1NDYA

Crystal structure of adenosine deaminase complexed with fr230513
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine Deaminase
publication title A highly potent non-nucleoside adenosine deaminase inhibitor: efficient drug discovery by intentional lead hybridization
pubmed doi rcsb
total genus 149
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ndyA00
3RHGA 4C5YA 1W1IE 5A6TC 1P6CA 3TN4A 4WGXA 2W9MA 4NG3A 4HJWA 4L6DA 4RZBA 1FWJC 4EPKA 3LY0A 1V51A 1PB0A 3URQA 1EF2A 4KESA 2I5GA 3F2DA 3QGAC 4XAFA 3UR2A 1NDWA 1J6OA 1XRFA 1K1DA 3WMLA 4XAGA 1NDYA 4KEZA 2HBVA 2RAGA 2GZXA 2VHLA 3E2VA 3F2CA 4IH3A 3GTFA 4B90A 4GX8A 1A5KC 4IGMA 4DI8A 4C60A 2GWGA 2CZVA 4J35A 3S4TA 4H9XA 2UZ9A 3E0LA 1A4MA 2OOFA 3LU2A 3NEHA 2OQLA 2WJEA 3C86A 1S3TC 1UBPC 2DVTA 3URBA 1POJA 2EG6A 3IV8A 4DI9A 2GWNA 3GTXA 4ICMA 3E74A 3GG7A 4IFOA 3E38A 1EJXC 1RA0A 5E5CA 1V4YA 1YBQB 1FWHC 5HMEA 3MKVA 2GSEA 3G77A 2UBPC 3IRSA 2PLMA 4CNUA 2VM8A 1FWGC 4LFYA 1RK6A 4C6JA 3EWDA 4NI8A 3URNA 3PNZA 1EJVC 1XRTA 3OVGA 2WM1A 3TNBA 3PAOA 4DNMA 4AQLA 3QY8A 4NP7A 4IG2A 2Z28A 4R88A 4BJHA 4RDYA 4YIWA 3MDWA 4H9MA 1RJRA 3A3XA 2ZC1A 3GRIA 1K6WA 2HQAA 4H9TA 2IMRA 4XD4A 2P50A 3OJGA 2R1NA 3TN5A 1JGMA 3URAA 4HK6A 3LS9A 4V1XA 3MDUA 4C6CA 3GTHA 4KETA 1VFLA 2KAUC 2WJDA 4DO7A 4KF1A 3LSBA 2Z25A 4XD5A 4INFA 1J6PA 2D2GA 3JZEA 4KEUA 4LALA 4IGNA 3R0DA 3A4JA 3DCPA 4L9XA 1EJRC 2R1PA 2XIOA 3IJ6A 4GY7A 2QVNA 3MJMA 1FWDC 4I6KA 4PCPA 4XAZA 1EJSC 1UMLA 3BE7A 1GKQA 2A3LA 1KCXA 4UB9A 1P6BA 4CQBA 4CNTA 2DVXA 3QGKC 4XAYA 1WXZA 4LCSA 3EGJA 4LH8A 3F2BA 4GC3A 4TQTA 3LGGA 4ZSTA 3K4WA 1FKWA 3MSRA 4ERAA 3ITCA 4C6KA 3RN6A 3K2GA 3T8LA 2FVMA 3B40A 3S2MA 3DC8A 1A4LA 3RYSA 1R9YA 2HNHA 4PBEA 3S2NA 1POKA 2BB0A 4LAMA 2PGRA 4DZHA 3OOQA 3GIQA 4GY1A 4DZIA 4P5UA 4GOAA 1DPMA 4H9YA 3PANA 4H9ZA 1FWEC 3PBMA 2O4QA 1E9YB 1O12A 4D8LA 3CS2A 3GU9A 2ADAA 4XD6A 1HZYA 1GKPA 3N2CA 1V79A 3AU2A 1EZ2A 2EG7A 1FWBC 1A5MC 3SO7A 1RAKA 3E3HA 2Z26A 2HBXA 1ONXA 2R1KA 2E25A 2VR2A 4GX9A 3NQBA 1YBQA 4C6DA 2R1LA 2VC5A 4C65A 1E9ZB 1UIPA 4MUPA 4QS6A 4RDWA 3F4DA 2Z00A 4ERIA 2YB1A 4PBFA 4C6OA 3T81A 2OB3A 1R9XA 2YB4A 3FEQA 1KRAC 4IFKB 4PE8A 4IFRA 1EJUC 4LCQA 1NDVA 3S2LA 4HA0A 2AQVA 4GZ7A 3IACA 4WVXA 2FFIA 4QS5A 3RCMA 3ICJA 4C6LA 4F0RA 1O5RA 3UF9A 1GKRA 4AC7C 3GU1A 1YMYA 3DUGA 2Q01A 2Y1HA 4HK7A 1J5SA 1QW7A 1V77A 2QT3A 4C5ZA 3AU6A 4CQDA 1KRBC 4EPEC 1XGEA 4KIRA 4R7WA 4B92A 3OQEA 4RDZA 4OFCA 5CH9A 5HMDA 4LEFA 2WJFA 4IQJA 2Z7GA 2F6KA 1A5OC 4RDVA 3GU2A 4R85A 2Q09A 4DLFA 1J79A 3GTIA 4GXWA 3SFWA 4F0LA 4H00A 2I9UA 1PTAA 2OODA 4C6FA 2HPMA 1PSCA 3UBPC 4ERGA 4G7EB 4G7EA 1M65A 4QROA 1RJQA 2Z2AA 1PO9A 3MTWA 2G3FA 1ITUA 4C6NA 4CEUC 2PGFA 2AMXA 3T1GA 1RJPA 2FTWA 3GUWA 3ID7A 1QXLA 3OODA 3MVTA 4G2DA 4UBPC 3AUOA 4DLMA 3O7UA 4C6IA 4CEXC 3WZ0E 3WYZA 4C6MA 4JOMA 1EJTC 3O0FA 2HPIA 3NURA 1I0DA 3B0YA 3IGHX 4GBDA 3LGDA 4GYFA 2D2JA 4C6QA 3IARA 3D6NA 3UR5A 5LXXA 4LANA 1I0BA 1M68A 1FWFC 4BKNA 1ZZMA 1ADDA 1NDZA 2Z4GA 3LSCA 3S2JA 2EG8A 4C6EA 1FWCC 2QS8A 3K5XA 3E0FA 1A5LC 5FSDC 4DIAA 4B91A 3OU8A 4PCNA 4WHBA 5G4HC 4QRNA 1K70A 3LA4A 4LAKA 2OGJA 1ONWA 4J2MA 4EPBC 4CQCA 3MPGA 2BGNE 4H01A 1EJWC 2GOKA 3GIPA 4M51A 1RK5A 1KRMA 4E3TA 4XD3A 1V7AA 1EYWA 3QY6A 3TN6A 4F0SA 4B3ZA 3QY7A 1XWYA 2ICSA 4CNSA 2ANUA 1YNYA 2Z29A 4IFKA 3UPMA 4H9VA 1UIOA 3IPWA 1ITQA 3V7PA 3HPAA 2PAJA 4EPDC 4H9UA 4DYKA 2E1WA 1RA5A 4HK5A 3TN3A 4IF2A 4C6PA 2VUNA 3MVIA 2PUZA 3ORWA 1WXYA 1P1MA 4V1YA 3FDKA 1M7JA 4RE0A 4IG2B 2R1MA 1IE7C 3EWCA 1FWAC 3HTWA 4I6VA 5FSEC 1R9ZA 2QPXA 2FVKA 2AQOA 4KEVA 4KQNA 5AKQA 4EP8C 5HMFA 3LNPA 3FDGA 2VC7A 2YZ5A 4GY0A 4J5NA 3CJPA 1NFGA 3HM7A 4ZSUA 1KRCC 2Z24A 2YXOA 2Z2BA 3ISIX 2D2HA 4C6BA 1FWIC 2O4MA 3F4CA 4KERA 3B0XA 4Z42C 1YRRA 1FKXA 2Z27A 4LCRA 2DVUA 1A5NC 1BF6A 3KM8A 4BY3A 2FTYA 3CAKA 4QTGA 4QSFA 4LAOA 1YIXA 4GK8A 3PNUA 2P53A 3A3WA
chains in the Genus database with same CATH superfamily
1CI1A 1IEXA 3BUVA 5HQLA 5I77A 4K37A 5M2FX 5EB8A 3WQPA 4CNOA 1IEVA 1NOUA 4GWEA 2A3EA 3WMCA 1BAGA 1E1EA 2YW4A 3QPYA 3LD5A 4KESA 3EX1A 3CAVA 4TUFA 3OVPA 1G7VA 2VCBA 5CPOA 3DI1A 2JE8A 3OZOA 1Q6EA 5T9CE 2PWVA 2YJQA 3I6TA 1R3YA 1RHCA 2VHLA 4DXVA 4AC1X 1OC5A 1D3CA 4B4FA 4L64A 1TB3A 1N7KA 3QSRA 2D1ZA 2VXNA 4HA4A 1O60A 3LU2A 3TA9A 3O3RA 3F03K 4KW2A 1S3TC 4YMZA 2DIJA 1W1PA 5C0QA 4AEOA 1KM1A 4HCDA 3LHVA 4AWEA 5TIMA 3T4CA 3A64A 3G77A 4POCA 2PTDA 4PZVA 4AZHA 4CNUA 1G0CA 3NG3A 1IQ8A 4W9TA 2JF7A 4NP7A 1F5ZA 1JZ6A 1K9DA 4RUBA 3W85A 4GO9A 3LBMA 3VI2A 3DXIA 1HF6A 1RLDA 3NQFA 3WNPA 3CU2A 1XIJA 2UY2A 2XH7A 3QOKA 1CXFA 3W2LA 1K8CA 5KZ6A 3URAA 1AW1A 4KETA 4M82A 4N9CA 1J6PA 1XHGA 2R24A 3FJLA 3S1XA 1XCXA 4L9XA 2VFDA 3ME3A 1FWDC 2PDLA 4AY1A 2QCDB 1JZ3A 1S2TA 3TC6A 1BFNA 4V2XA 5BXPA 2OU4A 1UWUA 3LTYA 4CNTA 2DVXA 3TTYA 3CUGA 2DUXA 4AIUA 3PULA 2VX6A 3V5FA 4QE5A 1UD8A 2WSKA 2XH0A 3Q45A 2FKPA 2FDMA 1X6LA 5L6UA 1HG3A 3D5HA 3W7EA 3ITCA 2CLLA 6TAAA 1B57A 3NZGA 1XQLA 1S5VA 5JH1A 2NWRA 2NV1A 1EA0A 3BL3A 1R30A 4HU3A 1CIUA 1TPC1 5DRCA 5HANA 2FHFA 3W73A 3W53A 4M29A 3KLLA 1F8IA 1R46A 4Q4RA 4PCTA 4H9ZA 4MHBA 4RNHA 3CS2A 2Z1KA 3GU9A 1XP3A 3LBCA 3BSHA 4WKHA 4DWSD 5DT7A 3QJAA 4UTKA 2CHOA 5A95A 1HTIA 4JTTA 3KOXA 3C2RA 4JFVA 3QFEA 3B97A 4EXBA 5KINA 5M03A 4H8HA 3VINA 2FHBA 1FDJA 4JIEA 3TZNA 1ONXA 1EOMA 5BOEA 1G4EA 1R6WA 2YPIA 3GY1A 3NQBA 4RE2A 1JL8A 1I9CB 2D24A 2BVYA 2CHNA 4F3HA 1DJZA 1UIPA 4WDTA 5F1VA 4JEJA 4ERIA 4GJIA 3NR0A 4L4LA 4FF7A 3W01A 2D69A 3IJ7A 4MKNA 3SR7A 1QOPA 1NQKA 4GVHA 1E15A 4L65A 4AZCA 3EA3A 3OTRA 4DB7A 4Z1CA 1O5RA 3JUGA 2CYGA 3C61A 2Q01A 4ZOBA 4IQEA 1R3VA 3L5MA 5AHMA 3UG8A 4FNPA 4PMVA 1A5SA 3HU7A 3U2ZA 3F4VA 4P7LA 4R7OA 1TV2A 2X0SA 4MY1A 1BVWA 2XTKA 3WQGA 3TE9A 1R38A 4RX0A 2CLFA 2I17A 2OODA 2BNJA 3G24A 2XVKA 4G7EB 1I2QA 4XZIA 2GGJA 3EEZA 3NZQA 4BQ2A 3T1GA 1UA7A 3RX4A 4M3PA 2VO5A 3A5FA 4JYEA 4GUGA 3THCA 2FFCA 3EWWA 3SN1A 2J9ZA 1KGWA 2OFJA 4OBRA 4BF5A 2NQZA 5D4YA 3AHZA 2PDCA 2OELA 4KFNA 2XH2A 1TPVA 1GOKA 2ZZ7A 1W5MA 4Y7EA 1XGZA 3UZJA 4JDBA 4YLWA 2EPOA 2V3DA 4NT0A 1ZSXA 4IMCA 5AC8A 2J7CA 3E96A 2VFHA 3OU8A 4WHBA 3M0YA 4I7WA 4L1XA 5G1TA 2D23A 4RW5A 5A1AA 4I5UA 3TK7A 3E2QA 1NF7A 5ECVA 3TN6A 1DJNA 1U22A 1GORA 3NL3A 4N2YA 1B3VA 1W91A 3GHSA 3PZQA 1XPGA 1E0WA 3G22A 3TNOA 1XM3A 1P0NA 3MVIA 4E2VA 3ARQA 4B5NA 5C9UA 4N6FA 4L61A 1QNPA 2ZRVA 4PUWA 4UTTC 4LXFA 4LW7A 5K4XA 1FCBA 4NQ1A 1XFBA 4AD4A 5IM51 5MHBA 1EX1A 4GI9A 3UYIA 2VR4A 3TVAA 4C90A 1B3WA 3A47A 5A8PA 2CLHA 3ARXA 3I4KA 1A5BA 3CJPA 3M0IA 1ZGDA 4OJYA 5HNNA 5EMUA 1FXPA 1SFTA 3NQ8A 4HHPA 1FWIC 2HRWA 3AS1A 3TYAA 1W5OA 3TH6A 2C71A 1X7FA 4R9XA 3MB9A 4Q8MA 5DN1A 5HUPA 2ALRA 3W1QA 3NL6A 3GQYA 2W9MA 5LNRA 4GKLA 4HJWA 1R0MA 4ZB0A 1GONA 4EPKA 1RBAA 4OVXA 1XSIA 4GIEA 3F5JA 4US6A 2VNCA 3JR2A 3SRHA 1EPVA 4PTXA 1OY0A 4AUBA 4EX4A 3WMLA 4ACZA 1NDYA 2TYSA 3LI0A 5DMYA 2PWDA 4NJJA 4F0HA 2A7NA 4AW7A 2GQ3A 3GTFA 1PKLA 3R43A 4C60A 1KQZA 2GWGA 1GZJA 3LRKA 4M56A 3WLMA 3C86A 3W7NA 3URBA 2HK1A 3A4XA 3CUFA 4PR4A 3MHUA 1W5PA 1E6XM 3QZEA 3S5ZA 3C0LA 4X0VA 3NM1A 1NOFA 4W4QA 4ADTA 1XX1A 4C6JA 4ORIA 2VRKA 4NNCA 5BWFA 1E70M 3C52A 1VD6A 2JEQA 4GHRA 6A3HA 4OZOA 4PYSA 1VYRA 1AH4A 2ZTJA 1L6SA 1GHRA 3BAIA 3II1A 2VGFA 5GJNA 1KO0A 2YL5A 2I57A 4HK6A 3H2AA 4LF1A 3GZ3A 3GNDA 4ZVJA 1DJHA 3GTHA 3NAVA 1MEWA 4IIBA 1X6NA 2X05A 5AYXA 1W9DM 3ZJ8A 1QRQA 3QTGA 4LX4A 2QMJA 3M46A 5U4NA 2XIOA 4I6KA 2J66A 3DAQA 3J7HA 3IVSA 4CQ8A 5LNWA 3CBWA 1MUCA 4IXHA 3L0KA 4MZYA 4LH8A 3VGHA 2XSBA 5C9XA 2VURA 3P61A 5CSYA 3QV6A 4FXJA 1GEHA 3POHA 1OCJA 4FSAA 2AAAA 4A3RA 2AOSA 4M1RA 1A4LA 1SMAA 3LX9A 3Q65A 4J1OA 5C54A 1OK6A 1XYCA 3OEXA 4DZHA 3L67A 4XZ9A 1M5WA 3F5KA 3SCQA 4B5SA 5A2BA 3N34A 1UPMB 4UIOA 3EB4A 3WG6A 3S46A 1GVRA 4KFPA 1S1PA 2HROA 2BGQA 1XYAA 1L0PA 3JVAA 5HNTA 1V79A 1OFDA 1H7WA 3WLHA 1UROA 2VFEA 3IUHA 1JPHA 3WQ8A 1EX5A 4DJDC 3WQVA 4GQRA 3FY1A 3GDLA 2HBXA 2R1KA 1TV3A 3I6EA 2R1LA 4C65A 1ISZA 3V0TA 3RLUA 3NQ6A 3ZXWA 3DBPA 1HUVA 3KEHA 2P0IA 3JS3A 4GUJA 3WENA 4S3JA 4PE8A 2ZDRA 2EBNA 1JGIA 1XDMA 2BFGA 4Q8TA 3BAJA 3PJWA 3OVRA 4WVXA 4CCZA 2E6DA 3IIZA 2V3FA 3RCMA 4CQ9A 4KCWA 5B7ZA 4YTTA 3TJIA 1NARA 2RUSA 1QW7A 1W3JA 4KIRA 3GVGA 3OQEA 4RDZA 5CH9A 3W26A 3AALA 4GH1A 3MWAA 4IQJA 3HQNA 4DF1A 1SZGA 3WD0A 1ZL1A 1UYQA 1KTNA 1VENA 4Y96A 3C8FA 4H00A 5LA0A 2XVNA 4PB3A 5C9RA 1O1ZA 4V27A 1ZPTA 5C71A 4QROA 3QN3A 4CEUC 3LQGA 2PF8A 2PGFA 3T0BA 1KFCA 1O66A 5FJRA 3BSGA 1HXJA 1WUFA 2ZC8A 3FSUA 4GMEA 4OQVA 3HFYA 1HO4A 1QCWA 2BVTA 1UKOA 1WPCA 4O13A 4S38A 4QX4A 3RJXA 1CLKA 2WK2A 1Q8JA 4IIGA 2OYLA 3TCSA 1WOBA 2DH3A 3HURA 3IVUA 1I6NA 4GI6A 5G4WA 3N14A 1EF3A 2ZICA 1YNPA 1A3WA 1HGWA 1ISVA 4JTHA 5E6YA 2CBUA 2FVLA 2E3ZA 2GJRA 1JVNA 4YJ5A 1AD1A 4X60A 1W9UA 4P7NA 1KB3A 5FJPA 2GGEA 4QRNA 3LA4A 4QG9A 3WLTA 5ABFB 3LCHA 3L4TA 3PWIA 4OOUA 4H83A 3LZ5A 2VWSA 1XDJA 4MNLA 1UKQA 3W1UA 3NM3A 4XD3A 3WDRA 2VEFA 1FHUA 1EUAA 4OKDA 1ITQA 4GA8A 4Z2KA 1SW7A 1HVXA 4CD7A 4LY4A 3WL1A 2DSVA 5IOBA 1DWAM 2DSKA 3CUIA 3T44A 3FNDA 2ZUUA 1J18A 1JYNA 4F2TA 3C8NA 1QR7A 2Y63A 4UNIA 2W3ZA 3QEZA 1TJ2A 5FSEC 3TR2A 1P7TB 4HZ8A 2V2CA 1XF0A 1XIMA 1ZCOA 5HMFA 3RMEA 5HR6A 4MG4A 2ACQA 1AZ1A 3NVDA 1PDZA 2GJXA 5C7HA 4Q32A 3LV5A 3W1RA 2X1RA 3T0CA 1VCGA 5MKGA 3CQJA 2IW0A 3JRKA 2OO6A 2ODOA 2EJ1A 4JN6A 4LGXA 1M1BA 1KCLA 4ZE5A 1NVMA 4BQ4A 3S6DA 2DVUA 1TTPA 2YL9A 3BMVA 3ZSTA 4O1EA 3KFTA 4JTGA 1LLWA 1OVDA 4JY9A 4NG3A 2A6NA 3FK4A 3OBEA 1J0IA 4YXGA 5ABEA 3SI9A 5I3GA 2ZZ2A 3PBWA 3H2MA 3VD3A 3ITOA 3CNYA 3T40A 4CKQA 3H2EA 4WRHA 1D8WA 2YDRA 3KWSA 1NWSA 1SO6A 3CPUA 3N2OA 4GRSA 3BICA 4NSBA 5AOUA 3F2CA 5T91A 2RDUA 5D05A 4REQA 1KA9F 1KKRA 2TPSA 3H70A 3W0KA 5JIWA 1MXDA 1FWRA 3QV8A 1EUNA 3MBFA 2WCAA 2BDQA 4IIDA 4K1GA 4DJDD 3HG5A 2PBOA 3EYPA 5D2WA 4MLJA 2OKTA 2WHLA 1O7AA 2WOQA 1FHLA 4ICMA 1SO3A 1EXBA 3NL2A 3G1YA 3KBWA 3W07A 1YBQB 3SEPA 3OLEA 2GSEA 2YXGA 3C3UA 2HNEA 5HOSA 3S6TA 1W3TA 3WO8A 3NUKA 1TCDA 3OVGA 1PZ2A 1TIMA 2YZRA 2YLAA 1DYSA 3M5YA 3CQKA 3WF0A 3LHYA 4A8IA 4GNKB 4FNSA 4OUEA 3A3XA 4KCTA 3UWVA 4CQAA 3ECQA 1L2QA 3UCDA 2R1NA 1L6FA 2CWXA 4ML9A 5M1TA 4DJFC 3IVTA 4MB1A 2GFTA 1WKDA 3S9ZA 5JQ9A 4AFYA 1DWFM 2O9PA 1LG2A 3JZEA 4IGNA 5C6MA 1XR2A 3WQDA 1YDNA 3XISA 1V3LA 1V3IA 1K7XA 1SO4A 4UB9A 2EHHA 1DE5A 1F74A 1YHTA 4XAPA 3DI0A 5AHLA 3U5UA 4OTKA 4DAFA 5FAJA 1Q63A 3F2BA 3C4UA 1JG9A 2XSAA 3WDJA 4ERAA 3ZO9A 1XSJA 1T5AA 1K7FA 4MJ4A 2FVMA 4JIHA 4KT2A 1R9YA 2CETA 5I23A 3ES7A 1POKA 3MP4A 1SJBA 3W7CA 1E4IA 1HKKA 3AMGA 1P4CA 4RPQA 3W2MA 1I1XA 1FWEC 2Q8ZA 1Z42A 5IBXC 2ZWZA 4FNRA 1VP5A 5HPCA 5BCAA 1EGMA 3LM3A 4ZA0A 2FMNA 3CHVA 4ADSA 1D8CA 3R2GA 1XLMA 4KGJA 5EBAA 3SJ3A 5LIYX 3ZR6A 9RUBA 1EWEA 3ARVA 3ZVHA 2QIWA 1X1OA 3L4WA 4IT1A 4EOUA 2VR2A 5I03A 1IT0A 3OG2A 3SIZA 3DFQA 2X30A 4K8GA 2JFEX 2YL6A 4XTDA 2E5BA 3R25A 3QF0A 2Z0IA 4NXSA 2ACUA 5EYWA 1OGSA 3RO6A 3B0VC 5BZAA 2WPGA 2GDUA 4TVDA 4JKLA 2E28A 1JFXA 4E3VA 3RFAA 3M0XA 4FLRA 4JZ5A 4Q8QA 4I9AA 2RJHA 3AS0A 4C6LA 1H4PA 3ALGA 3GC5A 4KCVA 1PPIA 4LOCA 1BTMA 5CG7A 1EHAA 1P48A 3P84A 1J5SA 1V77A 2CKSA 4DWSA 1PYMA 2BODX 3NQMA 2OCZA 1OABA 3GNRA 3H53A 2Z7GA 4LB3A 3FA3A 3W37A 2QGYA 2X0HA 1EC9A 4WQ6A 1RH9A 4GXWA 3ITVA 3DIPA 4GZIA 5I09A 3Q2DA 5DFAA 1RJQA 5D37A 2PTZA 3SCVA 4NAEA 1ITUA 2YIHA 3GDTA 1V7YA 5LYRA 3CIVA 3OODA 4A2SA 2DIKA 4FX7A 3NSNA 5D32A 1MW2A 1ZAIA 1OWQA 1KLZA 1GVSA 3LHUA 4Q4MA 2HPIA 2ZRXA 1ITCA 4QNWA 1GVQA 3O63A 3ANVA 3HJEA 1TPH1 2J9XA 2PRHA 2DP3A 2WO5A 4OT7A 4KPLA 3OBKA 4QBXA 2QS8A 5C7VA 5I00A 1HKWA 2GSJA 3MI2A 1KM3A 1HKMA 2CLPA 4LV4A 1AJ2A 3P8IA 1S5MA 3N4AA 1JUEA 1ZJAA 3V5OA 8XIAA 1SFSA 2ZE0A 3G1SA 2KZHA 3SUVA 3LPGA 3GKAA 1TELA 4WLCA 4X9SA 3ES8A 3ANYA 3W70A 1BLIA 3R10A 4J3TA 2R9RA 3IIOA 4TXEA 5EL1A 4ECLA 1UQYA 1GG0A 5EMJA 4FXFA 2NX3A 2PUZA 1O5KA 2DW6A 3EBVA 4QE4A 1GJUA 2BX7A 4LS2A 3KS6A 3GH7A 1ZU8A 2I56A 2W92A 4I6VA 3MMUA 5CPQA 1SJDA 3TCEA 2OLAA 4DJFD 4E8CA 1HKVA 3H2NA 2IPJA 4S39A 1OX4A 4LUTB 3TONA 6XIAA 3NO1A 3N9KA 4GY0A 2ZUTA 1SVDA 4ZSUA 1W5QA 4QG6A 4NHVA 4LUIA 2Z2BA 3OW1A 4FR1A 3EKLA 4PTDA 1YPIA 3L4YA 1BF6A 4NYYA 4N9EA 3W29A 2OOGA 5LXEA 4Y9MA 3VIKA 5A6BD 3RHGA 3C0SA 3THUA 1W1IE 3DHUA 4GNJA 3MUIA 1TJ0A 3QW3A 4PRRA 4Q4SA 2XIIA 1GJWA 1VYPX 1AZ2A 1HJQA 1LT8A 1OINA 3M0LA 4Z0JA 3SN0A 4H7ZA 4WXYA 4QXIA 2V82A 3OA3A 5D2YA 1D2KA 3F2DA 1MSSA 3NGJA 2VELA 4RR4A 3R58A 2QGHA 3PUEA 4EXQA 2YW3A 1DJWA 4GX8A 3U48A 1YLVA 5A8GA 4IMAA 2ZZ3A 3DECA 1ZBWA 2R82A 1SGJA 3SQMA 4A3QA 1Z41A 3OYZA 4HBKA 2QCEA 4G7FA 2V5LA 1IT7A 1UBPC 5DXYA 3ABSA 5DMNA 3BG5A 2YCKX 3O2LA 2DT2A 4ZOEA 4WY0F 3E74A 3KP0A 4W8BA 2C16A 2FJKA 4LRTA 3QTPA 5E5CA 1H09A 1PX3A 3EWUA 1AJ0A 1MVYA 4O1BA 3THQA 1B3ZA 2V2HA 2F84A 4NI8A 1BF2A 3AXKA 4H7CA 3CWOX 1QPRA 1JF5A 4IX0A 1UZ4A 4JTLA 5AECA 3RU8X 3FLUA 3LHTA 1M03A 3O16A 1XYZA 2PDFA 2WBKA 1UWIA 3EDFA 2CLEA 2OEKA 2JK2A 3UA3A 5HPOA 1I2RA 2F6UA 3ZIZA 1WZAA 1KFLA 1E55A 2PGWA 3TN5A 2QZRA 4N7QA 4QEHA 1HFBA 4JFUA 1QNRA 1CGUA 5JBDA 4IPLA 1CXKA 1JI2A 4FHAA 1BSIA 5FD0A 3QOMA 2PWEA 1EJRC 5LGXA 3IJ6A 3HV8A 2PRMA 3IUDA 4JNYA 1H51A 2QV5A 4K8EA 2WVUA 1VFHA 4XAYA 4B5VA 2WVSA 4ZFMA 3PZIA 2Y61A 1ELSA 3MSRA 3W7DA 2EJAA 5PTDA 3WBYA 2PP0A 4ZOCA 3TLLA 4XKYA 2WKJA 1VIZA 1GW9A 3W7MA 2OWXA 3S2MA 4YYCA 4J3VA 1TO3A 1XLLA 4AD0A 4MUZA 1W1ZA 4PBGA 1RPKA 4PBEA 2CC0A 2C1IA 3T0DA 3L5LA 2DT3A 3N29A 4B15A 1F73A 3EDKA 2V2DA 1NP0A 3UJFA 3WEOA 3W7RA 5LIWX 2PDIA 1DPMA 1KFBA 1DWHM 3VZZA 1CYGA 5GPRA 4AZ6A 4CD6A 4P8UA 3M9YA 1S5TA 3NVTA 4E6MA 3E9AA 4HN4A 1TCMA 4DEFA 4P7QA 1GKPA 1BD0A 4HJFA 1EO7A 3FHQA 3HFTA 4NZ1A 4K1WA 1BWKA 4YU1A 2IPGA 1XPYA 3VDBA 3CYJA 4C91A 4GNVA 1W1VA 3U8GA 1N8IA 4RNFA 4CCEA 3U7VA 1VJIA 2PP3A 3P5ZA 1VRDA 3VMOA 2BOEX 4IFKB 4H8UA 5C2CA 3AQUA 2AQVA 2PLKA 2CITA 2CBJA 4PGLA 4FEZA 1IZKA 2A3BA 3UXLA 3VOIA 3GDRA 4JNZA 2DW7A 4AC7C 1LJYA 3D47A 1TPUA 1KRBC 1UD6A 4B92A 1MW3A 6ALDA 1VHCA 5F1UA 1QHPA 3AIVA 1LYXA 1LRNA 1OSEA 3VVGA 1OFEA 3RPTA 1JYWA 3CO8A 1A50A 3SFWA 1BGGA 4S1FA 1XIHA 4G7EA 3FAWA 4XKMA 4R34A 1E1CA 1SFLA 1US0A 1C8YA 3S83A 2IKGA 1RVGA 4MYXA 3EPMA 1A0CA 3FJNA 2NX1A 1J93A 1RQHA 5CXPA 3SCPA 3ARPA 4K7VA 1SMDA 1REQB 1LZOA 3ATYA 1KWKA 4UTTA 2DSZA 5F4SA 1GZ1A 1GW1A 3LGDA 1XFCA 4A3YA 3IARA 1XIBA 3S1WA 3LXAA 2VC9A 3W1MA 1XC4A 4X2PA 2ZOXA 2CBIA 4AHQA 1A3HA 2X09A 3MHFA 1FFQA 3RLVA 2QLYA 5A6AA 3M6DA 5CC3A 5F2IA 3FOKA 1XDLA 3TIMA 2ESCA 3DX5A 3VDCA 5I5RA 4DM2A 3VPLA 4UOQA 4H01A 2PDMA 1QWKA 1V7AA 3UZZA 4F0SA 1TYGA 3DFSA 2ISSA 4GZJA 1TV4A 5C70A 2ZCGA 1JCNA 1TVPA 5FOOA 5HXMA 3NQGA 4HK5A 2A3AA 1FWSA 1C8QA 2VUNA 4AZGA 2VP8A 3WK3A 5AHEA 5IRPA 3NOEA 1ONRA 5LSMA 4QM1A 1YEYA 1DJXA 1B1YA 2W91A 1WNOA 1EFZA 2PWHA 3K46A 4HHLA 1S2CA 3LM7A 1JYXA 2OWWA 1BQCA 5H8MA 5IFPA 2WQDA 2DH2A 2VUYA 3MI6A 3OIXA 4IPJA 2PD5A 4YWSA 5BOFA 1OD0A 2QPXA 4X63A 1XRSA 3CIWA 3M5VA 3IAPA 2QPUA 2NSOA 4Q7IA 1TWIA 1RD5A 5KMYA 2YDAA 4Z2LA 1OX6A 1SU5A 1EC7A 3N3MA 3NPUA 4Y9AA 1IYXA 3F4CA 3K13A 3KTXA 3GXDA 1JQVA 1YRRA 5I6SA 4P7RA 4QTGA 4DUWA 3PPHA 1UUQA 3B9AA 2JKAA 4GFSA 1LQ2A 3WDHA 1M7OA 2XFRA 5A6TC 5LNSA 4KMQA 4F66A 4AYGA 1I1WA 1UJPA 2RHGA 2XPKA 1FP9A 4AX7A 1CGYA 3PWGA 3AXMA 2Y5JA 1KBLA 3TMLA 4OBSA 3E2VA 3UZYA 1S2VA 1J8VA 2X7WA 4IH3A 3N2BA 4QNEA 3TW6A 4ZQRA 2QCCA 3GNPA 3CL7A 1EQPA 3T6CA 4JX5A 3IANA 1W32A 4GI8A 1GUVA 4U3CA 3BZGA 3NEVA 1OFQA 4WCJA 3RRAA 4BEQA 4G8TA 1W3HA 2ZKMX 3IV8A 3WJYA 4N9DA 1ZHAA 3RR1A 1NH6A 3PWAA 2GVLA 3C5QA 1VEPA 3VNDA 3DFOA 2BVDA 4YVPA 4JNMA 4ZENA 5EKYA 4XZBA 2PLMA 1FWGC 3OGVA 1WAUA 4DRSA 3KWXA 3PAOA 4DNMA 4V28A 2ZX6A 5LIKX 4HCHA 3POCA 3VUPA 1AL8A 4JN7A 2XISA 1EH9A 1RJRA 4NJGA 5I07A 5HMSA 4Q3MA 4AZCB 3AIWA 1FCVA 1GOMA 1YX1A 4AZ7A 3N25A 2F2KA 2AL1A 1ZJIA 1SZNA 3KCLA 2QAPA 4X2RA 4INFA 4LALA 4DJDA 1H3GA 3A4JA 3DCPA 3DKLA 3N17A 5AY7A 2R1PA 4JKMA 1W1B1 4UOZA 3ONBA 5DRIA 3RF9A 4CD4A 4DUXA 4W7WA 4Y9OA 3PJXA 4P8XA 2P0OA 3D46A 1JZ8A 3XINA 1U1JA 1JEZA 3NPXA 1DEDA 1NP2A 3S3GA 1L9WA 1HP4A 1J0ZA 3U6WA 3DC8A 4Z1BA 3QXBA 1MW1A 4R9OA 3W2KA 3NCOA 1ME7A 3GS6A 4GY1A 2YL8A 4KKXA 3PZTA 3OQ8A 4JQ3A 3IK4A 2CLIA 4UQ9A 3KHJA 2ZYFA 1QPNA 3WBXA 3QMRA 5D33A 4AEEA 1H63A 1BYBA 2YSWA 1MUMA 3AU2A 2P5NA 4OBTA 1VF8A 2YLLA 4GYPC 1XYFA 1TWSA 4HZMA 4JTJA 3G8EA 3N9SA 5REQA 1LOQA 1H1NA 3MP5A 2OYKA 3TV8A 5A5WA 3WQ6A 3BC9A 3UGVA 1EGVA 4K6AA 2XYLA 4H41A 4FIRA 3BLOA 2NXIA 2HV5A 4DBUA 1W8SA 1L6YA 3ZWSA 2J8TA 3VNJA 3ZT7A 4FB7A 4KH2A 4MNJA 1NDVA 2ISFA 3NA8A 1VKFA 1W1A1 4GZ7A 2VCAA 4OU1A 1S2AA 2XIQA 2Y7FA 3N6QA 3DHPA 2A3HA 3S8HA 3UWEA 2PURA 1N2VA 3EOSA 3AMLA 4EXAA 3VKJA 3QYQA 4ZBCA 3UWWA 1WKFA 4IZGA 4LF2A 1MQRA 4XO6A 4ZL1A 4GIAA 4LC6A 4O15A 5XINA 2W79A 3RU6A 2VL4A 2QHAA 1M65A 3ENLA 1R5YA 3P0WA 1PO9A 1XKYA 4KCUA 1XLEA 1BKSA 3M0KA 2XGBA 5BXRA 4GD0A 4XUGA 3GXNA 4HTBA 4DLMA 1EBHA 1YTEA 4RNJA 4GUHA 4IXXA 4D1JA 4BI7A 1IR1A 2ZX7A 4AEFA 3A13A 3VILA 3TSBA 1C9DA 2EF9A 3LHWA 2A4AA 4C6QA 4RZ5A 3WELA 4CGTA 1RV8A 4BKNA 1NDZA 1LLZA 1BXCA 4JQ1A 4M19A 2IKJA 4XVEA 1U5JA 1PEZA 4ACZB 1UOZA 4D6EA 1OQFA 4C6EA 3GG8A 3EMQA 3WDIA 4JD4A 4HNCA 2V5KA 3GKFA 2ZUWA 1Q3NA 2OGJA 3QR3A 4J2MA 3H21A 4PMOA 3CQIA 1VBHA 3C6CA 4MWAC 5I3FA 1WXJA 3GIPA 1KRMA 1OYAA 1GOXA 2WSPA 1H0IA 1KM2A 3V75A 1ZBCA 4US5D 3V0UA 1MYRA 3PTQA 4GGHA 4C1NA 3HPAA 4UFIA 4B2DD 4O1FA 1UG6A 1AUSL 1QPOA 1RA5A 4AVFA 3OVQA 3QKEA 3TYDA 1XL9A 2PCEA 3SCTA 3W7PA 1I75A 1Z3NA 4WSHA 3WF3A 2J77A 3GK0A 2OT0A 4MKVA 1KNWA 3V3WA 2FVKA 2VGIA 4B5UA 3CLWA 4GH3A 1EHNA 3MBDA 4X9YA 1VFSA 4XISA 4JPGA 2FGBA 1G69A 1QOQA 4C6BA 3KXQA 3WUGA 2O4MA 2BSLA 2FDSA 7XIMA 2IUZA 3NQ2A 2F38A 2PI6A 2GQ9A 5A6JA 3TFCA 4H19A 1V02A 5A6SA 3A5VA 3WLOA 5DX7A 1CXLA 5D9PA 4O53A 2GQAA 5CCZA 4JX6A 3T4WA 1OD8A 3W7HA 1GOIA 4W5UA 4L56A 1JRCA 4U2ZA 1G5AA 3PPFA 1V51A 3KE0A 4IICA 3GO2A 3WNLA 4WDXA 1EF2A 1TREA 4PUKA 4YTRA 3W4RA 4IL2A 3CV7A 1E9IA 4LB4A 1E5JA 3GC2A 2HBVA 2V81A 4DJFA 3BCDA 3K8MA 5DY3A 3EZ4A 1PWLA 3GR8A 2CZEA 4IP4A 4LBUA 1WDWA 3P14A 5DELA 3L7RA 4EWJA 3VE7A 3BW4A 2C7FA 5CJMA 2MNRA 1H7PA 5FJTA 2EG6A 3I7RA 4DI9A 5F2MA 3F4WA 2GVGA 5G5IA 2ZDSA 3O6DA 1EJXC 2J79A 2OQHA 5E9AA 3VU2A 5A6BA 4I8DA 3WSUA 2VM8A 3BLEA 3URNA 2WKGA 4LT9A 4S3BA 2BOGX 3AIBA 4ML4A 3H4WA 5KZEA 3M7SA 2ACRA 3B8IA 3UGRA 1TMLA 4YIWA 4H9MA 4YWIA 1K6WA 3WD4A 1ALDA 4JTUA 5IBXA 1OGGA 5FF0A 3PM6A 4ZO9A 3MI3A 2E8YA 2ZQ0A 4LTSA 2KAUC 1XGDA 4UCFA 1NELA 3Q67A 4JFTA 2NSXA 1ADSA 3UFYA 2ZIDA 2REQA 1YNQA 1EDGA 4WY0A 3W7KA 1LWJA 1DL3A 3CIXA 2HE5A 2PB1A 4HKPA 2CFFA 3KDNA 3NPVA 5I3DA 1YADA 2G41A 2VX5A 3E0VA 1WXZA 4UMCA 1XUZA 2CLKA 1H62A 2F9RA 1MNZA 4P61A 3TQVA 2PS2A 4JBRA 5D8ZA 9XIAA 3FYOA 4FLOA 3N1AA 2H9AA 3T7VA 1RY8A 1THFD 1TR1A 3VKBA 2V67A 3S5SA 3GX9A 4FIQA 4QFUA 2OYMA 1IR2A 3MV01 4XZWA 3QLLA 3V36A 1TVNA 1QNOA 4XD6A 2NQHA 4JIIX 5G1YA 4P2VA 4GO8A 4QG8A 3EWYA 1QMLA 4DZAA 4B5XA 3UXDA 1EZ2A 1NWRA 4WZHA 2DFAA 2ZXBA 1BVNP 2XVGA 2FZDA 4MDOA 5E9XA 4MWAD 1IF2A 5BRBA 4H04A 3RITA 4Y9PA 1E9ZB 3FKKA 3ZQ9A 4MUPA 1ZCCA 1F61A 3DGBA 3G2GA 4WF7A 2YGYA 2O7SA 1R9XA 4K2SA 2A7PA 3MSDA 1MI3A 1UB3A 3HV9A 4A22A 4E2DA 2X7VA 2VZVA 3TU9A 2MANA 4AX6A 3FVMA 1GG1A 3GLCA 4RPPA 2VCCA 3TC3A 2QJNA 5AB3A 2FPTA 2NVCA 4IJRA 2WC3A 5CAHA 1LL7A 1PIFA 4BI6A 4CQDA 3IGSA 3VOJA 4A8RA 1L6WA 4M5PA 3WD3A 3EX6A 1MEIA 1T41A 4MMWA 1EDTA 1WBJA 4CD8A 5D2XA 1RCXB 5A6LA 4DAIA 1ISXA 3E0IA 2HPMA 1KWGA 3T42A 3R13A 1B9BA 2HVMA 2WSYA 2B7NA 5MKGB 4AZIA 1R7OA 3K8KA 1AK5A 3LG3A 1X96A 1RJPA 4FK9A 4G9PA 3W1AA 4E0CA 2X1TA 4LRSA 2QXWA 1XLDA 3VOHA 3PBVA 3HG4A 4CEXC 3NQEA 3M0ZA 3E02A 2HWGA 1JCYA 1HNYA 3W72A 1EB3A 4LUSA 2PDJA 1I0DA 5K7JA 1W3LA 4C7DA 1D7KA 1WAWA 1GQJA 2OGYA 4B5WA 3SUSA 1WDRA 1M68A 4M6PA 1Z32X 1MXGA 4FS9A 4JQ4A 2CZ5A 5FKYA 1W9XA 3CZEA 3K5XA 3E0FA 4REQB 1WYIA 3KRUA 1ISWA 4B91A 1G67A 1F9CA 3WQEA 5I3IA 4ZOAA 4GKTA 4LYKA 4DHGA 5M5DA 1JUKA 1KXQA 1VEOA 4UFLA 3MPGA 2BGNE 1V02E 4N02A 4YS1A 2QR6A 3QY6A 3K1GA 4R7JA 2XM1A 4F9JA 1XICA 2BHUA 4S23A 3CZLA 3V7PA 2PAJA 1GPFA 4JX4A 4JTRA 1E72M 2HJPA 4DPQA 1J9YA 4Y8EA 3SQSA 1L8NA 1QO5A 4PULA 3KZSA 4MDPA 5JIPA 1EJ7L 4UFJA 1YQ2A 1CWYA 2O9RA 1NQ6A 3L4VA 4G56A 1QJWA 3N19B 3BVJA 6ENLA 1QWGA 3DG3A 1H0GA 5H8PA 2MUCA 3MYOA 4CLMA 4FF5A 1KR0A 4XZMX 3VNMA 3AIEA 1LUCA 4XSMA 3IJQA 5G2IA 1BWLA 2PEVA 2PGEA 1Q45A 3UT0A 4UNLA 2NXGA 2ZRYA 1KRCC 4M8UA 3QKZA 2Z24A 2EGZA 3NNTA 3K8LA 3WH8A 2J25A 3T09A 1UR9A 1Q6CA 1F2JA 3SRFA 3TXZA 3CAKA 4A8LA 4E4FA 3BGAA 4HYRA 5E93A 1JULA 5AYIA 5C55A 2GQ8A 3STCA 4RZBA 3GVVA 4FALA 4LVAA 4ATLA 4AF0B 1J0HA 2FB2A 3T2QA 1WZMA 5EMYA 1PB0A 2YA0A 3MUXA 2NVAA 2ZX9A 1DBTA 5AN7A 5FAGA 3WQCA 3KRBA 1WDQA 3KUMA 1F3XA 2E9LA 5CSSA 1GVIA 3W7QA 1B0IA 3W24A 1EKOA 1YXCA 4Z08A 1A5KC 1X97A 2ZZ1A 1DQWA 2GUYA 1W17A 3ZMRA 1F6YA 4HA3A 1KM4A 2JGQA 3LPPA 1DHKA 3ZJ7A 2X1UA 2FPVA 2POTA 3FXGA 1QI5A 3QPZA 3WY1A 1DIKA 2X0YA 5AC7A 1E6QM 2QJMA 2QF8A 1CTNA 1VLIA 3F1QA 1VGAA 2CEQA 4QDPA 1E0TA 3LN3A 4HMCA 1PCWA 1F6KA 2OWCA 5LHFA 2JKEA 4HYVA 1JDAA 3ITGA 3PNZA 3UPWA 1EJVC 3VKCA 4GQ0A 3IIPA 3ZR4A 4AD1A 2ZWYA 2NUWA 5FF7A 1E0XA 1Q8AA 2QUNA 2VQUA 4RDYA 4HB7A 1O1HA 2J7HA 2PA6A 4H6EA 1XS2A 1W1TA 3P6LA 4ES4A 3SM0A 5F4WA 3KVKA 2W62A 2CNCA 2E9MA 2WZEA 3M4HA 3RM9A 4DWSB 3QPEA 3GD6A 3RXZA 2OZ0A 2E67A 2X8RA 2NT0A 4O16A 4UWMA 3NJ3A 2R14A 3TR9A 4J7RA 4GY7A 2YA1A 3VAVA 3WEMA 4X22A 4HZ7A 1ONEA 2W4XA 4L1GA 4WOQA 5G1MA 1QASA 4GJJA 1J2BA 3NXLA 1H50A 5LZLA 3OLIA 1PZ0A 3P62A 4NAEB 4Q8NA 3TZFA 5BWAA 4BR1A 1FDZA 4PFHA 3T8LA 1GQNA 5EMMA 1VJSA 4KRUA 3TAOA 3GR7A 3ZS4A 3G6MA 2GUUA 1DIOA 1U83A 1VFFA 3EWZA 4O0KA 4H9YA 5C2XA 1HN1A 1R3WA 3NXFA 3DG6A 1HJSA 4O11A 3E6EA 2QF7A 3VIJA 2BMBA 2OG9A 4EAYA 4GBUA 3RRXA 3HG2A 1CENA 5B80A 2D3NA 1EYEA 1CB2A 4M6QA 4X61A 1KCKA 4JHZA 4IPIA 3LCXA 4A2RA 1QI0A 1QVBA 2POZA 4KRZA 4GX9A 2VR5A 3BV4A 3IJLA 4M24A 4RDWA 3I3BA 3F4DA 3AUJA 5LA2A 4JTAA 3T81A 1SO5A 3AIRA 2W67A 4UFMA 1KRAC 4I9MA 2QJIA 1TTJA 1PVNA 2XU2A 3GB6A 2VRQA 3SUTA 4Q7BA 2EPMX 1XUUA 1OK4A 3A23A 4S3AA 2E4TA 3FVDA 3VGEA 3HIJA 1AH3A 4F0RA 2JBMA 5CPTA 2AKMA 1XCFA 2XINA 1LBFA 3MWCA 1YMYA 3AU6A 2RFGA 1S5NA 3WK1A 3LHZA 1V93A 2H8XA 2PWUA 4LEFA 5JBFA 4UTMA 4GUIA 2Y2WA 4R85A 4FOUA 3VOFA 2ZUNA 2NV9A 3GTIA 1OX4B 4F0LA 2X42A 3O6AA 4AD3A 3RLHA 2VT0A 2OZ3A 4UC5A 2BVWA 2QUUA 1EWDA 3EOUA 3SDOA 5LA1A 3QYSA 7PTDA 1XLIA 1R2RA 3DKJA 3G3DA 1OFPA 4QLKA 4MIMA 3TYUA 3KDOA 4O19A 2CW6A 3LCGA 5F4XA 3WNOA 2Q71A 1Q5MA 3ZLHA 3B8SA 1V3JA 4L9ZA 1KC7A 3T8QA 2JKPA 4KRTA 4O12A 2EQDA 1REQA 4M6VA 3W02A 1EJTC 3R4IA 2XZ7A 2VEKA 3NURA 1G4TA 4AVOA 1PCKA 2XZ9A 5FJIA 3W2JA 1KBJA 1Z9AA 1TE6A 3S2JA 2YFNA 3V1HA 1FWCC 4L7ZA 1QPKA 2ISWA 1Q65A 4H7VA 2PDQA 1BQGA 2A1YA 3CB3A 2DZAA 1JDCA 4PL2A 3W75A 2V3EA 1CBGA 1JCXA 3BURA 3ITYA 4TX6A 1H2JA 3AYRA 8CGTA 5CG0A 3HO8A 2BTMA 2HTMA 3UCQA 4JHMA 2FZ9A 5CPLA 1JD7A 2OSWA 1O6IA 2E1WA 2GYIA 4WR3A 5F2GA 1PX4A 4TVCA 3G5EA 4PCFA 2Y88A 3M5XA 2E6FA 3G1XA 1WXYA 3TYZA 1BHGA 1WE5A 2QUMA 3LLDA 4O8RA 2ZZ6A 1C8VA 5ABGA 4XV0A 1WOAA 4IM4A 2DT1A 4UQCA 1GK8A 4A05A 1MRAA 3TROA 5D03A 3KTSA 3LNPA 4W8AA 5E0FA 3OHIA 4MB5A 1K3UA 3KBVA 2EKGA 5CPNA 1M3UA 1MO0A 3BG9A 3VKDA 4KERA 1PJ9A 2J6XA 3KCJA 2ZTKA 4US5A 1UMYA 4HHMA 4B2DA 4WGXA 1DJYA 4MVAA 4K7YA 3UZWA 1IWAA 4XKYB 3BZJA 4UTHA 2DJXA 4JAWA 1A5CA 3BLIA 4GQGA 4R5EA 1TUFA 4ZQNA 1H1YA 2I5GA 2Q6ZA 3NDZA 4FMVA 3AFBA 4UTIA 3E1F1 3TWAA 5BU6A 1XIDA 4Z2HA 1OCQA 1W54A 3EOOA 3AIUA 2DJLA 2FZ8A 3WQWA 3G3MA 2KX9A 1PZ1A 3WBWA 5C5YA 3VDGA 5EFDA 4O50A 3DHDA 3T07A 4MY9A 4PRTA 1R3QA 3CGTA 2ZADA 3W76A 2XFYA 3SGZA 1PUDA 2VEPA 1KLYA 1TX0A 1W3NA 4LFYA 2XWEA 4ENLA 2GVEA 4O52A 3DESA 4AQLA 2FPYA 2NQLA 1WB0A 3CV6A 1IEIA 1T0OA 2A2IA 4HPGA 4L6HA 4HU0A 3BARA 3E5PA 3MDWA 3NYDA 4HPNA 4S2BA 5ABTA 2P50A 3ARUA 3KVMA 4N4PA 2ACSA 1Q2SA 3UNDA 4ZO7A 3VK5A 1TUXA 2WJDA 5BXSA 2Z25A 4GYPA 1U5HA 3ITXA 4XBKA 3WK2A 4LS0A 1AQMA 3LRMA 4RW3A 2WWDA 3W7OA 4KWUA 7ODCA 1UHVA 4Q6JA 3EAUA 2WMIA 1A0EA 4AWTA 4XBJA 3W6YA 4TTUA 5CGTA 3VOGA 2CZDA 3W25A 3WX7A 2WZIA 4N42A 3H22A 3S9IA 1E1CB 2W6RA 3HA1A 1XINA 4AIOA 3YPIA 4LVGA 4PCSA 2V38A 3MQTA 2HMCA 6TIMA 1CLVA 3GFZA 3CZJA 3VUSA 5T9BG 3WUBA 5GVJA 1O5XA 4TX9A 2HXUA 2PGRA 3E2RA 1UKSA 3CHFA 2VZSA 3AMCA 4QLLA 4QDMA 3UEQA 4HYWA 3CMGA 1PYFA 5DY2A 4PMJA 4X3ZA 4EKJA 2A79A 3SB0A 2ZZ5A 5K2ZA 3EDEA 3TP4A 1ZRQA 4O57A 4NJHA 3ITTA 4RZ6A 2J88A 3VNIA 1HZYA 3UCCA 1A5AA 4RJEA 4NL1A 3EA1A 1A5MC 1KD0A 1LWHA 2PPGA 3S2CA 2JEPA 2Z26A 4WOZA 1G4SA 4XIAA 1HJXA 5C2GA 2C1GA 5AYBA 3B8UA 1YDOA 1H5VA 4IMDA 2OX4A 1KGXA 4MKSA 1OJXA 3N2TA 4DUOA 1VAHA 5ENLA 2PDHA 1VFMA 3AO0A 2JQXA 4MTVA 4YTSA 4LVDA 4QQUA 5AC5A 4Q4KA 2FZMA 5JU6A 4U31A 1FX6A 3LCFA 4O4VA 4UR9A 4XQ6A 4EF9A 3VMNA 1EBGA 4NJKA 1X6UA 4HU8A 4C5ZA 1J01A 4R7WA 4IISA 2G97A 3TYEA 3SZ8A 1SZEA 1HKJA 4WJEA 2FZBA 2FTPA 3LBOA 4IUGA 4KWSA 4Q4PA 3FS2A 3W1NA 3L9CA 4Q8PA 3FEMA 3W74A 5CKSA 3N13A 4ZFCA 5FEWA 2I9UA 2G3NA 4MWAA 1OB0A 1LRQA 1YE4A 1PSCA 3N6JA 2ZVRA 5H2ZA 1G01A 3BTNA 4PMDA 1JPDX 1I2NA 2FTWA 4DBSA 3RM8A 2UY5A 3UNTA 4G2DA 3VD9A 1SFJA 1MNSA 4J4KA 5HA7A 5A8NA 3WH5A 3AUOA 4NRRA 3GXIA 1OG6A 3BAXA 3WYZA 1DQUA 3O0FA 2XIJA 2V8ZA 1O95A 1KFEA 3AMDA 4I9JA 3H23A 4DY1A 4LANA 2D22A 3ABZA 1HW6A 4QAIA 5E1QA 2YBUA 4PUJA 3IGXA 4CN6A 3O0KA 3BXWA 3UG4A 2O9TA 1BKHA 2O0TA 2I5IA 4DIAA 3VGDA 4I8YA 1FFRA 4IUOA 3SCSA 1U1HA 4GQBA 4PCNA 5G4HC 1V6UA 3V18A 4UTFA 3HQOA 4O1AA 7ENLA 1EC8A 4A3HA 4ZXLA 4XWUA 5HJXA 1G4PA 2GOKA 4M51A 2OJPA 3DFPA 3ARSA 1ESWA 5TNVA 1DJGA 2Z29A 3WUFA 4H9VA 3RCYA 1QTWA 4OV9A 2HISA 2RDXA 4DYKA 4GVGA 3EKGA 3TN3A 3MZ2A 1GYNA 3DYOA 2DZVA 4Y2WA 1R3TA 4S3DA 4V1YA 1M7JA 3GBEA 2RDTA 2Z1SA 3BW3A 2QCGA 1UWRA 2R1MA 2C3ZA 3EWCA 3HTWA 2Z1XA 5CLWA 1JPKA 3ARYA 3CEPA 2F7FA 3CZ8A 2IQ0A 3KOWA 1VFTA 4HNOA 2E7FA 1KXTA 4OGZA 4WJ8A 2QMKA 1OBAA 4UZSA 3FDGA 1DJIA 1TX2A 1IEWA 3PJUA 2Y5EA 1GNXA 1W3IA 4M1BA 1TJPA 2JIEA 2WW5A 3C2OA 3LXBA 3REQA 2QCLA 3WUEA 1P0BA 1VIWA 3THDA 5I0DA 1FP8A 2R6OA 1AW5A 2R8WA 3LUTA 4D6IA 3CT2A 1LT7A 3BLFA 1KBIA 4HNTA 2GK1A 4D1IA 5J04A 4DQWA 4XZLX 3T0TA 4BF7A 4IHCA 3N6HA 3ZJ6A 1TV8A 4JN8A 4MF4A 3SCUA 2VEIA 1B54A 3URQA 4HNVA 3STPA 3STFA 2QJJA 4E8DA 4R27A 5G2WA 4O10A 3QGAC 4CN1A 5DF0A 2WB5A 3LXCA 2OEJA 1JRBA 4FOJA 2RAGA 1OF8A 3EA2A 4GCAA 1UUOA 3RNDA 2PDPA 3B9DA 2WPBA 3B8DA 3HB9A 3W6MA 4AU0A 3KS5A 1FTXA 3GC4A 4QJ4B 1BTCA 4JS3A 3HG3A 2FJUB 5LNUA 2UZ9A 2JGYA 3M44A 3HGSA 5RUBA 1KBBA 3P0XA 4FA3A 2YDSA 3PB2A 4N6EA 3NTYA 1TA3B 3PBUA 5REQB 4UOJA 1E0UA 3KBJA 2WMJA 4IFOA 3VDAA 3ABQA 3VE9A 4Y90A 4Q4OA 2RDWA 4DF0A 6PTDA 5HWNA 3EWDA 2VZOA 2VQTA 3ABOA 3W88A 4CVWA 1J0KA 2FMOA 4R3UA 2OMAA 4IJCA 2Z28A 2BG5A 4UZUA 1EEXA 1EP3A 5LHEA 5HBFA 1VYSX 4PSRA 5FIPA 2VTFA 3W71A 4AXKA 4FZIA 2WNNA 1UR3M 5BU9A 3IJIA 4JR5A 3QZ6A 3UWYA 2WYSA 3FYPA 4RLIA 3FFSA 3M0JA 3R0DA 4FXRA 4L80A 2E6AA 2QVNA 1TZ9A 2P88A 3CTTA 3WF4A 3SW6A 2OPJA 2DU2A 3H7UA 1W3KA 1T8QA 5CAKA 2OLHA 5I06A 3W84A 1E43A 1I45A 4NILA 1FKWA 3PK7A 1F4HA 1V08A 2IQDA 3M1ZA 4C6KA 2PDGA 1RCOB 5LIUX 1JZ4A 4D9PA 2OZ8A 3LQLA 2PDKA 3B03A 1W37A 4IQDA 4GXMA 4F2BA 1WKEA 1SSGA 1RP8A 5CBBA 1JPMA 1O4UA 1GQIA 3QHMA 3UR8A 1LM1A 3O6CA 3B0UX 3PG8A 3SIMA 2V3GA 3G0XA 1UR2A 1XLHA 3QW4B 1E1FA 1US2A 3L4ZA 3VD5A 1BVZA 3PJTA 3HF3A 1E6SM 5AYZA 1TTQA 2CBVA 3VC5A 1L2UA 4F8XA 1FXQA 1QBAA 3FJ6A 4FP1A 4A29A 2Q3RA 1P0EA 4ALDA 1US3A 3TJLA 5F2LA 2FHCA 4UUIA 4PL1A 1F05A 4JIQA 4C1NB 3UWZA 3ANUA 4ILSA 3CLMA 4DBWA 1O5QA 1OFBA 2VFFA 3VFCA 1GQKA 3H26A 4GE8A 2EKCA 4GINA 5J5DA 3RUBL 1Y7VA 1K8XA 4IGSA 1AODA 4EPEC 1PIIA 1VQTA 2D2OA 5A2CA 1JNEA 2W66A 3ATZA 3R79A 1CEOA 3TTQA 1RD6A 3H2FA 3M6YA 4D2JA 2PRLA 3KX6A 2V5BA 4GFIA 3PBYA 1A3XA 1V6XA 2BS9A 1RVKA 3INPA 5C8BB 4M6UA 4K38A 2G50A 2CXEA 2WNWA 1QXLA 4O0QA 2B0MA 5EY5A 1U30A 1XYLA 2WZMA 3W87A 4UBPC 5JBEA 1A80A 3UXKA 1DTNA 2I16A 2GUBA 1W31A 4L4OA 4F79A 1CPUA 1E4MM 5DCEA 3EPOA 3APGA 6REQA 3KW3A 1JDFA 1F3TA 2QUVA 1M7PA 4G5DA 3NO5A 5LXXA 1Y0EA 4XBSA 3VNKA 3MSYA 5DMMA 1R2TA 3DYMA 1B31A 4TOQA 5K9CA 1SW0A 1CDGA 4QJ5B 3W2UA 5JVLA 4W87A 5FSDC 2FGLA 2DUZA 1V6WA 1AW2A 1AG1O 3FGCA 1AA1B 4LAKA 2AGTA 4FI4A 1UASA 1ZB5A 4ROPA 5HR7A 3FV9A 1RK5A 4FXSA 2HDJA 1PTDA 2YFOA 2VDIA 3AJXA 3VX1A 3EXTA 2YBTA 1XH0A 3M7WA 1MRQA 4U10A 1DKWA 3P67A 2DZTA 3QH2A 1IGWA 2J8GA 2WVVB 3H7RA 5KEZA 3UJ2A 1X1NA 2WHKA 5H1WA 3FIGA 3BH4A 3QQWA 4HPXA 1IE7C 2WZTA 2XWDA 3NDYA 3LTPA 2VJXA 2DEPA 4IX2A 2FB3A 3VXGA 2CCRA 4DO4A 4JTEA 2GJNA 1QI2A 3QC3A 3M47A 3PB0A 4IMGA 5FL0A 1TJ1A 1PL9A 4NNAA 1C93A 2GGIA 1NM9A 3N3TA 2REQB 2XJ7A 2BP1A 4DJEC 4WY0B 5DLCA 4Z42C 2DZBA 1FKXA 1TKKA 2I9EA 2XVPA 1PAMA 1VPXA 3IAQA 3W7IA 1FWNA 3KHDA 1B4KA 1P6CA 2X16A 3TN4A 4IJBA 2WLZA 1DXIA 2WQPA 2RH9A 4AF0A 4I5RA 2R94A 2H9AB 3H55A 3STGA 1NOWA 4ZR8A 1EOKA 4QEEA 2BOFX 5A8MA 1B3XA 1Q13A 4JYFA 2GZXA 3MS8A 4DO5A 1PWMA 3W28A 1UD3A 1XBVA 4B90A 3MMTA 1QO2A 4DI8A 4FNTA 2GGHA 5I79A 1IXNA 5D04C 3VM5A 3HN3A 2UY4A 2OOFA 3MHGA 3LCLA 4PUMA 3LDVA 1PIGA 4HPHA 4K36A 2Z6IA 3GG0A 3C56A 2GWNA 5AC4A 4XZNX 2C8NA 4DELA 2OX1A 1F3WA 1FWHC 5HNUA 1YTDA 3CQHA 2AQWA 3MUY1 3CQ0A 4W5ZA 1WUEA 2CHRA 1O94A 4M0XA 3BCFA 3M64A 4D6HA 1ZUAX 2QQ6A 2QCHA 5TBOA 3RCNA 5IHRA 1CCWB 2PBGA 1GTHA 3R89A 2IMRA 4CU8A 3BW2A 5AYYA 2DT0A 2X40A 1Q7ZA 4XVDA 4C6CA 3HPZA 2IPFA 1H7NA 2PE4A 4XD5A 4PTMA 4Y9NA 4O17A 3S5OA 1XLKA 3UR7A 1DWGM 3MJMA 3GXTA 5FESA 3MO4A 4MJZA 2CPUA 3NIYA 3LB0A 2Z1WA 1EJSC 2SFPA 1GKQA 2A3LA 4CU6A 4J3SA 1GT8A 1OIMA 3RMJA 5CLTA 4DO6A 3MSGA 2IXUA 4TQTA 2QIIA 3LGGA 1G9HA 3TMQA 3K30A 1VFUA 1IEQA 2INZA 3RN6A 1HIZA 3U0HA 3LPFA 1YYAA 2D0GA 3WLKX 5I7GA 2FGZA 3KL3A 3RAOA 3T55A 1UWSA 1J11A 2Q8XA 5J5RA 4P5UA 4JQ2A 4LUSB 1JDEA 1BEUA 3MANA 3CPGA 3WJXA 1KFWA 2WHJA 1E9YB 1O12A 4D8LA 2OTDA 1BSLA 1H1ZA 4F4RA 3OZYA 1E4LA 4OECA 3GNXA 2CWNA 1MMFA 4JGDA 3ZT6A 1M53A 1V0MA 1C7TA 2VGBA 2VC6A 3BV7A 4HCLA 1E9LA 3OB8A 4ZQPA 4UQAA 1DE6A 1UR4A 3VO0A 1MDLA 3PBGA 3WQOA 3HMJG 1RZMA 2Z00A 4OIFA 5K4ZA 3FEQA 1XYMA 3CT7A 7REQB 1VBRA 4AHOA 1SZFA 2VEMA 5CJNA 4LEQA 4J2PA 1JZ2A 2C79A 1B3OA 3IACA 2YCIX 3CH0A 3B8VA 2IXVA 5M17A 3H6OA 1CXHA 1IWPA 3H24A 2PDXA 3A3HA 1G94A 4PUDA 5EMLA 4B5TA 3E49A 4HK7A 5FA5A 1XGEA 5CZTA 1SUXA 4IIHA 5DMLA 3W1PA 1TPFA 4RDVA 3SY1A 3GU2A 3WFZA 1OEPA 2UY3A 3H7VA 1LUCB 3KVJA 1UH3A 1QNVA 1AL7A 1J79A 2PLJA 4AB4A 1MWOA 5DXXA 2B7OA 3HPFA 4DJED 4NZFA 2HXTA 2H8ZA 3UBPC 1F8MA 2TMDA 3GW3A 2G3FA 3QRHA 4ATDA 3O07A 3UWUA 3GDKA 2I14A 5H6HA 3PFRA 5GQBA 2D0FA 1P6WA 4UTUA 4QDWA 5FF2A 3NZPA 1QDSA 1M04A 1NFBA 1Q4NX 2DORA 4C6MA 2VOTA 4NZCA 3BAYA 2J8FA 1I4NA 2EPKX 3GAYA 4HNLA 3CMJA 2PTWA 3M0MA 3SBFA 4V33A 1UPPA 3UP8A 2Z4GA 1UD4A 3UQNA 1U2YA 3M0HA 3ERPA 4JCLA 3TX9A 3ABRA 3RX2A 3L66A 1VS1A 2V5JA 4YCOA 4Q7NA 2PTYA 1TPWA 2ON3A 1UH4A 2G3IA 2XFFA 3AI0A 4V15A 3K4DA 3P5YA 3DYPA 4EPBC 1E71M 4NUWA 4HA1A 2BY0A 2J4GA 4RKAA 3QY7A 1ZAHA 1W2VA 3RX3A 1UZDA 1EIBA 1NWUA 1VEMA 3R1ZA 1OC6A 4QLJA 4J27A 2D20A 3CXOA 3VZYA 4O18A 5I3HA 1HO1A 1K77A 5DQPA 3FDKA 1TQJA 1GTEA 4J9JA 4ZCWA 4J28A 3SUUA 1S39A 2V5DA 4B9ZA 2J9YA 1P5BA 5HAOA 1FHDA 1UBSA 4GJ1A 1MEHA 1YDYA 3BSMA 4W86A 1GVFA 3G1RA 2AQOA 4KEVA 3QM3A 3NDOA 3S5NA 1LL4A 3F7JA 1L8PA 2C0HA 2VX7A 2TRSA 3HGJA 3OIHA 3ARTA 1UWQA 3GVWA 1H7XA 1ODUA 2NWSA 4HD5A 4E5TA 8TIMA 3LEPA 4PEKA 4Z1DA 4HN8A 4P7OA 3WH9A 3FJ4A 1S2WA 4ASTA 1FA2A 4NAFB 2ZA1A 3V16A 3U2OA 1YIXA 4GK8A 2PDNA 1SR9A 3PVFA 1E56A 3KBMA 5FF4A 1E3ZA 2BBFA 4PTNA 2ZUSA 4L6DA 1GYLA 1LDCA 3WLSA 3LTSA 4ZQCA 4EF8A 2OR2A 3NQVA 4NY2A 4XIMA 1HX0A 3RK8A 1TG7A 3WH7A 4BS0A 2G4JA 4UFKA 4G6CA 3DC0A 2CZVA 1K8ZA 1B90A 2Y85A 3O1NA 4LYPA 5EMKA 1XH2A 3S6OA 3AHXA 1OCBA 2J7BA 1SJCA 1ZJHA 3OG3A 2B4GA 3L2MA 2WKLA 5FJOA 4NKCA 3GBDA 4Q33A 4MB4A 4DM1A 1QI3A 3GYCA 5AZ1A 4HSHA 3A6OA 2LLEA 3QLDA 1GOWA 4GCXA 1G1YA 3EX3A 4DPPA 3AWOA 3UU0A 2UBPC 4W93A 3WN6A 3ZFHA 3AISA 1MQPA 2CU0A 3R94A 1XRTA 5FJUA 1RY0A 1TPB1 3I7QA 3N12A 1FWTA 4PSPA 1RUSA 3WF2A 3AZRA 4IG2A 1ZALA 3AIQA 3AS3A 3HMCA 1VFOA 1BRLB 2VVSA 2WWCA 1AMYA 3HQ1A 3WD1A 1CGWA 5IDIA 2Y4SA 4K39A 2Y7GA 1FOBA 3FA4A 1DP0A 1Q6FA 3VGGA 2OKOA 1Y8BA 3M41A 4V1XA 1XJBA 1ECQA 4AZ5A 2QVHA 4JYDA 2G8ZA 4ONVA 3CV2A 2ZXQA 4CVUA 2BZNA 2XIBA 5DCBA 1WO2A 5E0KA 2QYGA 1UWTA 3P74A 1ENUA 1UMLA 1SYTA 2Y89A 1XLCA 4CQBA 4UR7A 3S5YA 4O1DA 3WMBA 1WKYA 2YCLA 3K4WA 4ZSTA 2BHYA 1W9PA 2J62A 4HHHA 3S1UA 4YTQA 3KVLA 1QK0A 5AVNA 1QUMA 3MV11 3T0AA 3KAOA 1IXPA 3KOYA 3PZMA 4EWND 3FCPA 3DOPA 4DZIA 1J96A 4IL0A 2C1HA 3JZUA 3L23A 3CMFA 3AZTA 1VBGA 1T99A 4HOXA 1J4EA 3BG3A 4GG9A 1G6CA 3TEVA 1H49A 2ADAA 3W2NA 1K9EA 1DWIM 4ZODA 5XIAA 3LENA 3VIHA 2D0HA 4MADA 2EG7A 1C9WA 3O8AA 3I65A 4OV4A 1LP6A 4YVVA 4HTYA 2WANA 3SCNA 2QULA 4RCXA 3CUZA 3TJ4A 3GIYA 4H3DA 1X8FA 2VC5A 3NOYA 4MZ1A 3OHMB 1XV8A 3K1DA 1T40A 3BOXA 2NLYA 2YB1A 3CYVA 4GXPA 3C0QA 2ZE3A 2W0UA 2YYUA 5HQMA 2Z1BA 4HVXA 3OP2A 5BMXA 4PEEA 1NAL1 3NWRA 1NSJA 1H7RA 1QBBA 4RL3A 1PS9A 1K4HA 1OC7A 4FO4A 2C6QA 4DX3A 3W27A 3B9OA 3GHRA 3VZXA 1IHIA 4L4PA 4UMBA 1JXJA 5IDZA 1TMQA 3W23A 4WKAA 1QT1A 1LORA 1JZ5A 4DBDA 1GJPA 2J6VA 1W0MA 3NZ1A 1PTAA 5CZSA 1NJJA 2AL2A 1RXOB 3PR2A 1C29A 1DVJA 2J7EA 3GHTA 3QQ0A 3DG7A 3N73A 3WLPA 2AMXA 3C2VA 4RK8A 3GUWA 2E77A 3GXPA 1QI4A 5C9WA 2Y8VA 3TA6A 3E2SA 1YXYA 3BOLA 1JCLA 4PC8A 3D0CA 4C6IA 4Z1AA 3PZUA 4BCEA 3WF1A 4S3KA 2P8CA 1J0YA 1ME8A 3IGHX 4GBDA 1P0DA 3V1PA 4GYFA 2WHMA 3UR5A 2VD9A 3TTEA 1IXQA 1DIDA 1EL3A 3UZ5A 2EG8A 5FCZA 4QP0A 4TMCA 2PDBA 2QDEA 2GGGA 1TZ7A 3BAKA 2QDDA 3SN4A 3G1HA 3TOPA 2ABBA 1JYVA 4S3FA 5EPDA 4C7FA 1GOQA 3PTKA 4NX5A 5A8QA 4UCGA 2B7QA 1VPQA 4MGGA 2TAAA 4J40A 1PHQA 2Q02A 3ARRA 1XYBA 1ZNNA 3GR4A 5A3HA 1M01A 1YNYA 2O9OA 1EDQA 3WIJA 3L21A 1DQXA 4Y6GA 4Q8OA 1AVAA 1W2PA 4IF2A 3B9EA 3T05A 1KKOA 2HVOA 1P1MA 1LRTA 1J5TA 5A6MA 4CNNA 1IGSA 1JCJA 5FEXA 4LQ1A 1ME9A 8XIMA 1T96A 1V6VA 3HPSA 1EA9C 2Q3OA 4HMNA 1MDRA 4C1LA 2VOMA 3CK5A 2DSWA 1JCTA 4WDUA 2WC7A 5FL1A 1WP6A 1OFRA 3I4EA 3N4FA 3ZYZA 2W63A 3E5BA 1YKWA 4Y8FA 1JZ7A 5TF0A 3EMCA 1XG4A 5H8UA 3MUAA 2IKHA 1A5NC 2WMIB 1EP1A 1KTCA 1VLWA 3EWBX 3PUGA 4QSFA 1XD1A 3VCNA 2Z1VA 4AWSA 5DCDA 1R47A 4EVZA 3WH6A 2A6LA 2J13A 1EGZA 4DWDA 4XSLA 4PN2A 1ZBVA 3L5AA 4LY8A 3RIKA 3UY8A 1W8GA 4XAFA 1LQ0A 1NDWA 1XRFA 3PUOA 4EK7A 3U57A 1WDDA 3WBEA 4RXFA 3BQ5A 1X39A 1QOXA 3GXFA 3MMDA 4FX6M 2QEZA 3TOYA 1TJRA 4IGMA 4J3ZA 5CJ5A 4H1ZA 4RV3A 5FACA 2VDGA 3VNYA 5HJYA 4A8NA 4LV9A 2F2HA 4UQEA 2OQLA 1KFJA 4ZMGA 3M5ZA 4B4HA 5D38A 2WJEA 1QK2A 4BA0A 4OWGA 4XG1A 3COTA 1TA3A 3U2EA 3GG7A 5I2UA 3SGUA 4H8VA 1RA0A 4FNQA 1S5WA 4HNNA 4KS0A 5HMEA 3IRSA 4CCDA 1BYCA 4HSOA 3DENA 3MCNA 3WNKA 1ZENA 3TFXA 2Z2UA 4E8GA 1K9FA 2WM1A 2PU0A 1FH7A 3PPGA 4CUCA 3TUUA 4GIRA 4R88A 5HDRA 1UP2A 4QCEA 4JHOA 4JKKA 3WJSA 2HZGA 3GRIA 4KEMA 2W27A 4XD4A 1L6GA 2QW5A 1FY6A 3D3AA 3LS9A 4KFOA 1XSKA 4OOZA 4MJMA 4AZBA 1VCVA 2BY1A 4H2CA 4WDWA 2V30A 2HS8A 4IMFA 3TQ0A 1V5XA 3VCCA 3WJWA 1EP2A 1RALA 1OM0A 3H2CA 3L0NA 1JAEA 1XIFA 1P6BA 1WQ5A 4MWAB 5CBJA 4N9BA 3TW9A 4LCSA 3EGJA 4GC3A 1W1YA 4ZGYA 2L5HA 2EPLX 2OSYA 4AYSA 2VRJA 3K2GA 1OT2A 1CNVA 2PD9A 3NQCA 2G5WA 2HNHA 1RR2A 1J0JA 1E4NA 2G37A 2E5CA 4JFWA 5D30A 2NZLA 3GIQA 4LBSA 3N9RA 2VI0A 4NASA 3EX4A 3VFLA 4B16A 2F61A 2O56A 2NQJA 4QR6A 2H90A 2O4QA 3P81A 5D9OA 3SAZA 3EMZA 1RP9A 2DSUA 3LMYA 2DUAA 1BGAA 1ZP3A 5IXEA 2TODA 2QV4A 4U33A 5JUVA 3SO7A 3UERA 3W1XA 2RKXA 5H91A 3VTRA 3ABXA 1G7UA 3GAKA 3NQAA 5BOOA 2C13A 3PZOA 3G1DA 4M80A 1KV8A 5HWMA 2O55A 4A4AA 4O8AA 4WD0A 4HT3A 4QS6A 1JD9A 3PTMA 3CAQA 2ZFAA 3U7BA 1ADOA 1PHWA 1R86A 3M0VA 4O0ZA 3L4UA 1E51A 1AQ0A 4H4IA 1EJUC 3M43A 4KWOA 1V0LA 3EWXA 1GOOA 3RG6A 1E6RA 1KW1A 3V4BA 2CXGA 2DZUA 1XIEA 3WLQA 1IZCA 8RUCA 1GKRA 2G0WA 3GU1A 3DUGA 1ICQA 2HSAA 4L1WA 5A2AA 3M16A 3THAA 3CHEA 1PZ3A 3L2IA 3GNOA 1U5VA 2X2GA 3WBAA 2YCJA 4PUNA 1N55A 3GHUA 5BROA 1ZJBA 3BCJA 1LOSA 3PUDA 3OO2A 3DERA 4TU1A 1QATA 1DJQA 2JALA 4KWVA 1I60A 3VGBA 3CPRA 3CV1A 5CC6A 1Z8AA 5KZDA 1CGXA 1S38A 1CXIA 1ZLPA 1QHZA 3AZSA 3QBUA 3REQB 3BLLA 4C6NA 3WK0A 1TE1A 3N04A 4AD2A 3CHDA 1LLOA 4JEQA 5FEPA 3R8GA 2PC8A 1HGYA 2GK1B 4WGHA 3O7UA 2Y62A 1F3EA 1MUWA 3S47A 4CU7A 4Q8WA 2QCFA 2CLMA 4HU4A 3BMXA 2A5HA 4QCFA 3DGRA 1XLGA 2NUYA 2BLEA 3D6NA 2PDUA 3IRDA 3AMKA 2G3MA 2DZSA 3MT1A 5IHSA 3ONCA 3GSMA 5CSRA 4GC4A 1D7FA 3AC0A 4Q6XA 3SY5A 2G3JA 3D3FA 1A5LC 2GPTA 2HK0A 1HQTA 5GJMA 4LYQA 3WLJA 3M07A 4TO8A 2PDYA 1K70A 1F07A 1UR8A 4DJEA 3N11A 3Q94A 4MNKA 3V0SA 4D6FA 3S9YA 4L9YA 1WA3A 3C3NA 4TMBA 4K68A 1B4EA 3FHAA 3SCWA 3MCOA 4PMZA 3BLKA 3CH9A 1PKYA 1EJWC 1WV2A 4FOKA 4JIPA 1NY1A 2AAMA 4B3ZA 4RZ4A 1W9VA 1BXBA 1UIOA 1IXOA 2C19A 4Z2IA 4AXNA 4EACA 2F6XA 3WFAA 4PFMA 2WVVA 3ORWA 9CGTA 4FNUA 5GNYA 4ZZ9A 1CLXA 5D2VA 2X41A 1UKTA 4RE0A 3VMPA 3FXYA 1LTDA 5T26A 4AY8A 3SECA 4S3GA 2CERA 1XLBA 5CGQA 4TV6A 4ZE4A 3DFHA 1FWWA 3ARWA 3ZSSA 4D8AA 3CL8A 1AD4A 4J5NA 4JTFA 3MYPA 1NFGA 4WJXA 3PG9A 1XLFA 3KLKA 5M3WA 4Z17A 2D2HA 2CZFA 1JFHA 4IP7A 1XQKA 4M7SA 3VKKA 3UWQA 4BY3A 3WCZA 2FTYA 3DDMA 2FIQA 1BYAA 8A3HA 3PNUA 3T08A 4LAMA 4U5KA 3UJSA 3E12A 3EEGA 3VNZA 3SRDA 3VKAA 3LLXA 5AZ0A 4LVFA 3UPBA 3A24A 3LY0A 3HPXA 1VH7A 5J8LA 3PZNA 4D6JA 1TPEA 4DZ5A 1V03A 3MW7A 4I9TA 3VCRA 7A3HA 1ZQ5A 1J6OA 1B3YA 1K1DA 4ADUA 2X2YA 1KM6A 3R6IA 4NXKA 1JI1A 2WSQA 3BLPX 3WLNA 4Q8UA 3RR4A 4I3GA 3RJYA 4BWLC 3NL5A 4BF9A 1KFKA 1FHVA 2A0NA 4JCMA 2P10A 3KZPA 4GQQA 2VWTA 4PUEA 3TC7A 1IWBA 2GOUA 1R8LA 1SZRA 4Z2JA 3G1AA 2FH6A 2PC4A 2V63A 1HJWA 3TTOA 4LYRA 2WBGA 2YR1A 3R11A 4NNBA 4MPKA 2J27A 2X1IA 4KGLA 1RK6A 4IPPA 1DHPA 2BWGA 2UV8G 3BQ6A 3TNBA 2C18A 4OE7A 2HEJA 1QW9A 1R7AA 2VX4A 4YPJA 1LBMA 4RNIA 2WMFA 4F40A 4F2UA 1H7OA 5BRPA 1W6TA 1CB7B 3G8RA 2OO0A 3A4WA 3CUJA 2DZPA 2NLIA 1X7IA 1VCFA 1JGMA 4AH7A 1KQYA 5AHNA 3SQLA 1E3XA 1VFLA 4DO7A 2PLCA 5DT5A 1DTUA 3UZXA 4KEUA 1Y5WA 2E68A 6XIMA 1VBJA 4S2CA 5CEWA 3U2CA 3MP3A 4KBXA 5FI8A 4JTCA 4WEVX 1GHSA 4D6DA 4XAZA 3AWNA 4BZYA 3I3EA 3Q58A 5E0CA 3R5EA 2VZUA 1KCXA 2WXDM 3CWHA 1V3KA 3CUXA 3EDJA 2PZNA 4AMAA 4HNUA 5CZ0A 1UD5A 1X8CA 3BGGA 3MZNA 1W5NA 1SR0A 4ZB2A 4AY7A 2HE8A 1OG0A 2WNQA 4YHEA 1FDYA 4PA8A 2VDHA 5I24A 4HMEA 3PS7A 2DPEA 4IIFA 3ZVIA 5K3VA 3SUWA 3WJZA 3OOQA 4K8HA 4MPQA 4LNYA 4AISA 6REQB 3QV7A 1ML1A 3SSZA 4E2BA 3PBMA 4ZXOA 2AGKA 4ZTYA 4KIEA 2VEGA 1Z44A 3HOJA 4JL2A 3C2EA 5EFFA 3BANA 3P80A 4G1NA 3QR1A 1FWBC 1BPLB 2ABAA 3IIVA 2QKFA 1R3RA 2V69A 2PMQA 5IFTA 3I7SA 2YA2A 1GGOA 2XFWA 3FYYA 3H54A 3FGCB 4F48A 4ZQOA 3GDBA 1AQFA 1QNSA 2H3DA 2V6AA 3AXIA 4YN5A 3W38A 4UFHA 2WNZA 2YDQA 3GG1A 4CN4A 5A6KA 7TAAA 3QHNA 1GWJA 1OZQA 4GZEA 7REQA 4IFRA 4DF2A 3MMWA 2WLYA 2QNEA 3LMZA 3OZPA 5A69A 3RM4A 3UF9A 3TW7A 2DGAA 2E5DA 1ZBKA 1A5UA 1FBAA 2QT3A 4FR6A 1R3SA 4A3UA 1Q66A 1AQHA 2E40A 1ICSA 3T9PA 5EA9A 2VFIA 4LS1A 4PMXA 4YNGA 2Y0FA 5HMDA 2WMGA 2WJFA 2F6KA 2DY3A 2Q09A 5HJLA 2QCDA 3H8AA 1M9HA 1E6ZA 4PMQA 1MW0A 1H61A 4C6FA 2E8ZA 3B8WA 1CECA 2RJGA 3P7YA 3PTDA 3V5CA 3B8TA 4QSHA 4R53A 3MTWA 3CZGA 4NZJA 5HULA 2AKZA 2YX0A 1M7XA 3ID7A 3OA5A 2WMKA 4WXZA 1LG1A 1A47A 1C91A 2ASHA 1PTGA 5D9NA 4D72A 5CC5A 2XN0A 1OT1A 1HP5A 4U4MA 5E09A 1B2YA 1KGUA 1XH1A 1DIEA 3W86A 5K9XA 3R7MA 3DH7A 4EAMA 2H3BA 1PKNA 4JY8A 1FWFC 4ZTXA 3KTCA 3H4XA 1XLAA 3PC0A 1DV7A 2BY3A 3GFYA 4JIRA 3QSTA 1E6NA 3AYTA 9XIMA 2PP1A 4PB5A 1IT8A 2E6YA 3BO9A 1B9ZA 4HQVA 3WL0A 3AHVA 4FLQA 4P8WA 2BXYA 5DEZA 2XDFA 2C15A 2DQXA 4PTVA 4E3TA 3G1FA 2PTXA 5LNVA 1UR1A 1V8EA 1TR9A 4TVUA 1Y5XA 3OYXA 5TD4A 1YPFA 3RO8A 3DU0A 2ZXAA 1KCZA 4IQLA 1Y65A 1E5NA 4QIUA 5F7UA 4EPDC 4A35A 2IQTA 2JIWA 3MKCA 3T2PA 3A9IA 3PF3A 4XO7A 3JU2A 2DIEA 1XISA 2ATSA 3LI1A 4C1KA 2OLSA 5C9ZA 4NI3A 1R9ZA 4MSSA 4HOWA 1JIBA 1UC4A 5AKQA 4G1KA 4WUIA 4DYEA 1V0KA 1KM0A 4UR8A 5HATA 4UTWC 4BK9A 3S42A 4W8LA 4PB4A 4UMAA 3IEBA 3GXMA 2QCNA 3PPCA 2NT1A 2JF6A 3NQDA 1CGTA 4GLEA 1HL8A 3PSVA 2Z27A 3AHTA 4GABA 4MFDA 3A12A 4LBRA 1LCOA 1OFOA 3KM8A 1TSIA 3UESA 1JQXA 4NAFA 3FA5A 4LAOA 4GI4A 1R2SA 3A3WA 1K4GA 4LJ3A 2INFA 5CQ1A 3TQPA 3IJ9A 2E9BA 3TTSA 3E0WA 3PZVA 3GVQA 3T2OA 5JMUA 2J47A 3LLFA 3XIMA 3CWNA 1PBGA 5A8OA 7CGTA 3NFUA 3H2OA 4D8ZA 2VFGA 2O92A 1OHLA 3VIPA 5HK4A 3KL5A 4CCCA 3S4TA 1IIGA 3QMTA 3E0LA 1A4MA 4ZO6A 1JNDA 3FAXA 2IKIA 2CIPA 7TIMA 4LNCA 1POJA 3MC5A 1DOSA 2G4FA 2GDVA 2DZWA 1PV8A 2NXHA 3SADA 1V4YA 2WV8A 3TDFA 6CGTA 1D3GA 3O05A 1YXDA 3ZOAA 1C3FA 3K4AA 5BMWA 2XM2A 3QY8A 1WCGA 1BRLA 3W83A 1OYBA 5BNKA 2HQAA 5KTLA 2HVNA 4DXKA 1UC5A 1WZKA 3MDUA 4JTDA 1JR1A 2BXVA 4CD5A 4KF1A 3LSBA 3ZWTA 2NVDA 3R8HA 4Z0SA 4I7VA 4D6CA 4GYJA 2B81A 5K9DA 4JICA 2CKRA 4PCPA 1OGBA 1TWZA 4S3EA 3W00A 1Z89A 3WQ5A 5AHIA 3TWBA 3QZAA 3DFNA 3WNMA 4DN1A 3C2FA 4U3AA 3IUIA 4RXGA 1GCYA 2OT1A 4UQDA 3PFMA 2VYOA 4KWWA 2EAWA 3G1VA 3B40A 3CC1A 2ZXDA 1TFVA 2V68A 3S2NA 1F4AA 2BB0A 3APYA 3BJFA 4GGBA 3DZ1A 1YPXA 3G6LA 2PCQA 2RGLA 2NQ5A 5SWUA 4MB3A 3OGSA 4GOAA 4UNKA 1RSCA 1B5TA 4DYJA 1E40A 2O7QA 3PANA 3W82A 2WAGA 3FSTA 3WMSA 4NU7A 4JTIA 4H6RA 1PX8A 3V35A 3A9BA 3IJ8A 3FN9A 3SRKA 3N2CA 1IV8A 1K02A 1YE6A 1E0VA 2PWFA 1TPDA 3GZAA 3QMSA 1RAKA 3E3HA 3NYZA 5BXTA 1T6MA 3UY7A 2WZHA 1A0DA 4LUJA 3KRZA 3QC0A 2E25A 4MZ8A 2OSXA 3CB8A 3BJTA 5D2TA 4ZQMA 4C6DA 4DBEA 4JL1A 4PTWA 3U4AA 3O6YX 1AFSA 3NGFA 4PBFA 4ROQA 5TAOA 1HL2A 1TV7A 1Z48A 2YB4A 1I2PA 4QQ3A 1UCWA 4HA0A 4IPNB 1QNQA 2VD8A 2VKZG 1H11A 1JJKA 2QDHA 2GDQA 4FX8A 3L4XA 3I10A 1VPYA 4HMDA 4ICNA 1E6PA 3R8RA 3LK6A 5DBUA 4UTLA 1CW2A 1XW8A 1IZJA 1RQEA 2OZTA 1WX0A 1JF6A 4LPCA 1TZZA 3PY2A 5MF5A 1K9TA 1A5OC 3STEA 2BY2A 2Y6ZA 2XGZA 4BFAA 3CAWA 3ZLFA 3VC6A 3VIMA 2C91A 4DLFA 4W7UA 5KETA 4Z2GA 4OUIA 1RCQA 3ALFA 1QAPA