3SUWA

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with nhac-cas
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
519
structure length
504
Chain Sequence
HHHHSSGLVPRGSHMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-hexosaminidase
publication title Gaining insight into the inhibition of glycoside hydrolase family 20 exo-beta-N-acetylhexosaminidases using a structural approach
pubmed doi rcsb
source organism Paenibacillus
molecule tags Hydrolase
total genus 193
structure length 504
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3suwA01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3suwA02
1OGGA 4TX6A 1UWTA 2V3GA 1G0CA 2VX7A 4W93A 1WAWA 3AZSA 1ZBKA 3AXIA 4L4PA 4M81A 5CGMA 3HN3A 2X05A 1CWYA 2PI6A 4E8CA 3UG4A 1HL9A 1UWRA 3WH8A 2ZX9A 2WBGA 1CXEA 3VDCA 2VR4A 5JIPA 4ZFMA 4MNJA 2VCAA 4WSJA 4HOXA 2YOCA 2WM0A 1OD0A 2QPUA 1TUXA 5M03A 3WD1A 1UD5A 3VM5A 4C7DA 3WFZA 3RDKA 3GZAA 1GOKA 1HNYA 8CGTA 4ZE4A 4AMCA 4TTUA 1B9ZA 1M04A 3PZUA 4M8UA 1KR1A 4IISA 4BZYA 4M80A 4ZXOA 3CBWA 3WH9A 1XSIA 4HA1A 4QCEA 1HXJA 2CYGA 1Z32X 4E2OA 2XGIA 2CIPA 2QHAA 3SIMA 3K8KA 1QNSA 4HPGA 3CGTA 5LA2A 3DHUA 3DYPA 4N42A 3AICA 2PB1A 2J7GA 4F8XA 2YKKA 1UA3A 4CKQA 2YL9A 4U2ZA 1H0IA 4WKHA 3N9KA 3IJ8A 3WD4A 3T0DA 2WZEA 4TVDA 1JYNA 1UQYA 2YA0A 2XFFA 3WEZA 3SUWA 3SURA 2ZUMA 3CUFA 3KE0A 2YA1A 4MAVA 2BHZA 1WPCA 3SCSA 3MMUA 2BY1A 3PZVA 2CKRA 3PTMA 1GONA 1NWTA 4UTFA 4KRTA 4M82A 4HZ8A 1B0IA 1EH9A 3VMNA 4AZBA 3NJ3A 3WF3A 1KFWA 1E43A 4B16A 1JI1A 1UR8A 1C92A 4KGLA 1V3KA 3GBDA 1SMDA 4Z2KA 4FLSA 1JF6A 1OGSA 3KEHA 1RD6A 2XIBA 4JCMA 3WEMA 2YL6A 4BCEA 4J27A 1GQKA 3SCTA 3UETA 3QOMA 3SCPA 3WDRA 3GXDA 2OSWA 4E8DA 3NSXA 5A2BA 3W29A 2PWEA 4PBGA 4NF7A 2D24A 4U33A 2XM1A 1KCKA 3MMDA 3WF0A 1UOKA 4GZJA 5BWFA 1NOUA 2XUCA 4CD5A 1PAMA 1QNPA 3UR8A 1JXKA 3I3EA 2CKSA 3KL3A 3UG5A 2QV4A 1CGTA 2XVKA 1MFUA 3AHZA 3BSGA 2YBUA 3K4AA 3ARWA 5C71A 3L4ZA 1UH4A 4HPHA 3ARZA 3OLIA 2WHKA 4C7FA 2G3IA 3NUKA 1R7OA 4HMDA 4JFUA 4HA4A 3BCFA 3PZTA 4A4AA 3ARPA 3WQWA 2XYLA 2EPKX 1HIZA 1UH3A 4FF5A 1WKYA 4YHGA 2A3AA 5JUVA 1KBKA 1W3HA 3AHVA 4U2YA 5D8ZA 3PN8A 5DO8A 4W8BA 4R5EA 2WVSA 3QHOA 1DWGM 5I3DA 4MJ4A 3CZ8A 1G9HA 3VD7A 5FCZA 3AQUA 4DWSD 1MYRA 2IXUA 3WF1A 1H3GA 2BHYA 4UQDA 3VVGA 1E6RA 3NDZA 2DGAA 1C8YA 2X2YA 2E8ZA 4H8VA 3WD0A 2YLAA 5FL0A 4W7WA 1F4HA 5JBDA 1E15A 1PX8A 3L4WA 4P8XA 3CIVA 1XSKA 6CGTA 2VMFA 1OWQA 1XHGA 3WELA 5FL1A 3AXHA 5IFTA 2JIEA 3ARXA 2VZOA 1RPKA 2VX5A 3MSGA 3WH7A 1HVQA 3AFBA 3N18A 4IM4A 1MW3A 2VCBA 2BXYA 5ABHA 2DSZA 3F4VA 1WB0A 3IAQA 2CBVA 1E5NA 3GBEA 3B8SA 4A3HA 4TVCA 4FLQA 3CZLA 4D6JA 3VIMA 1SR0A 3M7SA 1UWSA 2ZXBA 2WMIB 1WZAA 5HXMA 3MO4A 4D1JA 5A6KA 3UERA 1GORA 1H2JA 2EPMX 2VR5A 1TA3A 2E9BA 4CN6A 4J7RA 1JZ5A 5BROA 4GZEA 5FKYA 1GQIA 5CSUA 3WQ4A 2G3JA 1AVAA 1UR4A 3U5YA 4HOZA 1V0NA 4MTVA 1GOWA 2Z1SA 2JFEX 1O7AA 1V6WA 5E0FA 1GOMA 1CEOA 2OWXA 1UR9A 4MAZA 2ZX7A 3MUAA 3WY1A 4W7VA 2WCSA 4AYSA 2ZX6A 1GW1A 1J0HA 2D0HA 4KMQA 1BFNA 5ABGA 1V6VA 3OZPA 5GPRA 2XPKA 1V08A 5BRPA 5JBFA 1WDQA 1ZJAA 3VGDA 2XVNA 1GOQA 4IPLA 3OG2A 5A8MA 2X0YA 4W7UA 2OYLA 4UCFA 3WQVA 2XM2A 2ZUNA 4MDPA 1VJZA 2EXOA 5M17A 3VIIA 2WVUA 1VF8A 1CXLA 3VIJA 2WLZA 3UESA 1CYGA 4JHZA 4BQ2A 2G41A 3I3DA 1LG2A 3BAXA 4AZCB 1LJYA 3S6TA 1R87A 3ARSA 5JBEA 4AD0A 1JD7A 4OKDA 2WSKA 5ECUA 1W9DM 1E9LA 3SCWA 2PWDA 3HMCA 2XJ7A 1MXDA 1BLIA 4WSKA 2CHNA 1J9YA 1OIMA 2BHUA 2ZXAA 3AMLA 3FHAA 3EMCA 3N11A 3OGRA 4E4PA 1TCMA 1AMYA 4U5KA 1IV8A 1LWJA 4FMVA 3BAKA 3MS8A 1C91A 1JAKA 1BHGA 1PPIA 5D4YA 2VZVA 3VD9A 1E6XM 2Y8KA 1JZ3A 2VT0A 4DWSC 4DWSA 3ZT5A 2VZTA 1E1EA 4PUDA 2OWCA 2D3NA 2GDUA 1QW8A 2O9OA 5BYWA 1Q4NX 1HF6A 3WNOA 3F5KA 1C93A 3VGGA 5I6SA 5I78A 1XC6A 1LL6A 4GO8A 1KGXA 3FHQA 5HDRA 4PTWA 4UFMA 4CD8A 1NM9A 1RP8A 4HTYA 2YJQA 3DHPA 3PZIA 4J3TA 1WP6A 2W4XA 5A94A 1BGGA 2BVDA 4JCLA 3THCA 2J79A 1HN1A 1QNRA 2D0FA 1LWHA 3L2MA 2CITA 7A3HA 5AC5A 4X9YA 1JZ4A 1UD8A 1K9DA 4WJXA 1GPFA 3PZMA 4TTGA 1QHOA 1ODUA 1BYDA 4JFSA 4J3VA 3VIFA 3NIYA 1W9UA 1C3FA 1CECA 3EDEA 2DT0A 1TMQA 5E9AA 2EBNA 1U2YA 1VB9A 2DH2A 3AMDA 2OYKA 4LYQA 4CGTA 1CENA 4JHOA 4AD4A 3F5JA 3SEPA 3WDHA 1TZ7A 2O9PA 3EBVA 1JI2A 1QVBA 2EPNA 3AZRA 4HMEA 4YPJA 3K1DA 3WEOA 5DMYA 1D7FA 1QI0A 3PZNA 4LQ1A 1VJSA 3K8MA 1U33A 4PSRA 2VRKA 1OB0A 4TVUA 2D22A 1TFVA 2WC7A 3CMJA 2RGMA 1JAEA 2NT0A 2GK1A 3RCNA 2XVPA 3VNZA 4UFHA 2YBTA 2C8NA 1JZ6A 4PEEA 5A6AA 3QHMA 3CHFA 1E56A 3IJ7A 2WB5A 4HU0A 2EQDA 3NSNA 4ZENA 1K9TA 1EDTA 4MADA 2WMKA 1ZL1A 4MNKA 4YN5A 1JD9A 2PWFA 2X09A 3GDBA 1QNOA 2WK2A 3AIUA 3EMQA 1BPLB 1KQZA 2XFRA 1J10A 1GJWA 3G6MA 1V02A 1BG4A 2WKGA 4RE4A 3CZKA 3DYOA 3MU7A 1ISYA 1VBUA 3VD3A 4QLJA 1ZU8A 3M07A 1KXHA 4HMCA 2FHFA 4AC1X 4V28A 5CLTA 2ZUSA 4UR9A 4MJ2A 4KGJA 2NT1A 1KR0A 5CJ5A 2ZWYA 4LPCA 2GJXA 3BH4A 1GCYA 2WW5A 3W81A 1LQ0A 4L4OA 5BXRA 5A6SA 3IANA 9CGTA 1VAHA 2FHCA 4AEEA 3VM7A 1C8XA 3TTOA 1QI3A 3M46A 2UY5A 3EDDA 3LPFA 3MANA 3VGHA 1E4IA 1UHVA 1GOOA 2BNJA 4UNIA 1W1TA 1JYWA 1JIBA 3TOPA 1XH2A 4CUCA 2YL5A 4NRRA 2D2OA 1W91A 2EJ1A 1MW2A 3AS1A 5A1AA 2WWDA 1HKKA 1BVZA 1HJSA 1UYQA 3N15A 4XZBA 1FHDA 3OGSA 5CQ1A 1OIFA 1CLXA 1TVNA 3ZSSA 3VMPA 3SCOA 3G6LA 1JNDA 1CDGA 1HKJA 3T0AA 2UY4A 1KQYA 1EGZA 2A3CA 4DUXA 1V6YA 4JFWA 4HZ6A 1CZ1A 4R27A 4D6IA 4UQAA 1CXKA 5E6YA 1TVPA 1BYBA 2JE8A 2VJXA 5ABFB 3B9DA 5EFDA 2WKLA 2BV9A 4EE9A 3AMCA 3GNPA 1EO5A 1N82A 3WF4A 4J28A 1G5AA 2YA2A 4PCSA 3RO8A 4LYRA 2J7DA 1PX4A 1L0PA 5AC4A 2NSXA 3BGAA 3RJYA 4J3SA 2CEQA 3F5LA 2XWDA 1J12A 3UG3A 2GUYA 3OLDA 1NP2A 3VDAA 1K9FA 2YDRA 3FY1A 3QR3A 1VIWA 1FA2A 1G94A 4Q22A 4F66A 2E0PA 3T2QA 1EOMA 2V3DA 3N1AA 1EA9C 4CVUA 2BS9A 5BXSA 2VCCA 1A47A 2BFGA 4GI8A 5FD0A 1NH6A 3VU2A 1VENA 4NSBA 4TX8A 1OM0A 1EIBA 3W4RA 3ZOAA 1JL8A 3WUGA 1BSIA 5D9OA 4PMDA 1W1VA 1BTCA 4CN4A 3ARVA 4Z2HA 2XTKA 2ZWZA 1X1NA 2VOTA 1V03A 3B9AA 4U3CA 2EPLX 2XFYA 1IZJA 3BLPX 2VVNA 2X0HA 4PCTA 4ATDA 4MB3A 3L4XA 3VDHA 4C91A 4UFJA 2ZXQA 2WMFA 3WNMA 2DEPA 1FP9A 3AIEA 1W9BM 5E6ZA 2EPOA 4AISA 2VURA 5D8WA 4UOZA 1ISVA 4XB3A 5I0DA 3VNYA 3ZM8A 4W88A 4CVWA 1DTUA 1WZLA 4OIFA 4B3KA 1B1YA 5GNYA 3WF2A 2WYSA 1GJUA 4HP5A 2E40A 2WVVB 3BSHA 5I2UA 4N0RA 5TD4A 2UY2A 1UG6A 1XRVA 1BG9A 1UR0A 3AS0A 2VC9A 3BLKA 2IXVA 4ACZB 4WIWA 5D9MA 4J3UA 1QI2A 1I1WA 4RE3A 1UD2A 1JYXA 1E0VA 1UD3A 2J7EA 3VX0A 4EANA 1V02E 3AYRA 1IT0A 1W2PA 2CHOA 3CZJA 4AD1A 5D9PA 1ZBVA 1J11A 4GINA 3UEQA 5CLWA 1B31A 1E4LA 1XGZA 1ECEA 5DEZA 1V3LA 2Q8XA 2GSJA 4PMVA 2VTFA 4WKAA 1UR2A 3AS2A 4PMQA 3IAPA 4MNMA 1B3WA 1KXQA 4NRSA 4UQEA 2DH3A 3MKKA 1SFSA 4UQCA 2CERA 4Y7EA 2VUYA 1GVIA 1XD0A 1HJQA 3WSUA 4J3XA 4H7VA 1BQCA 3RM8A 4GZIA 3EYPA 1VFUA 1W9VA 2XWEA 5CPTA 2WANA 1FH8A 3OZOA 4V27A 3A3HA 5LA0A 1WZKA 4KH2A 3CMGA 3WNKA 1E3XA 3CHEA 3BAJA 2CXGA 2D23A 3VPLA 2AOSA 4GI9A 4D72A 3SCQA 4QLKA 2A3BA 2ZUVA 4OBSA 3WKZA 3CZEA 5A6BD 5FIPA 3GXIA 1H11A 4D6CA 2VI0A 2VX6A 1DWFM 4H2CA 5AYBA 2VRJA 4P7QA 4Z2LA 1JZ8A 3W24A 1CXFA 1NWRA 2FH8A 3NCOA 1E72M 4BA0A 2DT1A 1H1NA 2WC3A 3AISA 3ARYA 3JUGA 5GQBA 4PSPA 3L4TA 2HISA 1PIGA 2GK1B 4ATLA 3GNOA 1CGVA 1E4NA 1FFRA 4HA3A 4MB1A 4QFUA 4D6GA 1GQLA 3ZJKA 3T09A 3K4DA 5C70A 1V3JA 3AHTA 4GQQA 1KWKA 3NSMA 2VNCA 4UOQA 3O2LA 2YLLA 4QLLA 1EQCA 3CHCA 1JDCA 3LPPA 1W2VA 4FK9A 1PIFA 3GH5A 3ZT7A 4AZGA 2CBUA 2W67A 1NWUA 3GH4A 4TUFA 3CO4A 1GVYA 5BXPA 2VL4A 5E09A 7CGTA 2V38A 3GYCA 5E0CA 4X0NA 5JIWA 1E4MM 5M3WA 2EO7A 2PBOA 2J74A 1QW9A 3ZJ7A 1B2YA 2BXZA 1BYCA 4C7GA 1E5JA 1DEDA 5BXTA 3GTNA 3B9EA 1QPKA 5IFPA 5D9NA 4MB5A 4GQRA 3RIKA 1H49A 4GKLA 2VX4A 2ZE0A 1CIUA 1Y7VA 2XSBA 4BQ3A 4B9YA 3WQ8A 1S46A 1M7XA 3K46A 4H8UA 2ZUWA 3A6OA 4JL2A 3WMCA 4MNLA 2DSUA 1FH9A 3AHYA 4YHEA 3W38A 2WCAA 2DSVA 3I3BA 1XH0A 3D3AA 3L2LA 2GDVA 4JKKA 5A3HA 3ZJ6A 5CPSA 4W84A 1H0GA 1H41A 2BY0A 4UFIA 1EDQA 2J7FA 3EMZA 3N13A 2OYMA 3J7HA 1FOBA 3WNNA 1SYTA 3AIBA 3UCQA 1UR1A 4BQ5A 2QF8A 2PWHA 4ACYA 2JEQA 4RL3A 1PJ9A 1QBBA 1WE5A 3BAWA 5A8PA 2E4TA 4B15A 3WNPA 3WIJA 2A3HA 2D0GA 4AXNA 1FFQA 1XH1A 2VVSA 3A4XA 2GJPA 2X1IA 4WK9A 2Y8VA 4D1IA 5HBFA 1CTNA 5A6BA 2J62A 4UZSA 2XIIA 4P7LA 1E3ZA 5KEZA 2B31A 5BCAA 3WN6A 3AIVA 1DHKA 3VDBA 2ZUTA 5C8BB 2XHYA 3LMYA 1LG1A 4B3LA 1BGAA 5FOOA 1HVXA 2WNWA 1AQ0A 2CETA 3OLEA 4PTVA 2DQXA 2WAGA 5IDIA 4FLOA 1KBBA 3BCDA 1UWIA 1K6AA 4PMXA 4CD7A 2V5DA 2WLYA 5LA1A 1BAGA 2QMJA 1ZB5A 3VINA 4M24A 1XCWA 2J7HA 3A4WA 3TP4A 2J7CA 2W63A 3N04A 3WQ6A 1ZBCA 1UD4A 4X0VA 4JKMA 2C7FA 4PYSA 1RP9A 1GQJA 2WMJA 1UKTA 1OGBA 2J78A 1JNEA 2DIJA 1UZ4A 4W5ZA 1LL4A 3WDQA 2E3ZA 2WMIA 5F7UA 2XVGA 2G3MA 3OLGA 2FGZA 2UY3A 2W5FA 3O9NA 4QCFA 1MVYA 4CD6A 2W62A 1CNVA 4KWUA 3VGBA 4Z2GA 1YQ2A 1R8LA 1H4PA 3VIOA 3W27A 2DIEA 1G01A 2DT2A 4GO9A 3VILA 1UKPA 1TE1A 3BAYA 2J77A 1W3LA 1V3HA 4D6FA 3VTRA 1GZJA 5A6LA 1VEOA 4U3AA 1KGWA 1CGUA 3DECA 3CH9A 3UR7A 8A3HA 2XSAA 3CHDA 1E6ZA 1HJWA 1HP4A 4GI6A 4Z2IA 1U30A 3T08A 4HU8A 2F2HA 3TA9A 4F79A 1WDRA 1BYAA 2W61A 4AD2A 2V5CA 3EDKA 1E71M 4J3WA 2J8GA 1QBAA 5I23A 1DWJM 5ABEA 3QHNA 3T2OA 1MW1A 3WDJA 4OUEA 1PZ2A 2XG9A 1C8QA 1CGYA 4GIAA 5DF0A 1DP0A 1CXIA 4M1RA 1HKIA 4XUYA 1UKOA 3CUHA 2GFTA 1HL8A 1E70M 1J0ZA 4URIA 4XZWA 4AD3A 1NOWA 2A3EA 4U31A 1SMAA 4BF7A 1EQPA 4AZCA 3ALGA 4W8AA 2PBGA 3FAWA 2O92A 3ZR5A 4F9DA 1MWOA 2VQTA 3PBGA 2G8ZA 3AMGA 4WKFA 2DDXA 1E73M 3W82A 2JF6A 4PMOA 1I75A 3ARQA 3FN9A 4W87A 3VGEA 3MV11 3KL0A 3ZSTA 3SCRA 4P8VA 1J0JA 3IK2A 1F4AA 4XV0A 1EOKA 2AMGA 5EMYA 1V0KA 3AMKA 1DWAM 4D6DA 5I77A 4LGXA 1ZS2A 4WF7A 1B90A 3VX1A 1HJUA 1KGUA 5I79A 1J0KA 3WBAA 3BAIA 1C90A 4NI3A 1Q6GA 2J7BA 4AIUA 1OSEA 4H04A 2W91A 1EXPA 1MQQA 1QNQA 1KXVA 1OT2A 4JKLA 1E6QM 1NARA 4BQ4A 4OBRA 1R7AA 2PC8A 3GNRA 1HJVA 1OBAA 1US2A 1MFVA 4JZ5A 1KWGA 3ZQ9A 2ZOXA 2ZICA 2WHLA 1TA3B 1JGIA 4DM1A 2WHMA 1WCGA 2J4GA 3AS3A 4UFLA 2J8FA 4AWEA 4ML4A 5CZKA 5AY7A 4AY1A 5I24A 4KRUA 3SCUA 4PMYA 4PUEA 4W89A 1B30A 4F9JA 2G3NA 2DSKA 2ZXDA 3APGA 1VBRA 2FH6A 3AIQA 2WC4A 1V0MA 3ZT6A 1MW0A 3T0BA 3WDPP 1W9XA 5I5RA 2F8QA 2UWFA 1VFOA 1EO7A 4PMZA 3WL1A 3VIGA 4BS0A 1ISXA 2CNCA 1PX3A 2Y5EA 3MUIA 2JALA 4K68A 4LXFA 2IUZA 1B3YA 1LLOA 1I1XA 2DT3A 1ZBWA 1QOXA 3O6AA 1W32A 5HPOA 2W92A 2Z1KA 5DT7A 5E70A 1UUQA 4H41A 5EBAA 3SUSA 4AZHA 3WDIA 3VUPA 2BVTA 2WXDM 1W1YA 2E9LA 3POHA 4Z2JA 1W3JA 5A6MA 2D3LA 3W28A 4IPNB 4CU7A 1EHAA 2GJRA 3WD2A 3GXFA 1WDPA 3ECQA 1ZJBA 3AXXA 1R85A 1W9PA 2CPUA 1JG9A 1ITXA 4MDOA 1US3A 4P7NA 3LPGA 1A3HA 1XSJA 3PHAA 1DWHM 4CCEA 2EEXA 2OSXA 1V6XA 2QMKA 2WMHA 3NYDA 2G4FA 5HPCA 3RJXA 3E1F1 1Q6EA 3RM9A 4B9ZA 3VD5A 3FW6A 1K9EA 1PZ3A 4P8UA 2VZSA 4CCCA 3WMBA 3CLWA 3D5HA 1OD8A 2OSYA 3L4UA 5IHRA 4P8WA 3VOCA 4DWSB 1B3ZA 1AQHA 1FH7A 4AZ7A 1QHZA 4W8LA 5AYIA 1Q6DA 3RPMA 1XD1A 3PTKA 4RE2A 3S2CA 3U5UA 3KL5A 5A2CA 4EK7A 2CESA 1WNOA 1NOFA 3VD4A 3W25A 2ESCA 1L8NA 2DSWA 1LF1A 3SUTA 4PRWA 4DUVA 4JFVA 4MPKA 1TR1A 3AJ7A 3QOKA 2ZX5A 1MQRA 2WHJA 3POCA 4JFTA 4D6EA 3TTQA 2YIHA 4S3KA 1V0LA 4ATWA 3MUZ1 3AI0A 1UZ1A 1D3CA 1B3VA 1XV8A 1DWIM 4AEFA 3RMEA 1RH9A 2DPEA 3DC0A 3VGFA 1KCLA 1OINA 1Q6FA 4JL1A 3ARTA 3VIKA 1MXGA 5A8OA 1VFMA 2Y2WA 2TAAA 3WUEA 3CUIA 4CU6A 1CLVA 3MV01 3FXYA 1QI4A 1PBGA 3WQ5A 3CPUA 2FHBA 1E55A 1J01A 2QLYA 2CBIA 1JDDA 4A3YA 3ZO9A 3VMOA 3OGVA 1P6WA 4AZIA 4AZ5A 3AIRA 3U57A 2GVYA 4W86A 1D2KA 1E0WA 1WDSA 2YL8A 3PTQA 1GUVA 3K8LA 4S3JA 2VRQA 3SCNA 4GPNA 4UQ9A 3GH7A 2VO5A 3BC9A 3HJEA 3W37A 2WZIA 4H8HA 2BVYA 3WD3A 4DUWA 3ZR6A 1V3MA 5KZ6A 4NZCA 4MB4A 1OCQA 1W3KA 1CBGA 3W6MA 1M03A 1C7SA 6A3HA 1JZ7A 3HU7A 5ABFA 4UQBA 1J0IA 1NP0A 2VZUA 1FP8A 3WUFA 4OJYA 2CCRA 2WWCA 1E6PA 2ZIDA 1UWQA 1J18A 1X6LA 2PF0A 3T2PA 1JFHA 1BVNP 2Y4SA 1VRXA 3KZSA 5DT5A 4IUGA 1V6UA 4JIEA 4P7RA 5CG0A 4AIEA 1QI5A 1FHLA 3N12A 1YHTA 4ZEPA 4QAWA 2E8YA 2J25A 4EKJA 3M6DA 3ZJ8A 2JEPA 4TXEA 1M01A 1H09A 1M53A 3MMWA 1WZMA 3VKKA 3THDA 2WCGA 2V3FA 1E6NA 1NQ6A 1HX0A 2HVMA 3TTYA 4GXPA 2J75A 3SUVA 4AZ6A 3U7VA 3WH6A 4D71A 3WUBA 3BXWA 2CBJA 3PZOA 3TONA 3LPOA 3EDJA 5IHSA 2JIWA 2WZHA 1H5VA 1GOIA 3MUY1 2GJXB 3ARUA 2YDQA 2ZUUA 3VO0A 3W6LA 4DM2A 3W0KA 4Q7NA 1JF5A 2NW0A 3OA5A 1UKSA 1JZ2A 1MQPA 3CUGA 5DFAA 5EFFA 4TOQA 1EDGA 4M56A 4UOJA 5CXPA 4OZOA 4W5UA 1W1PA 4OOUA 3FNDA 5A8NA 4OOZA 4PN2A 3KWXA 3RM4A 1JYVA 2FGLA 1VEPA 5A95A 3BMVA 2D1ZA 3AIWA 2WVVA 4V2XA 2J47A 3BMWA 4C90A 3SUUA 5A69A 2C0HA 4XX6A 4ACZA 5HNNA 2FDMA 5A6JA 1JDAA 1EHNA 2XGBA 5GNZA 1X6NA 3WMSA 2YDSA 5IXEA 2OWWA 1WO2A 1GNXA 1UKQA 3OIHA 4CN1A 1HJXA 1XCXA 1GHRA 1JFXA 4CU8A 1UD6A 3VIHA 2OLHA 3WBEA 4QP0A 3SCVA 3OBAA 3W26A 2JF7A 2WPGA 1E40A 1IZKA 3WENA 2QPSA 4PTXA 2Y24A 1UA7A 2PWGA 2F61A 2WVTA 4PMUA 2W66A 1HP5A 1B3XA 1CPUA 4FLRA 4WLCA 4AIOA 3NDYA 4HZ7A 3PZGA 5CSYA 1BF2A 4D6HA 1UH2A 2O9RA 3A4AA 1TG7A 1V3IA 3PZ9A 1ISWA 5M5DA 4ZXLA 1ODZA 4JAWA 3AHXA 4AW7A 3ZIZA 3TTSA 2V3EA 2WBKA 5HOSA 4ZE5A 2BY2A 3DYMA 3N17A 5CGTA 3WFLA 4CD4A 4M29A 4PMRA 5A8QA 1UQZA 1LL7A 3W53A 2X8RA 4U5IA 7TAAA 2RGLA 1Q6CA 3AYSA 1O6IA 4QDMA 2O9TA 3L4YA 1JXJA 1OT1A 4W85A 4UFKA 3AOFA 3U7BA 1E1FA 3ZMRA 1CGWA 4LX4A 2MANA 3AZTA 3A47A 3QGVA 1E0XA 3AROA 3CUJA 2VQUA 1J0YA 1GHSA 2WMGA 4PMNA 3WH5A 3II1A 1ITCA 4LYPA 5A2AA 1HT6A 3CZGA 4P7OA 3ALFA 1ISZA 5GNXA 1QHPA 1E6SM 1AQMA 4PTMA 5BRQA 3VIPA 3OB8A 2WSPA 1CGXA 3PZQA 1C7TA 1KXTA 1VFFA 1NWSA 3WL0A 1G1YA 4EAMA 2ZX8A 3CTTA 3GXMA 5EB8A 3RILA 1PEZA 2D20A 1UWUA 3EDFA 2XVLA 1ESWA 1KB3A 6TAAA 3WNLA 5CPQA 2E9MA 3ARRA 3FAXA 1XYZA 2AAAA 3IJ9A 3L4VA 1HKMA 1R86A 2BY3A 4AD5A 3MSDA 1XYFA 3GM8A 4HOWA 1CXHA 4UZUA 4CCDA 5LYRA 1VEMA
chains in the Genus database with same CATH superfamily
4TX6A 1SU5A 1TO3A 2VX7A 4G7EA 4HK7A 4O13A 4RZBA 4QQUA 1WAWA 3ZFHA 3AXIA 4L4PA 3LCFA 4Q33A 5FF7A 4JTDA 3M0LA 3HN3A 2C71A 4O50A 2X1RA 2PI6A 3SGGA 1UWRA 4UUIA 4D2JA 1CXEA 1POJA 2OX4A 1TR9A 2IKJA 2YOCA 1UC5A 3DFNA 4MIMA 1TUXA 5M03A 3W1UA 1EXBA 5EYWA 3WFZA 3RDKA 2NUXA 8CGTA 4ZE4A 4HK5A 4AMCA 3PZUA 4BJHA 1FRBA 4ZB2A 1AJZA 3H23A 3GG8A 3TEVA 4BZYA 3BDKA 1EUAA 1S2AA 1XLEA 4ZXOA 3SM0A 3MVTA 2DZXA 3ZZ1A 2J27A 2CYGA 3A3XA 1Z32X 1NF7A 3K8KA 2R6OA 3DKJA 3DHUA 3XINA 2PB1A 2J7GA 3AUJA 4QSHA 4F8XA 2YKKA 4EPKA 3K5XA 2V8ZA 5I02A 4WKHA 1L2QA 2WZEA 4Y8FA 1JYNA 4O12A 1VPXA 3WLNA 3QYSA 1IXQA 3GIQA 2OQHA 3CUFA 3GTHA 1JCTA 3V1HA 3EEGA 1WPCA 3SCSA 5DXXA 3E02A 4HZ8A 3VMNA 1F6KA 1T0OA 1DJNA 1PTAA 1E43A 5F4WA 1UR8A 2IMRA 3TFCA 1V3KA 6TIMA 1AH3A 4H9VA 1OGSA 3KEHA 1RD6A 2XIBA 4LJ3A 1UUMA 4C6DA 1V79A 3G1FA 4JX6A 3LLFA 2YZ5A 1XLCA 1A5KC 3CQHA 3P5ZA 5A2BA 1TV4A 3N2MA 3WK1A 4KIRA 1A4MA 1KCKA 5BWFA 1UOKA 4NU7A 1NOUA 4CD5A 3PBUA 3S1WA 4Y9NA 3LCIA 1RJRA 3KL3A 2CKSA 5AC7A 4AYGA 2QV4A 4F0RA 1TPUA 3FOKA 1VFTA 2RDUA 1ZCCA 3K4AA 5C71A 3G1HA 5LZLA 1UH4A 4HPHA 3KBSA 1J2WA 3HBLA 4OE7A 1R7OA 3L21A 5D09A 3DUGA 4WX2A 3WQWA 2XYLA 4YWIA 6REQA 4TIMA 4A29A 3EKGA 4XKMA 1UPMB 3QZ6A 3GVVA 2BLEA 5D04C 4M6QA 2RHGA 2BXVA 3NQ6A 3NQEA 5I3DA 2TPSA 1G9HA 1GPWA 1TRDA 1A5SA 5FCZA 3GG1A 4DWSD 2IXUA 3H22A 2BHYA 4L64A 4MY8A 4UQDA 2E8ZA 4H8VA 4LV9A 3IJQA 3ORWA 3SECA 1AL8A 4HNLA 1H7RA 1PX8A 3L4WA 3CIVA 3L68A 4PUNA 3A13A 3GFXA 2YCJA 4KWSA 1H7OA 2WKJA 1IE7C 4EXAA 1VPQA 4GG9A 4NASA 4RUBA 4IM4A 1VQTA 2VCBA 4PTNA 3M44A 3IAQA 4ZA0A 1E5NA 3TXVA 2EHHA 2ZQ0A 3RCMA 1F5ZA 2ZXBA 4NIRA 2WMIB 3MKCA 4A3QA 2VC5A 5D2WA 2PD9A 1GORA 1YLVA 3QY6A 2J6XA 4CN6A 4EX4A 3RPTA 2E67A 3ABSA 5CSUA 4PC8A 1AVAA 4HOZA 3MI3A 1YEYA 4J1OA 4O19A 3DENA 4O8RA 2ZX7A 2PRMA 3WY1A 3D3FA 4LVDA 1GW1A 1SUXA 3OBKA 2WQPA 1Q45A 3B97A 3KCOA 3G22A 3VGDA 1YNYA 3DN5A 4M6PA 2PDMA 3OG2A 5HR7A 1ME7A 5CBJA 3HG2A 5HNUA 1IF2A 2OZ8A 5LXEA 1ZFJA 3FEQA 4MDPA 1VJZA 4P5UA 3HPSA 2YGYA 5M17A 3VIIA 5AHMA 4F0LA 4JHZA 2R1PA 4XKYB 2NZLA 2QJHA 4YL2A 4CEXC 4O1AA 5JBEA 2XH0A 2ZKMX 4IFKB 3VI2A 4C1NA 1OX4B 1U5HA 3SCWA 2PWDA 2XJ7A 2CHNA 2BHUA 2A1YA 3N11A 4G5DA 4E4PA 4TR9A 1N8WA 4US5A 5IM51 3OVPA 5FAJA 3MUXA 4GUIA 1ZZMA 3QC3A 1BHGA 3PWGA 4WVXA 1E6XM 3W72A 2R9RA 3EAUA 2VT0A 4KIEA 3W7OA 1GKQA 2VZTA 1XLAA 4PUDA 3NGFA 2DP3A 1QW8A 3QYQA 1Q4NX 3IUIA 3WNOA 1B4KA 5HDRA 4PTWA 3H4WA 3O1NA 1N55A 1NM9A 1P5BA 3MJYA 4GUHA 1WP6A 2W4XA 2V68A 2ACSA 4WDTA 1FHUA 2CZEA 2PPGA 4YTUA 2J79A 1HN1A 1QNRA 3ZS4A 4PB5A 3WLKX 2R91A 3CB3A 2V5KA 3FA3A 4CQ8A 3KRSA 5DN1A 5E5CA 1DVJA 1ZHAA 3S42A 1A5CA 5FJUA 2ISWA 2AKZA 1K9DA 1GPFA 4JFSA 3TAKA 4J3VA 4DF1A 1XYCA 3LI0A 2GGHA 5EMLA 4V15A 4K8HA 2EBNA 1VB9A 3AMDA 3ABZA 4FX6M 5M1TA 3NFUA 4CGTA 1CENA 1ZJHA 4DJDC 4NX0A 3BG9A 1L6SA 4AD4A 4AH7A 4DJDA 4PB3A 2A0NA 4DO4A 3GDRA 3CWOX 4NNAA 4OGZA 1QVBA 2EPNA 4HMEA 3M0HA 5T8GA 3ZLFA 3A64A 2VRKA 1OB0A 2C0AA 1PCKA 1TFVA 5BU9A 2WC7A 4QEEA 1JAEA 3W84A 3H4GA 4UFHA 1J2BA 1XP3A 3LTYA 5A6AA 1NTHA 4EXBA 5CH9A 4J5NA 1KM6A 2EQDA 4J40A 3PUEA 4ZENA 1GW9A 1K9TA 1P6CA 5CJNA 2BX7A 1ONEA 4LUTB 3QTGA 1JD9A 2X09A 3A9BA 4DF0A 3THQA 2A2IA 1YW1A 2XFRA 4MSSA 5DMNA 1XIFA 1J10A 1H60A 3TKFA 1V02A 5C9ZA 1BG4A 3L5MA 3DYOA 1Z8AA 3W7DA 1V6TA 4XZHA 4H00A 2WZTA 2DW6A 1ZU8A 3W1NA 4Y8EA 4ZO7A 3WJWA 1KRMA 4Q7BA 3RFAA 2A7RA 4O1BA 3W01A 2DZPA 1EJUC 2ZUSA 3MI2A 5F4XA 2FPTA 1KRBC 2NT1A 3LHZA 3REQB 1KR0A 4ZFCA 5CJ5A 4IIGA 2CW6A 4Q8PA 1W5NA 3W81A 3AYVA 4PULA 9CGTA 1VAHA 2FHCA 2PDHA 1GVSA 2G37A 3GYEA 3W87A 1C8XA 1QJWA 1TX2A 1M1BA 2VOMA 2UY5A 3EWDA 4FXRA 1OADA 1W1TA 4RNIA 1JIBA 3KVLA 4ZZ9A 3QW4B 5DELA 4HYVA 1W91A 1MW2A 2WWDA 1BVZA 1HJSA 2HXUA 3N15A 4MJZA 3N6QA 5CQ1A 5HK4A 1F8MA 1SVDA 1TVNA 3BOFA 3AXMA 1YXDA 2UY4A 3UJRA 1EGZA 3W1PA 1V6YA 2GUBA 3I6EA 1CZ1A 5AC8A 1K4GA 1XDMA 3LGGA 4FOKA 4QITA 1UJPA 2ZZ3A 3WLLA 3S5OA 5E6YA 1LT7A 1VR6A 2VJXA 4ZO8A 3B9DA 5EFDA 2OGYA 2BV9A 4UR8A 4EE9A 3GNPA 4HD5A 4HHMA 5T91A 4HPJA 2X30A 2DIKA 4E3TA 2J7DA 1L0PA 3CQ0A 1K02A 3K4WA 1W8SA 3BGAA 3F2CA 2XWDA 2GUYA 4IQEA 1Q6QA 3FVDA 4XBJA 4O4VA 3CTLA 3KP1A 4Q8WA 4Q4PA 3ZLGA 5F2IA 1K9FA 2YDRA 1OFAA 2FPYA 3UJSA 2OEKA 4Q22A 3R94A 3T2QA 2Z00A 3N1AA 5G4WA 1IGWA 5BXSA 4ILSA 2VCCA 2BFGA 4GI8A 1KW1A 3TC6A 3RHGA 1OM0A 2NVDA 3S9IA 3ZOAA 1JL8A 3LNPA 4UMCA 2XTKA 4U3CA 2C1HA 2EPLX 2NQ9A 2ZC1A 1IZJA 4GYFA 3IIOA 2QJNA 2QV5A 5BWAA 2Z6JA 2ZYFA 5FF0A 3VDHA 4C91A 4UFJA 4UTKA 3BGJA 3PTDA 1FP9A 1JDFA 4UOZA 4XB3A 5I0DA 3VNKA 4W88A 3UPMA 1E51A 2WYSA 3WLRA 4AHPA 4QG9A 4HP5A 2HVNA 4N0RA 4KWVA 2UY2A 3CQJA 3S2JA 3PBVA 1KCXA 3FYPA 2VC9A 3BLKA 5HNTA 2Z7GA 4LNCA 1L6WA 2R94A 1DIDA 4KRZA 1UD3A 4ADUA 3CZJA 4ASTA 1OVDA 2HS8A 2FGBA 3MQTA 2Q02A 1LLWA 4GINA 3UEQA 3GAYA 3GG0A 4JTLA 2Q8XA 4PMVA 3UA4A 1FXPA 4GIEA 3AS2A 1TB3A 2IS7A 2VEFA 4NRSA 1I2PA 1OCJA 4UQCA 3HTWA 4Y7EA 4ICNA 4ZQMA 4J3XA 5DXYA 3VC6A 1BQCA 1SFTA 1XR2A 1RV8A 3C52A 1W9VA 2VC7A 3CWHA 1OYCA 5LA0A 2OLSA 1LDCA 4MUPA 1SSGA 1WBJA 1E3XA 3BAJA 3MA8A 3L67A 3GWQA 4M1BA 4K2SA 4O18A 1SW3A 2A3BA 2ZZ5A 1TJ0A 4XK2A 3WKZA 1VCGA 3R0DA 1J5SA 3NPVA 4D6CA 1C8VA 1S38A 2VI0A 3LA4A 3MY9A 5D37A 3W2NA 4B5SA 4QISA 4E0CA 3CS2A 1QNVA 1JZ8A 2E1DA 1D3GA 4C60A 3W24A 3ZVHB 2DT1A 4ZB0A 3RX4A 5BW6A 3JUGA 2PDNA 2DUZA 2GK1B 1P0BA 4ATLA 1E4NA 4QFUA 3ZJKA 4DJDD 3TDFA 4EF8A 3K4DA 4FO4A 4D8LA 3O16A 4ZOCA 3T6CA 2F6KA 3OJGA 2VNCA 4L6DA 5HR6A 3UBPC 2HPIA 4HU3A 1FUYA 1XIBA 2Z25A 3CHVA 4GABA 3N2BA 1PIFA 2PP3A 3VYLA 4AZGA 3GH4A 5FSEC 1YMYA 3RU8X 1R3YA 4JTGA 5CSSA 7CGTA 2V38A 3PNZA 3BLDA 5M3WA 1OFDA 1D8CA 3GFYA 1OF6A 2BXZA 4C7GA 1E5JA 1KM4A 3UXAA 3HQ1A 4I7VA 1DEDA 2PTYA 3GW3A 4AUBA 3IGHX 3E3HA 2VENA 1PKLA 1PHWA 3M0KA 4MB5A 3FYYA 4G7EB 4V1YA 2CWXA 1H49A 2PP0A 7REQA 2VX4A 2ZE0A 1Y7VA 3WQ8A 4WOQA 4BEUA 3K46A 4WR3A 1DXEA 2OX1A 4D8AA 2FTPA 2DSUA 4HYWA 4KF1A 2WCAA 3L2LA 3QN3A 3Q4DA 3DKLA 4JKKA 1QT1A 4NL1A 5CC3A 3I10A 1RD5A 3K30A 2DORA 4YVVA 1DE6A 1H0GA 5HUPA 1TJPA 1CW2A 1RAKA 1ZENA 2J7FA 1SW7A 3N13A 1FOBA 3SRHA 4QJ4B 3WNNA 3UCQA 3M7WA 4I5UA 1Y8BA 2QF8A 3I7SA 1RCQA 2UV8G 1DL3A 2AKMA 3ITGA 4P2VA 1K7XA 1NDVA 1WE5A 3BAWA 5T26A 2FVLA 2LLEA 3W74A 4O0ZA 2IQTA 4B15A 3HZ3A 3EB2A 2D0GA 2VVSA 3DFQA 3E74A 4WK9A 4NVTA 2Y8VA 2G50A 2WJDA 1XS2A 2INFA 1EJXC 2WQDA 2XIIA 3UPWA 4YYCA 2B31A 3W88A 3ZYZA 2I9EA 1DHKA 1XJBA 2ZUTA 4L80A 1TPFA 4YVPA 3AALA 4XZMX 1BGAA 3IGXA 1HVXA 2WNWA 3TQPA 1EJ7L 4PTVA 1QU4A 1W1B1 4FLOA 1IWPA 1QTWA 3TQ0A 1UWIA 2QDHA 4TX9A 4CD7A 1EPVA 1BAGA 3HQOA 3LS9A 4E38A 2G5WA 4J35A 4M24A 4R7JA 4GFSA 4HBKA 3KOWA 4F4RA 1OFQA 2J7CA 2W63A 3N04A 3WQ6A 1UD4A 4PZVA 3GDMA 4PYSA 2WMJA 5DY3A 1UKTA 2AGTA 1G67A 2Q8LA 2VWSA 3INPA 3KP0A 4XAFA 1UZ4A 4W5ZA 3PWIA 5FI8A 1YXCA 1LL4A 5KETA 1FDZA 3R2GA 3ITLA 3W2MA 3LCXA 2QCNA 1AODA 1QCWA 4YNGA 1MVYA 3CNYA 1CNVA 1TPWA 4Z2GA 3H26A 1XIMA 4I8DA 1RALA 3V75A 3EX4A 4GOAA 3BAYA 2J77A 4KBXA 3VTRA 3SY5A 5AHNA 3NPWA 4U3AA 1Q2SA 3DECA 3CH9A 4IL0A 1YDNA 4GI6A 2XH7A 4HU8A 2F2HA 3DH7A 4C6JA 5CZJA 3PFMA 4FB7A 1YNQA 4ZGYA 3CT2A 1QBAA 4LBSA 1R2TA 2Z1XA 4DBDA 2P3ZA 1MW1A 3WDJA 3P5YA 1R47A 4XZLX 2XG9A 2P10A 6REQB 2VEKA 5DF0A 1M9HA 1L6FA 1HKIA 3UZJA 1KFKA 3CUHA 3QF0A 1E70M 3EPOA 4URIA 4XZWA 4AD3A 2A3EA 4U31A 3BV7A 2Z4GA 4YCPA 1W5MA 1EGVA 4IP5A 2XZ9A 3UP8A 1MWOA 3ATYA 3PBGA 2CLHA 4IGNA 2CHRA 2DDXA 3W82A 2JF6A 4Q4MA 4PMOA 1I75A 3FN9A 3HGJA 4A21A 4P8VA 4NY2A 4Q4QA 5MHBA 2V2HA 3FFSA 2BZNA 2PWUA 3AMKA 5C0QA 1ICSA 1Q6LA 4H9ZA 4JR5A 4A8NA 1GG1A 1HJUA 2JBMA 5I79A 5CC7A 1ZNNA 3T55A 1QNQA 1MQQA 2QPXA 1OT2A 4JKLA 1BRLA 4GVFA 3RU6A 1NARA 4OBRA 5DY2A 4JTJA 4O4WA 3ZQ9A 4MWAE 4POCA 2PU1A 2H3BA 2O4QA 1VJIA 2R1KA 1AW1A 3PB0A 4ML4A 5AY7A 1Q6RA 4PMYA 4C6LA 1JGMA 2WPBA 1EX5A 2J9XA 4WD0A 1GZ1A 4FNTA 3UW6A 3ZT6A 1MW0A 2Y5SA 3B3DA 1R3WA 3O7UA 1GYNA 1MDRA 2UWFA 4LFYA 1EO7A 4PMZA 3VIGA 4BS0A 1BKSA 1ISXA 1R9YA 1X6UA 3WLIA 3E0IA 1XIIA 5XIAA 3NQDA 1EWEA 4KFPA 3G1DA 1GGOA 4JYDA 4UC5A 4RNFA 4LT9A 1ZBWA 2G95A 5BU6A 1QOXA 1F74A 1BQGA 2CZ5A 2QW5A 3HG3A 4EPBC 5DT7A 4H41A 3LXAA 1RCOB 2BVTA 1IXPA 4DAIA 1KTCA 3CPGA 2WJEA 4QAIA 1REQA 1S39A 4ZQNA 3IJIA 3POHA 2Y89A 3N3TA 2RJGA 2X42A 3VKAA 2D3LA 5A6MA 4CU7A 4ZB5A 4JIIX 1FX6A 3O8AA 1VLIA 3GXFA 1WDPA 1ZJBA 3AXXA 3UG8A 1RXOB 3M0VA 4C1NB 1K77A 2OCZA 2HV5A 4MDOA 5GJMA 3PP7A 2DVUA 3MO7A 3PHAA 1XSJA 1IEWA 5HQMA 1DWHM 3VZYA 3RM9A 3VD5A 2PAJA 2OT0A 1PZ3A 4CNSA 4WOZA 4TMBA 1O1HA 4Q6JA 4YMZA 3EZ4A 3QMTA 3PF3A 4P8WA 1OFPA 4W8LA 4REQA 4HHLA 3HGRA 3PTKA 3KL5A 2XGZA 3Q58A 1AG1O 2ESCA 5LKYA 2VEIA 4DJED 1I0BA 4N9DA 3FCPA 3POCA 3R1ZA 1V0LA 1RHCA 2Z29A 1KBLA 4KW2A 2MNRA 2Q71A 1B3VA 4FXSA 3MDWA 3RMEA 1RH9A 4B5TA 1S1RA 1F76A 2X2GA 4HSOA 3ARTA 1I6NA 4FIRA 4V1XA 3W7IA 1XLGA 1ONWA 3A4JA 2Y2WA 2J88A 3NEHA 4NAFA 3G5EA 4QX4A 1PBGA 4IIBA 2ASHA 1VPYA 4GUGA 1E55A 1EJRC 4PL2A 5FSDC 1KV5A 5C7VA 3BJTA 4G8TA 3VMOA 1FDYA 2QJGA 3NYZA 3U57A 2GVYA 3H2CA 4LAZA 3R8HA 4IIDA 1B5TA 2A21A 3SN4A 1D2KA 4KPLA 1WDSA 2YL8A 3H12A 4QG6A 4S3JA 3SCNA 3IIPA 2PRHA 3MPGA 2O55A 3PB2A 4X3ZA 3W6YA 1FY6A 4ZCWA 4INFA 2VO5A 1JDEA 2EAWA 1HFBA 3W37A 2WZIA 2V69A 3KOXA 2B4GA 1WA3A 4BWLC 4BWLA 1DJQA 3ZR6A 1V3MA 4NZCA 3RYSA 1UASA 1CX9A 4MB4A 1OCQA 5KZMA 1CBGA 3W6MA 4NYYA 6A3HA 3DC8A 5ABFA 1A0CA 5IBXC 5IBXA 4L4MA 1UWQA 1EP1A 2QKFA 4GUJA 2PF0A 5C9WA 2Y4SA 4PH6A 1Z89A 4R88A 3RX2A 4HPXA 3TCEA 2DU2A 1O12A 4DLFA 3HFYA 5DCEA 2P0IA 1FHLA 1YHTA 1GTHA 3GS6A 4LOCA 4IQJA 2V5JA 4ZTYA 4EKJA 1WDDA 3M6DA 5C7HA 1LORA 4AXKA 2GJLA 1KO0A 1NJJA 3THDA 3RK8A 3LCHA 3M0ZA 1SO3A 3NO3A 1VLWA 3U7VA 4D71A 1JQXA 3BXWA 4C6QA 3DOPA 3TONA 1UC4A 3QXBA 1GOIA 4MFEA 5KSWA 3ARUA 3L23A 3W0KA 3OA5A 3W83A 4DXKA 5I06A 4EIVA 1W17A 3F03K 3QY7A 4Q8QA 2ALDA 4Z17A 1MQPA 4KFNA 4UOJA 1DQUA 4L61A 3B0PA 4OZOA 3EOOA 1W1PA 1Q85A 1KKOA 1E0TA 2ISSA 3V7PA 5A8NA 4OOZA 1DORA 1QK2A 1L6GA 4O10A 1VYSX 2WV8A 3S46A 5KITA 3BMVA 2PTWA 1SPQA 4AF0A 4AVOA 1NY1A 3BMWA 3CL8A 3C5QA 4H6EA 4QEHA 2Q3OA 3NQMA 4ACZA 3S5ZA 2FDMA 1EHNA 1X39A 2GGIA 3N4FA 2XGBA 5GNZA 2QULA 4D8ZA 1CI1A 3BG3A 2H90A 4CN1A 3UWWA 4JIHA 1JFXA 1SZRA 4CU8A 3EXTA 3LXCA 2GQ3A 3VIHA 1PUDA 3H2FA 3SCVA 2V81A 3W26A 3SFWA 2JF7A 2WPGA 1E40A 2I14A 1IZKA 1XIGA 3WENA 1T8XA 1TPH1 3UWUA 2VHLA 1UA7A 2PWGA 2QGHA 1KTBA 3TU9A 1CPUA 4BF9A 4HZ7A 2PD5A 5C5YA 3M0YA 2EG6A 5H1WA 4QNEA 3NTYA 1F73A 4JY9A 1ISWA 3S83A 4JAWA 1R0MA 3EA1A 3TOYA 3ZIZA 4KQNA 3O3RA 2V3EA 2BY2A 3UWEA 1ADDA 3W71A 1N7KA 4CD4A 2I5GA 4M29A 4QJ5B 1LL7A 3KX6A 2X8RA 2RGLA 4LB3A 2QEZA 1JXJA 3BG5A 2B81A 1OHLA 1OT1A 4UFKA 5K9XA 3TA6A 3W7HA 1F9CA 3TVAA 3ABOA 4Q4RA 4GC3A 2VFHA 3AROA 3MVIA 3WK2A 4C5YA 3I7RA 1J0YA 4IGHA 3MP5A 2OZ0A 2XN1A 1G4EA 1ITCA 4LYPA 4H2HA 5A2AA 1SW0A 3W1LA 2GGEA 3ALFA 1AQMA 4PTMA 5BRQA 4GA8A 1JPIA 2PCQA 3PZQA 1C7TA 1KXTA 2C19A 4Q3MA 1PDZA 3EB3A 4Q8NA 5K4ZA 4DVOA 4H9YA 2QR6A 4NJGA 3JU2A 3MZNA 1ECQA 4PR4A 2XVLA 1H63A 4LH8A 4IQDA 6TAAA 5CPQA 3M5XA 4I8YA 2CXEA 3V5CA 4HHPA 3VA8A 3IJ9A 3CPRA 3L4VA 2BY3A 3G77A 3U2OA 4AD5A 1XYFA 4LUJA 1IHIA 4UZUA 4CNUA 2PLKA 3PPCA 1AQFA 4ES4A 1G0CA 2QCEA 5HULA 4PMJA 1GOXA 5FJPA 3AZSA 5FACA 5H2ZA 1ZBKA 2HTMA 4JIQA 2W27A 2AMXA 2BOGX 2OJPA 2W79A 3QM3A 1BEUA 1LZOA 2PGFA 3FGCA 4LY8A 5XIMA 3UG4A 2H9AA 5I3IA 3WH8A 5KZDA 1HUVA 2QIIA 3RR1A 2VR4A 2PFHA 4GCXA 5JIPA 5C9UA 3UR5A 4WSJA 4IQLA 3KM8A 1IT7A 3T9PA 3W7MA 4J2MA 4ORIA 3L7RA 1SJBA 2QPUA 2QCMA 3WD1A 2PTDA 3VM5A 3LYEA 3QSTA 2ZE3A 1QAPA 4Z42C 4JIPA 4TTUA 1B9ZA 2W0UA 3CAVA 1WOBA 3QGAC 5HQLA 1VFLA 2QCDA 3CBWA 1XSIA 3QVQA 3C2FA 4QCEA 3CH0A 1XM3A 4E2OA 2XGIA 8XIMA 2OPJA 1QNSA 3CGTA 3DYPA 5LIXX 5CZ0A 2Z1WA 3LCGA 1O5RA 4IICA 4LF1A 1YPFA 4CKQA 4U2ZA 1H0IA 3N9KA 4UMAA 4TVDA 3VZXA 1L9WA 3BK0A 2NQHA 4LRSA 2XFFA 3CL6A 3WEZA 1AH4A 4R9OA 2GZXA 3DFSA 2Q01A 2Y63A 1I45A 3NA8A 3WCZA 3ITTA 4L1WA 1FBAA 2BY1A 2CKRA 3PTMA 1GONA 1NWTA 3IARA 4KRTA 1B0IA 5KTLA 2QCLA 4DWDA 2HRWA 3S5SA 1NFPA 1KFWA 4B16A 1JI1A 4X60A 1C92A 2BGSA 4KGLA 1IQ8A 4X2PA 3GBDA 4Z2KA 1T6MA 4FLSA 3C61A 2V82A 3I6RA 4JCMA 3WEMA 4P61A 1JVNA 2R24A 1TYGA 2PDYA 3EPMA 3UETA 7REQB 3SCPA 1R3RA 3GHUA 3S0CA 3VOGA 3BLIA 2DV0A 2YSWA 4OWGA 3FJ4A 4E8DA 3NSXA 3TYEA 4AX7A 4G1NA 4KEUA 5HUOA 1VD6A 4NF7A 2D24A 3TW7A 3P67A 4XD6A 5C55A 2A6NA 1QNPA 2RDXA 4M0XA 3UR8A 1JXKA 3UG5A 3BOLA 4YWSA 4NXKA 1CGTA 4DBWA 1G69A 3R8RA 1MFUA 4G1KA 3W75A 5H8UA 2VYOA 1DKWA 2XH4A 5C2XA 3EX2A 4MUZA 4UXDA 1L6YA 5F4SA 4A4AA 3ARPA 4IIFA 2EPKX 3A22A 1F7BA 1ZY9A 1I0DA 3BV4A 2FDSA 1JEZA 4BI6A 2A3AA 5JUVA 2AQOA 1W3HA 5CBIA 3B4YA 3JS3A 4HKPA 3BVJA 5HAOA 3SY1A 1A0EA 3PN8A 1DWGM 1YTEA 4NUWA 3VD7A 3FX4A 3NM1A 4LVFA 3CB8A 1E6RA 2PODA 3I4KA 3PWAA 3UZWA 1I60A 1IXNA 1IWAA 4P8XA 5IFTA 3IIVA 3AXHA 1RJPA 4E3VA 3ARXA 3IACA 2V5LA 3UY8A 3MSGA 1HVQA 5AC6A 1MW3A 3QKEA 1KBJA 3LEPA 2VKZG 2CBVA 3DFHA 3B8SA 3ABXA 1R9ZA 3VIMA 2V9DA 3M7SA 5B80A 3MO4A 4A8LA 5HMFA 4DY1A 4D1JA 2EPMX 2VR5A 5LGZA 4O1EA 4J7RA 3P80A 4GZEA 1LRTA 1GQIA 1TV8A 1R6WA 5IDZA 3U5YA 1V0NA 3HJZA 3KWSA 5KMYA 5LNWA 4GH3A 1CEOA 2INEA 1P4CA 4O53A 4AYSA 2ACUA 2XSXA 4KMQA 1BFNA 3N29A 5ABGA 3OZPA 2XPKA 1V08A 5BRPA 1IEIA 4H19A 5JBFA 2YXGA 4JS3A 3U2ZA 2XVNA 1UIOA 4UB9A 5A8MA 5JVLA 1TX0A 2OZ3A 2QCHA 4W7UA 1QO2A 3WQVA 2ON3A 1V7AA 2PLJA 2I57A 4R34A 3TR2A 2B0MA 5CEWA 4I5XA 3WLPA 3LG3A 2WLZA 4C6EA 3CEUA 3N34A 2VFFA 2G41A 3I3DA 4DJFD 3Q37A 4HA0A 1ZGDA 3QV8A 1R87A 5D03A 1LOSA 4AIBA 4XSMA 3E5PA 1U1UA 5C2GA 4OKDA 3WJZA 2NXGA 2WSKA 4C5ZA 4FX7A 1M7JA 2ALRA 3GKFA 3NL3A 3HMCA 4RCXA 2VGFA 1OIMA 4BFAA 3AMLA 4MG4A 4MY9A 1TCMA 1XLDA 4U5KA 1IV8A 5HANA 4FMVA 1NAL1 5EBUA 2YDAA 3LHWA 2GPTA 1C91A 3P82A 3GC2A 2VZVA 3VD9A 3KTCA 3CMFA 2Y8KA 1DE5A 2HE5A 3VKJA 2D3NA 2P1FA 2O9OA 3NAVA 1BRLB 1HF6A 3ZWSA 3F5KA 3VGGA 4GY7A 5I78A 2EPHA 1XC6A 4LAOA 2UBPC 1KGXA 4U10A 1PV8A 3PJXA 3QTPA 4MWAC 4MWAA 1XBYA 4RNJA 3PZIA 3VC5A 1IXOA 5L6UA 3UGVA 2BVDA 4QJ3B 3THCA 1XINA 1TPB1 3TYCA 2E77A 4G56A 3EXSA 4QDPA 3B04A 2R1NA 1UD8A 4WJXA 3KBMA 3N3MA 1ODUA 3VIFA 1C3FA 4GBDA 1CECA 1EIXA 4GFIA 4JN6A 4V33A 2DT0A 1TMQA 1IYXA 5E9AA 4ECLA 4JNYA 3WQDA 3GU9A 1SZNA 4JHOA 5CGQA 3SEPA 2XN0A 4O1FA 4Z0JA 2ZZ4A 3EBVA 1JI2A 3WEOA 3AZRA 3S4TA 3PZNA 4PBEA 3V5OA 1SZFA 4GZ7A 4LQ1A 3K8MA 4U4MA 3PG8A 4PSRA 1REQB 4RZ4A 3CMJA 3HB9A 2FPVA 3NXFA 5XINA 3RCNA 2XVPA 3VNZA 2YBTA 2C8NA 4RJEA 3NWRA 4KERA 4S3CA 3V0TA 4HU0A 2FFCA 1B4EA 2YW4A 1PE1A 4A2SA 1OX6A 2PWFA 1T5AA 1QNOA 1DJXA 2Z24A 3FA5A 3LZ3A 3OYZA 2ABAA 4YTSA 1ZTVA 3AIUA 3NVDA 1BPLB 2TMDA 4H6RA 1UW9A 2IW0A 3G6MA 4REQB 3MU7A 3APTA 3BLOA 3M07A 2V30A 1V4YA 3C6CA 3E49A 2FHFA 4AC1X 1K8CA 4DQWA 3FA4A 1KBIA 3ANUA 3WMLA 4MJ2A 4DAFA 4KGJA 3Q45A 1K4HA 1H61A 3PC0A 5IOBA 1VFHA 1W1ZA 2AL2B 2GJXA 3BH4A 3D6NA 3KBWA 2WW5A 1LQ0A 5BXRA 5A6SA 3IANA 3OPSA 1NQKA 4RDZA 3QC0A 4NAFB 4TV5A 1E4IA 3HGOA 1A49A 3TWAA 1UHVA 1GOOA 2BNJA 3BW3A 3R58A 1BSLA 3TOPA 4CUCA 3C2EA 1U22A 3AS1A 1R2SA 1HKKA 2BMBA 3TN4A 3TE9A 1XIHA 3OGSA 3E96A 1OIFA 3NL6A 5H6HA 1KC7A 3VMPA 3SCOA 3G6LA 2JGYA 4GXMA 1CDGA 1HKJA 3R6IA 4L1GA 3UT0A 3OEXA 4NJIA 4HZ6A 3V0SA 1XLFA 2NSOA 4IJBA 1PIIA 4OVXA 3SFKA 3CYJA 2YCKX 2I16A 5G1TA 3EX6A 4C1KA 4DPPA 5ABFB 3AMCA 1EO5A 3QV7A 1XQKA 4J28A 1X1OA 4GI4A 1G5AA 4GY0A 4E2BA 5BOOA 1ONXA 4I9TA 1PX4A 5AC4A 2ATMA 2NSXA 1Y65A 2CEQA 1OFRA 3PS7A 3VDAA 1DJWA 3U2CA 1FA2A 1MNSA 1G94A 3H24A 2VD9A 1FWAC 1EA9C 3MYOA 2CLPA 2BS9A 4CVUA 4GQBA 1AZ2A 5FD0A 2NQJA 1PSCA 1VENA 4NSBA 4TX8A 1EIBA 3OTRA 3W4RA 2C18A 1XYMA 3WUGA 1OJXA 1BTCA 3IGSA 4Z2HA 3ARVA 5F1VA 2NXIA 3XIMA 1VC4A 3B9AA 4CQAA 2XZ7A 1X8FA 3BLPX 4NXSA 5HATA 1TWDA 3U48A 4PCTA 3D46A 1Y0EA 3CT7A 2ZXQA 2WMFA 4JQ3A 3AIEA 3RRAA 1DTUA 4HZMA 2Z27A 1B1YA 1TELA 3WF2A 4MZYA 3DESA 2EG8A 4DZ5A 2E40A 3BSHA 1UG6A 1PKYA 4AF0B 1XRVA 1W31A 1JCLA 1TWZA 4L1XA 3S3GA 4ACZB 4WIWA 3HFTA 3T0TA 2FB2A 1O68A 4S3AA 2BDQA 4RE3A 1UD2A 3IUDA 5TIMA 2J7EA 3VX0A 1V02E 3KUMA 1IT0A 1B57A 2CHOA 4AD1A 4Z1AA 3LU2A 3QQWA 5D9PA 3E2VA 3HPXA 1E4LA 1XGZA 1ECEA 1EC9A 1BD0A 3W7RA 2GSJA 1UR2A 1RBLA 1C9WA 1H5YA 3E6EA 4AAJA 1SFSA 4OV9A 3ANYA 1SSDA 4OTKA 4IOTA 3LBMA 2C1IA 4GZIA 3ITYA 3EYPA 1G4TA 5CPTA 2WANA 5JMUA 3DFTA 4MWAD 3HV9A 1XBZA 2D23A 3KLLA 3VPLA 5EKYA 4A8RA 1R3SA 4D72A 3HQNA 4JN7A 4QGCA 2PP1A 3UYIA 2ZUVA 5E0KA 3R79A 4OBSA 4RW5A 3DCPA 1G4PA 3UFYA 5A6BD 4IHCA 3GXIA 2Y70A 3S2NA 2VX6A 1DWFM 1MSSA 1J8VA 2PA6A 2F7FA 4K3ZA 5AYBA 4S23A 4RZ5A 4WY0F 1DJGA 2C6QA 4H1ZA 1CXFA 2ADAA 4F2BA 4B5UA 3N14A 4I3GA 1H1NA 2WC3A 3OVRA 4PSPA 1PIGA 3GNOA 4HA3A 4MB1A 1ZAHA 4D6GA 1GQLA 4AG0A 1W3TA 2DFAA 1AH0A 2YYUA 3T09A 3LM7A 3LERA 4JYEA 4OT7A 4GQQA 1GVOA 4WUIA 5TBOA 4QR6A 3LPPA 3VFCA 1TPEA 4JEJA 3ZT7A 2C13A 7XIMA 2W67A 3WQOA 3BTNA 2R1LA 5E0CA 5A5WA 2FYMA 2EO7A 2PBOA 2J74A 1QW9A 3ZJ7A 1S5NA 1MO0A 1XDJA 2GVJA 1B2YA 3H7RA 1VCFA 4JTFA 4O0QA 4B2DA 3QH2A 1GEQA 5IFPA 1QW7A 5D9NA 4LB4A 1S2VA 5G1MA 1W1A1 4G9PA 1TVLA 2NV2A 5MF5A 3PPFA 2NX1A 3H70A 1KNWA 2XSBA 4ERGA 3N2OA 1XI3A 1BF6A 1M7XA 2ZCGA 4JL2A 4MNLA 1FH9A 3FGCB 4DLMA 2DSVA 3QR1A 3D3AA 2H9AB 1AJ2A 1YX1A 1EC7A 3ZJ6A 3QJAA 2E68A 2HE8A 3EMZA 1IR1A 2Z0IA 1IEQA 4O17A 2FJUB 1UR1A 1XYAA 2Q3RA 3DBNA 4B4FA 2ZRZA 3DBPA 4Q8TA 3GKAA 1PJ9A 4XO6A 5A8PA 1M7OA 2QCDB 2PDBA 3WNPA 2NLYA 3GHSA 1FFQA 2TODA 3VKBA 3F4WA 2QJMA 4WQ6A 4D1IA 4UZSA 4P7LA 4EAYA 4J3ZA 4RKAA 5KEZA 4I6KA 5B7ZA 3AIVA 6PTDA 2DVXA 4HCHA 3LMYA 1UROA 1M6JA 2ZBTA 5FOOA 3DFYA 1TTQA 1VYRA 4MMWA 2Y0FA 3UF9A 1HKVA 2AL1A 3CEPA 5IDIA 3EGJA 3BCDA 1A5OC 3NG3A 2QQ6A 2V2DA 4PMXA 1RPXA 2NX3A 3C3UA 3TJLA 1ZB5A 5I7GA 2R82A 2OO6A 4DXVA 1Q8AA 1A5BA 3CAWA 3TIMA 2Y7GA 3TP4A 4I5RA 4X0VA 4W9TA 4IJCA 4ZQOA 3KFTA 1XF0A 3AYTA 3EWWA 1V5XA 3KBNA 4HMNA 2YFNA 4KESA 4OU1A 4UTUA 2DJLA 2G3MA 4RXGA 3BOXA 4Z08A 2CLFA 4GACA 3S5NA 4QCFA 1UR3M 4QBXA 2W62A 1YPIA 2CC0A 4KWUA 1YQ2A 1TIWA 3PAJA 1FWGC 1G01A 4GO9A 3FIGA 4QXIA 4D6FA 3VNIA 1OEPA 1CGUA 5EA9A 3R89A 8A3HA 3UCCA 1E6ZA 4M51A 1P1MA 1UPPA 3TC3A 1GYLA 3DAQA 1EF3A 1QK0A 3LHUA 3A23A 1K7EA 4BI5A 3EDKA 4MF4A 3EOLA 1YADA 2FZNA 5I23A 3MHFA 5ABEA 2A85A 4QTGA 1MRAA 4C6KA 1PZ2A 1CGYA 2JKAA 2WZMA 1CXIA 3OVGA 5DLCA 2YW3A 4NYUA 1JCXA 4XUYA 3UGRA 5AHFA 3QGKC 1HL8A 4LBRA 4WSHA 5CC6A 3MDUA 2Z2BA 4PEKA 3NZQA 4WY0A 3ITXA 4N7QA 4BF7A 1SMAA 1EQPA 1PZ0A 4AZCA 3CO8A 3ITOA 2PBGA 3FAWA 2O92A 1IGSA 1XQLA 1Q66A 2G8ZA 3AMGA 1POKA 2PDFA 1XBVA 1Q6OA 2Q8ZA 5LHFA 3ARQA 2PTZA 1JJKA 3E9AA 3KL0A 1O5XA 3Q2DA 3MKVA 1V0KA 3GLCA 4D6DA 5I77A 3W7JA 1ZS2A 3W76A 3EA3A 3OYXA 3BAIA 1C90A 4NI3A 1U83A 3WQGA 4XG1A 1OSEA 1KXVA 1RK6A 4UTIA 2DZBA 1FTXA 3GZ3A 2HBVA 4GLEA 5AFDA 2BOEX 1UJQA 2PC8A 1V7YA 4OFCA 1OBAA 1WQ5A 1S5TA 1KWGA 3NPUA 2EKGA 2ZICA 1JGIA 4DM1A 2WHMA 3G1XA 2GJNA 2J4GA 5F1UA 4S39A 5HJXA 3TC7A 2J8FA 5CZKA 4EVZA 5I24A 4IMCA 4H4IA 4W89A 3AAMA 4RDWA 2DSKA 4RV8A 3APGA 3CC1A 5H8PA 5J5DA 4N02A 3WDPP 1VFOA 4QIUA 2CNCA 4AVFA 2VDIA 2HSAA 3SN1A 3G1YA 4IZGA 4N9EA 1AJ0A 1LLOA 3EOUA 2G97A 3GUWA 3QW3A 1ZPTA 4FNQA 3O6AA 1W32A 5HPOA 2X41A 2Z1KA 5E70A 1UUQA 1XICA 1RLCL 3L5LA 3WO8A 4AZHA 3MCNA 3L9CA 2OQLA 2WXDM 3S6OA 2QVNA 4KFOA 3LD5A 4M5PA 1JPHA 1IIGA 2E9LA 3UQNA 3M0JA 3W28A 8XIAA 4IPNB 1UBPC 1T8QA 1EHAA 3R8GA 3W2KA 1I2OA 4ERAA 5B7YA 5DRIA 3PNUA 1JG9A 1ITXA 4XBKA 1US3A 4GE8A 1AZ1A 1TV5A 2IKGA 4P7NA 4Q8MA 1FWIC 2EEXA 3CQIA 2OSXA 1F6PA 1V6XA 3LCWA 1G7UA 3WLSA 3W00A 3BLLA 4LC8A 4B2DD 1TWIA 4DELA 5L9FA 4CCCA 3DXIA 3VCNA 4FA3A 3D5HA 3E2QA 4ZODA 4IGMA 3TW9A 1B3ZA 1QHZA 3CV7A 4N6FA 3RLUA 5A2CA 2CESA 1WNOA 3VD4A 4KETA 5BZAA 1L8NA 1BVWA 3NO5A 5HQEA 3VUSA 4MWAB 3G1RA 1MQRA 2WHJA 4H6KA 3R0UA 3TTQA 4S3KA 4ATWA 4MYXA 4Y9AA 4ZQPA 1LROA 5J5RA 3CV6A 4R7OA 4AEFA 2OEMA 2D2HA 3TNOA 2YPIA 1A5UA 2VFDA 2DPEA 1P6BA 3DC0A 1C9DA 3VGFA 5I00A 2CLLA 3UVIA 5K3VA 1OINA 3T40A 2R14A 1QPOA 4NNCA 3VIKA 5A8OA 4B5NA 5BMWA 1N2VA 4CU6A 3EWYA 3P8JA 1PB0A 2FHBA 2QLYA 2CBIA 1JDDA 4UNLA 2PEVA 1YNPA 3OGVA 5CKSA 4AZIA 4HHHA 4W86A 3BQ6A 3CK5A 1KLZA 4UTMA 3RLHA 1EJSC 3PTQA 1GUVA 2VRQA 4F40A 4N4QA 4DNHA 3LZ5A 5U7SA 1P0KA 3BC9A 1YTKA 4ZMGA 4LBUA 4C6CA 1AMKA 5KZ6A 3P3BA 2NVCA 2QUNA 2CLMA 2HROA 1M03A 1C7SA 4FNPA 4MLRA 4JQAA 1Q5MA 1QOPA 4RXFA 3APYA 3HU7A 5I3HA 4KWOA 2GQ8A 1MEHA 2FZ9A 1ICQA 2CCRA 2ZIDA 4F0HA 3TN5A 4AVNA 1X6LA 2W3ZA 1BVNP 1LLZA 2VWTA 3UCDA 1A5AA 3LENA 3KZSA 5DT5A 4DYEA 4Q32A 3P74A 3U3HA 3W1QA 3IRSA 2CLOA 5AECA 1JCMP 2E28A 4LYKA 4UIOA 4X2RA 1XG3A 2V67A 3CQKA 3UJFA 4ZVJA 1A53A 2IPWA 2J25A 2BTMA 4IFRA 3ZJ8A 3M0XA 1H09A 3VE9A 4L56A 5K9CA 3M5VA 4K8EA 2E09A 2WCGA 4IPIA 2PSNA 1NQ6A 1HX0A 1RY0A 2HVMA 1OYAA 2CBJA 4WHBA 4L9ZA 1XPGA 3IJLA 5IHSA 2JIWA 2WZHA 1H5VA 3MUY1 2GJXB 2VFEA 1XXXA 4OBTA 2ZUUA 5A6TC 3W6LA 3V1PA 4A3RA 4DM2A 1JF5A 2X16A 2NW0A 3TYAA 1LQAA 3G24A 1JZ2A 2QJJA 1HO4A 2VXNA 3CUGA 3W2UA 4DX3A 4TOQA 5CXPA 3HIJA 4W5UA 4ROQA 4OOUA 3C56A 1SGJA 4RW3A 5HWMA 3KVMA 3GVRA 4PN2A 3C8NA 2FGLA 1EJWC 1VEPA 3SDOA 3LM3A 2D1ZA 4GVIA 1ZAIA 1VBHA 3SUUA 5A69A 2C0HA 3SW6A 3GXTA 4XX6A 4LAUA 2B7QA 3GNDA 4JYFA 4QS6A 1JDAA 4QROA 4DRSA 3BW4A 1X6NA 2YDSA 2OWWA 1UKQA 3OIHA 1XCXA 2P88A 7ODCA 1QRQA 2ZRWA 1GTEA 5EGRA 1XLJA 1RZMA 2OLHA 1R5YA 3WBEA 4JGDA 1K3UA 4QP0A 4QS5A 4ZSUA 3HG4A 3UXLA 3VKCA 2WVTA 3FYOA 5AHIA 1HP5A 4RR4A 4FLRA 4WLCA 3HPAA 3N25A 5CSYA 3IVUA 4D6HA 1LCOA 2O9RA 3VOFA 1TG7A 3RO6A 5M5DA 4ZXLA 2WSYA 3AHXA 1A4LA 4AW7A 1HG3A 2ABBA 5AZ1A 4LUYA 4XVEA 3DYMA 1J6PA 5CGTA 1OYBA 4PMRA 2Q6ZA 2ZRXA 3SI9A 3W53A 4U5IA 7TAAA 3AYSA 3QZEA 1JPDX 3L4YA 2Y7DA 1AFSA 1EC8A 4F0MA 2FMNA 4GH1A 1FWTA 1O60A 4LX4A 3AZTA 3M0IA 3A47A 4ZBCA 4K39A 4DYJA 1MEWA 1Q8JA 1GVRA 1RA0A 3L5AA 2VQUA 1GHSA 3GK0A 4FP1A 5C6MA 3CLMA 4NX5A 3S6DA 3TYDA 3BE7A 5FJOA 3MWCA 4P7OA 5GNXA 3VIPA 1WBHA 3MWAA 1CGXA 4NZ5A 2BG5A 2RH9A 3AXKA 1B54A 3OOQA 1NWSA 2Z7KA 2HS6A 1RJQA 4HN4A 3PJWA 1XX1A 3CV1A 3GXMA 3LNMA 3RILA 1PEZA 3PG9A 3RRXA 3FJ6A 1XRSA 2JKPA 1DIKA 1Z41A 3T0CA 1KM0A 4E6MA 4JTEA 4N4PA 2FQIA 3NGJA 4GJ1A 2VEMA 2HBXA 2FZBA 2AAAA 1SM9A 3FK4A 4GIRA 5FESA 4L9YA 1D9EA 4HOWA 1CXHA 3DERA 3T8QA 3FXGA 5LYRA 3GNXA 3W1TA 1VEMA 3G2GA 4S3BA 4C6PA 1UWTA 2P50A 3SGZA 3G0SA 4W93A 5CPNA 3N6HA 5AVNA 3A21A 4L7ZA 2QJIA 2VDHA 3C0JA 4RLIA 9XIMA 3H6OA 4M81A 5CGMA 1Q7MA 4MZ8A 1GKRA 2ZADA 1BWLA 4D9PA 1EBHA 3WLMA 5DCDA 2NUWA 4JTSA 1XKJA 2J6VA 2XINA 2ZX9A 1R38A 2PDGA 3GFZA 3VDCA 3UZZA 1W54A 4HOXA 5H91A 2WM0A 3WQEA 4GNJA 1J79A 2O7QA 3H21A 5CBBA 3CV2A 1TJRA 4JTIA 4JTKA 1M3UA 1S2TA 3C8FA 3U0HA 1UD5A 5DBUA 1S3TC 3FV9A 3G0XA 5FEXA 1LYXA 1GOKA 1XLLA 2ZZ1A 5C2CA 3G18A 1TTPA 1W3IA 4M80A 3WH9A 3GR8A 4I6VA 1HXJA 5CSRA 1KTNA 2CIPA 2QHAA 3SIMA 2YB4A 3IS4A 5C54A 5LA2A 3V36A 3AICA 3DG7A 2HZGA 2HDJA 2ZVIA 3IJ8A 3WD4A 3T0DA 3SY8A 2YA0A 1UUOA 1RLDA 3LLDA 3ICJA 3MZ2A 1RQHA 4WGHA 3SUWA 3SURA 2ZUMA 3GE7A 3SADA 2YA1A 4MAVA 3WLHA 1FWCC 4NZFA 1CB7B 3MMUA 4BKNA 3PZVA 1D8WA 5I09A 4A8IA 4UTFA 4M82A 4XWUA 3W7GA 1EH9A 2GVLA 1EP3A 3NEVA 4UMBA 5JH1A 3WBXA 1FQ0A 4H9UA 1KRAC 3BL3A 3EPNA 1SMDA 1JF6A 2V6AA 1GJPA 1OZQA 2A4AA 2I7GA 1SFLA 3CWNA 3QOMA 3WDRA 2IQ0A 1F8IA 4GYJA 3GXDA 3W29A 3M64A 3N4EA 4PBGA 4LAKA 2PDKA 3IJDA 3WF0A 3H4XA 3KRZA 4IWWA 3GTIA 1PAMA 1R30A 4JTQA 3LV5A 3I3EA 4B4HA 4E4FA 4ZOBA 3T81A 2XVKA 5AVHA 1I2QA 1ITUA 3BSGA 3L4ZA 4NKCA 3P6LA 3ARZA 4JQ1A 3OLIA 2WHKA 4C7FA 2G3IA 4HMDA 1MUCA 4WXZA 4HA4A 3BCFA 3PZTA 5AYYA 3ITCA 1HIZA 2UZ9A 1WKYA 3Q65A 2ACRA 2Z26A 2WSQA 2B7OA 3AHVA 4CCZA 4US5D 5DO8A 3GQYA 2PDQA 3QHOA 4O0KA 3TUUA 1K8XA 5DMMA 2BBFA 5E9XA 4TQTA 2OTDA 4IT1A 4B5XA 1MYRA 4XD5A 3WF1A 1H3GA 4RDYA 3VVGA 4F48A 4DZHA 4NZ1A 3W70A 3WD0A 1OG0A 1YKWA 4PGLA 3BARA 4W7WA 3LOTA 1F4HA 4XAZA 1XSKA 6CGTA 1QO5A 5FL1A 1XHGA 4OQVA 4O15A 1R3TA 4GISA 1BTMA 1A50A 1KM2A 1PKNA 1FCQA 3MBFA 1RPKA 3V16A 3WH7A 1ZLPA 1I8JA 4AWUA 5ABHA 1WB0A 3WZ0E 1LP6A 4TVCA 1CCWB 2CFFA 5D2TA 1SR0A 1HO1A 5LNVA 1WZAA 4FOUA 5A6KA 1H2JA 1MI3A 3PJUA 1JZ5A 5LIKX 5BROA 2PDUA 4ML9A 1UP2A 3RMJA 2G3JA 1UR4A 3QV9A 2Z1SA 4EOUA 2JFEX 2DZAA 1O7AA 4NI8A 1V6WA 1OABA 3NQ7A 4KCVA 1GOMA 4LS2A 2X1SA 2OWXA 2FZ8A 4LW7A 1Q3NA 3PFRA 1UR9A 2WSRA 2WCSA 3KCJA 3UYCA 1J0HA 5GPRA 1KKRA 2ODOA 1GOQA 1ZP3A 4IPLA 1FXQA 1GYMA 4AMAA 2VFGA 2XM2A 2ZUNA 5TAOA 1PWLA 3B0YA 1LBLA 2EXOA 3LBCA 4ALDA 1XW8A 3LI1A 1J6OA 2WVUA 3UU0A 2C14A 2E6AA 2VP8A 3H2AA 3GG7A 4UTWA 3XISA 1UBSA 3G8RA 4IXHA 4WY0B 1S5VA 4NT0A 1R9XA 3BAXA 4AZCB 1VHNA 3P0XA 3S6TA 3ARSA 2NV9A 4PFMA 5ECUA 1W9DM 1E9LA 4C6BA 5CG7A 3JVAA 1EFZA 4WSKA 1MXDA 1J9YA 3M9YA 4FALA 3O6CA 3CYVA 1LWJA 3MYPA 1LBFA 1K70A 1R3VA 1EX1A 1PPIA 1A80A 3OIXA 5D4YA 4PFHA 2X0SA 4DWSC 4DWSA 3KDOA 1E1EA 1OK4A 3RG6A 2GDUA 4Z1CA 5BYWA 1PWMA 3IIXA 4BHYA 2P8CA 3SRKA 4NILA 2FFIA 5FA5A 2J8TA 1BXNA 3OVQA 4CD8A 1RP8A 2GUUA 4HTYA 4H7CA 3DHPA 3W7EA 4JTCA 5A94A 4M7SA 1VP5A 2IPJA 3R43A 4JCLA 2F2KA 2X7VA 3RNDA 1QUMA 1R46A 5FAGA 3WJXA 1W37A 3ABQA 2D0FA 1LWHA 3L2MA 4Q7IA 2CITA 7A3HA 5A8GA 4X9YA 3JR2A 5K4XA 2PDWA 1JR1A 3MP4A 1TUFA 5ABTA 3LRKA 1JZ4A 3OZMA 4TTGA 1HTIA 1KFBA 5MKGA 4GX9A 3NIYA 4M19A 1FWBC 4J4KA 4MOZA 3EDEA 4N9BA 2DH2A 1P0EA 2OYKA 3ENLA 1YRRA 1K1DA 3F5JA 4LCSA 4GQGA 5HMSA 1JUEA 3KDNA 2YR1A 3TMQA 5BOEA 4MLJA 1TZ7A 4YPJA 5AOUA 1J96A 5DMYA 1EJTC 3L65A 4S1FA 3TSDA 1L2UA 3NR0A 4X9SA 2DUXA 4JPGA 4JQ2A 5KINA 2D22A 4M7TA 3GIYA 2RGMA 2NT0A 2GK1A 3URBA 1E1CA 1LRQA 4MFDA 4FSAA 4QNWA 1JZ6A 3IJ7A 4HPNA 3URNA 2WB5A 1WKDA 2QNEA 1NU5A 1QPNA 4JX5A 4MADA 2WMKA 1NFBA 1ZL1A 4MNKA 1GT8A 4YN5A 2MUCA 3W07A 2ZC8A 2WK2A 3MCMA 4AB4A 3F2DA 1XWYA 3ZVIA 1JUKA 3ES7A 4Q4SA 1EZWA 2E6FA 1O66A 5CCZA 3G0UA 3FDKA 3GHTA 3VD3A 4S38A 5FEPA 3QQ1A 1KFEA 4I90A 4AU0A 3N2CA 3HPZA 4UR9A 3TSBA 1JCNA 2AQVA 2CU0A 3QEZA 2ZWYA 4KS0A 4L4OA 1H7NA 1MRQA 5BRBA 4AEEA 5G1YA 1US0A 1Q2RA 5CPMA 3M46A 3EDDA 3MANA 4EACA 1V77A 1EEPA 4P02B 1JYWA 3B0UX 1HKWA 1XH2A 1M7PA 2YL5A 4NRRA 2H6RA 2D2OA 4QDWA 1LOQA 2EJ1A 1S5WA 3I68A 4HQVA 2C79A 4XZBA 2YFOA 4XBSA 3BSMA 4XAGA 5D38A 5DQPA 1FWJC 3GB6A 1FHDA 3MBDA 1OCBA 4LY4A 1Q7QA 1CLXA 2PZ0A 1GVQA 4U28A 3PY2A 3WBWA 2D2JA 3M5YA 1JNDA 2A3CA 3RPDA 4JFWA 5HWNA 3MHUA 3JRKA 4MY1A 3KBJA 3LCLA 1U1JA 3HURA 1CXKA 4UQAA 3QRHA 2JE8A 3VAVA 1O95A 1F61A 2WKLA 3WF4A 2NQLA 4LTSA 3EWUA 3LGEA 3GR4A 1TCDA 1ADOA 3NZRA 3RO8A 4Z1DA 1KA9F 3Q67A 3W22A 4HJWA 5EJ1B 5D33A 1J12A 3OLDA 1NP2A 5EL1A 1QASA 3FY1A 3QR3A 4X63A 2NLIA 1LOLA 1P0NA 4L9XA 4H7ZA 1VFSA 4F66A 2E0PA 2P8BA 1EOMA 2V3DA 2NWRA 3NURA 4C6IA 4S3FA 4HB7A 1A47A 3DGRA 1NH6A 3V3WA 3VU2A 2E6DA 3STPA 5DCBA 3RXZA 2PTXA 4IFOA 1BSIA 3EWCA 4PMDA 3AU2A 3STGA 5JXQA 3PULA 4PODA 4ADTA 4C6OA 2OFJA 4CN4A 3W02A 3B9NA 2XN2A 5LNUA 1V03A 2OELA 3IK4A 1T96A 4ZQCA 3GC5A 5J04A 3H8AA 3OQEA 3KAOA 4MB3A 3ABRA 3L4XA 1NVMA 4DYKA 3EXRA 4XZNX 1W9BM 4DZIA 1E0UA 4F0SA 1ISVA 5LIUX 1ZRQA 3H2OA 4JTTA 3UWVA 3L0NA 3TR9A 2OU4A 1EUNA 4GUFA 1WZLA 4TMCA 4B3KA 5GNYA 2FZDA 4PL1A 5TQLA 1DPMA 1WAUA 1CB2A 3E12A 1HGWA 5TD4A 3TAOA 1N8IA 1BG9A 1UR0A 1TTJA 4F2UA 3AS0A 1WV2A 3UWQA 2IXVA 3N19B 5AKQA 1Q7ZA 3F4CA 1T7LA 2EG7A 4HNNA 5D9MA 4UNKA 3WQPA 5M2FX 1QI2A 1I1WA 4S3EA 1JYXA 4EANA 3AYRA 4Q8VA 1W2PA 4WXYA 4LS0A 2O4MA 1B31A 2DUAA 3LQLA 3FKKA 3WYZA 4LUSA 1V3LA 4WKAA 1P43A 4PMQA 4MNMA 4LVGA 1B3WA 1KXQA 4YS1A 3MKKA 3ELFA 2CERA 2VUYA 1XD0A 1HJQA 4EPEC 5CPOA 3P60A 4H7VA 4G6CA 2POZA 4R53A 5IRPA 4Z1YA 4V27A 4KH2A 3CMGA 3WNKA 1IT8A 2L5HA 3CHEA 2CXGA 4FXFA 1VRDA 3E2RA 1ELSA 4NNBA 3SCQA 1IEXA 4QLKA 3BLEA 2Z1BA 4HU4A 3CU2A 3GTFA 3ID7A 1L8PA 3T1GA 2OG9A 5FIPA 3HM7A 3K1GA 2IPGA 4K8GA 3TYUA 3G1VA 2P3EA 2GOUA 4BK9A 4P7QA 3S2MA 3QFWA 4RE0A 4LCRA 1NWRA 1DBTA 3LHTA 4BA0A 7PTDA 1G4SA 1HL2A 3AISA 2PDLA 1OG6A 2Y85A 4NZ4A 3P61A 1B3OA 3PM6A 1CGVA 2OLAA 1FFRA 1PXGA 2PCEA 1DYSA 3NQBA 2WNQA 3VCRA 3P2VA 3O0FA 5CZSA 3HGSA 3PK7A 3NZPA 2VD8A 5C70A 3CIWA 1F05A 1TE6A 4UBPC 3AHTA 3L12A 4H6QA 3O2LA 4XAYA 1EQCA 2QS8A 3KW3A 1GVFA 1JDCA 1TJ1A 4AY7A 1IIHA 1RUSA 3LSBA 3HPFA 4FK9A 2XFWA 3GH5A 1I2NA 1GVYA 3QBUA 3GYCA 1YE6A 1FWNA 1XYLA 3KLKA 3K13A 2E5BA 3STCA 4I7UA 4YLWA 3DI0A 3B9EA 2YCEA 3MW7A 4K6AA 1TV2A 4FI4A 4GQRA 1NSJA 3R4IA 3RIKA 4ICCX 3NVTA 4GKLA 1T40A 1CIUA 2ONEA 3T4WA 4BQ3A 4B9YA 1S46A 4A05A 2VELA 1MMFA 4JTUA 4YHEA 4KCWA 3AHYA 4LV4A 3W38A 4F2TA 1D7KA 1XH0A 2OZTA 1DJIA 1PYFA 3QV6A 3UXDA 3ISIX 2X1TA 5CPSA