1R8LA

The structure of endo-beta-1,4-galactanase from bacillus licheniformis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords endo-beta-1,4-galactanase
total genus 144
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1r8lA00
1BAGA 5CPQA 1PBGA 3N12A 3MANA 3ZT5A 5DO8A 3ZM8A 3AMKA 1E4IA 3WD0A 1JYWA 4NI3A 1JF5A 2D0HA 1H0GA 3F5KA 1W9VA 4LXFA 2WMGA 5A6SA 5E9AA 1WO2A 2XHYA 5ABGA 1G94A 2XUCA 3ZO9A 4HZ6A 1QNSA 3UERA 4HU8A 2G3MA 4FLRA 4AIEA 4D6FA 1XC6A 2O9OA 1V0MA 1E9LA 3N15A 4GO8A 3UR8A 4B16A 1EDTA 5IFPA 1TG7A 1L8NA 4GXPA 5EBAA 4TX6A 4AZIA 3VTRA 1V6VA 4DWSC 3IAPA 2VQTA 3UEQA 1H2JA 1LL4A 3VGEA 4AC1X 4AY1A 1NOFA 3WDIA 4BQ2A 4GI8A 4JL1A 3VD7A 4QAWA 1W3HA 3RM8A 4GINA 3ZJ6A 2V38A 2E40A 2W62A 1OWQA 4QLLA 3ARUA 1Q6GA 3AMGA 2VRKA 1XHGA 1FH7A 1BYCA 4AD4A 5E6ZA 1EXPA 3EMQA 3W53A 3VIFA 5CLTA 2CBUA 1BVNP 1PIGA 2VC9A 1HJUA 3GNRA 4C7FA 4J3WA 5A8PA 1ZBKA 3OG2A 4UQBA 1J0KA 1XSIA 2UY3A 2PWHA 3W82A 3MS8A 1XGZA 4FMVA 1O6IA 3PZTA 3ARPA 1GJUA 4UZUA 2AAAA 1FH8A 1ZBCA 4J3VA 4U2YA 4ZXLA 1V0NA 1V0KA 3WD1A 4UTFA 1MFUA 1NWRA 4RE4A 3UETA 2WHJA 1HJVA 3E1F1 3ZJ7A 1MVYA 2XVNA 4BF7A 2YDQA 1PPIA 3QOKA 4M82A 2DT0A 1JDDA 5BRPA 1JL8A 2PB1A 2ZUWA 5A2AA 4PMXA 5BXRA 1GHSA 1NARA 4NZCA 5GNXA 2YOCA 1C93A 4UFMA 1G5AA 3UG3A 2DGAA 1EA9C 1QW9A 3TTYA 4CD5A 3VGFA 3S6TA 3MV01 3QGVA 3DHPA 3WQ5A 2XFFA 2AMGA 5I2UA 2FHFA 1VEOA 4PMQA 1E5JA 1WCGA 3ARZA 2OWCA 2CHNA 3THCA 4CCEA 5C8BB 1M01A 2PBGA 3CZLA 4M1RA 1W1PA 2XM1A 5FL0A 1E0WA 2EJ1A 1E6ZA 5DF0A 4PSRA 4URIA 1RH9A 1QHPA 2X05A 2A3EA 1M03A 3BCFA 3ZSSA 5LYRA 3SCPA 1CLVA 1B3WA 2BFGA 5ABEA 2J4GA 2W61A 1OSEA 5E70A 2BVTA 3RM4A 3ZR5A 1XCXA 2E8ZA 4D6JA 4OBRA 5M03A 1KCLA 1E3XA 3CHCA 2ZUUA 1Q6EA 5A6AA 1QHOA 3G6MA 4LGXA 3LPGA 4H8VA 4MPKA 5A94A 4E4PA 1H5VA 1N82A 1HJQA 1F4AA 2DT3A 2CNCA 4CN1A 1XH2A 1UD8A 1UZ4A 1HP4A 1Q6DA 1J9YA 4W88A 3WDQA 1CGXA 4F9JA 3MUZ1 3MUAA 1SMDA 4CN4A 3ALFA 1FOBA 3N17A 5ECUA 5JBDA 1RP8A 2Z1KA 3F4VA 3MKKA 4D6DA 1W9BM 2WMHA 8CGTA 1ITCA 4KMQA 3L2LA 3W81A 4Z2HA 3W25A 3D5HA 1I1WA 2C0HA 3T2PA 5FD0A 4CVUA 3SCTA 3CHFA 3A4AA 5HDRA 1US2A 1OCQA 3AS3A 3W0KA 3HU7A 2GFTA 3VIMA 1NM9A 1MQQA 3WNNA 1XRVA 1XD0A 3PZ9A 1MQPA 5DEZA 3AROA 1R86A 2CITA 4AEFA 2G3IA 4QFUA 4XUYA 1HP5A 3FW6A 2DPEA 2QLYA 3WNLA 1BF2A 5AY7A 1MW1A 4F66A 2WKGA 3HMCA 1GONA 5BXSA 3VIGA 1VEPA 4W7UA 1GPFA 5LA2A 4B3LA 1E6SM 2DSKA 4YN5A 1BG4A 4M8UA 1E4NA 1XH1A 1ISVA 2W67A 1EO7A 3RO8A 1W9XA 3GXIA 1CYGA 1EOKA 1JD7A 1JFXA 3POCA 4JKMA 2BNJA 3VX0A 4R5EA 4Z2LA 4PTVA 3WUBA 4QP0A 1EGZA 3U5YA 4PTWA 1WB0A 1JI2A 3PTKA 8A3HA 3VD4A 4MAVA 2V5DA 3AXHA 3WDPP 1PX8A 4IPLA 1FFQA 6TAAA 2UY4A 2A3AA 4UFLA 1R87A 3MUIA 1MYRA 2X2YA 3RIKA 4AEEA 4HA4A 2QF8A 4K68A 1D2KA 1ISWA 2VZVA 2D0FA 1KXVA 2CBJA 3AMCA 3SCQA 3U5UA 1BG9A 4KGJA 1OB0A 4GI9A 3NSXA 1IT0A 4NRRA 5CXPA 1JZ2A 1E70M 5A8NA 5M5DA 1KQYA 4ZXOA 1C8QA 3FHQA 3TTSA 2W5FA 3B9EA 3PBGA 2UY2A 3VUPA 2J47A 3DYMA 4TVDA 1KR1A 1PIFA 2O9PA 3ZJKA 1VENA 4OOZA 5A69A 2RGLA 3VIPA 5E6YA 5D9PA 4B15A 2XPKA 3MMWA 3NUKA 5CGMA 3AIBA 5M17A 1UKOA 4MADA 5I3DA 2GDUA 1EDGA 1LL6A 4WIWA 1UKTA 3MSDA 4R27A 3CBWA 2QPUA 4WF7A 3B9DA 2WK2A 5IHSA 3BAXA 1GQIA 1E3ZA 1JI1A 5I77A 2J79A 1U30A 1JFHA 2E4TA 4WKFA 4TOQA 2GJPA 2VQUA 3L4ZA 4J27A 3THDA 5D4YA 4P8UA 4YHGA 1DHKA 3A4WA 2WW5A 4DM2A 3LMYA 1J0IA 1XH0A 4TXEA 4Z2GA 3BSHA 2G3NA 2WC7A 3BLPX 2PF0A 4D6HA 3WF0A 1KXHA 4AWEA 3FN9A 1E4MM 3QOMA 3VINA 6A3HA 4BQ5A 2CERA 1EO5A 4GQRA 2BY3A 1GOOA 5AYIA 1B9ZA 1V3JA 1QHZA 4BZYA 1W32A 1XSJA 3W37A 5HPOA 3VDCA 2E0PA 1HKIA 4YPJA 1LLOA 4UFKA 4AW7A 4W5UA 1UKSA 2VMFA 1SFSA 4TVUA 3WY1A 1LJYA 4HZ8A 3UG5A 1GOQA 3I3BA 3WH5A 2YBUA 4Z2IA 4P7RA 3TOPA 2WLZA 1B3YA 4JFSA 1E15A 4AMCA 1IZKA 1BFNA 2D1ZA 4CVWA 1F4HA 3AQUA 1JGIA 4W8AA 5BXPA 4XZWA 4AD1A 3ECQA 3APGA 1CXKA 2YA0A 2QV4A 3NIYA 1UWQA 2YL5A 2Z1SA 4M80A 1UWTA 1QPKA 2ZX9A 4MJ2A 2PC8A 2Q8XA 2J7FA 1MFVA 1G0CA 5HOSA 5IHRA 4AIUA 2D2OA 2BY0A 4JHOA 1QI5A 3SUTA 5I0DA 2J8GA 2Y8VA 1QOXA 3WF3A 3GNOA 4BCEA 3WH6A 4U31A 3MU7A 1D3CA 2ZX5A 1MXGA 3TTOA 5DT7A 2JE8A 4IUGA 3AIRA 4FLOA 1KXQA 5LA0A 4U5IA 4WSJA 3B9AA 3VMOA 3FNDA 3OGRA 3M7SA 1KCKA 3ARRA 2VVNA 5BCAA 5E0FA 2D22A 3I3EA 1Q4NX 1V08A 5HXMA 3CZGA 1A47A 3WEOA 4XB3A 3ARYA 5DFAA 4PMRA 1FHLA 1CIUA 3HJEA 4W86A 3ZQ9A 2JEPA 5E09A 2A3BA 4PMZA 2VRQA 4A3HA 2J75A 2WM0A 1BHGA 3AISA 3GNPA 3OBAA 1V0LA 1TA3B 2NT0A 1TUXA 2NSXA 4KWUA 1GORA 3PZMA 5E0CA 1ODZA 3BLKA 4QCEA 1DWJM 4J3SA 4ZFMA 2EPOA 1ISXA 3WFLA 5BYWA 3RDKA 1OD0A 2E3ZA 2UWFA 2VZUA 4Z2JA 2WWCA 1DWIM 1UR2A 3FXYA 2YA1A 1GVIA 2XSBA 2VX5A 5A3HA 4HOWA 4N42A 5IXEA 2V5CA 2DT2A 3EMCA 2VTFA 1WZKA 2E9MA 1FFRA 1WNOA 1DEDA 4PMVA 1E43A 5CJ5A 2DSVA 5BWFA 4Q22A 2V3FA 1CGUA 4J7RA 1NP0A 1KFWA 2OSYA 4ZEPA 3IANA 1EOMA 1V6XA 4B9YA 1LWHA 2G4FA 1V3KA 3SCRA 2JF6A 1V02E 2CBIA 1H1NA 1HNYA 4DM1A 3M6DA 1BYAA 4UQDA 2YL8A 1JDAA 2GJRA 4JL2A 3CMGA 4HU0A 4W85A 2QMJA 5A2BA 1QBAA 2OWWA 5D8WA 1VEMA 1R7OA 1EQPA 1UH3A 4PCSA 4UQAA 4P7OA 4PCTA 3T2QA 3VNYA 1UKQA 4CCCA 2ZICA 1J01A 2WHKA 2ZE0A 3AIEA 4LYRA 4YHEA 3S2CA 2E9LA 5I79A 4JCLA 1C8YA 4PMDA 1CGVA 2Y4SA 3CUIA 3W27A 2ZOXA 3L2MA 2G3JA 1PZ3A 1UUQA 5FIPA 4Q7NA 2CEQA 4JKLA 2X8RA 1Z32X 2GJXB 4QDMA 3AFBA 4U33A 4CU7A 2VI0A 3VVGA 1TR1A 1YQ2A 2PWGA 3SUUA 1KR0A 1ISYA 1JIBA 3K8MA 3CGTA 3WMCA 1HKJA 3OGVA 4P7LA 3BAJA 1TVPA 3EDDA 1AMYA 2EQDA 3WKZA 3AS2A 3OZOA 1K9EA 1MW3A 2CCRA 1WZMA 1D7FA 4WKAA 3I3DA 2TAAA 4D1JA 2JALA 2CYGA 3A3HA 5CG0A 4X9YA 1NOWA 1GZJA 3KL0A 1VFOA 1OGGA 4TTUA 1V6YA 1PEZA 4HA3A 2YLAA 1UKPA 1B2YA 1WDQA 2VVSA 2D20A 3ZT6A 3VU2A 3GDBA 3U7BA 5D9OA 2DIJA 1JZ6A 4PBGA 2FH8A 5GNYA 5JBFA 2EPMX 2DEPA 3EYPA 1I75A 1OIFA 2WBKA 2ZX7A 4AZCA 1J10A 2XVPA 1ZBVA 4WKHA 3RJYA 1MW0A 3T0AA 3NCOA 1B3VA 2YL9A 4DUVA 4D6GA 1TZ7A 3EDFA 3AS1A 4TTGA 4D1IA 1UG6A 1ESWA 3T08A 3DYOA 3MUY1 3OA5A 4PTXA 3L4XA 2CKRA 3CUFA 2BXYA 4H8HA 2G8ZA 1BGAA 1CXFA 3DYPA 4GZIA 2XWEA 5A6MA 2GSJA 3L4VA 1CXIA 1VRXA 3L4UA 3ZMRA 3DECA 3SUWA 2X0YA 3BXWA 3MMUA 3CPUA 4UQEA 1OM0A 1V3MA 4AD3A 1UH2A 1CWYA 2VCAA 1FP9A 3AZSA 4MNLA 1DP0A 1GQKA 2ZUMA 1HX0A 2ESCA 2GUYA 4J3TA 4PUDA 4BA0A 4W7WA 4P8WA 1V03A 5I78A 2C7FA 3MO4A 3VKKA 1PZ2A 4JFTA 1K6AA 5DT5A 2OSXA 1G9HA 3HN3A 3AHVA 3OIHA 4ACYA 2WANA 4JFWA 1MXDA 3EDEA 1EH9A 1KWGA 1E73M 1NQ6A 5HBFA 3AHZA 3VPLA 1TA3A 4PRWA 3WUFA 1GQLA 1C7TA 1QI4A 1X1NA 4D71A 2BVYA 4JCMA 1GOKA 1UD2A 1M7XA 4WJXA 1B0IA 3CLWA 1UQZA 3RM9A 4N0RA 1TE1A 4ACZB 1J11A 4PEEA 4PMYA 3PZOA 1GVYA 4V2XA 5A6LA 1HVQA 4DUWA 3OLGA 4DWSA 2G41A 2O9RA 4OIFA 1RD6A 3A4XA 3WBAA 5FOOA 4M29A 4CU8A 5GPRA 3K4AA 4J3UA 2MANA 1CXEA 3VIOA 4ATWA 1HT6A 1DWFM 1JDCA 4F9DA 1QI2A 1E0VA 3WNPA 1HXJA 2OYMA 3MMDA 4ML4A 4GKLA 3ARTA 1J0YA 2DSWA 4ZE4A 4W8LA 1Q6CA 1CENA 1H3GA 2PWDA 4OZOA 1ZB5A 3BC9A 1CZ1A 7A3HA 1OD8A 1UWIA 1C91A 2EBNA 4HMCA 1JYVA 2CESA 2NW0A 1W9DM 5A8OA 4GIAA 4PYSA 4D6EA 4S3JA 3ZJ8A 1NWSA 4MNJA 2FHBA 1J18A 2J8FA 5FKYA 1Q6FA 3GH7A 1UYQA 1DTUA 3BMWA 3CIVA 1JAKA 2WMKA 3GXMA 3AHYA 1V6WA 3CUGA 1TVNA 3ARSA 1WE5A 1W9PA 4W87A 3CZJA 3ZT7A 1VFUA 4OKDA 2Y5EA 1E55A 4V27A 2XFYA 3U7VA 1CEOA 4OBSA 1J0HA 3PZQA 3MV11 2CXGA 1LQ0A 3FAXA 2VX7A 1HIZA 3NYDA 2WAGA 4UFIA 2FDMA 4MB4A 2VCCA 4HOXA 3BAYA 3WNOA 4JFVA 4AZ6A 4U3CA 2ZUSA 4AIOA 4TVCA 1B31A 3CZEA 1UOKA 1UR0A 4J28A 5A95A 2WZEA 2D0GA 2IXUA 1U33A 2J7GA 3W6LA 4GI6A 2XG9A 3MSGA 5JUVA 1ECEA 2A3CA 2EEXA 3SUSA 1UD5A 2O92A 2EPNA 4W93A 5I5RA 1HJSA 5JBEA 4M56A 1AQ0A 4F79A 4XZBA 3SCVA 4FK9A 4W7VA 5A6BA 3ARVA 2RGMA 5AC5A 1ZU8A 1ZS2A 2XSAA 2YIHA 3DC0A 4E8CA 4Z2KA 4QLJA 2WLYA 1QNOA 5A6BD 4H7VA 4CKQA 3M07A 3OB8A 2YLLA 3VD3A 1E4LA 5A6KA 1NOUA 5FL1A 2WCGA 3TONA 2VRJA 1KGUA 2ZX6A 4XX6A 3KEHA 2IUZA 4LPCA 3VOCA 1SR0A 1XSKA 1BYDA 5CQ1A 3WDRA 4TX8A 2XWDA 5CLWA 4OOUA 2BHUA 2VURA 4FF5A 1CPUA 1DWAM 4ATLA 3FAWA 4X0VA 3BAKA 1VBRA 3WQVA 5A8QA 2D23A 2J7DA 4GPNA 1UQYA 1ZJBA 1HF6A 1UWSA 5ABFA 4NRSA 3T0BA 1BGGA 4P7NA 4RE3A 4UOJA 1UWRA 1GUVA 3ZR6A 4RL3A 4HZ7A 1HL8A 4A4AA 1W9UA 1BLIA 4MNMA 3AYSA 1OIMA 2HVMA 4W5ZA 1OINA 3N9KA 2VZTA 3WIJA 1UZ1A 4UFJA 2J77A 6CGTA 3O2LA 1V3LA 3OGSA 1IZJA 5C71A 1GOIA 2VCBA 3BH4A 1CDGA 3POHA 2XFRA 1GOWA 3KL3A 1AVAA 2C8NA 2WYSA 3UR7A 3VD5A 3QHNA 1CBGA 1MWOA 2B31A 2WKLA 3D3AA 2JFEX 2OSWA 1JD9A 1ZBWA 1JZ3A 3CTTA 3WENA 1XYFA 2VZSA 5GNZA 4IM4A 2VOTA 3N11A 1CLXA 1UR8A 2WCAA 3AHXA 9CGTA 4UR9A 2BHZA 4ZENA 5D9NA 4B9ZA 5I6SA 2JF7A 4LYQA 4AISA 1VFFA 2WBGA 2ZXAA 2GVYA 3J7HA 1C3FA 1UHVA 4CUCA 3AHTA 2E8YA 4FLSA 3W29A 2DT1A 2VO5A 1V3HA 1HN1A 1GOMA 3T2OA 4JKKA 1FHDA 2CBVA 2DH3A 1XYZA 2O9TA 1GJWA 1CECA 3AS0A 3W4RA 4PSPA 3WNMA 1WDRA 4UOQA 1C92A 3CHEA 3N18A 3WD4A 1ZJAA 4DWSD 1E40A 2F8QA 2WXDM 2W66A 1KBBA 2XGIA 1P6WA 2XVKA 4JFUA 1GQJA 1VF8A 1EDQA 3WQ8A 1R85A 2FGLA 2J7BA 3TP4A 4AZGA 3AIVA 1M04A 1LF1A 3JUGA 5KEZA 1J0ZA 1H0IA 2JIEA 1JF6A 1E72M 1HL9A 3SCNA 1GW1A 3WBEA 3AYRA 3NDYA 5D8ZA 2BY1A 2D24A 3ZSTA 3WDJA 3BSGA 3K1DA 1SYTA 2PBOA 1RPKA 5I24A 4H04A 1W3JA 4LQ1A 2A3HA 1X6NA 2D3NA 1CGTA 5BXTA 3WFZA 4EAMA 4UQ9A 3N13A 5A6JA 4C7DA 3GTNA 2WMJA 4MTVA 3SIMA 3WL1A 4D6CA 3BGAA 3W24A 4AYSA 3VMPA 2X0HA 3AXXA 3IAQA 4P7QA 1IV8A 5EFFA 2W92A 3BCDA 5AYBA 1CNVA 1QNQA 4IPNB 1OGSA 1WKYA 1GNXA 2BXZA 1E0XA 2WVUA 3ARXA 3BAWA 2AOSA 1JNDA 1XV8A 3NJ3A 4V28A 4HMEA 2WVTA 1FH9A 4NSBA 3CUJA 1EHNA 1DWGM 5DMYA 3VMNA 1V3IA 4BQ4A 1WDSA 5ABHA 5EB8A 1A3HA 1JAEA 3T0DA 4CGTA 3UCQA 2EPLX 2W4XA 1UWUA 1S46A 1W1YA 1FP8A 1VFMA 1XD1A 2ZUVA 3KWXA 3AJ7A 2GDVA 7TAAA 4E2OA 2DSZA 2OYLA 1B90A 1WAWA 2WVSA 1UH4A 4PMUA 1I1XA 2WB5A 1CTNA 3LPFA 3SUVA 3CO4A 1KGWA 1VBUA 3W26A 3GYCA 3B8SA 1RP9A 1JYXA 2J74A 2OLHA 4HTYA 1ISZA 3GM8A 4EANA 1KXTA 4DUXA 4MNKA 2CIPA 2YDSA 3SCSA 1AQMA 2CETA 1UR1A 2WC3A 4EKJA 3ARQA 5CZKA 2WCSA 3VIIA 3VO0A 1CGWA 4JHZA 1JZ4A 1E6QM 4MB3A 1UD3A 4UQCA 2ZIDA 4AD0A 5M3WA 3VDHA 3SCWA 2VNCA 1XCWA 4GO9A 2J78A 1PX3A 5IDIA 1E6NA 2PI6A 3WQ4A 2VZOA 1UD6A 2W91A 5KZ6A 2JEQA 2VUYA 2XIIA 3CH9A 5HPCA 1YHTA 4P8VA 4UCFA 3GBEA 4HA1A 3SCOA 1R7AA 5F7UA 1BPLB 1WZAA 2WPGA 3OLDA 4MDPA 3LPPA 1Y7VA 1HKKA 1V02A 3O6AA 4NF7A 2XGBA 3KE0A 3WF2A 1LG1A 1VB9A 4JAWA 4AD5A 2WSKA 4AZCB 2CKSA 1K9TA 1PJ9A 3PHAA 4CD8A 4L4PA 1WZLA 2WC4A 5IFTA 2X09A 4AXNA 4AZBA 2IXVA 3VIKA 1KWKA 1UA7A 3WQ6A 1ITXA 3QHMA 4H41A 1UD4A 4UFHA 3NDZA 2VL4A 2XVGA 1L0PA 3O9NA 1BYBA 3ZIZA 1HJWA 1B30A 2J7HA 3GZAA 3WL0A 4HOZA 3K4DA 2F61A 3GH4A 3PTQA 1H49A 2D3LA 3GXFA 3PTMA 1VIWA 7CGTA 1KGXA 4GZEA 1LWJA 1DWHM 3VX1A 3ZOAA 3AOFA 1K9DA 3VGDA 3VM7A 1B3ZA 1G1YA 3VIHA 1WPCA 4M24A 4GQQA 3WF1A 3VM5A 5HNNA 2OYKA 4AZ5A 3ALGA 1E1EA 2VR4A 1TFVA 3WH8A 1BQCA 2DDXA 1G01A 4TUFA 3L4WA 1K9FA 2BS9A 2WVVB 3NSMA 4PTMA 1H4PA 3IK2A 1VJZA 3EMZA 3F5JA 4MDOA 3VD9A 1W1VA 4XV0A 2ZXQA 4MB1A 3WDHA 3W38A 3U57A 5EFDA 1QI0A 3IJ7A 1JYNA 4QCFA 1E6PA 3WEZA 1MW2A 2V3DA 5JIWA 4HPHA 1LG2A 1E5NA 3DHUA 4P8XA 4QLKA 1EIBA 3T09A 3N04A 4D72A 1QNPA 3RCNA 1B1YA 4E8DA 3II1A 3WMSA 1W2PA 3CHDA 1FA2A 3CUHA 4OUEA 3WN6A 1ZL1A 3VGHA 4WK9A 5LA1A 2ZUTA 4S3KA 1J12A 4LX4A 4X0NA 3WUEA 2DH2A 3KZSA 4CD6A 2WMIB 4H2CA 3UG4A 2GK1A 3PZGA 3PZVA 2OWXA 5BROA 3WELA 3K46A 4W8BA 4DWSB 3PZNA 4Y7EA 2WSPA 1ODUA 3OLEA 3TTQA 5D9MA 2WZIA 1WDPA 3IJ8A 1E1FA 2CPUA 4F8XA 1QI3A 3N1AA 1LL7A 5EMYA 3VIJA 2JIWA 3AI0A 3VGBA 1QBBA 3WUGA 3EDJA 3VDAA 3TA9A 4WLCA 1B3XA 1JZ5A 4W84A 2WHMA 3QHOA 3WNKA 3WD3A 2FH6A 2FGZA 1X6LA 4KH2A 5JIPA 1KQZA 3FHAA 3WQWA 2YL6A 1H11A 2BHYA 1NP2A 1C7SA 4C7GA 3GBDA 4MJ4A 3VDBA 3IJ9A 5C70A 2Y24A 1VAHA 2WNWA 1KB3A 4U3AA 2BV9A 1V6UA 2ZXDA 3VILA 2FHCA 3A47A 4L4OA 4KGLA 1CXHA 4A3YA 1KBKA 4RE2A 3A6OA 2EPKX 3AMLA 5CPTA 1BTCA 3SURA 4PMOA 2VX6A 3EBVA 5I23A 2Y8KA 1E6RA 1JG9A 3AZRA 3VNZA 5CGTA 4ZE5A 4CD4A 3K8KA 2CHOA 3AICA 2WWDA 2YJQA 3RJXA 3WD2A 4U5KA 1W3KA 4JZ5A 3AXIA 4HP5A 3W28A 1W3LA 4UZSA 2PWEA 4FLQA 1CXLA 3OZPA 1H41A 4EE9A 1MQRA 4ATDA 1QVBA 3RILA 4PMNA 4AZ7A 4MB5A 2XYLA 2ZXBA 1AQHA 3SEPA 2BVDA 1EQCA 2V3EA 2UY5A 2YDRA 1PX4A 3FY1A 4AZHA 4BS0A 1OT1A 2ZWYA 1GHRA 4MAZA 2J62A 2V3GA 1TMQA 2EO7A 1CGYA 4GZJA 2QHAA 1BSIA 1NWTA 2VR5A 1W91A 1OT2A 2VJXA 3GH5A 4ACZA 5CPSA 1HVXA 4CU6A 4KRTA 5CSUA 1TCMA 3PN8A 2QMKA 3WSUA 2XVLA 5GQBA 4W89A 2WZHA 3AIQA 4U2ZA 1JZ7A 1EHAA 5CSYA 3RPMA 1PAMA 3ARWA 1C8XA 3WH9A 4CCDA 1VJSA 1J0JA 1HKMA 2W63A 4CD7A 1W1TA 1UR9A 2DQXA 3NSNA 3W6MA 3WMBA 2VX4A 1UA3A 4H8UA 3AZTA 3SCUA 3PZIA 2XM2A 4J3XA 1WP6A 1SMAA 2YA2A 4PN2A 1US3A 1E56A 3LPOA 4LYPA 2XJ7A 1W2VA 3PZUA 2F2HA 3M46A 4PUEA 3WH7A 4IISA 3WF4A 4AD2A 3VGGA 4HPGA 3L4TA 2ZX8A 1JXKA 1QNRA 2Y2WA 3EDKA 2VT0A 3AIUA 1E71M 1JZ8A 3AMDA 2DSUA 5ABFB 2YBTA 2ZUNA 3K8LA 2PWFA 1O7AA 4M81A 3AIWA 4CN6A 2QPSA 4UOZA 3G6LA 5A1AA 3CZ8A 2WVVA 1QW8A 1JNEA 4D6IA 1BVZA 2YKKA 1OBAA 2J7EA 5AC4A 1E6XM 3RMEA 2DIEA 1U2YA 1JXJA 2EXOA 2X1IA 4WSKA 5TD4A 5BRQA 3F5LA 1UR4A 2NT1A 2GJXA 1R8LA 2WHLA 1OGBA 1C90A 3GXDA 4HMDA 4KRUA 2BY2A 3BAIA 4BQ3A 1M53A 4EK7A 3WEMA 5A2CA 4B3KA 2ZWZA 2XTKA 5A8MA 4UNIA 3CZKA 1GCYA 2J25A 2E9BA 3QR3A 4JIEA 2J7CA 3L4YA 4OJYA 1H09A 1NWUA 3KL5A 3OLIA 1HJXA 3BMVA 2WMFA 2XIBA 2WMIA 3CMJA 5FCZA 1NH6A 2GK1B 3UESA 2HISA
chains in the Genus database with same CATH superfamily
5REQA 4J1OA 5CPQA 3DH7A 3ZT5A 4LW7A 1EC7A 2KZHA 1TV8A 1QK0A 4HPJA 4G5DA 2Z26A 4GMEA 3N34A 4RKAA 3PJUA 1OK4A 4LXFA 3LU2A 2WMGA 3VI2A 5A6SA 5E9AA 1G94A 4Q7BA 2XUCA 7ENLA 4EIVA 3ZO9A 1QNSA 1AFSA 4XK2A 3B8WA 2PEVA 4B5XA 4GIRA 3N15A 4B16A 2I5QA 4Q4KA 3A4JA 4GXPA 4Q6JA 1XBXA 3DG7A 3L67A 5EBAA 3VTRA 4HA0A 2V82A 1AD4A 5LXXA 4DWSC 1XGEA 3IAPA 3VNLA 3UEQA 4NXSA 1SGJA 3GW0A 3WDIA 4GI8A 5KINA 4QAWA 3W1PA 1AL7A 3ZJ6A 4L7ZA 4QLLA 1RQHA 2VRKA 3R4IA 1Q2SA 1SO6A 1FH7A 3DAQA 1NQKA 2ISFA 3KBMA 3S9ZA 3D6NA 5CLTA 4JX4A 3QF0A 3IK4A 4ZQRA 4ERIA 1ZBKA 3OG2A 4UQBA 2UY3A 3FS2A 5FEXA 5JQ9A 3W82A 4H83A 4JPGA 1MO0A 3PB2A 4FIQA 3URBA 1EFZA 3GTFA 4ZXLA 2DZSA 1V0KA 3WD1A 4EVZA 1NWRA 3QOKA 4JQ4A 3C4UA 2PB1A 2ZUWA 4PMXA 4JNMA 1AQFA 5G2HA 1GHSA 2GL5A 3M16A 1A50A 5GNXA 1HKWA 4QG9A 3TVAA 3DG3A 1A5MC 4UFMA 3O63A 4HZMA 3RR1A 2Y6ZA 4TO8A 1A53A 3WLIA 5CPLA 2B4GA 3N19B 1UP0A 5I2UA 1MEWA 5EYWA 2OWCA 4CCEA 5G1TA 3VNJA 2PBGA 4M1RA 2W0UA 5CAHA 1ONEA 2EJ1A 3SSZA 3JZEA 3NPWA 1CLVA 5ABEA 2W61A 3TNOA 3SJ3A 4DO6A 5E70A 2ZRWA 3ZR5A 3MY9A 2X1SA 3BLEA 3QV9A 5M03A 1E3XA 3B0UX 2E77A 1QHOA 1K02A 4DN1A 2OKOA 4AMAA 1N8WA 3LZ3A 3LLFA 4E4PA 2XZ9A 1W1IE 2YFNA 1HJQA 3TYDA 3EPOA 1KCZA 4S38A 4XG1A 1UZ4A 4O18A 1IF2A 2X0SA 1J9YA 4OUIA 4W88A 1CGXA 1XI3A 1U5HA 3MUZ1 4FF7A 3G3DA 3SN1A 3UP8A 4CN4A 3PWGA 5CG7A 3ALFA 3N17A 2ZCGA 5JBDA 1RP8A 1ZENA 3F4VA 1XLLA 4GI4A 4HMNA 2WMHA 1BRLA 1W3IA 1XLAA 3D5HA 4MUPA 3SCTA 3BARA 1PWLA 3SBFA 4A8IA 3P0XA 1QPRA 3VIMA 5FSDC 1XPYA 4O54A 3UGVA 3TN3A 1M7OA 5DEZA 2RUSA 1R86A 1EGMA 4AEFA 2G3IA 1D3GA 2BXVA 2BASA 2HROA 1HP5A 3DBNA 3UPWA 5G4WA 2QLYA 8RUCA 1TTPA 4HHLA 4NL1A 2I16A 5BMXA 5M2FX 4W7UA 1GPFA 4B3LA 1E6SM 2DSKA 4M8UA 1VLWA 1XH1A 2W67A 3KOXA 1Q6LA 2NXGA 1EO7A 3CWNA 3OYZA 4US5D 3TZFA 5HULA 1JD7A 2TSYA 3POCA 4JKMA 2BNJA 1ZQ5A 2ZVRA 3VX0A 2PLJA 1P0BA 4PUJA 4GFIA 1A5AA 4AWUA 1W3TA 2NXHA 3U5YA 1R38A 1VYSX 4PTWA 2X1UA 1JCXA 3HBLA 1EJVC 2MUCA 4K1WA 5LNSA 1XG3A 4GZ7A 4IPLA 5D04C 2CLMA 1FFQA 4JIPA 2UY4A 4A3RA 4Q8WA 1EJ7L 4UFLA 3H54A 1NIUA 1EUNA 1MYRA 4IMGA 3APYA 1N8IA 4WCJA 1D2KA 1ISWA 2D0FA 1E51A 2CBJA 4JEJA 5K4XA 3W74A 4DXXA 2AKMA 3O6YX 4KGJA 1BWKA 1OB0A 4JTTA 5AC8A 1JZ2A 1E70M 4FAMA 1P6BA 4ZXOA 1C9WA 1C8QA 3C61A 3FHQA 5XIAA 2W5FA 3SY8A 3UWUA 4PBFA 1VPQA 2UY2A 4LVFA 2DUAA 2J47A 1WXZA 2QUVA 4F40A 1VENA 3MVTA 3N2OA 4OOZA 5A69A 1YE6A 2ZZ5A 1F2JA 4JN8A 1ZAJA 3P6LA 5E6YA 1ZCOA 5T9BG 2A6LA 1VH7A 3QRHA 5FEPA 2XPKA 1K7EA 1AK5A 1V8EA 3VKDA 4MADA 2GDUA 4I5UA 4ZFCA 3MSDA 3CBWA 3IV8A 3ZLGA 1G4EA 3MJMA 4O12A 1GQIA 4HT3A 1OVDA 1PS9A 1U30A 3LGDA 1YPXA 3RU8X 4MUZA 3V18A 1CB7B 1I2RA 4NYYA 4P8UA 5C2GA 1P0KA 1FCVA 4H2HA 4ORMA 3LNMA 1WKDA 4DM2A 1TPWA 3M5YA 3LMYA 3BLPX 3TMQA 3PK7A 4AX6A 2GGGA 4AWEA 3FN9A 1E4MM 3ERPA 1OFAA 4PA8A 2R24A 1EO5A 1GK8A 1GOOA 1W1B1 4FNSA 1B9ZA 3R10A 5KZEA 4BZYA 4A6GA 1FWJC 4AFYA 1HKIA 4MWAB 1NY1A 5HUPA 3MSYA 2QR6A 4AW7A 2VMFA 1SFSA 3R8HA 2YZRA 4IFKA 2HXUA 3GS6A 5G5IA 3GXPA 4FOUA 3B8UA 4F2TA 4L5ZA 2TYSA 4O0ZA 1ZRQA 1F4HA 3QR1A 2GGJA 3W75A 5IBXC 3NIYA 2YL5A 4M80A 1UWTA 3S46A 5DMNA 2ZX9A 3KTCA 5H8PA 1YPFA 5LIXX 1DQUA 1XRFA 2TODA 1G0CA 5HOSA 3H2EA 3FOKA 3ITVA 4AIUA 4Z0SA 4ZO8A 2BY0A 2IQTA 4XAZA 3PUOA 3NPVA 2ONEA 4HQVA 5I0DA 4PC8A 4WJ8A 3WF3A 1DE5A 4XAPA 3KVJA 3KTXA 4BCEA 3FA4A 3V4BA 3AXKA 3MU7A 4NJHA 2ABAA 2BB0A 1GTEA 3V5CA 4IUGA 1Q63A 4E6MA 4NHVA 1V79A 3B9AA 3VMOA 2OZ8A 4A3QA 3M7SA 1KCKA 3ARRA 2VELA 5E0FA 2D22A 4GVGA 1V08A 1FRBA 4XB3A 1F61A 2HNEA 4PMRA 3WJZA 4B4FA 5JXQA 4PMZA 3M0IA 3RLVA 4A3HA 1VCVA 2J75A 3GFXA 4GRSA 2PPGA 3OBAA 3SRHA 2FB2A 1V0LA 1LZOA 2X40A 3PULA 1RA5A 5D2WA 3G1DA 4DJEC 1TUXA 4KT2A 1Q7QA 1Q8JA 3W7HA 4HNOA 3PZMA 1ODZA 5E0KA 2ZDSA 4UNLA 1DQXA 5REQB 3TAKA 3H2CA 3UCDA 5U4NA 5FEWA 5BYWA 4LB3A 1EJTC 1UIPA 4WOQA 3WQGA 2VX5A 2WSYA 5A3HA 4N42A 1U1HA 2ZZ7A 3IIVA 3QLDA 5IDZA 1E43A 4MKNA 1SZNA 5BWFA 1TPH1 2V3FA 3D0CA 4XZMX 3EPNA 1TPC1 3LUTA 3P2VA 4DY1A 2OSYA 4ZEPA 3A12A 4IZGA 2VWTA 3H2AA 1LWHA 4B9YA 1OZQA 3SI9A 5FF2A 1LP6A 2NXIA 1D8CA 3RR4A 3HOJA 1XLFA 1JDAA 2YL8A 2FJUB 3N2MA 3G2GA 4PTNA 3B04A 3I4KA 5D8WA 1J6PA 1XCFA 3BW4A 1TZ9A 2JKPA 1UKQA 1Y65A 4RW3A 1TPFA 3GRIA 3PJXA 2PDFA 2ZE0A 3AIEA 5CEWA 3W7EA 4PMDA 3STGA 4TR9A 4Q6XA 1FCQA 3IJQA 3CUIA 4YTSA 1XPGA 1B4EA 4XVDA 5L6UA 1I2OA 2X8RA 3C0SA 3K8MA 3CGTA 3TV8A 2HS6A 2EQDA 3NEHA 2PP1A 4DBSA 3BZGA 3BGGA 1MW3A 1UC4A 2CCRA 2G50A 2CZ5A 3MBDA 1D7FA 2VDGA 3LENA 3KLLA 4PUNA 1JDFA 4D1JA 2CYGA 3A3HA 4IG2A 3F4WA 3SN4A 1NOWA 1GZJA 1L2QA 1PEZA 1UKPA 3ABRA 1O4UA 2VVSA 3ZT6A 4XD5A 4Q4RA 5D9OA 1BKHA 4HKPA 5GNYA 4HBKA 3E02A 1I75A 4UTWA 1U22A 1LBFA 3A3WA 1IEXA 4WKHA 3RJYA 3W7RA 2DZAA 3NCOA 4JEQA 5DQPA 2PC4A 5AVNA 3W1XA 3LHZA 4R9OA 1O5QA 4D1IA 1UG6A 3UZXA 3MBFA 3DYOA 4PTXA 4H9ZA 3TN4A 3PY2A 3UD6A 5DMMA 1F5ZA 3GYEA 3BW2A 4C6JA 3LXBA 4XIMA 4WR3A 3DYPA 2XWEA 5KITA 3WBWA 1D9EA 2E68A 4WOZA 2PDNA 2EJAA 2WO5A 1CXIA 1VHCA 2YFOA 1P0EA 3SUWA 3T7VA 3DEQA 4IGMA 2EKGA 5HAOA 1OM0A 1PE1A 1VJIA 4AD3A 1R5YA 3E2SA 3UNTA 1FP9A 4MNLA 1BWVA 2XN0A 1TV2A 2ZUMA 3QV7A 2ESCA 3MMTA 1R3VA 5I78A 4WY0F 3MO4A 4JFTA 1K6AA 3G18A 4B5SA 1PXGA 1R3RA 2JGQA 1J8VA 4D8AA 2WANA 3USBA 3DFHA 3AHZA 1TA3A 4US6A 3W85A 4S3BA 3WUFA 4JTKA 4D71A 2BVYA 2PZNA 4V1YA 3FGCA 1GOKA 1AZ1A 2WSRA 3DHDA 3SGGA 3GUWA 1B0IA 5C2XA 3CLWA 4O1AA 3FCPA 1UQZA 5AHNA 1TIMA 1TE1A 4ACZB 2FIQA 5A6LA 2DZVA 4A29A 5ENLA 2HVNA 2ZYFA 1RY8A 1RD6A 1WXJA 3A4XA 4E2BA 4GYFA 5I03A 1CXEA 1U5VA 3LK6A 1HXJA 2OYMA 4GKLA 1QW7A 4Y6GA 4W8LA 3LEPA 1Q6CA 1K6WA 3UZ5A 1S39A 1CENA 4TV6A 4PTDA 3BC9A 1UWIA 1O1HA 1JGMA 1Q85A 3E38A 2CESA 2R8WA 1W9DM 2YGYA 1H7XA 4QE1A 1GWJA 3G1HA 3MCNA 2QCCA 4O8RA 1LRQA 1UYQA 5GVJA 5EMKA 3WLTA 3M0KA 1IR1A 2CLEA 3I6RA 1ZNNA 4LVDA 3SRDA 5D37A 3UXLA 3SFKA 1WE5A 3C2FA 4GYKA 4YYFA 4W87A 3C6CA 1VFUA 4OKDA 1FWGC 1Z44A 1E55A 4N6FA 1J0HA 3PZQA 3MV11 1EX1A 2CXGA 3UYCA 3CYVA 3FAXA 1HIZA 2WAGA 4UFIA 4LBRA 2OU4A 3BAYA 4AIOA 2OKTA 1UR0A 4UR8A 4JOMA 1KLZA 4ZB2A 2XG9A 3MSGA 1VKFA 1UD5A 4OGZA 2C1IA 3D3FA 4BEUA 1KNWA 1GJPA 5I5RA 4JQ2A 3VC6A 1GT8A 3Q45A 4XZBA 3SCVA 4FK9A 4GUIA 4W7VA 3M9YA 1QNVA 4KFOA 3TUUA 5DX7A 2XSAA 3DC0A 1DORA 2V30A 4Z2KA 5LNUA 1X1OA 2NZLA 4YNGA 4H7VA 3CPRA 3M07A 1DVJA 3W1AA 1I8JA 2PCEA 3VD3A 5FL1A 2JBMA 5I02A 2VRJA 2VC7A 3RYSA 2ZX6A 2IUZA 4HK6A 3ZVHA 3OJGA 3VC5A 5J04A 4LAOA 3RUBL 1SR0A 1FWCC 2OEMA 3M0YA 4LH8A 5CLWA 5FSEC 1X96A 2NQ5A 2BHUA 2VURA 1FDZA 2VYOA 2OQHA 1FWBC 3FAWA 4GNVA 1SW3A 3WQVA 3L68A 2J7DA 4GPNA 1HF6A 2NLYA 1OFDA 2PUZA 5ABFA 2B81A 4LVBA 1YNQA 5HK4A 3BOLA 4UOJA 4LUJA 3N9RA 3OZMA 3ZR6A 1NEYA 3K1GA 4IIFA 1IIHA 1OIMA 2HVMA 4UIOA 4W5ZA 3CL7A 2VZTA 3CEUA 2J77A 2GLKA 4TX9A 2VGGA 2V68A 2OVLA 3EWWA 5I07A 1T5AA 2QPXA 4RNIA 2VD9A 5C71A 2VCBA 3SFWA 3BH4A 3POHA 1A5KC 2G5WA 5DCDA 2RDUA 3APTA 3GG0A 4GABA 3UQNA 4C6LA 3GNXA 2DUZA 8XIAA 3ZWSA 1MWOA 3TW6A 3T44A 1SFLA 4M3PA 1ZBWA 5BOOA 2PDJA 1ZP3A 4G6CA 4KCVA 1XYFA 3QZAA 4OV4A 4WDUA 3FYYA 4AXKA 2VOTA 2FYMA 1CLXA 1XIDA 4RNFA 2VOMA 4ROPA 6XIAA 2IKJA 2BHZA 1JQXA 2NX1A 4ZENA 4B9ZA 3UWEA 4AISA 2GVYA 4XWUA 3EWXA 5CC7A 4O0KA 4CUCA 3NAVA 1V93A 3JZUA 4ZOCA 4FLSA 1RJPA 3VOJA 4Y9PA 1ONRA 2VO5A 1MZHA 4AQLA 4HPNA 3T2OA 3TSDA 2CBVA 3LQGA 5DY3A 2O9TA 1GJWA 4PSPA 3WNMA 3B06A 4QJ5B 4AF0B 1C92A 3CHEA 5D33A 4R34A 5GJNA 3BK0A 1FBAA 1KBBA 3F4NA 3KRUA 4JFUA 5I09A 3ITCA 1GQJA 3LXAA 4PB5A 4R85A 1R85A 3EA1A 3GO2A 3AIVA 2PODA 2V2CA 4XZHA 3DFSA 1D8WA 1H0IA 1TPEA 3R25A 4K8HA 2FVMA 3TYZA 1HL9A 3OVGA 4RNJA 1GW1A 3BJFA 4C5YA 3CNYA 4X61A 3AYRA 3ZSTA 2D24A 2CZFA 2IKHA 2Z1XA 3WDJA 4XD6A 4Q4PA 1SYTA 2H6RA 3BE7A 4H04A 1X1ZA 4LQ1A 2PD9A 3BW3A 1A49A 4IP4A 4A2RA 4EAMA 4ZQOA 1F3WA 1UP3A 3PFMA 3VNMA 1WOAA 3BGJA 4W9TA 3GTNA 3KX6A 3GUGA 3MUXA 5GJPA 2ACSA 4C6EA 3LV6A 4XTDA 4AYSA 4JICA 3AXXA 3CS2A 3IAQA 4P7QA 1IV8A 3BCDA 5AYBA 1CNVA 4RZBA 1YXDA 2BXZA 2GQAA 3B0PA 1EIXA 3GQYA 5CC6A 4YIWA 1DWGM 3P8JA 4S3AA 4UCGA 1M68A 1HTIA 4O57A 4BQ4A 5EB8A 1A5OC 1UB3A 3P3BA 5E9XA 3NEVA 2EPLX 1DJXA 1KTNA 2W4XA 3IEBA 3UXDA 1FWAC 1W1YA 4L1GA 3KWXA 1LUCA 3AJ7A 2GDVA 2IPWA 2WVSA 1IXQA 5DCBA 2WZTA 3EB3A 4O4VA 5CZSA 5LXEA 1DIKA 3QFWA 4DF1A 5AOUA 5AKQA 3B8SA 2G0WA 3GVVA 3TXVA 4X2RA 1KXTA 3N2CA 2Q8ZA 1XP3A 4DUXA 4MNKA 2H3BA 1AQMA 1B4KA 3U4AA 4DJFA 2PRHA 1JZ4A 2G37A 1E6QM 4Y9NA 2ICSA 4MLJA 3NL2A 2VC6A 4QEHA 2J78A 2Z4GA 3WQCA 3W83A 2VZOA 1UD6A 4ZGYA 3TQKA 3KXQA 2VUYA 4AUBA 2YCKX 3CH9A 3SZ8A 4P8VA 4UCFA 3GBEA 3SCOA 4ADTA 3RLUA 4QG6A 2J6VA 2HQAA 3OLDA 5FJJA 4MDPA 4LNYA 5CZJA 3O6AA 3W00A 4ERAA 3KE0A 3WF2A 3SECA 4IL0A 4CNTA 3MCMA 1VB9A 3BV7A 4AD5A 2WSKA 4B4HA 4GC4A 2CKSA 1ADDA 2WC4A 1AL8A 2E1DA 2X09A 4AHOA 3EWUA 2I5IA 2OO0A 1OYAA 1UA7A 4PFMA 2BDQA 2PU0A 4GX9A 1NF7A 1YNPA 3S1UA 1ZFJA 5EPDA 3W87A 2XH4A 3PTMA 4GOAA 4GD0A 1KGXA 4GZEA 3KHDA 3H7UA 1DWHM 1TPB1 2FZNA 3VX1A 3AOFA 3VGDA 3VM7A 1B3ZA 3QJAA 1OG0A 3PFRA 4M24A 1XIIA 4EPBC 2QJNA 2XDFA 2TRSA 4GYJA 2VR4A 3NPXA 3KOZA 3WH8A 3HQ1A 2QQ6A 1K9FA 4GIYA 2O4QA 2BS9A 3PANA 4K7YA 3DX5A 1ALDA 4J2PA 4KCUA 4RXFA 4XV0A 2Y1HA 3W38A 1DIOA 5EFDA 1MXSA 2Q71A 1GKRA 3QV8A 3WEZA 1ZY9A 1A5NC 3M5ZA 2V3DA 2PDWA 5JIWA 5LHEA 1JCNA 3NNTA 1E0TA 4YXGA 3CAVA 4UTIA 3WLKX 3TR2A 3N04A 5FEZA 2WNNA 4LAKA 4EF8A 2VD8A 1QNPA 3MCOA 1B1YA 2AAMA 3HGSA 5C55A 3DENA 3M44A 4OUEA 3O15A 1ZL1A 3JR2A 3VGHA 2ZUTA 3UZWA 4LX4A 1AJ2A 3N4AA 2PDYA 4K39A 1OX6A 1KFJA 4QROA 4YCPA 3KZSA 4CD6A 3GHSA 3URNA 1VBGA 3T6CA 2GK1A 5EMJA 3CUZA 3KCLA 4A8LA 5BROA 3PZVA 4KCWA 1FHUA 3VOHA 1LOSA 3PZNA 5F4SA 1OFEA 2WSPA 1ODUA 1PO9A 2NQJA 4X22A 3TTQA 2FDSA 2EHHA 1S5NA 3GR7A 1D7KA 2D2GA 1AH0A 2BZNA 1K4HA 1LL7A 1R3WA 3AI0A 2C1HA 4G7EA 2D69A 4WLCA 1YDNA 3WD3A 4NAFA 2DIKA 4KH2A 1DV7A 4I7UA 3LA4A 4RX0A 4R3UA 3G1VA 3VFCA 1NP2A 1Q45A 4C7GA 3GBDA 4MJ4A 2ACUA 2VFIA 3IJ9A 3KS6A 3U6WA 4KFPA 2GJLA 5FF7A 2Y5JA 2WNWA 3OYXA 2BV9A 1SJAA 4NJKA 4IH3A 2FHCA 3CASA 4LCQA 1CXHA 3GE7A 3KOWA 4NG3A 4MY9A 4DO4A 4XD3A 3PPCA 3M0JA 4CQ9A 4YLWA 1YBQA 4KIRA 3V3WA 1GVQA 3H55A 4IWWA 5AC6A 4ZE5A 3K8KA 2CHOA 1TJ2A 1TMLA 1XIMA 3WD2A 1E9YB 4DYEA 3AXIA 1HG3A 1TWWA 4B92A 3W28A 4UZSA 4FLQA 4HK7A 2VXNA 3RRAA 1MQRA 2XYLA 2ZXBA 1AQHA 4CNUA 2V3EA 3W2MA 2D2JA 4GCAA 5D03A 3WK3A 5H91A 2YDRA 1PX4A 2QCFA 1OT1A 1JPKA 3RITA 1XICA 1GHRA 1R3YA 3AU6A 4NQ1A 4QNWA 1BSIA 4MWAA 4QR6A 2VR5A 2ZC8A 2VJXA 1QOQA 2V8ZA 3VKCA 1TQXA 3DKJA 2XH2A 5K7JA 2V63A 2PRLA 3WSUA 5J8LA 4W89A 2WZHA 1S1RA 1FWDC 2HCVA 1PAMA 3ARWA 3G1RA 1LQAA 3KAOA 2G3FA 4IGHA 1VJSA 1J0JA 2W63A 1UR9A 3ELFA 5DBUA 3WMBA 1UA3A 1HKVA 4H8UA 3N2XA 4M7SA 4GCXA 5HWNA 3PZIA 4XSMA 2XM2A 2PDBA 4OHQA 1SMAA 2YA2A 4G7EB 1THFD 3H2NA 2FVLA 1US3A 3UWYA 4L56A 4O1DA 2JKAA 5FAJA 3PZUA 4QQUA 2NVCA 3MKVA 4O4WA 2GYIA 2Y2WA 2VT0A 3R1ZA 1NDZA 3AMDA 2WJDA 5ABFB 3JS3A 3LGEA 4GHRA 2ZUNA 5E1QA 4BI7A 4GY0A 3R13A 4PUWA 3DGRA 3HPSA 4UTTC 3L0KA 2QPSA 1R2TA 2Z2BA 4UOZA 4DF0A 1OC7A 3G6LA 4M5PA 4MF4A 2GGIA 2A7NA 3UY7A 1TPDA 1QW8A 5C9UA 1BVZA 3E12A 5TNVA 4YTUA 6TIMA 2OELA 5XIMA 4J2MA 2O0TA 1WXYA 2Y89A 3NQGA 2GJXA 1H7OA 1OGBA 1IT7A 3GXDA 3QKZA 3MI6A 3TC6A 5JH2A 1RHCA 3SB0A 4B2DA 2VC5A 3BAIA 4AEOA 4BQ3A 4RZ5A 4B3KA 5A8MA 3CZKA 1JPDX 1WA3A 4E3TA 1NWUA 3NGFA 3OLIA 3BMVA 2WMIA 3HMJG 4PUKA 1L6WA 1M5WA 1BAGA 2NSOA 3BJSA 4DEFA 2J9ZA 3N12A 1MMFA 3MANA 3HG2A 5DO8A 4LU0A 3UXAA 2A4AA 5JH1A 2ACQA 3ZM8A 1F7BA 2OGJA 4XBSA 4BHYA 2PDXA 4ASTA 3KS5A 2D0HA 1H0GA 1X98A 2FZBA 3EOUA 2DW7A 1VD6A 5ABGA 3EXSA 2QDHA 5HQEA 1FWWA 4UMAA 4Z1DA 4M51A 4FLRA 3P5YA 4AIEA 1MRQA 3RN6A 5IFPA 3NL3A 4WDWA 4TX6A 2BODX 3I6TA 2VQTA 5U7SA 3NFUA 4PUMA 3T9PA 3LYEA 3STPA 4AY1A 4H9YA 1NOFA 1BF6A 4JTLA 4JL1A 4BQ2A 1P0DA 1PHWA 3ATZA 1Z9AA 4GNKB 2DVXA 5KSWA 2HE8A 1XS2A 1Q6GA 3AMGA 4FPSA 3JW7A 1LM1A 2DFAA 2PGFA 4AD4A 5E6ZA 1EXPA 4MJMA 4K37A 4WGXA 4FALA 1U1JA 1BVNP 1HJUA 3WLQA 4C7FA 4J3WA 5A8PA 1J2WA 1XSIA 1EXBA 1XGZA 3BOFA 1BRLB 3ARPA 4LBSA 3F2CA 4BF5A 4E4UA 5E93A 3AALA 4A8RA 3UETA 2VFFA 2ON3A 4FXFA 2UBPC 2DT0A 1JDDA 5AVHA 5A2AA 1R47A 3NDOA 3MVIA 2BWGA 3NXLA 1OFBA 1GYNA 2YOCA 1C93A 4XUGA 4R33A 3UG3A 2C15A 2DGAA 2OGYA 4CD5A 4AIBA 1Q65A 1FDJA 3S6TA 1W5PA 3MV01 2HVOA 4GBDA 3DHPA 3ISIX 2FHFA 1AMKA 4LS1A 4H3DA 3CV1A 4MKSA 2REQB 1W1PA 3PG9A 3CH0A 1E6ZA 3UWVA 5DF0A 3RK8A 1XYAA 4URIA 1RH9A 3BSMA 3S47A 2V0TA 1KBIA 1XIJA 1ZJIA 3GSMA 5HMSA 4KW2A 4BI5A 3LBOA 4L61A 4O50A 1CX9A 3E5BA 1KCLA 3VKAA 3TYCA 2CXEA 3FJLA 1F73A 1G4TA 5FJOA 4LGXA 3LPGA 1S3TC 1N82A 1XLHA 3LNPA 4LANA 3DGBA 3NQ2A 3W2NA 5BOFA 4CN1A 2QJIA 3LHTA 5D09A 3NA8A 2CC0A 1FWIC 4HHPA 3G0XA 4RDWA 1Q6DA 3GFZA 3S2JA 3WDQA 4GH3A 3K5XA 4F9JA 1QOPA 2Z24A 5ECUA 2Z1KA 4UUIA 2WQPA 2E1WA 3ANYA 2E6AA 1FCBA 1W9BM 1ITCA 3L2LA 4Z2HA 2VUNA 1GVRA 1I1WA 3TC7A 3VNDA 3A4AA 1XIFA 4EAYA 3IRDA 4DXKA 1VP5A 1OCQA 2KAUC 3R12A 4POCA 3L0NA 1NM9A 3LDVA 4AWSA 1MQPA 2H9AA 1W3NA 3OO2A 4UWMA 2CITA 3CT7A 4QFUA 5K9CA 1C29A 2DPEA 1MW1A 2YPIA 4F66A 2WKGA 3HMCA 1GONA 3MP5A 5BXSA 2P50A 2GVGA 1E0UA 3WBYA 3BJTA 3W7GA 1E4NA 1ISVA 2PMQA 2NQLA 3M1ZA 2YYTA 5LSMA 5FAGA 2ZRXA 2PDKA 1EOKA 4C6QA 1JFXA 4RDVA 3C3NA 3LRKA 1P43A 5I00A 1PTDA 3ITYA 2HZGA 1EGZA 3MI3A 4E2VA 4IJCA 1A0DA 1JI2A 3WBXA 3PTKA 1G7UA 3VD4A 4MAVA 4FHAA 4JD4A 3WDPP 3THAA 6TAAA 4AH7A 4TMCA 3WG6A 2X2YA 4IFKB 2NWRA 3RIKA 3MZ2A 4K68A 5C54A 1KM1A 3BVJA 3U5UA 3EXTA 2WSQA 3CAQA 3NSXA 5LHFA 2P0IA 5CXPA 5A8NA 5M5DA 4C65A 1JPIA 2C13A 3TTSA 3NWRA 1YLVA 3PBGA 4EACA 3VUPA 2Z2UA 2P76A 1PIFA 3QQ1A 5F1VA 1XDMA 1FCUA 2QCLA 3E3HA 5AZ0A 3LM3A 4ZL1A 3MT1A 4B15A 1VFHA 4HNCA 3T0TA 5KETA 1O5XA 3MMWA 3NUKA 3T1GA 3RU6A 3CQHA 3U2CA 3VE7A 4IX2A 4LF1A 1FQ0A 4CEXC 3AJXA 4WIWA 2QPUA 3B9DA 2QAPA 2C79A 5IHSA 5JU6A 2W27A 2ZRZA 3TSMA 1KKRA 3O0FA 1OEPA 3W71A 1F8IA 5CJNA 3FIGA 1E3ZA 1JI1A 5I77A 1JFHA 4O14A 3S1GA 3TJXA 3XIMA 4OBTA 1OF6A 3UGRA 1WYIA 4FP1A 3B8TA 1DHKA 4B5NA 2WW5A 4TXEA 3BSHA 2WC7A 4WEVX 1VLIA 2P5NA 2CZEA 4LUSB 4DJFC 6A3HA 4K36A 2GSEA 2QAFA 4EXBA 2ABBA 3QSTA 3FJ4A 1QHZA 1W32A 5EMUA 5HPOA 4ONVA 2OT0A 3EKGA 1RCOB 4TV5A 1AW1A 4GX8A 1UKSA 1W6TA 4I9AA 1GOQA 4AHPA 1BQGA 3I3BA 2OCZA 3WH5A 1H63A 3PPGA 5EY5A 3SRKA 2A3LA 2WLZA 1B3YA 4FX8A 4JFSA 4AMCA 1XW8A 4L6DA 2VFGA 4AG0A 1J96A 2D1ZA 3N6JA 2VFDA 3APGA 3PUEA 4WSHA 3SSJA 3UY8A 2XN1A 3W2JA 1NSJA 4MM1A 2YBVA 4YMZA 2VGFA 1Y5VA 4F0KA 1QPKA 1ZSXA 3O8AA 2PGWA 1AW5A 3UA3A 3TFCA 2DORA 2J7FA 2J13A 1X97A 3P84A 2PAJA 1T7LA 5CZ0A 2D2OA 3GK0A 4DBEA 5G4HC 3VCRA 3ES7A 3N4EA 5A5WA 1QOXA 2Z6IA 1TJ1A 5DANA 3WH6A 1US0A 3I65A 4U31A 2ZX5A 4FNQA 2Q09A 4I9MA 4XTIA 4KESA 4FLOA 2BOFX 1TCDA 3WYZA 3VYLA 5LA0A 3NR0A 1M41A 4MFDA 3OGRA 5CPOA 2VVNA 3ONCA 2FZ8A 2Y0FA 3IS4A 4C6PA 1Q4NX 3ATYA 3C2YA 5HXMA 1Z7AA 2PWUA 3WEOA 5DFAA 4ZVJA 3FK4A 1FHLA 3H2OA 3HJEA 1TWSA 2VRQA 5I3FA 4O8AA 1KCXA 1JCLA 2XZ7A 2CLPA 4HJFA 3MP3A 4YVVA 3BLKA 1VZWA 1Q2RA 5FJUA 1ISXA 4DAFA 3CHVA 3RDKA 2IKIA 3Q2DA 3R11A 5LNWA 2WWCA 4HNNA 1DWIM 1UR2A 5LIWX 2YA1A 2XSBA 5CC5A 3S3GA 5IXEA 4XKYA 2DT2A 4B91A 2P3ZA 3EMCA 1JCJA 4L6HA 2BTMA 4C6DA 5CJ5A 4JQ3A 3TQVA 4Q22A 2A2IA 3KVKA 4Y96A 4ZQPA 1PKNA 4PCFA 1K7FA 1KFWA 1EOMA 3GR4A 4HHHA 2QNEA 3P74A 4X60A 5HNRA 3HQNA 2A79A 4D8LA 1QR7A 4KQNA 3M6DA 1MI3A 1XYCA 3NO1A 2QMJA 5A2BA 2HV5A 2X2GA 3NQEA 1LUCB 1PSCA 1VEMA 1G7VA 4PCSA 3WLRA 2G4JA 3I68A 1J01A 4DZIA 2WHKA 3OIXA 4JQAA 4WY0B 1NDWA 3LOTA 1MRAA 4JCLA 1DJQA 3F2DA 1JPHA 1CGVA 3W27A 3G1FA 4E2DA 3V0TA 1UUQA 4Q7NA 2CEQA 1I0BA 2ISWA 3H4GA 4JKLA 1Z32X 4CU7A 1QK2A 4LALA 3VVGA 3SUUA 1KR0A 5EU9A 3T55A 3RRXA 1ISYA 4I6VA 1YW1A 4HU4A 3EDDA 3R7MA 5I3IA 3PJWA 3KOYA 3WKZA 3NGJA 3GDTA 1OYBA 4YVPA 1XBZA 3I3DA 2JALA 1Y5XA 1VCGA 4X9YA 3O7UA 4KEZA 4MZ8A 3Q67A 2YLAA 4XIAA 3NVDA 2HRWA 1WDQA 3VU2A 3U7BA 3MPGA 2DIJA 3GD6A 4KWOA 2F84A 2FH8A 4S39A 3H21A 3N29A 1DHPA 1DTNA 4ML9A 3N14A 2WBKA 2ZX7A 3CAKA 1VC4A 4AVOA 4AZCA 4EXAA 2FZ9A 1MW0A 1TWDA 4ZB0A 5I3JA 4Y9OA 1F8MA 3AS1A 1B3OA 1EC9A 1TMHA 2O56A 2OOFA 3S8HA 3O1NA 4OT7A 1XLCA 4TTGA 1ESWA 2QCDA 4ZQCA 3MUY1 3OA5A 3L4XA 1IEWA 1MEHA 3M5XA 2BXYA 3FFSA 1AJ0A 1BGAA 3M0HA 1CXFA 4KRZA 2O7SA 1I45A 1ADOA 5A6MA 4FZIA 2GSJA 2DU2A 3L4VA 4LWWA 1VRXA 1EJWC 3NQ6A 3ZMRA 3VAVA 3LBMA 3CPUA 3B8VA 2VEFA 3ICJA 3EZ4A 1SQ7A 1W1A1 1UH2A 1YBQB 1ZUAX 2PD5A 1ZCCA 3NQCA 1H61A 3A13A 4BA0A 2A5HA 3IVSA 5B7YA 2C7FA 3QC3A 3OA3A 2HK1A 2QCHA 5DT5A 2OSXA 3G22A 1VR6A 1TWIA 3G3MA 9RUBA 2Y8UA 1MXDA 1EH9A 2ZZ1A 2QUMA 3W7NA 3VPLA 2E5BA 4LV4A 3GHTA 3FVDA 5BNKA 1X1NA 3NQFA 1K03A 3URQA 4JCMA 1T8QA 1M7XA 4FOJA 4BF9A 2I9UA 2OOGA 4GNJA 3QBUA 4L9XA 2XINA 1GVOA 1MEIA 4PEEA 4PMYA 1R0MA 3PZOA 3NYZA 1RJRA 5HQLA 2WZMA 4JIHA 2NQZA 4DWSA 2G41A 4OIFA 2O9RA 1TREA 4CU8A 5GPRA 3K4AA 1J2BA 4J3UA 3AUOA 2ZZ3A 1DWFM 1NFGA 3AUJA 4GJ1A 3MMDA 1J0YA 4ZE4A 2IQDA 1DOSA 4XKMA 3A3XA 1CZ1A 7A3HA 1OD8A 4HMCA 3KBNA 2NW0A 5A8OA 3N3TA 4M7TA 2Q01A 3GDKA 4D6EA 4S3JA 4GGHA 2Q6ZA 4Z17A 2D2HA 2J8FA 5FKYA 1Q6FA 5H6HA 4LEFA 3CIVA 1UBPC 3CL8A 3MYPA 2YCJA 2ODOA 3W7OA 3GXMA 3AHYA 4WVXA 1R2SA 3GDRA 1GVSA 2OZ0A 3CZJA 3ZT7A 1ZJHA 2HXTA 4IICA 5A6TC 4XO7A 2DZBA 3DFPA 5BW6A 3M43A 5DLCA 2XFYA 3GDMA 1CEOA 3HM7A 3K2GA 5K2ZA 3OU8A 2VX7A 4MB4A 1B31A 1OFQA 3CZEA 4IGNA 4PB3A 1UCWA 2GQ9A 2ZQ0A 4GI6A 2Z28A 4YL2A 1ECEA 3MKCA 4O1FA 4CNOA 4DZHA 1J4EA 3SUSA 4GYPA 2YXGA 3E6EA 2EPNA 3TWBA 3EX2A 1EF3A 1HJSA 2CHRA 2YW4A 4IG2B 3TJLA 4M56A 1X38A 2RGMA 1ZS2A 1TYGA 5D38A 3IIXA 1Z89A 1A0CA 1SJBA 2BGSA 3LHVA 1QNOA 1NDYA 1UBSA 4MY1A 3TCSA 3CQIA 3HTWA 4PZVA 1NOUA 2VM8A 3KEHA 2DJLA 3B9OA 2EG8A 1L6FA 2VEMA 3B05A 4TX8A 4C1KA 2XWDA 1OABA 3N6HA 4OOUA 4O1CA 3CT2A 3I10A 4M6VA 1RD5A 3QYSA 4DRSA 4GXMA 2D23A 3TN6A 2HPIA 5HUOA 1UQYA 1ZJBA 5FJTA 3GG1A 3T0BA 4QX4A 1BGGA 4RE3A 1H51A 3CUXA 1GUVA 4RL3A 4HZ7A 1W9UA 4PL2A 4H9XA 1OINA 2BOGX 3N9KA 3WIJA 3R5EA 3RGTA 3UF9A 3S5SA 4DVOA 2ATSA 3O2LA 1V3LA 5DY2A 1VCFA 3S5NA 4HNLA 1GOIA 1CDGA 2QGHA 2XFRA 2PF8A 1GOWA 1DXFA 4XZIA 4F0HA 3W9ZA 1WUFA 1KO0A 5DMLA 3CYJA 1XISA 2WYSA 3UR7A 1XUUA 3QHNA 4PCNA 1DIDA 3MDUA 1S2UA 1YTEA 1B5TA 2B31A 3D3AA 3GKFA 4NZ1A 1S2TA 2VZSA 2FPTA 5GNZA 5M1TA 2C91A 3DOPA 3FGCB 9CGTA 2PDQA 4UMCA 5DCEA 4UR9A 3INPA 4GWEA 1LBMA 3C52A 2QW5A 4LYQA 2ZXAA 1UHVA 4HIBA 3AHTA 2E8YA 4BI6A 4HVXA 1ML1A 3MHUA 4JTEA 2POTA 4F0RA 4D8ZA 3GKAA 5AECA 1FHDA 4FEZA 5CAKA 1P7TA 6ALDA 2DH3A 3NXFA 3G5EA 1CECA 3WQDA 1DKWA 4UOQA 2NV1A 3WD4A 3RPDA 1TTJA 4GVIA 5AHLA 3TKFA 2W66A 2DZXA 3UZJA 4ZR8A 4DPPA 2ZRUA 3S0CA 3LG3A 1XLMA 2E67A 2FGLA 4AZGA 2JIEA 1PTAA 3SCNA 3WBEA 4GXWA 2Y62A 3VK5A 3UXKA 3AXMA 5G2WA 2BY1A 1M1BA 1UJPA 3UNDA 1Q5MA 1Z48A 3FSUA 1I9CB 3K1DA 1RPKA 5I24A 2ZRYA 4LCSA 4CQAA 1XRTA 3ZLFA 2A3HA 2D3NA 5HNTA 3H4XA 3UJRA 3WFZA 2WQDA 3PVFA 3FV9A 3UWZA 3SQMA 4F3HA 1XBVA 4QJ1A 1A80A 4MTVA 3BGAA 3VZZA 4ZO9A 3W88A 3PUDA 4DNHA 2Y61A 1WKYA 3ARXA 2X1TA 1H62A 4H6QA 2FZMA 1EHNA 2AQWA 5I3GA 4MZ1A 3VMNA 2C3ZA 2NUYA 1JAEA 3IWPA 1LT8A 4W4QA 3T0DA 5CBJA 5AHIA 1UUOA 2H9AB 1LRTA 3KVLA 1XD1A 3UCCA 5EBUA 3ZXWA 2CFFA 2OYLA 2DZUA 3S2LA 5KZDA 4CCZA 1IWAA 4C6OA 1VPYA 3SUVA 3CO4A 4JIIX 3W26A 2HEJA 3C3UA 1JYXA 3IUDA 4JNZA 2OLHA 3EB4A 4EF9A 3S4TA 3B4UA 1XKYA 3U0HA 3GM8A 4EANA 2ASHA 3G8RA 3PPFA 2YDSA 2P10A 2EGZA 2ACRA 2DQWA 4MY8A 2ZKMX 4JHZA 3CO8A 1E1CB 2V2HA 1F6YA 3COTA 4H7CA 2ZTKA 2ZIDA 3BUVA 4JTCA 5DN1A 3QPZA 5M3WA 4IPIA 2XN2A 4GO9A 4DJFD 1E6NA 2PI6A 4B3ZA 2W91A 3GW3A 3HFTA 1EP2A 5KZ6A 1NAL1 1YHTA 3ZFHA 1R7AA 5F7UA 1XFBA 4IXXA 4BFAA 1WZAA 3QGAC 3LPPA 3VOGA 3SIZA 3OVQA 5MHBA 2XGBA 3TIMA 2CLIA 5BMWA 4JAWA 1S2AA 4AZCB 4S2BA 2HJPA 3M5VA 4ZO6A 1OC6A 3FEMA 3WQ6A 1ITXA 3W1RA 2VL4A 3O9NA 1HJWA 3GZAA 5CGQA 4IQEA 3Q58A 2FVKA 3GH4A 4MHBA 2R1KA 4UNKA 3GXFA 1EWDA 4PFHA 1LWJA 2F6UA 1G1YA 5H8UA 1KBLA 5FF4A 4H6RA 3WF1A 2PDIA 3VM5A 5HNNA 2OYKA 4AZ5A 7REQB 3PWIA 1YDVA 1VFLA 1POJA 1TFVA 3KLKA 2BG5A 3BWWA 5LNVA 4N4PA 3W2UA 4WD0A 2A7RA 1PTGA 3OEXA 2WVVB 1R30A 4XISA 5KMYA 3DU0A 1W17A 1UZHA 3EMZA 4AF0A 1DXEA 1L6SA 1W1VA 6XIMA 3WDHA 3V0UA 1QI0A 3IJ7A 1A3WA 1JYNA 2PDLA 1Q8AA 3LB0A 1LG2A 3WLMA 3DHUA 1O5RA 3DUGA 1EIBA 4EX4A 1W31A 3LTSA 4JYEA 4NU7A 3E74A 4IIDA 3ZLHA 4E8DA 4CQBA 3WMSA 4DJEA 2QCMA 4IMCA 3EKZA 1FA2A 1OCJA 3UXIA 5LA1A 4S3KA 1J12A 1GOXA 4RK8A 3OZYA 2ATMA 4H2CA 1T41A 2WNZA 4FSAA 3PZGA 2OWXA 1EYWA 3WELA 1R3TA 2HE5A 4PCPA 4H4IA 4DWSB 3W23A 4H7ZA 3KP0A 3E0WA 2OEKA 5D9MA 2YCEA 2WZIA 4Z08A 1KM4A 2ZRVA 2CPUA 2VWSA 4AHQA 3VIJA 3DFQA 3VGBA 3WUGA 3L5MA 3QPEA 2PE4A 4C6NA 4A22A 3F4CA 1FY6A 3KFTA 1KM3A 2FGZA 1SZFA 5CPNA 4GVFA 3O07A 4I6KA 5C7VA 1F6KA 1XUZA 3CWHA 4MOZA 3FHAA 1GYLA 1H11A 4ADUA 4G8TA 3W2KA 1RA0A 3VDBA 3BLFA 2Y24A 2IPJA 1OCNA 3VILA 2A21A 4L4OA 4KGLA 2QCNA 5CPTA 3HPXA 3M0ZA 4PMOA 3DFNA 1W8GA 3EBVA 5I23A 2Y8KA 4IMAA 4NZ3A 3CL6A 4CD4A 2OODA 2WWDA 3WO8A 1GTHA 3RJXA 4U5KA 2RDTA 2BSLA 3IARA 1QVBA 4AZ7A 1MDLA 3LM7A 3KCJA 4LT9A 1P5BA 3U2OA 2GGEA 4X3ZA 1ME9A 1PYMA 2Z1BA 3T0CA 3KZPA 5CBIA 4DZAA 4BY3A 4AZHA 3ZYZA 2ZWYA 4MAZA 4O28A 1A5BA 2J62A 1TMQA 2EO7A 3SR7A 4RPQA 3ID7A 1W91A 4LTSA 3GH5A 5CPSA 2V9DA 4KRTA 5FJRA 4C6FA 2VGBA 3KBJA 2QMKA 2Q02A 2XVLA 5GQBA 5LGZA 3NM3A 3AIQA 1GQNA 1C8XA 4DUOA 3ITTA 3WH9A 1EZWA 3H24A 1S5TA 1VQTA 2JKEA 1JUKA 1W1TA 3W84A 3W6MA 1Z6KA 1LLZA 5FACA 3EOLA 1IQ8A 3LPOA 3LGGA 4FB7A 1W2VA 3NPUA 2F2HA 3L4TA 1JXKA 1QNRA 3SQLA 3EDKA 3HG3A 1JZ8A 3K8LA 5HJYA 1UIOA 3HQOA 1OQFA 4I8DA 2Y7FA 3NZRA 4CN6A 4QISA 3GC5A 3L12A 5D30A 4ICCX 5IBXA 5A1AA 3CZ8A 4UBPC 1GZ1A 2ZZ4A 1JNEA 2J7EA 2DIEA 4IIGA 1R3SA 2QDGA 2EXOA 2X1IA 3WQPA 4WSKA 4GVHA 2GJNA 3F5LA 1OY0A 1R8LA 4DWDA 1XR2A 1RPXA 3OVPA 7ODCA 4HMDA 4YTTA 3QQWA 4IJRA 4EK7A 3WEMA 4A8NA 1QRQA 1EWEA 3QR3A 4JIEA 2J7CA 2Y63A 3IJ6A 4OJYA 3KL5A 3UJEA 2OB3A 4ADSA 1HJXA 1QPNA 3UESA 4GG9A 1JPMA 4O13A 3CMFA 3TLLA 3P82A 3SRFA 3ORWA 2R82A 5LIYX 5MF5A 1UMLA 4IHCA 1V5XA 3GC4A 3AMKA 1LCOA 4EOUA 5D2TA 3A24A 3WD0A 4XKYB 2IW0A 3W76A 3E0LA 4H1ZA 2G95A 2YB4A 1W9VA 2RKXA 5ECVA 1EL3A 2EG6A 3ENLA 1WO2A 2IQ0A 2EG7A 1SSDA 3VNIA 2QYGA 5D02A 2REQA 3AWOA 4HCHA 3UERA 2G3MA 3KBWA 4J4KA 4IXHA 4UTMA 1XC6A 2O9OA 1V0MA 3RHGA 1E9LA 3T4CA 1EDTA 2CLKA 3DFTA 2A1YA 4KCTA 4AZIA 3BLOA 4DB7A 3BMXA 1KV5A 1W8SA 3W1QA 1H2JA 1LL4A 4ILSA 1JCYA 3VGEA 4AC1X 3LCIA 4AC7C 3S2MA 1BSLA 1X8CA 4R7JA 3DHFA 3XINA 3VD7A 2FFCA 1W3HA 4FR6A 4WY0A 2YCIX 4DI9A 2QZRA 3N25A 2W62A 1OWQA 2GUUA 3ARUA 1OCBA 3W3OA 3IUHA 4LUTB 3LLDA 5DXXA 1BYCA 5FF3A 3URAA 2R1PA 3W53A 1A3XA 4BKNA 3VIFA 4CQ8A 1XX1A 1H7WA 3PNZA 4PODA 4KFNA 4Z1BA 2R91A 1F6PA 4ECLA 3MS8A 3QTGA 2NV2A 1DXIA 2OTDA 4S3FA 2Y7DA 4UZUA 2FTYA 4B90A 4J3VA 3ANVA 3MDWA 2PTYA 2LLEA 1V0NA 3C86A 2IKGA 2SFPA 3ZJ7A 1MVYA 4Q8PA 4BF7A 5AZ1A 2YDQA 1PPIA 4M82A 4AVNA 1T0OA 2EF9A 4NZCA 1UOZA 4MVAA 2PWVA 1WDDA 1G5AA 4DIAA 3HGJA 1KRAC 1QW9A 3TTYA 4B5UA 3AWNA 4HJWA 4Q8MA 4GY1A 3A9BA 3OVRA 2XFFA 4Q33A 4PMQA 3ARZA 3PSVA 2CHNA 5C8BB 4PULA 1M01A 3L2IA 3CZLA 1LBLA 1IR2A 5FL0A 2CWXA 2VFEA 2WV8A 5K4ZA 4Z1CA 4LV9A 4MWAD 1QHPA 2A3EA 3WLSA 4C6MA 4Q7IA 3AU2A 4E3VA 1B3WA 2BFGA 2J4GA 1PB0A 3NG3A 3TNBA 2ALRA 2BVTA 3RM4A 2E09A 1XCXA 2E8ZA 4OBRA 4DAIA 3CHCA 1Q6EA 1IEQA 5A6AA 3P0WA 4H8VA 5A94A 4QAIA 5BRBA 4IMFA 3TLQA 1T8XA 3H22A 1F4AA 2CNCA 1XH2A 2A6NA 1IXOA 2OXNA 1UD8A 3H53A 1HP4A 4IX0A 3KOFA 5C9RA 3E2QA 2J6XA 4GLEA 2FMOA 1XQKA 3MUAA 3SADA 1FOBA 3MKKA 1K8ZA 1KKOA 2I1OA 4B5TA 2QJHA 5C6MA 2Z0IA 8CGTA 3W81A 3MYOA 2QJGA 1K1DA 3UVAA 3CQKA 2WJZA 2RHGA 5FD0A 4CVUA 2VDHA 3CHFA 1QCWA 5HDRA 3STEA 4OE7A 4KEUA 4JY9A 4K2SA 1Q66A 2GFTA 4HNUA 5F1UA 5TBOA 1O66A 4JDBA 4MKVA 1XRVA 5C9WA 3PZ9A 3IGSA 2OMAA 1IYXA 1B9BA 1EP3A 1S5WA 4XUYA 3LBCA 3FW6A 3WNLA 4GUHA 4ZTXA 3JVAA 4G1KA 3GVWA 1GG1A 3ITXA 4C1LA 3C2RA 3N3MA 3VIGA 4I9TA 1VEPA 2NUWA 3THUA 1O12A 1RLCL 3RO8A 5CC3A 2PLMA 3GXIA 4XBJA 1CYGA 2R6OA 1C9DA 2QXWA 4JNYA 4R5EA 1W0MA 2P53A 4Z2LA 4PB4A 1Y5WA 4F0LA 3WUBA 4QP0A 1T96A 3L66A 5BOEA 2FLIA 4LUSA 1WB0A 2J9YA 4PMJA 4P2VA 8A3HA 3GWQA 4H9VA 1X8FA 3AXHA 2DUXA 3LCLA 4O52A 4UC5A 3H7RA 1LOLA 5LIUX 3NZPA 3QMSA 2F6KA 2XIOA 3MUIA 3K30A 2VZVA 3AMCA 3N4FA 4MJZA 3VZYA 3SCQA 1BG9A 3EEZA 4H6KA 2GQ8A 4GI9A 3UZYA 1QMLA 2JK2A 4HK5A 3KRSA 3O06A 1KQYA 1ZLPA 3GNNA 3D46A 3HPAA 4TVDA 4LAUA 1KR1A 1XQLA 2QIIA 4AY8A 1JUBA 4GKTA 4O16A 2QUTA 2ZDRA 2RGLA 3VIPA 1RSCA 3DBPA 1DJZA 3V16A 4Y8EA 4Q4QA 4ICNA 2ZA1A 1M6JA 4DHGA 1RVKA 3OQ8A 3DIPA 2PGRA 4OECA 3BQ6A 5M17A 1UKOA 4XAFA 3MSRA 4R27A 3T40A 1PVNA 2WK2A 1P7TB 3BAXA 5T9CE 1JCTA 3TW7A 2ANUA 3FVMA 4QSHA 3W22A 4EWJA 2J79A 1VFTA 1CT5A 2E4TA 2CZDA 1KFKA 4WKFA 2GJPA 2VQUA 2FTPA 3L4ZA 3THDA 5D4YA 3WQFA 2XU2A 2YR1A 4L65A 4Y8FA 3TA6A 1HW6A 1SZRA 1YNYA 2PDHA 2G3NA 4TQTA 4GY7A 2PF0A 3WF0A 1GGOA 4BQ5A 3W72A 2R94A 3T07A 4GQGA 3UWQA 5AYIA 4C1NB 1V3JA 3LY0A 4KPLA 4LBUA 2AGKA 4OV9A 4FI4A 1A5UA 3PB0A 3LHUA 1LLOA 4UFKA 4W5UA 4TVUA 4IQLA 3WY1A 1LJYA 1VFSA 3UG5A 4JTAA 4Z2IA 4P7RA 3TOPA 1MSSA 1E15A 4NKCA 1BFNA 4CVWA 3AQUA 1JGIA 5BXPA 4XZWA 4AD1A 3ECQA 2YA0A 5I3HA 7XIMA 1FWTA 4GYPC 1A0EA 3BICA 3H26A 4MJ2A 2Q8XA 4I5XA 2IPFA 3B03A 4ZB5A 1X7FA 1FXQA 3KDNA 1U1UA 1MFVA 3V7PA 4Q32A 3TE9A 1UMYA 1TV7A 1ZZMA 1R9XA 4NZ5A 3SUTA 1KM0A 1OX4B 2OG9A 3GAKA 1YTKA 4UR7A 2Y8VA 1T99A 3UR5A 4NP7A 4ZSTA 1I2QA 1MXGA 4QHRA 5JVLA 3G1SA 3EPMA 1R9ZA 3VCCA 2JE8A 1R9YA 3LTYA 1XYBA 5EMLA 4WSJA 3T81A 3UJSA 4DJDA 5BWAA 4O0QA 5BCAA 4QE5A 3I3EA 1A47A 3TYBA 1FWHC 1CIUA 3ZQ9A 2JEPA 2Z6JA 3P61A 2A3BA 4QJ3B 4LJ3A 3MHGA 4R9XA 3GNPA 3U2ZA 2NT0A 4E8GA 2NSXA 1FWFC 1SUXA 2DVTA 2P88A 2X16A 1GORA 5E0CA 1PV8A 2P0OA 3T4WA 4QIUA 4J3SA 4ZCWA 2EPOA 1EX5A 3U4FA 1XLEA 3VFLA 3FYOA 5CJMA 1XJBA 5DRIA 4S2CA 3LCHA 4D2JA 3CAWA 2UWFA 5D2YA 2VZUA 1TTQA 1LQ2A 1F3EA 1GVIA 4OVXA 4HOWA 3S5YA 1F9CA 1DBTA 1TV4A 3E5PA 4JTUA 1SR9A 4L1XA 2E9MA 1KRMA 1FFRA 3GY1A 1DJYA 4PMVA 3QYQA 4RW5A 2DSVA 3ITLA 5HATA 4QGCA 3XISA 4J7RA 1NP0A 1KD0A 3GU2A 1LYXA 2V67A 4C6CA 3IANA 1Q6OA 2DZPA 3NO3A 4WDTA 1V3KA 1V02E 2CBIA 2W6RA 4HCLA 4LC6A 1I0DA 3V36A 4UQDA 1RK6A 1KC7A 5I06A 4I8YA 2OWWA 1KFEA 2I17A 5D05A 3LMZA 1PL9A 1EQPA 1UH3A 3T2QA 3VNYA 1F3TA 4CCCA 2ZICA 3GC2A 4GFSA 3NQVA 3S2CA 5I79A 1C8YA 1XXXA 2Y4SA 1MNZA 2ZOXA 3P93A 2G3JA 2NWSA 1Q13A 4I3GA 3TXZA 5HWJA 5IRPA 3SAZA 2F9RA 1NVMA 3AFBA 4U33A 2VEPA 1TR1A 4LRTA 4Q4SA 3W70A 1JIBA 1LDCA 1KA9F 1HKJA 4P7LA 3BAJA 1TVPA 4NXKA 4NAEA 3RX3A 2I56A 3AS2A 3OZOA 1TVLA 2QJJA 3UJFA 3JRKA 4N02A 3QPYA 1K9EA 3FJ6A 3QEZA 1WZMA 4GQBA 4ORIA 3C0LA 2PDGA 4WKAA 5CG0A 3LSBA 4C91A 1VFOA 1OGGA 4TTUA 1V6YA 4HA3A 1V51A 4HYWA 1B2YA 1DE6A 1ME8A 1Z69A 2BX7A 4E38A 3GDBA 3OBKA 1JZ6A 3C5QA 1JEZA 1YADA 1EP1A 1LOQA 4HNVA 2IMRA 1PWMA 3EYPA 2RJGA 4MMWA 1J10A 4XQ6A 4IFRA 2XVPA 4MIMA 1ZBVA 4DQWA 1DQWA 1B3VA 3ZVHB 1TZ7A 1PDZA 3V1HA 3NZGA 1DL3A 4IP7A 3R0DA 4YWIA 2WJEA 4IFOA 3B97A 3E2VA 3T08A 4NAFB 3NOYA 1H7NA 3FDGA 2CKRA 3CUFA 3AC0A 2A0NA 3TQ0A 1U83A 5AN7A 4H8HA 2G8ZA 1RAKA 2UV8G 1UJQA 3ABOA 2RFGA 3TROA 4ZQMA 4F0SA 2P3EA 3L4UA 3QC0A 4UTHA 1F3XA 3C0JA 3BXWA 3LTPA 4EPDC 4UQEA 2VENA 3MTWA 3A22A 1CWYA 5HMFA 2OPJA 4PH6A 1A5SA 1TSIA 3PBYA 3QV6A 1TJRA 1CCWB 4NJGA 1GQKA 1HX0A 2VHLA 1FX6A 1S2VA 4W7WA 1RCQA 1V03A 3FKKA 2ISSA 3VKKA 2GVJA 1OF8A 3B0YA 3EDEA 1KWGA 4RDZA 1NQ6A 4JX5A 4PRWA 1QI4A 3VOFA 3QXBA 1FWSA 1AH4A 4WJXA 1LTDA 4KETA 3RM9A 1IGSA 4N0RA 3NQMA 2PTWA 3LCGA 1GVYA 3LXCA 2FMNA 1YXYA 4RZ4A 4CNNA 4MLRA 1H50A 4DUWA 2GSHA 3OLGA 2Q3OA 3P62A 5FOOA 4M29A 1N55A 1I60A 1VIZA 3UPBA 3ABSA 1REQB 5EA9A 3VIOA 4HN4A 4ATWA 3C2VA 4F9DA 1UR3M 3WNPA 5ABTA 2X7VA 4ML4A 3WZ0E 3HG5A 5T91A 3W7LA 2DSWA 5C9XA 3G8EA 1RBOB 3W1NA 4LNCA 2XIQA 3A5VA 1ZB5A 3G77A 4O53A 1C91A 1OADA 2EBNA 4S3DA 1JYVA 4JQ1A 5KZMA 2QDDA 4GIAA 3BL3A 2FTWA 3GX9A 2YB1A 2I5GA 5C7HA 3ZJ8A 1J18A 3GH7A 4MFEA 3BMWA 4F2UA 2WMKA 3W86A 3EA3A 3MB9A 1V6WA 1TVNA 1XF0A 2PP0A 4MZYA 4LS2A 3B3DA 5FI8A 4KKXA 4V27A 4WZHA 3D47A 4N9CA 4PRTA 3ZVIA 4OBSA 2VDIA 1A5LC 3TYEA 3Q4DA 3MO7A 4HOXA 1I2NA 3WNOA 1GKQA 4JFVA 4AZ6A 4U3CA 4TVCA 5I3KA 2OEJA 1UOKA 5A95A 1CI1A 4J28A 2WZEA 1U33A 1KFCA 4NI8A 1G6CA 3N2TA 3DESA 2F7FA 3GVQA 2B7QA 1NFBA 1X6UA 3TOYA 5JBEA 2RDWA 1EPXA 1S2WA 3RF9A 5C9ZA 1BD0A 1RXOB 1UPPA 3UA4A 1S2CA 1TPVA 4E8CA 2VGIA 1YTDA 3BLLA 1GVEA 3E0VA 1TZZA 4WGHA 3PS7A 4QLJA 2WLYA