1R8LA

The structure of endo-beta-1,4-galactanase from bacillus licheniformis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords endo-beta-1,4-galactanase
publication title The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 144
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1r8lA00
4CGTA 1TZ7A 4UR9A 3A4AA 3BH4A 9CGTA 2Y8KA 5DT7A 1EO5A 4BCEA 4UQAA 1WNOA 2WXDM 4D6FA 3AIQA 3W6LA 2D3LA 4MB5A 3OZPA 3UESA 4JFWA 3NSMA 4GQQA 3AISA 4KWUA 2XIIA 4DUVA 4A3HA 4UQ9A 2XGIA 4YN5A 2J7BA 3WF1A 3B9AA 3K4AA 1RP8A 4IUGA 3ARUA 2V5CA 3VIGA 1Y7VA 4H8VA 1FH9A 4OZOA 3PBGA 4JZ5A 3A4WA 2D24A 1W1TA 1UR2A 3FXYA 4GKLA 2XVNA 3KE0A 1EO7A 2DT3A 1W3HA 2YDSA 5LA1A 3WDJA 3L4ZA 3SUSA 3CMJA 2CITA 3CZEA 2Y8VA 4D6DA 3WEMA 3A6OA 4ZEPA 1V3JA 4MPKA 1RD6A 3WL0A 1H2JA 3AS3A 2J75A 3CHDA 3WDRA 1H3GA 3CTTA 3U57A 5M5DA 4J7RA 1EHNA 2WANA 4W93A 3VD3A 3VDHA 1VRXA 2V3GA 3PZNA 3O6AA 1W9UA 2WAGA 2E3ZA 1OCQA 1KWGA 1E70M 1UR1A 1UG6A 1U30A 3VOCA 4W8BA 3OG2A 4C7GA 2YA0A 4QP0A 2E40A 1CLXA 2X09A 3AIBA 3CUHA 1E43A 5ABFB 1WDSA 3M46A 4PMYA 4X0NA 3T0BA 3EYPA 2D0GA 4UQCA 1J0HA 4PCSA 3ZJ6A 1DHKA 5FKYA 4QFUA 4PUEA 2JFEX 2W67A 3WIJA 1W9DM 2JIWA 2WBGA 3CUFA 2J78A 4AZGA 4J3TA 2CBVA 4BA0A 3UR7A 3AXIA 2PWGA 2JEQA 1BYCA 4BQ3A 1MW0A 2EPOA 1TG7A 4CD6A 1Q6DA 3UEQA 3MMWA 3SCOA 4F9JA 2WLYA 2JIEA 1WB0A 3ZR5A 2VNCA 1G1YA 1KQZA 5BXRA 5ECUA 2VUYA 1B90A 1FFRA 3W38A 3CHEA 1W1PA 2A3EA 2ZX9A 3S6TA 3VIHA 1G5AA 4AIOA 2ZUMA 2EEXA 4GO9A 2PWHA 3PZVA 4QDMA 1WO2A 3AHZA 3CH9A 4MB3A 2WMKA 2DEPA 3ZQ9A 5IHRA 4H41A 2VX5A 2VJXA 4CN6A 1JYVA 2IUZA 4QLKA 3WNKA 4WJXA 4AW7A 1E1FA 2X2YA 4TX6A 3WBAA 5IHSA 3LPPA 1KGUA 3CLWA 4P7NA 4ZE5A 1KBKA 3SCNA 4CU7A 1O7AA 3VD4A 2OWWA 3T0DA 2J4GA 3WENA 1UD8A 1XYFA 5CPSA 3WEOA 4HPHA 2W62A 4MDPA 2NW0A 2VOTA 3MS8A 2V3DA 3ZO9A 4PTWA 4WSKA 3OA5A 2CHNA 2VO5A 4Q22A 3ZJKA 8A3HA 3II1A 2HVMA 1CGTA 1LJYA 2TAAA 3MANA 3SCUA 4HMCA 3WUFA 4QCFA 3FN9A 4UQEA 2BXYA 3BMWA 1SR0A 3NCOA 4W88A 1H5VA 4WK9A 3L2MA 3CPUA 3A47A 5CLTA 2V5DA 3AIVA 1QI0A 1E6QM 2WZHA 5BRPA 3PZ9A 2CKSA 1GPFA 4KRUA 1MXDA 1DEDA 3B9DA 1HKMA 1BFNA 4AEFA 3N15A 2X8RA 1GORA 2J7FA 3ZSTA 2PBGA 5JBDA 4U3CA 4AISA 3AZSA 2OLHA 1EDGA 1FOBA 1UWQA 2OSXA 4UFHA 3N04A 3AMGA 1KR1A 2GJXB 3SUWA 3WUBA 1UHVA 2D22A 4PTVA 4M80A 4S3KA 3VNZA 3VU2A 2WSKA 4MB4A 1TVNA 2DT0A 1FP8A 1CGXA 4MNKA 4X9YA 3OLDA 3CZLA 3WNPA 1OBAA 1QI5A 3MKKA 2UY4A 1UKPA 3OZOA 1JYWA 1JZ2A 3LPFA 3SCRA 5BCAA 2BHUA 4LGXA 1EXPA 3AHVA 4CD4A 4DWSC 4IISA 2BHYA 1W2VA 4HU0A 4HA3A 2G4FA 4EANA 2X1IA 4DWSD 5CQ1A 1U33A 2ZX6A 2OWCA 4ZENA 3SIMA 5F7UA 1R7AA 4MAVA 4MTVA 4Y7EA 3ZMRA 3OLGA 3WF3A 2DT2A 3ZIZA 4AZ5A 1W3JA 2DQXA 3EMCA 2WCGA 4D72A 5I23A 1QBAA 3OGRA 5CPTA 1ITCA 1UWRA 2QMKA 2VMFA 2D23A 4B15A 4TVUA 4F8XA 1KB3A 2G3MA 1DWHM 2W61A 1TE1A 1FH7A 1ZS2A 1JFHA 3RM9A 1MVYA 5KEZA 4UFMA 4PYSA 3O9NA 2VQTA 1QOXA 5CPQA 4TOQA 1UD5A 4LXFA 5D8WA 4AMCA 1ZJBA 1C8XA 1QBBA 5FOOA 4DUXA 1W32A 4AIEA 4W7UA 5ABFA 5D4YA 3ZT5A 1Q6EA 1XD1A 1AVAA 1LL7A 1PJ9A 1VENA 2VL4A 3EDFA 1VEOA 1M53A 4LYPA 1V6VA 1CENA 1MFUA 2J7DA 3CZJA 3UG5A 3WNMA 4W85A 1ESWA 5CGMA 2JF6A 4JCLA 3L4WA 4TVDA 5IFPA 1YQ2A 1DTUA 3WQ6A 1JD7A 1VFMA 3AIRA 4ATLA 4Q7NA 1UUQA 3L4XA 4X0VA 5A8OA 1GOMA 3K8KA 4CCDA 2CIPA 3DYPA 1BGAA 1IT0A 1JDCA 5A8MA 2VURA 3W4RA 2WZEA 1CPUA 2WMHA 4U3AA 4AD1A 3T08A 5I6SA 1UOKA 6TAAA 3GXIA 3UETA 4DWSA 1KGXA 2DSWA 1Q6CA 2ZX5A 1WCGA 4BQ2A 1BQCA 1EDQA 1DP0A 1HVQA 2DDXA 3ZOAA 5A8PA 2XWEA 4KGLA 1KXTA 5M17A 4ACZA 3SUTA 2YL5A 1NH6A 3GBDA 4PBGA 4Z2IA 3BLPX 3EDKA 4H8UA 4P8WA 2CCRA 6CGTA 3FNDA 1W9VA 1GHRA 3TP4A 5CLWA 2YOCA 3AYSA 4UCFA 3AMCA 1BSIA 1HN1A 2XVLA 3OGVA 2YDQA 3TTSA 4D6IA 3BLKA 2VZTA 2OSYA 2ZUNA 1SFSA 1WDQA 3AQUA 2WKLA 1FP9A 1E4IA 5DMYA 1MYRA 1JDDA 3SURA 5D8ZA 2ZIDA 4LYQA 1H49A 2GDUA 1V0NA 3MSDA 4B3LA 3K4DA 4JL2A 3WD1A 1PX3A 4NRSA 3MUIA 3QHNA 1WE5A 3OLEA 5DF0A 1I1WA 4CVWA 5AC5A 3MUY1 5BXSA 1QHZA 2XPKA 1HKIA 1V3MA 5D9NA 1A47A 1AQ0A 3VD9A 3VX1A 3TTOA 2FH8A 3AHYA 4HMEA 3WMBA 1CXHA 1E72M 2XSAA 2PF0A 1WDRA 3ZR6A 4D6EA 4AZCB 1CYGA 1UD6A 1HKJA 1W9BM 3BAYA 2J7CA 4QAWA 3ARTA 1E40A 3PZGA 1GCYA 4PCTA 1GVIA 4RL3A 4QLJA 4AZ7A 5HOSA 4FMVA 4PMNA 3GYCA 2VVSA 1UKSA 1E6ZA 4GI8A 1VFUA 2J25A 4UFKA 3WH5A 4HPGA 1OB0A 1QI2A 1NM9A 3QOKA 4ZE4A 3PZIA 3GH4A 4AXNA 1E4NA 4J3SA 5BXTA 4B9ZA 1UYQA 2PB1A 3ZT7A 1H0GA 3GBEA 3PTKA 1V03A 1C7SA 3G6MA 4M24A 1GQJA 4IPLA 2E9MA 3ARWA 3JUGA 4LPCA 2UY5A 1EQPA 3W25A 3FHQA 2EO7A 4PSPA 2A3AA 1VEMA 2DIJA 3NSNA 3ARXA 3U5UA 2UWFA 3EBVA 3CGTA 1UR9A 1W9XA 1NWSA 2G3JA 4UFJA 4AIUA 1D2KA 1QHOA 1CDGA 1H4PA 1ITXA 1W2PA 3UERA 1KXHA 3BC9A 3WQ8A 1QNOA 1HJSA 1HX0A 1K9DA 2J8FA 1EH9A 3VDBA 3RIKA 1AQHA 1EA9C 1R8LA 2YIHA 1S46A 2FHBA 1IZKA 2VCAA 2EJ1A 1JL8A 3N1AA 5HDRA 4PTMA 3AMLA 2Z1SA 2XUCA 1QNRA 1JI1A 1UH4A 3T09A 1UWIA 1UWTA 4PMXA 1R87A 2EQDA 1CXFA 1H11A 1HL8A 1BTCA 2WHKA 1GONA 1AQMA 3VVGA 4JFVA 3WH8A 1K6AA 1UA3A 4BQ5A 1MQQA 3B8SA 4OBSA 3HN3A 4L4OA 1E0WA 4H2CA 4NSBA 1HVXA 1CWYA 4CD8A 4P7RA 1CGYA 3UCQA 1UD3A 1QW9A 4UTFA 3BAJA 1E6RA 2W5FA 4GO8A 1J10A 1QVBA 4U2YA 3VIFA 1UKQA 3UG4A 3BAIA 3PN8A 2ZXQA 2W91A 4CU8A 5DT5A 2E9BA 3FAWA 1MW2A 3SCPA 3CUGA 4IM4A 2DH2A 3LPGA 4WKAA 1W3LA 3WMSA 4HZ6A 4W86A 3I3EA 2WC3A 3QHOA 4AD5A 3WDPP 3THCA 1FA2A 1OT1A 4J3WA 1BYBA 2WHJA 3VINA 1E3XA 1LQ0A 5BWFA 1W1YA 3AI0A 1UWUA 5DO8A 5ABHA 4M8UA 1PZ2A 1W91A 2XVPA 2BXZA 1CTNA 5I3DA 1NARA 2VVNA 1GUVA 4HZ7A 2WB5A 4TXEA 2VCCA 4NZCA 3ARPA 1BG4A 4HZ8A 1J11A 4D1JA 3J7HA 1CGVA 1TFVA 3RDKA 4MB1A 3WF2A 2Y2WA 1VAHA 4GPNA 4KRTA 3VD5A 3GH7A 5M03A 3ARSA 2IXUA 5I2UA 5A2AA 4AD2A 5I77A 4CD7A 1QHPA 3KEHA 2OYKA 2VZSA 1WZLA 1X6LA 2PC8A 3AIEA 3AXHA 2WBKA 3ARVA 3TOPA 1ZBWA 3RCNA 2XGBA 1EHAA 2DSKA 3VGFA 4ATWA 4WKHA 3TTQA 1CEOA 2QF8A 1PX8A 5CSUA 3FW6A 4U5KA 1SMDA 2FDMA 3VGEA 1OGBA 2ZX8A 3BCFA 4PTXA 5HBFA 3AXXA 4B9YA 2DIEA 1JGIA 4HA4A 4L4PA 4W89A 1ODUA 1QW8A 3IJ7A 3FY1A 1E71M 2JF7A 1NOWA 1NOUA 2YA1A 3VUPA 4W7VA 2GK1A 4PRWA 2E4TA 3VMOA 1ZU8A 4N0RA 1B1YA 3WDHA 3BMVA 2EXOA 1GOIA 4C7DA 2WMIB 4RE4A 1LL6A 4EK7A 3ZSSA 3W81A 4W7WA 4BS0A 2BY1A 1WZAA 2XHYA 4LYRA 4CKQA 3WL1A 2UY3A 3GM8A 2FGZA 2F8QA 4HTYA 3CZKA 2MANA 1VFOA 1HL9A 1OIFA 1BLIA 3AHTA 2ZUTA 4W5ZA 2XJ7A 7TAAA 3MUAA 5A6AA 3U7VA 1L0PA 2ZWZA 4AD4A 4NRRA 2UY2A 4K68A 4PN2A 1GHSA 1E6PA 2G8ZA 1JZ5A 5HXMA 3M6DA 1UZ1A 1FHDA 1M7XA 4CUCA 1JIBA 2YDRA 3W28A 3UG3A 1CBGA 5EFFA 3WMCA 4UOZA 3RM4A 3DC0A 4E2OA 1U2YA 4CN4A 4JHOA 4PMRA 1R7OA 2RGLA 5DFAA 4MADA 3WEZA 3VPLA 1QI3A 3L4UA 4JFTA 2CEQA 1EDTA 1OD0A 4B3KA 2WVTA 3F5JA 1KBBA 5FCZA 1E9LA 4HA1A 1ZBCA 2XM1A 5JUVA 4P7OA 3WD2A 2QPSA 4B16A 5A3HA 4PMVA 2XIBA 1KFWA 4GIAA 2D1ZA 3NUKA 3CO4A 4DUWA 3KL3A 4JKLA 3RJYA 4HOXA 1GJWA 3K8LA 3N13A 2V3EA 3RMEA 3POCA 1CGUA 2PWDA 1V3KA 4OOUA 2B31A 1E5JA 3VGHA 3IJ9A 3EDDA 3WQ4A 1JNEA 1UQYA 1UQZA 3WQ5A 2WMJA 4D6CA 2YBUA 5A6JA 4YHEA 1H1NA 2WPGA 4U33A 4PEEA 5E09A 1OSEA 1CGWA 3FAXA 4Z2KA 3W24A 1XHGA 1J9YA 1E3ZA 2WMFA 1LG2A 3MU7A 4LX4A 4WSJA 4D6HA 1LWJA 4UFLA 3F4VA 1FFQA 2WLZA 3VIMA 4Z2HA 4M82A 2WC4A 4PUDA 4MJ2A 1M04A 3CHCA 1MWOA 2V38A 1TA3B 4JFSA 3L4TA 1NQ6A 2DT1A 1HJQA 1BF2A 3A4XA 4WF7A 1TCMA 4YHGA 1HP5A 4QLLA 3TONA 1HKKA 2J47A 1GOKA 4FLQA 1H0IA 5AY7A 1ECEA 3T0AA 1C93A 1E5NA 1XCXA 1CXLA 3W0KA 3QOMA 1HF6A 2JE8A 4UNIA 1V0MA 1C92A 4GI6A 1KR0A 1CXKA 4U2ZA 3KL0A 1ZBKA 1C8YA 1V6YA 2BS9A 2ESCA 3GZAA 2J8GA 1CLVA 1BVNP 2WW5A 4XB3A 5GNXA 1JZ7A 4ATDA 5LA2A 1E6NA 3O2LA 3T2OA 1A3HA 3GXMA 2HISA 1E15A 3GTNA 4MNJA 4HOWA 3W53A 5AC4A 1W1VA 4OJYA 2E8YA 2VT0A 3PZMA 3U5YA 1MW1A 1NP2A 1UR0A 1UD4A 2F2HA 7A3HA 4AD0A 3MV11 4GXPA 2D0FA 4W87A 2GDVA 2OYLA 1HNYA 1X6NA 4DM2A 3K1DA 2DH3A 2QLYA 1GOWA 2WK2A 3ARZA 5CZKA 5A6SA 2ZXBA 4JIEA 1PIFA 2WMIA 4D71A 2WCAA 4XX6A 4D1IA 3AICA 5E0CA 4PMQA 4UZSA 1JZ6A 3WN6A 4EKJA 3E1F1 1E6XM 4OBRA 1TMQA 4EE9A 1V08A 2C0HA 3W6MA 3NDYA 2QMJA 1RH9A 3OGSA 2D3NA 4OKDA 4C7FA 1JZ3A 2XFFA 4AEEA 3WD4A 1GJUA 3ZT6A 5EB8A 2WHMA 4W5UA 3HU7A 1GW1A 4J3UA 3VDAA 5JBFA 3IANA 3OLIA 5A6BD 4WKFA 1FH8A 5I5RA 2CERA 4MAZA 1VEPA 1ISZA 2EBNA 1J0IA 1C8QA 1X1NA 4OUEA 1G94A 1WZKA 3NYDA 5I78A 1KWKA 2J7GA 3SUUA 1UWSA 2GJXA 3NDZA 3BSHA 1LLOA 4JKMA 2Z1KA 2XYLA 2ZX7A 2QV4A 1OINA 2VI0A 3AJ7A 1SMAA 2FHCA 5D9OA 1E6SM 5A2BA 4PSRA 4D6JA 2VR5A 2CPUA 1UKTA 3W37A 3ALFA 1N82A 2WWCA 2F61A 4F66A 3L4YA 2JALA 3BAXA 1XH0A 1EOKA 4P7LA 3WQWA 4F9DA 3N12A 1DWFM 3AMKA 2VX6A 6A3HA 4CVUA 3I3DA 2XVKA 5A6LA 1QPKA 2O9OA 2OYMA 4OOZA 1GOQA 2WWDA 1JNDA 5AYBA 4MNLA 3IK2A 2ZE0A 1DWIM 4AZHA 1JZ8A 4TX8A 2WCSA 4MJ4A 1OD8A 1O6IA 4NF7A 1V6XA 1OWQA 2WNWA 5EMYA 4Z2LA 3CZ8A 4JL1A 5CXPA 1YHTA 1E56A 2VX4A 3CHFA 2YBTA 5CGTA 5IFTA 4TUFA 3VGBA 4W8LA 1XRVA 1OIMA 4GINA 1M01A 5A6BA 3FHAA 1HJWA 2WSPA 1TA3A 1QI4A 2D0HA 1MQRA 3NIYA 1E4LA 2J74A 2XM2A 1E0VA 1W3KA 2BFGA 1C7TA 3CIVA 5LA0A 1IZJA 1NWUA 3K8MA 3I3BA 3F5KA 2NT0A 1JFXA 2WVVB 3WDQA 1TVPA 3GDBA 3VMNA 3ECQA 4S3JA 4MDOA 5LYRA 2AAAA 3ARQA 3MUZ1 3SEPA 1OT2A 1SYTA 5C71A 4CU6A 2AMGA 3UR8A 1HP4A 1UD2A 1B9ZA 2DSZA 3SCWA 1JF5A 1LF1A 1Q6GA 4PMDA 2EPKX 3F5LA 1F4HA 1JG9A 4AZIA 1LWHA 1OGGA 1V6UA 1M03A 3WF0A 1NOFA 3N18A 3ARRA 2ZUUA 5BYWA 4BZYA 3VX0A 4UOQA 1VBRA 4JKKA 1QNQA 2WVSA 3A3HA 3WD3A 3AFBA 5CSYA 1G9HA 1E55A 2X0YA 1GNXA 5EFDA 1PX4A 2CYGA 2D2OA 3AS0A 3WELA 1MW3A 5CJ5A 1B2YA 2VCBA 1LG1A 4AD3A 1GQLA 4A3YA 3VGDA 2GVYA 3AS2A 2V3FA 2IXVA 4W8AA 1HXJA 3PZTA 3DECA 3S2CA 1JI2A 2XWDA 2BY0A 1MQPA 3MMDA 1XYZA 3THDA 2A3CA 1JD9A 4WLCA 5E6YA 2E8ZA 4BQ4A 2O92A 1P6WA 1UA7A 2BY3A 2JEPA 2Y5EA 2ZICA 1XSIA 4AYSA 5I24A 1TR1A 5I79A 5FL0A 1B3XA 1KCKA 3RM8A 1EGZA 3PZQA 4E4PA 2J7EA 2O9PA 3L2LA 3OB8A 5DEZA 2CBJA 1V0LA 1JZ4A 1JXJA 2Y24A 5BROA 4D6GA 3OIHA 1B0IA 2Y4SA 1CXIA 2VRKA 2CETA 1VF8A 3QHMA 1B30A 3W29A 1WKYA 1V0KA 3RJXA 4H7VA 1ZL1A 3N11A 3WNOA 5A8NA 2G3IA 2QHAA 3T2PA 1PZ3A 3KL5A 1NWRA 4JCMA 4P8VA 4P7QA 2FH6A 4AZCA 4HU8A 1XD0A 5HPCA 3GNOA 3WUGA 4DWSB 1NWTA 3B9EA 4XZWA 5TD4A 2VC9A 1JYXA 3ALGA 3WF4A 1E0XA 1HJXA 2EPMX 3EDEA 5A6MA 1GQIA 4RE2A 3BCDA 5AYIA 1US3A 2BVDA 2ZXDA 3WDIA 3NJ3A 1QNSA 2X0HA 2CHOA 4A4AA 3VIIA 4UZUA 4ACZB 1EQCA 2XFRA 5I0DA 4UOJA 2E0PA 1E1EA 3WH6A 2AOSA 2BVYA 2O9TA 4H04A 4MNMA 1CIUA 1JAKA 4V28A 2GFTA 2FGLA 3WFZA 1J18A 4JHZA 1KXQA 2WKGA 1DWJM 1J0ZA 1VFFA 3K46A 5C8BB 1BYDA 3AOFA 1BVZA 3LMYA 1HIZA 1EOMA 3N17A 7CGTA 1PBGA 2D20A 2CXGA 2VTFA 3WD0A 2YA2A 2GJRA 3PTQA 2BY2A 2PWFA 3ZM8A 1BAGA 4XUYA 1JF6A 4R27A 4AWEA 3AROA 5A6KA 1XSKA 2GSJA 2J7HA 3IAPA 1VBUA 4GZJA 4GZIA 2VX7A 1KGWA 1ODZA 2DSUA 2XVGA 3AZRA 1BYAA 3APGA 4GI9A 3M7SA 4U5IA 5A94A 1UR8A 2O9RA 1XGZA 3AIUA 2ZUWA 4URIA 1V3IA 2G41A 2WVVA 1R86A 2WHLA 3MV01 4E8DA 2DGAA 1PEZA 1W9PA 1C90A 1EIBA 3WY1A 1RPKA 4JAWA 5IXEA 1ZBVA 3ZJ8A 3AMDA 2PI6A 3PZOA 5D9PA 1ISVA 1IV8A 1H09A 5ABEA 5BRQA 2W92A 1I75A 1JYNA 5FL1A 3VIKA 2BNJA 1HJVA 1VJSA 2YKKA 3EMZA 4ZXLA 5BXPA 3VIOA 3D5HA 1US2A 3RO8A 1CXEA 1GZJA 1XV8A 1FHLA 3VIJA 3HJEA 2W4XA 2W66A 2YJQA 1OGSA 4BF7A 2NSXA 3VM7A 3EMQA 1BG9A 3BAKA 2YLLA 5C70A 1GQKA 3ZJ7A 5EBAA 1C3FA 1WAWA 1BHGA 1XC6A 4HMDA 3GNPA 1Q6FA 3VTRA 4AZ6A 2VZVA 2VRQA 4UFIA 1J01A 5GNZA 4TTUA 4PMOA 3VNYA 4UQDA 1LL4A 3GXFA 4GQRA 4PMUA 1DWGM 3W27A 3PZUA 4EAMA 1K9TA 2RGMA 4NI3A 2VZOA 3EDJA 3WQVA 3AIWA 1B3ZA 3BSGA 1CECA 3BGAA 2X05A 5GQBA 3MMUA 5A8QA 2XSBA 5JIWA 3TTYA 2W63A 4YPJA 5HNNA 3G6LA 1Q4NX 2WM0A 2E9LA 3CZGA 3KZSA 3QGVA 1WPCA 4FK9A 1WDPA 3NSXA 1D3CA 2CBUA 3PHAA 4ACYA 5HPOA 3GNRA 1ISWA 1Z32X 4V2XA 3IAQA 1E4MM 4LQ1A 8CGTA 1OM0A 1DWAM 5FD0A 1J0YA 1GVYA 4N42A 5D9MA 4CCEA 3MO4A 4KMQA 4U31A 2GUYA 4Z2JA 4J27A 4FLRA 5GPRA 5E6ZA 1VJZA 1G0CA 2XFYA 3VKKA 2BVTA 4AC1X 3PTMA 4ML4A 1JDAA 1B3VA 4AZBA 3OBAA 2ZOXA 3VGGA 2C7FA 3L4VA 3VILA 1CNVA 1JXKA 1BPLB 2XTKA 4R5EA 4AY1A 2ZWYA 2EPLX 4OIFA 4Z2GA 2GJPA 3WKZA 5E70A 3RPMA 3VDCA 1ISYA 4J3VA 2DSVA 1J0KA 3M07A 2VQUA 1KXVA 3VMPA 3CMGA 1V3LA 3WNLA 4DM1A 2BHZA 3CUJA 3WBEA 1VB9A 4M56A 2CESA 2OWXA 5FIPA 3U7BA 4M1RA 2CKRA 1G01A 5A1AA 1UKOA 2YL9A 3VIPA 4ZFMA 3W26A 2YL6A 2VR4A 1L8NA 4CD5A 3AS1A 4TVCA 4WIWA 1K9FA 1XSJA 5IDIA 1MFVA 1XH1A 4PMZA 1TUXA 2OSWA 3DHUA 5E9AA 5CG0A 3SUVA 3POHA 2YL8A 3ARYA 2A3HA 1E73M 3SCVA 4JFUA 5KZ6A 3GH5A 3W82A 1KQYA 3VD7A 4M29A 2PWEA 2VZUA 5A95A 4UQBA 2QPUA 1F4AA 5JIPA 1ISXA 3DYMA 3LPOA 1B3YA 1VIWA 3AHXA 5M3WA 3N9KA 3WFLA 3SCSA 1UR4A 4H8HA 4KH2A 3CBWA 1AMYA 4HP5A 4ZXOA 1B3WA 2Q8XA 3VM5A 5ABGA 2FHFA 5GNYA 1V6WA 1UH3A 3BXWA 1R85A 3T2QA 1NP0A 4F79A 1H41A 2BV9A 3RILA 2WYSA 1ZB5A 3WNNA 2G3NA 3IJ8A 4FLSA 1JAEA 2PBOA 4M81A 5A2CA 1UZ4A 3WH7A 1GOOA 2CBIA 1KCLA 2WVUA 2WMGA 2A3BA 2C8NA 4KGJA 2ZUSA 1RP9A 4CN1A 4J28A 2WC7A 3VO0A 1K9EA 3DHPA 1PAMA 4CCCA 1C91A 3TA9A 3KWXA 4TTGA 4W84A 4P8XA 1J12A 1QNPA 3BAWA 3D3AA 1XH2A 3GXDA 4XV0A 4HOZA 1V3HA 5E0FA 2ZUVA 2J77A 3MSGA 1WP6A 2GK1B 1MXGA 1HJUA 1D7FA 1I1XA 1HT6A 4IPNB 3AZTA 2NT1A 2YLAA 1PIGA 1WZMA 3WSUA 1B31A 2CNCA 3SCTA 3DYOA 4RE3A 1XCWA 4XZBA 5A69A 3CUIA 4FF5A 4V27A 2ZXAA 4GZEA 2EPNA 3SCQA 4E8CA 2WZIA 3AYRA 3QR3A 4J3XA 3WUEA 2J79A 2DPEA 2J62A 2VRJA 1J0JA 1ZJAA 3HMCA 2XG9A 4FLOA 3WH9A 1BGGA 5JBEA 1V02E 1CZ1A 1UH2A 1V02A 1PPIA 4P8UA 4QCEA
chains in the Genus database with same CATH superfamily
3T0CA 1TZ7A 4LUIA 3H2FA 5D2YA 3BH4A 3WQPA 4L61A 1V6TA 9CGTA 1A5KC 4UQAA 1R6WA 3RHGA 1WA3A 4D6FA 4KEUA 4MB5A 1H63A 4JQ3A 3A64A 2OT0A 5DMLA 4HSOA 4GQQA 2CLEA 1FCQA 2VDGA 1IXNA 3R11A 6REQA 3WF1A 4GYJA 1B54A 4IUGA 3G3MA 1H7WA 4IG2A 4DLFA 3H53A 4DBEA 3LD5A 3ZZ1A 1TTPA 2D24A 1YTDA 3EOUA 1UUMA 2NUXA 3KE0A 1P0DA 4FI4A 1W3HA 2ADAA 4NJHA 2YCJA 3DGBA 4EF9A 3L4ZA 3WLJA 2Y1HA 3SUSA 4FHAA 1FXPA 1M6JA 2G4JA 3CZEA 1FHUA 4GQBA 5HINA 4D6DA 1Z42A 3WEMA 4MPKA 1P7TA 5LXEA 1SW7A 4XZNX 3PWGA 1Q7QA 1KM2A 1TTJA 4MOZA 3CHDA 1UOZA 4DN1A 2IMRA 4W93A 3W7DA 1VRXA 3WLOA 3FSUA 3CAWA 2WAGA 4GY1A 4ASTA 2AAMA 4M6PA 2D2JA 4JEJA 1E70M 4ENLA 1U30A 2OQHA 1W1ZA 3TYAA 2YA0A 2E40A 3BE7A 2VFFA 3STPA 4MKVA 3GFYA 1UW9A 3OOQA 3H21A 3V1PA 5D02A 2EGZA 3B8UA 1WDSA 3M46A 3N2TA 4PMYA 2FJKA 4UQCA 1VPQA 1D3HA 4RZ5A 4PCSA 3HPAA 2YYTA 4HNLA 4QFUA 2Z1XA 3WIJA 4QDWA 4IIBA 4R7OA 1W9DM 3OPSA 3CUFA 1XIBA 2J78A 2PSNA 2INFA 1XYLA 3H2OA 5CC6A 3AXIA 5LNVA 1YPXA 2PWGA 4YCOA 4LOCA 4HPNA 1BYCA 3O6DA 4AXKA 1Q6DA 3CUZA 3UEQA 4IJRA 4RLIA 4WJ8A 2JIEA 1WB0A 3ZR5A 4Q4OA 1KO0A 5BXRA 2VUYA 2Z7GA 1W1PA 2ZX9A 3W7CA 1G5AA 3G8EA 2PWHA 1YTKA 4V33A 5H8UA 1J5TA 3CB3A 4KEZA 2WMKA 3LB0A 3OVQA 1GT8A 4IGNA 3LSBA 5FJJA 5HMSA 3UZ5A 1JYVA 2QXWA 4LF1A 3QTGA 5E0KA 4WRHA 4TX6A 3F03K 3WBAA 3W1XA 3LA4A 3OW1A 2Z0IA 4GNJA 1KGUA 4ZE5A 4MFEA 4IQLA 4Q3MA 3VD4A 3T0DA 2J4GA 4HYVA 3LDVA 4HPHA 1G69A 2OODA 4UMBA 2NW0A 3T0TA 3TN6A 1Q13A 4HNUA 3HA1A 2PODA 1R3TA 3ZO9A 3NQAA 1MNZA 4J4KA 4Q22A 8A3HA 3M44A 5BW6A 2HVMA 1LJYA 4IMFA 4W88A 4RNJA 3G0UA 4ZOAA 5CBJA 1S1PA 3L2MA 1KKRA 3TR2A 4C1KA 5I07A 3PBYA 1GPFA 1XFCA 2OZTA 1MZHA 2QIWA 3LGDA 2OOGA 3C0QA 4ZQOA 1FDZA 4AEFA 3N15A 3C61A 2CWXA 1XBXA 2X8RA 5EMUA 1GORA 2HWGA 5F4XA 3GW3A 1PDYA 3TYEA 4LALA 5JBDA 4G56A 4OV9A 1RLCL 4DNHA 4GK8A 3N25A 1EDGA 1FOBA 5J5RA 4UFHA 1XJBA 1FWWA 1KR1A 3TMLA 2WSQA 1QJWA 3VU2A 1XP3A 2WSKA 1OG6A 3LCGA 3TE9A 1KRBC 4MNKA 1XBZA 3UJ2A 3WNPA 1OBAA 3N3TA 3OZOA 5D33A 3FVDA 4S3FA 1JZ2A 3SCRA 4LGXA 3W7JA 4DWSC 4L7ZA 3STEA 1LOQA 2BHYA 1W2VA 2Q6ZA 4HU0A 5CG7A 4C1NB 3T42A 4EANA 3AUJA 4HSNA 5BU6A 2D2GA 4LBRA 5F7UA 1KBIA 4MTVA 4Y7EA 5TAOA 3I10A 2DT2A 3ABZA 4M6QA 1W3JA 2YW4A 1QBAA 2X1SA 2V9DA 2WM1A 1JDEA 2BBFA 2R1NA 3NQ8A 4GIEA 4Y90A 4B5TA 4R7JA 4UR8A 1XIMA 2G3MA 3IVTA 5H8MA 4GIRA 4IMDA 4L4LA 4MGGA 1X38A 1TZ9A 1JFHA 4OUIA 1MVYA 3O9NA 2DU2A 5CPQA 2PTZA 2PD9A 2QCGA 1C8XA 4PA8A 3EX4A 1KD0A 4WQ6A 3LX9A 3ORWA 1W32A 4EXAA 1PV8A 5FF4A 4YTRA 5I3IA 1XD1A 4DQWA 3FVMA 2VL4A 4R33A 1VEOA 2GWGA 2O55A 4LYPA 2NVDA 1Q8JA 1CENA 4POCA 1MFUA 4YCPA 3GKFA 1ZALA 4HSHA 1EA0A 3KRSA 5CGMA 1DVJA 3B06A 4QJ4B 1Q5MA 1K4HA 1VFMA 4Q7NA 1OADA 3JRKA 1Q7MA 5G5IA 1GOMA 3K8KA 2CIPA 1BGAA 2LLEA 5GJPA 1IT0A 4XAPA 1ELSA 2RAGA 3CLMA 1O95A 3GUWA 2WMHA 4U3AA 2GUUA 5I6SA 3T08A 5D32A 1SO4A 2QS8A 4MKNA 4L1XA 4H3DA 4DWSA 2PU1A 3P61A 1WCGA 2DZXA 4QQUA 1XLCA 3FFSA 1Z69A 1KXTA 4WJEA 4U10A 5M17A 4G5DA 1NH6A 4Z2IA 2CCRA 3LCIA 3FNDA 4O1CA 1W9VA 1GHRA 3W1LA 3RRXA 4UWMA 4UCFA 1HN1A 4ROQA 4D6IA 5HMFA 2GZXA 2Z26A 2HTMA 4JYEA 2ZUNA 1TIMA 1FP9A 3MB9A 4IP7A 3PSWA 1MYRA 2QUMA 1JDDA 2HNEA 4E5TA 5D8ZA 2YCEA 4LYQA 4XBKA 4B2DA 2GDUA 4ROPA 1V0NA 3WZ0E 4ZFCA 4JTSA 3IJ6A 2Y7FA 3WD1A 1PX3A 1S3HA 1WE5A 4WDWA 5DF0A 4IXXA 2QAPA 2WJDA 4EP8C 1LRNA 3S1GA 2WO5A 1R5YA 1XUZA 2Z4GA 4JTTA 3TTOA 1OFQA 3CS2A 4HMEA 4ERGA 3GY1A 3Q45A 3DHFA 1H62A 1MI3A 1U5VA 5I7GA 1W9BM 2GYIA 3PZGA 4H9VA 3PM6A 1QO5A 1F7BA 4XAZA 2FKPA 5HOSA 3HGOA 4FMVA 5F2LA 4PMNA 3EX1A 1QK0A 2TODA 1VFUA 3WH5A 5C9RA 1QI2A 1NM9A 4JR5A 3PZIA 4Z0JA 4AXNA 1BKSA 4AUBA 1H0GA 3GBEA 1EC9A 3PTKA 3W72A 3E5BA 1GQJA 2A4AA 3I6EA 3BMXA 2E9MA 2UY5A 4GUGA 3FHQA 3RLGA 3TCEA 2VEPA 1O1HA 2EO7A 4Q6JA 1V77A 2DIJA 3GVRA 3KLKA 3NSNA 4FXJA 4ZA0A 1JPKA 4J40A 3U4FA 1DXFA 4DLMA 1FBAA 1NWSA 2POTA 4UFJA 5FACA 5G4WA 4AVFA 1KXHA 1GJPA 1QNOA 2O7SA 3TLLA 3T55A 2VCAA 4UTJA 3QGKC 5HDRA 4Q32A 2VGBA 2Z1SA 4NZ5A 2UBPC 2ZZ5A 1JPDX 2V2DA 4M6VA 2J6XA 3EA1A 3M0JA 1H7PA 1UH4A 1UWIA 3MVIA 1ADOA 1O60A 1BTCA 2AMXA 4M1BA 5I3KA 3T07A 4DBUA 3VVGA 3WH8A 4NU7A 4IXHA 3CEUA 1A5OC 1YLVA 4L4OA 3XINA 3E0LA 4DEFA 4NSBA 3THQA 3VNJA 3AYVA 3RK8A 3KBJA 1CGYA 3MO7A 1GQNA 5JU6A 1O5KA 1O1ZA 4A8NA 1UKQA 1IF2A 5DT5A 4KW2A 3JW7A 4H1ZA 3C3UA 1GVQA 3CUGA 3C2EA 3LPGA 4QS6A 4PC8A 1IEVA 3JR2A 1SJAA 3I3EA 3GR4A 4GNVA 3NQBA 1LUCA 4Z17A 4AD5A 2ZRWA 3VNLA 3WDPP 3W01A 1FWBC 4RK8A 1OT1A 3DCPA 2WHJA 3VINA 3SY8A 1LQ0A 1EBHA 5ABHA 2XVPA 4UNLA 1UUOA 5I3DA 1IEWA 1ZZMA 4TXEA 4HZ8A 1SSGA 3NQFA 3J7HA 1AH0A 1EX5A 3BLOA 2Y7GA 1A3XA 4HCHA 3HV8A 1MUWA 4O4WA 3S8HA 1H1ZA 1SZRA 1VAHA 1SFLA 4LNYA 3EAUA 5M03A 3ARSA 5I2UA 4MIMA 4AD2A 3QLLA 3KEHA 1V5XA 2NLYA 2V5LA 3AIEA 3AXHA 2WBKA 1W1IE 2BX7A 1ZBWA 3M0MA 3B9OA 3GDLA 3GIQA 1CEOA 2Q8ZA 5CSUA 5AYYA 4NXKA 4OT7A 3CO8A 2QULA 2HK1A 2FDMA 3TN5A 5CZJA 1OGBA 3BQ5A 2ZX8A 3NR0A 5HBFA 3AXXA 4HA4A 4RUBA 4L4PA 3LYEA 2BODX 2A7NA 4ZGYA 3W88A 1P5BA 4W7VA 2B0MA 5F2GA 1HGWA 3BMVA 4L6OA 4NAFA 4QM1A 1QU4A 4BS0A 1WZAA 3LV6A 4LYRA 3LV5A 3SB0A 2FGZA 3LHYA 2VWTA 4GD0A 1V8EA 5FEPA 1RBAA 1HL9A 3THUA 3L23A 4O54A 2PDHA 3BGGA 2ACQA 4HN8A 1ZY9A 4XAFA 1OX4B 2PF8A 1XUUA 4HHMA 4PN2A 4OFCA 4NNAA 1RUSA 3M6DA 1UZ1A 3NDOA 4PFMA 4MG4A 1IIHA 3W1MA 3KRBA 3SQLA 4FPSA 3UWQA 3U9IA 2A5HA 4MMWA 2BZNA 2OU4A 5FF2A 3C6CA 1KM0A 2FZ9A 1R7OA 3CQHA 2RGLA 3LQGA 1Y65A 3PG8A 3WEZA 4DXXA 1S2VA 2VR2A 4OV4A 4JFTA 2CLKA 1GTEA 1EDTA 4CNTA 5FCZA 1KBBA 1ZBCA 5JUVA 1ZP4A 3SRHA 3NM3A 4Q8QA 2QPSA 3KVMA 1UR3M 4B16A 4FOJA 3U2ZA 4GIAA 4JKLA 2P53A 4G8TA 5IBXC 2Y5SA 4QEEA 3K8LA 4IGMA 4EXBA 1V3KA 2B31A 3TXVA 3IJ9A 3WQ4A 3DFTA 1NF7A 4P61A 2WSRA 5A6JA 4GGHA 4TO8A 2WPGA 2OZ8A 8RUCA 3RCMA 2PGEA 3UXDA 3NPXA 1OSEA 3QEZA 1E3ZA 2WMFA 4QROA 4LX4A 3M0KA 3L0NA 4QG9A 4FNSA 4GFSA 3ZR4A 1GG1A 1EXBA 3F4VA 3RPTA 4Z2HA 3OG3A 1Q7ZA 4M82A 5LXXA 3HQ1A 2OXNA 1PKNA 3CHCA 3L4TA 2DT1A 1WKEA 3A4XA 4BI5A 4FXFA 2ZC8A 4JTRA 1RV8A 4QLLA 1HKKA 3KOYA 1H0IA 3C4UA 5AY7A 2VDIA 2P8BA 5FAJA 2EF9A 4HCLA 2R1LA 1Z48A 1XCXA 1CXLA 5CC3A 3W0KA 2HS8A 3QOMA 4UNIA 1C92A 4UC5A 3ZFHA 5MF5A 3C8NA 1YPIA 2YFNA 1ZAIA 1P43A 2XH0A 3I7RA 4K37A 1X1ZA 2GGEA 4XB3A 4DJFC 4ICNA 1OC7A 1E6NA 3T2OA 5D37A 4NYYA 4NNBA 3GXMA 1E15A 3OP2A 5C5YA 2QAFA 4YWSA 2QCDB 2QPXA 4WCJA 3EWZA 4HOWA 3W53A 5IBXA 1VYPX 4OJYA 2XDFA 2PLJA 2VT0A 3JU2A 5TF0A 4JIHA 1EGMA 1OJXA 1LBFA 2F2HA 3GXPA 7A3HA 3M4HA 3OVGA 4QE4A 2E09A 2QDDA 1KLYA 1HNYA 4HN4A 2ZZ4A 1VKFA 1NDZA 1OF6A 3L67A 2FZDA 2QLYA 3LU2A 4RJEA 5A6SA 1YDNA 2B81A 4WUIA 2WMIA 1RQBA 3NWRA 1TV8A 3N3MA 3VOJA 4D1IA 3AICA 3WLMA 5E0CA 4HPXA 5DQPA 3LGEA 4PMQA 1NVMA 3KS5A 4UZSA 5I3HA 5I3GA 4QQ3A 4OBRA 1TMQA 4IIFA 1H51A 1UBSA 1RH9A 2DZBA 2DUAA 2ZTKA 1GJUA 3ZT6A 2DORA 3E9AA 3MP3A 4J3UA 4H4IA 5A6BD 3GVQA 2CERA 3R43A 3QSTA 3RGTA 5K9CA 1G94A 7XIMA 1KWKA 3SUUA 3UPWA 1UWSA 3SBFA 4KWOA 4RX0A 2Z1KA 1A80A 4DZIA 3WLHA 2EKCA 1SMAA 2X2GA 4DJFA 2I7GA 4UTIA 4OECA 1Z89A 1JCYA 2IPJA 1N82A 2WWCA 4F66A 3L4YA 3UJSA 4H19A 2UV8G 4UTWC 1EOKA 3WQWA 1ZRQA 5DN1A 1DWFM 5G4HC 6A3HA 2INEA 4OOZA 1GOQA 1JNDA 1B4KA 5AYBA 1N55A 2QUVA 2ZE0A 3QC0A 3PAJA 1AFSA 4A35A 1TZZA 1JZ8A 3N2XA 2WCSA 3VFCA 1XQKA 1OFAA 4MJ4A 3ITGA 4L9YA 4R34A 4O8RA 4JIRA 1V6XA 3PY2A 3MY9A 5EMYA 1QCWA 4Z2LA 2Z2AA 1W31A 2CZDA 2I5QA 2VX4A 4DB7A 5CGTA 5IFTA 4TUFA 3VGBA 3NXFA 4W8LA 2Z6JA 3W7HA 2VGIA 1TTQA 3LCFA 3CV6A 1KM5A 3DN5A 3NIYA 1E4LA 2J74A 3EXTA 4Y9MA 4CNSA 1V93A 1ICQA 3K8MA 1I2PA 3S5OA 3I3BA 3F5KA 2ZZ2A 1LM1A 2FMOA 3ZLHA 3C2RA 4F4RA 3VMNA 4MDOA 3EPNA 3C56A 2RUSA 5AECA 1DIEA 2AMGA 3UR8A 1B9ZA 2V2CA 4Q4PA 5CZTA 1R9XA 2DSZA 3ONCA 1KV8A 1Q6GA 4JYDA 2YGYA 2EPKX 1R9YA 1M1BA 4G7EB 4DYKA 1OGGA 3RU8X 3PC0A 5C9XA 4X61A 3LRMA 4ZQRA 4I7WA 3N18A 4UTWA 2D2HA 4Z42C 4IF2A 5BYWA 3VI2A 4NYUA 4A21A 1QNQA 2OGYA 3SQSA 3AFBA 3WD3A 4N9CA 1E55A 5C2GA 2PCQA 5EFDA 5AYXA 1WUFA 4KEVA 1TIWA 3WELA 1B2YA 3C2VA 5AC6A 1CI1A 4AD3A 3VKAA 4GYKA 4YJ5A 4GLEA 3IRDA 4H2HA 2GVYA 2V3FA 1MDRA 1UP0A 3W23A 3FK4A 5D05A 4WOZA 2BLEA 3R4IA 3UWVA 1HXJA 3MJYA 5MHBA 2XWDA 5SWUA 3KDNA 3S47A 1PTGA 5HJXA 2A3CA 1JD9A 1JEZA 2E8ZA 2BY3A 2JEPA 2Y5EA 1OFEA 3DFYA 3WX7A 1O5XA 4AYSA 4FB7A 3S9ZA 1TR1A 5I79A 1B3XA 3USBA 4E4PA 1L6WA 3V3WA 2WKJA 1V0LA 1JZ4A 1V51A 4D6GA 2GJNA 4ZQPA 3B0XA 4GH1A 2VRKA 1VPYA 3KRZA 4C6EA 1EUAA 1ZL1A 3N11A 3PB0A 4C60A 4M51A 3ZWSA 2QCMA 2QHAA 1XKJA 3T2PA 1GK8A 1H7NA 1RVGA 4P7QA 2YCLB 3W3OA 2FH6A 5EPDA 4AZCA 1T7LA 1ZUAX 1SU5A 4CQ8A 5J8LA 1NFGA 1DJGA 3B9EA 5TD4A 2EPMX 3NZ1A 1QFEA 5A6MA 1GQIA 4Q33A 5AYIA 3SIZA 2ZXDA 3NJ3A 1QNSA 4ACZB 4UIOA 3DX5A 1EEPA 3TLQA 3V18A 1ZSXA 2O9TA 2X1UA 3WQEA 4Y9PA 3S1UA 1CIUA 1SR9A 1JAKA 2WNZA 4V28A 1E1CB 1ZAHA 1J79A 3D6NA 1TJ2A 4JHZA 1JGMA 4P2VA 2WKGA 2QJJA 1HTIA 2Y85A 3B0YA 1BYDA 3TC3A 2OQLA 3LMYA 1HIZA 3S83A 4DPPA 2PRHA 1EOMA 7CGTA 2QJNA 1PBGA 2D20A 2VFDA 3WD0A 2HPIA 5REQA 1ML1A 4XUYA 3KFTA 4PCNA 4E0CA 1F76A 4AWEA 2REQA 5A6KA 4X2PA 2GSJA 3C8FA 3NQVA 5BWAA 1OK6A 3DENA 2W9MA 1KGWA 2DSUA 2XVGA 1DIOA 3G18A 1BYAA 3BCJA 5F1UA 4GI9A 4GYPC 2FIQA 2WJEA 3FEQA 1K8YA 4LVDA 2WVVA 3C52A 1IEXA 5HATA 1XLMA 3MV01 3D47A 2DW6A 3GG7A 3UR5A 3WY1A 3BW3A 5IXEA 1SM9A 3AMDA 3ZJ8A 4FS9A 1ISVA 1QDSA 4DRSA 2OEJA 1I75A 2BNJA 2IQ0A 1ADDA 1VJSA 3EMZA 2ISVA 4ZOBA 2QCFA 1CLKA 1XV8A 7ENLA 3TVAA 2GGHA 3HJEA 1Q3NA 2W4XA 2YJQA 3O6YX 2NSXA 2E68A 3EMQA 5LNUA 2VD8A 4Q8WA 4XQ6A 3FYOA 4D9PA 4AYGA 4ONVA 3CIWA 4DF2A 4DX3A 2PGRA 1KV5A 1TV2A 3BARA 3SN1A 1X8CA 3VTRA 4AZ6A 3B4YA 2VRQA 1RCOB 3CM4A 3PP7A 4PMOA 2B4GA 1GGOA 3O16A 4UQDA 3M5XA 3KOXA 4K8HA 1AQFA 3OHIA 1K9TA 2HXTA 2JK2A 2VZOA 1DJIA 1LBLA 3EDJA 2PZ0A 5A8QA 4Y9NA 4LVFA 3TTYA 4EWJA 3QMSA 1TJRA 3DOPA 3FYYA 3DERA 4IIEA 4F0KA 5HR6A 1Q4NX 2E9LA 3CZGA 4FK9A 2CBUA 1AL7A 3PHAA 4J9JA 5HPOA 4IG2B 1DL3A 1Z32X 3IAQA 2IKGA 4GYPA 1RD5A 3BLDA 4N42A 5D9MA 3MO4A 4KMQA 4U31A 2GUYA 2BXVA 3UZZA 1PHQA 2RFGA 4J27A 2HBVA 1VJZA 2J27A 4L80A 4AC1X 3PTMA 2VHLA 3CL7A 3HGSA 1YEYA 1P7TB 3HPXA 3OBAA 4PE8A 2ZOXA 4IP4A 4GBUA 1W8SA 2C7FA 3KXQA 1UASA 3VILA 1EJTC 1BPLB 4LCRA 3R12A 4NX0A 2Z2UA 4K3ZA 3VDCA 4J3VA 1DHPA 3IGHX 3TN3A 1KXVA 4GY7A 3WNLA 4PODA 4IP5A 1H5YA 3LZ5A 3WBEA 3P8JA 2CESA 2OWXA 4B3ZA 1VQTA 2CKRA 3PNZA 1OFOA 1UKOA 2OKTA 2TRSA 2YL9A 3VIPA 4GOAA 3LOTA 5EMMA 4K8GA 3BJSA 2GDQA 4CD5A 3ZVHA 3PAOA 2OSWA 1TUXA 2VENA 4IQEA 2ANUA 3DFSA 3BOXA 2NXHA 3QZEA 1HUVA 2A3HA 2BASA 1YDVA 1E73M 4JFUA 5KZ6A 1GKPA 4B5SA 2Y62A 4LY4A 4JY8A 4M29A 4R88A 3M7WA 2PWEA 3S5YA 1RY0A 3DYMA 3LCXA 3PS7A 1B3YA 1VIWA 3AHXA 4IT1A 3N9KA 4YVPA 1JPHA 1EJRC 1UR4A 4MJZA 2ZC1A 4HGXA 3ATYA 4HP5A 1EJSC 3LEPA 1UH3A 2WYSA 3PWIA 2PBOA 4HK5A 1SO6A 3FJNA 3FGCA 4Q4SA 3TSDA 3R5EA 1KCLA 3I7QA 4MJMA 2A3BA 1PHWA 4CN1A 3BUVA 1F74A 3HG4A 4JQ1A 2E6AA 3FIGA 1K9EA 4CCCA 4Z1DA 3TA9A 4W84A 4HHLA 1WYIA 4XV0A 1I2NA 4L1GA 5FI8A 5E0FA 4CQBA 1FWAC 3MSGA 3PBVA 4ICCX 1WP6A 1YNYA 5CGQA 4E6MA 1HJUA 1HT6A 1XLHA 1OFPA 1VHNA 4M6UA 3C5QA 1B31A 3HV9A 3T7VA 3SCTA 3DYOA 3EWUA 4AX6A 4TQTA 3CUIA 1IEQA 1OFDA 2WZIA 3FV9A 4C6MA 1X7FA 2J79A 2VRJA 3UWZA 1FRBA 4FLOA 1PZ1A 5K7JA 1QK2A 1JCNA 3EA3A 5JBEA 1CZ1A 3IIXA 3KOZA 1UH2A 2GSEA 1OCJA 5CCZA 2BOFX 4UR9A 5T8GA 3A4AA 3QR0A 3SRFA 3CWOX 1J6PA 5DT7A 4XIMA 1OC6A 6ENLA 3G1YA 3EGJA 3GZ3A 5LGZA 2WXDM 5CPLA 4CQ9A 1TR9A 2D3LA 1F2JA 1IR2A 1YYAA 3FLUA 1UPMB 2PMQA 2ABAA 2FYMA 2NLIA 3AISA 3N2OA 2HDJA 3QR1A 1VJIA 4YN5A 2XU2A 3B9AA 1RP8A 1VR6A 1Y7VA 3BW2A 4OZOA 3NGFA 3TYUA 3A4WA 4NIRA 1W1TA 1XRFA 3H7RA 1W5OA 2DT3A 3VOHA 3ANVA 2YDSA 3C2OA 3WDJA 1XYBA 1JUKA 3IVSA 4XD6A 1IWBA 3P8IA 2WNNA 3H2AA 1FTXA 4H9XA 1RD6A 3RO6A 4GCAA 4NL1A 1TV4A 1H3GA 1K1DA 5J5DA 1EHNA 1SW3A 3V0TA 3F7JA 2V3GA 3SY5A 3O6AA 3LBMA 3R10A 2R94A 2E3ZA 5D38A 3MKCA 2B7QA 2YXXA 1UR1A 1UG6A 3VOCA 5C0QA 3GTHA 4W8BA 3KTSA 4C7GA 2KAUC 2WSYA 3RX4A 2X09A 1EGVA 1FUYA 3GU2A 4IMAA 3CUHA 1U5JA 3W7PA 4GNKB 4X0NA 1KM6A 1I0BA 1DHKA 2J9ZA 4PUEA 4O10A 2W67A 3DKLA 3EZ4A 1XLGA 2WBGA 1QMLA 5G2WA 4AZGA 4J3TA 2CBVA 1O4UA 2NXGA 1YBQA 3UR7A 2BP1A 1XLFA 2QZRA 4KT2A 2JEQA 3TH6A 1XQLA 3CEPA 6TIMA 1TG7A 4PCPA 3DC8A 4CD6A 5JH1A 4L9XA 3NVTA 3Q4DA 2VNCA 3LBOA 2GVLA 4RPQA 1FKWA 1FFRA 3S6TA 3VIHA 4AIOA 2O4MA 1QWKA 4GO9A 3PZVA 3BTNA 3AHZA 4JQ2A 4IPPA 2BOEX 1R38A 5IHRA 4ZTYA 1RR2A 1WDWA 1IIGA 3UG8A 4H9TA 4DYJA 1LDCA 2CLIA 3WNKA 4WJXA 1A5BA 1E1FA 3BSMA 3SCNA 4CU7A 1VLWA 2GSHA 4CQCA 2OWWA 4JTDA 1XIIA 4DZHA 2NQHA 3KTCA 4I9AA 1W1A1 3WENA 3W85A 2W62A 4JTIA 2VOTA 1A5AA 3MS8A 3QBUA 5LNRA 3MT1A 4LSBA 1BSLA 3MUXA 4MYAA 1CGTA 3RF9A 2C15A 3UXKA 4QCFA 3FN9A 2BXYA 3FJ4A 3NCOA 4EX4A 5I09A 2Z2BA 3GHSA 1AODA 1CX9A 1G7VA 1KBJA 3HJZA 1Q45A 4WVXA 3BLFA 1E6QM 3IUIA 4H8NA 3PZ9A 2CKSA 3VXGA 1DEDA 3R0KA 1G4PA 2R1MA 4DO6A 2VFEA 4JY9A 4S3BA 3E38A 5CBIA 3NO5A 3QPZA 4GX9A 2V82A 3A9IA 3PUGA 5C9UA 2OLHA 3N04A 2ZE3A 2GJXB 5A6TC 3ZWTA 3P80A 2D22A 4XSLA 4PTVA 1RQEA 4S3KA 4CLMA 3VNZA 4MB4A 1TVNA 4X9SA 4X9YA 3CZLA 5FEXA 3HGRA 1QI5A 3MKKA 2UY4A 1JYWA 4C1LA 4O1DA 2BHUA 1MUMA 1R47A 4HNVA 3QM3A 4XO6A 2C18A 3USZA 1VGAA 4GIYA 2EAWA 2INZA 4U4MA 3W76A 5CQ1A 3JZEA 4O53A 1R7AA 4B5VA 4MAVA 1RK6A 3ZMRA 3OLGA 3H24A 2DQXA 3GRIA 3SECA 4D72A 5I23A 3OGRA 4LUSA 1UWRA 2VMFA 2D23A 3OZYA 3ZLGA 4GRSA 3ITCA 3APYA 5BMWA 1TE1A 2G95A 4LXFA 4N6EA 4AMCA 4DELA 3XISA 5FOOA 7ODCA 2CZFA 1XF0A 4AIEA 2WJFA 3NL2A 5ABFA 3ZT5A 2PFHA 4TU1A 1PJ9A 3FA4A 4A8LA 3MW7A 1WXZA 4MVAA 4DAIA 2J7DA 3THAA 2ZRVA 3NL3A 2PLKA 2QEZA 3UCDA 3I6TA 3PUOA 1ESWA 4W85A 2JF6A 5EGRA 5IFPA 1YQ2A 1KFKA 1VC4A 3N34A 3GD6A 3L4XA 2WPBA 4NJIA 4CCDA 3M43A 5DBTA 2VURA 4NKCA 1RCQA 4I3GA 4KFPA 1MDLA 4UTHA 2JQXA 3U4AA 3KW3A 3UETA 3MYOA 1GKQA 2ZX5A 3FX4A 4IJBA 1K70A 3FSTA 1D8CA 1ME8A 1YPFA 3H4WA 3N73A 3W2MA 2XWEA 1PCKA 3QKEA 2YL5A 4LCSA 3EDKA 4P8WA 4H8UA 4ORIA 1TPDA 6CGTA 2FDSA 2VFGA 2FGBA 3CL6A 1BSIA 3TTSA 4NILA 4RXFA 3HQNA 2ZZ1A 1LROA 3BLKA 3KBMA 1SFSA 4JXCA 4LUJA 2WKLA 2AL1A 2RDWA 3QY7A 4Q4MA 5DMYA 4JTEA 3IRSA 3VCRA 2ZIDA 3VYLA 1R2SA 4XO7A 4IX2A 4JX6A 1WX0A 1M7JA 5T26A 1NU5A 2J24A 3E5PA 3QHNA 4FX7A 3HGJA 2PTXA 5AC5A 1QHZA 1HKIA 4S23A 3VD9A 1UIOA 1GVFA 4JTCA 4C6PA 6PTDA 3S2NA 1E72M 2XSAA 2PF0A 3RUBL 3UJEA 4D6EA 1UD6A 4S38A 4XISA 4FSAA 3BAYA 4DJED 1GVIA 1EWEA 4RL3A 4QLJA 4YTUA 2R1PA 3GVWA 3EOOA 2DZAA 1YADA 3ITTA 1UKSA 1E6ZA 4N4QA 5TNVA 3QOKA 4ZE4A 2QYGA 1UPPA 1OF8A 4J3SA 1H50A 2HVOA 5EY5A 2PB1A 1ZQ5A 3M9YA 4A29A 3L2IA 1V03A 1W5NA 1F3WA 5AZ1A 3ARWA 3JUGA 5A5WA 1EQPA 3KOWA 4PSPA 2A3AA 3STCA 3WK2A 4MM1A 4GJIA 1OCNA 1KRAC 3CGTA 1X97A 1KCXA 1ITXA 1BWVA 1BXBA 4I5XA 1HJSA 1B3OA 1K9DA 2VUNA 2ALDA 3OIXA 3DIPA 1EA9C 1R8LA 4NX5A 2Y88A 4LT9A 2FHBA 1KNWA 3TYBA 1IZKA 2ZRZA 1TPEA 2EJ1A 4K36A 2B7OA 3ME3A 1T99A 3W7KA 2PDQA 3WLIA 4US5D 4UTMA 2XUCA 1XICA 1QNRA 2ONEA 2GWNA 2EQDA 3VKJA 2GVGA 5AVHA 3CQKA 4JFVA 1K6AA 2X0SA 1UA3A 5L6UA 1F8IA 4HMNA 3W7LA 3IWPA 3HN3A 4O0ZA 4A3RA 4ZMGA 1HVXA 4HVXA 4DXKA 2AGKA 3O6CA 1QW9A 3TQVA 2W5FA 2Q01A 1QVBA 1KTBA 1S39A 1XGDA 2OQYA 4C6CA 2ZXQA 2W91A 4CU8A 2F84A 1YIXA 4JN7A 3AYTA 1QO2A 2PP3A 4HA0A 4IM4A 4JYFA 2DH2A 3QZ6A 3AALA 1W3LA 4NP7A 3WMSA 2EG7A 2WC3A 3BV7A 3H7UA 4TR9A 3QMTA 3DI1A 3THCA 5FJUA 1FA2A 4J3WA 1YDYA 2CC0A 3WQDA 1W1YA 1UWUA 2YZ5A 1PZ2A 2BXZA 1NARA 2GQ8A 4HZ7A 3SO7A 3KM8A 3P2VA 3ARPA 3DESA 3FXGA 1SGJA 1TFVA 3W22A 2FTYA 3UJFA 2Y2WA 4HNNA 3TYZA 3TIMA 3G1AA 3UPBA 3VD5A 4HBKA 2CLPA 1YDOA 2GJLA 1EF2A 3QJAA 2IXUA 3G24A 1Y8BA 5F4SA 5I77A 4CD7A 2VZSA 2PC8A 4NT0A 3P82A 3VK5A 5CZSA 1OZQA 4AHPA 1US0A 3RCNA 2XGBA 1NIUA 3W86A 3TTQA 4ATWA 1XC4A 4GKTA 2OOFA 1VBGA 3FW6A 4U5KA 3VAVA 3AU6A 3QH2A 1SMDA 2GUBA 1D9EA 4O1BA 3BCFA 1LWIA 1QPRA 3DFPA 3PANA 1ODUA 1QW8A 2PTYA 3IJ7A 4NAEB 2EKGA 2JF7A 2QCLA 1NOUA 2VYOA 5GJMA 2GK1A 3BG9A 2QCCA 4C6IA 1M9HA 1VFHA 1TO3A 4QDPA 2E4TA 3NVDA 4C7DA 2RKXA 2WMIB 9XIMA 1LL6A 4EK7A 4W7WA 5MKGA 4FXSA 2BY1A 3HB9A 3KUMA 5KZMA 3WL1A 3BURA 2UY3A 4ZOEA 1FWJC 4HTYA 4FAMA 4QEHA 3CAKA 3KDOA 4IQJA 3AHTA 1J96A 3G1DA 4XTDA 2XJ7A 4I5UA 7TAAA 5A6AA 2PDGA 1Y5WA 4AD4A 4NRRA 1Y5VA 4PFHA 4R9OA 4FIQA 1E6PA 3R2GA 4ZQMA 2G8ZA 1JZ5A 4DVOA 4PTNA 3N6JA 4OTKA 1LT8A 4CUCA 1JIBA 3N2BA 3N4EA 3W28A 3UG3A 4ZZ9A 4UOZA 1XL9A 4MY8A 1CCWB 1Q6OA 4E2OA 3E3HA 2HRWA 2HE5A 5DFAA 4H00A 3VPLA 2Y7EA 3WK0A 4F2TA 2CEQA 4PUNA 1YX1A 1OD0A 1XIFA 4HNOA 4HA1A 4DI8A 2XM1A 3WD2A 3KS6A 3TKFA 3GX9A 2GQAA 4GMEA 5DMNA 3MHFA 3GK0A 2XIBA 4QSFA 1KFWA 1KBLA 4FX6M 1PKYA 3KL3A 3L9CA 4IUOA 2FFCA 3O15A 5DX7A 2PDNA 1GJWA 3N13A 1GYMA 4ZOCA 4N6FA 3N9RA 2FPTA 3POCA 3A4JA 4FF7A 1E5JA 2GGIA 1UQYA 1E9ZB 3URBA 2VP8A 1UQZA 3QV6A 3WQ5A 3G0XA 2WMJA 4W4QA 4D6CA 2YBUA 3NQMA 4JN6A 4YHEA 1GG0A 3VE7A 4U33A 5E09A 4K7YA 3T05A 1J9YA 1LLWA 3W73A 4WDUA 3URAA 4D6HA 3S1WA 2YXGA 1O66A 3LSCA 1RLDA 4DY1A 3AUOA 3CTLA 1BD0A 3D46A 4US6A 1OFRA 1KLZA 3MQTA 3KTXA 1TV7A 4JFSA 5HQLA 3SADA 4JICA 4EVZA 1XR2A 1Q6RA 4DPQA 3GLCA 1HP5A 1BEUA 3WLNA 3NL6A 3MWAA 3H55A 1XLIA 3TDFA 1GOKA 4FLQA 1PS9A 5CJMA 1C93A 2NQ9A 1UMYA 4O17A 1EIXA 3T8LA 2RDUA 1I45A 3F2CA 2DVTA 1YMYA 3CQ0A 1CXKA 2DY3A 5CPNA 2P5NA 2R14A 3E0WA 5AFDA 3NO3A 3OEXA 1C8YA 3EWDA 3CH0A 1V6YA 2Y6ZA 3GZAA 1CLVA 4PB5A 5LIUX 2WW5A 1DE6A 4HT3A 4WDXA 2ISSA 3W7GA 2CU0A 4IICA 4JTLA 1IZCA 3PPCA 3OHMB 4ATDA 5LA2A 3O2LA 3IUDA 3GTNA 3RLHA 1P6BA 1XIDA 4MNJA 3GAYA 3GKAA 3QXBA 5TBOA 1W1VA 2PPGA 3S2MA 4AC7C 2ZCGA 3NQ2A 2C3ZA 4PRTA 1MW1A 1NP2A 2QGYA 1QPNA 3W1AA 2D0FA 4MWAD 2GDVA 2PUZA 2OYLA 3NQDA 2I16A 4NZFA 4DM2A 5LIWX 1K7XA 4QITA 3VDGA 2DH3A 1XIGA 1Q65A 2QCNA 4JIEA 1PIFA 1EP1A 1KFBA 3RX3A 4C6KA 2UZ9A 4XX6A 5FJPA 4GHRA 3WLLA 1JQXA 2FZNA 1E6XM 2Q3OA 4EE9A 1RBOB 4I7UA 4BWLC 3W6MA 3E2QA 3NOYA 2QR6A 2D3NA 4W5UA 1QW7A 2F9RA 5LNWA 2DVXA 2NV2A 3M16A 1DBTA 1FH8A 1N8WA 4MAZA 1ECQA 2P1FA 4B5NA 4OUEA 1SZGA 2AQVA 3R1ZA 3WLKX 5I78A 2B7NA 4NHVA 4MSSA 3BL3A 2AGTA 3ID7A 4WOQA 2ZX7A 2QUUA 1OINA 3N2MA 4HNCA 2VI0A 1VFLA 4MFDA 2C1HA 2A7RA 4GVHA 5A2BA 1NTHA 2X1RA 2WQPA 2HPMA 2VR5A 2CPUA 3W37A 3ALFA 2F61A 2TYSA 4P7LA 1XG3A 5J04A 1R46A 5KSWA 1BVWA 3AMKA 2VX6A 3I3DA 2VGGA 1GVSA 1GZ1A 2OT1A 2W3ZA 3RU6A 1K02A 1MZRA 3LNMA 4JTQA 1HW6A 4HU3A 2POZA 1DWIM 5ENLA 5AKQA 1Z41A 1AD1A 3EOSA 3ABOA 1OD8A 2IKIA 4H83A 1LQ2A 2IQTA 1G4SA 3S6DA 1R30A 4JL1A 1YHTA 1E56A 5REQB 1G67A 2DV0A 2GOUA 4PULA 1BRLA 3CHFA 1AZ1A 1QOQA 1L6GA 1A0DA 2REQB 3ISIX 1OIMA 4GINA 3SGZA 5A6BA 4QHRA 4O8AA 1HJWA 2WSPA 2D0HA 1MQRA 3BPWA 2PE4A 4UTTA 2XM2A 3HG2A 3R13A 1E0VA 1EPXA 3R8RA 3L21A 1C7TA 1NWUA 1Z3NA 1JFXA 4JDBA 2WVVB 3TFXA 5RUBA 1WDDA 3ECQA 5LYRA 2AAAA 3ITXA 3NZGA 3MUZ1 2XIQA 2WOQA 1SYTA 3IARA 5C71A 2GL5A 1HP4A 1MO0A 3NAVA 1UZDA 1KM1A 3SCWA 1LF1A 2GQ9A 4OBTA 3STFA 2V0TA 4AZIA 4MY9A 2FMNA 3L12A 3WF0A 1AA1B 1NOFA 3PSVA 4JX5A 2OVLA 4QG8A 1TTIA 3PBWA 2J9YA 3ARRA 2ZUUA 3PUDA 4UOQA 1VBRA 4K7VA 3A3HA 2Z1VA 1EBGA 2Z25A 1PX4A 1UP3A 5EA9A 8XIMA 4MHBA 3F4CA 2D2OA 1MW3A 1LG1A 4PBEA 3ITLA 3VNMA 5C55A 2O7QA 4QR6A 4XAYA 2IKJA 4N02A 1OG0A 1E51A 5EMLA 3ZLFA 1ONEA 4NJJA 3CASA 3THDA 1TV3A 4GABA 4PEKA 3B0VC 3GFZA 1P6WA 3N4AA 3D3FA 5KZDA 4FNRA 3ENLA 3R8HA 4AF0A 5FL0A 1KCKA 2J7EA 2O9PA 3L2LA 2CBJA 3QQ0A 3RN6A 1R3SA 1CXIA 1ENUA 1B30A 4ZR8A 4C6NA 1F8MA 4H7VA 2I5GA 3WNOA 1V7YA 3P62A 2G3IA 1PZ3A 2VEFA 4JCMA 1OCBA 4LH8A 1F3TA 5HPCA 3GNOA 4WGHA 4IIDA 3T78A 4B90A 3E2RA 1NWTA 1ZTVA 4EWND 5CJNA 1TX2A 2W0UA 4RE2A 1TVLA 2P50A 3IIPA 3TOYA 1QASA 1M65A 4M19A 4LEQA 2V63A 4UZUA 5I0DA 2I1OA 3FDGA 3TSBA 1E1EA 3WH6A 5AHIA 4LRSA 3O63A 3SY1A 4NUWA 4XZMX 2GFTA 1IQ8A 2FGLA 4KESA 5EYWA 5U7SA 3W75A 3QPYA 1KXQA 1DORA 3M5VA 4HQVA 1BVZA 3FYPA 2QCEA 1DE5A 4JNZA 3SR7A 5F2MA 4FZIA 4GISA 8XIAA 3GHTA 2QGHA 4IGHA 3TYDA 4Y2WA 2YA2A 3GXNA 1VYSX 2W6RA 1FDJA 4HHPA 3QV8A 5PTDA 1BAGA 1JF6A 5CAHA 4MKSA 3GAKA 3Q67A 4S3EA 3DDMA 1X1OA 3TJLA 1OYAA 3S46A 2OPJA 3TV8A 3AIUA 4YS1A 2HXUA 4FALA 1OX6A 2G41A 5K2ZA 4ZODA 3B8TA 1PWMA 2WHLA 4HCDA 4HYRA 3TFCA 2BG5A 1PEZA 1W9PA 5ECVA 1C90A 1PB0A 3LUTA 4IIHA 1RPKA 3RRAA 4JAWA 2Q09A 1ZBVA 4KPLA 4UMAA 2DZTA 1YXDA 3LM3A 1HQTA 3PZOA 5D9PA 2VKZG 1IV8A 1JYNA 5FL1A 4WXYA 1PCWA 2Q3RA 4C91A 1BWKA 4ZXLA 2VC6A 3GHUA 2XN2A 4BF7A 1EP2A 3VM7A 1BG9A 3W1NA 2PLMA 3BDKA 1GQKA 5AB3A 5EBAA 1BHGA 1KFLA 3RG6A 4NJKA 3UZYA 2FLIA 3LXCA 1NF0A 4DYEA 1HL2A 3GUGA 1J01A 1JDFA 5GNZA 4AVOA 3VNYA 2RJGA 2OTDA 4PMUA 1DWGM 4I6VA 4Y6GA 2TSYA 4JHMA 4KWVA 1W0MA 2X05A 3NGJA 2PDWA 2QJGA 4W9TA 5JIWA 1L8PA 1DJYA 3W2NA 3TROA 4XTIA 3EB3A 5HNNA 2NSOA 3G6LA 3WFAA 1ALDA 1J4EA 1S1RA 1WDPA 1S5VA 3NSXA 1PIIA 1TRDA 5KINA 2R6OA 4HK6A 1FWRA 3LY0A 3SFWA 4QNEA 4LQ1A 4CQDA 5FD0A 4Z1CA 3GTIA 3ELFA 3QTPA 5DCEA 1N8IA 5BOFA 2CXEA 5E6ZA 1G0CA 3VKKA 4C6JA 1DXIA 2R8WA 3TJXA 2V5KA 3TX9A 4AZBA 4Q7IA 2Z1WA 3NEHA 3VGGA 4OWGA 1ADSA 3T8QA 3TXZA 4R5EA 1K7FA 2V5JA 2EPLX 2C91A 3I4EA 4OIFA 3WJWA 1JPMA 3T44A 1Q6LA 2GJPA 4NASA 3M07A 3CMGA 3WLQA 3G2GA 3ITOA 1B57A 2XIMA 3PR2A 4M1RA 1G01A 1KC7A 3E6EA 4ZFMA 1FQ0A 2YL6A 1AL8A 2HZGA 2VR4A 1L8NA 1OHLA 5HWJA 1XKYA 4TVCA 4WIWA 2FTPA 4G7FA 1EC8A 5IDIA 1MFVA 1Q2RA 1XDLA 5E9AA 5CG0A 3SM0A 3V5FA 2R9RA 3QRHA 4A3UA 4J3ZA 4RW3A 3MDWA 2NQLA 3W82A 8TIMA 4JTKA 2YCKX 5HQMA 1YBQB 2XN1A 3RLUA 3G8RA 3S6OA 3WBYA 4UQBA 1S5NA 1JR1A 3LTPA 4DBSA 2PDKA 5M3WA 3SDOA 3IJQA 2ZZ3A 2JGQA 4DF1A 4IFKB 5ABGA 2X7VA 4FEZA 5E5CA 2A6LA 2PU0A 2BV9A 1UJPA 3PPFA 1FVPA 3BG5A 4GE8A 3WJSA 1JAEA 1VFTA 6ALDA 5GJNA 1NAL1 1U5HA 3WH7A 2HVNA 2HBXA 5C7VA 3FA5A 3EOEA 1GEHA 1P1XA 2VFIA 3SI9A 3VO0A 5EMKA 2ACSA 5I3FA 3KWXA 3D3AA 4BI7A 1SQ7A 4ERAA 3HG5A 2J77A 4QBXA 2V69A 3M47A 2J6VA 1C9DA 1CT5A 2F2KA 1I1XA 3M0VA 4IPNB 2YLAA 1OVDA 3GB6A 3UPMA 3TEVA 2CNCA 4OU1A 3ANYA 5G1TA 1ICSA 2NX1A 4JQ4A 4V27A 2Y70A 4C6QA 4DF0A 5BRBA 3SCQA 1AJ0A 4E8CA 3PVFA 3QR3A 3N6QA 1F6YA 1I8JA 1QATA 3QC3A 3WQCA 2SFPA 5FEWA 1V02E 3W7QA 1V02A 2QF7A 1VBHA 3B05A 1L6SA 4Z1YA 5H2ZA 1PPIA 4Q8UA 4QCEA 3APTA 4GXMA 4CGTA 4IZGA 4LAKA 4CNUA 2FZ8A 2Y8KA 1LRQA 4ZCWA 3UF9A 1DQUA 1WNOA 3AIQA 3W6LA 4JFWA 2R24A 3M0ZA 4AWSA 4KWUA 5CBBA 1VRDA 4O16A 3H70A 1XIHA 3O1NA 2XGIA 5HMDA 2J7BA 1ZJIA 3EWWA 3I6RA 1IR1A 3VIGA 2FVKA 1FH9A 2AKMA 4JTHA 1U1HA 1OK4A 5F2IA 3B4UA 5IRPA 4R3UA 4UUIA 3FXYA 2XVNA 4S3DA 3URQA 2BMBA 3GDRA 3G1VA 2CLLA 4WDTA 4JGDA 3V0SA 2V68A 4NI8A 2F38A 1DYSA 2Y8VA 3GNDA 4PTDA 1V3JA 3M0LA 1Z7AA 4OGZA 2QCDA 3E02A 3WDRA 2WZMA 1G7UA 3CTTA 4LUSB 3K2GA 3U57A 3GG1A 3UZXA 4J7RA 2QV5A 3VD3A 1NDWA 5KTLA 1W3TA 3PZNA 4N2YA 1W9UA 4KWWA 3NQ7A 1XLJA 4EPEC 1OCQA 1KWGA 4PUMA 4QP0A 4NG3A 1EZ2A 4PUWA 3OBKA 3MBFA 5HWNA 5ABFB 1WQ5A 3GTFA 4HKPA 3EYPA 2D0GA 2BGQA 3ZJ6A 2JFEX 3F4DA 3B8VA 4KERA 3DBNA 4G6CA 2YPIA 4PUKA 4JTJA 4LBUA 4BKNA 4QSHA 2FB2A 3UXLA 4IGSA 4BQ3A 3LG3A 3EWYA 4H6KA 1MW0A 2YX0A 3AU2A 3SCOA 3Q94A 2HEJA 2WLYA 4DO4A 5ECUA 1B90A 4K2SA 2A3EA 1M7OA 3C0JA 2ZUMA 1PKLA 3QYSA 3F4NA 1WO2A 3CH9A 1D3GA 3KX6A 1EL3A 1DJHA 2DEPA 3PK7A 3ZQ9A 4ZSTA 2VJXA 3QSRA 2PDCA 4CN6A 1QPQA 1XIJA 3RLVA 4AW7A 4JNYA 2X2YA 3GO2A 1UMLA 3H2MA 2FTWA 1SJCA 4BR1A 3RFAA 3G77A 1KBKA 1RALA 1O7AA 3W7MA 4DAFA 4QIUA 1SUXA 5CAKA 3NPVA 5CPSA 3DH7A 3MCNA 5CPOA 2V3DA 1KRCC 1A5LC 3OA5A 4JPGA 3ZJKA 2XH7A 1FY6A 2FQIA 3SCUA 4YYCA 3VABA 4HMCA 4LF2A 3WUFA 5JVLA 4UQEA 4WY0F 3BLIA 4KCUA 1SR0A 1H5VA 2E7FA 3TUUA 2C1IA 5FJIA 2PRLA 4DBWA 1TRIA 2R82A 2V5DA 3IIZA 3CU2A 1J8VA 3AIVA 3URNA 2WZHA 3P84A 5CH9A 3PFMA 3FA3A 1ZP3A 4DHGA 3CHVA 4FR1A 1T40A 2J7FA 2V2HA 4AHQA 1CB2A 4U3CA 2IPWA 3AZSA 3BANA 1UWQA 3GW0A 2PP1A 3AMGA 3GR7A 4DBDA 3A3XA 1ZJHA 3G1SA 1UHVA 4M80A 1H7RA 1DV7A 1BQGA 1RJQA 2ZA3A 2CFFA 1X96A 1XBVA 1UKPA 4O19A 1TWDA 4JS3A 5ABTA 2PWUA 5BCAA 3HOJA 4RV8A 4DO5A 3AHVA 1S3TC 3SW6A 4HA3A 3L66A 3UVAA 4G7EA 4H9MA 1FWEC 3F4WA 3F2BA 2A3LA 2G4FA 3DKJA 2X1IA 5FJOA 2A79A 4LW7A 1U33A 2ZX6A 5DY2A 4X63A 1XLKA 2IKHA 1VBJA 3QN3A 4PBFA 4MZYA 1A49A 3ZIZA 4LB3A 4XBSA 3EMCA 3P6LA 1ITCA 3E2SA 4B15A 2EG8A 2RH9A 4TVUA 3QVQA 1SZFA 1ZCOA 2RHGA 4F8XA 1KB3A 1T5AA 1DWHM 3GU9A 1XS2A 1ONRA 3FJLA 3BZJA 3TA6A 3NXLA 4QX4A 1W54A 4YNGA 2XISA 5KEZA 2VQTA 1QOXA 3CPGA 3T4CA 2HQAA 1TUFA 1W17A 3LZ3A 1TPVA 1PSCA 4DUXA 3DG7A 3S1XA 4J1OA 4W7UA 4AG0A 2OX1A 1Q6EA 3QFEA 1AVAA 2DUXA 4H9ZA 3NEVA 3EDFA 1M53A 4RNIA 1V6VA 3IUHA 1MEHA 3NM1A 3PJWA 3CZJA 3VC6A 2Y63A 5DANA 3GE7A 2AL2B 4JBRA 4JCLA 3L4WA 5K4XA 1UC5A 5FF3A 5TIMA 4K39A 3WQ6A 1JD7A 2PTDA 3UXIA 4UB9A 2I9UA 2QVHA 1HKVA 1S2AA 3OU8A 3DYPA 3JS3A 1AZ2A 3CV1A 3LI1A 1OZMA 2C71A 4I9MA 4KS0A 1CPUA 4GUIA 3DG3A 1XFBA 4IWWA 1UOKA 6TAAA 3O07A 3KBVA 1PO9A 2DSWA 1Q6CA 4BQ2A 4NZ4A 5H8PA 1BQCA 4ZO7A 4YWIA 5HA7A 1EDQA 3IJDA 1HVQA 1L9WA 4F3HA 1A50A 3UWUA 4Y8EA 5A8PA 3QYQA 3A21A 4ACZA 3SUTA 4PBGA 4PRRA 1S2CA 3R89A 2Z7KA 1K03A 3JZUA 1L2QA 3TP4A 3KBSA 3JVAA 1E1CA 2YOCA 1ZAJA 3AYSA 1KCZA 4UTKA 3N9SA 2XVLA 3LK6A 2QCHA 3OGVA 2FFIA 1RVKA 3KCJA 2VZTA 1PL9A 3AQUA 1WDQA 3GG0A 1ITUA 4IPJA 1E4IA 1TPB1 5FEZA 4H01A 1WBJA 3F1QA 2XZ9A 3A24A 2OR2A 3SURA 2PEVA 4YTSA 4FOKA 5BNKA 1H49A 1ZHAA 4I8DA 2DJLA 4B3LA 3NURA 1R3VA 4B4HA 3A9BA 1LTDA 4G9PA 4GC4A 3MUIA 3W7EA 3OLEA 1I1WA 3V4BA 4CVWA 3P81A 3MUY1 1TWSA 4C6BA 5BXSA 2XPKA 2Y8UA 2ODOA 1V3MA 5D9NA 1A47A 2BB0A 4RDWA 5BZAA 1SO5A 2FH8A 4Y9AA 3AHYA 4C65A 3WMBA 1CXHA 3PG9A 2DJXA 1NY1A 3UWWA 3NZPA 4LWWA 4INFA 4DJEC 2Z1BA 1HKJA 3CK5A 3HURA 2J7CA 3ARTA 1E40A 4K6AA 1GCYA 3GIPA 4PCTA 4S3GA 3HFTA 3W9ZA 4ERIA 2AQWA 4X60A 1RA0A 4L9ZA 2JGYA 3GYCA 3PJTA 2VVSA 4GI8A 4UFKA 1Q63A 4HPGA 1MRQA 5AHEA 3QY6A 5I00A 3EXRA 1KW1A 2NWRA 1E4NA 5BXTA 1SJBA 1LLZA 2BSLA 4N9EA 3VE9A 3GDKA 3ZT7A 2VC5A 4M24A 4GUJA 4O13A 3W25A 5TQLA 2PDBA 3NL5A 4EPBC 1F61A 4Q4KA 3C86A 1DIDA 4NZ1A 3EBVA 2W79A 1UR9A 2G3JA 4AIUA 1D2KA 1QHOA 1CDGA 2PTWA 2VEMA 5LHFA 1H4PA 1W2PA 3VZXA 1EH9A 4WD0A 2ZZ7A 3M5ZA 4Q8OA 3ES8A 4QTGA 1YE6A 2Z29A 2YIHA 2V8ZA 1XRTA 4C6DA 1EYEA 1P1MA 2I14A 2V6AA 1Z44A 4PTMA 4LAMA 1XIEA 4GG9A 3I68A 3T09A 2YDAA 4PMXA 4YTQA 1R87A 1CXFA 2OLSA 1H11A 4MPQA 1HL8A 2WHKA 1AQMA 4BQ5A 4BJHA 4OBSA 1SFJA 4O12A 4DJEA 4WGXA 5XIAA 3I7SA 4YL2A 1POJA 3ZXWA 3P0XA 3V1HA 4CD8A 4LYKA 4P7RA 4DJDD 5HNUA 1P0BA 2XIJA 4XVDA 3UCQA 3W2LA 4UTFA 3BAJA 4GO8A 2ISFA 4O57A 2EJAA 4ZB5A 4NQ1A 5DMMA 3UG4A 3BAIA 3N6HA 2C79A 3PN8A 1TJPA 4IFOA 1ITQA 1R2RA 3TSMA 1UCWA 5AC7A 4N7QA 4WKAA 1I2OA 4HZ6A 4XKMA 3SZ8A 3GU1A 1GOXA 4S3CA 5BWFA 3AI0A 3QPEA 1EWDA 1A4LA 1CTNA 2RDXA 5HMEA 1GUVA 2WB5A 2P3ZA 1BG4A 1YNQA 4D1JA 5G4EA 5B7YA 1CGVA 1ZPTA 4WY0A 5F4WA 3E0IA 9XIAA 3RDKA 5CZ0A 4MB1A 3WF2A 4GPNA 4KRTA 3IACA 5DLCA 2PP0A 1KFCA 4H9YA 3L5MA 5A2AA 4US5A 4LC8A 1T8XA 5LZLA 3L0GA 3GSMA 1X6UA 1WZLA 3K13A 1XYAA 2Q71A 1YE4A 5FSEC 3ARVA 1LORA 4K8EA 4UTUA 1EHAA 2DSKA 4WKHA 4I9TA 1AD4A 3UWYA 4IMGA 2NUYA 3VGEA 2VC7A 4PTXA 4B9YA 4R85A 2ZDRA 1JGIA 4O11A 2VFHA 3FY1A 4O28A 3QLDA 5HULA 3VUSA 2V30A 1FX6A 9RUBA 2YA1A 5LIXX 1FKXA 3VUPA 3MJMA 1G4TA 3LHVA 3WDHA 3GC5A 2EXOA 2X42A 4IMCA 2VEKA 4QS5A 4ZBCA 4RE4A 3MI6A 3W81A 1THFD 3HPSA 1XX1A 2OO0A 4MLJA 1TPC1 4CKQA 3GM8A 4JIIX 3CZKA 3PWAA 1F6PA 4F0HA 2MANA 2G37A 4D8AA 1VFOA 3SSJA 3S9IA 2Z00A 2ZUTA 4W5ZA 1PYFA 4ADUA 4QAIA 5HUOA 3GHRA 3VKBA 3U7VA 3CWNA 1IGWA 1S2WA 4O52A 4K68A 1GHSA 2OFJA 5H91A 4XG1A 5G1YA 7REQB 1JJKA 3MC5A 3WQOA 4F2UA 1SSDA 2Z27A 3U3HA 1UROA 3RCYA 1U2YA 4CN4A 2DP3A 3TCSA 4JHOA 4IIGA 3QF0A 3W07A 3CMFA 4MADA 4IPIA 3HM7A 2X40A 1KKOA 4RR4A 3B03A 2FB3A 3L4UA 3LHZA 3KBNA 4B3KA 2WVTA 3F5JA 3S2JA 4P7OA 1SO3A 4FOUA 4B5UA 1RA5A 1WOBA 5A3HA 3IS4A 3B40A 1I6NA 2CLFA 3PULA 3NUKA 3CO4A 4DUWA 3KAOA 1MSSA 2OZ0A 5DXXA 4XZIA 2WQDA 1CGUA 2PWDA 4OOUA 2PDPA 3VGHA 1MMFA 4L6DA 4PZVA 2C13A 1LT7A 3TR9A 4PEEA 1C8VA 4GGBA 3FAXA 2DUZA 3W24A 1XHGA 1LG2A 1BRLB 3MU7A 5D2VA 3N2CA 4K38A 3HF3A 1LWJA 4UFLA 3VIMA 3BWWA 2V38A 1NQ6A 3FKRA 4JTAA 1HJQA 4XD3A 4WF7A 1TCMA 4LS1A 4D2JA 1EC7A 1XWYA 4YHGA 3MBDA 3SGGA 3TONA 1FWGC 3KBWA 3H2NA 2J47A 4HNTA 4LVAA 1ECEA 3P93A 5E93A 1JRCA 1KA9F 2A7PA 1O5RA 3AXKA 3EWBX 4GWEA 1E5NA 6REQB 1IT7A 3QV7A 1HF6A 2JE8A 4GI6A 4EAYA 3KL0A 4MZ1A 4UXDA 1ZBKA 1MEWA 3LMZA 3K30A 3UA3A 2NVCA 3C2YA 5L9FA 2J8GA 3UA4A 1XW8A 1BVNP 2PDXA 2PCEA 5K9DA 5E9XA 3S2LA 3AWOA 1AJZA 1GWJA 1JZ7A 1RPXA 3DFOA 4X2RA 1Q8AA 1NDYA 2HISA 4CNOA 3NZQA 5HANA 1Q4WA 1REQA 4TX9A 3VOIA 3KCOA