4UIOA

Structure of the salmonella typhi type i dehydroquinase covalently inhibited by a 3-dehydroquinic acid derivative
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
250
Chain Sequence
TVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Chemical Modification of a Dehydratase Enzyme Involved in Bacterial Virulence by an Ammonium Derivative: Evidence of its Active Site Covalent Adduct.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
total genus 94
structure length 250
sequence length 250
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uioA00
2QKFA 3FJLA 3TAOA 2A5HA 3CWNA 3KRSA 4JICA 4AHPA 4RKAA 4HNTA 3M16A 2B7QA 1T0OA 1TIMA 3NQ7A 3NQ2A 3PB0A 3PBUA 1N8FA 3SZ8A 2W6RA 2QCDB 4Q4KA 2YSWA 3L21A 1LOSA 4N4QA 3NEVA 4UTHA 3M44A 3LBCA 1BTMA 2AQWA 4JTHA 3SJ3A 2OX1A 3G0XA 4N02A 4OE7A 4AB4A 3TSBA 4BI5A 2RDWA 2VC6A 3BLIA 1A53A 4MZ8A 5KZDA 3OBKA 1FBAA 4XTIA 3UZJA 1DVJA 1X7FA 1EB3A 2G96A 2ZZ7A 5CGQA 4IX0A 4UTIA 4Y6GA 4JYEA 4S1FA 2QJHA 4O0ZA 2X30A 1SPQA 4H3DA 3QC3A 2ZRXA 1TREA 5G2WA 3S8HA 4Z1AA 1QDSA 3CQ0A 5G5IA 4N9DA 4EF8A 3O16A 4KWVA 5LNUA 3NAVA 2ZTKA 3LOTA 5DBTA 1OJXA 3GLCA 5AC7A 1TRIA 2ZFAA 1JCNA 4XKYA 2CLMA 5AC6A 1EWDA 1W5OA 3G3DA 5I3KA 3C2OA 4MYAA 3O15A 1GG1A 5HNRA 1X6UA 4EOUA 2YW4A 5AHLA 1ZHAA 2QCEA 4OV9A 2FQIA 1XXXA 3W7IA 4PODA 3O63A 3KX6A 1CW2A 4CLMA 4UMBA 1I8JA 2ZQ0A 4O10A 1SR9A 5HULA 4JIQA 2OT0A 3GNNA 4OGZA 2QUVA 3CLMA 1QNVA 3W3OA 4YL2A 5G4WA 2DU2A 2PRLA 4IJBA 2O7QA 4KKXA 2JKEA 2G97A 3MJYA 1FCVA 1YPFA 1GVFA 1VQTA 3LHZA 3FIGA 3W7EA 1XDLA 4RV8A 3W87A 3W1PA 3CT7A 2Y89A 1KM2A 5F2IA 3SGUA 4KWWA 1PHQA 2XFWA 3O1NA 2WSRA 3L67A 3IGUA 5D32A 4C1LA 1LRTA 3N73A 3O8AA 4Z0SA 1LROA 3FYPA 3G1SA 3GAKA 4HKPA 1W5NA 3C6CA 4XBSA 3TE9A 2V0TA 3LX9A 1O4UA 4FNTA 3E9AA 1DHPA 2OCZA 1H7PA 1KLYA 5CPNA 2FPYA 4XWUA 2I14A 1OX4A 2B0MA 2QDHA 2YYUA 2JGYA 1JR1A 4K8HA 1YTKA 3L2IA 3R12A 3N3MA 7TIMA 1O94A 4RX0A 3PF3A 4IQLA 1MEWA 4H6KA 3JRKA 4JR5A 2VFIA 3GB6A 3HG2A 1TPC1 4JDYA 3G24A 4Q33A 4O57A 1M7OA 3NQDA 3M1ZA 3VE9A 2EPHA 1I2OA 2C16A 5TQLA 4UTWA 4O1AA 4JTIA 3TKFA 4JS3A 3LHVA 4YWIA 3HPSA 1W31A 2X2GA 4LNYA 1QPNA 2V5BA 4QISA 2I1OA 2NZLA 4JTGA 3FJ6A 5DN1A 4I7UA 1W1ZA 4K39A 3M5VA 4UC5A 1NSJA 1FWWA 1A5CA 1F6PA 1FCBA 2KZHA 3C3NA 3IIPA 3QPYA 2VFFA 1ALDA 1EP1A 4XUGA 4A29A 1ME9A 1VCFA 4O52A 1EX5A 3NQAA 4JX5A 5LZLA 3IIVA 4LUIA 1VRDA 1VCVA 4TMBA 5EY5A 2QEZA 4RZ6A 3I7SA 3HBLA 3EXRA 2J6XA 1D9EA 5FF0A 4DXVA 3GZ3A 2E68A 5D37A 3TQKA 1UUMA 1FX6A 4PA8A 3INPA 3PBWA 2G5WA 4XBKA 1KFEA 1GYLA 1MEHA 2CLLA 1T8XA 1AK5A 1V7YA 4GUIA 1BWKA 3MI6A 1KLZA 4NJGA 1LOLA 3KAOA 3W7LA 2NX1A 3B05A 4UNKA 3PUOA 3USBA 4UTUA 2CLHA 2B7PA 1SO5A 3OIXA 3N9RA 3R5EA 3S1XA 4U28A 2CZEA 5D03A 1XUZA 1IXPA 2IQTA 2G95A 3SR7A 3TUUA 3TC6A 4AHQA 1KM5A 3LHTA 3MHGA 3EEGA 3LB0A 1PV8A 4MYXA 4TO8A 2TPSA 3G1HA 5GVJA 1GVSA 4A2RA 3PC0A 3UWYA 4IPIA 5DCEA 4WOQA 1HFBA 1JCLA 2J27A 3PWAA 2HMCA 4YLWA 5I3GA 3TROA 3NQCA 4CNPA 1SQ7A 4IMCA 1YTEA 5HWNA 3TC7A 4PFMA 5F2MA 2H8ZA 2WV8A 2J9XA 3DKJA 3G0SA 3LXAA 4O1CA 2V81A 2X1SA 1XBXA 1MEIA 2FB3A 3F1QA 4WY0A 1QPOA 1SO6A 1TPFA 3RLVA 3GVGA 5I3FA 3CHVA 2V2DA 4OV4A 5DXYA 3UWUA 3W1XA 1HG3A 1TPB1 4FF7A 1KV8A 1R2TA 3FKKA 1H50A 1B4KA 2J88A 3VKJA 3QSRA 2ZA3A 4HT3A 1KTCA 3LCFA 2JGQA 4O13A 4O53A 5MHBA 5K3VA 4LY8A 4K38A 5LGZA 5T26A 3ABSA 4O54A 3LRKA 1A5AA 4ZQCA 1P0NA 4OBTA 4FX8A 2NUYA 1ZNNA 1K8ZA 3S9YA 4CQ8A 1W54A 2GJNA 1MO0A 4L4MA 1DJNA 3MWAA 2HS6A 3C2EA 4GUHA 2Z0IA 3S42A 3W86A 3LI0A 1GVQA 1V5XA 5D05A 4IMFA 1W5MA 2W0UA 3O06A 1VLWA 5BNKA 3H54A 5AHNA 1KFBA 1TMHA 1WBHA 1TSIA 1QOPA 1W56A 3P5ZA 4MZYA 4UR7A 3TQ0A 2E6FA 3DFTA 3BARA 3M5XA 4UTMA 3TK7A 4M7TA 3T4CA 1S5TA 4ZQMA 2DZXA 2QR6A 2VFDA 1LRNA 2VELA 3ABOA 3HOJA 3W73A 2JKAA 1HO1A 1XBVA 2DZPA 3A5VA 1VHNA 1FWSA 4DPPA 4JN6A 3ZS4A 1DQXA 3DKLA 3V1PA 3OA3A 3W2KA 1ZJIA 3LM7A 2EF9A 1LDCA 1ONRA 4AF0A 5AHIA 3TNOA 5EKYA 3W7MA 1EWEA 3GAYA 4JEQA 1OYCA 2NV2A 3NO5A 3P82A 4D2JA 5C54A 5G1TA 3G8RA 1P5BA 1EUNA 2Y88A 4KFOA 3SGZA 1LBFA 3DZ1A 2Z6JA 1DORA 1KM4A 1KV5A 2VEPA 1JCXA 2HSAA 4HSOA 3TFXA 4WJEA 2E6YA 5TIMA 4LRSA 1KFJA 4MLRA 3TAKA 1KTBA 3DFNA 4MY8A 3BVJA 3EX4A 4UFLA 3WJYA 1YDOA 4NJJA 1TV7A 4JXCA 3HPZA 5FEPA 3L0NA 1SZEA 3TFCA 1QOQA 2CZDA 3A24A 2V5LA 3Q2DA 1TJRA 3NYZA 3VNDA 1QO5A 1HL2A 2E77A 4N2YA 4HNVA 4N4PA 3TSMA 2GVGA 2DJLA 2E1DA 1VJIA 4HNNA 1IXOA 5LSMA 2QUTA 1RQHA 1WOAA 5EA9A 1GWJA 1ZENA 4FEZA 1KM3A 1OF8A 2WNZA 4Y9AA 4LS0A 4NZJA 2EKCA 3MYOA 5D2TA 1I4NA 5F4XA 1PE1A 4PL2A 3G1FA 1SZNA 3QSTA 4MUZA 3GX9A 5G4EA 1J5TA 1ML1A 3I65A 3CU2A 2QCHA 1OF6A 3MHFA 4DBDA 1XI3A 3A21A 1VS1A 2PURA 3LTSA 4LOCA 1DL3A 3IVTA 3LHUA 3W1AA 3T44A 1P1XA 2WNQA 1OVDA 3AO0A 3WK1A 1OX5A 4WQ6A 5AYXA 3VE7A 3HIJA 4HN4A 4XTDA 5CZ0A 1H7WA 1XL9A 2LLEA 1LLZA 2ZYFA 4ZMGA 2Q3RA 1G4SA 1ICPA 3HMJG 3S6DA 2WJZA 1TRDA 3NXFA 2V2CA 3S1WA 1R47A 3NDOA 3W1NA 3KVJA 4JTTA 3MYPA 2FLIA 3U6WA 4TX9A 2DZWA 3KFTA 5K9XA 1OFQA 1XDMA 4X9SA 4FNPA 4UFHA 5HWJA 3UQNA 1XFBA 3U2OA 3UD6A 3DU0A 3TSDA 1YXDA 4TR9A 1OHLA 4FNQA 3LI1A 5HUOA 4BWLA 3QMTA 3L68A 3G1DA 3W7JA 3UWWA 3P60A 2ISSA 2RH9A 3E02A 4WOZA 1Z48A 4IWWA 3W75A 3EX1A 3KVKA 2JK2A 4O8RA 2DORA 1OYBA 3W7NA 1SW0A 2YPIA 1UBSA 4O17A 2YDAA 6ALDA 1NF0A 1W5QA 2QAPA 2A7RA 3O07A 1QCWA 5FEZA 5FEXA 3M5ZA 2XN2A 3N34A 4JY9A 2QCDA 1DBTA 4M5PA 3KVLA 3BG5A 3E0IA 3S0CA 1G4TA 3AJXA 3RFAA 3H55A 2C0AA 1WV2A 3TMQA 2WSQA 1FXQA 1G67A 3KXQA 3GDRA 4UTTA 1G69A 2V8ZA 3C2FA 4MJMA 1KBJA 1FQ0A 5LNSA 3TJXA 4R53A 3O6DA 2VFEA 4N9BA 1TTPA 3CEPA 1JUBA 4WX2A 3C52A 4Y90A 1XCFA 3WK2A 1W3NA 4DPQA 1SUXA 3VFLA 3M47A 1IF2A 1TCDA 1H5YA 1OK6A 1SSGA 1GOXA 2Q3OA 2ZZ5A 2Y7GA 1FCQA 1GZGA 3HQ1A 1WA3A 1BWLA 1WOBA 2ZTJA 1GTEA 3N2MA 3CC1A 3W74A 3SFKA 3MUXA 3UY8A 3TH6A 5U7SA 3B04A 1F76A 3OEXA 4Z08A 3L0GA 1L2UA 2ABBA 2EGZA 3Q58A 1PIIA 3PY2A 1F74A 4IX2A 4LV9A 2WKJA 1TPVA 1I2RA 1AL7A 4X22A 2YX0A 1T99A 2CLFA 1BEUA 3P67A 4ZQPA 1IIGA 3L66A 4EVZA 3LRMA 1OFPA 1G4EA 1TPWA 1QR7A 1Z42A 2NXHA 1TQJA 3HGRA 5AN7A 3QQ1A 1EIXA 3MHUA 4LT9A 3NNTA 5KZMA 1VLIA 2J24A 3I6RA 5D38A 3RU6A 1LBMA 1WDWA 3LV5A 1TPDA 5ABTA 3ATZA 3JR2A 4MFDA 1OFDA 3W2NA 1C9DA 3TQVA 4IOTA 4BFAA 5AYYA 4HNUA 2NWSA 4UXDA 1VZWA 4S2CA 3NPXA 2BX7A 5HQEA 5KTLA 5IBXA 1QAPA 1UJPA 1FXPA 3PULA 3CIXA 1QMLA 1OFOA 4Q32A 4EIVA 1DOSA 4JTLA 1K7XA 3TXVA 1O5XA 3CB8A 3IVSA 3LDVA 2RHGA 5F4WA 2HTMA 2AAMA 1QPRA 3S1UA 5KITA 3QMRA 4PL1A 1SW3A 2YYTA 3EWXA 4KFPA 3IV3A 3G18A 4UFMA 3TX9A 3L5AA 1YDVA 1TJPA 2R94A 5FESA 2Z6IA 5FF7A 1M7PA 3DHFA 4TIMA 3W2LA 1W37A 3DFQA 1Z44A 1IXNA 4HIBA 1Z41A 1S3HA 4PC8A 5C2XA 4E38A 3SW6A 3RK8A 3HO8A 1LLWA 2QCMA 2ZZ1A 1OYAA 5DELA 3UWQA 2E5BA 2B4GA 3W7KA 1X8FA 2ISVA 3KRUA 4MOZA 3W1RA 3EX3A 4Z1CA 4O19A 2BSLA 1NF7A 4LC8A 4AHOA 3W7GA 1ICSA 3LXBA 5D2VA 1SO3A 2B7OA 5DCDA 3M5YA 2Y7DA 2Y85A 1LRQA 4YCOA 3LERA 2Y61A 5K9CA 4AVFA 2NLIA 2ABAA 4R34A 4GWEA 1UUOA 2DJXA 2DZSA 1PVNA 3PS7A 2PC4A 4JYFA 2GVLA 3GNDA 4O4WA 5U4NA 2A0NA 4B5NA 4LWWA 2FPTA 4K7YA 3W7OA 3N9SA 5CKSA 1R2SA 3S1VA 1K8YA 5I3JA 4MZ1A 5TBOA 3HF3A 3M43A 5C55A 1FDJA 3UXDA 3W6YA 1KM1A 2FFCA 3F4NA 3W9ZA 4O0KA 3TW6A 4DF0A 1KM0A 2QJGA 4M19A 1LM1A 1L6SA 4YCPA 3HG3A 4AWSA 3K30A 3NOEA 1RVGA 5CPLA 5KMYA 1VCGA 3LCHA 3DFPA 2CZ5A 1F2JA 1MSSA 5EBUA 3P74A 2DZUA 4K7VA 1KFLA 3W7CA 5F1UA 5AC8A 3O6YX 2C6QA 3MMTA 5K7JA 4UFJA 1VPXA 3LTPA 5CZJA 3HPXA 3P5YA 2Y7FA 3FKRA 3L5MA 4IXHA 4ZQOA 1T96A 3W83A 1N7KA 1OX6A 3UZ5A 1FWNA 2VFHA 3P61A 4CNOA 1S5WA 4LVDA 2GVJA 2WNNA 3BG3A 1TPH1 2X1RA 4BWLC 3W2MA 1OFAA 3BGGA 3PB2A 1W3IA 3LCXA 1H62A 3HG5A 1RQBA 3E96A 4N9CA 1G4PA 2ZRWA 1GVOA 2TRSA 4P2VA 3UY7A 3PSWA 3MW7A 4MFEA 5KZEA 4Y96A 4QIUA 5I3IA 2QCGA 3P62A 5HINA 1F5ZA 2V2HA 3OVQA 2V30A 3WJXA 2A2IA 3C56A 5A5WA 3IIOA 2Q8LA 1SZGA 3EKZA 3QM3A 5DBUA 3GXTA 5BMXA 1RV8A 3ZFHA 4S2BA 1H7XA 3G3MA 3QZEA 3QFEA 2Y70A 4AH7A 5LNRA 2P10A 2PE4A 3NPWA 3UNDA 1K03A 2H3DA 2NX3A 4RZ4A 4LS1A 4A22A 1B3OA 1GYNA 1JUKA 2GPTA 3GXPA 3W1QA 3G1VA 3W1UA 1DQWA 3EB2A 3WJSA 3ELFA 4X3ZA 3DBPA 3GKAA 1WBJA 4E0CA 5D2YA 1A5SA 5BRBA 1AW2A 4FXSA 4NJHA 5L6UA 2TMDA 5C6MA 3LHWA 2ALDA 1LCOA 3A22A 1E51A 1GEQA 5I3HA 3PG9A 1YTDA 3EWZA 5LNWA 3MP4A 3THAA 3A5FA 3TMLA 4QJ1A 1C29A 3PM6A 3BG9A 3TR2A 3C4UA 2V9DA 3M9YA 2Y6ZA 4AWUA 1JULA 1YYAA 3BLEA 5H91A 3EWBX 4O4VA 2C14A 3RNDA 2DZVA 2ZRUA 3QPZA 1M6JA 2WSYA 4HPJA 1VYPX 2YGYA 2FB2A 2Y62A 4BI7A 3SIZA 1IIHA 2CLEA 2YR1A 1L6WA 3STEA 1EEPA 3LLDA 1ZCOA 4NNCA 3LCIA 2CWNA 4E2BA 2EAWA 3T40A 1OFEA 4QSHA 2C3ZA 1HTIA 3UWVA 3VI2A 5EL1A 4FHAA 4PH6A 3WJZA 1GT8A 5DY2A 4PCFA 4MVAA 5LHEA 2ZA2A 3W1LA 1R30A 2YCEA 3PUDA 5F2GA 2C13A 3P84A 3T78A 4K36A 1PHWA 2RKXA 1QWGA 4NXKA 5HWMA 3LRLA 2FIQA 4MPQA 1GG0A 3OG3A 1W3TA 2GQ9A 1U83A 3ANYA 4WY0F 5HJLA 1SFJA 1Q6QA 3D0CA 4O11A 5D2WA 5HR6A 2CLKA 1M5WA 3I7RA 3MI3A 3DFOA 3W7RA 1G7VA 2O7SA 3KRZA 5D09A 4LV4A 1XM3A 3WJWA 5F1VA 2NUXA 3L9CA 2E09A 5E0KA 5LGXA 3GR8A 2ZDRA 1J4EA 1EP2A 3IVUA 1YLVA 3KOFA 1LORA 5F4SA 4GBUA 1MZHA 2WO5A 3C61A 1EA0A 1VR6A 3STGA 3C0JA 3N19B 3ZWSA 4LVGA 5CZSA 2VXNA 1RZMA 3LGEA 3RLUA 3DGRA 2Z2UA 4GE8A 5D30A 5KINA 1AG1O 5CPMA 4ADUA 5LNVA 3C2RA 3TDFA 1DKWA 2QDGA 1R2RA 4TU1A 2QUUA 3QJAA 3DENA 1SO4A 1Q6RA 3PBYA 4FX7A 2A4AA 4JGDA 1C8VA 4H4IA 1KTNA 2R14A 4G1KA 1X1ZA 4UTWC 3NL6A 2ZZ2A 4FNUA 4RZ5A 1KFKA 4DO6A 1AL8A 3LHYA 3CM4A 4JX4A 4MY9A 2RDUA 3GK0A 2WPBA 1YPIA 1TTJA 1TV8A 3OVRA 4FIQA 4O18A 2PRHA 1XBYA 1SFLA 2C19A 2A21A 4NNAA 1EPXA 3IEBA 2Z1BA 4BF9A 4AAJA 4W9TA 4NX0A 2QCNA 4UR8A 1H60A 3I7QA 3W84A 4K37A 3B0VC 4CCCA 3LXCA 3DI0A 1FY6A 1X1OA 4ORIA 4UTKA 4CCDA 4L4LA 3EXSA 3A23A 1P0KA 4E2DA 4DELA 1YXCA 4BK9A 3IGXA 3E49A 3TA6A 4N6EA 4IUOA 1HUVA 1Q6LA 4OU1A 4NX5A 5FF4A 4RK8A 1LBLA 4P61A 1VH7A 3JS3A 3CWOX 3N14A 1L6YA 2XN0A 3WFAA 1K7FA 4CQAA 2H90A 3O05A 2RFGA 2C1HA 5BMWA 1K3UA 4ZL1A 2YW3A 1JQXA 1O5KA 3KHJA 1GJPA 1L9WA 3YPIA 4UMCA 2I9EA 4TMCA 3LCGA 3DFSA 4QQ3A 1WYIA 1RPXA 1VC4A 2X16A 3RF9A 2BZNA 2W79A 1ZFJA 4O50A 3LTYA 2A85A 3G22A 3R2GA 5D04C 1RQEA 3FOKA 3W70A 1TV5A 4UTJA 4GXMA 3BW2A 3I68A 5EYWA 3TV8A 4RR4A 5AYZA 1UCWA 1TPUA 4GUJA 1ME8A 1H7NA 2PRMA 3W07A 3TCEA 3QQ0A 1JCMP 2VKZG 2GQAA 2CW6A 4OWGA 4LTSA 3HGJA 1ZALA 2GJLA 1O95A 4NZFA 2VEKA 2QCCA 5AHMA 1N55A 5LKYA 4LC6A 3QW3A 1SZFA 3TW7A 5AHEA 3N2XA 2C15A 1F05A 3B4UA 3CTLA 1ADOA 3QRHA 4WUIA 3NQFA 3GDTA 1YDNA 3PG8A 4U4MA 5E1QA 4WXZA 3GIYA 2NXIA 3IRDA 4RLIA 4NNBA 1TB3A 4NQ1A 2YXGA 3B0PA 2NV1A 1KM6A 4ML9A 1UB3A 1QO2A 3ABRA 4ONVA 4WXYA 4ZQRA 4DO5A 4NUWA 3CIWA 3B0UX 4DEFA 3UPBA 1VHCA 3W23A 4XKYB 4A3UA 3UWZA 3R89A 4OQVA 1OK4A 4QAIA 3EWUA 1W5PA 1TYGA 4I9AA 3HB9A 2NXGA 1YADA 4FIRA 4UFKA 3W1TA 1K8XA 1ZAIA 3BK0A 1OABA 3KVMA 3QMSA 3WK3A 4Y8FA 1JRCA 4WZHA 1B57A 3L5LA 2ZRVA 4AWTA 3QEZA 2FTPA 4MLJA 3EKLA 2F7FA 2ZZ3A 3W7QA 4JY8A 5F2LA 3BPWA 3GKFA 4FNSA 3PR2A 2OT1A 1EP3A 4GNJA 4PTNA 1I2QA 2VOMA 3TU9A 2QAFA 4IPJA 4ALDA 4GC4A 5K4XA 4JDBA 4JTSA 3GYEA 4CCEA 3DXIA 4JIPA 1GVRA 5BOOA 3ZWTA 1JRBA 2FDSA 3UPWA 3ZR4A 3PUEA 2R8WA 3STFA 3G1YA 4JYDA 3FYOA 1WX0A 2P1FA 5LHFA 2OMAA 5SWUA 5DLCA 3UXAA 5K2ZA 2H3BA 4LVBA 4M6PA 1F6KA 4JTJA 4IMEA 4RXGA 1JVNA 5EMUA 4K8EA 1OX4B 3FLUA 2OZ0A 4O1DA 4R7JA 3T7VA 1FDYA 2CLOA 4JX6A 1R46A 4IMGA 4BR1A 3DHDA 3THQA 5AOUA 1IGSA 3M0ZA 3W7PA 1TTIA 2QCLA 1TTQA 3NGJA 2Q8ZA 4ZZ9A 4GJ1A 3FFSA 1NFBA 1TPEA 3ATYA 3DI1A 5A8GA 2A6LA 4JTKA 3ABQA 2R91A 2Y7EA 3HJZA 2ZZ6A 4YMZA 2ATSA 1F73A 1JUEA 1H7OA 3M7WA 2A7NA 2E5CA 2XN1A 1LP6A 3P81A 2VEMA 3FEMA 4ZQNA 5H2ZA 1K02A 1PS9A 3U8GA 5DCBA 2VEIA 4NJKA 1WAUA 3NQ6A 1W0MA 3B8DA 3IGSA 1H61A 4A21A 4HHPA 3QYQA 4XQ6A 3S5YA 1QPQA 3E12A 3NZ1A 1KA9F 3W7HA 1SU5A 2YZRA 5J5RA 4C1KA 3SECA 4FXRA 1G7UA 1FDZA 1P4CA 1W8SA 4MJZA 5CSRA 5HMSA 2BLEA 3GDKA 5KSWA 4IMDA 4JD4A 1QFEA 1D3HA 2ZZ4A 2QF7A 3RMJA 3W88A 4N9EA 2C18A 4LVAA 4PEKA 2GQ8A 3NPUA 1A5BA 1JCYA 4O14A 2X1UA 4NJIA 4YXGA 3R8RA 3W72A 3NQGA 1A50A 1Q3NA 3PVFA 2YFOA 5K4ZA 3DH7A 1J2WA 2H6RA 3LV6A 1IXQA 3W2JA 2GUUA 1JCJA 4JNMA 1H63A 3W2UA 1JQVA 4RXFA 2DZTA 1GTHA 4JTFA 2CZFA 1OG0A 1B4EA 2OJPA 4UUIA 3STCA 4RJEA 1LZOA 4ORMA 3FA5A 2X1TA 3MP5A 3W85A 2E6DA 4IGHA 3NR0A 2ISWA 4DQWA 6TIMA 3G1AA 2F84A 5J5DA 2QCFA 1FWTA 3NQMA 1LOQA 1MXSA 3LLFA 4JTUA 1TQXA 2UV8G 1DV7A 3W1MA 1Q45A 3S5ZA 4M7SA 1XBZA 1GQNA 3W76A 1U5JA 4DF1A 5FI8A 1ZAHA 3P8JA 1EUAA 1VYRA 5C5YA 2RDTA 2E5DA 4WY0B 1Q6OA 3GDMA 2B7NA 1KW1A 4ZVJA 2WOQA 4XZ9A 4GFSA 3T55A 1I2PA 5G2IA 1AW5A 5CG7A 4A2SA 1UASA 3EWWA 5D33A 1B9BA 3R13A 5AFDA 4M6QA 1DJQA 1XUUA 4OHQA 5HUPA 3LCLA 3DAQA 3BV4A 3G8EA 3QW4B 2J9YA 3P7YA 3QH2A 3NQEA 2ZBTA 1OFRA 4UTTC 3VCRA 4DBEA 3L0KA 1D3GA 1F7BA 1XKYA 1CX9A 3BGJA 3BW3A 3NM3A 2GOUA 1RD5A 1YXYA 4NU7A 1WQ5A 4FB7A 2E6AA 2TYSA 3PSVA 3WK0A 3B06A 2A1YA 1ICQA 4OT7A 2FPVA 4GRSA 4JTEA 4M6VA 8TIMA 1HO4A 3MP3A 4LU0A 1ME7A 4NXSA 4O12A 4UNLA 5D2XA 4QNEA 4LRTA 1JJKA 3MO7A 1VGAA 4WD0A 5FF3A 3EWYA 4HPXA 4N6FA 1S5VA 1XC4A 2ATMA 1AMKA 3HGSA 1OFBA 4ICNA 1TO3A 4LVFA 4NT0A 1PCWA 2NX9A 3QF0A 4UFIA 4CQ9A 4Z1BA 4UTLA 3LCWA 1NAL1 3BLFA 1WXJA 1ZAJA 3FS2A 4NVTA 2CU0A 4MKNA 1FUYA 4ADSA 2ZCGA 5CPOA 5DY3A 1K7EA 5IM51 3G0UA 4UCGA 2ZA1A 2AGKA 5DXXA 2BXVA 4GUGA 4J9JA 4R33A 4AF0B 1CI1A 3PAJA 3HGOA 3C8FA 1H51A 3H53A 3M6YA 3BW4A 3MI2A 2NUWA 4MY1A 5E93A 3P80A 2NWRA 3F03K 4AXKA 3SSJA 5G2HA 3SI9A 4EWND 5L9FA 1KFCA 1ZY9A 2EHHA 3IIZA 5IBXC 5AB3A 2PCQA 4QITA 3S5NA 4HSNA 4AMAA 3W7DA 3HG4A 2VENA 4RCXA 2DP3A 3NQ8A 2A6NA 1THFD 4FNRA 3CEUA 2ZRYA 3A9IA 3NA8A 3S5OA 3P8IA 1H1ZA 3NL2A 3NQVA 3SY5A 1AW1A 3TJLA 2TSYA 3TXZA 3Q37A 1SW7A 3EX6A 3NL5A 1KBIA 4Z0JA 4I7WA 3Q94A 4LUJA 4FO4A 5CSSA 3IIXA 2JKPA 3UYCA 4Z1DA 2QJIA 3BO9A 4UMAA 4EF9A 3CPRA 3W71A 1NVMA 1I2NA 3MBDA 3NZRA 3O6CA 1BKSA 4KFNA 2P0OA 3NPVA 5FEWA 3EXTA 2HS8A 2D73A 4X2RA 1H1YA 4O28A 4O1BA 1H7RA 5EPDA 5FF2A 1SSDA 3GR7A 3M41A 1FCUA 4FX6M 3NVTA 1RR2A 3OVPA 4BI6A 4O15A 1I45A 2VFGA 2J9ZA 4I7VA 5AHFA 2CFFA 2V82A 3G1XA 1O60A 3TIMA 4AEOA 3L65A 5BW6A 4QNWA 4DF2A 3OHIA 3LBMA 4DO4A 5G1YA 1FWRA 1LTDA 3V75A 2BTMA 2H8XA 1GPWA 4GUFA 4LS2A 2JBMA 4MIMA 2WQPA 2Y63A 4UIOA 3F4WA 1LYXA 2FJKA 2YFNA 3MBFA 5CZTA 3EX2A 3C2VA 4K6AA 3NM1A 3W22A 4IXXA 1NEYA 3B03A 1PCKA 3NL3A 4QM1A 5D02A 1VYSX 1G6CA 4CNNA 5K9DA 3GXNA 4LW7A 4POCA 2BWGA 1PL9A 4O16A 3PBVA 2ZRZA 1Y0EA 4ADTA 5HR7A 3GDLA 3NG3A 2A7PA 2CLIA
chains in the Genus database with same CATH superfamily
2QKFA 4DJDA 3WD0A 3W81A 4JICA 2AMXA 2ZC1A 4IJRA 4JCMA 4HA1A 1W9VA 3L2LA 3ZLHA 2YSWA 3L21A 3VZZA 3NEVA 3M44A 3LBCA 1BTMA 3JZUA 1HT6A 4JTHA 4AB4A 3URNA 4W88A 2VC6A 4PB5A 3BLIA 4ZO6A 4PMUA 4B5UA 4ICCX 2J25A 2G96A 2IPFA 4UTIA 3UJEA 4S1FA 4O0ZA 1SPQA 1WE5A 1QDSA 2DVTA 2PWHA 2VGBA 5G5IA 4N9DA 3O16A 3UG5A 4B3ZA 5A6BA 3MSDA 4Q6XA 4IGNA 3CUJA 2ZFAA 4D71A 1JCNA 1WCGA 2QMJA 4AY7A 4FLQA 5ABFB 3SCVA 2A3CA 3G3DA 3C2OA 4MYAA 4C1NA 4EOUA 2QCEA 2FQIA 2V63A 4D6FA 3BANA 2XJ7A 1EQCA 3L4XA 4PODA 3KX6A 2C79A 4BA0A 1SR9A 2QUVA 4IPNB 5G4WA 2DU2A 2JKEA 4OJYA 1P48A 3DG3A 4B92A 3LHZA 4PYSA 3FIGA 1XDLA 3CT7A 1T8QA 5F2IA 1J11A 1VBGA 1MNZA 4LUTA 1V4YA 4ES4A 1OZMA 4HKPA 3C6CA 3BAYA 4Y7EA 4PUNA 1UIOA 1A0CA 3CNYA 2D22A 3QY7A 5A1AA 2WB5A 3WQ6A 4ZR8A 1A0EA 4B9YA 4YS1A 3VUSA 1OX4A 3HFYA 1YTKA 4IPLA 1TG7A 2DQWA 4MPKA 2BVDA 2HJPA 1T40A 3N3MA 1O94A 3NSXA 4H6KA 2XINA 1O66A 1NFPA 4J3UA 3GB6A 3HG2A 2XH2A 1TPC1 1AQ0A 1PJ9A 2V3EA 4Q33A 1QW7A 1M7OA 2ESCA 3NQDA 3M1ZA 1LUCA 2C16A 4ZO7A 3PANA 5TQLA 2I5GA 3H24A 1VPYA 3TKFA 4IQJA 4JS3A 4JTAA 1EGVA 3IJ6A 4YWIA 3CZKA 4OUEA 1ZTVA 2E8ZA 1KXVA 5DN1A 4HQVA 4UOQA 3Q65A 5HOSA 4B2DD 3KS5A 3TJ4A 1N82A 4C6EA 1MFVA 3C3NA 2R1PA 3GXFA 4LF1A 1EP1A 1JD7A 3PHAA 4GK8A 3BMXA 1A3XA 1EX5A 4HNCA 4L80A 4TX6A 3MSYA 3GO2A 2PDWA 3M0MA 4TMBA 4F9DA 3RRAA 3I7SA 2WYSA 1PIFA 3FY1A 1ESWA 2VX6A 2E68A 1XIGA 2J13A 1E72M 2CETA 2Z4GA 1S2AA 2G5WA 3MUZ1 4RNFA 1Q85A 1WDPA 4FLRA 1KFEA 1PDZA 2CLLA 4D1IA 1AK5A 1UW9A 2D24A 2PDIA 3MI6A 2J8GA 1E1FA 1QNQA 2WZIA 3K1DA 4G7EA 2XIMA 2NX1A 1S39A 4UTUA 1XQKA 4C6NA 2HNEA 4XAGA 3OIXA 2CZEA 3RPMA 3TUUA 1IXPA 5C9RA 2G95A 3SR7A 1BGAA 5GVJA 1P6WA 1GVSA 3WKZA 2VD8A 3UWYA 1U5VA 2P3ZA 3TTYA 2VEFA 1UPPA 1HFBA 2Q8XA 3NTYA 4WOQA 4HVXA 4IZGA 1V0MA 5I5RA 3TROA 1H11A 4Q4QA 3NQCA 1TV4A 1SQ7A 1YTEA 4R27A 3F5LA 4PFMA 5F2MA 4GYPC 1HKVA 3G0SA 4GNVA 3LPPA 2OKOA 2V81A 3F1QA 1XBXA 4WY0A 3SB0A 3W0KA 1SO6A 3GTNA 3BQ5A 3CHVA 2V2DA 3SCRA 1TPB1 4UQ9A 1KV8A 1E4MM 1UP2A 2VCBA 4HHMA 2QJJA 1B4KA 1UZDA 4H2HA 2IKHA 3FSUA 4WDUA 3QSRA 1BRLA 4O13A 3TZNA 5K3VA 3UWEA 5T26A 2GJPA 3QN3A 1GQLA 3WQOA 2E1WA 4Q4OA 1E40A 2CNCA 1EC7A 4OBTA 4QCEA 3B8VA 3S9IA 2GJNA 3UCCA 4L4MA 2HS6A 2DSWA 4GUHA 2Z0IA 3W86A 5ABHA 3N29A 1V5XA 5D05A 4GZ7A 3KP0A 2W0UA 1K6WA 4TXEA 2VCCA 3M0KA 1XKJA 5AHNA 4RE2A 3GBEA 1B54A 4ZCWA 3ARVA 3MQTA 3GYCA 3FA3A 3M5XA 4KEUA 1DIEA 3BAJA 4C60A 1RY8A 2DZXA 2QR6A 5CBJA 2PSNA 2YB1A 1LRNA 1W3JA 4Y9MA 2UZ9A 2CZVA 2CBUA 1XBVA 1ZJBA 3A5VA 1VHNA 2ASHA 1BPLB 3DFYA 4K8GA 1ZJIA 1RA5A 1K9EA 1TMQA 2DSKA 3H7RA 1LDCA 4LUSB 1EDTA 3TNOA 1L6GA 4U2YA 1F07A 4NSBA 3IJLA 3ITLA 2D2HA 4JEQA 3SUTA 5G1TA 3SGZA 2Y88A 1H3GA 4HSOA 3K5XA 5TIMA 4MLRA 3GWQA 3GS6A 1B9ZA 3EX4A 3WJYA 1SVDA 1YIXA 3CAVA 3HPZA 5FEPA 4KRZA 3A24A 2V5LA 1DJHA 3M64A 3Q2DA 3NYZA 1QO5A 4QE5A 3TSMA 3AWOA 1VJIA 1IXOA 3LYEA 1GW9A 1RQHA 1WOAA 4AD5A 3T0DA 4FEZA 2UY3A 3IJ7A 3JW7A 2EKCA 3B9NA 3T0CA 1TUXA 4PL2A 1CEOA 1SZNA 5G4EA 1ML1A 5H8PA 1OF6A 3MHFA 4IJCA 1XI3A 7TAAA 3MCNA 2PDKA 3N4EA 2Y8UA 1AH4A 3THCA 3LHUA 3ITVA 1P1XA 3CZGA 3KOWA 1A5KC 2Q71A 4Z2GA 2F2HA 4XTDA 5CZ0A 1H7WA 2LLEA 2CBJA 1LLZA 4ZMGA 2X40A 2Q3RA 2WKGA 2VOTA 1ICPA 3B8SA 3SGGA 2WJZA 3GTIA 2V2CA 3JVAA 1R47A 1A4MA 3NDOA 3MYPA 2FLIA 3U6WA 2DZWA 3KFTA 4AY1A 4X9SA 5M5DA 5HWJA 4NZ4A 1XFBA 5D9NA 3U2OA 1HKJA 5A6JA 1XLJA 4GCAA 4S3JA 3TSDA 1J0JA 4TR9A 5FL0A 4FNQA 3LI1A 1E6QM 5HUOA 4BWLA 3A6OA 3L68A 1LJYA 2E7FA 3G5EA 4JEJA 3WQ8A 3P60A 2ISSA 4IIHA 5CH9A 1E5NA 1Z48A 3KBSA 3DBNA 3AZTA 4CQCA 3KLKA 1OYBA 3ZM8A 1SW0A 1VBHA 4NAFB 3MMWA 4FXJA 1UBSA 1ZB5A 2R6OA 3UJ2A 1B2YA 2A7RA 4YTTA 1XH0A 3O07A 1IWPA 3PJXA 3M5ZA 4Q4RA 2XN2A 3WLJA 4JY9A 1DWFM 2NQZA 3UG3A 3BG5A 3S6TA 3WQCA 3S0CA 3AJXA 5CLTA 5IHSA 1FXQA 3VIIA 4UTTA 4DYEA 4MJMA 1KBJA 1FQ0A 4YVVA 4GC3A 4N9BA 1U1JA 1TTPA 1TR1A 2OEJA 3F4VA 1Q63A 5C8BB 1JPKA 2E4TA 3WK2A 1W1IE 2WQDA 2DUXA 1SSGA 4EXAA 1M3UA 3T4WA 4C6IA 1GOXA 2Q3OA 3VGEA 2IKGA 3MCMA 2ZTJA 1WOBA 4JL1A 3W74A 3UY8A 3TH6A 3ZR6A 3N13A 5ABFA 4Z08A 1DJIA 1V6YA 3MKKA 1I2RA 3NIYA 1AL7A 1AQMA 2Z1XA 1S2VA 3PTQA 1C8QA 4Q8QA 4X22A 1BEUA 3P67A 5G1MA 4ZQPA 3EKGA 4LBUA 1S38A 3CQHA 4UQAA 2EG6A 4KT2A 1RLCL 3HGRA 5AN7A 3UESA 3QQ1A 2VHLA 3RPTA 2D20A 2PWEA 2X0HA 3RU6A 1J0IA 2VDGA 3KE0A 3GTFA 1WDWA 2QVNA 2V5DA 1PZ0A 5ABTA 3PPGA 2GJRA 2ALRA 3DYOA 3W2NA 1MW3A 4ZGYA 4BFAA 5A8QA 4XZMX 1D7FA 3T8QA 3TLQA 3GU2A 2Q01A 1UJPA 4WHBA 4LAUA 2WJFA 2DIKA 1GZ1A 4Q32A 3UXLA 2OWCA 4DUXA 1O5XA 3IVSA 1AODA 3ZYZA 3UG4A 2WMFA 3UXIA 3WLHA 3QMRA 4KEVA 3DECA 1SW3A 2YYTA 3EWXA 4Z2JA 3IV3A 1J0YA 2IPGA 1YDVA 3RR1A 3R6IA 4GNKB 1SJAA 1S1PA 3UVAA 3DHFA 4RDVA 3AHZA 3L4VA 3DFQA 3BSGA 1Z41A 2PF0A 4PRRA 1YNYA 4KGLA 4KWOA 2FZBA 4E38A 2FZMA 4HMNA 3H2MA 5DELA 3N18A 5B80A 2ZUSA 3W7KA 1XCWA 4OUIA 3IANA 3W1RA 3EX3A 2FZ8A 3GG1A 4FMVA 2YCKX 3CHDA 1XD1A 3BLDA 1F8MA 4PTXA 1ICSA 3LXBA 3R7MA 1SO3A 2XGBA 5DCDA 1O5QA 5GNYA 5CGTA 2Y7DA 2Y85A 1LRQA 4YCOA 3LERA 5K9CA 4PUMA 4AVFA 2NLIA 2ABAA 1SM9A 3SCUA 4R34A 3H70A 5C7HA 5JXQA 2DJXA 1E6XM 2WWCA 4QG8A 2CHRA 3GNDA 3M0XA 4B5NA 2FPTA 1D8WA 3VMOA 4K7YA 2VZUA 3VU2A 5CKSA 3UBPC 5A2CA 4MZ1A 4PGLA 1K4GA 3M43A 2GOKA 4U33A 3VNJA 2DQXA 3W6YA 5EMYA 2HCVA 3F4NA 2YL9A 1JDFA 1KM0A 2QJGA 2WLYA 2J47A 1XIHA 5CPLA 5KMYA 2HE8A 3DFPA 1F2JA 1S3TC 1PXGA 4NI8A 4QQUA 4K7VA 3W7CA 2J79A 4MNMA 2CXGA 4QBXA 4UFJA 3UR5A 3WDPP 1UH3A 1VPXA 3DN5A 3FEQA 3LTPA 3POHA 4K1WA 3P5YA 1LL7A 3FKRA 3ABZA 1QNOA 1PX4A 4HNOA 1N7KA 3TTOA 2VFHA 4LVDA 2WNNA 3BG3A 2WK2A 3C0QA 3LCXA 3NSMA 4NZCA 1H62A 4WDXA 4HTYA 4BEQA 5I3DA 1WKYA 2TRSA 4YIWA 2G4FA 5HINA 1F5ZA 4Q8WA 2V2HA 2A2IA 3LUTA 2XVGA 3VM5A 3EKZA 3UW6A 4MM1A 3EA3A 4S2BA 3G3MA 3QZEA 3QFEA 3U2EA 1LQ2A 3NPWA 2NX3A 4RZ4A 1B3OA 2J75A 3NYDA 1JUKA 2J7BA 2BVWA 3EB4A 3WJSA 4X3ZA 4K2SA 4MB4A 1WBJA 4AW7A 5D2YA 1OBAA 2GL5A 1AW2A 4FXSA 2TODA 4J3WA 1LCOA 5I3HA 3VMNA 3EWZA 4HA4A 2E40A 4GIEA 3THAA 2PGEA 1OCQA 1C29A 3C4UA 1EJUC 3GVRA 3RU8X 3M9YA 4Z42C 4H9YA 2VWTA 1YYAA 3O2LA 1QU4A 3EWBX 3APTA 2VURA 2WSYA 1VYPX 2YGYA 2FB2A 1T7LA 1HVXA 5H8UA 2CLEA 1EZ2A 5A8MA 4CNSA 4KQNA 1ZCOA 3W82A 3GFZA 4IIDA 1PX3A 2YBVA 4KWUA 5A6AA 2CWNA 4E2BA 1MQPA 1HTIA 1OGSA 4KESA 2C0HA 4WSJA 4H04A 5DY2A 4PCFA 5F2GA 5LIWX 4LYKA 3CAQA 1DYSA 4G2DA 4KIRA 4Q6JA 3LZ3A 3G77A 3FXGA 4MPQA 2QIWA 3ANYA 3FYYA 3WQVA 4LUSA 4LEQA 3WQDA 1BYCA 5ABGA 4AZ6A 5T91A 3W7RA 3KRZA 3UJSA 1V3JA 5F1VA 1JDDA 1XISA 3U2CA 1SMDA 3RR4A 1LORA 1BLIA 5F4SA 3S1GA 1XS2A 1EA0A 1VR6A 5CAHA 3KBJA 4LVGA 2G3NA 3VNKA 3IJQA 3IWPA 3LGEA 4CQDA 3RLUA 1MW0A 1A5OC 4UOJA 5CPMA 4ICMA 3E3HA 4MNJA 1VBRA 4IL2A 4TU1A 3VD4A 5LXEA 3PBYA 1C8VA 2YZ5A 1KTNA 1GHRA 1PDYA 3OVGA 4FNUA 1KFKA 1UD2A 1HJXA 3E2VA 4LUYA 3W6LA 4JX4A 1AA1B 2WPBA 4B5XA 4I5RA 5A2AA 3W29A 1QUMA 1AZ2A 5CBIA 4ZA0A 4O18A 2PUZA 4NNAA 1EPXA 4W8AA 4D6DA 3ARRA 2OEMA 1QRQA 4NX0A 4W9TA 3W4RA 4KS0A 4UR8A 1OC7A 3TYAA 1EDQA 2IPJA 4JTCA 4NASA 4CCCA 4PUDA 3HURA 1X1OA 2HISA 4UTKA 1B90A 2RGMA 4QJ3B 1VEPA 4V27A 1XH1A 1R3QA 3E49A 4S3FA 4N6EA 4GH3A 1QI4A 1UR1A 2BG5A 1RCXB 1XSIA 4ZTYA 3JS3A 3W02A 1GGOA 3SUUA 5CBBA 2XN0A 3TR9A 3SEPA 4M82A 5LIUX 4EPBC 5EMMA 1JD9A 4ZL1A 1O5KA 3OZOA 1HF6A 4UMCA 3BV7A 4JTQA 4QQ3A 5A8PA 2BZNA 4D8AA 2VVNA 3LTYA 1OY0A 2X42A 1RQEA 4YYFA 1QT1A 3EMZA 1TV5A 3BW2A 3I68A 3OQ8A 5EYWA 3TV8A 3CUIA 4PCPA 3V5OA 1ME8A 1RK6A 1H7NA 2PRMA 4V15A 4HU3A 3W07A 4OWGA 1P0BA 3HGJA 3G6LA 3VOHA 4NAFA 2Z28A 3FGCB 2VRQA 1O95A 3IUIA 2QCCA 4BZYA 3K4DA 2D2GA 5LKYA 1KNWA 3GVQA 1SZFA 3RJYA 5BZAA 1OGBA 1XPGA 1C91A 1F05A 3EB3A 3CTLA 3NQFA 5KETA 3QV9A 1K9FA 3ARZA 4W5ZA 3P3BA 3QHNA 4BQ5A 4KPLA 1FHUA 1Q6EA 3GIYA 3IRDA 4RLIA 3H2NA 4NQ1A 2NV1A 4WJXA 5LIXX 2HNHA 3ABRA 4ZQRA 3OZPA 2WPGA 4FALA 4B5VA 1X96A 3AIVA 3W23A 3LMZA 4OQVA 1W3HA 2PLCA 3TN4A 4I9AA 1B0IA 1ADDA 5CAKA 1XYBA 2NXGA 4FIRA 2FDMA 2GWGA 3W1TA 3M6DA 3WK3A 4DWSB 1JRCA 3IK4A 3SFWA 2F7FA 3FX4A 5EMJA 4JY8A 3WDHA 2FZ9A 3B9OA 5F2LA 3BPWA 4YTRA 1HKMA 2W67A 3PR2A 1CGYA 4GNJA 4PTNA 3UVIA 5BRPA 1QW8A 4JDBA 4WCJA 1GVRA 1B5TA 1TKKA 2XVLA 3ZWTA 1JRBA 4GHRA 4NAEB 1LL4A 4OTKA 4H6RA 1PX8A 3PUEA 3H7VA 3VNLA 3IRSA 1NP2A 1BSLA 1S2UA 3FYOA 2FVKA 3FDKA 2P1FA 5DLCA 4CD6A 2A3AA 2H3BA 2V68A 3W25A 4RXGA 3UZXA 3VZYA 3TW9A 3T7VA 2QIIA 4JX6A 1JIBA 1UA7A 4LH8A 3REQA 4JQAA 3EZ4A 2P0IA 3FFSA 2PI6A 1XLHA 1TPEA 1P6BA 3AI0A 2WZEA 4NZ5A 3VOFA 1H7OA 4GACA 2E5CA 4MKVA 2VEMA 1TA3B 4J3VA 4S23A 3SRFA 3U8GA 5MKGB 1OSEA 4RNIA 3GFYA 3IGSA 3WLQA 4I90A 3ZSTA 3QYQA 4XQ6A 2E9LA 1BYDA 1K1DA 5J5RA 3AMKA 1G7UA 1P4CA 4FK9A 1D3HA 2OTDA 2QF7A 3RMJA 1ELSA 1ITXA 2C18A 2CITA 4JHZA 3AS1A 6CGTA 1UMYA 3GU1A 2WVTA 1UKPA 4YXGA 3W72A 4H7ZA 2D1ZA 5K4ZA 4YVPA 3DH7A 1M53A 1CYGA 2BS9A 2ISFA 4L9XA 1IXQA 3LBOA 4JNMA 3B4YA 1WP6A 1G0CA 3W2UA 3GNXA 2BVYA 3H2AA 1EO5A 4XIAA 4XV0A 3DG7A 2EPKX 1EXPA 2VM8A 1NOWA 3H8AA 4WSKA 4US6A 3U5UA 1LZOA 3AYVA 4ORMA 1OQFA 2E6DA 3ORWA 1YNQA 1OD8A 2ISWA 3M4HA 5J5DA 2QCFA 4M6UA 3RM8A 1MXSA 3IGHX 3W1MA 3BCDA 1IGWA 3QY6A 1XBZA 1HIZA 2JE8A 3UXKA 4DJEC 1U5JA 3CUFA 4C5ZA 3CMGA 1OM0A 3WH7A 2WLZA 1UD4A 4AMCA 2B7NA 3VOJA 2REQB 4ZVJA 3KW3A 2Y4SA 3LS9A 3ZOAA 3CUZA 4XZ9A 3T55A 1HP5A 2Y2WA 4IUGA 5JBFA 4KMQA 5D33A 1B9BA 4YTQA 4TV6A 2CERA 3PZTA 1I60A 3PZ9A 1R9ZA 3QH2A 3L12A 2OXNA 3AHXA 4DBEA 4TV5A 1D3GA 3N12A 4S3GA 1XKYA 2QS8A 3VZXA 1YXYA 4FB7A 1QHOA 5CEWA 2DIEA 3K2GA 1NWUA 4TUFA 2VX5A 4W89A 1M7XA 1W32A 4ZB0A 4DZ5A 4JTEA 4ACZB 3T0AA 3MP3A 4S3CA 3CUGA 4QNEA 4LRTA 4AXNA 5IOBA 3GUGA 1A5UA 1PCWA 3QF0A 4UFIA 3E74A 3R4IA 3BLFA 1WXJA 2PDYA 3VPLA 2E28A 1UZHA 2CU0A 4MKNA 1FUYA 5DY3A 1OWQA 4PUWA 4NYYA 3AISA 2BV9A 2BXVA 4U31A 4J9JA 4V28A 2J77A 4E8CA 2VI0A 3AIRA 1E0WA 3C8FA 3H53A 4JKKA 4Q8UA 3D6NA 5D8WA 3SUVA 1B3VA 1R86A 1XW8A 3F03K 3TCSA 5L9FA 1ZPTA 1KFCA 3IIZA 4CVWA 5AECA 4QITA 4XVDA 3WQEA 2FH8A 1K4HA 3WENA 3WDJA 1Y5XA 4AD1A 5BOFA 2X05A 3CEUA 1WDSA 5FOOA 3S5OA 3NL2A 4IFRA 1SW7A 4PE8A 3EX6A 3NL5A 1KBIA 2AMGA 5BXTA 4LUJA 2QHAA 1J12A 3IIXA 1Z89A 2JKPA 3P2VA 3FCPA 4ZOEA 3QV7A 2OSWA 1WNOA 3NURA 3ARYA 3F4CA 1NVMA 1I2NA 3I4EA 3MSRA 5FD0A 2P0OA 1TE6A 1XGDA 1VFMA 1DXEA 4X2RA 4O28A 1H7RA 5EPDA 5FACA 3URBA 1SSDA 3LM3A 2XPKA 3GR7A 1R7AA 1W1PA 3SRHA 4U3CA 4KGJA 3H4XA 1LT7A 4O15A 1I45A 5AHFA 4H1ZA 1V51A 4AEOA 3L65A 3C5QA 3WF0A 1CTNA 4J28A 2BMBA 1A80A 3UNTA 4D8LA 1FWRA 3WY1A 2WQPA 1HQTA 2X0SA 4IICA 2Z7GA 1F3EA 2CHOA 3KUMA 4JQ4A 4OIFA 4AZCB 3KBMA 3UYIA 4K6AA 2YDQA 6XIMA 3LK6A 4QM1A 5K9DA 2QZRA 1F6YA 3CGTA 5A95A 4LW7A 4POCA 3N25A 4CGTA 4R5EA 4H00A 2BWGA 5BWAA 1UD3A 4O16A 4D6IA 3PBVA 3OOQA 3HV9A 4QP0A 4JCLA 1Q8JA 2ZXQA 1MDRA 2A7PA 1V93A 3KP1A 4AWEA 1GKRA 2A5HA 4GYPA 3N04A 3FW6A 2E9MA 4HNTA 2WMHA 3PB0A 2W9MA 1KGXA 1HGWA 2Z27A 4HZ8A 3TN6A 2QCDB 2A79A 4L9YA 1LOSA 2FGBA 1M68A 2ZWYA 1BQCA 1ZZMA 2AQWA 1AVAA 4Q4MA 3W24A 4Z2IA 3G0XA 4BI5A 1X7IA 3FGCA 3WLSA 4FZIA 3KL5A 7PTDA 3SCWA 1EHAA 2MUCA 1YE6A 4P7QA 3IACA 1FBAA 4GI6A 3XINA 1DVJA 3GW0A 1P7TB 4R3UA 4Y6GA 1CCWB 4D9PA 5ECUA 2QV4A 4IHCA 1NU5A 2ZRXA 3ZVHB 1TREA 3WUBA 2QQ6A 1XIEA 4B15A 4Q7BA 3AHYA 5LNUA 4QS6A 3T81A 3S47A 1OJXA 1WZKA 3GG7A 1TRIA 4DI9A 3T8LA 1UWIA 1XPYA 1XYZA 2C8NA 5AC6A 5DANA 2VQUA 3QVQA 1KXTA 4A3HA 1JDCA 1EWDA 5I3KA 4I8DA 4OZOA 1PTDA 1ZHAA 1RCQA 3FAXA 3W7IA 4DWSA 4HU8A 1E9YB 3CLWA 2PC8A 5HULA 4GD0A 1EJWC 3W3OA 2V5JA 4YL2A 1E70M 1ODZA 3WUEA 1YPFA 2J6VA 1GVFA 1PYMA 1XLBA 1E4IA 3W1PA 1CWYA 2Y89A 1KM2A 3V16A 1J0HA 1PHQA 2XFWA 3L67A 1D8CA 3IGUA 4NAEA 1TELA 1LRTA 3HU7A 1NM9A 3ARSA 3ID7A 2EPMX 1LROA 3FYPA 3TP4A 1UWQA 1DWGM 3KL0A 2XFYA 2PD5A 1CGXA 1BFNA 1XLDA 4XBSA 2FFIA 4FNTA 1DHPA 4H2CA 1BG4A 2OCZA 5CPNA 1R6WA 3BCFA 2I14A 2ZX5A 2YYUA 3OBEA 4Q8PA 1JR1A 3R12A 4OBSA 4BCEA 2O9RA 7TIMA 4IPPA 2OELA 4D8ZA 3JRKA 4JR5A 5CQ1A 1NJJA 1OT1A 4JDYA 3DHUA 3BLOA 3G24A 4O57A 3ES8A 2EPHA 1I2OA 1B31A 2ZUNA 3T2PA 4AD3A 2AL2B 3LHVA 4K68A 3V4BA 4P7NA 4L9ZA 2NZLA 3WQ4A 3W00A 4JTGA 1TA3A 4AIUA 1Z9AA 3AQUA 1E9LA 3DX5A 2VZSA 5MKGA 4K39A 3VABA 1Z6KA 1NSJA 1WAWA 1FWWA 3GUWA 5ENLA 1FCBA 1X6LA 4GABA 2KZHA 1SYTA 1ALDA 4XUGA 1OC5A 2BOFX 4RNHA 2ZKMX 2PDJA 3IIVA 3WLTA 4LUIA 1J10A 4DUOA 1SR0A 4DM2A 5EY5A 1ONEA 2QEZA 3AIWA 5M03A 2PA6A 3SQMA 3EXRA 2AQVA 1Q4NX 1BTCA 2GYIA 4H19A 3AS3A 2ZXDA 3WDRA 4L1WA 1UUMA 1G94A 1U1UA 4PA8A 1W3KA 3R43A 2OYKA 3C0SA 4UQBA 4DNMA 3CYJA 1MEHA 1T8XA 3I6TA 3AROA 3WH8A 5JIPA 1V7YA 3CHCA 1R0MA 1KWKA 3BWWA 1KLZA 4NJGA 2IQ0A 3WMLA 1Q6DA 3B8IA 4PUKA 2B7PA 1A3HA 2PF8A 3LQLA 2DT1A 1TFVA 3TNBA 3TC6A 2CWXA 1KM5A 1PV8A 3KOXA 1XYMA 3VAVA 1O6IA 1TVNA 2DUAA 3PC0A 4A2RA 5DCEA 2J27A 3PWAA 4BS0A 5I3GA 5CJNA 3CH9A 2V5CA 4CNPA 4IMCA 5HWNA 1YPXA 3AOFA 4GIRA 3UU0A 5BXRA 4HCLA 2J9XA 4HMEA 2BY0A 4RDZA 4O1CA 1UP0A 1TPFA 1W1VA 3GVGA 2REQA 3HQNA 3UWUA 3W1XA 2QT3A 1HG3A 1FWDC 5HDRA 5I09A 4IL0A 2WAGA 3FKKA 1NDYA 2Z1VA 3IK2A 3SADA 2EPOA 3GH5A 2JGQA 4LY8A 5LGZA 3WNKA 2YBUA 3WLPA 3ABSA 4O54A 5EU9A 5GNZA 2CYGA 3SCNA 2XVNA 1U5HA 1ZNNA 1K8ZA 3WEMA 2WANA 3S9YA 5FKYA 3S83A 2YLLA 2J74A 3S42A 1GVQA 2YDSA 4ACZA 2GGGA 9XIMA 2R1LA 2HPIA 1E1EA 3AYRA 4X0VA 4GLEA 1KFBA 1TSIA 1W56A 4UR7A 4H8VA 1UUQA 3NO3A 3DFTA 4IH3A 3TK7A 1S5TA 1AJZA 3BGAA 3A4JA 3S5SA 1R9YA 3ABOA 3VM7A 1LLOA 3OLGA 1AMYA 2ON3A 5BXPA 2JKAA 3QYSA 1Z3NA 5E0FA 3K13A 2I16A 1FWSA 4UZSA 4DPPA 3CV1A 1DQXA 4FSAA 2Z26A 3W2KA 3RAOA 4LXFA 2EF9A 1CBGA 3V35A 1EWEA 4V1XA 4WJ8A 2YCIX 3S2CA 3R0UA 4XAYA 3KLLA 1AH3A 2AKZA 2NV2A 4DUVA 3P82A 4D2JA 3KDNA 1QOXA 2EPNA 3E0FA 1LBFA 4AISA 3DZ1A 1DORA 1KV5A 3TFXA 2E6YA 4LRSA 1KFJA 3TAKA 1W9UA 2GLKA 2FMOA 3DFNA 2VL4A 4UFLA 3GXIA 1YDOA 3NFUA 3PJTA 1WZLA 3H7UA 1TV7A 3RRXA 1VENA 3L0NA 4AX6A 1OG6A 4M56A 3CQIA 3OJGA 2X7WA 1HL2A 4N2YA 1XH2A 3A64A 5EFFA 2E1DA 4NYUA 3FDGA 1Q6GA 2OSXA 5I23A 4MWAE 2B31A 4M1BA 1FWCC 2WNZA 4NZJA 3B9AA 4HSHA 3S2NA 4G5DA 3MYOA 4DWDA 3K46A 1I4NA 1PE1A 4JNYA 4JZ5A 3G1FA 1XC6A 4MKSA 3QSTA 4MUZA 3LPOA 1J5TA 2P3EA 4XG1A 3A21A 3D46A 4IISA 5PTDA 1DL3A 1UKTA 1H41A 4PBFA 1IT0A 3HFTA 1K6AA 4LYRA 1V8EA 5CSUA 1OVDA 2WHLA 3AO0A 3MVTA 5DQPA 1OX5A 3FV9A 4IP7A 3BOFA 3MANA 3VE7A 1XL9A 1G4SA 3WLNA 2Y5EA 5DT5A 1P6CA 2E67A 4L56A 3S1WA 3PTDA 4X63A 4JTTA 2GFTA 4S38A 5A8OA 5K9XA 1C7TA 1XDMA 3IJIA 3T42A 2IMRA 3QC0A 3V5CA 2BB0A 1JF6A 4X61A 3K4WA 4IQEA 1JXJA 4AZCA 4DJFC 2YL8A 4LB4A 4YHEA 1JPIA 2XVKA 1UPMB 2UWFA 3BQ6A 3QHOA 2O55A 1VJZA 2GVEA 5BWFA 4IWWA 4QXIA 2HK0A 4ZO9A 3QR3A 4UCFA 3KVKA 3MUCA 2DORA 3UGVA 4QG9A 1JZ4A 2YDAA 3ONBA 4HA3A 6ALDA 3CV6A 3VDHA 1ZP4A 1GOIA 3PBMA 1VFLA 2NQJA 3VIGA 2QCDA 4M5PA 5TAOA 2VX4A 3ISIX 4GI8A 3RFAA 4QE1A 1R38A 1FWJC 1VRXA 1VFOA 1WV2A 4H9MA 1GOMA 5CC7A 1EJVC 3VGDA 3RM9A 1G67A 2V8ZA 3C2FA 2PTXA 3RUBL 3WF3A 1SJDA 1IWBA 3O6DA 3OGSA 1P7TA 3T0TA 1IZJA 4HU4A 4L4PA 5FIPA 4TQTA 2JQXA 4WX2A 1G01A 4Y90A 1XCFA 1W8GA 3ZVHA 2XFFA 3AIQA 2QW5A 4DPQA 3ITYA 3M47A 4JL2A 1IF2A 1AJ0A 2ZZ5A 2P8CA 1WKDA 1US0A 1W1YA 4W93A 1WXYA 3OEXA 1Q7QA 3L0GA 3UEQA 1PIIA 3PY2A 2J7EA 4AZBA 3VIMA 2W5FA 4CEUC 2F8QA 1AFSA 1BWVA 1IIGA 1UWRA 3BZGA 1QR7A 3AMDA 1E0TA 1E71M 5HA7A 3MHUA 4LT9A 3PZUA 3V18A 5EFDA 1VLIA 5D38A 1M9HA 3AWNA 4US5D 3NZQA 2ODOA 3KZSA 2NVAA 1ITUA 1KRMA 3ABXA 3N2TA 2V6AA 4MWAC 4GA8A 4ASTA 4QDPA 4MFDA 1OFDA 4IOTA 5AYYA 1PPIA 2NWSA 4UXDA 4H8UA 3BJTA 5DO8A 3LEPA 3RXZA 1F3TA 2OR2A 5HQEA 3KTCA 1V3LA 5IBXA 1QAPA 3OA5A 1XRTA 1FXPA 3CIXA 2PDUA 1DOSA 1K7XA 3TXVA 3SIMA 4XBJA 3LDVA 5F4WA 2HTMA 4ERAA 4GVHA 3S1UA 5IFPA 4XZBA 4KFPA 4WIWA 1ZU8A 3TX9A 4GFIA 3L5AA 1RVKA 2NT0A 5FESA 3GM8A 5FF7A 1TWDA 1NTHA 2OO0A 1M65A 3W2LA 3KBVA 2P88A 3GZAA 2D0FA 2PP0A 2F2KA 1XFCA 1XWYA 1IXNA 3C86A 4LAMA 4PC8A 2OLHA 1UWUA 3H2EA 3SW6A 1BYBA 2YA1A 2BASA 3JZEA 2DPEA 2GSJA 3EWDA 1NQKA 3UWQA 1X8FA 2ISVA 1R3YA 3S9ZA 3AALA 2VQTA 2AL2A 4W7WA 4LC8A 3CV7A 3W7GA 3MMUA 4CN1A 3LD5A 4N42A 3PWIA 3ITGA 2B7OA 3SN1A 4JBRA 1FP8A 1ZL1A 4LGXA 4GWEA 3RX3A 1UUOA 2PTWA 2DZSA 4DO7A 1PVNA 2GVLA 1W17A 1P1MA 4O4WA 5CXPA 4JN8A 1M7JA 4AD0A 2HRWA 3TOPA 4BQ2A 1NH6A 4US5A 3S1VA 3W01A 5I3JA 3V3WA 3CIVA 3LGGA 1YBQB 4LBRA 3VILA 1L0PA 3UXDA 2I57A 1EXBA 1ECEA 5M1TA 4DF0A 1XR2A 3ENLA 2WC7A 3OZYA 1MQRA 3QR1A 1JAKA 1VCGA 4GINA 3LCHA 3VKAA 2CZ5A 1C8XA 1Q7ZA 2DZUA 4XSMA 1KFLA 3NWRA 2DSZA 5AC8A 1CNVA 3A13A 1V6TA 5CZJA 4LCQA 5T9BG 3NQBA 5I78A 1RHCA 4AIBA 4GO9A 4PMVA 1YRRA 6REQB 1FA2A 4JIEA 4CNOA 1S5WA 4HJFA 1REQB 1J96A 2GVJA 4J2PA 1O68A 4DZAA 1E6PA 4H7VA 3HA1A 5JBDA 1XP3A 2ZRWA 1ZBWA 3UY7A 2P5NA 3WQ5A 3MW7A 4QIUA 2OSYA 5C9WA 1O12A 3FJ4A 1UJQA 3POCA 4N7QA 3IIOA 3GXDA 1SZGA 2F61A 3GHUA 1V03A 3TONA 3QM3A 5CC6A 5DBUA 3TOYA 5BMXA 2FYMA 1RV8A 2J78A 3H12A 3ZFHA 3OG2A 2ZVRA 1I1WA 2OQLA 4ML4A 4C6CA 2Y70A 5C71A 4LY4A 2P10A 1K03A 1XYLA 1GYNA 5EB8A 2GPTA 2RUSA 3ELFA 3GKAA 4E0CA 4JPGA 4QRNA 4QLJA 2FZNA 3QY8A 3LHWA 1MXDA 2C71A 4GJJA 1E51A 1MRAA 1GPFA 1WKEA 4GYFA 3PG9A 4FS9A 3MP4A 4CUCA 1NDZA 3CUHA 1EOKA 4W8BA 3LGDA 3K1GA 1BHGA 4HMDA 2DFAA 1NP0A 4XD6A 2C14A 1M6JA 3FN9A 1KXQA 3OBAA 1XLEA 1EQPA 2PLJA 4IIBA 3MVIA 2YBTA 1QI3A 1SMAA 4KWSA 4QEHA 1S5MA 2XWEA 1OFEA 1VPQA 3QTGA 3BJSA 3UWVA 1PYFA 4PH6A 3WJZA 1V79A 3FAWA 1XG4A 1GT8A 4CCZA 5B7YA 3RCYA 1R30A 4J40A 2ZWZA 2C13A 1RA0A 2GUBA 4K36A 4PTMA 3OTRA 1KR1A 1DXIA 1D7KA 1QWGA 4XAFA 3OZMA 5HWMA 1S2WA 2VGFA 1XYCA 4GVGA 2NLYA 4EP8C 3QZ6A 1ZBKA 4B5TA 1W3TA 1U83A 4GISA 1EA9C 2PWGA 4WY0F 4GO8A 4XO6A 2O7SA 5D09A 2IQDA 4H9ZA 5A94A 3TWBA 2NUXA 2E09A 4DJED 3UF9A 2RJGA 5E0KA 5LGXA 1J4EA 1EP2A 3I4KA 3KOFA 2VRKA 2WO5A 3ZLGA 1B3YA 2VXNA 2DW7A 4QTGA 1TWSA 1KD0A 4GE8A 1AG1O 5LNVA 4Q4PA 3BOXA 1DKWA 1R2RA 1UWTA 4IGMA 4LAZA 4MDOA 4O1FA 1Q6RA 1YHTA 4H4IA 2R14A 1DJYA 2VD9A 1E6RA 3NL6A 1FWAC 2YKKA 3ZVIA 1AL8A 3CM4A 2Y0FA 4MY9A 1GNXA 3GQYA 1F4AA 2ACRA 4P8VA 1YPIA 1UR0A 2WWDA 4XZHA 4FIQA 1ZLPA 1BVZA 1XBYA 2C19A 2A21A 4AQLA 1WKFA 4K37A 3DI0A 4RW3A 1FY6A 4ORIA 1RD6A 3AXXA 5M17A 3VIPA 4CCDA 3R58A 3ZQ9A 1TZZA 4DELA 5GNXA 2Z1WA 4F4RA 3GNRA 1M41A 4GX9A 3ME3A 1Q6LA 1UWAA 5FF4A 4P61A 3UA3A 1UR4A 3EOLA 3NZPA 5FJUA 4CQAA 1S2CA 2H90A 3BAKA 2D3NA 5BMWA 3BSMA 1OEPA 1EJXC 3KHJA 1L9WA 1UD5A 4PRWA 1W9XA 3DFSA 4QCFA 1VC4A 2G41A 4JTDA 4HK5A 3M0LA 3EYPA 2A85A 1DIKA 3R2GA 3T09A 2O92A 2DUZA 4RR4A 2OYMA 1TPUA 4Q8MA 1J8VA 3E2RA 1JCMP 4I9MA 1GYMA 4LTSA 4PBGA 1ZALA 2GJLA 2YL5A 2KAUC 4RE0A 4LEFA 4ZSTA 3CBWA 3I3DA 2ZX7A 3OW1A 3WFLA 5C9UA 4A3QA 4QG6A 5AHEA 3N2XA 1GOWA 3SQLA 3B4UA 5DFAA 4I6KA 4XISA 5T8GA 3ZR5A 3WDIA 3EWCA 3M07A 2OLAA 3GDTA 2I5QA 4XO7A 4QE4A 2OWXA 1TE1A 4IM4A 1IEXA 4HPHA 4ML9A 1UB3A 2WHMA 2V5KA 1QI2A 2DT0A 4DO5A 4DLMA 3CIWA 3VIHA 2XIOA 4XKYB 5IHRA 1OK4A 2PGFA 4QAIA 1KC7A 1W5PA 1S46A 2V67A 3HB9A 1ISZA 1P43A 5T9CE 1CB7B 2GSHA 3GD6A 2WMKA 1YADA 4KERA 1HN1A 2QMKA 1YKWA 3ZO9A 1OABA 5XIMA 3EGJA 3KVMA 4WZHA 2ONEA 2ZRVA 3DYPA 4AWTA 3QEZA 2E9BA 3EKLA 2ZZ3A 3O3RA 1XIJA 2D2OA 1FH9A 4FNSA 5E09A 2QXWA 1Q4WA 2OT1A 1EP3A 4PZVA 2VOMA 4DB7A 4XK2A 4MAZA 4FPSA 1TR9A 5K4XA 2J66A 1H4PA 3GYEA 4XD3A 5BOOA 1OC6A 4M0XA 3VDGA 4D1JA 4XB3A 5EMLA 1FRBA 1A5MC 1E9ZB 1RP9A 3V0UA 2PTYA 1TX0A 1JGMA 3W38A 1WX0A 1POJA 5LHFA 4Y9PA 5SWUA 2XVPA 5K2ZA 4LVBA 1F6KA 4JTJA 2IW0A 5MF5A 1EL3A 4XSLA 4K8EA 1L8PA 4I5UA 4LQ1A 4R7JA 4O1DA 2CLOA 2OOFA 3H6OA 1R46A 3SCPA 2OG9A 2FMNA 5AOUA 4LALA 1IGSA 3QFWA 1Y5VA 3M0ZA 4LCRA 3W7PA 1TTQA 2Q8ZA 4GJ1A 2VGIA 3GTXA 2G3MA 1RLDA 1JDAA 5A8GA 5E9XA 1MXGA 2R91A 2Y7EA 1VB9A 2ATSA 5AYBA 2NQ5A 1LF1A 3I3EA 2PWDA 4Z2LA 5AKQA 3U2ZA 4U5IA 1V3KA 2XN1A 4GZIA 4XVEA 2E0PA 4LX4A 4AD2A 1K02A 4LJ3A 1PS9A 5M2FX 5CZKA 3T0BA 2VEIA 1UKSA 2XTKA 3NQ6A 3N2OA 1H61A 3MT1A 4A21A 4GGBA 5HATA 2CKSA 2X8RA 4JTRA 2YZRA 3PP7A 3MV01 4IMDA 1EEXA 2WSKA 4JD4A 3C8NA 5HPCA 1XRVA 3WLIA 2X1UA 4NJIA 3NQGA 3S2JA 4MSSA 1GQJA 4R7OA 3FSTA 2FVLA 3OLEA 2H6RA 3OU8A 3LV6A 1YBQA 2WVVB 3W2JA 5LA1A 2GUUA 1JCJA 3NSNA 1JQVA 4CNTA 4C6PA 3GXMA 2D0HA 4JNZA 2CZFA 1XIMA 1B4EA 3CB3A 4DLFA 3ICJA 6PTDA 3FA5A 4AEEA 1GOKA 4GQQA 4RV3A 5RUBA 3G1AA 3EDJA 2G3FA 1LOQA 4F3HA 6REQA 4HZ7A 4EPEC 4C6LA 1REQA 5FI8A 1ZAHA 3P8JA 2NW0A 1EUAA 1FH7A 4GXPA 1XIFA 4FLSA 2E5DA 2W4XA 3WUFA 2OQYA 5HNTA 1N2VA 2VYOA 5G2IA 2QULA 3L7RA 5CG7A 3CXOA 3E0LA 1PEZA 4MGGA 4W84A 1E6ZA 1DIOA 5HUPA 8XIAA 2BGQA 4UR9A 1RUSA 4Y9OA 4JFVA 1V0KA 4B2DA 4IP4A 1IV8A 1VFFA 2XSXA 3NQEA 2ZBTA 4UTTC 2WC4A 3VCRA 1ZBCA 4AC1X 1XG3A 4W86A 1CX9A 3EA2A 1E5JA 2YB4A 1WQ5A 2PAJA 2E6AA 1GEHA 2YLAA 2TYSA 3PSVA 3WK0A 3B06A 2A1YA 1ICQA 5DMLA 5I2UA 4F0MA 1HO4A 2I17A 4NXSA 1ME7A 4O12A 2DW6A 1JJKA 4WD0A 1RY0A 3BAWA 3GIPA 3B40A 1OFBA 4AZIA 4PMJA 3Q45A 2EO7A 4NT0A 4D72A 3H22A 3LCWA 1NAL1 1VEMA 1ZAJA 3UJFA 4V2XA 3K8LA 1B3WA 4ADSA 2CPUA 5IM51 3A4AA 2AGKA 1VJSA 1KR0A 4MB5A 5DXXA 4P7OA 4R33A 4AF0B 4GCXA 4GKTA 1H51A 2DY3A 3M6YA 3MI2A 5GQBA 4CN4A 1U33A 2ACQA 1WO2A 2NWRA 3N4AA 4AZ5A 2V38A 3SSJA 1E55A 3UFYA 2JF6A 2EHHA 1GQIA 4XUYA 2PGWA 4X9YA 4NRRA 5HJXA 2I5IA 3V7PA 2JIEA 1X38A 3S5NA 4ERGA 4HSNA 5IDIA 2XIQA 4RCXA 3NQ8A 4REQB 1THFD 3PPHA 5ABEA 4ACYA 3NA8A 3P8IA 2PS2A 3SY5A 3TJLA 3TXZA 4I7WA 3N4FA 3UR8A 2ZXBA 4FO4A 4WKFA 5CSSA 3QXBA 1J5SA 3SY1A 4UMAA 2ADAA 4GMEA 3NZRA 3O6CA 5ECVA 1BKSA 2D3LA 5FEWA 3EXTA 3KL3A 1K8CA 1ZRQA 5FF2A 3CZLA 4CD7A 4HOZA 3RLHA 3NVTA 2PODA 5BOEA 4BI6A 3PNZA 4M51A 4ZBCA 4E4PA 2CFFA 5I06A 2EG7A 3TIMA 3WEOA 2GDQA 4NY2A 2DVXA 3WFZA 3OHIA 4DO4A 1JZ6A 1LTDA 2GGIA 2BTMA 3OLIA 2H8XA 1GPWA 4GUFA 4LS2A 2Y63A 4J3ZA 6XIAA 3F4WA 4DYJA 4W8LA 4IIFA 4H41A 1FKXA 3B0YA 3MBFA 1XSKA 3AUOA 3C2VA 2IXVA 4RZBA 3H2CA 5AC4A 3B03A 2J8FA 2VGGA 3QQWA 1G6CA 4CNNA 3PZNA 4YNGA 3WBXA 3MUAA 1KWGA 3JU2A 4FOUA 3BXWA 4ADTA 1NOFA 5HR7A 1J93A 1JYXA 3N3TA 3DOPA 2PB1A 3FJLA 2BDQA 3U7VA 5A8NA 3CWNA 4M29A 1Q66A 1JPHA 4RKAA 3M16A 1ZGDA 2B7QA 1T0OA 1TIMA 4AD4A 3NQ2A 3PBUA 4Q4KA 4ZENA 2WMGA 4UTHA 3PTMA 4KRTA 2NQLA 3SCTA 4JKLA 4N02A 2RDWA 1QATA 3U4FA 1A53A 3K8MA 1CXKA 1R7OA 4G6CA 5KZDA 3OBKA 1CECA 3VD3A 4XTIA 3UZJA 2JEPA 2ZZ7A 3ARQA 5CGQA 5FJRA 2XIJA 3AHVA 4AY8A 2X30A 3U9IA 4H3DA 3F5KA 4ZXLA 3S8HA 1W9BM 1IYXA 3CQ0A 1VFUA 2D0GA 4EF8A 1KCKA 3NAVA 2F6XA 5LIKX 3LOTA 5DBTA 2XH4A 3PWGA 4XKYA 2HEJA 3O15A 1GG1A 5HNRA 1X6UA 5AHLA 4OV9A 3W6MA 1XXXA 3AU2A 1KGWA 4UMBA 1I8JA 4O10A 3AS0A 2Y8KA 4AZGA 4B9ZA 2OT0A 3GNNA 4TOQA 4OGZA 3CLMA 1QNVA 1QPKA 4IJBA 2O7QA 4KKXA 2G97A 4ZB5A 3MJYA 3UA4A 2QDDA 1NWSA 4RV8A 4DJFD 4KWWA 2WSRA 1IZKA 1US3A 4C1LA 3N73A 3O8AA 1XD0A 2BY1A 3G1SA 2OGJA 3H4GA 4F66A 1W5NA 4S3DA 3TE9A 1O4UA 3WIJA 1W9PA 1H7PA 1KLYA 4DNHA 4A8NA 5D9MA 4LCSA 3WMBA 4XWUA 1XDJA 2OZ8A 2QDHA 2JGYA 3G2GA 4WDWA 3WELA 2PDMA 1D2KA 2R82A 4RX0A 3PNUA 1MEWA 4TTUA 1TX2A 2HPMA 5E0CA 3WQWA 2XIIA 1XCXA 4CU8A 4IGSA 4AYSA 2VFIA 3EPMA 4MF4A 4L1XA 4NZ1A 4R85A 3AIEA 3IJ8A 4UTWA 4M24A 1CLXA 3T6CA 1W31A 2V5BA 4QISA 3M0JA 3EBVA 4H6EA 1WB0A 3HPAA 4RDWA 3CQKA 1HKWA 1R3RA 1WZMA 1X8CA 1KBKA 3R0DA 3QV6A 1DTNA 1A5CA 4GZEA 4J2MA 1F6PA 5GJMA 1QNPA 2MANA 4E4FA 2VUNA 5FAJA 3SBFA 4Q8OA 1VCFA 1US2A 3S46A 5LZLA 3NVDA 2ISDA 3SO7A 1VRDA 1GUVA 3PZQA 3HBLA 4GQGA 1D9EA 4S3KA 3VOCA 5HJYA 4A8IA 3NO1A 3ZZ1A 1UROA 3TQKA 4QJ4B 3GHRA 5KZ6A 1FX6A 1HP4A 3M7SA 4XBKA 2PDQA 4I9JA 1PTAA 2WVVA 3SURA 1NWRA 1GQKA 2B81A 1GONA 3VC5A 5HMDA 1LOLA 3KAOA 3USBA 1ECQA 4F2BA 1YQ2A 2CLHA 1WXZA 2XDFA 3F7JA 5DT7A 1PAMA 4U28A 2A3HA 3DC0A 2V69A 4MNKA 2PP3A 2Z29A 3HV8A 4ZFMA 4HCDA 3LHTA 1UH4A 3EEGA 3LB0A 1XLKA 5FSEC 4L65A 1NOUA 2TPSA 2VC9A 3G1HA 4HBKA 3WD3A 4ECLA 3HQOA 4DBUA 3GC5A 1DPMA 4LANA 4J3XA 2HMCA 5CPQA 3D5HA 4YLWA 1ZSXA 2BOEX 3TC7A 2EJ1A 2QVHA 2WV8A 2XIBA 1VFSA 3DKJA 3LXAA 2X1SA 2FB3A 2Y8VA 1GKQA 1QPOA 3RLVA 3C0LA 1OCBA 2PZNA 4OV4A 4WGXA 4YJ5A 3VTRA 4FF7A 1RSCA 1H50A 4C6BA 3CHEA 2J88A 4ZTXA 3MSGA 1LWHA 4HT3A 2ZA3A 3CHFA 1KTCA 3LCFA 5MHBA 4O53A 1L8NA 3NJ3A 4K38A 1WUFA 3UG8A 1A5AA 1EOMA 4ZQCA 4W85A 1PZ2A 3SY8A 1P0NA 4FX8A 2QV5A 3AXIA 2GVYA 4K3ZA 5AZ1A 1W54A 3BSHA 1DJNA 2C91A 4A8LA 4PCNA 3LI0A 4B90A 4IMFA 1W5MA 3BAXA 2FGZA 3O06A 3S4TA 2BOGX 5BNKA 3H54A 4HB7A 1WBHA 2NQ9A 1QOPA 4MZYA 1OT2A 3TTQA 2E6FA 3ZLFA 4R9OA 3BARA 3ARXA 1XV8A 2XZ7A 3DG6A 3QTPA 2VFDA 4FOKA 2YXOA 1XRSA 3ZMRA 5C9ZA 3HOJA 1R3VA 2HVOA 3P0XA 3U3HA 1QHPA 4JN6A 4GI9A 2YCLB 1Q2RA 3DKLA 1EBHA 1GHSA 2OO6A 3OA3A 1HJVA 1JYWA 3LM7A 2VR5A 3WSUA 1UMLA 4MB3A 3I10A 1JL8A 3II1A 4AF0A 4RPPA 5AHIA 2QYGA 1W3LA 3BCJA 4EX4A 5XIAA 4FR6A 1Y65A 4CKQA 2F38A 3NO5A 5C54A 3QGAC 1W2VA 2QDEA 3G8RA 1IE7C 4IMAA 4KFOA 7A3HA 1HVQA 2VEPA 1JCXA 2HSAA 2R1NA 4EE9A 4WJEA 3M0HA 3SRDA 1WUEA 5LA0A 1KTBA 1WDDA 4MY8A 4HU0A 1S1RA 4REQA 3ZXWA 4JXCA 3AZSA 3B0XA 3TFCA 3AMLA 2CZDA 3MKCA 4PSRA 9CGTA 2G50A 1TJRA 3EMCA 2UY2A 3VNDA 5JH1A 2GVGA 1FWFC 3LQGA 2D2JA 2DJLA 1UZ4A 4HNNA 3ARUA 5A69A 1R85A 1G9HA 5EA9A 3TTEA 1ZENA 3BE7A 3QPEA 1H1NA 1KM3A 4L61A 4Y9AA 4LS0A 4HHLA 7CGTA 1CLVA 4EWJA 2FHFA 2PDLA 1VIZA 3GW3A 3GX9A 4XD5A 3I65A 1BKHA 1TZ9A 1XICA 2BNJA 2VDIA 4LNCA 3SDOA 4NHVA 3ARWA 3LTSA 1YW1A 4LOCA 4M81A 3IVTA 4MUPA 3W1AA 1FOBA 3N6HA 3GFXA 2WNQA 3WD2A 4HK7A 3WK1A 5AYXA 4HN4A 2DT2A 4W7VA 1LWIA 3HMJG 3S6DA 1TRDA 3R1ZA 5I79A 3NXFA 3RMEA 3WBWA 2XWDA 4TX9A 4XZIA 3MB9A 3AXMA 4BHYA 1BAGA 1HW6A 3UQNA 1F3XA 4UB9A 1Z69A 3OYXA 3CS2A 3DU0A 4J35A 4GIYA 3DCPA 4XZWA 3QMTA 3G1DA 1OCJA 1LQ0A 5JUVA 5HANA 2VT0A 2WZHA 3E02A 4L7ZA 3W75A 2E25A 4PMOA 2JK2A 3WMCA 1JZ2A 3C2YA 3W7NA 1PO9A 2YPIA 4O17A 4PMDA 1NF0A 3B9EA 5FEZA 1GJWA 3VGGA 2IXUA 3KCOA 4H9UA 1DBTA 4BQ4A 2YJQA 3ZSSA 2FTYA 3KVLA 5DRCA 3IAPA 3E0IA 2BY3A 1G4TA 4LAKA 3H55A 4G1NA 1LWJA 2C7FA 4DXKA 2WSQA 1QW9A 4MAVA 3N2CA 5TD4A 2V3DA 3KXQA 1G69A 5LNSA 1DJGA 4R53A 3F2BA 2VFEA 3GU9A 4CD8A 1S2TA 2QUMA 4PRTA 4QX4A 2ACSA 1JNEA 4H9VA 1HX0A 1W3NA 1SUXA 3KOYA 1C93A 1W1B1 1TCDA 1H5YA 1OK6A 4C6QA 5AVNA 5HBFA 2Y7GA 4MDPA 1GZGA 3IUDA 3HJEA 2PLMA 4GVFA 3WH6A 3N2MA 4ZEPA 1BSIA 1Q5MA 5BROA 1UG6A 5U7SA 5A3HA 2ZICA 3B04A 1F76A 2ABBA 2EGZA 3AMCA 3Q58A 3VYLA 4ZOAA 4IX2A 4LV9A 1V0NA 1TPVA 3QGVA 1FP9A 3F2CA 4CU6A 1JFXA 4EVZA 1OFPA 4ATDA 1G4EA 1AQHA 1V02A 1Z42A 1JI1A 3GG8A 4OKDA 5KZMA 4OVXA 2J24A 5I00A 3VINA 1R87A 1LBMA 3R25A 3VVGA 3GH4A 3LV5A 1MI3A 1TPDA 8XIMA 3ATZA 3JR2A 2AL1A 4GQ0A 3TQVA 1NDWA 3MMDA 1KCLA 4DZHA 4LBSA 4GY7A 1DJXA 1VZWA 3HM7A 3E38A 4S2CA 3TZFA 3GY1A 2FHBA 4PULA 2BX7A 2EJAA 1TWIA 5HQMA 4KETA 1JEZA 3PULA 1QMLA 1OFOA 4EIVA 4JTLA 4L64A 3ITCA 2RHGA 1P0DA 4NF7A 3MC5A 2AAMA 1QPRA 5KITA 4DY1A 4UFMA 1E15A 3FK4A 2ZUMA 2R94A 2Z6IA 2WW5A 2R9RA 3LU2A 4TIMA 4XD4A 1Z44A 3R11A 4HIBA 5AYIA 3V36A 5C2XA 3ERPA 1HNYA 4NP7A 1B1YA 1LLWA 4IFKB 4GIAA 9XIAA 2BY2A 3KRUA 1EF3A 4MOZA 3VNIA 4O19A 1V6WA 2GQ3A 5CJMA 3GC2A 3Q4DA 4AHOA 5D2VA 1JYVA 2FJUB 4AVNA 1V3IA 3AS2A 2Y61A 2PDPA 2MNRA 3CWHA 1Z8AA 1A49A 5GJNA 5BCAA 2PC4A 4JYFA 3TEVA 3SUWA 3NCOA 1EFZA 3DYMA 3PJUA 1W9DM 4WR3A 5U4NA 3PZMA 1OADA 3GC4A 2QPXA 3W7OA 4KRUA 3NXLA 3RIKA 3HF3A 5C55A 2O0TA 1FDJA 1KM1A 4JQ3A 1A0DA 1E4LA 3WUGA 3W9ZA 1RH9A 3FJNA 4O0KA 3TW6A 4M19A 1L6SA 1LM1A 4JHOA 2AAAA 1FFRA 4YCPA 2QLYA 3UCDA 4AWSA 3K30A 1RVGA 4DYKA 4QHRA 2QUNA 1ONXA 3CAWA 4HK6A 3SN4A 3VMPA 2XUCA 5F1UA 2RAGA 5BYWA 3O6YX 3O6AA 3CTTA 2C6QA 3MMTA 4E4UA 4EAYA 4C6MA 2EQDA 3L5MA 2YA0A 4IXHA 4BQ3A 3ZIZA 1T96A 4TTGA 5BRQA 3W83A 3D3AA 5H8MA 1B30A 1BF2A 2OOGA 3UZ5A 1FWNA 2L5HA 1JYNA 4AC7C 2X1RA 4XIMA 3W2MA 1OFAA 3BGGA 3UT0A 2OPJA 1UR9A 4P2VA 2W63A