4UIOA

Structure of the salmonella typhi type i dehydroquinase covalently inhibited by a 3-dehydroquinic acid derivative
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
250
Chain Sequence
TVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Chemical Modification of a Dehydratase Enzyme Involved in Bacterial Virulence by an Ammonium Derivative: Evidence of its Active Site Covalent Adduct.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 94
structure length 250
sequence length 250
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uioA00
1IXQA 3F03K 1FCBA 5AYZA 3A9IA 4IMEA 1KLZA 3BO9A 4ZQRA 2VFGA 3E96A 1A5SA 1Q6LA 4LVDA 4C1KA 5BRBA 4ADSA 5FF7A 3YPIA 3UWWA 1KM3A 1JCJA 3DGRA 2QCEA 3E9AA 5F2GA 1OFAA 2QCDB 5EKYA 2BWGA 3NG3A 1G67A 2Z2UA 3G8RA 4FXSA 3SGUA 1AW1A 4UFLA 5CZJA 4JYEA 2A7PA 3RF9A 1W5MA 3USBA 2ZZ5A 1B4EA 3HPZA 2O7QA 3DBPA 4JYFA 3UZ5A 5AYYA 2DZVA 3MHFA 4FIRA 1SO5A 4IGHA 4JNMA 1GVOA 1T8XA 4QJ1A 3ABQA 2NUXA 1TQJA 1VPXA 2EAWA 3M9YA 3TU9A 2EF9A 3TIMA 4CQ8A 4ZQOA 1XXXA 2VXNA 3BW2A 1O5XA 3W1UA 2X30A 1SW0A 1GVSA 2P10A 2NXIA 3CC1A 3LLFA 3MI2A 1TMHA 1SZEA 5KMYA 4IMFA 1B3OA 2ATMA 2ZZ7A 3B0PA 2QCMA 5DBTA 4TIMA 2Y70A 4JX4A 4N6EA 3BVJA 3FKKA 3IVUA 1KFBA 1QPNA 3G1XA 3L0NA 4JTSA 2Y6ZA 4LV4A 1VS1A 4O11A 4M6PA 5DY3A 1KV5A 4PEKA 3TMQA 5FF2A 3G1HA 1DJNA 3O05A 3TA6A 4XTIA 1IF2A 4NJGA 1TPB1 2DZTA 4UFHA 5LNVA 5E0KA 1DOSA 1W5PA 4FO4A 1Y0EA 3HIJA 1KBJA 1KM2A 3N73A 3MI3A 4UMAA 2J9XA 2ISVA 1K7EA 1TSIA 3PC0A 1UBSA 1UASA 1E51A 2B7OA 5CZTA 3KOFA 3N9RA 2Q3RA 3EX3A 2YXGA 2JKPA 3HMJG 3W7GA 3GK0A 4MY9A 4ZVJA 2G95A 3L5MA 3S1VA 4OHQA 4WXYA 4A21A 3UXAA 1SO6A 1KV8A 4NZJA 1VGAA 4LOCA 1MEHA 5G5IA 3RMJA 3W2NA 2RFGA 4UTMA 1DQWA 3PB2A 3G1AA 1GWJA 2V5BA 4GUFA 3IVSA 3W3OA 1WOAA 3P8IA 2GJLA 3DFTA 2ZRUA 1XC4A 4MJZA 1O94A 4HSOA 3M5XA 1VLIA 1ZNNA 3CLMA 4N02A 1WBJA 4FNTA 4R7JA 4O53A 5TBOA 1PL9A 3GAKA 1W54A 3F4WA 4AXKA 2FDSA 1LM1A 2J24A 3PUOA 3LBMA 3LV5A 1FCUA 3SFKA 3M43A 1TPFA 5F4XA 4PL1A 3RK8A 2QUVA 3LXCA 4JY8A 3NM1A 4R53A 4I7VA 2FIQA 2CZEA 4JDYA 1L6YA 1D9EA 1QOQA 2Y88A 5U7SA 3TDFA 3LCLA 1LOQA 3QM3A 4HNTA 1KTNA 3SI9A 3GLCA 3EKZA 1BWKA 1LCOA 4DF2A 1LRQA 1RQEA 4A29A 4HIBA 2XFWA 3STCA 1Q6QA 5DLCA 3C61A 4A2RA 1GZGA 1TO3A 4UC5A 4RK8A 3VE9A 1U5JA 2WNNA 2ZRYA 1P5BA 2R14A 3TSDA 3A5VA 3BK0A 4K7YA 2E6FA 5KZMA 5HWNA 2ZRZA 1DORA 2WNZA 3WK3A 3W2LA 3ZS4A 3W7HA 1AG1O 1VYPX 1NF0A 4GXMA 3AJXA 1JCMP 4N6FA 2HSAA 2XN2A 3R12A 1QPQA 2OT1A 4JTGA 1DJQA 4Z1DA 1VHNA 2VFIA 3W87A 4WD0A 3LERA 4UTWC 1B4KA 2QJGA 4L4MA 3EWYA 4KWWA 3W72A 3NZ1A 1G69A 1XBXA 4O1CA 2C13A 4I7WA 3KHJA 3PM6A 3W2JA 2B0MA 4Q32A 3LHYA 3MW7A 4LUJA 1YXCA 5J5RA 1SZNA 3LTPA 4QITA 4W9TA 2HS6A 4LVGA 1ALDA 3TW7A 2BLEA 3S42A 1M7OA 5LGXA 3UYCA 1TRDA 1SZFA 4UFMA 3TJXA 1EA0A 4D2JA 3M5YA 3EXRA 1ADOA 3P82A 1UUOA 4FNPA 1UJPA 1Z48A 5HUPA 2Y7EA 1N55A 4JTLA 4FNRA 4Q33A 2ISSA 5KZEA 2E6AA 2JK2A 3IV3A 4OV9A 3GXTA 4KFOA 3G1DA 4LVBA 3M41A 4HNVA 1X1ZA 3LLDA 1YADA 1LDCA 3PBWA 3SR7A 3HO8A 2CU0A 4HHPA 2QDHA 1TV7A 2ZZ4A 1LRTA 4O12A 3C2OA 4AF0A 1TPUA 3CTLA 2VEIA 2ZTJA 3KAOA 3UQNA 1SUXA 4IMCA 1MEIA 3FYOA 4XBKA 5AYXA 2Z6JA 5D09A 5BW6A 4WOZA 3W1RA 4JGDA 2C1HA 3P5ZA 3TQKA 1W31A 3UPBA 3LBCA 4UNKA 2ZTKA 4ADTA 1DQXA 2V81A 4DELA 1NAL1 1PV8A 2WNQA 5DBUA 1GTHA 5HR7A 2FPYA 1GOXA 1R46A 1RV8A 4O19A 1RQBA 2C15A 2UV8G 2QF7A 5F1UA 4JD4A 3W7KA 2VC6A 1AW5A 3IIVA 4AF0B 1S3HA 3QPZA 1TPH1 4UCGA 3H55A 3RU6A 2WV8A 2BZNA 3NQFA 4LW7A 5F4SA 3FS2A 4ICNA 5HMSA 1SO4A 3W76A 4NJHA 4HT3A 2ZZ3A 1R2TA 4PCFA 3W7NA 1M7PA 3HPSA 3G18A 2HTMA 4JTKA 3UNDA 4FX6M 3IEBA 1G4TA 3LCHA 5F4WA 4FB7A 2WQPA 2CLEA 1P1XA 1QOPA 1P4CA 2W6RA 5LZLA 2NX9A 4CNPA 5CSRA 3C6CA 3KVLA 1XBZA 4DPPA 4WQ6A 2NUYA 4XKYA 1GG1A 2DU2A 1YTKA 2I9EA 5MHBA 4S2BA 1GEQA 1YDOA 1KFJA 2DZUA 4K8EA 1F2JA 1QR7A 1NFBA 3EWUA 4O10A 1F7BA 3A21A 4O0KA 1BWLA 5D33A 5HJLA 2CW6A 3LRKA 4BI5A 4AB4A 1I2PA 3W7RA 3EX1A 4IXHA 2W79A 3G3DA 3PSVA 1HTIA 4LVAA 5A8GA 4JIQA 3P80A 3E02A 2H8XA 3T55A 1L9WA 1QWGA 4JDBA 4KFNA 4POCA 3ZR4A 1VC4A 1ICQA 1YTDA 4O16A 2DJXA 4ONVA 1IIHA 4Y96A 3M7WA 4QSHA 4LUIA 5AC8A 4XKYB 1GVRA 3LHTA 1TREA 2C19A 3GR7A 2ZZ6A 2DORA 4EOUA 4LT9A 4GBUA 1FBAA 2QCGA 1TJPA 3HGSA 1FWWA 4MYAA 1VCFA 2ZA3A 4JIPA 3EB2A 4N4QA 4NNAA 2NWRA 1PHWA 3QYQA 3QMSA 4UTIA 3TUUA 1XUUA 4YL2A 2VEMA 3VCRA 1ML1A 3S8HA 5HWJA 4NU7A 1KFCA 3QSRA 3TQVA 3CT7A 4O52A 3H53A 3P61A 2R8WA 1L2UA 4MZ1A 5C2XA 4JYDA 3QC3A 1ZENA 4M19A 3TXVA 1M5WA 2AQWA 4ZL1A 4K6AA 4MUZA 2HS8A 3QQ0A 3OVPA 5K9XA 4LC6A 3SY5A 4WOQA 4XWUA 4LNYA 1EIXA 2C0AA 3Q58A 3O6CA 3TQ0A 5LGZA 4Z0SA 3B04A 3G24A 1SSGA 5D37A 2WJZA 1LLWA 3UY8A 1G4EA 4JTTA 1EWEA 1VR6A 1OHLA 1WV2A 2A5HA 2GPTA 4BWLA 2QDGA 4QAIA 3A24A 4MY8A 1C9DA 3BG3A 3NQ7A 2X1TA 2V2CA 4NNBA 3G22A 3SZ8A 4IXXA 2GQ9A 3NGJA 3BW3A 3DI0A 1RVGA 4IX0A 4U4MA 3UZJA 3DKLA 5IBXA 1KFLA 3QPYA 3B03A 4CCCA 1O5KA 4HKPA 1OVDA 4E2BA 3FYPA 2TRSA 1V5XA 4FNQA 2V82A 2HMCA 3O6DA 4WY0F 4A3UA 1FUYA 4NZFA 2ZRXA 3LTYA 1N8FA 3W88A 1SU5A 5TQLA 5K4XA 5U4NA 2H90A 6TIMA 2Y7GA 5I3GA 2YZRA 3GAYA 4M6VA 3PSWA 3TH6A 2ZBTA 4TR9A 4JTHA 3M6YA 4H4IA 3W70A 4UNLA 4WY0A 3M1ZA 3P8JA 1FCVA 4BFAA 3LI1A 3NM3A 5HINA 3P67A 3U8GA 3T78A 1QAPA 1XDMA 3HF3A 1GYNA 2A7RA 4JX5A 2C6QA 5SWUA 1W37A 1VHCA 1D3GA 2OMAA 3U6WA 2J27A 5J5DA 2ZCGA 5FI8A 3CB8A 5CKSA 1T99A 4OE7A 4WX2A 3ATZA 1GVQA 2TYSA 1RQHA 3PF3A 2Y7DA 1EX5A 4WY0B 2VFEA 3G3MA 3PWAA 1I8JA 1WXJA 4R33A 1MEWA 4HNUA 3JS3A 4JN6A 1J4EA 1H1ZA 1SSDA 3NQ8A 3WK0A 2R94A 2ZQ0A 3KVKA 1A5CA 1H1YA 5KSWA 2NUWA 3TROA 4OU1A 5EPDA 3P81A 4GUIA 3GDKA 1F5ZA 3W7MA 3TMLA 4NJIA 1P0KA 2QKFA 2VELA 3CEPA 3W2MA 2E68A 3S5YA 1HL2A 1QFEA 1WA3A 4FNUA 5H91A 1WOBA 5CZ0A 4K37A 3TX9A 4X9SA 1VLWA 2Q8ZA 1QDSA 4AWSA 1F6KA 3W1AA 1HO4A 2QAFA 1IXPA 1A5BA 4Z1BA 1Z42A 4H3DA 1LYXA 2FQIA 4O4VA 3L21A 1QMLA 3CEUA 3G1VA 5FF4A 1G4SA 3O1NA 4DQWA 1GG0A 3L65A 3EWZA 4AVFA 1LLZA 5KTLA 4UFKA 3RLVA 3O16A 5D04C 4M5PA 3TE9A 3ABSA 5FEWA 4OQVA 3G0XA 4O15A 3LCXA 2FFCA 2X16A 5E93A 3NPWA 4O4WA 4ZQPA 3PG9A 2PURA 4X2RA 4LC8A 4P2VA 2GQ8A 4JTJA 1GJPA 1FWRA 3UWYA 4IMDA 4HSNA 4GNJA 3E0IA 4CNOA 3HGOA 1I2RA 4BR1A 2PRMA 5AHIA 3BARA 1YTEA 3CWOX 1F74A 4GE8A 3LHUA 1VZWA 1R2RA 3W1QA 4NUWA 1N7KA 4O1AA 2VFDA 3B05A 1JR1A 4KWVA 4ZQCA 3ZFHA 3E12A 1PE1A 3DFOA 4DXVA 5D32A 2A21A 3L5LA 3MMTA 5AC6A 4IUOA 4S2CA 3IIZA 4ORIA 2V2DA 3NQVA 4X3ZA 4FXRA 4FX8A 5L9FA 4K8HA 1JJKA 1X6UA 2GQAA 3G1YA 4LY8A 4WUIA 1HO1A 3W85A 2I1OA 1CW2A 1AL7A 2W0UA 3LV6A 4OBTA 4PTNA 3TFXA 2RH9A 1LP6A 4GRSA 1YPIA 4Z1CA 2AGKA 1V7YA 5I3JA 4TX9A 3NDOA 3MI6A 1JVNA 2F7FA 2NLIA 3L2IA 1ZAHA 4YLWA 5FEZA 2YYTA 2A7NA 3C2FA 4LS2A 3W7QA 4G1KA 3FOKA 2OT0A 3EWWA 2QCHA 3L0GA 3P62A 1QO5A 4MJMA 2CZ5A 3R8RA 2A0NA 3EX2A 4MVAA 4O1BA 2YFNA 4JTFA 3W7JA 3GR8A 3LRMA 4NJKA 3TV8A 1AL8A 1LRNA 3FLUA 1EB3A 4P61A 1G6CA 3CHVA 1JULA 3NPVA 3NQDA 4QM1A 4X22A 1I45A 3NXFA 3R2GA 2Q3OA 2WSRA 4CCDA 5AHMA 3DHFA 4YCPA 1PS9A 2GUUA 4O57A 2B4GA 2ATSA 3S1UA 5C5YA 1LOLA 2E6DA 3JRKA 4TMCA 3MHGA 4N9CA 5AHLA 2X1SA 3W74A 1ZFJA 3NO5A 1LORA 2Y85A 3TXZA 2X1RA 5AFDA 5AHFA 3SJ3A 5CSSA 3W83A 5LHFA 4YCOA 1XI3A 4PH6A 2NXHA 2ZZ2A 4UIOA 1YPFA 1JCLA 3G1SA 2J6XA 3A23A 3I7SA 4RJEA 1FWNA 5HNRA 1K7FA 5G1YA 3GNNA 1H7PA 5AOUA 1R47A 3SW6A 1W5OA 3W22A 5EYWA 3BGGA 3EWBX 5BMWA 4AHOA 2OJPA 5L6UA 1SW7A 2ABBA 4O50A 3S0CA 4N9EA 1P0NA 3VI2A 2VKZG 3QH2A 2FB3A 3QW4B 2YGYA 4FHAA 2E5CA 1OFQA 1JQXA 4GFSA 3MJYA 1R2SA 4LV9A 2RDTA 4XQ6A 3NNTA 1GPWA 1QPRA 1PIIA 3QEZA 4PFMA 3NQCA 2Y89A 3HOJA 1ME8A 2CLFA 3CWNA 1QCWA 3CM4A 4JXCA 2JBMA 4Z1AA 4GUGA 2PRHA 3CQ0A 3UWQA 5AHEA 1MO0A 3OIXA 3LXBA 5ABTA 1FWSA 5EMUA 3QJAA 4QNWA 1D3HA 1KFKA 3W7LA 2FLIA 2X2GA 3TAKA 3TCEA 3R13A 1KM5A 5F1VA 1XKYA 1TRIA 4UMCA 1OX6A 3HG4A 3BLFA 4NVTA 4OWGA 3N19B 2H3DA 4DF1A 4UUIA 3A5FA 4AAJA 1FXQA 3NR0A 1MZHA 3QSTA 1TPWA 3EX4A 2IQTA 3W86A 3PBUA 3KXQA 3MYOA 4RZ5A 1TV8A 3ABRA 5E1QA 5AC7A 1ZAJA 3WJXA 3F1QA 4MOZA 2EGZA 4C1LA 3ABOA 1QO2A 3HGRA 2JKAA 4DBEA 3IIOA 3TFCA 2WO5A 4ALDA 2CLLA 4QQ3A 1OK4A 3SIZA 1TIMA 1PVNA 1VCVA 2I14A 4FEZA 3DAQA 1HFBA 2CLHA 4LS1A 3MO7A 4RXGA 4LRSA 3MYPA 5HQEA 2Y7FA 4UTUA 3IRDA 1TPDA 2ISWA 2PE4A 3DXIA 2ZRVA 4FIQA 1OK6A 4EVZA 4MLJA 3V1PA 1H7WA 1LBMA 3PS7A 1FDJA 4LWWA 1Z44A 4L4LA 1EPXA 3G0UA 1IGSA 5DY2A 3V75A 3C0JA 4UTTA 5F2IA 4N9DA 3UPWA 3KFTA 5C54A 5LHEA 5D38A 5EA9A 2O7SA 3QW3A 3EXSA 3B4UA 5F2MA 3G1FA 3TSMA 1J2WA 3GB6A 3W2UA 4ORMA 2PRLA 1LOSA 4AMAA 4QIUA 3Q37A 3KRZA 3LCFA 3NVTA 1OJXA 3THAA 1K03A 4ZZ9A 1KM0A 2NXGA 1HUVA 2YCEA 3O6YX 5CG7A 3WFAA 3CIXA 3UWZA 2NZLA 1SFLA 2Z1BA 1LTDA 1LBLA 2V8ZA 1KM6A 3EEGA 5I3HA 5K7JA 4O0ZA 1CI1A 2TPSA 3DFSA 3A22A 5FEPA 4IQLA 1H50A 3Q2DA 2VEKA 2GVJA 1EP3A 2QUTA 1SFJA 3GDMA 3VE7A 1KA9F 1BTMA 1FWTA 3L66A 3C56A 3GKAA 1OG0A 3IGUA 3NA8A 3TC7A 2QCNA 2WSQA 2OX1A 3CIWA 3EWXA 5AB3A 4H6KA 2QUUA 3TKFA 4TO8A 3NQMA 2DZPA 1LROA 2QAPA 3DZ1A 2Q8LA 3QZEA 2WSYA 2X1UA 7TIMA 1X7FA 2OCZA 2GVLA 1DV7A 1G7UA 5BNKA 3PR2A 1Z41A 3S5OA 4O14A 5D2XA 3P60A 4OT7A 2QR6A 3TAOA 1AK5A 4A22A 4HNNA 3SECA 5K2ZA 4NX5A 5FF3A 2BX7A 3D0CA 5D03A 1OX5A 2QJIA 3C4UA 3Q94A 1ICPA 1TV5A 4MFDA 4IPIA 4O1DA 5EY5A 2NV1A 2GVGA 2YYUA 1XUZA 3LCWA 3OVRA 1OYBA 2DZWA 4BWLC 1TPEA 4DBDA 3NQ6A 2CLMA 5G2HA 4HPXA 1GT8A 3IVTA 2XN1A 1H62A 1FX6A 1NSJA 2TSYA 2V9DA 1G4PA 1VRDA 2Z0IA 1OFEA 1SQ7A 2G5WA 5IBXC 3W84A 4Z0JA 1VH7A 2ZA1A 1VYRA 5I3IA 2E09A 5D05A 1AMKA 1L6WA 3W1NA 4NXKA 1TTJA 5KINA 2ZRWA 5K9DA 3W1TA 1SO3A 3NL5A 4O18A 4MPQA 4O13A 1EWDA 1PCWA 2QCLA 5GVJA 3W75A 1HG3A 3HPXA 3L5AA 3M16A 1OX4A 4JX6A 4JS3A 4TU1A 1OF8A 1O95A 3LRLA 5G4WA 2D73A 4RR4A 4JICA 3OA3A 1EP2A 4FX7A 3P5YA 5DXYA 1WX0A 4ZQMA 1TYGA 2E77A 2ZZ1A 4AWUA 3KRUA 4JR5A 1JCNA 4IWWA 1RD5A 2GOUA 3NPXA 1RPXA 3FEMA 3UY7A 3AO0A 5CZSA 4I9AA 1FXPA 1OFRA 3VFLA 3C2EA 2DJLA 4DO6A 5K4ZA 3VNDA 3I7RA 3IGSA 5AN7A 3DFNA 1ME7A 3FJLA 4Y6GA 1L6SA 3SGZA 3HG5A 3W1LA 3INPA 3CPRA 4PA8A 1OX4B 2V2HA 2GJNA 2EHHA 1JQVA 1ICSA 2JKEA 3LX9A 2BTMA 1JRBA 3L9CA 4I7UA 4BI6A 4MLRA 1A50A 3FJ6A 2BSLA 1K8YA 3STGA 2B7PA 3LTSA 1YXYA 1BEUA 3W7EA 1X8FA 4A2SA 2VENA 3QF0A 1SPQA 3NPUA 2QJHA 3HQ1A 3VKJA 3TW6A 3GVGA 2ABAA 3JR2A 1SW3A 4LS0A 5CGQA 3PG8A 3I68A 3M0ZA 1VJIA 3GNDA 4IJBA 3K30A 3O15A 3B0UX 4UMBA 4MZ8A 2CLOA 4Y90A 2YPIA 4CCEA 1S5WA 4ML9A 3MUXA 2E1DA 1W0MA 2ZDRA 1XM3A 3M47A 4UTJA 3KX6A 4YWIA 3W1MA 1TTQA 2A2IA 3B8DA 2V0TA 1VYSX 2FJKA 1W3TA 1DL3A 4IPJA 3W07A 2EPHA 5HR6A 4IMGA 4UR7A 3GXPA 4AHPA 3OG3A 3BV4A 4QNEA 3CU2A 3MBFA 1FQ0A 3UWVA 3NAVA 5D02A 1C8VA 2PCQA 4WZHA 4PODA 1DVJA 4UFIA 1IXNA 2DP3A 3I65A 2YFOA 3O8AA 4RKAA 4YMZA 1ME9A 4U28A 5LKYA 3FFSA 4Y9AA 8TIMA 3DH7A 1F76A 1VCGA 4K38A 1S5TA 3LB0A 1EP1A 3WK1A 3N2MA 2H8ZA 4Q4KA 3R5EA 4DO5A 3NQ2A 4DEFA 2Y62A 2VOMA 5DN1A 1TPVA 1FDYA 3PBVA 1JUBA 3W7DA 3QMRA 2OZ0A 4HPJA 4NXSA 1XBYA 1SR9A 3GXNA 2C18A 2J9ZA 4CNNA 3UWUA 4CQ9A 2QCFA 5EBUA 5I3FA 4TMBA 1WQ5A 3MHUA 1NVMA 3NL6A 3W7CA 1WAUA 1T0OA 1K02A 3W9ZA 1OABA 5BMXA 2G96A 5D2TA 1IIGA 2WPBA 4DO4A 1THFD 4UR8A 2PC4A 3W7OA 4DPQA 1H60A 4Z08A 3W23A 4YXGA 2F84A 3ATYA 3TSBA 1X1OA 2NX3A 3BG9A 1WBHA 3KRSA 1F6PA 3DKJA 4RV8A 4XBSA 1OFOA 3HG2A 1BKSA 1KFEA 1OFPA 2TMDA 4E2DA 2CFFA 2VFHA 5CPLA 4IOTA 5CPOA 5CPNA 3W7IA 1ZCOA 5HULA 2P0OA 1Q6OA 1KBIA 4BK9A 1I4NA 5FF0A 2QEZA 3MP4A 3L67A 3W6YA 3EXTA 4RX0A 1OYCA 4GJ1A 5LNSA 1KLYA 1TTPA 5IM51 1Q3NA 1LZOA 3WJWA 3LOTA 3I7QA 3TR2A 3N9SA 2NWSA 3PY2A 4E38A 3SSJA 5H2ZA 2JGQA 1UUMA 5G2IA 2RDWA 5T26A 5FESA 3L0KA 2ZFAA 2G97A 2H3BA 2A1YA 3LI0A 3LDVA 2YW4A 5G2WA 2YSWA 3T40A 3GDLA 1W1ZA 1GTEA 3H54A 1J5TA 1H5YA 2YDAA 3GKFA 3GIYA 3WJZA 2R91A 3ELFA 1YLVA 3O07A 1AW2A 4B5NA 5DCEA 1NF7A 5KZDA 3ZWSA 5AHNA 1W5NA 4K39A 4M7TA 1UB3A 3TK7A 1K8XA 3S9YA 1Q6RA 1JUKA 4O17A 5LNUA 4WJEA 3BW4A 4LRTA 4UTWA 3STEA 3N2XA 4JY9A 1K7XA 1TQXA 1KTBA 3G8EA 3PB0A 4HN4A 4O28A 3RNDA 3QMTA 4MZYA 1WYIA 2C14A 3M44A 4OV4A 1EEPA 3GDRA 3S5NA 1H7OA 4GWEA 4CLMA 3E49A 4JTEA 1A5AA 4NJJA 1TJRA 1Q45A 1KM1A 1XDLA 1JCXA 4M6QA 3HGJA 3T4CA 1ZJIA 1QPOA 4WXZA 4JTIA 3W73A 3RLUA 4RLIA 3W71A 3S6DA 3NEVA 1K8ZA 2A6LA 3C52A 4Y8FA 3S1WA 3WJSA 3LHVA 3MWAA 4S1FA 5D2YA 1ZY9A 3OVQA 3C2RA 3DENA 5DXXA 1ZALA 2BXVA 3HG3A 2FTPA 2VFFA 4K7VA 3P7YA 3LGEA 3C8FA 4EIVA 4NT0A 3PAJA 4J9JA 1LBFA 3DHDA 1ONRA 2E6YA 3LM7A 1TPC1 4EWND 5K3VA 4GC4A 4EF8A 1F73A 3FIGA 1I2QA 3QQ1A 1GVFA 5HUOA 1FDZA 3PUDA 1W3NA 4R34A 1ZAIA 1VQTA 2B7NA 3NYZA 4RZ6A 4XZ9A 5DELA 3IIPA 4QISA 4UFJA 3BLEA 3DFPA 4UTKA 5K9CA 1H61A 4RXFA 4PL2A 4BF9A 2J9YA 3TC6A 5C6MA 4AH7A 1MXSA 2A85A 4RCXA 1JRCA 2ZA2A 3QRHA 2RHGA 1TCDA 2YW3A 3I6RA 4NQ1A 3W7PA 5CPMA 1PCKA 2WKJA 5I3KA 3P84A 1W8SA 1A53A 1MSSA 2CZDA 2NV2A 3C3NA 1XBVA 1I2NA 5DCBA 3BLIA 4RZ4A 1B57A 4OGZA 1RR2A 3BG5A 4UTTC 1YDNA 4GUHA 5D2WA 3DFQA 5G4EA 1UCWA 5G1TA 1W3IA 3KVJA 4LVFA 3BGJA 3PVFA 1SZGA 3F4NA 4M7SA 1DKWA 4XTDA 1DHPA 3IGXA 5LNRA 2CZFA 3MBDA 3P74A 1O4UA 4MY1A 4N9BA 1KM4A 3THQA 2CLIA 3B0VC 5BOOA 1H7XA 1G7VA 5LSMA 1W5QA 3WJYA 1B9BA 3FKRA 1OFDA 4K36A 1H51A 3RFAA 3W2KA 5DCDA 1PHQA 3DU0A 3TJLA 4ZQNA 3WK2A 1IXOA 5KITA 2Z6IA 3GZ3A 4E0CA 4N4PA 3HB9A 4KFPA 2EKCA 1KTCA 4JTUA 5TIMA 3S1XA 1JCYA 3GYEA 4JEQA 4ADUA 1YXDA 4PC8A 2P1FA 2QCCA 3OEXA 1OFBA 3U2OA 1R30A 4DF0A 3LCGA 1DBTA 2Y63A 5C55A 3QFEA 3NQAA 3OHIA 4CQAA 1EUAA 3TNOA 4AHQA 2ZYFA 4UTLA 4MKNA 2VEPA 3LHZA 3N34A 2A4AA 3MP5A 2WOQA 1I2OA 2DZSA 3DI1A 2XN0A 1XFBA 1XL9A 3BPWA 3KVMA 3M5ZA 4MIMA 1WDWA 3EX6A 1TTIA 5D2VA 3OBKA 4N2YA 3PBYA 2Y61A 3ANYA 1S5VA 3MP3A 2FB2A 3NL2A 1JUEA 3W1XA 3NL3A 3NOEA 3ZWTA 2NX1A 2CWNA 2V30A 3FA5A 1H63A 4NNCA 1FY6A 5LNWA 4IX2A 5HWMA 2YR1A 1KW1A 2C16A 3GDTA 1ZHAA 2C3ZA 4O8RA 5A5WA 2V5LA 1T96A 1F05A 2FPTA 5FEXA 1H7RA 4EF9A 2A6NA 1H7NA 1C29A 3T44A 1U83A 4GUJA 2RDUA 1OF6A 3LCIA 3M5VA 2H6RA 1YDVA 1GYLA 5D30A 3S5ZA 3EKLA 4MYXA 4LU0A 4ZMGA 3HJZA 1RZMA 3L68A 4AEOA 2JGYA 3STFA 3NQGA 3LXAA 4MFEA 3N14A 4UXDA 1TB3A 3NQEA 1CX9A 3HBLA 1QNVA 3UXDA 5EL1A 3GX9A 3LHWA 4LTSA 2FPVA 3T7VA 3O63A 4XUGA 1NEYA 3R89A 1W56A 4BI7A 5F2LA 4NX0A 4AWTA 3B06A 2ALDA 2QCDA 2YX0A 3UD6A 1YYAA 1EUNA 1GQNA 4KKXA 4O54A 3W1PA 3PULA 3G0SA 2CLKA 1M6JA 4UTHA 1OYAA 2E5DA 2LLEA 2DZXA 3IIXA 1O60A 3N3MA 6ALDA 1K3UA 3C2VA 2B7QA 4FNSA 4FF7A 1FCQA 3PUEA 2E5BA 3O06A 3NZRA 2AAMA 2J88A 2RKXA 1XCFA 2KZHA
chains in the Genus database with same CATH superfamily
1WUFA 2OYLA 3ME3A 2J7FA 4W93A 2VFGA 2VR2A 3E96A 5B7ZA 3SRFA 3EDKA 4KESA 3STPA 5BRBA 4ADSA 3MWCA 3WH8A 1QNRA 2QCEA 5EKYA 2BWGA 3NG3A 3G8RA 3SGUA 3R43A 1I9CB 4KIEA 1A0CA 2DY3A 4RV3A 3RF9A 1UUQA 3TOPA 4XZLX 4YPJA 2O7QA 3UZ5A 2EKGA 2ISFA 4A6GA 1JDEA 3CK5A 4FOJA 1W9BM 4GJIA 3WNNA 4S3FA 4HOWA 3TWAA 1VPXA 3M9YA 4F2UA 3ARVA 4CQ8A 1XXXA 3EA1A 3KM8A 3BW2A 1O5XA 2AMGA 2X30A 2WLZA 3MSRA 1Z7AA 1E72M 4MM1A 1TE6A 4PBGA 3EA3A 2AOSA 5EMKA 3SRKA 3E6EA 1J0HA 2PBGA 4IIBA 4JX4A 1U5HA 4QJ5B 1XGDA 3BVJA 3FKKA 4DNMA 1KFBA 4QBXA 4W8AA 1MUCA 2OELA 4JTSA 4LX4A 2Z7GA 2Z1SA 3AMCA 3TA6A 4HMNA 4L5ZA 3BMWA 3V7PA 2WQDA 5LNVA 4U3AA 4FO4A 1VEPA 1NFPA 4UMAA 2J9XA 3CQHA 1RJRA 1TSIA 3GFZA 5A6BD 1XG3A 1UASA 2X40A 4HNOA 4JIEA 2Q3RA 2P88A 4AZGA 1W17A 2VZTA 3G6LA 3W7GA 4HU8A 1EHAA 1XIJA 1PTAA 4C5ZA 1XLJA 1NM9A 1GZJA 3CYVA 4A21A 1KV8A 1E4NA 1PTDA 3TNBA 3GZAA 2Q71A 1SFTA 2XDFA 3W3OA 5DMLA 4ZFMA 3BAKA 2I5IA 2YL9A 2Z24A 3DFTA 1T40A 2IW0A 3GHUA 1MDLA 2VGBA 2OR2A 3M5XA 1QATA 3TR9A 4PMZA 3CLMA 4R7JA 3G77A 2D22A 2IUZA 3RYSA 3VYLA 5LIXX 3DGBA 1FOBA 4PL1A 2QUVA 1DWFM 3LXCA 3SN0A 4B2DD 4EAYA 1JXKA 3HMCA 1D9EA 2HVOA 3SSZA 3VXGA 4HNTA 1KTNA 5HDRA 3PK7A 1HXJA 2W62A 4DNHA 3G1RA 1BWKA 1QNOA 3N17A 4DF2A 4Y8EA 3WBAA 3CB3A 1RCQA 4BQ5A 4A29A 2Z1WA 3ITXA 1Q6QA 4AD5A 5HQLA 3DCPA 4IF2A 3WUFA 1YMYA 4RK8A 1M3UA 2J7HA 2ZE0A 4MGGA 4ZO6A 1KBLA 3BK0A 1NWUA 5KZMA 1SGJA 1IE7C 1DORA 3SY8A 5H8PA 2IMRA 1VBJA 1HNYA 1XV8A 2Z2BA 4R5EA 5ABGA 1VYPX 2DIKA 2IS7A 4P8UA 2HSAA 3VOGA 4J7RA 2VR5A 4Z2GA 2DSUA 4US5D 1XRVA 5FACA 2QJGA 3EWDA 2CHNA 4KWWA 5AC5A 1QPKA 3AHVA 1TA3A 1XBXA 2B31A 4PSRA 4LF1A 3SCNA 3U2EA 3KHJA 3PM6A 3WL1A 2W66A 4LSBA 2B0MA 3RLHA 4FMVA 3MW7A 3AIUA 4LUSA 1V6VA 4GI9A 1NOWA 1C9WA 1FWCC 3A3XA 2GJPA 2BLEA 3AU2A 1Z89A 1PKYA 4U10A 2XSBA 3UYCA 1TRDA 4L9XA 1XLCA 3KHDA 3OW1A 5DEZA 2EJAA 3DYPA 3GVWA 1VB9A 1D7KA 2JEQA 4Y9NA 3SN1A 1TA3B 1DP0A 2XIIA 4KWSA 5A95A 4S3DA 3M0MA 2JK2A 3GXTA 4LVBA 1X1ZA 4IQEA 4LUSB 1TZZA 3TYEA 3BQ6A 2REQB 3PBWA 3SR7A 3HO8A 3PZOA 3ARTA 4HHPA 2QDHA 2ZZ4A 4PUDA 1LRTA 2G3JA 3C2OA 3EKGA 4WJ8A 2VEIA 2ZTJA 4GCXA 4JNYA 1SUXA 2E3ZA 1MEIA 2VP8A 4E4FA 2QV5A 2NQLA 3SCRA 4JGDA 3W1RA 4IFKB 3LBCA 6A3HA 2ZTKA 1DWGM 3BTNA 3APGA 4KRZA 1GTHA 1JDCA 5HR7A 4XAFA 4O19A 2FZ9A 4Y9PA 8A3HA 2UV8G 2D23A 1KR1A 5D9PA 1AW5A 4UCGA 3RU6A 1ADDA 2ZICA 3AC0A 3FVDA 3FS2A 2BASA 1A4MA 3W76A 2W61A 1PIFA 3TTSA 3HPSA 3QVQA 3G18A 5TD4A 1DEDA 4JTRA 4FX6M 1XPGA 1G4TA 3IEBA 3LCHA 1HW6A 3ISIX 4WGXA 1UPMB 4I5RA 3ZJ6A 1QOPA 4GACA 3KVLA 3VGHA 1KD0A 4DPPA 3SN4A 2DZUA 1F2JA 1JDAA 1YKWA 3EWUA 2V3FA 1CT5A 1DPMA 3QKEA 9XIAA 5D33A 3QHMA 4BI5A 2J47A 1I2PA 3W7RA 3EX1A 3G3DA 3H4WA 4JTDA 3PHAA 4LFYA 4MKVA 5H6HA 3ZR4A 2DJXA 2RGMA 4DBSA 4QSHA 2SFPA 1XS2A 3GC4A 4C91A 3BCJA 4TTUA 3W26A 1FBAA 1VEOA 3IWPA 1TJPA 3K46A 3ZT5A 2PDXA 4DJEA 4KPLA 3FN9A 1LT8A 3EB2A 4A8IA 1SVDA 1PHWA 3CZKA 2HCVA 4YL2A 2VEMA 1AZ1A 4GZJA 1ML1A 3S8HA 2ZE3A 5FJRA 3CT7A 5CGMA 2OWWA 3H53A 4HNLA 3VO0A 2FVMA 4C1NA 4HU3A 2ZKMX 3CUFA 1OD0A 1ZENA 3PZGA 3TXVA 1CGXA 2ZADA 4GI8A 1Q4NX 2R1LA 3QQ0A 5K9XA 4LC6A 4AXNA 2IPGA 2C0AA 3N4EA 3Q58A 1IT8A 4B5WA 3B04A 5D37A 2FHFA 2WMHA 3LN3A 4JTTA 2A5HA 3VKKA 1UWAA 3A24A 4MY8A 2QYGA 3BG3A 3VZXA 2NV9A 1WKEA 1XW8A 4HJWA 4IXXA 3S4TA 1RJPA 1P7TB 1RVGA 1E4MM 5DANA 5C71A 5EU9A 3KW3A 2VGFA 1H1NA 1KFLA 3EDJA 3QPYA 4Q3MA 3B03A 1SR0A 3S2NA 4PRRA 1CENA 2TRSA 1BYDA 4FNQA 1GVYA 1YBQA 2O4MA 3K4WA 4NZFA 2BODX 2NT0A 3W88A 4C6OA 1EXPA 3WEZA 2OOFA 4S38A 2VR4A 2Y7GA 2OWCA 2ZBTA 3BMVA 2GZXA 1HL9A 1QT1A 4JTHA 4RPPA 1HN1A 4WY0A 3P8JA 3U3HA 3QZAA 3I6TA 3M0VA 3LI1A 3K1GA 2MNRA 4PMXA 1U5VA 3GTNA 3LMYA 5I24A 3WLPA 5EFDA 2A7RA 2VRQA 4H9MA 3V4BA 1CIUA 1YBQB 1VHCA 3U57A 2BHYA 1D3GA 2OMAA 3UJ2A 2P50A 2ZCGA 3CB8A 3UESA 2PPGA 3B3DA 4NYUA 4OE7A 2RAGA 3ATZA 1E15A 2HRWA 5FKYA 2F61A 1EX5A 2ESCA 4WY0B 4R33A 5M03A 2OYMA 1MEWA 1TMLA 1RK5A 4JN6A 3WK0A 1N82A 3AAMA 1LL7A 4BEQA 2YXOA 2HK1A 4EPDC 3GG1A 3P81A 2OGJA 3RX3A 5ECUA 1EJSC 4PYSA 5A94A 1P0KA 2QKFA 1IEXA 5CEWA 1V6YA 1LQ0A 4PMVA 3VOCA 3GYCA 3EOSA 5CZ0A 2VUNA 4QP0A 2DSZA 3EDDA 1A5BA 1W1TA 1Q7ZA 4H3DA 2FQIA 3L21A 3CEUA 1G4SA 4P7NA 4DQWA 4UB9A 3L65A 2OVLA 3AHTA 1N8IA 3ARRA 4LAUA 2WC4A 4S3CA 5D04C 3OQ8A 3U2CA 4XSLA 1CTNA 2X16A 1RUSA 2PURA 3TTEA 4ASTA 1UKQA 4JTJA 4WF7A 2XVGA 3UWYA 4TQTA 1GNXA 4GD0A 1RK6A 3CAKA 3HGOA 1HL8A 4BR1A 2PRMA 2WMKA 4IGMA 3CWOX 3NGFA 2A79A 1J8VA 4O1AA 3B05A 5IRPA 1JR1A 1AQFA 3PTKA 1PEZA 4IJRA 1F6YA 2NQHA 1T41A 1R38A 3RJYA 1UKTA 3L5LA 5AC6A 5C0QA 2Y24A 3IIZA 1R7AA 4X3ZA 3MSYA 1B31A 4WUIA 4OUIA 4H19A 2IQ0A 4FAMA 4LCSA 3BMXA 3IJ6A 3SM0A 3UR7A 2I56A 2NLIA 4G1KA 3PFRA 2QCHA 3L0GA 1QO5A 4KCWA 2OOGA 3GR8A 4NJKA 3B40A 1XLLA 5H8MA 4LALA 3FLUA 1EB3A 4GH1A 3CHVA 3NQDA 3RXZA 1XGZA 3NXFA 3VUPA 3C5QA 2FJUB 3EPMA 1XQLA 2WSRA 3NZPA 4GY1A 4O57A 4MMWA 4I8YA 4RE3A 3S1UA 1IWPA 4DJDC 3EWCA 3FYYA 3JRKA 4TMCA 1OM0A 1ZS2A 1S2AA 4IHCA 4H7ZA 3W74A 4WKHA 4ILSA 3QGKC 4KQNA 2X1RA 3CUGA 4DZIA 4UQEA 4EAMA 1DJIA 4AEFA 3POHA 4NZ5A 1A5KC 1RJQA 3A23A 3LEPA 3QY6A 4R88A 2JIWA 4HA1A 5I0DA 3O0FA 4PMUA 2QGHA 1O5QA 5L6UA 1SW7A 5ABFA 1JZ2A 2YGYA 3MJYA 5BWFA 2QV4A 1PIIA 3SRHA 4PFMA 1ME8A 1QCWA 3GC5A 4I5XA 4UOQA 4HPHA 2VC9A 3OIXA 2HNEA 3QJAA 4P5UA 3W7LA 5LIUX 5ABFB 1CXLA 2ZX9A 2VMFA 4KETA 1Y5XA 3C2YA 4NVTA 4OWGA 3ZIZA 3CLWA 1R5YA 4DF1A 3NR0A 3QSTA 4P8VA 1TPWA 2YL6A 3EX4A 3W86A 1W6TA 3MYOA 4HA3A 4FP1A 5ABEA 5AC7A 3RPDA 4MOZA 4A3YA 5EBAA 3TYAA 3H26A 4DBEA 5CLTA 2QF8A 4QQ3A 3GTFA 3MUCA 1H11A 4ZA0A 1MW1A 3AS0A 4FEZA 1FWHC 3WH9A 1HFBA 3ICJA 3LSCA 4KCTA 2Z27A 4UTUA 1WZMA 1V0NA 2VX7A 3TYUA 2PE4A 4E3TA 1P6BA 3V1PA 2YOCA 1LBMA 8RUCA 1V51A 4WDWA 4MB3A 4CD4A 1W3JA 4GY7A 1EPXA 1MVYA 3FEQA 2KX9A 3URQA 3N4AA 3W53A 4N9DA 3AIBA 5C54A 1X98A 5D38A 3LLXA 3T8QA 3QW3A 2WM0A 4HPGA 2QMKA 3G1FA 1J2WA 2R9RA 4ORMA 4AMAA 4EKJA 1RAKA 3R58A 4QIUA 3KRZA 3K8KA 3VMPA 3KS5A 1VIWA 3DFYA 3NVTA 3M0LA 2X09A 3O6YX 5XIAA 3RR4A 2GSJA 4GIAA 1BD0A 1SFLA 2Z1BA 4LAOA 3V5FA 3MC5A 4EP8C 1LBLA 2V8ZA 3PTMA 5I3HA 5K7JA 3GD6A 4IPPA 4UCFA 4I6VA 4NP7A 4C7DA 5DMYA 4UZSA 5HK4A 5M17A 4IQLA 3E5PA 2PDIA 1EP3A 2VDHA 5AY7A 1F8MA 1VFTA 1KA9F 1BTMA 1FWTA 3L66A 4O1FA 3U4AA 3TC7A 1MNZA 2WSQA 3SQMA 3FDGA 1BF2A 3TN6A 4XZWA 5AB3A 4H41A 1W9VA 2PP0A 3B8UA 3WNPA 1HQTA 2BY1A 4GGBA 7TIMA 1UZ4A 1G7UA 3PR2A 3A12A 2Z28A 2PP1A 4YYCA 5BU6A 2V38A 3E38A 3TAOA 4G8TA 3FJNA 4HNNA 3CZEA 1P0EA 2X7VA 1Q2RA 2QJIA 4P7LA 1ICPA 4HHLA 4MFDA 2XGIA 3QTGA 5EY5A 2GVGA 4QE5A 3R8HA 3ZLFA 2CBVA 1J79A 1OYBA 2CETA 3AZRA 1GT8A 3AMKA 5JQ9A 1J12A 1U1HA 4ZE5A 4L6DA 1XJBA 3PZUA 1SQ7A 2G5WA 3IAPA 5IBXC 4Z0JA 2OG9A 1VH7A 2ZA1A 1L6WA 2X0SA 2ZRWA 2WNWA 1M65A 1F4HA 1UKOA 4MPQA 2V5KA 4B92A 1EFZA 3UERA 2VCBA 1EC7A 4L64A 3W75A 1HKWA 1UWUA 1OIFA 4L80A 3VM7A 1OF8A 3T4WA 1O95A 1OC6A 1BHGA 2D73A 3IK4A 3GNRA 3VGGA 1EP2A 4FX7A 4ZQMA 2BOEX 3KE0A 4NY2A 1FWBC 3PZQA 2E4TA 3AIQA 3FEMA 3UY7A 3VFLA 3VNDA 5A8OA 1LL4A 4QLJA 2HQAA 3FJLA 2WSKA 3SGZA 3HG5A 3INPA 3VKDA 4HBKA 1JFHA 4XVEA 2V2HA 4GINA 3AZSA 5I09A 4CU6A 3OPSA 3L9CA 4H8VA 3M7SA 4RE0A 4MJ4A 4MLRA 1BYAA 1K8YA 2BSLA 2B7PA 4X61A 1YXYA 1X7IA 4P8XA 1BEUA 1FHDA 2ZUUA 3LY0A 1XPYA 2VEFA 9RUBA 3LPFA 4Q4PA 2CXGA 1GOKA 1XRTA 2YKKA 4M56A 1E6SM 2ABAA 3JR2A 3W81A 3BDKA 3M0ZA 1NJJA 3GNDA 5ENLA 3O15A 3B0UX 2Z00A 4OKDA 1E6XM 3MUXA 2E1DA 4AIOA 1TTQA 2A2IA 3B8DA 1BWVA 2V0TA 1NWSA 4F0HA 3BOFA 3OYXA 3WH7A 1HP5A 2GDUA 4W7VA 2EPHA 3SIMA 3N6QA 3MUAA 2XWEA 2V6AA 3HPAA 5GQBA 3NO3A 5CH9A 3WEOA 3NAVA 3IJDA 1UH2A 4EK7A 3DX5A 4PODA 1BSIA 4GLEA 1ODZA 1PWLA 3W37A 1DVJA 2F6XA 1SJCA 1GJWA 5LKYA 3FFSA 3DC0A 3K4AA 4MPKA 3WZ0E 3LB0A 3WK1A 1F07A 3BSGA 3QLDA 1JGMA 5C2GA 4DEFA 4DRSA 2VOMA 3EMQA 2X7WA 1X96A 4PR4A 1R87A 4O1EA 3VKCA 2J9ZA 1UA7A 1UJQA 4DYEA 3PJWA 4CNNA 3TLQA 3W02A 2QCFA 4PMQA 1LG2A 3B8IA 4QEHA 1E70M 3TONA 3WF4A 1DYSA 3K8MA 3KBVA 1EA9C 4YU1A 1NVMA 3NL6A 3W7CA 1T0OA 3S2CA 1V6WA 3IS4A 1QK2A 3ZXWA 4F66A 5I6SA 1JNEA 3UT0A 3BICA 5CXPA 3WQ8A 4Z08A 3W23A 3ATYA 5D8WA 1C90A 3UCQA 3WQOA 2A3AA 4DO7A 1WXZA 3UJRA 4E2DA 2J7EA 1IQ8A 3B9OA 5CPLA 1JZ7A 4WK9A 2WCGA 2J74A 3UR2A 3W7IA 1JPIA 5E9XA 1Q6OA 4BK9A 1XIDA 4QLLA 1XYMA 1T6MA 3GS6A 3W6YA 1JZ8A 4CU7A 4XZHA 1NQKA 3WJWA 1EDQA 3MU7A 3PY2A 1R3SA 3SSJA 1C92A 1JI2A 3AMGA 1UUMA 5JBDA 4A8RA 4OOUA 1CXIA 2ZFAA 3AHZA 3SURA 4B91A 3LMZA 4ZB2A 1W1ZA 3MS8A 4LUYA 2G3MA 3H54A 1LQ2A 4OJYA 1J5TA 1H5YA 4HYVA 1M7JA 2GGGA 5LA0A 3ELFA 4HJFA 1YLVA 3O07A 1W32A 3NUKA 2XIMA 4B5NA 4GCAA 3ZWSA 2I7GA 1CGYA 1W5NA 4K39A 3BLDA 3CH0A 1DTNA 4LRTA 3STEA 3N2XA 4JY9A 1TIWA 3CV1A 2WANA 3RNDA 3QMTA 3H21A 4CD5A 1WYIA 4ZBCA 1IEVA 1QI2A 4NJJA 2ZUTA 4XIMA 1Q45A 3QGAC 4YTTA 1WCGA 3OJGA 4IIGA 1BAGA 2POZA 3MPGA 5GJNA 2HVNA 4RLIA 3TYCA 2J8TA 2FZBA 4G7FA 2FGLA 3CS2A 3NEVA 2OQLA 3C52A 3MWAA 3W28A 1EC8A 3DENA 3GE7A 1ZALA 2F8QA 3HG3A 3EMCA 2FTPA 1OEPA 4K7VA 4BF5A 1XYBA 2ZWZA 1OT1A 3NTYA 3B4YA 3PAJA 4ACZA 2E6YA 1JGIA 4EF8A 2VQUA 3FIGA 3QQ1A 1MXGA 3CXOA 1KXVA 1VJZA 2D0HA 1ZAIA 1AVAA 4HU0A 4RZ6A 3VIPA 3W27A 3WEMA 1P43A 4ZODA 3ZVHA 4QISA 2PTDA 1JPHA 3AXMA 3ZZ1A 4PUWA 7XIMA 5GPRA 4R9OA 4AH7A 1V77A 1JRCA 2ZA2A 3LSBA 1CGVA 1TCDA 2YW3A 4JPGA 4NQ1A 3W7PA 5LYRA 5XIMA 4HZ8A 1FH8A 3P84A 2PTZA 3C3NA 1XBVA 4MAZA 3BLIA 4AD2A 2Y4SA 4DHGA 1RR2A 1ESWA 1VENA 3M64A 1YDNA 4GUHA 5D2WA 2DT2A 2WZEA 3BGJA 2GGHA 3PVFA 1J0YA 2OSWA 3S2JA 3TOYA 1Z9AA 1DHPA 2CZFA 3MBDA 3P74A 1O4UA 4MY1A 3MDUA 1KM4A 3W0KA 4AIBA 4Q8WA 3THQA 1XLKA 2CLIA 1HVXA 4E5TA 1V6TA 2FKPA 1Q13A 5IFPA 4F40A 1AMYA 3TJLA 3WK2A 4LF2A 3UVIA 5REQA 1UOZA 4KFPA 3EDEA 4JTUA 1P6WA 3S1GA 3GYEA 1FRBA 3R0KA 1HKKA 4ADUA 2DZAA 4PC8A 3V36A 2QCCA 3ARQA 3OEXA 3U2OA 4C6LA 1R30A 1VKFA 4JQ3A 4DF0A 3WYZA 3LCGA 1W9DM 4DB7A 3ABZA 2J25A 2X0YA 4WHBA 2XGZA 4GXPA 1ZCCA 3TNOA 4RDYA 3GBEA 1KFWA 1W3KA 4UQBA 1UD5A 3MP5A 4NAEB 4QDPA 2V5CA 3OBEA 2DZSA 3DI1A 2XN0A 1XL9A 2I16A 3WF3A 1EJ7L 4LB4A 1XISA 3EX6A 1TTIA 3OBKA 2J13A 4UBPC 4JOMA 2PWVA 4LEFA 4R3UA 3MP3A 3O9NA 1QOXA 4AY8A 2OX4A 3OHMB 1B3XA 3CAQA 2OZ3A 5LNWA 4NNCA 1FY6A 4IX2A 2NSOA 2QUMA 2YR1A 3TZNA 5A5WA 2V5LA 4C7FA 2D69A 3LYEA 2FPTA 3B97A 1IEQA 2BHUA 4D6CA 1U83A 1RXOB 1FHLA 3WL0A 3LCIA 1ENUA 4GI6A 4F2BA 5LIKX 5FA5A 1ZP3A 3ZO9A 1TJ2A 5D30A 4X0VA 3B8SA 5CSYA 1XX1A 1RZMA 5DFAA 3L68A 4QSFA 3STFA 3DEQA 4UXDA 2PDGA 3NQEA 3UXDA 3WD3A 5EL1A 5CJMA 2FPVA 5DRIA 3T7VA 5M1TA 4BI7A 2VZSA 3LA4A 2YA0A 3RGTA 1WZKA 1GQNA 4C6EA 2YL5A 3BJFA 2BY2A 4XZMX 1E3XA 2VRJA 1JPMA 1Y65A 1K4HA 4I9JA 4M8UA 1K3UA 2F2HA 4FNSA 1FCQA 3KOYA 1VFHA 4G2DA 2RKXA 2KZHA 1MYRA 4HZ6A 4IMEA 3PWIA 3BO9A 5JBFA 2YBVA 1A5SA 1JF5A 4D6IA 1Q6LA 4C1KA 5JUVA 1OIMA 3YPIA 3UWWA 1WDQA 2ASHA 4WIWA 3RM4A 2Z2UA 3AMLA 1AW1A 1GW1A 3CQKA 2ZZ5A 2PTYA 3VNJA 3A64A 1RPKA 5DQPA 3SRDA 2DZVA 3CL6A 4Y7EA 1SO5A 4JNMA 1Q6DA 3NURA 1KRBC 2QZRA 4R85A 3M4HA 3TU9A 3WFZA 4GGHA 3TIMA 5JIPA 1IWBA 2HPIA 3W1UA 1GVSA 4GKTA 1TMHA 3FHQA 4GYPC 2ATMA 4ZEPA 2QCMA 5DBTA 5FL1A 1GQIA 3GHRA 3IUIA 1MQPA 1BVWA 4DI8A 4O11A 1KV5A 4PEKA 1TJ1A 3THCA 3TMQA 1M01A 2OEJA 2XM2A 3G1HA 3HQOA 3UCDA 1FFRA 1IF2A 4HGXA 1TPB1 2YCJA 2KAUC 4GQGA 1E5JA 1DOSA 1W5PA 2O0TA 1K1DA 4PUKA 2V5JA 4RUBA 3VZYA 3SB0A 1E51A 3AI0A 5CZTA 3W01A 3DC8A 1L6GA 1EC9A 3GK0A 4PCSA 3L5MA 3S1VA 4QE4A 4J3ZA 3GFYA 3RIKA 1VGAA 2GWNA 4LOCA 1MEHA 4PTXA 2VC5A 2GSHA 1XH2A 3MB9A 2XIQA 2V5BA 4Q8PA 1J5SA 1S2TA 3P8IA 2GJLA 3PPGA 1REQA 3KOZA 4L4OA 2XIBA 4A05A 4UNIA 1E0VA 1IZCA 1PYFA 1W54A 4FZIA 5C9RA 1T8QA 3PUOA 2A3EA 1LLOA 4L9YA 3R7MA 1QW8A 3SFKA 1TPFA 1QK0A 3W29A 3MKCA 5C8BB 1J6PA 2VQTA 3V5CA 4R53A 4I7VA 2CZEA 1HJXA 4JDYA 2AKZA 3VU2A 1L6YA 5JH2A 2WZTA 3AJ7A 3U4FA 1HJUA 3B8VA 2Z1VA 3SI9A 1CDGA 3GY1A 3EKZA 3QKZA 1LCOA 4HIBA 5BOEA 1MWOA 2ZVIA 4XZNX 3NVDA 3EB3A 1H3GA 4G56A 1TO3A 2YCLA 2WNNA 3HURA 3VDAA 1P5BA 1MFUA 3A5VA 1EH9A 4ROPA 8XIMA 5RUBA 2PDWA 2EBNA 4JQ2A 3W7HA 2OXNA 1TWDA 4GXMA 3AJXA 4PBEA 1US3A 3R12A 4IJCA 4H8HA 1TMQA 2YCIX 3S5SA 4Z1DA 2V67A 5HAOA 2VHLA 4TUFA 4WD0A 1X97A 3LERA 1B30A 3VIGA 1VIZA 4NASA 3N25A 4HMEA 1EEXA 3W72A 1JZ5A 2WJEA 3R6IA 1RA0A 3EB4A 2YCLB 4AUBA 2C13A 2WK2A 1SYTA 1DE5A 3W2JA 3UNTA 3LHYA 3DG3A 3ARXA 4LUJA 1YXCA 3W24A 5J5RA 4JIRA 1KQZA 2R82A 1YNPA 2J6VA 5A8PA 1KCXA 1V7AA 3AXIA 2DSWA 4BKNA 3VNIA 2R6OA 4UFMA 4OZOA 3WELA 4M1BA 4DUXA 5JVLA 1OCNA 4FNPA 3DESA 1KRAC 1NDZA 1Z48A 4EPKA 2Y7EA 1N55A 3ECQA 4JTLA 4FNRA 1FKWA 1WAWA 3AYRA 4Y9OA 4D6HA 4KFOA 3M41A 1W2VA 3LLDA 4GQBA 1YADA 1LDCA 4WJXA 4M0XA 3ID7A 2E0PA 1TV7A 2FMOA 4O12A 1KWGA 3GU1A 3FXGA 3FSTA 2WMFA 3QY7A 2GL5A 4XBKA 2HE8A 1OB0A 1X1NA 4LAKA 4GFIA 3ZLGA 2GOKA 1CZ1A 2C1HA 2VX6A 3ITGA 2GJRA 3P3BA 4UNKA 1A0DA 2PDMA 4M24A 5J04A 1EJRC 4DELA 4BY3A 1XH0A 5DBUA 1E6QM 1NWTA 2ZUMA 2HNHA 4B3KA 1ZBCA 1OGSA 2OSXA 4H7VA 1GOXA 1R46A 1RV8A 2C15A 5F1UA 2VC6A 3QPZA 1HX0A 4MDOA 2WV8A 2BZNA 2PU0A 3OGSA 1K70A 3NQFA 2R1PA 4LW7A 1K8CA 2PDQA 1XICA 1QNQA 4NJHA 1PKMA 4HT3A 4DWSA 2ZZ3A 3TJ4A 1YE4A 5I78A 1DE6A 3W7NA 1M7PA 4U2ZA 3NQBA 3KLLA 2HTMA 1OZQA 3AIVA 4MDPA 1E40A 3UG5A 4RL3A 4QCEA 1P1XA 4NF7A 4XAGA 2HVMA 5CSRA 1XBZA 1TWZA 2DU2A 1YTKA 5MHBA 4DJFC 4PTVA 1F3WA 2R1NA 1YDOA 4O10A 4LYQA 1HVQA 4DWSB 1BYBA 4I6KA 2I17A 2OO6A 3T0CA 3SCUA 3PSVA 2BVDA 2WVSA 4HP5A 5A8GA 5CC6A 2GUYA 1TKKA 3B0XA 4GKLA 5EMMA 1QRQA 3T55A 1QWGA 4U3CA 4POCA 1VC4A 1XRFA 1YPXA 4JTCA 4O16A 3LGGA 4JL2A 4Y9MA 4L6OA 3VCCA 4R7WA 5AC8A 2OPJA 4FS9A 4AIEA 3GR7A 3F5JA 1ECEA 1G94A 1UOKA 2PDPA 2ZZ6A 4PE8A 3E0FA 3TW9A 4GBUA 3OZMA 2D1ZA 1VFFA 2QCGA 4ZTYA 3CUHA 4MYAA 5A69A 4DZ5A 1XFCA 3TJIA 1Z69A 1YW1A 2XUCA 4MNLA 4UTIA 3PFMA 4ZB5A 3MSDA 1VEMA 1A3XA 2D2HA 3TQVA 3P61A 2R8WA 2V3DA 1XSJA 3NDYA 4JYDA 4H9ZA 4BQ2A 3CZ8A 3CZGA 3WIJA 2AQWA 3OA5A 2HS8A 1R0MA 2IPWA 2X2YA 4WOQA 4XWUA 1PX8A 2O9OA 1B90A 3TQ0A 2CBUA 5LIWX 4GZIA 4CVWA 5T9CE 1IZJA 2G4JA 1OHLA 4B9YA 1WV2A 2GPTA 4BWLA 2WHJA 3JZEA 3K8LA 5HA7A 3WNOA 1EGVA 3BW3A 1GKRA 4IX0A 4NKCA 3S2LA 3UCCA 3UZJA 3SCOA 1VBGA 4H00A 2FZMA 4W86A 4HKPA 2ADAA 2EG8A 4E2BA 5I7GA 3FYPA 3PWGA 1W1B1 2V82A 1W2PA 1MRQA 3SAZA 2ODOA 4HYWA 4GQ0A 1JAEA 1AJ2A 5D8ZA 1FUYA 2GGEA 3LTYA 1SU5A 4HCHA 4NILA 4HN8A 2G3FA 3KTXA 5TQLA 1PIGA 4FLOA 3G2GA 4IGSA 5U4NA 4KERA 4TTGA 2P53A 5BCAA 6TIMA 4BZYA 5A8MA 2JF6A 1E55A 1E6NA 3PTQA 4M6VA 3WLLA 3PSWA 4DVOA 3M6YA 4EXQA 2V63A 4HD5A 3S46A 3W70A 4UNLA 5CC3A 3M1ZA 3ZVIA 2FZNA 1LWHA 3T78A 1XDMA 1DWHM 2RUSA 1UQZA 3HF3A 4JQ4A 1E6ZA 3ZT7A 1K4GA 4F0LA 4MWAA 3VC5A 1OC5A 5J5DA 2ANUA 2VRKA 1U1UA 3ANUA 5D9MA 2OODA 4AY1A 3SCWA 4WKAA 1HJWA 1OGBA 4YVPA 2FDMA 3PF3A 4H1ZA 1ADSA 1E43A 4GX9A 3MMUA 4TV5A 1I8JA 1ZBKA 4S3JA 1UWTA 1J0ZA 3MY9A 1J4EA 2R94A 2ALRA 3H2OA 3TROA 1V0LA 3E0WA 4MWAB 4GUIA 3T2OA 2C7FA 4J2MA 4I90A 2PS2A 3UETA 3S5YA 3T08A 2A3CA 2DDXA 5H91A 3IARA 3LPGA 4K37A 3TX9A 3DBNA 4X9SA 2GGJA 4JCMA 3W1AA 4LGXA 1QJWA 4EX4A 4Q8VA 1Z42A 1QMLA 4AVFA 5KTLA 3RLVA 4B5UA 4B5VA 2DQXA 3O16A 5A2BA 3KBWA 2IQDA 5FEWA 3WCZA 2PD9A 3G0XA 1FWIC 2FFCA 3NPWA 3TTQA 3VM5A 4ZQPA 3WX7A 4P2VA 1KCZA 2GQ8A 2NVCA 1GJPA 4LY4A 4DM2A 4C6PA 1Q63A 4NZ3A 1RY8A 2CWXA 1J01A 1XLHA 4AIUA 4OBSA 5IDZA 5AHIA 4IIEA 1O12A 1UP0A 1VZWA 2VFDA 4KWVA 3N9KA 4ZQCA 2HZGA 1X6LA 3E12A 3DFOA 1ZBWA 1N2VA 1V79A 1ZJAA 2WW5A 5D32A 1ZJHA 2V2DA 3NQVA 1TR9A 3KWSA 1QI3A 4K8HA 1JJKA 1X6UA 4M80A 1ITQA 2I1OA 3K5XA 3B8TA 4CEUC 3R4IA 2W63A 1AL7A 3TFXA 1GOWA 2AGKA 5FEZA 3MI6A 1JVNA 2F7FA 1ZAHA 5E6YA 1S1PA 2A7NA 4LS2A 2OZ8A 3KTSA 5I00A 3ONBA 1A49A 5ECVA 1XLDA 3R8RA 2A0NA 2YFNA 4JTFA 4DLMA 3PZNA 5FD0A 4JNZA 1LRNA 3VGDA 4D6EA 4ERIA 2OQYA 4XBJA 1I45A 3N15A 5EMYA 3DHUA 4CCDA 5AHMA 2GUUA 2DT3A 4B90A 5C5YA 2DEPA 1BG4A 3P0WA 4MB5A 5AKQA 5IFTA 1O7AA 1W9XA 4N9CA 3DG6A 2YB4A 2WZMA 5CSUA 1E4IA 3NO5A 3SO7A 1IV8A 3TXZA 4Q8OA 1CPUA 5AHFA 3VVGA 3PZIA 2VDGA 3CUIA 2NXHA 4AISA 1YPFA 3G1SA 2CCRA 4RJEA 1FWNA 3NZGA 1K7FA 4AD0A 3GNNA 1R47A 4H7CA 1V3LA 1W5OA 3SW6A 3W22A 5EYWA 3BGGA 3HFYA 3CT2A 5BMWA 2OJPA 5E70A 4PGLA 4V27A 1P0NA 2VKZG 3URAA 4ML4A 4PEEA 1UMLA 1D8WA 2DQWA 4KT2A 4GFSA 3UGVA 1R2SA 4LV9A 1T7LA 1XLMA 4QS5A 4XD5A 1QPRA 2MANA 3VMNA 4JXCA 3CM4A 4ZSTA 2JBMA 3BJTA 4IQDA 4Z1AA 2WMJA 4HCLA 1FP8A 4UTFA 3QN3A 3UWQA 3H70A 1NH6A 1GORA 3IUHA 1MO0A 5ABTA 2ZX6A 1FWSA 3UG8A 5LXXA 3UJFA 1UC4A 2X2GA 5F7UA 3L4ZA 4IL0A 3BANA 4ZXLA 5F1VA 3VDGA 1WDRA 1XKYA 2HV5A 3BLFA 4LB3A 4E4UA 1UBPC 2ZXAA 4UUIA 1XLEA 1MZHA 1F3XA 2ONEA 2IQTA 4PUNA 3RR1A 3PBUA 3KXQA 2YBTA 4DWDA 3ABRA 5E1QA 1R6WA 1ZAJA 4BQ3A 3F1QA 1EYEA 4PCTA 4W5ZA 2EGZA 4C1LA 3ABOA 5M2FX 4DYKA 3HGRA 4IISA 5IDIA 1ISZA 4ALDA 4M29A 4Q7BA 1KXQA 2Q8XA 2CLHA 1J0JA 4O8AA 2VEGA 4RXGA 7CGTA 4LRSA 3VX1A 4TX6A 4GK8A 2Y7FA 2YBUA 3IRDA 4GC3A 1TPDA 1H0IA 3C0QA 2XIJA 3D3AA 3DXIA 3V0TA 4EVZA 2DPEA 1H7WA 3U2ZA 4W85A 2D3NA 4D8AA 4Q7IA 1AZ2A 3RMEA 1W1A1 3JW7A 2Y5JA 1YE6A 1U2YA 4QQUA 3F5LA 1E9IA 3I10A 5HNUA 4UTTA 4NZ4A 2EEXA 3VPLA 1Z6KA 5EA9A 3EXSA 4QHRA 3B4UA 4S3EA 3TSMA 3FXYA 3SDOA 1MDRA 5BU9A 2C0HA 1UH3A 3TYBA 3IACA 2ZC8A 3LQLA 2P0IA 2PC8A 3THAA 3ZYZA 3EDFA 2NXGA 2XGBA 2YCEA 5CG7A 3KCJA 2NZLA 1F3EA 1LTDA 1UR4A 3EEGA 1WDDA 3W38A 1CI1A 3DFSA 3PUGA 5FEPA 4K2SA 1CXHA 3Q2DA 3R25A 1US0A 4TVUA 3GDMA 3VE7A 5AZ1A 1TWIA 3T09A 4C6FA 1EPVA 3QY8A 1OG0A 1WE5A 4DJEC 4W7WA 4A4AA 1F4AA 3GHTA 3N6HA 3F5KA 1LROA 2QAPA 4LYPA 5C9WA 2WSYA 2X1UA 1Q7MA 3R11A 2OCZA 4BQ4A 4MWAE 4RE4A 5BNKA 5BXTA 3BSMA 4TXEA 4XB3A 2E9LA 5DT7A 2Y5SA 2QR6A 1VRXA 1AK5A 3SECA 5K2ZA 5HMEA 2BX7A 3D0CA 1PZ1A 1OX5A 1E9YB 3QV8A 4CUCA 1SJDA 4C6NA 4IP5A 1XD0A 5FL0A 2NV1A 1XUZA 2QUNA 3PPFA 3OVRA 4PTDA 2DZWA 1TPEA 2OB3A 2VI0A 3ITYA 3CMJA 1E56A 4HPXA 1ZB5A 2FGBA 3FSUA 1H62A 1FX6A 1NSJA 2NQZA 2TSYA 2V9DA 1W1VA 3WUBA 1MNSA 4GVHA 1PX3A 2QS8A 3LBOA 3OG2A 2VCCA 3W84A 2Q6ZA 3HQNA 1ZGDA 5D05A 3KUMA 1AMKA 4NXKA 3ERPA 3LNPA 1EF3A 2ZUSA 3DECA 4AD4A 3ARZA 4O18A 2JE8A 2P8CA 7ENLA 4O13A 3WENA 5AYIA 2WZIA 3GVRA 2DIEA 4FLSA 3HPXA 3L5AA 1ITXA 1VPQA 3M16A 4QS6A 5HANA 1DJHA 4YTSA 3P14A 4Q4OA 5CBJA 3OGVA 1XIBA 5DXYA 4RZBA 1VFMA 1TYGA 3W4RA 1DJGA 1E0TA 1MW0A 5A6KA 3KRUA 5MF5A 3BCDA 1AUSL 4KCUA 2GOUA 2OKTA 5CZSA 1FXPA 3C2EA 4P7OA 2QGYA 1WZLA 1JZ6A 3M46A 2R1MA 4U5IA 4DIAA 4Y6GA 3RU8X 2CLPA 3CPRA 1EQCA 3KP1A 4PA8A 1DIOA 3BAYA 1KBBA 2JKEA 4YTUA 2BTMA 1V3HA 3RRXA 3TC3A 5A3HA 1JRBA 3GG0A 3QOMA 4PUEA 1RP9A 3W7EA 2YB1A 2D2GA 3QQWA 3JVAA 4A2SA 3U5UA 3TW6A 1UMYA 4ZR8A 3VIIA 3BOXA 2O9PA 1B54A 3I68A 4IJBA 3TN5A 4UMBA 4MZ8A 4Q4SA 4Y90A 1OSEA 4ML9A 3M47A 1XM3A 4UTJA 3KX6A 2OWXA 3GSMA 3ES8A 4K1GA 4Z2LA 5M3WA 1Y5WA 3FW6A 1U1JA 4WDUA 2GLKA 4RDWA 9CGTA 2FTYA 4E3VA 4AZHA 4QDWA 3OG3A 3BV4A 4QNEA 4BF7A 3MBFA 4E4PA 5D02A 2PCQA 2D2OA 3QHNA 1R3RA 4CN1A 3BV7A 4UFIA 1E1CA 1IXNA 1ZUAX 2DP3A 3U0HA 4WSJA 3T0BA 3K1DA 4RKAA 4AY7A 2J77A 3GTXA 1ZL1A 4Y9AA 1TVLA 4K38A 1HJQA 1S5TA 1EP1A 3N2MA 5AZ0A 1JPDX 5KETA 2H8ZA 3GH5A 1ZLPA 1CEOA 1IYXA 1FWAC 4DWSD 4HPJA 4NXSA 2FZ8A 1RHCA 3P93A 1PJ9A 2C18A 3N29A 3VINA 2C8NA 3BC9A 3UWUA 4B5TA 4CQ9A 5I3FA 3GXFA 1FHUA 4LH8A 1AQMA 2QNEA 1E1CB 3IJLA 1TUFA 3MHUA 1WAUA 4B3LA 4LYKA 1B5TA 5A6AA 4LBSA 2AKMA 2DFAA 3HTWA 1OABA 5BMXA 3KEHA 5D2TA 4DO4A 4UR8A 4NZ1A 4DPQA 4KWOA 4V33A 4H6EA 3H2EA 4LYRA 3TYZA 1KCKA 2F84A 3TSBA 5CC7A 3ONCA 2NX3A 3NJ3A 1S2WA 4H9UA 3KRSA 1BSLA 1D2KA 1UKSA 2E8ZA 2ZXBA 3GH4A 1OFOA 3H23A 3HG2A 1J0IA 1GCYA 1UR8A 3I4KA 1H4PA 2VFHA 3B0YA 3DERA 4IOTA 4J2PA 1D8CA 5CPNA 2CXEA 2YL8A 4FOUA 2Z1KA 3KDNA 4CU8A 4D72A 3WLRA 4NAFA 5FF0A 2QEZA 4GO8A 1L2QA 4Q8MA 4IPNB 4IZGA 4NHVA 5LNSA 1KLYA 5IM51 1Q3NA 4EXAA 1G9HA 1XG4A 3TR2A 7TAAA 5AVNA 4AC7C 4YN5A 2A3HA 3CBWA 3L4VA 2OU4A 3KL3A 2RDWA 5T26A 3L0KA 2H3BA 1GK8A 2YW4A 5G2WA 3VD7A 4OECA 1Q65A 3GKFA 1GVIA 2PTWA 3ZQ9A 1XLFA 1EBHA 5DCEA 4NAFB 3GTHA 5AHNA 3M0KA 3LUTA 1ZU8A 4M7TA 3BZJA 1UB3A 3E74A 1OCBA 4WJEA 2I5GA 4UTWA 1KTBA 1RALA 5DF0A 1L6FA 3UXIA 1Q5MA 3WLHA 3M44A 4Q8UA 3GDRA 4CLMA 1LG1A 4JTEA 5FJTA 4ICMA 4Q6JA 1TJRA 1XDLA 3PZTA 3R8GA 3HGJA 2DW6A 1ZJIA 2J7DA 3BLPX 4JTIA 3T8LA 3RILA 1O1ZA 5I79A 3W71A 2J7CA 2UY5A 2X05A 2A6LA 5CPQA 3S1WA 1EZ2A 1UR1A 2DUZA 3ARWA 4GYKA 5DXXA 3EPOA 3MA8A 4AYSA 2PDJA 3P7YA 3LGEA 4UQ9A 3C8FA 4NT0A 6XIMA 1LBFA 3DHDA 1JL8A 1EDGA 2ACSA 2OLSA 1F73A 4F9DA 3WF1A 5I06A 3S6TA 1RY0A 1VQTA 3U48A 1MZRA 3NYZA 1TELA 1Y5VA 3FHAA 4UFJA 3BLOA 3DFPA 1M41A 1SFSA 4UTKA 1V3JA 3L2MA 3GG8A 1H61A 4RXFA 4MWAD 1KGXA 4PL2A 1H09A 2J9YA 3TC6A 1KRMA 2XVLA 3WKZA 2A85A 3KOWA 4RCXA 4HZ7A 4EXBA 2RHGA 5DT5A 5CPMA 1PCKA 2WKJA 1DIEA 2CZDA 4XAZA 3BAWA 3IUDA 5DCBA 3SUSA 4RZ4A 1QW9A 4GABA 3KBJA 3FJ4A 5GJPA 3KZSA 3H6OA 4RNIA 4HOZA 5G1TA 1UZDA 2VCAA 2ZUNA 1W3IA 3KVJA 2PWUA 5C2CA 1SZGA 3NOYA 3IGXA 5LNRA 3Q67A 2AL2A 3QV9A 4AYGA 1BQGA 3VMOA 1PDYA 3B0VC 2XU2A 3CV6A 3WJYA 3N2CA 3FKRA 1VJSA 3TP4A 3MUIA 3RFAA 3DU0A 4IG2A 2VD8A 3CYJA 2ISDA 3GZ3A 3OU8A 4Q8QA 3HB9A 2EKCA 3E0VA 5TIMA 3S1XA 1S46A 1JCYA 4JEQA 2J66A 4AZ7A 3C8NA 4GG9A 3SCQA 3VOFA 2AL2B 2OGYA 1OFBA 2QW5A 2L5HA 5JBEA 5I5RA 3LG3A 3WQ4A 5C55A 3NQAA 3FA3A 3U5YA 2C1IA 4KBXA 1LQAA 3RJXA 2ZYFA 4UTLA 1K9TA 2VEPA 3THUA 3LPOA 2A4AA 2DVUA 2WXDM 2WOQA 3KVMA 2YLAA 1WDWA 4R27A 1QASA 4J3TA 4N2YA 1XCWA 3FDKA 4H04A 3E5BA 2J4GA 3OTRA 3WDQA 3W1XA 3NL3A 3M6DA 3ZWTA 3CMFA 4F0MA 1IT7A 5A2CA 1H63A 5HWMA 3OBAA 2C16A 3GDTA 1ZHAA 4WLCA 4O8RA 4HMDA 2YCKX 1GYMA 5FEXA 2OEKA 1BQCA 2FVLA 4M51A 2A6NA 1H7NA 3T44A 3WH6A 4GUJA 3H2CA 1VBHA 1C91A 3MDWA 3M5VA 4C60A 1GYLA 4ERGA 3A4XA 4AEOA 1UPPA 2IPFA 1TB3A 2WBKA 4M81A 1QNVA 1W3LA 2PWEA 3I3EA 3LHWA 4LTSA 4AQLA 4GJJA 4ZSUA 3QR1A 3R89A 5F2LA 4NX0A 4HPNA 2QCDA 3UD6A 2YX0A 1YYAA 1EUNA 1ZBVA 4C1NB 1M6JA 3WDPP 3TCSA 4UTHA 1OYAA 1NP2A 2DZXA 3IIXA 3N3MA 3SQSA 6ALDA 4BS0A 1SM9A 1CXEA 1RCOB 4AD1A 1M04A 2AAMA 3OB8A 4UR9A 1UKPA 4QJ4B 1IXQA 3F03K 1FCBA 3IPWA 3A9IA 4CQCA 1GHRA 3E0LA 1EHNA 2WHLA 2WKLA 7REQA 5FF7A 1KC7A 4MF4A 1JCJA 5F2GA 3UJSA 2QCDB 3QTPA 4W89A 5CZJA 3R0UA 5EGRA 1W5MA 4KRTA 2EPKX 4FA3A 1B4EA 5A6TC 4QXIA 3DBPA 4JYFA 3U9IA 5AYYA 4C90A 5H1WA 4GISA 4IGHA 4HK7A 3WNMA 3IAQA 1J2BA 1T8XA 2NUXA 1XC6A 5FSEC 1NDWA 3KBNA 1QTWA 3N6JA 7REQB 3HQPA 4CN4A 1HIZA 2X1IA 2VXNA 4Z17A 1OGGA 3OLDA 1SW0A 3TWBA 2BY0A 1QHZA 3BAXA 4Z1YA 3ES7A 1FFQA 2V69A 4MB4A 3MI2A 1TX0A 2HEJA 1B3OA 3MT1A 3RCMA 2ZZ7A 4US6A 4TIMA 4GXWA 2Y70A 4G9PA 3BE7A 4N6EA 1TV2A 3S2MA 3L0NA 3ITLA 1VFSA 1IHIA 2BY3A 1VS1A 5DY3A 3EBVA 1NDYA 4NRRA 5FF2A 3CPGA 3O05A 2DZTA 5E0KA 3NZQA 2OO0A 2EJ1A 3S9IA 1Y0EA 3HIJA 1KM2A 3GIQA 3O0KA 3N73A 1RA5A 2ISVA 1XLGA 1K7EA 3PC0A 5CJNA 1I1XA 4W84A 3RPMA 3XIMA 1QVBA 4ZB0A 3EX3A 2YXGA 1IWAA 3UBPC 3ENLA 2G95A 4ZVJA 4OHQA 4WXYA 1UP2A 3MQTA 3PANA 3UXAA 4NZJA 4ZXOA 5G5IA 3ZSTA 1POJA 2A3LA 1DQWA 3PB2A 5CBBA 4GUFA 3IVSA 1P6CA 4AX6A 5BYWA 1XC4A 4TVDA 2P3ZA 3U7BA 4MJZA 3F4CA 3THDA 1O94A 1VLIA 3V3WA 1WBJA 4FNTA 4QG9A 1XQKA 5TBOA 4PUMA 1PL9A 3ZM8A 3GAKA 4AXKA 1LUCA 4XSMA 1BRLA 1LM1A 3BL3A 2VVNA 3LV5A 1FCUA 5F4XA 1BPLB 3WSUA 3RK8A 5HQMA 1R3YA 4I8DA 3NM1A 2FIQA 2XVKA 4C6IA 4DJFD 3RM8A 3VKBA 4QCFA 7ODCA 2CKSA 2EQDA 4JIIX 3GTIA 2Y88A 5I07A 1LOQA 3QM3A 4FR1A 1PWMA 2WMIA 3GLCA 4IQJA 1PZ3A 1LRQA 1RQEA 3WUEA 3VD4A 4LCRA 2XFWA 3UP8A 1LUCB 5DLCA 3C61A 3MUZ1 4GYJA 4A2RA 4F8XA 3VE9A 4HK6A 1DIKA 1NDVA 1U5JA 2ZVRA 1UYQA 3E2RA 2DUAA 4KEMA 2R14A 4XZBA 4ES4A 4K1WA 4Q4QA 4K7YA 5HWNA 4A8LA 4LBRA 1A5MC 1OINA 4CD8A 2YA2A 3FAWA 1GGOA 1A0EA 3FV9A 1JCMP 4GNVA 2XN2A 1QPQA 2W67A 2BVTA 1X39A 4OFCA 2OT1A 4JTGA 5A6MA 5JH1A 1DJQA 1W1IE 2VFIA 3UW6A 4GX8A 1LT7A 3AS1A 4JFSA 3WLOA 4DYJA 5D4YA 4H9XA 1B4KA 4L4MA 2XIOA 3NZ1A 4B5SA 1G69A 2DSVA 4MHBA 1XYLA 4HNCA 3T1GA 3WMLA 4Q32A 1WPCA 5JU6A 1MW2A 4XISA 1E6PA 1SZNA 4D6FA 4W9TA 4LVGA 4L56A 4D9PA 4IM4A 4FOKA 3TW7A 1EKOA 1EQPA 3S42A 1M7OA 2O56A 2Y0FA 2CERA 3GXMA 1M9HA 4BCEA 1HT6A 1VFUA 1SZFA 1QW7A 1EJUC 3TJXA 1V02E 3EXRA 1X8CA 5C70A 1ZQ5A 3R10A 3WF2A 3P82A 3HJEA 5BXPA 2VWTA 4Q33A 2ISSA 5KZEA 1EGZA 4OV9A 3CASA 1ISVA 2AL1A 4HNVA 1PPIA 4AEEA 2CU0A 1LL6A 2WVTA 4ENLA 4IP4A 4AF0A 3BSHA 4WVXA 1TPUA 3CTLA 1GQLA 2WSPA 2BOGX 3KAOA 4FI4A 1HKVA 2Z6JA 5D09A 3N18A 1V93A 5GNXA 5BW6A 1QXLA 4WOZA 4BA0A 2CC0A 3VDBA 3P5ZA 3T0AA 1W31A 3UPBA 3BLKA 4TV6A 4RDZA 2FPYA 3P0XA 4XKMA 1RQBA 4HOXA 5GJMA 4V1XA 1PYMA 4AF0B 1S3HA 2XWDA 1J9YA 3H55A 4GO9A 5F4SA 1PAMA 3MO4A 1R3TA 4ICNA 5HMSA 4DZHA 5A2AA 1SZRA 4JTKA 3UNDA 1XLIA 2W27A 2VVSA 4FB7A 2WQPA 2VL4A 3LU2A 1UROA 4KW2A 4P7QA 3BGAA 2CLEA 1P4CA 2X0HA 3C6CA 3H4GA 4CQBA 1UHVA 4WQ6A 4D71A 3EEZA 4XKYA 1GG1A 1L8PA 2WVVA 4BEUA 1KFJA 3VK5A 4K8EA 2VUYA 1F7BA 3A21A 2PTXA 1XYAA 1BWLA 1F3TA 2CW6A 4AB4A 1DTUA 4J5NA 4L4PA 4IXHA 1ELSA 2DT0A 1C8QA 3EOOA 3P80A 3COTA 4JDBA 4A35A 3UZXA 4KFNA 1YTDA 4F2TA 1V3KA 4Y96A 4IICA 2H9AA 4LUIA 4XKYB 1GVRA 1UWQA 3LHTA 2GJXA 2WVVB 2C19A 3R79A 2DORA 1K9FA 4YWSA 2G8ZA 4N7QA 4AU0A 1AJZA 1GZ1A 4GY0A 1L8NA 4JIPA 4X0NA 2W91A 4NNAA 1JAKA 2NWRA 3VIJA 5C9XA 4GIYA 4IIFA 1R8LA 1I0BA 1KQYA 3TUUA 4XO7A 4JEJA 2HK0A 3VCRA 1JD9A 5HWJA 5C9UA 4AZCA 2E7FA 2FMNA 4MZ1A 2H9AB 1CLKA 3OO2A 3QC3A 3USZA 3QR3A 2GJXB 1BXNA 4K6AA 4MUZA 3OVPA 3SY5A 1BTCA 2HBVA 4Q7NA 4PCPA 5LGZA 4Z0SA 4ECLA 1SSGA 2CYGA 2WJZA 4OBRA 4WSKA 3J7HA 2GK1A 1CB2A 1VR6A 3S6OA 2QDGA 1MUWA 4QAIA 3GXIA 1C9DA 3NQ7A 2X1TA 2PMQA 3AHYA 1UWSA 4NNBA 3G22A 4AZCB 1W9UA 2GQ9A 2RJHA 1MFVA 3ZR6A 3DI0A 3LPPA 2DH2A 5A6LA 2I5QA 4F48A 4HB7A 2NVDA 4CCCA 1EBGA 1OVDA 1S38A 2VD9A 4UQCA 4CNTA 4M1RA 4YHEA 1V5XA 4PMNA 5IOBA 2J62A 3O6DA 2PZNA 1PZ0A 2GK1B 4WY0F 1FH9A 1GVEA 2HXTA 5IHRA 2ZRXA 1N8FA 3NYDA 2IPJA 1FWFC 4JQAA 3CHCA 3V1HA 1LWIA 3TH6A 4PMOA 3CO4A 5FOOA 2XSXA 4H4IA 4UQAA 3UG4A 3HV9A 1B3WA 1FCVA 4OOZA 4BFAA 3NM3A 3W82A 3UYIA 3P67A 3U8GA 4F3HA 1GYNA 3WNLA 2YXXA 4JX5A 2VO5A 5SWUA 3WN6A 1DXIA 3CNYA 1DJWA 5T9BG 3U6WA 2J27A 3WQFA 3PAOA 4YTQA 4AW7A 2NQ5A 5CKSA 4ZCWA 3VD9A 3OLIA 2TYSA 4E8DA 2G3IA 3AALA 4LUTA 1H5VA 3APTA 4AZ6A 2VFEA 3VCNA 6PTDA 3ARUA 1U33A 2PDBA 3JS3A 4PCNA 1SSDA 2ZQ0A 5I2UA 3CGTA 2DW7A 3H24A 1B3ZA 4OU1A 3GDKA 1F5ZA 1UWIA 3W7MA 1YQ2A 2PWFA 2VELA 3CEPA 3W2MA 2E68A 1Q8AA 1H49A 1HL2A 1WOBA 4ZO9A 3T81A 3BWWA 4D1JA 1YRRA 2Q8ZA 4AWSA 1F6KA 1HKIA 3RAOA 1HO4A 4LUTB 4AZIA 2QAFA 4HA0A 2MUCA 5HATA 3VIFA 5AYBA 4BHYA 2PUZA 4OVXA 4C5YA 3EWZA 1EL3A 1LLZA 4UFKA 4Z2KA 1D7FA 4TX8A 3XINA 3TE9A 3P6LA 4M5PA 1TVPA 2PD5A 4NRSA 3JU2A 5E93A 4O4WA 3PG9A 2Y8KA 4B9ZA 3PJTA 4LC8A 4PMRA 3BQ5A 3WQ5A 5E0FA 5LIYX 4IMDA 4HSNA 1NWRA 5E0CA 2OLAA 4GNJA 4CNOA 3BARA 1YTEA 3LHUA 3L4WA 3W1QA 1KCLA 1N7KA 1AH0A 3VUSA 4J40A 1VP5A 3QGVA 5E9AA 4FXFA 3L4UA 4M82A 4DXVA 3MMTA 1HZYA 4IUOA 4S2CA 3EA2A 3WBEA 3WQPA 1A5LC 5JIWA 4FXRA 1E9LA 2W5FA 4LY8A 2R24A 4Q22A 3LV6A 4PTNA 4RPQA 2RH9A 1LP6A 4GRSA 3HFTA 3DIPA 4LQ1A 4E2OA 4N0RA 3SUTA 3BCFA 1Q66A 1V7YA 3C0SA 4TX9A 2C1GA 2WJDA 4DM1A 4TVCA 2YYTA 3W7QA 1V6UA 1WNOA 1UD6A 2OT0A 1JDDA 4A8NA 3P62A 4MJMA 1WKDA 2CZ5A 3EX2A 4B15A 1V08A 3A9BA 3LRMA 1ODUA 3QZ6A 4LEQA 1AL8A 1JULA 4QM1A 3AROA 2Q3OA 3HPFA 3S47A 2B4GA 2ATSA 4H8UA 1LOLA 1PZ2A 5CLWA 4GVIA 4XK2A 4DUWA 1B3VA 4DJED 2UY3A 1ZFJA 4V15A 5AFDA 3E2QA 3W83A 4YCOA 1CCWB 2QIIA 1C8XA 1FH7A 2WC3A 4DBWA 4UIOA 5B7YA 1JCLA 1P0BA 2Y8VA 3I7SA 3RG6A 5HNRA 3URNA 2VC7A 5G1YA 4JHZA 4QAWA 1H7PA 5AOUA 1C93A 1DIDA 1B0IA 3EWBX 2ABBA 5CC5A 4N9EA 1BVZA 2CIPA <