4ZVJA 3N17A 1J0YA 2A85A 3PR2A 2JK2A 3MT1A 2ISSA 1CB2A 1A5CA 2DW7A 3OBKA 3BJSA 3EMZA 3GIQA 3LHZA 4GK8A 4L6OA 2R1NA 3A6OA 3LMZA 3PAOA 4IXXA 2P3EA 4XB3A 1N8IA 4NY2A 2G3NA 1D8WA 4HKPA 1EDGA 4FLRA 3LPOA 1MDLA 4HT3A 4B2DA 1UWQA 1SFJA 3QQ1A 3SY8A 5BZAA 2NVDA 2BB0A 2OODA 4UTIA 1I2PA 3UJFA 4RKAA 1WXJA 3PVFA 3S1UA 4Z2KA 1ZZMA 4NZ1A 1EJ7L 3CL7A 3ELFA 1C29A 4ES4A 3GHTA 3PUOA 5HOSA 3WQ8A 3DFYA 3QZ6A 2DH2A 1JCTA 5C0QA 3GS6A 4LVGA 3GTFA 4P5UA 1AD1A 3B04A 4MAZA 3WLLA 3TVAA 2G0WA 2FMOA 4PA8A 4NVTA 4A21A 5BNKA 5FEPA 4HPJA 1UKTA 2PAJA 3M0HA 1CXFA 3CPRA 3UEQA 4XISA 4J3UA 3KOZA 2EGZA 2XN1A 2DW6A 1F3WA 4HG6B 5H8UA 3WO8A 2OVLA 4JN7A 4ZL1A 2OCZA 3BLPX 2BHUA 2WLYA 2YLLA 3AO0A 4W5ZA 3LHWA 1VRXA 3AJ7A 4JEJA 4PFMA 4DBUA 3DG7A 4AY7A 1TJ2A 1YMYA 4GNJA 5C54A 1S3HA 3KW3A 4GZ7A 3CQHA 2PDBA 1ISZA 1YTKA 3TOYA 3FJ6A 3MSYA 1LM1A 3RFAA 1VBJA 3IUHA 1KD0A 1PS9A 5HNRA 1TE1A 2Q02A 2QHAA 2WMHA 5ABFA 2HQAA 3M16A 1R30A 1HKVA 2PGFA 2GJNA 3UFYA 2B7NA 4JCMA 5EMYA 5CJNA 3VDCA 4EF8A 4PRRA 2ZX6A 3WBYA 2O4QA 3GE7A 3MUAA 1WKFA 3TCEA 2C1HA 1PHQA 2C1IA 1PXGA 1K6WA 3R89A 3C4UA 3SY5A 4ZFMA 4AMAA 4C6LA 3UWQA 1Q6EA 3SFKA 2Q3OA 3RO6A 3DFPA 4JNMA 3OHIA 5KTLA 4QG8A 5DBUA 3TA6A 1UUMA 3YPIA 3GY1A 2WC7A 2XZ7A 3BAWA 4P7NA 2BXVA 4W86A 1MQQA 2NUWA 1BVWA 2DVXA 4LFYA 4O0QA 5JIPA 3S2MA 3URNA 5CPOA 1JQVA 2ZZ6A 3R8HA 3P2VA 4N9CA 3TCSA 2PWFA 3V5FA 1AQ0A 2EXOA 2O9TA 3AMLA 3CMGA 2RDTA 3TYAA 1H7WA 1AW5A 2GGEA 1A5NC 2VC6A 4RZ6A 4MZYA 3T42A 1EUNA 4L4MA 4OQVA 1LQAA 2ZWZA 1MFVA 3PZMA 3AXHA 3UG8A 1UWIA 4QJ3B 3NWRA 4WJ8A 2O9PA 1EA9C 3CUZA 5A8GA 4L4PA 2FYMA 2P50A 1BG4A 1P6CA 4DWSA 6TAAA 1M7XA 5FF2A 2W4XA 2VNCA 4MG4A 4RXFA 4Q7NA 4E6MA 1ZBWA 3NEVA 1IF2A 4AB4A 2PF0A 3V0SA 5M5DA 4AXKA 3AYVA 1EJUC 2PDXA 3ZR4A 3WF3A 2XGIA 4N7QA 3DN5A 3BQ6A 1MDRA 2E40A 2PDPA 3P14A 2A3AA 2Z7KA 3W07A 3WF0A 1XLIA 2AL1A 4AIUA 5F1UA 1DJZA 3E3HA 2HCVA 2OGYA 5I09A 4EWND 3E9AA 5CAHA 5HJYA 1E9ZB 1RD5A 3SCNA 4DYEA 4H7ZA 5LXEA 1XL9A 3T09A 3NL3A 1ENUA 1R3VA 3N13A 1T0OA 4O1CA 3WK3A 2EO7A 5AHFA 3AIQA 5F1VA 5DRIA 3WSUA 5D2YA 4DUOA 4DF1A 3WQ5A 3NR0A 3URBA 3W26A 3P3BA 4FR6A 3VYLA 2QJMA 3RPMA 3ISIX 8RUCA 2CLPA 4AD2A 1V7YA 1XD0A 1XIGA 1M7JA 3EKGA 2W6RA 4XG1A 1G5AA 2IKGA 3B0UX 1BVNP 3E96A 2FPYA 4UTUA 2HRWA 4DPQA 1JYVA 1QU4A 4QDWA 4DF0A 3UWZA 2BGQA 1X96A 2HS8A 2VQUA 3EDJA 1US2A 1E4IA 1DQWA 1UD2A 2VD8A 1LBFA 4AX7A 1GZ1A 1Q6OA 4JX4A 4CD5A 3A21A 5J8LA 1E73M 3DFOA 2F9RA 1XX1A 2BV9A 3V36A 3DYPA 1LOSA 4CQ8A 4P7LA 3FLUA 3HQOA 4JIHA 3L7RA 4B2DD 4PCPA 1DQXA 1HP5A 3L65A 1OD8A 5LA0A 5EMUA 4LQ1A 1B3WA 4RV3A 4GVFA 1WOAA 2Z2UA 3ENLA 3FA5A 5A3HA 1G7UA 3MI2A 3IRDA 5FL0A 3FHAA 1X6LA 4JTTA 4JTRA 3QFWA 3TYUA 4DZAA 1ZBKA 1QNQA 3SR7A 2HISA 2ZX5A 3HG3A 3LTSA 4OV4A 4IFOA 4LVFA 3IAPA 2KZHA 2ODOA 2VOMA 3EEGA 4WLCA 1NDYA 4HHMA 3G1VA 1AD4A 5D03A 4MM1A 3FA4A 3CAWA 4Y8FA 3CPUA 4Q8MA 3KDOA 3DX5A 4RDVA 3VILA 1YDOA 2VFDA 3S46A 5DO8A 2NXGA 4KT2A 1SJCA 3NYDA 2WVTA 3LYEA 3R0KA 1L2UA 1K8YA 4MY8A 3W1NA 3ZJKA 5HXMA 4ZOEA 5K9DA 3L21A 1E0TA 4PSPA 3EWYA 2RAGA 4Q8QA 1JR1A 2OOFA 3BLDA 4LVAA 4L9ZA 2IS7A 5CJMA 4AZCA 1FBAA 4H3DA 3E2VA 1E55A 1M01A 4PRTA 1P0DA 5DBTA 3HPXA 3P80A 2VGGA 1VQTA 3LUTA 3L2LA 3NL2A 1QWKA 2YKKA 3ABXA 4E38A 3QW3A 2ZXQA 4C1NB 4NJHA 1VS1A 3GBDA 4IH3A 4OOZA 3PBMA 2RH9A 2QAFA 4RV8A 4BCEA 3A24A 4LAUA 4DO6A 1FDZA 1W2VA 3C8NA 2ZZ3A 3BC9A 1VPQA 4LV9A 4G7EB 3C8F