4U5KA

Complex structure of mutant ctcel5e (e314a) with cellobiose
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
306
structure length
304
Chain Sequence
PKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGYKNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEFTHKWRGTWGTQEDMDTVVRVFDFVKSWSDRNNIPVYFGAFAVMAYADRTSRVKWYDFISDAALERGFACSVWDNGVFGDNDMAIYNRDTRTFDTEILNALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Characterization and Structural Analysis of a Bifunctional Cellulase/Xylanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Hydrolase
molecule keywords Endoglucanase H
total genus 113
structure length 304
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4u5kA00
2XVKA 4AWEA 1E73M 1QBAA 2BS9A 4R5EA 3MV01 1EDTA 2F61A 5E70A 3AIRA 1WB0A 1OGSA 1UA3A 4JL2A 1UR2A 1JI2A 1UH3A 2WB5A 3B9EA 1DWGM 1M7XA 3AMLA 1KGWA 3MKKA 4MNLA 2EO7A 3DHPA 2EPOA 5JBEA 2W67A 1FH9A 1E3XA 4E2OA 3AS2A 2ZIDA 5BCAA 3CTTA 2J74A 3OLGA 4KWUA 3IJ7A 3TTSA 4PEEA 3S6TA 1H1NA 3BLPX 2PWFA 2ZX6A 4MDOA 2WZHA 3WDQA 2VR4A 3CZLA 4W84A 3OB8A 1J0HA 2BHUA 3HMCA 1GCYA 3THDA 3RDKA 1NWRA 3WF0A 3SUTA 1E1FA 1NOUA 1V0LA 3DHUA 3VIGA 2IXVA 4UOJA 2V3GA 1KFWA 2E4TA 2BVTA 1UUQA 4XZWA 4R27A 4KH2A 2XWEA 1GW1A 2ZX5A 1NQ6A 1WE5A 2WCGA 4MNKA 3VIOA 5LA1A 2IXUA 1W9UA 3FAXA 4DWSC 1ZB5A 1AQ0A 1J11A 9CGTA 1W9DM 3WNOA 1XV8A 1K6AA 1DWFM 1XHGA 3W28A 1GOIA 3N1AA 4C7FA 1TMQA 2E8YA 4HMDA 3QHOA 3T2OA 4QAWA 5BYWA 2W61A 1MYRA 2DT3A 5E0FA 2VZVA 1TA3A 5A95A 1HP5A 2J7GA 5CPSA 1HF6A 3VD9A 5A8MA 3AXXA 1JIBA 1GQIA 2W66A 3G6MA 3IAPA 2WBKA 3RPMA 3UESA 1O6IA 3SCUA 4D71A 4TXEA 4HZ7A 1W9BM 3TP4A 1PIGA 5A2CA 1B9ZA 3O9NA 4QP0A 3RM8A 3CIVA 3B8SA 3WL0A 3ZR6A 4ACZA 2X1IA 3VNZA 3WBEA 3WF2A 3NSMA 3GNPA 1JNDA 1FP9A 3PTMA 4P8VA 3EYPA 2XFYA 1IV8A 3HU7A 4W5UA 2BY0A 2YL8A 2ZUWA 5D8WA 3AHXA 1LF1A 4AZBA 4J3WA 1C8XA 2X0HA 4HA1A 3N15A 3T0BA 1UD6A 5DF0A 4IUGA 4AW7A 4GXPA 4RE3A 2DSUA 2QPUA 3CZEA 4N0RA 1WP6A 1JD9A 2E9LA 1FHLA 2VTFA 1BAGA 3BCFA 3UG4A 3KEHA 3RILA 4EE9A 1RPKA 2Y2WA 1PX4A 3GBDA 3ARRA 3BMWA 3QR3A 3VILA 4IPLA 2X8RA 5HNNA 5A6MA 3W25A 1B30A 3T09A 3TTOA 2VCBA 2J8FA 4BZYA 5CGMA 4JAWA 2WVSA 4WF7A 3SCWA 1UG6A 2A3AA 2E9BA 3PTKA 2DEPA 3PZTA 1G94A 2VZUA 3M46A 4TVUA 3FHQA 4PCSA 1C8YA 2UY2A 4KGLA 3GYCA 1J01A 2JIWA 1V3HA 2C7FA 4W93A 2VRJA 2XHYA 4S3JA 4JKMA 3II1A 1V6WA 2X05A 1VFMA 1WDSA 2E9MA 3SCQA 2O9OA 2VR5A 1IZKA 2XWDA 3I3BA 1HKKA 3W4RA 1W3JA 1UKQA 3CZGA 2NT0A 2BXZA 3CH9A 5JIPA 3BXWA 3U7BA 4WLCA 5I3DA 2D3LA 3A4XA 3F5JA 3AIEA 1QI4A 5BRQA 3WNMA 3A47A 4EAMA 1VEPA 5A8QA 1E4IA 3GDBA 2XM2A 2A3BA 1H4PA 5CPQA 4CD8A 3TTQA 2E8ZA 4ACYA 3ALGA 3M07A 2ZUSA 3SCTA 4WSJA 3UG3A 1J12A 4FLOA 1MQQA 4UFMA 3T0AA 1HT6A 4QLJA 4Z2GA 1W2VA 1TVPA 3MSGA 1WKYA 3AI0A 1ODUA 4PSPA 3FXYA 4FMVA 2WVUA 2EXOA 2D0FA 3A4AA 1P6WA 3WNNA 2WCSA 1J0KA 1H11A 4WKHA 5EB8A 1SYTA 1CNVA 2FGZA 1CIUA 4AZCB 3BAIA 4MB5A 2PI6A 5CPTA 5M17A 4HOZA 1QNPA 3CO4A 1MWOA 2EJ1A 3WELA 2FHFA 1GQJA 3L4VA 1HL9A 2J7DA 2WMHA 3CUFA 4CVWA 1D7FA 3GXDA 3GXIA 5A6SA 2BVYA 1EO5A 1GJUA 4EK7A 3SIMA 4AEFA 1AQHA 3CHDA 1ZBKA 4UQBA 1J18A 1WDQA 3ZJKA 1GHRA 3ARWA 4Z2JA 5A2BA 2Q8XA 1V08A 5C71A 2GSJA 4D72A 5IFTA 2CPUA 2WHJA 3KE0A 1NOFA 1OGBA 4LYQA 4CCDA 1ITCA 2EPMX 1MW1A 2CHNA 4JFWA 5AYIA 3AHYA 4OBRA 4P7RA 1O7AA 1MXDA 1UH2A 1ZBWA 1CDGA 7A3HA 1OM0A 3FN9A 2WLZA 3PZVA 3FY1A 4IPNB 4CD4A 4B9ZA 3F5KA 3AHVA 4TX6A 1F4AA 5GPRA 1GQKA 1JYVA 5AY7A 1NOWA 1OB0A 3PZOA 4HMCA 2CBJA 2WC7A 4OIFA 4QLKA 1J0YA 5A94A 1JFHA 1E1EA 5LYRA 4GZEA 2OWWA 3WF1A 5CQ1A 1K9EA 1HVQA 3ALFA 3ZJ6A 4E8DA 4B3KA 1UQYA 2J8GA 4M81A 1HJXA 1ISVA 2WVVB 4AD3A 1CGYA 4PN2A 1EHNA 3WEOA 4PMYA 1W32A 1BTCA 4TUFA 4ATLA 1H0IA 2VRKA 3K4DA 1UD2A 5D8ZA 3ZR5A 5AC4A 2XTKA 1UR4A 3M6DA 4JCLA 4BQ2A 5D9NA 1NWUA 3UR8A 3LPOA 5A6BA 1UD5A 3W53A 1SMDA 3WFLA 3L2LA 3SUVA 5EFFA 3W27A 4GINA 3GNOA 3F4VA 2W4XA 4PYSA 4UFKA 3VUPA 1JZ3A 1V02A 4F9DA 1UA7A 2XIBA 2VURA 3PZ9A 7CGTA 1GZJA 1H3GA 1J9YA 1CTNA 4W8LA 2ZUUA 1KXTA 4W85A 4QCFA 2GFTA 4DM2A 1JG9A 1MXGA 1OIFA 4NF7A 4PMRA 2VNCA 3NYDA 1QI3A 2VO5A 3O6AA 4AY1A 2PWHA 3APGA 3MO4A 1JZ6A 4PMVA 1UQZA 1KBBA 4YHEA 4NI3A 1CYGA 1E40A 4PMDA 3RCNA 3VNYA 3BC9A 2WANA 1NM9A 3EDJA 2AMGA 2BY3A 4C7DA 4D1JA 1EXPA 1K9TA 2XJ7A 4JHOA 3LPPA 5FL1A 4D6EA 2W92A 4W89A 2GDVA 2UY4A 3GZAA 3WBAA 3MV11 2Z1KA 3GBEA 1XCXA 1UYQA 3CZKA 1GPFA 1WZMA 1HP4A 3AHZA 3IAQA 3SCSA 3K1DA 1V0NA 1X1NA 4NRSA 1PZ2A 2YIHA 2EPLX 3WUBA 2OYLA 4AZIA 2WSPA 1WO2A 5BXSA 1HJSA 1NP0A 5ABGA 2OLHA 1MQRA 1NP2A 3ZM8A 1JGIA 4GQQA 4GIAA 4GO9A 1LWJA 2J7BA 2DT2A 2F8QA 3GXFA 1CBGA 3VD4A 2CNCA 1GJWA 3VVGA 2C0HA 2VCAA 2Z1SA 1WDRA 1XSIA 2YBTA 3L4XA 1EQPA 1QHZA 3WFZA 1CLXA 4D6DA 3WUEA 3DYMA 1LL7A 1CXEA 1EO7A 3EMZA 3SUSA 3AYRA 2FGLA 1E55A 5A2AA 1JDDA 1HJQA 2EPKX 1PBGA 1UR9A 3OLDA 1R86A 5GNZA 4P8WA 2J4GA 4UQDA 3SEPA 3WEMA 1MW2A 3WEZA 2ESCA 4UOZA 2V38A 3ARSA 4URIA 1BYBA 1V0KA 3VIPA 3OGSA 3U7VA 4AZ7A 3SCVA 1XYZA 3K8KA 2AOSA 2WPGA 3A6OA 1NWTA 2GK1A 3WDJA 3BLKA 1EHAA 3WDRA 4AZGA 3GH7A 4AD5A 1Q6FA 1OD0A 3VX1A 4OUEA 1ESWA 3IANA 4RE2A 1Y7VA 1PPIA 3K8MA 4H8VA 1JXKA 3WD3A 2WXDM 1FH8A 1DP0A 2JEPA 2XVNA 3EMQA 4IM4A 4L4PA 1E72M 3AS3A 4J27A 5TD4A 1CXKA 1GORA 4WIWA 1GQLA 1EDQA 1E15A 4PRWA 1QVBA 4PUEA 2GVYA 2BV9A 2G4FA 3WDPP 2VZSA 2WBGA 1SR0A 5BRPA 3QGVA 1X6LA 2XFRA 3ECQA 4J7RA 3VIMA 2J79A 2D1ZA 1XCWA 5GNYA 3BMVA 3OA5A 1HJUA 1JZ7A 4JHZA 1ODZA 5CGTA 2J7CA 2VL4A 4P7QA 1RD6A 1C8QA 4A4AA 3ZQ9A 4TX8A 3A3HA 4P8UA 5KEZA 5A1AA 3BAKA 3LPFA 1H49A 1JYXA 1US2A 1BVNP 2GJXB 2GK1B 4HU8A 1ZBVA 4YPJA 2DT0A 2BHYA 3BAXA 1BGAA 4MJ4A 1V03A 4DUXA 3AROA 5CSUA 4W8AA 3VGFA 3MMDA 3CUIA 4PMQA 5I5RA 1B3WA 4DUVA 2G41A 3POHA 3B9AA 1KBKA 2WKLA 2VUYA 5IXEA 3EDDA 2A3HA 1PX8A 2X0YA 1C93A 3RJXA 4UQEA 3L4WA 4UCFA 1ZBCA 4LYRA 3ZT6A 2ZX9A 2DSWA 4MB1A 1R87A 2JF7A 4XX6A 2WMKA 5A6BD 4NSBA 2ZWYA 1TR1A 3MUY1 3WMCA 1WAWA 4MJ2A 1VIWA 3AOFA 3WH6A 3ZIZA 2XYLA 2VVSA 3UG5A 3PZQA 3G6LA 3VDBA 3A4WA 1Q6CA 3KWXA 4JIEA 1ZJBA 1BYCA 1V3MA 2VVNA 3U5YA 1KXQA 3D5HA 5FOOA 4LXFA 1QNRA 7TAAA 2Y8KA 1V3LA 1W3LA 3VIHA 3ARQA 3CUHA 1LJYA 1JL8A 2VQUA 4ZEPA 1XSKA 3AIVA 4UZUA 5ABEA 5E0CA 3U5UA 3PZIA 1H2JA 3WF4A 4H8HA 3N04A 4A3HA 1NWSA 1I1WA 2GJPA 1EDGA 1C90A 3BGAA 4V28A 4CU8A 1QW9A 1OWQA 1WZLA 1ZS2A 5GNXA 1GOOA 1B1YA 2XGBA 2XSBA 1UKPA 4Z2IA 3EDEA 2XUCA 4CU6A 4DWSD 1JAEA 5C70A 2ZXAA 2XSAA 4ATWA 2VCCA 1E3ZA 2YL6A 5FD0A 4LQ1A 2EQDA 2NW0A 6CGTA 1W9PA 4AD2A 4HOXA 2QF8A 3SCRA 2VQTA 1J0JA 4HA4A 2ZXDA 3EMCA 1XH2A 5ECUA 3WH5A 4S3KA 2J78A 2QHAA 1OD8A 2PWEA 3MUIA 4OBSA 4ZENA 1UD4A 2PBGA 3OBAA 1JFXA 4D1IA 1CGUA 1Q6DA 4C7GA 2NSXA 3T08A 2DDXA 2YL5A 3EDKA 3AQUA 5A8PA 1JZ8A 1MVYA 3D3AA 1HXJA 5IHRA 1CPUA 1K9DA 3ZT5A 1ISWA 1WCGA 4WKAA 1KB3A 4V27A 1E43A 3T0DA 2ZOXA 2PWDA 2Y8VA 5D9PA 4F79A 2BY1A 2WHMA 4XUYA 5KZ6A 1Q6EA 2XPKA 1GOKA 1EOMA 2XVGA 4W7VA 2BNJA 3N18A 1GVIA 1M04A 1VFUA 2J77A 3JUGA 2Y24A 5HDRA 4KRUA 1G9HA 4CKQA 2CXGA 4P8XA 2CESA 2C8NA 3GH4A 1W3KA 1FFRA 1KWGA 4NZCA 3VGHA 2FHBA 1HIZA 4KMQA 1VFOA 3QOKA 1CEOA 3PHAA 1TE1A 2TAAA 1QNSA 4CCCA 3SUUA 3K46A 3MS8A 4UOQA 4Z2KA 1KQZA 4LYPA 3AMGA 4BCEA 1E4MM 4MNJA 5A6LA 4LPCA 3GM8A 4MADA 5EBAA 4GI8A 1TG7A 1DEDA 2JFEX 3WQ4A 3CBWA 1FOBA 4Z2HA 2BVDA 4WKFA 4QCEA 3NSXA 4H7VA 3BAYA 1HJVA 1CZ1A 4J3XA 2CETA 2VC9A 1H0GA 3B9DA 1FHDA 3FW6A 4GO8A 2J7FA 1E0WA 2OWXA 4PMUA 2QLYA 4CUCA 2PWGA 2WYSA 1JYNA 1M01A 1ISXA 4EKJA 1XYFA 2V3DA 1BG4A 4ZFMA 3QOMA 3OZOA 3CHCA 3CHFA 3WQ6A 2WW5A 1B31A 3UCQA 3OG2A 2PBOA 1F4HA 2G8ZA 2VX7A 4E4PA 4CD6A 1W3HA 2WMGA 1HL8A 4KGJA 2PF0A 2YKKA 1V3KA 2CBIA 1EQCA 1HNYA 3T2QA 5AYBA 4GQRA 4LX4A 3EDFA 3RM4A 5DT7A 4JKKA 2HISA 1GNXA 1R85A 1DWAM 3ZT7A 3CMJA 2CITA 4AD4A 1UR1A 3BSGA 1CWYA 3VGGA 1RP8A 1ZL1A 5DO8A 1R7AA 2XG9A 1PJ9A 3CMGA 4OKDA 3PZMA 2DIJA 4MAZA 1LL4A 3MMWA 4JKLA 4N42A 3W82A 1CXHA 2DIEA 3VO0A 4QFUA 3SCPA 1QNOA 2WNWA 4WK9A 4YN5A 4UNIA 4FLSA 3VD5A 3O2LA 2EPNA 4U3AA 4ZXLA 1QI2A 2YA0A 3E1F1 1VENA 3VDHA 5A69A 4K68A 2IUZA 1B3XA 4GZJA 1J0ZA 3VDCA 3WENA 1E6SM 1VAHA 3RO8A 4QLLA 4CD5A 2E0PA 4PBGA 2CBUA 4AZ5A 2WCAA 2WVTA 1LL6A 1E71M 2X09A 2GUYA 5HPOA 3VM5A 2J47A 5EFDA 2ZUTA 2W91A 3WDIA 4UFLA 1UD8A 2JIEA 4MB4A 3NDYA 1PIFA 3AISA 3MUZ1 2FDMA 4M29A 4Z2LA 4AD0A 2WMIB 4CD7A 1GOWA 4CN1A 4RL3A 4M1RA 4U33A 3W0KA 1UH4A 3ARZA 3N9KA 3WF3A 2D22A 2WHLA 5I77A 3KL3A 1UWTA 2YBUA 5ABFA 1G5AA 3MANA 3AS1A 2ZX8A 3WD2A 5ABHA 3WNKA 1KGXA 1V0MA 3OLIA 1M53A 2YDSA 4X9YA 1DHKA 3PTQA 1N82A 4HP5A 1JAKA 2WWDA 3VIKA 5ABFB 2XVPA 3IK2A 4U2YA 3GH5A 1H41A 2J7EA 3N13A 2VX6A 4MAVA 1ISZA 2F2HA 5LA2A 1FFQA 5DFAA 3VMNA 1CGXA 1EH9A 5D4YA 1MFVA 5DMYA 2JALA 4PTWA 1GVYA 2V5CA 2DH2A 1UD3A 1WZKA 2W5FA 3VINA 3VPLA 3NIYA 1UWRA 1KXHA 4DUWA 4U31A 1B2YA 1WZAA 2OSWA 5FCZA 5I78A 3PZGA 4P7OA 1CXFA 2A3EA 2VOTA 3GTNA 1NH6A 4HOWA 1BG9A 1KR1A 2D20A 4J3TA 3VKKA 3SUWA 2OSXA 3ARYA 4U5KA 4M8UA 1HX0A 2E40A 4U3CA 3PZUA 1B3ZA 4AISA 3MMUA 2UWFA 3AS0A 4MPKA 1SFSA 1Z32X 5CJ5A 2BY2A 3AJ7A 3AMCA 1HJWA 3WQVA 1QPKA 4AC1X 1XRVA 4L4OA 2B31A 3ZJ8A 2O92A 5CG0A 1WPCA 3LMYA 1E0XA 3AIQA 1UZ4A 1X6NA 4GI9A 1GOMA 2FH8A 2YDRA 1W9VA 5IFPA 5D9MA 3K8LA 3LPGA 1TZ7A 2QMKA 2YL9A 4HMEA 2CIPA 3ZO9A 1KR0A 4GI6A 1UZ1A 3QHNA 3W26A 3ARTA 2VI0A 1U2YA 1V3JA 3J7HA 3WMBA 4TVDA 2WVVA 1JZ5A 1UWUA 2EBNA 3NDZA 4CU7A 2ZUNA 2V3FA 4PMXA 4AMCA 1E0VA 3N17A 5FIPA 4NRRA 1G0CA 3WD0A 1S46A 1FA2A 5I0DA 2Y5EA 1EIBA 1QNQA 4W5ZA 4ML4A 2UY5A 2OWCA 1UOKA 4AIUA 1W9XA 4HPHA 4PMOA 1TUXA 3SURA 3CZJA 1W1VA 1I75A 3TOPA 3WDHA 1UKOA 1PZ3A 4V2XA 3OIHA 1V3IA 1HVXA 3TONA 4X0NA 4PCTA 1VF8A 1C92A 3UEQA 3N11A 5CZKA 2DSZA 3WD1A 4B16A 1L8NA 1R8LA 1E4LA 4ZE4A 3AIWA 4M24A 3PN8A 2CKSA 3U57A 3VGEA 4AYSA 4AIEA 1JDCA 1EA9C 2A3CA 4J28A 1CGWA 4BF7A 5C8BB 3NCOA 5JIWA 3BH4A 2O9TA 1JNEA 3VD7A 2XVLA 3GXMA 5BROA 4WSKA 5DEZA 3TA9A 3RM9A 1CGTA 1U30A 1HKMA 5BXPA 2O9RA 4MNMA 4PTVA 5IHSA 3OGRA 4B3LA 1E6RA 3POCA 4J3SA 5A6KA 5M5DA 1QHOA 1JI1A 1CLVA 2WZEA 4PUDA 2EEXA 2G3IA 5HPCA 3PZNA 1UR0A 1KCKA 2YDQA 3VU2A 3AIBA 2YA2A 4FF5A 2VX5A 4HZ6A 1VJZA 3K4AA 2W62A 5LA0A 2OSYA 1VJSA 5F7UA 3SCOA 2ZUVA 3BCDA 4UFHA 4H2CA 2DSKA 2J75A 4B15A 1MFUA 1PEZA 2E3ZA 3FHAA 3VD3A 3AZSA 4HTYA 4UQ9A 1GONA 1W1TA 4M82A 3AZTA 2DT1A 2D2OA 5HOSA 1OT1A 4JL1A 1G01A 1OT2A 4AD1A 1BF2A 3CHEA 2MANA 3UERA 1WDPA 5HXMA 5D9OA 2WLYA 1B0IA 4RE4A 1DWIM 3AFBA 4GZIA 1UHVA 3CLWA 2QV4A 1BQCA 1JZ2A 1QI0A 1D2KA 4FK9A 3EBVA 3UETA 3WKZA 4TTGA 4IISA 3IJ9A 3WH9A 1JXJA 4H8UA 2QMJA 1JDAA 1AMYA 2G3MA 1TVNA 1CENA 1JYWA 1EOKA 1OIMA 1W1YA 4F9JA 4OZOA 2BXYA 1JZ4A 3NJ3A 1OSEA 3FNDA 4F8XA 2VZTA 1VB9A 2WMFA 3W37A 1E6PA 1QHPA 2WMIA 4TOQA 1CXIA 3WN6A 3HN3A 3L4YA 4BS0A 3WUFA 2V3EA 1KQYA 3NUKA 5FL0A 4D6JA 4D6CA 4AXNA 1KWKA 2NT1A 2QPSA 4D6HA 3WQWA 2VMFA 4BQ3A 5JBDA 4JFSA 1LQ0A 2D24A 3KL5A 2WC4A 1XD0A 4AIOA 5HBFA 4Q7NA 1CXLA 1ISYA 1V6XA 2YJQA 1OCQA 1R7OA 6TAAA 2VT0A 1GUVA 8CGTA 1DTUA 1E9LA 1W1PA 2V5DA 4B9YA 1M03A 5M3WA 1NARA 1HN1A 3W6LA 1XH0A 5DT5A 4UFIA 3WUGA 3VM7A 1IT0A 1U33A 1OBAA 1BSIA 1SMAA 1RH9A 2VRQA 2DGAA 1VEOA 4LGXA 1CECA 1KXVA 2AAAA 3W38A 2CHOA 1VEMA 4HZ8A 1G1YA 1LG1A 3VMOA 5BXTA 1TA3B 3VIFA 1MW0A 3CUGA 2ZWZA 5I23A 3L4ZA 3VGBA 1JD7A 1PAMA 4WJXA 1PX3A 1VBRA 1EGZA 1V6UA 2GJRA 3WNLA 1IZJA 1JF5A 2D0GA 4JCMA 3W29A 2WKGA 1J0IA 1J10A 4J3VA 1LG2A 1OGGA 4ZE5A 3RIKA 4JFTA 5EMYA 2BHZA 3AXHA 4FLQA 2CBVA 2CEQA 2WZIA 4W88A 1YQ2A 3KL0A 2JF6A 3MU7A 8A3HA 4W7WA 2XGIA 2WSKA 3MUAA 1DWHM 1K9FA 3AMKA 3W6MA 4OJYA 3L4UA 5CXPA 3WL1A 1B3VA 4M80A 4PSRA 4X0VA 3PBGA 1QBBA 1H5VA 3QHMA 4HA3A 4OOUA 1GOQA 2WAGA 4D6IA 2D3NA 3HJEA 4CN4A 2YLLA 4UZSA 4JFVA 4OOZA 4QDMA 2DPEA 2WHKA 1YHTA 1UKSA 1C3FA 1LLOA 1E5NA 2GJXA 1D3CA 1V6YA 3VX0A 1BVZA 2WK2A 3N12A 3T2PA 3OLEA 3VIJA 4F66A 4U2ZA 4ATDA 3WH8A 3ZSTA 2ZX7A 1ECEA 1FH7A 4BA0A 2RGMA 3WIJA 3WQ5A 3F5LA 4AZ6A 3M7SA 1FP8A 2CYGA 1MQPA 2PB1A 3DC0A 1E56A 3DYPA 4UFJA 1WNOA 5A8NA 3ZMRA 1KCLA 1GHSA 3THCA 5A8OA 1V6VA 1UWQA 4JFUA 3VDAA 2ZICA 4DWSB 1BLIA 4W87A 5E09A 3GNRA 4AZCA 1E6ZA 4A3YA 3WNPA 3L4TA 1Q4NX 2Y4SA 5E6YA 2OYKA 3BSHA 2DSVA 4MB3A 5BXRA 4PMNA 1DWJM 4FLRA 4P7LA 4Q22A 1A3HA 3CPUA 3AMDA 2WMJA 1B90A 1ZU8A 3WQ8A 4W8BA 3AXIA 4CN6A 1XC6A 1UR8A 1BHGA 1W91A 2J7HA 6A3HA 4HPGA 1TCMA 4D6FA 3I3EA 1TFVA 2CKRA 1I1XA 4UR9A 4TVCA 2XFFA 2WM0A 2DH3A 1LWHA 5BWFA 4EANA 1MW3A 5FKYA 4DWSA 2WC3A 5CLWA 4AZHA 2VZOA 1BYDA 3ZOAA 1UWIA 4GPNA 4TTUA 1A47A 4CVUA 2D23A 3BAJA 1XSJA 5GQBA 4BQ5A 3OZPA 1W2PA 1BGGA 4XV0A 4BQ4A 1B3YA 2YA1A 2VJXA 1Q6GA 5I6SA 2CERA 1E6XM 2FH6A 3ARPA 3ZSSA 1UKTA 1UWSA 3AZRA 4PTMA 1VBUA 3CZ8A 2DQXA 1BYAA 1L0PA 4P7NA 1C91A 4W86A 2YLAA 1V02E 2W63A 1H09A 5CLTA 1AQMA 1HKJA 1ITXA 5JBFA 5JUVA 2ZXBA 4YHGA 5IDIA 2OYMA 3I3DA 1QW8A 4MTVA 3VGDA 5M03A 5E9AA 2BFGA 3RMEA 3S2CA 3AICA 1VRXA 3DYOA 3BAWA 4W7UA 1E6NA 2J62A 3KZSA 2O9PA 4HU0A 2UY3A 3IJ8A 4KRTA 4XZBA 4CCEA 2JE8A 1E6QM 3WSUA 3TTYA 4H41A 4J3UA 2CCRA 3VTRA 4CGTA 3OGVA 4ACZB 2XIIA 4ZXOA 2JEQA 2FHCA 3AYSA 4H04A 2G3NA 4PMZA 1VFFA 3NSNA 5A3HA 3VOCA 3VMPA 1RP9A 3WD4A 1CGVA 1XH1A 1HKIA 5E6ZA 3AIUA 2GDUA 2X2YA 2ZE0A 1KGUA 2HVMA 5I24A 1US3A 4MDPA 3UR7A 4UQAA 1QOXA 1BPLB 5CSYA 1BFNA 3VIIA 4UTFA 1ZJAA 4DM1A 4Y7EA 5I2UA 5A6JA 4E8CA 2XM1A 1JF6A 4U5IA 2J25A 5AC5A 1AVAA 4M56A 1XD1A 1C7TA 3WH7A 1OINA 5I79A 2ZUMA 2PC8A 4JZ5A 4AEEA 3MSDA 4UQCA 3ZJ7A 3AHTA 4PTXA 3W81A 2RGLA 1C7SA 3W24A 4D6GA 1E4NA 1E5JA 3ARUA 3DECA 3RJYA 2VX4A 2D0HA 3ARVA 1XGZA 1E70M 2WWCA 3SCNA 3ARXA 5A6AA 3L2MA 4GKLA 3FAWA 3WMSA 2G3JA 4XB3A 2ZXQA 3WY1A 1QI5A 3CGTA 2YOCA 3CUJA
chains in the Genus database with same CATH superfamily
3BV4A 2XVKA 1E73M 1QBAA 3MV01 1LOLA 1EDTA 1WB0A 4G7EA 1OGSA 1UA3A 4IL2A 2WB5A 4V1YA 1OX5A 5AC6A 2C6QA 3LCLA 3MKKA 2ZC1A 4GUFA 2ONEA 3LLFA 5JBEA 1J6PA 1E3XA 3AS2A 4E2OA 2J74A 3F1QA 3IJ7A 4DXKA 3W1TA 2WZHA 3CZLA 3OB8A 1G4EA 3TROA 3M64A 1V93A 3UR5A 1H7NA 2XISA 3VABA 3VOHA 3K1GA 1NOUA 4HN8A 4DF0A 1AG1O 1A0CA 3V1HA 2Y6ZA 4E8GA 1WE5A 4JEJA 1IZCA 3ZWSA 1W3IA 1W9UA 1YX1A 3FAXA 3S1WA 1IQ8A 3V5OA 1W9DM 3WNOA 2HJPA 1VH7A 1K6AA 1ADOA 1Q7MA 3E74A 3T0CA 5HWJA 1GOIA 3N1AA 3G1HA 1BSLA 3TJLA 1XYLA 2GJNA 3PNZA 3DIPA 1RCQA 1TA3A 1HP5A 1DJQA 2Q8ZA 5CPSA 1QCWA 1JIBA 3ME3A 2W66A 3G6MA 4MFEA 2WBKA 1TV4A 4N6EA 4G1NA 2TYSA 4MLJA 4MZ8A 1PIGA 3L0KA 3UXAA 5A2CA 2AQVA 4H7ZA 1B9ZA 1RLDA 2EG7A 1I2PA 3RM8A 1U5JA 5DELA 3ITGA 3CIVA 4I5UA 3NSMA 4FXFA 3GNPA 1JNDA 4FR1A 2C15A 1FP9A 1XLLA 3PTMA 3EYPA 2NVDA 2FDSA 3SQSA 5LHFA 2WZMA 5D8WA 3M0IA 1C8XA 2X0HA 4F0MA 3RITA 3T0BA 2QPUA 1RVKA 2EKGA 3CZEA 1WP6A 4O4VA 5LNWA 4NNBA 3RILA 4EE9A 2PDQA 2YGYA 3ARRA 4PR4A 2PCEA 1B30A 4MVAA 3TTOA 3MKCA 3OP2A 5CGMA 2WVSA 1XQKA 4RK8A 2NQJA 3WJWA 3LHWA 3E02A 4WZHA 3PZTA 4IG2A 3FHQA 3BOLA 4PCSA 4BEUA 4XAYA 3QTGA 4YYFA 3E5BA 1OC5A 5C7VA 3GYCA 1AJ2A 4XAGA 3CC1A 1I2QA 2C7FA 4W93A 3II1A 4WD0A 2VFEA 1VFMA 5D2TA 3QJAA 3HPSA 3S9YA 1P7TB 1GZGA 1HKKA 2J66A 1W3JA 1S2TA 3CZGA 2DZTA 2VC6A 4K37A 4J35A 1TREA 2B4GA 3EAUA 1EUAA 3F5JA 4JEQA 4EAMA 1U1HA 3GD6A 2P5NA 3SR7A 5MKGB 2GUUA 3GDBA 2XM2A 4XVEA 1V7YA 5CPQA 1H4PA 3P93A 3TTQA 5LIYX 4ACYA 3TQKA 3SCTA 4PZVA 1J12A 3UG3A 5H91A 3R5EA 3T0AA 3KVLA 1Z41A 2XN1A 3AI0A 3NQ6A 3F2BA 4ZOEA 3KRZA 4PSPA 4JDBA 4FMVA 4WCJA 2WVUA 2KAUC 3JU2A 5EB8A 4MPQA 2C1GA 2FGZA 3SN4A 3MCNA 3Q94A 3O6DA 4AZCB 3PTDA 3UZYA 5M17A 1MWOA 2EJ1A 2ZZ5A 1UIOA 1GQJA 2J7DA 3LERA 3HGRA 4Q6JA 1U5HA 3G24A 2V68A 1EO5A 2VXNA 4EK7A 1AQHA 3PJXA 1ZBKA 1J18A 3ZJKA 4IQLA 2ZRUA 3DXIA 5A2BA 4LB3A 2QDHA 3L5AA 3R58A 4D72A 3I7QA 4YVXA 1NOFA 1OGBA 1W5QA 4LYQA 2E6FA 4JQ3A 4H3DA 3OBKA 2EKCA 1BQGA 2XN0A 4K7YA 3PZVA 3FY1A 3FK4A 4IPNB 4GVIA 3SRFA 4JTLA 2O4QA 4TX6A 1TWIA 2ACQA 1L6SA 5FF7A 3H8AA 2BOGX 1GQKA 2FTYA 3RLVA 5C9WA 1JYVA 5FEPA 5AY7A 3GG7A 4QHRA 3RCYA 2WC7A 2E7FA 3MP4A 5LYRA 1OK6A 2OWWA 1K9EA 1XUUA 2XSXA 1UQYA 2PURA 4DJFC 1TJPA 3W71A 4M81A 1HJXA 1ISVA 3NQGA 2WVVB 3GS6A 4AD3A 3VC6A 1EHNA 4DHGA 4UC5A 1BTCA 1EZWA 4TUFA 2PDIA 1H0IA 5T91A 3PC0A 3K4DA 1NELA 1UD2A 1QT1A 4LJ3A 4WGXA 3ZR5A 2PGEA 5AC4A 5EMUA 4WRHA 4C6JA 2VGIA 3BJFA 4I9TA 2HV5A 4BQ2A 3NWRA 4FR6A 1E9YB 3CL6A 1UD5A 1EEPA 1SMDA 3SUVA 5EFFA 1JPHA 4LCRA 1NDWA 3GNOA 4UFKA 1OVDA 1JCTA 1BTMA 1R30A 3R2GA 4OGZA 3PZ9A 1H3GA 3NGFA 2DW6A 1CTNA 4JYDA 1EFZA 3WQGA 3PP7A 3C2FA 4Y9AA 2GFTA 4DM2A 1MXGA 1XYCA 1DQXA 2Q3OA 2QXWA 3GFZA 3B97A 4Z1BA 4S38A 1PL9A 4ZODA 2E5CA 1K77A 1AZ1A 2BXVA 4AY1A 1JZ6A 2ISWA 1A80A 4PMDA 2RJHA 3BC9A 4C6CA 3DBNA 1NM9A 4QTGA 3NQ7A 2AMGA 4M51A 4C7DA 4I5RA 1EXPA 1K9TA 4D6EA 3U8GA 2OG9A 3MV11 2Z1KA 2FMNA 2V5JA 1KTCA 1THFD 4RDVA 1GGOA 2IQ0A 8TIMA 3JRKA 1C9WA 4HNLA 2GLKA 1L8PA 4WXYA 4DBSA 2WSYA 1X1NA 4NRSA 3A21A 2YIHA 3LCFA 2DZXA 3ICJA 1Q5MA 4GWEA 1HJSA 1X1OA 4C6EA 5XIMA 1GKPA 3LENA 2CW6A 1P0KA 1LWJA 3GXFA 5CC3A 5K4XA 2CNCA 4OE7A 4O8RA 3SN0A 2YBTA 1EQPA 1DBTA 3M5XA 3TYAA 3WFZA 3URQA 1CLXA 2C91A 2YXOA 5JVLA 2QR6A 1KD0A 3EMZA 3SUSA 1FWSA 3GVWA 1E55A 1JDDA 2EPKX 1XFCA 1YXDA 3FEMA 2VWTA 2OX4A 4JTQA 2AQOA 4K39A 3V18A 1TZZA 5CGQA 4LUYA 1KFKA 1FX6A 3KRSA 4GC4A 1Z8AA 3SADA 1O5XA 1XYZA 1JQXA 2V6AA 3MKVA 3RPTA 2GGHA 3OYZA 3TU9A 4AZGA 4WEVX 1OD0A 2KX9A 3VX1A 3IUHA 3LGDA 2B7NA 4RE2A 3PF3A 4P61A 3GUWA 3TMQA 1DP0A 3U0HA 3CASA 4L4PA 4OV9A 1DVJA 4J27A 1TPUA 2IPFA 5AHFA 4H9ZA 4PRWA 4PUEA 4GQGA 2NQLA 1EUNA 3DG6A 2GVYA 4L5ZA 2VZSA 4H4IA 1AH4A 3ECQA 4L64A 5GNYA 2H8XA 3CHVA 5FA5A 4LOCA 3TN4A 3CUZA 3OA5A 5F2GA 1HJUA 3MZNA 1ODZA 1Q13A 5DCEA 3MDUA 3ZQ9A 1GTHA 1HO1A 3A3HA 5A1AA 4NJHA 4PL1A 1H49A 4YTQA 2DY3A 2GK1B 1ZBVA 4MWAA 5HMDA 3C0LA 1R47A 2QW5A 1FWTA 2NXGA 4W8AA 4IP7A 3F4WA 1XICA 4PMQA 4DYEA 4UTLA 3B8UA 1KBKA 2VUYA 4GH1A 1PX8A 5HNRA 5HATA 5G1MA 1FCVA 4XISA 3ZT6A 4I9JA 4ZVJA 3DKLA 1LROA 2HBXA 1KC7A 5A6BD 2WMKA 4OVXA 4A6GA 4Q4RA 4H1ZA 1LDCA 1OFDA 3TOYA 1Q6CA 4JIEA 4ZO7A 1BYCA 1V3MA 3U5YA 3GIYA 3HG5A 3D5HA 4IGHA 4HSOA 2A6NA 4CQBA 4LS1A 5G1YA 4HCDA 1XRTA 3VIHA 2AMXA 2VQUA 3WG6A 3C5QA 2FGBA 3QC0A 4K2SA 2A6LA 5E0CA 1H2JA 3D3FA 4HSHA 2GOUA 3N04A 1I1WA 4IX0A 4ENLA 1EDGA 1QW9A 2XGBA 2I1OA 5KSWA 5LNRA 4HVXA 4AVNA 4DWSD 3RMJA 3M0YA 5CJNA 1BVWA 1VJIA 3GFYA 5C70A 3D0CA 1IE7C 2VCCA 1QXLA 1SO6A 3HA1A 4PODA 1DJHA 1J0JA 3R8RA 3NQAA 1XH2A 5JMUA 4ICCX 2J78A 5HWMA 1OD8A 2PWEA 3Q65A 3MUIA 3MCMA 2R24A 3JW7A 1FWWA 2G97A 2PDLA 2NWSA 2ZRXA 1EF2A 2YL5A 3AQUA 5A8PA 1JZ8A 3TYDA 5IHRA 1K9DA 3RRAA 2OR2A 4WKAA 4HNCA 4JTKA 4MJMA 2DQWA 1EWEA 2C1IA 4GUIA 5D9PA 3FA5A 4F79A 3THAA 3NAVA 1EOMA 4O13A 4FX8A 1DTNA 1M04A 3JUGA 4FA3A 4QDWA 3GKFA 2CESA 1XR2A 1YTKA 1XLBA 1FFRA 1F61A 3H12A 4QDPA 4WJEA 3VGHA 4MY1A 4BF5A 1VFOA 5I3HA 5BU6A 3VK5A 3CK5A 3LCHA 4QAIA 2C18A 1H61A 1YTDA 3BMXA 4DYKA 3OOQA 1TWZA 1TPFA 5DBUA 1E4MM 1EC9A 4KWOA 1KNWA 4MADA 3MWAA 3S6OA 5EBAA 1DEDA 3KCLA 3WQ4A 3CBWA 1FOBA 1QPQA 1IEXA 3E9AA 3W1PA 3SY1A 3NL3A 3ZLHA 1GW9A 4DX3A 1GG1A 1CZ1A 2CETA 1H0GA 3FW6A 4UTJA 3EA2A 1J2WA 1ZFJA 2PWGA 2TPSA 1JYNA 4QG8A 1ISXA 4RPQA 3I68A 3M47A 3Q2DA 1ML1A 4O18A 3L0GA 1BG4A 2ZVIA 1OF6A 2PMQA 4OWGA 1AJZA 5KETA 3OZOA 1VD6A 4XD3A 2WW5A 5E5CA 2A79A 5BOEA 3TW9A 2VX7A 4E4PA 1W3HA 2WMGA 1V3KA 4HYVA 3P61A 4P5UA 1WXYA 1JCYA 3RM4A 4AC7C 2RJGA 2V67A 2Z00A 2HISA 5DCBA 3MUCA 3S1VA 2R1NA 2FPVA 4O57A 3PS7A 4JTAA 1D8WA 2YZ5A 2PRHA 3ZT7A 2FTPA 3GXPA 3D47A 2GGEA 1X98A 3TN6A 1CWYA 3VGGA 4NUWA 1R7AA 1ZLPA 4IICA 1PJ9A 2ZCGA 3PZMA 2DIJA 3FIGA 1X39A 4MAZA 4PFHA 5K9CA 3T6CA 3W82A 3Q4DA 2VDIA 2OZ3A 2PE4A 1QRQA 3SCPA 4LF2A 3WBXA 4IGMA 3R79A 3C8NA 4FLSA 3VD5A 1GOXA 3H2FA 3ABOA 2EPNA 4U3AA 2YA0A 4FOKA 5FF4A 3OPSA 4PB5A 5A69A 1QPRA 1TJ2A 2CLHA 4K68A 4S3GA 2GDQA 2PDJA 5D2XA 1B3XA 4WJ8A 3VDCA 3WENA 2AL1A 1VAHA 3T44A 1VBGA 4PBGA 1PZ1A 2WVTA 3PBWA 1LL6A 4LUTB 1UP0A 3FSUA 5HPOA 3NQ8A 4O1DA 1KM3A 1GPWA 3W73A 2IQDA 2AGKA 1TSIA 3UF9A 1OFPA 1DV7A 4HB7A 4U33A 1XIIA 4KFPA 1UH4A 3GNNA 1RA5A 3W2NA 5I3GA 4KETA 2Z25A 1JCMP 4E2DA 4RE0A 1RV8A 2QDEA 3WNKA 2F6UA 3KLLA 1TV8A 2G50A 3I6EA 4C6QA 4X9YA 3PTQA 2V9DA 4GG9A 2SFPA 3MA8A 1S1PA 1TJ0A 2E77A 3VIKA 3W7RA 5HQEA 4FHAA 1K7XA 3CQIA 2QJNA 1VC4A 2CU0A 1PYFA 2QAPA 5EKYA 2YFNA 2DV0A 3DZ1A 5FJUA 1DOSA 2G0WA 1W54A 3JZEA 2YR1A 3C0QA 2ACUA 1SO4A 2DVXA 1Q65A 2YBVA 2JALA 3VNKA 3CAKA 1M7PA 2HDJA 3UU0A 2V5CA 2DH2A 1UD3A 1WZKA 3W1UA 2Q01A 3VINA 2X30A 4DUWA 1B2YA 3PZGA 3B06A 3M0LA 4GYFA 2YXGA 3CQHA 3QH2A 1NH6A 2D20A 3VKKA 2PWVA 3SUWA 3UR2A 2PTYA 3ARYA 2BMBA 4M8UA 3G2GA 2GUBA 3C2VA 4AISA 1TMLA 1DYSA 2UWFA 2A1YA 2Y7FA 3O0FA 4MPKA 5CJ5A 2BY2A 3CXOA 3ZJ8A 2O92A 3WK0A 5CG0A 5G5IA 3LMYA 4XIAA 1VYSX 4R7JA 2F6KA 1GOMA 1FWNA 1DXEA 3PK7A 3ITLA 4K1WA 3LPGA 5H6HA 2CIPA 4UMAA 3W26A 3O6YX 1V3JA 5F1VA 1OEPA 1M41A 2ZUNA 2Z24A 1E0VA 2V5KA 3INPA 3MI6A 3M44A 1S46A 1FA2A 2ZVRA 1JJKA 3GDLA 2OWCA 2UY5A 3ATZA 5U4NA 1W9XA 4HPHA 3G0SA 3W2JA 2ZE3A 1I75A 5LHEA 3QY6A 4R34A 2OEKA 4V2XA 4ZTYA 1HVXA 1WYIA 4LCQA 3PNUA 4F3HA 1LOQA 1EPVA 3UEQA 3EPNA 3WD1A 3TNBA 3R0DA 1XBVA 2QYGA 1YRRA 1R8LA 1R3YA 1TPC1 4IMDA 5U7SA 1H62A 5C2GA 2WZTA 3TMLA 3N2TA 4FAMA 3N34A 3OIXA 5G2HA 3VNLA 4ASTA 2O9TA 4IH3A 3B9NA 1XQLA 1IIHA 3SGUA 3K13A 5DEZA 3PAJA 1XPYA 2PC4A 4NJKA 5H8PA 7XIMA 3WLNA 1MUMA 1VGAA 1E1CA 3LG3A 1KM6A 3NQ2A 5M5DA 2NXIA 3GLCA 4AMAA 1CLVA 4IPJA 2WZEA 3F4CA 3H4XA 1PB0A 4PUDA 1G69A 4KERA 3WO8A 1VP5A 1UR0A 3NZPA 3V16A 2ZTJA 3QKZA 3FFSA 3PJWA 2YDQA 1XG4A 3PPHA 1J8VA 2QCEA 2QV5A 2H9AB 5LA0A 1FHVA 3BCDA 4UFHA 3NYZA 2J75A 4B15A 1DE5A 3PSVA 1K8XA 4QE4A 4UQ9A 1GONA 4R7WA 5L6UA 1VS1A 3I7SA 1UP3A 5I3JA 1OT2A 1K03A 2AQWA 2MANA 2QKFA 4HCHA 5HXMA 4RE4A 1EKOA 4K8HA 2Y7GA 1UOZA 4B5NA 4PL2A 1BQCA 4H01A 4X2PA 3KVMA 3CIWA 3LCXA 2VEMA 3WKZA 2BGNE 3CU2A 1ECQA 1R5YA 4E38A 1JYWA 1W17A 4ROPA 3WLKX 2G37A 1A50A 3FNDA 1VB9A 1EBHA 4TOQA 4JQAA 4BS0A 5I3IA 3ZXWA 3WUFA 3WFAA 4LVBA 5IBXA 1M1BA 4D6JA 4D6CA 2UZ9A 3UCCA 4AXNA 4D6HA 5JBDA 2CLOA 2POTA 3PUOA 3LRLA 5CC7A 1XRSA 2A7PA 5LGXA 4AIOA 4C1NB 2ALDA 2P8BA 2REQA 3QGAC 1OCQA 2VUNA 3TFCA 9XIAA 3SO7A 1LT7A 1GUVA 1YPIA 1DTUA 1H1ZA 4Q8OA 3BQ6A 1UC5A 5M3WA 2EF9A 1EC7A 1XH0A 1C29A 1YE4A 4XZMX 3VM7A 3PPCA 2Z29A 1OF8A 5BOFA 3VCNA 5CJMA 1OJXA 4IJRA 3W7NA 2B81A 2AAAA 3R10A 2CHOA 3DEQA 2QCGA 4XZIA 1LG1A 4O8AA 5BXTA 1NIUA 2ZWZA 1PAMA 1XX1A 1P0NA 1PX3A 2BODX 5D09A 3WNLA 3FGCB 3W29A 5IM51 3SJNA 2C13A 1J10A 4PB3A 1TX2A 3W87A 3H54A 4GVHA 1MEWA 3A5VA 1Z9AA 2Y63A 4FLQA 4O1FA 3GYEA 3STPA 1BD0A 4W7WA 2XGIA 1OK4A 3MUAA 3N4AA 3LYEA 3F7JA 4OJYA 5CXPA 4M80A 4X0VA 2J8TA 3ZR4A 1H5VA 1ME7A 4HA3A 2YX0A 4OOUA 5EGRA 1GOQA 2FZBA 2WAGA 3W85A 1T41A 3HJEA 4CEUC 3S46A 4IIBA 4FP1A 1YHTA 2ZZ4A 1RHCA 1UKSA 2ATMA 4DELA 4B5VA 3RUBL 1LLWA 1D3CA 1V6YA 4DN1A 1BVZA 4AXKA 5TNVA 3W83A 3VIJA 3IV8A 5D33A 2Z1XA 3W7JA 2ZX7A 1LBFA 5H8UA 1UR3M 3HTWA 3NM3A 1UIPA 1TWSA 1EL3A 4OFCA 4PB4A 4RV3A 2X1UA 2CZFA 1MQPA 3WLPA 2PB1A 5A8NA 4Q33A 5A8OA 1JPMA 2GJLA 3MVTA 1M3UA 1VYRA 1BLIA 3WJXA 4W87A 1E6ZA 2INZA 1N55A 1ME8A 3GTXA 3NEHA 1OCJA 3BSHA 3ISIX 2DSVA 1AQFA 3U9IA 4P7LA 4Q22A 4O1EA 3DN5A 1W91A 1OFEA 1RPXA 1IWAA 5CC6A 3RFAA 4YWSA 3I3EA 1TTIA 1XGDA 2CKRA 4TVCA 2XFFA 1RR2A 2WNZA 1LWHA 2GZXA 1MW3A 4NI8A 1PTAA 4XBJA 1A47A 4ZR8A 3BAJA 5GQBA 2YXXA 4BQ5A 3OZPA 1TO3A 4YTRA 4NNCA 3TC6A 3LNMA 5DXXA 3RHGA 3LLDA 1MEIA 4WOQA 2VJXA 1X7IA 4WHBA 4L7ZA 2FH6A 1FDZA 1MSSA 1XLHA 1UWSA 2E28A 4G8TA 3AZRA 4DRSA 2A3LA 4PTMA 1BYAA 4HTBA 4P7NA 5LKYA 1XLIA 4W86A 3GFXA 2YLAA 4O1AA 3TYEA 5K9XA 1T5AA 4RZ4A 2DP3A 3O16A 5IDIA 1VHCA 2HZGA 3WLOA 4MTVA 3VGDA 1I8JA 3CYVA 3A9IA 3GRIA 3GAKA 1E6NA 2O9PA 3M16A 1KFCA 4O54A 3H24A 2XH4A 3E2VA 5EBUA 1OC6A 2CCRA 3VNJA 3L2IA 4ACZB 1PZ0A 1UZDA 1ZCCA 2DZSA 4G1KA 2QZRA 3AYSA 1WAUA 2G3NA 1VFFA 3NSNA 1HGWA 5A3HA 2CLFA 1IXNA 3VOCA 3WD4A 3RX2A 3U6WA 1CGVA 4HNVA 3UJ2A 3IV3A 3NPVA 2GDUA 2O55A 4MDPA 3UR7A 3NXLA 4JY9A 3VKDA 1QOXA 4HGXA 4F48A 5CSYA 1LLZA 4L4LA 1T0OA 4E8CA 3LCGA 4NT0A 3A23A 1OINA 1CW2A 2E6AA 3MSDA 4JYEA 2GVJA 3AHTA 3VNMA 4PTXA 1C7SA 1E4NA 1E5JA 1NDYA 2NXHA 4AQLA 3ARVA 3KZPA 4BF9A 3KLKA 3L2MA 4GKLA 3DAQA 5FAGA 1R0MA 4XB3A 2ZXQA 3CGTA 3FJ4A 2YOCA 4AWEA 1H51A 2Q02A 4Z08A 5D02A 3E2QA 2PZ0A 2CLPA 5M1TA 4FNPA 3B9EA 3IVSA 3AMLA 1B5TA 1F05A 2VFDA 1JCXA 3HURA 3DHPA 4FX6M 1OYCA 3M0HA 4L6DA 3FKRA 3W74A 1TCDA 4JHMA 3TTSA 1FWJC 5HR7A 3BLPX 3SN1A 5E9XA 2VR4A 3RG6A 4H8NA 2XN2A 1J0HA 1GCYA 3THDA 3RDKA 3AXMA 1NWRA 2ZZ7A 3LK6A 3DFHA 1A0DA 3AC0A 1J79A 1V0LA 3DHUA 3VIGA 2IXVA 2V3GA 3HG2A 2ZFAA 5A5WA 1S2CA 2BVTA 4QJ5B 4R27A 3W6YA 1GW1A 3HFYA 1O94A 3VZXA 1NQ6A 4H9YA 2FPTA 2WCGA 3VIOA 3W7DA 2IXUA 4I9MA 1J11A 9CGTA 3O15A 4PULA 1EJWC 3WLTA 1YMYA 3NL6A 5AYYA 4C7FA 1AA1B 4HMDA 3T2OA 3W07A 1MYRA 5E0FA 3SJ3A 2RHGA 3W7GA 1T8QA 4C60A 3I65A 1P0BA 5FJPA 3VD9A 2ATSA 3AXXA 2GOKA 4S3DA 4C5ZA 1XLDA 5G4EA 3GSMA 3UESA 3FYPA 3SCUA 4TXEA 3KCJA 5J5DA 3W1AA 3V7PA 1PKMA 3DFTA 2XIJA 4PH6A 4ADTA 4S1FA 3B8SA 1NFPA 2PCQA 3LTYA 4AFYA 3WL0A 3ZR6A 4ACZA 3DESA 4AUBA 3WBEA 3E0LA 3P7YA 3S5NA 4F0SA 2ZC8A 4P8VA 1TR9A 1IV8A 1HO4A 5AOUA 1NQKA 4HA1A 3WX7A 4FALA 1UD6A 1KFJA 4AW7A 3W01A 1EJSC 1FXQA 4RE3A 3PUGA 1RCXB 5A6TC 4N0RA 1JD9A 1YXCA 4DPPA 1S39A 4E4FA 5G1TA 2JQXA 3GAYA 1N8IA 2Y2WA 3GBDA 3BMWA 3GNXA 4A2SA 5A6MA 3W25A 3HJZA 3T09A 2VCBA 5CG7A 1UG6A 1DIDA 1ZP4A 3PAOA 2E9BA 5C2CA 3QM3A 2GWGA 1G94A 5IDZA 3M46A 3I6TA 3LZ3A 4GYPA 2ADAA 3HQPA 3GR4A 4RX0A 2BTMA 1TIMA 1SPQA 3ELFA 2VRJA 4DYJA 3WJYA 3KBNA 1V6WA 1WDSA 2E9MA 3SCQA 4N6FA 4ICMA 2DFAA 2XWDA 3I3BA 1CB2A 3W4RA 4NQ1A 4L1GA 5D2YA 1LRNA 4IWWA 4PE8A 3GE7A 4GI4A 4WLCA 3AIEA 1XF0A 1IR2A 3E96A 3A47A 4JN6A 3S2MA 1EJVC 3GU9A 1O60A 1E4IA 5BRBA 4LB4A 5DBTA 2ZUSA 4MM1A 1BKSA 1X96A 1MQQA 2FVLA 1ZAJA 4QLJA 4Z2GA 1W2VA 3UD6A 1ODUA 4NZFA 4HYRA 3C4UA 2EXOA 2D0FA 1P6WA 4IP4A 1B4KA 1J0KA 4WKHA 1RY8A 1SYTA 1QAPA 4REQA 1R3RA 3NQEA 3BAIA 3LN3A 4MB5A 4X61A 5CPTA 4HOZA 3B05A 1AZ2A 5I06A 1JVNA 2OEMA 2FHFA 3UGRA 1HL9A 2WMHA 1BRLA 3CUFA 3GXIA 2PDUA 3DG7A 3SIMA 3V0TA 4AEFA 1SJCA 2UBPC 3CHDA 3PFMA 4UQBA 1WDQA 3EWBX 4YVPA 2R1LA 5IFTA 4F2BA 1SM9A 1OCNA 1WX0A 3KE0A 4CCDA 3K4WA 1UB3A 4JFWA 3AHYA 1XGEA 1O7AA 1ZBWA 4C6FA 2IPWA 1OM0A 1ICSA 4LWWA 4KCVA 1F4AA 5DRIA 5B7YA 3NO5A 4FXJA 3OHIA 5FEZA 3SBFA 1RBOB 3G8EA 1OY0A 2Y7EA 3URNA 2CBJA 3JVAA 1O5QA 4OIFA 1QO5A 2HCVA 4Z17A 4QNWA 1E1EA 1EXBA 5CQ1A 3LEPA 1HVQA 4RDWA 3IJDA 4Q8TA 4WQ6A 4E8DA 3HB9A 4PUJA 3C86A 3CV6A 1U5VA 1H5YA 1V77A 5TAOA 1CGYA 3EB3A 1W32A 3YPIA 4ATLA 4RDYA 5EMJA 2D73A 3MMTA 5D8ZA 1PV8A 4UTKA 3MUXA 3P3BA 4GA8A 1K02A 2BBFA 2QULA 3L5MA 3NQDA 1A0EA 1R3SA 1A5AA 4UXDA 3WZ0E 3LPOA 1K7EA 1XCFA 3G1RA 3IACA 5HQMA 3O63A 3GK0A 3WJZA 2X16A 5AHEA 3F4VA 3AYVA 1I2RA 5DXYA 1S5TA 2VURA 4HPJA 5F2IA 4KRZA 2WM1A 4W8LA 2ZUUA 1IEWA 2ABBA 1P4CA 4W85A 4QCFA 4XWUA 3SAZA 2PDMA 1JG9A 4OT7A 4MFDA 1OIFA 3LZ5A 2ZRWA 2OQLA 2VNCA 4WDWA 3TA6A 1NSJA 3NYDA 4MOZA 2IS7A 1QK2A 2FZDA 1Q6OA 1A5CA 4BKNA 3CPGA 2VEKA 2TSYA 3IGUA 3MO4A 2GQAA 1UQZA 4YHEA 4PRRA 1CYGA 1HFBA 3RCNA 2WANA 4MKVA 4QJ1A 1ZGDA 4D1JA 3T40A 3HQNA 4TQTA 4DBDA 2UY4A 2QCDA 5BOOA 1XCXA 3M0JA 4C6KA 1DHPA 4LAKA 4GY1A 1GPFA 1WZMA 3ENLA 1HP4A 1Q6LA 3SCSA 3L5LA 1IWPA 4MG4A 1V0NA 3NGJA 1YIXA 1PZ2A 4LF1A 6TIMA 3B0UX 4QRNA 5ABGA 4Y6GA 2WNQA 1R3WA 3UZZA 2JKAA 4GIAA 2A2IA 4GO9A 4EIVA 2J7BA 3R6IA 3E2SA 5HAOA 1CBGA 2QAFA 3AYTA 4XBKA 1IXPA 3P5ZA 1S5MA 3VD4A 2I57A 4DB7A 1YYAA 2C0HA 5GVJA 4XKYA 1WDRA 3MSRA 3IPWA 1UROA 3B8DA 1KM4A 3WK2A 2DZAA 2J24A 3WUEA 2OVLA 1LL7A 3MO7A 1EO7A 4JQ2A 3HG4A 4B4HA 4PGLA 2GQ3A 3AYRA 2FGLA 5A2AA 1UBPC 3WQOA 1HJQA 4Q8VA 3CYJA 4GNJA 1PBGA 3NQCA 3W1NA 4LVDA 5FESA 2WKJA 1R86A 1SFJA 2J9ZA 3SEPA 1SQ7A 3WEMA 4MY9A 2PD9A 1BF6A 1E1CB 2V38A 1BYBA 3OGSA 3MP3A 1ITQA 4MGGA 1HKVA 2NX9A 4GFSA 4EF9A 4E5TA 3K8KA 4XUGA 3WDJA 2CXEA 2PDGA 4AD5A 3P8IA 4OUEA 3UW6A 1F74A 1JXKA 3WD3A 4Q8NA 2Z28A 3EMQA 2NV2A 3PG8A 1E72M 2OLSA 3BLDA 1GORA 4Q4SA 5JU6A 1ZP3A 4US5A 3M5YA 4JTSA 3M1ZA 1EDQA 1DJIA 4HHMA 4AAJA 1PO9A 3C3NA 2BV9A 4R7OA 5BRPA 4ONVA 2XFRA 1J5SA 4J7RA 3VIMA 2WJFA 3BMVA 3M4HA 1JZ7A 3NXFA 3EX2A 4JHZA 3BO9A 4RXGA 1RSCA 1TE6A 2VL4A 1QFEA 3FYYA 4GIYA 4H9MA 2Z2BA 3V36A 2R94A 4P8UA 2NQ5A 3BAKA 3LPFA 3CMFA 1VCGA 4HU8A 2BHYA 5CSSA 4HD5A 3AROA 3MPGA 2FZNA 3VGFA 3MMDA 3UYCA 5I5RA 2WOQA 1B3WA 4DUVA 2P8CA 4Q4QA 4US5D 2ANUA 5IXEA 3EDDA 1B4EA 3RNDA 2X0YA 1GVQA 2CZEA 3M0VA 1FCQA 4UCFA 4XZHA 1NJJA 2PZNA 4FXSA 2XGZA 4JTIA 1R87A 3TEVA 2JF7A 4XX6A 1A5SA 3NR0A 4HZMA 3MUY1 1WAWA 3LQGA 1VIWA 3AOFA 4V15A 1DE6A 4XSMA 3VOJA 3KWXA 3LGEA 2VVNA 1R9YA 2QGYA 4Q3MA 2Y8KA 1V3LA 1PVNA 2JGYA 4JTTA 3T4WA 4KCUA 1XSKA 1KW1A 1V6TA 4UZUA 4CQ8A 5ABEA 3GG1A 3U5UA 3WF4A 4C6PA 4A3HA 1NWSA 3QQ1A 3O1NA 5LSMA 3BGAA 2Y61A 3F03K 4K3ZA 1WZLA 2F7FA 4L56A 1PE1A 4ZO9A 3EWCA 3O06A 1A4LA 1LUCA 1MDRA 2XSAA 4ERGA 3IIPA 4UMBA 1WDDA 3GTHA 3C2YA 5FD0A 6CGTA 2QF8A 3SCRA 4KFOA 3Q58A 3LSCA 2D2HA 3ERPA 4NKCA 3G18A 2PDXA 4S3KA 4ZENA 1UD4A 3B4UA 3SB0A 3OBAA 1Q6DA 1P43A 1N2VA 2NSXA 4N9BA 1CPUA 3LGGA 4QG9A 3UVAA 1ISWA 1WCGA 1KB3A 4O0ZA 4V27A 4TIMA 3BWWA 2YZRA 3T0DA 3KVKA 1BWVA 4EP8C 3PBVA 3TTEA 4GC3A 2WHMA 3QC3A 5KZ6A 1Q6EA 1PTDA 4W7VA 3STFA 1JUBA 3N18A 1VFUA 2J77A 3NQMA 4C91A 1XI3A 1UBSA 2CXGA 3APYA 1TMHA 1W3KA 4TR9A 3AXKA 4N9DA 4EACA 1KWGA 1ITUA 1KLZA 4IIGA 2Z27A 3EOLA 3QMRA 3TUUA 2B7OA 1CEOA 4XAPA 1AW5A 2I7GA 3LY0A 2TAAA 3NL2A 1QNSA 2PP3A 3SUUA 5AB3A 1GK8A 4IPPA 3K46A 1XJBA 3VE7A 4YCOA 3EOUA 4Z2KA 1YDOA 3AMGA 4RCXA 4DJEC 3DFQA 3UXKA 4MNJA 5A6LA 3WQCA 2QCHA 4GI8A 4XKYB 2WSQA 2V2CA 1OX4B 4DAFA 5DRCA 3S5ZA 1M68A 4QCEA 3L68A 3G5EA 4XAZA 3W7QA 3QQWA 2VC9A 2OELA 1F8MA 2DJLA 2OWXA 4CUCA 2WYSA 3RLUA 3H55A 3MWCA 1RK5A 4JNZA 4EKJA 1W56A 3PBYA 4AEOA 2VYOA 4Z0JA 3CHFA 4I5XA 4MWAE 1B31A 4JYFA 3OG2A 4OECA 3DGRA 2G8ZA 2FIQA 4LANA 1ADDA 4CD6A 1HL8A 1REQB 2PF0A 3N25A 1HNYA 4AIBA 3LM7A 1OZQA 3GR7A 4B5TA 1JDFA 1AJ0A 1GNXA 1R85A 1DWAM 1XRFA 2W6RA 1R3VA 2CITA 3U48A 4AD4A 2CZDA 5B80A 1XXXA 2ACSA 4NILA 4A35A 1ZL1A 3B0XA 4ZSTA 4U4MA 3H21A 2QVHA 1T99A 3RXZA 1VLWA 1CXHA 4S3BA 4H6EA 4HPNA 1XYAA 2IPGA 1OFOA 1W5PA 3VA8A 1TPWA 3NG3A 2WNWA 4G2DA 1ME9A 3W3OA 4YN5A 3N4EA 5HJYA 3HPAA 3O2LA 1WV2A 4M7TA 1VENA 3CV2A 3M0ZA 2IUZA 3E2RA 5E0KA 1E6SM 1EEXA 5JH1A 3RO8A 2E0PA 3IUDA 3T0TA 3UA3A 3M6YA 3VYLA 2WCAA 1JCJA 4JTGA 1XIGA 4IQEA 1E71M 3CAQA 5EFDA 2W91A 1Z6KA 3WDIA 2JIEA 3NDYA 1PIFA 3AISA 4HQVA 4H6KA 1H60A 3TZFA 1IXOA 4Z2LA 3ZVHB 4OBTA 1VBJA 1TZ9A 4WDTA 1O1ZA 1KV5A 1QASA 2IKIA 4NIRA 1KKRA 5XIAA 4M6UA 4BFAA 1YNQA 2Y8UA 3LD5A 2WHLA 1WA3A 4A8RA 2YBUA 1G5AA 3MANA 5LNVA 3UPWA 1QUMA 3QSRA 4D8ZA 1F3XA 2Y62A 1TV5A 4ADUA 1M53A 1N82A 5I3FA 1CCWB 3MHGA 1PKYA 4O12A 3OODA 5KINA 5K2ZA 3IK2A 4U2YA 1A5BA 5HMEA 3WQFA 1LOSA 3IGXA 5LZLA 2J9YA 4RJEA 5LA2A 3MHUA 1M6JA 2PGRA 3H2OA 4XO6A 3TZNA 3UA4A 5KZDA 3E0FA 5D4YA 1MFVA 5DMYA 3MVIA 3XINA 4PTWA 4H9UA 3ANYA 4AHQA 4JN7A 3O05A 4LSBA 3UG8A 3KS6A 1WZAA 2ZRZA 1GYNA 1FVPA 3HIJA 2QPXA 5I78A 2QVNA 2A3EA 3W9ZA 2FB2A 1KLYA 1RAKA 3KP0A 3L9CA 1BG9A 4TU1A 5AKQA 2FTWA 1OQFA 1G4SA 3LHUA 4FNUA 2Z1WA 3BLFA 3DKJA 4U5KA 4I6VA 1ZALA 4Q7BA 4U3CA 3PZUA 3OO2A 1B3ZA 8RUCA 3TW7A 2C1HA 4JTHA 3MMUA 4NAFA 3RR4A 4S39A 4Z42C 1UC4A 4FPSA 4O17A 3WQVA 4L4OA 2OFJA 1WPCA 5TF0A 2FH8A 2YDRA 1D8CA 1W9VA 3UWYA 4WOZA 5A8GA 3MJYA 3TYBA 2QMKA 2YL9A 3W2UA 1KR0A 2RDUA 4GI6A 1U2YA 3J7HA 1E51A 5FJOA 3EXRA 4H19A 4TVDA 2WVVA 1JZ5A 1UWUA 1YTEA 4CU7A 2V3FA 4AMCA 3VAVA 3N17A 3G3MA 2WQPA 3A9BA 4DIAA 3WD0A 2PP1A 3NZ1A 1FWCC 1X7FA 4W5ZA 4AIUA 3KHDA 1G4PA 1TUXA 1PCWA 1XIEA 1RUSA 3COTA 3NZQA 4XVDA 3ZWTA 2PDPA 2B7PA 1G7VA 2BX7A 5F2LA 3MI2A 5C9UA 1PKNA 3TC7A 2NLIA 3WDHA 1UKOA 2BGQA 1PZ3A 1KM1A 3FX4A 3HGOA 4IQJA 1V3IA 3VXGA 3QZ6A 3TONA 3ANVA 1VF8A 8XIMA 3NO3A 4ZOAA 1G4TA 3RN6A 5TQLA 4F0RA 5CZKA 4XSLA 4EX4A 1L8NA 1E4LA 4ZE4A 1BWLA 1ONRA 4RZ5A 2FVKA 5I00A 4M24A 4BWLA 3B9OA 4AYSA 2I5QA 3PUDA 2A3CA 3WLLA 3CWNA 4UNLA 1TWDA 4LVGA 3MYOA 4A05A 1ZENA 1JNEA 3VD7A 2XVLA 1MNZA 2NUWA 3RM9A 1F6PA 1HKMA 5BXPA 4Q6XA 2PA6A 3MSYA 4GLEA 3FDKA 1W5OA 3GVVA 3LTPA 2BVWA 4PUKA 1J4EA 4ZCWA 4J3SA 4DWDA 2FZMA 1JI1A 1KM5A 3LM3A 4BHYA 1Q63A 3URBA 3H4GA 3QPZA 5FF2A 5I7GA 3REQA 4HNUA 3ABQA 4GABA 4FF5A 2VX5A 6ENLA 3F2DA 1MXSA 2W62A 2OSYA 5F7UA 1LRQA 1W1IE 3ONBA 2W3ZA 2HS8A 2ICSA 1K8ZA 3FHAA 3VD3A 3W88A 6PTDA 3M5VA 4YNGA 1ICQA 3AZSA 4Q7IA 5JH2A 1I0DA 4Q8WA 1HKWA 3AZTA 1KKOA 1Z7AA 1P7TA 4O11A 5HOSA 4DAIA 3DUGA 1BF2A 3EB4A 2NLYA 3UERA 1WDPA 3U2ZA 1T8XA 3EWWA 1B0IA 5GJPA 3AFBA 4FIQA 4GZIA 1JQVA 2FJUB 4BJHA 1ZZMA 4EWJA 1GYMA 1DORA 1D2KA 3EBVA 3VKAA 4TTGA 2FQIA 3GHUA 3IJ9A 4L80A 3TQPA 1XWYA 4DJDC 1JDAA 2G3MA 2Y5JA 1W37A 1EOKA 1IEVA 1OIMA 4WX2A 1W1YA 2HEJA 4IJBA 4OZOA 3VZYA 2NSOA 2VZTA 1GTEA 3W37A 2OT1A 3ZLGA 1DJXA 2ISSA 3M0MA 3U2EA 1CXIA 3WN6A 3IVUA 3NEVA 3L4YA 4C6IA 1AODA 1Y0EA 4E0CA 1KWKA 2NT1A 2QPSA 4RKAA 1XIHA 2NUYA 4A3UA 3EWZA 3BCJA 1AL8A 1PUDA 1FDJA 4MZYA 3N14A 3KTCA 3SDOA 3DI0A 5G4WA 1S5WA 4XTIA 2BWGA 3NDOA 2XINA 3PBMA 2AAMA 4LC8A 4M7SA 4CNTA 1E9LA 4O28A 5DMLA 1HN1A 3ES8A 5DT5A 5D30A 1OFBA 3PPFA 1DJYA 5AHIA 1OBAA 1G6CA 1RH9A 1KBLA 2VRQA 2DGAA 5AFDA 4AVOA 3QQ0A 1AW1A 4GVFA 4JXCA 4ZOBA 1TA3B 1MW0A 2PD5A 1VBRA 1V6UA 4BR1A 2D0GA 4DNMA 4FX7A 2WKGA 5CH9A 1J0IA 4K1GA 1VIZA 2XU2A 4PCNA 1KBIA 1TX0A 1YQ2A 5AYZA 1SZRA 2WSKA 1DWHM 4MWAB 1PKLA 2OB3A 3L4UA 1V8EA 2CZVA 1XLJA 4GCAA 3RK8A 5F4SA 1QBBA 3NO1A 1V5XA 3RU8X 3MBDA 3R89A 2OZ0A 3GQYA 4UZSA 1WKEA 3HV8A 3K2GA 5BMWA 1WUFA 2XIMA 2NZLA 4EVZA 1C3FA 1LLOA 1E5NA 5EMKA 2GJXA 4LUJA 3LSBA 3S1XA 2DVUA 1OHLA 2WK2A 2OGJA 3CT7A 4F66A 4U2ZA 2Y89A 4ATDA 1AUSL 4JNYA 3W72A 3ZSTA 4L61A 4BA0A 3P81A 3WIJA 3W75A 4NZ4A 3T05A 3F5LA 2ODOA 1S5VA 3PG9A 1FP8A 2CYGA 4ILSA 3DC0A 3OG3A 5IRPA 5SWUA 3DYPA 4IJCA 4L6OA 3ZMRA 4E3TA 1ONXA 4ICNA 1GHSA 5LNUA 1V6VA 4JFUA 1A53A 3CT2A 3VDAA 2G96A 4WDXA 1TPVA 3STGA 3QZEA 3GNRA 4AZCA 5K3VA 2HTMA 3KTSA 5D03A 4JTFA 3WNPA 3L4TA 1Q4NX 2RDWA 3NZRA 2OYKA 3UJRA 1ZY9A 4QIUA 4CLMA 4KW2A 2BDQA 2ZZ2A 4UTIA 1SZEA 4ZZ9A 4MB3A 5BXRA 3KVJA 2IKJA 2P88A 5I09A 2WMJA 2CLEA 4W8BA 5FEWA 3AXIA 2E5DA 1UR8A 2R82A 2QJMA 3NOYA 2HXUA 4NAEA 3S0CA 4HPGA 3UVIA 3QY7A 4QGCA 4OQVA 2WM0A 3LDVA 1NTHA 2PLKA 3UGVA 3MHFA 3ABXA 3LS9A 1VCVA 3GHTA 5BWFA 3BDKA 3QKEA 1F9CA 5FKYA 4EANA 2WC3A 2VZOA 1BYDA 3ZOAA 1UWIA 2X7WA 4GPNA 4NNAA 4HHHA 2MUCA 3CWHA 3TYUA 2D23A 4NY2A 1BGGA 1WXJA 4BQ4A 1Q6GA 3Q45A 3ZSSA 4JIHA 1JULA 3U3HA 1VBUA 3CZ8A 1L0PA 1Z42A 1UPMB 4DO4A 1SW7A 3QF0A 2H90A 1Z44A 1V02E 2W63A 5T9BG 1AQMA 5C5YA 3EOEA 5JUVA 3G77A 3ITTA 4IF2A 2OYMA 1C9DA 1QW8A 3AUOA 3MB9A 4DZ5A 3P84A 2VDGA 5AZ1A 3RMEA 3S2CA 3IUIA 4RPPA 3C61A 1OC7A 5J8LA 1TKKA 5KITA 3PSWA 3SGZA 3DYOA 3BAWA 3W7MA 1QR7A 3IIXA 4B5SA 1P5BA 4DF1A 4HU0A 3ES7A 4KRTA 3AWOA 1O4UA 1E6QM 3TK7A 3WSUA 1WKDA 3TTYA 2ZQ0A 3LBOA 4H41A 4HBKA 1BRLB 4IFKB 4CGTA 4K36A 3RF9A 3UZXA 3A13A 1JUEA 3PUEA 4IMFA 3LNPA 2JEQA 2FHCA 4H04A 4DBEA 1A5KC 4B5XA 5J04A 2G95A 5E6ZA 4Q4PA 1IGWA 3AIUA 4MUPA 4XKMA 4YJ5A 4H9XA 1KGUA 3OZMA 1XUZA 1US3A 4L1XA 1GEQA 5FF0A 1BFNA 4LV9A 4UTFA 3N6HA 3DDMA 3OW1A 4JQ1A 4Y7EA 2HK0A 3FSTA 4U5IA 3H2MA 4XD6A 2J25A 5AC5A 1AVAA 1KRAC 1XD1A 4AF0B 4H83A 3WH7A 4XZNX 4GJJA 4DBUA 2ZUMA 2PC8A 5BW6A 3AU2A 4UQCA 3C0SA 1ZUAX 5C9XA 4LAZA 1HTIA 1YEYA 3H2CA 1F5ZA 2Z2AA 3RJYA 1Z69A 3VNDA 3W7EA 2WWCA 1RA0A 4M5PA 3SCNA 2ZZ3A 4WXZA 3TDFA 3WMSA 5DY3A 3UWZA 2P1FA 2WO5A 5FJIA 5E70A 4LVFA 1UH3A 3E12A 1DWGM 2WJDA 3LMZA 1FY6A 1MUCA 1KGWA 1GT8A 3DG3A 2EO7A 3THQA 3QXBA 3S47A 2EPOA 5CCZA 1AH3A 2ZIDA 3S2LA 5AECA 3OZYA 4PEEA 1RXOB 1U1UA 3KUMA 4DBWA 2PWFA 3WDQA 3LX9A 2Y5SA 3UZJA 5CKSA 2BHUA 1CB7B 2BASA 3BGJA 3CL8A 4PEKA 3N3MA 4LEQA 4UNKA 3SUTA 1AMKA 1JUKA 2PTDA 4H9VA 4HHPA 1TV2A 1VFLA 2VC7A 4UOJA 5DX7A 1TJ1A 2E4TA 4K8GA 2ASHA 8XIAA 4XZWA 1XLGA 1S38A 2XWEA 1L6WA 1AW2A 2ZX5A 3W1XA 4GMEA 1EX5A 4MNKA 5LA1A 2PGWA 1ZB5A 1AQ0A 2Y88A 3ATYA 3FV9A 4XK2A 4ZMGA 4GNVA 1NFGA 1Q8JA 4GOAA 2JKPA 1X6UA 1DWFM 4QSFA 5CBIA 4Y9PA 2O56A 1A5UA 3W28A 4C65A 3APTA 3AAMA 2V5BA 1TMQA 2E8YA 3QHOA 2PFHA 4TV5A 4AH7A 1S2VA 1H7WA 3LQLA 1PS9A 4IQDA 1K3UA 4F2UA 4GXMA 1WOAA 2J7GA 1HF6A 3BZJA 5A8MA 5CPNA 2HXTA 3WLRA 2YYUA 3RPMA 1O6IA 2CFFA 1W1B1 3LBCA 4HZ7A 3N2XA 1W9BM 3W2LA 1E0TA 3TP4A 4S3CA 4N02A 3DCPA 4P2VA 3SFKA 1POKA 2VC5A 3WF2A 2Q6ZA 3PWIA 4X22A 4FXRA 3HU7A 2BY0A 1UJQA 2YL8A 2ZUWA 3LTSA 2ZA2A 4LU0A 3GW3A 3IIVA 3G0UA 5DF0A 4IUGA 2RDXA 3CUXA 2DSUA 3GU2A 3KW3A 3S1UA 2E9LA 2VTFA 3VOGA 3STCA 4KPLA 1O12A 3UG4A 1FKXA 1P1MA 3ABRA 3FJLA 3W7KA 1RPKA 1PX4A 3QR3A 3TXZA 4IPLA 2X8RA 4QS6A 4BZYA 4XD4A 3QW3A 4WF7A 2A3AA 3E0IA 2OO6A 4GJIA 2W27A 3SSZA 3HPXA 2F38A 1DKWA 3GC4A 4EPBC 1C8YA 4A3QA 2UY2A 4LS2A 4KGLA 1A3XA 3A22A 2OEJA 2JIWA 1V3HA 4AX6A 3T81A 2P10A 2XHYA 1YNPA 4S3JA 4JKMA 2X2GA 2O9OA 4LW7A 1IZKA 3NA8A 3DHDA 2E6DA 1UCWA 4O1BA 1V4YA 2NT0A 2BXZA 3CH9A 5AVHA 3BXWA 3UPMA 3ID7A 3U7BA 1KCXA 3GDRA 2H6RA 3A4XA 3TVAA 5BRQA 1A5OC 3AALA 3VFLA 1VEPA 3QV7A 1POJA 4CD8A 2E8ZA 3MBFA 3M07A 1TPB1 1NVMA 3UWVA 1SR9A 3FXGA 4FLOA 4E2VA 4UFMA 2OZ8A 4AY7A 2NV1A 4DLFA 1TVPA 1OYAA 3NURA 4C1NA 4EOUA 4F0LA 3NQVA 3NM1A 3ITOA 2WCSA 2QIIA 2QCLA 1CIUA 2ZA1A 1XG3A 2PI6A 4E6MA 1QNPA 4JY8A 4IZGA 2RAGA 3L65A 5CBJA 3DBPA 2Z2UA 1YNYA 3QR0A 3L4VA 1VKFA 3KAOA 2GPTA 3N2BA 4CVWA 3GXDA 5A6SA 1AH0A 2BVYA 3AJXA 4FZIA 4I7WA 3TWBA 4Z2JA 1V08A 4PUUA 2DORA 1MW1A 1ZAIA 4GACA 2CLKA 2Z7KA 5LXEA 1K4GA 1UH2A 1MXDA 1W8GA 4DF2A 1CDGA 7A3HA 4O10A 3ZVIA 4BEQA 2A4AA 3BJTA 1P48A 2YSWA 4CD4A 3F5KA 4ZB5A 2XH2A 3P80A 3AHVA 5AHLA 5GPRA 3S4TA 4DNHA 1OX4A 4C6OA 3L21A 1K4HA 1OB0A 1SO3A 3PZOA 4HMCA 3HPZA 1QTWA 5A94A 1JFHA 3IRDA 4GGBA 2I9UA 4UTTA 3TX9A 4CNSA 5H1WA 3BW2A 1DIKA 1YKWA 1I60A 3WEOA 3CIXA 4PMYA 4RNJA 2VDHA 2VRKA 1P6CA 1TTJA 3RX3A 2XTKA 4RV8A 4AWSA 4B5WA 3NPUA 4QG6A 4JCLA 2WQDA 3W7OA 3SSJA 4QR6A 3W7PA 2HRWA 3UXDA 5D9NA 1NWUA 3UR8A 3FCPA 4MJZA 5A6BA 3W53A 3W27A 2R1KA 4J2PA 3HF3A 4GINA 5GJNA 2BB0A 4PYSA 4I7UA 3IVTA 4L4MA 4I9AA 1V02A 4F9DA 1UA7A 7CGTA 1DXIA 1EJTC 1GZJA 4Y8FA 1WBHA 1J9YA 3M0XA 3THUA 4YYCA 4L6HA 1RBLA 7REQB 5LIUX 1H7XA 4PMRA 2GQ9A 4F4RA 7TIMA 1QI3A 3QV8A 5AHMA 3WLQA 4HA0A 3BGGA 3APGA 4PMVA 2DUXA 4WDUA 4NI3A 2INEA 3WCZA 3MY9A 4EF8A 3EDJA 2BY3A 1CX9A 4MYAA 1AD4A 2XJ7A 4JHOA 2PEVA 3LPPA 5FL1A 4NG3A 2W92A 5AZ0A 3OVQA 4W89A 2TODA 2VEFA 3GZAA 5ECVA 3K5XA 5HR6A 1DJZA 4QS5A 1UYQA 4D9PA 4YTTA 1DQUA 3O3RA 3NPWA 3AHZA 3IAQA 3B8VA 4J4KA 3W23A 3TFXA 4NU7A 3LB0A 4XTDA 3WUBA 2GGJA 4AZIA 2WSPA 1WO2A 1EJ7L 2CZ5A 3H23A 2QJJA 3ABSA 3ZM8A 1NP2A 3P6LA 1JGIA 4M6PA 2DT2A 2F8QA 1N7KA 3M43A 3DFYA 1HG3A 1XFBA 1ONWA 3VI2A 4QM1A 2Z1SA 3RRXA 1XSIA 1W5NA 2VWSA 2E09A 2ABAA 3CWOX 1QHZA 1M5WA 2QT3A 3LBMA 3E6EA 4D6DA 4L65A 3TYZA 3DYMA 3MT1A 2EHHA 2UV8G 1H63A 4OU1A 3V0SA 2VELA 1VFHA 4I7VA 1AK5A 1JPDX 3NOEA 2X40A 3OLDA 4WGHA 2POZA 4P8WA 4ES4A 2J4GA 4UQDA 2ZRYA 3L0NA 4N4QA 3TSDA 3A5FA 3S5SA 4URIA 1V0KA 3VIPA 4POCA 7ODCA 1E0UA 3U7VA 3SCVA 3IS4A 2AOSA 1NWTA 4UCGA 3BLKA 3BE7A 1Q6FA 1Q45A 1RJPA 3IANA 4XD5A 2PLCA 3LXBA 4LBSA 2WXDM 1FH8A 4IM4A 1F7BA 2I9EA 5CZJA 4Y9MA 2QJIA 2GVGA 1RD5A 3JS3A 5GJMA 2G4FA 1FWEC 1ZPTA 3LCIA 5HQLA 5EY5A 1XCWA 3R12A 4MWAD 3N6JA 4R88A 5HUPA 1RD6A 1FCBA 3FKKA 4TX8A 1IGSA 4DJDA 4QISA 1JYXA 1US2A 3T42A 1SZFA 1BVNP 2GJXB 1G7UA 4YPJA 2DT0A 1OG0A 1VFTA 1BGAA 3H7VA 1V03A 1Z3NA 1FBAA 3HQ1A 3PPGA 4EPEC 1GVFA 3G3DA 3PB2A 4JX5A 4F2TA 3GUGA 3CUIA 1B3OA 1MDLA 5LXXA 1YW1A 3BLIA 2G41A 3POHA 2OKOA 3W84A 2C19A 2A3HA 2IQTA 1C93A 3W70A 3RJXA 1D3GA 3BLLA 2X0SA 4EXAA 3STEA 4IX2A 4RUBA 1ZBCA 4LYRA 3RR1A 1V7AA 2ZX9A 4NYYA 3S3GA 2DSWA 4MB1A 5G2WA 3LV6A 4K8EA 4NSBA 2ZWYA 5CZTA 3V1PA 4MIMA 3N9SA 4JTRA 2XYLA 2PU1A 3IJLA 1E9ZB 3UWWA 2VVSA 3D46A 4B2DD 3G6LA 3VDBA 4GYKA 4FNQA 4D2JA 2FLIA 1I4NA 1XW8A 3TJXA 5FOOA 3TQVA 4LXFA 2B0MA 5C2XA 1W3LA 1PTGA 3ARQA 3CUHA 4O50A 1JL8A 3C2RA 3NTYA 3SY5A 3AIVA 5HNUA 3UCDA 3PZIA 1GWJA 3KBSA 2GJPA 2R1MA 3DOPA 4IIHA 4B5UA 4V28A 1ZS2A 1OWQA 2XSBA 3P62A 1P0EA 1UKPA 3EDEA 2XUCA 3H4WA 4CU6A 2QCDB 3OJGA 4ATWA 1JGMA 4HNTA 3T55A 3QBUA 3B40A 1DIEA 1E3ZA 1PDYA 2YL6A 3ABZA 2EQDA 2NW0A 3TR9A 4UTWA 4UTTC 3KCOA 3HV9A 3S9ZA 3EX1A 5ECUA 1JRBA 1VPQA 3WH5A 2QUMA 2QHAA 3QLDA 5HWNA 2V2DA 4LT9A 2PBGA 3QSTA 3M0KA 4IFKA 4HKPA 2OO0A 3WLHA 1DJNA 2NQ9A 2DDXA 2AL2A 1UP2A 2R9RA 2C79A 4PRTA 1TVLA 1L6YA 3D3AA 1HXJA 3ZT5A 2DZPA 2F6XA 4D8AA 2ZOXA 4LUSB 4DLMA 3CB3A 2Y8VA 2BY1A 2INFA 1Q6QA 3HPFA 4XUYA 2XPKA 2XVGA 4FI4A 5D38A 1GVIA 3E0WA 4GNKB 4J40A 1GKRA 2Y24A 3L67A 5HDRA 1G9HA 4CKQA 3HO8A 2OMAA 3DI1A 4P8XA 3GH4A 1OX6A 2J6XA 2XZ7A 1KBJA 4E3VA 1Q2SA 3CQ0A 4NZCA 3W7LA 5F4XA 3RYSA 3PHAA 1TE1A 3LRKA 5HK4A 1KCZA 1DJWA 1F6KA 2QCCA 1N8WA 4ROQA 3R94A 2DZBA 2Z6JA 4HYWA 1KQZA 4LPCA 1FRBA 4JBRA 2P53A 1XYMA 3KM8A 3T7VA 2BVDA 4IMAA 5LGZA 3NSXA 2F2KA 3B3DA 1HJVA 2QUNA 4RW3A 3B0PA 2WJEA 6REQB 3B9DA 1FHDA 2J7FA 3C2OA 1HQTA 2QLYA 4PMJA 3AO0A 2HQAA 3KOWA 1Y5XA 1M01A 3GIPA 4LAUA 4ZB2A 3KOFA 1KV8A 5TIMA 4ZFMA 3QOMA 1PIIA 5HNTA 2VD9A 4N2YA 2ZDRA 4I3GA 3WQ6A 2W9MA 3V3WA 4QE5A 2PBOA 1F4HA 1L6GA 4DY1A 3PWGA 1IEQA 4YLWA 4KGJA 3L7RA 5CZ0A 1DIOA 4KCTA 4N9EA 2CBIA 2DJXA 3T2QA 5AYBA 4GQRA 4IP5A 4LX4A 1XPGA 1LWIA 4ORMA 3D6NA 3EX3A 4KKXA 1ZHAA 5DANA 1KTBA 3CMJA 5AYXA 5HJXA 3N29A 4LNCA 3BSGA 5T8GA 1RP8A 4XIMA 4S2BA 3GW0A 4QXIA 4IUOA 3GC2A 4JTEA 5FJJA 1RQBA 4OKDA 3H6OA 3U2CA 4Z1CA 1LL4A 3MMWA 2IW0A 4HT3A 2DIEA 1MNSA 2P3EA 3VO0A 1SFTA 1QNOA 3SW6A 2QGHA 4C1LA 2YCKX 3KS5A 4RZBA 4ZXLA 1QI2A 3GDKA 4X3ZA 1RJQA 3E1F1 5I07A 4GIRA 3VDHA 2PLMA 3E5PA 2DU2A 4GZJA 2DIKA 4CD5A 3QYQA 2WPBA 4IL0A 4AZ5A 3BV7A 1FWAC 4Q8PA 4A2RA 1UWAA 3VM5A 2J47A 3VUSA 1UD8A 3FS2A 1KFEA 1CLKA 2FDMA 2Q71A 3N4FA 3BOFA 3W22A 2GYIA 2WMIB 3NNTA 1GOWA 4AD0A 4CD7A 3GG0A 3SGGA 3URAA 4PUNA 2VD8A 1NF0A 1RY0A 4GD0A 3W0KA 4OV4A 3ARZA 4J3ZA 3N9KA 1A4MA