4U5KA

Complex structure of mutant ctcel5e (e314a) with cellobiose
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
306
structure length
304
Chain Sequence
b'PKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGYKNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEFTHKWRGTWGTQEDMDTVVRVFDFVKSWSDRNNIPVYFGAFAVMAYADRTSRVKWYDFISDAALERGFACSVWDNGVFGDNDMAIYNRDTRTFDTEILNALF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase H
publication title Biochemical Characterization and Structural Analysis of a Bifunctional Cellulase/Xylanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Hydrolase
total genus 113
structure length 304
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4u5kA00
4NRRA 3ZJ8A 1OD0A 1JFXA 6CGTA 1HP4A 4PTWA 1HX0A 2J74A 1SYTA 2JIWA 3W27A 2CITA 4AY1A 3CGTA 2FHFA 3WF0A 5C71A 3SCRA 4L4PA 5GQBA 3VIFA 1VF8A 1J0HA 3EYPA 1CWYA 1VJZA 1TG7A 1WZMA 5CSUA 4QLLA 4JFTA 3TP4A 1AVAA 4P7RA 3VINA 2GJRA 3L2LA 1X6NA 1GHSA 4P8XA 2VR5A 5HPCA 1XSKA 4ACZB 3EDEA 1UD4A 4HU0A 1ZBKA 2CKSA 3ZIZA 4M29A 4DWSD 5A8NA 2MANA 1TFVA 1EHNA 5A6JA 1QHOA 2VUYA 1H41A 2D22A 4LXFA 4PBGA 3GH4A 4AXNA 1ZJBA 1E6PA 4NF7A 1J01A 4FF5A 4D6DA 1BYAA 3AHYA 3WH6A 3VNZA 3NSMA 2WVVB 5DMYA 2WNWA 3VDBA 1ODZA 1V6YA 1S46A 2W63A 3VU2A 5JIWA 1EQPA 2DIJA 2E9MA 5DF0A 3ZR5A 2PB1A 5GNXA 1EHAA 4HA4A 1HVXA 1GQJA 1U30A 4GO9A 1QI0A 4B9YA 1M01A 3AXIA 5JBEA 3AISA 3ZJ7A 4OZOA 1E5JA 2WC3A 3PZGA 3RM4A 1UWSA 1W1YA 4W89A 1JZ8A 2EO7A 2GVYA 3ARWA 2XJ7A 1GOKA 1ZS2A 3LMYA 3VKKA 5JUVA 1VEOA 1H0GA 5A95A 5BRPA 1BTCA 1W3KA 3ZJKA 1HKKA 1UWUA 2X8RA 1J9YA 3EMQA 2WSPA 3ARYA 3EMZA 5A1AA 4AD0A 2O9RA 1PIFA 2ZOXA 4U5IA 1U2YA 4X0VA 5DT7A 1PPIA 3T09A 2YLAA 3WQ5A 3WEZA 1HKJA 2J7BA 3U57A 5IHSA 2WMFA 1C8QA 4D6HA 3AYSA 2WMGA 4NSBA 3VDHA 5ABFA 3VIKA 3MV01 3UESA 3IK2A 4FLRA 2DIEA 4PTVA 3ZT7A 4HOZA 1CDGA 1QI4A 5DO8A 1K9DA 3VMOA 2DSVA 3OLIA 4F66A 4CU8A 1W3HA 3MUIA 3LPPA 5A2AA 1KWGA 1J10A 2WB5A 1C8XA 1YQ2A 4QCFA 4UR9A 5CPTA 1V3JA 2BS9A 3FW6A 2BVYA 3WD1A 4CVWA 1GOIA 3W26A 3L4ZA 2Y8VA 3L4UA 3WL0A 4QAWA 4GO8A 1JXKA 2GSJA 1C91A 1KGUA 2WWDA 3TTQA 4P7OA 3KE0A 1EQCA 4PMYA 2E4TA 5AYBA 4UQBA 3AZRA 1PIGA 1B3XA 4M82A 2WHKA 1SMDA 4MDOA 2RGLA 3WD3A 3BC9A 2VCCA 3ALFA 2CIPA 3N17A 3CHCA 3QHMA 3SEPA 3W38A 5CSYA 3NDZA 4D6FA 3ARQA 3WBAA 1FA2A 1H11A 5M3WA 3BXWA 3GXFA 3IAQA 5D8WA 2AMGA 1JF5A 2HISA 3MV11 1LWJA 1E6XM 5TD4A 5I0DA 3VD4A 2CESA 1JZ5A 1ITCA 1V0NA 3WD2A 3RO8A 4LQ1A 3WUGA 4CVUA 4MB3A 1V02E 1OBAA 1LF1A 2G3IA 1WAWA 2QPSA 1LWHA 1HJUA 3VM7A 1GJUA 3F5LA 1ZBWA 3WUBA 1OCQA 1UA3A 3GH7A 2DSZA 1ISWA 1R8LA 3WNLA 3U7BA 1WKYA 2J7CA 4AZBA 4AD2A 1KWKA 5I79A 1KGWA 3BGAA 4GI9A 5AC5A 3WF1A 4GI8A 3ZT6A 1CXHA 1CLVA 1UWTA 3QHOA 4BQ2A 5D9NA 2GDVA 2PWGA 5I24A 1FH9A 4E8CA 1Q6DA 3LPGA 1OT1A 2E40A 2J7FA 4BCEA 2A3BA 3OA5A 1GW1A 1H3GA 2FDMA 1WZLA 2BHZA 1UR8A 3UCQA 2QMJA 4X9YA 4ML4A 3KEHA 2NW0A 3CZLA 4B16A 1XGZA 1NM9A 4GQRA 3AHTA 5BXTA 3FHAA 3UR7A 4AZCB 3PN8A 2VO5A 4LYRA 3QR3A 4AISA 1KXHA 1EOKA 1VBUA 3DHUA 3W25A 3RCNA 3ZSTA 2YDRA 2WSKA 4OKDA 3AS1A 2XGBA 2DH2A 2WZEA 4ACZA 3ARTA 3F5JA 5BCAA 1CEOA 1VAHA 3RJYA 2EEXA 3NJ3A 1ZU8A 5DFAA 1OINA 3T0AA 5A8PA 1W9DM 2V5CA 1W32A 2YL6A 1K6AA 2WZHA 5FCZA 1WDSA 3IJ8A 2JEQA 3ZJ6A 4CN6A 3N13A 1BG9A 5FOOA 1MW1A 2YJQA 3F5KA 1CXLA 1E73M 1R7OA 3BCFA 1JD7A 4W7UA 4PTMA 4QCEA 2V3GA 2V3DA 3AIWA 4PRWA 3U5UA 7CGTA 1QNRA 4DWSB 1M7XA 2B31A 1BPLB 2PBGA 4KRTA 1QNPA 2QPUA 2GK1A 4WK9A 2NT1A 3SCOA 1ZBCA 3K8LA 1BFNA 2VRKA 4ZENA 3WEMA 2W62A 3NSXA 4MB5A 3MUAA 1UKQA 3LPOA 3PZ9A 3AJ7A 3WNPA 5I2UA 1NP0A 1YHTA 1CXEA 2YL8A 4J3XA 2J79A 2W91A 3SUUA 1IZKA 1L8NA 4TOQA 1R87A 4WKHA 3VGGA 4UZSA 5AC4A 5CQ1A 1P6WA 3AS3A 3GDBA 4F9DA 4CN4A 1ISXA 4W85A 1JZ7A 3ZR6A 4BQ5A 4KWUA 4AZ5A 9CGTA 3UERA 1G5AA 2VNCA 4IPNB 4PUEA 3ARPA 3VNYA 2YDSA 3CUJA 2XSBA 4W87A 1C8YA 4CU6A 3PTQA 1DWHM 2E0PA 2XPKA 1R85A 1KR0A 4MADA 1E4IA 3WDIA 1GOWA 1MFUA 3DECA 1HKMA 1UG6A 5FL1A 1JG9A 2XM2A 3VGBA 1E40A 1SMAA 4J3TA 4JKMA 4PSPA 4FLQA 4W7VA 1VFMA 5A6MA 1GJWA 4D6IA 1E9LA 1PBGA 2ZUVA 4Y7EA 5BWFA 5M17A 1CTNA 1F4HA 2VOTA 3UR8A 3GNPA 3DYOA 5ABGA 5KZ6A 1NP2A 2YKKA 5CLWA 2CERA 5A6SA 4ZXLA 1C3FA 3OZPA 4Z2LA 5ABEA 1EO7A 2OSXA 5D9OA 3L4VA 1OGSA 3VM5A 2V38A 5A8MA 4FLOA 2BV9A 4AD1A 1TCMA 3MMUA 1KGXA 3BAWA 1XC6A 1MXDA 3CZKA 4A3HA 3MU7A 5JIPA 1J0IA 4D6JA 2WHJA 1CLXA 2ZX6A 1TUXA 3M46A 2CHOA 3D3AA 3CUFA 2DSUA 4HA3A 1ZJAA 4NI3A 4GQQA 4JHOA 4Z2HA 5JBFA 1GOQA 4HZ7A 4H7VA 4WF7A 3WENA 2D23A 2QHAA 3GNRA 5I78A 2CHNA 1H4PA 3CHDA 2GJPA 1UR1A 4D6CA 2WK2A 4H8UA 2D24A 3HMCA 3QHNA 1FOBA 1XV8A 4UFJA 1E3XA 5A3HA 4FMVA 1BYDA 3PZVA 1D3CA 5FD0A 3AIUA 3WD4A 2Y24A 3S6TA 1N82A 2VVSA 4LGXA 3A4XA 1XCWA 2VZUA 2YOCA 1UD6A 3N18A 3VIJA 1NQ6A 1KXTA 4CUCA 5GNZA 1KXQA 4A4AA 1NWTA 1B2YA 3WKZA 3VOCA 5BXPA 3WH7A 4KRUA 2EBNA 4K68A 4JKKA 4L4OA 2W92A 1V6XA 1WNOA 1E6NA 1HVQA 4JCLA 3IANA 3K8KA 3GH5A 1J0KA 3W81A 3FN9A 1ISYA 2O9TA 5I77A 5HXMA 3I3EA 1RD6A 3FAXA 4A3YA 2ZUNA 1H1NA 1FFQA 3DHPA 3THCA 2HVMA 4R5EA 2UY3A 4Q7NA 3ECQA 5I6SA 5JBDA 5KEZA 1PEZA 1DWIM 1IZJA 1QHPA 3GM8A 4YPJA 3SCTA 4HP5A 3NIYA 4W86A 4AC1X 3PTMA 4RE4A 1B9ZA 4PMOA 1EDGA 1C92A 3L4YA 5BRQA 1GORA 4TVDA 3MANA 3SIMA 4H41A 1UWRA 3AS0A 3O6AA 5D8ZA 3AIEA 4CCDA 3AROA 2YL9A 2D3NA 3WDJA 3ARZA 1OSEA 2BXZA 1XH0A 1CBGA 3N12A 3RMEA 1VFUA 2OSYA 2UY4A 3WF4A 1RP9A 1DEDA 1GZJA 2GFTA 4B9ZA 2J8FA 1Q6EA 4PMQA 4W8BA 1FHLA 4DM2A 1FP9A 2BY3A 2W4XA 5A2CA 4M56A 1TMQA 2CBUA 5E70A 4UQCA 2XFYA 1CXKA 3AS2A 1Q4NX 1WO2A 4ZXOA 4U31A 1K9EA 1UZ1A 3VD7A 3WQVA 3ZOAA 1BYCA 1CGWA 4KGJA 1K9FA 1GVYA 3SCNA 3ZMRA 1VJSA 3AXXA 3WMCA 1VB9A 2YL5A 5HDRA 3GXMA 2QF8A 4CN1A 5A8QA 1G1YA 3AMKA 3WNKA 4XZWA 3CHEA 3VGHA 2JIEA 4JKLA 2WMIB 2E8ZA 1JF6A 1V08A 1QVBA 2E9BA 1W91A 4MNLA 3BMVA 3N1AA 3VIHA 3T08A 1GOMA 2G3NA 3K8MA 1QNSA 3PZQA 1GNXA 2DEPA 2XIBA 4R27A 3W29A 1E56A 4LX4A 4W8LA 2VJXA 5DEZA 3VMNA 2ZXQA 2DT3A 2JE8A 2QMKA 3WH5A 1US3A 5IFTA 2BXYA 3WELA 3L2MA 1CGTA 2CPUA 3LPFA 1FHDA 4UFKA 1WDPA 4U2ZA 3M7SA 2WVUA 1NWUA 2X0YA 3TONA 3WFZA 5HNNA 2J7EA 2ZUMA 1QHZA 3KWXA 2X05A 1JL8A 4W8AA 2WKGA 3O9NA 1E4MM 4AIOA 4PMXA 4D6GA 1EDQA 2YLLA 3EMCA 4JFUA 4MAZA 4UQDA 1ZL1A 1B3WA 1NOFA 1LL4A 2VL4A 3AHZA 4KGLA 3MUZ1 4TX6A 1E0XA 2WC7A 3N15A 3AXHA 2XVGA 2XIIA 1X6LA 2XVKA 1CENA 3EDJA 1NWSA 1B31A 1WZKA 2ZIDA 1VIWA 2VQTA 2DT0A 4J7RA 3SUSA 4URIA 4DWSC 3TTSA 4E8DA 3VX0A 3CZJA 3OLDA 1J0ZA 4IM4A 3GXDA 4CU7A 1CGXA 4JL1A 4HZ6A 5LA2A 2CXGA 2VX4A 1I1WA 2XVNA 4PTXA 4HPGA 2CBJA 1MFVA 1C93A 1E5NA 3S2CA 2Y8KA 2D0FA 3VMPA 5E09A 1V02A 5EB8A 5FKYA 3AI0A 1BSIA 1TA3A 4PMDA 4UFHA 3CTTA 3TTYA 3II1A 3NSNA 2CKRA 3NCOA 2EPMX 2VCBA 3BAYA 4J3WA 4KH2A 3PZMA 2J25A 3GBEA 2VZTA 1EO5A 3N04A 2OWXA 3W0KA 3OIHA 4GINA 3GTNA 4Q22A 5DT5A 4J3UA 4JIEA 1KQYA 3MMDA 4H8VA 3W6MA 2RGMA 1G94A 1EGZA 3PZUA 3OZOA 3W28A 1MYRA 1U33A 2W67A 2QV4A 4J3VA 3HJEA 3WF3A 1DWJM 1EA9C 3IAPA 5I5RA 1HP5A 1W1TA 2A3CA 1ISVA 3EBVA 4EK7A 1DWAM 2J7DA 3SCSA 1OIMA 3U5YA 1UR0A 1V3KA 4UOQA 5CGMA 2WBGA 4H8HA 1E6SM 4D1JA 4MNKA 2VI0A 1BAGA 3T0BA 4JL2A 1J12A 1OWQA 2ZX7A 3WH9A 4W88A 2DGAA 3AIVA 4RL3A 4JFVA 5CG0A 1CXIA 2Q8XA 1W9XA 3WMSA 3VGDA 2BY2A 5C8BB 3N9KA 4WSKA 2YA0A 1JI1A 4ZFMA 3WN6A 3WQWA 2YDQA 1BLIA 1PZ2A 1RP8A 3FAWA 1R86A 5E9AA 1GQLA 2J77A 1E72M 1G01A 5A94A 2VCAA 3KL0A 3N11A 4NZCA 4F79A 2W66A 1HJSA 5IDIA 1M53A 1L0PA 3RDKA 4ATDA 5LA1A 4C7GA 1LG2A 1UA7A 4B3KA 1HL8A 2W5FA 1V6UA 1B3YA 2OYKA 3WH8A 3B8SA 4D6EA 1JNEA 3VTRA 4U2YA 1LQ0A 4AEFA 4CD4A 4PMUA 1DHKA 2G8ZA 2WVVA 1J0JA 1V3IA 2IUZA 2ZX5A 1FH8A 3ALGA 4AZIA 3SCQA 5GNYA 3TOPA 1JZ6A 4PMZA 5D4YA 3SUWA 3AHVA 1Q6GA 2W61A 3B9DA 4QDMA 4AIUA 3L4TA 5AY7A 2X1IA 4CKQA 4X0NA 1MW0A 3WUFA 3RILA 1MXGA 3AMGA 4UQAA 4W7WA 2CBIA 1O6IA 3SUVA 1X1NA 1W9VA 4JHZA 1LL7A 3SCPA 3IJ7A 1JYVA 1UWQA 1EH9A 1V0MA 1QBAA 1CZ1A 4EAMA 1D2KA 1XH2A 4XUYA 3UG5A 2A3HA 4M1RA 1TE1A 1KCKA 1XHGA 4B15A 1JD9A 3AIRA 1K9TA 4HOWA 3NDYA 4AWEA 1ISZA 4EKJA 4PMVA 4ATLA 3VGEA 2VURA 3PZNA 2UY2A 5FL0A 4UOJA 5E0CA 3W53A 4U3AA 3EDKA 4OOUA 2ZWYA 4U33A 4ZE5A 4QP0A 2WM0A 4BQ3A 3RPMA 4WLCA 2BNJA 4S3JA 1JIBA 5IXEA 1E15A 1VBRA 2XUCA 2ZE0A 2VMFA 4LYQA 1FP8A 3GNOA 1ODUA 2PI6A 3DC0A 4UCFA 4AW7A 2Z1KA 3HU7A 1LJYA 1PX8A 4IUGA 4WKAA 2DPEA 2ZXBA 1IV8A 1HKIA 1UR9A 3DYMA 1UKPA 1GCYA 3VO0A 5ABFB 2EPOA 4Z2IA 4PYSA 2WVTA 4UNIA 4TTUA 2JF7A 1HXJA 3T2QA 3AMCA 4WJXA 5LYRA 1W1VA 2CNCA 4MPKA 2XGIA 1JAKA 1LG1A 1TVNA 1ITXA 3WDQA 2IXUA 3BCDA 4P7LA 5A6BD 4GPNA 1WDQA 1AQ0A 5A6BA 4EE9A 1GPFA 1XSIA 1PAMA 1HJXA 2EPLX 4RE3A 4V2XA 4OUEA 4C7DA 2G41A 1KXVA 3FNDA 2BHYA 2DH3A 2O9PA 2BVTA 1CGUA 1V3LA 3DYPA 2ZXDA 1E43A 8A3HA 4IISA 1UOKA 3POCA 1JDAA 1H5VA 2J47A 1QPKA 2BVDA 2J75A 5FIPA 3AOFA 1UR2A 3O2LA 3AMLA 2A3AA 3AFBA 1V6VA 3OLGA 5HBFA 2A3EA 3VIGA 2GDUA 1WCGA 3AIBA 2PWFA 4CD6A 2XFRA 3B9EA 3UG3A 5BYWA 1H49A 3BAJA 5IHRA 3KL3A 2WXDM 1JNDA 1ZB5A 1GOOA 1B3VA 2JFEX 1B0IA 2C8NA 1UKSA 3APGA 2D0GA 3WUEA 2OWWA 1NOUA 4KMQA 2VX7A 5A6LA 3MSGA 1UH4A 3VILA 1FFRA 2XVPA 4MDPA 3VX1A 3MKKA 2EPNA 1Y7VA 4RE2A 1XRVA 3MS8A 4H2CA 5A6AA 2GJXB 3BH4A 3CH9A 5M5DA 1UD5A 2JF6A 4V27A 4Z2JA 2VR4A 2TAAA 1D7FA 1M04A 2CEQA 2E3ZA 1JYWA 1E1EA 4LPCA 1NARA 1NH6A 1EOMA 3ZT5A 2UWFA 5EBAA 3CZ8A 3CUIA 3MUY1 3UETA 3SUTA 3BLPX 4D1IA 4HU8A 4W5UA 5AYIA 1BG4A 2EXOA 3PHAA 3W4RA 3ARSA 3VIPA 4AZCA 4MB1A 3WFLA 4W93A 3WNNA 4ZEPA 2VZVA 1RH9A 3ZO9A 3VIMA 3VIOA 3WDHA 1KFWA 1Q6CA 1UH3A 2YA2A 2VVNA 4P8WA 4U3CA 2O9OA 4OOZA 1HNYA 3TTOA 3NUKA 1DWGM 1XH1A 4AYSA 3W6LA 1W9UA 1RPKA 2Y4SA 3BAKA 1FH7A 3K1DA 4MTVA 2FH8A 5I3DA 4MJ2A 1TZ7A 1G9HA 1VFFA 2WZIA 4P8VA 1OGGA 3VPLA 4QLKA 1MW3A 3WQ6A 3SCVA 1M03A 2WCAA 3TA9A 2J7GA 2FH6A 1QBBA 1HL9A 3VIIA 3PZIA 1J11A 3VDCA 1W2PA 1WZAA 3CUGA 1H09A 2VTFA 4DWSA 4YHGA 1JDCA 3QOKA 3OGVA 1NOWA 2WANA 2UY5A 2G3MA 1PJ9A 4B3LA 3D5HA 1PX4A 3JUGA 1EDTA 1A47A 1J0YA 1PZ3A 3CMJA 1OT2A 3WIJA 1XSJA 1UR4A 4GZIA 1E55A 4AMCA 1CGVA 3W24A 4J27A 1CYGA 1W9PA 3CPUA 1UZ4A 1E71M 2GK1B 1EXPA 4DUWA 1G0CA 4HZ8A 1UYQA 2NT0A 3CMGA 4D71A 3SURA 3ARUA 5ECUA 1E3ZA 3MO4A 4GXPA 3K4AA 2VC9A 3VD3A 1JZ3A 3NYDA 3WEOA 3RJXA 3J7HA 2XM1A 3ZQ9A 1V3HA 1Z32X 1V03A 4AZ6A 2CETA 4BS0A 3RIKA 3WNOA 1UWIA 1HT6A 2CBVA 2G3JA 3PZTA 4JFSA 3I3DA 4MNJA 4JAWA 4JFWA 2D0HA 2F8QA 3CUHA 1UQYA 3BAIA 1JXJA 2FGZA 4UFMA 2YBTA 1BYBA 4FK9A 5CJ5A 3AHXA 3ARVA 1US2A 2EQDA 3CZGA 1W3JA 3VUPA 5E6ZA 1MWOA 3L4XA 2Z1SA 2XHYA 7A3HA 2J7HA 2WMKA 2FHBA 1XYFA 5D9PA 2J78A 3WQ4A 5E6YA 4FLSA 2E8YA 2E9LA 3BLKA 4ACYA 1XD0A 1XCXA 3VD5A 1AQHA 4LYPA 3VGFA 1MQQA 4QLJA 1E0VA 5ABHA 1BVNP 4HOXA 3KL5A 2YBUA 1JYNA 3U7VA 1QI3A 1QI5A 1B30A 1W9BM 2OYMA 4UQEA 2Y5EA 2X0HA 3BSHA 1OGBA 5C70A 1KQZA 1C90A 1I75A 1UH2A 4AIEA 3WDPP 3OBAA 4HMCA 3AIQA 4BZYA 1XYZA 2ZWZA 3F4VA 1CIUA 4N0RA 2O92A 4D72A 3PTKA 3CIVA 4WKFA 4DM1A 3WSUA 3WF2A 2WW5A 4CD5A 1J18A 2VZOA 3VVGA 4M80A 4UQ9A 3GXIA 5A6KA 1E4LA 1GONA 4C7FA 3T2OA 4P7QA 1IT0A 2OLHA 2PC8A 4HA1A 5EFFA 1JYXA 4HPHA 3EDFA 2EPKX 3QOMA 1E1FA 4AZHA 3ZM8A 4J28A 5CZKA 1QW9A 3BAXA 2WLYA 3KZSA 4TXEA 4XX6A 1XD1A 1DP0A 3RM8A 2XG9A 2YIHA 5CGTA 4TVCA 4IPLA 1GUVA 1V0LA 1VRXA 2GJXA 3OG2A 4CGTA 1O7AA 2WPGA 2CYGA 4UFLA 2F61A 4HMDA 2D3LA 1CXFA 4BA0A 2VQUA 4XV0A 1E4NA 1BGAA 5HPOA 4MB4A 2BY0A 3M07A 3FHQA 1HJQA 1H2JA 1HF6A 2ZX9A 3UEQA 4GIAA 4GZEA 2D2OA 1HJVA 4EANA 4V28A 2QLYA 1ECEA 1CPUA 5BXRA 3CLWA 1I1XA 3A4WA 4HMEA 1SR0A 1UD3A 1WP6A 6TAAA 1E0WA 2WYSA 1ESWA 1UD2A 3AMDA 2DSKA 2VRQA 4WIWA 1OD8A 3OLEA 2PWHA 3ARRA 1GHRA 3UG4A 3WD0A 3GYCA 4CD7A 2XSAA 2VZSA 1Q6FA 2VRJA 1R7AA 1UD8A 3A47A 1B3ZA 3MSDA 1OIFA 2WBKA 1MQRA 4M8UA 5E0FA 2WLZA 1KCLA 1JZ2A 1B90A 2CCRA 1GQIA 2G4FA 1UUQA 2BFGA 1JZ4A 5A8OA 1JFHA 2ZXAA 4BF7A 2OYLA 3FY1A 1WE5A 4ATWA 1DWFM 3G6MA 1KR1A 4PCTA 1LL6A 1JAEA 4BQ4A 3WY1A 1UKTA 3MMWA 2ZICA 4UZUA 3OGSA 4GKLA 1BHGA 4E2OA 2DDXA 4JZ5A 2WMHA 3WL1A 4ZE4A 4NRSA 5M03A 4E4PA 2JEPA 1QW8A 2C0HA 2ZX8A 3I3BA 3WMBA 4AD5A 4PMNA 4W5ZA 2PWDA 3OB8A 1E70M 1BVZA 1W2VA 3ARXA 3CZEA 1LLOA 2WCSA 2ESCA 5A2BA 1H0IA 2FHCA 4MAVA 1V6WA 3EDDA 2WMIA 3AYRA 3K4DA 2WKLA 2JALA 2FGLA 1MQPA 3B9AA 4HTYA 2IXVA 3M6DA 1SFSA 3E1F1 1VEPA 2AOSA 2BHUA 1NWRA 1E6RA 4AZ7A 2X2YA 5CXPA 3GZAA 4MNMA 1AMYA 2XFFA 4F9JA 3BSGA 3THDA 1F4AA 2XYLA 4CCEA 5IFPA 4CD8A 1CNVA 1PX3A 2C7FA 2PF0A 2NSXA 4DUXA 2DT2A 2WWCA 2GUYA 1HIZA 3A4AA 4TX8A 3AZTA 1OB0A 2EJ1A 2XVLA 1JGIA 1EIBA 3PZOA 3RM9A 2PBOA 4UTFA 3GBDA 4M81A 4MJ4A 4DUVA 2XWDA 1A3HA 2V3FA 4PMRA 5CPSA 1V0KA 4XB3A 6A3HA 4PCSA 4H04A 2ZUSA 2PWEA 4PEEA 4N42A 2VX5A 5F7UA 2VT0A 4OBSA 5CPQA 4P8UA 3PBGA 2WHLA 3T0DA 1QI2A 1JI2A 4OIFA 1MW2A 1UKOA 3G6LA 2WC4A 1C7SA 1TVPA 3WBEA 2ZUTA 4AD3A 4GI6A 1BGGA 4YN5A 3POHA 5HOSA 3SCWA 3AZSA 2DQXA 4OBRA 5EMYA 2AAAA 3T2PA 3W82A 3WNMA 3ZSSA 4UFIA 2BY1A 3FXYA 2XWEA 1KBBA 5EFDA 4F8XA 1KB3A 4PN2A 3AQUA 3QGVA 5A69A 1V3MA 4Z2KA 2V5DA 1UHVA 2VX6A 4UOZA 2XTKA 1HN1A 2X09A 5CLTA 2V3EA 1GVIA 1WPCA 1AQMA 3W37A 2J62A 3L4WA 3HN3A 4GZJA 3CO4A 4QFUA 4CCCA 1W1PA 4AZGA 3SCUA 1OM0A 1C7TA 2J4GA 1WDRA 2DT1A 4J3SA 2DSWA 1CECA 1ZBVA 4TTGA 4YHEA 1QNQA 3VD9A 3VDAA 3CHFA 2OWCA 2OSWA 2WVSA 4TUFA 2ZUUA 1TA3B 1DTUA 3A3HA 2WAGA 1VEMA 2YA1A 4M24A 1E6QM 4P7NA 4U5KA 4S3KA 3CBWA 2WHMA 4W84A 1B1YA 1QNOA 2D1ZA 3K46A 1HJWA 1QOXA 5BXSA 3WQ8A 1BF2A 2ZUWA 1BQCA 4Z2GA 4TVUA 4AD4A 3IJ9A 5LA0A 1TR1A 5I23A 4OJYA 1CGYA 2J8GA 2F2HA 3AICA 3OGRA 4PUDA 4PSRA 1UQZA 2WMJA 1MVYA 1VENA 4JCMA 1GQKA 8CGTA 4WSJA 2Y2WA 1WB0A 5GPRA 7TAAA 4AEEA 1JDDA 3WDRA 5D9MA 3BMWA 3A6OA 2D20A 1E6ZA 4XZBA 2WCGA 1KBKA 1VFOA 1W3LA 5BROA
chains in the Genus database with same CATH superfamily
2ISSA 1ZRQA 4DO7A 1JFXA 2HDJA 6CGTA 3CWNA 4GVFA 1XX1A 3CT7A 4Z1BA 1XLIA 3BQ5A 3JRKA 3UZJA 3W1TA 4K1WA 2JIWA 4A8RA 1OC6A 4AY1A 4XKYA 3LHYA 4NZ5A 1L6YA 4L4PA 3I7QA 1TV5A 1YE4A 4I9TA 3N14A 1K77A 1WZMA 3PBMA 3TQKA 5CSUA 3ICJA 3TP4A 1OVDA 2GJRA 4GJJA 2A4AA 1GHSA 4P8XA 2VR5A 4HU0A 1RHCA 3E6EA 3ZIZA 3JVAA 4RDVA 2QGHA 3R4IA 4QJ1A 1WBJA 4AXNA 1E6PA 2OO6A 3S5YA 4FXJA 1F9CA 3V0SA 3I7SA 1ODZA 4GA8A 1S46A 3VU2A 4FALA 5GNXA 3L67A 2GWNA 2PD9A 3ITOA 1H7XA 4JS3A 4JTQA 4ZOBA 4IFOA 1M01A 4PH6A 1E5JA 4I9MA 4IGMA 3HGJA 3KS6A 2RDXA 1UWSA 4G56A 4Y2WA 1QFEA 3E2RA 1JZ8A 2GVYA 4QJ5B 3VOJA 2JKPA 1ZS2A 5JUVA 1LM1A 1VCGA 3N6QA 3OQ8A 3W7GA 4QS6A 5HNTA 1R9ZA 4JY9A 1S3TC 1FWBC 2WJZA 1EXBA 1EJTC 5L9FA 1UWUA 4XD3A 1J9YA 2WSPA 3KOYA 3ARYA 4XAZA 3EMZA 5A1AA 4Q8WA 1OYCA 2OTDA 5LNRA 5D32A 2ZOXA 3AWOA 2HWGA 5DT7A 3RX3A 3T09A 2YLAA 3WQ5A 1S1PA 4O4VA 1E51A 4OE7A 5K4ZA 2WMFA 8XIAA 2A7RA 3R1ZA 3VDHA 3T4CA 3BLOA 3VIKA 3MV01 4FA3A 3WQPA 4FLRA 3WQFA 2DIEA 4H19A 4AAJA 1J5SA 3VMOA 4YWSA 2H3BA 1Q13A 4CU8A 3MUIA 2PA6A 4QAIA 3W7IA 1CB7B 2WB5A 1C8XA 2PDWA 1V3JA 3V0TA 1W17A 2BVYA 1EJRC 3PR2A 3DHDA 4CVWA 2Y8VA 3L4UA 3GDLA 1UPPA 3WL0A 4GO8A 4D9PA 2GSJA 3VZXA 1KM2A 1FY6A 3EZ4A 3TTQA 1EQCA 3EX4A 5LGXA 4UQBA 3MBFA 4DXXA 4MDOA 2VCCA 3ALFA 2MUCA 3NDZA 3M4HA 2Z0IA 1FA2A 2EG8A 1TRDA 3CUXA 4DZIA 3URBA 1YW1A 3T55A 2YCJA 2X42A 4AWTA 4KFNA 3BXWA 3GXFA 3GAKA 1P7TA 4LB4A 5D8WA 2AMGA 3DXIA 1UMLA 3MV11 4LS0A 5I0DA 1JZ5A 3W72A 3WD2A 1FWHC 3KZPA 3VKCA 2INFA 3FKKA 3WUGA 1V02E 3O6YX 3BJSA 1NEYA 1LWHA 1P1MA 1GJUA 3TN4A 3WUBA 4YNGA 3GH7A 1PWLA 1RK5A 1DYSA 1ONEA 3RHGA 3TQPA 1KWKA 3UJRA 5GJPA 1XLMA 2FPTA 4GI9A 5AC5A 4NNAA 1XPGA 4BWLC 3QYQA 2QW5A 3P81A 2DW7A 2GDVA 2PWGA 3CAWA 3EWDA 4CNUA 4AF0B 3UYIA 3T4WA 2XH4A 2HBXA 5CH9A 3WG6A 1GOXA 5KETA 2ZE3A 2VOMA 4B5UA 1P5BA 1H3GA 2VFIA 1TTQA 3HGSA 4LB3A 4ILSA 1UR8A 2CWXA 2VWSA 2NW0A 3WK1A 1NFGA 3NPWA 2FZDA 2FDSA 1XQLA 3FHAA 3CTLA 3PN8A 4ZB5A 4CNSA 4HPXA 4ZB2A 4AG0A 1J2WA 3C2YA 4AISA 4UR7A 1KXHA 4J2MA 1IEWA 3HQNA 4XAYA 1Q5MA 3RCNA 2NXIA 2XGBA 5SWUA 3GU9A 3K1GA 4GXWA 3MHGA 5BCAA 1CEOA 3EOEA 2EEXA 5HWJA 3WBYA 1OINA 4IFKA 3BDKA 2DP3A 2YL6A 1K6AA 3EXRA 1QAPA 4INFA 5FCZA 2V5JA 5KTLA 3IIVA 3CEUA 3GD6A 1E0UA 1UIPA 1BG9A 4KEMA 3F5KA 3TYUA 1CXLA 1TPUA 2A0NA 1JD7A 1KO0A 4QCEA 5LKYA 4PE8A 4YIWA 3U5UA 4YTTA 3JU2A 1XLJA 2PBGA 3MKVA 1Q2SA 4WK9A 3EX2A 4MFDA 3M5ZA 4KFOA 1ICSA 4GIEA 1JPKA 4YYFA 1Q63A 1GYLA 1KCZA 3CWHA 2GDQA 3LPOA 2Z00A 4J3XA 2W91A 3M0KA 1M5WA 3QY7A 3QGAC 2B7QA 4JX6A 4WKHA 3P61A 4F9DA 4QBXA 3ZLGA 3AC0A 1P0EA 1ISXA 4QG6A 5LGZA 2E1DA 4DUOA 2A85A 4KWUA 3Q2DA 9CGTA 3UERA 4PUEA 1C9WA 5G4HC 4DPPA 1SFJA 1YNPA 3CUJA 2XSBA 1XINA 4XTDA 1YPIA 4CU6A 3DGRA 3BMXA 4BFAA 1JDFA 5FF3A 1FWJC 5F1VA 3VKDA 3M0ZA 4IUOA 1OC7A 2XM2A 3VGBA 1E40A 5K4XA 1DJNA 1EWDA 4ZA0A 5A6MA 1VFMA 4LH8A 2OVLA 4D6IA 1IYXA 1E9LA 1EBGA 1PYMA 2FTWA 2GGIA 3G2GA 1QPOA 4GHRA 5F4WA 1VD6A 3W2UA 3TC7A 1CLKA 3NR0A 3OZPA 3VC5A 4Z2LA 4JNYA 4AB4A 3UR2A 4EPBC 1SSDA 1W56A 4CQ8A 2BV9A 3W7LA 1B5TA 3IV3A 2YFNA 5DCDA 1MXDA 4Y8FA 4A3HA 4B3ZA 5JIPA 1J0IA 1BTMA 1TUXA 3CPRA 2DSUA 4HA3A 1W8SA 4NI3A 4DY1A 4O1EA 1A3XA 3QQ1A 1GOQA 4HZ7A 5C2GA 2Z2AA 2ODOA 4QROA 1X98A 1H4PA 3STCA 3LXBA 2GJPA 4QITA 1R47A 2WK2A 1PIIA 3FIGA 1UZDA 2IKJA 4H8UA 3UNDA 3PPFA 2HXUA 3QHNA 1DKWA 3DN5A 2G50A 3FFSA 3KRZA 3PTDA 4M6UA 1XV8A 2H9AB 2YCEA 1D3CA 1WX0A 3RCMA 2PDMA 3PSVA 2PRHA 5EL1A 4X63A 4LGXA 2YOCA 3N18A 1NQ6A 1RBOB 1XJBA 2ACSA 4JYEA 3U2ZA 3IUIA 4MPQA 3VOCA 1XBZA 2FPYA 3DEQA 1XDLA 3MY9A 2FB2A 3FDKA 4AF0A 4WSHA 3LK6A 4G7FA 1LRTA 3FKRA 1E6NA 3K8KA 3GH5A 1QPQA 1J0KA 3W81A 1L8PA 8XIMA 2DVTA 1I2OA 4LUIA 1W1A1 5I77A 5HXMA 3JW7A 1H1NA 3DHPA 4R5EA 1Q85A 4RZ4A 5JBDA 1DWIM 3OIXA 3ITCA 3C0SA 3UNTA 4HP5A 4AC1X 3PTMA 4Y90A 2NLYA 2P8BA 3RNDA 1B9ZA 1EDGA 4NZJA 4H9TA 2ZDSA 1GORA 4C6KA 4RXFA 3GU1A 3TJLA 4RJEA 1UWRA 5AHEA 2QXWA 1PCKA 1OFOA 3SN4A 3EWCA 4JYDA 2ZZ3A 2QVHA 3IV8A 3DH7A 3N12A 5D04C 3W2KA 4ZTYA 3S1WA 3URQA 2PDCA 2GFTA 4B9ZA 2J8FA 3V75A 1IXQA 4A21A 1VPYA 3C2OA 3W1QA 2HMCA 4IMDA 3WQEA 3SGGA 5K9CA 5A2CA 2CBUA 4UQCA 3GXTA 4JTSA 1Q4NX 1U5JA 3OYXA 3ZOAA 3AXXA 2QAPA 3NO1A 2DZPA 2YL5A 4PGLA 3B06A 3Q65A 1RUSA 1BKSA 2GUBA 1P0DA 4XZWA 5LXXA 2QS8A 3CHEA 4EACA 4NJHA 4FNPA 4PUUA 1EF3A 1QWKA 1W5MA 4Q32A 3PPHA 2VDGA 3VIHA 1GOMA 2G3NA 2VGFA 1GNXA 3B05A 5DY3A 4QQUA 5DEZA 4CEUC 3FJ4A 4Q4MA 2JE8A 2QMKA 3WH5A 4JEJA 4N02A 3L2MA 4NYYA 3SGUA 4BWLA 3B9OA 4UFKA 4NILA 3GVQA 3HV9A 3OHIA 1EZWA 4GYJA 3WLSA 2WQDA 1JL8A 4PL1A 3L23A 2WKGA 3WCZA 1XRFA 3E9AA 4DO5A 4MWAD 4MKSA 3EMCA 3VKAA 4JFUA 1TV7A 1W54A 4FOKA 1B3WA 4MUPA 4KGLA 3EEGA 2I1OA 3MUZ1 1FWWA 3LRMA 2Q71A 2EPHA 4JQ4A 1E0XA 4OGZA 3AXHA 1YTEA 2ZA3A 3QMRA 4O8RA 3NXFA 3EDJA 1NWSA 4J3ZA 3VZZA 1GVOA 2DT0A 4MUZA 1KBLA 4ERGA 2PCQA 4JN8A 3TTSA 4RK8A 4E8DA 3CZJA 2VEKA 3ZS4A 3IEBA 4HZ6A 4YVPA 4HPGA 3WFAA 5FESA 1MXSA 3TLQA 1DIOA 3NL5A 3OG3A 2DW6A 5D37A 4A22A 3EEZA 1TA3A 4PMDA 4EIVA 4O4WA 1H50A 1IWAA 4FNQA 2J9XA 2VCBA 4J3WA 2PLCA 4KH2A 1A5CA 4FI4A 1OFBA 2J25A 3G0SA 2VZTA 3KBMA 3N04A 3LM7A 2OWXA 4NJKA 4WY0F 4A8LA 3MJYA 1FTXA 1TRIA 3N2CA 3RGTA 4MHBA 2XN2A 5DT5A 4J3UA 3NPXA 1A5UA 1KQYA 2PRMA 4H8VA 4DAIA 3GKAA 3G0UA 1EGZA 3KTXA 3OZOA 3R6IA 3C2RA 1F07A 3CEPA 1VS1A 2W67A 2QV4A 4GY0A 2Q3RA 3P5YA 5AC8A 5I5RA 5EYWA 4US5A 3B3DA 1DIEA 1P43A 4DLMA 3A3XA 3U5YA 2Z6IA 3MT1A 3HQPA 1UR0A 4H8HA 1E6SM 2RJHA 4M6PA 4D1JA 3BJFA 2RH9A 3VNIA 3ZFHA 4LUYA 4CEXC 1YNQA 4PFMA 2R1PA 5AHMA 1J12A 3GU2A 4K6AA 5IM51 3H2OA 3SRHA 2Q8XA 1DQWA 3WMSA 1XYCA 3MHUA 3N9KA 4A8IA 5G5IA 2WSRA 1D7KA 4KESA 1AFSA 1LTDA 1PZ2A 3VKJA 3FAWA 5AHFA 5EMJA 1Q6QA 2J77A 1EPXA 3KLKA 2VCAA 3KL0A 4NAFA 3HOJA 4NZCA 3RDKA 7REQB 4R7JA 1HL8A 1B3YA 4D6EA 1KW1A 4QHRA 5D2VA 4O0QA 1RQEA 3FOKA 1EZ2A 1IT8A 1LQ0A 4C1KA 4MVAA 4GJ1A 3MDUA 4HT3A 1J0JA 2IUZA 4NZ3A 3SCQA 5GNYA 1XCFA 1KRMA 1EJ7L 1WXYA 1PKLA 3M47A 3NURA 2CZDA 3NL2A 1TQXA 4ZGYA 5IOBA 3KDNA 5DXXA 4CCZA 2PP3A 3GR7A 1MXGA 3B04A 4W7WA 3KVMA 4LNCA 3UY8A 2V67A 3FXGA 4JHZA 2ISWA 1LL7A 3SCPA 3IJ7A 3W85A 2NSOA 4CLMA 1CZ1A 1AH4A 5FI8A 3WLJA 4S3FA 2DZTA 3CV6A 3B8UA 4XUYA 3UG5A 3H2NA 1L9WA 1TE1A 3L65A 5TQLA 4FSAA 2RJGA 3AIRA 3KHJA 4HOWA 4AWEA 2UY2A 3ZLHA 2OFJA 2JKAA 5E0CA 3QGKC 3EDKA 5HMSA 2WM0A 2WO5A 1F3TA 2NQ5A 2BNJA 4C6NA 1O5RA 3NL3A 2VMFA 4LYQA 2PI6A 3PJTA 3DC0A 5D2TA 1KFCA 4UCFA 1WDDA 2PDKA 1LJYA 2D73A 3LNPA 3GDRA 5F2GA 1XDJA 3GKFA 2HNEA 4ZSUA 1PYFA 1IV8A 1HKIA 3C0JA 1GCYA 3VO0A 5ABFB 2EPOA 3GUWA 4ZL1A 3TW9A 2F84A 5A8GA 5TF0A 3GFZA 3GHSA 3L12A 4GIRA 4Q8UA 1W1VA 4MWAB 1REQB 3ITLA 3PULA 4MPKA 4GE8A 3BCDA 4P7LA 2H8ZA 4OQVA 4GPNA 4DF0A 3IGUA 5A6BA 5HR6A 1XSIA 1RR2A 2J6VA 4LS1A 4IG2A 2BHYA 2ZTJA 3EOUA 3GIQA 1MNZA 2O9PA 4HD5A 1CGUA 2ZXDA 3M9YA 3B8DA 1UOKA 3H6OA 1JDAA 3LV5A 1QPKA 2BVDA 3W2LA 4GOAA 4XG1A 3TX9A 4B2DD 3E12A 1SW0A 4A8NA 4XK2A 1OADA 3P5ZA 4KWOA 1A4LA 1TPEA 3RX2A 1VZWA 3R7MA 2R1LA 1Z7AA 3B8WA 1AJ0A 3E0WA 3EPMA 1RSCA 4F2TA 1ZB5A 1GOOA 1B0IA 2VEFA 2ZBTA 2ABAA 4NT0A 4KMQA 3CB3A 5G2HA 5A6LA 3VILA 1UUOA 2XVPA 4MDPA 1YDOA 3VX1A 2BGQA 1EGMA 3MKKA 3CWOX 3MCOA 2EPNA 3G8RA 1Y7VA 4RE2A 1KM1A 3MS8A 1A0EA 4F0HA 2W9MA 3G24A 3EOLA 1RBAA 1GT8A 2TAAA 1D7FA 1M04A 4QM1A 1JYWA 2F7FA 1NARA 1NH6A 1TYGA 2YX0A 3ME3A 5CPLA 5EBAA 1W37A 3CZ8A 1JPMA 3CUIA 3OBEA 4N9BA 3BLPX 3TN3A 5AYIA 1BG4A 2EXOA 5AYYA 3PHAA 3SADA 4QISA 4AZCA 2A21A 2I9EA 3WNNA 3NO5A 3S83A 3VOHA 3ZO9A 1OC5A 3WDHA 3AXKA 3LOTA 1UH3A 5AOUA 1G6CA 3F03K 4OOZA 1HNYA 1DJZA 1TWDA 3SO7A 3I6TA 1XH1A 2ZVIA 1LRNA 3LENA 3URNA 3PWAA 2Y4SA 3BAKA 1DJQA 7REQA 4ZQPA 4MY9A 2P53A 3QPZA 5I3IA 4LBSA 4QNWA 4Q4QA 1UC4A 3NZGA 1MW3A 1X6UA 2FH6A 2Z28A 1WDWA 3BLEA 1FBAA 3CUGA 2QCNA 3LTYA 1J2BA 1LBFA 1H7OA 3OGVA 4S3AA 2WANA 3QF0A 3ES8A 2IPFA 1CB2A 2OT1A 1N7KA 1KTNA 3JUGA 2Q8ZA 1A47A 2Y88A 1PZ3A 1DJIA 2HE5A 1RV8A 1XQKA 1ML1A 3NL6A 1MMFA 4GZIA 1KBJA 3EWBX 1UZ4A 1POJA 4K7YA 1ZALA 3F2CA 2GK1B 3LQLA 1G0CA 4HZ8A 5REQA 2NT0A 3CMGA 4MY1A 5CBIA 3ARUA 2E6YA 1XKJA 3MO4A 3PPGA 2VC9A 1L6WA 4ORMA 1JZ3A 3ZQ9A 5E1QA 1H51A 2CETA 2D2JA 3AYTA 3RIKA 3THAA 5HA7A 1IIHA 2A6LA 2B81A 4K3ZA 1HT6A 4NVTA 2CLPA 2G3JA 4O14A 2ZCGA 4GUHA 4JFSA 4IIGA 4MNJA 4HCDA 1TTPA 4JFWA 2D0HA 3ANUA 3MP4A 2F8QA 4ZB0A 1ZP3A 1GYNA 1W3TA 4C6PA 3KVJA 5CJ5A 2PGFA 4MJZA 2V82A 1S2UA 2OZ8A 4OECA 4DHGA 3SAZA 3VUPA 2PGEA 4GVHA 7A3HA 1Q6LA 3TK7A 5D9PA 4WX2A 5U4NA 2E8YA 3H7VA 3VD5A 1NU5A 3VGFA 3GX9A 4QLJA 1I9CB 4HOXA 3NEVA 1SPQA 1D8WA 4L5ZA 3U7VA 4ADUA 2YCIX 5AN7A 3W88A 2ZC1A 3ABQA 1OQFA 1O5KA 1OGBA 2INEA 1KQZA 2FTYA 1I75A 2XU2A 5HNUA 2QCGA 2C19A 1AK5A 3UT0A 3HPSA 2O92A 3JS3A 2GYIA 3DFHA 2WW5A 4HNCA 4RW5A 4CD5A 3IRDA 4ZVJA 2P1FA 1OABA 3KM8A 5E0KA 2NV1A 2OLHA 3FYOA 2FJKA 3QW3A 4AZHA 2F2KA 3ZM8A 2BBFA 4JTRA 1YKWA 2JGQA 3C6CA 3R5EA 4XX6A 4RNFA 1GTEA 3WBXA 3P7YA 1V0LA 4CGTA 2F61A 5DCEA 3IS4A 1CXFA 1XLBA 3KX6A 3FHQA 1O60A 5G1TA 2PDBA 4L64A 4MY8A 2E6DA 2FMNA 4EANA 4V28A 1LWIA 1ECEA 1CPUA 3TXVA 2X1UA 3AU2A 1SR0A 3M5XA 1XS2A 4XZMX 2OQHA 1UD2A 4FF7A 4WIWA 3OLEA 3UG4A 3ARRA 1GHRA 1EJUC 3KTSA 3T8QA 4Q7BA 4CD7A 2VZSA 1R7AA 1B3ZA 5T9BG 1OIFA 3O0KA 3CS2A 2WLZA 2H8XA 2ZADA 5E0FA 3B97A 1N2VA 1B90A 2OJPA 2G4FA 5LSMA 1SFTA 4JN6A 1B9BA 2CWNA 5A8OA 4KRZA 1T7LA 1JFHA 2R14A 4EXQA 4ATWA 3LLDA 3WLOA 2P3ZA 1XYLA 1MO0A 1NELA 3CB8A 3G6MA 1KR1A 4UTTC 2HQAA 4EPKA 3USBA 1JAEA 4BQ4A 1ME9A 3MMWA 2ZICA 3CQIA 4FNRA 4Y9OA 1BQGA 1P0BA 3P2VA 4NRSA 5M03A 2ZZ5A 1MZRA 3I3BA 4WR3A 1T5AA 2LLEA 1BVZA 3O8AA 1LLOA 2ESCA 1I0DA 3KP0A 4UNKA 1BWLA 3S2LA 3FJLA 4EX4A 3UZZA 1F6PA 3TN5A 3AYRA 3WLQA 1K8CA 4O1FA 4HTYA 1EB3A 3TYZA 1EJSC 2FMOA 2VD8A 3M1ZA 3LZ3A 4AZ7A 3GZAA 1QO5A 2V81A 4MNMA 1WYIA 4ROPA 3UJEA 1F4AA 2XYLA 4K8HA 4Q6JA 2PF0A 2RAGA 2NSXA 4O1DA 2WWCA 3IIOA 3UW6A 1XIFA 4O1CA 3ITTA 1EIBA 1X8CA 2RKXA 3RM9A 1YEYA 3GBDA 3LNMA 4M81A 3BUVA 3GDMA 5CPSA 3W1XA 3R94A 1LOQA 4H04A 1XRSA 2SFPA 3H24A 4N42A 5F7UA 2IPGA 3PBGA 1PTGA 4A6GA 1XLEA 3V16A 1MW2A 3E5PA 2IKIA 2PDFA 1C7SA 1KNWA 4L9XA 1N8IA 1H5YA 9RUBA 5E93A 2DQXA 2AAAA 3ZSSA 4NHVA 4UFIA 5EBUA 3PB0A 3QVQA 4FIRA 1V6TA 5EFDA 1S2WA 4HNNA 5TNVA 3AQUA 2PDNA 3HTWA 2QJMA 1Z69A 1XIBA 1V3MA 3TJ4A 1UHVA 2XTKA 4LRTA 4ZO8A 2X09A 3UZXA 1GVIA 1VBJA 1Q45A 3EOOA 3N34A 2J62A 1BXBA 4GZJA 4QFUA 3T8LA 1GGOA 1OM0A 3JZUA 1WDRA 1K4GA 2Y7FA 2IQDA 1QR7A 2ABBA 3S6OA 3ZVHB 3W7OA 3GVVA 3TYAA 3D3FA 1JCLA 1QNQA 1FWSA 3PNZA 3O15A 5FAGA 3GYEA 2WVSA 1KRBC 5CC6A 3WO8A 3A3HA 1SZGA 1VEMA 3ABZA 3SM0A 4U5KA 3V3WA 2WHMA 3PBWA 5AKQA 3TXZA 2D1ZA 3TFCA 3R8GA 1SVDA 4AU0A 3RYSA 1BQCA 2ACQA 4TVUA 4Z2GA 1YXYA 1PV8A 1A5OC 1CGYA 2P76A 2F2HA 3OGRA 1UQZA 1MVYA 6REQA 2EJAA 1YLVA 1YX1A 1JDDA 4E4FA 3A9BA 4JTCA 3N4EA 5CAKA 1VYPX 3CC1A 1AH3A 2P5NA 2YDAA 4OV9A 1RPXA 5I3HA 1R3YA 1D8CA 3PAOA 4NP7A 4C6DA 1HX0A 2J74A 1SYTA 3HG2A 4MKVA 3CQKA 1XGDA 4JNMA 3M5VA 3EWWA 4GVGA 2OB3A 1R3VA 4N6FA 1HKVA 3ABSA 3ZWTA 2DZUA 1TG7A 1IE7C 4HSOA 3NOEA 4P7RA 1H60A 4BK9A 1X6NA 3NG3A 3IGHX 5HPCA 4JTTA 4CNOA 4PCPA 3BCJA 3WJWA 1UP0A 3W7JA 3USZA 2PDUA 4M29A 5A8NA 4DJFD 4Z0SA 1U83A 2CXEA 2V6AA 1H41A 4LXFA 2A1YA 4PBGA 3IIPA 1X1OA 5DCBA 2TMDA 1ZJBA 4NF7A 3EOSA 3NOYA 4PUNA 4F0KA 4IIDA 1BYAA 2PEVA 1OJXA 2OOGA 5DMYA 1NY1A 2WVVB 1V6YA 3EX3A 4YVXA 3SECA 2HBVA 3S5ZA 2DIJA 5DF0A 2PB1A 1EHAA 1HVXA 3M43A 4R85A 3B40A 1PVNA 1ZJIA 1U30A 3S5SA 1VCFA 4GO9A 4H9YA 1QI0A 4K38A 1GJPA 3AXIA 3EB3A 1XLAA 3SIZA 3AISA 1LLZA 3ZJ7A 3PZGA 3RM4A 3CAKA 4AVFA 1J6OA 2O56A 4A35A 5HQMA 3ARWA 2XJ7A 1VLIA 1GOKA 3VKKA 3LMYA 3W22A 1VEOA 1H0GA 5A95A 4A3UA 5BRPA 1RZMA 2QGYA 1W3KA 4AX6A 1XGEA 5FJRA 3VE7A 4PB3A 1XBXA 3EMQA 4DYKA 2CZVA 2XH7A 3IACA 4Q8MA 4AD0A 4XD5A 4U5IA 1GZ1A 1XM3A 2G5WA 3NQMA 3P60A 2ISFA 3QLLA 4Q8NA 4G8TA 3WEZA 1DJGA 3QQWA 1HKJA 5BRBA 3U57A 3DBPA 1X39A 3UESA 6PTDA 3IK2A 2ONEA 4PTVA 4ECLA 3D47A 3TWAA 1NTHA 3MCNA 1S5WA 4F66A 4KKXA 1W3HA 3M0YA 3M7WA 5A2AA 5F2MA 5ENLA 1YQ2A 1CX9A 4QCFA 4UR9A 1GVSA 5H91A 1NAL1 1GEHA 5A5WA 3PWIA 2ASHA 3L4ZA 3QV9A 3BOLA 4XBKA 1KGUA 3RN6A 3F1QA 5AYBA 3A12A 1PIGA 3RXZA 3ANYA 4S3EA 1AW1A 4UTTA 1AW2A 4HHHA 3SEPA 3W76A 1T99A 2Y7EA 4KEUA 1WXZA 4GG9A 3TH6A 3SY1A 5M3WA 3KCOA 2G3FA 4XIAA 3VC6A 3IAQA 4H7CA 1LWJA 1NIUA 3SN1A 5TD4A 3VD4A 2CESA 4OWGA 4LQ1A 1A5NC 3PM6A 5DX7A 1JCYA 3W7QA 2G3IA 4O53A 1HO1A 1WAWA 3TCEA 3YPIA 3PG8A 2DSZA 4FS9A 2V2CA 1FWAC 4YCOA 4M3PA 4AD2A 3HG3A 3QFEA 2POTA 3LHTA 3HFTA 3VFLA 3WK3A 4HK5A 1K3UA 1QATA 3BGAA 4KIRA 4GI8A 4FAMA 5I24A 2YSWA 4LTSA 3OP2A 4AEOA 4OTKA 4UTKA 1VBGA 5DMNA 2BXVA 1EPVA 2R1KA 3NM1A 2A3BA 3O6CA 3NGJA 5J8LA 3UXAA 3OA5A 2PGRA 1WZLA 3B03A 4PRRA 4GH1A 3UVAA 4GQRA 2DJLA 2WV8A 3WJZA 4WZHA 3AHTA 4XZIA 3L2IA 3GRIA 4L1XA 3UWZA 1R0MA 1EOKA 5D03A 3WQDA 4LNYA 1OFAA 2WSKA 3AS1A 1A5SA 1GPWA 2DH2A 1MEHA 4L7ZA 4F3HA 1EA0A 1VHNA 1VAHA 3RJYA 7ODCA 2FZMA 4CNPA 1Z8AA 4W4QA 1GG1A 3RLVA 4ZMGA 2WZHA 1YPFA 3DFSA 3EB4A 1Q3NA 4H01A 4TIMA 2YJQA 3N9RA 1EF2A 3BCFA 1A50A 1XC4A 3BG5A 2GVEA 4FOJA 4Y9AA 4C65A 1WQ5A 2PLMA 3GW3A 1NDZA 1FWEC 1M7XA 4LUJA 4PUMA 1IT7A 4KRTA 3ABOA 4WDXA 3SCOA 3PNUA 4ZENA 4LAUA 3W3OA 5AECA 3NSXA 2B4GA 1NP0A 1YHTA 2J24A 3WZ0E 4O18A 1JULA 4DF1A 3SUUA 1IZKA 2IQ0A 5C5YA 1R87A 1MRQA 5CQ1A 1RBLA 4X60A 2YB1A 3GDBA 4W85A 3SSZA 1G5AA 4R7WA 1FHUA 3RU8X 4NU7A 3SY5A 3VNYA 4IT1A 1C29A 5T8GA 2C14A 3QTGA 3FDGA 4O57A 1A3WA 2YYTA 3OVRA 4EP8C 1E4IA 4AMAA 4G7EA 4QSHA 3UCCA 4JQ1A 1T40A 3RG6A 4E8GA 5HJXA 1DJYA 1RJRA 1JG9A 3V36A 1X7FA 1XIJA 4JKMA 3IJQA 2HXTA 4PSPA 1XKYA 3L0KA 3LG3A 3HFYA 2DZWA 2ZUVA 4Y7EA 3APYA 4ZBCA 1CTNA 2VOTA 2WM1A 3UR8A 1BD0A 3PBVA 4KFPA 4IMCA 5KZ6A 4AVOA 2YKKA 5CLWA 2QDHA 5A6SA 2NUXA 3N2OA 3SRDA 1S5MA 5D9OA 2OSXA 3STFA 1OF6A 4RCXA 2GVJA 2V38A 4FLOA 4NJJA 3B0XA 1EJXC 1ITUA 1J4EA 5JH2A 4LY4A 1XC6A 1KLZA 2YYUA 3MU7A 3E49A 2C71A 2WHJA 4S3DA 3KS5A 3NO3A 4HYRA 1AD1A 2CHOA 1TPDA 3CUFA 2HJPA 4Z2HA 5F2LA 1Z44A 4YL2A 3QV7A 2F38A 3GNRA 1TTIA 4IPPA 3P0XA 2YXGA 4HYVA 4JTJA 1EP2A 1H7RA 1LZOA 4HHMA 4B4HA 1FOBA 4EXAA 4UFJA 3FCPA 2PP0A 4DNMA 3UG8A 3Q58A 4N9DA 2VVSA 1PZ1A 3A4XA 2VZUA 2DQWA 1UD6A 3OO2A 3LRLA 1KXTA 4CUCA 5GNZA 4A4AA 5CCZA 1VIZA 1IR2A 4O1BA 4ICCX 3EX1A 3N2XA 4L4OA 2W92A 3UXLA 4DEFA 1V6XA 2QAFA 1R3RA 4JCLA 3L5MA 3IANA 3MSRA 3RR4A 1AQFA 3DERA 3W75A 4PCNA 4J5NA 5HMFA 1J93A 5J5RA 4NAEA 4L9ZA 1RD6A 1EX1A 4A3YA 2A79A 3CL7A 1FCBA 2X16A 1HG3A 3FA3A 3ECQA 3MPGA 3TTEA 1KCXA 2J9ZA 3GM8A 3NIYA 1XWYA 4UCGA 1R9YA 4Q8PA 1L6FA 1O1ZA 5D30A 5HJYA 5BRQA 5CBJA 3C8NA 4QJ3B 4TVDA 3FV9A 3AS0A 1M7JA 2XIMA 2XISA 4C6OA 3AROA 4DX3A 2YL9A 2D3NA 3ARZA 3CQ0A 1OSEA 1XH0A 4TO8A 3GVWA 1VFUA 2UY4A 1NQKA 4IGSA 1AW5A 4J4KA 3EPOA 3MVTA 1PTAA 1ZNNA 5I7GA 4D8ZA 1Q6EA 1IHIA 4DM2A 2E77A 2I17A 4PBFA 2XFYA 4NJIA 3AS2A 1WO2A 2GQ3A 4ZXOA 3R8HA 5LIYX 3P84A 3TIMA 1K9FA 3SCNA 1QDSA 2Z29A 4CNTA 3MUXA 1KM5A 3GXMA 4CN1A 1VYSX 4AH7A 3WNKA 5AFDA 2EG6A 4JKLA 4L65A 3LCHA 3COTA 4JTUA 1JF6A 1V08A 2QV5A 1QVBA 2YZ5A 1NDYA 2E9BA 1UJPA 3BMVA 1NVMA 4MNLA 6ENLA 1IEXA 1OCNA 2HS8A 2QUTA 2QPXA 1QNSA 3OEXA 1S3HA 2DEPA 2XIBA 3GNDA 4JTEA 1E56A 2EKGA 2DIKA 3LRKA 3VMNA 3G1AA 1OX4B 3QN3A 1QK0A 1US3A 1QK2A 5IFTA 1CGTA 3FX4A 3W07A 3LPFA 1FHDA 4YTSA 2HK1A 1NWUA 5DRIA 1DORA 5HNNA 4UTUA 4BR1A 2ZUMA 1T96A 1SQ7A 2X41A 2C15A 4HYWA 4IICA 1AG1O 3E5BA 4PMXA 4D6GA 3UWVA 4RPQA 4GD0A 2VL4A 1K02A 3N15A 1EKOA 2XVGA 4NX5A 1B31A 4ERAA 2ZIDA 3NFUA 3FS2A 5K2ZA 4J7RA 3KUMA 4RW3A 4DWSC 2QJHA 4C6BA 3DESA 3RU6A 4RV3A 4IM4A 5XIMA 4CU7A 3SRKA 4JL1A 2W79A 4GH3A 1LT8A 2WQPA 3R79A 2XVNA 4OT7A 5F2IA 1ZCOA 1C93A 2C1GA 2D0FA 3M5YA 4Z1YA 4GI4A 1BSIA 3TN6A 4UFHA 1FWRA 3NSNA 2QUUA 3BE7A 3PPCA 3BAYA 3PZMA 2YCLB 3GK0A 3TFXA 1M1BA 3L9CA 1W8GA 1MUWA 3OZYA 3NNTA 3W0KA 4KT2A 4N7QA 3OIHA 4GINA 3GTFA 4HB7A 3GTNA 1UROA 2E67A 4UIOA 2BB0A 2PRLA 4JIEA 3MMDA 2JBMA 1XYAA 3RUBL 1LBLA 1DOSA 1DWJM 1EA9C 1R5YA 3IAPA 2QUMA 2PURA 4NX0A 2A3CA 4H6RA 1MSSA 3EBVA 3O3RA 4GUJA 4DB7A 5JU6A 1SGJA 5LNUA 1GVRA 1NFBA 5HATA 1DWAM 3SCSA 3UCDA 3LA4A 3VFCA 4UOQA 5CGMA 1GVEA 1TUFA 4JDBA 4MNKA 1PDYA 1UUMA 1A5BA 4JL2A 5EMKA 4FPSA 5KZMA 2ZX7A 2DGAA 3AIVA 4RL3A 4JFVA 3VNJA 2FPVA 4DWDA 3VYLA 3VGDA 1TV8A 1G7UA 5JMUA 2V2HA 4AFYA 3LU2A 1W1IE 2E09A 2YA0A 3OOQA 4PEKA 4BI5A 3WN6A 2Q02A 3T9PA 4KETA 4HJFA 4LYKA 3TV8A 5E9AA 3M64A 1YMYA 5A94A 4R33A 4QSFA 3UWEA 1L0PA 3APTA 3R11A 4C7GA 3H2EA 2ZRXA 1V6UA 3WH8A 3VTRA 4ERIA 2H3DA 2HTMA 3IJ6A 4CD4A 1R2TA 4PMUA 5CC7A 1P0KA 2ZX5A 3TOPA 2BX7A 1FDJA 4K2SA 4POCA 3M44A 1FX6A 2BLEA 2VENA 5DLCA 1UP2A 1Q6GA 5KMYA 3BURA 2DZBA 4QDMA 4AIUA 5AY7A 3GE7A 3RILA 3E2QA 3AMGA 2GJLA 4UQAA 1O6IA 1X1NA 2ZFAA 3UBPC 3F7JA 1JYVA 3EA2A 3S4TA 2OGJA 1OY0A 1EH9A 4EAMA 1KM4A 1XH2A 1UZHA 8RUCA 4GUIA 3OVPA 5BW6A 4M1RA 2I5QA 1EC8A 3W1MA 1JDEA 4RZ5A 4AHPA 3EPNA 4B15A 1JD9A 3NDYA 3LZ5A 1R9XA 4EKJA 3LHVA 3VGEA 4EAYA 3OVGA 4XAGA 1PZ0A 4C90A 1POKA 3LCIA 1KFLA 1GEQA 2ZWYA 5AHIA 3G1FA 4JXCA 1W5PA 4WLCA 3CIWA 1TE6A 2CW6A 1JIBA 4JQ3A 2V30A 1VBRA 2XUCA 2ZE0A 5AVNA 4NZ4A 1ODUA 3HU7A 3DU0A 3W01A 3TW6A 2DV0A 4Q4RA 3JR2A 4IUGA 4WKAA 4F0SA 4XAFA 4S23A 1XFCA 3IJLA 3S0CA 1T0OA 3DYMA 1UKPA 2FFIA 4AHQA 1UWAA 1OZQA 1HXJA 4O8AA 5FJPA 5K9DA 1L6SA 3AMCA 4DXVA 5LYRA 2EKCA 3TYCA 1RA0A 4F2BA 1LG1A 4WD0A 1ITXA 2IXUA 3FA5A 1ZPTA 3V35A 4JICA 1OX6A 4EE9A 1PAMA 4RE3A 1XLLA 3IWPA 4V2XA 1KXVA 2W6RA 5HR7A 3BLDA 2X7VA 2DH3A 3O05A 1E43A 1DIKA 3POCA 2AQOA 1YXCA 5FIPA 4YLWA 1FWNA 4DELA 1AZ1A 2A3AA 3AMLA 4CQDA 1IIGA 4NUWA 5HBFA 2A3EA 1F61A 2GDUA 3DC8A 5JH1A 2XFRA 3B9EA 5J04A 3BVJA 3GHUA 3MSYA 2Y5SA 1LBMA 4O0ZA 1P7TB 1CW2A 1QOPA 4WCJA 3UG3A 5BYWA 1A5AA 3QC3A 1H49A 1YDYA 3BAJA 4H6EA 2VGGA 4I9AA 1UKSA 4AX7A 5HINA 4LAZA 2C0AA 4IGNA 4U4MA 1IEVA 3V1HA 1FKXA 2GWGA 4LEFA 3QR1A 4DBUA 2CZFA 3DDMA 2VKZG 1R38A 3IGSA 4QR6A 2GJXB 3CH9A 4QDPA 5LIUX 5M5DA 2YR1A 3WBWA 4ZOCA 3LTPA 1T6MA 4LPCA 4QE5A 2Z1WA 1EOMA 2O7SA 3T78A 3N4AA 3MO7A 3Q4DA 4D1IA 4GY7A 5PTDA 1QPRA 3E96A 3DFNA 4LAOA 3ARSA 4HHLA 1FCQA 4GIYA 1I2QA 3RPDA 2R91A 3BOFA 1NDWA 1ENUA 2YA2A 4L61A 2VVNA 3PWGA 5CG7A 3U3HA 4X9SA 1W9UA 3QV8A 3RAOA 4S2CA 4DYEA 3K1DA 1TZ7A 1X1ZA 1G9HA 2WZIA 1OGGA 3VPLA 1DQXA 4QLKA 1LQAA 1JUBA 4ADSA 4I5UA 1WOAA 1QBBA 3ZVIA 3PZIA 1J11A 3VDCA 4M19A 1HO4A 1O95A 3H2CA 1H09A 3OHMB 3E3HA 5C2CA 4DWSA 5LIWX 4IFKB 1ZAHA 5KZEA 5K3VA 1DBTA 3D5HA 4MLRA 2I14A 1J0YA 3BL3A 2PU1A 1XSJA 3ITGA 3LN3A 2WNNA 3MVIA 4QS5A 1XLFA 3IGXA 5HAOA 1OX5A 5C7HA 3CPUA 1GYMA 4DJDC 3G1XA 3R0KA 1EEPA 4R53A 3IUDA 3OVQA 4DUWA 4HCHA 3ES7A 2FFCA 3SQMA 3WLMA 4D71A 3SURA 3DKJA 3LSBA 1G4TA 1E3ZA 1QRQA 1F73A 3CASA 3G1YA 3K4AA 2WJEA 1GZGA 4GXMA 3N25A 1ZAIA 2XM1A 2WNZA 1EJVC 1K70A 2OKTA 4X2RA 1K8ZA 1V03A 4BS0A 3THQA 4DXKA 1VC4A 1EYEA 3TNBA 3H22A 4QDWA 1SUXA 3B8IA 5CZJA 3AJXA 2XIJA 3PBYA 1HUVA 1JXJA 2PAJA 2YBTA 4FK9A 1FWIC 3ARVA 1US2A 3CZGA 3O0FA 5EA9A 3OU8A 3EAUA 4GYKA 2Z1SA 1TELA 3RF9A 2J78A 5E6YA 5AZ1A 4FLSA 1PSCA 1SJBA 2ZVRA 1FVPA 1XCXA 2OKOA 1MEWA 1RAKA 2NZLA 1E0VA 2YBUA 4I8DA 3R58A 1B30A 3SW6A 2QIWA 3NYZA 2WJDA 2X0HA 1U5VA 5C70A 1C90A 4DJFC 3OTRA 2NWRA 1UPMB 2R94A 4AIEA 3WDPP 1IWBA 3OBAA 3AIQA 3LXAA 1XYZA 4LCQA 4D2JA 1CIUA 2NXHA 4XTIA 3PTKA 1TJPA 2QJNA 2ZKMX 2A5HA 2PDGA 1KA9F 5D05A 3WF2A 4Z1DA 1OEPA 1WOBA 1J18A 2VZOA 3VVGA 5I03A 1Y5VA 3MWAA 1TV2A 2J88A 3I65A 4GLEA 1PHWA 2JKEA 3UQNA 2PC8A 4H3DA 4DYJA 1ZQ5A 5EFFA 1JYXA 4HPHA 3H2MA 5CZKA 2HROA 2XFWA 1QW9A 3BAXA 1TIMA 1XD1A 5FJTA 2P88A 1DP0A 2VDHA 2D2GA 2X7WA 2YIHA 3DFQA 1F2JA 3BARA 3NQ6A 4PUKA 4K8EA 4KCWA 1VRXA 2GJXA 2QCFA 1O7AA 2WPGA 4US5D 4UFLA 2Y89A 2D3LA 4M7SA 1ME8A 4BA0A 1ONWA 1C9DA 2VQUA 4RPPA 5HPOA 4Z1AA 3L21A 1TPB1 2BY0A 3S1GA 3GFYA 3FK4A 1IWPA 3N9SA 1RY8A 3CV2A 2QLYA 3KBWA 3CLWA 4F0LA 4HMEA 3HPFA 4NZFA 1ESWA 3AMDA 2VRQA 2I56A 3ZR4A 3S2MA 3C0QA 4JTFA 1TWZA 4DZAA 5FSEC 4I5XA 4V15A 4H9XA 2GGJA 2VRJA 4UTWC 1UD8A 3VI2A 3KP1A 3DFTA 4GUFA 1S5NA 2Z25A 2WBKA 3DI1A 4M8UA 4RX0A 1KCLA 1JEZA 1GQIA 2QCEA 4EXBA 5I3JA 5LIXX 5HUPA 2BFGA 3W6YA 2FYMA 5H2ZA 4ZQNA 3MW7A 4BF7A 3OW1A 2OYLA 3FY1A 4FHAA 1KTBA 3I4EA 1WE5A 1TTJA 2VHLA 1DWFM 1M9HA 1UC5A 4PCTA 1LL6A 3LX9A 4HN4A 1UKTA 2FGBA 3F4CA 3OGSA 1UB3A 1BHGA 4C6IA 1IXPA 4P5UA 2MNRA 4O28A 2V5BA 4JZ5A 4LVDA 2OO0A 2WMHA 1VLWA 2V9DA 1TPWA 2O4QA 4IH3A 4KQNA 2JEPA 1X38A 4UBPC 2ALDA 1R46A 1TKKA 2PTYA 3DFOA 3WMBA 4W5ZA 4WOZA 3QR0A 3LYEA 2PWDA 1E70M 2GGGA 1W2VA 4IQJA 1QCWA 1JUEA 2WCSA 3MYPA 1RQBA 2DY3A 2XN1A 2FHCA 4QTGA 5XIAA 2POZA 3INPA 1V6WA 2PDQA 2WMIA 3B0UX 3W7HA 4IIBA 1MQPA 3B9AA 4O17A 3T7VA 1JGMA 4AVNA 1SFSA 2AOSA 1E6RA 4PZVA 2CLFA 2X2YA 5CXPA 4LEQA 2E68A 4MG4A 3BSGA 4Q4OA 5IFPA 4CD8A 1K7FA 3TSDA 3SN0A 2C79A 2VFGA 3W74A 4TX8A 3KBVA 3AZTA 1OB0A 2XVLA 4ZQCA 4I3GA 4UTFA 3UWUA 3EX6A 2XWDA 2V3FA 4HZMA 4H83A 4PMRA 1UBSA 4ZO7A 6A3HA 2AL2A 4Q4SA 5FEPA 2ZUSA 2OMAA 2AKZA 4PEEA 2O4MA 3GXPA 5T26A 2VT0A 3CJPA 5CPQA 4P8UA 2ZRUA 2H6RA 3UR5A 3T0DA 1K03A 4O12A 1JI2A 1PCWA 3BTNA 3G6LA 4LVFA 2WC4A 3KOZA 4CQ9A 1TVPA 4J35A 4A3QA 4LOCA 3P14A 3WQGA 4OBRA 5A6TC 3WNMA 3QC0A 3QMSA 1U5HA 1D3HA 1KB3A 1O68A 3P0WA 3N73A 4JQ2A 4FB7A 2D2HA 4G2DA 3QTPA 2VX6A 4X61A 1HN1A 3KCJA 1AQMA 1LCOA 3I10A 4TMBA 3GC2A 3DG3A 2Q8LA 4WY0A 1OG6A 3HN3A 1LQ2A 1LT7A 4UB9A 2PLKA 4AZGA 3D0CA 4ALDA 2DT1A 1TWWA 4J3SA 3PJUA 3V5FA 1I8JA 3FLUA 4H7ZA 2DSWA 4A2SA 4NXSA 1CECA 3H21A 3HURA 4R9XA 4JTDA 4TTGA 4YHEA 3VDAA 2HEJA 3CHFA 1XR2A 2OSWA 3LBOA 4TUFA 1TA3B 1KRAC 4IWWA 2BASA 3S9YA 2WAGA 4C1NA 3HMJG 1RY0A 2YA1A 4IL0A 4P7NA 1YYAA 4W84A 1QNOA 1HJWA 4DJDA 1LRQA 5BXSA 4OBTA 3IARA 1BF2A 2E28A 1VBHA 2ZUWA 3ZLFA 1TR1A 1JCNA 1O66A 1I2NA 5I23A 5LNWA 5JVLA 2J8GA 3GTXA 3AICA 4PUDA 1HGWA 4PSRA 3KHDA 2WMJA 1VENA 1GQKA 2GVLA 8CGTA 1YTKA 2Y2WA 1WB0A 5GPRA 4AEEA 3V5CA 5RUBA 3P67A 1QPNA 2D20A 4IP7A 2WCGA 1VFOA 1W3LA 3E02A 3S5NA 5K7JA 5BROA 4NRRA 3ZJ8A 1OD0A 5G1YA 1FUYA 2VXNA 1HP4A 1XIEA 2OZ0A 3MTWA 3W1AA 3W27A 3CGTA 2FHFA 2OQYA 3WF0A 4ENLA 3M0XA 4Z08A 4H9VA 1TJ1A 5C71A 1M7PA 1J8VA 1BKHA 3UZWA 2CLMA 3EYPA 2HE8A 1VJZA 5I00A 3KOWA 4JFTA 4C1LA 3HGRA 3VINA 4IP4A 3WJYA 1GWJA 2QR6A 3AWNA 4ACZB 2PE4A 5M1TA 3EDEA 1UD4A 1LUCA 2DU2A 4LV4A 1ZBKA 4Q33A 4Y9NA 5F4XA 4IFRA 4N2YA 1IF2A 4NAFB 1EHNA 3IRSA 1QHOA 3TE9A 2VUYA 2D22A 4REQA 3GH4A 2R24A 2PFHA 3U6WA 2VD9A 4D6DA 1HL2A 4CQCA 4K1GA 3WH6A 3VNZA 4LFYA 3NSMA 2W63A 2QZRA 4UTJA 3QSRA 4PB5A 1OYBA 1EQPA 3G1SA 2E9MA 4H9MA 3AALA 2P8CA 3XINA 1PO9A 2AKMA 4LCRA 4PFHA 1OK6A 2FIQA 3R8RA 4OZOA 1D3GA 1RD5A 2I5IA 2JQXA 4C6JA 1XYBA 5D2WA 3BANA 4W89A 1R3TA 3B0YA 2EO7A 1WXJA 3H54A 4YCPA 3S42A 4GZ7A 4UC5A 1YXDA 4X3ZA 5KSWA 1TX2A 2ZZ4A 2X8RA 2XINA 2XZ7A 3STGA 3MA8A 4DVOA 1O5XA 1PIFA 4RDZA 4PRTA 1JVNA 1KC7A 2Z26A 1EP3A 4JHMA 5IHSA 1C8QA 4D6HA 4B91A 3G3DA 2WMGA 4WJEA 3H8AA 1K8XA 3VUSA 2GGEA 2VM8A 3ZT7A 5DO8A 1W5NA 1EYWA 1RVGA 3LPPA 4KEZA 1KWGA 1J10A 4MF4A 2DZXA 4UTWA 2XSXA 2BS9A 4I8YA 1YBQA 4U28A 3O7UA 3FW6A 3WD1A 1GOIA 3W26A 2UZ9A 4PUWA 4Q8QA 3TQ0A 2XH0A 4LJ3A 2PZ0A 4LF1A 5CZ0A 5BWAA 2HVOA 3UJSA 2E4TA 4AHOA 2E6AA 3AZRA 3KTCA 2WHKA 4GQ0A 1EIXA 3WLPA 2VUNA 3CHCA 2EF9A 3W38A 2P0OA 3ARQA 2R82A 3WBAA 3REQA 4IG2B 4UNLA 3W87A 4FX8A 1H11A 3BLLA 4CQBA 1K6WA 1XP3A 3GLCA 1EGVA 2HISA 1O94A 1E6XM 2IPJA 4MB3A 3FJNA 2Z27A 4XSMA 1OBAA 2EHHA 1TSIA 3ORWA 1OZMA 3SJNA 5FA5A 3F5LA 1ZBWA 1SZEA 1OCQA 1UA3A 1H7NA 6XIMA 5LNSA 3WNLA 4R88A 2ZTKA 1DV7A 1WKYA 2J7CA 3NZQA 1AH0A 3LCXA 5I79A 4BF5A 1CLVA 1J5TA 3U9IA 3RPTA 5D9NA 2B7PA 1SZNA 3CL8A 3N4FA 4E8CA 1Q8JA 3U48A 3LPGA 1OT1A 3F4WA 5BOOA 2E40A 2FZ9A 1QWGA 2J7FA 2ADAA 4BCEA 4XZHA 4AWUA 2P3EA 3GHRA 4AUBA 2FDMA 1PE1A 7PTDA 2BHZA 3MP3A 3LHUA 2NV2A 4ML4A 4L4MA 4HU3A 2VC7A 3DG7A 3C2VA 3CZLA 3CK5A 4ZO6A 1XGZA 4HA0A 1NM9A 4Q7IA 3SZ8A 1QU4A 4RLIA 5BXTA 4QIUA 3UR7A 4AZCB 2YW4A 2DORA 2X0SA 3TDFA 3W7MA 3AU6A 1XLCA 4JTLA 1VBUA 2J66A 5AZ0A 3DHUA 2UV8G 2IMRA 3V18A 3W1PA 3ZSTA 3PUOA 4OKDA 5BU6A 1ADDA 4ACZA 3ARTA 4JY8A 1Y0EA 1ZU8A 3EWUA 5DFAA 2OR2A 3T0AA 5A8PA 1W9DM 2V5CA 3RX4A 1WDSA 4UTMA 3VNKA 1B4EA 1ME7A 3N13A 1F3WA 1MW1A 1E73M 3S1UA 1R7OA 2E5CA 3MP5A 4S3GA 2V3GA 2V3DA 2QUVA 3G18A 1GG0A 3DKLA 4US6A 3QV6A 5LNVA 2B31A 2ZZ7A 2Y1HA 4QRNA 2OEJA 2QPUA 4S38A 1KFBA 1ZY9A 2NT1A 3G8EA 3H53A 3NZPA 1Q6OA 1JUKA 2VRKA 1YADA 4HK6A 1UKQA 3PZ9A 5KINA 1R3QA 3WNPA 2V5KA 5I2UA 1CXEA 2YL8A 4M6QA 3EWYA 2J79A 3R2GA 1L8NA 5I02A 1I2RA 3VGGA 5REQB 3C61A 5AC4A 1Y5XA 5C9UA 2PTXA 1P6WA 4QE1A 3DHFA 4CN4A 3ZR6A 4LVBA 2P10A 4BQ5A 2Y85A 3A21A 5C9XA 2VNCA 2QUNA 4IPNB 3ARPA 2XDFA 1DE6A 1IEQA 5DMLA 3A4JA 2YDSA 1ZSXA 1JCMP 1Q65A 4W87A 1C8YA 2E0PA 2VEMA 1TB3A 2XPKA 2Z1XA 1R85A 1KR0A 4MADA 1A80A 3KW3A 2FZBA 4B92A 4PTDA 3DECA 3QW4B 1W5OA 1HKMA 1UG6A 2Q3OA 4O16A 2A7NA 3TZNA 3LQGA 3TAKA 4FLQA 4W7VA 1GJWA 4YU1A 4HU4A 2YW3A 3TC6A 1WKDA 5C9WA 5BWFA 3VA8A 1RLDA 1TPC1 3NQAA 3GNPA 3DYOA 1W3IA 3UZYA 2CERA 4ZXLA 4KIEA 1H61A 1C3FA 1EO7A 1TV3A 5A8MA 3SFWA 1XIDA 1TCMA 4QG9A 2AGTA 4FR6A 2O0TA 5FF0A 2WSQA 3T42A 2FTPA 2X2GA 1EUNA 4ZODA 3MKCA 4GYFA 3OBKA 4D6JA 3C5QA 2NV9A 3DENA 1GTHA 4LRSA 3M46A 1G4SA 3IIXA 5JBFA 5KZDA 1VR6A 3H4XA 2L5HA 4W9TA 3WENA 3QFWA 1ZJHA 2QHAA 5I78A 1SJDA 3CHDA 2I5GA 3QH2A 1UR1A 4D6CA 4QNEA 1KKOA 4KBXA 2D24A 3W7KA 3W1RA 4XWUA 5D09A 4E2VA 4DJEC 4FMVA 3AIUA 1HFBA 1TIWA 2OELA 1UP3A 4GNKB 3EWZA 2GQ9A 4M1BA 1N82A 1XCWA 5T91A 4RNJA 1P6BA 1KXQA 4PUJA 1OCBA 3WKZA 3WH7A 2IS7A 4KRUA 2EBNA 1Z6KA 4PA8A 4FNSA 4WGHA 1SW7A 1KV8A 1HVQA 1ITQA 3W7RA 3Q37A 3FN9A 4GCXA 1TWSA 1VCVA 4HQVA 1OHLA 4NNCA 2ZUNA 1FFQA 2HVMA 3UXKA 2UY3A 4Q7NA 2OEKA 1XISA 4QE4A 1TVLA 4YPJA 2J27A 3SCTA 3GNXA 2P0IA 4JGDA 4GQBA 4RE4A 3AXMA 4ZOAA 4PMOA 5F1UA 3L4YA 4AY8A 3MMTA 3ATYA 5ECVA 5B7ZA 3MANA 3SIMA 3N6HA 5D2XA 3S9ZA 4H41A 3O6AA 1S5TA 2QF7A 1TJ2A 5D8ZA 2REQA 3KFTA 4CCDA 3DOPA 2BXZA 3STEA 1XRTA 4H6KA 4GGBA 1CBGA 3RMEA 1QW7A 3S47A 2OSYA 3WF4A 3QRHA 2WSYA 3DUGA 3GTHA 2J6XA 4V33A 2Y7GA 1GKPA 4E3VA 4W8BA 1FHLA 9XIMA 4IP5A 7XIMA 3ONCA 2PDIA 2F6XA 2W4XA 1TMQA 5E70A 1KRCC 1CXKA 3AYVA 4U31A 1K9EA 3VD7A 1DVJA 4K7VA 2Y7DA 1BYCA 1CGWA 2Y70A 1GVYA 3CQHA 3TYDA 1VJSA 4GK8A 4D8AA 1Q7ZA 3WMCA 4Q8VA 1T8XA 4QEEA 5HDRA 5TBOA 4GMEA 3SQLA 1QNVA 5A8QA 3AMKA 3VGHA 4LAKA 3W2NA 4MYAA 2PDJA 2E8ZA 5CBBA 1GVQA 4LY8A 3UXIA 1W91A 4OHQA 2ZRVA 3N1AA 4BF9A 3TROA 2AGKA 3PZQA 3IK4A 4R27A 6TIMA 5AYXA 4LX4A 2EAWA 2ZXQA 3LLFA 3SRFA 5MKGB 3H2FA 2ISDA 3HA1A 3G1DA 3L5LA 4NJGA 4NASA 1WDPA 1NFPA 2WVUA 5BMWA 2NXGA 3TONA 1BVWA 3B0VC 1T41A 4YTRA 1QHZA 3NQCA 2G0WA 3KWXA 3H23A 4XAPA 3I6EA 4RDWA 5K9XA 4F4RA 1FCUA 1E4MM 3O1NA 4UQDA 1ZL1A 1E9IA 1Q7QA 1M41A 4LV9A 1DJHA 2OLSA 4C91A 4TX6A 1YDVA 3TZFA 1SO6A 1R2SA 1X6LA 2VC5A 2Z4GA 1O5QA 3W73A 2QDGA 2EGZA 1L2QA 5AYZA 1KM3A 4ZSTA 2PMQA 3VX0A 4D8LA 4KF1A 3OLDA 3GXDA 4IXHA 1MNSA 4DZHA 1CGXA 3C52A 4MWAE 6ALDA 3T44A 5LA2A 2CXGA 2XN0A 1I1WA 4PTXA 2ZZ2A 3S2CA 1E5NA 1XUUA 3E2VA 5E09A 1Q4WA 3GIPA 1DXIA 1V02A 5EB8A 2YFOA 1U1HA 2Y63A 4GNVA 4MGGA 3CTTA 3TTYA 5I3KA 4DBEA 3NCOA 2EPMX 2G96A 3PC0A 3CYJA 3PJXA 4KCUA 3LMZA 2Z7GA 1AL7A 4OU1A 4XVEA 3GAYA 5DRCA 3MDWA 4GFSA 2DZAA 3PK7A 1UIOA 3W83A 4O50A 3B0PA 4Y8EA 3LHZA 3W6MA 2RGMA 3R0DA 3PSWA 5FJJA 4Z17A 1U33A 4Y96A 3WF3A 4XZ9A 3RO6A 2DZSA 1FHVA 5D2YA 1HP5A 1W1TA 3T1GA 5FACA 5HJLA 3H26A 3B4YA 1L6GA 5BU9A 2J7DA 1OIMA 4QEHA 3BZGA 1V3KA 2WBGA 2VEIA 2PWVA 3O63A 2QCMA 6REQB 3T0BA 1KTCA 1VKFA 3TSMA 4ZQOA 1CXIA 1W9XA 2QYGA 4H4IA 2BY2A 5C8BB 2RDTA 3NWRA 2ATMA 4ZFMA 4LVGA 1PL9A 8TIMA 4IF2A 3WQWA 2YDQA 4I6VA 2PS2A 1BLIA 1RP8A 1R86A 3KCLA 4KW2A 1GQLA 1RXOB 1ZCCA 1E72M 1G01A 3PUGA 2ICSA 1HJSA 4M6VA 5IDIA 1YTDA 4ATDA 1F5ZA 5LA1A 3MWCA 4B3KA 2W5FA 2OYKA 3CV7A 3UA3A 2H90A 4Q4KA 4U2YA 1O4UA 1AODA 1DHKA 3GVRA 3LGDA 2CZEA 1EJWC 1FH8A 3ALGA 1IEIA 4J2PA 4WJ8A 4DQWA 3PY2A 4IQLA 5C7VA 3SUWA 5FEZA 2Y8UA 3KOXA 3B9DA 3L4TA 5EMUA 4X0NA 1MW0A 3WUFA 1P1XA 5C2XA 1QTWA 2KZHA 3Q94A 1I45A 2CBIA 3SUVA 1W9VA 3L5AA 4EWJA 1KV5A 3WLHA 4ONVA 3GVGA 2ZRWA 1D2KA 5EMMA 3QZEA 1JCTA 5I07A 5AHNA 2NQLA 2QCCA 1FDYA 4UWMA 3R43A 2FVMA 1LORA 2Z7KA 4H6QA 2GLKA 1W31A 5DN1A 3OODA 4FXSA 3PBUA 1ISZA 1KM0A 4DJEA 3GXNA 5MHBA 1VQTA 2PTDA 3PZNA 3NQ2A