3SUWA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with nhac-cas
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
519
structure length
504
Chain Sequence
b'HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase
total genus 193
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3suwA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3suwA02
2OYMA 1Z32X 1FHDA 3W4RA 4JKLA 3AMGA 1OD8A 2BVYA 2XVGA 1CGVA 4AC1X 1EXPA 1BYBA 1WDSA 1C8XA 1M03A 2YDRA 3AIUA 1X6LA 3PZOA 1JL8A 2QMKA 2WNWA 1W3KA 2PI6A 4CN4A 4OBSA 6CGTA 1WB0A 3ARTA 4YN5A 1JZ6A 1E40A 1E15A 3GBEA 4HU0A 3W53A 1KBKA 4YPJA 5IHRA 3WUBA 4C91A 4J28A 2DSVA 3WKZA 1V3LA 3WEMA 2WZEA 2C0HA 2V5DA 3WNOA 4UQEA 2WVVA 1J0ZA 2GJRA 4P7NA 2JE8A 2AMGA 3S2CA 4E8DA 3CUHA 3AHXA 3AXIA 3VTRA 1UD4A 2VT0A 4GQRA 2XYLA 1UR9A 1HKMA 3GNPA 4HMEA 3T2QA 2XHYA 3UG4A 4B3LA 1O7AA 2VX7A 1IZKA 4W5UA 5CPQA 3T0DA 3CIVA 5C70A 2J78A 3WN6A 5M17A 3KZSA 4BF7A 3K46A 3TTYA 1H0IA 1W2VA 4S3KA 1ECEA 3QHNA 4HA1A 1WE5A 2VJXA 1L0PA 4JHOA 2CNCA 4E8CA 4GO8A 1RP8A 2YA2A 2ZX5A 1UUQA 3EDDA 1EO5A 2ZUTA 3TTOA 3AIWA 5D4YA 2IXUA 1HJWA 4GZEA 1W1PA 1CTNA 4Z2IA 4AZCB 1HF6A 2JIEA 4A4AA 1UZ4A 3OIHA 2GJXA 5KEZA 1UWRA 2CETA 2VZUA 1R87A 4XZWA 3WD0A 4B3KA 4CCDA 2BHUA 2PB1A 1SR0A 2F61A 1N82A 3GNOA 1G9HA 4CN1A 4P7LA 2CITA 2WVTA 1W9BM 1U33A 1XH0A 5E6YA 1ESWA 1FH9A 5BRQA 5CQ1A 1UOKA 4ZE5A 1W91A 1PJ9A 3ARUA 2OYKA 1WNOA 3VMNA 4GZJA 3QR3A 2GDVA 3AYRA 4U5KA 1BTCA 3GDBA 2WHMA 1P6WA 3ALFA 1ISYA 4MJ2A 3VOCA 4DUVA 5D8WA 1EOMA 4HPGA 2QHAA 2J79A 2WW5A 3W26A 3RM8A 1M53A 2MANA 2UY3A 2ZIDA 4PMXA 1SFSA 4CUCA 1OT1A 1V6WA 4A3HA 1B3XA 1NOFA 1Q6CA 4WSJA 3PZVA 2X8RA 3MSDA 5JIWA 2DSWA 5A8QA 1Q4NX 3L4XA 4D6CA 2VRKA 5E70A 3PZNA 4NRSA 2JALA 4QDMA 1K9DA 1EIBA 3AS0A 1GVIA 3T2PA 1H1NA 3MO4A 3WEOA 1OIMA 1ITXA 1E5NA 3PZQA 5I2UA 3VGEA 4CCCA 4H8HA 3ALGA 1LL7A 1US3A 2V3DA 2ZWYA 2JEQA 1HKJA 3PZIA 1XRVA 4FF5A 5I24A 1UQYA 2XVNA 3PN8A 1C92A 4Z2JA 4Q22A 2XVKA 4RL3A 4C7FA 4OBRA 4PTXA 1ZL1A 1QVBA 1VF8A 4AZGA 1JAKA 4PMDA 5A69A 4M24A 5HDRA 1V6YA 1BPLB 1AMYA 2FH8A 2CKSA 4E4PA 2XVPA 3NYDA 4PMNA 5BXTA 2BS9A 5BRPA 3KL5A 1Y7VA 2E40A 3W81A 1C90A 3VILA 1GVYA 1GW1A 3M7SA 3T0BA 3WFLA 5A95A 1DWIM 1JF5A 1A47A 3FY1A 4MB3A 2WC4A 3MMDA 2ZE0A 3U7BA 5JBEA 5AC5A 3WQ6A 2GK1B 5I77A 2JFEX 1OM0A 3WMBA 4U2YA 4Z2HA 1GCYA 4CD4A 2QPSA 1EGZA 1PZ3A 2VR4A 4TVDA 3AJ7A 4FMVA 3VIJA 1GZJA 1H4PA 2VRJA 4MB5A 3JUGA 3THCA 4DWSB 1E56A 1UR0A 1EDGA 2E8ZA 4HMCA 3WF2A 1ISWA 4ACZA 1LG2A 2DPEA 4PTWA 1QBBA 3BMWA 1BYDA 2RGMA 3ZO9A 4GINA 3IK2A 4J3WA 1V6UA 2E4TA 5D9PA 4AIEA 5IFTA 2D23A 1V3MA 5FIPA 1H0GA 4J3XA 1J10A 3CHFA 2OWXA 1B3ZA 4HP5A 4ATLA 3IAPA 3U57A 1UKOA 2DH2A 1GOQA 2CEQA 2OWWA 4DUWA 4Z2LA 1UKQA 4QLJA 3AHZA 3IAQA 4AYSA 1JDDA 3VM5A 2CIPA 2J77A 5CPSA 3WFZA 1V0NA 3A47A 3WH7A 4XZBA 1BLIA 3VIIA 2VZOA 2XSAA 4BQ2A 2WZHA 2E9BA 1C8QA 5I79A 2WMFA 3TTSA 5AC4A 2VO5A 3W6LA 1TZ7A 7A3HA 4U31A 5A3HA 1O6IA 1E6RA 2ZX8A 3A4AA 3EDFA 5DT7A 3VX0A 3BSHA 1MW1A 3AISA 1W9XA 2WBGA 3NCOA 4P8XA 1JD7A 2DSKA 1AVAA 4J3VA 4U2ZA 5FL0A 4AD2A 3VM7A 1J0KA 1R7OA 1GQKA 1V3HA 4BQ5A 2ZUMA 3OBAA 2YBUA 3T0AA 2V5CA 5I78A 5GPRA 5CZKA 1YHTA 3GH5A 1TR1A 2DDXA 3NIYA 4PMYA 3GBDA 4ZENA 3WF4A 1CPUA 4AW7A 4ATDA 1EOKA 3HJEA 5A2AA 5DT5A 3K8MA 3NDZA 1B30A 2DT3A 3W6MA 4U5IA 2WLYA 2J62A 3BGAA 1UD5A 1UKSA 5ABFA 4MB4A 2WMKA 1KCLA 1MXDA 1LJYA 1W32A 4AD0A 3AI0A 4QAWA 5ABEA 3CUIA 3THDA 2BVTA 3AMLA 2WZIA 1BG9A 3B9EA 2G4FA 1M7XA 1BG4A 5EFDA 4F79A 1HXJA 1DWJM 1UYQA 2Y8VA 3A3HA 4LX4A 2XVLA 1FOBA 1XHGA 7TAAA 3OLEA 1KBBA 1E43A 4KWUA 1XSKA 1GONA 3CO4A 2OSWA 4RE2A 4D6DA 4WLCA 1CGXA 1DWAM 1JI2A 2WC3A 3WDPP 4HA4A 3MMUA 3W24A 1SMDA 5IFPA 4IM4A 3SEPA 3VGBA 5CSUA 1QI3A 2YOCA 2WPGA 3VIHA 4UQBA 4PCTA 1HVQA 2VVSA 1BVZA 5EMYA 1XD1A 4Z2GA 2G8ZA 1E6NA 4PBGA 6TAAA 2EPMX 4QCFA 3OLGA 3ARZA 3GXMA 1XCXA 2F8QA 3TA9A 3RPMA 4BCEA 1EDTA 3AZTA 3WBAA 3F5LA 4A3YA 3ZJ8A 3VMPA 3OZPA 1VJZA 1W9UA 3UETA 3N11A 3AIQA 5A94A 2ZXBA 4L4OA 3ZSSA 5GQBA 4J3TA 3K4AA 4W85A 3UR7A 4AWEA 4TVUA 1JDAA 2WMGA 4GKLA 2G3MA 3BXWA 1Q6EA 1M04A 1MXGA 1JXKA 3OGSA 3VIKA 5E9AA 4B9ZA 1MQQA 4F9DA 4LPCA 3CH9A 2WMIA 2D24A 2W62A 2Y4SA 1PZ2A 3N18A 6A3HA 3WUFA 4U3CA 1VFOA 3BCFA 1MFUA 3SUWA 2XIBA 3E1F1 2ZWZA 1W9VA 4OOZA 1OWQA 3UG5A 4MAVA 1UH2A 1GORA 3UG3A 1HT6A 1NARA 2CBUA 4UFHA 5ECUA 3CUJA 2W67A 1E6SM 4XV0A 2XIIA 2PF0A 3FXYA 3ARQA 4GXPA 4Z2KA 3VIFA 4GO9A 1KQYA 3WSUA 3BLPX 1KB3A 4H7VA 1V6XA 4CKQA 4KH2A 2QPUA 3WD2A 3KL3A 3TP4A 5EBAA 5CJ5A 5AYIA 3BAJA 1WZAA 5BROA 4CU6A 2CBIA 3VIPA 1JNEA 1B90A 1B2YA 3WNMA 3ECQA 4HZ6A 1BHGA 3TONA 2YLAA 2QF8A 2YL9A 3AZSA 3VUPA 5LYRA 2YL8A 3J7HA 2BHYA 2ZUUA 3NUKA 1JXJA 1PX4A 4YHGA 1E70M 3VD4A 3UERA 1G01A 4JCLA 3W0KA 1HKIA 2PBOA 3AOFA 4FLSA 1UR2A 1ZBCA 2XJ7A 2XGIA 3CMGA 2OYLA 4HMDA 3WDQA 2VVNA 2XFYA 1NP0A 3VDAA 2BNJA 3PZTA 1Q6DA 4IPLA 1HN1A 4PCSA 1H2JA 4MNJA 1WPCA 1D7FA 2J8GA 1GOOA 4HOWA 1HVXA 5M03A 3WL1A 4W93A 1CXHA 1GOKA 1CNVA 1J18A 3LPOA 4J3UA 2BFGA 3DYOA 3OB8A 2F2HA 1E0VA 2PBGA 2G41A 2FGLA 3QOMA 2VZVA 2D20A 2WCAA 1XH1A 2UY5A 1LWJA 2ZUVA 2OSYA 3ZMRA 2J7BA 2VL4A 1HP5A 1ISXA 1LQ0A 1KGXA 5CGMA 2VQTA 1G94A 2JF7A 1B3VA 3D3AA 3OG2A 4LYPA 2DIEA 2EPOA 5DEZA 3WDHA 4TX6A 2EPNA 3BAXA 3B9AA 1HNYA 3WUEA 3T08A 2EEXA 4OJYA 1GNXA 1FFQA 3OLIA 1XC6A 1DP0A 3MKKA 1IZJA 5GNXA 5A6MA 2VNCA 4AZ6A 2A3BA 4ZE4A 4H8UA 4EKJA 1E6PA 1VEMA 4MTVA 3RMEA 3O2LA 4UOQA 1J12A 5DF0A 4GIAA 2XFRA 3AICA 1NP2A 1Q6FA 4WK9A 2W63A 1MVYA 1QNPA 4HZ8A 4MADA 3FN9A 4TX8A 4PMUA 2BXYA 3IJ9A 1EO7A 5A1AA 1UWQA 1QI2A 2WVUA 1V02E 4R5EA 1ODZA 2VX5A 1BVNP 3QOKA 3W27A 1UZ1A 3G6MA 5GNZA 2WMHA 2VCBA 1JYNA 3KWXA 3BCDA 3ZR5A 2XM1A 1V03A 2CESA 3SCWA 2X0HA 2YA1A 4X0NA 1WDQA 2X2YA 3SURA 2WLZA 2WWCA 2V3GA 4LXFA 4BQ4A 3ARSA 2Y5EA 4PMQA 4BS0A 2GJPA 2AOSA 5DFAA 2XM2A 3VIGA 3MV01 4J3SA 1B31A 3K4DA 2ZX6A 3PTQA 3G6LA 3AHTA 1BYCA 1J9YA 4X9YA 2V3FA 1GQJA 1UWTA 3L4ZA 4LYRA 1ZJBA 2CERA 3WUGA 3EBVA 1DEDA 3CHCA 1J11A 2BY3A 1ZJAA 5AYBA 2VX6A 1W3JA 4MNLA 2XUCA 4HOZA 3ZJ7A 1DWFM 3EYPA 1FFRA 1TA3B 2YL5A 4W84A 2W92A 3MU7A 2QMJA 5A6LA 3FW6A 1CWYA 1VFMA 2CCRA 1FHLA 4UFLA 3WQWA 1RPKA 1OIFA 3AS3A 4MNKA 4QLLA 1UD8A 3PBGA 4W7VA 1V3JA 2V3EA 3M6DA 4RE4A 2A3EA 1E0WA 1UA3A 3RDKA 3UESA 3A4XA 2W61A 3BLKA 4JAWA 4NI3A 3SCVA 3M46A 2WWDA 3N9KA 2WC7A 3ARRA 4PUEA 3SUSA 3B8SA 4JHZA 4D71A 2DT1A 3L2LA 4WF7A 4MDPA 4ZEPA 4PMZA 1FH8A 2J7CA 3EDJA 2E8YA 2WVSA 5I0DA 2ZXDA 1FP9A 2Y2WA 2XWEA 1D2KA 1W2PA 3L4YA 2DEPA 2CHNA 3PTMA 4JFWA 1U2YA 1RD6A 3WL0A 1V08A 5BYWA 1V0LA 1WDRA 3OA5A 1XSJA 3WDIA 3F4VA 1CGTA 3CBWA 4ATWA 2VUYA 4XUYA 2WKGA 4PEEA 4AIUA 5F7UA 1EH9A 2J8FA 4J27A 1V02A 5CLTA 5A8MA 8A3HA 1V3IA 3CZJA 1DTUA 4JFVA 3AROA 4W8BA 3T09A 2DGAA 2E9LA 3SCOA 3OGRA 2XSBA 5DO8A 4MB1A 1OGBA 1GOWA 4JL2A 4AZHA 1ZU8A 2DT0A 3SIMA 2GDUA 4AY1A 2DQXA 4AZ5A 1B9ZA 3WF1A 3I3BA 1CGYA 4Q7NA 4URIA 3VMOA 1BF2A 1HJQA 4W87A 2NW0A 4WKFA 5ABGA 2WANA 3RM4A 4NRRA 1TMQA 1UWIA 2D0FA 1GQLA 1NOWA 3ZJ6A 1HP4A 2WSPA 1UKPA 5FD0A 3NSMA 3GNRA 1WDPA 2WHKA 2X0YA 2QLYA 3DHPA 3VDHA 3WQ8A 3ZJKA 5M3WA 1BFNA 2J7DA 2W91A 4XX6A 5A8NA 2Z1KA 4M82A 5JUVA 2BV9A 3GXFA 4J7RA 1ZS2A 3FAWA 1JZ8A 3WH8A 3MV11 2Z1SA 4TVCA 1CGUA 2CBJA 3TOPA 3AIRA 3WH6A 4U33A 3WENA 4UQ9A 2VZTA 2WK2A 4R27A 1OGSA 2YIHA 3EMQA 4JFUA 1UR1A 3WNKA 3AXHA 1JZ7A 4AZCA 1W3LA 2WVVB 3RIKA 3FHAA 5FCZA 2Y24A 3A4WA 4P8UA 1E3XA 2WAGA 4P8VA 3AIBA 3CTTA 4C90A 4JCMA 1QW8A 3GXDA 2HISA 1VBRA 3MMWA 4E2OA 3ZOAA 1BGGA 4EANA 5HXMA 2XTKA 4W5ZA 4PN2A 3L4VA 1XGZA 3AMCA 1CXLA 1GJUA 3L4TA 5I6SA 1H49A 1W1VA 1VJSA 3WQ4A 3EMZA 3AMDA 3AHVA 4LYQA 4OUEA 1UR4A 1OD0A 1QBAA 4H41A 2UWFA 4PSPA 2WB5A 4H04A 1WAWA 1E5JA 4U3AA 1VAHA 1TE1A 5E0FA 1R7AA 1TFVA 3ARWA 2UY4A 3UCQA 1UD2A 4CD8A 2VMFA 2YA0A 2XG9A 1JI1A 4YHEA 4PSRA 3IJ7A 3LPGA 1CGWA 1U30A 1KGWA 3ZQ9A 2PWFA 2YLLA 5DMYA 1WZMA 3A6OA 3WMSA 4L4PA 3N13A 4AISA 4QP0A 3UEQA 3W82A 5BCAA 4JIEA 3POCA 3L2MA 5JBDA 2G3IA 2J75A 2J47A 1CYGA 1H3GA 3W37A 1QI4A 1C7SA 3FAXA 2O9TA 2GJXB 4CN6A 3HMCA 2W4XA 3BAKA 4D6GA 1HL9A 4WJXA 1AQMA 5IXEA 1CXEA 3O9NA 3SCRA 8CGTA 4UOZA 1OT2A 1KFWA 1WO2A 1HJUA 1BYAA 2PC8A 4AD5A 4MAZA 2WYSA 3QGVA 5TD4A 3CUGA 1NWSA 2J7EA 1KCKA 4UOJA 2UY2A 1WZLA 1QI5A 2CYGA 1V0KA 3FNDA 5KZ6A 1PBGA 1PPIA 3WNLA 2ZX9A 3ZM8A 3W25A 4D1JA 1FA2A 1GOIA 2CXGA 2XWDA 4DM2A 5A6BD 1MWOA 2GSJA 5CGTA 1E4IA 4W89A 5ABHA 5D8ZA 3VNZA 4HA3A 4V27A 3VD7A 2WMJA 1XV8A 2G3NA 1DWGM 3ARVA 2VX4A 5A6BA 4DWSD 1ODUA 5HOSA 1QNSA 2GK1A 4DUXA 4D6HA 3D5HA 4V28A 2ZX7A 4D6EA 3W38A 1JIBA 1H11A 3CHEA 3N04A 1J0HA 4OKDA 1W9PA 1JYXA 1QNRA 1WP6A 4DWSA 4EK7A 1W3HA 1HJVA 4PMOA 4BA0A 5FL1A 2WM0A 1OCQA 2EO7A 3CMJA 4W7WA 3MSGA 3RILA 3GH4A 1KGUA 1F4AA 4HZ7A 1KXHA 1JYVA 5E0CA 3LPPA 2CBVA 2E3ZA 2TAAA 1VENA 1DWHM 4PRWA 3N15A 4W86A 3EDKA 3QHMA 1QNQA 3MUZ1 3VO0A 5HPOA 3RJYA 1A3HA 1K9TA 1E6XM 2GUYA 1VEPA 3ZT7A 1G1YA 4C7GA 1NOUA 5BXSA 1W1YA 4FLQA 1E1EA 3CUFA 5A6AA 1PEZA 3CGTA 2ZICA 2HVMA 1PIFA 1HJXA 3AYSA 1CZ1A 2VTFA 4D6IA 5EFFA 3VGGA 3VU2A 3I3DA 1E9LA 2E9MA 3ZIZA 2YDQA 1EHNA 3VGFA 1GOMA 4OIFA 3L4UA 1B0IA 1GHSA 3WH9A 3II1A 3MUY1 4PMRA 1C91A 2D22A 1I1WA 1E0XA 3M07A 1UKTA 3WD3A 5BXRA 1KXQA 2X09A 4FLOA 3AIEA 3IJ8A 3AS2A 4ACZB 1HIZA 5A8OA 4AIOA 1K6AA 2EJ1A 4CU8A 3U7VA 1R85A 4AZBA 4W8AA 2OWCA 1R8LA 3N17A 1MW0A 1US2A 1HX0A 3VKKA 1CEOA 1B3WA 3WNNA 4QFUA 1SMAA 4FK9A 1E6QM 5C71A 3WH5A 5A2CA 4ACYA 4JKKA 1ZBWA 1GJWA 1KQZA 1GQIA 1TVNA 2J7FA 4HTYA 9CGTA 4HPHA 1QHOA 2BHZA 3VD9A 1BQCA 4UFMA 4AD3A 5A6SA 1NH6A 3VDCA 3SCTA 4GI9A 4WKHA 3SCNA 2RGLA 3NSNA 4GI6A 3OZOA 2YKKA 1LL6A 3HN3A 4TUFA 3DC0A 1FH7A 2YDSA 1TUXA 4M81A 1H5VA 3AIVA 1VFFA 2W5FA 1GUVA 2EQDA 3VX1A 2CPUA 2DH3A 2BY1A 1H09A 2BY0A 4UQAA 1E72M 1LF1A 2DT2A 2A3CA 1C93A 4KGLA 2BVDA 3LPFA 3RO8A 3ARYA 1QOXA 4PTVA 1XYZA 4NF7A 1UHVA 5A6KA 3SCQA 3WD1A 5JIPA 5A2BA 3F5JA 1QI0A 2VCAA 4GI8A 3NJ3A 2DIJA 1UG6A 5D9NA 2CKRA 5JBFA 1RH9A 3VVGA 3VDBA 5CSYA 3CZGA 2GVYA 1XH2A 1PAMA 4DWSC 1W9DM 3CZEA 5ABFB 5C8BB 1KWKA 3VPLA 3VD5A 2WKLA 4D72A 3BAYA 5A6JA 1WKYA 1OINA 4GPNA 4LGXA 1G5AA 1ISVA 4IPNB 3OGVA 2J7GA 1JDCA 3L4WA 3AXXA 3SCSA 4AEFA 2WHLA 3RM9A 2XGBA 1MQPA 4WSKA 1EDQA 2D3NA 4QLKA 1MYRA 3AZRA 3SUTA 3GH7A 1H41A 1K9EA 5CG0A 1J0IA 1EA9C 1G0CA 3PZMA 3AFBA 1HKKA 1JNDA 1ZB5A 4UNIA 4CU7A 4F9JA 1YQ2A 4IISA 2EXOA 2D3LA 3N1AA 3PZGA 2EPKX 2OLHA 1E4LA 1VRXA 1ZBKA 2B31A 3AQUA 4UCFA 4H2CA 4CVUA 1E4NA 1B3YA 2VCCA 1CENA 2C8NA 4X0VA 3VD3A 1KXTA 5FKYA 4AZIA 3LMYA 2O92A 4UFKA 1NWTA 3CZ8A 1C8YA 3SCPA 1C7TA 1C3FA 3KE0A 1MQRA 1JFHA 1OSEA 2D2OA 4PMVA 3DECA 4XB3A 1J0JA 1V3KA 1F4HA 2FHCA 3WY1A 2J25A 2YJQA 3ZT5A 2VR5A 2O9RA 3EDEA 1GPFA 3EMCA 3PZUA 3SUVA 3BMVA 3WQVA 2XPKA 1XCWA 1NWRA 4ML4A 3ZSTA 4AXNA 1E4MM 1LL4A 3WQ5A 4OOUA 1MW3A 3U5YA 1VBUA 5IDIA 4C7DA 1CXKA 4MNMA 1M01A 3WF3A 4TOQA 4AD4A 4B16A 1KR1A 3IANA 1OB0A 4KGJA 4W88A 4TTUA 2WMIB 2X1IA 5AY7A 2VC9A 2ZOXA 2VOTA 2BY2A 1E55A 4UR9A 3WD4A 1QHPA 3N12A 4W7UA 1XD0A 2WCGA 1UWSA 4UZSA 1ZBVA 1QPKA 4CD7A 4RE3A 1PX3A 2WHJA 1CXIA 5IHSA 4AMCA 1JAEA 5LA0A 1BGAA 4TTGA 1I75A 1E71M 4AD1A 1UA7A 3KL0A 3BC9A 1LG1A 2NT0A 3GM8A 4M56A 1GHRA 1AQ0A 2C7FA 1VB9A 2D0GA 2FHFA 3PZ9A 4UQDA 1QW9A 2WSKA 1E73M 4V2XA 1TG7A 3WBEA 1XSIA 4P7QA 1JFXA 1NM9A 5CPTA 2VZSA 4JZ5A 3RCNA 1SYTA 2BXZA 3K1DA 3KEHA 1LWHA 4B9YA 1CBGA 1ITCA 1JZ5A 4ZXOA 1JD9A 2VRQA 2V38A 3MUAA 4D6FA 5CXPA 3VIMA 2J74A 3GZAA 1DHKA 5I5RA 4KMQA 3VINA 4AEEA 1EQCA 2A3AA 1E3ZA 1QHZA 1UQZA 1FP8A 3CPUA 3SCUA 4P7OA 4NSBA 2DSZA 3GXIA 2JIWA 1NWUA 1KWGA 3ARXA 1JG9A 3GYCA 4MPKA 2D0HA 1W1TA 4UFIA 4HU8A 4GZIA 4PUDA 4ZFMA 2EPLX 4W8LA 3S6TA 1OBAA 3GTNA 4Y7EA 1TVPA 5A8PA 3TTQA 4M8UA 2O9OA 4UFJA 1EQPA 5CLWA 3WNPA 4CGTA 1QNOA 3RJXA 4CCEA 2YL6A 5FOOA 4KRTA 1MW2A 2YBTA 4HOXA 2CHOA 3APGA 4OZOA 2E0PA 1VEOA 3BH4A 3UR8A 4NZCA 2J7HA 5BXPA 1VFUA 2DSUA 5D9OA 2FHBA 3NSXA 1CECA 2NT1A 4DM1A 1EHAA 3ARPA 2W66A 3B9DA 1IV8A 1BAGA 3AMKA 5E09A 1UH3A 4WIWA 3K8LA 1I1XA 1JZ2A 1V0MA 4H8VA 2A3HA 3ZR6A 3BAIA 1UR8A 1CLXA 3CLWA 2J4GA 2ZXQA 3T2OA 1UD6A 3BAWA 5BWFA 4N42A 4LQ1A 4PTMA 2VI0A 4UTFA 1J01A 2VQUA 3CHDA 3VIOA 4P8WA 2ZXAA 5I23A 1TA3A 1UWUA 5LA2A 1IT0A 4JFSA 2X05A 4MDOA 2IXVA 1Q6GA 1NQ6A 4JKMA 2Q8XA 3MS8A 3K8KA 4QCEA 2IUZA 3WIJA 1X1NA 2NSXA 2D1ZA 3ZT6A 1JZ4A 4CD6A 5LA1A 4TXEA 1CXFA 4S3JA 4KRUA 4M1RA 1L8NA 2WCSA 2ESCA 1HL8A 1WCGA 4ZXLA 2XFFA 3CZKA 3FHQA 4JFTA 1S46A 4IUGA 3U5UA 7CGTA 4B15A 4CD5A 3I3EA 1E6ZA 1UH4A 4FLRA 3AS1A 1BSIA 3F5KA 2GFTA 1LLOA 4MJ4A 4BQ3A 1R86A 1B1YA 5HPCA 1KXVA 1PIGA 1X6NA 1PX8A 3WDJA 3POHA 2FH6A 4CVWA 5I3DA 2AAAA 2ZUNA 5D9MA 3WMCA 2WXDM 3W28A 1E1FA 2JEPA 3O6AA 4P7RA 3WELA 1KR0A 5HBFA 2ZUSA 4F66A 3VGHA 3WF0A 3NDYA 2ZUWA 3WEZA 4BZYA 2QV4A 4PYSA 1HJSA 1OGGA 4M29A 5E6ZA 2WBKA 3AHYA 2G3JA 3PTKA 1WZKA 1JGIA 1XYFA 5EB8A 3VNYA 4EAMA 1CDGA 1VIWA 4UQCA 4EE9A 4AZ7A 2O9PA 3W29A 4K68A 1JF6A 4M80A 2PWDA 2FDMA 3OLDA 1V6VA 4GQQA 3DYPA 4JL1A 4WKAA 1CLVA 4N0RA 3DHUA 1JYWA 4D6JA 2PWGA 3QHOA 3PHAA 3MUIA 1JZ3A 1CIUA 3CZLA 2EBNA 4UZUA 2VURA 5HNNA 1J0YA 2PWEA 3SUUA 3WDRA 2PWHA 4F8XA 5GNYA 3BSGA 3HU7A 1MFVA 1UD3A 3DYMA 1AQHA 1D3CA 2JF6A 2Y8KA 1TCMA 1K9FA 3VGDA 2OSXA 1RP9A 3MANA 2FGZA 5M5DA 4D1IA 1ISZA
chains in the Genus database with same CATH superfamily
4QR6A 4DJDD 3L2IA 2Y88A 5BRBA 1DHPA 4JKLA 2W3ZA 4AXKA 1JPDX 1OD8A 2BVYA 1K70A 3F2DA 1CGVA 4AC1X 3E2SA 3GXNA 3QEZA 3ITVA 1O5QA 1BD0A 1SVDA 1WDSA 4FPSA 3HG2A 2Y8UA 4JQ3A 2WNWA 1A50A 4CN4A 6CGTA 4HHLA 1SZRA 5AHEA 1WB0A 1D7KA 2QJNA 1JZ6A 4L6DA 1E15A 1NDYA 3L0GA 3WUBA 4C91A 4HPJA 5GJPA 3WKZA 3WLTA 3WEMA 2REQA 2HPIA 3WNOA 2V5DA 1X7IA 4NZ3A 2HXUA 1R5YA 2GJRA 3HOJA 1DL3A 3LV6A 3W2UA 2V30A 4E6MA 2MUCA 4DF2A 1YPIA 1EEXA 4GQRA 4QAIA 2HROA 3UPMA 2POZA 4X2RA 3W2KA 1IZKA 3UVIA 3WN6A 3KZSA 3UZJA 3QQ0A 3ANVA 4FX7A 1S2CA 2Z4GA 3QHNA 2VJXA 4GXMA 1OF6A 4GC3A 1ZGDA 2R9RA 3V5OA 1F05A 4BKNA 3M44A 5CSRA 4E4FA 3V16A 1FXPA 3REQB 2PCQA 2GQAA 1VBJA 3AIWA 1NF0A 1CTNA 1FWDC 3P62A 3WZ0E 2OOGA 1XIBA 1Q13A 3W7HA 1HF6A 5F2IA 5FF2A 4H00A 4QGCA 1UWRA 1PYMA 4MGGA 1OG6A 3T8QA 4LAKA 5MF5A 4NZ5A 3GNOA 5D2XA 4FXFA 3U4FA 1PVNA 3QPYA 1U33A 4PCNA 4TU1A 1XH0A 3EPNA 4JYFA 2V0TA 5BRQA 1Y5XA 5CQ1A 2DUAA 1PJ9A 4K1WA 1LT7A 1PKYA 4LCQA 4WJEA 4UTIA 3R7MA 3LQLA 3QR3A 2GDVA 4H1ZA 1NEYA 3IRSA 4GFIA 4RPPA 5CJNA 4ORIA 4GY1A 4K2SA 1AG1O 4Q3MA 4DUVA 5D8WA 1XIGA 1EOMA 3TKFA 1ZUAX 4NKCA 2E68A 2WW5A 3RM8A 4L1XA 1A3XA 4PMXA 1SFSA 3UY7A 3MY9A 3RITA 1V6WA 3E02A 3AWOA 1B3XA 1OFEA 1Q6CA 2DFAA 3DH7A 4WSJA 1EF2A 3V36A 3VOGA 1FWTA 3B4UA 3E96A 3VFLA 2DSWA 5A8QA 2CW6A 3CH0A 1W5NA 3E74A 4F0RA 1RALA 1M7OA 3EA2A 3H2MA 3PZNA 2NV2A 2ZZ2A 2H8ZA 5BOOA 1L2UA 3T2PA 1X98A 3W1PA 1OIMA 4PULA 1IGSA 1ELSA 3PZQA 3VGEA 4DJFA 1HKJA 1XRVA 1QO2A 2XVNA 1OYBA 3ATYA 1CX9A 1TPUA 3RYSA 1LLWA 4PBEA 4Q22A 4RL3A 3T42A 2RUSA 3O8AA 1VF8A 3T78A 1SGJA 1HKWA 4M24A 5HDRA 3N2XA 2QVHA 3OOQA 4WR3A 4PMNA 4AVOA 1VCFA 3D47A 2RJGA 3KL5A 3MZNA 1Y7VA 4I9AA 2E40A 3R89A 1GVYA 3V7PA 5I3FA 3T0BA 1DWIM 1JF5A 4NUWA 2ZE0A 1P48A 5JBEA 2AKZA 3WQ6A 2GK1B 5I77A 4CQAA 3UZZA 5T26A 1GCYA 3HV9A 4GH1A 4TVDA 4O0ZA 4H6RA 3VIJA 4FX8A 3JUGA 2DORA 1UR0A 2E8ZA 4HMCA 3UQNA 3WF2A 4ACZA 4V33A 1X8CA 1LG2A 1GVSA 1TKKA 3UWEA 3ZO9A 1C29A 3IK2A 2V67A 2E4TA 4HT3A 1GW9A 4YWSA 3P8IA 2IQTA 1H0GA 1RUSA 2F6UA 4J3XA 3CHFA 5FAGA 2ICSA 4HP5A 2EJAA 1UKOA 3GIPA 3VCRA 3UYCA 1VJIA 1W5MA 2QDDA 4RNHA 1RVKA 4DUWA 1F7BA 1LM1A 5I00A 2A21A 3L7RA 4KCVA 3WFZA 1V0NA 3SY5A 4LF2A 4Q33A 2XSAA 4BQ2A 1S2VA 2VR2A 3FYPA 4MWAB 7A3HA 4GQ0A 4AVNA 5ECVA 3H2FA 2V68A 3ZFHA 3MHFA 3GZ3A 1B57A 4FNPA 5AYYA 3GKFA 5EYWA 3DFYA 5HINA 3AISA 3QW3A 4S3CA 1W9XA 2BLEA 2NSOA 2WBGA 2BP1A 2CLKA 4LUJA 4EOUA 5E0KA 2DSKA 4JICA 4J3VA 4FIRA 4AD2A 1W0MA 1GT8A 1DKWA 3TR9A 1GQKA 2AL2A 4HNVA 1G4PA 4ZO8A 4BEQA 4MY1A 1Q4WA 2V2HA 5CZKA 1NTHA 2PLJA 3W2MA 4GVGA 1FBAA 5JQ9A 4IP5A 1S5VA 4AW7A 3HJEA 5A2AA 3H7RA 3PG8A 3RMJA 4U5IA 3R43A 3T07A 3GXPA 3P8JA 4GG9A 3OBEA 3CIXA 3NQ2A 3IACA 2X40A 5ABEA 4QAWA 4DJFC 3B9EA 2G4FA 4GYJA 4ADSA 1BG4A 2PPGA 1J2BA 5G2IA 4JTRA 5FJJA 1IIHA 2FIQA 1ENUA 3NO3A 2XVLA 4XQ6A 1XHGA 4JX4A 1IR1A 2QJHA 1KBBA 2YCEA 4J4KA 4QG6A 1XSKA 3CO4A 4MHBA 2OSWA 4ASTA 1CGXA 1DWAM 1OK4A 2XH2A 4NNAA 4PODA 3D3FA 1JI2A 3WDPP 4PFMA 3W24A 3OEXA 5I03A 4LBUA 3VGBA 3F4NA 3WQCA 4UQBA 3TAKA 5B7ZA 1HVQA 2EHHA 1Y5VA 3LTSA 2G8ZA 1E6NA 4AF0B 6TAAA 1KKOA 3OLGA 1UASA 3GXMA 2WZTA 5CZJA 4AEOA 4BCEA 6REQA 1LROA 2AGKA 3LBOA 3AZTA 4HIBA 3F5LA 3W1TA 1OCBA 3VMPA 4RV3A 4JQ2A 3UETA 3N11A 1ZALA 3KBMA 3ZSSA 4L6OA 4CNOA 4JIIX 3KFTA 4R9OA 1YX1A 4PUUA 1JDAA 2WMGA 4GKLA 3TNBA 4QSHA 2PTXA 1M04A 3QGAC 2FDSA 1RD5A 1ZTVA 4I90A 1MQQA 9XIAA 4LPCA 4X61A 2D24A 3LCIA 3L67A 2W62A 4JN6A 2VFHA 3BCFA 3SUWA 3E1F1 3W7RA 3VCNA 3UG5A 1QPQA 4C6FA 1GORA 4JQAA 3UG3A 4RW3A 4KEMA 5ECUA 4YCPA 4Q6XA 5HNRA 2XIIA 4P5UA 3GTHA 2INEA 4GXPA 4GO9A 3WSUA 2FMNA 3BLPX 3PF3A 4Q7IA 3GU9A 2PUZA 2Q3OA 5REQB 1YDOA 4F0KA 1OABA 4G9PA 4Z08A 1W56A 3G0SA 3WK2A 1JNEA 1B90A 1Z69A 7REQB 4O1BA 5H2ZA 3KX6A 3ZZ1A 2NWRA 3KWSA 1FWSA 3GU1A 4YHGA 1E70M 5T8GA 3CL8A 4WZHA 4PMJA 4ZO9A 2PBOA 2XU2A 1I6NA 5HUPA 1ZBCA 1TV3A 1AD4A 2GOUA 3WDQA 2XFYA 1NP0A 3CS2A 3VDAA 1Q6DA 4MVAA 4IPLA 4PCSA 3A12A 2O7SA 3TXVA 1H2JA 1WXZA 2ZA1A 1NIUA 3WL1A 3E12A 1GOKA 3OB8A 1H1ZA 2R1NA 1E0VA 2PBGA 3QOMA 4G2DA 4NZFA 2OKOA 4PR4A 3TROA 1XH1A 4WD0A 1LWJA 4N6FA 3ABXA 2VL4A 1HP5A 1ISXA 3M0XA 3W76A 5CJMA 3BLFA 2C13A 2JF7A 1Q85A 5DMLA 3D3AA 5CKSA 2FTWA 3V0TA 3S9ZA 4TX6A 2ZTJA 4QHRA 1I8JA 1HNYA 2EEXA 1GNXA 2OB3A 3OLIA 1IZJA 2OZ3A 1MDRA 3WK3A 1K7XA 1JPKA 1KM6A 4RX0A 2CZDA 4QS5A 3QV9A 3ME3A 2X30A 4N6EA 3O2LA 1P1MA 1P7TA 1J12A 1G4EA 3U3HA 4TX8A 1H1YA 1EO7A 4FNQA 3RR1A 4LF1A 3URQA 5A1AA 2WVUA 4WHBA 4R5EA 4GX9A 3ZLHA 1BVNP 5IOBA 3QOKA 5H1WA 4Z1BA 3G6MA 1XKJA 4LALA 1JCTA 3ID7A 4IT1A 1X1ZA 3BG5A 1I2PA 2YCJA 2CESA 3RRXA 1WDQA 4NU7A 3SURA 3FLUA 3VA8A 4NL1A 1REQA 2GJPA 3H2CA 2AOSA 5DFAA 4KWOA 1QUMA 3LMZA 5FEWA 4Q8UA 3DBNA 3MW7A 3T9PA 1BYCA 3IK4A 1J9YA 4X9YA 4FB7A 1GQJA 1OYCA 2BVWA 3MUXA 3MP3A 3CHCA 1JCMP 1Z42A 4H9ZA 1W3JA 1QMLA 1V7YA 3OYXA 2QMJA 2ABBA 2WNQA 4WCJA 4KW2A 1KV8A 4UFLA 4LAOA 3S1UA 1R30A 3GDMA 3RAOA 4MNKA 4QLLA 3PBGA 4YTTA 4W7VA 2Z6JA 4UWMA 2PDFA 5I06A 3B04A 3OQEA 4I5XA 4ICNA 2PU1A 4JAWA 3M46A 2WWDA 3N9KA 3R25A 2WC7A 5FSEC 2RDUA 3CNYA 3VI2A 2DT1A 3GY1A 1ZCCA 3N2MA 2W27A 3EDJA 2E8YA 4JYDA 2ZXDA 4GD0A 2FFIA 3QV7A 1XYLA 2IKHA 1TX0A 4YVXA 3V4BA 3WL0A 3OA5A 3F4VA 4ZA0A 1LWIA 4XUYA 4JNYA 5F7UA 1CCWB 4BK9A 4Q32A 4JFVA 3AROA 4BFAA 3SCOA 3K30A 2XSBA 4MB1A 1OGBA 4QX4A 2WJDA 1MNSA 4XD5A 2VD8A 2FPYA 1QOPA 4O50A 2DT0A 2R91A 1FWAC 1GG0A 3WF1A 1SM9A 1CGYA 2FYMA 1Q6LA 2XFWA 4ZR8A 1D9EA 5ABGA 2WANA 3W7MA 2OZTA 1UWIA 3LRKA 2C6QA 4QJ4B 2B4GA 1HUVA 5BOEA 1EA0A 3KRSA 2LLEA 3GNRA 3WQ8A 3VDHA 3DHPA 5C9RA 1OC6A 2Y63A 5A8NA 4GFSA 4TV5A 3BANA 2Z1KA 2BV9A 5H8PA 3GXFA 4J7RA 4PZVA 3WH8A 1N8WA 3REQA 5HK4A 4UTHA 1EJVC 3MV11 3MC5A 2CBJA 4YJ5A 3TOPA 2Q8ZA 2FVLA 2WK2A 2VHLA 1J8VA 3WJSA 2V5LA 1OFDA 3BW3A 3UYIA 1PDYA 3CQIA 1W31A 1S2UA 1PKMA 4S3BA 3FKRA 1QW8A 3UZXA 2L5HA 3VKDA 1P4CA 2HBXA 3MMWA 3DI1A 3ZOAA 5HXMA 1XR2A 4FI4A 4OFCA 1GJUA 2ACQA 1W1VA 4G5DA 3WQ4A 3EXRA 3MTWA 2V2CA 2PDJA 3FV9A 4US6A 1AL8A 4LUTB 3C5QA 1A5CA 4H41A 2X1TA 3NGJA 2ZFAA 4H04A 4N4QA 3LBCA 1R7AA 4HCHA 3QV8A 1UD2A 4CD8A 2VMFA 4WY0F 4HJFA 4YHEA 2Z6IA 2X1UA 3IJ7A 3TQVA 1KGWA 3F7JA 2PWFA 2YLLA 5DMYA 4AISA 2QKFA 5AHLA 3L2MA 3N9RA 2J47A 3F1QA 5D2YA 3KXQA 3EXTA 3NQ7A 3FAXA 3KBSA 4J9JA 5C54A 3RRAA 3NQ6A 4MKSA 2GJXB 1DIKA 4RZ6A 3SJNA 3T0CA 3VZYA 3HMCA 1TUFA 3PPFA 3HIJA 2ZYFA 1UMLA 3LLXA 3G1HA 3PNZA 1A0EA 2TODA 3HGRA 1W3IA 4Y9AA 8CGTA 2J9XA 4GBDA 1XDLA 1OT2A 2QW5A 1KFWA 4GJJA 4ADUA 4AD5A 3QGVA 4L6HA 1PXGA 4MYAA 3E49A 3B40A 2ZADA 1WZLA 1XGDA 4L5ZA 2CYGA 3PUEA 3IIVA 5G1TA 1PPIA 3WNLA 1V77A 4D1JA 1GOIA 2CXGA 1MXSA 2CLEA 5ABHA 4WDXA 1BRLB 5EMJA 1QU4A 2EPHA 2QDHA 4HD5A 1XIJA 2WMJA 2DQWA 2QXWA 3QR0A 2VX4A 3IPWA 4N7QA 2ON3A 5HOSA 4EWND 2GK1A 4DUXA 4V28A 4OKDA 1JYXA 3CWOX 4K37A 4IIEA 2NWSA 3A23A 4EK7A 5FL1A 1IXOA 4PMOA 4QS6A 3RILA 1TX2A 3B0XA 3SQSA 1RA5A 3LPPA 3QYQA 3STCA 2OX4A 2E3ZA 4JTKA 2J27A 2TAAA 1A5LC 1HZYA 3EDKA 5F4XA 4LS1A 4PB5A 5DXYA 2GGEA 3TN3A 1HL2A 1TV4A 3RJYA 1A3HA 1K9TA 4C5YA 3UR2A 2I57A 3EX4A 3GQYA 4FLQA 4KWWA 1E1EA 4O4WA 1QK2A 3UFYA 2VFIA 4WXZA 3TA6A 3LI0A 5HR6A 4LUIA 1F8MA 4MWAA 3VU2A 1E9ZB 1E9LA 2E9MA 3W1MA 3TH6A 3ZIZA 3CHVA 2YDQA 1LRNA 1GOMA 1K77A 2HS6A 4UTWA 3OHMB 3MUY1 4PMRA 3U0HA 5TQLA 1W1IE 1EJRC 1Q7ZA 3UXKA 3WD3A 2X09A 3AIEA 3IJ8A 1W17A 3GR4A 2RFGA 1AMKA 1XXXA 4FNUA 2FZDA 3IVTA 1WUEA 2PTDA 4HPXA 3FSUA 4CU8A 1EP1A 1FKWA 1KC7A 1R8LA 1JCNA 1TTPA 1NAL1 1Y5WA 3FYOA 5DRIA 3WNNA 2UV8G 3U2EA 4M3PA 3BOXA 4BJHA 3NAVA 5C71A 1EBGA 4JR5A 5EU9A 5A5WA 3WLLA 2FJUB 1GJWA 2Z0IA 1EJTC 1GQIA 2J7FA 4HPHA 4ONVA 3VD9A 1BQCA 2PD5A 3L21A 4UTUA 1QT1A 5CAKA 3VDCA 4GYKA 1UZHA 4GI9A 4ZCWA 1Z89A 2PP3A 2VELA 3A5FA 2CLHA 4O8RA 3NSNA 3BDKA 5HJYA 5BU9A 2PDQA 3R0UA 4TUFA 3QSRA 1UP0A 4Y9MA 3ISIX 1VFFA 2W5FA 3C2EA 5HJLA 4Q4PA 2VDGA 1MUWA 4FZIA 1E72M 2QVNA 5CC5A 3UW6A 5LNUA 1KCZA 3QMRA 2A3CA 3LPFA 2Z24A 1XYZA 3CK5A 1Q6OA 3T4WA 4NF7A 4J1OA 5A6KA 4P02B 4Z42C 4R88A 3SCQA 3I4EA 3WD1A 4AF0A 1YNYA 3BGJA 4GUIA 4M7SA 3OTRA 3AU2A 3H7UA 2DIJA 4JGDA 1EPXA 3CAKA 3N3MA 5JBFA 3VDBA 1CT5A 1W1ZA 4GUFA 3THUA 4GIYA 3FJ4A 1Y65A 3GC5A 4BHYA 1A5NC 5A6JA 1WKYA 3OU8A 3ITLA 4G8TA 2VDIA 4EF9A 4PRRA 1DJXA 1XYCA 5IDZA 4C65A 2H3DA 2XGBA 4F2UA 4WSKA 4Y8EA 3HGJA 3W1UA 2D3NA 2HMCA 3ITOA 3AZRA 3HQPA 1KM4A 2Y85A 1O95A 1G0CA 3PZMA 3A13A 1JNDA 4KF1A 1AH0A 1ZQ5A 4IISA 2EXOA 3N1AA 5AFDA 3MP4A 2YCKX 2B31A 4UCFA 3FA4A 1B3YA 5D02A 2C8NA 4X0VA 2RJHA 5FKYA 2G97A 3LMYA 4MWAC 3QZAA 3UVAA 2OZ8A 4MKNA 3SCPA 1PS9A 2X16A 3DI0A 1F3WA 4HNNA 1SO4A 1QWKA 2YFOA 1F4HA 2P0IA 3MVIA 4OECA 3GG0A 5REQA 4LC8A 3G22A 4L80A 3CQ0A 2VR5A 2O9RA 2F7FA 3PG9A 2WNZA 3DG6A 3EMCA 5HANA 2XPKA 1R0MA 1LL4A 5FJUA 1I2NA 3WQ5A 5L6UA 3B97A 2A79A 7REQA 5IDIA 4MNMA 4QNWA 4TOQA 1YPFA 4XD3A 3VK5A 1WKFA 4A8LA 1QRQA 1A53A 2D2JA 4KGJA 1XRSA 4TTUA 2E6AA 3HPSA 4Q4OA 3W75A 3QY7A 5AY7A 3SN1A 2BY2A 1E55A 1MRQA 4HJWA 3UWYA 1U5HA 4RE3A 3S6DA 1PX3A 3MZ2A 1KBIA 2WHJA 1DBTA 5IHSA 3DFPA 1JAEA 3A9IA 1BGAA 5T91A 1H7NA 3RGTA 3B8WA 1BWVA 3SM0A 1E71M 1UA7A 3AC0A 3PFMA 2PA6A 4ERIA 4F0LA 1DV7A 3BC9A 1LG1A 3GM8A 4Y90A 4LYKA 5AHFA 3TN4A 4UQDA 5CBIA 3URAA 3P93A 3HPAA 1J6OA 2CZEA 3TC7A 1XSIA 3BV4A 1DXIA 2F38A 1JFXA 4PEKA 1XKYA 5E5CA 3NM3A 1R9ZA 2OO0A 4JIPA 1JZ5A 1HG3A 2GJNA 1KBLA 2VRQA 4FR6A 2CWXA 3B8UA 1YDYA 4AEEA 2VYOA 1EC9A 3S2NA 1JCLA 3G1FA 4NSBA 3KBVA 3GXIA 5HULA 3IJLA 3WQDA 3NWRA 1PV8A 5BU6A 1W1TA 2OLSA 1KRBC 2VFGA 1PHWA 4NXKA 2NV1A 4Y7EA 3WJXA 3IUIA 4UFJA 3E5PA 1BF6A 3M4HA 3PNUA 5FOOA 2YBTA 4DVOA 1SJCA 4HOXA 2CHOA 3APGA 5XIAA 4OZOA 1LT8A 2WPBA 5K3VA 1VEOA 4D8LA 3UR8A 3M5XA 2J7HA 4GWEA 4NYUA 3NSXA 1IXPA 1EHAA 2W66A 2BOFX 3T8LA 4MLRA 3AMKA 4HNLA 3GFXA 1I4NA 1XLCA 4GY0A 1QXLA 3BAIA 4UXDA 1TCDA 3UWQA 2J4GA 4AHOA 2FKPA 3V35A 1JQXA 3EKZA 3UA3A 4QTGA 4S3GA 4V15A 3CHDA 3C8FA 2Y7DA 2J6XA 5I23A 4C6KA 3DAQA 5J8LA 1TIMA 1E0UA 3LBMA 3VDGA 3HG3A 1XM3A 1PL9A 3K8KA 2IUZA 4L9ZA 3M0IA 1W5OA 4KRUA 4M1RA 1L8NA 3CJPA 2ESCA 3U5UA 1XLDA 3N29A 3B05A 5TIMA 1GTHA 3MKVA 4CD5A 3WG6A 1Z8AA 3LCLA 3AS1A 3F5KA 1AJ2A 1NY1A 1W3TA 1B1YA 5DCBA 3VOFA 4GVHA 4MUZA 5HPCA 1KXVA 3ZVIA 4LOCA 1PX8A 3WDJA 3POHA 1QATA 4A8IA 3W28A 4MZ8A 3GVVA 3VABA 2OT0A 3WELA 1KR0A 5AN7A 3GSMA 2PRHA 3VGHA 3WF0A 3NDYA 2ZUWA 4BZYA 3AJXA 1EBHA 4PYSA 4A8RA 2HNHA 1SFTA 3FXGA 1R47A 2WBKA 2G3JA 3PTKA 2ANUA 1XYBA 1WZKA 3KOFA 4EAMA 1CDGA 1VIWA 1J5SA 4JHMA 3H2EA 2FZBA 3W29A 4K68A 1JF6A 4M80A 1W8SA 3ABOA 4JL1A 4MMWA 1IIGA 4JTDA 2YFNA 1DJIA 3QHOA 4YXGA 1FCBA 1JZ3A 1CIUA 3GW3A 4UZUA 3CUXA 2VDHA 1J0YA 3WDRA 1FWNA 3RU6A 2INFA 4OGZA 3QTPA 3DYMA 3CUZA 3NURA 3CQJA 1RXOB 1RP9A 1WQ5A 2FGZA 2QCDB 1KFCA 1Z32X 1ZPTA 3NQVA 2AQOA 1EYEA 1QNVA 4DPPA 3OYZA 2DJLA 1M03A 1DIEA 1X6LA 4U4MA 3G1DA 4QG8A 4JTFA 1JL8A 1PKLA 4XZNX 1I0BA 4IGMA 1DJZA 3LOTA 4PCFA 2PRLA 4YN5A 3D46A 3GBEA 2OQHA 4HU0A 3W53A 3IVSA 5IHRA 2DSVA 2ZZ3A 4JY9A 1ZNNA 2WSYA 4UQEA 1J0ZA 4P7NA 2JE8A 1QFEA 4IMCA 4E8DA 3CUHA 3B9OA 1UUOA 2C3ZA 2PFHA 1UD4A 1TRDA 4RCXA 1BXCA 1HKMA 3WLRA 4HTBA 3GNPA 3I7SA 4FNTA 1O5RA 4XZIA 2G4JA 1O68A 4B3LA 4GX8A 4A3RA 3ZR4A 5CPQA 1R2SA 3CIVA 3T0DA 4GY7A 1S3HA 4J40A 2CWNA 5AC8A 1W8GA 5M17A 4H9VA 2YZRA 1FWGC 3SQMA 5AHNA 4FOKA 3TTYA 5IBXA 1H0IA 4LUTA 2Z26A 1WE5A 5B7YA 2TPSA 2NVCA 2CNCA 1T5AA 1QJWA 4NJKA 4GO8A 4UR8A 1X6UA 4DB7A 3M43A 1V6TA 2GGGA 4OUIA 1V5XA 1XBZA 2YA2A 5A8GA 5FA5A 3OHIA 2QDEA 3JR2A 3O63A 3TTOA 3GE7A 2Y7EA 4FHAA 4GZEA 1W1PA 1XFCA 4AZCB 4HYRA 4KWVA 2FZNA 3NQBA 1OVDA 2XH0A 3EX1A 4REQB 5EBUA 3P80A 4HU3A 3E0WA 4TMBA 2GJXA 4K8GA 1NFGA 1TPDA 2VZUA 1BXNA 3S6OA 3ZVHB 3I68A 2BHUA 3RXZA 4Q8OA 2PGEA 4LCSA 4CN1A 4QNEA 2CITA 3MMTA 1MUMA 2WVTA 3KP1A 3OPSA 1A5OC 3QLLA 3NL2A 1UOKA 1TV7A 2BXVA 4S3AA 4UR7A 1X97A 3AAMA 4I5UA 3SGUA 3W70A 3ARUA 2OYKA 2DZAA 1WNOA 3EOSA 1WX0A 1I2OA 4AHPA 3R58A 4JY8A 3NOYA 8TIMA 4H6QA 1VKFA 4Z0JA 3UWZA 1FTXA 3AYRA 1BTCA 5I02A 1P6WA 1JCXA 4IXXA 3VOCA 2CFFA 2RDTA 2BASA 3G8EA 4HPGA 1RY8A 3GUGA 2CZFA 4DI9A 2J79A 3RN6A 2PGWA 4MYXA 3W26A 1BRLA 3TX9A 3IEBA 4NVTA 4KEZA 4A3HA 1HW6A 1NOFA 3P5ZA 4M6PA 3KBJA 3ZLGA 1H62A 1GJPA 3TSBA 4O1DA 3W1LA 4MFEA 3NEHA 4DJFD 3SW6A 3WX7A 4D6CA 5E70A 2QUNA 4NRSA 2JALA 2QCEA 1K9DA 3N2TA 4MLJA 3AS0A 4B91A 1VS1A 4EF8A 3PPCA 2JKEA 2OEJA 3T0TA 5D05A 1JDEA 5I2UA 3S5ZA 3ALGA 1US3A 3UJRA 2ZWYA 3RR4A 4I8YA 3L23A 3PZIA 3MCMA 1TRIA 3IUDA 2JQXA 4M19A 5C55A 1U1JA 1C92A 2FB3A 1F6KA 4Z2JA 4OVXA 2XVKA 4M7TA 2VC7A 1UC5A 1OC7A 1XYAA 2ZC1A 4JPGA 2PEVA 1XBXA 4AZGA 1V6YA 2FH8A 2QPXA 2CKSA 4E4PA 1ADOA 1YEYA 1S39A 2POTA 3H22A 4GUHA 4IQJA 4KPLA 5BRPA 1S38A 3MVTA 4RNJA 1DE6A 3VILA 1GW1A 1WV2A 1A5MC 3SAZA 3G3DA 4WEVX 4NG3A 1TWSA 1A47A 6ALDA 3MMDA 3NXLA 3CYVA 5DY3A 2G5WA 4U2YA 1BSLA 4N2YA 2QPSA 1FCUA 1PZ3A 3DHDA 4H01A 3Q65A 1XG4A 3RCYA 4FMVA 3WLNA 2P10A 1K1DA 1CB7B 1NFBA 3K5XA 4RNFA 2VRJA 5F1VA 3EX6A 3WLPA 1EDGA 2BOGX 5D38A 2RDXA 2OQYA 2DPEA 4PTWA 1QBBA 1KTNA 3BMWA 1RBLA 2ZZ1A 2WSRA 4XIAA 5CZTA 4RE0A 2NV9A 1V6UA 4AIEA 5IFTA 1TQJA 1A80A 3RO6A 5FIPA 1ONWA 4FXJA 1OG0A 4UB9A 4ZTXA 1TMLA 3PJWA 2HVOA 1BVWA 3R0KA 3DHFA 3IAPA 2BDQA 2HJPA 1Z41A 2XIMA 4NAEB 4Z2LA 4QLJA 3AHZA 3IAQA 3MJMA 2HK1A 3VM5A 3HG4A 3G0UA 5CPSA 1ZRQA 3VIIA 4GUGA 4UTJA 2WZHA 1C8QA 2WMFA 3VZXA 2ASHA 2VO5A 3SIZA 3UZYA 2CLLA 1KW1A 2YCLB 1XLHA 1E6RA 3EDFA 5DT7A 3GVRA 4DNMA 1RV8A 1SU5A 4KCWA 3C0SA 3NCOA 4FP1A 3VNLA 1JD7A 3K4WA 1AVAA 4IQDA 3WMLA 1ZP3A 1J0KA 3V5FA 4M0XA 3H12A 1V3HA 4BQ5A 4QJ1A 3W7QA 2ZUMA 2YBUA 3C4UA 3C0JA 3CB3A 2OG9A 2V5CA 4KETA 4JNZA 5GPRA 4DO7A 1YHTA 2I14A 3ITXA 4PMYA 3GBDA 1EZ2A 4XZMX 2EG7A 1CPUA 1ME9A 3LEPA 3TJ4A 5D32A 5DT5A 3K8MA 1X1OA 5CPMA 2DT3A 3W6MA 2WLYA 5KMYA 3WLMA 4TX9A 3BGAA 1UD5A 4WX2A 3SY8A 1MXDA 1W32A 4AD0A 5JXQA 3LZ5A 3AI0A 3CUIA 4IQEA 4ZL1A 3THDA 3T1GA 3ZWTA 4PTDA 1KFJA 4CNNA 1TJ1A 3PBWA 3H55A 4QJ5B 4LX4A 4L9YA 3OLEA 2Z25A 2O4QA 1OYAA 4B5XA 1E43A 4KWUA 3MKCA 4O1AA 1RPXA 4GQBA 2YXOA 3CEPA 4HA4A 2QUMA 5CBBA 2INZA 1SMDA 1W5QA 3GC4A 4G6CA 1DVJA 1Q8AA 1R46A 3QZ6A 3FX4A 2VUNA 1MZHA 2VVSA 1BVZA 3PJUA 4HB7A 1EGVA 5A6TC 4CCZA 2WNNA 3ARZA 1EIXA 1XCXA 2F8QA 1WA3A 2C15A 3STPA 2OXNA 4O17A 1T96A 3ZJ8A 1SW7A 4A05A 1TPEA 2HK0A 5A94A 3WK1A 2GLKA 3NDOA 4L4OA 1A5BA 5GQBA 4GMEA 2P76A 1VIZA 3K4AA 1L2QA 3L65A 3F2BA 1GWJA 2G3MA 4E5TA 4GGHA 1Q6EA 1X7FA 3FVMA 4L7ZA 1X38A 2VEGA 3CV7A 1JXKA 4M6QA 5E9AA 4B9ZA 1O5KA 1VRDA 2YXGA 4N9DA 3CH9A 4N4PA 3HBLA 4H6KA 1VFOA 2DP3A 2PF8A 1OWQA 3T7VA 2X7WA 1HT6A 1B5TA 3LN3A 2P5NA 3PPHA 5HQLA 1E6SM 4XV0A 4B2DA 2PF0A 3VIFA 3TC3A 3LM7A 1KQYA 3KLLA 3MYOA 3CXOA 3G3MA 3HGOA 2Q6ZA 1EJWC 4XSLA 3LU2A 3WD2A 1AUSL 2MNRA 1EB3A 4DZIA 4DO4A 1TPFA 3MYPA 5CJ5A 5AYIA 4DJDA 2F2KA 4O15A 4NJGA 3BAJA 3G1RA 2CBIA 3CWHA 4JN8A 1B2YA 1SPQA 3D6NA 7ENLA 3QLDA 1L6GA 3ECQA 5AZ1A 4HZ6A 1BHGA 3AZSA 2BZNA 3VUPA 1FWEC 5LYRA 3H70A 4NZ4A 2ZUUA 1JXJA 5CC6A 3UXDA 1Q65A 3NQCA 4PL2A 3W0KA 1LORA 2VENA 3AOFA 2XJ7A 3CMGA 3ES8A 3LG3A 2FTPA 1FKXA 3PZTA 3S0CA 5K4XA 1HN1A 4GJIA 4R34A 8RUCA 1F76A 3MP5A 1HVXA 1NDVA 4W93A 3S2MA 3GX9A 1J18A 1EX5A 3DYOA 3MUCA 1MEHA 2YYTA 1LRQA 2G41A 2GZXA 1KKRA 2FGLA 4I9TA 3GC2A 5AVNA 3QN3A 2I17A 4O11A 5LIWX 1GZ1A 2A2IA 1M5WA 2GVJA 2OSYA 4DYEA 4EACA 1LQ0A 4WXYA 3DENA 4LRTA 3O15A 2QUTA 1B3VA 2X41A 2QCHA 4LYPA 4IL2A 3H4GA 3WDHA 1FCVA 4LB4A 2EPNA 3L0NA 3MO7A 1DIDA 4JDYA 1DP0A 1DJQA 2OODA 4BI7A 1DJWA 4XAPA 3PUOA 3UU0A 2A3BA 1DPMA 4EKJA 3W86A 1XG3A 4MTVA 3PFRA 3WLQA 3QGKC 5DF0A 4EWJA 2XFRA 1Q6FA 2OLAA 3VFCA 4IICA 4MADA 4M5PA 2I5QA 3SSZA 2X7VA 1E9YB 3IJ9A 4EP8C 3TNOA 1T6MA 4JEQA 4LS2A 3GB6A 1QI2A 4TV6A 1V02E 5H8MA 4K1GA 1UZ1A 3G1VA 2Y61A 1R3YA 1JYNA 2FMOA 3ZR5A 4GVIA 5K9DA 1YW1A 2VP8A 4TQTA 1FX6A 3SCWA 3PP7A 3UCDA 3PWIA 2ZKMX 3CAQA 2V3GA 3ARSA 1UJQA 2Y5EA 4BS0A 3VIGA 1YBQB 4DQWA 4KKXA 3G6LA 3QC0A 1FWIC 2V3FA 1TPH1 5ENLA 5BMWA 3L4ZA 1UWTA 3TYUA 1TSIA 1GYMA 2CERA 3WUGA 3EBVA 3P14A 2BY3A 1ZJAA 2VX6A 4Z1YA 4OBTA 4HOZA 4DJDC 4QXIA 1FFRA 1TA3B 3MB9A 3UT0A 4EIVA 5BMXA 1CWYA 1FHLA 3WQWA 1RPKA 3AS3A 5LXXA 1UD8A 2C16A 3QYSA 4QJ3B 4DYKA 4U10A 1UB3A 4GK8A 3B8IA 2A3EA 3T4CA 3HM7A 3C3NA 2VD9A 3W6YA 4QQUA 4IMFA 3SCVA 2Q3RA 1ADDA 3OZYA 3DDMA 1SJDA 3M5VA 4U28A 4PUEA 2QCDA 3GTXA 2A6NA 4QIUA 4XZ9A 4MDPA 3IIXA 4ZEPA 4PMZA 1YIXA 1FH8A 2ADAA 2F84A 2WVSA 4MSSA 1IEWA 4PE8A 5AECA 1RCQA 1RZMA 4IXHA 3U8GA 1IF2A 1SZFA 3L4YA 2DEPA 3PTMA 4GYPC 1I2QA 5DN1A 1SJAA 2PLKA 3IIPA 1WDDA 4IP4A 3DG3A 2GPTA 1I9CB 1XSJA 3H6OA 3WDIA 1O1HA 3PULA 1CGTA 2VUYA 2I9EA 4PEEA 4QDPA 1EH9A 1KRCC 2J8FA 5A8MA 1R3QA 4K38A 3T09A 4YTQA 3OGRA 4MF4A 3VE7A 3GDTA 1XICA 4JL2A 1OX6A 4JYEA 1SO6A 1XW8A 4PFHA 1UWAA 4AY1A 2DQXA 4RV8A 2RHGA 3W73A 3WYZA 2XSXA 4CNTA 1RQHA 1KO0A 4E38A 1HJQA 1Y0EA 1R3TA 4NRRA 1TMQA 3GD6A 1Q6QA 2D0FA 1GQLA 1VQTA 2E6YA 1NOWA 3ZJ6A 5HWNA 1VLIA 2WSPA 1WDPA 3T40A 2Z7KA 1OFRA 3CC1A 3MCNA 1DIOA 2CLMA 4ML9A 4DUOA 4M82A 3W7GA 1F8IA 3IJIA 2J24A 2YXXA 5AB3A 3RX4A 2Y6ZA 4H7ZA 2Z1SA 4TVCA 2OMAA 4RNIA 5EMUA 4BR1A 4U33A 3AALA 4UQ9A 1TJPA 2PAJA 4R85A 3UR5A 1Q7QA 4AZCA 2IKGA 1SZEA 1XL9A 2WVVB 2B0MA 3ABRA 3JZUA 4REQA 3RIKA 5FEZA 3OVQA 1DE5A 5C9ZA 5EJ1B 4P8VA 3AIBA 4CQ9A 1A5UA 3ZVHA 1VBRA 4LJ3A 2E25A 2CZVA 1IGWA 1PIIA 1BGGA 2B81A 4EANA 4L1GA 4PN2A 3L4VA 2C1IA 2VWTA 1PDZA 1CXLA 2QAFA 3WLHA 1MUCA 5I6SA 3LHZA 3G1XA 4OUEA 1VPYA 1QBAA 3LENA 1K8XA 1D3GA 1SW3A 4GGBA 2UWFA 3TCSA 2WB5A 1VAHA 1WAUA 1SFJA 5EJZB 1RJQA 4O12A 3ARWA 2J9ZA 2YA0A 2PDGA 1JI1A 2HDJA 2QULA 4PSRA 3S46A 3QQ1A 1CGWA 1M3UA 3T55A 1WZMA 4FNRA 1F74A 4QP0A 3UEQA 4JIEA 2Y70A 4HHHA 5JBDA 2WQDA 3BWWA 2V6AA 1JR1A 5CC3A 4HHPA 4CN6A 2W4XA 4WOZA 3LQGA 3DKJA 4D6GA 2HEJA 3W7IA 4WJXA 4Q8VA 1AQMA 3CAWA 5IXEA 4XKYB 3ZLFA 3O9NA 3SCRA 1VYRA 3GFYA 3DEQA 3FEMA 2VEIA 3PY2A 1ZP4A 3TC6A 1HJUA 4Y9NA 2PC8A 1YNPA 4CEUC 4MAZA 4XTIA 3GDLA 3QY8A 5TD4A 3CTLA 3VAVA 1A5KC 2GOKA 3KP0A 4DBEA 2H8XA 3N6QA 1HO1A 3SY1A 1I45A 3M47A 1V0KA 2ZX9A 3G5EA 1RBOB 1S2TA 2GSJA 5CGTA 1E4IA 3EA1A 2I5GA 3VNZA 1C8VA 5EKYA 1HQTA 4V27A 3VD7A 4ZSUA 2G0WA 3P84A 2G3NA 2XZ9A 3EWXA 2E7FA 4WSHA 5A6BA 1ODUA 3O1NA 1QNSA 1DOSA 4DO6A 5LSMA 1S5NA 3D5HA 1XLFA 4EPKA 3IARA 4JEJA 1JIBA 3CM4A 1OZMA 3N04A 1J0HA 1LZOA 3HPZA 4ILSA 1KNWA 4W7WA 4MY9A 3MSGA 3LHVA 3G18A 1V51A 1F4AA 3L5AA 2QIWA 3LHUA 2CBVA 2R8WA 3R79A 3GLCA 2A4AA 1AL7A 1YRRA 3MWCA 3QHMA 4W86A 1QNQA 2TSYA 3KM8A 3VO0A 1E6XM 3ZT7A 5BXSA 5DCEA 4NAEA 4MWAD 3RPTA 3CUFA 3SN4A 1PEZA 3FDKA 1YXDA 1HJXA 3AYSA 1CZ1A 4D6IA 3L9CA 2Y1HA 3DOPA 4HQVA 4K3ZA 3VGGA 3QW4B 4ZBCA 3M41A 3ATZA 3L4UA 2YCLA 4X60A 3CPGA 1AZ2A 1H50A 3R8GA 3WBWA 5DCDA 4DJED 5D33A 4PTNA 5K2ZA 1QDSA 4ORMA 5FJRA 3VKJA 3VOJA 1UKTA 4LUSB 3INPA 2DZTA 4YYCA 4UMCA 2WJEA 1S5WA 3F4CA 1TTQA 3R0DA 5DELA 3E9AA 4NAFB 1LQAA 3JS3A 3TR2A 3NYZA 1VGAA 3KBNA 1K6AA 3N73A 2XINA 3EWDA 1IXQA 3N17A 2HXTA 1US2A 1J93A 3NPVA 4GNVA 2R94A 1ONEA 1E6QM 2ZRWA 3BGGA 5D2WA 2I1OA 1SQ7A 1DQUA 3IJ6A 1XCFA 1KQZA 3LCGA 3MSRA 1TVNA 2YCIX 1EPVA 4HTYA 2BHZA 3BE7A 2PODA 4NT0A 4AD3A 2DZVA 5I3IA 1EF3A 3E0FA 2ZZ7A 2RGLA 1XIEA 3VNDA 1IEQA 5DXXA 5M1TA 1ZZMA 5H91A 3BUVA 3DC0A 2GWNA 2QCFA 3I7RA 4M81A 2QCCA 3VX1A 2DH3A 2BY1A 1Z44A 1H09A 2Y89A 4UQAA 3SGZA 4R33A 2DT2A 4KGLA 2BVDA 7TIMA 4PTVA 4MIMA 4LAMA 1EJUC 5A2BA 1QI0A 2VCAA 4GI8A 3W71A 3HFYA 2D73A 4H9MA 3N6HA 4PB3A 1PAMA 3RX2A 1W9DM 4LV9A 3HF3A 2Q02A 4D72A 3NQEA 1OINA 3S2JA 1ISVA 4HNCA 4XAZA 2NVDA 3VCCA 1G6CA 2J7GA 2R82A 1T0OA 1JDCA 2ZDSA 2OFJA 3L4WA 4ZZ9A 3SCSA 2WHLA 3RM9A 2ODOA 1MRAA 1NJJA 3LSBA 1FDZA 3QKZA 3V75A 3GH7A 1TV5A 4ZFCA 1HKKA 3LERA 4CU7A 4F9JA 1RR2A 1YQ2A 1Q3NA 2D3LA 3PZGA 1E4LA 3EOOA 5KINA 3AQUA 4H2CA 3O6CA 3GRIA 4OTKA 2VCCA 1ME7A 1CENA 2Z1VA 1ADSA 4UFKA 3RHGA 2BGQA 3T81A 1F9CA 2KAUC 1R3VA 4J2PA 1C8YA 1C7TA 1FWRA 1R9XA 1KM3A 3CV6A 5LNWA 2X42A 1DTNA 2PSNA 1T8QA 3DECA 4XB3A 3BO9A 3QXBA 4RDVA 3EAUA 3SR7A 1VPXA 1UOZA 2NXHA 3VE9A 3PZUA 3SUVA 5LZLA 1R3SA 3BVJA 3ZSTA 4FSAA 4JTUA 4H9UA 4LH8A 2G50A 1FDJA 5BZAA 1LUCB 3U5YA 1VBUA 1CXKA 1JRCA 4S39A 2F9RA 2OKTA 1NVMA 4W88A 1EJ7L 4S2CA 1N2VA 2X1IA 4Q4RA 2HV5A 1QHPA 3STFA 4CLMA 4UZSA 2ZRVA 5G4WA 3BL3A 1PTDA 4CNSA 4PUWA 2QUVA 3NZPA 1I75A 4AD1A 3GG1A 2P88A 2HCVA 2VFEA 2NT0A 4NNBA 4LWWA 3TYBA 3C61A 4UMAA 2D0GA 4IFKB 4Q4QA 3PZ9A 1QW9A 3ABZA 4V2XA 1E73M 1I60A 1THFD 1TG7A 3WBEA 3SFWA 1SW0A 2NQ5A 1C9WA 3GR8A 2VZSA 2YZ5A 3RCNA 1SYTA 4C6JA 3K1DA 1LWHA 2WJFA 4Y6GA 1CBGA 2AQVA 3G0XA 4ZXOA 5C9WA 1CW2A 2DUZA 1JD9A 1AA1B 1XX1A 2HS8A 3QPEA 3VIMA 1JPMA 4XVEA 5I5RA 3BLDA 3EX2A 1EQCA 1E3ZA 1FP8A 5HA7A 2JIWA 1NWUA 3CQHA 2QZRA 3ANYA 1Q2SA 2D0HA 4UFIA 3LXCA 4Y96A 2XN0A 5TF0A 1OCNA 3F4DA 3AU6A 3GTNA 5CPLA 2BX7A 4AAJA 2Y62A 3FYYA 3WNPA 1QPRA 2ZA2A 1NDWA 3PBMA 1GG1A 2FLIA 5D09A 2A6LA 4O0QA 3G8RA 3ES7A 4PL1A 4NZJA 4NZCA 1ECQA 2H9AB 3VOHA 5D9OA 3KTXA 4OU1A 1CECA 1UPMB 3ARPA 2PMQA 3LGEA 1A4MA 3EOLA 4TMCA 1UH3A 4WIWA 3W72A 3BK0A 2VOMA 5G2HA 4HNTA 1PYFA 5TBOA 1UR8A 1YBQA 1UW9A 2ABAA 3CLWA 3LTPA 4S1FA 3IGXA 2Z2UA 5KZMA 3W1XA 2D69A 5I3HA 3GAYA 1LBMA 5BWFA 4UTFA 1G7UA 1ZJIA 3M0MA 4PUMA 3VIOA 4P8WA 3LCWA 4DPQA 2ISVA 4ZOBA 1TA3A 1TV8A 3LCXA 3UY8A 4C6NA 2GDQA 4I7UA 2PDXA 3AXMA 2ZBTA 1U1UA 1NQ6A 3CEUA 4MWAE 1K7FA 2Q8XA 4C6LA 2E5BA 2D1ZA 3C0LA 1JZ4A 3R8RA 4TXEA 1CXFA 4S3JA 2WCSA 1R2TA 3FA5A 4JFTA 2XFFA 1F6YA 3CZKA 3FHQA 3TFCA 1VFSA 4B15A 3I3EA 1E6ZA 4LRSA 4ZVJA 1PE1A 3KUMA 4MJ4A 1R86A 2YW3A 1RY0A 2YDAA 1A3WA 3TJLA 1X6NA 2QUUA 4W4QA 2E09A 3I65A 2OEKA 4ZQMA 2FH6A 4E2VA 4CVWA 5I3DA 3JRKA 2WXDM 4RDZA 2BSLA 2JEPA 2PDPA 3O6AA 1Q5MA 2R6OA 1B9BA 4JS3A 3STEA 3U2ZA 2XGZA 2ZUSA 4GBUA 2WM1A 1VFLA 3UJEA 1B54A 3C56A 2ATMA 2QV4A 1HJSA 3A21A 3W00A 1WXJA 4KBXA 4L4MA 4D9PA 3PWGA 1DQWA 4AZ7A 3KHDA 4JTTA 2PWDA 4FXSA 3PJTA 4GQQA 4N0RA 2H3BA 1JYWA 3TK7A 4D6JA 4DN1A 1ZAJA 3PHAA 9XIMA 4HSHA 1H7OA 4F8XA 2ZQ0A 3BSGA 3FEQA 3HU7A 1MFVA 3L5LA 2GQ9A 1D3CA 3GNNA 4N9CA 4H3DA 3VGDA 4LVDA 4XISA 1FWCC 1YE6A 3MANA 1F07A 1U22A 3WLIA 1IWBA 4UUIA 1L9WA 3AMGA 1ZLPA 1S2WA 3PBUA 4O57A 2XVGA 4LS0A 4PRTA 5HNTA 2GVLA 1BYBA 2C18A 2NLIA 5D04C 2B7NA 1XDJA 3AIUA 1TTJA 3DESA 4CNUA 3PZOA 4LANA 2QMKA 3G1AA 2PI6A 4K7YA 3MBFA 4YVPA 3CLMA 3C2FA 1F3TA 1MO0A 2YSWA 3R6IA 5FF3A 4YPJA 3DN5A 4F0SA 2BTMA 1BXBA 1V3LA 4CQDA 2WZEA 4H83A 2C0HA 2PDWA 2WVVA 4GOAA 3XISA 1M1BA 5IM51 3AHXA 4DO5A 4O10A 1Q63A 1N8IA 1QPNA 4IMAA 3AXIA 3VTRA 3BZGA 2A7PA 2VT0A 3R4IA 3M64A 2XYLA 1SFLA 1MZRA 2FZMA 3DKLA 2XHYA 4DF1A 4JIRA 1BTMA 2UBPC 1O7AA 2PCEA 3LGGA 5JMUA 2VX7A 2NLYA 4IMGA 1Q7MA 3K46A 3EWZA 2PDHA 1LOSA 2G95A 3WQFA 4JTAA 4S3KA 4B5VA 5FF7A 3O07A 3OQ8A 1PB0A 2I56A 3H7VA 3NPUA 2Y0FA 3HQ1A 3BG9A 2TRSA 2DJXA 3KW3A 2ZX5A 3E0LA 3WQPA 3WO8A 3N2BA 1EO5A 4ECLA 1TPB1 3H2NA 4XIMA 4Z2IA 4QBXA 1XQLA 2JIEA 4YIWA 4KIEA 4A4AA 1R6WA 4GJ1A 2NUXA 5AKQA 1GPWA 3C52A 1GK8A 1R87A 3WD0A 3SADA 1G67A 4CCDA 3S1WA 2PB1A 1VPQA 3TU9A 1SR0A 2F61A 4XKYA 1S1RA 3ABSA 1W9BM 3KCLA 3MSYA 3QH2A 5E6YA 1ESWA 1FH9A 1VBGA 3FOKA 2G96A 4ZE5A 1LTDA 1LLZA 1IEIA 4NP7A 3TWBA 2O56A 3EOUA 3P74A 3S47A 3RLGA 3WFAA 1F5ZA 4HBKA 3TTEA 2CLPA 3GDBA 4DRSA 4JNMA 4MJ2A 4EPEC 1XIMA 3TJIA 3B8DA 2VM8A 2QHAA 2AKMA 1X39A 3NEVA 3TW7A 1QPOA 4CUCA 1VZWA 1OT1A 4M6UA 5I09A 4IMDA 3S1XA 4RJEA 4HN4A 1O5XA 2V63A 9RUBA 3PVFA 4F40A 5I3KA 3W2NA 2VRKA 4NXSA 4UC5A 2QQ6A 1GVIA 1H1NA 3H8AA 3O05A 2FFCA 4CCCA 1LL7A 2V3DA 1XRFA 4Q8NA 5CBJA 1L6WA 1TMHA 2QT3A 3W2JA 1TZ9A 4QE5A 5C2GA 4O14A 3ONCA 3AYVA 5C2XA 3P5YA 4IQLA 3CYJA 4C7FA 1TB3A 5G2WA 1ZL1A 3L5MA 1QVBA 5A69A 4PMDA 4DBUA 2CU0A 5DRCA 1AMYA 3GW0A 3NYDA 2QJMA 4UCGA 5BXTA 3D0CA 3E0IA 4IL0A 2GJLA 1TV2A 3USBA 4AWUA 1C90A 3PS7A 3UGRA 1RCXB 3WFLA 5A95A 4IPJA 4YL2A 3FY1A 2WC4A 5H6HA 3NQAA 4O28A 5AC5A 2PGRA 2ALDA 5HWJA 1OM0A 3WMBA 4Z2HA 3NQGA 3TXZA 4CD4A 1EGZA 2VR4A 4YMZA 3AJ7A 3PWAA 4LUSA 1TWDA 4IJRA 1H4PA 1DQXA 3OA3A 4DWSB 1E56A 1TIWA 3O6YX 3ITYA 1ISWA 4DYJA 3QY6A 4NAFA 4R7WA 4D8AA 3MI6A 2RGMA 3KVLA 5D9PA 3S1VA 4S3EA 2CHRA 1Z3NA 3TQ0A 5FF4A 3ABQA 4LNCA 4C1LA 1TJ2A 4XAYA 2P8CA 4S38A 1PKNA 1PTGA 1RQBA 1GOQA 3GHTA 1UIPA 4RLIA 4LCRA 5DQPA 2OR2A 1UKQA 1JRBA 2WZMA 1JDDA 1LYXA 1OADA 2CIPA 2J77A 3UG8A 3WH7A 5HMFA 2VZOA 4DI8A 3BG3A 3UPWA 2DVXA 3TTSA 3UJSA 3W6LA 4U31A 5A3HA 3VX0A 3A4AA 3GG7A 4IIGA 2QYGA 3BSHA 1MW1A 1P6CA 4Q4KA 3RCMA 1RJPA 4FR1A 3R94A 1TVLA 2JKPA 1E1CB 3LTYA 1DORA 2VFDA 4UTTA 4INFA 3LV5A 3H4WA 3FJLA 1O12A 3T0AA 5I78A 5MKGB 3BLIA 1AZ1A 1TR1A 2DDXA 3NIYA 4ZENA 1K3UA 5KETA 4ATDA 1Z7AA 2HBVA 1VBHA 1B30A 4C6CA 1KCXA 4K6AA 2J62A 3E2QA 3VC6A 4MB4A 3LLDA 3P60A 1KCLA 1LJYA 3APYA 3AMLA 5H8UA 1BG9A 3COTA 2C1HA 3QZEA 5EFDA 3T05A 5SWUA 3NZRA 3QMTA 4L1WA 4F79A 1HXJA 4F2TA 2BMBA 1UYQA 2Y8VA 2NXGA 4TR9A 7TAAA 3ITCA 4XK2A 2Q71A 3SB0A 1GONA 1JUBA 1RBAA 4D6DA 3HB9A 5EIYB 4ZQPA 1KTCA 4A2RA 1IEXA 3MQTA 5U4NA 3C8NA 3LB0A 2WC3A 2AGTA 1EJSC 3DCPA 5IFPA 5HMEA 4IM4A 3SEPA 1V7AA 5CSUA 1QI3A 2YOCA 2WPGA 4O16A 3B4YA 3VIHA 7XIMA 3EB2A 4PCTA 4PBGA 2C71A 4QCFA 1XGEA 1S5MA 1ICPA 1QR7A 2V5BA 3TA9A 3R2GA 1TELA 3WBAA 4A3YA 1A49A 1VJZA 3IGSA 3WQGA 3AIQA 1FWWA 1H51A 2J6VA 5F4SA 3OVRA 1ITUA 1EUAA 4W85A 3UR7A 4AWEA 4OT7A 4TVUA 1GEQA 3LGDA 1LUCA 3BXWA 4FA3A 5F4WA 2VGGA 5J5RA 2X1RA 1BEUA 3NZGA 1BKSA 5KZDA 4KCTA 3W7JA 5FACA 4F9DA 4J3ZA 3FVDA 1PWMA 5CPOA 1PZ2A 3CV1A 4IGHA 3WK0A 3WUFA 6A3HA 4U3CA 1QW7A 1MFUA 2EKGA 2XIBA 3NXFA 4OOZA 1NDZA 3USZA 2PLMA 3CWNA 5FJPA 3NL3A 5F1UA 1CB2A 1NARA 2CBUA 4UFHA 2C0AA 2V5JA 5KITA 4Y9PA 4TO8A 3KLKA 4CNPA 3FXYA 1KBJA 1W54A 3DU0A 4KQNA 3CAVA 1P0EA 3S5SA 5TAOA 2YPIA 3S9IA 3IRDA 3OW1A 4N02A 1V6XA 4IFKA 4CKQA 4QEHA 4UTTC 1JUEA 4KH2A 4Z17A 2YYUA 4N9BA 3TP4A 5EBAA 4I7VA 1A0CA 2DVTA 1WZAA 3FSTA 4Q4SA 5BROA 4NNCA 3ANUA 3SRHA 1TQXA 3TONA 5C9XA 2YLAA 2Z29A 2QF8A 3SBFA 2V69A 3OIXA 3HG5A 2P53A 2QCLA 1PX4A 2A5HA 2W9MA 3V3WA 2A7RA 1E0TA 4GC4A 3UERA 3LA4A 3UNTA 3M0KA 4FLSA 3A3WA 4YU1A 2OYLA 2VVNA 1R38A 1VHCA 2BNJA 1DJNA 3VYLA 3NGFA 3IVUA 1ALDA 1XLJA 4MNJA 3QR1A 3PB0A 1D7FA 2A85A 1A5SA 1GOOA 3GHRA 4UBPC 3G24A 5M03A 1CXHA 1JVNA 3N4FA 5FJTA 3LPOA 2BFGA 4H2HA 4GABA 4UTLA 5DBTA 1Q2RA 4ZSTA 2VZVA 2EKCA 4PCPA 2H9AA 2WCAA 5GVJA 1GVQA 1ZENA 1JUKA 5BWAA 4MG4A 6XIAA 2JBMA 2DUXA 2A3LA 2VQTA 5CGMA 2PGFA 3B8TA 1G94A 2ACUA 3EPOA 3KHJA 3KZPA 3A9BA 3OG2A 5D37A 3DFNA 4FF7A 2DIEA 4ROQA 5JH2A 1GOXA 3V1PA 2I9UA 3BAXA 5J5DA 3T08A 4OJYA 2Z1XA 1FFQA 4IHCA 3QC3A 1XC6A 2ZE3A 3MKKA 1GVEA 5GNXA 4ZQRA 2WO5A 5A6MA 2PTYA 2VNCA 4AZ6A 1OJXA 5HAOA 2HQAA 4IIBA 1MNZA 3RMEA 2VKZG 4B5WA 4UOQA 3SGGA 1TR9A 3TEVA 4WK9A 1QNPA 4HZ8A 4XO6A 4PMUA 5K4ZA 3W7DA 5FAJA 1UWQA 4C6QA 4X63A 2R1KA 3URNA 2VX5A 5AVHA 4FX6M 3IIZA 1AJ0A 3HV8A 2WMHA 2VCBA 3KWXA 1H7WA 3BCDA 2XM1A 1V03A 2GWGA 3DFHA 2Z2BA 1GKPA 4HK7A 2X2YA 2WLZA 3S4TA 3W1RA 2QR6A 2XM2A 1YXCA 3VNJA 2ZX6A 3PTQA 3QPZA 3URBA 3E3HA 1YYAA 4QQ3A 1G69A 4S3DA 3W7EA 4POCA 4R53A 1ZJBA 3TLQA 3HO8A 1DEDA 3KDOA 4S23A 5AYBA 3TE9A 4Q6JA 5DMNA 2W79A 3B0UX 2YL5A 2W92A 3MU7A 3W07A 4V1XA 5I3GA 4RZBA 5A6LA 1XQKA 3FW6A 5EY5A 3U2CA 2Z7GA 3W7LA 1OIFA 2ZRZA 1V3JA 4WOQA 3TYCA 2OX1A 2R14A 3M6DA 3ONBA 4RE4A 4IIHA 3TW9A 5XIMA 1E0WA 4B5SA 4FS9A 1T7LA 2IQDA 4M6VA 3RDKA 3UESA 4JIQA 2W61A 5AHMA 4H7CA 3V0UA 4UTWC 4FOUA 3GAKA 4LBSA 2NQLA 3SUSA 3B8SA 4D71A 4WF7A 4JDBA 1EGMA 4BI6A 3TDFA 1FP9A 2Y2WA 2XWEA 3MI3A 5DY2A 3U4AA 1ONRA 1D2KA 1XLIA 2WJZA 1UZDA 4WQ6A 3P7YA 1J79A 1WDWA 4ES4A 1RD6A 2ZC8A 3THQA 1V08A 4ROPA 5BYWA 1V0LA 4DY1A 1K8YA 3CBWA 4YS1A 5DLCA 2WKGA 2HVNA 1L6FA 3FA3A 5HQEA 4J27A 1V02A 5CLTA 2XZ7A 3CZJA 3TV8A 5JH1A 2GYIA 4W8BA 3W7OA 3BZJA 1P0NA 1M6JA 2E9LA 5DO8A 1GOWA 4GCXA 1IE7C 1XYMA 5AYZA 4C6DA 1ZU8A 4B5TA 4JX6A 2GDUA 4D8ZA 1ZFJA 3T44A 4LVFA 3LNPA 4URIA 1BF2A 3SZ8A 3AUJA 3SSJA 4W87A 3W7KA 1H5YA 4WKFA 1YADA 4OV4A 4UNLA 3RM4A 3DUGA 4O18A 4DBDA 1KM2A 1WXYA 4XBSA 1HP4A 1O94A 3NSMA 1S5TA 2X0YA 3RU8X 5M3WA 4NJHA 2GGJA 1KFEA 3GFZA 3RFAA 3TZNA 4XX6A 4FALA 5JUVA 3AUOA 4GIRA 3A3XA 3PM6A 1KFKA 3FAWA 5E1QA 1JZ8A 3CMFA 5G4HC 5HUOA 1CGUA 5HMSA 1NFPA 3LY0A 1RK5A 4LFYA 3WENA 4FNSA 2OVLA 4WVXA 2YIHA 3EMQA 4BY3A 4JFUA 4IWWA 4FO4A 1PWLA 3AXHA 2PWVA 1JZ7A 2V9DA 3RLHA 3HGSA 1W3LA 4OHQA 4IUOA 3W74A 2Y24A 4B5NA 2UZ9A 1F2JA 4X2PA 3MPGA 4P8UA