4U5KA

Complex structure of mutant ctcel5e (e314a) with cellobiose
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
306
structure length
304
Chain Sequence
PKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGYKNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEFTHKWRGTWGTQEDMDTVVRVFDFVKSWSDRNNIPVYFGAFAVMAYADRTSRVKWYDFISDAALERGFACSVWDNGVFGDNDMAIYNRDTRTFDTEILNALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase H
publication title Biochemical Characterization and Structural Analysis of a Bifunctional Cellulase/Xylanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Hydrolase
total genus 113
structure length 304
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4u5kA00
3UG4A 1A47A 4RE3A 2CBUA 2XFRA 4W86A 1BYCA 2A3EA 1LL4A 1XD0A 4WJXA 3QOKA 1KBBA 1C90A 1CXFA 4JKKA 2GSJA 2HVMA 4B16A 1JYWA 2OWXA 1KXHA 4JL2A 4BQ5A 3CUJA 3FHQA 3VM7A 2VVSA 3EDFA 3AOFA 3WNMA 3AIWA 1R8LA 3T0DA 3U57A 4TX8A 3UETA 5CGTA 3PN8A 2X8RA 1JIBA 5D8ZA 3WDPP 4ATLA 1AQ0A 3OIHA 4B3LA 2V3DA 2WPGA 2XUCA 1MQRA 4AMCA 1UH3A 3WF3A 4AEFA 3WY1A 3ZJ8A 1CNVA 4ZEPA 4MAZA 2W91A 4JCLA 2PWGA 1NP0A 3VGDA 1B3YA 1XH2A 3L4WA 1BFNA 2BVYA 3O6AA 4K68A 2WAGA 4L4OA 3VMPA 4UOJA 3ZO9A 4F66A 2CITA 2VX7A 2PWHA 3CLWA 5A6KA 2J8FA 4AY1A 4QCFA 1H09A 2G41A 3PZ9A 5LYRA 4AZIA 1D3CA 4W85A 4OZOA 4UQ9A 4QDMA 2YIHA 1DEDA 1CPUA 1QHZA 2WWDA 1RD6A 1FH9A 2J62A 1W9UA 3WH8A 4CD7A 5AC4A 1ODUA 1W1YA 2WKLA 5A69A 2EPKX 1V6VA 4PSPA 3VDHA 3WH6A 1WO2A 2J7DA 1UWIA 3SUUA 3GXIA 2ZOXA 1E5NA 2EO7A 3NSXA 5FD0A 4LQ1A 3KE0A 4D6EA 4F9DA 3ZR5A 3AS1A 4GXPA 1UR2A 4UZUA 2DIEA 2DSZA 4M56A 3THDA 5A6LA 3EMCA 2FGLA 4BQ4A 3WUEA 3PTMA 3VDAA 3LMYA 1HF6A 4UFLA 3MKKA 5HDRA 4ACZB 4WIWA 1QNPA 3WF1A 1KR1A 4WF7A 3L4XA 1JFXA 1BVNP 3SCSA 3CUFA 4DUWA 2WCGA 1UA3A 1UR0A 2Y24A 3IJ7A 5BXTA 2VJXA 1X6NA 3S2CA 3UEQA 2WZHA 4AD1A 1OWQA 1W2PA 5I3DA 2C0HA 2X2YA 2FDMA 3OLGA 1KGUA 1BLIA 3OGSA 1HKIA 2WMJA 1VAHA 4WK9A 3L4VA 3VMNA 2A3HA 1GOWA 2VNCA 5BRPA 5E09A 2YOCA 1UR9A 1CGUA 2X1IA 2X0YA 2YA2A 3RM4A 1JYNA 2G8ZA 3JUGA 3TONA 2D0FA 2GJRA 2VT0A 1VENA 4H41A 3ZOAA 1NWSA 1GOOA 1FP9A 1UH2A 1KWKA 4C7DA 1J01A 3RM9A 1JXKA 2PF0A 3WNPA 1DWHM 3GZAA 4MB1A 2JE8A 1DWFM 5A6BA 3ZR6A 4E2OA 5FOOA 3L4ZA 2IUZA 2G4FA 2WMIA 2YL9A 4GI8A 1E43A 3F4VA 3WH9A 2J25A 4UQBA 3OZPA 1IZKA 4EE9A 3CGTA 2O9OA 1JNDA 2G3IA 3OLEA 4UQEA 1BPLB 1PZ2A 3AZRA 1XSJA 4HA3A 1UD6A 3TOPA 1LG1A 2HISA 3GH5A 3I3EA 1TE1A 3W82A 1EHAA 3PTKA 1XYZA 3AYRA 1GQKA 1UR1A 1CXHA 4DM1A 1KB3A 2OSYA 4P7LA 1VB9A 4MPKA 4JKMA 4P8VA 1GJWA 4TXEA 2DH3A 4YPJA 1CXIA 1MW3A 4PTWA 3ARXA 2JIWA 1N82A 3ZJ7A 1E55A 1B3ZA 1E6XM 2ZX8A 5IFPA 6TAAA 3HJEA 1SR0A 3PTQA 4M8UA 4IPNB 1WP6A 4UTFA 3W81A 1IT0A 5BXRA 2CXGA 1GONA 3WUFA 2VOTA 1R7AA 4CD6A 1OT2A 1JZ4A 1ZS2A 4FLSA 1EH9A 1BGAA 1JL8A 4ZXLA 3WIJA 3AS3A 4AD5A 2PWDA 3WF0A 2XGBA 3CBWA 3GBEA 5D4YA 1XYFA 4GINA 1KCKA 1MXGA 1UWSA 2ZX6A 5E0FA 1E4MM 4AIUA 3FHAA 2WCSA 3UG5A 4PCSA 1PEZA 3KWXA 3EDEA 4UR9A 1C8QA 2YKKA 4BS0A 4HPHA 2VZUA 4JFSA 3U7BA 3FN9A 3VIKA 1JXJA 2EEXA 1E3ZA 4PTVA 3EDJA 3SUWA 1G9HA 1AQHA 1M04A 2XVNA 1RP8A 5GQBA 1TMQA 3WFZA 4JFTA 4P7QA 1F4HA 2XVGA 1UD4A 4MNMA 1V0LA 4U5KA 1CDGA 1JI2A 1JD9A 9CGTA 4W5UA 1KR0A 3ZT7A 3AHTA 3HN3A 2VRKA 1JZ8A 2WXDM 3M6DA 2D23A 1ZBWA 2CKSA 4H04A 1JNEA 3EYPA 4V27A 1US2A 2J7EA 1I1WA 2ZUTA 2UWFA 3AMKA 3EMZA 2Y4SA 3AFBA 4CD8A 2TAAA 2W5FA 1CXEA 5IXEA 1AQMA 2XTKA 5C70A 2WHJA 1QOXA 2DSVA 5EMYA 3D5HA 3ZMRA 2JF6A 4YHEA 3T0AA 2DH2A 4KGLA 1EQCA 1VFFA 1V3LA 3NSNA 3AHZA 5E9AA 2XIBA 1V6YA 3AXXA 2GVYA 3VIGA 4F9JA 1BVZA 5AY7A 4H8UA 1MYRA 3SCPA 5JIPA 5I78A 1XV8A 1E0WA 3QHOA 1WZKA 4HZ6A 3MSGA 3WMCA 2WW5A 3VKKA 3L4UA 4GPNA 1VBUA 3ARVA 4PMNA 4UOQA 2VTFA 3WELA 3BC9A 4UNIA 3G6MA 4MDPA 1XCXA 1JG9A 3W37A 1MW2A 4X0VA 1U30A 2YL5A 1CYGA 1ODZA 4D6GA 1EA9C 1QVBA 3IK2A 1PPIA 3W29A 3AS2A 5CJ5A 4PUEA 2CERA 3WQ6A 5HNNA 5BWFA 2YDSA 5D9NA 2J74A 1K9EA 4GIAA 4Q22A 5HBFA 5DMYA 3N15A 1B30A 1I75A 2D22A 5E6ZA 1H41A 5D9OA 3B9AA 4WKHA 5M5DA 1NOUA 3WF2A 1TZ7A 1H1NA 3N11A 3MUY1 3FXYA 4A4AA 2J7CA 7TAAA 1NWRA 3N9KA 4P7OA 2V5DA 1UWUA 3MO4A 1XCWA 4FK9A 3ALFA 1JAKA 4QFUA 1US3A 3L4YA 4KRTA 5JBFA 1C7TA 3AIEA 1VEOA 1DWGM 2WMFA 3OGVA 3AHVA 3G6LA 2VCCA 4MADA 2VX5A 4QAWA 3WQVA 4LYQA 1E70M 1NP2A 5CLWA 4ATDA 4HOWA 4B3KA 4GO8A 5CXPA 3W6MA 5A2BA 1G5AA 2CCRA 4CCDA 4M24A 3NYDA 2Z1KA 4F79A 4DWSB 3BAWA 1XSIA 3N18A 3AROA 1V6XA 3RMEA 1ITCA 2BY1A 4CU6A 1H4PA 6A3HA 4PTXA 3QOMA 4D72A 1W91A 3T2QA 1V3IA 5KEZA 3WUBA 3LPFA 3TTOA 2XHYA 3VUPA 3KL3A 1BGGA 2CBVA 4AD4A 1E1FA 5FCZA 1F4AA 1DWIM 1EDGA 3BXWA 4XX6A 4NI3A 1X1NA 3AIQA 2O92A 2EJ1A 2DSUA 2VURA 1UR4A 1EOKA 1CECA 4H8HA 2YBTA 1KQZA 1WPCA 4KWUA 3BSHA 2GFTA 2DT2A 4D1JA 1TA3A 1GW1A 2YDQA 4CU7A 3FY1A 3WEMA 1J0HA 1GOKA 3N13A 2BXYA 1QI2A 1E0VA 2E9LA 4PMRA 1G1YA 2JFEX 1SYTA 2CNCA 1UYQA 2ZX7A 3CTTA 4EK7A 1JZ7A 1XH1A 5A8MA 1QBBA 5GNZA 2WSPA 4A3YA 1R7OA 4LXFA 4AIEA 1PIFA 3UR7A 5DEZA 2X05A 1NARA 4N0RA 1J0IA 1GOIA 4UQAA 2DDXA 1BTCA 4YHGA 5HPOA 2WVVB 1BYAA 3FAXA 3GXMA 4GZIA 1Q6CA 4FLQA 2AMGA 5A2CA 1MFVA 3NJ3A 2VX4A 1EHNA 1BHGA 4BA0A 1W32A 2V38A 2BY3A 3WEZA 4D71A 3LPGA 2ZUUA 4IM4A 2C7FA 2J7BA 1XC6A 2E8ZA 3W0KA 4HOZA 2WANA 2WVVA 5CG0A 3QHNA 4UZSA 5IHSA 3VU2A 1KXVA 1UD8A 1UKQA 4F8XA 3VNZA 2UY4A 1D2KA 2DT1A 4JHZA 2WC3A 2DGAA 1QW9A 2ZUVA 3CHFA 3ZJ6A 3KL5A 5A6SA 1ZB5A 2XPKA 4W84A 1E4LA 2UY3A 1QNSA 4AZCA 1C93A 1SMAA 3M7SA 4PMOA 4J3XA 3DC0A 4J3UA 5CSYA 2ZX5A 5AC5A 2FHBA 2XVPA 1BSIA 4W89A 5AYBA 4PMYA 2D1ZA 3NDYA 1FH7A 3W6LA 1H0GA 4CCEA 5I24A 3AIRA 4JL1A 2FHCA 3EDDA 4PCTA 3MU7A 1MVYA 3OLIA 2ZICA 4JKLA 2ZX9A 1ISZA 1FOBA 1P6WA 2G3NA 1LWJA 4M1RA 5CPTA 1JF6A 3CHEA 2QV4A 3PZMA 2GK1A 3WNOA 1C7SA 3WKZA 5HPCA 4C7GA 1HKJA 3AIVA 5JUVA 4CN6A 3T09A 4HA1A 3DYMA 1JAEA 3K8LA 4WKFA 5A6AA 4FMVA 2GJPA 3GDBA 3AQUA 2XWEA 1KFWA 5I23A 5CSUA 4KGJA 8CGTA 4QP0A 1TR1A 2DT3A 5EFDA 4AC1X 3GTNA 3ARRA 2EQDA 3OG2A 2XWDA 5M17A 1FHDA 1UG6A 3GXFA 1RPKA 3UCQA 4GZJA 2PWEA 5CQ1A 5A3HA 4X9YA 3WDRA 1BF2A 5TD4A 4IISA 4CVWA 2FHFA 5ABFA 2NSXA 2WMIB 3UG3A 2DSKA 5JBEA 4MJ4A 2E4TA 1FA2A 3FW6A 5A6BD 1V3HA 3ZQ9A 1E6SM 1ZBVA 3L4TA 2W67A 1E15A 2E9BA 1JZ6A 3OGRA 5FL0A 1RH9A 2JF7A 5C71A 1TVPA 2VRQA 3VX0A 2CHOA 4CD5A 1QI4A 3RDKA 3QR3A 1HX0A 3BLKA 3PZGA 5BXPA 3VX1A 4WSKA 4HA4A 2VCAA 3ZT5A 2BFGA 1NWTA 3AZSA 3PZIA 4RE4A 2OYMA 1U2YA 2QLYA 5D9PA 2D3LA 4UFHA 1K9FA 2VZOA 3WFLA 4JZ5A 3K8MA 4MTVA 2BHUA 5LA0A 4A3HA 3MMUA 1KWGA 1Y7VA 1OIMA 3WBAA 5I2UA 4J7RA 1EDTA 5M03A 2UY2A 3WQ5A 2WSKA 3OLDA 2VL4A 3VO0A 1O6IA 1UWRA 1H11A 4TVUA 2W92A 1IZJA 3ARWA 3SCTA 1OD8A 3MV01 4EANA 2OYKA 1UKPA 3ZJKA 4ZENA 2WWCA 4YN5A 1HJXA 1UKSA 1JZ5A 4J27A 1UQYA 2WC4A 3WDHA 2ZWZA 3WL0A 2O9PA 4OOUA 4OOZA 2CESA 2BS9A 2E9MA 1JDAA 2GDVA 2Q8XA 2VO5A 4B9ZA 2YA0A 4H2CA 4U5IA 4BCEA 1WDRA 2WHKA 3ALGA 1QHOA 4J3TA 4NSBA 4WSJA 1B0IA 3KL0A 3AXIA 5I0DA 4HP5A 2XGIA 2J7FA 4GZEA 1OGBA 1MQPA 1HN1A 2PWFA 1KGXA 2JALA 1E9LA 4W7VA 3FAWA 1V03A 5D8WA 1QNRA 4AZ7A 1QNOA 4GI6A 4P8XA 1W9VA 1E6ZA 2JEPA 5CLTA 1OINA 1U33A 2RGLA 2NW0A 3ZT6A 1KXQA 8A3HA 2VQTA 4W8BA 1G94A 3A3HA 4UFIA 5DT7A 3II1A 5FIPA 1EOMA 3K4DA 2DSWA 3SUVA 4U2YA 4Z2LA 4PSRA 4CGTA 3WSUA 4D6JA 5I5RA 1KXTA 3ARTA 4PEEA 4MB4A 3WUGA 1GVYA 1WZLA 4D6DA 3CHCA 5IHRA 4LYRA 4CN4A 2RGMA 2WHLA 3VD5A 3B8SA 3N04A 3IAQA 2F61A 3VD3A 2OYLA 4HPGA 2X09A 3T08A 3BAXA 1GOMA 4LX4A 3RPMA 2WK2A 1L8NA 1UH4A 4OUEA 1E6QM 4AD0A 1B1YA 1E4NA 3VM5A 2EPLX 3PZQA 4PMDA 2EPOA 4XV0A 2WZIA 4PMUA 4OBSA 3T2OA 2CKRA 3OBAA 4R27A 1SFSA 1GZJA 2J79A 1VFMA 3ZSSA 1JZ2A 3IJ9A 3LPPA 5A6JA 5CZKA 4UFMA 1H5VA 1B3WA 3CH9A 2WVTA 3K8KA 4W7UA 2BY0A 3WNLA 5HOSA 3UESA 1WDSA 3WQ8A 2VUYA 1J0ZA 4U31A 4M81A 5ECUA 1GOQA 3CZ8A 4CUCA 2MANA 4AZBA 1JF5A 2BHZA 4MNJA 1HP5A 3AI0A 4AD3A 3ZSTA 3CMGA 4M82A 1NQ6A 3M46A 5KZ6A 2W66A 2ZUSA 4H8VA 3SCUA 5D9MA 3WEOA 4GKLA 4JFWA 2X0HA 3ARQA 3A4WA 1HL9A 4OJYA 4Q7NA 3EMQA 4JHOA 1UUQA 1H3GA 2QPUA 1W1VA 3N1AA 2DIJA 5ABHA 3GM8A 2OWCA 3WMSA 3A4AA 3VIIA 2W61A 3RIKA 3W38A 1HXJA 2XFYA 3MS8A 2W4XA 2EBNA 1CTNA 1PAMA 1UWTA 3WDIA 1ECEA 1MQQA 3GNOA 1ITXA 4LYPA 2O9TA 1LG2A 4D6HA 4PBGA 1HJVA 1QBAA 2J78A 4U3AA 2WKGA 1W9DM 3AIBA 2F2HA 1W3LA 2G3JA 1OCQA 5BRQA 4NF7A 2GJXA 2D20A 1HJSA 3GNRA 4PTMA 1UQZA 3AMDA 1E56A 3W25A 5A1AA 3T0BA 3BLPX 3BH4A 4Z2IA 1DWJM 2QMKA 5LA2A 1CGVA 1WKYA 1QW8A 1J9YA 2ZE0A 2YL6A 4HZ7A 4B15A 3K1DA 3SCQA 4CCCA 4FLOA 4S3JA 3PZVA 5HXMA 2CPUA 2VQUA 1WNOA 2WLZA 4R5EA 1JYVA 4MAVA 3WD0A 4XB3A 2XVKA 1LJYA 1XH0A 1BG9A 2BY2A 2ZUNA 3CZGA 1W3JA 4TX6A 5A8PA 2YL8A 4JCMA 1EO5A 2JEQA 3BAKA 1WAWA 3SCOA 4AZ5A 3N12A 1TA3B 3ARYA 5BROA 1YQ2A 2CYGA 3O9NA 1FHLA 2OSWA 3HU7A 3VVGA 2E8YA 2ZIDA 1EGZA 1UD3A 3BMVA 1JDDA 1W9XA 2A3CA 3VGGA 4TTGA 3TA9A 3RM8A 4ZXOA 1QI5A 1Q6GA 1UR8A 1VEMA 4U3CA 4AW7A 5F7UA 4UQCA 3VNYA 1UZ1A 2D0GA 3MUIA 2BXZA 1C8XA 1V6WA 3LPOA 4NRRA 3FNDA 2PBOA 3CUHA 1UD2A 1EDQA 3NCOA 3U5UA 1B9ZA 1NM9A 3CMJA 4PYSA 3VGEA 2VI0A 3VD9A 3KZSA 1LF1A 1WZAA 1KBKA 1UHVA 4TVDA 1MW0A 1DP0A 5JIWA 1OIFA 2G3MA 2WMGA 2AOSA 1CGWA 3F5KA 3N17A 2FH6A 1EQPA 2CBIA 1CZ1A 4Z2HA 1VF8A 3AHXA 5GNYA 1OGGA 1HP4A 5M3WA 3VD4A 2ZXQA 1PJ9A 4UFKA 2VR5A 1ZBCA 2A3BA 3S6TA 3VOCA 4BF7A 2WMKA 4OIFA 4RE2A 4TVCA 2WCAA 1ZJBA 1DHKA 2PI6A 3B9EA 1J0KA 4E4PA 3VGFA 5FKYA 1V0NA 4J3WA 3WD3A 4CD4A 4PMXA 2NT1A 3ZM8A 2CHNA 3VTRA 1C92A 1S46A 1JYXA 4M29A 1OGSA 2DT0A 1CBGA 4WKAA 1C8YA 3RCNA 1ZU8A 3CZJA 3POHA 1OBAA 2Z1SA 4X0NA 4AZCB 3A47A 3CPUA 4JFUA 3PZOA 2GUYA 3PBGA 4OKDA 4BZYA 4ZE4A 3WENA 5BXSA 6CGTA 2D0HA 3PHAA 1ISYA 3CUIA 4W7WA 2VCBA 1V0MA 3D3AA 2J7GA 3U7VA 1QPKA 4CVUA 5A8OA 3VIOA 4QLKA 4D6FA 3PZNA 1W3HA 2BNJA 1VIWA 1VJZA 1BYBA 1HNYA 3SUTA 2ZUMA 1O7AA 1E5JA 3AHYA 1K9DA 1ESWA 2GK1B 3ZIZA 2XFFA 3MMDA 1J11A 1M03A 4QLLA 1HVXA 5GNXA 1JZ3A 4KRUA 3PZUA 4P8WA 1NH6A 2WM0A 3WF4A 4V28A 1L0PA 2EPNA 4S3KA 1FFQA 3A4XA 2XG9A 2VMFA 4MB3A 2VVNA 1JDCA 4U2ZA 1OSEA 1M53A 1J10A 5IFTA 1CXKA 1C91A 2CEQA 3GNPA 2YJQA 3CIVA 1HKMA 1V02A 1PX4A 1QI3A 1TVNA 2E40A 1ZJAA 1PBGA 3WDJA 3WD2A 4N42A 1CLVA 3O2LA 4PUDA 2J4GA 1V3JA 5A8NA 1PX8A 1MW1A 2D24A 1BYDA 5A95A 2VZVA 1W1PA 5ABFB 3WQ4A 5CPQA 5EB8A 1GQIA 3T2PA 4UFJA 3BGAA 1LLOA 3VIHA 1VRXA 4AWEA 4QLJA 4B9YA 4AZ6A 1XGZA 1KQYA 3WMBA 1TCMA 4D6CA 5I79A 1BQCA 1KGWA 2DQXA 2EPMX 2XJ7A 1MFUA 3CO4A 2EXOA 1ISWA 3F5LA 5A2AA 2OWWA 1ZL1A 1EIBA 4GQRA 1UZ4A 3AZTA 4E8CA 4LGXA 3ARSA 1J18A 1FH8A 4GQQA 5ABEA 2WVUA 4URIA 1OD0A 1DTUA 4D6IA 1E1EA 1CENA 4MJ2A 3SCWA 3W28A 3NSMA 4CU8A 1UA7A 5BCAA 4GI9A 5E6YA 4ACZA 1LWHA 2NT0A 1H0IA 4W93A 2DEPA 1B90A 2YBUA 1V6UA 1Q6DA 4HMEA 3VD7A 2QF8A 1V3MA 4GO9A 2XSBA 3BAIA 1FP8A 3MUAA 1XD1A 2WB5A 1GUVA 2VZSA 1E6PA 3W26A 4XUYA 1B3XA 1IV8A 3WN6A 3I3DA 1WDPA 3BSGA 3GYCA 1K6AA 3EBVA 4J3VA 1X6LA 4AIOA 4QCEA 3VIJA 1Q4NX 5IDIA 3SIMA 1PIGA 1AVAA 3I3BA 4TUFA 2WLYA 1UKOA 2V3GA 1WCGA 3DHPA 4P8UA 3BCDA 2YLAA 3RO8A 3AXHA 2B31A 2XIIA 3W24A 3WDQA 1V3KA 4NRSA 4AYSA 4HMDA 3SEPA 4EKJA 3W53A 1J12A 4CKQA 4D1IA 1HJUA 1VFOA 3AMCA 2XVLA 4PMZA 3MV11 2FGZA 2JIEA 3MUZ1 1GQJA 2E0PA 3TTYA 1GJUA 4ZE5A 1VJSA 4W87A 1GHSA 1TFVA 3VIFA 2XM1A 3EDKA 1RP9A 4ATWA 1PX3A 2QHAA 1DWAM 4DM2A 3WD1A 5I6SA 2VX6A 3B9DA 4EAMA 3OB8A 2V5CA 1Q6FA 3CUGA 4AD2A 4PN2A 4IUGA 4TTUA 2WHMA 3GH4A 3DECA 1EXPA 5AYIA 4JAWA 1BAGA 1CXLA 1GPFA 1J0JA 3AICA 1OM0A 3L2LA 1G01A 1VBRA 3K46A 1GNXA 3TTSA 1VFUA 1HVQA 3WNKA 1JGIA 2AAAA 3IANA 4HOXA 1LL7A 1YHTA 3AJ7A 4TOQA 5E0CA 5LA1A 3WH7A 2IXVA 3WQWA 3APGA 2O9RA 4HU0A 2CETA 2PB1A 3VPLA 2D3NA 1A3HA 1V02E 3AS0A 3MMWA 1TUXA 2IXUA 2J47A 3SCRA 4AZGA 1M7XA 5DO8A 1W3KA 2WBGA 3OZOA 4JIEA 2WYSA 1H49A 1Z32X 2BV9A 5FL1A 2UY5A 4P7NA 5C8BB 3MANA 3J7HA 2WBKA 1ISVA 1CGTA 5I77A 3WH5A 3F5JA 4PMVA 3AMLA 3BMWA 5JBDA 1GQLA 5A94A 2Y5EA 1JD7A 1GCYA 3IAPA 4XZBA 3AYSA 3VMOA 1BG4A 4UCFA 3VGHA 4M80A 1PZ3A 4Z2GA 2Y8VA 4BQ3A 2WC7A 1QHPA 1WZMA 3VDBA 1R86A 1ZBKA 4E8DA 4AZHA 4AEEA 1G0CA 3TP4A 4FLRA 4J28A 2J75A 2VZTA 2J8GA 1B3VA 3SCVA 2J77A 2PC8A 1LL6A 3BCFA 4Z2JA 1B31A 3L2MA 7A3HA 1WDQA 2BHYA 1HL8A 1XRVA 4KMQA 1JI1A 4MNKA 5GPRA 2E3ZA 1WE5A 1OB0A 1CGXA 3PZTA 2F8QA 1LQ0A 3VIMA 3K4AA 1JFHA 1H2JA 3SCNA 1I1XA 4C7FA 1CLXA 5EBAA 2OSXA 4W8LA 3WL1A 3E1F1 1E73M 4J3SA 1XSKA 4W5ZA 3AMGA 1UWQA 1M01A 2BVTA 4DUVA 1QI0A 4WLCA 1ISXA 3DHUA 1AMYA 3VINA 1V0KA 1MWOA 4UQDA 4UOZA 2YA1A 1HJWA 1XHGA 3WBEA 4ML4A 5ABGA 2XM2A 4AISA 4AXNA 5EFFA 3VDCA 5DT5A 3VGBA 4Z2KA 1E6NA 3NIYA 5DF0A 1FFRA 2V3EA 4XZWA 3VILA 3WD4A 1E3XA 3QGVA 2ZXAA 3AIUA 3NUKA 2Y8KA 3CZKA 4RL3A 2VR4A 3U5YA 1CIUA 1CWYA 1V08A 1W9BM 2A3AA 2VRJA 4W88A 4HZ8A 2GJXB 1UKTA 3ARPA 3BAJA 2FH8A 3POCA 4HTYA 3TTQA 4NZCA 2ESCA 5DFAA 3UERA 3KEHA 3W4RA 1VEPA 3NDZA 4JFVA 1B2YA 3ARUA 1W9PA 4PRWA 1GORA 1EO7A 4PMQA 2ZXBA 2D2OA 1GHRA 1R87A 1UOKA 4U33A 4MB5A 5A6MA 1J0YA 4MNLA 1OT1A 1HKKA 1NOWA 4W8AA 4LPCA 1TG7A 1K9TA 4HMCA 1HT6A 2BVDA 1E72M 1CEOA 4ACYA 2J7HA 3CZLA 1HJQA 2YDRA 2C8NA 1Q6EA 2CBJA 2GDUA 1NWUA 1QNQA 7CGTA 2V3FA 3SUSA 1KCLA 2WVSA 2Y2WA 1E6RA 1WB0A 1MXDA 3M07A 2QPSA 3AISA 3IJ8A 2WNWA 4KH2A 4V2XA 1D7FA 3RILA 3BAYA 4DUXA 4MDOA 4H7VA 1E4IA 4OBRA 3A6OA 2WMHA 1W1TA 1SMDA 3MSDA 3WNNA 1CGYA 3HMCA 1GVIA 4Y7EA 4HU8A 1UD5A 1E71M 3DYPA 1R85A 3CZEA 4IPLA 3RJYA 5A8QA 4CN1A 2VC9A 3QHMA 3OA5A 3W27A 2W63A 5CGMA 3UR8A 4ZFMA 4DWSD 2XYLA 2OLHA 4FF5A 3ARZA 3GBDA 2YLLA 1W2VA 2DPEA 4DWSC 4DWSA 2ZWYA 3THCA 5E70A 2PBGA 3GH7A 5CPSA 3GXDA 2CIPA 1HIZA 2W62A 1E0XA 4BQ2A 3RJXA 4L4PA 3SURA 5BYWA 3VIPA 3DYOA 1C3FA 2QMJA 2ZXDA 4P7RA 2XSAA 2ZUWA 3CHDA 1E40A 3ECQA 1NOFA 2WZEA
chains in the Genus database with same CATH superfamily
3UG4A 1A47A 4RE3A 4W86A 1OQFA 3TYEA 3QOKA 1KBBA 1C90A 2CLOA 3NZQA 2GSJA 1VYRA 2HVMA 1JYWA 1KXHA 3PJTA 1PKMA 3WNMA 1LT8A 4TX8A 5AECA 3CPRA 3W7HA 3UETA 5CGTA 2NLIA 1DIKA 3WLTA 3ANVA 3MDUA 4L80A 3MKVA 2OQHA 1AQ0A 3OIHA 4B3LA 4C6QA 2WPGA 2Y1HA 6PTDA 3WF3A 5CBIA 1CNVA 2CZEA 4FX8A 4OE7A 1NP0A 3DG6A 3VGDA 1UZDA 4EIVA 3L4WA 3O6AA 4K68A 3VMPA 3GNDA 4ZQCA 4LUSA 2QT3A 1PZ1A 2XIQA 3VFLA 3I68A 3T8QA 1MUMA 3BJSA 2J8TA 2PFHA 1DXEA 4X22A 1TQJA 4QDMA 3L9CA 3CS2A 2Y0FA 3HM7A 2WWDA 3IJQA 5FF7A 2J62A 1W9UA 4YTTA 4CD7A 5AC4A 2WKLA 3W7JA 1QW7A 3B0VC 2CZFA 2VGIA 4MYXA 4JXCA 4OTKA 2BOGX 5FD0A 4LQ1A 3PC0A 2WJDA 4D6EA 3IIOA 2PDNA 3MQTA 4V1XA 4R85A 4GXPA 3M0LA 5A6LA 3NQBA 4BQ4A 2OQLA 3W23A 1LUCA 1XIHA 3AUJA 1SO4A 2DFAA 2HZGA 4TR9A 3AXKA 1LLZA 2CWNA 1BVNP 2R94A 4PR4A 1PYFA 5D37A 5LXEA 3EEZA 4POCA 2Y24A 3RPTA 2DORA 1X6NA 3S2CA 1KFCA 5I3DA 3FA5A 2X2YA 1F6KA 4ZQOA 4DNHA 3P8IA 1HKIA 1VC4A 2WMJA 1K4GA 3VMNA 1GOWA 3GKAA 4LANA 1X96A 3LERA 2I17A 4GY7A 1VFHA 5EPDA 2X0YA 3RM4A 2G8ZA 1MDLA 2D0FA 4GA8A 4GWEA 3QYSA 1KTCA 3ZOAA 4LC6A 3F1QA 2J9XA 3QPEA 4A05A 1EX5A 3RPDA 3DKLA 1DWHM 3GZAA 3S5ZA 2JE8A 4QNWA 3S5SA 3KOYA 1G6CA 2CLEA 4M19A 2QCGA 3RR4A 3D6NA 4GI8A 6ENLA 3P5YA 1ONEA 2VGGA 3NOEA 2PCEA 4DQWA 4R33A 1Q2RA 1VBGA 3QZAA 2RDTA 4QJ1A 4L61A 2G3IA 3OLEA 3BOLA 4DX3A 1FWTA 3L67A 1LG1A 3RO6A 1PCKA 3I3EA 3IRSA 3PTKA 1K03A 3AYRA 1XDMA 2B7PA 3CAWA 1YNPA 4C6OA 1O60A 3WLPA 3B8WA 5BRBA 3NGJA 4MPKA 2Y7FA 4JTHA 2DH3A 3EAUA 1CXIA 1ZUAX 5I3FA 3AU6A 1SJBA 1B57A 1Z8AA 4LAMA 1N82A 3SJNA 4F48A 4ZQMA 3S2NA 4FB7A 3ZJ7A 1BSLA 1JUBA 4AHOA 2ZX8A 6TAAA 1HL2A 2Y89A 2PP3A 1GVOA 3SRFA 4UTFA 4KEVA 1VGAA 3FSTA 1ZALA 3U6WA 2CXGA 1G4SA 4PULA 2Q8LA 1R7AA 1ZS2A 1XPGA 4FLSA 1EH9A 4H19A 4ZXLA 2JKAA 2C1IA 2X1TA 3WF0A 4O0ZA 5EMJA 2PD9A 2DW6A 2ZZ3A 1MXGA 2ZX6A 5E0FA 4L4LA 4PFHA 3OTRA 4IQLA 2WCSA 2Z7KA 4PZVA 2UBPC 4J4KA 1TYGA 3EDEA 2YKKA 3G5EA 2POTA 1ONWA 2EEXA 1ZP4A 2XVNA 3B3DA 4G1NA 3DI1A 1UD4A 4MNMA 1V0LA 4U5KA 1TMHA 3E2RA 2OT1A 4KQNA 2NV2A 3TW7A 2VRKA 1JZ8A 1ZBWA 1MEWA 3JU2A 3OYZA 1JNEA 5AVNA 1LQ2A 1TIMA 1US2A 3QC0A 4AAJA 2FKPA 4G7EA 3R0UA 2OT0A 3SADA 1PHWA 1ZAIA 2TAAA 3MP5A 4G56A 4MWAE 1HW6A 3FXGA 4M51A 5IXEA 5BMXA 3OVPA 2VEIA 1Y5WA 3G1XA 2DSVA 4YHEA 2DH2A 3KBVA 3W83A 1BWLA 3MCNA 1V3LA 4IQJA 5E9AA 2HK1A 3SN0A 4H9YA 2XIBA 3BANA 2GVYA 3OU8A 1EPXA 4F4RA 1BVZA 5AY7A 1MYRA 5JIPA 2VFFA 5I78A 3RCMA 2V5KA 4XZNX 4A8RA 3VKKA 1UWAA 4IT1A 2YCLB 2P0IA 1XCXA 2QDDA 4YVPA 1XIEA 3W37A 1U30A 2TMDA 4O18A 4JTLA 1JCTA 4MYAA 3NQFA 2INFA 1XX1A 3DCPA 1T96A 2KZHA 2CERA 5HNNA 3U0HA 2J74A 1MNSA 3GVRA 4Q22A 3UZJA 5DMYA 4K2SA 2D22A 5E6ZA 1IWBA 3DZ1A 3RU6A 1X1OA 4PA8A 5LHEA 4ICMA 3U8GA 1TZ7A 4L4MA 1R3SA 3N11A 4PE8A 1E9ZB 4A4AA 1UMLA 2J7CA 1NWRA 2BOEX 1UWUA 3MO4A 1XCWA 4JEQA 4QFUA 4Q6JA 1GEHA 1US3A 4LALA 1AZ1A 5JBFA 1YE4A 3LV6A 2B4GA 3AIEA 3A3WA 3W7DA 5CEWA 1VEOA 3ISIX 4N02A 3BTNA 3T42A 4DJEA 1DWGM 2WMFA 3AHVA 3UG8A 2EKCA 3SBFA 1JJKA 1ME9A 3NQDA 2PDGA 2R82A 3TH6A 5CLWA 3LLDA 4ATDA 4UCGA 3SFWA 1G5AA 2YR1A 4NZJA 4LNYA 2OXNA 4AVOA 4O8RA 1TIWA 4I9TA 2R1PA 4MY8A 1L6WA 4H3DA 3TXZA 2R1MA 5C9UA 3IGHX 3C3UA 3QOMA 1TV4A 4B90A 2WJFA 3Q58A 4DJFD 2PLMA 3LA4A 5KEZA 4OWGA 3LPFA 2XHYA 3UZYA 2CBVA 4DRSA 3TZFA 1E1FA 5FCZA 2PA6A 1F4AA 3BXWA 1G67A 4XX6A 4GMEA 1KA9F 3KP1A 3H23A 1WPCA 2ZKMX 4KWUA 3R7MA 1SSDA 2GFTA 3PPFA 4ZGYA 5CC3A 1GW1A 2H3DA 3LGEA 1GOKA 3N13A 2BXYA 1QI2A 3E0WA 2V5JA 1E0VA 1G1YA 3NEVA 2VC5A 4Q3MA 5I00A 1KTNA 1SYTA 1UYQA 2XIOA 1EJUC 3CTTA 1XH1A 4AB4A 4WDUA 3W85A 4KERA 1R7OA 4MF4A 3OEXA 4LXFA 3UR7A 5LIYX 3W1RA 5DEZA 1Z89A 2FZ8A 4ZO8A 1XIJA 5TBOA 1FWAC 1DTNA 4IGMA 4UQAA 2QJHA 1BYAA 4FXJA 4GZIA 1R5YA 4K6AA 3I4KA 2FZMA 2PLKA 2VX4A 4JQAA 3T0TA 3UP8A 4BA0A 2V38A 2G0WA 3R8RA 4C6DA 1W37A 2GWNA 3WEZA 4D71A 2PDBA 3V0TA 1OYBA 3GWQA 2FMOA 3HPXA 3NQGA 3TN5A 3G3MA 4Y9AA 1ITQA 5FJUA 3FK4A 1KXVA 1P6CA 3W71A 3OZMA 2Y7GA 1D2KA 1PWMA 2DGAA 1C9WA 4PL1A 5KITA 3C0JA 4QG9A 1RCQA 4CQAA 4W84A 2QNEA 2NVCA 1C93A 3WCZA 4J3UA 3KW3A 3PANA 1Q7ZA 5JH1A 4I7WA 3JRKA 4QROA 4A29A 1IIGA 1EWEA 3OODA 3DFSA 3F2BA 4JL1A 3NPXA 4PCTA 3MU7A 1E51A 3LHUA 3IVUA 1W8GA 1X8CA 1FOBA 2JQXA 1SJCA 2G3NA 1KBIA 3AU2A 5C6MA 1K02A 3NR0A 4C7GA 4HA1A 1MUCA 1JAEA 2Z0IA 4FMVA 6TIMA 4MWAB 3HGJA 1XIDA 3U2ZA 3AQUA 1IYXA 1DIEA 8CGTA 1BWVA 3OQEA 1Q8AA 4DZ5A 1FDZA 3C2EA 3M5VA 1G7VA 1NVMA 3ARRA 3OG2A 2A79A 4DELA 4MZ1A 1K77A 3GXFA 2GQAA 3UCQA 1T7LA 1ZFJA 3UZWA 4GZJA 3MHUA 5A3HA 4LUYA 1BF2A 5FJTA 4IISA 2PSNA 2Q3RA 3KRUA 2NSXA 5AC7A 3ITOA 1LT7A 4O12A 5H8MA 4DZAA 2VWTA 3IIXA 1VRDA 3MI3A 2W67A 3B97A 5CPNA 4NAEA 1JZ6A 4JTIA 1EIXA 3DBNA 1XLAA 2P3ZA 3V0UA 3SY1A 4WRHA 2VR2A 2ADAA 3GG7A 3W7RA 4DO5A 1TPH1 2DIKA 3PZGA 4H9UA 4JTFA 3VX1A 4WSKA 3H2NA 3WX7A 1DYSA 3FJNA 3WLNA 2VCAA 3ZT5A 4H83A 3SDOA 3AZSA 4RE4A 3TYZA 2OYMA 2HEJA 4WGXA 1DE5A 3RR1A 2EG8A 5D9PA 4DZHA 3G24A 3WFLA 5DELA 2KX9A 4A3HA 4LTSA 1QASA 3MMUA 5KMYA 4IMCA 5C9ZA 1Y7VA 4ENLA 2UY2A 1MDRA 4NJHA 3UWZA 2OR2A 3R79A 4Q7BA 4J35A 2PDUA 3VO0A 1O6IA 1W17A 1UWRA 4X2PA 1J6OA 3O0KA 3EOEA 5C7VA 3TQKA 3CC1A 1VZWA 4EANA 3ZJKA 2WWCA 1HJXA 2TSYA 1JZ5A 2O9PA 2FB2A 4I5XA 2CESA 4QE1A 3KTCA 4JDYA 2E9MA 2GVJA 3ITLA 4Z0SA 1YXYA 1WDDA 4IZGA 4K36A 3W75A 2PDWA 2WHKA 3CQHA 3FKKA 1DXIA 3W1XA 2O0TA 4WD0A 3GHTA 2PLCA 3GU2A 1OGBA 1MQPA 3LY0A 3G1VA 4H1ZA 2JALA 1KM0A 3ITVA 2HPIA 3UCDA 1L2QA 3FAWA 3I4EA 3S47A 1TB3A 2E5CA 1LROA 1QNOA 1RLDA 1OC6A 1NF7A 4GI6A 1OINA 1U33A 3ZT6A 4M1BA 4NJJA 2H9AA 1Q63A 5D30A 3VCRA 3W7CA 3SUVA 3IJDA 4U2YA 4IFKA 3LS9A 3CUZA 3TAOA 1ZSXA 1WDWA 4W4QA 5FA5A 3QSRA 1KXTA 2ATSA 5DBUA 1XM3A 4D6DA 5IHRA 1DJGA 3BLOA 3BV7A 1GKQA 4WY0B 3F2DA 1B4KA 4AMAA 2GGEA 2ZADA 3B8SA 4JPGA 2F61A 4H7CA 2HBVA 3TAKA 1EJSC 4C6LA 2X09A 1EUNA 3T08A 3W76A 4J5NA 3VM5A 3EPNA 2YGYA 3N4AA 1UPMB 2CKRA 2BG5A 1IGWA 1SFSA 3ZSSA 4B3ZA 5I02A 3LRKA 4K38A 4O13A 3NPWA 3M6YA 3QMSA 4REQB 4WDXA 3HURA 3WNLA 1WDSA 3MA8A 2ALDA 3WQ8A 5DXYA 4U31A 4JQ2A 4M81A 5ECUA 1AH0A 1QK0A 1JF5A 4RNJA 3WJSA 3TW6A 4AD3A 2R24A 1MUWA 3A5VA 4JTKA 1L6SA 2PDQA 1OCBA 5D9MA 1PWLA 4NYYA 2PEVA 2X0HA 1DORA 9RUBA 4JHOA 5I3IA 1TPFA 1UUQA 3GXTA 3N1AA 3PTDA 3GO2A 4I8YA 3TYAA 4UR8A 2NV1A 2QJMA 5AZ1A 2R6OA 3RIKA 4JNZA 1GT8A 3T1GA 4PFMA 1ECEA 3NQ6A 3VE7A 4FR6A 3WQEA 2AQOA 1MQQA 2Z1BA 4LYPA 2O9TA 2E1DA 5FJOA 1AW2A 1PTDA 3PWIA 3GNXA 4N9CA 5AKQA 3E2QA 4JTAA 1W9DM 3AIBA 3IIZA 4IIBA 4DJED 7REQB 3EX3A 1XYBA 2D20A 3ITTA 1HJSA 2V2DA 5DBTA 4PTMA 3LLFA 1HG3A 3TQPA 3W7KA 1UQZA 3AMDA 1E56A 1O4UA 5A1AA 1YBQB 3T0BA 5AYYA 4M6UA 2QAPA 4HNVA 1CGVA 1WKYA 1OG0A 2E7FA 2VD9A 2YL6A 4CCCA 3O7UA 4FLOA 2XN2A 4OECA 3PZVA 5HXMA 2Y7EA 2CPUA 4XKYA 3L5LA 5AC8A 4IGNA 1W56A 1LJYA 1XH0A 3HQ1A 4TX6A 2ZZ4A 2JEQA 3K2GA 4K1GA 2NQ9A 3N12A 1TA3B 3DG3A 1S39A 3XIMA 4DBDA 5FEWA 2ICSA 1JDDA 3GDKA 5G4WA 2CLHA 3VGGA 3RM8A 1QI5A 5E5CA 1Q6GA 1R9ZA 4CLMA 3WQPA 3MUIA 5G1YA 4HA0A 3TMQA 3VABA 1TPWA 5CSRA 3U5UA 3UVAA 1B9BA 4QHRA 3RFAA 3FVDA 4NVTA 2VI0A 3VD9A 3KZSA 1LF1A 1WZAA 1UHVA 2YXXA 2ZBTA 2FB3A 3F2CA 1MW0A 1DP0A 3QSTA 1OIFA 1Y0EA 1CGWA 3F5KA 3V75A 5FJPA 1J79A 1H61A 3S83A 3AHXA 1EX1A 1U1JA 2ZA2A 2QR6A 5MKGA 1I6NA 3ES7A 1F05A 4ZL1A 3VOCA 4I5RA 1R2TA 3IJ6A 4RPPA 4L5ZA 4TVCA 3O3RA 4AWSA 1GVSA 5DQPA 1J0KA 2GOUA 3DHDA 2PDCA 3OZYA 4XBJA 2Z6IA 1OCNA 3ZM8A 4DXXA 2CHNA 4AXKA 1JYXA 1IZCA 5A6TC 4S3DA 3NQMA 3KS6A 3EPOA 2CW6A 3POHA 2PC4A 2V69A 3R4IA 2W9MA 7XIMA 2GVEA 3S9YA 3PULA 6CGTA 3PHAA 4MKNA 3S9ZA 4Y8FA 1OX5A 3VIOA 4QLKA 2A7RA 3TW9A 2PDKA 2O4MA 3SUTA 4FO4A 3H4WA 5K9XA 3EX1A 1RQBA 1E5JA 1P43A 1K9DA 4CNUA 3MMDA 1YEYA 3CYVA 3PPCA 4LB4A 2AL1A 3A4XA 4MB3A 1MO0A 3GRIA 4U2ZA 1OSEA 2OGYA 3H2AA 4EX4A 4RE0A 1TPEA 4GJ1A 5I3HA 1PX4A 2WOQA 3LCHA 2E40A 3WDJA 3E0IA 3PUGA 4N42A 2PZNA 1W31A 3SGGA 1PX8A 3W02A 2ZZ7A 5A95A 1W1PA 3WQ4A 1DJQA 2GGJA 5E9XA 4IUOA 4UFJA 1LLOA 3TA6A 1XGZA 4XVEA 5KZDA 3WMBA 3LCGA 2XJ7A 2DQXA 2G3FA 2INEA 1EEXA 2V63A 4R7WA 1T41A 3R6IA 3F4DA 3AZTA 4E8CA 2DUXA 4C6PA 4BI6A 4MFDA 1N8WA 4D6IA 4B5TA 1R2RA 3W28A 2DJLA 4GI9A 5E6YA 1L6YA 3C56A 4KF1A 4C60A 1ML1A 1QU4A 1XYMA 2DEPA 1B90A 3PWGA 1V6UA 3SRHA 4HMEA 4EPDC 3BZGA 1HQTA 2QS8A 3CQIA 1GUVA 2RDUA 3TIMA 1KM3A 1TJ2A 1QT1A 3LV5A 3W26A 4E4FA 4KS0A 3WLOA 4DVOA 3I3DA 4IMFA 3EX4A 3C0SA 3CB8A 4J3VA 2DZUA 3MY9A 4FXFA 4G8TA 4KWWA 5IDIA 1XRFA 1OVDA 3I3BA 2FVLA 2WLYA 3GFYA 3GTXA 1W5PA 4Q8WA 1U83A 1UKOA 1WBHA 1WCGA 1HO1A 3DHPA 2GGHA 3BCDA 3LMZA 2B31A 3EB4A 4NRSA 1AW5A 3SEPA 3S5OA 4EKJA 3EPMA 1Z44A 2OB3A 9XIAA 1J12A 3NFUA 4CKQA 4A2SA 4D1IA 1VFOA 2XVLA 2B0MA 2CXEA 4TO8A 2E0PA 2Y8UA 3LZ5A 2QJNA 3EOLA 1V4YA 2XM1A 3EDKA 1XYCA 2R14A 5FF3A 3BICA 1DIDA 3QR1A 4XD6A 1KV5A 4MVAA 3N3TA 1S2TA 4G6CA 4C6IA 4B5XA 4TTUA 1WUFA 3PSVA 3KBMA 3DECA 4M7SA 4L56A 2PDHA 1J0JA 4MPQA 2YSWA 4B92A 1G01A 3TTSA 3L2IA 4ZMGA 2OZ8A 2AAAA 3QMRA 3H2FA 2FTPA 2W6RA 4IQDA 1YHTA 3RMJA 1OCJA 5AYZA 5LXXA 2J47A 3UU0A 1W3KA 2WBGA 5HJLA 1Z32X 3ERPA 3NDOA 3CEUA 1EF2A 2BV9A 5FL1A 2HE8A 1JUKA 1O5RA 3QMTA 4QSHA 5C8BB 3M41A 2QKFA 1FCUA 3TU9A 1ISVA 5I77A 5FF0A 1BVWA 3UWEA 2JKPA 2XH0A 3AMLA 1UPPA 1PDYA 1JD7A 4GUJA 3AYSA 3UXDA 4LYKA 1PZ3A 1THFD 1AQFA 2DJXA 1QPQA 2OOGA 3CXOA 1SZGA 1WZMA 3VDBA 1ZBKA 4I7UA 3LEPA 3MCMA 4AZHA 3LYEA 9XIMA 2V82A 5KSWA 1GKRA 4PEKA 7ENLA 4J1OA 1B3VA 2J77A 3BCFA 2PDJA 3SY8A 1WDQA 4AVNA 3N6QA 3W72A 3BLLA 4NZ5A 1RPXA 3OVGA 1RBAA 3ANUA 3I6EA 1E0TA 2E3ZA 2A85A 3QF0A 1U1UA 2F8QA 1LQ0A 3K13A 3TJXA 3ABOA 4GOAA 3ZR4A 3TE9A 3BWWA 3BJTA 4C7FA 1H7OA 5F4WA 1QTWA 4Q8NA 5LIWX 1SR9A 4W5ZA 4HCHA 4LVDA 1Q6OA 4WLCA 5H8UA 1ISXA 1W5QA 1AMYA 3NQ2A 3LU2A 3VINA 3W87A 4UOZA 4UQDA 1D9EA 3WBEA 4AX7A 2FMNA 3QV6A 2HK0A 4HYVA 1N8IA 3VDCA 3GD6A 1A5LC 2V3EA 3C61A 3ID7A 3QGVA 2ZXAA 3AIUA 2VR4A 1CWYA 2RHGA 1D3HA 1POJA 1KLYA 3MDWA 1CCWB 1YDNA 3KCJA 3RLHA 2FFCA 2GJXB 1VBHA 1EJXC 3C52A 4NZCA 2ESCA 3TWAA 3UERA 3VKDA 1VEPA 2MUCA 2YCLA 1S38A 1NFBA 3ARUA 3MJMA 4PB3A 4KEZA 4PMQA 5E93A 4ADTA 4MB5A 3IV3A 4YTSA 4FOKA 1WAUA 3D3FA 1ENUA 3HGRA 3CT2A 3B0XA 4O4VA 1I4NA 5H1WA 1TCDA 3JZUA 4LPCA 1K9TA 3BW4A 4HMCA 4O15A 4FNUA 3JVAA 3BO9A 4UC5A 4PCFA 3OJGA 1JRCA 3N9SA 2C8NA 1Q6EA 5A5WA 3SGUA 5AHFA 1LYXA 3SUSA 2FTYA 2Y2WA 1TWIA 3R0KA 4LAZA 1TO3A 3M07A 3PVFA 1W5MA 1D7FA 3RILA 4MDOA 4H7VA 2OLSA 4JIQA 1PZ0A 1IHIA 4MSSA 1UR3M 3W00A 3NM3A 3M0XA 3MSDA 3WNNA 1T40A 3UQNA 4HU8A 1SZRA 1ZHAA 2GOKA 3CZEA 2OCZA 2Y85A 1IEIA 5A8QA 1Y5VA 3GQYA 4O16A 3TWBA 2DZPA 4DYJA 2PU0A 1XIMA 4O1EA 1VH7A 1W8SA 4HPNA 1IEXA 5C9WA 5H6HA 3LHYA 4L7ZA 3KZPA 3THUA 4E2VA 1VLIA 2CHRA 2YLLA 3SY5A 3W1AA 2DPEA 4ERIA 2X7VA 1Z69A 1TTQA 2DZWA 5G4HC 2CIPA 1KBJA 2QDGA 1E0XA 4MKSA 3FLUA 5DCBA 2I7GA 3CHDA 4IL0A 3C2FA 3EB3A 3ECQA 3ABQA 2IPGA 1OY0A 2P10A 1SU5A 2YCIX 1JCNA 4JS3A 3GU9A 2XFRA 1F76A 1BYCA 3EWDA 2NXGA 2D2HA 4JN8A 2A3EA 4CEUC 3P5ZA 1F7BA 1CXFA 1NFPA 3EWYA 4LUIA 3KBNA 2OWXA 4JIIX 2HNEA 4JL2A 3HIJA 2IQDA 4BQ5A 3FHQA 3VM7A 3EDFA 3UR2A 3U57A 1DXFA 3BE7A 4WVXA 3B8IA 4PRRA 3PN8A 4XZIA 3VCNA 1YPXA 1BXCA 1U5VA 5D8ZA 3WDPP 4ATLA 2BVWA 1VFTA 2A3LA 3KCLA 3L66A 1UOZA 1SGJA 4ZOEA 3VNIA 1FXPA 2QXWA 3PB2A 2OKOA 1VR6A 1A49A 3QFEA 4FNSA 1BXNA 1C9DA 2BVYA 3P84A 3ABSA 3QKZA 4XUGA 4UOJA 5EMLA 5A6KA 4YYCA 4QCFA 4YMZA 1XUZA 4M6QA 3W73A 3FEMA 2G41A 3PNUA 1XWYA 2EKGA 1D3CA 1A53A 4IFOA 1CPUA 1QHZA 4XQ6A 1FH9A 1XCFA 3H12A 1FWNA 2ZA1A 1XIFA 3GUWA 2QJGA 3IARA 2ZOXA 2EO7A 1PE1A 2BOFX 5ECVA 4HK5A 5CZ0A 3KE0A 4M3PA 4LW7A 1P6BA 1XL9A 2OX4A 3ZR5A 4UMCA 4UZUA 2NSOA 1JEZA 3H4GA 1J4EA 4M56A 1SUXA 2QJIA 3P0WA 2A5HA 5F2MA 2B7NA 1LRNA 3TROA 1FWIC 3VDAA 1FHUA 1FWEC 1HF6A 3CV2A 5HDRA 4RR4A 4ACZB 4LBRA 2NQHA 3BL3A 1QNPA 2PRHA 3WF1A 4WY0F 1OZQA 3SCSA 1KM4A 2C19A 4DUWA 2WCGA 3WMLA 3CV6A 2VJXA 3ENLA 3V3WA 1K6WA 1OWQA 3FFSA 3K30A 3L0GA 2JKEA 2HWGA 3DENA 1BLIA 3OGSA 1X7FA 1VAHA 4MWAA 1XGEA 5BRPA 2QIWA 3NNTA 1CGUA 2X1IA 3JUGA 3TONA 2GJRA 1VENA 2DZSA 4HHHA 1FP9A 3CL6A 1FWSA 5G1MA 4NL1A 1KO0A 2GYIA 3F4CA 1JXKA 2HNHA 5DN1A 3XINA 4DUOA 3M0HA 1FUYA 2AGKA 3EOUA 4B5WA 5FOOA 3L4ZA 2IUZA 3V7PA 2G4FA 4O54A 1E43A 3VNMA 5EU9A 3WH9A 2HROA 1FCQA 4EP8C 1ZRQA 3PFMA 3E5BA 4JYEA 1X6UA 4S3GA 4CCZA 2J25A 2CLPA 1R3QA 1ZAHA 3NZGA 5CAKA 3OZPA 4EE9A 3CGTA 2C91A 3DN5A 3HFTA 4DXKA 1JNDA 6XIAA 4Z17A 1GZGA 2P76A 2WJEA 4YCOA 4GD0A 1XSJA 2ABBA 2PP1A 4HBKA 3VNDA 1AMKA 1UD6A 3TNBA 1KNWA 4B5SA 3GH5A 3BVJA 3TR9A 2Y7DA 1EHAA 2C1GA 3LG3A 1XYZA 1K8XA 3MMTA 5IBXC 5HNTA 2GPTA 3FX4A 1CXHA 3KTSA 1KB3A 3E74A 1RHCA 3FVMA 1VB9A 1TTIA 5H8PA 4HIBA 3GVWA 4P8VA 3R89A 2P88A 3NEHA 4F0SA 4HKPA 4NNAA 3K4WA 3H6OA 1E55A 5IFPA 4M7TA 4DZIA 1SR0A 3PTQA 2C6QA 4ROQA 4M8UA 2B7OA 5FEPA 4HTBA 4GCAA 2CLMA 3W81A 4MLRA 1IT0A 2O7SA 4Y2WA 2XU2A 5BXRA 3GDRA 2VEPA 1TJ1A 3WUFA 3PJUA 1EC8A 2OKTA 1ZLPA 4LB3A 3SJ3A 3BOFA 4PMJA 1BGAA 3WJYA 1OFPA 3WIJA 2PWDA 4AWTA 2CC0A 2YBVA 4LH8A 2XGBA 3CBWA 3GBEA 3H7UA 1XYFA 4GINA 1KCKA 3UF9A 3TC7A 1TV5A 1UWSA 4MM1A 3ZVIA 1VQTA 1E4MM 1O5QA 3FHAA 2P0OA 3KWXA 4C6BA 5EY5A 1C8QA 3O6YX 4BS0A 4K1WA 4HPHA 3AUOA 1LOQA 1H7RA 3KRSA 4Q8QA 1E3ZA 3I7SA 1MI3A 1M04A 3ATYA 1XG3A 3VKCA 1SW3A 3WFZA 4FZIA 2BDQA 4GHRA 1H63A 1JD9A 1KR0A 2JGQA 4XAFA 5C55A 3ZT7A 3UZ5A 2QVNA 3HN3A 3LRLA 2QUMA 3EGJA 4LV4A 3IVTA 4NY2A 1YPFA 1I1WA 3EMZA 5FF2A 5G2HA 1K7FA 4CD8A 1R3WA 1RALA 3N6HA 4ZVJA 5FSDC 2W5FA 1JULA 2KAUC 1CXEA 4KBXA 1AQMA 2XTKA 3JW7A 2WHJA 4YL2A 3D5HA 2NVAA 1EUAA 2QEZA 3WBXA 4RLIA 1EQCA 2J27A 2HPMA 3NSNA 4WY0A 4UTJA 4C6KA 3AXXA 1T5AA 3TJIA 1Z6KA 1P1XA 1A4LA 1XV8A 1E0WA 1WZKA 1POKA 3GHUA 5HMEA 2F84A 4UOQA 4LS0A 4C6NA 1QXLA 3KWSA 5AZ0A 1HGWA 1KC7A 1QOQA 4DI9A 1CW2A 1SFTA 1JG9A 3G22A 1MW2A 4X0VA 2YL5A 3PAOA 1CYGA 2EF9A 1M6JA 1QVBA 4REQA 3IK2A 1R3TA 2QPXA 3AS2A 3R8GA 3WQ6A 3NL2A 4JDBA 4YNGA 3DFHA 1B30A 3CAKA 3OQ8A 4HGXA 1I75A 3QGAC 1UC4A 1V7YA 3B9AA 3O63A 2J9YA 3GDLA 5CGQA 4F0KA 4NILA 4H6EA 1XLIA 1XKYA 3ITCA 3VNKA 1JRBA 2A21A 4N9EA 3NXFA 3ATZA 1GKPA 1C29A 5G1TA 4C5ZA 7ODCA 3QQ0A 3N14A 3UXLA 3S1GA 1O1HA 4FK9A 3UJFA 4HU4A 4JTJA 2IKHA 5DMNA 1ME8A 3L4YA 1IGSA 4HN8A 4ERAA 1S2UA 5AC6A 3PJXA 1EYEA 4BR1A 2VCCA 3TYUA 1JUEA 1RLCL 4UNLA 2WV8A 1VYSX 1EZ2A 3CTLA 3W1UA 3TSBA 4YVXA 5CXPA 4DPQA 3LHVA 1GGOA 3B04A 4ZOCA 7REQA 2CCRA 4G1KA 4CCDA 2Z1KA 5BWAA 4F79A 1R47A 3BAWA 2YB4A 3N18A 1KRCC 4XD5A 1YBQA 1ITCA 1WYIA 3IACA 7TIMA 3T2QA 1Q3NA 2GGGA 4OFCA 3NURA 3GKFA 3MT1A 3VUPA 4QJ4B 3VKAA 3TYBA 1XLCA 5K9CA 1DWIM 3BW2A 4NI3A 1X1NA 2O92A 1H50A 5DY2A 4R34A 2VURA 1EOKA 2PDXA 4PUNA 1KQZA 1UASA 2DT2A 1BKHA 3C5QA 1TA3A 1JPIA 4CU7A 3W88A 1LM1A 3MB9A 5CPOA 1UP0A 3T4CA 2VELA 5T91A 4PMRA 4OHQA 1I2OA 1QJWA 4S3CA 1UB3A 1CB7B 4H6KA 2HS8A 3TCEA 3H22A 4PUJA 3E12A 5GNZA 4H9MA 3E0LA 3G0SA 1RVKA 1ME7A 3A5FA 4WEVX 3WO8A 1PIFA 1M9HA 1XISA 2X05A 5AOUA 4I9MA 3P14A 2ZZ6A 1J0IA 3RG6A 4N6FA 4YHGA 3GXMA 4F2UA 1P7TB 4H9ZA 1Q6CA 5BOOA 4S39A 2I5IA 5A2CA 3NJ3A 2XN1A 1BHGA 4GRSA 2O56A 1NU5A 2QUVA 3LPGA 3UGVA 2R1LA 5T9CE 1CLKA 4JTDA 2C7FA 3W0KA 4HOZA 2WVVA 5IHSA 4WGHA 4XSMA 2DT1A 4Q8MA 1XPYA 2WC3A 1TX2A 2P5NA 4OV4A 1Q2SA 4QRNA 4F0RA 5A6SA 1OFQA 1LLWA 3DOPA 2W3ZA 4J3XA 1I2RA 3DC0A 4HNUA 5CSYA 2Y6ZA 3LBMA 2XVPA 4KW2A 3IS4A 1J5SA 4PMYA 4F0LA 3NDYA 3W6LA 1LDCA 1MVYA 2J6XA 5AB3A 4EXQA 3BLIA 1JF6A 4FEZA 2QV4A 3LBCA 3PZMA 3LCWA 4NYUA 1Z7AA 4MIMA 3URNA 3GXPA 3DYMA 3LI0A 4RV8A 3VCCA 1SW0A 3LB0A 3GDBA 1ZENA 4KGJA 5K4XA 3BLEA 1QATA 4H6RA 4S3BA 5T9BG 4GK8A 3GTNA 1P0BA 2AGTA 3FOKA 1W1A1 4MWAD 4GYPA 2VFDA 3B8UA 2BZNA 3UPWA 2ZRZA 4JY9A 1RK6A 3WDRA 4DN1A 4B91A 5J5DA 3GHRA 2ASHA 2FHFA 2WMIB 3RK8A 3EKZA 3HPSA 3S1WA 3GR7A 4LWWA 3GC5A 3FGCB 1T8QA 3L4TA 2ON3A 2E9BA 2VGBA 3MUCA 1RJPA 4CNNA 1O66A 1TWWA 3F4WA 1TVPA 3TDFA 3H55A 3ELFA 3WLQA 4C1KA 4UTIA 4CD5A 3TEVA 3BLKA 4LV9A 2QIIA 1GJPA 5BMWA 1L6FA 2BFGA 1VPXA 2QUNA 2QCEA 1BXBA 3C2OA 4IG2B 1JCMP 2X7WA 2VEKA 3QGKC 3STEA 2D3LA 2ZRXA 4UFHA 4GH3A 3K8MA 1SO6A 4CNOA 3EWWA 4EACA 5DX7A 1FX6A 3WBAA 3MVIA 4J7RA 3T05A 4FS9A 4JY8A 1ICSA 4GIRA 1JGMA 4V33A 3W1MA 1ELSA 3KLLA 2VL4A 1UW9A 3N34A 1H11A 4IPJA 4TVUA 5FEZA 2W92A 3LTSA 3PK7A 3GE7A 4Y9OA 1EYWA 3MV01 2OG9A 4Z1YA 2CZ5A 2OYKA 3UNDA 4G9PA 4YN5A 3QV9A 4DJDA 2ZVRA 4YU1A 4J27A 1A0DA 3DIPA 2WC4A 1FBAA 2ZWZA 3B06A 3WL0A 3B8TA 3LCIA 4OOUA 2YW3A 4Y90A 3CQJA 4RDVA 4AU0A 4D8ZA 2GDVA 2Q8XA 1FWCC 3GG8A 1LBFA 3UXAA 4O50A 3IGXA 2R91A 3TC6A 4GNKB 4NSBA 4Z1CA 4LNCA 1H1YA 4GZEA 3NQAA 2IPJA 3SO7A 4O53A 4PUWA 3ZFHA 4IIEA 1TPUA 3RXZA 4WJEA 3KX6A 2DQWA 1E6ZA 2JEPA 2RJHA 8A3HA 4W8BA 1WA3A 1T0OA 5SWUA 5DT7A 1WKDA 1GZ1A 5FIPA 1EOMA 3K4DA 4GE8A 4Z2LA 4IJRA 4A3RA 1XF0A 5AFDA 3WSUA 1YPIA 4MB4A 1GVYA 1WZLA 1L2UA 3CHCA 4GQGA 2VUNA 3OBEA 2I57A 3KAOA 4WR3A 3UPMA 4V15A 1I9CB 3N04A 3IAQA 5CH9A 1OFEA 4AH7A 3NL5A 3BZJA 4RZ5A 3VD3A 1DL3A 2PTYA 3BAXA 3RPMA 2WK2A 1L8NA 3GYEA 4QEEA 4LJ3A 1E1CB 2PDYA 2AL2B 3N4FA 2EPLX 4PMDA 1LOSA 2EPOA 2FZDA 4XV0A 4LRTA 5G4EA 3V5CA 3OBAA 4R27A 4MHBA 3BARA 1GZJA 2J79A 3MWCA 1VFMA 1O5XA 2EAWA 2DP3A 3EWZA 4FNPA 3SN4A 4RKAA 1FKXA 5CZKA 2BASA 3CH9A 2WVTA 3VYLA 3DKJA 4W7UA 2BY0A 5HOSA 3UESA 2TODA 5FESA 2I16A 2VUYA 2QULA 2ZTJA 3MZ2A 2R9RA 4AZBA 1OADA 4K8GA 4MNJA 3DAQA 3QY6A 3MSYA 3AI0A 4IL2A 3CMGA 3TOYA 3LNMA 1NQ6A 2GGIA 4H9XA 3APYA 2VDGA 5JU6A 5KZ6A 4PRTA 4H8VA 3WEOA 4Q7IA 1R9XA 4JFWA 4FF7A 1JPMA 3KOZA 3M47A 3R12A 2ZRYA 2A1YA 1HL9A 1MEIA 3EMQA 4RNIA 3T9PA 1M5WA 1FDJA 2DIJA 3GM8A 2V5BA 4QIUA 3A4AA 4ZCWA 3M64A 2O7QA 5D2WA 1KV8A 4HSOA 1PAMA 3KLKA 1EP1A 1J2BA 1VPYA 1ITXA 1HJVA 1QBAA 1BRLB 2WM1A 2OX1A 4RDZA 2J78A 4KT2A 3EA2A 3PB0A 1XLBA 1OCQA 5BRQA 2GJXA 4FXRA 1V77A 1VHCA 4E6MA 5U7SA 3GNRA 1Z41A 4AY7A 5C0QA 1VKFA 5FJIA 4DJEC 3ITGA 4XVDA 3BH4A 1WOAA 3R0DA 1EC9A 2QMKA 4RK8A 4C6FA 2ZE0A 4HZ7A 2SFPA 4S3EA 3C86A 4S3JA 1WNOA 1ZZMA 2JGYA 2WLZA 3C0LA 5CKSA 4JTGA 1X38A 1XICA 4XB3A 2XVKA 4KRZA 1BG9A 1PB0A 1GYLA 1GG1A 2PDIA 3W7LA 3CZGA 1W3JA 3FEQA 3NQ8A 5A8PA 4JCMA 2XH2A 1WAWA 3SCOA 4IIFA 5C9XA 2P50A 5BROA 4HN4A 5AHLA 1FHLA 3L0KA 1UD3A 4TTGA 1EF3A 4UTKA 1XS2A 3GVGA 4ZXOA 2UZ9A 3BCJA 1UR8A 1VD6A 1VEMA 5F7UA 2FPVA 2WJZA 2D0GA 1C8XA 1V6WA 1ZCCA 1G69A 3FNDA 2PBOA 3G77A 1EDQA 3QR0A 1KBKA 4PBFA 1M3UA 1PTAA 4ILSA 3NOYA 4PBEA 2E6DA 1F3TA 1DBTA 2WMGA 3V5OA 5K2ZA 4C6EA 2D2GA 1F9CA 1CZ1A 1VF8A 1OGGA 3MSRA 1HP4A 4GXMA 4JTQA 2EG7A 1FKWA 1H7PA 1GTHA 2VR5A 1ZBCA 4BF7A 4CQ9A 4MY1A 2OEMA 4OIFA 4RE2A 2PI6A 1HTIA 2GQ9A 5FKYA 2PMQA 3GB6A 3LHZA 4DHGA 1MXSA 4PMXA 3VTRA 1E9YB 2ODOA 3KRBA 1HKWA 1C8YA 4QS5A 3RCNA 4FR1A 1XLFA 2GUBA 1TPB1 3N25A 4XAGA 4AZCB 3H2OA 3N2MA 1LBMA 4JFUA 3SSJA 1XI3A 3PBGA 3GAYA 1Q6QA 5KZEA 4IP5A 4RDWA 4EAYA 3WENA 1TKKA 5BXSA 4FI4A 4A35A 4XG1A 3CUIA 3D3AA 1V0MA 2GJNA 2C71A 3N2TA 5A8OA 4BFAA 2BNJA 3STPA 1VIWA 1IT8A 4E3TA 3DFTA 4C91A 1IIHA 2ZUMA 4DLMA 4UTWA 3FYPA 4QM1A 3CH0A 5M1TA 1M03A 3PZUA 3QN3A 3PAJA 4GVFA 4P8WA 4S1FA 1SO3A 1NH6A 2WM0A 3GNNA 3WF4A 1L0PA 4S3KA 1FFQA 1LWIA 4AHQA 2XG9A 4MOZA 4RXGA 5J04A 3S1VA 1HZYA 1AG1O 4HNCA 2Z29A 1F3EA 5CG7A 2GQ3A 1QI3A 3S46A 3ITYA 2DUAA 1PBGA 3WD2A 4S3AA 1CLVA 4LT9A 3O2LA 4PUDA 2RDXA 5A8NA 2F6XA 2FJUB 2AKZA 1MW1A 2PGWA 4GKTA 5CPQA 4LCRA 1KKRA 4R9XA 2ACUA 3VZYA 5I09A 3U9IA 3VIHA 4AWEA 4B9YA 3QEZA 4QISA 4ZA0A 3WLRA 1TCMA 4D6CA 4JQ4A 4LAKA 4O8AA 1BQCA 3GDMA 3QQ1A 3BV4A 1ISWA 4FALA 3F5LA 5A2AA 2OWWA 1ZL1A 4L9ZA 2IMRA 1PVNA 3QJAA 1UZ4A 4LGXA 5HUPA 2WVUA 4H01A 4GJJA 1DTUA 3NSMA 4CU8A 1CB2A 5I06A 1UA7A 2GLKA 1BTMA 5BCAA 1XW8A 4ACZA 1ZP3A 3CAVA 3E38A 2YXGA 3D0CA 4CNPA 1QMLA 3P93A 1L6GA 3O15A 4A8NA 1S5TA 5HUOA 5JVLA 4H6QA 2XSBA 1PKYA 4GGHA 1Q13A 3MUAA 2PGFA 1P0NA 1E6PA 3P7YA 1B3XA 2AQWA 2C1HA 3R5EA 3WN6A 4EOUA 1WDPA 4YTQA 2AKMA 3EBVA 4I5UA 1OFBA 3WBWA 1Q4NX 3SIMA 2OELA 2FFIA 1VFSA 4P8UA 5HMDA 3W24A 4AHPA 3LTPA 2WQPA 4DO4A 5CZTA 4AYSA 3TTEA 3QC3A 3I6TA 4RZ6A 3AMCA 4PMZA 4N4QA 2JIEA 3MUZ1 5EKYA 5L9FA 5EGRA 4DJDD 4ZE5A 4W87A 1TFVA 3VIFA 1KM1A 2QCFA 1RP9A 1IT7A 3DFYA 1DWAM 4DM2A 4YWIA 2VX6A 2PWUA 5FF4A 3OB8A 2NUXA 4QG6A 2V5CA 4JX5A 4ZOBA 1O12A 4J2PA 4IHCA 1OX4B 5D2VA 4JTTA 2Z28A 4IUGA 2NQZA 3UBPC 3KRZA 3GH4A 1DV7A 5U4NA 3U2OA 1EXPA 1K7XA 1V5XA 4JAWA 1BAGA 1CXLA 1OFAA 3AICA 4DBUA 1OM0A 3L2LA 1GNXA 3I10A 1V93A 4O1AA 4LAOA 3WNKA 3TVAA 1JGIA 3C8FA 3IANA 1TWSA 3KCOA 1Q7MA 1LL7A 4XKMA 3SB0A 4ML9A 3AJ7A 3CIWA 5HMFA 1EZWA 3WH7A 3WK0A 4DAIA 5C2XA 4RNFA 3E96A 2Q8ZA 2VDIA 1H5YA 4HU0A 2H90A 4GXWA 2HVNA 4M0XA 4ZO7A 3GVVA 1A3HA 1V02E 3AS0A 4PC8A 1TUXA 2IXUA 1DKWA 1WKFA 2EGZA 1YTEA 3LQLA 1D3GA 2UY5A 3ZLGA 5LGXA 3ZVHB 2PTWA 3SIZA 3HG3A 4PMVA 3G1AA 3QZ6A 3A64A 4IPPA 3IAPA 2V9DA 4XZBA 4GNVA 3VMOA 1UJQA 4BQ3A 1PCWA 1V6TA 3TP4A 4FLRA 4J28A 2J75A 2VZTA 3IJIA 3CWNA 4K37A 3B0YA 5CC7A 2J8GA 2TYSA 3SCVA 4O0QA 4LEFA 4NJKA 4I90A 3L2MA 2BHYA 3O06A 1XRVA 4LS2A 4LY4A 1JI1A 3N2BA 3W2LA 4GFIA 4Z0JA 3NTYA 3UNTA 3W74A 3MYOA 3UGRA 1Q66A 1OB0A 1CGXA 5TQLA 3VIMA 4QDWA 3K4AA 3M0ZA 2W0UA 2NX1A 4JGDA 5AYXA 3U4FA 3H70A 1BWKA 1DQWA 5D02A 3WL1A 4AEOA 1RY0A 5K3VA 3LCXA 4IH3A 4GUFA 4BWLC 2PPGA 3DHUA 3M5ZA 2Z1VA 2YA1A 3HJZA 5D03A 2XDFA 3W01A 1XHGA 3TR2A 5BNKA 2J9ZA 2X42A 5ABGA 5HR7A 2Y88A 5DT5A 1JYNA 3NIYA 4C65A 3VILA 4OGZA 2Y8KA 2QGHA 3UJEA 1V08A 2IQTA 4JTSA 5XIMA 2VRJA 5ENLA 4CNSA 3KHDA 2NX9A 4HZ8A 2P8BA 1UKTA 4UXDA 3TTQA 5DFAA 1DJYA 3W4RA 4NQ1A 2BGNE 3NDZA 1KD0A 1B2YA 3PBWA 3E9AA 3P61A 3A22A 3QRHA 1EO7A 2ZXBA 1GHRA 1R87A 4NX0A 1UOKA 1J0YA 3W7NA 1LCOA 1SZFA 5KINA 3EXTA 3CIXA 3CL8A 1RCXB 3NQEA 5I3GA 4W8AA 1XP3A 3I7RA 3B05A 4GUIA 1E72M 1XBYA 3UXIA 1CEOA 3M0VA 2J7HA 4KCVA 4IXHA 4FA3A 1LRTA 5HATA 1QPNA 2CBJA 2GDUA 1NWUA 2BWGA 1QNQA 7CGTA 1EGMA 2WZMA 1J96A 1WB0A 5HNUA 2NQLA 3AISA 3IJ8A 2I5GA 2WNWA 4KH2A 2EPHA 4OBRA 1M7JA 4UUIA 3W7EA 2ACQA 2Z24A 3R11A 4IIHA 2JK2A 2OJPA 3CT7A 4NJGA 1Z42A 2ZDRA 1R85A 4BEQA 4XK2A 3RJYA 2PCQA 1FWHC 1Y65A 5D38A 3IVSA 3QPYA 3NZRA 4QJ3B 3QBUA 1X97A 3HPFA 4DWSD 4N2YA 4XZHA 4JX4A 2ZFAA 3ARZA 4JX6A 1EL3A 4O4WA 1W2VA 1ADSA 2ZWYA 3THCA 3EX2A 4GUHA 5E70A 1A3WA 3GH7A 3LD5A 4TMBA 4UNKA 3ZXWA 1HIZA 2OO0A 3URBA 3RJXA 3UYIA 4L4PA 3G1FA 3LM7A 4RJEA 3VIPA 3N29A 3WK2A 4P7RA 5T26A 3RCYA 2ZVIA 1PHQA 2EHHA 3HTWA 2RDWA 1NOFA 1TMQA 3MYPA 2NUYA 4FIRA 3RX2A 2HS6A 2CBUA 3RITA 1LL4A 1XD0A 4WJXA 2PF8A 3QZEA 1XBVA 3VC5A 2C18A 1NDZA 4KWSA 4C1NB 2VVSA 3AOFA 3AIWA 2X1UA 3DGRA 4R9OA 1IXOA 3SQMA 4XTDA 1ZY9A 2X8RA 1JIBA 3IRDA 3I65A 4Z42C 4I9AA 3RX3A 3AO0A 1QWGA 2DVXA 2XUCA 1MQRA 4AEFA 3ZJ8A 4ZEPA 3W7PA 4MAZA 4JCLA 2PWGA 4L1XA 3LXAA 3NPVA 1RAKA 1B3YA 1XH2A 3OVQA 1BFNA 2WAGA 4L4OA 4KCWA 1P7TA 3E2VA 4F66A 3FCPA 4GCXA 2HCVA 3ITXA 3N19B 4KETA 3U48A 2PWHA 3CLWA 8XIMA 3CAQA 4AY1A 1A5OC 1H09A 3CO8A 3PZ9A 1AH3A 1GK8A 3TLLA 4OZOA 4UQ9A 3VK5A 2YIHA 1DEDA 3JZEA 2G37A 3M44A 4FX6M 4Q8OA 1JCXA 1GVEA 3WH8A 2QQ6A 1ODUA 1G4EA 3PS7A 4PSPA 1V6VA 3VDHA 2BBFA 2J7DA 4HVXA 1UWIA 3SUUA 3KOWA 1E5NA 5I3JA 3NSXA 4NP7A 2V5LA 3EA3A 3I7QA 3UT0A 2PGEA 1ITUA 1UR2A 2DSZA 3EMCA 2FGLA 2V2CA 4ASTA 3WUEA 3PTMA 4IF2A 4Q4PA 1QO2A 3Q65A 6XIMA 3LMYA 4UFLA 1TQXA 1AJZA 3N3MA 3MBFA 4NZ3A 4WF7A 2V2HA 1JFXA 5CC5A 1QO5A 3CUFA 5HWJA 1UA3A 5I07A 4AG0A 3UEQA 3VFCA 4AD1A 5LHFA 3HV8A 2C0HA 4X3ZA 4ZSTA 2FDMA 3OLGA 1UUMA 4EVZA 4BI5A 2FVMA 3M9YA 4PH6A 2VFHA 4WK9A 2VNCA 1VLWA 1UR9A 4XZMX 1SFJA 3GLCA 3STGA 3AYTA 2VGFA 3TFXA 1DHPA 5E0KA 1KWKA 2YPIA 3Q37A 3WK3A 4C7DA 1J01A 3RM9A 4TV6A 2PE4A 2PF0A 3WNPA 1QK2A 4MB1A 4H8NA 2FZNA 1DWFM 4LVAA 3WLLA 2LLEA 3ZR6A 5LZLA 4E2OA 4JOMA 3MHGA 4GG9A 2WMIA 2YL9A 1FWFC 4UTTA 2BP1A 1MEHA 3USBA 4A3QA 4Q8VA 3OPSA 5FAGA 2Z27A 4L1GA 4UQBA 4RNHA 3N6JA 1IZKA 3BLFA 3FGCA 3GIYA 3VDGA 1RSCA 5ABTA 1RQEA 2PURA 4EPBC 4UQEA 1BPLB 3AZRA 2V30A 4HA3A 1RBLA 1TZ9A 2TRSA 2A6LA 4M6VA 1XDJA 1TE1A 1WXJA 2V8ZA 3PBYA 3W82A 5IBXA 5D32A 1SQ7A 3GC4A 1UR1A 4DM1A 4UB9A 4C90A 4IG2A 1TUFA 2OSYA 4P7LA 5F2GA 3WFAA 1X98A 4JKMA 3MP4A 1S5MA 3ARXA 3BQ6A 3L7RA 3GR8A 3FA4A 4XAZA 1XGDA 1DIOA 2E28A 4IPNB 1PKNA 5LIUX 4S2CA 4GY1A 4F0HA 3R1ZA 1YXCA 2GSEA 3C4UA 3UY8A 1V79A 3ORWA 4US6A 1OT2A 3E49A 5BZAA 3IWPA 2O55A 1XBZA 5JMUA 1AD1A 4AD5A 3ZLHA 1K7EA 1XLDA 3ONBA 3PF3A 3HZ3A 4GX9A 3UG5A 1PEZA 1WUEA 4UR9A 1EP3A 2VZUA 2PDPA 1AD4A 2A7NA 4JFSA 5CPLA 3U7BA 2HXUA 3FN9A 1JXJA 1U5JA 3HG2A 4EF9A 3CASA 5GQBA 1XLJA 4G7FA 3CM4A 4P7QA 2X30A 3WQGA 1F4HA 1KBLA 3LZ3A 3PFRA 4W5UA 2GJLA 5D2TA 3M6DA 5CZJA 1FTXA 2D23A 1Q6LA 4ECLA 4ES4A 4RDYA 3H8AA 3EYPA 2VHLA 1AJ2A 3T6CA 1KTBA 2WSYA 2Y4SA 2NXHA 3WZ0E 3WG6A 3HQOA 3PSWA 1R9YA 4EWND 1LOLA 4GFSA 3UR5A 4E4UA 2VENA 1QOXA 2GZXA 1TWDA 4DB7A 4IMAA 4Q4RA 3JR2A 4KGLA 1RJQA 1VFFA 1XLMA 3AHZA 1GWJA 1V6YA 3VZZA 3VIGA 3ABRA 4NU7A 1XJBA 4H8UA 2F7FA 4QDPA 1E1CA 2WW5A 4GPNA 1VBUA 3ARVA 2AL2A 3BJFA 4KWVA 2VTFA 3WELA 2HVOA 3CPGA 1JQXA 4E0CA 4HMNA 3BC9A 3G6MA 3HG4A 1P0DA 3L21A 4MDPA 4OT7A 4Z1DA 4WDTA 4OBTA 3H54A 3V36A 3WK1A 4GBDA 2VKZG 4Q4KA 3VA8A 2Z6JA 2EG6A 4F2BA 4N4PA 3HMJG 1AL7A 1XLHA 1ODZA 4D6GA 1EA9C 3P82A 4DY1A 3GUGA 1XYLA 2B81A 4LS1A 2ONEA 3W29A 4NZ1A 3DFNA 2G97A 3H7VA 3DG7A 3GDTA 3LOTA 1KCXA 5BWFA 2YDSA 4QE5A 3TQ0A 1K9EA 4GIAA 2CLKA 5CJMA 4NX5A 4IP4A 1H41A 3SZ8A 1TPVA 5C9RA 4WKHA 2Z26A 1Q8JA 5M5DA 3IGSA 2GL5A 4GYFA 4ICCX 4JBRA 1RY8A 1A5MC 3MUY1 3FXYA 3V16A 3RGTA 3R2GA 4Q4MA 1ZAJA 2PAJA 3UWUA 1TRDA 3W86A 4L6OA 4LBSA 3LSCA 3IUDA 5TIMA 1EJWC 3GVQA 4KRTA 2W27A 3GX9A 4HNLA 1C7TA 1V8EA 4LSBA 4F2TA 1KFEA 2NXIA 2IPFA 3B40A 2E6FA 4R3UA 3WQVA 3CWOX 1BRLA 4LYQA 3W2KA 4B3KA 3W6MA 3QY7A 4E3VA 4BK9A 4M24A 4LVGA 1YW1A 1XSIA 3AROA 1V6XA 4GISA 8RUCA 3GG0A 1H4PA 4PTXA 4I9JA 1MZRA 1TV3A 2BGQA 4JD4A 2OFJA 3WUBA 3BW3A 5DMLA 1BGGA 3PWAA 3N4EA 4AD4A 5I7GA 4RUBA 1EDGA 4N6EA 3AIQA 3RLUA 4E5TA 1UR4A 1YKWA 4GABA 2QCCA 3RLGA 1QPOA 2PDLA 2YXOA 2OEKA 3BSHA 4D1JA 2RJGA 3BG3A 2YDQA 1GVRA 2E5DA 3FY1A 2FDSA 3W1TA 1OABA 3C3NA 2E9LA 1AFSA 1A5AA 4NAFB 2CNCA 7PTDA 2ZX7A 4NUWA 3TCSA 3SRDA 1FWJC 1TVLA 4EK7A 1W0MA 4K3ZA 3ABXA 1F07A 3G18A 4A3YA 2FQIA 1VS1A 1TR9A 4YS1A 3UY7A 4L6HA 1Q7QA 2A0NA 3EKLA 4EWJA 2XH7A 3BSMA 4FX7A 3EOSA 3CEPA 2WVVB 4JN7A 3P62A 3RX4A 2ZQ0A 1S2AA 4LAUA 5CZSA 1W1ZA 1TELA 1MFVA 4OV9A 1EHNA 2QCDB 1W32A 3M0KA 2BY3A 4JHMA 2ZUUA 1GYMA 3TYCA 2J7BA 2E8ZA 5CG0A 3QHNA 3ZYZA 3P0XA 5DLCA 4MMWA 5C2GA 1UKQA 3VNZA 4ORIA 4JHZA 2E77A 2X2GA 3W9ZA 1WKEA 1QW9A 3CHFA 4XZLX 3ZJ6A 4D9PA 2YW4A 3AWOA 1S1PA 2XPKA 3R25A 1A4MA 2UY3A 4AZCA 1SMAA 3M7SA 1W3IA 2ZRUA 4AWUA 2XH4A 3GXNA 2DZVA 1MZHA 2ZX5A 5AC5A 2FHBA 4QS6A 1DJNA 1BSIA 1ZTVA 1O5KA 4W89A 3WLMA 5AYBA 1FVPA 4BJHA 4LRSA 2WQDA 1FH7A 3F7JA 4CCEA 3AIRA 2FHCA 3EDDA 3A3XA 3G1SA 1ADOA 3OLIA 2ZICA 4JKLA 1P6WA 5K4ZA 4J3ZA 3CHEA 4GYKA 3WNOA 1DOSA 2CWXA 5HPCA 3AIVA 5JUVA 4FOUA 1FWWA 3T09A 2XSXA 2VD8A 4GY0A 2GVLA 1YTKA 4AYGA 4WKFA 2WSQA 3U4AA 1RK5A 4TU1A 5A6AA 1B3OA 3L5AA 1KFWA 4CQCA 4A8IA 2PDMA 2Z25A 2DT3A 5EFDA 4AC1X 1TTJA 1TZZA 2H3BA 2EQDA 4X9SA 2V81A 4RXFA 1FHDA 1UG6A 1RPKA 3LI1A 4TIMA 2FGBA 2FIQA 4MWAC 4UBPC 4JNMA 2XZ9A 2REQB 4H2HA 4RCXA 4CVWA 1QWKA 1SW7A 3OW1A 4QE4A 2VEMA 2DSKA 5JBEA 2J6VA 2E4TA 1RCOB 1FA2A 1DQUA 3FW6A 1SM9A 1V3HA 4GQBA 3P3BA 1Z48A 1ZBVA 5CCZA 3OOQA 3P2VA 3NAVA 3V0SA 5FL0A 3EZ4A 4S23A 3TQVA 1LP6A 5C71A 4EF8A 2VRQA 3NQCA 1QCWA 1XFBA 2CHOA 1QI4A 3RDKA 3QR3A 1HX0A 5BXPA 1KFKA 3PZIA 1NWTA 3GC2A 3XISA 4ZB0A 3GTFA 3ME3A 2VZOA 2G95A 4JZ5A 1H51A 4MTVA 2BHUA 5LA0A 4IPIA 2G96A 1CI1A 1J2WA 1KWGA 1OIMA 3ONCA 4S3FA 5I2UA 1H7NA 2FPYA 3LNPA 1FRBA 2CZDA 4KEMA 4XZ9A 5AHEA 3WLIA 2OLAA 3VZXA 3CLMA 1RR2A 3OHIA 3EX6A 4GNJA 1IZJA 3ARWA 1OFDA 4HCLA 1OD8A 5HQMA 2HMCA 2OEJA 3G0XA 4ZENA 4RZBA 3CNYA 1UKSA 5EBUA 4MUZA 3WDHA 1DJZA 3OG3A 4PUKA 5LIXX 2E6AA 4OOZA 2BS9A 3DBPA 2MNRA 1YMYA 3QFWA 4H2CA 5F2IA 4HSNA 4IX0A 4OVXA 4BCEA 1WDRA 3ALGA 1QHOA 3KBJA 4HB7A 3KVKA 4WSJA 2XIJA 1B0IA 3KL0A 3AXIA 5I0DA 3DUGA 2E09A 3MZNA 2XIMA 3S5NA 1E9LA 1OX4A 1TPDA 4XSLA 4W7VA 1GG0A 4KEUA 8XIAA 3BLDA 5D8WA 1RVGA 1Q5MA 3H2EA 4ZTYA 4GC4A 3UWVA 1OF8A 5GVJA 4JTRA 1O94A 2RGLA 2YX0A 2NW0A 2V0TA 3O07A 4H9VA 1NDVA 1G94A 3A3HA 4DIAA 3R13A 3KOFA 1PUDA 4WXZA 3M0MA 2PS2A 4HSHA 3OA3A 1TSIA 2WNZA 4D6JA 5I5RA 2VP8A 2P1FA 3GTHA 5RUBA 3DESA 1YE6A 4LYRA 4CN4A 2GWGA 1H60A 2RGMA 1N