3SUWA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with nhac-cas
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
total genus 193
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3suwA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3suwA02
1JG9A 1GPFA 1JAEA 2IXVA 5GPRA 1HN1A 3WUGA 1UH3A 2ZX5A 4HZ8A 2A3BA 2XVLA 1H1NA 4U33A 5I0DA 3EMQA 1WDRA 1GNXA 3OIHA 4HPHA 1V02A 1ISXA 1ODZA 3BCFA 1VF8A 3MANA 1JYXA 1VFOA 2QV4A 5DT5A 5A8MA 5A2BA 1UH2A 2J79A 1US2A 2DIEA 2J25A 5BXPA 4GQQA 1VFUA 4PMRA 2C8NA 2ZWZA 3F4VA 4C90A 1QOXA 3TOPA 1FHLA 1E3XA 4JIEA 5ABFA 3GZAA 2WHLA 4PMOA 1KFWA 4AEEA 4P7NA 2VURA 3O2LA 2Z1SA 3ZT7A 2RGLA 3L4ZA 4W5ZA 1QW9A 1VENA 3PHAA 5A6AA 1VEOA 3ZJ6A 1NP2A 4V28A 3IAQA 4Q7NA 1Q6DA 1HKIA 5DEZA 2VCCA 1KGWA 1EQPA 1UHVA 1JF6A 3UR8A 5C70A 4AXNA 1F4AA 3BAYA 4BQ5A 1LJYA 3KE0A 2X0YA 2C7FA 3G6LA 4YHEA 4PEEA 1XD0A 3AHXA 1FOBA 3SCNA 3WMBA 4AZ6A 1RP9A 1H0IA 5CLWA 2WMJA 4M1RA 2JIEA 2DT1A 1Q6GA 1HJVA 5CPQA 1OGSA 4AZCB 1W9VA 2UY5A 4KWUA 2WANA 1ISZA 4AW7A 1EOKA 3BC9A 1NH6A 2ZUVA 1QNPA 5I78A 3QOKA 1OSEA 1QNOA 4EAMA 2J8GA 2EPLX 3A3HA 4U3AA 3VILA 4D6DA 4Q22A 1QHOA 2J47A 1K9DA 3AS2A 1CPUA 3POHA 2CIPA 3AIVA 1BSIA 3PZNA 7TAAA 3S2CA 4JFVA 1FFQA 4MNJA 4V27A 5CXPA 4TVDA 5AYIA 4FLSA 3SCRA 1V3LA 3U7BA 2VRKA 2BVYA 1J0JA 2CNCA 4CN6A 3SUSA 2ZUUA 9CGTA 2ZIDA 1V3MA 2XTKA 2VR4A 3VD5A 1Q6FA 1E43A 2WCSA 4CUCA 5HNNA 1UD4A 2VCAA 4W8BA 3AMKA 4MTVA 2YDSA 1E4NA 5F7UA 1WDQA 4J3XA 3VINA 2XHYA 3VIGA 3IJ7A 4IM4A 3ZQ9A 1V6VA 1W1TA 4F9JA 1WAWA 3MUAA 2XPKA 4PMVA 4NSBA 1UH4A 1AQHA 1ZBCA 1W91A 3GNOA 1GOMA 3WL1A 3AS1A 2W67A 1CBGA 2ZOXA 3VO0A 2WCAA 3DHUA 1G1YA 1W3HA 1E6NA 1XD1A 4MNLA 5FL0A 3MV11 5EMYA 1US3A 4OOUA 3AIEA 2XFRA 4JCLA 4PMYA 3THCA 3PZQA 3WFLA 2XGBA 2O9RA 4IPNB 4WSJA 2J4GA 1WO2A 1MWOA 1QI4A 3ZT6A 4AIUA 2ZUNA 4JCMA 2YA1A 2YL8A 3AIBA 3CZGA 5A6BD 3CTTA 4YN5A 3ZJKA 3W4RA 4QAWA 4PTWA 1C92A 2OYLA 2D0GA 1Z32X 3WL0A 1EHNA 4QFUA 4N0RA 4CGTA 3HMCA 1NARA 1KCLA 1MFVA 5ABHA 2VX6A 1OBAA 3WDJA 2GJPA 4TX6A 4UQEA 3GBEA 1LL7A 1S46A 5D9NA 4D6JA 4XV0A 2Y2WA 1K9FA 1SFSA 2PF0A 1PZ3A 1JFHA 3WH7A 2DT2A 1RP8A 3CGTA 1ZL1A 3AYSA 4AWEA 4CD4A 2UWFA 2V3FA 2VZUA 4D6EA 2VZSA 1FH7A 2O9OA 3OZOA 5A6KA 4KRTA 1UD6A 2MANA 4UR9A 2WCGA 1X6NA 3ARZA 4TUFA 5JUVA 1EO7A 3QOMA 3OB8A 3CPUA 4AYSA 3K46A 3L4XA 3W82A 4TTGA 1LL4A 4AD4A 2WVVB 3MMUA 5ECUA 2RGMA 4FLRA 5A8OA 2VX7A 1G94A 2WLZA 2V38A 2WB5A 1G01A 3I3EA 3CO4A 4AISA 4AZ5A 1GOOA 2V5CA 2D2OA 2J8FA 2GDVA 4ATDA 3RJYA 3L4VA 4TXEA 5BROA 3LPGA 2VQUA 1BVZA 4WIWA 1UKTA 1K9TA 3APGA 4L4PA 4PMZA 1MXGA 3OGSA 3WF0A 3IK2A 2W92A 2X09A 1DWIM 3VPLA 3D5HA 3VUPA 1ZU8A 1C8XA 3TP4A 2WM0A 1V02E 3MSDA 4B15A 2JALA 1CGYA 1CXFA 3PZMA 2XM2A 4W86A 1A3HA 3AS3A 1BYAA 1ZB5A 3UERA 2CKRA 5CPSA 1KB3A 1V6WA 2WHMA 4HP5A 2WC4A 3A4WA 5DMYA 4B3KA 4RE4A 4TVUA 3FHQA 2BS9A 3THDA 1G5AA 1CXIA 4GZEA 1JZ3A 1UWUA 3EBVA 2WWDA 3WH8A 1JZ2A 1GQLA 2XYLA 1XHGA 5BWFA 2WC7A 1HVXA 3ZIZA 5DO8A 3WH9A 1VBUA 1LWHA 1WCGA 1V0LA 1CLXA 3AXHA 3A6OA 4HU0A 1IZJA 2FGZA 5HPOA 3WQVA 1KWGA 1FH8A 1MW1A 3ARSA 4KGJA 1BYDA 2ZX8A 1C91A 1TVPA 3WEOA 1BGGA 5JBDA 4M82A 4E8DA 2ZICA 2F61A 2WYSA 3K8MA 3AZSA 2XWEA 4D6CA 1W3KA 2VMFA 1PIGA 1JGIA 1CYGA 4FLQA 4OBSA 3ZSTA 3SCWA 1W9BM 5IFPA 1VAHA 3FW6A 4KRUA 4FMVA 4XX6A 1KGUA 4J28A 1JXKA 4X0NA 1ZJBA 3QHOA 1UUQA 1PAMA 1ZS2A 3ALFA 3WDIA 2WMIA 2YJQA 4UOQA 3ARTA 4EK7A 2CBUA 4W88A 2WBKA 1BGAA 1KXQA 4X9YA 3EMCA 1JDCA 3PZVA 4QLLA 5EBAA 1NM9A 1V08A 4XUYA 3RJXA 3AMDA 4XZBA 3B9DA 1QBBA 4PCSA 1F4HA 8A3HA 1QI2A 2JEPA 4OJYA 2X05A 3BGAA 2V3DA 2VRQA 3CUFA 2Y24A 4C91A 5EFDA 3CUHA 2J62A 1MYRA 2CESA 3TTYA 4UOJA 4P8UA 4UTFA 3WQ5A 2C0HA 1C7SA 4X0VA 1GHSA 5KZ6A 4E8CA 4J3WA 4A3HA 3EDJA 3PZUA 2VX5A 1UKPA 4UCFA 1R85A 3B9EA 1X1NA 4MB1A 1KR0A 2J7GA 4LQ1A 4CU8A 1BYCA 5E0FA 3WNOA 2DSVA 4CD7A 4Z2HA 1EIBA 1JNDA 3QHNA 4NRRA 2OLHA 3CHFA 4WF7A 3WDQA 3EYPA 2IUZA 3M6DA 1BHGA 4W5UA 2E8ZA 3CMGA 3IANA 1V6YA 2CBVA 2G41A 3T09A 4B16A 5DT7A 2XFYA 3DHPA 3ARQA 5A6JA 3UG5A 1SYTA 5E6ZA 2JF6A 1J12A 4GIAA 3GXMA 4GPNA 4AY1A 3CZ8A 4B9YA 1UWQA 3OA5A 2GUYA 3LPPA 2A3CA 2PB1A 4PTXA 1NWRA 3MV01 1UZ1A 2VNCA 4PSRA 3GNPA 3W6LA 1HXJA 5BXRA 2WK2A 4GINA 5A8PA 1R87A 1XH0A 3ZOAA 1B30A 3GYCA 1W2PA 4V2XA 2WWCA 1XH1A 4LX4A 4EANA 1JYNA 1LQ0A 4JFSA 1LG1A 4NZCA 1V0KA 1WDPA 1E71M 4B9ZA 1RH9A 1TUXA 2XIBA 3U7VA 2BVDA 1EH9A 4Z2JA 1ZBWA 3NDYA 2QPUA 1UYQA 4P7RA 1UQYA 2IXUA 2VX4A 3ZT5A 3NYDA 1GOKA 3EDFA 3AMGA 4M81A 2E40A 3BSHA 1E4LA 4H8UA 1GOWA 1XYFA 2D0HA 5GNXA 2BNJA 2D3NA 3OLDA 1UR1A 1HJXA 1J9YA 3GM8A 1B9ZA 2ZUTA 4LGXA 5EFFA 4D71A 3QHMA 1XCWA 3GXDA 3FAXA 3AZRA 1UQZA 1TA3A 3PN8A 4JFWA 2G3MA 3MMDA 3AJ7A 1SR0A 5KEZA 1NOWA 3GNRA 2PWGA 2CHOA 2PWHA 3ARUA 1UR2A 1MW3A 2D1ZA 4D72A 3BCDA 1JAKA 4DM2A 3VIOA 4AC1X 4W85A 4C7DA 5IXEA 3WNPA 1H4PA 3POCA 3G6MA 2X0HA 4CD6A 2EXOA 4D6GA 3ARYA 1WKYA 2WC3A 5A3HA 4ATLA 3W37A 1B31A 4M24A 1UR9A 1ISVA 2VR5A 3AOFA 1JYWA 1OT1A 1CGXA 2YL5A 3VGDA 1GUVA 1DWHM 1IT0A 4GO9A 1QHZA 3UEQA 3CMJA 4JHOA 1WB0A 1VJZA 4AZBA 1MW0A 3CHCA 4ZE4A 4GO8A 4PMNA 1L8NA 2X8RA 3PBGA 4BF7A 1H5VA 3SEPA 3W27A 2F2HA 4AD2A 2J75A 3VM5A 1ISWA 4JFTA 2Y4SA 2AOSA 4J3SA 1D2KA 3WSUA 1GW1A 3UG4A 3RIKA 3VGEA 3KL5A 4PMXA 5BRQA 1QI5A 2PWFA 4MAVA 2BFGA 3SIMA 4PN2A 4UFKA 3AZTA 2JF7A 2XG9A 1KR1A 4GI6A 3RM8A 1FH9A 4D1JA 1R86A 3ZJ7A 5A8NA 2PWEA 1J11A 2XFFA 1KGXA 2W91A 4URIA 1PIFA 1MVYA 4GKLA 5EB8A 2EJ1A 1BG4A 2GJXB 3WY1A 1W3LA 1UKOA 2DQXA 1O7AA 2J7BA 4ZEPA 3VGBA 4H41A 4AMCA 1E72M 4Z2GA 3W24A 3VD7A 5CZKA 4BS0A 4J7RA 4LYPA 4FLOA 5CSUA 1VIWA 2JFEX 3RM4A 3K1DA 2Y8VA 4UQCA 1UZ4A 3T2PA 1Q6CA 5I3DA 4C7FA 1UR4A 1XH2A 2ZXBA 4DUVA 4MB3A 1B1YA 3W26A 1RD6A 4DUXA 4W7WA 2WKGA 5CGMA 3NSXA 1QNQA 2VTFA 3NJ3A 5I2UA 3CIVA 1QPKA 2YLAA 1GONA 3MS8A 2WVUA 4W7UA 5M3WA 3W38A 4ZE5A 2WMFA 3BMWA 3WH6A 3MUZ1 3AHVA 4DWSD 1ITXA 3ARPA 2ZUMA 1ZBVA 1DWFM 2WNWA 2XVKA 4PUDA 5ABFB 4RL3A 3RCNA 3BXWA 3WF3A 3PZ9A 1GJUA 2WVVA 1VEMA 1IZKA 1QBAA 1EOMA 2YL6A 4CD5A 2XVPA 1W9PA 2GJRA 1TE1A 2GK1B 1G9HA 3QGVA 5CG0A 1BF2A 3VDCA 2ZXDA 1J0IA 3D3AA 2G3JA 1KBBA 1CTNA 5CPTA 3TTSA 2ZX6A 3ZJ8A 2EPMX 1XYZA 5CGTA 1GORA 2QLYA 1J0ZA 1GHRA 1QNRA 1UWTA 3HU7A 5JBFA 3MSGA 2QF8A 1LWJA 1BG9A 3CHEA 1EQCA 2BY1A 4TOQA 2WXDM 1O6IA 3WIJA 3PTKA 1HT6A 4CCDA 4CVWA 3BLPX 4OUEA 5TD4A 4ZXLA 4BQ2A 1HKKA 5FOOA 3JUGA 3VIFA 3AXXA 1E4MM 4P7QA 2OWWA 5D8ZA 2FHFA 4TX8A 4DWSC 4IPLA 1PX3A 1BFNA 1XV8A 2WSPA 3GH5A 2XVNA 4MJ2A 1W1VA 3F5JA 2YLLA 4RE2A 1W3JA 1VFMA 2VRJA 1C90A 1I1WA 1CZ1A 1KBKA 2OYMA 3BAXA 1HKJA 1E4IA 3ALGA 5A2CA 4F66A 3VIMA 4F79A 1LF1A 2PBOA 2WZIA 3WNKA 4UZSA 4ACZA 1H2JA 3N04A 2W63A 3WD0A 1OM0A 2EQDA 4PMDA 3SCTA 3VD3A 3KL0A 2WLYA 5I79A 2EPNA 1OIFA 1B3ZA 4M29A 2VOTA 4OBRA 4ZXOA 1CDGA 1WPCA 3UCQA 2GDUA 2CEQA 4U5IA 2OWCA 4IISA 4CVUA 2W61A 4JL1A 2WKLA 5A95A 1OD8A 2EEXA 4U3CA 4BA0A 4CU7A 4UNIA 3AXIA 3BMVA 2B31A 2XUCA 3DYMA 5LA2A 2J7HA 3WQWA 1E15A 1AVAA 4W93A 1U33A 2W62A 4LYRA 3BAWA 3WDPP 4HOZA 3W25A 1XRVA 3IJ8A 3AISA 4HTYA 2O92A 1V3JA 2A3HA 1JZ6A 2ZXQA 4WKAA 3L4UA 5ABGA 3AIRA 5CJ5A 4LYQA 2EBNA 3AYRA 5M03A 2VI0A 2W4XA 3I3BA 1JL8A 3EDKA 3BLKA 5IHSA 3ARXA 1JI2A 1UA3A 1MW2A 3SCVA 2BVTA 3NIYA 1HJSA 2PWDA 4HA3A 4JKLA 1B3VA 4S3JA 3AI0A 4A4AA 3BSGA 2Y5EA 1HF6A 1BTCA 1D3CA 2YBUA 1VFFA 1CIUA 4AD3A 1U2YA 1CGVA 4YPJA 3T08A 4CN1A 1EDTA 1JIBA 3EDDA 1FP8A 1W9XA 4UQDA 1CXKA 1CXHA 2E9LA 1WDSA 4W7VA 3UETA 3ZM8A 5A94A 3EDEA 4W8AA 1BVNP 4NI3A 5D9OA 1OINA 1ECEA 4W87A 3TONA 3TTQA 3OLGA 1KXTA 2A3EA 1J0YA 2Z1KA 2WHKA 1XSIA 4JKMA 3WD3A 1AQMA 4W89A 2PBGA 2CETA 2JE8A 2BY3A 3UESA 3FAWA 1HX0A 3CZKA 4RE3A 3WH5A 4HOXA 5FKYA 5LA0A 2J77A 3VX0A 1JD9A 4Z2IA 1DWGM 5BXSA 1MQQA 3BAKA 2ZUSA 3WF2A 1CLVA 3ARWA 1TG7A 2WZHA 2GVYA 4H8VA 4QLJA 4WKFA 2V3GA 3PZIA 4H2CA 2TAAA 5A6LA 1GCYA 1GVYA 4GI9A 2ZX7A 2ZXAA 4H8HA 1EA9C 3WENA 1UR8A 1JZ4A 2AAAA 1H11A 1HJWA 3RO8A 2W66A 4Z2KA 1XGZA 4QCFA 1PZ2A 2AMGA 3PZOA 2VO5A 4QP0A 1NOUA 1C7TA 3CUIA 4WLCA 1E70M 1KQZA 2QMKA 4F8XA 3WQ4A 2HISA 4AD0A 5D8WA 5CQ1A 3MO4A 4EE9A 4H7VA 2FDMA 3WFZA 2QHAA 6TAAA 5I77A 2BHZA 1HJQA 2E3ZA 4M8UA 3OLIA 3SUVA 4UFLA 3FXYA 5I24A 3EMZA 3T2QA 1W2VA 4GQRA 2WVTA 2ZE0A 2VVNA 2PC8A 5E0CA 3ZSSA 4IUGA 3WQ8A 3CZLA 2CHNA 2EO7A 3WD1A 1EDQA 2VJXA 2G3IA 2OYKA 3DC0A 3NSMA 1E1FA 1IV8A 3VTRA 7A3HA 4H04A 4DWSB 3W28A 1CEOA 3VIHA 1C8QA 3T0DA 3F5KA 3TA9A 3MMWA 1WP6A 1GQKA 1HVQA 3L2LA 4JL2A 4J3TA 6CGTA 3MUY1 5LA1A 1TVNA 3VDBA 2CCRA 1M53A 1M7XA 3FN9A 3VNZA 6A3HA 1U30A 5IDIA 5CLTA 4OIFA 3OGRA 1H0GA 1Q6EA 2DSZA 3AQUA 2WMIB 1H49A 2YDQA 3VX1A 1OIMA 3WQ6A 2XIIA 1JDDA 1VJSA 1JFXA 4CCEA 3AHYA 2J7EA 1TMQA 3AFBA 3IJ9A 2VCBA 4HZ7A 3SCSA 2WPGA 2D24A 3T0AA 4K68A 1J18A 4W8LA 5A6SA 3B8SA 3ZR5A 4HOWA 4AZCA 2CITA 3CUGA 1CECA 1TZ7A 3WF4A 1PEZA 3LMYA 3AIWA 1E5JA 2CBIA 3L4TA 3VGFA 1JI1A 2CERA 5FL1A 5HBFA 3DYPA 1LLOA 5D9PA 2O9TA 3CUJA 3GDBA 1EDGA 1HKMA 5JIWA 4QDMA 2XGIA 1JXJA 3LPFA 3VGHA 1W32A 3N13A 2ZX9A 5IFTA 4UQAA 2JIWA 1H41A 3K8KA 3PTQA 5AY7A 3N1AA 3BH4A 2D23A 2WSKA 2W5FA 4MPKA 3N12A 3NDZA 1UD5A 3GH4A 5FIPA 2YBTA 2YDRA 3WUFA 3OLEA 4U31A 3AROA 3WDRA 3OZPA 4AEFA 2V5DA 5M17A 4J3VA 3SUTA 2XSBA 4OOZA 2J7FA 1QI3A 3ECQA 3L2MA 5C8BB 1UA7A 2WHJA 3AIUA 3GBDA 4PUEA 2Y8KA 4EKJA 2BV9A 3WUEA 3WBAA 3ZMRA 1B0IA 1OGGA 3T0BA 1ODUA 5I23A 4WK9A 4HMCA 2DGAA 1DP0A 2NSXA 3VNYA 2GK1A 2CKSA 3RDKA 4ACYA 3F5LA 3FY1A 1JZ5A 2DT3A 3VKKA 1J0KA 4DUWA 1E6ZA 3VM7A 1UG6A 1CXLA 1E1EA 1FA2A 2FHCA 1E3ZA 5D9MA 3WMCA 4AZGA 1NOFA 3WN6A 1UOKA 3GXFA 3SURA 2ESCA 1DTUA 4U2YA 1YQ2A 5DF0A 2DH3A 1JNEA 3KL3A 2EPKX 4WKHA 1W1YA 4HPGA 1GOQA 1CGUA 3VD4A 2VZTA 2D22A 3VVGA 1WZMA 1AMYA 1GZJA 1KXHA 4UQ9A 1H09A 2YOCA 3ZR6A 1BLIA 3WNNA 2D0FA 2WAGA 1HL9A 4UFJA 1B3YA 1BPLB 4M56A 1D7FA 1ZJAA 3VOCA 1CNVA 2BY2A 3B9AA 1R7OA 1E0XA 3SUWA 4TVCA 1G0CA 4NF7A 2O9PA 1PPIA 5FCZA 1CWYA 4MJ4A 5JBEA 1FHDA 1E40A 1GVIA 1KCKA 5D4YA 1E6SM 1GOIA 4HA1A 1XSKA 1K6AA 1E55A 1RPKA 1TA3B 1HP4A 1VB9A 1V6UA 1MXDA 1QVBA 4A3YA 1DWAM 2BXZA 1V3KA 7CGTA 1FFRA 2WMHA 2VQTA 1JF5A 3KEHA 2VVSA 3PZGA 5E6YA 4MDOA 2BHUA 3CZJA 2OWXA 5LYRA 3VMOA 2WZEA 1WZKA 3NUKA 4D6HA 4ATWA 2DSWA 3VGGA 5C71A 4GXPA 2E4TA 1BQCA 4D6FA 1ITCA 1J01A 1HJUA 1TFVA 3RPMA 2J7DA 2UY4A 3W81A 4B3LA 4L4OA 1ISYA 2YA2A 2FGLA 4MNMA 1EGZA 5HXMA 4R5EA 2DIJA 3K8LA 4MAZA 4PCTA 1JYVA 3OGVA 2E0PA 1V0MA 1UD3A 1PJ9A 1NP0A 1E6QM 5AC4A 1UWSA 1X6LA 1BYBA 2FH6A 1TR1A 3AMLA 1AQ0A 3O9NA 2G8ZA 3WEMA 1DHKA 3TTOA 1EHAA 4MB5A 4Y7EA 5A2AA 4PTMA 1E9LA 2V3EA 1BAGA 2OSYA 2WW5A 5BXTA 1V3HA 5BYWA 4KH2A 3RILA 1I1XA 3N9KA 2QMJA 2YL9A 3VU2A 3K4AA 1UR0A 4D1IA 3SUUA 1W9UA 1NQ6A 5A8QA 5JIPA 1OGBA 1MQPA 2BHYA 3GTNA 4CN4A 3CBWA 1QHPA 3AHZA 3OBAA 2PI6A 4LXFA 5AYBA 3IAPA 2YIHA 1E6XM 3U5UA 3BAJA 4PMUA 2VZOA 8CGTA 4BQ4A 4PYSA 4JAWA 3KZSA 4UFMA 3WELA 4AIEA 4HA4A 2XSAA 3FHAA 2BY0A 5CSYA 2DSKA 3PZTA 5M5DA 4F9DA 4BZYA 3VIKA 4P7LA 1C93A 1GQIA 5A69A 4P8WA 1J0HA 3ARRA 4QLKA 3M46A 2GFTA 3HN3A 4HZ6A 3DYOA 4AZ7A 2DSUA 4NRSA 3LPOA 3ZO9A 3W29A 4PBGA 2JEQA 2E9BA 4PMQA 4J3UA 5GNYA 3L4WA 2VZVA 5HOSA 3UG3A 1CGWA 1V03A 3WKZA 5E70A 5I5RA 1B3WA 4DM1A 1JZ8A 1B90A 1P6WA 1LL6A 4P8VA 1JDAA 1W1PA 4MDPA 1N82A 3VMNA 2DDXA 3AICA 3WDHA 1EXPA 3A4AA 3E1F1 2DEPA 1WNOA 3WEZA 2OSXA 1UD2A 3N11A 2VUYA 1VBRA 1JD7A 2CXGA 3MU7A 1J10A 4AIOA 1NWUA 3GXIA 2Q8XA 3VDAA 1B3XA 4UFHA 3QR3A 3W0KA 2D3LA 1E73M 5I6SA 3NCOA 5A1AA 3AS0A 1SMAA 5HPCA 1UWRA 3PTMA 1YHTA 4CU6A 4UQBA 2E8YA 4UZUA 1OT2A 2BXYA 1B2YA 1PX4A 4D6IA 4OKDA 1VEPA 5A6MA 1EO5A 2VC9A 3N17A 4OZOA 2XM1A 2EPOA 4GZJA 1WZAA 3ARVA 4PRWA 3N18A 1H3GA 3NSNA 4UFIA 4TTUA 1CGTA 2NT1A 3AHTA 3KWXA 3SCOA 1GQJA 2UY3A 2QPSA 4P7OA 2E9MA 4QCEA 4E4PA 4GI8A 3VIIA 4ML4A 2WMGA 2WVSA 1M03A 1CXEA 4HU8A 2D20A 5BCAA 2YA0A 1KQYA 3MKKA 2CYGA 4DWSA 3SCQA 2DH2A 4ACZB 1NWTA 1R7AA 1XC6A 1OD0A 3VIPA 3VIJA 1Y7VA 3VD9A 1LG2A 2FH8A 5E9AA 1E5NA 3CH9A 3U5YA 3WNMA 1TCMA 4FF5A 2FHBA 4C7GA 1XCXA 1HIZA 2G4FA 4MADA 4LPCA 4CKQA 1W9DM 4P8XA 5GQBA 2UY2A 1M04A 3WUBA 1HP5A 3S6TA 3SCUA 1R8LA 1HL8A 3WD2A 4UOZA 2ZWYA 1WE5A 3CHDA 4R27A 3RMEA 1A47A 5IHRA 5A6BA 1NWSA 1L0PA 4CD8A 4PSPA 3WNLA 4M80A 2G3NA 2HVMA 1C3FA 1I75A 3A47A 1OWQA 3AIQA 4AD5A 1UKQA 5HDRA 3CLWA 3M7SA 1V6XA 5ABEA 3WMSA 1K9EA 3W6MA 1E0VA 3UR7A 3VDHA 2YKKA 2J74A 3II1A 2WMKA 4PTVA 1SMDA 4JHZA 4YHGA 1M01A 1E56A 3RM9A 5FD0A 4W84A 2ZUWA 2XJ7A 2WBGA 4KMQA 5GNZA 2A3AA 3WF1A 3W53A 4KGLA 5DFAA 4JKKA 2NW0A 3SCPA 1PX8A 1C8YA 1UD8A 2F8QA 2GSJA 3FNDA 1FP9A 4BQ3A 1HNYA 1JZ7A 3VMPA 3DECA 4XB3A 4MNKA 4S3KA 1DEDA 2J7CA 3GH7A 3CZEA 3U57A 3MUIA 5BRPA 4MB4A 1UKSA 3WD4A 3N15A 4FK9A 1CENA 1QNSA 1QW8A 4JFUA 2DPEA 4HMDA 3K4DA 3HJEA 1DWJM 3L4YA 1Q4NX 3I3DA 5AC5A 4GZIA 1E6PA 1XSJA 5E09A 1OB0A 2X1IA 4U2ZA 1V3IA 3BAIA 3J7HA 4WJXA 4U5KA 3O6AA 1ZBKA 3M07A 3A4XA 4AZHA 1MFUA 1VRXA 1V0NA 2DT0A 1KWKA 1ESWA 2CPUA 2XVGA 3OG2A 2X2YA 3WBEA 1OCQA 1KXVA 4JZ5A 3T2OA 2NT0A 4ZENA 4ZFMA 2CBJA 2XWDA 3AMCA 4J27A 2VL4A 4HMEA 4N42A 1E0WA 1QI0A 2VT0A 4BCEA 4E2OA 1GJWA 1MQRA 1PBGA 1E6RA 2GJXA 4AD1A 1WZLA 4Z2LA 4WSKA 1UWIA 4AZIA 4CCCA 2J78A 2OSWA 4XZWA
chains in the Genus database with same CATH superfamily
3FIGA 4KT2A 5GPRA 1HN1A 4H3DA 3WUGA 3NEHA 4DJDC 1H1NA 3EMQA 4O0QA 1JPDX 1W8GA 4UC5A 1LBMA 1KLZA 4HPHA 1V02A 5CH9A 1QK0A 3QVQA 3CASA 1XLJA 1F6PA 4DPQA 3MHGA 4O1CA 1ZPTA 2J79A 3OBEA 3M4HA 2PLKA 2ALRA 3TTEA 2POZA 3TX9A 3AYVA 1JDEA 1ITQA 4IOTA 1RLCL 2WJDA 5D32A 1E3XA 1YXYA 1KRBC 3WYZA 3WQGA 2VFFA 1XGEA 3V75A 3GFZA 3LXBA 2Z1SA 3TCEA 3IARA 5DY3A 1OX5A 3MVTA 1NP2A 1ONEA 1KGWA 1EQPA 4Z1DA 4IGHA 3LHWA 4ZODA 2CWNA 3GTFA 4K7YA 1BWLA 4GC3A 1L2UA 2C7FA 1DVJA 4YHEA 2ZZ4A 3DOPA 1XD0A 4GJ1A 4PEEA 4GG9A 4Q8NA 1RP9A 1TV5A 1H0IA 1TWIA 3QY7A 2DT1A 1F8IA 5CBBA 3WBYA 2VGBA 2UY5A 1W56A 4GY1A 4ZTXA 3U2CA 3GX9A 4O4WA 2FYMA 3M41A 3ZFHA 1D8WA 1QNOA 1LOLA 4FF7A 3G1VA 3VILA 6XIMA 4LF1A 4Q22A 4J40A 3VFLA 3AS2A 4I8YA 1BSIA 4I7VA 4N9CA 3HZ3A 3S2CA 2OZ8A 5IBXC 3VCRA 4KWOA 3F1QA 4TVDA 5E5CA 2JGQA 2AGKA 3GG0A 1XLBA 3MBDA 3R0DA 1P48A 2ZUUA 3RHGA 4ICCX 1UD4A 2VCAA 2GVEA 1WDQA 3VINA 1TWDA 3IJ7A 3E5BA 4FNSA 3QTPA 1IQ8A 2OEKA 1W1TA 3MI2A 4HB7A 1ME9A 3M7WA 3SJNA 4NSBA 1UH4A 1AQHA 4AWSA 1W91A 3GNOA 1J5SA 3PFRA 3OZMA 4WCJA 3ZXWA 1CBGA 4AVNA 2QKFA 3DHUA 1H61A 4LCQA 4GVGA 2VGFA 1XD1A 4P00B 3MV11 3B04A 2XFRA 4O18A 4PMYA 1N2VA 2XGBA 1E9ZB 4WSJA 1I45A 1AD4A 1O95A 4AIUA 2HBVA 3C61A 1CB7B 1G4TA 3ONCA 1XGDA 3SY1A 2YL8A 3AIBA 5MF5A 2GOKA 1YYAA 2RDWA 3W7EA 3C52A 1OX4B 4QFUA 4CGTA 2I5QA 1NARA 3ZZ1A 1H5YA 2P0IA 1ZAHA 2YCJA 2C19A 3T78A 4QGCA 5H91A 2WPBA 4TX6A 4UQEA 1RY0A 3GBEA 1LL7A 4PODA 3AAMA 2XIJA 3MMTA 2XN0A 1K9FA 2PF0A 3A23A 1YDVA 4XZMX 4DLFA 4G2DA 1QXLA 3AYSA 1H1ZA 1MDLA 4D6EA 5JU6A 4A2RA 4Q7IA 2VZSA 3QY8A 3CV2A 4J9JA 2J24A 1ZLPA 3HJZA 4KCUA 3SIZA 1X6NA 2PRMA 4TUFA 3QOMA 1QNVA 2W3ZA 1EA0A 2Y7DA 3E0LA 3LMZA 3L4XA 2Y89A 4GE8A 2RGMA 1TWWA 3DFSA 4DNHA 2VX7A 2YW4A 1NQKA 2WLZA 4RNFA 4NL1A 1G01A 2QGYA 2ASHA 2W27A 4AISA 4AZ5A 3UA3A 1AODA 2FZNA 2GGJA 4ATDA 4TX9A 3L4VA 2GVJA 1UKTA 3APGA 4L4PA 1H62A 3OGSA 1TJ2A 3R6IA 2X09A 1EJ7L 3VPLA 3TP4A 5EKYA 5IOBA 5EJZB 2GGIA 1A4LA 3OG3A 4B15A 1DJQA 5H8MA 2NXGA 2ISWA 2BZNA 3PZMA 4BJHA 4F48A 4W86A 3AS3A 3GO2A 2HZGA 4ZO9A 1V6WA 3GHRA 2WHMA 2X7VA 3TOYA 5LIYX 1IT7A 2BS9A 4A3RA 2ALDA 1JZ3A 5FSEC 1J2WA 4H1ZA 1RSCA 1M3UA 1QDSA 2XYLA 1LUCA 2WC7A 1HVXA 4C6CA 1LQAA 4IIBA 1VBUA 1LWHA 2HS8A 1EP3A 1V0LA 5CCZA 4JIHA 3AXHA 4JTAA 4NZ5A 1IZJA 3E2SA 2I16A 3WQVA 5HPOA 3T4WA 3RN6A 3H21A 1CW2A 4N9EA 1U5JA 1C91A 3LXAA 5AHIA 3I68A 5JBDA 2ZICA 4M6QA 1ADDA 3ZLHA 1W3KA 2PDWA 1WYIA 2VMFA 5EMMA 4FLQA 4EAYA 3LCIA 3KP1A 1XPYA 4GFIA 1Q63A 3W6YA 4FMVA 4XX6A 4LUIA 1KGUA 4E2BA 4J28A 3QHOA 1UUQA 1P6CA 3BURA 2WMIA 1LLZA 2IPFA 3IJDA 3RG6A 4MJMA 4Q8PA 4E3TA 1BGAA 3NQ2A 4R9XA 1KXQA 4X9YA 3DN5A 5EBAA 4HYRA 4KF1A 1FQ0A 3AMDA 3KW3A 3UZJA 3B9DA 4RX0A 2VEFA 4MKSA 1BWKA 3O6DA 2Y24A 1OF6A 1GW9A 4C91A 2IKIA 4GJIA 1NIUA 2CESA 5AVNA 4UOJA 3GNNA 4QAIA 2V81A 5KZ6A 4E8CA 4NXKA 2P10A 4A3HA 3GDKA 3B9EA 3L0NA 2QV5A 3PBVA 4RNHA 1HUVA 1ZCCA 4QNWA 3W7KA 2J7GA 4LQ1A 1IGSA 1BYCA 4A6GA 2QCGA 4KEZA 1X8FA 4CD7A 4Z2HA 2Y7FA 2QIWA 4NRRA 2OLHA 3S5ZA 1WOAA 1LBFA 1BHGA 3KM8A 2E8ZA 3FFSA 3IANA 2L5HA 4LS1A 4B16A 1S3TC 2HNHA 1EJSC 2XFYA 3MA8A 5A6JA 1VBGA 3DXIA 2JF6A 1J12A 5EJ1B 4GPNA 1J96A 3ID7A 4ZOBA 5EMKA 3PJXA 4B9YA 3OIXA 3OA5A 4IFKB 1KFBA 5FF4A 3UJ2A 4LCRA 4PSRA 3GNPA 3W6LA 3U2ZA 3T9PA 1FRBA 4C6JA 1AL7A 5BXRA 3BQ5A 5HMFA 4AEOA 1DJXA 1LDCA 1QJWA 4G1KA 4GINA 2GSEA 4GOAA 4IJBA 3LDVA 1IWBA 3TAOA 1M5WA 3R12A 4IQJA 3NFUA 5K7JA 4LV9A 1H7RA 2WWCA 3THAA 5AN7A 3A9BA 4L7ZA 1Y65A 4Q6JA 5HWJA 5C2GA 1OC6A 4B9ZA 3ES7A 5TF0A 1NVMA 3U7VA 2BVDA 1EH9A 1UYQA 1YPIA 4LUYA 4H8UA 1XC4A 5HK4A 3NPWA 2ONEA 3UF9A 1GVEA 5EFFA 2VKZG 4DWDA 3AZRA 4RXGA 1UQZA 3PN8A 3MMDA 3AJ7A 1YRRA 3B8WA 1K8XA 5KEZA 5CC5A 1ML1A 2INFA 2PWHA 3ARUA 1MW3A 4C6EA 2E1DA 1V79A 4EP8C 5CEWA 3WNPA 1H4PA 3FCPA 2XSXA 1N7KA 3KTSA 1ISVA 1CGXA 4C6IA 4IFRA 1IT0A 3UEQA 2JKAA 3O1NA 3B8TA 1MW0A 2XH0A 4CQCA 2X8RA 3PBGA 3L0GA 3WLKX 4JFTA 4O1AA 1FWSA 1ONXA 2TYSA 3VGEA 3KL5A 2ZBTA 5BRQA 3CS2A 2X41A 4GY0A 4UFKA 4RW3A 3AZTA 2YX0A 4FOUA 1Q6QA 5HJYA 2E09A 3S1WA 4RDZA 3P60A 3TJLA 3PPHA 3RM8A 4D1JA 1GVRA 2XFFA 3GKFA 1PIFA 1MVYA 3KBJA 3MI6A 4GKLA 3NPUA 1BG4A 1SSGA 7ENLA 1UKOA 3LOTA 1O7AA 5J5DA 3QZEA 3Q4DA 5KTLA 3EX3A 5HR7A 4BS0A 4J7RA 3E12A 3ZS4A 3TE9A 4LVBA 1HGWA 5CSUA 1VIWA 1AJZA 3RM4A 3W7GA 4JGDA 1XFBA 1Q6CA 4L1XA 1O5KA 5CPLA 4NAEB 1XH2A 1BEUA 3C56A 4XKMA 1EB3A 1GT8A 3NJ3A 3LTSA 3M9YA 1QPKA 3LK6A 1B9BA 4W7UA 4ZE5A 2DZAA 2PSNA 2OU4A 3AHVA 4S23A 1ITXA 4JIRA 2ZUMA 2Z2BA 3CLMA 4C1KA 1DWFM 2WNWA 3LM3A 3W1PA 4O8AA 1X38A 4H83A 3WF3A 1GJUA 3BANA 1IZKA 3GVRA 2YL6A 2EG6A 4XISA 1TX0A 2AKZA 2GK1B 2OLAA 5GVJA 1SFLA 1FWDC 3QFEA 4ZOAA 1I2PA 2PGRA 1OFDA 3QQ0A 1RCOB 4PR4A 1LOSA 4B91A 2ZX6A 2EPMX 5CGTA 3FX4A 1GORA 4FEZA 2IW0A 2B81A 3HU7A 4N02A 3MY9A 2C18A 2EGZA 2HVOA 3W1NA 3QGAC 1GG0A 1LWJA 1I0DA 3CHEA 2BY1A 3LENA 2VFIA 3V36A 5LXEA 4XG1A 2Z29A 4CCDA 3SW6A 4FZIA 3SN0A 3UZWA 4NX5A 3QV7A 4NASA 4AY8A 4BQ2A 2FPVA 3S9IA 4YJ5A 3JUGA 3DKLA 2HXTA 3GNDA 5D8ZA 2FHFA 4Z1AA 2V8ZA 3LXCA 1H1YA 3S9YA 5JH1A 3QR1A 2C1IA 5E9XA 3N4FA 3I6RA 1PX3A 1BFNA 2WSPA 2XVNA 4MJ2A 4BEQA 2GSHA 2XIMA 3O8AA 3TSDA 3T1GA 3QRHA 1LT8A 3RNDA 3KHJA 4DZ5A 3ATYA 5AECA 4B3ZA 1XINA 3BAXA 1PDYA 5A2CA 4F79A 4FR6A 1LF1A 2VEKA 4NQ1A 4IMFA 3GUGA 2PD9A 5D09A 2O7SA 1U5VA 4J1OA 1DIDA 2WZMA 5I79A 2W0UA 4XWUA 1S1RA 3LBMA 3R58A 4REQA 1SO5A 4H6QA 3ANUA 4ZXOA 4G8TA 2FTWA 4DAIA 4U5IA 3QPZA 3TZNA 4IISA 4QSHA 3S5SA 1KTNA 3WQOA 2I1OA 2V5BA 3TYEA 5KETA 2ZVIA 3DENA 2XDFA 4GWEA 3WO8A 4AC7C 3H2NA 1TX2A 4IPPA 3W73A 4HOZA 5AZ1A 1QASA 1GVSA 4HTYA 2O92A 1V3JA 4CNPA 4RK8A 3MDWA 3PPGA 5ABGA 5REQA 4YS1A 3QLLA 1EWEA 1QWGA 1GQNA 2W4XA 3I3BA 4WVXA 3LU2A 2B7QA 4WSHA 4AF0A 3SCVA 1R2SA 1YXDA 5T9CE 1EBGA 4KFNA 2BVTA 4XO7A 3HGRA 2PWDA 4HCHA 1FWTA 4JKLA 2EKCA 4LTSA 2Y5EA 1BTCA 2YBUA 1VFFA 4AD3A 1U2YA 2ZE3A 1Z8AA 2FB3A 1Y0EA 3VK5A 4W7VA 3MUCA 5A94A 3EDEA 4GISA 2A6NA 3TONA 4IMDA 1TO3A 1D8CA 1YDYA 1EFZA 2A3EA 4N6FA 1J0YA 4UTLA 2JE8A 3E2RA 1KM2A 3UESA 3RUBL 3LTYA 1K8YA 5H1WA 4PH6A 5FKYA 4AVFA 2FGBA 3OHIA 3VX0A 5C9ZA 1PB0A 4Z2IA 5BNKA 4H9VA 1R46A 5BXSA 1MQQA 3SRFA 5JQ9A 4I9TA 3F03K 4K1WA 2NUWA 1TG7A 1C9WA 1Q7QA 2WZHA 3WQCA 3H12A 3QMSA 3EWWA 3DHDA 3TC6A 4S2CA 5DXYA 2V30A 2BDQA 4J4KA 3ZYZA 4GI9A 1NTHA 1JZ4A 2ZRYA 1ZGDA 1H11A 4PZVA 1W0MA 4MFDA 4RZ4A 3NG3A 3M0ZA 3T81A 4Z2KA 1XGZA 2NWRA 2AMGA 1OHLA 4OQVA 1C7TA 4WLCA 1TSIA 4PULA 3V0SA 2NWSA 1OY0A 5CQ1A 3NL3A 2QNEA 4ZSUA 2IPWA 1XW8A 3H2CA 5I77A 1HJQA 1I0BA 3O15A 1E0UA 3T2QA 3C2OA 2ZE0A 4POCA 2VVNA 5E0CA 2QUNA 3ZSSA 3WQ8A 3F4DA 4B5XA 2EO7A 3WD1A 3CL8A 3GFXA 4LUJA 2DFAA 4XZIA 1RK5A 3C0QA 3VIHA 1A3WA 1TPEA 2ZA3A 4CQBA 4RNJA 3CAWA 4GXMA 1WP6A 1IEWA 4NZJA 4LUTA 3T8LA 3L2LA 4MWAC 2FPYA 3BK0A 4RJEA 3W2MA 5IDIA 3WLMA 4OIFA 4DYKA 2VEIA 3KP0A 3AQUA 3EB3A 3JR2A 4Y9NA 1AW5A 1SO4A 3SGUA 4CCEA 1F6YA 3AHYA 3IJ9A 2BBFA 1KV8A 4BI7A 4S3AA 3R8HA 3T4CA 3BW2A 2O55A 4HOWA 1JPHA 4CNSA 4IG2A 1AA1B 1BRLB 2GUUA 2PDQA 2OT1A 2CERA 1AW2A 5BW6A 5HBFA 4JEJA 5LNWA 2B7NA 3ABXA 7ODCA 4Q6XA 3SGZA 2UV8G 1GZGA 1AK5A 1FWNA 2E68A 2ZX9A 3FYOA 3D47A 3CYJA 3BOXA 4C1NB 2JIWA 4E5TA 2X40A 3N1AA 3DFQA 2D23A 2WSKA 5JXQA 3N12A 4I9JA 4NI8A 1UD5A 3GH4A 4DJEC 5D38A 3SRKA 2RUSA 1K7EA 2DORA 2YDRA 1V8EA 4U31A 1Q65A 3WDRA 1B4KA 2V5DA 4NZ3A 4YTTA 5M17A 2INZA 3SUTA 2PE4A 2ZVRA 1A5UA 1UA7A 2PU1A 3UGVA 2CLPA 3B8VA 3W7HA 1XWYA 4H9MA 2BV9A 4JQ4A 4Y90A 2YXXA 5I3HA 1CX9A 1EJVC 4DI9A 2C15A 3VNYA 2GK1A 3K5XA 3UXAA 4ACYA 3F5LA 2OKTA 2X30A 4RPQA 1MXSA 1UJQA 1W1IE 3VKKA 5AHLA 5G5IA 5F2IA 1FA2A 3ORWA 5D9MA 4AZGA 3H53A 1UOKA 3SURA 3IUDA 1DTUA 4ML9A 4G56A 1G6CA 4WKHA 2VZTA 3FXGA 2D22A 4PB4A 3C86A 3OYZA 1AMYA 1XIDA 4QG8A 2QJNA 1BLIA 3WNNA 4Y2WA 2OZTA 3M0VA 1XIBA 1B3YA 2QCDA 3UXDA 3PFMA 4C6DA 3B8DA 3O0FA 3QH2A 1CNVA 3HBLA 5D02A 3BV7A 2ON3A 4TVCA 1G0CA 3TQ0A 1WDDA 1PPIA 5FCZA 1CWYA 3FEMA 1E6SM 4JTFA 5TNVA 1GOIA 5BOFA 1K6AA 4ZQPA 3WLOA 1V6UA 3H7UA 1DWAM 4DJFD 1TV7A 3N25A 1V3KA 4L65A 1UPMB 3LERA 1P0DA 3C5QA 4MDOA 2CZVA 1BXNA 1YLVA 3FA3A 4IGMA 4ATWA 4GNJA 4ROPA 1TWZA 4L4OA 1EGZA 5HXMA 4B4HA 1P1MA 2DIJA 3K8LA 3RRAA 8XIAA 1TZZA 3KBWA 3OGVA 4KETA 2PDXA 1D3HA 3U9IA 3USZA 3UR5A 4HN8A 1BYBA 1M7JA 2FH6A 1TR1A 1AQ0A 1DHKA 3TMQA 3KOFA 5A2AA 4AAJA 1PYFA 1E9LA 2I7GA 5EL1A 2OSYA 4F0RA 5BXTA 4FNUA 4X22A 2J6XA 1I1XA 4PRTA 1ME7A 5I02A 1GWJA 3MO7A 4Q8VA 3BOLA 2PPGA 1UR0A 1PE1A 4XUGA 1OGBA 1IR1A 3NQ7A 2Z24A 2HMCA 2WNZA 4FI4A 5AYBA 3IAPA 2BP1A 1E6XM 3CAQA 1JPMA 3K13A 4GYPA 4HSNA 1XG3A 2OZ3A 3VOHA 2Z7GA 4JAWA 2TPSA 4UFMA 1L8PA 1RALA 3WELA 4AIEA 4HA4A 3O63A 2E6YA 3W70A 4F9DA 3HG4A 4RDYA 3R0KA 3G2GA 3QN3A 1A0CA 3P2VA 3DFNA 3VZZA 2NUYA 3VXGA 3M46A 3G0SA 2HDJA 3KCOA 1XYBA 4HZ6A 1NDZA 1PTGA 2DSUA 3UWWA 4NRSA 1KLYA 4PBGA 2E9BA 1XL9A 2PEVA 5CZTA 4H9XA 2AL2B 3U2EA 2FZBA 1R3VA 5HOSA 5DXXA 5E93A 4EVZA 5D30A 1CGWA 4NIRA 4G1NA 3P80A 2VFHA 2R6OA 1AJ2A 4OE7A 2VFEA 1FXQA 1LL6A 1XKYA 3NQ6A 4MDPA 3I7QA 1RJRA 3VC6A 4PUMA 4K7VA 4WY0F 3FJ6A 1WNOA 1TQJA 3H2EA 1JD7A 2BOFX 3DDMA 2WSQA 1JCMP 1OVDA 3GXIA 3VZXA 2Y7EA 3AUOA 2D73A 1JCXA 4M0XA 1B3XA 1WUFA 3W0KA 1TJ1A 2D3LA 1EYEA 4I90A 2Z1VA 5A1AA 3AS0A 3PAOA 2ODOA 1UWRA 4UQBA 2E8YA 4US6A 1VC4A 2NXHA 5H6HA 3UP8A 2BXYA 1XYAA 3ITCA 4KIEA 1VEPA 5I3GA 3N17A 3DERA 3W1AA 4OZOA 4JPGA 3W2NA 4BF9A 3ARVA 4PRWA 3EEGA 3N18A 3WJYA 4ZR8A 3NSNA 4B5TA 4TTUA 3HQ1A 4LNCA 1RA5A 1P0NA 2QPSA 4P7OA 2VC5A 1R3RA 1M03A 1EF2A 4I3GA 2DZUA 2QJGA 2YA0A 3MKKA 1AQFA 4A3QA 3SCQA 2DH2A 1PCWA 3KDOA 4GGBA 1XIEA 1R7AA 3L5MA 2E1WA 1Y7VA 3VD9A 4OVXA 1E5NA 3CH9A 2NQ5A 2YB1A 4FF5A 1F6KA 1H7PA 4ZB5A 2CLLA 1K7FA 4X2RA 4P8XA 3LCWA 5GQBA 5CZSA 4GIEA 1M04A 4X63A 4QDWA 4B5VA 1S2CA 2X1TA 4HNOA 4ADSA 1YTKA 3PF3A 3I7SA 5A6BA 3FSTA 2CC0A 4EXBA 1E9IA 3S1VA 1L0PA 1N8FA 3C3UA 2G3NA 4AD5A 1JQVA 2PTDA 2IQ0A 5HDRA 5ABEA 2PDPA 3ENLA 4AXKA 4CQDA 3OODA 1E0VA 3QC0A 2J74A 3RLUA 4EWND 3AYTA 3O6YX 4JHZA 3IIXA 2J27A 3WMLA 4UXDA 4W84A 3RPDA 2ZUWA 3ABOA 1F3EA 4O17A 3S2JA 1XG4A 3PG8A 4F0LA 3T40A 4JKKA 4C1NA 3G3MA 2H3DA 4GQ0A 4S3FA 4KFOA 3SCPA 2XN2A 4Y9OA 2RKXA 1KCXA 1UD8A 3WLLA 4XD5A 3DKJA 3N34A 2PU0A 3VMPA 3KS5A 4XB3A 2IKJA 1DV7A 3MWCA 2J7CA 3OVPA 3CZEA 4MVAA 3EB2A 5LGZA 4F2TA 1NFGA 1UKSA 3LBCA 4PCPA 1CENA 2NQZA 2V2HA 4Q32A 3W72A 1A0DA 3L4YA 5D04C 4AIBA 2F9RA 4N9BA 1E6PA 3EWZA 4M6UA 1OB0A 2FVLA 3IV8A 1V3IA 4HPXA 4WJXA 1LQ2A 3GTIA 2Z0IA 4YLWA 4O28A 3IPWA 1V0NA 3F7JA 3DU0A 1KWKA 1RXOB 4JZ5A 3T2OA 1A5NC 3LV6A 2CBJA 1UPPA 2FTPA 3AMCA 4C60A 2P76A 3FVMA 2HCVA 2BODX 4J27A 2VL4A 4N42A 1R2RA 3G18A 4K3ZA 1XQLA 4NZFA 1E6RA 1O60A 4Z2LA 3SY5A 3R25A 3MB9A 4AWTA 1GPFA 1JAEA 1UH3A 4HZ8A 1TJRA 3EWBX 1KBJA 3B0UX 1WDRA 3EA2A 3C2EA 1GNXA 2PDNA 3LCGA 3KLLA 1Q2RA 1ODZA 3HB9A 3NPVA 4RV8A 1PKNA 2GJNA 1T7LA 1ALDA 3LZ3A 5A8MA 3TR9A 3UJSA 4QJ5B 4Q33A 2DIEA 3BOFA 4Z0SA 2J25A 3AJXA 3W7NA 3C8FA 2ZWZA 4GIRA 1PZ1A 2HROA 3O3RA 3V5FA 1PWMA 2PUZA 2GPTA 3GC2A 1EGVA 3GE7A 4I5XA 2WHLA 3O2LA 3T55A 3TSBA 1UR3M 4JN7A 4W5ZA 3IGSA 3Q94A 5A6AA 5F2GA 3IAQA 3GDRA 5EMJA 1UHVA 5I00A 3DZ1A 1X8CA 5BMWA 3M5VA 4UTMA 4UCGA 3NAVA 2GQ9A 1LJYA 3KE0A 3QFWA 3W88A 3SBFA 3NZQA 3EXRA 4AZ6A 5CLWA 2WMJA 4M1RA 5FAGA 4FIQA 2J6VA 5CPQA 3M16A 1OGSA 1W9VA 1EL3A 4QSFA 4JN8A 4GYPC 4AW7A 1EOKA 4IXXA 2ZUVA 3WK1A 4B5NA 4JDYA 3BCJA 4JTHA 4NJGA 1DOSA 1OSEA 3R8RA 1ICPA 4U3AA 1TPH1 3A3HA 3UCCA 5C7HA 4DEFA 4HA0A 3GR4A 3BSMA 3NQCA 2PA6A 2CIPA 3WLHA 4JFVA 4MM1A 4MNJA 3TJIA 5CXPA 5AYIA 5K9DA 2P88A 5G1TA 4DBUA 3DFPA 1JCJA 1FWJC 2VRKA 2CNCA 3SUSA 4HHHA 2DIKA 1TV3A 2I5GA 4WRHA 2ZIDA 1V3MA 1EJXC 1Q6FA 3USBA 4JYFA 2V5LA 3AMKA 3BTNA 4AFYA 1E4NA 1QFEA 4LBUA 3ZQ9A 3LRLA 2VEPA 2XN1A 3I6EA 3OA3A 4UNKA 5CKSA 1XP3A 1ZBCA 4ASTA 3IIOA 1XRTA 5AKQA 3WL1A 3L66A 3AS1A 2W67A 3MHFA 1KV5A 3TLLA 1G1YA 1E6NA 4XSLA 2B4GA 4NAFA 3AIEA 2E77A 3MCNA 4N2YA 4JCLA 3HPFA 4L4LA 2O9RA 4IPNB 4HGXA 1PO9A 3ZT6A 2PS2A 1J6PA 1F3TA 2ZUNA 3PAJA 3UFYA 2YA1A 1A5AA 3CZGA 3QQ1A 5BU9A 4YN5A 4QAWA 2PGEA 1C92A 3IJ6A 3W1UA 1Z32X 4QROA 3UQNA 4RZBA 4UTJA 3RR1A 3QW3A 2ZFAA 1XIIA 4F0HA 3BGGA 2VX6A 5FJUA 2Q8LA 4HNNA 4WY0B 2Q3RA 4C5YA 4PB3A 1S46A 4D6JA 4R7JA 3F4CA 1T8QA 3QMRA 3DG7A 3WH7A 1OJXA 1XLIA 2DT2A 2ACUA 1ZL1A 4AWEA 3NQ8A 3ZVIA 2VZUA 4OWGA 1A50A 3T05A 4ZTYA 2O9OA 4KRTA 4BEUA 3ARZA 3U3HA 3LRKA 3EPNA 4AYSA 5I7GA 4S2BA 4N4QA 1JQXA 3N19B 2QIIA 2WVVB 3MMUA 1EGMA 1D7KA 2YR1A 4QISA 4FLRA 5HUOA 1XDJA 4HNTA 1SPQA 4TU1A 3ZVHB 1LM1A 2JKEA 3NQDA 1B57A 3FV9A 2D2OA 1BVWA 3TWBA 4MG4A 1Z3NA 3WLRA 2QCNA 3T42A 1K9TA 4PMZA 3BVJA 3HTWA 4Q4OA 1WXJA 3E49A 4QM1A 1QWKA 5HWNA 5MHBA 1H7NA 1ZU8A 1EPXA 2C79A 1GTEA 4G5DA 1V02E 3MSDA 2Q71A 3BICA 3EOOA 3R43A 3AALA 2BGSA 2A7NA 3M5ZA 3RLGA 3VDGA 3UERA 4QS6A 2CKRA 5CPSA 1KB3A 3VNIA 3VA8A 4DAFA 1WDWA 5DMYA 1TRIA 3IIPA 3H23A 4GZEA 5DRIA 3FA5A 3WH8A 4PGLA 3CWHA 2DZWA 5DO8A 3U4AA 1OCJA 1PXGA 4CQ9A 2D2GA 2IQDA 1CLXA 3ZLGA 1D3GA 1TPDA 3ARSA 4GH3A 3OEXA 3EKZA 3WEOA 2F2KA 4M3PA 1QW7A 1RY8A 4XVEA 3HMJG 4D9PA 2F61A 2WYSA 3K8MA 4H6EA 4A3UA 1TE6A 4OBSA 1M65A 3SSZA 3ZSTA 4K8GA 4JX5A 4LVAA 3FW6A 3P6LA 4KRUA 1EZ2A 1YTDA 3EWUA 4X0NA 3V18A 3MP4A 2KZHA 1DKWA 1P7TA 4UOQA 3ARTA 1VYPX 4W88A 3K4WA 1SJDA 2XFWA 2PDKA 1DQWA 5K4XA 3EWCA 4LCSA 3PZVA 1NM9A 4Z42C 1F61A 2KX9A 1YIXA 1QBBA 3G1AA 4PCSA 3R79A 8A3HA 1QI2A 2V2DA 3M5XA 2JEPA 2X05A 3KXQA 3KFTA 1P0BA 2HSAA 5D37A 5EFDA 3IIVA 2J62A 2VD9A 1MYRA 4GX9A 3QZ6A 1SZFA 2OG9A 4P8UA 4UTFA 4PL2A 1Z42A 1S1PA 3P14A 2J66A 1R85A 4FNQA 3NZGA 1TV2A 3TMLA 2VDIA 4S1FA 1AH0A 3C8NA 2DSVA 4PBEA 1JNDA 3QHNA 3CHFA 4WF7A 1A53A 3WDQA 4GKTA 3TDFA 1EZWA 3V3WA 1TPVA 5CJMA 3W71A 1FHUA 4NT0A 4OT7A 4E4UA 1V6YA 2G41A 3T09A 3COTA 3KVMA 1CI1A 1J6OA 3ITVA 2E28A 3ARQA 1KM5A 5E6ZA 3SJ3A 4A8LA 2I14A 1OYAA 2I5IA 3P5ZA 4Z08A 2OCZA 4QXIA 3RX2A 2A3CA 2PB1A 1NWRA 1AH3A 2GDQA 2WK2A 3H70A 1F5ZA 2NLYA 1R87A 3OQEA 2I57A 2HBXA 2ZTJA 2QAFA 1JYNA 4DBWA 3GXTA 1EWDA 3PB0A 1V0KA 3SQMA 3ZR4A 1E71M 1RH9A 1K03A 4JY9A 4M7SA 1VCVA 3MSYA 4AMAA 4P7RA 3WQDA 2YBVA 2VX4A 3NYDA 3N2OA 4O53A 3UXIA 3BSHA 3T7VA 1XYFA 2D0HA 5GNXA 5LIUX 2VHLA 5F4XA 4P2VA 1LRNA 1J9YA 1DJHA 1B9ZA 2ZZ2A 2JK2A 4H9ZA 2DZVA 1MI3A 1XCWA 4RE0A 3KDNA 1SVDA 2YZRA 3LQGA 1NOWA 4NYUA 2PWGA 3HQNA 2CHOA 1EEXA 4L61A 4D72A 2D1ZA 4Z0JA 4DM2A 3VIOA 3L5AA 3GIQA 1QT1A 3POCA 4CD6A 4D6GA 1RLDA 4HN4A 1WKYA 2WC3A 3OBKA 2J9ZA 2WO5A 1TJPA 2YL5A 3VGDA 5FEPA 1DWHM 3IUIA 1UP3A 3CHCA 4GO8A 4PMNA 3S9ZA 3SEPA 3CH0A 3KOYA 1OYCA 3VM5A 3GDLA 3URQA 1GW1A 3W86A 3UZXA 4PMXA 3N9SA 1L6SA 3TYBA 4C6FA 3QXBA 1KR1A 4KCVA 5FF2A 2X42A 4UTTA 3ZJ7A 3TR2A 3MTWA 3THUA 3W75A 2H8ZA 1I2RA 4AYGA 3WJWA 2EJ1A 4AX7A 2DQXA 1US0A 3CPRA 1T6MA 4AMCA 1OK6A 1A0EA 2Z2AA 3G1HA 4LYPA 4L1GA 4IGNA 4WY0A 4WGHA 2YGYA 3PVFA 4GK8A 2NQHA 3K2GA 5LNVA 3CC1A 5DMLA 1O1ZA 4H6KA 4DUVA 1YBQB 1RD6A 2WKGA 1IXQA 3N9RA 4DJDA 5I2UA 4JYDA 3W38A 2WMFA 3BMWA 3MUZ1 2DUXA 4JTLA 3TV8A 2BWGA 1MDRA 3VE7A 2FJUB 4RL3A 3PZ9A 2WVVA 4WZHA 3AU6A 3URNA 3E74A 1OABA 3KVKA 1TE1A 2VEGA 1NU5A 1JVNA 2QULA 3XISA 2GQ8A 1G9HA 1YW1A 3CPGA 5CG0A 3HV8A 4EF9A 1DYSA 2HQAA 1J0IA 4JTQA 3D3AA 3UVAA 1A49A 1EJUC 1GHRA 1QNRA 3A13A 5JBFA 2QF8A 3W3OA 1DTNA 1GKQA 3A5VA 3S2LA 2INEA 2ISVA 2OGJA 3VOGA 4NU7A 1FDZA 4I7WA 4GUJA 5G1YA 1O5XA 2J9YA 2OWWA 3JW7A 3M5YA 1IEXA 1TIWA 3V4BA 4XK2A 2EKGA 4DWSC 4IPLA 3HFTA 3N4AA 1ZSXA 4FXFA 1W1VA 4MHBA 2YLLA 3PC0A 2VDGA 1I1WA 1CZ1A 2DW7A 1KM4A 1DQXA 3IIZA 3WNKA 1NFBA 1MO0A 4UZSA 4ACZA 3HQPA 3N04A 3VCCA 2G37A 3VD3A 2BGQA 3HGOA 1JPKA 1OIFA 1B3ZA 1GYLA 4M6PA 4M29A 4AWUA 1W6TA 3M44A 3ITLA 7PTDA 2Z6JA 1WPCA 5CPOA 2C71A 2CLIA 3E0IA 2OWCA 1IIGA 4JL1A 4AH7A 2WKLA 2D2JA 1SW0A 3MHUA 1ZHAA 2R1MA 4BA0A 2PLJA 4JTRA 3UWQA 5HAOA 3RCMA 3S1GA 2IMRA 3WQWA 1TRDA 5ECVA 1U33A 3VABA 1G4SA 1XIMA 2W62A 3BGJA 1AL8A 1A5OC 3GDTA 2OEMA 3IJ8A 5H2ZA 4H4IA 3L4UA 3AIRA 3UA4A 2EBNA 3AYRA 1OG6A 1N8IA 2PDBA 1JI2A 1UA3A 2A7RA 4MIMA 3I6TA 1OFPA 3W7LA 4G7EB 1HJSA 3O07A 1RCXB 2Y85A 4HA3A 3HF3A 3BSGA 4K39A 3IEBA 1D3CA 2OO6A 1CGVA 4QHRA 3SGGA 1EDTA 1JIBA 4GNKB 4MWAE 1W9XA 3IUHA 3VOFA 1XLAA 3NXFA 2RDXA 1XUUA 2BGNE 1FDJA 3ZM8A 4G7FA 3NOYA 5I07A 4NI3A 4XSMA 1ECEA 3UBPC 4JX6A 3OLGA 4LBSA 1UCWA 1XSIA 5CBIA 5C0QA 1Q66A 3RXZA 3STGA 3TW7A 2P1FA 3V0TA 2BY3A 1HX0A 1W5OA 3CZKA 3MQTA 3V7PA 3KRBA 3RR4A 4S39A 3GYEA 2PTXA 3BV4A 3P0XA 5T9BG 1DWGM 4UTHA 3Q58A 2ZUSA 4DZAA 1UIPA 3WF2A 3ZWSA 4GVIA 1ZAJA 3ARWA 1IZCA 2Y5JA 4MWAD 4OV9A 2Y6ZA 4LC8A 4TV6A 3WJZA 4GC4A 3B3DA 1K4GA 5J5RA 4QLJA 2OX1A 4KQNA 4WKFA 2V3GA 1XLFA 4H2CA 4K8HA 3UT0A 1RJQA 3WK0A 1GCYA 1UIOA 3RU6A 3U8GA 4LEQA 3SECA 1EA9C 3WENA 1UR8A 3PWIA 4O11A 4S3DA 3TQKA 5HANA 1HJWA 2W66A 2BSLA 2V5JA 1PZ2A 1YDNA 1WA3A 2O4MA 2VO5A 1QU4A 3S42A 1KRMA 2Q8ZA 3MJYA 4P61A 1HO4A 1ZY9A 2C16A 4FO4A 4AD0A 5D8WA 3Q2DA 4HMNA 2YFNA 2QCFA 4H7VA 3G1SA 2FDMA 4E2DA 2QHAA 1XLMA 3OLIA 3BW3A 1TB3A 5AHFA 3S46A 1LUCB 1V51A 4ZO6A 4GQRA 4PEKA 1XRSA 1NELA 5FF0A 2Z26A 4DBSA 1VCFA 2Z25A 5K9XA 3DC0A 3CYVA 1E1FA 3VTRA 4FP1A 4BR1A 7A3HA 1GEQA 2DZSA 1CEOA 2PFHA 2WJEA 4FOJA 4NJKA 1W5MA 3LTPA 3BG9A 5F1UA 4P02B 1TIMA 4KEVA 3T0DA 1MEHA 1EUAA 3Q45A 3OHMB 2REQA 1PYMA 4O50A 2WSYA 1VQTA 3TNOA 1C8VA 1QO2A 4DJED 2CCRA 1M53A 4XKYA 4NNCA 1OFAA 4DVOA 1M7XA 3E02A 3FN9A 2PDHA 6A3HA 2ICSA 1EP1A 3GC5A 2VOMA 3OGRA 1Q6EA 3REQA 2WMIB 1H49A 2YDQA 3VX1A 4UTTC 2FJKA 4BWLC 3LM7A 4X9SA 2C14A 2J7EA 1TMQA 3AFBA 2VCBA 3OTRA 2WPGA 2D24A 3TSMA 1K7XA 1UBPC 4A8RA 5C9RA 3AUJA 1J18A 2NV1A 1AMKA 5A6SA 2A7PA 1JDFA 4GBDA 4AZCA 3CUGA 1TZ7A 1K02A 3LMYA 2OR2A 4FNPA 2GGEA 4ZCWA 5FEXA 5FL1A 3AC0A 1IWPA 1QAPA 3DYPA 1TPC1 3CUJA 1EDGA 1HKMA 4YYCA 2XGIA 4XBKA 5DBTA 1W32A 4QE4A 5I3JA 1EX1A 5IFTA 5AB3A 4UQAA 1QR7A 5ABTA 3MZ2A 3BH4A 3NDZA 3UY7A 5TQLA 3NO5A 3OLEA 1YBQA 3N14A 3OZPA 2Y63A 4AEFA 3A4JA 1DJWA 3FEQA 4GMEA 2DP3A 3C0JA 1V7AA 2R24A 4J3VA 2PDCA 2ZRZA 2J7FA 1QI3A 1XYMA 5CAKA 1Q4WA 1UMLA 5T26A 2HWGA 5C8BB 3OW1A 3AIUA 2DZXA 3GBDA 5DQPA 3GG7A 4QTGA 2Y8KA 4EKJA 1R3YA 1FKXA 4JEQA 3WUEA 4O14A 1NY1A 3V35A 4E38A 3T0BA 1ODUA 2DVTA 2DGAA 4TIMA 3TUUA 1DP0A 2NSXA 4DN1A 2CKSA 2VGIA 3OVQA 4YMZA 3ZLFA 1G4EA 3DCPA 3UGRA 4JS3A 4C6LA 1JZ5A 3LBOA 1J0KA 4DUWA 3VM7A 3KCLA 4LS0A 2FHCA 3WMCA 3JVAA 3M0JA 3G0UA 2ESCA 1H7WA 1YQ2A 2A0NA 1JCYA 4BI6A 8RUCA 3KL3A 4UNLA 1W17A 3IJLA 4KEMA 3VVGA 1GZJA 4KWVA 3SN1A 1KXHA 2G95A 4UQ9A 1OQFA 2YOCA 3EPOA 4ERGA 3ZR6A 2CLHA 2D0FA 4JXCA 1ICSA 1DXFA 4GRSA 1Q13A 1BPLB 3VOCA 1VKFA 3B9AA 1R7OA 3NPXA 1E0XA 3SUWA 2QJJA 1R47A 2O9PA 1FHDA 1GVIA 5D4YA 2C13A 4HBKA 3WLQA 3NTYA 1UP0A 4XBJA 2WNNA 1FBAA 5D2TA 4MUZA 2XH2A 1ONRA 2YB4A 4JHMA 1VB9A 1MXDA 3URBA 2BXZA 2QUVA 2YYUA 3EX1A 2RH9A 3PSWA 2HS6A 2VQTA 1JF5A 3KEHA 2VVSA 4L56A 3HOJA 2OODA 4WD0A 5FF3A 4U4MA 2OWXA 4KERA 1KA9F 1WZKA 1F74A 2ACQA 4LC6A 4D6HA 3RU8X 2DSWA 3VGGA 4GXPA 2WV8A 4PUJA 2ZKMX 1BQCA 4I6KA 3C0LA 2BVWA 1ITCA 1HJUA 5BOEA 1I6NA 2J7DA 1Q85A 4LBRA 2V68A 1ISYA 2YA2A 1Z69A 4PTNA 5G1MA 4MNMA 4R5EA 4MAZA 4H00A 5H8UA 1JEZA 1NP0A 1E6QM 4MWAB 3W76A 1UWSA 3NO3A 3JS3A 3AMLA 1GVFA 1SZGA 3TTOA 1IXOA 1EHAA 1JR1A 2DY3A 4CEXC 5F2LA 1L6YA 3N3MA 3H2AA 3BWWA 3PNZA 3W7RA 3LUTA 3E38A 1TCDA 4D1IA 3SUUA 1W9UA 5A8QA 4Q4QA 3N2BA 1ZJIA 5HQMA 3GTNA 4CN4A 3OBAA 1K4HA 2E5DA 4L9YA 3U5UA 1A5KC 5DN1A 4PYSA 4QJ4B 3KZSA 4DO4A 4G7EA 2PGWA 1RQHA 3FHAA 8XIMA 5CSYA 3DFYA 3N6HA 2D69A 1RZMA 5JH2A 4BZYA 3G5EA 1J0HA 3ARRA 4OECA 2VELA 2GFTA 3IVSA 3HN3A 4AZ7A 2A1YA 4JTIA 3EOEA 2JEQA 4L6DA 4G6CA 5GNYA 2V6AA 4IIEA 3L4WA 2P5NA 2VZVA 3SRDA 3WFAA 3TU9A 1V03A 1BTMA 2RDTA 4K1GA 3WLNA 1Q8AA 3HO8A 1JZ8A 4CEUC 1S38A 1JDAA 1DIEA 1N82A 2GGGA 4HK6A 2A6LA 1X39A 3KLKA 1VBRA 4ZOEA 3MU7A 1OG0A 4XAZA 4WJ8A 5G2IA 1NWUA 2Q8XA 1OFRA 3VDAA 4KIRA 2PODA 4MMWA 3DX5A 1XQKA 1G7VA 3PTMA 1I8JA 3LSCA 4CU6A 2NZLA 2V9DA 3G0XA 2IPGA 4IZGA 4I9AA 2H8XA 4PL1A 4F2BA 1PIIA 4F0SA 2EPOA 4GZJA 1WZAA 4PA8A 4XD6A 3E3HA 1H3GA 2Q02A 1CGTA 3WJXA 3AHTA 2O7QA 3SCOA 1GQJA 5LNUA 2E9MA 2FMNA 3VKCA 1REQB 3EOLA 4DY1A 1KFKA 5I09A 1CXEA 2BB0A 4HU8A 3AWNA 4QITA 4MF4A 1EEPA 1X7IA 2G5WA 3BLFA 1S2VA 1NWTA 3TC3A 3TXZA 1B4EA 3C3NA 3VIPA 4NILA 1OFQA 3VIJA 2BMBA 2G97A 3BMXA 4H01A 3TYCA 1ZNNA 3U5YA 4HJWA 2FHBA 3ERPA 4C7GA 1XCXA 4MADA 2VYOA 4REQB 1QOPA 5PTDA 3WZ0E 3N29A 4CKQA 1UOZA 4A2SA 3NZRA 3APTA 4GH1A 3WUBA 2Z1WA 4DHGA 3A21A 4QQ3A 1SQ7A 3DG6A 3O7UA 4MY8A 4O10A 3WD2A 4LAMA 2NXIA 2ZWYA 2ISFA 1T41A 4IP5A 4CD8A 4Z1CA 5LHFA 1C3FA 1S5WA 3A47A 4RKAA 1UKQA 1R0MA 3CLWA 3M7SA 1V6XA 1T99A 5LHEA 3W6MA 1Q6OA 5AC7A 5REQB 4QE5A 2WMKA 4PTVA 4YHGA 2BG5A 3I7RA 1E56A 2X1RA 3RM9A 1XLGA 5FD0A 3RRXA 2QJIA 4CCZA 1QPQA 5GNZA 4AF0B 4DYJA 1GVOA 1KRCC 4PCNA 1ZUAX 2EF9A 3W7JA 3UU0A 1PDZA 5CPMA 2WKJA 2F8QA 3S1XA 3FNDA 1FP9A 1Q7ZA 4FR1A 1J79A 1HNYA 4L6OA 4MNKA 2CWXA 3U57A 1F3XA 4NP7A 2FLIA 4QRNA 4MB4A 4ALDA 3N15A 4FK9A 3LQLA 2R91A 1YPFA 1HKVA 3TYDA 4AG0A 4JFUA 2QJMA 1DJYA 1B3OA 1Q4NX 3IWPA 5AC5A 1XPGA 2X1IA 3RO6A 1P0KA 3DG3A 2NX3A 3SAZA 4O4VA 1VYSX 3PB2A 4H7CA 5AVHA 4YTRA 3QM3A 1AJ0A 3HPZA 2C91A 4LFYA 1R30A 4FX7A 3GTXA 1NSJA 3KRUA 2PRHA 1SZEA 3A5FA 5HJXA 3M64A 2AL1A 5FJTA 3LNPA 1KXVA 2WOQA 2NT0A 7XIMA 2Z00A 1GJPA 3OP2A 3LCLA 1PBGA 3W23A 5LNSA 2GJXA 3D6NA 1WZLA 4UUIA 5FJRA 4L64A 2P8BA 2O0TA 3V5CA 4DF0A 5G4WA 3ABZA 3TVAA 1QPRA 1XF0A 1JG9A 4NJJA 1L6WA 2IXVA 2QT3A 1KO0A 2ZX5A 5I0DA 2PF8A 2NX1A 2QVNA 8TIMA 3G1YA 3GRIA 1ISXA 3UPBA 3BCFA 4LAKA 1VF8A 3LS9A 2BLEA 4GFSA 5A2BA 4M6VA 2OZ0A 5DCDA 1UH2A 3B4UA 2PDFA 3PUOA 5LIWX 1US2A 2QQ6A 3NDOA 3EX6A 4ZBCA 1H50A 3UWEA 3TYUA 1A4MA 4ECLA 3QJAA 4YTQA 3CV6A 1QOXA 3TOPA 1Q3NA 3B4YA 3SDOA 5D2YA 5ABFA 4LUTB 4AEEA 4P7NA 3W00A 4JY8A 3ZT7A 1VENA 3PHAA 1VEOA 3ZJ6A 1Q2SA 4R53A 1Q6DA 1W8SA 4HSOA 4R7OA 5DEZA 3GHSA 3STFA 4DIAA 3VNJA 4C5ZA 1JF6A 3CB8A 3UR8A 4AXNA 2A21A 1CLKA 4BQ5A 1MEWA 3DC8A 4MWAA 1R3QA 1U1HA 3IK4A 2YW3A 3H7VA 3PWGA 3G6LA 2NQ9A 4IH3A 2HTMA 2QJHA 1FY6A 5I03A 1S2UA 1TTQA 1Q6GA 1T96A 3CJPA 1AH4A 1HJVA 1HTIA 4IG2B 2QZRA 2WANA 4YVVA 4GIYA 2YCIX 3BC9A 4JIPA 4KRZA 4FNTA 5I78A 3M0MA 2OT0A 4O1FA 4Q8MA 3N6QA 2B7PA 4ZL1A 1SJAA 2EPLX 2R14A 1UB3A 4D6DA 4TR9A 3N6JA 1QHOA 1X1ZA 3M1ZA 5C9WA 1CPUA 2WJFA 3NR0A 5CG7A 7TAAA 4ILSA 3W7MA 1WXYA 3RYSA 2IKGA 4V27A 4DQWA 4FLSA 1V3LA 3BUVA 2BVYA 4E3VA 2XTKA 2VR4A 2E5CA 1E43A 1EJTC 3V5OA 5HNNA 1GTHA 4MTVA 2V0TA 1LRQA 3RPTA 2YDSA 3AO0A 1YADA 4DJEA 1ICQA 4YVXA 1UUMA 3QEZA 3K1GA 1V6VA 2XIQA 4PTDA 1WAWA 1EF3A 5HATA 3MUAA 1DBTA 2XPKA 3KS6A 3PM6A 4GABA 4QNEA 1GOMA 3NL2A 4YTUA 3FJ4A 4RCXA 5AC6A 2WQPA 1I2OA 1W3HA 1YPXA 3IGHX 5FL0A 1US3A 4OTKA 3THCA 1WO2A 1QI4A 4JD4A 1PWLA 4O1DA 3EZ4A 5A6BD 3CTTA 2G4JA 4DJFC 3W4RA 1XDLA 1TR9A 3QV8A 2OYLA 3P8JA 4LAUA 1EHNA 4N0RA 1NF7A 3HMCA 2QCDB 3VE9A 2C1HA 1KCLA 1MFVA 1F3WA 5ABHA 3FYPA 2GJPA 2YYTA 3MW7A 9XIAA 2GWGA 5D9NA 4OHQA 1HQTA 4XV0A 4WUIA 2Y2WA 3W1RA 5XIMA 3UWYA 1JFHA 3L65A 4CNUA 1XBXA 5HA7A 3CGTA 4WOQA 4CD4A 1O1HA 1P4CA 2V3FA 1A3XA 1REQA 3CXOA 3HG2A 3V0UA 2HV5A 4XZHA 3GFYA 4V15A 2V67A 1FH7A 2P3ZA 3OZOA 5A6KA 1ZQ5A 1H51A 1UD6A 5U7SA 2MANA 4ZOCA 2B0MA 4UR9A 2WCGA 3R8GA 3G77A 5JUVA 4J35A 3OU8A 3QSRA 1T40A 4A22A 2BASA 1MZRA 3W82A 4EPEC 4TTGA 3WBWA 2GZXA 4AD4A 3FYYA 3LCXA 4IICA 1TREA 1TJ0A 5ECUA 4PB5A 4PUNA 5A8OA 1POJA 2WB5A 3IV3A 1F07A 4J2PA 4F40A 3CO4A 1GOOA 1TV4A 2V5CA 3BLOA 2J8FA 3NO1A 4TXEA 5BROA 1W31A 2VQUA 3LPGA 3DUGA 1MXGA 3IK2A 3PWAA 2W92A 3VUPA 2Q09A 4RLIA 3QW4B 4ZQNA 4LVDA 2CW6A 1V77A 3QPYA 2XM2A 1A3HA 1FVPA 1ZB5A 3P5YA 4GJJA 2FMOA 4HP5A 3LGGA 4B3KA 1PKYA 4RE4A 4TVUA 4D8AA 1GVQA 3LHUA 1PHQA 3E2QA 4PMJA 4RV3A 3R7MA 2WWDA 6XIAA 3W1MA 1JZ2A 1GQLA 1XLHA 1SJBA 2PCEA 1ZAIA 1AZ1A 5BWFA 3ZIZA 3ANVA 1RUSA 3QQWA 4DF1A 4B5SA 1RBAA 4DLMA 1ZRQA 3GVWA 1M9HA 5LXXA 3L2IA 2FGZA 2OKOA 1KWGA 1FH8A 3GU1A 4YCOA 2ZZ3A 1IYXA 4KGJA 4NNAA 1RJPA 1VR6A 3BG5A 2TRSA 1BGGA 4E8DA 1P5BA 2XWEA 1Y8BA 3GK0A 1PIGA 1IEVA 1JGIA 1CYGA 3UNDA 3EX4A 4IMGA 3SCWA 1W9BM 2XGZA 5IFPA 1VAHA 1VZWA 3NQGA 1XS2A 1HZYA 1ZJBA 1O5RA 1PAMA 3ALFA 4KWSA 1A5LC 2YJQA 4EK7A 4NG3A 2CBUA 3C2VA 2X7WA 3DFHA 1PCKA 2QVHA 1R38A 3OJGA 2RJGA 3EMCA 3W84A 5FEWA 1RBLA 3MP5A 4HNLA 5GJNA 1SM9A 4DZIA 4XUYA 2OLSA 1IEIA 5H8PA 4XZBA 3QZAA 3HIJA 2QCHA 1F4HA 2V2CA 3RFAA 1L2QA 4HJFA 4OJYA 3BGAA 2V3DA 2VRQA 3XINA 3CUFA 3UY8A 3PNUA 3UXKA 2G96A 2IKHA 3TTYA 4MPQA 2Y5SA 3H2OA 4F0MA 3WQ5A 2C0HA 3M47A 3IJQA 2OFJA 1RK6A 4X0VA 3KZPA 1OZMA 1NF0A 3EDJA 2VX5A 1UKPA 1MUCA 4E2VA 1X1NA 1XBYA 1KR0A 3M0KA 1XCFA 3GWQA 3WNOA 1TPB1 1WUEA 3QKEA 1EIBA 5CAHA 3CV7A 3M6DA 4W5UA 3OVRA 3Q37A 4C6BA 2VDHA 4WDTA 2XU2A 3G1RA 5CC3A 5DT7A 4F4RA 3DHPA 3UG5A 2P0OA 1ONWA 4GIAA 3FDKA 3GXMA 1HGYA 1XYCA 3CZ8A 2YSWA 3AWOA 3WLIA 4ZO8A 4Q8WA 3WG6A 3LYEA 2GUYA 4IWWA 2ZDSA 1HXJA 4HKPA 1LYXA 3BO9A 2NQLA 4E8GA 1O66A 1RVKA 3M0HA 1XH0A 2R1LA 3ZOAA 4E4FA 1W2PA 4V2XA 1XH1A 1KKRA 4LX4A 4PFMA 3UNTA 2QCEA 3EX2A 4LVFA 2FKPA 3W07A 4JFSA 1LG1A 4NZCA 3W22A 3S1UA 5G4HC 3G8EA 2XIOA 4IPIA 4P5UA 1ZBWA 3QR0A 4H19A 4DB7A 1UQYA 1IT8A 3VNLA 4O8RA 1GOKA 3EDFA 1EC7A 4M81A 4IL2A 2DJLA 4BKNA 1C29A 1HJXA 1RBOB 4GZ7A 3OOQA 2ZUTA 4D71A 1ZENA 2ACSA 4K6AA 3QHMA 3L21A 3W7PA 3NM3A 1TA3A 4Q7BA 4C6KA 4N6EA 3VKJA 3GNRA 3NL5A 3ITXA 4LV4A 1UR2A 5EPDA 3BCDA 1SR9A 3VKAA 1JAKA 1EBHA 3FGCA 3F4WA 3WLJA 4W85A 5HULA 4C7DA 3TA6A 1MMFA 3G6MA 4XD4A 2NQJA 5A3HA 1VLIA 1B31A 3W37A 4GQBA 3F4NA 1W3NA 4M24A 1JYWA 1ZALA 3P67A 1KRAC 1IXPA 3CK5A 1OT1A 4JTDA 5LIXX 1XXXA 5C9XA 1SW7A 3SZ8A 3DAQA 3PJWA 2EPHA 4Y8FA 3AU2A 3CMJA 4JHOA 1WB0A 4ZE4A 4BF7A 3KTXA 4LAOA 1J2BA 3GU2A 1I9CB 4MYAA 3W27A 2F2HA 4AD2A 1EKOA 1ISWA 3EWXA 2Y4SA 4RPPA 2AOSA 4OBTA 1D2KA 4IGSA 2PWFA 4EOUA 3ABQA 3SIMA 4M51A 4PN2A 5CSSA 3BZJA 4GI6A 1LP6A 3GTHA 4ZQOA 2VGGA 1FH9A 1R86A 1J11A 5IRPA 1JCTA 5EB8A 3WY1A 5JVLA 2V5KA 3GHTA 4DO5A 3WCZA 3CV1A 2J7BA 4RUBA 4ZEPA 5AYYA 1FWIC 3VGBA 4H41A 3UWZA 1E72M 1XLKA 4L4MA 4Z2GA 5CZKA 4C6OA 3MWAA 4WX2A 2CLMA 4MLRA 5MKGA 3NWRA 3GVQA 4QG9A 3QV9A 4UQCA 3A9IA 4IMEA 4IX2A 3T2PA 1OCNA 5I3DA 4GBUA 3WK3A 3LNMA 1YTEA 3CQJA 4MB3A 1B1YA 1L9WA 3EXTA 2AAMA 3L7RA 4KKXA 4W7WA 1FDYA 1EPVA 5CGMA 1F9CA 1QNQA 2YLAA 3PS7A 3MS8A 1QTWA 5M3WA 4B92A 1VYRA 4HHMA 3WH6A 7REQB 4IIHA 1TELA 3NZ1A 4DWSD 2R82A 2FFCA 3ARPA 4Q8TA 1KM1A 5F4SA 2XVKA 3CWOX 4PUDA 3RCNA 3BXWA 4Q8QA 1W1B1 4KFPA 4ZZ9A 1QBAA 4ROQA 3MVIA 1EOMA 4K37A 4O19A 1W9PA 1BXBA 2WM1A 3QGVA 4HIBA 1BF2A 3UWVA 3VDCA 4XZLX 2G3JA 1KBBA 4UR8A 1CTNA 5CPTA 3I4EA 3TAKA 3ZJ8A 3MYOA 2QLYA 1UWTA 2DU2A 1PUDA 1BG9A 1LZOA 2OOGA 4TMBA 1VFHA 1EQCA 3KVJA 2GUBA 1VP5A 2WXDM 1O6IA 3S47A 1RA0A 4CVWA 1GKPA 1WKFA 4ZB2A 5TD4A 3UPMA 4ZXLA 3H8AA 1IR2A 1HKKA 2OB3A 4YNGA 1KFCA 2VXNA 4P7QA 1E1CB 3W2LA 4ADTA 2DV0A 3RX3A 3F5JA 1OZQA 1XIGA 3RLHA 1VFMA 3P7YA 2VRJA 4DO6A 5HMSA 1VJIA 3CHVA 1KBKA 3K30A 4QX4A 1HKJA 3NQAA 1ADOA 4DUOA 1XICA 3PBWA 5CBJA 3HPAA 3FKRA 1H2JA 2W63A 3WD0A 3MKVA 3SCTA 3HM7A 6REQA 1UZHA 2YZ5A 2VOTA 1LLWA 1GPWA 2QPXA 3HGSA 4LF2A 4OBRA 4F2UA 1CDGA 1FWHC 3UCQA 2GDUA 3U6WA 2PTWA 4QIUA 5BOOA 1DPMA 3B05A 2P3EA 1WKDA 2EEXA 4U3CA 2TODA 4S3EA 2ZZ7A 2PWUA 4WEVX 3AXIA 4WOZA 3BMVA 2B31A 4QBXA 2XZ7A 2XUCA 2VD8A 3P81A 2FB2A 1PSCA 3DYMA 5LA2A 3LZ5A 2J7HA 4IIGA 4L80A 5FACA 1IXNA 3WLPA 4NAFB 4W93A 3KCJA 3BAWA 4LYRA 4F0KA 5FEZA 2A3HA 1JZ6A 3CL7A 4WKAA 3ZWTA 3PPCA 4GVFA 2I17A 4BF5A 4LYQA 3V1PA 5M03A 3CAVA 2HPIA 1JL8A 3EDKA 2PDIA 3ARXA 3IGXA 1O12A 3C0SA 4N9DA 4JNYA 2J13A 4HU3A 4A35A 4GVHA 3NIYA 1F2JA 3RMJA 1B3VA 4S3JA 1WAUA 3AI0A 2NVAA 2CLEA 2QR6A 4LEFA 1CIUA 3CEPA 4YPJA 3EDDA 4OFCA 1FP8A 3BJTA 1CXKA 2CZDA 1CXHA 2E9LA 1WDSA 1DE6A 2A2IA 3QKZA 4S3GA 3UETA 1DJIA 2G3FA 1SFTA 3B0XA 1OINA 1BF6A 2R1NA 4JR5A 3FVDA 4ZFCA 4W87A 1QATA 1KXTA 1QO5A 4ZQMA 3LV5A 4JKMA 3RITA 4Z1YA 1AQMA 3PUEA 2YCKX 4W89A 1UMYA 1EIXA 3FOKA 3FAWA 5LSMA 2YCEA 5I3KA 3WH5A 4HOXA 4B5WA 1X1OA 2CZEA 2F6XA 2I9EA 4FPSA 3R0UA 1JD9A 5C7VA 4EPKA 4HHPA 3BAKA 1IF2A 1CLVA 5KITA 2GVYA 1JRCA 3WX7A 2OELA 3FLUA 5A6LA 4DXKA 2ZXAA 5HQLA 3G3DA 4KCWA 3RO8A 4RZ6A 4EXAA 1ME8A 4QCFA 3SADA 1BQGA 1KM6A 1QOQA 3PZOA 1NDYA 4O52A 1NOUA 1JJKA 4CQAA 3GC4A 4O0KA 1E70M 1KQZA 2QMKA 4US5A 2QUUA 4NX0A 3S2NA 3W7CA 2F6KA 2HISA 4GY7A