1NDYA

Crystal structure of adenosine deaminase complexed with fr230513
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
349
structure length
349
Chain Sequence
b'TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine Deaminase
publication title A highly potent non-nucleoside adenosine deaminase inhibitor: efficient drug discovery by intentional lead hybridization
pubmed doi rcsb
molecule tags Hydrolase
total genus 149
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1ndyA00
1YBQA 1W1IE 2Z27A 3A4JA 1UMLA 1V4YA 3OQEA 3AU6A 4LH8A 2EG7A 1KRBC 3OVGA 3HTWA 2F6KA 3GUWA 4CEUC 3E0FA 4DLMA 4MUPA 3QY6A 2AQVA 4QROA 3PBMA 2PUZA 1YBQB 3WMLA 3QGAC 4WVXA 1RJPA 4NI8A 1KRMA 4UBPC 1ONXA 2DVUA 3FEQA 1ONWA 3MPGA 5FSEC 1PTAA 4C60A 2KAUC 1R9XA 2D2GA 4TQTA 4V1YA 2FFIA 4PCPA 4G2DA 4CQDA 2R1KA 3E3HA 2WM1A 4GXWA 1FWJC 4OFCA 1FWIC 4KIRA 4LAKA 2PGFA 4EPDC 1QW7A 2FVKA 1M68A 4DI8A 4QTGA 1FWBC 2PAJA 4GY1A 4GZ7A 2EG8A 3E38A 1WXYA 4DI9A 3R0DA 4IFOA 3DUGA 2OGJA 1EF2A 4J5NA 2VHLA 4LALA 4KQNA 4ERAA 3GU2A 4GK8A 3ORWA 4QRNA 4EPKA 5HMFA 4H9MA 1RJRA 5G4HC 4B92A 3F2DA 4B91A 1RA5A 4CQBA 4BJHA 4C6IA 1FKXA 4CEXC 2D2HA 3IACA 4P5UA 3TN3A 3HPAA 4LCQA 3GTHA 1BF6A 2QS8A 3IJ6A 4IH3A 4XAFA 2ICSA 3S2MA 3FDGA 3ITCA 1YMYA 4D8LA 3F2BA 3MTWA 4BY3A 4QS5A 4KESA 2DVTA 5CH9A 1R9ZA 4GYFA 3MVIA 1ITUA 3GU1A 3K4WA 3F4DA 4IG2A 4H9VA 1WXZA 4ZSTA 3S2LA 3QY7A 2Q09A 3UF9A 4B90A 3LU2A 3GU9A 2PLMA 4HK7A 1XRTA 4XD5A 3T81A 3PAOA 5A6TC 3IARA 4ERGA 4IG2B 4WGXA 2EG6A 1V79A 4F0LA 2HBXA 3MSRA 3LS9A 3T1GA 3F2CA 4C6PA 4C6FA 4PCNA 2Z00A 3B40A 3S4TA 3MDUA 3GTXA 1FKWA 1ZZMA 1EJRC 4NG3A 4PE8A 4IF2A 4IFRA 1XRFA 3URAA 1EJUC 4R85A 3LGDA 3RCMA 1EYWA 1V77A 1FWEC 4C6DA 4ERIA 3IRSA 2GWNA 3F4CA 3LGGA 2YXOA 4EPBC 4CNSA 1A5MC 4C6NA 3AUOA 3B0XA 3A3WA 4DIAA 2Z29A 1S3TC 4F0SA 2Z24A 5HMEA 1A5KC 5E5CA 2R1MA 4B3ZA 1M65A 3E74A 3TN6A 4RDWA 1IE7C 4KEUA 1NDVA 1UIOA 3GRIA 3E0LA 1K6WA 4QSFA 1K70A 3ID7A 2OB3A 3IGHX 4CNUA 2ANUA 2VUNA 4IGNA 2PGRA 1QXLA 2IMRA 3N2CA 1A5OC 1J79A 1XGEA 1I0DA 4CQCA 1EJSC 3K5XA 1R9YA 1E9YB 2ZC1A 3WZ0E 3S2NA 1POJA 1YRRA 1K1DA 4KETA 3E2VA 4C6JA 1POKA 4H00A 4H9YA 2P50A 5FSDC 2I5GA 4PBEA 4CNTA 4AQLA 4IFKA 4I6VA 4QS6A 1UIPA 2QVNA 2Z2AA 1DPMA 2OOFA 4XAZA 1ADDA 2HPIA 1PO9A 1KCXA 1FWDC 3URBA 4UB9A 3GTFA 3UPMA 4KF1A 4IFKB 4IGMA 4DLFA 1EZ2A 4LFYA 2R1NA 3MDWA 2FTYA 3RHGA 4KEZA 4YIWA 2CZVA 1KRCC 4HA0A 1V51A 4ZSUA 3CS2A 3GG7A 4GY0A 2QT3A 2BB0A 4C5ZA 4EPEC 4KEVA 4XD3A 3MKVA 2Q01A 2AMXA 4C65A 1KRAC 4XAYA 3URQA 2VC7A 1J5SA 4M51A 1PB0A 1J6OA 1M7JA 4LCRA 3RYSA 4LAOA 3IPWA 3ICJA 2E25A 4V1XA 3OOQA 1A4MA 3SFWA 4GY7A 3EWDA 2I9UA 2P53A 4LEFA 2YB4A 3OJGA 4RDZA 1GKQA 2HQAA 4XD4A 2R1PA 4J2MA 4L9XA 1J6PA 3KM8A 4DNMA 3CAKA 4JOMA 2GOKA 1V7AA 4BKNA 4HK6A 1E9ZB 1FWGC 1RK6A 3TN4A 4C6BA 4H9TA 2HBVA 1O12A 2FVMA 4L6DA 1A5LC 4XAGA 3BE7A 1NFGA 1JGMA 2VM8A 1RA0A 2VC5A 1FWAC 3O7UA 3LA4A 2Z25A 3FDKA 4HJWA 4H9UA 1P6CA 2W9MA 2UBPC 3A3XA 1A4LA 3LSBA 1YNYA 2GSEA 3QY8A 4C6MA 2BGNE 1EJWC 3NURA 2Y1HA 3DC8A 4J35A 3PNZA 2Z28A 2GWGA 2O4QA 3WYZA 4RE0A 1HZYA 4DZIA 1RK5A 4E3TA 3D6NA 3S2JA 3NEHA 4PBFA 1NDZA 4C6EA 1PSCA 4LANA 2YB1A 4GX8A 1XWYA 3V7PA 1EJVC 4DO7A 4F0RA 4HK5A 1VFLA 2WJEA 1GKPA 3SO7A 3G77A 3TN5A 3CJPA 4GX9A 4C6QA 2Z2BA 1FWHC 4WHBA 3GTIA 4DZHA 3O0FA 4GBDA 1EJXC 4AC7C 2QPXA 4RDVA 4C6OA 2ADAA 4INFA 1RJQA 1NDYA 4XD6A 4GC3A 4EP8C 2WJFA 3UBPC 3OODA 2O4MA 3TNBA 3GIPA 2Z4GA 4G7EA 4KERA 1GKRA 3MVTA 4C6LA 4RZBA 4RDYA 4C5YA 4DYKA 3LNPA 1O5RA 3URNA 2XIOA 1P6BA 1UBPC 3UR5A 2Z7GA 3T8LA 4G7EB 3UR2A 1FWCC 3LSCA 4H9ZA 2D2JA 3DCPA 4LCSA 3AU2A 3GIQA 4R7WA 2HPMA 2R1LA 3MJMA 2HNHA 5LXXA 3C86A 2VR2A 2G3FA 2GZXA 4C6CA 4I6KA 4R88A 4C6KA 4Z42C 4NP7A 3EWCA 1A5NC 1RAKA 2RAGA 2UZ9A 3NQBA 3PANA 4LAMA 1EJTC 2OODA 1FWFC 2DVXA 3PNUA 5AKQA 1I0BA 4IQJA 1P1MA 4ICMA 3RN6A 3LY0A 2WJDA 3EGJA 2OQLA 3JZEA 2Z26A 1ITQA 3K2GA 2AQOA 1YIXA 1NDWA 2E1WA 5HMDA 3IV8A 2FTWA 4GOAA 3HM7A 3B0YA 3OU8A 3QGKC 2A3LA 4H9XA 3ISIX 4H01A 2YZ5A
chains in the Genus database with same CATH superfamily
4TV5A 2V5JA 3KOWA 4HSHA 2VWTA 4V28A 1UMLA 3HMJG 1LP6A 1KRBC 1ZUAX 4IJBA 5U7SA 1THFD 3PJUA 3TP4A 3FV9A 4RE3A 3GB6A 2A4AA 3OGVA 1V3IA 1ONWA 4N6EA 3WJXA 4CD4A 3CUJA 2VX5A 2W63A 2WQDA 3OP2A 1PYFA 4TQTA 2WCSA 4MPKA 1E4MM 2BHUA 4WZHA 4JY9A 1Q4WA 1FDYA 2D0HA 3UG4A 4KPLA 2WM1A 1S46A 3PPGA 2X1SA 3KL0A 5HDRA 2YCJA 2ISDA 1PZ1A 2DH3A 5HANA 3A24A 2DIEA 4FAMA 2FGLA 2VGIA 2YLLA 2VQTA 1UWSA 4LALA 2YCLA 2WHLA 2NV1A 4TMBA 4W8LA 3GHSA 3LPOA 5D02A 3W2LA 1HKMA 2BGSA 4S3FA 3IS4A 1WKDA 1WKYA 1QVBA 1TVLA 2Z7KA 2RGMA 4OOUA 3ME3A 4RE2A 3WLIA 1UA3A 1JNDA 4JAWA 1VFSA 4XAFA 2ICSA 1TTJA 1YMYA 3PBWA 2XH4A 1G4TA 4BY3A 5G2IA 4AD5A 5MKGB 4YCOA 1GPWA 3RRXA 3CEPA 3MVIA 4BF9A 4NSBA 3VGEA 2GJLA 9XIMA 3CIWA 3WLSA 1GK8A 1QPQA 1VFMA 1Z32X 1F74A 4ADTA 3B8DA 5DBTA 3EXTA 2X09A 2PRLA 3CZLA 4ZCWA 3VOHA 1QAPA 5K4XA 4MYXA 3APTA 1O1ZA 2PCQA 4HPJA 4FALA 1B90A 2QCGA 3TJXA 4UCFA 1CB7B 3S4TA 2PDCA 4P7RA 4BEUA 3QF0A 4E8DA 3IVTA 3G8EA 3N19B 1TPC1 1V77A 4HMEA 5MF5A 1TPEA 1LG2A 4A3YA 1LOSA 3HG2A 5EKYA 3AJXA 3WNOA 1Z9AA 3S5NA 1W1B1 3TKFA 4CNNA 4V27A 4ZO8A 3LRKA 3T9PA 3B0XA 4S39A 1OYBA 2AGTA 4J3UA 4RPPA 4US5D 2GL5A 1MUMA 3KDOA 2VZVA 1RP8A 2V67A 1HJXA 1XLJA 2GGEA 1YTEA 2X7VA 2PZNA 3AYRA 4CNUA 2C13A 3DENA 4XQ6A 4IIGA 2PGRA 3ARSA 3PP7A 2YCKX 2VELA 2WNWA 2CFFA 1EJSC 4JTGA 4YLWA 1H1NA 2ZC1A 1QNQA 1YRRA 3CUZA 1V02E 4P7OA 4W8AA 2BWGA 4UTKA 1FP8A 4AF0B 1TJ1A 4DJFD 3UT0A 4YJ5A 1LLWA 1DPMA 3V4BA 2BXZA 2DSVA 1ADDA 3MI6A 1OF8A 3HGOA 2ZRVA 5A94A 3I3BA 2JALA 3WX7A 4OZOA 5ABHA 1JCTA 3VIHA 1E9LA 4FXRA 3QLDA 1K8ZA 1EA9C 3BJFA 3A21A 4CCCA 2FB2A 4GUGA 5I24A 2QDDA 3A4XA 4LUIA 3MKVA 4Q8WA 3DFOA 3MP5A 2D23A 4CNPA 4S3CA 1O68A 4AD3A 3K1DA 5A6AA 1FOBA 4LAOA 3K1GA 3EDEA 3VMOA 3FHQA 3KHDA 3TV8A 2YIHA 1N82A 4F4RA 3U2EA 1A5UA 3GXMA 3VTRA 2OX4A 3CAKA 2FJUB 1V7AA 4HK6A 4F66A 3EMCA 4D1IA 3P0XA 4HYWA 4L9ZA 1NVMA 5U4NA 2WCAA 4H9TA 4ORMA 3H4WA 2HK0A 3I3DA 2RFGA 1A5LC 4K1GA 2ATSA 1JVNA 2V69A 4MTVA 2F84A 3VDGA 2CLOA 1FHLA 4JL2A 1MW3A 3AXHA 1OIFA 1BRLB 5G1TA 3H2AA 1MQQA 1UD2A 2RKXA 4NI3A 4I7UA 1TFVA 3L2IA 4MWAE 4A8LA 2HISA 3THQA 1M41A 4MOZA 1P5BA 2VTFA 1E4IA 2QJNA 1NDZA 5H1WA 3O1NA 4LANA 4DO7A 3MV11 4F0RA 2OT1A 4M24A 5A6MA 5A2CA 4GX9A 1YYAA 4C6QA 2ZTKA 2GQAA 1V6YA 1ZHAA 3OLIA 3ARTA 4QFUA 4F2UA 1TX2A 1DIKA 4G7EA 1CPUA 2RHGA 1AH3A 1J2BA 2BVYA 4N42A 5BROA 4JKMA 3VNJA 4DUOA 1VFOA 3R58A 4F3HA 3GNPA 4GFSA 1W9XA 1VFTA 2VJXA 3EPMA 1JD9A 1U1UA 4W87A 2PA6A 5LXXA 2WMIA 1YE6A 5C9XA 2XH2A 1CXLA 1L2QA 4R88A 1X7FA 2V2CA 4MMWA 4E6MA 3M0MA 3PPHA 4AD2A 4KFNA 2X40A 2CITA 3GW0A 4DO4A 4C7GA 1KXTA 1Q6GA 3ZMRA 1SFJA 4GI9A 5HULA 1GUVA 4KH2A 1M04A 2DW6A 4HGXA 1YKWA 2BOGX 4FS9A 4AWTA 4Z2IA 4PMVA 5B7ZA 3QGKC 3FJ6A 2INZA 3WF2A 3W37A 4NYYA 3GZ3A 1V6VA 1E0UA 2IKJA 3ABOA 4LV4A 3H7VA 2C8NA 2J8FA 3NYZA 4I9JA 2PTXA 3QY6A 2AQVA 4DM2A 3M5ZA 3WDRA 1YBQB 4K37A 4FB7A 1Q8JA 2NVAA 4UBPC 4US6A 1ONXA 2IKIA 3GKAA 4KEMA 1W9VA 1E1EA 2VYOA 5J8LA 1PTAA 5FIPA 3ARVA 3T2PA 2GSHA 1W3TA 3EWBX 2RDXA 5C7HA 4MUZA 3PZOA 2QPSA 5CQ1A 5IXEA 4KIRA 2PGFA 5K9DA 1QW7A 4QTGA 3FSUA 2PAJA 1DV7A 2QCMA 4Y6GA 2KZHA 1RUSA 4YHEA 1TUFA 2OGJA 2VZSA 5J04A 2RGLA 4IXHA 2PSNA 3GU2A 3TR9A 3WL1A 1OC5A 4BJHA 1QATA 5A5WA 1XYBA 4S38A 2D2HA 1DL3A 4F9DA 2WHKA 3B05A 1KXHA 1UPPA 5GVJA 4D8LA 1EEPA 2OLAA 3BARA 3EPNA 2POTA 3T7VA 2FMOA 2HS8A 1JZ8A 1QOQA 5F2LA 3W28A 4AZCA 1UKOA 3CHCA 4IIBA 2D0FA 3VKCA 3VGFA 2XVPA 3N15A 4O0KA 3AXXA 2BHZA 4CQ8A 2PLMA 5KINA 2P0IA 3CYJA 4O15A 3FJ4A 4NAFA 3M0VA 4TTUA 3B9NA 2NVDA 3M41A 4JQ1A 2C15A 4PCNA 2ONEA 4Q8OA 4UOZA 5CCZA 2O7QA 3CC1A 2OLSA 3W3OA 3MDUA 2PRMA 4UOQA 1ZZMA 3TQKA 4NG3A 5FJTA 1U5HA 5K2ZA 3ANYA 4LUSB 3W7GA 2A3BA 3NCOA 1IF2A 4GXPA 5CPOA 4CNSA 4PYSA 5CXPA 5FEXA 4GI4A 2ZDSA 2Y70A 4D6CA 1I8JA 2WJZA 4F0SA 4U3AA 2L5HA 2GOUA 5I2UA 1XYMA 4S3GA 4CCEA 1R3WA 2J7EA 3OGRA 1X6NA 2PD5A 1TRDA 3H55A 3AMKA 4JFTA 2W5FA 3TMLA 1O94A 3SN1A 5IDIA 3W7QA 1BYAA 3UJ2A 3BAYA 1FWTA 4OTKA 4DJDD 2OR2A 3TW7A 3SURA 3RILA 4N7QA 4Q7BA 3M5XA 3TQPA 1A5AA 1SW0A 3E2VA 2XVKA 1K9FA 5TBOA 1BXCA 4FXFA 4LBSA 3JVAA 4L4OA 2FZ8A 1BF2A 2ZZ2A 3A4WA 3GBEA 3NL6A 2GPTA 1OC7A 1FWDC 4U28A 4OT7A 4JTUA 1W1VA 5F1UA 5E0CA 1CI1A 2C16A 3MANA 1I9CB 1P6WA 1VENA 2GQ3A 4KIEA 4JIRA 3QKZA 3UG3A 2Z0IA 3WBAA 5EA9A 3BLKA 5GJNA 3DGBA 2QAPA 1XIHA 1XLHA 3OOQA 1Q5MA 1V03A 1U1HA 4Q8TA 2I9UA 3GFZA 1MW1A 3M0ZA 1ICSA 4IMEA 1LQ2A 3UD6A 3S0CA 3AWNA 4LY4A 1B3XA 2BNJA 1PAMA 1T6MA 2PURA 3VIMA 2TMDA 1UR2A 1DWIM 3DYPA 3HU7A 4IWWA 2YCIX 3M5VA 3RM4A 2XVGA 1ADOA 4AWEA 1X97A 2G95A 3C61A 3IUIA 3LCHA 2WNQA 3PFMA 4BFAA 3ANUA 3I6RA 4HTBA 1TV3A 2PDYA 4ML4A 2PDWA 3D0CA 1R2TA 4F0HA 1PWLA 2UY3A 3SGZA 5C9WA 3NO1A 1N8WA 4KCTA 3KLLA 2D22A 4P7LA 1MSSA 3C2EA 1CENA 3UWYA 3LRMA 1UBSA 1D9EA 3HGJA 1H5VA 2VT0A 3CUIA 3ARZA 4PUJA 5PTDA 3VNDA 3E5PA 5EMMA 4O1FA 3S1WA 4A2SA 4AXKA 3DFTA 3N2TA 3WQPA 1HXJA 5I3FA 4Y96A 4Y8EA 5JXQA 5C70A 3G1VA 3L4VA 4PRWA 3HPSA 2Q71A 1FWHC 3GTIA 3QR3A 1XSIA 3AROA 4WDUA 1TPUA 2CZEA 4HNNA 3GIPA 3PUDA 1S5TA 1ZPTA 1SJAA 2OQHA 4WEVX 4Y9PA 3LNPA 2GQ9A 4F0MA 5KZ6A 2OXNA 2NUYA 3EMQA 3FA5A 3K8MA 2QIWA 1W5OA 2XH7A 2EPOA 2WSPA 1XS2A 4BI7A 1O95A 2QYGA 5HWNA 4R9XA 2HWGA 3UG8A 3WH8A 3HN3A 2B31A 3ZJ7A 2XVLA 3GYEA 4LAMA 2Y61A 3PVFA 1EJTC 5J5DA 4O8RA 4IQJA 3T0BA 3RPTA 4W93A 4Q8NA 4QEEA 1RR2A 3I4EA 4JTFA 4UOJA 3L21A 3EX6A 2WSKA 3H22A 4D6DA 3KXQA 3RR1A 3GQYA 2E67A 3OU8A 4WDWA 1GJWA 3UJSA 4GYJA 2Y5JA 1EIXA 3HPZA 1NARA 4PR4A 1W1A1 3IVSA 2JBMA 2X05A 1KFBA 3KZPA 2ZZ4A 4I5UA 4ATLA 5XIAA 4FXJA 4FR6A 1PZ0A 2WXDM 4LVDA 3GUWA 5A6JA 1B4KA 1OY0A 1OX6A 1WCGA 4IISA 3E2SA 4TVCA 4YCPA 3XINA 4K1WA 1T5AA 4LPCA 1YPXA 1FWSA 4DAFA 4Q3MA 1DORA 1TV7A 1J0KA 3G0UA 3VKJA 3VUSA 3W7KA 1V6TA 1W9UA 4UFMA 4J3ZA 4PCPA 3AZTA 4G2DA 4JD4A 2IPGA 3GM8A 2R1KA 3LD5A 1ZBWA 1TA3B 3W1AA 3WH6A 2CBJA 3VVGA 1QK2A 2J7DA 3PJXA 2XSXA 3WQWA 4N4QA 4LYPA 3SN4A 5CG7A 2HNEA 5D2TA 2D2OA 1I2RA 2Y85A 4LB4A 1ZJHA 4OBTA 3L4WA 4B91A 2WAGA 3OEXA 5AC5A 3W70A 4GRSA 3BANA 1KTBA 1X8FA 3QYSA 3I10A 5F2MA 3S1UA 3N9RA 4UTLA 3WLLA 3W02A 3VOGA 3P81A 3V35A 4JIEA 3ZWTA 1TQXA 2X1RA 1X39A 3APGA 2ABBA 4ZSTA 2I7GA 5AC7A 4NXKA 5HJYA 1K8CA 3W22A 1HJSA 1BQGA 4UTJA 1DVJA 2I16A 4FIRA 4BWLA 1VHNA 1F3TA 1YTKA 4O0QA 4MWAB 4W7VA 2J47A 4AEFA 1GQJA 3QQ0A 4LY8A 4PUMA 3MSRA 4Q8QA 3LS9A 3T1GA 1VYPX 1GWJA 3SY5A 3G18A 3VKAA 5BYWA 4DB7A 1J93A 3ARUA 2WMGA 3WEZA 2GGGA 5C2XA 2FFCA 1QO5A 3GTXA 3IJQA 3MHUA 5G5IA 1JZ6A 2DY3A 1Z8AA 1AJ2A 1F3WA 4ERIA 3GVQA 4PB4A 3VINA 3B04A 1YQ2A 3FA3A 3LGGA 6CGTA 4Z0JA 2IQDA 1A5MC 4LUJA 2ZWYA 4QG6A 4D9PA 3FCPA 3D3AA 4ZTXA 1F73A 3DFHA 5HMEA 2Z2UA 3MZNA 3RJXA 1MEIA 5CPQA 3C3NA 3DXIA 3ATYA 3TN6A 4CN6A 4DF2A 3NUKA 1Q6LA 1H4PA 1UIOA 5BRPA 4B3LA 5H2ZA 1IR1A 1WDRA 1GQLA 2PDXA 4MY8A 2DGAA 1EDQA 3BL3A 1OQFA 3WNLA 1E15A 1JQVA 2BY2A 1V8EA 4ZOCA 4FNUA 4OUEA 3GC2A 2X30A 1R9YA 4OU1A 1WBHA 1MWOA 1MDLA 2PLKA 3DFYA 4K68A 4H00A 4EOUA 5IFTA 4M5PA 4NNBA 1LWIA 3WQGA 3G1AA 2QMJA 5A8PA 3N17A 4J40A 3UW6A 1FCBA 1PCWA 1XIDA 3WBXA 3OIHA 4REQA 4J3XA 3G22A 3QSRA 2VEIA 1KKRA 2G3JA 4HP5A 1J01A 5JIWA 3KOXA 3C2YA 4WSHA 1QI3A 2O0TA 5E9AA 3W87A 2OZ3A 5EU9A 1KBLA 1AVAA 3QBUA 3H4XA 3FY1A 4GVGA 4B5VA 4XIAA 2Q01A 1VPYA 4UXDA 4HNCA 2JQXA 3DN5A 2ZRXA 1M3UA 1V3HA 4HA4A 3WEOA 2IKHA 3AMDA 1YE4A 3SCPA 1YHTA 1EQCA 5J5RA 2YZRA 3EWDA 2BXVA 3BLEA 2P53A 1CIUA 3W24A 4AD1A 2VENA 2O92A 5EFDA 3PWAA 2VD9A 3WY1A 3QZ6A 2GLKA 4JOMA 4RNHA 1EGVA 4BWLC 2R8WA 3TCSA 2FVMA 3EDDA 1I2PA 5E93A 4XAGA 1KCZA 3MY9A 4IIDA 5M03A 4XIMA 3NQ2A 3VNYA 3SQLA 2YA1A 2CWNA 3OYXA 2DEPA 3SIZA 3NURA 4HPXA 1QUMA 3LLDA 1XSJA 4J35A 4F0KA 2ODOA 3VNIA 9RUBA 2BDQA 1DE6A 2QCLA 1R2RA 3E0IA 2PP1A 4RE0A 1WO2A 3LM3A 2PGEA 4CU8A 1US3A 5ENLA 4RNIA 2A6NA 4AH7A 3ZFHA 1VGAA 4Z0SA 4NJGA 4PUUA 3F03K 1TSIA 3LOTA 2J9YA 4UFHA 1WPCA 4A3QA 4PUWA 3C8FA 3SO7A 4WQ6A 2E5DA 3CT7A 5EY5A 3ZJ6A 2PU0A 3OVPA 4DYJA 3PUEA 4LQ1A 4NX0A 2WK2A 3SUUA 1FWNA 3SJNA 4AC7C 4EE9A 2EKCA 4DYEA 4YPJA 1B3OA 2XWDA 1MRAA 3TNBA 2HSAA 1L9WA 4R53A 4JHMA 2YCEA 5DMNA 3REQB 4AYGA 3NTYA 4RCXA 3URNA 4W8BA 3N25A 1JF6A 2V6AA 3D3FA 4LAUA 4GPNA 2PE4A 4JKKA 2ALRA 1S3HA 2CLMA 4TXEA 1R3TA 3DCPA 3H2EA 1EHNA 3B9OA 2HPMA 2R1LA 3MJMA 4C6CA 4NRRA 5HJLA 4GMEA 1PIGA 1OX4A 2PDIA 1C92A 4DRSA 4W86A 4ZOEA 3CQHA 3SCVA 4B16A 1TV2A 2UZ9A 2QJJA 1E1CA 4XUYA 4F40A 3LPFA 4GVHA 3SI9A 2A1YA 1ZBKA 2OQLA 2TPSA 2DPEA 1ZLPA 3KS6A 3EWYA 1E56A 3OVRA 5BXSA 3LLFA 5BWFA 3UFYA 3ARPA 3CZ8A 4H9XA 2NX1A 4W7WA 1OB0A 3CHFA 1UR1A 5DANA 4CD8A 1ZJBA 5LNRA 1Q7QA 1C93A 1W1PA 1W3KA 5LNVA 2WZTA 2ISWA 2IPJA 2J27A 2OSXA 1M9HA 2A3CA 1KQZA 1QO2A 5CZTA 4PSPA 4C1NA 2G41A 2A7NA 4ZB5A 1A3HA 4LXFA 3OLEA 1HKIA 3VO0A 2A6LA 3LB0A 3G2GA 4QIUA 4LVFA 2DZWA 1F2JA 3TTOA 2GJPA 4X9YA 5D33A 3WN6A 4GY1A 1H0GA 3PZIA 3AIQA 2EG8A 2PF0A 3GNDA 4D6FA 3R0DA 3EZ4A 1CW2A 1V6WA 2OZ0A 4W5UA 4GG9A 3RPDA 3W1RA 1NAL1 4QAIA 3S9IA 1G7VA 3F2DA 4PB5A 2QIIA 1RA5A 4ATWA 5FEPA 5H8UA 4YTTA 5D03A 1GJUA 2TODA 3UZXA 1TUXA 3IACA 1YNQA 3VXGA 3NQ7A 2QS8A 1BLIA 2NUXA 1HVXA 3S2MA 3FDGA 3ITCA 3VZZA 3W85A 1GVIA 2GGJA 3ARWA 3GHRA 1E5JA 3S46A 5CH9A 3TVAA 4GYFA 1SZEA 2DZUA 5E70A 7A3HA 3IJ8A 3L4TA 4E2OA 4ATDA 3CLWA 3W7RA 1DJXA 1LBLA 2ZX9A 3W25A 4DJDA 3LCLA 1EWEA 3MZ2A 4JX5A 4DWSD 3WLTA 1EJ7L 4MNKA 1E6PA 4F0LA 1YXCA 1DWFM 2OQYA 1IT8A 2CC0A 4GQRA 1F6YA 2VC9A 1QHZA 3TA9A 5BNKA 2Z1XA 1HQTA 4A3HA 4UR7A 2A3HA 3G1YA 4EX4A 5A8QA 3TXZA 3NPWA 3PZUA 2YFNA 4O16A 1ODUA 1G7UA 2NQ9A 1A3WA 1OCNA 1HFBA 3W2JA 1V0LA 1FXPA 3W71A 2V3GA 4L1XA 3N3TA 5KTLA 2VX6A 5L6UA 3ARYA 4DZAA 3TQ0A 5A6BD 1UQZA 4PMXA 5CKSA 1MXSA 4ZMGA 3IUHA 4IQLA 3DHUA 1DIEA 3AMLA 4QE4A 5F2GA 3APYA 1JPDX 2FYMA 4PMRA 2Z1VA 3TC3A 4QCEA 3WELA 1A5OC 1MVYA 4WXYA 3L7RA 4P2VA 3RX3A 2YBVA 5F2IA 1TCDA 1XH2A 2AKMA 2G3MA 3W1MA 4IPLA 4HU3A 1XH1A 4KETA 1U83A 3C8NA 4H9YA 4U2ZA 1EOMA 1AMKA 1EXBA 2OWWA 4L6HA 2J66A 5CSSA 3KX6A 1E6SM 4MJ2A 1PO9A 1EC8A 3B9DA 3H2FA 3QQWA 4NY2A 2CZ5A 3WMBA 4PL2A 4QBXA 5BWAA 5EYWA 4LYRA 3RHGA 4AW7A 3NVDA 4PUEA 1JRBA 1OD0A 2J79A 3AOFA 3TU9A 2Y2WA 3H53A 4GFIA 3NSNA 3CM4A 1SFSA 3PZNA 2G96A 1FDJA 2QXWA 5F4WA 2Q3RA 2CU0A 4OGZA 1M7PA 3BZJA 4GBUA 1PCKA 2OEKA 5E0FA 4DUWA 5AB3A 2Y4SA 1GKQA 3FKRA 4D6JA 4XZLX 3NNTA 2EPNA 2E9LA 3PTMA 1RH9A 3HO8A 4JTHA 1J18A 1OGGA 1KXVA 1HKVA 4DJDC 3QW3A 4BCEA 4IICA 3M0JA 1HL8A 3TLLA 3NZ1A 4HA1A 4A6GA 3O7UA 3SRKA 4XO7A 1TKKA 4FIQA 3L0NA 2CLPA 4E38A 2HVNA 3GG0A 2VMFA 1H60A 2G5WA 3W7LA 5I00A 1ISVA 5EBUA 4M7TA 3CEUA 3CWOX 3ZLGA 1LUCB 1XCWA 2XINA 4FNQA 3MI3A 5FJJA 1VS1A 3N4FA 1Y8BA 2XM1A 3MS8A 3NEHA 1UZDA 2BTMA 3CQ0A 5A6SA 3N2XA 3WLNA 3GXPA 4E5TA 4AY1A 3H12A 3B0UX 3TSBA 1VFLA 4CVWA 3G77A 3TN5A 1IIHA 3FYYA 2V8ZA 3V16A 4MM1A 4JX4A 3EB4A 3NQ6A 3R12A 2JE8A 2WC7A 3MMWA 3FGCB 4B5TA 2H9AA 3EKZA 1GVOA 2VEKA 4NJHA 1DKWA 2TAAA 4PUDA 1KD0A 3GNNA 2UV8G 4JTQA 2W62A 3Q94A 2YBUA 3BCJA 5LNSA 3EOSA 3QOMA 3SIMA 2OOGA 4RZ4A 1F3XA 4PRRA 3B8WA 3GAYA 3LYEA 4DXXA 1K9DA 4H9ZA 3WBYA 3ABZA 4B9YA 2A3AA 2JEPA 3BDKA 2Q8ZA 5D4YA 3MMUA 4A3RA 4DJEA 2YA2A 4RKAA 4IJRA 4IJCA 4TU1A 3PZMA 1I0BA 3AMGA 1CLVA 1TWZA 3BG5A 5FAJA 2WJDA 3H26A 3QOKA 1ITQA 3UZ5A 1VH7A 3K2GA 2DZAA 3WQDA 5AYZA 3UCCA 3PULA 4W5ZA 1XLGA 4RV3A 3C52A 3R8RA 1QK0A 2HEJA 4AB4A 1W1IE 3ATZA 1TMHA 3TW6A 3EA2A 1AW5A 1OD8A 2F6KA 3LXBA 2B7PA 1CGUA 1AH0A 3EDKA 1EIBA 4NVTA 3M0KA 5DRCA 3P14A 3FLUA 1W91A 4A8IA 2DVUA 2ZFAA 3FEQA 3M0IA 3OIXA 3WQEA 3WF3A 3R43A 4FOJA 2X0HA 3VCRA 2E77A 1BAGA 4IP4A 1WDSA 2DIJA 1KM1A 4QJ4B 1PE1A 3VE7A 3HV8A 2XG9A 4IPIA 1BVNP 3QV7A 4H6QA 4NZ3A 5FJRA 4DI9A 1GHRA 1RPXA 1DJWA 4IFOA 1QR7A 1A0CA 1XIJA 4KQNA 2A3EA 1ICQA 1KTNA 3DHPA 4QRNA 2RJGA 4B92A 2WZHA 3SADA 1HG3A 3E0VA 1PZ2A 4C6IA 1ITXA 1TRIA 3VDAA 3TN3A 2WYSA 1XUZA 3H8AA 3PHAA 1ZP4A 3GDRA 4U31A 1F6KA 1HW6A 3GNOA 3W7NA 3K4WA 2PI6A 4JZ5A 1YDYA 3M0YA 4XBSA 4CCDA 5EB8A 4LTSA 2EXOA 1KC7A 1WBJA 3AQUA 2WBKA 3BLOA 1QRQA 1WZKA 3WL0A 2YYTA 2DORA 3ZIZA 5CC7A 4JNZA 3B8TA 2VFIA 3BCFA 5EMKA 4B5NA 4HYVA 1NF7A 3KVKA 1C7SA 1XFCA 2CETA 1LM1A 1TR1A 1C8XA 2VFGA 1AUSL 3URAA 1UR9A 4DJEC 1RV8A 2V5CA 4JTCA 3AHYA 3GH7A 3S1VA 4AX7A 4HCLA 1JCMP 3UWZA 4AIEA 4JY8A 4AXNA 2INFA 3LTPA 4UNKA 1LRNA 1UWIA 2PDKA 3CT2A 3UPWA 5DN1A 1MXDA 1B57A 8XIAA 3NGJA 3E0LA 4AZIA 1DEDA 4G8TA 3ARRA 3A5VA 4X3ZA 3LXAA 4M6UA 5IRPA 4AMAA 4NJKA 2CW6A 4CGTA 1J79A 1I0DA 2GK1B 3K5XA 4EAYA 3DEQA 4GIRA 4ZFMA 3VOIA 3QVQA 2BY1A 1LYXA 4UQCA 1JULA 4K36A 4IFKA 4L7ZA 3WQ5A 2OG9A 2WM0A 3K30A 3RMJA 5AZ0A 4GE8A 1MW0A 3VI2A 2QCDA 3S1XA 3ITYA 1Q65A 2ZX8A 3A12A 4O10A 3SR7A 3HF3A 2GVLA 2GDUA 4YIWA 3IV3A 5HQLA 4TVUA 1OGBA 1GVEA 4FSAA 4X0NA 4QLJA 2P10A 3TIMA 1RQEA 2DFAA 2C0HA 2BB0A 3KOFA 4C5ZA 3JU2A 5EMLA 2AOSA 2WC3A 1H3GA 4NAEA 4O1BA 4MZ8A 1PB0A 2WHMA 3UPBA 4LCRA 3AIUA 1V3MA 3WJYA 2J6XA 4H2CA 4PUNA 3RPMA 4PTDA 2W27A 3CH0A 3NO5A 4RDZA 2YYUA 1TPB1 2R1PA 4L4MA 3VDBA 3W84A 4EWJA 4UIOA 4NZ4A 1PYMA 1TCMA 1XIFA 3A5FA 3G1FA 5AN7A 5HK4A 1Q6RA 3FVDA 4ZQRA 3BMVA 2DQWA 4P7NA 1HP4A 1Q85A 1UW9A 5KMYA 4DELA 3MU7A 1Q7MA 2NQHA 1K4HA 1JCXA 1OG0A 3O3RA 1DYSA 1FWRA 4H9UA 1R7AA 3STPA 4QAWA 3SCUA 2BGNE 3TUUA 3KS5A 3M44A 1UJQA 2OFJA 3C56A 2ZICA 1TWIA 3V36A 1PX8A 3W81A 1NIUA 2O9RA 4V33A 3WFZA 1YPIA 1B9BA 2YA0A 1GG0A 3RMEA 3SCOA 5AC8A 1XGZA 4XKYB 5LNWA 1H11A 5CBBA 4C6EA 4IPPA 1GCYA 4LC8A 2J7FA 2D3NA 1XWYA 1SO5A 4KWVA 1EJVC 1VEMA 3K8KA 4WKAA 4WOQA 4AZ5A 3TYEA 4WCJA 4FZIA 2ZRWA 2GVJA 1OBAA 5DFAA 1UC4A 1BSIA 1O7AA 1VBGA 4C1KA 3C0QA 3QJAA 1VBJA 2DT1A 2EAWA 3S5SA 3E96A 1GYNA 1V7YA 1UZ4A 1GOKA 4QQ3A 1BWLA 1C29A 1A47A 4HCHA 4M1RA 3DGRA 4RZBA 4D2JA 4MLRA 1VFUA 4DYKA 2HS6A 3W75A 3WD4A 4ZE4A 1FH8A 2BG5A 3RGTA 2E6FA 3L67A 3BJSA 1GOXA 5C2CA 3AHXA 4MFEA 2CBUA 2XHYA 3N2OA 1OT2A 5FJPA 3C86A 4XV0A 2ZCGA 2WLZA 5EFFA 3HMCA 3VNMA 4POCA 5CC5A 5GJMA 3GO2A 1DQXA 2A7RA 3PANA 1E40A 3ZLHA 4Z2GA 2E6DA 2DVXA 3NQFA 1KM0A 1P1MA 4ICMA 2NXHA 3LY0A 1U22A 4AVNA 3W2MA 4Q4RA 4ALDA 1YIXA 1P0BA 3T0DA 3PB0A 1WZAA 2FPVA 1LDCA 1Q6CA 3KBVA 3TYBA 4H01A 4UFKA 2PDJA 7TAAA 4MSSA 4WY0B 3CNYA 1KO0A 3K8LA 1QFEA 2X16A 3OQEA 4OV9A 2EG7A 3MO4A 4IPJA 3OVGA 3ZXWA 4NHVA 4E4PA 4WJEA 2DJXA 2BOFX 1UASA 3KOYA 4WVXA 1YNPA 1PJ9A 1V3LA 3HPXA 3OHMB 4W84A 2DZXA 5EGRA 4TOQA 1O5KA 3UETA 4DZ5A 1LORA 5GNYA 4DWSA 1MEWA 1R7OA 3QC0A 1FCUA 2EPHA 2YL8A 4CQDA 2QULA 1A5BA 2FVKA 1M68A 3BG3A 1UWAA 1W5QA 4GZ7A 3H54A 1OWQA 3PY2A 2REQB 4HJFA 2Z6JA 1TVNA 2HROA 1ZP3A 4ECLA 2QGHA 3W27A 5CEWA 1VPQA 2BY0A 5I3GA 1FH7A 1AW1A 1NEYA 5G4HC 4JFVA 4C90A 5AHIA 3RXZA 4QDWA 3VOFA 3UA4A 2IKGA 4JQAA 5LA0A 2WZEA 4H8VA 4LCQA 3WMSA 3THAA 4MKVA 3AALA 2ZA3A 3UWQA 3NZGA 1XG4A 1YXYA 3VYLA 3NIYA 3N6HA 1ITUA 1DJHA 3F4VA 4IG2A 1XHGA 1EUNA 3BAIA 4NIRA 3AXIA 2YPIA 3QHNA 2Q09A 3B8UA 4UQEA 5LIWX 4HK7A 1Z7AA 4ERGA 3P67A 4CNOA 3N4EA 4I7WA 1NJJA 2ZBTA 1UC5A 1K3UA 2CXEA 5TAOA 4ZQOA 3T44A 2WSRA 4ADSA 2CLEA 4HMDA 4KMQA 3U0HA 3A9BA 1HIZA 1EJUC 4BI6A 2DQXA 3PPCA 3TR2A 3IRSA 1BGGA 1X8CA 1CB2A 1W32A 2GWNA 5CSYA 4PUKA 3QR1A 3L4UA 1HJVA 1M01A 1CXKA 5EBAA 1DWGM 3SB0A 3VD3A 1D3HA 1XLEA 3DFPA 2Z29A 5L9FA 1FH9A 1JYWA 1C90A 3LZ3A 1BSLA 2W92A 2DH2A 4O19A 2W0UA 2OZTA 4B3ZA 1M7XA 3R25A 3LNMA 3BLIA 4FEZA 1U30A 1IE7C 1NDVA 3QW4B 2XFWA 2VX4A 2NWSA 4QSFA 4ZOBA 1K70A 1PHWA 3VE9A 1PKYA 3ID7A 1Q13A 4L5ZA 1OFRA 2GVGA 1JAKA 3AC0A 2J7BA 3ZVHA 2VUNA 1QXLA 1UUQA 1XLBA 1IYXA 1SZFA 3WZ0E 4RR4A 1WE5A 3RX4A 5FL1A 3IJIA 3BK0A 1K1DA 3V5OA 1WOAA 3ZZ1A 5FSDC 4O28A 4PBEA 3VNLA 4CNTA 4AQLA 1UIPA 4DWSC 1DHKA 2XN1A 3VGGA 2HK1A 3GXIA 4HPNA 1SGJA 3VOCA 2HPIA 1N2VA 3URBA 3NM3A 5HOSA 2QGYA 1ZY9A 1XP3A 2GQ8A 1XYAA 2FTYA 2XFRA 3R5EA 4W88A 2OTDA 1XFBA 3OZMA 1WP6A 1D3CA 3HJZA 4D6IA 2PDQA 4HZMA 4ZL1A 2AAAA 3OTRA 1P0DA 3LI0A 4LWWA 2I56A 2GVYA 3WCZA 1W8SA 1PX3A 1PKNA 3W6YA 4F8XA 4S3DA 4NNCA 1YDVA 5JH1A 4DUVA 5REQB 1WZLA 2XISA 3ZO9A 3KM8A 1EX5A 1FA2A 4IMDA 4QSHA 1IWPA 3R13A 2C71A 6TIMA 5F7UA 2DZTA 3S9ZA 2ZQ0A 2JF7A 3HG4A 4KW2A 4ZEPA 1BFNA 4ES4A 5CLTA 2PP3A 3R94A 2NQLA 2EO7A 5JVLA 1NFGA 3OHIA 4J28A 1NQ6A 3DX5A 2QR6A 1KFWA 5A3HA 1RALA 4NASA 1VCVA 4O57A 3NVTA 3LSBA 1YNYA 1OK4A 3QY8A 3A6OA 4N2YA 4MAZA 1ME8A 4HOWA 3RNDA 4W89A 2NLYA 4IMCA 3I65A 5HQEA 3EB3A 6REQA 1NWUA 4E3TA 4UTMA 3COTA 4WOZA 3RFAA 3BSMA 5KSWA 1HGYA 1Z44A 3N1AA 3ES7A 1M6JA 3KFTA 3BXWA 4GVFA 1HF6A 3FX4A 3DHFA 2AL2B 4XZIA 5KZMA 3NOYA 2VZUA 4H83A 3JZUA 4R3UA 1AQMA 5IOBA 4R7OA 1NWRA 4DO6A 1KWGA 1VJSA 1EJXC 5HUPA 1TX0A 4D8AA 1KXQA 2VUYA 4PB3A 2INEA 1Q6DA 2FPYA 4HU4A 4HOZA 4K39A 3RLUA 4AIOA 1H7PA 2XZ7A 5JBDA 3EXSA 3M47A 3LSCA 3V1HA 1LQ0A 1IR2A 2OYLA 1S2AA 4AU0A 7REQB 3LG3A 1F07A 4LBRA 1Q66A 2GZXA 3LHUA 4E4FA 4LBUA 3B8SA 1PTDA 2NUWA 5AVHA 3AAMA 3LBMA 3LPGA 1QNRA 1A5NC 7ODCA 1B2YA 3W7JA 1NWSA 5T91A 3PNUA 3L5MA 1WX0A 3KRBA 1EZWA 3JZEA 1SW7A 2AQOA 3FAXA 4R7JA 1K03A 2DV0A 1RCOB 2YJQA 3HM7A 5LKYA 4WR3A 4S1FA 5DELA 2Z27A 3UVIA 5HATA 4GJJA 1V4YA 4HMCA 1AK5A 3QYQA 3ZS4A 1I60A 1XLLA 1RY8A 2VGFA 4GJ1A 4YVPA 3VDCA 3NZQA 5LGXA 3PBMA 2XN2A 1QOXA 2NX3A 5BXTA 4U10A 1XBYA 3G1XA 1XW8A 1Y5VA 3KL5A 1TREA 5AYIA 2Y89A 2JKAA 2E68A 5C8BB 1SQ7A 1JXKA 4H1ZA 1D8CA 4A21A 2V3FA 3WD3A 1KQYA 1H1ZA 1Q6QA 4LW7A 1LTDA 3DHDA 3KOZA 2ALDA 2QV5A 4JCMA 2PDLA 2WSYA 1XRVA 2EPKX 5D37A 2OO0A 3WK3A 5MKGA 4ML9A 5AYXA 3P8JA 5BU9A 2FDSA 1R47A 1CYGA 3VCCA 3ZR6A 3F2BA 4PTVA 4L4PA 3CUXA 5AHFA 1VJZA 4QG9A 3ALGA 4GH3A 3ZSTA 3GSMA 3WH5A 3KP0A 4O1CA 1NH6A 1GQNA 2VQUA 1V79A 1T96A 3AHVA 3FS2A 1NOWA 4PFHA 1OF6A 3POCA 2YL5A 2Y62A 3ECQA 4S2CA 1AQHA 3SRHA 1FKWA 4OWGA 2C3ZA 3Q67A 4GISA 1TR9A 1AQFA 4UC5A 3TOPA 3CPRA 4BA0A 3HURA 2TRSA 2AGKA 3GXTA 3HGRA 1CGYA 1WKEA 2XIQA 4WRHA 4C7FA 4C6NA 3P80A 1Q2RA 4DQWA 1I1XA 2Z24A 3S5YA 5JH2A 3RAOA 3F4WA 1W31A 4C7DA 4O4WA 1IZKA 1TIWA 1E0XA 1LZOA 1UCWA 1GNXA 1UP3A 3LI1A 3IVUA 2MNRA 2ANUA 4ZBCA 4DO5A 2B7OA 3LHWA 1XD1A 1T40A 3TZNA 4AF0A 1DE5A 1CGTA 7PTDA 3N14A 1E9YB 3WLQA 3MCNA 4WGHA 1B3YA 4RPQA 5FF0A 2P50A 1UROA 4IM4A 2HVOA 1XKJA 2PDGA 2QZRA 3VMPA 3WQFA 2OLHA 3MC5A 1VLWA 1WUFA 1NFPA 3QFWA 3N29A 1UKSA 1FHUA 3P84A 4KCWA 1IXQA 4XZBA 2EKGA 4O18A 1S5VA 4JX6A 1SZRA 3SJ3A 1CT5A 3BGGA 4HTYA 3C2RA 2DUAA 3IRDA 1B5TA 2A21A 4Q4PA 1HP5A 4XSLA 2WBGA 3G3MA 1KRAC 4MNMA 4V2XA 3KEHA 1LJYA 3UJFA 2GJXB 3CPGA 3WDHA 5I02A 3TC7A 3VX0A 5BU6A 4CD5A 1H51A 5HR7A 1MNSA 1W3NA 3A23A 1YDOA 1OCBA 4NQ1A 4AY8A 4J1OA 3NDYA 3U2ZA 4JTLA 3P5ZA 3UCQA 3AJ7A 3ENLA 3BLLA 2WVSA 2HZGA 3DESA 1FWGC 3KHJA 4PGLA 4JHZA 3Q45A 5E6ZA 1BRLA 5IBXA 3IK4A 3BLFA 3B97A 4DY1A 2R94A 2ASHA 1DJZA 2B81A 2XN0A 1EXPA 4WDXA 1CECA 6ENLA 4RE4A 1TO3A 4LF1A 1RD5A 5TIMA 2WV8A 3FHAA 5K7JA 3NPVA 2VFHA 3D6NA 3V0TA 4HNUA 1XDMA 1SM9A 3WUFA 2ZZ1A 2ZZ7A 1Z6KA 3AZRA 1S2VA 4KCVA 3D47A 3MP4A 1QU4A 3LXCA 3VKDA 3V3WA 2Y8KA 3F5JA 5LIYX 5BMWA 3DYMA 1GW1A 4OECA 4HYRA 3M1ZA 4GJIA 4ROPA 2V3DA 4B5WA 4EP8C 3IIOA 1JUKA 1ZCOA 1AQ0A 4EXBA 1FP9A 3B03A 4GZEA 4R9OA 1UZHA 4Q8MA 4NZJA 1GKRA 3MVTA 4RDYA 4C5YA 3L12A 4NILA 1PIFA 1O5RA 1TPVA 3NPXA 4A2RA 1Z41A 4KRUA 1WAWA 4LSBA 4B3KA 4B2DA 1K9TA 1IWAA 4Q4KA 4KWWA 2XSBA 1ZENA 3HB9A 4I6KA 3MBDA 4M19A 2E0PA 4Z2HA 4JICA 3SCWA 1OABA 4JYFA 2OJPA 1A0EA 3EWCA 2Z6IA 3SM0A 4PZVA 8CGTA 1UMYA 5EMJA 2GDVA 4CQ9A 3PTDA 3CV1A 1UD3A 1RPKA 4GI8A 4YHGA 1C7TA 4GQ0A 1DJIA 1XLCA 3DFSA 1CX9A 1H50A 3STEA 2QKFA 2A3LA 1E6RA 1FDZA 3BH4A 1YBQA 4ASTA 1CXEA 3JR2A 5C6MA 1ONRA 1BVWA 1ZAIA 2NT1A 3STCA 1XBVA 3HIJA 1FCVA 2Q6ZA 2P1FA 3OLGA 1PTGA 5HAOA 1G01A 3T2QA 5BMXA 3TAOA 4UR8A 3TXVA 4YYCA 3RRAA 1JFHA 2JF6A 1UJPA 2VCCA 3CWHA 2QJIA 5FSEC 4C60A 4AHQA 1J0ZA 4U4MA 1SR9A 5IBXC 1K7EA 1W3LA 1G6CA 2FFIA 4QE5A 3G1SA 2R9RA 2ZDRA 1JL8A 3TQVA 1FWJC 2J13A 4OFCA 5T9BG 2CHOA 5CJ5A 3FYOA 3U6WA 3TYDA 3E38A 1XKYA 1BQCA 3DC0A 3WJWA 2Y0FA 1IEIA 2NQZA 3UXAA 1EH9A 1IEXA 3CMJA 1Z48A 3WKZA 1OYCA 4AVFA 2C1GA 3WLOA 1RJRA 1EB3A 3TH6A 2FZDA 3KE0A 4BQ2A 4NZ1A 4HNOA 3WQCA 4HA3A 1VPXA 2QDEA 3PG8A 2X0YA 4S3BA 8TIMA 5BCAA 4KESA 3OPSA 1R9ZA 6ALDA 3QN3A 3CL6A 1WXZA 3NL5A 3EOEA 4YTRA 2VI0A 3NA8A 2W4XA 3G1HA 2DT3A 2A0NA 2PDMA 1IT7A 1JJKA 3IJLA 5CC6A 3LPPA 3PWGA 2QF7A 2YFOA 4LUSA 4C6FA 3FYPA 2FZ9A 2ZXBA 1R8LA 1GVRA 3DKJA 4TIMA 4JHOA 5DMYA 2EF9A 3M07A 3RCMA 2V81A 4H2HA 1JI2A 4ZQNA 2PWGA 2ZE0A 3LBOA 2E1DA 2QNEA 5G2HA 2WVVB 1W2VA 3FJLA 4A3UA 4ZR8A 4YS1A 2EJAA 3Q2DA 3ITGA 2DT2A 3M64A 4XO6A 4LS1A 2ZUMA 3WLHA 5AC4A 3UXIA 5G1YA 3L2MA 3S47A 3I6EA 1OSEA 5KITA 1RD6A 1W9DM 5LA1A 4B5SA 1JPKA 4X60A 2VOTA 1EF3A 1A80A 4M81A 3RCYA 2ZZ3A 1BYCA 3O6CA 2X1TA 3TYCA 5D2YA 1WB0A 2J74A 4LT9A 4DPQA 3UR7A 1KKOA 1ZFJA 1XGEA 4M0XA 4GHRA 4FMVA 3MW7A 3TJIA 1FX6A 3THCA 3B0VC 2I5GA 1RQBA 4CU7A 5CAKA 1CWYA 3NR0A 3HA1A 5GNZA 3IANA 4H7ZA 1PUDA 3W86A 1KCXA 4UR9A 3ZT6A 3UPMA 1ZCCA 2F38A 4IIHA 2BVDA 1QNOA 1F5ZA 4E3VA 2FGZA 3T55A 2ISSA 1JZ3A 4GIEA 5FJOA 3KCLA 3U3HA 2Z1SA 2C14A 1XM3A 1PXGA 4HVXA 3LDVA 4MF4A 3H2CA 4PEKA 2NLIA 4AX6A 3O8AA 5D9PA 1J6OA 1JAEA 3FXYA 9CGTA 2TYSA 3A9IA 4QDPA 4NZFA 5DY2A 3ICJA 1P0NA 3OG2A 1QI2A 2P3EA 2VCAA 5C7VA 1HJUA 3SQMA 3T0TA 1KA9F 2Q8LA 4H4IA 4H7CA 5A8MA 2PWUA 1UG6A 3UGVA 1RBLA 1K7FA 4XBKA 4CU6A 1RVKA 2WZIA 4LYQA 2VRKA 1HUVA 4HNVA 1VFFA 1W3HA 1FWAC 3LA4A 1GTEA 7XIMA 2Z25A 1XV8A 2G0WA 4PFMA 3NQ8A 1P48A 1VZWA 4C6MA 2RH9A 3DI1A 3N4AA 4R34A 4UFJA 2DUZA 1HKJA 4GZJA 4L4LA 4LRSA 1EOKA 1WV2A 1S2TA 4UZSA 3EWUA 2YGYA 1VIWA 2XYLA 3ITXA 3FAWA 3W7OA 5M1TA 1SVDA 3PWIA 1X6LA 4IPNB 4EACA 3WO8A 4JTAA 4MB5A 1KW1A 2YB1A 1LT8A 2H3DA 4AWUA 3V7PA 3DFNA 3VX1A 3O6AA 4G6CA 2OELA 3AS1A 3NDZA 4B5XA 5CGQA 3G3DA 3T08A 1O4UA 3WUGA 4E8GA 3O0FA 5A6KA 5CG0A 3WDJA 3UA3A 5ABGA 4DHGA 2PWFA 2D0GA 3CAVA 2C0AA 4LVBA 3N73A 1GJPA 2J24A 1XISA 4ZB0A 4JTJA 3OQ8A 2A79A 2ACQA 1CCWB 2V68A 3QPYA 4ICNA 3NO3A 2WMFA 3GUGA 5BOEA 3QTGA 2QUUA 5KZEA 3ABXA 3GK0A 3W7DA 2OEMA 3EWXA 2D20A 2FGBA 4IUOA 1UH2A 4H19A 2HNHA 3AIEA 1NP0A 2CKSA 3W2KA 1IV8A 1OINA 2JGQA 2PF8A 5JU6A 1DQWA 4C6KA 1H7RA 4A8NA 2B4GA 2RAGA 2XPKA 2PZ0A 3SSZA 3VIPA 3LQLA 1Y5WA 2QPUA 1KFLA 1G4SA 3WIJA 1V02A 5FESA 2OPJA 2E1WA 1H2JA 2HV5A 3BSGA 4UTFA 4ACZB 4WK9A 3FK4A 2H3BA 2GUBA 3OA3A 1EL3A 3P61A 2YDSA 1UR4A 4JEJA 4GUHA 1G9HA 3MYPA 4LH8A 5A2AA 4ROQA 3HTWA 5F4SA 3GLCA 3LX9A 4J27A 4HNLA 1R46A 2ZX6A 3UR8A 4ZO7A 4WXZA 1TA3A 3KBJA 3KRZA 3RLHA 4PMZA 4AMCA 3PC0A 3L4ZA 1T0OA 4DF1A 1FBAA 4ZTYA 4A22A 3FVMA 3CBWA 1YTDA 4EPDC 4QDMA 3S6TA 4G1KA 3MHGA 1LRQA 1Y65A 4JTKA 1R87A 3NAVA 2G3NA 4JNMA 3WENA 3DUGA 4N9EA 3T07A 2FVLA 4EPKA 4L9YA 5HMFA 1B0IA 3NXFA 4ZVJA 3ZJKA 1DXFA 4FOKA 2VDIA 4A8RA 5FF7A 3IJ6A 4O13A 1MDRA 3VIFA 1OFPA 1MRQA 1H63A 2DVTA 1GORA 4IHCA 4MNLA 3NG3A 1JQXA 4MWAA 3GU1A 3KRUA 3P74A 4F79A 1TV8A 1S1PA 1W8GA 4JQ3A 1XRTA 5FD0A 4KFOA 4RNJA 5FF4A 2LLEA 1NU5A 1G0CA 1DJQA 3DBPA 2DW7A 1M5WA 3MMTA 1SO3A 3B40A 4YU1A 2OCZA 1QNSA 1EJRC 4YYFA 1Z42A 2E6AA 1ZB5A 1Q63A 4A4AA 3R6IA 3D46A 3I68A 4C6DA 2OKTA 4IP7A 1VCGA 1YDNA 1A50A 1QI4A 2J7CA 3KWSA 2O56A 2NV2A 3F4CA 3QKEA 2PLCA 4EPBC 3MKCA 2DSKA 1C9DA 3Q4DA 3AUOA 3A3WA 4JYDA 1ISWA 4RW3A 3LMYA 1EC9A 5HBFA 4X22A 2BXYA 3D5HA 1JIBA 1LROA 3SUSA 4R33A 2PTZA 3MMDA 4U5IA 5FF2A 2YOCA 1H62A 4E2DA 2EPMX 1L2UA 2XFYA 2J4GA 3WK1A 4IGNA 3WQ8A 3IK2A 1AL7A 5ABEA 7TIMA 1E72M 1OIMA 1SSGA 1XJBA 4HT3A 2OT0A 4JGDA 3KAOA 3SCRA 4D72A 5CPTA 4Z2LA 3GX9A 1JI1A 1ECEA 4C6JA 2H6RA 4Q4QA 4AC1X 3NEVA 5LIUX 1XIEA 3THUA 4RK8A 1PEZA 3HQPA 4PC8A 4MFDA 4FP1A 1NP2A 5KZDA 2QDGA 5JIPA 2EJ1A 1JZ4A 4E2BA 1BYBA 2CZVA 2TSYA 4PMNA 4HA0A 3LLXA 3S8HA 3L68A 2WB5A 2EGZA 3HBLA 4LUTB 1W1YA 2G8ZA 3EDFA 3LEPA 4PODA 5XIMA 3MUZ1 3E02A 2FB3A 1CEOA 3TDFA 4M51A 2QCCA 5GQBA 1H7NA 5E6YA 1U5VA 3TA6A 3WH7A 3P3BA 1MI3A 4GWEA 3EWZA 4JTDA 1VKFA 2DU2A 1GOQA 1RBOB 2P8BA 3E0WA 4MWAC 2I9EA 3QR0A 4U5KA 1OFDA 4J2MA 3WJZA 4NU7A 3GKFA 5K9CA 2W61A 3VOJA 2Y7DA 3BW4A 3SAZA 4JTEA 4C6BA 1XQLA 4MZYA 1K9EA 1UUMA 3N04A 1PPIA 1SU5A 3LUTA 1KFJA 4Q6JA 1O12A 2AMGA 1J0YA 1W37A 2YDRA 2R91A 4MJ4A 3F4NA 1J11A 1KTCA 5HA7A 3T05A 5LA2A 1P6CA 1AMYA 1KM6A 1Z3NA 2NX9A 3GG1A 3WLRA 2ZE3A 2GSEA 4I8DA 4UMBA 2C6QA 1R86A 4UQ9A 3U8GA 3DC8A 1UKQA 4YNGA 3PSVA 1W0MA 2E3ZA 3M0HA 4HZ7A 2WSQA 4E8CA 3FJNA 3WYZA 1WXJA 1WDPA 3W23A 2VDGA 4PTWA 3LQGA 2ACUA 3H21A 3UZWA 1GOMA 3OLDA 3MSDA 1Q2SA 3XISA 3W7HA 1U1JA 3TTSA 5M3WA 4C91A 4EK7A 1DWHM 3S5ZA 1JG9A 1C8QA 3M6YA 1QCWA 1SO6A 3REQA 3B4YA 2ISFA 1QWKA 4HU0A 1AD1A 3YPIA 6A3HA 2CLLA 3EKLA 2CCRA 1N8FA 3J7HA 2DDXA 1G1YA 2ZXDA 4RW5A 4RLIA 2I14A 5FA5A 3BAKA 2ZRUA 3UR5A 3T8LA 3FSTA 4US5A 4I8YA 2VEMA 3K13A 4Z1BA 2HMCA 3GIQA 4O12A 4NRSA 4O1DA 1CZ1A 1GVYA 3PF3A 5FCZA 1US2A 3EX3A 1R3YA 4M82A 1B30A 4NP7A 1J9YA 5AVNA 3IJDA 3NQBA 3VC5A 3NYDA 3OYZA 1FWFC 4I3GA 1FHDA 5I07A 1IHIA 1G94A 2J7GA 5BW6A 1UD5A 1BD0A 1JZ5A 4QISA 4DJFA 1BPLB 4J3VA 2B7QA 5HPCA 1NFBA 1DTUA 2QUMA 1S38A 4FXSA 2QCNA 2WCGA 3B4UA 1TZ7A 1BWKA 4MB4A 3DDMA 4RX0A 2F6XA 2ATMA 3E0FA 4M6VA 4MUPA 4QROA 3ABQA 4WKHA 5HXMA 1CXIA 5C54A 3CL7A 4XAPA 1DHPA 1JCYA 2YXGA 2YXXA 3P0WA 3S1GA 3P93A 1HKWA 1TQJA 4IX0A 1DOSA 1MMFA 2MANA 5D8WA 3E12A 1SUXA 4H41A 4LAKA 2XUCA 5D2WA 3CMFA 5BRQA 2VEPA 1CGVA 3JW7A 1WXYA 1TWSA 3S2CA 1T7LA 4TMCA 4IOTA 4QLLA 4Z17A 4EF9A 3S3GA 1F3EA 1DJGA 4WDTA 4GK8A 3UGRA 3TONA 4PMUA 2VFFA 2CLKA 2ZXQA 4UNLA 3DYOA 1MXGA 2X41A 2ZUUA 4XZNX 1T8QA 1FKXA 3R0UA 2XU2A 4QE1A 3W1QA 1GPFA 2ZUNA 4XB3A 4N4PA 4W4QA 2IS7A 4OKDA 3M7SA 1ZU8A 2E9MA 2OGYA 3KCOA 3S2LA 5B80A 1PKMA 3INPA 1EBHA 3B0PA 3W88A 4P8UA 3IARA 3CQIA 3R89A 4FA3A 1ADSA 1SPQA 2VX7A 5XINA 1JNEA 4E2VA 1GEHA 4QITA 3SCSA 2OX1A 2QHAA 3ZQ9A 3SFKA 3CIXA 4MKSA 4Q7IA 1P7TB 1E0TA 1TJRA 3VDHA 5CJMA 1OCQA 5HNNA 4HSOA 4GC4A 1PL9A 4D6GA 1XLDA 5DEZA 3IWPA 4U2YA 5CZKA 3VZXA 3UG5A 1J8VA 3JUGA 1QW9A 3PTKA 3G6MA 4MB1A 1QPKA 4R5EA 1S3TC 2FKPA 3OA5A 1A5KC 3QSTA 1O5QA 3JRKA 4S3AA 3CB8A 3BICA 4DJFC 4PCFA 1EHAA 2NQJA 4S3EA 2Q8XA 2YBTA 4LU0A 4WSJA 3EWWA 1FWWA 3IGHX 4J3WA 5A8GA 2QLYA 4CCZA 4Q7NA 2RJHA 3PUOA 1K6AA 2IMRA 3UJEA 5FACA 1TE6A 1UR0A 5C0QA 4OE7A 3GNRA 2PPGA 3G24A 2YX0A 2CIPA 4ENLA 3PR2A 4ADUA 4G56A 3R7MA 4GNJA 1KNWA 3T40A 1W9PA 2YDQA 3BV4A 2CBIA 1ENUA 2EPLX 4JTTA 3WJSA 2V9DA 4OIFA 4O17A 1F4HA 1XPGA 3SUTA 2IW0A 1X7IA 3CYVA 3EOOA 1V51A 4UTWA 1L8PA 5T26A 1TMLA 3GWQA 2VVSA 1O5XA 1V0NA 3EDJA 2AMXA 3GXFA 2V38A 1I45A 1WDWA 4MIMA 2PDHA 3ZWSA 5JQ9A 1JZ7A 2GGHA 5HJXA 4N9CA 2V63A 2PRHA 4V1XA 3BPWA 1BTMA 4GY7A 3UWUA 4P8VA 1TTPA 3HQ1A 2WQPA 3TFXA 2V5LA 2HQAA 1XSKA 4I5XA 4M29A 1ZBCA 3IIXA 2VGBA 1VAHA 3H4GA 3KZSA 3W2UA 1EO5A 2X1IA 2YW3A 1UR8A 3GDTA 5H6HA 1M53A 2NXIA 3RK8A 2GVEA 2I5IA 4N6FA 3ITOA 3E1F1 2UBPC 3STGA 1LUCA 4ZQPA 3N9SA 3ARXA 3MWCA 2ZVIA 2Y1HA 1IXOA 1JYNA 5LIKX 3QZAA 1TE1A 5G2WA 4LRTA 2X2YA 1JEZA 1S5WA 1WQ5A 1KLYA 1CBGA 2X1UA 1UYQA 1Y7VA 2FDMA 2X7WA 3WQ4A 2RDTA 5ABFB 2HTMA 3FGCA 3T0CA 2WJEA 4D6EA 1REQB 5BRBA 5SWUA 2CHNA 1A0DA 4PSRA 1K4GA 4IIFA 4UZUA 1SO4A 4WHBA 1W6TA 4GBDA 4INFA 5HR6A 1NDYA 9XIAA 2B7NA 1B31A 3KTCA 3MUY1 1E0WA 4GINA 3T0AA 1EUAA 2F6UA 1H61A 2FHCA 1TVPA 3G6LA 3U2OA 4QJ1A 3ABSA 3SGUA 4TTGA 1ZJIA 1H49A 4UUIA 1GVSA 2PLJA 4FK9A 1P6BA 2V5DA 2ZUTA 1XYCA 1E5NA 1E6NA 3TJ4A 4XVDA 3IIVA 1U2YA 4JFSA 1JDAA 2Q3OA 4NYUA 1VEPA 2AQWA 1EA0A 4Q32A 4AEEA 3N3MA 4IMAA 3FKKA 2NSOA 1RLCL 1BG9A 2CKRA 3F7JA 4O4VA 4QXIA 4MLJA 2PCEA 2FZNA 1OK6A 3A3HA 1BEUA 1OYAA 4UTWC 3VNKA 1J5TA 5CPMA 2PODA 4UCGA 4QGCA 3EGJA 3OG3A 1UD4A 1DBTA 3L65A 5CPNA 3MB9A 3P7YA 1BG4A 3DFQA 4GABA 4ZE5A 2RUSA 2J9ZA 1GHSA 1P0EA 1N55A 4O1EA 2YZ5A 3AO0A 1ELSA 1EDTA 3PFRA 2Z1BA 4URIA 2VL4A 4DBDA 1EQPA 4S3JA 1H7XA 3BV7A 2E8YA 3MT1A 1UZ1A 4FHAA 1ZSXA 1W54A 1E71M 1UP0A 3CO4A 2V3EA 1W3JA 2VP8A 3CL8A 4QEHA 4GQQA 3B9EA 3AMCA 4Y8FA 4S3KA 2D2GA 3MSGA 2RDUA 5B7YA 2I1OA 3V18A 4IQEA 1Q3NA 4LB3A 3E3HA 1QPNA 2J8TA 4PMQA 1FWIC 1MFUA 4BQ3A 4OHQA 1VBRA 2VOMA 2AL1A 4LAZA 5GNXA 3GW3A 4IX2A 4L1WA 3H7UA 3EXRA 3VU2A 3W01A 1JDCA 3T6CA 4AZ6A 1ZJAA 3TTQA 3ORWA 2AKZA 4HZ8A 5CAHA 3TTYA 4CQBA 4K6AA 1JUEA 2DZBA 1LLZA 2F2KA 2DSUA 2OSWA 4HSNA 2JKPA 2YCLB 3MKKA 3W7MA 3KL3A 1BF6A 1DXEA 4I5RA 4IH3A 4KBXA 2FHBA 4O53A 4GACA 1X1NA 4LF2A 3NQMA 1V6XA 1FXQA 3TFCA 3QZEA 3R2GA 1LL7A 2NVCA 1HX0A 1QI0A 6XIMA 2BSLA 1KBKA 1DWAM 3CZEA 3U2CA 1XUUA 1SMAA 5A6TC 3U5UA 3KWXA 5E09A 2D3LA 4GUIA 1IT0A 2HBXA 1IGWA 3IGSA 3GY1A 3TEVA 3TE9A 4IUGA 3BC9A 4EKJA 3LENA 2X0SA 1HO4A 5K4ZA 4Q6XA 8RUCA 3KCJA 3O15A 2GJRA 3OBAA 4NUWA 4JN7A 4IGSA 1EYWA 5D32A 3RO8A 4AUBA 1HJWA 4HN8A 1GQKA 1X1OA 2DZSA 5GJPA 2QJMA 2YXOA 4L65A 3NL3A 4HB7A 3BAJA 1FFQA 3CUHA 4BHYA 4QJ3B 3QTPA 5E5CA 1JZ2A 4JR5A 4X63A 2V82A 5E0KA 3UYIA 3C5QA 4LS2A 4RDWA 3E2RA 3LV6A 5EMUA 1XRSA 2GK1A 2RDWA 4EF8A 3FOKA 4Y2WA 3QV9A 3ZJ8A 1BKHA 3M43A 4Q4SA 1MUCA 5C9ZA 2WVUA 2C1HA 2PTWA 1ISXA 3VZYA 8A3HA 1NTHA 3SRFA 1MQRA 3GZAA 3AHTA 4O52A 2E28A 2QVNA 4DEFA 3VM7A 4LVAA 2A7PA 3GYCA 1TIMA 1ZQ5A 5HMSA 4JIPA 1EC7A 4UB9A 3STFA 1EPXA 2XGBA 1ONEA 4ZZ9A 4IGMA 1EZ2A 4AD0A 3W1TA 3M4HA 2GUYA 2PBGA 1CXFA 1WDDA 3FIGA 3VAVA 4JEQA 1E3XA 3S5OA 3WLPA 5DF0A 2VDHA 4PN2A 1JR1A 3URQA 1E73M 2VC7A 3ZLFA 1J5SA 3A4AA 1TYGA 2HXTA 3RYSA 3VK5A 4DWDA 4AFYA 1NOUA 3MWAA 1VFHA 1WOBA 2VZOA 2DSWA 3RIKA 1E6QM 1F4AA 4M56A 1ZBVA 2ZOXA 3W9ZA 3V0SA 1RP9A 3SECA 3TSMA 4BF7A 1BVZA 3QGVA 4KCUA 4Q8UA 2HBVA 1FQ0A 1E55A 3RU6A 3UZJA 3WDQA 2VFDA 3IJ9A 3B06A 1JGMA 2VM8A 3H7RA 4MPQA 1UH3A 3R0KA 4BQ4A 1D7FA 4UQAA 4NNAA 3MHFA 1FVPA 5C5YA 2P8CA 3PZGA 4D6HA 2J88A 3UP8A 4ZA0A 4XKYA 3SY8A 3PNZA 2QV4A 3LM7A 2PU1A 2EQDA 1SZGA 3UNDA 3S2JA 3UQNA 3H2OA 2EBNA 5CZSA 1WA3A 2CZFA 1IQ8A 1XCXA 3PN8A 3K46A 1TPH1 4B4HA 3E6EA 3VKKA 2PFHA 5IHSA 1GKPA 1XYLA 1QBAA 1UB3A 1R38A 3O6DA 4FLQA 4GO8A 5D38A 8XIMA 3UZZA 1LOQA 5AZ1A 2WJFA 5D9OA 3NL2A 4V15A 3OODA 2ZVRA 4MB3A 4GQBA 4GUFA 1K77A 1LWHA 4GVIA 1SMDA 4C6LA 3N6QA 5I23A 5D30A 1TTQA 3TNOA 1RY0A 5GPRA 1O66A 4PMJA 4G7EB 4P7QA 3UR2A 4Q22A 1IEVA 1UWRA 5DY3A 2PTYA 2G37A 1ISZA 3KBSA 3W6LA 4ZO9A 1RSCA 3AS0A 1LT7A 1IZJA 1J96A 2A5HA 5I3DA 3G0SA 5F4XA 1F9CA 4YTQA 4Y9OA 5BXRA 1XX1A 3EOLA 2VCBA 1JF5A 2E5CA 1ECQA 2BASA 2XIIA 1JDDA 4UFLA 1ME7A 2WMIB 3QM3A 3GVWA 3NDOA 3EEZA 2PMQA 3LMZA 3SDOA 3WFAA 3CMGA 3BGJA 2J25A 3CV2A 1XIBA 2WMHA 4WY0A 3GR8A 4RXGA 2R24A 3AS2A 1GOWA 3GBDA 4XKMA 2NWRA 3B8VA 5TD4A 1OC6A 3B0YA 4GLEA 4LC6A 1VBHA 2J77A 3Q37A 4JXCA 1N7KA 5FJIA 1V93A 4PL1A 1TMQA 1EGZA 2PDUA 5DT7A 3NQVA 3TWBA 3ZR5A 2QUNA 2QVHA 4EXAA 3HQNA 3DG7A 1MQPA 4CD7A 3QXBA 4DLMA 3TTEA 2XJ7A 4HKPA 2PUZA 3QGAC 4Q4MA 1E51A 5JUVA 1B4EA 4FNPA 4WIWA 4Y9MA 3VILA 4M6PA 1GZJA 1VBUA 4UQBA 3II1A 1FY6A 5AHMA 2REQA 3UYCA 1UPMB 4BI5A 4P61A 2CLFA 3V5FA 4GYKA 3A47A 3S83A 2VVNA 3BOLA 3MSYA 1SJBA 2QEZA 3WUBA 4B9ZA 3W73A 4DBUA 1G4PA 3LTSA 1PDZA 2QCFA 2WC4A 4J5NA 5TF0A 2VR4A 4PRTA 4PBGA 2ZRYA 3AYVA 4W85A 1C91A 3UY8A 3EPOA 4O14A 4CEXC 1F7BA 2NV9A 2BZNA 3SZ8A 3VGDA 4EXQA 5CPLA 1H09A 1L0PA 4LS0A 2WKGA 4QS5A 1YW1A 4B4FA 4XSMA 3RU8X 2D1ZA 4H9VA 1TB3A 3G8RA 5HNUA 5I78A 1J0HA 3BW3A 7ENLA 3C4UA 3BURA 3O6YX 1E3ZA 2WLYA 5AC6A 3L9CA 2QMKA 1PIIA 4AZCB 4K8GA 1KV8A 3PZQA 3G1RA 2PDBA 3M0XA 2D69A 2W3ZA 4GNKB 2W67A 3F2CA 3AXMA 2DUXA 1KM2A 2V5KA 3W7PA 3W7IA 3HG5A 1QDSA 2FZMA 2ISVA 3FN9A 4NAFB 4IFRA 5CGMA 2PDNA 1W2PA 4EANA 1V08A 2BFGA 4GXMA 4YVVA 4WY0F 3RUBL 4LX4A 1W5NA 1F6PA 3QFEA 4KWOA 2ZX5A 4UTHA 3BSHA 3GH4A 1HL9A 3PZ9A 4BQ5A 3RF9A 4FX8A 2PWHA 1OZQA 2WW5A 4N0RA 4J4KA 4JTSA 3QPEA 1M65A 5HQMA 3U4FA 3TWAA 3GRIA 3N2MA 2ZXAA 3NM1A 2OB3A 2XIMA 5JMUA 4DJED 1LF1A 4FLSA 1A3XA 2ESCA 4O54A 3QMSA 5IDZA 5BOFA 4MYAA 3L2LA 1XG3A 4M6QA 3U7BA 1JGIA 3WSUA 1ZALA 3KP1A 1MO0A 3V5CA 1T8XA 1CLXA 2Q02A 3IJ7A 1TV5A 4Y90A 1KWKA 4I6VA 2XVNA 1SZNA 5A2BA 1FUYA 2NXGA 4PULA 1D8WA 4KKXA 4XAZA 5AFDA 2ZA2A 1GVQA 5E1QA 2H8ZA 4LFYA 4QNWA 3SEPA 4KEZA 3MYOA 1NM9A 1QPOA 4ZSUA 4YMZA 3P2VA 3GG8A 3LGEA 1XQKA 2O55A 1P1XA 4XAYA 5I3HA 2GSJA 4GNVA 2O9OA 4G5DA 5REQA 5I77A 3QRHA 1PX4A 1ICPA 1OFEA 4GIYA 1O6IA 3SFWA 1S5NA 3GFXA 1JPIA 4ICCX 4LEFA 1T99A 3O07A 5AY7A 3AWOA 3DOPA 4YVXA 1TJPA 2CEQA 3VPLA 2ZZ5A 4DNMA 4MVAA 4AISA 2GOKA 4DUXA 1E9ZB 3O0KA 4IQDA 1RK6A 1J0JA 3O16A 3PAJA 4PH6A 4AIBA 3IUDA 1OFBA 3AXKA 3GVVA 4IZGA 1J0IA 3HFYA 5FEWA 3ZYZA 4UTIA 2XDFA 3RITA 4X2PA 4XUGA 3GVRA 4FX6M 2WVTA 3LHTA 3CZJA 2W9MA 1YX1A 4L64A 4LOCA 1OFQA 4LNCA 1K02A 1L6FA 2HVMA 3W26A 2W66A 4RZ6A 2AL2A 1HZYA 3IIPA 2YR1A 3L4XA 5C2GA 1VYSX 1JYXA 2VURA 3ANVA 3ERPA 1PSCA 2J6VA 3Q58A 1MUWA 3LHZA 1EP2A 1F76A 5IFPA 4MG4A 5AYBA 5CZ0A 4ZQCA 3RJYA 3BQ6A 2HRWA 2G97A 2E4TA 2CLIA 3TCEA 3GE7A 3P60A 4F2BA 1VC4A 4HD5A 2QPXA 4AYSA 2ADAA 1RJQA 2IXUA 2O9PA 2BP1A 5CC3A 1ZAJA 3UBPC 3VD9A 1VQTA 4KWUA 2POZA 1XD0A 4K38A 4KGLA 5A1AA 7REQA 1QW8A 1E0VA 3CLMA 3O63A 3I7SA 3KUMA 4I9MA 2XIOA 4YL2A 5A6BA 1FWCC 1BXBA 1Z69A 4WUIA 4AY7A 3QPZA 3CZGA 3USBA 3DG3A 3P8IA 3WG6A 1B3WA 3UCDA 4TX9A 2GDQA 1W5MA 3VC6A 5I0DA 1KFEA 1W1ZA 4Z42C 2YW4A 1X38A 1TPWA 2PDPA 5FOOA 5HWMA 1UUOA 4J3SA 3GIYA 1CGXA 3W83A 1R3SA 2W79A 3W1LA 3RN6A 5D8ZA 1XYFA 4CUCA 4UNIA 2I57A 3DERA 1JFXA 1NDWA 5A8OA 3O06A 3W1PA 2Y24A 1N8IA 3RO6A 3N12A 3LRLA 3P82A 1I2QA 3LK6A 1V0MA 3PSWA 1D7KA 1RHCA 3DKLA 4XZMX 1I1WA 4DXKA 3T8QA 2XIJA 5I03A 5DCDA 3OZYA 2GJNA 3PZVA 3H70A 1XLIA 4LJ3A 5BXPA 1W1TA 2EEXA 3BWWA 4XZ9A 4LVGA 1OADA 4OVXA 1GT8A 4PCTA 1CXHA 2QUTA 2CLHA 2P76A 3MPGA 4WX2A 1MZRA 1TJ0A 4NZCA 2KAUC 4AWSA 4MGGA 2F9RA 2C7FA 2GGIA 3CUGA 3NQDA 3CUFA 1WYIA 3WD1A 3CH9A 3WK0A 1QHOA 2G3IA 2ZIDA 3FXGA 1R30A 3LTYA 3GR7A 1DWJM 4FF7A 4XZWA 1PS9A 3CO8A 4UMCA 2VO5A 2WNZA 3EAUA 1OX5A 4O8AA 1EF2A 4JCLA 2VHLA 1F05A 4MJMA 1G67A 3HZ3A 1UQYA 3QQ1A 1JPMA 3V75A 3MUAA 1R85A 3IAQA 4XVEA 4G7FA 4MY9A 4RV8A 3W7CA 2D24A 2CWXA 1ESWA 1W9BM 3SSJA 1AW2A 1RCXB 5CPSA 3VIOA 3WDPP 3AIWA 3T09A 1TPDA 3R1ZA 4GKLA 3F4DA 1IXPA 2OSYA 3QY7A 4GIAA 3UF9A 4AEOA 4ZO6A 3LU2A 4GZIA 4DM1A 4NJJA 3UWWA 2XM2A 4KFPA 2Y7FA 1UWTA 3S42A 1VYRA 2BVWA 3W0KA 4YWSA 5EPDA 3NQAA 1L6WA 1CLKA 4AHPA 1R3RA 2EHHA 4EVZA 4IF2A 2P3ZA 3AICA 4HOXA 3LGDA 5KETA 3ABRA 1EFZA 1S1RA 1VR6A 2PC8A 2PWDA 3DH7A 2BMBA 4LYKA 4LUYA 1KM4A 1M1BA 1ISYA 1NOFA 3TOYA 1NQKA 3L4YA 1UHVA 1GQIA 4QX4A 3MCOA 3N2BA 2JIWA 3F5KA 3E74A 1HGWA 1DJYA 1YEYA 1Q8AA 1K6WA 4CN4A 2X2GA 5D09A 4Z08A 2XIBA 4DBWA 5DCBA 2WO5A 1AH4A 1J10A 3L0GA 3B9AA 4YTUA 3MUXA 1JCLA 4ILSA 1F61A 4M3PA 1S2UA 2R82A 2VGGA 3M0LA 3S2NA 1POJA 3OGSA 4M80A 2JFEX 2VR5A 3W38A 1X98A 3TMQA 5BZAA 2JKEA 3QV8A 5LXEA 3IAPA 1ODZA 2BS9A 2DJLA 5I6SA 3R11A 3BLDA 4Z1DA 3VFCA 1W5PA 3GTFA 1XLFA 1QBBA 3S6DA 1NSJA 2HCVA 4F2TA 1H0IA 2WNNA 2E5BA 5CZJA 1XPYA 1KRCC 2FH8A 1XLKA 4REQB 3WQ6A 4AVOA 3M5YA 3CS2A 4D71A 2GJXA 4EPEC 4XD3A 4YTSA 2G4JA 3OO2A 1DJNA 1DXIA 4PEEA 5F1VA 3LCWA 1UKPA 1VIZA 3PTQA 1ZRQA 2FJKA 2PEVA 4YXGA 1TPFA 2UY5A 3LBCA 3EEGA 2HE5A 3CPUA 2YB4A 3ITLA 1XC6A 1M03A 1NELA 4KT2A 2CERA 1VLIA 1J12A 4L9XA 1J6PA 1BTCA 3SGGA 4IIEA 4S2BA 2FH6A 3NQCA 3GS6A 4XTIA 5ECVA 5C55A 1TZ9A 1XIIA 4LV9A 1R3VA 4BR1A 4W7UA 3UZYA 5LNUA 3MQTA 2VC5A 1A53A 4IMGA 4JFUA 4O1AA 1EKOA 4RNFA 2ZUSA 3U48A 1V5XA 2BLEA 2GWGA 3GHUA 4NJIA 5CBIA 2FHFA 3C3UA 4AG0A 3HQOA 2WWDA 1YPFA 2KX9A 4PBFA 1PWMA 2HJPA 3F1QA 3WLMA 4B5UA 1VEOA 3W6MA 3A22A 2OZ8A 4HK5A 5AOUA 3SQSA 1VD6A 1GZ1A 2VRQA 3RR4A 1Q4NX 1IZCA 3NSXA 2FIQA 2WMKA 2Y6ZA 3EBVA 1OG6A 5HUOA 5DMLA 5T8GA 1XCFA 3SN0A 2O4MA 3GNXA 3EA1A 1LBFA 2WKLA 3ZT7A 3BMXA 1BXNA 3SCQA 1H5YA 3EX2A 3W53A 4L61A 3H23A 1UBPC 3BMWA 1JDFA 1E4LA 2D2JA 1MYRA 3LV5A 4HHMA 3USZA 1DP0A 3VIGA 2G3FA 3LHVA 3RM8A 4DN1A 5I3JA 3KVJA 1JCJA 1RAKA 3WQVA 3GD6A 1PV8A 2CESA 4PMOA 5AYYA 3SY1A 4AAJA 1OX4B 1ZL1A 4M8UA 1QHPA 1OFOA 3R4IA 3KVLA 3MJYA 4RJEA 3VGHA 4QLKA 3VABA 1LOLA 5EMYA 1E1CB 3PG9A 1F8MA 3AUJA 3PK7A 3ISIX 3AI0A 1AD4A 5DT5A 3H2MA 3UVAA 1I2OA 4NX5A 4AIUA 3WLKX 2E8ZA 4QP0A 3AU6A 3GDMA 5CJNA 3WNPA 1I75A 3C2VA 4CEUC 1Y5XA 3RG6A 1I2NA 4JL1A 1KV5A 1XIMA 5EL1A 1ZGDA 5FJUA 1KRMA 1XC4A 3QHOA 4ZXLA 1A5CA 4FNSA 4X9SA 4XX6A 4I90A 3W00A 4FLOA 5M2FX 1V3KA 2YDAA 4C1NB 3JS3A 4DI8A 2GUUA 2OU4A 2X42A 3CGTA 1QMLA 4NKCA 1V3JA 3NQEA 4ORIA 3EX1A 1CGWA 3CQKA 1W56A 1EPVA 3AHZA 4TVDA 2QUVA 4I7VA 3PBGA 5I5RA 3DECA 1XBXA 1D3GA 2WMJA 1EP1A 5DQPA 4J7RA 2JK2A 2BHYA 4KRTA 4O0ZA 4AZBA 3SUWA 1XR2A 3IGUA 3KLKA 5BOOA 4MDOA 3IGXA 2IUZA 3KDNA 3A64A 4JDYA 5HINA 3QV6A 4QG8A 4QJ5B 2ACRA 3ONBA 5T9CE 2WANA 4KRZA 2OYMA 3GU9A 5M5DA 4XD5A 4GH1A 1AFSA 3NJ3A 5DO8A 2WZMA 2UY4A 1ITCA 1R2SA 2EG6A 4PA8A 4HN4A 1QOPA 1RQHA 3VIJA 4QNEA 2I17A 4C6PA 2ZRZA 3WMCA 2WVVA 4LGXA 4FR1A 1HVQA 1FCQA 4FO4A 4IXXA 3WFLA 5DRIA 4H8NA 2SFPA 4PE8A 4H04A 4MZ1A 5I3KA 3AIVA 2Z1WA 3GDKA 1WDQA 1XL9A 1YLVA 4FPSA 1L8NA 2ACSA 3LCFA 1B3ZA 1UWUA 1YADA 4L80A 3DG6A 3N13A 2H8XA 1JYVA 4HPHA 4JKLA 2PWVA 1U5JA 4DIAA 5HNRA 3C6CA 2AAMA 3PBYA 3WLJA 2R1MA 2XSAA 2PB1A 3SRDA 2Z1KA 4FLRA 2IQ0A 3RDKA 3THDA 4GKTA 2VRJA 1ZS2A 4WF7A 3MV01 1UH4A 1E1FA 2J78A 1C8YA 1VJIA 4HIBA 2QDHA 3H6OA 1KGUA 3GVGA 1GW9A 2NQ5A 2BGQA 1EP3A 4JTRA 5DBUA 4CQCA 3NPUA 2CYGA 5C9UA 1EYEA 1E6ZA 4P8WA 1XI3A 2OVLA 2OWCA 4XG1A 1IGSA 4F48A 1BKSA 1SJDA 4UFIA 2Z2AA 1SR0A 5I7GA 4GQGA 1LLOA 3NXLA 4A35A 1GOIA 4AD4A 6TAAA 1OT1A 1VP5A 3V1PA 4DLFA 3MDWA 6XIAA 4PMYA 1UD6A 2ZZ6A 5I09A 1HTIA 1OGSA 3QH2A 3NQGA 4JIQA 4L6OA 2X8RA 4H6KA 2QT3A 4KEVA 2XH0A 5A6LA 5LHEA 3WK2A 2ON3A 1L6GA 1LRTA 1P4CA 1M7JA 2WPGA 3EKGA 3NOEA 3IPWA 3MUCA 3F5LA 5TQLA 2E25A 3HJEA 1QNPA 3KVMA 1QJWA 1JPHA 4Y7EA 3CU2A 1KB3A 1AG1O 1M7OA 3AYTA 1SW3A 3OJGA 4XD4A 5DCEA 1WUEA 2H90A 4CVUA 2IPFA 4Z2JA 4KS0A 1OCJA 1IXNA 3QMRA 2CPUA 4K3ZA 4BKNA 3NZRA 1E43A 2OMAA 3TN4A 3GR4A 1HKKA 2ZWZA 4I9AA 4NT0A