1R8LA

The structure of endo-beta-1,4-galactanase from bacillus licheniformis
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
386
structure length
386
Chain Sequence
b'GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords endo-beta-1,4-galactanase
publication title The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 144
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1r8lA00
2XFFA 4NSBA 4RE3A 2WKLA 3FHQA 2DT2A 4J3XA 1DWJM 1XHGA 2CITA 2J74A 4BA0A 2Y2WA 2Y24A 2Q8XA 1KBKA 1PX8A 1EHNA 1KQYA 1NOFA 1Q6GA 3GH7A 2DSVA 5A3HA 3FXYA 1O7AA 1GONA 2BHZA 3CUHA 1E73M 3ZSTA 3CZEA 3RDKA 3WN6A 4AMCA 4U31A 2WHJA 3VD5A 3VIGA 1CXEA 1XH1A 1W1PA 4W89A 3WY1A 2O9TA 4TXEA 1UUQA 1QHPA 3DC0A 3QHMA 3SIMA 1LL4A 3IJ9A 3PZOA 1E0WA 2QF8A 4HA1A 5AY7A 3T2PA 3VDBA 3AMDA 3RPMA 4D6DA 1F4AA 1DWAM 4J27A 3CMGA 3GM8A 2EO7A 2RGMA 1VENA 2FGZA 5BROA 2WMFA 1ISXA 4Q7NA 1GOWA 4UFKA 1IZJA 5A8MA 3AHYA 3WNLA 3WD3A 3ARUA 3VIPA 1E6XM 1KWKA 3GNPA 4V27A 5I5RA 1E3XA 1E4MM 3ZIZA 3OLDA 1KR0A 3VIFA 2A3HA 4D6FA 4PMNA 1AQHA 5IFTA 2WVVB 1FP8A 3DHPA 1GQIA 3KWXA 4W8BA 4OZOA 4U5IA 1HJUA 1TMQA 1OCQA 2WBKA 3AOFA 4JL1A 2W62A 3WH5A 2GFTA 1BG9A 1CIUA 2Y8VA 2DSZA 5D8ZA 2CNCA 5ECUA 1E1EA 2X05A 3SCRA 4ZE5A 5A6JA 3LPPA 2NT1A 1Y7VA 3GH4A 3W38A 3L4WA 4GO9A 1B30A 3OZOA 2ZXBA 2XUCA 4W7WA 3AHZA 1PEZA 2ZUWA 5A6AA 3WBAA 1OWQA 3MUAA 3CTTA 4ACZB 1JF6A 3W28A 3W27A 3PZ9A 3OZPA 2G41A 2VVSA 1TZ7A 3MV01 3EDKA 1HKMA 2EPOA 4P7QA 1W91A 1WB0A 2ZUVA 2VX6A 3MMUA 1EH9A 1XH2A 3DYPA 1ISYA 2PI6A 3TTYA 1V03A 4MAVA 4UCFA 3BAWA 2OYMA 4WLCA 5TD4A 3CHFA 2W4XA 1JZ2A 2G3NA 2OYLA 3RM8A 1SR0A 1J0HA 2YLLA 3WDQA 2WHMA 4R5EA 2D23A 4BQ3A 2CBVA 4BS0A 2VOTA 4W85A 1U33A 4YN5A 3EDJA 3ZJ6A 2CERA 3VU2A 5I24A 1K6AA 3M6DA 4EAMA 3N04A 1RP8A 1CGYA 4PMQA 3A4AA 3EDFA 3VDHA 1AVAA 4P8UA 5EBAA 3A47A 3GBEA 1ISWA 4GINA 3A3HA 3A4XA 4MNKA 4C7FA 5E0CA 3AIBA 5A6BA 2PF0A 4BZYA 1FA2A 2CIPA 2J7GA 1GOIA 3CZGA 4UQ9A 4ATWA 1UKSA 5CJ5A 3IANA 1MFUA 1FP9A 1Q6DA 1R8LA 2W66A 4CKQA 2D0FA 4PCTA 1BYDA 1PX4A 4XV0A 3UR8A 2XGBA 3U7BA 4CCDA 4AXNA 1CZ1A 1E4LA 2YDRA 4P7RA 4KWUA 4QDMA 5BWFA 3HMCA 1BG4A 2DH2A 3AHXA 1E56A 1M03A 4CCCA 3WF3A 2ZE0A 1UYQA 3AROA 3W53A 2DEPA 1AMYA 4PTMA 1PZ2A 2YDQA 3OLEA 1J01A 3BLPX 4UOQA 1B3VA 1W3KA 4E4PA 3BCDA 3AS3A 4GZIA 2BXYA 1R86A 1K9FA 1W3HA 2J25A 4LPCA 1C8XA 3U7VA 3LMYA 3II1A 2JEPA 1JGIA 1QW8A 1ZU8A 1E5NA 3OBAA 2VRQA 1E72M 1JNEA 4C7GA 1H4PA 1PJ9A 2D0HA 2V3DA 4LYQA 3VVGA 3CLWA 1G5AA 4JZ5A 4W8LA 2OWXA 1UKOA 4QCFA 5DMYA 4IPNB 1V08A 2W91A 2D20A 1KXTA 2E9MA 3TONA 1J9YA 2J7EA 1GQJA 2UY5A 1OD8A 2ZUSA 4PMYA 1HNYA 3BLKA 1QHOA 4MTVA 3WH7A 2D2OA 4PMUA 1J18A 2PWGA 4EANA 4MJ2A 3POHA 5JIWA 3WFZA 4D6IA 4B3KA 1UWSA 2O9OA 3ALFA 4JKMA 3D3AA 2FH8A 4U3CA 2OSWA 1EOMA 1UH3A 2UY2A 4M1RA 5CZKA 4PUDA 4Z2JA 3MUZ1 2VX7A 1E3ZA 1QNRA 4UZSA 3NYDA 1E0VA 3WSUA 3VIKA 2BVDA 5A69A 4NZCA 5FD0A 3NUKA 2JALA 4ZENA 3WF2A 3SCNA 4P7NA 4AYSA 1HP5A 3OG2A 3FW6A 4J3SA 1JZ7A 1Q6EA 2DT3A 4MADA 3NSXA 1JD9A 4HZ8A 1SMAA 1JNDA 5C70A 2YKKA 1WDPA 2WWDA 4FLQA 4HOZA 3WKZA 3ECQA 4E8DA 1CXHA 3GNOA 2PWDA 3BSHA 1V3LA 3ARRA 4ZEPA 1MQPA 3RJXA 1HJXA 3AHTA 1VBUA 2VZVA 2XVPA 1UWIA 1BSIA 2BFGA 1E1FA 1K9TA 2CHNA 3F5LA 4TTUA 5FL0A 3LPOA 2YOCA 5GNXA 1R7OA 4B15A 2CBJA 4CN1A 1HJQA 5CLWA 1EO5A 4N0RA 2WPGA 2VR5A 5A6LA 1JD7A 4H8UA 5A2BA 4M82A 2W67A 2VO5A 4D6HA 5D9NA 1DWHM 1DTUA 1UKPA 4PMDA 1JYVA 2X0YA 4M8UA 4MB3A 4UQEA 1BYAA 2GSJA 1XSJA 3PHAA 4UOZA 1WPCA 3TTOA 4CD8A 4B16A 2VCAA 1TVNA 4PMZA 1H2JA 1OT2A 2WBGA 3MO4A 1GUVA 1BGGA 1WP6A 2BV9A 1KQZA 4PSRA 1JYWA 4JCLA 1V6WA 3AZTA 4PCSA 3PZMA 2D0GA 1WZAA 4AC1X 1VBRA 4W7UA 4D72A 5CGMA 1GVYA 1FH9A 4JAWA 3ZR6A 3BAYA 4ACYA 3VX0A 4W7VA 3CHEA 7CGTA 1XD1A 2EPKX 1OIMA 3LPGA 4AD4A 2CYGA 5DEZA 1LF1A 2G3MA 4H8HA 3VMNA 5E09A 5JIPA 5E0FA 1NOWA 4FF5A 1BFNA 5I79A 4OOZA 1UZ1A 4J3WA 1W9BM 2TAAA 1GORA 3UR7A 4MNLA 3PN8A 3NCOA 5A8PA 4H7VA 2ZX7A 3B9EA 1UA3A 3ARSA 3K1DA 3UESA 5BXRA 1V0MA 1UR4A 4D6JA 4MNJA 1XYFA 1I1WA 1KB3A 5DFAA 4NI3A 1V3HA 4JFTA 4QLLA 4XB3A 3WQ6A 4Z2LA 2MANA 1VF8A 3SEPA 3TTSA 3W6MA 1BYCA 3CZ8A 1VFOA 3MMDA 2E8ZA 1GPFA 1TR1A 2WVTA 2YBTA 2WMHA 4BF7A 3SUUA 3BSGA 4X9YA 1JFHA 1LWJA 2E9BA 2UWFA 4KRUA 3VMPA 3WDRA 3WDJA 1GQLA 2XYLA 1UD3A 4JCMA 4E8CA 5ABFA 3WD1A 1LL6A 2GK1B 2WMJA 3WMCA 4PMRA 3QGVA 1W9DM 2J47A 1FOBA 1GHSA 3WMBA 4GI6A 1V6UA 1J11A 3S6TA 2C7FA 5D9OA 1RPKA 3WFLA 4RL3A 4PYSA 2Z1SA 3VUPA 1EQPA 1NWTA 1US3A 1WZLA 1JZ8A 1ITXA 1QVBA 4J3UA 3TA9A 5FKYA 5E70A 3DECA 4UFLA 4JIEA 1X6NA 3W82A 4CU8A 3WBEA 4GO8A 2XVGA 3ZSSA 4CD6A 2PBOA 4LYPA 1C92A 1AQ0A 3VDCA 3GH5A 2EBNA 2DDXA 3ALGA 1TVPA 1HN1A 2DIJA 3VIIA 1UD4A 5IXEA 3VGFA 2UY3A 4HPHA 1L8NA 3WEMA 2ZXQA 4GIAA 4URIA 2WZIA 5HOSA 1V6VA 3WD0A 3PTMA 3DYOA 3G6LA 3AYRA 5A8QA 2V38A 2E4TA 1CDGA 2B31A 1EDGA 3WNOA 2O9RA 4KGLA 3N17A 4Z2GA 4GI8A 3VIHA 3L4VA 4F9DA 2BNJA 4XZWA 1WKYA 4OBSA 1MW0A 3F5KA 4CU7A 5CSYA 4ZXLA 1HKKA 1JYNA 4F9JA 3CUJA 3AZRA 5D9PA 8CGTA 1NARA 1NWUA 6TAAA 1B2YA 5ABHA 1B3ZA 1OBAA 5M5DA 2CXGA 4U5KA 4AZ6A 1ISZA 3UG3A 2XJ7A 4AD3A 2WHKA 4QCEA 5A6SA 3CZKA 3WENA 1EHAA 4Z2HA 2HVMA 3MUIA 2W5FA 4M24A 3EDEA 1BPLB 3KE0A 4OBRA 3T0AA 3W25A 3PZVA 3AIQA 4TX6A 4HP5A 1ZJBA 3BAXA 2ZX6A 2WXDM 1A3HA 3L2LA 3GXFA 2XPKA 3UETA 4UFIA 2X1IA 2WVUA 2IXUA 1HL9A 2DT1A 2ZX5A 1LL7A 4JFUA 4MB5A 3L4UA 5A8OA 1M01A 1JFXA 5AC5A 4JHOA 1UD2A 3OGSA 4M29A 1BGAA 3SURA 5ABEA 1VIWA 4B9ZA 2GJPA 4AD2A 3RILA 3HU7A 1HF6A 5C8BB 1H1NA 1GQKA 1AQMA 2X09A 5CSUA 1ITCA 2VL4A 3AIUA 1UR2A 3VGDA 1NH6A 2XHYA 3QHOA 4HA4A 3CPUA 1UA7A 1VRXA 1BTCA 3CZJA 1WE5A 4CVUA 2E3ZA 4LXFA 3WQ5A 3ZO9A 2VJXA 3EDDA 1C90A 1MWOA 2XWDA 5AYBA 3UG4A 1ISVA 1J0ZA 2BY0A 1OT1A 2DH3A 1H0IA 4TUFA 2BHYA 2AOSA 4AD1A 1UWTA 1JXJA 4AIOA 1MFVA 2WLZA 1ECEA 5FIPA 2PB1A 1B31A 5CPQA 1UR1A 2OYKA 1KFWA 4MDPA 5I23A 1NQ6A 1EIBA 2C0HA 1GHRA 4WKFA 4YHEA 2CKRA 3ARWA 1V3JA 3K8KA 5BCAA 1VFFA 1YQ2A 1E55A 1CXIA 1OGSA 4PN2A 2A3EA 3FN9A 1I75A 4LGXA 5IDIA 1ZBKA 3AISA 4AZCA 2QMJA 3WNNA 5I6SA 1NWRA 2NSXA 1LWHA 4HMEA 4ZE4A 1JIBA 2GJXA 4CUCA 2QHAA 1DP0A 2VRJA 2WLYA 3BAIA 5CG0A 2Y8KA 4U2ZA 1U30A 2VCCA 1MXGA 2VTFA 3B9DA 4H8VA 5FCZA 4F66A 1E4NA 2W61A 5D4YA 4OJYA 1WNOA 2J62A 4DUVA 1HT6A 3PZUA 1XV8A 3MSDA 3GZAA 1XD0A 1US2A 2NW0A 4GI9A 1BF2A 3I3DA 2PWFA 4Z2IA 2G8ZA 4AWEA 1CENA 3B8SA 4AISA 4CD4A 3WUGA 1E6PA 1UD8A 3EMZA 2E9LA 1TA3A 1KGXA 4MDOA 5FL1A 4NRSA 2ZX9A 3NIYA 4GZEA 1D7FA 3ZT6A 5DT5A 4AIEA 1D2KA 5M3WA 5EMYA 1QI3A 4DWSA 5D8WA 3OLIA 4GZJA 3SCUA 1GJWA 1HVQA 3TP4A 3VD4A 3F4VA 1KGWA 4JHZA 5E9AA 2EPMX 5A94A 3WD4A 3CBWA 1SYTA 5M17A 3WEZA 5GQBA 3ZT7A 3K46A 1E71M 3ZMRA 3BMVA 4LQ1A 2XG9A 1A47A 1CNVA 1NOUA 2JIWA 3M7SA 1JDDA 3AFBA 1WDSA 5A95A 1WDRA 1BVNP 3ZT5A 4FMVA 1EDTA 3T0DA 4M56A 4ML4A 2BVTA 3D5HA 3VPLA 3BGAA 3U57A 2D1ZA 1B3YA 4FK9A 1E0XA 3OIHA 3O2LA 2XSAA 4XX6A 3SCQA 2DSKA 3QOMA 3MANA 1JF5A 2JIEA 4CD5A 2D3LA 2OWCA 1J12A 5CXPA 1P6WA 1G94A 4MPKA 1VB9A 1CLVA 3MMWA 2W92A 3VNYA 5A8NA 2BVYA 4DM2A 3PTQA 2J8FA 1CYGA 3VD7A 3SUVA 1B0IA 3T2QA 1GW1A 1CGWA 1JG9A 4PTXA 4RE2A 4HA3A 4ZFMA 1E43A 1Q4NX 1JAEA 1B9ZA 5HBFA 2VZOA 7A3HA 1W9UA 3KL0A 4AY1A 1EO7A 2DGAA 1QI5A 3FNDA 4CN6A 2YL8A 5EFDA 4TX8A 3VNZA 5GNZA 3GXIA 3VX1A 5DT7A 1CXKA 3W6LA 4JFWA 4M81A 4U2YA 2FH6A 1MW3A 2J75A 1ZS2A 1XSKA 1TG7A 1HXJA 4GQQA 2YIHA 2YA2A 2BS9A 3AIEA 3UG5A 1E4IA 3QOKA 4XZBA 3SUSA 2YL6A 1R87A 3ZR5A 3CGTA 4JKKA 1MW1A 1E6QM 3WH8A 1V6XA 3VIJA 3CO4A 2JF6A 3AXXA 1MQRA 2W63A 4P8XA 3CH9A 4NRRA 3AMLA 2Y5EA 4WSJA 3CHCA 1PIGA 2PC8A 2ZWZA 4EE9A 2J7FA 3GNRA 1IT0A 2WMIA 3B9AA 1FFRA 3NDYA 1WZMA 2GDVA 4D1JA 1DEDA 9CGTA 4Y7EA 3AS0A 2BY1A 3VTRA 3WQWA 2FHBA 1ESWA 3IAQA 1O6IA 1H09A 1OB0A 2Y4SA 3L4XA 4W88A 4LYRA 3SCTA 3WF0A 3ARVA 2WVSA 2WSPA 1CXFA 1H5VA 1X1NA 3N13A 5EB8A 5IHRA 2X0HA 3WL0A 1TUXA 4JFVA 2HISA 3VGHA 1JDAA 2WHLA 3S2CA 1QOXA 5CQ1A 2J8GA 2V3FA 2JE8A 1KXQA 2CBIA 2EPLX 4ZXOA 1QBBA 3T2OA 4E2OA 1BAGA 2VR4A 5EFFA 2J79A 4UFMA 3WH9A 1E15A 2F2HA 1UD6A 3I3BA 3WNKA 1KXHA 4K68A 4ATDA 4UQBA 4IUGA 4UR9A 1OD0A 1BHGA 1VEPA 2PWHA 2CEQA 3VO0A 4WKAA 3RMEA 3W0KA 1JL8A 2G3IA 3L2MA 2WZEA 2YLAA 4AZ5A 2DIEA 1MVYA 3MS8A 2A3BA 4WIWA 4EK7A 5A2AA 3AMKA 3WIJA 1UWQA 3GBDA 1XSIA 1FH8A 3MKKA 3AMGA 2J4GA 1M53A 3BXWA 1VEMA 1WDQA 1DWGM 3AZSA 1CXLA 2JF7A 1J0KA 1NP0A 2UY4A 3VD9A 1BLIA 3BAKA 1UR8A 4UFHA 2BY2A 2VURA 4W86A 1MXDA 6CGTA 1TCMA 1JZ6A 2A3AA 1J0JA 2DSUA 4J7RA 4AZHA 2A3CA 1H3GA 5I77A 1N82A 4R27A 2ZUTA 3ARTA 1CWYA 3N15A 3GYCA 1UKQA 2X2YA 2WM0A 2GUYA 1CGXA 2OSYA 3ZOAA 1OSEA 3VOCA 3VM5A 1XGZA 1HL8A 1EOKA 1HIZA 6A3HA 1HJVA 2QMKA 2ZIDA 4U33A 4LX4A 2FHFA 2ESCA 4GXPA 3N18A 5A6MA 2CKSA 5ABFB 4DUWA 1HX0A 1Q6FA 1QNPA 3AJ7A 2CCRA 1V6YA 1E9LA 3PTKA 1B1YA 3WUEA 3K4AA 4AD0A 4HMCA 1QNSA 2VCBA 4NF7A 1JI1A 3QHNA 3AIVA 1UH4A 4MAZA 3HN3A 1MW2A 1GOOA 5AC4A 3KL5A 4N42A 1TFVA 3BC9A 1ZB5A 2AMGA 2O9PA 1XYZA 1UR0A 1KCKA 3EYPA 4J3TA 5HDRA 3W4RA 1G0CA 3SCWA 3WF4A 2RGLA 2D3NA 4F8XA 2YDSA 2WNWA 2XGIA 1CEOA 1C3FA 5M03A 1ZBWA 4AD5A 5CPSA 1V3MA 2EJ1A 2ZXDA 3G6MA 5IFPA 3W81A 3WL1A 1OGBA 3IJ7A 2Z1KA 4WKHA 1HJWA 5A6BD 1IZKA 4BQ5A 4FLOA 4KRTA 2F8QA 3IK2A 1VEOA 1OGGA 1QNQA 5JBDA 3VIOA 3CHDA 4H2CA 3KEHA 3TOPA 4OOUA 1PX3A 1WZKA 2ZUUA 5BXSA 1QBAA 4M80A 2YL5A 4A3YA 4IISA 4FLSA 5F7UA 1C7TA 3CZLA 1OINA 1CTNA 3JUGA 3SUTA 3UCQA 4YHGA 4S3KA 4ATLA 1JYXA 2XFYA 1X6LA 1LG1A 2CPUA 4HU8A 3PZIA 2NT0A 3WELA 3AICA 3THDA 1EQCA 5AYIA 1UG6A 5CGTA 4PTVA 1QNOA 1V0LA 1BYBA 2WYSA 4WK9A 2OWWA 1ODUA 3CUFA 3U5UA 5KEZA 2FHCA 4RE4A 1NM9A 1OIFA 2V3EA 1JZ4A 4AZBA 3PBGA 1B3XA 1PPIA 3GXDA 2G4FA 2WVVA 2WANA 4GPNA 1UZ4A 2CHOA 2GJRA 5BRPA 1MYRA 1LG2A 4DWSD 3J7HA 4D71A 4DM1A 1C8QA 1XH0A 4AZGA 3W29A 1YHTA 1GOKA 3MSGA 4H04A 1J0IA 1QI0A 1HKJA 2C8NA 3L4YA 3ARQA 2YA0A 3MU7A 4UQAA 3SCVA 1PAMA 1E6RA 1K9EA 1M7XA 2J7DA 1VFUA 3PZTA 4UNIA 1UQZA 2ZWYA 4ACZA 2VZSA 4W93A 2VT0A 1KBBA 3RJYA 1H41A 1KGUA 4MNMA 3VIMA 5BYWA 3WDHA 1OM0A 3WUBA 2EPNA 1C91A 1UHVA 5LA0A 2XVKA 4D6GA 4WF7A 4D6CA 2XSBA 1I1XA 3N9KA 1QW9A 5DF0A 1UH2A 2CESA 3VD3A 2XVNA 5JBEA 4P8VA 3NSNA 3VDAA 2CBUA 4XUYA 5A6KA 3WQ8A 5GPRA 4BCEA 4QLJA 3MV11 3PZGA 1H49A 4TVCA 1QI2A 3SCPA 1PZ3A 1XCXA 4W5ZA 1ODZA 4HZ7A 4A3HA 4JL2A 1LJYA 3AS1A 2VVNA 3AQUA 3PZQA 2QLYA 1FH7A 1WO2A 2WMKA 2ZX8A 1VAHA 2GDUA 4X0NA 2VNCA 1HVXA 5GNYA 2QPSA 3RO8A 4AZCB 1BVZA 3FAXA 5LYRA 4UQCA 3THCA 1V3KA 2DQXA 5I2UA 1JI2A 2J78A 2GVYA 3ZJ7A 1ZBCA 1W32A 1V02E 2GJXB 5E6YA 1H11A 2IUZA 1H0GA 1VJSA 3OA5A 5BXPA 4Q22A 1RH9A 5ABGA 1IV8A 2WKGA 1GVIA 4KH2A 3APGA 1B3WA 1HJSA 1W9XA 4W84A 3WQVA 2VI0A 4BQ4A 2BY3A 2WMGA 7TAAA 4TVUA 1BQCA 1ZBVA 2ZUMA 3VINA 4L4OA 1UD5A 4OIFA 3ZJ8A 5HPOA 4AEEA 3NJ3A 3KZSA 3VGBA 1C8YA 3GDBA 2PWEA 1CGVA 3N1AA 2YBUA 4AIUA 4UZUA 2IXVA 3W24A 1TE1A 2OLHA 4AEFA 3AXIA 1JXKA 2VQUA 1E70M 4F79A 4GKLA 1E6SM 3BAJA 2BHUA 1TA3B 2DPEA 3WDIA 4HTYA 2WC4A 3NDZA 3IAPA 1MQQA 5I78A 5BRQA 2AAAA 3MUY1 4CU6A 3VGGA 4IPLA 3WMSA 3OGRA 4PRWA 2EQDA 2X8RA 2J7HA 4DWSB 2QV4A 4X0VA 2D24A 3T0BA 1RD6A 3N11A 3OGVA 3IJ8A 3T09A 3K8LA 3VILA 1RP9A 1R85A 3VGEA 3ZQ9A 3W37A 3UEQA 5A1AA 1CLXA 1C7SA 3WH6A 3EBVA 5BXTA 1J10A 1GJUA 4UOJA 2WB5A 4YPJA 3EMCA 3WEOA 1W2PA 3EMQA 4WJXA 4PMOA 3RIKA 2XTKA 8A3HA 3L4ZA 5LA1A 3CUIA 4PEEA 2XFRA 1WCGA 3OLGA 3L4TA 3FHAA 1W3LA 1W1TA 3BCFA 2CETA 2ZUNA 3ARZA 1UR9A 4Z2KA 1DHKA 3BH4A 2XIBA 5A2CA 1W3JA 1CGTA 2E8YA 4CGTA 1R7AA 3AMCA 2EXOA 4WSKA 2D22A 2VZUA 3CIVA 1SMDA 1C93A 1GNXA 1VFMA 4CCEA 3U5YA 1E6NA 5HNNA 3FAWA 1XCWA 3SUWA 4BQ2A 2ZXAA 3AIWA 4CD7A 3DYMA 1GOMA 2VQTA 3N12A 4HOWA 5JBFA 2VMFA 3AI0A 4W87A 4A4AA 3VKKA 5KZ6A 3CUGA 4MJ4A 1FHDA 4HOXA 5IHSA 2WK2A 2EEXA 4HU0A 1DWIM 1LLOA 5I3DA 2E0PA 1KXVA 3AHVA 4U3AA 1ZL1A 1GCYA 3M07A 1WAWA 2O92A 4EKJA 1J0YA 1D3CA 4UFJA 1EA9C 4FLRA 1HKIA 2XWEA 3BMWA 1QI4A 4OUEA 2ZICA 1V0NA 1FFQA 3WUFA 3TTQA 4TOQA 2WAGA 4V2XA 4W5UA 3VMOA 4OKDA 5I0DA 1JZ3A 1B90A 4KMQA 2WWCA 1EDQA 3ARPA 4B3LA 5DO8A 3T08A 1S46A 2WMIB 1F4HA 1GZJA 1CPUA 2VZTA 2WW5A 4CN4A 2V5CA 1EXPA 5CLTA 2YA1A 3K4DA 1L0PA 4JKLA 1PIFA 4P7OA 3O9NA 1UWRA 2ZOXA 4S3JA 1NP2A 2WCAA 4B9YA 1CGUA 4CVWA 4D1IA 4W8AA 3GTNA 3UERA 4PMVA 3M46A 4PTWA 2FDMA 3AYSA 3NSMA 4AW7A 3QR3A 1UQYA 1KR1A 1E40A 4IM4A 4PBGA 4V28A 3PZNA 5CPTA 2VUYA 4H41A 4D6EA 3POCA 3E1F1 1V0KA 5HXMA 4TVDA 2OSXA 3WF1A 3WD2A 2WSKA 1W1VA 2E40A 3AIRA 2J7CA 5D9MA 2WC3A 1FHLA 3RM4A 3SCOA 3LPFA 4HZ6A 2QPUA 4GQRA 1V02A 1HP4A 3I3EA 3HJEA 3ZJKA 4PUEA 1UKTA 1CECA 2V5DA 1M04A 5C71A 1G9HA 4QLKA 1KWGA 1V3IA 3OB8A 3WNPA 2XVLA 4HMDA 2VC9A 3A6OA 1E5JA 3O6AA 2VRKA 3SCSA 1JAKA 1JDCA 4AZ7A 4QP0A 2WC7A 2XIIA 4JFSA 4TTGA 3GXMA 5JUVA 1LQ0A 4P8WA 4UQDA 2VX5A 2XM1A 3F5JA 3RCNA 2WZHA 1JZ5A 4QAWA 3ARYA 4KGJA 1CBGA 1DWFM 2F61A 2XM2A 2V3GA 4C7DA 5FOOA 2YL9A 2GK1A 5HPCA 4J28A 4UTFA 3K8MA 4DWSC 2VX4A 3W26A 3AS2A 1W1YA 3WQ4A 2DT0A 1UOKA 2FGLA 1XRVA 3AXHA 1NWSA 4PSPA 4L4PA 1Z32X 1K9DA 3WDPP 3WNMA 1GOQA 1Q6CA 1QHZA 2DSWA 1W9VA 2WCSA 1UWUA 2J7BA 1W2VA 2WCGA 1VJZA 3DHUA 3A4WA 3ARXA 1G1YA 1EGZA 1W9PA 1ZJAA 4AZIA 2BXZA 3CMJA 1SFSA 5LA2A 4DUXA 5E6ZA 1XC6A 3ZM8A 4PMXA 1PBGA 2PBGA 4P7LA 4QFUA 2G3JA 1U2YA 1G01A 2J77A 4MB4A 4J3VA 3KL3A 3RM9A 2YJQA 1QPKA 3FY1A 3VM7A 1KCLA 4MB1A 2JEQA 4HPGA 2JFEX 1E6ZA
chains in the Genus database with same CATH superfamily
3QC0A 3KS6A 4RE3A 2WKLA 1DWJM 2CITA 2J74A 1W37A 2D2GA 2Q8XA 4LALA 4DAFA 3BVJA 4YVPA 4US6A 3IIPA 3NEHA 3QKZA 1B57A 3EB2A 3GH7A 2DSVA 3FXYA 2VUNA 1W3IA 2GGEA 3PSVA 3ZSTA 2X16A 5CZ0A 3HMJG 3WN6A 3BJSA 3VD5A 3JS3A 3BO9A 1IEXA 4LUIA 2FZ8A 4KW2A 1CB7B 1VQTA 1W1PA 4W89A 3ELFA 6ALDA 3WY1A 4TXEA 8RUCA 5AYXA 2QF8A 4HA1A 1OX5A 5D30A 3WLSA 3AMDA 4NZFA 4D6DA 1YIXA 2RDWA 1KM4A 3NPWA 2EO7A 2FB2A 3H2FA 2VDGA 1VENA 5BROA 3LHUA 4Q7NA 4WDWA 2NVAA 1XRTA 4DO4A 2QCDB 3GNPA 3L2IA 3HG4A 3L0GA 4HYRA 5D32A 4X3ZA 1KR0A 4PMNA 1RA0A 3CT7A 5HQEA 1SZGA 1Y5XA 3NG3A 1GQIA 2Q71A 4W8BA 4OZOA 5CZJA 1GVQA 1SGJA 3E5PA 1OCQA 2NUYA 5G2IA 5ABTA 3WH5A 3PB0A 5FF4A 1BG9A 4JTHA 3LHWA 1G7UA 3F4CA 3GH4A 2CLMA 2J24A 3L4WA 3VFLA 3GR7A 3AHZA 3ATZA 3WBAA 1OWQA 4DF2A 3JRKA 4MZ8A 4ACZB 1JF6A 1RLCL 2G41A 2EG8A 1U1UA 2IKIA 3WG6A 3VE9A 1A50A 1TZ7A 2E7FA 2EPOA 1WB0A 5EMLA 2R8WA 4MJMA 2CW6A 2V2DA 1ISYA 3ABOA 2WPBA 3TTYA 1SJDA 5FF3A 4MAVA 3C8NA 4H9UA 4WLCA 1M1BA 4GJJA 3S1XA 3CPRA 4C6BA 1OFRA 3ZS4A 1SR0A 2PCEA 4KFNA 4BQ3A 4NQ1A 2VOTA 1R2SA 1U33A 4YN5A 3URBA 1YYAA 4JY8A 5I24A 5HMSA 4PMQA 3NZRA 1LUCB 4I9JA 3QTPA 4WHBA 3A47A 1FRBA 2G5WA 1YTEA 3VZZA 2O4QA 3VOGA 4C7FA 1AK5A 3C3UA 4NU7A 2X2GA 1H7RA 3IARA 1Y5WA 1GOIA 4KEVA 1WBHA 4XVEA 3LEPA 1PX4A 3CT2A 4BWLA 4XV0A 3UR8A 4AXNA 1E4LA 2YDRA 2QDDA 4P7RA 3GHRA 4QDMA 5AYYA 4MFEA 5HAOA 2BGQA 5BWFA 2DH2A 3SRFA 1RSCA 1E56A 1M03A 2YW4A 4A2RA 2J9ZA 3RAOA 1EB3A 3GDRA 3BLPX 4K7VA 1XLHA 3GFXA 2GGGA 4AIBA 4HYVA 3KS5A 2UBPC 5D2XA 1W3KA 3BCDA 3AS3A 4IQEA 1S5NA 4Z17A 3HG5A 4C6CA 3VCCA 4KESA 1SQ7A 3EX3A 1K9FA 1QPQA 3QW3A 4LPCA 4KIEA 1V7YA 3II1A 1EC8A 1QW8A 3S0CA 3E5BA 4LS1A 3SDOA 2OLSA 3LNPA 4C7GA 1H4PA 1EJRC 2D0HA 5FESA 3CLWA 4JZ5A 4IP7A 4LH8A 1UKOA 1L9WA 4KCUA 5KZMA 3DI1A 3N25A 2D20A 4M7SA 3NPUA 4S2BA 1TJ0A 1Y8BA 1A5NC 3G77A 3QV8A 3TONA 3N73A 1J9YA 1GVFA 2UY5A 1OD8A 3FJ4A 3BLKA 3RYSA 2PC4A 3WH7A 4PMUA 4IIEA 5H8UA 1J18A 4WVXA 3UR5A 4MJ2A 5L6UA 5JIWA 2O9OA 4JKMA 4U3CA 4C90A 4GG9A 1UH3A 4O0KA 1M5WA 1R3SA 4M6VA 4GH1A 4O4WA 2C18A 3BL3A 4S3CA 3NPXA 3FKKA 3NYDA 3TJ4A 3WSUA 3N4FA 4AMAA 3WLQA 3STCA 4NZCA 4DBSA 4LOCA 5I7GA 3LHYA 1TV4A 3L65A 3TMLA 4AU0A 3SCNA 1F3WA 1TMLA 1O5RA 1EJXC 3GK0A 3SRKA 4EWJA 4J3SA 1JZ7A 4LYKA 1JD9A 2FFCA 1G4PA 1SMAA 1WA3A 1JNDA 3VOJA 2Z2BA 4DXXA 1EP2A 3V5OA 3RRXA 2PZNA 3HG3A 2WWDA 3APTA 3WKZA 4E8DA 3GNOA 1F5ZA 1XFCA 2KAUC 3G1AA 1WAUA 2QCHA 1VBUA 5K3VA 2PDBA 3GUGA 2BFGA 1WX0A 3H55A 1AW2A 4DZAA 1R7OA 4B15A 4CN1A 1EO5A 2WPGA 4PRTA 1JD7A 3R0UA 4O1DA 4ERGA 2FMNA 5FSDC 2PGRA 5D9NA 1DTUA 1WPCA 2VCAA 1TVNA 2D2JA 4ZSUA 1FCBA 1OT2A 2LLEA 4LF2A 2FPTA 1M9HA 4XK2A 1W1IE 5D02A 4MM1A 1V6WA 3S9YA 4HHHA 3PZMA 4PCSA 2D0GA 4AG0A 5I03A 3LSBA 1VBRA 3NQ6A 4EAYA 4D72A 5CGMA 1NIUA 3BGGA 1H60A 1Q8JA 1PXGA 3ZR6A 1A5SA 2PLMA 4W7VA 2WNZA 4R7WA 3T9PA 2EPKX 2XIQA 3GRIA 3ITYA 1OIMA 3HG2A 3OVPA 4AD4A 3E9AA 3EX4A 3M0XA 2G3MA 4H8HA 1TYGA 5G2WA 5E09A 3TLQA 1BFNA 4IMEA 1UZ1A 1W9BM 3W1PA 3BPWA 2TAAA 3UZXA 2I57A 1HO4A 2O55A 1Q45A 5EKYA 4MNLA 3BLLA 4HJWA 3PN8A 3NCOA 5A8PA 4H7VA 1N2VA 1ZAIA 3ZVHA 3K1DA 2X1UA 3V3WA 5BXRA 4RK8A 1UR4A 4FAMA 2C71A 5DFAA 4QLLA 4XB3A 5I09A 1WQ5A 2O56A 2PDUA 2MANA 3TEVA 4O13A 5DCBA 3SEPA 4AUBA 5E1QA 1BYCA 1FWCC 4RDWA 1O12A 1R3TA 3TXZA 1T99A 3OYXA 2YBTA 1LBLA 2WMHA 2J6VA 4G6CA 2DJXA 1JFHA 4KRUA 3VMPA 1GQLA 2XYLA 1AL7A 4ZL1A 2QAFA 4PMRA 2E6FA 1O1ZA 2J47A 1GHSA 1TELA 2HXTA 5C55A 2OTDA 3VKJA 3W84A 2OJPA 2HK0A 3VUPA 1F8IA 4HCLA 3P82A 4KCVA 1TV3A 1ITXA 1JZ8A 4O1AA 5E70A 4EX4A 2WSRA 3OYZA 2I16A 3C86A 1N8IA 3EWYA 2PZ0A 4CU8A 3GTHA 1QATA 4NIRA 1B4EA 1AQ0A 3GH5A 1QUMA 3ALGA 3F2CA 3DFPA 4FXFA 2QIIA 2GVGA 5RUBA 3SN4A 3DKJA 4GIAA 4OUIA 2OELA 1DJWA 1V6VA 3FFSA 1PB0A 3DYOA 3G6LA 5A8QA 3IJLA 2E4TA 4FNSA 4R3UA 5G4EA 5IOBA 2GGHA 5ECVA 3G8EA 3N17A 4GI8A 1I0BA 3VIHA 3L4VA 1KTNA 4F0RA 4UMCA 5GVJA 1MW0A 3F5KA 3RR1A 2RDXA 3FVMA 4RXGA 4O1BA 4JTGA 2EHHA 3MDUA 3TK7A 1LOSA 3IUHA 6TAAA 1XUZA 3RO6A 3SZ8A 4MF4A 1B3ZA 2CXGA 4LY8A 2VC6A 2XJ7A 4LV9A 1EHAA 3WBXA 2HVMA 1FUYA 3VZXA 4M24A 3EDEA 1SFLA 3W25A 3PZVA 2H6RA 4JYFA 1ZJBA 3BAXA 4DB7A 1TPB1 3G22A 4AEOA 4O28A 2X1IA 2IXUA 4MB5A 3GNNA 3L4UA 3M41A 4DPQA 4TIMA 1UD2A 2PDKA 3CQJA 1J5TA 1TPFA 1RY8A 2ZRWA 4LAKA 4NX5A 4M7TA 4LB3A 1JRCA 3PWAA 1HF6A 5DRCA 5C8BB 2YYUA 5HMDA 1YMYA 3IIXA 3QQ1A 5CSUA 3OO2A 3NQEA 4XVDA 4NJJA 1UR2A 4BR1A 4Y2WA 3KM8A 2AQVA 2JBMA 2VEFA 3G1FA 3CZJA 4DYJA 2VEMA 3GO2A 3ZO9A 3TWBA 4AX6A 3MJMA 4QITA 5TIMA 2DUAA 5F2GA 5AYBA 3UF9A 1B3OA 4L6HA 3SI9A 3DOPA 2AOSA 3USZA 2INFA 1OFAA 1MFVA 4WXYA 4B2DD 5CPQA 1WKEA 1LROA 3AUOA 2FQIA 4WKFA 3ARWA 2CZVA 3L66A 4FI4A 3GE7A 4FR1A 3TFXA 4MUZA 1ZY9A 1CXIA 4RPPA 2O0TA 1MSSA 1ALDA 5IDIA 1FTXA 1R6WA 1FWTA 1OZMA 5I6SA 3FDKA 4HMEA 1UW9A 2GJXA 3KFTA 4DHGA 4J2MA 4NZ1A 2WLYA 4L1WA 5LHFA 3EWBX 3R1ZA 4U2ZA 1F2JA 2VCCA 2IW0A 1MXGA 5FCZA 4H8VA 1V93A 1V51A 2CLEA 1A3WA 5D4YA 4AH7A 4OJYA 1JUBA 4DJFA 5G2HA 3QZ6A 1IEQA 1SJCA 1XD0A 4JX5A 2PRLA 3N2BA 4K1WA 4X22A 3R0DA 4HN8A 2OLAA 4L1GA 1BF2A 2DVUA 2H9AB 4ES4A 4Z2IA 4H6EA 4I6VA 3ABXA 3GW3A 4MUPA 4AISA 2OGYA 1XFBA 7ODCA 4G9PA 1UD8A 4HSNA 3NVDA 3SADA 3CYVA 1XLMA 4JQ2A 1KGXA 1A4MA 1ZJIA 3QM3A 2ZX9A 3B8WA 3BV7A 4IXXA 4WX2A 5EMYA 2Q09A 1S3HA 3DG7A 3OLIA 2DORA 1GVEA 2QEZA 1REQB 3VD4A 3F4VA 3L68A 4JHZA 3BLIA 1XLCA 1KCZA 1SO6A 4ZB5A 3CBWA 3WD4A 5M17A 2C1HA 2Z27A 5GQBA 4R7OA 3P93A 3OW1A 1MUMA 4AWUA 1S1PA 3ZMRA 4LQ1A 1EA0A 3EKLA 3P0XA 1OG6A 4EXAA 3NQGA 1RAKA 3R13A 1WKFA 4GABA 1JDDA 1WDSA 2YCKX 3RR4A 4X2RA 3M7WA 5A95A 2OQHA 5K4XA 3NQMA 3T0DA 1S2CA 2GVEA 3U57A 2VELA 1B3YA 1E0XA 3OIHA 3O2LA 3Q58A 1J8VA 3LM7A 3W1XA 5CSRA 5EGRA 1G94A 1VB9A 1CLVA 1V6TA 2Z1VA 1EXBA 4NZ3A 3WLTA 2V6AA 3QY8A 4O17A 2R91A 1B0IA 1GW1A 4RE2A 4C6DA 2VDIA 3UW6A 3GVVA 1JAEA 3N6HA 4A6GA 4JTCA 2QJHA 2AL2B 1ZP4A 2VZOA 1VBHA 7A3HA 3KL0A 3W7KA 1TPC1 1LTDA 2QCLA 2YL8A 4OE7A 2XH7A 4TX8A 1FY6A 3MWCA 4HIBA 3VX1A 1TV8A 5DT7A 3WX7A 3W6LA 4B4HA 1UPPA 1MW3A 3MP3A 4HPXA 4GQQA 2YIHA 5G1MA 3UG5A 4JIQA 1FWGC 3TWAA 1R87A 3ABQA 4JKKA 3P5YA 4XIMA 3WH8A 1TIWA 5M1TA 3VIJA 3CO4A 2JF6A 4MY1A 5AFDA 2DFAA 3HM7A 3WCZA 3L9CA 4AWSA 2Y0FA 1SZRA 3B9AA 1FFRA 2PGWA 3LCFA 4D1JA 1DEDA 3BOFA 4IMAA 7ENLA 1J2BA 1PTDA 3AS0A 2BY1A 1ELSA 4B92A 1ESWA 3IAQA 1OB0A 4LYRA 3QGAC 3S1VA 4AF0A 4K3ZA 3P81A 2IS7A 3IGUA 1CXFA 2VEKA 3QMSA 4IXHA 5HJYA 3TJIA 5I3GA 1GYMA 2PDLA 5IHRA 2Q8LA 1TUXA 2WHLA 2YCLB 3M4HA 4FB7A 4AHQA 1OADA 1LCOA 5CQ1A 4ROPA 2V3FA 4LSBA 1VP5A 4IOTA 2EPLX 4G1KA 4I5UA 5HMFA 3TN3A 4H01A 4E2OA 3QC3A 1TPEA 3AWOA 1VFTA 1W17A 3LLXA 3TJXA 3W72A 1UD6A 3V16A 4K68A 4F0HA 4WCJA 1VEPA 2PWHA 3R79A 3IIVA 1PZ1A 3JZUA 3WQEA 4CNOA 1E1CB 2X42A 1GZGA 4EK7A 4A8RA 4ZOBA 1UWQA 1M68A 3MKKA 3AMGA 2I7GA 4ZQOA 3W1RA 2I14A 3G1HA 1J0KA 1EIXA 4J40A 1WV2A 4UFHA 3EA3A 4EPBC 4W86A 1RALA 1AODA 3CQKA 4L9ZA 4QS5A 1EJVC 3HIJA 3QLDA 1MI3A 4AZHA 4PE8A 3UVAA 1H3GA 3BQ5A 1N82A 2CWNA 4R27A 6REQA 3GYEA 4FXSA 2EG6A 3LDVA 2X2YA 1TJRA 1EPVA 3P60A 4GIRA 5DQPA 2O7SA 1XIMA 4LX4A 2ESCA 4GYPA 4LUJA 5LKYA 3LB0A 3N18A 3RPTA 2CKSA 1X6UA 1KKOA 1B1YA 2ZQ0A 4HMCA 2PMQA 1LT8A 5TAOA 1NY1A 1F6KA 1QNSA 3NZ1A 1XC4A 4NF7A 3EXTA 3QHNA 2QVHA 4MAZA 3G18A 2P8BA 3KBVA 3KL5A 4NJHA 2P0OA 2O9PA 2RDTA 3KRZA 4DJEC 1O5XA 2PFHA 2W0UA 3NPVA 3W4RA 4YTTA 1Q6RA 2RKXA 5M03A 4AD5A 3LRLA 3FLUA 3WL1A 1IXPA 5A6BD 4FLOA 1UP0A 4F4RA 4XKYA 1OGGA 5D33A 3ITGA 5JBDA 3VIOA 3CEUA 4F48A 3KEHA 4FXJA 3IGHX 2YL5A 1NFBA 4FLSA 3VI2A 1OINA 1HG3A 2L5HA 1CTNA 3SUTA 4YHGA 4S3KA 2X0SA 2PAJA 3NAVA 3U48A 4JEJA 1OK6A 1P6CA 2CPUA 4JQ1A 4HU8A 3THDA 1EQCA 5AYIA 5CGTA 1NF0A 1EJTC 1V0LA 3DAQA 4GX8A 1YDOA 1SSDA 1GOXA 4QR6A 3U5UA 2VOMA 4RE4A 3WLMA 4JIIX 1XDJA 4AZBA 1B3XA 2G4FA 3VUSA 5D2TA 5K9DA 1UZ4A 3MKVA 4IP4A 4E4UA 4DWSD 3GW0A 3BG9A 5EMKA 2OXNA 1FDJA 1C8QA 3BLOA 1PKMA 4IMGA 4ZQRA 4FNRA 4ZTYA 3MSGA 5CBJA 1J0IA 2W79A 4IL2A 3PWGA 5A5WA 3W1UA 3MU7A 3GXPA 3R43A 3O06A 1Q85A 1L8PA 1AZ2A 4KWWA 1P0EA 3L23A 2VT0A 3M6YA 1KBBA 1ML1A 4PCPA 3VIMA 4GBDA 5BYWA 3H54A 4TMCA 2HSAA 2XVKA 1LBMA 4WF7A 4D6CA 1I1XA 4IJBA 1YEYA 4FF7A 1W6TA 2XVNA 4NKCA 2VWSA 4P8VA 2ISDA 3NSNA 2ZZ7A 4DNHA 3SIZA 1F61A 4RX0A 1H49A 2QUMA 5J5DA 1QI2A 4FS9A 3PC0A 4HZ7A 3EPMA 4A3HA 1TO3A 4V15A 4K8EA 3OTRA 5EMMA 3UZZA 3PZQA 2QLYA 1WO2A 1O95A 3KDOA 1OK4A 2GDUA 3OP2A 4HGXA 2VNCA 5GNYA 3LI1A 4AZCB 5F2LA 5CEWA 1EF3A 2J78A 2E1DA 3KBMA 3I65A 1W32A 1V02E 3CAWA 1DJYA 1NAL1 2G95A 3T7VA 2IUZA 4GUIA 5BXPA 1SZFA 4Q22A 1RH9A 4IP5A 1IV8A 2WKGA 1GVIA 2BASA 1ONXA 3B03A 3APGA 1US0A 4LY4A 4HSOA 2VI0A 2WQPA 3S5NA 1OVDA 3I6RA 3KZSA 3C3NA 4FNPA 4M6UA 5LXEA 1P0BA 2HROA 5FF0A 1C29A 2PU1A 3W24A 4D2JA 1XI3A 3EWCA 3AXIA 3GTFA 5J8LA 1YBQB 1QPNA 4LBUA 5AHMA 3OZMA 2FJUB 3FV9A 4DYKA 5TQLA 4LUSA 2AAAA 1DV7A 5HUPA 4UC5A 3WMSA 4WY0F 4GNKB 2PCQA 3W07A 2I9UA 2EGZA 1BRLB 3IJ8A 3VILA 4QHRA 3VGEA 4EWND 3WLNA 3N29A 4RW5A 5A1AA 1J10A 3LGEA 3MI3A 2ZZ3A 3EMCA 1QDSA 2PLKA 5HA7A 1IEVA 1QJWA 4H9XA 3M5VA 8A3HA 1W1ZA 4NUWA 2V5KA 3OLGA 3FHAA 4W4QA 5BRBA 3ARZA 1UR9A 3HFYA 4QISA 2D2HA 4B4FA 5A2CA 1UBSA 3GB6A 4EIVA 3AMCA 3WQFA 5A6TC 4GY1A 4WSKA 2A79A 3GG0A 4IG2B 1SMDA 1C93A 1XINA 1TB3A 1VFMA 4CCEA 3U5YA 3OVRA 1E6NA 2VDHA 3FAWA 1XCWA 3SUWA 1GT8A 3HQPA 3P6LA 5I3HA 2ZXAA 1U5JA 3CC1A 3JVAA 5HJLA 4CD7A 1GOMA 2VQTA 4IPPA 1OC6A 5JBFA 1WUFA 3GD6A 5AHLA 4A4AA 5KZ6A 3CUGA 5IHSA 2PDMA 4RLIA 4HNCA 3UWEA 4MG4A 2E77A 3FVDA 3E0LA 1NSJA 1JPIA 3AHVA 1ZL1A 4H83A 1FQ0A 5CPLA 1WAWA 1D3CA 5MKGA 1EA9C 4QNWA 2PD5A 3H70A 4S1FA 4XZ9A 1EUAA 1V0NA 3H2EA 3WUFA 3B8DA 4IQDA 3TTQA 4W5UA 2V5JA 4KT2A 1YPFA 2DVXA 4KMQA 1XIFA 4FIQA 1QO2A 1TQJA 3MSRA 4CLMA 1EKOA 2WMIB 1F4HA 2VZTA 3PPCA 3C4UA 1CX9A 2G0WA 3JR2A 2CHRA 3NO1A 1ZGDA 1L0PA 5C2GA 5XINA 4QSFA 3O9NA 1UWRA 2ZOXA 1NP2A 1XYAA 4IMFA 4PMVA 5BNKA 4LRTA 2YX0A 1AJ2A 4J1OA 3UWQA 3W75A 3LN3A 1HQTA 2HE5A 3W71A 3GTIA 3LRKA 1UQYA 3A23A 3U4AA 4WZHA 4PBGA 1QK2A 4V28A 3POCA 5HXMA 1XLGA 2NV2A 1LYXA 2XU2A 3SCOA 3LPFA 4JYDA 3TQPA 2Y85A 4IFKA 4HHPA 5DBTA 5HANA 2QF7A 3I3EA 5K2ZA 3GVWA 3ZJKA 4CQAA 1G9HA 1TPUA 1EEPA 4PA8A 2QCMA 4D8ZA 4F0LA 2VC9A 3HQNA 1H1YA 1W54A 1TVLA 4DBEA 1RQHA 3O6AA 3SCSA 2CXEA 3NQBA 4ADSA 3SN0A 1Z41A 3GXMA 4P8WA 1V79A 3TYEA 4XZNX 4JTLA 3RCNA 2H8XA 4QAWA 4MKNA 4ZO6A 4IGSA 1H50A 1J5SA 1T8QA 4C7DA 2GK1A 5E5CA 2VWTA 3K8MA 1Q4WA 4H6KA 4GY0A 1Q7QA 2PWVA 2ZA2A 4O1CA 3PJTA 4GXMA 4QQ3A 4L4PA 1K9DA 3WNMA 2J9YA 2P88A 3A9IA 3H2AA 1UP2A 3TSBA 3VAVA 2DP3A 3DHUA 3W7GA 4O8AA 1EGZA 4GRSA 1PE1A 2QJJA 3DBNA 4N6EA 1ONRA 4E4FA 4DZ5A 3UWYA 1KM6A 1LBFA 4O1EA 4JTFA 1TWWA 3RM9A 3FA4A 4NAFB 4J4KA 4CNUA 3TW7A 2YR1A 3P62A 3LA4A 4MB1A 2JEQA 4GXWA 3UWWA 2J66A 3W7JA 2DT2A 4J3XA 4U4MA 3BJFA 1C8VA 2Y24A 1I9CB 1NOFA 3AYVA 1Q6GA 3VKAA 5A3HA 4JNZA 3ITCA 3Q94A 2C19A 4JNYA 1GONA 3CUHA 1OEPA 1QO5A 4K7YA 5FEPA 3HO8A 1TTJA 3B8UA 3LQGA 3HGOA 4HK5A 3RDKA 1FDZA 2WHJA 3VIGA 2HPMA 2IPWA 1XH1A 3HGSA 3EAUA 4DVOA 2HBVA 1VGAA 2ALRA 2O9TA 1UUQA 3SIMA 3KBNA 4H7CA 3QFEA 4B3ZA 3KTCA 3W2KA 3T2PA 1VCFA 2NXHA 5AC6A 5G4HC 2WMFA 3TZNA 1GOWA 5LNSA 1IZJA 5A8MA 3DG3A 4DXVA 3E0VA 3RGTA 5EPDA 1E4MM 3E02A 4RCXA 2WQDA 2YBVA 3VIFA 2VYOA 4PC8A 4D6FA 1XBVA 5AYZA 2WVVB 1K7EA 3C0SA 4AHPA 2Y89A 4PTNA 3MMTA 4U5IA 1HJUA 5DMMA 1TMQA 3JZEA 1I8JA 2JK2A 3AOFA 5C7VA 1RCQA 4YIWA 3OA3A 1Z6KA 1CIUA 1PV8A 2DSZA 1PWLA 5ECUA 4FOUA 1E1EA 2X05A 2PLCA 3XIMA 2PA6A 5A6JA 4A35A 3JU2A 3ICJA 2NT1A 1Y7VA 3W38A 3OZOA 1I2QA 2XUCA 3GVGA 1DXFA 3MUAA 4G7FA 3CTTA 4BI5A 1TSIA 3PZ9A 2CU0A 3OZPA 3NL2A 1KM3A 2ZZ1A 4BFAA 3VE7A 3EDKA 4GQ0A 3UD6A 3A5VA 5AB3A 4MWAB 4UCFA 2OYMA 1UJPA 4ADTA 2OYLA 1FWDC 4AFYA 4N9BA 3RM8A 3NURA 2WHMA 1XUUA 4R5EA 1D3GA 4ERIA 1C9WA 3UXDA 1UWAA 3KBSA 3UQNA 4W85A 5K7JA 1XQKA 3ZJ6A 3VU2A 3M6DA 2HS6A 4XSLA 1CGYA 4AVFA 3CJPA 2X1RA 2QDEA 2JKEA 3M0MA 2PF0A 4XO6A 3TFCA 2CIPA 2J7GA 3UJEA 1OJXA 5LZLA 2W3ZA 4UQ9A 4ATWA 4NASA 5CJ5A 1FCVA 1FP9A 1Q6DA 3LV5A 3MHFA 3S3GA 2HWGA 2ABAA 2D0FA 4GH3A 5CCZA 1W8GA 3PAJA 1VYRA 3UA3A 4S38A 5J04A 3IS4A 4NZJA 1Q6OA 1M65A 3B9NA 3MVTA 3HMCA 3TC7A 4KCTA 2ZE0A 4IUOA 1HTIA 3OJGA 3W53A 2YDQA 2EJAA 1WXYA 4UOQA 2FGBA 4N9DA 1QOPA 3HA1A 4E4PA 1MO0A 1B4KA 5H8PA 2VFIA 4WDUA 3QY7A 1TCDA 1R86A 1TRIA 2PU0A 4JQ3A 4C1LA 2A4AA 1JGIA 3EX2A 1V77A 2YPIA 3M16A 4HQVA 3OBAA 1JCJA 1JNEA 1XBZA 3O15A 3O7UA 4IPJA 2GWNA 2HDJA 4QROA 3GG1A 4ICNA 3S42A 5DMYA 2B4GA 2BVWA 3RG6A 2Z6IA 3W85A 2J7EA 1K7FA 4PMYA 1NF7A 1H61A 4MTVA 3UR2A 3VKBA 1FWBC 3VABA 3WK0A 3SN1A 3W7CA 4IGHA 2BSLA 4LVAA 4B2DA 2PWGA 1HFBA 4OECA 1PYMA 1XKJA 3QPYA 4GC3A 3ALFA 3KAOA 4KEMA 2J13A 1KRBC 4DO6A 4M1RA 4PUDA 2VP8A 5D2YA 3NL6A 1E3ZA 1VPXA 4GC4A 2C0AA 4YXGA 4UTWA 3VIKA 5AKQA 4LC8A 5KZDA 3NUKA 1KFCA 4ZENA 3U2OA 4M0XA 1FWHC 3QXBA 3UXKA 1HP5A 3W23A 3ABZA 4ZTXA 1JULA 3MTWA 3NSXA 3DFOA 1POKA 2Z1WA 4HZ8A 1P7TA 3N2CA 2QGHA 1KC7A 3TR9A 1IF2A 1OC7A 5C70A 4JN6A 2YKKA 1J79A 1T5AA 1W56A 4NNCA 4HOZA 2IQTA 3T42A 3BSHA 4MJZA 4HK7A 3CIWA 2NXGA 3ZLGA 3I4EA 2CHNA 3DN5A 4TTUA 2XH0A 4TV6A 3E0IA 5GNXA 1JCXA 2E6YA 1XLFA 1HJQA 3BZJA 2E1WA 3GDLA 4N0RA 1QTWA 3DGRA 2OR2A 2VR5A 3M0JA 5A6LA 5CJNA 1F74A 3V5CA 4H8UA 3V75A 2CLHA 3GX9A 2W67A 2VO5A 3S46A 3EKZA 1DWHM 1SFJA 1UKPA 2A5HA 2REQB 2X0YA 4M8UA 4IIBA 6ENLA 3QV7A 3PHAA 4G56A 3TTOA 5I3FA 4PMZA 3RITA 2YZRA 2HV5A 1V8EA 3MO4A 3DUGA 4ZVJA 3G1DA 3CU2A 1PDYA 1KQZA 4PSRA 4AC1X 1DQUA 1ZSXA 4W7UA 4LS0A 5AZ1A 3IGXA 3NXFA 4ACYA 3VX0A 7CGTA 4DJFC 2R14A 2HE8A 3LPGA 2ZC1A 1LF1A 4JD4A 1GVRA 5JIPA 1JCLA 3A12A 4GVFA 4FF5A 4XBJA 5I79A 4OOZA 5EU9A 3LM3A 1UB3A 1GORA 1PWMA 1DE5A 1UUOA 3B9EA 1UA3A 3PUDA 3ARSA 3GAKA 3C2YA 3T4WA 3UESA 4B5WA 2ONEA 1V0MA 3VNLA 4ZMGA 3EA2A 1XYCA 1I1WA 4QE4A 1HGYA 4M19A 4F0MA 4KRZA 1VF8A 5KZEA 1GTHA 3TTSA 4LVFA 3MMDA 1CLKA 1TR1A 3AU6A 3G1XA 3SUUA 3GHUA 4S3GA 2UWFA 3U3HA 1S1RA 4RDYA 4JCMA 4E8CA 2CLIA 5ABFA 4O57A 3QGVA 3U0HA 2H90A 3GVQA 1I6NA 4X63A 3ABRA 4GI6A 1V6UA 2X1SA 3WFLA 4RL3A 1K70A 1GKQA 3LZ3A 1QASA 4S3EA 1US3A 1WZLA 1GJPA 3BMXA 1QVBA 4E5TA 1IZCA 5FKYA 4Y8EA 3O0KA 4JIEA 1X6NA 4FNUA 3FGCB 2Z4GA 4LTSA 5DMNA 3WBEA 4GO8A 4AWTA 4CD6A 1C92A 3SGGA 1HN1A 1T40A 1MDRA 1S38A 1UD4A 3L5MA 2YB4A 5FJOA 2BODX 1UPMB 1X1ZA 3BG3A 5HOSA 2V30A 1MEHA 1U1HA 2VGGA 4Q4MA 2Z7KA 3IV8A 4C1KA 2V38A 1CDGA 1ZFJA 1EDGA 3EB4A 5FI8A 5DX7A 3B0YA 3OEXA 1YNPA 2BNJA 3P3BA 3EWUA 1WKYA 3UWVA 1RHCA 5HULA 4ZXLA 3QV6A 3CUJA 3HPZA 3AZRA 4NP7A 5D9PA 1NARA 1NWUA 4QDPA 4UTLA 2I5GA 2P50A 9XIMA 3VNJA 4KQNA 5ABHA 3TYUA 5M5DA 4U5KA 4U28A 3UG3A 4AD3A 4Q4KA 4JY9A 1SSGA 4QCEA 2NZLA 4Z2HA 3PFRA 3BW4A 3MUIA 2WKJA 1RJQA 4L9XA 5AC7A 4OBRA 2DIKA 2XSXA 4GGHA 2QXWA 1DJQA 1MRQA 3L2LA 1J93A 2XPKA 1JEZA 4POCA 2WVUA 3EOSA 3QSTA 1JDEA 2ZX5A 2DT1A 4IT1A 4L7ZA 4YJ5A 1JFXA 2Y62A 2BGSA 1BGAA 4I5XA 4JIPA 3SR7A 1QNVA 4GJ1A 1DKWA 2GDQA 1GQKA 2A7RA 3UZWA 3EB3A 4GIEA 3AIUA 3VGDA 3W7EA 3QHOA 4X60A 4RNJA 5FAJA 5B7ZA 3M0ZA 1BTCA 3KVMA 1WE5A 1OYCA 3EDDA 3UT0A 1MWOA 3UG4A 4N7QA 3GU9A 3ZYZA 4DJED 1W1B1 1OT1A 3TTEA 2ALDA 2BOFX 1VZWA 4ZO9A 3URNA 2CLLA 3KWSA 2NWRA 1UWTA 4F2TA 2F7FA 2BTMA 2PB1A 1B31A 1EGMA 4ONVA 4ZO7A 1KFWA 4MDPA 1EIBA 1GHRA 2V5LA 4JOMA 5DRIA 1KM1A 1M7OA 3K8KA 5CC5A 3UBPC 1UIOA 1JDFA 4FOKA 4PN2A 1I75A 3M0KA 4LGXA 3PPGA 3MCMA 2QMJA 4WDXA 1BEUA 1EYEA 2WM1A 3B8VA 2NSXA 1LWHA 2INEA 3N14A 3TNOA 1SO5A 4ZE4A 3M5ZA 1ITQA 3CWOX 2QHAA 5JH1A 3AUJA 1DP0A 3U4FA 5H1WA 3NQCA 2Y8KA 1U30A 1POJA 4B5UA 3ME3A 2VTFA 1MEWA 2J6XA 1EP1A 1MNSA 1A4LA 2J62A 4I8YA 3OG3A 4GX9A 5C9UA 4IX0A 4AQLA 4PCFA 1PCWA 1US2A 2NW0A 3ONBA 4GYPC 5I07A 4LANA 3BZGA 3MO7A 3RLVA 1RVKA 4UTTC 4FO4A 1T6MA 4AWEA 4YS1A 4CD4A 3CB3A 4N4PA 2GOKA 4AVNA 4JR5A 3ZVIA 3LTSA 5JMUA 1TA3A 4MDOA 4F0KA 3MQTA 4NRSA 2ZRUA 3NIYA 2NSOA 1D7FA 3ITVA 3ZT6A 5DT5A 4AIEA 4L56A 3TVAA 1QI3A 4DWSA 3NQ2A 4GZJA 2C6QA 3PTDA 3GNXA 5FJUA 3FJLA 4FX7A 2CLKA 4LAUA 5A94A 1SYTA 3QTGA 3WEZA 3FS2A 3S5YA 2OZ0A 1BWKA 3ZT7A 3K46A 4ECLA 3R25A 1E71M 1RJPA 2OB3A 4DAIA 1CNVA 4K8GA 4H9ZA 5LHEA 1XXXA 3ERPA 4ZO8A 5G5IA 3E49A 2JIWA 4GVGA 2KX9A 3Q67A 1WDRA 1BVNP 5BMXA 2WJFA 1KV5A 3MDWA 4S3FA 1EDTA 4BF9A 4ML4A 3D5HA 1ZAHA 2SFPA 3WK3A 2OO0A 4XX6A 3SCQA 3W88A 3TN5A 1K03A 5CXPA 4YMZA 4EXBA 3UA4A 4MPKA 3DX5A 3MMWA 3MBFA 4DM2A 1EWDA 1CYGA 1VC4A 2QZRA 4ZZ9A 1JG9A 5CSSA 4PTXA 5KSWA 1XJBA 1OYBA 3UY8A 5HBFA 4GUGA 4J9JA 3S2JA 2DGAA 3N2MA 4CN6A 3VNZA 1CXKA 3O1NA 4JFWA 4U2YA 3TAKA 1XS2A 3FDGA 2J75A 4N2YA 2BS9A 3FA3A 1E4IA 3PS7A 3QOKA 3DG6A 4XZBA 4QE5A 2YL6A 2DZSA 3KRSA 3TDFA 4PUWA 1MW1A 3AXXA 3DFYA 1XLKA 3W7MA 4PBFA 2UV8G 2QIWA 2Y5EA 2PP1A 2PC8A 3NDYA 1P1XA 4OBTA 3WQWA 3VTRA 1P48A 1PTGA 3OIXA 3TNBA 3L4XA 1FXQA 1JCYA 4LS2A 3WF0A 3EOOA 2WVSA 1L6WA 4JX6A 4PODA 3N13A 4Q8PA 2BGNE 3PPFA 3CQHA 4NY2A 2X0HA 3WL0A 1IQ8A 4JFVA 2ISVA 3VGHA 4LEQA 3SSZA 3G3MA 4JTEA 4E0CA 3XINA 3NDOA 4O16A 3DEQA 4MKSA 2Q3OA 3CL6A 3T2OA 3N34A 1BAGA 2OT1A 3CO8A 3WH9A 3QPEA 1I2PA 4K39A 2F2HA 3DCPA 4O53A 1BQGA 3WNKA 4MWAE 4QG6A 3GTXA 3RMEA 4RUBA 2G3IA 2YLAA 4WIWA 2A3BA 5F4SA 5A2AA 2FYMA 1EGVA 4AAJA 3RU6A 4DNMA 3EGJA 2R9RA 3HZ3A 1KTCA 3SECA 3BXWA 1VEMA 4EF8A 1DWGM 1SU5A 1CXLA 4DF1A 3ANUA 3B04A 2FB3A 4LAOA 3EEGA 2YCIX 4JN7A 1MXDA 3ZVHB 6CGTA 4DXKA 2TSYA 1EBGA 3CV2A 5LIYX 2ZUTA 3N15A 4Q8UA 2WSYA 2WM0A 4GFSA 2GUYA 2OSYA 4FNTA 2A21A 5EYWA 2A85A 3UZJA 3ZOAA 2C79A 2QUVA 4KF1A 1DBTA 4HNUA 1HL8A 4TO8A 4L61A 4H9MA 1HIZA 1HKWA 1PSCA 1B9BA 2QMKA 1GKRA 4U33A 2OMAA 2TODA 1T8XA 3V35A 5A6MA 4NZ4A 3S83A 1QNPA 1KLZA 3GFYA 3PTKA 4AD0A 2H3DA 4XD6A 5I02A 1CI1A 5BWAA 4C5YA 1MW2A 1GOOA 4FX8A 5AC4A 1I4NA 1EP3A 3BC9A 1ZB5A 2PTYA 3W7DA 1TPH1 1UR0A 4IHCA 2W9MA 2VEPA 1S3TC 1RZMA 3V36A 4J3TA 4L5ZA 3SCWA 1LOLA 3WF4A 1CB2A 1LDCA 4F8XA 1RCXB 1CEOA 1C3FA 5CKSA 1V3MA 2EJ1A 4GNJA 3TKFA 1N55A 4B5NA 3G6MA 5IFPA 2Z1KA 1D8CA 3GSMA 1Z89A 1HJWA 2B81A 1R3YA 2Z24A 1XIBA 2RHGA 1VEOA 4CNTA 1VRDA 3CHDA 4H2CA 3ABSA 3L7RA 2ZUUA 1QBAA 4M80A 4A3YA 1AMKA 2ZRXA 1JPDX 1KFBA 3TR2A 2ACRA 1XPGA 3BICA 3JUGA 1Z44A 3DKLA 3WLHA 4E2VA 1X6LA 3S6OA 1JCMP 1UZHA 2NT0A 4LRSA 3WELA 2CLOA 4JNMA 3AICA 5C9ZA 1UG6A 4G1NA 2GYIA 3T4CA 5G4WA 1BTMA 1MUWA 3VKDA 1ODUA 2FHCA 3B06A 3N9SA 3EOUA 4GHRA 3GXDA 1TV5A 4GUFA 2GJRA 3H26A 1LG2A 3J7HA 4D71A 1EFZA 3F4DA 2R94A 4Q8OA 4AZGA 1X39A 1YTKA 4GUJA 3RK8A 1D3HA 4REQA 3CWHA 1R38A 3L4YA 1AD1A 3T44A 1QAPA 4UQAA 3WBWA 2OZTA 2F2KA 4A21A 1M7XA 1VFUA 4UNIA 2ZWYA 1KTBA 1P0KA 4W93A 5CPNA 4RR4A 3S9ZA 1RQBA 3T1GA 1XF0A 3VNKA 2CZ5A 2X1TA 3BG5A 1H41A 4K6AA 1KGUA 3V7PA 1OM0A 3WUBA 1UHVA 5LA0A 3WLRA 4D6GA 4I7UA 2BG5A 4DI8A 1O66A 3W7NA 1UH2A 3VD3A 4IIDA 4QJ5B 2P8CA 2AL1A 5H8MA 3VDAA 4HHMA 3NVTA 4G5DA 1LT7A 2CBUA 3QYSA 4XUYA 5GPRA 3GC5A 1TTIA 1M7JA 2PDWA 4BCEA 3QEZA 4WY0A 3PZGA 5K9CA 3M0IA 3HV9A 4Y9PA 3GC4A 3N2XA 1KM2A 1PZ3A 4BEQA 1ODZA 3HPSA 4AXKA 5BU9A 1S5WA 1K8ZA 1LJYA 3RCYA 4H1ZA 3H4GA 3FYOA 4YWIA 4FX6M 5D2VA 1UUMA 3RHGA 1W1A1 2GQAA 2C16A 4MZ1A 4Y6GA 3KVKA 3RO8A 1DPMA 3FAXA 5LYRA 3ZLHA 5LGZA 3QQWA 3THCA 4C6EA 1XLAA 3BJTA 1WBJA 3NQVA 2GJXB 4M3PA 3WQDA 1H11A 3KTXA 5ABGA 3UXAA 2RUSA 1IWBA 2GQ8A 1HJSA 1G69A 3G1SA 2WMGA 3DU0A 1ZBVA 5HWMA 2IKHA 4DBWA 1R3QA 1VYPX 1YDNA 3P0WA 1C8YA 2ATMA 3OHIA 1T41A 1CGVA 4WOZA 1IWAA 2E09A 4U10A 5BOEA 1OFEA 2YBUA 4US5D 3KOFA 2IXVA 2ZE3A 2GUBA 1DIEA 1HGWA 1JXKA 3WJZA 1VJIA 4A3UA 3HTWA 3TAOA 4GKLA 1E6SM 3BAJA 2BHUA 3M43A 1U83A 3S5OA 2DPEA 2RDUA 3WDIA 4HTYA 1EL3A 3L5LA 2WC4A 3IAPA 3M47A 1MQQA 5I78A 2PLJA 4A29A 3VGGA 4PB3A 4IPLA 2GVLA 1YRRA 3STEA 2EQDA 2X8RA 2J7HA 3LSCA 4C60A 2PURA 4GIYA 2D24A 3T0BA 2E5BA 3UWZA 1RD6A 4IGMA 3T09A 3K8LA 1R85A 3M0LA 5C54A 1XQLA 3ZQ9A 1XIGA 3W37A 1Z69A 2E6DA 3L0KA 5DMLA 4UOJA 2NQHA 5FEXA 2WB5A 2OT0A 5EMUA 5FJRA 1W2PA 1YX1A 1FWFC 3BARA 4PMOA 3GC2A 3RIKA 1DJXA 3L12A 1NDYA 5IBXA 3L4ZA 1TWIA 3CUIA 2XFRA 1WCGA 4RZ5A 3CWNA 5B80A 4PUNA 2ZUNA 3NO3A 4B5VA 2NVDA 4Z2KA 1YKWA 4Y90A 1DHKA 3F4WA 3BH4A 4Q8VA 4IQLA 3S6DA 1W3JA 1EEXA 2E8YA 1JR1A 2DZBA 1R7AA 5DELA 2EXOA 3Q37A 4E8GA 1IT8A 2QCCA 1RQEA 2HPIA 3FJ6A 5FEZA 3KVJA 3LLDA 3SRHA 1BXNA 2J8TA 3ISIX 2PDQA 1PZ0A 4MFDA 3N12A 2FPVA 4ZQPA 2NX1A 1PKNA 3DHFA 2XN2A 3VCNA 5LXXA 3XISA 3W83A 3AYTA 4MPQA 3EPOA 4U3AA 1SO3A 4IIFA 1HL2A 1J0YA 1L2UA 3QN3A 3IJDA 4FLRA 3BMWA 2HCVA 3VXGA 3EWDA 4RZ6A 1TX2A 5F1VA 4EOUA 4NAEA 1F8MA 1A53A 3WQGA 4LT9A 1NQKA 3R89A 2QGYA 3N4EA 3B9OA 3BANA 4OKDA 1B90A 3IVSA 2WWCA 4G7EA 4S3AA 2OKTA 3W9ZA 4B3LA 1QWKA 5DO8A 4S39A 2WW5A 3VNIA 4IF2A 4CN4A 1VD6A 1EXPA 3PG9A 5CLTA 4JHMA 3K4DA 1O5QA 3BOLA 1W8SA 1JGMA 4GYJA 1IIGA 1CGUA 5CPMA 4CVWA 2P3EA 2R1LA 1GGOA 4PMJA 3GTNA 1TR9A 3MYOA 1PCKA 4AF0B 3LYEA 3M46A 2XDFA 4PTWA 1Q7MA 4IX2A 4TV5A 4Q8NA 4ZCWA 2FDMA 3DERA 1QRQA 3KZPA 5AVNA 3P2VA 1UMYA 3O05A 4AY7A 3QR3A 3RPDA 1KR1A 4N9CA 1E40A 4IM4A 2Z0IA 5HATA 4C6JA 3CIXA 3KRUA 4H41A 7XIMA 3E1F1 5CBBA 3S2MA 3W1QA 3REQA 4O0ZA 3WD2A 1FCUA 1W1VA 2E40A 4LUYA 3FSTA 4HBKA 3LRMA 2BB0A 2QPUA 1YXDA 3AJXA 3CAQA 4GYKA 1TWSA 4Q8QA 1Q13A 4CNNA 3T8QA 5EY5A 2O7QA 2V5DA 3HPXA 5C71A 4QLKA 2Z1XA 2XVLA 3KCOA 1E5JA 3N3TA 1GZ1A 4IGNA 1JDCA 3SW6A 4AZ7A 5AHFA 2CFFA 4Q6XA 1BKHA 5F4XA 2NQ9A 2XIIA 2QJMA 4JFSA 5JUVA 4YCPA 1R2TA 3B8IA 4D8AA 1JUEA 3C6CA 3ARYA 2EG7A 1CBGA 2GQ3A 4UIOA 2XM2A 5FOOA 5HPCA 3UPBA 3PBMA 3H2CA 2VX4A 3V5FA 6REQB 4O12A 2HMCA 4PL2A 3LNMA 1Z32X 3WDPP 3OQ8A 4R85A 1Q6CA 1QHZA 4PRRA 4QJ1A 2J7BA 1W2VA 3T55A 3S5ZA 4FPSA 2NQLA 3A4WA 5XIAA 3ARXA 1ICSA 1G1YA 1TIMA 1W9PA 1ZJAA 3VC6A 3CMJA 2MUCA 3MC5A 2J88A 5CZTA 3R12A 2AKZA 1SFSA 1PBGA 1DJIA 2FZNA 2J77A 3UJ2A 4XTDA 1OY0A 1V5XA 4ORMA 2GPTA 1QU4A 4LVDA 1QPKA 4NG3A 4ZGYA 1BXCA 4HPGA 4I7VA 1V4YA 2XFFA 3PP7A 4GQGA 1A49A 3W70A 2GJLA 1UZDA 1KBKA 3LCGA 2Z1BA 3GHSA 5H2ZA 1O7AA 4JQ4A 1E73M 1Q8AA 4UTWC 3HFTA 4DJFD 3I6TA 4AMCA 3KUMA 1CXEA 1Q6LA 2B7PA 5TF0A 4XKYB 4MVAA 3NZQA 3B0PA 4KPLA 3FKRA 3O6YX 1GWJA 1YADA 3QHMA 3QBUA 1LL4A 1PKLA 4O18A 1VHCA 3IJ9A 3C8FA 3UG8A 2BZNA 5AY7A 3RXZA 3VDBA 4JTAA 2OEKA 2YB1A 1DWAM 1R3VA 3MP5A 4J27A 4I5RA 1VKFA 1F9CA 1XDLA 2W27A 2FGZA 4AHOA 4I7WA 2Y7FA 2A6LA 1S2WA 3BWWA 3BE7A 4DX3A 5I5RA 3GIQA 3ZIZA 5AHNA 2C3ZA 4ZBCA 3EWZA 2DUZA 1AQHA 3O6DA 3KWXA 2QKFA 3UWUA 1P6BA 4OT7A 2WBKA 1LRTA 1GVSA 1IWPA 4AYGA 2GFTA 2VGBA 1O1HA 2PDPA 2CNCA 1F3EA 3FA5A 3USBA 1GEHA 3HB9A 4UBPC 2I5IA 3LPPA 3D47A 4ZOEA 2GL5A 2WV8A 4GO9A 4HCDA 4TQTA 3P8IA 1BSLA 1PEZA 3RU8X 5A6AA 1MXSA 3W28A 5K9XA 3MY9A 3W27A 1T96A 2VVSA 3ENLA 2PGFA 1XIDA 2QCGA 3MV01 3IJIA 4P7QA 1XISA 3QR0A 2ZUVA 4L1XA 1ADDA 2WOQA 1XH2A 3DYPA 4C5ZA 1UASA 2ZA3A 2BLEA 5TD4A 3CHFA 3W86A 1JZ2A 2G3NA 2P1FA 1OQFA 5DCDA 1AH0A 4AC7C 1ZPTA 3OQEA 1AZ1A 1CT5A 1J0HA 2YLLA 2D23A 2V81A 1ZCCA 1J6OA 3LTYA 2CBVA 4BS0A 1SZEA 4UTUA 2C13A 3EDJA 3THQA 2J27A 4X9SA 3GVRA 3N04A 1RP8A 2PSNA 5HMEA 4JN8A 3A4AA 3EDFA 4YYCA 4NILA 4HKPA 4JIRA 1AVAA 3IIZA 4P8UA 5EBAA 3GBEA 1ISWA 3A4XA 4MNKA 5E0CA 7REQA 3AIBA 1OYAA 4XAYA 1FA2A 4NVTA 3CZGA 3L0NA 5DANA 2F6KA 2VC5A 3DFHA 1UKSA 4IWWA 3LHVA 3BLDA 1L6FA 4P5UA 1R8LA 1IXOA 4S3BA 2W66A 4CKQA 2Y5JA 4PCTA 1BYDA 1W5MA 4CCDA 4LCRA 2HS8A 3HPAA 4KWUA 1YXCA 4DN1A 4FEZA 4GYFA 4CCCA 3GKFA 4KETA 3MWAA 1ME8A 3LI0A 1UYQA 3AROA 3BURA 2DEPA 3STPA 1AMYA 2HQAA 3WZ0E 1PZ2A 8XIMA 4YCOA 1IXQA 3E2RA 3U6WA 2PRHA 3NZPA 2JKPA 2VD8A 3LZ5A 4XZIA 3OLEA 1J01A 2HXUA 4LUTA 2A0NA 2FKPA 2GSHA 4GZIA 2V63A 3I6EA 4MOZA 1P0NA 3H12A 2G3FA 4I90A 1KM5A 2OZ3A 4L6DA 3AWNA 1JPMA 1C8XA 4LUSB 1JCTA 2JEPA 1LM1A 4Z1AA 1GTEA 3IRDA 1E5NA 1R5YA 2V8ZA 5C2XA 2VRQA 1E72M 4D9PA 2FFIA 3HPFA 1FX6A 3SJNA 2WO5A 3VVGA 5A8GA 2OWXA 4C6LA 1VCGA 4IIGA 4QCFA 4IPNB 1V08A 2W91A 3SJ3A 2HRWA 3D6NA 1KXTA 2E9MA 3WLLA 3QKEA 4HB7A 1QPRA 4PZVA 1QFEA 1HNYA 3UCDA 1QHOA 3LBCA 5AVHA 3LX9A 3S47A 3ITLA 4EANA 2Y7DA 1WDWA 3TN6A 3Q45A 4XIAA 4B3KA 1UWSA 2ZVIA 2FH8A 1RJRA 4DELA 1FCQA 4XD5A 1EOMA 3M64A 1X1OA 5CZKA 1A80A 4Z2JA 2WJDA 3GKAA 2ODOA 4FHAA 2B7OA 2PDHA 1DJZA 2OO6A 3N2TA 3RNDA 5FD0A 1M6JA 1NFGA 3WF2A 2JALA 4C6NA 6XIAA 4P7NA 1LP6A 1PVNA 3INPA 3FW6A 2PD9A 3DXIA 3OPSA 1QOQA 1Q6EA 3BUVA 3I10A 4HU3A 3QV9A 3E6EA 1N7KA 3KBJA 5AHIA 3G5EA 2V82A 2DW7A 3MHUA 1DE6A 1YW1A 2OCZA 5MKGB 1E9YB 3ECQA 1CXHA 2PWDA 4WSHA 1V3LA 3ARRA 1MQPA 4OU1A 1HJXA 2VZVA 1ZQ5A 2XVPA 1JJKA 2PPGA 4B5XA 1E1FA 1EC9A 1K9TA 1OF8A 4ERAA 3H4WA 5FL0A 2VHLA 4R53A 3IVUA 4MWAC 1YLVA 4XUGA 3ANYA 5LNUA 1DORA 4LEFA 1NFPA 2R24A 3UY7A 3MYPA 3WQOA 4A22A 5A2BA 4BI6A 4M82A 3SQMA 2Z2UA 4D6HA 1WUEA 2V2HA 4KCWA 1JYVA 4MB3A 2Y7EA 4UQEA 2E68A 2GSJA 4XD3A 3AXKA 2XIOA 4XSMA 4UOZA 5CZSA 3T81A 4B16A 1NVMA 1H2JA 2WBGA 1GKPA 1XLIA 1YXYA 3W7PA 5FEWA 3E0WA 3EWXA 1BGGA 1WP6A 2BV9A 1JYWA 3AZTA 1WZAA 4O50A 2XINA 2QDGA 4IFOA 3KW3A 2PODA 4XBKA 1GVYA 1FH9A 4GZ7A 5DCEA 3G0SA 3BAYA 3CHEA 2HJPA 2CYGA 5EL1A 3LXBA 5CAKA 3W7IA 1NOWA 2E5CA 3C0LA 2NV1A 4IFKB 3D46A 4J3WA 4Z1BA 5G1TA 3NR0A 1X8CA 1VS1A 1D8WA 3QGKC 4UNLA 5EBUA 1DIOA 2ZX7A 1JQXA 5LNWA 2B7NA 5BU6A 5C5YA 1XLEA 4MNJA 4K38A 2QV5A 1HZYA 1V3HA 4Z2LA 3HURA 4Z08A 3PY2A 3MA8A 1X97A 4Q33A 1SW7A 2FTYA 4JTKA 4QSHA 2YCEA 3O3RA 3M9YA 1OZQA 3CZ8A 3ITOA 3CV1A 1ME9A 2WVTA 4F40A 4GA8A 3DENA 2FMOA 3B0UX 4X9YA 3OVQA 5REQA 5GJNA 3WDRA 2HTMA 1UD3A 3MJYA 4J3ZA 4QS6A 2DJLA 3GIYA 2GK1B 2WMJA 3WMCA 3SFWA 5I06A 1W9DM 1K3UA 4RV3A 4WGHA 3WMBA 1TZ9A 1J11A 1KO0A 3S6TA 5D9OA 1RPKA 1F7BA 4LNYA 2Z1SA 2Z29A 3APYA 1EQPA 3QJAA 1ZTVA 3MKCA 1I2OA 3W82A 3IEBA 2PTZA 2OPJA 3ZSSA 2JGYA 3H7UA 4LYPA 6PTDA 3M5YA 4ILSA 2EBNA 3RRAA 3TUUA 1TVPA 1RXOB 2DIJA 3VIIA 5IXEA 3ZWTA 3A5FA 4QG8A 4DJDC 1K4GA 2ZXQA 3ZFHA 4URIA 3UGVA 1BXBA 2G4JA 2WZIA 3MUXA 3TE9A 4JTQA 3LHZA 3WD0A 4O54A 2ABBA 3KOYA 2O9RA 4KGLA 3UJFA 3I4KA 3UZYA 2OX1A 1Z9AA 3L5AA 5T9CE 3DFQA 4QEEA 1GK8A 4O19A 4CU7A 1UCWA 1JYNA 3C2VA 4S23A 4CEUC 1ICQA 3E0FA 3GAYA 1UP3A 4LV4A 4GMEA 2VFGA 2WHKA 5A6SA 3CZKA 2ISSA 4NT0A 4EXQA 5HWJA 3PWIA 2ZADA 1XM3A 1KW1A 3T0AA 3AIQA 3W7QA 2YXOA 4HP5A 1OX6A 2WXDM 3UETA 1ITUA 1H62A 4UFIA 3G2GA 4LBSA 3LV6A 4Q8TA 1LL7A 3IJ6A 2VD9A 2NWSA 2XIJA 4IICA 5A8OA 4QJ3B 1YPIA 4O10A 5FAGA 4M29A 3C0QA 1IGWA 3PNUA 1U5VA 3WYZA 3B3DA 3TSDA 3SURA 5ABEA 2NV9A 2YGYA 4B9ZA 1X7FA 2CZFA 1RUSA 3RILA 3TSMA 3HU7A 1O68A 3CS2A 3CL7A 4PUUA 1H1NA 1AQMA 2X09A 1IEIA 3F03K 3CPUA 1UA7A 1UOZA 1VRXA 1ONWA 4CQBA 1IHIA 3W2NA 2WNQA 4XBSA 1ICPA 2ZFAA 3EWWA 1EX5A 4LXFA 2VJXA 4DYEA 3F1QA 1ISVA 2AQWA 1J0ZA 2IKGA 2DH3A 1H0IA 4TUFA 2BHYA 3S8HA 3VDGA 1QPOA 2YFOA 4AD1A 2BP1A 1PL9A 2WLZA 1ECEA 1P1MA 1Z42A 5FIPA 3QYQA 3G1YA 2P5NA 3MI6A 5BMWA 3NZGA 5I23A 1NQ6A 3ONCA 3B8TA 4YHEA 1V3JA 5BCAA 2J9XA 4GVIA 1E55A 2DZTA 3CXOA 3W01A 1TMHA 2A3EA 3GQYA 3K30A 3D3FA 4PGLA 2OX4A 3AISA 4MLRA 4NJIA 1NWRA 1R2RA 3TIMA 4L9YA 3NNTA 3Q2DA 3RUBL 3ZZ1A 1H5YA 1JIBA 2E67A 4ICMA 4CUCA 3B0VC 4H9YA 4GE8A 4DBUA 3KHDA 3BAIA 5CG0A 3QPZA 4CQCA 3KDNA 1MRAA 4C6IA 3GDTA 1IGSA 3A4JA 1E4NA 4MKVA 1RA5A 2W61A 1WNOA 4DUVA 2XISA 8TIMA 3PZUA 3CV6A 1XV8A 5BW6A 3MSDA 3RCMA 2Q02A 4GI9A 1RY0A 4A2SA 1OX4A 4X61A 1Q63A 3OU8A 3E2QA 3I3DA 2PWFA 3VKCA 1VBJA 4S2CA 3B8SA 4QGCA 3WUGA 1XX1A 1ZENA 1XYMA 4YNGA 3HBLA 5FL1A 3F2BA 4GZEA 3A9BA 3N6JA 4YTRA 1HUVA 5M3WA 4C6KA 4LW7A 1PIIA 3SCUA 1GJWA 3NXLA 3TP4A 5C9WA 2P3ZA 5E9AA 3BK0A 1GPWA 1TJ2A 1UC4A 3PULA 2QAPA 1NDVA 1A47A 3NGFA 1NOUA 2FZ9A 5KMYA 4EP8C 2HZGA 1TUFA 2EF9A 2PE4A 4FMVA 4ZB2A 1OFQA 4H00A 3M44A 5GJMA 3VPLA 3BGAA 3LXCA 3NL5A 2ZRVA 1XYBA 3TW9A 1TV2A 3GIPA 2IPFA 3W87A 3NGJA 4JTUA 4RDZA 3MANA 1JF5A 2JIEA 4GNVA 1O4UA 2D3LA 3NQAA 1J12A 3AU2A 3P7YA 1P6WA 3C56A 2D69A 1XIEA 4OV9A 5A8NA 2BVYA 4C6OA 1WXZA 2J8FA 3MCNA 4M51A 1YNYA 1CGWA 4QG9A 3CHVA 1U22A 3PJXA 4KIRA 1XGDA 1B9ZA 5JU6A 1EO7A 1VHNA 2Z6JA 2DZXA 1X98A 4ENLA 3K4WA 1OFPA 3GXIA 4HD5A 4I9MA 1XRSA 5T26A 4M81A 4FXRA 1TG7A 1TKKA 4MYXA 4J2PA 4A3RA 2ZVRA 3NL3A 3CUZA 3CGTA 4E3VA 3KLLA 1E6QM 4UR7A 1V6XA 5M2FX 2ACSA 1ZRQA 4NYYA 2W63A 1XLJA 4NRRA 4AY8A 3CHCA 2ZWZA 1P7TB 4J5NA 3EA1A 3W74A 1WZMA 4H2HA 2I17A 4JIHA 3SQSA 2VXNA 2GDVA 4PUKA 4WEVX 3MUCA 3N19B 9CGTA 4Y7EA 2FHBA 1FKXA 4PH6A 3CM4A 3A13A 1ZJHA 4W88A 3KHJA 3SCTA 5CG7A 5AN7A 3IPWA 2WSPA 1RV8A 4OHQA 2FIQA 3MSYA 4US5A 3TX9A 5CAHA 4H9TA 5EB8A 2NQZA 4S3DA