3SUWA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with nhac-cas
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase
total genus 193
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3suwA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3suwA02
2XSBA 1OD8A 2XG9A 4H8VA 1XRVA 2Y4SA 3ZT5A 2WCAA 4NI3A 3AMLA 3SURA 3TTSA 2VVNA 4GZJA 3VDCA 3A4WA 3EMQA 1KQZA 1QI2A 3VGBA 4H41A 3ECQA 1SMAA 1H0IA 3KL5A 4UZUA 3FNDA 4H04A 4R27A 1AQMA 3W82A 3ZOAA 3QGVA 1TR1A 4H8HA 4CVUA 1OT2A 1JZ7A 2WB5A 1E56A 2WANA 2EPKX 3MSDA 3WD2A 4HMDA 1JAKA 2OSWA 3T2PA 3IAQA 2FHFA 2J7EA 3AROA 1E0XA 3KEHA 4PMUA 4C7FA 1E1EA 2WBKA 1V6YA 5CG0A 1GOWA 3QOMA 3WDQA 3ZO9A 3VKKA 4QLLA 5CSUA 3RILA 4M82A 2W63A 1MW2A 3WNMA 1TA3B 3S2CA 3WEMA 4F79A 4PYSA 4GKLA 5BYWA 3TTOA 2WXDM 1MQRA 3CHFA 1E6SM 3SCVA 1NWTA 1J01A 4XV0A 3GTNA 4MB5A 2W62A 2W67A 5HPOA 3TTQA 1FH7A 1CIUA 2X1IA 3MUZ1 1PZ3A 4MADA 4PUEA 3DYMA 1UA7A 3W6LA 3DHUA 2XPKA 4WK9A 1J0YA 2WLZA 3K8LA 2VX6A 2XVKA 1GQKA 1GW1A 3VU2A 3WMSA 1UG6A 4W87A 3WSUA 1JF5A 1KCLA 2O9TA 3UR8A 4Z2LA 1UWSA 1M03A 3RMEA 4XZBA 3T0AA 4ZXOA 2XSAA 3VO0A 6CGTA 1JFXA 1E5NA 3NDZA 4AY1A 3ARVA 4PMVA 4NF7A 5M17A 1WDQA 1G0CA 5FKYA 1UD2A 2QV4A 1V03A 3GBDA 3AI0A 2OWCA 1SYTA 1QHPA 1WAWA 4MJ4A 3DHPA 3N15A 1US3A 4MJ2A 3GXIA 1UKTA 1SFSA 5I23A 2J77A 3HMCA 4W8LA 2YL6A 3OG2A 3WY1A 2ZUVA 4LYRA 3VD4A 3GXMA 2W4XA 4PSPA 3GH5A 1QI3A 2V3DA 4UR9A 2D3LA 1Q6EA 2UY4A 3T0BA 3U5YA 1ISZA 1NOFA 2XJ7A 1OB0A 3GNRA 1Q6GA 2EPNA 1HT6A 3LPPA 1ZBCA 1QNOA 2J7DA 1P6WA 3EMZA 4PBGA 2XM1A 3GM8A 4GIAA 2JALA 3TP4A 1C93A 2D20A 4PCTA 1XSKA 2E40A 2UWFA 4EE9A 3VIFA 3BAKA 4BQ5A 1AQ0A 3W4RA 2OWXA 1CPUA 4JKKA 4MDOA 5F7UA 5IHRA 3WFZA 2VRJA 4B9ZA 2J47A 3FAXA 3PZIA 1OIMA 1HX0A 4PMRA 3SCOA 5JIPA 5EMYA 3MANA 3VMPA 2VCAA 1HVXA 2WSKA 3TOPA 2WMIA 4Z2JA 5A1AA 2CXGA 2VCBA 3UERA 1KGXA 4NZCA 1K9TA 3QOKA 2JEPA 1GOOA 1OBAA 1B30A 2YLLA 4TUFA 4KH2A 3N17A 1GQJA 1UD6A 1UHVA 1TZ7A 2NT0A 1CZ1A 3AMGA 4FLOA 1CGTA 1QNRA 2VZOA 4D6FA 3FY1A 4RE4A 4D6JA 2CHNA 1E73M 2WMIB 1NWUA 2WVTA 3OLDA 3O2LA 1GCYA 5GQBA 3IJ9A 3GYCA 2Y8VA 2FGZA 3M6DA 1PX8A 3TTYA 2EPMX 4CN6A 2A3EA 1E15A 1WDSA 2PBOA 1XSJA 3GH4A 4W5ZA 3IJ8A 2XVNA 2WHKA 3QHOA 5CPQA 1CGYA 4D6EA 2E3ZA 1YHTA 2A3HA 1UQZA 1OM0A 3CUGA 4IUGA 3S6TA 3MV01 1WO2A 4MNKA 1UH2A 4JFWA 3CIVA 3VD9A 2YDQA 4AD4A 5BCAA 4HA3A 4AZIA 1RP9A 4LYPA 3GZAA 3SUVA 3PZNA 2E4TA 2EQDA 3AIUA 4J7RA 1ZBWA 1QW9A 5A6JA 2V5CA 5JBFA 1GOKA 4TX8A 4MDPA 1RH9A 3VINA 1J0ZA 2DT0A 2PC8A 4HPHA 3CLWA 2X0HA 4CKQA 5C71A 2JE8A 2YDSA 3WNPA 5LA1A 5D9PA 1LL4A 5E6YA 1BGGA 3OGVA 2J4GA 2QMKA 4HA1A 5EFFA 4KWUA 2V3GA 1X6NA 4PEEA 5ABHA 4W8BA 1CGUA 1NWRA 1XGZA 2W61A 4M29A 3WH5A 1W3HA 2BY1A 1KQYA 1NP0A 2PI6A 1D3CA 3N9KA 3GXFA 3E1F1 5HPCA 1XH2A 3F4VA 1E6QM 1KBKA 1NP2A 1W9XA 4PTXA 3WD4A 1QW8A 1TVPA 2YLAA 4CN1A 9CGTA 4J3SA 1JNEA 1RD6A 5C8BB 2F61A 2ZOXA 3CUJA 1WZKA 3WF1A 1E72M 3VIJA 3GNPA 3WUGA 1BAGA 1PIFA 1VFFA 4MB4A 5ECUA 4MAZA 2Y8KA 1HKJA 2WMKA 4BF7A 4D6CA 5BROA 2A3CA 3WDRA 4JHOA 5I5RA 2X0YA 2OYKA 1XH0A 1DWJM 1SR0A 1JYVA 5KZ6A 1O6IA 1W9DM 4DWSB 3WUEA 4CD5A 4Z2HA 4U5IA 1W2VA 1B3WA 1EHNA 2D0GA 3WDPP 5EB8A 1FH9A 1V3HA 2VR4A 1IZKA 5FIPA 1LL6A 2OYMA 2C8NA 2VURA 3F5JA 4ATLA 5BXSA 4PMOA 1AQHA 1H5VA 3THDA 1B2YA 4CCDA 4UOQA 3U5UA 2J7GA 1W3KA 4XUYA 5FL1A 1W1PA 2ZX8A 4ATWA 2VQUA 1VEMA 4N42A 2VRQA 1XSIA 1W9BM 3IK2A 3A4AA 2RGLA 3B8SA 5DT5A 4P7NA 3VDAA 4BZYA 3W37A 1WNOA 3WH7A 4AZCB 3PZOA 2VX7A 4P7QA 2C7FA 3OA5A 1VENA 3WBAA 5DT7A 4PMXA 2AOSA 2ZUTA 5D9NA 3TONA 2O9RA 1QHOA 4UQBA 4Z2GA 4NRSA 2WC4A 1V0MA 5A8NA 3CHCA 1JXKA 2GSJA 2BHUA 2J7FA 5EBAA 3SCNA 5A6LA 5BWFA 1JIBA 1FP8A 4JZ5A 1ISVA 3PZMA 2GJXA 4YPJA 1GORA 3VPLA 3VIPA 1U33A 2PB1A 3AHYA 4BQ2A 4U31A 1OGGA 5I24A 2ZXQA 4GINA 1JZ6A 4UFMA 3AMKA 3WBEA 1E5JA 1UQYA 3PBGA 2VZTA 4U2YA 5M03A 1D2KA 1L0PA 4BQ4A 4L4OA 4MAVA 1E4MM 3RM9A 1HJUA 2DDXA 3W0KA 3UCQA 3FHQA 1C3FA 5I77A 4PSRA 1I1XA 2WPGA 1ISXA 1K9EA 5D8WA 5AY7A 5HXMA 4NSBA 3VMNA 1I75A 3VD3A 1J0HA 3FAWA 3PTQA 4OOUA 1C8QA 2GJRA 1NOWA 5A2AA 4D6IA 2FH8A 2CBVA 2ESCA 1GVYA 1VBRA 1HL8A 1BYCA 4A4AA 1CXIA 4TVUA 6A3HA 3BXWA 1V02A 3AXIA 3WD0A 2WAGA 4JIEA 4OJYA 1CLVA 2B31A 1C8XA 5A2BA 3N13A 3W27A 1PZ2A 5M5DA 5M3WA 1SMDA 4CU7A 1EDQA 5IXEA 4UOJA 3HN3A 3AIBA 4ATDA 1JXJA 3FHAA 2EO7A 4KGJA 1B1YA 2WK2A 3T2OA 2WLYA 1JDAA 3NJ3A 1KWKA 2WMGA 1HJWA 4KRUA 2XM2A 1H3GA 1V3LA 1JZ3A 5AYBA 4JHZA 1L8NA 4L4PA 1CLXA 3MS8A 2WWCA 4DUXA 2D3NA 1J10A 4FLRA 4KGLA 3MUY1 2BVDA 3MV11 1ODUA 1AVAA 1E6XM 4W88A 4X9YA 1Q6FA 4GQRA 1UR1A 3WD1A 4AMCA 1HKIA 1WDPA 1V6UA 2D23A 1V02E 2F2HA 5IHSA 1NWSA 1BF2A 1VEOA 5IFPA 1EIBA 3W38A 3OLIA 2DSWA 4XX6A 4MNJA 3ZMRA 2DT3A 4TOQA 1FFRA 1MWOA 2WW5A 3SUSA 2CEQA 4HZ8A 4JCLA 2JF6A 3ARSA 3IJ7A 1JYNA 3ZR5A 1E6RA 1AMYA 2JIEA 1E0VA 4WLCA 2YIHA 1VBUA 3ZQ9A 3WMBA 3L2MA 2VJXA 4QLJA 2E8ZA 5CPSA 3QR3A 1W1TA 4P8UA 3RM4A 4M56A 3ZJ7A 1EQCA 2OWWA 3F5LA 4IISA 4W93A 4GI6A 2VTFA 1KXTA 4UFJA 1E6ZA 3WNNA 2CETA 3WF4A 3K46A 4FMVA 1V6WA 4C7DA 1PJ9A 1H09A 3POCA 2WZEA 4U5KA 3AZTA 3APGA 4AIEA 3HJEA 1UWRA 3T2QA 5HOSA 4UFIA 3MMDA 1K9DA 3ZJ8A 3RCNA 2XUCA 3MU7A 1VFUA 1H0GA 4CN4A 3OBAA 3U57A 3SCPA 3ARYA 1I1WA 3LPOA 3WQ8A 2E0PA 3W25A 1XH1A 1FOBA 2X05A 1D7FA 4MB1A 5D9OA 4N0RA 1NQ6A 2J8GA 4AZ5A 3VMOA 1ECEA 2GDUA 3GBEA 1UD8A 3UG4A 4X0NA 4HZ7A 5E6ZA 4A3YA 4B3LA 4F9DA 5ABFA 3K1DA 3WIJA 5A8PA 1VJZA 3ARPA 2J75A 1HNYA 3BMWA 2ZX6A 3OLGA 1HKKA 2D2OA 3PZTA 5A8QA 1MW1A 1FP9A 3EBVA 4TVCA 1WZAA 1EHAA 1G9HA 2JFEX 5GNZA 3W24A 1CDGA 3FW6A 3WH8A 2BHZA 3VIIA 1PAMA 4W7UA 3NYDA 4W7VA 1V3IA 1EA9C 2AAAA 2VI0A 1B0IA 3ZJKA 4AZ6A 2XWDA 4CU6A 2CBIA 1XHGA 4HTYA 1UR0A 2XVPA 2ZUWA 4C90A 4RE2A 2J7HA 3WENA 1CXFA 3ARRA 1F4AA 4J3WA 2XIBA 4ML4A 1QPKA 2VZUA 4CD8A 2EEXA 2BVYA 3VGFA 1JZ2A 5I6SA 4ZFMA 2WNWA 1PIGA 1V3MA 4HA4A 3EDFA 1W9PA 1UYQA 3W6MA 2G3MA 4D6HA 3SUTA 2ZWYA 3SCUA 4J3UA 4KRTA 3CZLA 1JZ8A 1ITXA 4NRRA 3K4DA 1QOXA 2HISA 2ZXBA 3EYPA 1JDCA 2WVVB 4S3KA 3FXYA 3VGGA 2E8YA 2J78A 1ODZA 2VCCA 2PWFA 3W28A 2YBUA 3LPFA 1J0JA 1CGVA 2CYGA 3CUHA 1WDRA 3T0DA 2HVMA 3WUFA 2WKLA 2CCRA 1W3LA 2XFRA 7CGTA 2EPLX 4X0VA 4Q7NA 4F8XA 4F9JA 5CGTA 2FDMA 2WVVA 1KGWA 3WF2A 3QHMA 1B3YA 4IM4A 1DWFM 3ARXA 4D71A 4EKJA 2J79A 2QF8A 1KGUA 3AHZA 4J3VA 2YJQA 1W2PA 1BYAA 1UKQA 3A4XA 3GH7A 3OZPA 3MUAA 2CIPA 1UD4A 3SUUA 4CD6A 1IV8A 1ISYA 1J9YA 2V38A 1JFHA 2BY2A 3B9AA 1DWAM 3BMVA 4PRWA 1E4LA 1TG7A 1WP6A 2UY3A 1UKSA 4CU8A 3VVGA 2WHMA 2ZWZA 4UQ9A 3AHXA 4PTVA 3NSNA 2IXVA 3O9NA 1UWTA 1GOMA 4IPLA 1VIWA 1CXLA 1B3VA 3VX1A 4WSKA 2X2YA 3CGTA 1MFUA 1QI4A 1BG4A 4W5UA 4WKAA 2ZXAA 2BHYA 3N18A 3WNKA 4B9YA 1GNXA 4PUDA 5LYRA 4HOWA 3D5HA 4PN2A 5DEZA 3AMDA 4DUWA 3ARTA 2VZVA 2ZX9A 3AHTA 4Z2IA 1E43A 4UFHA 3D3AA 3DC0A 1VAHA 1LWJA 1GOIA 1PX4A 1UZ4A 4AEFA 1BLIA 5I2UA 2WSPA 3EDEA 1KWGA 1KR1A 2AMGA 1QNPA 4OIFA 4CCEA 5A6BA 3K4AA 1JI1A 4WJXA 3TA9A 4ZXLA 2GJXB 2FGLA 1HIZA 4MNMA 1GVIA 2XVGA 4OZOA 3J7HA 3W53A 2BS9A 3BAJA 1V6XA 4GI9A 1WZMA 3ALGA 1WE5A 3AZRA 3WN6A 3DECA 5LA2A 1BSIA 3PZQA 1JYWA 2NW0A 2ZUMA 5JBDA 2YOCA 2YL8A 2VX5A 5E0CA 5FL0A 3MO4A 3GNOA 1PPIA 3GXDA 4AZHA 4ZENA 3AIWA 1CXEA 1FHDA 1R7OA 1UR9A 1X6LA 2ZUNA 4GO8A 1HJVA 5A8OA 3L4ZA 1ESWA 2Y2WA 3WDJA 1C92A 2WCSA 1QVBA 3WL0A 3RIKA 1X1NA 4AEEA 1JI2A 4W85A 1K6AA 3AMCA 4ZE5A 4J3TA 1PEZA 5I79A 4AIOA 1FHLA 4AWEA 1E1FA 5DF0A 1NM9A 2WMFA 3MUIA 3BLKA 2JF7A 1V3JA 1LJYA 2Y5EA 1F4HA 3U7VA 2ZUSA 1EXPA 2O92A 3OGRA 4CUCA 1XD1A 3WD3A 2CHOA 3CHEA 5CGMA 4P8WA 1CXKA 1M7XA 1UR8A 1S46A 4UZSA 3K8MA 1M53A 3M7SA 4TXEA 2GFTA 4AZ7A 5DFAA 4LGXA 3N12A 2O9OA 2OLHA 3EDDA 4PMDA 2VVSA 4M1RA 2DPEA 2J7BA 3ZIZA 5FOOA 2VUYA 3MKKA 2W5FA 4YN5A 1H11A 4HU0A 3UG5A 2PWHA 3ZT7A 3AS1A 3QHNA 1OCQA 2DH2A 1B9ZA 2V3EA 4MPKA 4W86A 1WPCA 1E40A 1E6PA 1M01A 2WVUA 4WKFA 2J7CA 3RDKA 5ABGA 2FH6A 2DSZA 1BFNA 5A95A 3KE0A 3AS0A 1UWUA 4H8UA 4CD7A 5EFDA 3B9EA 2WZIA 3AZSA 3CH9A 1JD7A 5A3HA 1DWGM 3WQ5A 3PTKA 3AHVA 1J11A 3EMCA 3AIEA 1EOKA 3VGHA 1ZJBA 4GZEA 1UD5A 2D0HA 6TAAA 3SCQA 2CITA 1EDGA 1KBBA 4D1IA 1G01A 4UFLA 4P7RA 4YHEA 5CSYA 1BPLB 1K9FA 4D72A 3AFBA 3F5KA 5D4YA 3VNZA 3VILA 4QLKA 4TVDA 1CGWA 1CGXA 3AIVA 2UY5A 1LG2A 4KMQA 3UEQA 4JFVA 1J18A 5D8ZA 1W91A 5AC4A 4ACZA 1XYFA 4P7LA 4U3AA 2EXOA 2D24A 3SCWA 2VNCA 3AYRA 3AQUA 3SCRA 3VDHA 1UWQA 2ZUUA 3IANA 1CXHA 5A8MA 1MQQA 1MXGA 1V0NA 1W32A 5CPTA 3WL1A 3DYOA 4DWSA 4AZBA 3CBWA 1GQIA 1HJQA 4HOXA 3RM8A 5BRPA 1W9UA 1GOQA 3UESA 4AD1A 2ZE0A 4JKLA 1B3XA 4ACZB 4ZEPA 1E0WA 2J62A 3VM5A 2BV9A 3ZJ6A 2EBNA 4LYQA 1BGAA 1OIFA 1QBAA 2BNJA 2XFFA 5LA0A 2VO5A 1LQ0A 2WC3A 3VD5A 4WIWA 4EANA 3VTRA 4AISA 1U30A 3BGAA 1HP5A 5E0FA 2YBTA 1B90A 1E3XA 3AXXA 4GI8A 1V3KA 2YL9A 4JCMA 4FF5A 4QCFA 2D22A 5A2CA 4CVWA 5A94A 2NSXA 4H2CA 1R87A 1CNVA 2PF0A 4D6GA 2WCGA 3KZSA 2QLYA 4GPNA 1MFVA 3T09A 3PN8A 4FK9A 1ZU8A 2CESA 3WQ4A 4AW7A 1GONA 2Y24A 2Q8XA 1V0KA 2BY0A 2VT0A 4GXPA 1BYBA 5E9AA 1CBGA 3ZSTA 3WQVA 1CWYA 1GPFA 4M81A 5DO8A 2FHBA 3G6MA 5AC5A 4A3HA 2NT1A 1A47A 1J0KA 2BXZA 5CLWA 2WC7A 3SCTA 1C91A 3OB8A 4OOZA 3PHAA 1UD3A 1DWHM 1N82A 3AS2A 3WH9A 4QP0A 1J0IA 3WNLA 1UOKA 2WBGA 4E4PA 1ZL1A 4W8AA 3NIYA 4XB3A 1WZLA 4HMEA 4PTWA 3A47A 3VDBA 2W91A 4J27A 3ALFA 3CZKA 3BAIA 3BC9A 5I0DA 1H41A 1CYGA 4Z2KA 3WDIA 1KB3A 4F66A 2YA2A 2PWEA 4MNLA 5C70A 4OBRA 8A3HA 1UKPA 1HN1A 3EDJA 3OIHA 5DMYA 1VB9A 4UNIA 1VEPA 1W1YA 4DUVA 4ACYA 4S3JA 3BSGA 3CO4A 3NSMA 1HJXA 3VIKA 2V3FA 1RP8A 4K68A 4WF7A 5JIWA 1QBBA 1ZS2A 1C8YA 1H4PA 1EOMA 2BY3A 1EO5A 4JFUA 4HMCA 1MXDA 2E9BA 3WUBA 2MANA 4XZWA 1WCGA 1OWQA 4C91A 4AIUA 4JAWA 5FCZA 5HDRA 2VZSA 1JZ4A 2WWDA 1BVZA 3M07A 2CPUA 2E9MA 4V27A 2VMFA 3MSGA 1KXHA 3VM7A 7A3HA 1KCKA 2DIEA 2DSKA 3PZUA 5ABEA 2VC9A 2XTKA 1ITCA 1HJSA 4P8XA 3DYPA 1R7AA 1BG9A 1HXJA 1HL9A 1B31A 4AD5A 4LXFA 3T08A 2VQTA 1US2A 2WMHA 4DWSD 2RGMA 1UR2A 2ZX5A 4UCFA 3CHDA 2W92A 5D9MA 5CQ1A 2XFYA 2XWEA 1WKYA 2DSUA 4AD2A 4Y7EA 4UFKA 2WM0A 4UQCA 1QNSA 5GNXA 1JD9A 1CECA 2GK1B 2ZIDA 3MMWA 1VFOA 4DM2A 3II1A 1UR4A 5A69A 3WNOA 3FN9A 1EH9A 4PTMA 3LPGA 1UKOA 1ZBKA 1VJSA 4TX6A 3WF0A 3WQWA 3L4WA 1JAEA 2W66A 1Z32X 2CNCA 1LL7A 5A6SA 3ARWA 4W84A 3L4TA 2PWDA 3AJ7A 5GNYA 1MVYA 4P8VA 3RO8A 2G41A 4UTFA 4DM1A 4OUEA 5A6MA 3L2LA 1DTUA 1BHGA 2D1ZA 1TMQA 3AICA 3NDYA 3VIMA 1TUXA 4BS0A 3PTMA 3AXHA 1MQPA 1G94A 2VX4A 4BQ3A 8CGTA 2OSYA 4P7OA 4E8DA 2GJPA 2QHAA 3MMUA 1QI0A 1PX3A 1GQLA 1VRXA 2YKKA 4RL3A 2OYLA 4UQDA 4M24A 4DWSC 3WMCA 1YQ2A 1GZJA 1M04A 5A6BD 1XD0A 2X8RA 3OZOA 3NCOA 2A3AA 2QPUA 2QPSA 4YHGA 2ZICA 4JFSA 3AIQA 2CKRA 1KXQA 3CPUA 3N11A 1J12A 1V0LA 1DHKA 2O9PA 1BYDA 1MW0A 1XCXA 4JL1A 3BSHA 2YA1A 1PBGA 3CZ8A 2J8FA 3UG3A 1TVNA 1Q6DA 4PMNA 4HP5A 2QMJA 2X09A 3HU7A 2WZHA 2DIJA 2EPOA 4U3CA 2C0HA 2XGBA 4C7GA 1RPKA 3BAWA 4QFUA 1JZ5A 1QHZA 5JUVA 1W3JA 4QDMA 3WF3A 4JL2A 4V28A 4E2OA 5JBEA 3CMJA 4FLSA 1FH8A 2J74A 3AIRA 3CUIA 4AZCA 4AD3A 2Z1KA 4UQAA 1GHSA 1HF6A 4W7WA 4TTUA 3A3HA 2VRKA 2UY2A 5CZKA 3OGSA 3WEOA 1MW3A 2XIIA 3VIGA 3VIOA 3LMYA 1C90A 3NUKA 1FFQA 1OT1A 3L4XA 4HU8A 4WKHA 5FD0A 2DQXA 2WMJA 3PZ9A 1U2YA 4PMZA 5E70A 1CENA 2XGIA 1C7SA 1OINA 3WQ6A 1JNDA 2JEQA 3SIMA 1EQPA 2XYLA 4AC1X 2BVTA 2E9LA 3N1AA 3PZGA 1G1YA 3VGDA 3CMGA 3CZGA 3WELA 2XVLA 4U2ZA 1IZJA 2G4FA 4GO9A 3BCFA 4LPCA 4GZIA 4CCCA 4EAMA 3W29A 1G5AA 3L4VA 3BAYA 4MTVA 2WKGA 1UH4A 2YA0A 3VUPA 1UH3A 4D1JA 1V6VA 1TA3A 3RJXA 5TD4A 4AXNA 4HOZA 2DT1A 4AYSA 1A3HA 1VF8A 1LG1A 3VIHA 3VNYA 1IT0A 1EO7A 3WDHA 4BCEA 2A3BA 2WVSA 2BXYA 2V5DA 2G3IA 2PBGA 2YL5A 2D0FA 1MYRA 1ISWA 4MB3A 1OD0A 3EDKA 3AISA 1XC6A 1C7TA 3OLEA 1ZBVA 1JGIA 1BVNP 5I78A 5CJ5A 3L4YA 3SCSA 4LQ1A 1OGSA 3ZT6A 7TAAA 3VGEA 3K8KA 1R86A 2FHCA 2ZXDA 3BLPX 2DGAA 1E55A 2IUZA 1LLOA 2G8ZA 5A6AA 1UZ1A 3CTTA 1R85A 3VD7A 1BQCA 1E71M 3I3DA 1DEDA 4PMYA 3RJYA 1KFWA 3SEPA 4GQQA 3O6AA 4TTGA 1JL8A 4U33A 1E4NA 3IAPA 4ZE4A 3M46A 4FLQA 1BTCA 3ZR6A 2TAAA 1XYZA 4E8CA 3UR7A 3ARUA 3BCDA 3ARZA 2EJ1A 2CKSA 3CUFA 3I3EA 1ZJAA 3POHA 1Q4NX 4CGTA 1GUVA 5CLTA 1JDDA 1E9LA 1WB0A 4AD0A 3BH4A 4IPNB 5BXRA 3A6OA 2G3NA 5BRQA 1E4IA 4JKMA 4UQEA 2WHJA 2G3JA 1CEOA 1DWIM 1TE1A 4JFTA 2YDRA 4B16A 1B3ZA 2Z1SA 2PWGA 1Y7VA 5HBFA 1NARA 2CBJA 3U7BA 1GJUA 3GDBA 1Q6CA 1QI5A 5IDIA 3SUWA 3B9DA 3VOCA 4W89A 1O7AA 3W81A 1V08A 3JUGA 1EGZA 4V2XA 3AOFA 1R8LA 2JIWA 3VX0A 4EK7A 4QCEA 2GVYA 1NH6A 2GUYA 4URIA 4LX4A 5BXTA 2IXUA 1UWIA 5CXPA 1KR0A 2DEPA 2DT2A 3WEZA 2XHYA 1DP0A 3L4UA 1JF6A 1LWHA 3ARQA 1FA2A 1E6NA 1UUQA 5GPRA 2VOTA 2OSXA 5IFTA 4J28A 1E3ZA 1VFMA 1XCWA 4QAWA 5AYIA 2CERA 3CZJA 1H49A 4D6DA 2BFGA 2CBUA 1EDTA 3WFLA 5ABFB 4R5EA 1KXVA 2WHLA 1E70M 1GJWA 4RE3A 2DH3A 1W1VA 4B3KA 1UA3A 2ZX7A 2F8QA 3I3BA 4WSJA 1W9VA 3KL0A 1LF1A 1GHRA 3ZSSA 2J25A 1HP4A 3CZEA 2VR5A 4B15A 5A6KA 4H7VA 5KEZA 4AZGA 1NOUA 4HPGA 1OSEA 1TCMA 2DSVA 3N04A 4J3XA 1H1NA 3THCA 3UETA 3KL3A 1CTNA 4PMQA 5HNNA 1OGBA 4HZ6A 2GDVA 4M80A 2VL4A 3PZVA 1JYXA 3KWXA 3ZM8A 1H2JA 4BA0A 5E09A 3AYSA 4CD4A 3NSXA 3W26A 1XV8A 1HVQA 4UOZA 4PCSA 3AS3A 1JG9A 1QNQA 1HKMA 1ZB5A 5BXPA 3WKZA 3RPMA 4M8UA 1TFVA 2WYSA 3WH6A 4OBSA 3G6LA 4OKDA 2GK1A 5I3DA 3BAXA 4Q22A
chains in the Genus database with same CATH superfamily
4DJFC 1OD8A 2XG9A 3E2VA 2Y4SA 2WCAA 4B2DD 4NI3A 3ORWA 2FPYA 2VVNA 4QM1A 3HG3A 3I68A 3VDCA 1QI2A 3LYEA 3PF3A 3ECQA 1YTKA 4ROQA 1TQJA 1ZCCA 3KL5A 1UASA 3TEVA 4HHLA 1S2VA 1YNPA 2Q71A 4U28A 1OT2A 3BO9A 2UV8G 1V51A 4GIEA 3LRMA 3MSDA 3WD2A 4GYFA 2C13A 2OSWA 2CWNA 3T2PA 3GS6A 2FDSA 2FHFA 4UTWA 1H51A 4X61A 1M9HA 1E0XA 2DW6A 3KEHA 4LWWA 3ZLHA 2JQXA 4C7FA 4FNUA 2WBKA 3SRFA 2EF9A 1V6YA 5CG0A 4JIPA 1FCBA 1TZ9A 3CQKA 3OTRA 2QDHA 1MW2A 2AQWA 2DORA 3NURA 3WNMA 1TA3B 3S2CA 5KSWA 3WEMA 2VEPA 1QNVA 5BYWA 2VELA 3TTOA 2Q01A 3KVLA 1E6SM 5CPNA 4XV0A 2W67A 4R7JA 5LIWX 3MUZ1 1PZ3A 1EPVA 2ZE3A 4MADA 1O5XA 1SQ7A 3BMXA 3B8IA 1OABA 3DDMA 2RHGA 3BVJA 1GW1A 1OX6A 3WBYA 1KRBC 4FP1A 1SVDA 1M7PA 3WLKX 1UWAA 4XAZA 1M03A 2POZA 3EKLA 3NM1A 4AMAA 4F3HA 1BKSA 5I09A 1JFXA 4JYDA 3ARVA 4RUBA 1NJJA 2QV4A 5AC8A 3GBDA 4P02B 4DAFA 4XSMA 4BWLC 4QS5A 1QHPA 4MJ4A 3N15A 5D2VA 3GXIA 1UKTA 1ZNNA 1MRQA 4YIWA 3WY1A 2JKAA 2ZUVA 4UXDA 3GXMA 1H63A 4D9PA 1EJSC 2W4XA 4PSPA 2V3DA 1OC5A 2PS2A 2OZ3A 4BWLA 4V15A 1NOFA 4RNJA 1ZSXA 1EZWA 3D46A 1T41A 2J8TA 3LPPA 2I1OA 4GYJA 1FWSA 2J7DA 3URNA 3NEHA 2YBVA 3E0WA 1EB3A 3GM8A 3F4DA 4GIAA 1MXSA 2JALA 4DJDC 2D20A 3TJLA 2E40A 2UWFA 2I5QA 3TSBA 4BQ5A 4N4QA 1AQ0A 4MIMA 2TPSA 4JKKA 3U6WA 5IHRA 2VRJA 3V4BA 5BU9A 1PKMA 2R1LA 3BLFA 1OIMA 3T07A 1SW0A 4UTLA 5JIPA 4FNTA 1TMHA 1SZFA 3VMPA 1HVXA 3E6EA 1VS1A 5A1AA 3EB3A 4LB4A 3R58A 3UERA 3IV3A 3V36A 1VGAA 5FEZA 3QOKA 3W7QA 1VLWA 1TV4A 2VD8A 4FXFA 4LUTB 1GOOA 4G7EB 3B06A 3DGRA 3FA4A 1P0DA 2YLLA 2XN2A 1GQJA 1UD6A 3QV8A 3UQNA 3P74A 1XBZA 1CZ1A 4IG2A 1KTNA 3AMGA 1QNRA 2Z27A 3FY1A 2DW7A 4RE4A 3CEUA 3N2BA 1VPQA 4D6JA 2CHNA 1LT8A 3K5XA 4LUJA 1MEWA 3QXBA 4MY9A 3WLMA 2WVTA 4Q8MA 2X40A 3O2LA 1KM1A 5GQBA 3ENLA 4UNKA 2E68A 5AC6A 4NJIA 4PZVA 3GE7A 2BVWA 3TTYA 1XS2A 3H2MA 3MA8A 4GCAA 4KFNA 1F8IA 1WDSA 1M41A 2A2IA 3M5ZA 3KRBA 2WHKA 4C6NA 1CGYA 5AHEA 4J35A 1YHTA 3IGUA 4C1NA 5C7HA 2A3HA 3QRHA 2DUAA 3CUGA 3MV01 1AL7A 4L80A 5D04C 2L5HA 4AHOA 3LBOA 4JNMA 4AD4A 5BCAA 3VABA 1RP9A 2NQ5A 3WQEA 5DY2A 3MCMA 2QVHA 1MSSA 4YYFA 3W1XA 2QNEA 1QW9A 1R46A 3R25A 1OFDA 3VINA 2CWXA 2DT0A 1NDWA 3CLWA 3DERA 2JE8A 2YDSA 2PDJA 5LA1A 2PDKA 1LQ2A 2WPBA 2QMKA 5EFFA 4FX8A 1MO0A 2VFFA 4W8BA 5FACA 2CZVA 3GAYA 2W61A 2PDPA 3WH5A 3EWXA 1D3CA 4MF4A 1ME7A 3D3FA 5CBBA 1E6QM 1NP2A 1W9XA 2ZZ2A 3KAOA 4LAKA 3WD4A 3H70A 4DI8A 1TVPA 1AJ2A 2PCEA 5EKYA 4CN1A 9CGTA 4J3SA 4NZ4A 1EZ2A 2ZOXA 3CUJA 1WZKA 3IARA 2V9DA 3SGZA 3GNPA 3HGOA 2HXUA 2DZTA 1XYCA 3VKCA 3N6QA 1HKJA 4P00B 2WMKA 3R8HA 2HZGA 1DKWA 1J6PA 5I5RA 2Q3RA 4BJHA 1Q66A 5EMUA 1DWJM 3T8QA 4O0KA 4JX6A 3NGFA 1O6IA 3IJ6A 1GWJA 1W9DM 4DWSB 3TWAA 3WUEA 4CD5A 3OVGA 3MKVA 1B3WA 3T9PA 3TCSA 1V3HA 1F05A 4R9OA 1E9YB 4IWWA 4F2UA 1OC6A 1LL6A 2OYMA 4LFYA 3GFZA 2C8NA 2R94A 1CB7B 3W7HA 1XUZA 1EUNA 3FIGA 3SJNA 3JW7A 2YB1A 4XUYA 4LT9A 5FL1A 3ZWTA 5JQ9A 3D47A 4NKCA 4AF0B 5LIUX 5LIYX 4LBSA 2X42A 3W84A 3A4AA 3FGCB 4BZYA 4NI8A 3HPAA 4L61A 3UZWA 1LWIA 3RCYA 3PZOA 2R14A 4NAFA 2VX7A 1KC7A 1Q13A 5E5CA 3T4WA 3V35A 2O9RA 4MUZA 1QHOA 4UQBA 1SSDA 2WC4A 4XKMA 3M9YA 1YDNA 3L67A 2PDWA 4XQ6A 3CAQA 2BHUA 1QPRA 2J7FA 5EBAA 1F6YA 5HATA 1JIBA 2XFWA 2ZDSA 5LNWA 3VIPA 4WDXA 1JZ6A 3B05A 3G22A 4UFMA 2ICSA 1IWAA 3M5XA 2ALRA 1R30A 3NPUA 4U2YA 4UCGA 3UYIA 1E4MM 3KBSA 4DVOA 4QJ5B 1VIZA 3W0KA 3UCQA 1C3FA 4TV5A 2YCKX 3V5FA 1K9EA 4A35A 4EPDC 3BW3A 3K2GA 4NSBA 2CHRA 4DXKA 4JTIA 2FTYA 5AZ1A 3VMNA 1I75A 3KOXA 5DLCA 3V16A 3FAWA 3PTQA 2GJRA 2VDIA 1NOWA 4O52A 3TW9A 3H2CA 3NXLA 3STEA 1UJPA 1BYCA 2H9AA 4A4AA 1CXIA 1RAKA 3WJSA 3BXWA 3Q37A 1AMKA 2D2HA 3U9IA 4OJYA 4A2SA 3C61A 3W27A 5M5DA 1A5LC 1E9IA 2WJZA 2HBXA 1XC4A 4LEFA 3O7UA 2CLEA 4KGJA 1Y5VA 1BD0A 2NV2A 3FJ4A 1KWKA 2WMGA 3HQOA 1HJWA 4KRUA 4WR3A 4A22A 4NHVA 1LQAA 3O3RA 1JZ3A 4L4PA 3NTYA 1VCFA 2WWCA 3RPDA 4AAJA 1WKDA 4FLRA 4REQB 3TSDA 4XSLA 2NVAA 4LCSA 1AVAA 1VYPX 1KCZA 1BF6A 4A05A 3F2BA 4DQWA 4Q4PA 1OX4A 4UIOA 4LSBA 3H4GA 2CLLA 2XH4A 2F2HA 1NWSA 1BF2A 3DIPA 1W5NA 4XX6A 3G1AA 2DT3A 3MWCA 4TOQA 5FSEC 1FFRA 5AVHA 4I7UA 1S5MA 3ARSA 4KCWA 3IJ7A 5BRBA 1JYNA 5I7GA 3BQ5A 2GQAA 3UZJA 1AMYA 2BOFX 4U4MA 2VWSA 3WMBA 3NQGA 2VJXA 5CPSA 3UXIA 3QR3A 1Z48A 4AHQA 1ME8A 5HNUA 4MZYA 1IR2A 4HQVA 5GVJA 5AOUA 3GX9A 3QF0A 1OC7A 1FWNA 5HWNA 3WF4A 4FMVA 1V6WA 4C7DA 3NZRA 4JR5A 4DI9A 2O7SA 2CC0A 4LOCA 3SR7A 3APGA 5EJ1B 4WY0F 2XDFA 2VD9A 2GVJA 3U3HA 4DO5A 2ATSA 5HOSA 3VKBA 1K9DA 3B0XA 3GFXA 1XPYA 3CYJA 4CN4A 3OBAA 3ITTA 1TJRA 2PAJA 1NEYA 3SCPA 5CH9A 2HVOA 3PWIA 3WQ8A 3LPOA 2VFGA 3Q45A 3W25A 1JCLA 1SO4A 4S38A 1D7FA 1OG0A 5D9OA 1NQ6A 2J8GA 4AZ5A 1OADA 3UA3A 2GDUA 3UG4A 3L66A 4DPQA 3ITYA 4DF1A 4B3LA 5B80A 4LVFA 4F9DA 5BZAA 5HNRA 1WX0A 1QW7A 1VJZA 3HM7A 2ZC1A 3N4EA 3T44A 2J75A 4DJED 1O95A 2ZX6A 3OLGA 4AEOA 2PZNA 1AODA 4IF2A 1WBHA 1MW1A 1GTHA 3EBVA 1WZAA 1G9HA 4DY1A 4DO4A 5GNZA 3W24A 3S5NA 3HFTA 1PAMA 4LH8A 1JGMA 3NYDA 3CQ0A 4W7VA 1V3IA 1P1XA 1EA9C 3IK4A 2HS6A 2VI0A 2ZZ3A 1S3HA 2PWUA 2WNZA 4CU6A 2ZUWA 2ISVA 2QCHA 4RE2A 3IIVA 4C90A 1P4CA 3ARRA 1F3EA 3NAVA 4J3WA 2XIBA 1FWTA 1R3TA 1WXJA 3QMSA 1W0MA 4BI6A 5I6SA 4O54A 2WNWA 4FNSA 1V3MA 4LV4A 4KCUA 2ZYFA 2R82A 4NJKA 5C55A 3EDFA 4IPPA 3VYLA 2BLEA 2PP1A 3W6MA 3BOLA 1IZCA 3OU8A 2G3MA 1R2RA 3MUCA 3SUTA 4GY1A 1R9YA 4O1BA 4P2VA 4KRTA 1NF0A 4ZQMA 4I9TA 1XLBA 4Q6XA 4HU4A 2C6QA 1JDCA 5EY5A 3VGGA 4L9XA 5HJYA 5K9DA 1ODZA 1HTIA 2VCCA 3LPFA 3VK5A 1CGVA 2Z00A 3ATZA 7REQB 3EOLA 3TNOA 3UXDA 2BTMA 2HVMA 5EL1A 2WKLA 4G2DA 2NVDA 4O28A 1IWBA 1W3LA 2QCCA 7CGTA 5MKGB 3C2OA 4Q7NA 4F8XA 3RK8A 1I2PA 3R7MA 3TW7A 3NOEA 5CGTA 4I90A 4QG9A 4JTKA 1KGWA 3QHMA 5EYWA 4IM4A 1F3WA 1R9ZA 2J79A 2QF8A 1KGUA 3GAKA 3AHZA 4J3VA 3NQBA 4X63A 5AB3A 1XLCA 1BYAA 4PUNA 4MJZA 3CTLA 1BXNA 3KVMA 1KRMA 3GH7A 2PDBA 2CIPA 3T55A 4EF9A 1UD4A 3EOOA 1PUDA 1ISYA 5I3JA 2V38A 3VZYA 2BGSA 4PRWA 3M1ZA 3HPSA 2NXIA 1H7PA 3VVGA 1TV3A 2WHMA 3VDGA 4JX4A 2ZWZA 4UQ9A 7ODCA 3MQTA 4K8HA 1FCVA 1IGWA 1JCMP 1VIWA 2JK2A 1LORA 1BG4A 4W5UA 2O4MA 4WKAA 3WJXA 3N18A 3WNKA 5G4HC 4PN2A 1DJGA 4IG2B 1DPMA 5FJPA 4K37A 1IIHA 3DC0A 3GC4A 6REQA 1UZ4A 1OFPA 4AEFA 4Q7IA 3CQHA 3EDEA 2H8ZA 1UPPA 1LDCA 4D8ZA 4CCEA 3TA9A 1I2OA 2P8BA 1O94A 5DQPA 4AWTA 4R53A 3J7HA 3A3XA 4CNNA 1WE5A 3QM3A 4PCFA 2PDFA 3DECA 3NA8A 5J8LA 3GG1A 2ZUMA 2INFA 3VA8A 1K8ZA 5FEWA 1JPKA 1M6JA 4QX4A 5E0CA 5FL0A 3MO4A 2X16A 3GNOA 3GXDA 4AZHA 2C1HA 1EUAA 1R7OA 5CPMA 3UR2A 1HJVA 3L4ZA 1ESWA 4LW7A 1C92A 1QVBA 4LNYA 5EU9A 1DQWA 2E25A 4A8LA 4AEEA 1DXFA 2C14A 2ZZ7A 4W85A 4ZE5A 2BWGA 4O8AA 4J3TA 1KW1A 4YJ5A 1E1FA 4ZO7A 1NM9A 1VBJA 4F4RA 4XTDA 1AH0A 4Q8TA 1LJYA 2Y5EA 4MWAC 1F4HA 3U7VA 3VNIA 3LCIA 4L9YA 1KCXA 4BF9A 3OGRA 1OFQA 4FNPA 3KRUA 2CHOA 4P8WA 1Z89A 1CXKA 4K8GA 1M53A 3M7SA 5FEXA 5HR7A 3QYSA 2D73A 4C1NB 4AZ7A 1FCQA 5CC7A 2O9OA 3A5VA 3EDDA 1K03A 3G3MA 4M1RA 4JIIX 2J7BA 2J24A 3NO3A 3QQWA 3MKKA 1MUWA 3EXSA 4HU0A 3L23A 5AYYA 3ZT7A 3AS1A 3QHNA 3GDLA 3UY8A 2V3EA 4HMNA 3CV6A 3V1PA 3OYXA 3NQVA 3L65A 2V30A 1VCVA 2QULA 4QNEA 4E6MA 1WPCA 1E40A 2WVUA 4WKFA 1VFLA 1S39A 1W37A 5ABGA 3S0CA 3C2YA 1M7OA 4PGLA 5A6TC 5K4XA 4EX4A 3AS0A 4H8UA 3CJPA 2OFJA 2P8CA 2WQPA 3B9EA 1DIOA 1K8CA 5F4XA 3CH9A 3M0KA 3LU2A 3PTKA 3AHVA 1ME9A 1R3WA 3AIEA 4GZEA 1UD5A 4RCXA 2CITA 1KA9F 3NZPA 5FF3A 4YHEA 2E5DA 1YTDA 2G95A 2VUNA 3H2AA 3LTPA 4AWUA 3TROA 1CGXA 4L4MA 1JQVA 3UEQA 4JFVA 1VBHA 3C0JA 5AC4A 4ACZA 4U3AA 2ISFA 3S6OA 4JTAA 3D6NA 3L12A 4IMFA 3PBUA 3G1VA 3VDHA 3W75A 2OQHA 3IANA 5HK4A 3F2CA 4FZIA 1LROA 3PVFA 1MXGA 1TZZA 3WL1A 3DYOA 2OELA 4DWSA 3KS5A 1TKKA 3O6DA 3GWQA 3QZ6A 4AZBA 1HJQA 2XSXA 1A5SA 3MC5A 4AD1A 2HE8A 4IFKB 4JKLA 4ZEPA 2BV9A 1OFAA 3WCZA 1QBAA 3P14A 2BNJA 3N2TA 5CGQA 4S3EA 2ZA1A 3R4IA 9RUBA 3ZWSA 5IM51 4S3BA 4EANA 1YDVA 3GDTA 3VTRA 4JS3A 4AISA 4XO7A 3UBPC 3F4WA 4BEQA 2YW4A 3L21A 1V3KA 4JCMA 2D22A 2AL1A 1BQGA 3WO8A 1R87A 2NUWA 1LUCB 3SQMA 3CIXA 1MFVA 1K6WA 1XQLA 2FGBA 3TTEA 5H1WA 1RCOB 3S1GA 5LSMA 3E0VA 3VZZA 1GONA 2OXNA 2Y24A 1IHIA 1XG4A 1CBGA 1V77A 1UMYA 2FHBA 1DOSA 4A3HA 2NT1A 4UTIA 3SCTA 1C91A 1UD3A 2V81A 3PUGA 1N82A 4NT0A 1J0IA 3OG3A 3G2GA 3TKFA 4E4PA 5JXQA 2DVUA 4PTWA 3HTWA 3MT1A 3GDKA 3TFCA 3MI6A 1R47A 4AVFA 1YMYA 3A21A 5I0DA 4JN8A 3BK0A 1NIUA 4Z2KA 2PSNA 4F66A 1OFEA 3VKJA 4MNLA 3TN3A 8A3HA 1FRBA 3W1MA 3GIPA 3M0ZA 1IQ8A 5JU6A 1W1YA 4S3JA 3BSGA 4LAMA 2AL2B 2V3FA 5DN1A 1RP8A 4K68A 5J04A 1QBBA 2QIIA 4NAEA 2VFHA 1RSCA 4IIGA 4DF0A 1C8VA 2I16A 4HMCA 1ZCOA 1IXQA 1TUFA 4CQAA 1SZNA 4WDWA 2MANA 3UGRA 1TWDA 3OIXA 4C91A 4AIUA 2AMXA 4HYRA 3EWCA 3NL6A 2VZSA 5H8MA 1JZ4A 2PFHA 2W79A 5LHEA 3LHUA 1JULA 1FWDC 3MBDA 4G56A 1KXHA 2OG9A 1KCKA 1RBOB 2DSKA 4GIRA 2BXVA 1A5NC 1UIPA 4MFDA 1HJSA 2Z1XA 2I14A 1X7IA 4YXGA 4DIAA 3DYPA 1R7AA 3DKLA 1BWLA 1HXJA 1W1A1 4LXFA 1JUKA 4O1DA 3S8HA 9XIMA 1D7KA 2WMHA 1GJPA 3AU6A 4MPQA 5D9MA 1XIJA 1K3UA 1I2RA 1FHVA 4M1BA 3EWWA 2OGYA 1LLWA 4ZVJA 4JTEA 4E5TA 2QCLA 4S2CA 1AL8A 2HDJA 3TQVA 4XD3A 3LPGA 1T99A 5HAOA 1UKOA 1UPMB 1JCJA 1Q7ZA 2CNCA 3NQ2A 1A80A 2PWDA 2ISWA 4P8VA 4NXSA 3RO8A 2G41A 1YPIA 3JZUA 3WLJA 1PCKA 4ZQRA 1GVSA 5A6MA 3NDYA 3PTMA 1Z44A 3W86A 2SFPA 3UWYA 1YRRA 2OSYA 4E8DA 2QHAA 4HU3A 4O14A 5HINA 5XINA 2BB0A 3LI1A 1YQ2A 1XINA 5A6BD 2YW3A 5HWMA 1TRDA 4YTQA 3C86A 4H1ZA 2QPSA 3QV9A 2BX7A 1V0LA 2O9PA 3G0UA 3O05A 4HVXA 4KEMA 1XCXA 3CZ8A 4TQTA 1TVNA 1OX5A 2QMJA 2WZHA 2XGBA 3HB9A 4QFUA 1QHZA 1ZPTA 1NDZA 1W3JA 4RX0A 4Z42C 4US5D 4QDMA 5HANA 5U7SA 4V28A 2HWGA 5JBEA 4B5WA 3BOFA 3G3DA 2FZ8A 3OEXA 3CUIA 1W6TA 4AD3A 2Z25A 1GHSA 1AW1A 1X7FA 1TPWA 3OHMB 4DBEA 3VFLA 3R1ZA 2OZ8A 1R0MA 5D09A 1MW3A 3VIOA 2OT1A 2Z6JA 2HNHA 4BEUA 3IVSA 1LYXA 1NVMA 3I4KA 3USZA 1O4UA 3PZ9A 4PMZA 1Q6OA 1E0UA 1V8EA 3BL3A 4JEQA 1AJZA 2QDDA 1YIXA 4NYYA 1IE7C 4PA8A 2YCLA 1DL3A 1TV5A 4EVZA 2I7GA 1CW2A 3TZFA 4IJRA 2XYLA 2Q6ZA 4YTTA 3S6DA 4PEKA 4DYEA 1V79A 3WFAA 3PNUA 3N1AA 1E0TA 2FJUB 3PZGA 3TV8A 4WY0B 3CMGA 4FNRA 4U2ZA 4FX7A 2G4FA 4LPCA 3W29A 1G5AA 3L4VA 1XJBA 3M5VA 2BGQA 1K1DA 4GJIA 3LM7A 4D1JA 1P7TA 1JUEA 2FJKA 4IQJA 1TA3A 5K7JA 1F76A 4US6A 2GL5A 2Y7DA 4AYSA 1VF8A 5LGXA 1LG1A 3EKGA 1XFCA 2NWRA 5F1UA 3WDHA 4BCEA 4JQAA 4YWIA 2V5DA 2G3IA 1UBSA 2D0FA 1ISWA 1OD0A 2FZBA 1XC6A 2ZVRA 4GNJA 3R8GA 2Z1BA 3DI1A 1VC4A 3L4YA 4LB3A 1QR7A 1EXBA 1VKFA 5C9RA 1OGSA 3WYZA 3VGEA 1R86A 3WK1A 3RX2A 2MNRA 3RF9A 3GHSA 2E67A 1R85A 3VD7A 1LP6A 1E71M 2OCZA 3O0FA 1A5CA 2G5WA 1KFWA 1LTDA 1JRCA 3MUXA 4JPGA 4JEJA 1QJWA 3IAPA 4QE4A 1Q6RA 4Q4SA 4M5PA 1XYZA 3CM4A 3ARUA 2W3ZA 2EJ1A 3XIMA 6XIAA 2CKSA 3I3EA 3KVKA 1LT7A 3WLTA 3POHA 3RLVA 4L56A 2AGKA 1YEYA 4L65A 4AD0A 3RLGA 4NAEB 1VZWA 3A6OA 2PC4A 1E4IA 3DFSA 4R33A 2WHJA 1TE1A 2FPVA 1Y5XA 3ONBA 4AU0A 1B3ZA 2Z1SA 5HBFA 3R11A 2CBJA 5I00A 3DFNA 3BLOA 1GJUA 3GDBA 1Q6QA 2QKFA 4W89A 1O7AA 3AOFA 3FVDA 2G96A 2GVYA 2PGFA 2EHHA 2GUYA 4LUSA 1UWIA 2BOGX 1KR0A 3PULA 2DT2A 4N9CA 3H7VA 2FKPA 1LWHA 2X7VA 4B4FA 1FA2A 4B2DA 2GWNA 2VOTA 4ZTYA 1H61A 4B91A 1B57A 1VFMA 3SJ3A 5I3FA 2BZNA 2AL2A 2WSYA 2RDUA 3AXKA 4UTUA 3LCHA 5TNVA 3CZJA 4UTMA 4IMEA 2V63A 4TX9A 1DVJA 1EDTA 3TMLA 4ORIA 1T40A 2GGIA 3BLEA 2D69A 1E70M 3E9AA 1F74A 3M41A 4B3KA 2F8QA 3SY1A 3I3BA 4WSJA 2FVKA 1GHRA 3NQCA 1PCWA 1DE6A 1HP4A 2V6AA 4Y2WA 5KEZA 3QLLA 2REQA 4GH3A 2YFNA 1UUMA 4Q3MA 4JIHA 3N04A 4J3XA 3THCA 4RDZA 4WJ8A 2DZPA 1OGBA 4DYKA 3GTXA 4Q4MA 1S2AA 1VFHA 1RVGA 4CD4A 1XV8A 1HVQA 2VEFA 1JPIA 1BRLA 3AS3A 4F2BA 2VEGA 2IKJA 4M8UA 3UWVA 1TFVA 2C16A 4ZFCA 4ZODA 3ZVHA 5HA7A 4QROA 3F7JA 3I7SA 3BAXA 4HHPA 2WKJA 1UC5A 4E38A 1FHUA 3QSRA 3PC0A 1VLIA 5TBOA 3S9IA 4K1WA 3E2SA 3F1QA 3SURA 4NYUA 1MEHA 2NLYA 3FLUA 4PB5A 3EMQA 5EMMA 1KQZA 3KP0A 3VGBA 4FXRA 1DYSA 4HZMA 1SMAA 1B4KA 4MZ8A 5LNUA 1OFRA 4HSOA 1TR1A 3SM0A 3GU1A 2WB5A 3XISA 2IQDA 2WANA 4F0MA 2EPKX 4HMDA 1UROA 4HJFA 2YZRA 3IAQA 2RKXA 4GABA 4X3ZA 4GE8A 3H54A 1TTIA 4QG8A 3QQ0A 1E1EA 4JQ4A 2P53A 1KM2A 3VKKA 2J88A 4QLLA 4QGCA 2I5IA 3RILA 2W63A 1T5AA 3PPCA 3DBNA 1MZHA 4GKLA 3MJYA 1NWTA 3R43A 5HPOA 2W62A 3TTQA 1X1ZA 1FH7A 1ZP4A 4CEXC 1XPGA 1PDZA 2X1IA 1CLKA 3W6LA 3DHUA 1RQEA 1VR6A 3CNYA 5CBIA 1W56A 3K8LA 1GQKA 1SU5A 3NZGA 5I06A 3WMSA 2HXTA 2BSLA 3NQ6A 3WSUA 1JF5A 5KMYA 3KDOA 1POKA 3T0AA 2GPTA 3HG2A 4LYKA 1V6TA 6CGTA 1BEUA 3NDZA 4PMVA 4XZ9A 5FKYA 5IOBA 4C5ZA 3C3NA 4IH3A 3DG6A 3A4JA 3DHPA 4MJ2A 3B9NA 4K7YA 3HMCA 4W8LA 4ICCX 1UC4A 3IJLA 3VD4A 1PV8A 2ODOA 5EA9A 3GH5A 4UR9A 3DFQA 4ADTA 4ZO9A 3U5YA 1ISZA 5KTLA 3L2IA 4EF8A 2RDXA 1HT6A 3OBEA 4KFPA 1XLDA 3N4AA 1QNOA 2CZFA 3INPA 3OBKA 3T42A 1GKPA 1Q3NA 3FK4A 5FF0A 4L6OA 4EE9A 3BAKA 2PTYA 1LM1A 2OWXA 2OGJA 3IGSA 2DZVA 4PB3A 3EXRA 5F7UA 3MYOA 4ZZ9A 2DJXA 4B9ZA 3FAXA 3PZIA 4XWUA 2KAUC 4M3PA 3SCOA 4GVHA 3MANA 1QPOA 2YR1A 2Z2UA 2CXGA 1ELSA 1Q8AA 4NZCA 1K9TA 4NNAA 1FWJC 3HV9A 3EB2A 3BE7A 2JEPA 5DBUA 1A5MC 1OBAA 2VC7A 4E2BA 1B30A 3VKAA 1TVLA 3WLRA 4LY4A 2PGRA 2DUZA 3ID7A 3G1SA 3Q65A 3KWSA 2DZWA 3LEPA 1T8QA 4CQCA 4H7ZA 1FWHC 5H91A 1E73M 3DX5A 4TR9A 2WMIB 3S2JA 3ZLFA 3R0DA 3O06A 3IJ9A 1OK4A 2MUCA 4IMAA 3PBYA 4IIBA 1MDRA 1XIFA 2Y8VA 2FGZA 2AKMA 5D02A 4CN6A 4BR1A 3GHUA 4DF2A 3KX6A 3UJSA 4HNNA 5RUBA 3GH4A 3KBWA 4W5ZA 4AXKA 3BOXA 2E3ZA 2VR2A 4H9UA 1LLZA 1UQZA 3BG9A 4IUGA 3T40A 2GQ9A 2IKHA 3WQPA 3CIVA 3OPSA 3CUXA 3V18A 4AZIA 3GZAA 1H7NA 5FJUA 3PZNA 3LV5A 2EQDA 3IUIA 3QV7A 4DZHA 3W9ZA 4AX7A 3AIUA 4ORMA 3MKCA 5A6JA 4JD4A 4FOJA 1A3XA 1RH9A 2E09A 5C71A 1K8XA 4QRNA 3WQDA 4H2HA 3NGJA 5D2TA 1VD6A 5E6YA 2J4GA 3B4YA 4KWUA 2Y85A 2V3GA 3WJWA 4PEEA 4L4LA 5ABHA 1CGUA 4FAMA 5EMJA 1KQYA 3HGJA 3GXFA 5HPCA 3MY9A 2OODA 2WJFA 5E1QA 7ENLA 2YLAA 4Q4KA 1EFZA 5C8BB 2TRSA 2NQZA 4IGMA 1J79A 1E72M 4LTSA 1BAGA 3F4NA 4MB4A 3UT0A 3TMQA 3OP2A 3GO2A 1EBGA 2ZA2A 2A6NA 4JN6A 3CYVA 5BROA 3WDRA 4CLMA 4V33A 2OYKA 4Q8OA 4UMCA 2PDQA 1XH0A 1WUFA 2A5HA 4QEHA 4Z2HA 5C2GA 4KFOA 3GTIA 4LC6A 2EG8A 3NOYA 1FH9A 3FGCA 1IXNA 1GYLA 3PM6A 3IWPA 1BVWA 2VURA 3ES8A 2CXEA 4ATLA 5BXSA 4DZ5A 4XBJA 1DHPA 2GYIA 4G7FA 3R13A 4L6HA 4OV4A 3V5CA 4C6OA 1W3KA 2VQUA 1VEMA 5I3IA 2VRQA 5BW6A 3TH6A 1FWIC 1W9BM 1J5TA 2RGLA 3B8SA 3VDAA 4P7NA 4CQBA 4RW3A 3W37A 2B7OA 4WDTA 3B8WA 2A4AA 1SO6A 3BWWA 3BDKA 4P7QA 2C7FA 2GQ3A 1KRCC 3ANYA 2AOSA 5D9NA 1D3HA 4GJ1A 4KS0A 2A0NA 4AF0A 2GSJA 3SDOA 3SCNA 3EXTA 5BWFA 3W76A 2GJXA 1ZHAA 3P62A 3N2CA 1GORA 4YPJA 2O0TA 2PB1A 3AHYA 4BQ2A 4J3ZA 4U31A 1OGGA 5I24A 2ZXQA 4WSHA 3S4TA 4RNIA 1QK0A 1RQHA 1TR9A 3AMKA 3M43A 3WBEA 3WLQA 1E5JA 1EEPA 4EPBC 1QOQA 1TB3A 3BW4A 1L0PA 4MAVA 2XN0A 3RM9A 4E4UA 5BOFA 4B3ZA 3FHQA 5CZ0A 2WPGA 3SQLA 4J9JA 1YTEA 5J5DA 3VD3A 5FF2A 5FAJA 1TIWA 1C8QA 1XW8A 4OOUA 3AO0A 3UZZA 4ZO6A 3CT7A 4D6IA 4GVIA 2V5KA 1UZDA 3QSTA 5D2XA 2ZCGA 4TVUA 1EIXA 1V02A 3GW3A 1E1CA 4JIEA 1CLVA 4GUHA 3TE9A 3BGGA 2YXGA 5A2BA 1PZ2A 3EX4A 3RN6A 1DJNA 1XGEA 3HN3A 1Z7AA 3AIBA 4ATDA 3LNMA 3CWNA 3O8AA 4PTNA 3T2OA 2DUXA 1ADSA 3EEGA 1S3TC 1V3LA 4JHZA 3IIPA 1L8NA 3TYDA 4RZ5A 1CLXA 1SJCA 3MS8A 2ZRWA 4IIEA 2D3NA 2GSHA 3UZ5A 4KGLA 1SPQA 4E3TA 2TMDA 2HRWA 3MV11 2DZAA 1XM3A 4R7WA 1E6XM 1LRQA 4X9YA 3WQCA 4GQRA 5CSSA 3LS9A 4GUIA 5CC3A 1Q7MA 1WDPA 1V6UA 2D23A 1OFOA 1N8WA 3W1PA 3TR2A 2I56A 3VNMA 4UTHA 3OLIA 3MMTA 4QR6A 1FX6A 5LNSA 1TE6A 4REQA 2PLCA 4HZ8A 4GQBA 2JF6A 3WLOA 1LOQA 1MMFA 1AA1B 2FZDA 1VBUA 3ZQ9A 1EP3A 1HW6A 3H23A 4O11A 1W1ZA 4GI4A 4N9EA 1A50A 1GVQA 2FTWA 3O15A 4QIUA 3ZJ7A 3A9IA 2OWWA 4Q8PA 3IACA 4GI6A 2HVNA 4UFJA 1XIEA 4GIYA 4QJ3B 1KM4A 3FJLA 2X2GA 4YCPA 4L7ZA 1L6GA 1H09A 1LZOA 4NZFA 3POCA 5XIAA 1WAUA 3IJQA 3AZTA 4EWJA 4HPXA 1TJ0A 3HJEA 3T2QA 1H60A 3EWZA 1J2BA 1AUSL 4I3GA 2G4JA 1H0GA 2PODA 3NNTA 2O55A 1Z42A 1I1WA 1A5OC 4GYPC 4Q8UA 5DCDA 2E0PA 4HGXA 5LXEA 2IKIA 1XH1A 1EF2A 2X05A 3FDKA 3GU2A 4N0RA 4O1CA 3OA3A 1SGJA 3GBEA 1I45A 5F2MA 4YS1A 3A3WA 3LNPA 4DBUA 2Y63A 4YL2A 5ABFA 5A8PA 4FR6A 4Z08A 4EXBA 3OOQA 4E3VA 4R85A 3W00A 4EAYA 3H4XA 2D2OA 1FP9A 4TVCA 1EHAA 6ENLA 3EX6A 3GXPA 4JQ3A 1CDGA 3IRDA 2Y6ZA 2FB3A 4JQ1A 4QBXA 2VC5A 2ACSA 3G77A 3NPVA 4MY1A 2IQTA 3ZJKA 4AZ6A 5I07A 1UR0A 2J7HA 3CB8A 3WENA 2G50A 4ML4A 4QE5A 2VZUA 3A5FA 1P7TB 4ZFMA 2CLMA 4C6CA 4IJBA 1W9PA 1XLGA 1TYGA 7REQA 5M1TA 5CPLA 3QYQA 4NQ1A 5G4WA 2ZWYA 3SCUA 3TK7A 3GKFA 3CZLA 1JZ8A 3LGDA 1ITXA 2W9MA 4NRRA 5GJMA 3K4DA 4ICNA 1QOXA 2ZXBA 4K38A 2VEMA 3LI0A 3PB0A 2YBUA 3U2CA 1J0JA 3CUHA 3T0DA 3LY0A 1W5MA 1YXYA 2CCRA 2XFRA 1FVPA 2EPLX 3N73A 4F40A 3QLDA 2FDMA 3OODA 5D2WA 1Q2RA 4QS6A 4D71A 1A0DA 2NV1A 3RO6A 1RVKA 5K3VA 5T9CE 1UKQA 5DXYA 4GH1A 1FWAC 1Y0EA 1LBLA 4CD6A 3S9ZA 1IV8A 3LBMA 4C6MA 1DWAM 1UP3A 1WP6A 4JHMA 4CU8A 1WXYA 2PTWA 1RK5A 1F6KA 3LCGA 3NSNA 1JUBA 3O9NA 1UWTA 5K9XA 3N19B 1CXLA 1B3VA 2XZ9A 3C2FA 4IL2A 4WSKA 2X2YA 3CGTA 5DRCA 1MFUA 1QI4A 1RCQA 5F1VA 2TODA 3ITXA 1GNXA 2IPWA 4GX8A 3P60A 4PUKA 3PUOA 4IXXA 2VZVA 4LAUA 4Z2IA 2WO5A 3UWZA 1FWEC 4UFHA 4HNVA 3FYYA 1LWJA 1GOIA 1PKYA 1K7FA 1BLIA 4LAZA 4ZB5A 1UZHA 6PTDA 4E2VA 3U4FA 4NX5A 3VFCA 2GJXB 3BURA 1HIZA 4HHHA 4XZHA 1UJQA 4AIBA 4GQGA 4OZOA 1PB0A 1K70A 3QFWA 1V6XA 3ALGA 5LA2A 3PZQA 1JYWA 5JBDA 2YL8A 1B3OA 2X41A 2PZ0A 4O10A 1KNWA 5H8UA 4I9MA 3TYBA 3UR5A 4ZENA 1CXEA 3S2MA 1P0EA 2QGYA 5A8OA 3DG3A 4A3UA 1ICSA 2WCSA 3WL0A 4W9TA 4I6KA 5C54A 3PBMA 1JI2A 4J5NA 2A79A 3F2DA 1RR2A 2O56A 5I79A 3TYCA 1L6SA 2ZTKA 4AWEA 2F84A 2YCEA 1ITQA 2OLSA 2JF7A 4GYPA 9XIAA 2PDCA 5HR6A 4X9SA 5D38A 2O92A 5B7ZA 4CUCA 3LHZA 3W2KA 5FESA 1TPVA 5CGMA 3DXIA 3ERPA 4BF5A 2Q8ZA 1OZQA 1UR8A 1O68A 3K8MA 1TPC1 4Y9NA 4JY8A 3QFEA 2VOMA 3GNXA 3ES7A 4RJEA 4LGXA 3N12A 2DZBA 2OLHA 3E12A 3KBNA 4HTBA 3ZZ1A 3PWGA 4YN5A 3P80A 2GLKA 1VCGA 4WX2A 4EIVA 3ANUA 3G1YA 5C0QA 5HJXA 4OWGA 1K7EA 3AYVA 3BTNA 5AYXA 2DFAA 1GOXA 2OLAA 4WCJA 3XINA 4PUMA 4Z1DA 1IYXA 1H7OA 2FH6A 4TIMA 3PBWA 5A95A 3KE0A 5LIKX 4CD7A 4YYCA 4CNPA 3EX3A 2WZIA 3KBJA 3AZSA 1JD7A 1DWGM 2WSRA 3AJXA 4F2TA 3UG8A 1AD4A 3NVTA 3LSBA 2NX1A 4KETA 6TAAA 3T78A 3EPOA 3GVVA 2V69A 1EDGA 1KBBA 4D1IA 1EL3A 1G01A 3OVPA 4P7RA 2OO6A 1HFBA 3K1GA 4JNYA 1L8PA 1K9FA 3RG6A 3M16A 2YDAA 4KKXA 3SN4A 5D4YA 3VNZA 3VILA 4QLKA 3RCMA 3UPWA 1I2NA 1J5SA 4L5ZA 4G1KA 2J6XA 5D8ZA 3TOYA 1XYFA 2QS8A 3EA2A 1UB3A 4P7LA 2EXOA 2D24A 3SCWA 4XAFA 3B0VC 5DY3A 3SCRA 4QAIA 3ITVA 1FXQA 3B0PA 5A8MA 1Q5MA 1FKWA 2PP0A 3I65A 5CPTA 4YLWA 4LF1A 2XIJA 3UD6A 1TREA 1RJPA 3T1GA 3T4CA 1LRTA 4N7QA 1GQIA 2QJNA 3I6EA 2QJMA 4EXAA 4HOXA 1BXCA 2NV9A 5BRPA 1J96A 4OU1A 1B3XA 4ACZB 1GVRA 3S1WA 4RW5A 2GOUA 1SFTA 3MVTA 3ANVA 5KETA 2EBNA 1XIBA 2XFFA 3C0LA 3BJTA 3W07A 1ONEA 2Q3OA 2X1TA 4AQLA 3W2NA 2YBTA 1TJ1A 3AXXA 2YL9A 4JDYA 4QCFA 5A2CA 3SW6A 3NPWA 4CVWA 2QPXA 3DI0A 4LNCA 2YCLB 4NVTA 2PDUA 4N9DA 3UZXA 2QLYA 5EMLA 3P3BA 3T09A 3RU6A 3W02A 4H6QA 3MJMA 4PCNA 1XLIA 2CESA 3BG3A 1PDYA 4AW7A 2OPJA 3GR4A 3MDWA 2VT0A 3FKKA 2DP3A 4GY0A 3H2EA 5E9AA 2BASA 3WQVA 1K4HA 5DO8A 4YTRA 5AC5A 4KERA 2BXZA 5CLWA 1SSGA 3OB8A 1DWHM 1H7RA 3FV9A 4GXMA 1KO0A 3WH9A 3R8RA 2OEMA 1UOKA 4EXQA 2Z0IA 4ILSA 1ZL1A 3STFA 4HMEA 2ZADA 4GHRA 4I6VA 4J27A 2QYGA 1YPFA 1CYGA 3WDIA 3TNBA 3LXCA 1TPB1 5C70A 4OBRA 3ITOA 3IGHX 2XINA 2QCDB 3SGGA 1VB9A 1KLZA 1D3GA 3BLLA 4AWSA 3M6YA 4UNIA 1VEPA 4A29A 2YCIX 1ALDA 7TIMA 3NSMA 3QKZA 1HJXA 1PZ1A 1A4LA 2YX0A 4NZ1A 3LV6A 4KCTA 1ZS2A 5FSDC 1C8YA 1EOMA 1RA0A 4DUOA 1EO5A 3ICJA 3F4CA 4PODA 1IF2A 2PGEA 4DBDA 3EEZA 4AVOA 2GWGA 4GCXA 4XZWA 3PR2A 1V93A 2NX9A 3P6LA 3NL2A 1OWQA 3QTPA 4JAWA 1EF3A 3L5MA 1BVZA 4I8DA 1REQB 2VMFA 1YE4A 3VM7A 1OCNA 2DIEA 2OMAA 3QTGA 5G5IA 4IQDA 2H9AB 4EOUA 1VBGA 2QCGA 5U4NA 2BOEX 3PPFA 4XISA 1YYAA 2WM1A 4ZMGA 4LVAA 4ALDA 3VCRA 1OCBA 3W7GA 3B0YA 5A5WA 3B4UA 1N7KA 3LHVA 1M3UA 2VFIA 2ZX5A 3VOHA 4ERGA 3LLXA 3Q94A 5CQ1A 2XWEA 1WKYA 1EJUC 4AD2A 4Y7EA 5XIMA 1H1ZA 2WM0A 1QNSA 5GNXA 1CECA 4XVDA 4O57A 4DM2A 2NVCA 3II1A 2PDGA 1UR4A 4HN8A 4LANA 5A69A 2VDHA 3NVDA 5AHMA 4PTMA 3QGAC 1ZTVA 4MMWA 1SZRA 4TX6A 1EX5A 3WF0A 1I2QA 4Q4RA 4DJFD 4JDBA 1JAEA 2W66A 1LL7A 1C9WA 4S3DA 5A6SA 1QU4A 4QQ3A 4W84A 3RRAA 5BWAA 1QPNA 2P1FA 2GJNA 1DJIA 3GQYA 4O17A 3GXNA 4GISA 3CU2A 4DM1A 1Q4WA 1XBVA 3S1XA 1PS9A 4ES4A 2NQ9A 2D1ZA 3GD6A 3QGKC 4IP5A 2Z2AA 1MQPA 1G94A 4BQ3A 5G1YA 1QI0A 1VRXA 2YKKA 2OYLA 4DO7A 4M24A 3WMCA 1GZJA 1M04A 1TWWA 2NQJA 3GW0A 3OZOA 3NCOA 2A3AA 3A13A 4YHGA 3MHUA 4O4VA 3AIQA 2CKRA 3PSWA 3W1UA 1KXQA 3CPUA 3PBVA 3E0LA 1DHKA 3BSHA 3MB9A 1PWMA 3HU7A 2Z2BA 1B54A 2EPOA 4FOUA 2C0HA 3UPMA 4XBSA 3UVAA 2GVGA 1RPKA 1JZ5A 1XLEA 3M0YA 4DN1A 4UTWC 2IPFA 5LZLA 1FH8A 2E5CA 2J74A 3GNNA 3S42A 1F07A 3OQ8A 3KTXA 6ALDA 4XUGA 4AZCA 3LENA 3TFXA 3GVQA 4W7WA 3KOWA 3QR0A 4TTUA 3A3HA 3UY7A 4PBEA 2QQ6A 3LDVA 1GYNA 5CZKA 4X2RA 3WEOA 3IIOA 3C8FA 3NUKA 2GZXA 4XTIA 3TLQA 5LHFA 4K8EA 5EGRA 5E70A 1KM0A 2BDQA 1OY0A 1OINA 2KZHA 4N2YA 2ON3A 2OX4A 4IUOA 2VXNA 3IUHA 2Y1HA 4OE7A 1AD1A 3S1UA 3R6IA 1KBIA 2BVTA 5H2ZA 1GZ1A 2QDEA 2E9LA 3UXAA 2E6DA 4RLIA 1FWRA 1L6FA 1TV2A 2DVXA 4XG1A 3STGA 1LBMA 1XYBA 2Y7FA 5FJJA 1IZJA 3BCFA 4EAMA 3DN5A 1YNYA 1FWWA 1KFLA 4AXNA 4HOZA 2F7FA 1X8CA 3K13A 4RPQA 1A3HA 4KT2A 1FY6A 1U1HA 1P0NA 2Z28A 4IX2A 4JX5A 1KRAC 2QUNA 2IS7A 2QUTA 2YL5A 2DZSA 3AISA 1QTWA 2C19A 1KKOA 2VP8A 3TC3A 1ZBVA 1JGIA 5I78A 3CUZA 5AVNA 1DIEA 4M7TA 3FX4A 5CJ5A 4LQ1A 1A5AA 2Z7GA 7TAAA 3LRKA 3K8KA 4Y96A 1IEVA 3LGEA 1QATA 2ZXDA 3BLPX 1E55A 4LS0A 1DXIA 4IIFA 1LLOA 5LXXA 2G8ZA 5AYZA 1AH3A 3PJXA 3BJSA 2QCFA 2RJGA 4H19A 1ICQA 4C6LA 3SEPA 3KTSA 5DMLA 4GQQA 3O6AA 2P0IA 4I7VA 1E4NA 1Q65A 3W6YA 3M46A 3G5EA 4PRTA 1TPEA 1NFGA 1NFPA 4E8CA 3UR7A 2YCJA 1OF6A 5BNKA 4WUIA 3O07A 3H24A 3VNDA 2G3NA 5LKYA 4UQEA 4R7OA 1VFSA 5BU6A 2PLJA 3HZ3A 3VNLA 2PWGA 3TUUA 1WDWA 5IDIA 3VOCA 4PUJA 3JUGA 2UZ9A 4Z0JA 1R8LA 2PLKA 2ZC8A 2NUYA 4QE1A 4A3QA 4NP7A 4LX4A 3OO2A 3VC6A 3URAA 5BMXA 1XIDA 3A24A 1JF6A 1POJA 1XI3A 5BMWA 1BKHA 4EPEC 3PTDA 1E6NA 3G1XA 3UYCA 2PDHA 3W01A 2XIQA 1PL9A 2OSXA 5IFTA 2PTDA 1E3ZA 1I0DA 4QAWA 3C2VA 3MP5A 1AG1O 3AC0A 3AAMA 2CERA 1AQFA 3B97A 1H49A 4OQVA 3GDMA 4MWAA 5DELA 3WFLA 4DEFA 5E9XA 4R5EA 2PEVA 3S5OA 2WHLA 1GJWA 2DH3A 4KCVA 1W1VA 3N34A 4DJEA 1UA3A 3CL7A 3W7KA 5CEWA 4O50A 1IGSA 1NFBA 5A8GA 4WD0A 1W17A 3PP7A 1W9VA 3O1NA 2A1YA 3CZEA 3N25A 1SFLA 2VKZG 4Q33A 3TIMA 1G69A 2YYUA 4AZGA 4HPGA 1OCJA 4GOAA 2DSVA 2QJJA 2JGYA 3U8GA 2VL4A 4KQNA 3PZVA 1JYXA 1XLJA 3KWXA 1HUVA 1H2JA 2YZ5A 4BA0A 1NQKA 4JTCA 3H55A 3NSXA 1S1PA 5MHBA 2OKTA 4UOZA 2FZNA 4WY0A 2C0AA 1W1IE 2FPTA 1ZB5A 2YB4A 4DBSA 3IEBA 1T7LA 3UWEA 3BUVA 3SN1A 1GGOA 1XYMA 3KLLA 1HZYA 4OBSA 1YBQB 1H1YA 3DZ1A 5CCZA 3CIWA 4GUJA 4H8VA 1XRVA 1FQ0A 3GIQA 3NL3A 3AMLA 3P61A 5IDZA 3MW7A 1TO3A 4G8TA 3A4WA 5HWJA 2C79A 4H41A 3CB3A 3MBFA 1H0IA 3MWAA 1NY1A 1M7JA 4H04A 4R27A 1AQMA 2W0UA 2EKCA 5K2ZA 1DORA 8XIAA 1S2TA 4H01A 1JZ7A 3QBUA 1IEIA 2A21A 4NILA 1E56A 4DB7A 2NSOA 1JAKA 4HA0A 4PRRA 3P8IA 3N2MA 5KZEA 3AROA 5G4EA 3L9CA 1RK6A 1A4MA 4Y8EA 3QQ1A 2H8XA 3T7VA 4PMUA 3EGJA 2HEJA 3DCPA 1GOWA 2QEZA 3QOMA 3ZO9A 4DWDA 1W1B1 3W70A 1WQ5A 3GVRA 5G2WA 3S5SA 4F79A 4OUIA 4ADSA 1MQRA 3CHFA 3GTNA 4MB5A 3KVJA 1CIUA 4IQEA 4OV9A 4N6EA 4NXKA 1R3YA 5DMNA 1J0YA 3KFTA 1QK2A 3R12A 3VU2A 3VE9A 4JYEA 3QZAA 1W54A 3UJRA 2HROA 4W87A 2O9TA 1KCLA 3UR8A 1ZGDA 4MKNA 1GT8A 1EKOA 4ZQCA 1UWSA 3D0CA 3RMEA 5HUPA 4ZXOA 3VO0A 1F2JA 2VGIA 1AZ2A 1E5NA 4AY1A 1IXPA 3UZYA 5M17A 1L2QA 1V03A 4MM1A 3AI0A 2OWCA 3M0LA 4LBUA 3BCJA 1JPDX 1US3A 4JXCA 1VJIA 4O1EA 3B3DA 5I23A 2IKGA 4YCOA 1AW2A 5G1TA 3OG2A 1J93A 3L68A 4OHQA 4LYRA 2CW6A 1JPMA 3KDNA 3EA1A 2UY4A 4HG6B 3TQPA 3T0BA 4PL2A 2XJ7A 1OB0A 1LUCA 3P7YA 1F73A 4IP7A 4QSFA 1ZBCA 1P6WA 3EMZA 3SRDA 6XIMA 2OOFA 4PBGA 1GEHA 2XM1A 2Z26A 1C93A 1XSKA 5C6MA 3SQSA 1N2VA 2OOGA 4CNSA 4MDOA 3WFZA 2CZEA 3M7WA 3GTHA 1HX0A 3TDFA 1CT5A 3S2NA 3P81A 3TX9A 5EMYA 2PF8A 1I4NA 3CAKA 4CNUA 2WMIA 4Z2JA 4D8LA 3T6CA 3NQMA 5HMFA 3BANA 2PA6A 2INEA 5PTDA 4DZAA 3NQ7A 1U22A 3KBMA 1W8GA 4KPLA 1BWVA 4TUFA 4KH2A 2QGHA 2NT0A 4FIQA 4FLOA 3ABRA 1CGTA 4D6FA 3PWAA 4JTRA 5ABTA 3WX7A 5REQA 4OVXA 5D33A 3QJAA 4PBFA 4WXZA 3OLDA 1EJTC 1PXGA 5I3GA 1GCYA 1MNZA 4PL1A 4QQUA 3LQLA 2VHLA 3GYCA 4LUYA 3W1RA 1H5YA 4NJGA 3M6DA 1PX8A 1KFKA 1FXPA 2A3EA 3EX1A 1E15A 3FCPA 4B5SA 3TA6A 1XSJA 3IJ8A 4KESA 3EA3A 1HO1A 4HT3A 4D6EA 4RK8A 1PKNA 1MI3A 3TYAA 5HMEA 1P0BA 1OM0A 2CLHA 1G4PA 1UH2A 4JFWA 5C7VA 2XISA 4HA3A 2XU2A 3M64A 3NQ8A 4LYPA 4NG3A 2E4TA 1KFJA 1WYIA 4QJ4B 1NSJA 1Z69A 4J7RA 3C0SA 4TX8A 2PC8A 2X0HA 3QKEA 2CFFA 2NXGA 3WNPA 2A7NA 2YSWA 3GKAA 4AY8A 5D9PA 5FEPA 2BP1A 1LL4A 3OGVA 4HA1A 5GJNA 3DFPA 1X6NA 1OFBA 5KINA 1W3HA 2BY1A 1VYSX 2PI6A 2V2HA 3LG3A 3EWYA 3N9KA 1XICA 2P76A 3E1F1 3F4VA 3OQEA 1KBKA 3TXZA 2R91A 4PTXA 2RDWA 5FI8A 1X38A 3CS2A 4S3CA 1JNEA 5CC5A 4UTKA 2QJHA 4ZSTA 1GKRA 2VEKA 5C9WA 3VIJA 2JBMA 1PIFA 2CZ5A 4CQ9A 3W83A 3SO7A 4D6CA 1JCTA 2A3CA 4IICA 4JHOA 2X0YA 3E5BA 4WOZA 1HG3A 3PJWA 4XAPA 3FS2A 4M7SA 1PSCA 4J2PA 4U5IA 1HGYA 3HMJG 1EHNA 4GYKA 3NXFA 4O12A 3GFYA 3K4WA 5FIPA 1R5YA 1ENUA 3IJIA 4MZ1A 3L0GA 1A5KC 4PMOA 4PUWA 4ZOAA 4Z0SA 1H5VA 4GXWA 1AQHA 4UOQA 1D8CA 4ERIA 3FXGA 2ZX8A 4ATWA 3S1VA 1M5WA 1UMLA 1XSIA 2YXOA 3IK2A 5DT5A 2G37A 3URQA 4CEUC 2PDMA 1H7WA 1JCXA 3CL6A 8TIMA 1RBLA 3OA5A 3WBAA 3QC3A 3FJNA 4HB7A 2ZUTA 4N6FA 4INFA 4Z2GA 1ZUAX 4NRSA 1GZGA 3CT2A 1V0MA 4O18A 3UFYA 3N9SA 4FO4A 4H9YA 2ZDRA 2O7QA 1O5KA 3NG3A 1EEXA 4UR8A 4IJCA 1FP8A 4R9XA 3PZMA 1Y5WA 4XD5A 4CQ8A 1U33A 3V0UA 4KIRA 1ZLPA 3TC7A 4GINA 2ISSA 3THQA 1GTEA 1RXOB 1UQYA 1HKVA 1ZALA 3DOPA 1EA0A 4K6AA 3P2VA 2VZTA 4C6FA 4L9ZA 5M03A 1D2KA 4BQ4A 3E38A 4L4OA 3U48A 1DJHA 1KM3A 4PSRA 2E1WA 1I1XA 3G8EA 1ZAJA 1ISXA 2HMCA 2ALDA 5HXMA 3O16A 4IMGA 2ABAA 3HA1A 1J0HA 2FYMA 3U2EA 1B9BA 1AW5A 2FQIA 4YNGA 5A2AA 2CBVA 1H7XA 1HL8A 3TYZA 2YGYA 4ZOCA 2V0TA 1Q85A 6A3HA 1XLKA 1KD0A 3WD0A 4YMZA 4QXIA 5FJIA 1C8XA 1MUCA 1N55A 4CU7A 1EDQA 3C56A 4UOJA 3OYZA 3I6TA 3BW2A 1JXJA 1B1YA 2WK2A 3G0XA 2WLYA 1JDAA 3H2NA 3W73A 2OQLA 4DZIA 3VE7A 4XD6A 2UBPC 3MI2A 1H3GA 3LGGA 3T8LA 1RJQA 3DG7A 4N4PA 4DUXA 1EYWA 2C1IA 1W3IA 5G1MA 4MWAB 3MUY1 2VEIA 2BVDA 2WZTA 1D8WA 4PE8A 4RV3A 4W88A 4NY2A 4G6CA 1JR1A 1Q6FA 3W2LA 3DENA 1UR1A 2D2JA 2IPGA 3AXMA 4AMCA 4GUFA 1HKIA 3E49A 4XZIA 1V02E 5IHSA 1F3TA 4HN4A 1VEOA 1WUEA 4MHBA 5IFPA 1EIBA 4HNTA 4MNJA 1EYEA 3WLHA 4ZSUA 3M0JA 2WW5A 5CAHA 3G1HA 3GHRA 4O8RA 3UU0A 5IRPA 4GC3A 1EWEA 4FEZA 1O60A 1E6RA 2JIEA 1E0VA 4WLCA 2YIHA 1TPUA 4QLJA 1EJ7L 1QT1A 3VCCA 1W1TA 4M6VA 1QO2A 3RM4A 2HNEA 1XCFA 3CWOX 2Z1WA 2XH2A 1O5RA 2WSQA 2VTFA 4FF7A 1E6ZA 3WNNA 3ZR4A 2CETA 4WVXA 1PYFA 5D30A 2TYSA 4DXVA 2VC6A 4LUTA 3W7MA 1UWRA 1RZMA 3E96A 4UFIA 3MMDA 3ZJ8A 3R5EA 2XUCA 3RCNA 1MEIA 3QY6A 1W5OA 3JVAA 1FOBA 4FOKA 4MB1A 2HS8A 3LCXA 3THAA 1V7YA 1XYLA 3ONCA 1UD8A 3R0KA 4HZ7A 4H00A 3ZYZA 4Q4QA 3M0IA 3MP4A 2FZMA 2XH0A 2DVTA 1HNYA 3BMWA 2QJGA 4HCLA 3TN4A 1HKKA 5A8QA 4F48A 2JFEX 3WMLA 1RY8A 2QIWA 1RLCL 2VENA 3FW6A 2Y89A 1PHWA 2BHZA 4KWWA 1YXDA 4UTJA 4W7UA 4GKTA 1QOPA 2F38A 3FEMA 3RITA 5G2IA 2HTMA 2R1NA 3QN3A 2CBIA 1KFEA 3WQOA 4HTYA 1V5XA 2XVPA 3IV8A 3G18A 1F4AA 3N3MA 3QVQA 2OU4A 4CD8A 4IQLA 3PY2A 1JZ2A 4HA4A 3RYSA 3TJXA 1QXLA 2X1SA 3ELFA 4B5UA 5HJLA 1UYQA 2WV8A 1WA3A 2V68A 4DBWA 2B4GA 2PU0A 4J3UA 1VHNA 1ZY9A 4UTTC 4MLJA 4C60A 1H50A 2AQVA 3OVRA 2QV5A 4M6PA 2HISA 3H26A 1AH4A 4LV9A 2ACQA 4S3KA 2CU0A 2Y5SA 3QC0A 3WLSA 3W28A 3UNDA 2F9RA 2ZKMX 3LK6A 1JVNA 2JGQA 1EJWC 2HJPA 4L6DA 4OECA 5C2XA 3HOJA 3W2MA 1A0CA 3B8VA 1W5PA 3N3TA 3S46A 1QAPA 3NDOA 4HSNA 2EGZA 2WVVA 1TJPA 4CNOA 2C91A 2PLMA 1DWFM 3ARXA 4KF1A 3NM3A 3RUBL 1W2PA 4KWOA 2VFDA 1GYMA 1Z3NA 4S3AA 3UW6A 1F61A 2E6FA 3OZPA 1XDLA 3MUAA 4GRSA 3SUUA 3TLLA 3EAUA 2DZXA 3UWUA 1J9YA 1XLAA 4PULA 1GK8A 4MVAA 5DMMA 1TG7A 2UY3A 1UKSA 2VGGA 4MGGA 3ZXWA 1SJDA 1EC9A 3AUJA 4Z1CA 3W7EA 3AHXA 1XFBA 1X96A 1UUOA 3LSCA 2IXVA 1R38A 4IPLA 4GD0A 3VX1A 1PTAA 1F5ZA 2ZXAA 2BMBA 3GC2A 4Y9PA 4B9YA 3SGUA 4HOWA 3D5HA 3N9RA 5DEZA 2ISDA 4DUWA 1PVNA 3ARTA 2OT0A 2BGNE 1LBFA 2ZX9A 3AHTA 1E43A 3D3AA 1Q45A 2WSPA 1KWGA 5C9UA 1KR1A 2D2GA 3UPBA 2AMGA 4I7WA 1QNPA 1VQTA 5A6BA 1KM6A 4JOMA 1QCWA 4MNMA 3SRKA 3PK7A 4E4FA 4ZQPA 1CI1A 3RR4A 2XVGA 2OTDA 3W53A 2BS9A 3AZRA 4JNZA 3VOIA 3WN6A 1EP2A 2P5NA 2OB3A 3CHVA 2QUVA 4HKPA 2YOCA 4NNBA 1UP2