4UIOA

Structure of the salmonella typhi type i dehydroquinase covalently inhibited by a 3-dehydroquinic acid derivative
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
250
Chain Sequence
b'TVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Chemical Modification of a Dehydratase Enzyme Involved in Bacterial Virulence by an Ammonium Derivative: Evidence of its Active Site Covalent Adduct.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Lyase
total genus 94
structure length 250
sequence length 250
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4uioA00
1L2UA 1D3HA 4MUZA 2Y70A 4O0KA 2DZWA 4QISA 2GPTA 3DFTA 2ZRWA 3W07A 1H7WA 3SJ3A 2C3ZA 3HQ1A 2CLHA 3O05A 1LBLA 3PUDA 5FI8A 3PB2A 1P0KA 3T78A 2PC4A 5DLCA 1LYXA 1A5AA 4CNPA 2RDWA 5LKYA 2VELA 1RZMA 1UUOA 2EGZA 3W7EA 4QIUA 4JY9A 3P84A 3WJSA 4MZYA 2ZRZA 3NQ8A 2PE4A 3TAKA 1R30A 3OG3A 2C18A 4ZMGA 1TPWA 1FQ0A 3NPUA 1F76A 1H60A 3TSBA 2F84A 3W7KA 3HGRA 3BGJA 4DO5A 1K7FA 4JDYA 2DZTA 5K9XA 4NJHA 2A0NA 4O19A 3W2NA 4QNEA 1L9WA 5AYXA 5AHFA 1BWLA 4IMGA 4E2BA 4FNSA 3TW7A 3P5ZA 1W5PA 1IIHA 3NVTA 3S1XA 2XFWA 4ICNA 4LWWA 3GKAA 1WBHA 2H3DA 5J5RA 1SFJA 2ZZ6A 3RFAA 4HKPA 1KFEA 5CPMA 2F7FA 2V5BA 1XI3A 3TJLA 3WK2A 1ONRA 3W1AA 4JICA 1ZALA 5D32A 3I6RA 3A5FA 3TKFA 4BFAA 3FYPA 3W23A 2NUWA 2FLIA 1TRIA 2C16A 3KXQA 1ZNNA 1MO0A 1KTCA 2WKJA 1VHCA 1UASA 4M6VA 3NQ7A 3LCWA 1JCLA 5AYYA 4AF0A 3P61A 3ABRA 4FEZA 3GNDA 4X2RA 3TUUA 2E6FA 3OVRA 4IMFA 2X1TA 5DBTA 2ZZ7A 2A6LA 4YXGA 5CPNA 5D2XA 2WJZA 1EP3A 2CLKA 3GVGA 1SO6A 2V30A 5LNUA 4XTDA 2ISWA 3BG5A 3SGZA 3C56A 4LVGA 4R53A 1TPC1 3DFOA 3M1ZA 1VCFA 4HSOA 4AHPA 4LC8A 1K8XA 4JX5A 3DKLA 3LI0A 4RKAA 1HG3A 4RXGA 1O5KA 1WDWA 2BWGA 1QDSA 4DBEA 3A24A 2YCEA 1RVGA 3PC0A 1NF7A 3R8RA 3TFXA 3BG9A 2WO5A 2ZBTA 4UTWA 1DBTA 1FCUA 1GG1A 4M7SA 5EBUA 5K3VA 2QCEA 3L66A 3M9YA 3SZ8A 3IVUA 1F73A 4ML9A 2FFCA 4JYEA 1GWJA 2OX1A 2CLFA 2DZVA 4E0CA 2E1DA 3WJWA 1SR9A 1JQVA 3UPWA 3MHUA 1SUXA 3W76A 4IPJA 1J5TA 1XM3A 5J5DA 2J6XA 3FJLA 2E68A 4XUGA 4LVAA 2QCMA 4O28A 5CSRA 4OGZA 3THAA 3N9RA 4OWGA 4N02A 4NZFA 4PA8A 2V2CA 4UFHA 5TIMA 5BOOA 4XTIA 2ATSA 1H61A 4S2BA 4FIQA 2WSQA 4Z0JA 4UTUA 4MZ1A 8TIMA 5G2HA 3IGSA 3STEA 4K39A 5IBXA 1MXSA 2HS8A 2QKFA 2O7SA 5C2XA 1R46A 3H54A 3QM3A 1UB3A 3VNDA 5E1QA 3B4UA 4GE8A 1FY6A 3CIXA 4BI7A 1KLZA 2YFNA 3BW4A 4ADUA 4CNOA 4LNYA 2QDHA 3O6CA 1Z41A 4PFMA 1IXNA 1KW1A 1DL3A 1OFPA 1IF2A 4JTKA 4XBSA 3PBVA 1PCWA 2ZTJA 4A22A 3TFCA 3O6DA 4Z1DA 4FX8A 1SFLA 4PL1A 1QO5A 3G1DA 4LVFA 5D04C 2DU2A 3S0CA 3M7WA 3IIXA 3NO5A 1O95A 2Y88A 1YTEA 4UTIA 4GBUA 5A8GA 4O57A 1ML1A 5H91A 1EIXA 1QFEA 4AF0B 1OK4A 2DP3A 4RZ4A 5LNSA 1TPVA 3DI0A 1IXPA 2JKPA 3PM6A 1B3OA 1Q45A 3P74A 4P61A 5F4SA 4LY8A 5HULA 1FCVA 3TQVA 1TB3A 1LDCA 3PVFA 2A7RA 3L0NA 4CCDA 1W31A 3W72A 2V8ZA 4LS0A 3HGOA 3IIOA 1LRTA 3STGA 1Q6QA 1Z44A 4NJKA 3NZRA 1W8SA 3KVKA 1TPEA 4JTFA 3GXTA 4TU1A 3HG2A 4MJMA 3TCEA 4DF0A 1TTPA 2DZSA 3MJYA 1MZHA 3G1XA 1BEUA 3G22A 5AHEA 3MMTA 5CSSA 2QF7A 4WD0A 3YPIA 4A21A 3S5NA 4AWUA 1S5WA 2EPHA 3O07A 1AW1A 2ZQ0A 4YLWA 3R13A 2VEPA 1Q6LA 3W1RA 3C2VA 4AHOA 1KM0A 1V5XA 4MY9A 2NZLA 3G1YA 1ICSA 2ZZ3A 4OQVA 3A23A 3FS2A 4KWVA 4GC4A 2ZFAA 2ZRVA 3C2RA 5BMWA 2YYTA 3O15A 2NUXA 3N19B 1ZAIA 4IXHA 1LOLA 1VYPX 4ONVA 1OFOA 2BZNA 2B7NA 5D09A 4O13A 2Y63A 3QZEA 1W3IA 2VXNA 1H7OA 4Z1BA 1H5YA 5DBUA 5FEPA 3PWAA 4UUIA 3M16A 5EPDA 3UWYA 2A4AA 3OA3A 5ABTA 4EOUA 1FWRA 4LW7A 3L0GA 3OBKA 1LRQA 1TYGA 3C4UA 3LHUA 1H51A 3KHJA 2Y85A 1XUZA 1KA9F 2GQ9A 4FXRA 3H53A 3UWUA 2C6QA 1SSDA 3TV8A 4B5NA 4O18A 3QFEA 5AC6A 3CU2A 3E02A 1KTBA 3GDTA 3EWZA 3S1VA 1QPRA 1OK6A 1ZY9A 2QUTA 3EKZA 4M6QA 5D33A 3G1SA 3ATZA 3TJXA 3P81A 4O0ZA 5K9DA 3FYOA 1A50A 4S1FA 4A2SA 1FX6A 2RDUA 3BVJA 3Q94A 4ADTA 1LORA 3LRLA 1OYCA 3QMTA 4LC6A 1K8ZA 2X16A 3DU0A 1OFAA 3F1QA 2ZA1A 3EXRA 1IXOA 2WPBA 1G7VA 5LHEA 3TR2A 1W37A 2VOMA 3GR8A 3D0CA 3W2UA 1G67A 4UMBA 1XBZA 2VENA 4W9TA 3I7SA 1WOBA 2JGQA 1OFQA 3A5VA 3NDOA 3QYQA 3GB6A 4WOZA 3C2EA 4POCA 4DO6A 4LRSA 1VGAA 3S6DA 2OCZA 1JCMP 1S5VA 4M5PA 1EP1A 2A6NA 2VEMA 1RQBA 2DZUA 2KZHA 5A5WA 4QNWA 1AMKA 4K6AA 3EX4A 1RQHA 2QAFA 4KKXA 5U4NA 3M6YA 4EVZA 1T0OA 1YPIA 4YWIA 3U6WA 2PURA 2VFEA 4WOQA 2V81A 2Y7GA 1R2SA 2NV1A 3AO0A 3W7LA 3DKJA 1QPQA 3MYOA 1R2TA 1SW0A 3RK8A 2J27A 2X1RA 4RXFA 3S5ZA 2ZZ4A 5KSWA 4N6EA 3NQAA 2QCNA 3LHVA 1TPH1 4P2VA 4K36A 3MP3A 1M7OA 1LLWA 1WOAA 3A9IA 5AC7A 4BI5A 2CLOA 4JY8A 5AOUA 5LSMA 3W7GA 1XXXA 3QEZA 4EF8A 3KRUA 3OHIA 5DCEA 1C29A 3GYEA 1XFBA 3UNDA 1VHNA 3IRDA 3HMJG 1MEWA 3BLIA 2GQ8A 1VCVA 3L21A 1CX9A 1GVSA 1ZAHA 3LCIA 3DGRA 5HWNA 1GVRA 1I2RA 4Y90A 2C0AA 1M5WA 3HPSA 3NPVA 1QMLA 3GDKA 1FDJA 1XDMA 1KFCA 2FB2A 3UXDA 3W7CA 1UBSA 1OF8A 2R14A 4ZQNA 5KITA 3DH7A 2QEZA 1T99A 1XDLA 2WNNA 1L6WA 4TIMA 3ELFA 4JN6A 4NUWA 4ORIA 3TROA 2A21A 1LRNA 1N8FA 1T8XA 3PY2A 1PVNA 1U83A 1KLYA 4D2JA 5FF0A 5HJLA 4GRSA 1JJKA 1H7RA 2QJGA 4R7JA 5F2MA 4CQ8A 3HPZA 3OVQA 1NF0A 2HMCA 2JGYA 1DQXA 3W2LA 3GNNA 1W56A 1ALDA 4MY1A 1Y0EA 3TH6A 5D2VA 4WXZA 3SECA 3CB8A 1B4KA 3LCGA 3TX9A 4HPXA 4BWLC 3PSVA 1O5XA 4MFDA 3W2JA 2V0TA 2H8ZA 4AMAA 1K03A 1ME9A 1I8JA 4MVAA 4RK8A 4MYXA 1LBFA 4E2DA 3HGSA 3WK1A 4JS3A 5D02A 3T55A 1K02A 4RX0A 3V1PA 1RPXA 2RH9A 3ABSA 4Y8FA 3BGGA 1OX5A 5F4WA 4RZ5A 3W7NA 1W5MA 3W85A 4LUJA 4JNMA 1T96A 3CT7A 4CLMA 3W86A 3BPWA 3FKKA 3EXSA 4ALDA 2ZRXA 3WJXA 4WQ6A 1JVNA 1X6UA 2Q3OA 2HTMA 2FQIA 4AWSA 2OT1A 4OE7A 2RHGA 1DQWA 2G96A 3M5ZA 1FWWA 3LHWA 2GUUA 4ORMA 3PSWA 3MW7A 4RJEA 3VCRA 1JUKA 1CI1A 3TC7A 3P5YA 2J9YA 2NXGA 5HR7A 1KM5A 5G1TA 1F05A 1W0MA 2VFDA 2G95A 4MLJA 4JIPA 3I7QA 1K8YA 3K30A 4XZ9A 3USBA 1FDZA 4JEQA 4NX5A 4JD4A 1I2PA 5K4ZA 3NNTA 2ISVA 1QOPA 3BW2A 2XN1A 3E49A 4LVBA 3UWQA 4O16A 4FB7A 4ZQPA 3DHFA 1UJPA 3STFA 4EWND 2NXHA 4NQ1A 3LHTA 5FF7A 1OG0A 2WQPA 1LP6A 5I3KA 3UY7A 2CZFA 4ZQCA 1P5BA 4RR4A 5G4EA 3IEBA 5F2GA 1SO3A 1VZWA 3N2MA 4OBTA 2VEKA 4WUIA 4A29A 1I2NA 2GVJA 3W70A 1TJRA 2QCDA 3KVLA 3RLUA 2J24A 3NOEA 4UC5A 3INPA 3EWXA 2TSYA 2AQWA 4I7VA 4OT7A 1SO4A 1M6JA 2E77A 2ZZ1A 3TXZA 4MJZA 3W22A 3O6YX 2VC6A 1TV8A 3RLVA 5DXYA 4ADSA 3E9AA 5FEWA 2PRMA 3QJAA 1XBVA 3DHDA 3LTYA 1KBIA 4AWTA 1TO3A 1VRDA 4FNPA 4TO8A 4AHQA 4O4VA 1W3NA 5L9FA 4UTKA 5AC8A 1SW3A 4RCXA 1OFBA 2GVLA 4JTUA 2BSLA 4S2CA 2OZ0A 4NT0A 2QJHA 3NA8A 4IXXA 3P8JA 3S5YA 1OX4A 4JTHA 4CNNA 5HNRA 3LCFA 3GAYA 2ABBA 3LXBA 1WA3A 3G18A 5FEZA 5MHBA 4FXSA 1LBMA 3M41A 3O16A 2VEIA 2CLMA 4ZQMA 1FUYA 5D2YA 1U5JA 1SZEA 3RMJA 3TDFA 4IMEA 1FWNA 2I9EA 3HOJA 1KBJA 4JTTA 4A3UA 4N9DA 5AHMA 3CLMA 3KFTA 4M7TA 4O1DA 4DPPA 1G69A 1F2JA 3ZWTA 4MFEA 4WY0F 2EAWA 2B7OA 1BWKA 3TSMA 1F74A 3DI1A 3LTSA 4LV9A 3UWWA 2DJXA 2Y61A 4I7UA 4ZL1A 1G7UA 1P1XA 3EWWA 2Z1BA 5HUOA 1VYSX 4NJJA 5BMXA 2DORA 4UTLA 5D30A 3SR7A 4C1KA 1TPUA 1HO1A 1FBAA 2PRLA 3W2MA 3VKJA 4O54A 2Y89A 3CHVA 1VS1A 4K8EA 1PCKA 3TQKA 3BLEA 3HIJA 1TPFA 3RF9A 1J4EA 1EX5A 4GUJA 5G4WA 1IGSA 4IGHA 3UYCA 4HNTA 3QSRA 4X3ZA 2WSRA 2YYUA 3TXVA 3CC1A 1H7NA 3CEUA 1PE1A 3B8DA 3LB0A 2X1UA 4J9JA 4HNVA 1NAL1 4JTJA 4OU1A 1E51A 3BV4A 4IX0A 1KFKA 3F4NA 1R47A 3W74A 3FKRA 3N3MA 3P7YA 5CGQA 2YW4A 3HG5A 1TSIA 4FNUA 4BWLA 2HSAA 4UFIA 2V9DA 3L0KA 4UR7A 4JIQA 2E5CA 4BR1A 1GOXA 3TA6A 2JKAA 3N14A 4YCPA 2JKEA 5TQLA 1OF6A 2YR1A 1O94A 3CWNA 5I3GA 2G97A 3WFAA 3N34A 3WJYA 2Z6JA 2B7PA 3P60A 4FNQA 2C19A 1TMHA 5CZTA 2LLEA 3TAOA 3HPXA 2QCGA 3LRKA 2HS6A 3PR2A 2QDGA 2VKZG 3A22A 1B4EA 4HSNA 2RFGA 2ZZ2A 5T26A 4HIBA 4IJBA 5DY3A 3GDLA 1IXQA 1M7PA 4JDBA 4NJGA 2FPTA 4IOTA 3CQ0A 5LGXA 3R2GA 3M0ZA 3SW6A 3B05A 3QPYA 2R91A 3LXAA 5F2IA 4UTTC 5E93A 1KM2A 2A85A 5D03A 1OVDA 4PTNA 1EP2A 1OYAA 1X7FA 3R5EA 3SSJA 2YW3A 1OX4B 1TCDA 2QAPA 2CLIA 1KV5A 3FLUA 1OABA 1VC4A 4PC8A 1OX6A 2OT0A 5DCDA 2QCLA 1TQXA 1KM4A 3PB0A 3HJZA 2Y6ZA 1GZGA 1YDVA 1TQJA 1DVJA 4XQ6A 1AL7A 3GXNA 3IIVA 3CWOX 4N2YA 1FCBA 1G6CA 2QR6A 3UQNA 1QNVA 3M43A 3LCHA 4K7VA 1LLZA 3C2FA 1VR6A 1FWTA 1HL2A 4DPQA 5EY5A 1TPDA 2CW6A 1PHWA 3NL2A 4XKYA 4UNKA 1TRDA 4FHAA 2XN2A 4QITA 3F03K 3GK0A 1A5BA 1Q6RA 3PAJA 1I4NA 2W79A 1JUBA 4O12A 1C8VA 3QMRA 4NVTA 3THQA 4MLRA 3MO7A 4JTLA 1N55A 5K7JA 4O1AA 4MYAA 3KX6A 2NX1A 3B0PA 1XUUA 3QPZA 3PG8A 1KM6A 4H4IA 3P62A 3AJXA 3PUEA 1SSGA 1VH7A 2NWRA 1JCJA 4N4QA 3NQ2A 3PULA 1YTDA 2QCHA 2NV2A 3BO9A 1XBXA 1PV8A 5LNVA 5LZLA 1QCWA 4UFLA 3EX2A 3W73A 4HNUA 1XBYA 1SW7A 2TYSA 4HNNA 2X1SA 3W1MA 4JTSA 2C1HA 3W7IA 3W1TA 4O8RA 1GVFA 1SO5A 4FX6M 3SI9A 1NEYA 5LGZA 1K7XA 1BTMA 4QSHA 5HINA 2D73A 1FDYA 3LERA 1DJNA 3EEGA 3T44A 5KINA 5LNWA 4Y96A 1VCGA 1W1ZA 1DJQA 5LNRA 4Z1AA 4Q32A 1YADA 1QWGA 3E12A 3W1XA 1KFBA 1I45A 3UXAA 2WSYA 2CZ5A 3E96A 3NPXA 1J2WA 2ZYFA 4KFOA 5D38A 1N7KA 1O60A 1OJXA 2A2IA 3C8FA 2DJLA 1YDNA 2ZA3A 1L6YA 1TTQA 2YDAA 2X30A 4M19A 4NX0A 5G2IA 1ZAJA 2V82A 1NFBA 3W84A 5K4XA 3LHYA 3NQGA 5CKSA 3EWBX 3RNDA 1Q3NA 4UFKA 5K2ZA 3QRHA 2NUYA 4DF2A 2ALDA 4WXYA 4XBKA 1GEQA 2RKXA 4WZHA 1GYLA 4JYFA 2DZXA 3O63A 2C14A 3TSDA 4IMDA 2ABAA 3DENA 3NPWA 1W5NA 2CZEA 2FB3A 3IVSA 3W7RA 1NVMA 3FOKA 4JTEA 3KRSA 1MEHA 4FF7A 1Z42A 1KFJA 1ZENA 4C1LA 4NU7A 3SGUA 5HWJA 4I7WA 4CQAA 4YCOA 4KFNA 1HO4A 1G4EA 4FNRA 4OHQA 5CZJA 2TMDA 1HTIA 5AB3A 3G8EA 5CPLA 3KRZA 1GYNA 2WNQA 4FO4A 1PL9A 3KVJA 1VLIA 3Q37A 2ISSA 4LTSA 3GX9A 1DV7A 1ME7A 1TV5A 1DORA 5DELA 4DQWA 4HPJA 1ME8A 1YDOA 5CPOA 4PCFA 3IIPA 1JRBA 2IQTA 2JBMA 3TU9A 3QW4B 5D2TA 3T40A 2CLEA 1TJPA 2Z0IA 5HUPA 4IPIA 4UTTA 5EL1A 1OFRA 1TIMA 4CCCA 4Z0SA 4UTHA 3PBUA 3TW6A 3BW3A 1ADOA 2XN0A 5K9CA 3FJ6A 3FEMA 3DFQA 2QUUA 1EEPA 4O52A 4EF9A 1XCFA 5CZ0A 3U8GA 3KAOA 1DKWA 3HG4A 1A5SA 2ZA2A 1YLVA 3S8HA 3CPRA 3JS3A 4O50A 3VE9A 1OFEA 2CZDA 3N2XA 4R33A 3N9SA 3LOTA 3W7PA 6TIMA 5F1VA 3B06A 3GXPA 1TTJA 3G24A 3MI2A 4LVDA 3O8AA 4L4MA 4PEKA 1IIGA 1JCNA 4LU0A 5E0KA 3TC6A 4DBDA 5HR6A 2B7QA 4NJIA 2WV8A 2GQAA 2Y7EA 5D2WA 1L6SA 5F4XA 3M47A 4MY8A 1VQTA 1W5OA 1SPQA 2ATMA 3W7JA 4ZQOA 5AHIA 3M44A 2QCCA 3QW3A 5KZMA 4O1CA 5FF3A 4MZ8A 4Z1CA 4CCEA 3NM3A 2DZPA 2BLEA 3W88A 4Q33A 1F7BA 4UXDA 3UZJA 1SZFA 2RDTA 3LM7A 5BNKA 3NL6A 2J88A 3MBDA 2BTMA 3MUXA 1I2QA 1GT8A 3EX6A 5G5IA 4O10A 3E0IA 3G3MA 3EKLA 3IGUA 2A7NA 2E5BA 2V2HA 3PBWA 4Y6GA 2QJIA 3LCLA 4L4LA 4N9BA 4FX7A 1XKYA 2PCQA 3LBCA 1TPB1 4LS1A 1YXDA 1YXCA 3MP4A 3G1VA 3S42A 1JULA 1SZNA 1QOQA 3NQ6A 3NQMA 3OEXA 2NXIA 1D3GA 5GVJA 4O4WA 3DZ1A 2FJKA 1ZHAA 3PBYA 1ICQA 1AL8A 1S5TA 5KZEA 3HF3A 3SFKA 4IX2A 1OHLA 3LLFA 2YXGA 3LX9A 1UUMA 3ZS4A 1C9DA 1JCYA 3DAQA 4A2RA 5AHNA 4HHPA 1JUEA 3G0SA 1WAUA 1KFLA 1G4PA 1BKSA 2V5LA 3W7QA 2Q8LA 3W71A 3NQDA 5EYWA 5C6MA 5DXXA 3G1AA 1GVQA 3GIYA 3UZ5A 3TNOA 3CTLA 4IMCA 4O53A 3EB2A 5U7SA 1R2RA 1EB3A 3QH2A 3LRMA 1FCQA 1W54A 2YPIA 4K38A 4UCGA 2NX9A 3G1FA 3LCXA 1WX0A 3L2IA 1KM3A 3GAKA 3LV6A 3W1LA 3I7RA 4O1BA 2P10A 1GVOA 4AEOA 3GR7A 7TIMA 3WJZA 3O06A 4LOCA 2ZTKA 3P67A 5EA9A 4LV4A 4Z08A 2YZRA 2H6RA 3MI6A 4LS2A 4EIVA 1VYRA 4LUIA 3T4CA 3PS7A 3CIWA 1RQEA 1VPXA 4JTIA 4TMCA 5H2ZA 1PHQA 1WBJA 4JX6A 1H1ZA 3S9YA 3WK3A 3NQVA 3C3NA 2ZDRA 5F2LA 1SZGA 1LTDA 3GLCA 5DN1A 4LRTA 5C5YA 5DY2A 3W1QA 3PUOA 1GTHA 3W7HA 4AAJA 3ZFHA 3LDVA 4TR9A 1OFDA 2I14A 4XWUA 3BARA 2CWNA 1K7EA 3VI2A 1FXQA 5HWMA 2Y7FA 3R12A 4O15A 1AW5A 1LM1A 4GWEA 5EKYA 1AG1O 3T7VA 6ALDA 4UFMA 1WV2A 3MYPA 4NNBA 3L67A 3W6YA 5KTLA 1VJIA 2E09A 2EHHA 3DBPA 3LBMA 1SQ7A 2A7PA 3ABQA 5EMUA 1F6PA 3DFSA 5C54A 3NL3A 4X22A 3W9ZA 4UMAA 3C0JA 2E6AA 3LXCA 5AHLA 3W3OA 4KWWA 5I3JA 3A21A 2J9XA 5FF4A 2FIQA 3L9CA 5SWUA 3PG9A 5KZDA 3P8IA 3VE7A 2I1OA 2A1YA 3EX3A 4ZVJA 5L6UA 2H8XA 1H7XA 1VLWA 2NWSA 3L5LA 1LOQA 3B0VC 4N9EA 3LV5A 4YL2A 3S1UA 2Z2UA 2QCDB 1H50A 4JTGA 2PRHA 3GKFA 5F1UA 2JK2A 4QAIA 1RR2A 4PODA 1LCOA 1GG0A 4R34A 5FESA 4GFSA 3EX1A 3W75A 1SU5A 1TREA 1V7YA 1Z48A 1P4CA 1WXJA 3WK0A 4MOZA 4JR5A 3W7DA 4JXCA 3S1WA 4PH6A 4YMZA 3OVPA 1HFBA 4M6PA 1G4SA 2UV8G 4UR8A 4BK9A 4UMCA 1EPXA 4OV4A 3NXFA 2FTPA 3L68A 1P0NA 2QUVA 1EWEA 4MPQA 3NQFA 1THFD 3QQ1A 4UNLA 1EWDA 1QPNA 2B0MA 3C52A 4O14A 1TTIA 4JGDA 4GUIA 1TV7A 1QAPA 3NEVA 4AXKA 3NZ1A 4GNJA 3MWAA 3HO8A 2FPVA 1UCWA 3QC3A 3MI3A 4UIOA 4K37A 1GTEA 1HUVA 2YSWA 4Q4KA 4QM1A 4QQ3A 3IIZA 4NZJA 2ZZ5A 2H90A 4X9SA 3UPBA 3H55A 3GZ3A 3G1HA 1JQXA 3GDRA 1LOSA 2FDSA 4NNAA 4MIMA 4UTJA 3G3DA 1D9EA 3L65A 2J9ZA 4GUGA 3F4WA 3MBFA 4HT3A 3M5YA 3PF3A 4DO4A 3B03A 3FFSA 2W0UA 1JR1A 3NYZA 4K8HA 3UY8A 4BF9A 1YTKA 3L5MA 2B4GA 4UTMA 3I65A 5CZSA 2E6YA 4RZ6A 4WY0A 2VFHA 5I3HA 2CFFA 1X1ZA 4G1KA 1X1OA 3CEPA 3DFNA 5I3IA 1OYBA 3LHZA 5BRBA 1O4UA 3W1PA 1S3HA 3FIGA 1PS9A 4GXMA 2V2DA 3QMSA 5DCBA 4GUHA 1EUAA 3NM1A 4DXVA 1YPFA 3QQ0A 2EF9A 3R89A 1KV8A 2CLLA 3LTPA 1WYIA 3NGJA 4FNTA 5HMSA 1H1YA 3I68A 2C15A 4CQ9A 3ZWSA 3SY5A 1KTNA 1DHPA 2VFFA 3G0XA 5FEXA 1FXPA 2WOQA 4JYDA 4E38A 4K7YA 3MHFA 4O11A 4IQLA 3EWUA 3STCA 2Q8ZA 5AFDA 4U28A 2GOUA 4IUOA 2AGKA 2E6DA 4AB4A 3DXIA 3W83A 3L5AA 3QSTA 3B0UX 1XL9A 2VFIA 4N4PA 1JCXA 2BXVA 3NG3A 3P82A 2VFGA 3NQCA 2C13A 3JRKA 3W1UA 2YX0A 4O17A 2NX3A 2O7QA 4GUFA 3N73A 2P0OA 1ZCOA 3IV3A 3TIMA 3M5XA 2YFOA 4N9CA 3Q2DA 3DFPA 3ANYA 3HG3A 4IWWA 5FF2A 4PL2A 1B9BA 3M5VA 3S5OA 3W7OA 3NR0A 3V75A 3IVTA 1NSJA 1JRCA 3P80A 5G1YA 3SIZA 4TMBA 3IGXA 5TBOA 1B57A 3OIXA 1F5ZA 3MP5A 1FWSA 1YXYA 1YYAA 3MHGA 3ABOA 4H6KA 5G2WA 1H7PA 1EA0A 3G8RA 2AAMA 4NNCA 3QF0A 4QJ1A 3UWVA 1LROA 3NQEA 4Y9AA 2G5WA 3Q58A 2QCFA 4N6FA 4NXSA 2TRSA 1MEIA 1RV8A 1WQ5A 5I3FA 1QO2A 4H3DA 3C6CA 3G0UA 3HBLA 4XKYB 2CU0A 3VFLA 4UTWC 5D05A 3EXTA 3C61A 1EUNA 2EKCA 1RD5A 3C2OA 3TMQA 2NLIA 5BW6A 4WX2A 2Z6IA 1W3TA 4AVFA 2Q3RA 4UFJA 4KFPA 3BK0A 4WY0B 4DEFA 3KOFA 3TK7A 2YGYA 4RV8A 5HQEA 4AH7A 1GQNA 1F6KA 2P1FA 1A53A 3B04A 4RLIA 1H62A 2ZCGA 4NXKA 2ZRUA 5D37A 3LI1A 1Q6OA 3JR2A 1MSSA 1QR7A 3TE9A 4BI6A 4DELA 1AW2A 3W1NA 1ICPA 5C55A 3O1NA 3RU6A 5LHFA 2FPYA 2H3BA 3TMLA 3CM4A 1H63A 5IBXC 3BLFA 3UD6A 1AK5A 3HGJA 1KM1A 3FA5A 3GDMA 2OMAA 1A5CA 2W6RA 2E5DA 1CW2A 4WJEA 2WNZA 3LLDA 3TQ0A 4FIRA 2Y62A 1ZFJA 5AYZA 3UWZA 4ZZ9A 2R94A 4I9AA 4U4MA 1GJPA 3NAVA 1GPWA 3NL5A 4GJ1A 1X8FA 3ZR4A 5KMYA 5IM51 3KVMA 2GJLA 1LZOA 2BX7A 2Y7DA 4DF1A 4OV9A 3ATYA 2GVGA 1PIIA 2TPSA 3LGEA 4LT9A 2X2GA 3HB9A 5AN7A 1DOSA 1XC4A 3U2OA 1G4TA 1K3UA 2ZRYA 4TX9A 1QPOA 4ZQRA 1W5QA 2GJNA 3BG3A 2OJPA 4MKNA 2A5HA 1I2OA 3W2KA 3W87A 5CG7A 2R8WA 3W7MA 4JX4A 3EWYA 4HN4A 1ZJIA
chains in the Genus database with same CATH superfamily
1D3HA 1E43A 2Y70A 2DZWA 3BURA 3QZ6A 4QISA 4E3TA 3DFTA 1XIGA 3DG7A 1RY8A 1ZGDA 2CLHA 2ACRA 3PUDA 1ZUAX 1EYWA 1P0KA 2Z27A 3ZXWA 3WSUA 2NVAA 2VGIA 4GYFA 2UY3A 2QQ6A 4JY9A 3P84A 2PE4A 3TAKA 2C18A 4S3JA 3PTDA 4FOUA 2F84A 3W7KA 4HPNA 2OZ8A 3VINA 3BGJA 2XIIA 1K7FA 3WQDA 1L8PA 1AZ1A 3BH4A 4U33A 2A0NA 4DNMA 4O19A 3E2RA 3W2NA 4PMNA 5JBEA 4IMGA 5I6SA 1YE4A 4FNSA 1ZRQA 2XYLA 1W5PA 2DT1A 2FGLA 4UBPC 4H41A 2XFWA 1OGBA 4ICNA 3GR4A 3TYAA 5J5RA 1T7LA 2WZIA 1KFEA 1UR1A 4QR6A 2E8ZA 3W1AA 2OLAA 5D32A 4C6KA 5BROA 4JTCA 4Q8VA 3CHFA 3RAOA 3RJXA 2VRKA 1UP2A 2I17A 2C16A 3KXQA 5IRPA 1MO0A 1KTCA 4Y9MA 2WKJA 3WX7A 1KGWA 3CYJA 4PMZA 4DJFA 3GNDA 3OVRA 4F48A 4YXGA 5CPNA 5D2XA 1SO6A 2VD9A 5GNZA 3U3HA 3BG5A 1Q7QA 3C56A 3SGZA 4R53A 3NVDA 1LQ2A 3DFOA 1MZRA 2PDWA 2Q01A 1JZ8A 2XG9A 3WUGA 1V4YA 1HG3A 1WDWA 2D69A 3TQPA 3C3UA 1UC5A 3PC0A 3ARXA 1DBTA 2DW7A 5K3VA 5ECUA 3UYIA 1PTGA 2QMJA 4DZIA 3IVUA 3DYPA 5AZ0A 1WXZA 1GCYA 3WQOA 4E0CA 2YL8A 2XVKA 4C6MA 3MHUA 2ZX5A 4IPPA 3CAWA 3WLIA 1J5TA 4G1NA 5J5DA 3QV9A 2HVNA 2QXWA 2DUAA 5DMNA 4XUGA 2QCMA 5CSRA 4HGXA 3THAA 1BVNP 1VIZA 3CLWA 3IJDA 3K5XA 1S2VA 5BOOA 3SN1A 3H4GA 4GQBA 1L8NA 1LF1A 5BOFA 4MZ1A 4UTUA 4ZO7A 3GRIA 1F3EA 2GOKA 2O7SA 4HYRA 3O0KA 2AKZA 3VNDA 5E1QA 1M68A 1MNZA 5BWAA 2CC0A 4BI7A 1UWRA 4CNOA 3ZT5A 2B31A 4PFMA 4XV0A 1IF2A 3S6OA 1PCWA 3R11A 2ZUWA 2FZMA 2ZTJA 4GYKA 5AZ1A 5LIKX 4J5NA 4AY8A 5BZAA 1HJQA 1SFLA 4PL1A 1TMQA 3G1DA 1XC6A 1PWLA 3IIXA 3NOYA 1MUMA 3TJIA 1J11A 3GXIA 4UTIA 2G3JA 5H91A 1EIXA 1T41A 7ODCA 3UWEA 1QFEA 2DP3A 4JN8A 1ZP4A 3DI0A 3PWIA 1IXPA 2JKPA 1KB3A 3GC2A 3UG8A 1Q45A 5F4SA 4JN7A 4LAKA 1EJRC 2CBUA 1VRXA 1ADDA 3TVAA 2TAAA 4E2OA 1LRTA 3H22A 1CGYA 5FKYA 1P6BA 1B3VA 1Q6QA 2AKMA 4L9ZA 4NF7A 4U5IA 4AMCA 3AICA 5H1WA 3KVKA 5HXMA 5DRIA 2PDQA 4B5TA 3AUJA 1XH0A 1EOMA 1VFFA 5CSSA 2QF7A 3S5NA 2EPHA 3O07A 3I6EA 4IG2B 2ZQ0A 4YLWA 2HNEA 2VEPA 3C2VA 3BAIA 2NZLA 5JMUA 1A0DA 1PTDA 2DW6A 1W9XA 2DIKA 4C6JA 3FS2A 3KP0A 1TJ1A 4QP0A 1OFOA 2B7NA 2Y63A 2VXNA 4L9YA 1E72M 4Z1BA 2BXZA 2DVXA 5FEPA 3VCCA 4KT2A 4UUIA 2IMRA 1ZZMA 3OA3A 3AWNA 4EOUA 6PTDA 4LW7A 1LRQA 4WGHA 1NY1A 4HU8A 3LHUA 3KHJA 2Y85A 3N13A 1DWIM 1KA9F 2QUNA 1WPCA 4WVXA 5JH2A 2V69A 2ZC8A 1M7JA 2BASA 1SSDA 1ZJAA 3T09A 4O18A 4B5NA 2OKTA 3F4CA 3EWZA 3S1VA 4MB3A 1OK6A 1ZY9A 5DRCA 1KQYA 4M6QA 5D33A 3G1SA 5BOEA 3HN3A 4GVGA 2HE8A 1C92A 5K9DA 5ABHA 1NDYA 4S1FA 4R88A 4PTDA 1SVDA 4A2SA 4ADTA 9RUBA 3DU0A 1Q85A 1OFAA 2PF8A 4FSAA 3MV11 3TR2A 4MAVA 1EO5A 3BZGA 4MHBA 1G67A 3FV9A 1DJIA 1XBZA 4MJ4A 2JGQA 2VGFA 2W5FA 2PDYA 4R3UA 1DYSA 4E4PA 4X9YA 2OSYA 4LRSA 3AMCA 1RAKA 4CQBA 4PRRA 1QHOA 3EKGA 2DDXA 2A6NA 1RQBA 5M3WA 3EX4A 1L2QA 1EC7A 1RQHA 5U4NA 4GVIA 1J18A 1PYFA 4Z42C 2HVMA 5XINA 4LYKA 3M0YA 4DAIA 3LU2A 3CPGA 1WB0A 4GH1A 3WLMA 3AO0A 2J8GA 1PKNA 1K1DA 2XZ7A 3UZWA 4HTYA 1R9ZA 3MYOA 2RGMA 3ME3A 1TR9A 4GISA 5C9XA 3MCNA 4AC1X 3MP3A 1WOAA 5AC7A 1BAGA 2YIHA 3R0UA 4GNKB 2EJAA 2PMQA 1Q6CA 5CZKA 4OIFA 3UNDA 3IRDA 4NL1A 2GQ8A 3SRHA 3VCNA 1CX9A 1XGZA 1NELA 4J35A 3V36A 1GVRA 1I2RA 2VL4A 1PDYA 2C0AA 5FAJA 2ESCA 4UOZA 2PPGA 3GDKA 4PUUA 4YWSA 3QVQA 2DZAA 4WGXA 2WNNA 4AWEA 5EMJA 4KBXA 2H9AA 2CKRA 1T8XA 3PY2A 4D2JA 2POZA 2DT0A 1JJKA 3OO2A 2QJGA 4M1BA 4R7JA 5F2MA 3OVQA 5C7HA 3QY8A 1ALDA 4ZEPA 5HPCA 4WLCA 4IZGA 3H24A 1RCOB 1UZDA 4DWSD 3PSVA 2OEKA 1ME9A 1I8JA 3I3EA 4RK8A 4MYXA 2DQWA 4E2DA 3HGSA 4QAWA 4GO9A 3WK1A 4F0RA 5JIWA 1N82A 1RPXA 3GHRA 2RH9A 4H8UA 3BGGA 1OX5A 4GBDA 4RZ5A 3W7NA 2F8QA 1R85A 3K4DA 1W5MA 5BRQA 2PTZA 4JNMA 3CT7A 2AGTA 1JYXA 1Y5WA 3FKKA 3NZGA 1VFLA 4XO6A 5DX7A 4WQ6A 3M0JA 2VDHA 2HTMA 4AWSA 4PB3A 2G96A 3M5ZA 4M6UA 4JTAA 3PSWA 4AVNA 3MW7A 3TC7A 1WZMA 2OODA 4AX6A 2J9YA 4GABA 3HPFA 3MWCA 1UMYA 1F05A 1W0MA 4MKVA 1VIWA 1Q66A 3K30A 4ZB0A 3VD9A 3BJSA 1FDZA 4LYPA 4QBXA 4JD4A 3AROA 3LG3A 2IPJA 1V0KA 3U2EA 4O16A 3UU0A 1RHCA 4LSBA 1MQRA 3DHFA 5M2FX 1B3YA 4JIEA 4EWND 4Z1YA 2NXHA 3LHTA 2WQPA 1HKWA 4RR4A 2BGNE 3IEBA 3JW7A 4XZHA 3BUVA 2VZUA 1VZWA 2E9BA 3P0WA 2VOTA 1BYCA 4MDPA 1A5OC 4CD5A 3BAXA 1UC4A 1POKA 4NIRA 3RU8X 3FY1A 2QCDA 3RLUA 2J24A 4RW3A 4UC5A 2BHZA 5GJPA 3AS1A 4OT7A 1SO4A 3QOMA 1UG6A 1QWKA 2ZZ1A 3TXZA 4GYPA 1A5MC 5A8PA 4GIYA 3LTYA 4HYWA 1V93A 4AD5A 5HQMA 3RGTA 1VRDA 4ZO8A 4TO8A 4JCMA 2D2GA 1W3NA 4UTKA 5AC4A 3E3HA 3GU2A 7CGTA 1OFBA 4DUOA 2XIQA 4QG9A 4EAYA 2XSAA 4JIRA 3SO7A 4IXXA 3VGFA 2MNRA 4S3FA 3AMLA 2ACQA 2X41A 1J0YA 1OX4A 1ISXA 5HNRA 3PBGA 1EYEA 5FEZA 3VILA 4FXSA 1LBMA 1QI5A 1JZ7A 3ZVIA 2BVWA 2VEIA 1FUYA 4QJ3B 1OIMA 4DBWA 2E4TA 1FWNA 2I9EA 3HOJA 1KBJA 3OZYA 3UT0A 3RITA 1UP3A 2OQLA 1XRFA 3BLKA 3ZVHB 1J6OA 1Q6EA 3ZWTA 1GOMA 1VEPA 2QNEA 1C90A 3BSHA 4JKMA 3LTSA 3UWWA 3PZVA 1M3UA 2Z1BA 4QJ5B 4O1FA 5BMXA 1UD5A 5D30A 1TPUA 1HO1A 2RDXA 1O5RA 3W4RA 3VKJA 3SQLA 4O54A 5BXPA 1VS1A 1PCKA 1R38A 3HIJA 1TPFA 1M7XA 1K6WA 1J4EA 1EX5A 4HD5A 4DB7A 5G4WA 1UH3A 2FFIA 3UYCA 4RDZA 4I5XA 1CBGA 3B8DA 4J9JA 3PZTA 1SFTA 4JTJA 4OU1A 3CTTA 3EDJA 1ZJHA 3EPNA 1PJ9A 3N17A 1KFKA 3F4NA 5JU6A 4PUJA 2FZ9A 1UKPA 4DYKA 5CGQA 3G5EA 2HSAA 4UFIA 4DUXA 1CECA 1MW1A 3IUDA 2E5CA 2VNCA 2XZ9A 3PNZA 4KEVA 3N14A 3GXMA 2A3LA 5TQLA 1OF6A 2YR1A 4AZCB 1GJWA 1O94A 5I3GA 1TWSA 4B90A 2G4FA 1HJXA 3N34A 3WJYA 4I5UA 3P60A 7PTDA 3NDYA 2W63A 3UA4A 3AIRA 3JUGA 3D5HA 1DIKA 2QDGA 2VKZG 1IT0A 2RFGA 3EOLA 2ZZ2A 4EXAA 2OYLA 4HIBA 3K4AA 2FPTA 4IOTA 3M0ZA 4G7FA 3RLGA 3SW6A 4PUMA 3LXAA 4RNFA 1JYWA 2G4JA 2A85A 1PX3A 4US5D 3WLNA 1NP2A 4HOWA 1PZ1A 5ABFB 1M41A 1X7FA 1JDDA 2OG9A 1TCDA 1TUFA 1EDTA 3RIKA 1Z3NA 4D6FA 4BA0A 2P88A 2QCLA 1JDCA 3B3DA 3BTNA 3KL0A 2Y6ZA 1E73M 3VD3A 3GXNA 4ML4A 3IIVA 1W1A1 1FCBA 1G6CA 1QNVA 1Y5VA 3C2FA 2WJFA 1VR6A 3H2NA 6CGTA 3ITLA 3GH7A 4JPGA 4DPQA 1E9LA 1RA0A 2POTA 3NL2A 3KL3A 3EMQA 3SY8A 3UCDA 3GK0A 4GZIA 1Q6RA 4PBEA 2QIIA 2W79A 3WENA 3RYSA 3ICJA 4BF5A 5C9ZA 1UR0A 1HX0A 2R1NA 4O12A 1C91A 2BY3A 4HNLA 2QYGA 2A3BA 3MZNA 4V33A 1N55A 1QI4A 1UMLA 3V16A 2J8TA 3E1F1 4F66A 1I0DA 3W27A 2R24A 1W6TA 3P62A 3AJXA 3VNLA 2NWRA 3PULA 2EQDA 1YTDA 5I03A 1OINA 3BO9A 3DFHA 4X0NA 5LZLA 1QCWA 3W73A 1SW7A 2JF6A 3S47A 4AZBA 1R86A 1I6NA 4O8RA 1JFHA 4RW5A 4IGSA 4IICA 3SI9A 4W7UA 1NEYA 4ICMA 4IQJA 3GVVA 1BTMA 2WQDA 3LERA 1DJNA 5FCZA 4Y96A 1VCGA 4F8XA 4B91A 4Z1AA 2J8FA 4Q32A 1YADA 3VM7A 1QWGA 4GFIA 2VEFA 3A3XA 1KXHA 1S5MA 3WQVA 2ZYFA 4KFOA 4J2PA 3GG0A 4MKSA 1TTQA 4D6IA 3LHYA 5CKSA 3RX2A 4B3LA 4MNLA 1BRLA 5C2CA 4AQLA 3KCLA 4WXYA 2PLKA 4J3UA 4XBKA 3T0CA 1GEQA 1GYLA 5EMMA 1JZ4A 4XD5A 2DZXA 3O63A 2GUBA 3VOFA 5T8GA 1Q4NX 4IMDA 5XIMA 3DENA 4UOJA 1W5NA 1NFGA 3F5LA 3W6LA 4G8TA 3BOXA 3IVSA 3E2QA 1M1BA 2DUZA 1ITXA 4NU7A 5HWJA 1UP0A 2JIWA 3PZ9A 3VC5A 4KFNA 1G4EA 1GOQA 1KCZA 3WG6A 1JFXA 4MWAD 2A3HA 2R9RA 1UZHA 3ALGA 4I6KA 3A3WA 4XKMA 4QRNA 2DT3A 2WZTA 1GYNA 3GTFA 5LXEA 1NDVA 3CV2A 4ACZA 4U3AA 5CPTA 4AIOA 3Q37A 2A3AA 1FWEC 3O2LA 3GX9A 3GNPA 4S3KA 1TV5A 5DELA 4DQWA 4HPJA 1YDOA 5CPOA 4ROQA 3IIPA 3REQA 2VWTA 5E0FA 3AXXA 1VFHA 3WLHA 1CB7B 4ERAA 1LQAA 5IDZA 2HPMA 5HUPA 3TYBA 1A5KC 2GJRA 3WZ0E 3PBUA 3PPGA 3TW6A 4W84A 1ADOA 1TA3B 2D3LA 2XN0A 2Y5EA 4JIIX 4L80A 2QUUA 4DUWA 1XSKA 5I06A 4JHZA 3W28A 3QKZA 4HZ8A 1UJQA 4UQEA 2ACUA 3ES7A 2ZA2A 3S8HA 3I4EA 4U3CA 3N2XA 4BKNA 2P8BA 4R33A 4PB5A 5FOOA 1JGMA 3W7PA 1LWHA 1SR0A 2V5KA 5F1VA 1TTJA 4NY2A 3FN9A 2WLZA 4PEKA 4IP4A 4YYCA 4LU0A 1H5VA 3AU6A 2FZ8A 4HK6A 4LAOA 4TV6A 1JYVA 1VQTA 1XIFA 1SPQA 1M9HA 2ATMA 2HXUA 5GNXA 4B2DD 3DYMA 3M44A 3QW3A 4JQ4A 5FF3A 4MZ8A 3SCOA 3T2OA 2BLEA 4LUSA 2Z29A 4HQVA 1V08A 1IEWA 5FJIA 1YDYA 2Y8KA 3UZJA 3WLOA 3SQSA 1KCLA 3FNDA 1YMYA 3MBDA 4QCEA 5G5IA 3WUBA 2V2HA 2E5BA 3PBWA 4N9BA 3NXLA 1BD0A 4FX7A 3GBEA 3GVWA 3SN4A 1YPXA 3GM8A 3LPFA 3M07A 4G9PA 1FH9A 1XIJA 1YXCA 2QDDA 3G1VA 4HZMA 4E8DA 2OPJA 1SZNA 3ENLA 4IFOA 1EZ2A 3OEXA 4DYEA 3UG5A 3AZSA 1D3GA 5GVJA 4PMOA 1F4AA 3LLFA 2GVYA 4GQGA 3A64A 4FOJA 2XM1A 1CYGA 4HHPA 1C3FA 1G4PA 2QMKA 3DHUA 4D8LA 2V5LA 2HBXA 1YIXA 5EYWA 5DXXA 3GIYA 5E70A 1TX2A 3UNTA 5U7SA 1R2RA 3WEMA 3LRMA 4MNKA 5BXRA 1FCQA 2YPIA 1E6ZA 1QNQA 4UCGA 1Y8BA 4M8UA 3LCXA 2HEJA 3STPA 1XYAA 4O1BA 3SCVA 1GVOA 3A47A 4XSMA 3GR7A 4AEOA 3WJZA 1UD8A 4LOCA 3P67A 3U7BA 4Z08A 1EJSC 3R58A 2H6RA 4LS2A 3TN5A 4LB3A 2VP8A 1NWSA 4XZIA 3EWDA 3RHGA 1L6FA 3CIWA 1MDLA 1FWGC 2WAGA 2FVMA 5MKGA 2CIPA 5TNVA 2EEXA 3HU7A 1WAWA 4PCNA 1V02A 5F2LA 1U1JA 2HCVA 1HKIA 4LRTA 5C5YA 5DY2A 4ILSA 3SJNA 2AOSA 3KLLA 1BQGA 3UR5A 4AAJA 3AIEA 4A8LA 4HHLA 4KH2A 2I14A 1GZJA 3D3FA 2PDCA 3BARA 1UQZA 2Z1WA 1FWBC 2WANA 1FXQA 4O15A 4BF7A 2XIOA 4GWEA 4JKLA 5EKYA 4IMAA 1UWQA 1V8EA 5HAOA 3UG4A 3W6YA 3L67A 2PGFA 1XINA 2CITA 4FI4A 1JDFA 3DBPA 5I09A 2A7PA 3NL3A 3GW3A 5CCZA 1B2YA 2E6AA 3VKCA 4O8AA 2FIQA 2EG8A 1PX8A 1TX0A 1NWTA 2I1OA 1G01A 3EX3A 1W9UA 3GUWA 5L6UA 2Y0FA 2H8XA 4DWDA 1H7XA 4Q8NA 1LOQA 4YN5A 4NZ5A 3LZ5A 1UUQA 4YL2A 3AAMA 3WBEA 3SCUA 2PTWA 1P1MA 5F1UA 4AD4A 3EX1A 3W75A 3N25A 1WXJA 2XSBA 2GK1A 3MS8A 1J9YA 4GI6A 1QNOA 1NTHA 1ISWA 3ZSTA 4BK9A 3N6JA 2QUVA 2WVUA 4MPQA 1H41A 4O1EA 3BQ5A 4DZAA 4PRWA 4RL3A 1EWDA 4E6MA 1ESWA 3POHA 3JVAA 1A80A 4GUIA 2QJNA 1QAPA 1Z32X 2C1GA 4AXKA 2NT0A 1MW3A 3MI3A 4ERGA 3GWQA 2ZX6A 3TA9A 4Y9PA 1W32A 1XYZA 3UXKA 4QM1A 2QW5A 4NZJA 2ZZ5A 2DT2A 2YCKX 1JPDX 1W1YA 1OCQA 3GZ3A 1V0NA 2WVSA 3GDRA 4LXFA 4GX9A 3TYZA 3G77A 4UTJA 5C9UA 3MDWA 1YNYA 5XIAA 3ALFA 2E67A 1TR1A 2J6VA 4PUDA 3MBFA 4HT3A 3CUGA 1EDQA 3MSDA 3QN3A 2OKOA 1YTKA 3L5MA 2PBGA 2X7VA 2CFFA 4V1YA 4KPLA 2GDUA 2E3ZA 3VD7A 5I3IA 3LHZA 1L6GA 3S9ZA 3W1PA 1KRAC 3FIGA 3CV1A 5DCBA 2VR2A 3AIVA 5HMFA 5KZ6A 2PDFA 4DXVA 4Q8OA 2Y4SA 4ZTXA 2PDBA 2E8YA 1WYIA 5DQPA 1H1YA 1W9PA 2BHUA 4CQ9A 3ZWSA 4AEEA 2OGYA 1TJ0A 1DHPA 4PSPA 3ZJ6A 1FXPA 4JYDA 3MHFA 4O11A 1D2KA 4MG4A 3STCA 3RMEA 1R9YA 2NT1A 4HOXA 3C86A 1P0BA 3CQIA 2E6DA 3THUA 3FXGA 1HL8A 3W83A 4JNYA 2WJDA 3QSTA 2G3FA 4UZSA 1KFWA 3KTSA 3P82A 3K4WA 3H2OA 1A4MA 4PMUA 3OQ8A 4C1NB 1V3LA 4GUFA 5E0CA 4GC3A 3N12A 3PNUA 3TIMA 3OGSA 4HPHA 3WUFA 3M5XA 1GHSA 1XG3A 1RSCA 3ANYA 4PL2A 1C7SA 1B9BA 3XISA 1OGSA 1WDRA 4HSHA 4F2BA 3P3BA 1JRCA 3SEPA 3SIZA 1B57A 1YXYA 3MP5A 1YYAA 3MHGA 1HJSA 1E1CB 4DX3A 4NNCA 1D3CA 4QJ1A 5C0QA 1J0JA 3AALA 1RY0A 1E0TA 3EPMA 4HMDA 1GW9A 4DIAA 1JDAA 2Q02A 3L23A 5REQA 1MEIA 3S5SA 4P5UA 2VDGA 1XLBA 3TMQA 4WX2A 3FK4A 3PN8A 2Z6IA 2Q3RA 2X7WA 4KFPA 1F3TA 3BK0A 1XX1A 3TYUA 3AZRA 4RNJA 1LG2A 1XIDA 2D2OA 3WEZA 1EC8A 1H62A 5A8MA 2ZCGA 1P0DA 3PZIA 4NXKA 2I5GA 8XIMA 4MWAC 3WH5A 2PB1A 4KEUA 1QR7A 1ZSXA 4TTGA 2GJXA 4BI6A 4JFWA 2DY3A 1EOKA 3UJ2A 2ZDSA 4LBUA 4L7ZA 1MI3A 3AMKA 2H3BA 1HZYA 3GDMA 3MMWA 4WJEA 3UCQA 2XFFA 2IXVA 3FJNA 5AYZA 4I9AA 4WKAA 1GJPA 3NAVA 5CH9A 1GPWA 5LIXX 1WNOA 3MKKA 3PHAA 1X8FA 1HF6A 1LZOA 2BX7A 1FOBA 4OV9A 2PAJA 3LGEA 6A3HA 1DOSA 1TV2A 4L56A 1UZ1A 2ZRYA 4ZQRA 1O7AA 3AYTA 2GJNA 3UR7A 2A5HA 3W2KA 3W87A 3UW6A 3W7MA 1BG4A 1FHDA 4IFKB 3MUIA 3EWYA 3S5YA 2F9RA 3OVGA 1WDSA 2V6AA 2YL5A 3H6OA 4D6HA 1KO0A 3BICA 1UD4A 3NEHA 1JF6A 3HQ1A 3HFTA 1JPIA 4PRTA 1GVIA 5FI8A 5B7ZA 3PB2A 4ZBCA 3T78A 4MB1A 4LFYA 1TE6A 2GGHA 2XVLA 4H9XA 5LKYA 3MUZ1 4NYYA 4QIUA 4IGMA 3WJSA 3OG3A 4Q7NA 2HXTA 3TSBA 4AZ5A 4D71A 2FYMA 4ZOCA 3HGRA 1JDEA 3AC0A 4NZCA 5K9XA 4NI3A 4FF5A 1H0IA 5AYXA 5AHFA 2GSJA 1JD9A 1DEDA 4CQDA 4YVXA 2Z25A 1UH2A 1UW9A 2YA0A 1IIHA 3NVTA 2J62A 4F9DA 3CHCA 3S1XA 4V1XA 4F2UA 2ZX7A 4XAPA 3GKAA 1WBHA 2H3DA 4HCHA 4JKKA 4S38A 1MRAA 1SFJA 9XIMA 3AQUA 6ENLA 2Z28A 5JUVA 3ITXA 5FAGA 4W5UA 4JICA 3I6RA 3OGRA 4BFAA 4QE5A 1F6YA 1A5UA 3U2CA 2V5DA 1UASA 4M6VA 3O3RA 3WLJA 3ZR6A 3SIMA 3R79A 1MWOA 3P61A 4FEZA 4X2RA 2E6FA 5DBTA 4Q4PA 3KP1A 3L2LA 1V7AA 1JPKA 3GVGA 2V30A 5LNUA 1K9DA 4HJWA 2ISWA 8RUCA 1V3JA 3HMCA 1TPC1 4J3TA 5PTDA 3ARPA 3UEQA 1K8XA 1XISA 2REQA 4JX5A 5EB8A 3B0XA 1LL6A 2P53A 1JI2A 3RPDA 4W8BA 5DO8A 2BWGA 1QDSA 3TYDA 3TC3A 3E2SA 2YCEA 3K8KA 1RVGA 2AQVA 3N4AA 1UKSA 1EJVC 2WO5A 7TAAA 4EAMA 1FCUA 1GG1A 3UZZA 4V28A 3TOPA 2WCGA 2QCEA 1F3XA 3L66A 1R9XA 4AZGA 2OX1A 1S2WA 1HXJA 4TX6A 3WJWA 2XJ7A 1E6XM 3UPWA 1G1YA 2HQAA 4PBGA 2DSKA 1IT8A 4LBRA 2J6XA 4JHOA 2E68A 1AD4A 3O6AA 3HV8A 1BGGA 4PA8A 4JL2A 4XAGA 5TIMA 4XTIA 1E4LA 1H61A 1DWFM 3BLDA 1KD0A 4FIQA 2OEJA 3IGSA 2V3DA 2J13A 1H09A 3PUGA 2HS8A 3VIJA 4Y9NA 3WNMA 5C2XA 1ZCCA 1R46A 3QM3A 4GE8A 1FY6A 1TV4A 1KLZA 2XVPA 4ADUA 2VI0A 2PTXA 4LNYA 2QDHA 2F6KA 1IXNA 1VJSA 2ALRA 2IPFA 4XD3A 4JTKA 4R5EA 3PBVA 1HJUA 5FJUA 1RBOB 2UY4A 4GQRA 2HZGA 1XS2A 4ZGYA 3F4DA 5GJNA 2PLJA 1C8XA 2Y88A 1UKOA 4O57A 1ML1A 5LNSA 2PDNA 3SCPA 5HULA 1MW0A 2GGJA 1M01A 3FGCA 4L1XA 4IP5A 3OHMB 4PMXA 4CCDA 1W31A 5FIPA 4R27A 4CN1A 4BEUA 3HGOA 1XRSA 2QLYA 2IKIA 3W24A 4QLKA 4WKFA 1CGXA 2ZADA 3NZRA 4I6VA 7A3HA 3VABA 3FAXA 1TPEA 4MJMA 3WDQA 3TCEA 4DF0A 4KW2A 1TTPA 4D6DA 1MZHA 2YZ5A 1BEUA 3G22A 5AHEA 4WD0A 3YPIA 4A21A 4LPCA 4EANA 1AW1A 3CPUA 1RBLA 4GXPA 4AEFA 2XISA 3APGA 4AHOA 1ICSA 4KRZA 1QATA 2W9MA 2ZZ3A 3HFYA 5E6ZA 3A23A 2X40A 3EDKA 2ZRVA 2WKGA 3O15A 2NUXA 2ICSA 3N19B 4JIHA 1ZAIA 4IXHA 1VYPX 1JD7A 2PA6A 5D09A 4O13A 4AZ7A 3AIQA 2ZWYA 1QNSA 3WCZA 3UXIA 1H7OA 1QNRA 4BHYA 4C7DA 4CD6A 1V6VA 3CYVA 3C0SA 2ONEA 5EPDA 1IGWA 3AS0A 5AYBA 3VOGA 4LF1A 2VUNA 3VDBA 2VZSA 3I6TA 1TYGA 3MUY1 5DT5A 3C4UA 1H51A 2Y5JA 1PUDA 4FXRA 3LPOA 3VGHA 2C6QA 4PCTA 5I00A 4GINA 3TLQA 3TV8A 1IZJA 1W3JA 3AHTA 3E0VA 3QFEA 3CU2A 3E02A 1KTBA 2UZ9A 4OVXA 1O5QA 3HM7A 3R6IA 1QPRA 1XR2A 5H6HA 3TWAA 3AFBA 3ARQA 1XYCA 2J7GA 4CEUC 3PPFA 4LEFA 1UOZA 4C6EA 3LM3A 4O0ZA 2P50A 1IEXA 5A6KA 1BTCA 5FJTA 1TA3A 2W91A 3BVJA 2OELA 4LEQA 4WR3A 4LC6A 1K8ZA 2WPBA 5BYWA 5LHEA 1KRBC 3FX4A 1VBRA 2V68A 1XLJA 4QS6A 2OWXA 3VNMA 3GXFA 1AVAA 2YDRA 2OLHA 3GB6A 4WOZA 1E55A 1ZQ5A 1F07A 1VGAA 1E9YB 1S5VA 3RRAA 2O9RA 1RALA 2DZUA 4RNHA 3DECA 3GG1A 2Z1KA 3M6YA 3A13A 3WL1A 2KX9A 4EVZA 1YPIA 4N7QA 6XIMA 3U6WA 3GTHA 3DBNA 4WOQA 3S2LA 5HMDA 3WD2A 5GJMA 3N04A 3GHUA 2JE8A 2Y7GA 1R2SA 3W7LA 3VM5A 4DM2A 1CGVA 1QPQA 1R2TA 3S5ZA 2CETA 3N4EA 3EA2A 1VJZA 1M7OA 1IWAA 3ZT6A 5JQ9A 3SRDA 2Z1VA 1XXXA 3N2TA 5DCEA 3GU9A 1VHNA 4HU3A 3BLIA 1VCVA 1UD3A 1ZAHA 2E1WA 3AISA 3II1A 2DSVA 3RRXA 2W62A 1BQCA 3EBVA 1AODA 1RJPA 2FB2A 1EDGA 3QGKC 3UXDA 3WKZA 1OF8A 1E5NA 2R14A 1T99A 1EBGA 1XDLA 1XLLA 1AH3A 5CSYA 4NUWA 3TROA 2XH7A 2A21A 2WMIA 1LRNA 5DMYA 1PVNA 1W91A 4HTBA 4W93A 1H7RA 1OBAA 4CQ8A 3HPZA 1NF0A 3CGTA 3CQJA 2HMCA 2JEQA 2JGYA 3GNNA 1W56A 4MY1A 4Q8PA 3TH6A 2ZUNA 3TJ4A 4WXZA 2QPUA 3CB8A 2O4QA 3IJIA 1QNPA 4BWLC 1HQTA 1KKRA 3W2JA 2EBNA 1AH4A 1B90A 1LBFA 1PDZA 3WQCA 3W37A 4RX0A 3V1PA 1EXBA 2WHJA 3M4HA 5F4WA 4LUJA 3BXWA 1OCJA 1AMYA 1PEZA 4OBRA 5I23A 2A79A 3WJXA 1JVNA 2GVEA 3COTA 4GGHA 2RHGA 3LHWA 4PMRA 2GUUA 3O7UA 5LA0A 2ZICA 3I10A 4OKDA 4RJEA 4RZBA 4ICCX 3B9OA 1E4IA 4PBFA 4YVVA 3AMGA 3KM8A 3P5YA 3CZ8A 3VO0A 5A6LA 3H2EA 5G1TA 4J28A 2VFDA 3B0YA 1US2A 1XD1A 2G95A 4JIPA 1IQ8A 1KKOA 1K77A 2D2JA 2W4XA 3WELA 3CZGA 3KWXA 4EX4A 3VKBA 5JIPA 4XK2A 3E49A 2NW0A 1E3XA 3SCNA 3K2GA 3H12A 2AMGA 4ERIA 1FKXA 3MCMA 2YLLA 4JFTA 5T9CE 4NQ1A 3BZJA 5FF7A 2VGBA 1LP6A 4H04A 1JXJA 3UY7A 5F2GA 1ONEA 4C6QA 2HNHA 4OBTA 2VEKA 2WSPA 3GW0A 1AQHA 1TVNA 2O9PA 4C6LA 3ITTA 2VGGA 1TV3A 2WC4A 2XFYA 3AZTA 1TJRA 3KVLA 3NOEA 3INPA 3ZSSA 2PC8A 4I7VA 4U2YA 1SYTA 1PZ2A 3BMWA 2YBVA 3V0SA 1KCKA 4MJZA 4QDWA 3W22A 2H9AB 1Q8JA 1VFTA 3W00A 4ADSA 1TV8A 3PZMA 3RLVA 3E9AA 4ZB2A 4DJEC 2P76A 3VIKA 3MZ2A 1UPPA 5AC8A 1SW3A 3CJPA 4RCXA 2QUMA 1FWAC 2GVLA 2WVVA 1E4MM 2BSLA 3B8TA 3QQWA 4S2CA 4NT0A 3L2MA 1UWSA 1XIBA 1R87A 2GSEA 2QJHA 4HHHA 4PUKA 1OEPA 2J7DA 1KQZA 3WH9A 3VIIA 3WNPA 4CNNA 4JBRA 3LCFA 4ZA0A 2VD8A 4KQNA 1WA3A 3G18A 5MHBA 1QASA 4R7OA 3O16A 2P5NA 1U5JA 3RMJA 2EKGA 3BAJA 4LAZA 4I9JA 4PB4A 4JTTA 4Y8EA 3AYRA 5AHMA 4K1WA 2C7FA 3A12A 1N2VA 4MFEA 1B31A 5E6YA 1QW8A 3WO8A 2DJXA 4I7UA 3EWWA 1MYRA 2CPUA 4UTLA 1JL8A 3L4TA 1SMDA 2Y89A 1KNWA 3CHVA 1EF2A 2BG5A 3BLEA 4GKLA 4GUJA 5HBFA 4IGHA 5D8WA 4PZVA 3KDOA 1DXIA 3CC1A 3QTPA 4NASA 2ZUVA 3BCDA 3T1GA 3VFCA 1KXVA 1XKJA 3WQ6A 3BV4A 2DSUA 1R47A 3W74A 3KBVA 3P7YA 3H70A 5IHSA 3L0KA 4UR7A 3K8LA 4AUBA 4YCPA 3ONBA 3BL3A 2P3EA 3Q4DA 1RP9A 1UWTA 3OODA 3M64A 2B7PA 7XIMA 2ASHA 4I90A 3GD6A 2VX4A 1VPQA 5F7UA 3TAOA 3LRKA 2ADAA 5C71A 1BLIA 1E6SM 2PDPA 5A3HA 4JNZA 3GDLA 3TR9A 1M65A 3R2GA 4BQ4A 1X39A 5FA5A 3E2VA 3T9PA 4L6DA 1E9ZB 1JPHA 4UTTC 5E93A 1U30A 3HTWA 5D03A 2ZXAA 5CG0A 1EP2A 2NQZA 1Q7MA 3MKVA 1OYAA 1OX4B 2OSWA 4LGXA 3CHDA 4NAFA 1DIDA 1VC4A 3AUOA 1OX6A 3NFUA 5DCDA 4CGTA 1TQXA 3PB0A 3B9DA 1J8VA 1WKYA 3ZM8A 5AC5A 1E0XA 1YDVA 3IAPA 1DVJA 4R7WA 4XQ6A 2C8NA 3PTQA 2UY5A 2WMHA 3CWOX 3THDA 4N2YA 3UQNA 3WEOA 1X1NA 3IARA 1KBBA 4B5UA 5EY5A 3BV7A 5JBDA 4HA3A 4S3CA 1VF8A 1PBGA 2Y2WA 1ODZA 1PHWA 3LLXA 3AIUA 4UNKA 4CUCA 4FHAA 5CJNA 1A5BA 3BJTA 3PAJA 1I4NA 1S2UA 3OZMA 4FK9A 1UWAA 1TCMA 3D6NA 4YU1A 1RK5A 2J66A 4V2XA 3WLSA 1C8VA 5GNYA 5IDIA 3QMRA 4NVTA 5A8QA 3FSTA 3MO7A 1J79A 5I24A 4JTLA 2ZXDA 3SDOA 4MYAA 3RCNA 3S2NA 1DJXA 1U1UA 2NX1A 3B0PA 1XUUA 1B3ZA 1F61A 3BCFA 3PG8A 4H9YA 5CQ1A 4H4IA 2X8RA 3UZXA 2BHYA 3L7RA 1K9TA 4N4QA 5HNTA 2JEPA 2OYMA 3VX1A 4QJ4B 5E5CA 4ZR8A 1XBXA 2WB5A 4TUFA 1P0EA 3EX2A 4HNUA 1XBYA 4HNNA 1XIHA 2X1SA 3W1MA 1D7FA 4DYJA 2GGIA 2E9LA 4FX6M 1K4GA 4WDXA 5LGZA 5HINA 3IJQA 2D73A 2VCBA 1KGUA 4C5YA 2NV9A 3TW9A 5KINA 1KCXA 1W1ZA 4CEXC 1UD2A 2Q6ZA 4L6HA 1H0GA 4R9XA 3E12A 1NWRA 5HPOA 2HBVA 3KBWA 3UCCA 3R8HA 1WKEA 2CZ5A 3E96A 3KE0A 1A0EA 4Z2IA 1SGJA 5D38A 3FDKA 1OJXA 2DJLA 4MB4A 4C6PA 4M19A 1ZAJA 2V82A 1NFBA 3W84A 2E40A 5ECVA 3ZO9A 1Q3NA 4GNVA 4UFKA 1VFMA 1XCXA 4CD8A 2RKXA 3MT1A 2XH2A 5FSDC 1MNSA 2C14A 3TSDA 2ABAA 4PTXA 1KGXA 3FEQA 4AU0A 3VNIA 3KRSA 1UWIA 1MEHA 1OB0A 3T6CA 1ISYA 1Z42A 2HV5A 5BRPA 3GFYA 5LA2A 4F0SA 4YCOA 4HP5A 2G50A 1EJ7L 1JI1A 3IJLA 1HTIA 2FHBA 5AB3A 4TTUA 3EOSA 3VZZA 3S6TA 1S46A 5FD0A 4M3PA 1G5AA 2NQLA 4FO4A 1PL9A 4AZIA 2FZDA 3SRKA 1VLIA 4TVDA 2BB0A 4H83A 2ISSA 4A3YA 3VDAA 3QLDA 5LYRA 3IGHX 1ME7A 4AY7A 1DORA 5G1MA 1QHZA 4CD7A 2GLKA 1JRBA 3QGAC 1E0VA 2X1IA 5BU6A 3T40A 2G8ZA 1DPMA 4Y7EA 1UR8A 5I2UA 4J3ZA 4CCCA 2KAUC 4XVEA 1H2JA 2PDHA 3IJ6A 4KWSA 2DPEA 1UA7A 2PWVA 1ECEA 4O52A 3QOKA 1KWKA 2QV4A 1J0IA 4PMDA 3OBEA 1A5SA 5DMLA 1YLVA 4XUYA 4B5WA 4AZ6A 1E4NA 3CPRA 3JS3A 4O50A 3VE9A 2CZDA 1HGYA 4ATDA 4YTSA 1XWYA 4RE2A 1TZ7A 3LOTA 4MF4A 3B06A 3GXPA 1CTNA 4LVDA 4W86A 1IIGA 1JCNA 5E0KA 4DY1A 3VTRA 4Q22A 3WDPP 2GQAA 1W9BM 3B8SA 3ID7A 1UA3A 1HKVA 5AHIA 2BODX 4AYGA 4IPLA 3DIPA 1UQYA 1XF0A 2OTDA 3TNBA 2VM8A 4UXDA 1HKMA 2EPMX 5A6MA 5BNKA 3GZAA 3LS9A 3NL6A 2WCSA 1HJWA 2PFHA 3VMPA 2F6XA 4C6BA 3MUXA 1GT8A 3E0IA 4J40A 4ATWA 3EKLA 3IGUA 2P3ZA 1XYFA 4C91A 3LCLA 4GI9A 3BANA 5A2BA 4GVHA 1QHPA 4CVUA 3LBCA 3EAUA 1BYAA 4WDTA 2PZNA 2CBVA 2D3NA 1KR1A 3NQ6A 3NQMA 4ACZB 1E6QM 1XICA 3OP2A 4C6FA 4O4WA 3EA3A 1V0MA 4J3WA 1ICQA 2V5JA 4IX2A 1OHLA 3H4WA 3ZLFA 1UUMA 5EU9A 1UKQA 3FYYA 4A2RA 5AHNA 3REQB 2F38A 1BWVA 3G0SA 1WAUA 3N2CA 1R3WA 2Z7KA 1T8QA 4MAZA 2Q8LA 3W71A 5C6MA 3G1AA 1B3XA 1EBHA 2ANUA 4O53A 2WZMA 3QH2A 3LENA 3NTYA 3G1FA 3SUUA 3WNNA 2CEQA 1EJUC 3E74A 3L2IA 1KM3A 3I3BA 2NVCA 3I7RA 5M1TA 1U5HA 5GPRA 2ZTKA 4HYVA 4L5ZA 1VYRA 3V1HA 4LUIA 1SFSA 3PS7A 3IUHA 1RQEA 4L1GA 2X09A 3QV6A 2Y24A 2XH0A 4JTIA 3B8WA 4OJYA 3NQVA 4AG0A 3ITVA 4GZ7A 4MADA 4J7RA 3GLCA 5DN1A 5HQLA 3W1QA 4IIHA 1T6MA 3NO3A 3ZFHA 1K7EA 5HWMA 3D3AA 4WCJA 2Y7FA 3R12A 1UR3M 2QT3A 2OO6A 4LUSB 3MYPA 3VU2A 5KTLA 2TODA 5A8NA 2VR5A 1CLVA 4LUYA 2QPXA 3ABQA 4PCPA 5EMUA 1E9IA 5C54A 3BSGA 4Y2WA 2BGSA 4GO8A 3LN3A 2WMJA 3EOUA 3C0JA 3W3OA 4BQ3A 4CNTA 5FF4A 4JEJA 1DWGM 1JPMA 3P8IA 3T0DA 1DIOA 3UR2A 4ZVJA 3E0LA 1IR1A 3S1UA 2Z2UA 1H11A 3ZZ1A 4JTGA 3O0FA 3WLQA 3LEPA 4ZXLA 4PODA 1LCOA 5FESA 4R34A 2VC5A 1VBUA 2W66A 1LJYA 1Z48A 1RH9A 1P4CA 5IXEA 3WK0A 3A4JA 4MOZA 3LQGA 3W7DA 2Z24A 4UWMA 2VT0A 3D46A 3OVPA 1HFBA 3KOXA 4WJ8A 1QI2A 4GH3A 4B3KA 5D9OA 4WK9A 4XG1A 1EWEA 5ABEA 3NQFA 1OM0A 4ZO6A 3KZPA 3QQ1A 1PPIA 4F79A 4PULA 2PTYA 3C52A 2QVHA 4YHGA 5A2AA 1R0MA 4WJXA 2PI6A 3N6QA 4C7GA 4DLMA 2WHMA 2XPKA 1PYMA 4TVUA 1S2AA 1ZBWA 4H19A 4G2DA 2VWSA 1GTEA 1HUVA 3DX5A 4H2CA 1BKHA 3VGGA 6REQA 2YSWA 4QQ3A 5MKGB 1FFRA 4C90A 2H90A 2O9OA 1ZBVA 2XGIA 4GCXA 3RR1A 1U5VA 1AUSL 3G1HA 1Q8AA 4X60A 1ZP3A 3NSXA 4NNAA 1R7AA 4IPNB 3L4UA 5ABGA 5DFAA 3L65A 2J9ZA 2Q71A 4GUGA 3F4WA 3M5YA 2WK2A 3PF3A 2W0UA 1JR1A 3UA3A 4LB4A 1E5JA 4NKCA 1JZ2A 4GK8A 3WNOA 3UY8A 4BF9A 5D9NA 2B4GA 4UTMA 2I56A 2E6YA 3PWGA 4WY0A 3W02A 2Z26A 4GG9A 4IIFA 1X96A 5DF0A 2CYGA 1OYBA 1O4UA 3CMGA 1S3HA 2O92A 3GH4A 5IHRA 4GUHA 1ONWA 2OSXA 3N1AA 1EUAA 3UFYA 3CAQA 3VGBA 4NZ3A 3NM1A 3PBMA 2ZOXA 3QQ0A 3WMSA 4MNMA 2EF9A 3R89A 1KV8A 4Q6XA 1AQMA 4FNTA 3C8NA 3I68A 3RM9A 2BVDA 2C15A 3OLIA 3SY5A 3CZKA 2VFFA 4W8LA 1RA5A 4E38A 4UQBA 4MB5A 3URAA 1KXTA 3EWUA 3WBYA 1GKQA 1XSIA 1C8QA 1US3A 4QLLA 3VXGA 4S3AA 3R0DA 4DZ5A 2ZE0A 4DVOA 3R0KA 3DXIA 3VD4A 3L5AA 2G3MA 3B0UX 1TELA 3CAKA 1AFSA 1GNXA 2GK1B 1ITCA 1JCXA 2BXVA 3NG3A 4EPEC 2VFGA 3W1UA 4QXIA 1LL4A 2NX3A 1W3LA 4P7LA 5CC6A 2ZWZA 4H6RA 2FDMA 3RG6A 2P0OA 3VDGA 3IV3A 2ZX9A 3GH5A 1B1YA 3CUFA 4N9CA 4ZXOA 1NOWA 2GSHA 3R4IA 5FF2A 1A4LA 2J47A 2NQHA 2PLCA 5BCAA 3S5OA 3U0HA 4IP7A 1OC7A 3T2QA 3AJ7A 3P80A 4A4AA 5G1YA 5TBOA 3C2YA 1Q2SA 1F5ZA 4ZOEA 1YX1A 2WC7A 5G2WA 2OZTA 3M0KA 1EA0A 1P6WA 2WM0A 2AAMA 3UWVA 2G5WA 3UXLA 1R3RA 1WCGA 4N6FA 4DXKA 5JVLA 5IFPA 3OG2A 1BSLA 3GFZA 1BPLB 2TRSA 1Y7VA 5I3FA 4CU8A 3QGVA 1QO2A 4H3DA 3G0UA 3HBLA 2CU0A 2W61A 4UTWC 3EXTA 3QR0A 2EKCA 1CGTA 5BW6A 2XWDA 1EHAA 4UFJA 1FWJC 5HJXA 4DEFA 2J77A 3KOFA 2JF7A 2YGYA 1F6KA 2P1FA 1CCWB 4UNIA 4W5ZA 2FH6A 4RLIA 3WF3A 4GKTA 4IJRA 3GU1A 2QVNA 2XUCA 3T07A 4XSLA 2HK0A 5D37A 3I4KA 3JR2A 2OWCA 4IH3A 5CJMA 2WZEA 1LUCA 2PGRA 3O1NA 3WDJA 1KRCC 4L61A 1H63A 5IBXC 3UD6A 3HGJA 4FP1A 2BBFA 3FA5A 4LJ3A 1MVYA 2W6RA 4PFHA 2E5DA 5HOSA 3TQ0A 4FIRA 3QV8A 2OEMA 1ZFJA 2Y62A 3KS5A 5T9BG 2R94A 1E3ZA 4U4MA 1G0CA 1FP8A 3MANA 1QXLA 3ZR4A 5KMYA 2AAAA 4US5A 3ATYA 3AWOA 3QZAA 1TMLA 2TPSA 4JQAA 4LT9A 4Z2LA 3BGAA 3A4AA 3OGVA 1K3UA 1QPOA 3R43A 3OPSA 3IV8A 1I2OA 4JQ3A 3ZLHA 1V79A 3W26A 4OECA 4U5KA 1NIUA 4HN4A 1L2UA 4MUZA 1YNQA 2XGZA 3GBDA 1DJGA 2GPTA 2ZRWA 3W07A 4H9ZA 3SJ3A 4J4KA 3HQNA 3U2ZA 1WDDA 1RK6A 5BWFA 3VOJA 4B3ZA 4B5SA 3LK6A 5DLCA 1W1PA 3SSZA 1M04A 2VELA 1UUOA 1FKWA 4BQ5A 4A35A 2ZRZA 1R30A 5REQB 4Q4OA 1TPWA 1FQ0A 3NPUA 2IS7A 1XGDA 1XLAA 2DZTA 4NJHA 3N4FA 3EMZA 3GNXA 4KETA 4FS9A 1EH9A 4J3SA 1GQLA 3P5ZA 4QDPA 5KETA 3OLGA 1VEMA 2PS2A 2O55A 3TN3A 1NARA 4HKPA 3UJSA 1HJVA 2F7FA 2YXXA 4REQA 1DHKA 3HQOA 1ONRA 2BNJA 3PP7A 3TP4A 1DTNA 3A5FA 3TKFA 4J3VA 1BHGA 3FYPA 2WWDA 3W23A 1TJ2A 1JIBA 2NUWA 2GJXB 5LA1A 2FLIA 4Q8TA 1TRIA 3KWSA 1ZNNA 1VHCA 1EL3A 1UHVA 3IS4A 1HL9A 3LCWA 3POCA 5AYYA 4AF0A 3ABRA 1NJJA 4I5RA 4GQ0A 4IMFA 3MV01 1BF2A 3HV9A 2WJZA 1EP3A 2CLKA 2RUSA 1QUMA 5HNUA 2DSWA 4LVGA 1BF6A 1IWBA 1ITQA 4KCWA 2INFA 3PFRA 4HSOA 4LC8A 4KCUA 3DKLA 2PUZA 4RKAA 4UQ9A 5JH1A 4RXGA 3UPMA 4PMYA 5CLTA 2ZX8A 1W2PA 1UIOA 3MUAA 3R8RA 3GHTA 3NCOA 4YIWA 5EBUA 5I07A 2PODA 4D72A 3PPCA 3M9YA 1A5LC 2J7EA 3K13A 2CLFA 3HURA 1S3TC 3AMDA 1KWGA 1SR9A 1WDPA 4JAWA 4AC7C 1H49A 1JQVA 2YA1A 3OA5A 4I3GA 1SUXA 4S3GA 3TWBA 3VMOA 4ZFCA 1XM3A 3QC0A 3FJLA 3BLLA 3WL0A 4MWAA 5HK4A 1CLXA 3N9RA 4OWGA 4HPGA 4NZFA 2V2CA 4HCDA 3PJXA 2ATSA 4FLOA 4Q6JA 2GGEA 3VGEA 4KCVA 4GXWA 4Z0JA 8TIMA 3W6MA 4DAFA 4K39A 1MXSA 2QKFA 3H54A 1KRMA 3B4UA 3CIXA 3LMZA 3F5KA 1ITUA 2DSZA 3GXDA 3O6CA 1DL3A 4WSKA 4DZHA 3FCPA 3DFYA 1JG9A 4UTFA 3GY1A 3TFCA 1RPKA 3OIHA 3O6DA 3VVGA 4Z1DA 3RILA 3S2CA 4AD3A 4HMCA 4MTVA 3TZNA 3RCMA 4HK7A 4FXFA 2GGGA 1NFPA 5A8GA 4GBUA 1XGEA 1G94A 4GI4A 3GS6A 1XIEA 2VEGA 1OK4A 4RZ4A 4A8IA 1ZBKA 4Q7IA 2XDFA 1FWCC 3P74A 3AXIA 4LY8A 1FCVA 3TQVA 2J25A 1XLGA 1TB3A 4G6CA 3PVFA 3W72A 4AZHA 2R1LA 3Q65A 3STGA 3WNLA 2REQB 2PDKA 1JYNA 4NJKA 1UR9A 1W8SA 1GVEA 3ERPA 3SAZA 4JTFA 3GXTA 4D6CA 3SUSA 2DZSA 3MJYA 3URBA 3MMTA 1DE6A 1HGWA 1SJCA 1K6AA 4AWUA 4A8RA 3U5UA 1S2TA 4B2DA 1R5YA 2R1KA 5HA7A 4EK7A 2XVNA 3R13A 1Q6LA 3W1RA 2Z2AA 4MY9A 2VVSA 4D6GA 5M5DA 4Q4RA 3MJMA 3C2RA 5BMWA 4MMWA 3FW6A 3GQYA 5EMLA 1A3WA 1FA2A 3B4YA 5I5RA 4F2TA 4Q8MA 2WM1A 5DBUA 3SFWA 4JTQA 3PWAA 2AMXA 1J0ZA 1F8IA 3UWYA 2A4AA 4PTVA 5ABTA 5A6JA 4HVXA 3OBKA 2O0TA 3SCRA 4KIEA 2Q8XA 1GPFA 2O56A 1XUZA 2X05A 1UOKA 1RVKA 3UWUA 2ISFA 2YBTA 1V6TA 2VMFA 3GVQA 5CC3A 1EQPA 3GDTA 2VDIA 2QUTA 3VX0A 2VRQA 4P7QA 3EKZA 4H1ZA 1POJA 4XAFA 2MUCA 4EXQA 3SBFA 2EPOA 3ATZA 4Q7BA 5FL1A 3PZUA 3IACA 4LBSA 1XYBA 3MKCA 3WQPA 1OYCA 2VURA 1EO7A 3QMTA 1Q63A 3RM4A 4PE8A 2ZA1A 4UQDA 3TYCA 1IXOA 1G7VA 1W37A 1VB9A 2HVOA 2VOMA 3GR8A 3D0CA 3W2UA 4HNCA 1J2BA 2AQOA 1MFVA 3I7SA 2XM2A 1WOBA 3KBJA 1B30A 2EPKX 1ADSA 3A5VA 5A6BA 3QYQA 3FGCB 2OCZA 2YCJA 3VPLA 1EP1A 3SCSA 2WKLA 1WDQA 1DP0A 1XLIA 4QNWA 3SY1A 2QAFA 4KKXA 1E15A 3NO1A 2QHAA 1EZWA 1T0OA 2VFEA 2V81A 1ECQA 5TAOA 3WDHA 1DTUA 1FWHC 2NV1A 5CGTA 5HMEA 3DKJA 3GTXA 3RK8A 2J27A 4PTWA 2ZZ4A 5KSWA 3GHSA 4N6EA 3NQAA 3VK5A 2PLMA 3LHVA 4P2VA 4W88A 1OG6A 1XJBA 1Z69A 3EOOA 1LQ0A 1LLWA 1BVWA 5E09A 3RX4A 1V77A 4A3RA 2CLOA 5D4YA 4JY8A 5LSMA 3W7GA 3QEZA 4K3ZA 3OHIA 2I5QA 3GYEA 4KGLA 2D2HA 4F0HA 3HMJG 1MEWA 2E28A 1NOUA 3L21A 1TWIA 1B9ZA 1GVSA 2BY2A 4LUTB 3LCIA 3DGRA 1GQIA 5HWNA 3AHXA 4RE0A 1QBAA 2DUXA 1M5WA 3U48A 3NPVA 3W01A 1QMLA 1S5NA 1Z7AA 1PIGA 1ODUA 1KFCA 4D1IA 4AFYA 4MDOA 1D7KA 4YS1A 4IIBA 4ZQNA 3DH7A 4EKJA 3CASA 1L6WA 2WXDM 3ARYA 4JN6A 1XLFA 4ORIA 3WQWA 1U83A 4L1WA 1V3KA 1TIWA 1HKJA 2PP1A 4GRSA 3LZ3A 1IT7A 2VTFA 3S9IA 3OZPA 2ZIDA 1QW7A 3A3HA 3WF4A 1OGGA 2WMKA 2SFPA 4V15A 1XFCA 1Y0EA 3MCOA 2Y8VA 3NWRA 4H00A 1A0CA 2WW5A 5D2VA 1GQJA 4OUIA 3TX9A 2DQXA 4HPXA 3GIPA 4MFDA 1HIZA 2H8ZA 5I3DA 3UVAA 4MVAA 3LY0A 3LQLA 4QTGA 3WLRA 1Q65A 3T0BA 4JS3A 5D02A 3T55A 3PJUA 1K02A 4D8AA 3BAWA 4XAZA 4Y8FA 1RD6A 4RUBA 4J2MA 2PDIA 3W85A 1XQLA 4C6CA 3U57A 4K2SA 4CLMA 3W86A 3BPWA 1GOKA 4ALDA 1SM9A 2ZRXA 2FZNA 5RUBA 1R6WA 4DWSC 2FQIA 3H8AA 2OT1A 2J7FA 1PWMA 1DQWA 2BGQA 3R94A 3T0AA 4CN6A 4ORMA 1AA1B 3NZQA 3VCRA 2INZA 2BXYA 4M82A 2YDSA 1JUKA 3TONA 5A8OA 4P7NA 2YKKA 2NXGA 5HR7A 1J12A 3PTMA 3FDGA 4DJDD 3I7QA 1K8YA 1FRBA 4XZ9A 3USBA 4URIA 4NX5A 1W17A 3GUGA 4LF2A 2XN1A 4NZ4A 3UWQA 1BYDA 4YHEA 4OOZA 4PMQA 4AX7A 3FJ4A 3STFA 3F7JA 1BVZA 1OG0A 4F0MA 3EB3A 3MUCA 1REQA 3IAQA 2YB1A 2FHFA 1A3XA 5G4EA 1FWFC 4TOQA 2W3ZA 1RLDA 2OOGA 3BLPX 4WUIA 4H7VA 2OQHA 2ZKMX 3SCTA 1WZLA 1X6LA 2Y1HA 3J7HA 3L4XA 1OCBA 2W92A 3IWPA 2PP3A 3GYCA 1I2NA 4YJ5A 3A4WA 4US6A 1S2CA 2PDUA 3FHAA 2TSYA 2AQWA 3UP8A 3AXKA 2V5CA 4D9PA 2IUZA 3O6YX 3B9AA 1DJZA 2WMIB 5DXYA 2PRMA 3SQMA 3WLLA 2Q09A 1TO3A 4FNPA 3UF9A 4GQQA 3ZIZA 4O4VA 5L9FA 3S1GA 2PDXA 5AKQA 1I75A 3M0IA 4JTUA 3VOIA 3JZEA 4E8CA 3ZJKA 5BXTA 3N11A 4IGNA 4XISA 1GONA 3NA8A 3SGGA 2CBJA 4P7OA 5H8MA 1LLOA 3GAYA 4NRRA 5JBFA 2ABBA 3UZYA 3UJFA 3ARSA 2X0SA 1P48A 4ZQMA 3WN6A 3WD3A 4R9OA 1SZEA 3BE7A 3QBUA 4IMEA 4H7CA 4ZSTA 5D8ZA 7REQA 3L12A 4ZE4A 3XIMA 3KFTA 1XIIA 4M7TA 1EJXC 3AYVA 4O1DA 1S1PA 1G69A 1F2JA 5CEWA 2QDEA 4WY0F 1S39A 4ZCWA 3DI1A 1DQUA 2Y61A 1P1XA 3L4WA 3LPGA 3SCQA 3SR7A 1K9FA 3T05A 4C1KA 1FBAA 3WD1A 2PRLA 3UJRA 3W2MA 1GGOA 2OO0A 4GZJA 1FWDC 4K8EA 4NP7A 3TQKA 2BDQA