4U5KA

Complex structure of mutant ctcel5e (e314a) with cellobiose
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
306
structure length
304
Chain Sequence
PKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGYKNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEFTHKWRGTWGTQEDMDTVVRVFDFVKSWSDRNNIPVYFGAFAVMAYADRTSRVKWYDFISDAALERGFACSVWDNGVFGDNDMAIYNRDTRTFDTEILNALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase H
publication title Biochemical Characterization and Structural Analysis of a Bifunctional Cellulase/Xylanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
total genus 113
structure length 304
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4u5kA00
2OSWA 4PMQA 2VZSA 1NP0A 2YLAA 3IAPA 4FF5A 2UY5A 2E9LA 3SURA 2Q8XA 4AIUA 4BS0A 2CXGA 1CLXA 2CERA 3ZSTA 5JBDA 2YJQA 4W8AA 2J79A 4CD4A 1WZMA 2DDXA 5GNYA 3W4RA 3RDKA 1V0KA 2ZUSA 4JFWA 4B9ZA 4HOZA 2W92A 3VMOA 5A6BA 1GCYA 2XFYA 1VFMA 2DSKA 2CCRA 2O9TA 5IXEA 2VRJA 1FH7A 3VDAA 4F8XA 1CXFA 4JCMA 1HF6A 4UQ9A 1J18A 1JG9A 4MDOA 1HKMA 4LGXA 3MV11 2G3MA 2HISA 1E3XA 1GQLA 4P8VA 3SCPA 5JBEA 2XTKA 1EDQA 2WYSA 4ML4A 5AY7A 1BYBA 3EDEA 1XSJA 4GQRA 5A8OA 2VCAA 2E3ZA 2ZUNA 4B3KA 2O9PA 5A6JA 1JFHA 2XHYA 4DWSB 2QLYA 4CUCA 3OBAA 1UWTA 2A3CA 2NW0A 4UFJA 1XH2A 1VFUA 5EFDA 2D0HA 1VAHA 1DWJM 3CMJA 5CXPA 3O2LA 4JHOA 3W6LA 4PTWA 3WF3A 3WY1A 2ZX8A 2OYKA 1ISVA 1ISWA 2V3GA 2PBOA 1TZ7A 4ZXOA 2E8ZA 3FW6A 3T0AA 1GOOA 3ECQA 3WENA 3RILA 3QOMA 2X2YA 5C70A 3DYPA 1UOKA 2TAAA 4KMQA 3MO4A 4GIAA 2ESCA 1SYTA 1WZLA 3B9DA 4JIEA 4NI3A 1E3ZA 3EDFA 3T0BA 2GFTA 3FAXA 3WEZA 1W9VA 1HNYA 3AMDA 4Q22A 1PX4A 5M17A 2CYGA 3EMZA 4F79A 4NZCA 2WMJA 3WSUA 2PBGA 3SCWA 2G4FA 2JIWA 3U57A 1DTUA 1J0HA 5JIWA 1LL7A 5DT5A 2J4GA 3RO8A 3G6LA 2VZOA 3TTSA 3ZJKA 3WFLA 2DGAA 1VRXA 5ABFA 3AS0A 4TVCA 4OJYA 2E9MA 1XGZA 3PZ9A 2ZWYA 1KFWA 1W1TA 2ZXBA 4WSKA 1J10A 2NT0A 3OG2A 4NSBA 2VTFA 3KL3A 1JAEA 3U7BA 3T08A 2ZX5A 3MUZ1 3VGHA 1E71M 2O9RA 1UD4A 5C8BB 2W91A 4ATWA 3WD4A 1UA3A 4UR9A 1UKOA 2GJPA 1UYQA 5CG0A 1WNOA 2C0HA 3K46A 1F4HA 1VEOA 1CGXA 1QW8A 1V6XA 2DEPA 3FXYA 4JKLA 4BQ4A 5KZ6A 3VMNA 2IUZA 4B15A 3CPUA 4A3HA 1TCMA 2UY3A 3W26A 3L4WA 5D8ZA 1HL9A 1VBUA 1W9BM 1R86A 2J74A 2W63A 4P7NA 3VDBA 4AYSA 4QCFA 1ZB5A 5FL1A 1TR1A 1GJUA 3APGA 4Z2GA 5KEZA 1BVZA 2DT3A 3WQVA 1KXTA 1QHPA 2G41A 2D3NA 3LMYA 1UWQA 4BQ3A 3PZQA 1UR9A 4OOUA 2XVLA 3CHDA 1V08A 3WUFA 1KR1A 4H7VA 4J7RA 4FLSA 3BXWA 2GSJA 4HZ7A 1QVBA 2JEPA 3CUFA 1AMYA 1K9FA 2WCGA 3CUIA 2VR4A 3K8KA 2WVVB 1TMQA 4AZ6A 1JD7A 3LPOA 4P7RA 1OT2A 3GNPA 2CESA 1W9PA 2EPLX 1JDAA 4U31A 2EXOA 2QPUA 4HZ6A 1LLOA 2BS9A 2WVSA 3D5HA 4Z2JA 3AXHA 3QOKA 4U2ZA 3NUKA 3RIKA 2WZHA 3EBVA 2PWDA 3ZMRA 2V5DA 4DM1A 1V3JA 2Y8VA 3TA9A 2CBJA 4PMUA 4CN4A 1JZ8A 4PTXA 3UERA 1BG9A 3VVGA 5D9OA 5ABEA 2X05A 4PCSA 4RE3A 3BMVA 5A69A 2V3FA 2VR5A 4U5KA 4FLOA 1FH8A 4CKQA 2EO7A 4P8UA 2YA1A 3RM9A 4GI6A 4CCEA 3RJYA 4WIWA 1JZ3A 2OSYA 3WH5A 1V3KA 1JZ2A 1JDCA 3F4VA 3W6MA 2B31A 1ZL1A 1VF8A 3RJXA 4AEFA 3PZTA 4OKDA 2EPNA 3F5JA 3FHQA 7TAAA 3FNDA 3PTMA 4UQAA 3WMSA 3AXXA 3MANA 3KWXA 1HKJA 2JIEA 4ATDA 1KXHA 5HDRA 1JXJA 3WQ6A 1XH0A 3BCFA 4MNMA 5A1AA 5AYIA 3WL0A 4TOQA 3A4WA 3MS8A 1H4PA 3KL0A 4M24A 1RPKA 4UFHA 1VJZA 4U3AA 1MFUA 1QI2A 4UOJA 2YL9A 1OBAA 1S46A 4W85A 4UZUA 1GQIA 2E9BA 4L4OA 4URIA 4UQEA 1U2YA 1NARA 3BSHA 3VPLA 3HMCA 1CGTA 2V38A 3WDPP 2JFEX 2WB5A 4PN2A 3VX1A 2ZXDA 4PTVA 2WZEA 3OZPA 1ISYA 4MB3A 4M8UA 1D2KA 1EIBA 3MV01 1UKPA 4W8LA 3IANA 3FY1A 1XC6A 1DWIM 3S6TA 4UOZA 1E9LA 2XWDA 4CD6A 3OGVA 3AYSA 3GXDA 1NOFA 4JCLA 3WN6A 1HJXA 2WMIA 2F61A 2BY0A 2FHFA 4CD8A 1ZBKA 3VNYA 3SUTA 1R85A 1Q6EA 2XGBA 5JIPA 2WLZA 2D1ZA 2QMJA 3WUEA 4E8CA 2JEQA 4U5IA 3BLKA 4KRTA 3TOPA 1GQKA 2UWFA 2E0PA 1UWIA 1MQQA 3N17A 2DT1A 5C71A 4AD3A 3CZEA 3II1A 3GNRA 1V3MA 5DF0A 3IJ7A 1CGVA 4PSPA 4GPNA 1V3IA 3AJ7A 4UOQA 3AHYA 3I3BA 2Z1KA 3F5KA 4MB4A 2CBUA 5EFFA 6A3HA 1XSIA 2VX5A 3L2MA 1E4IA 2WC7A 1EXPA 1H5VA 2DT2A 2WCAA 4X9YA 2GJXB 4PMRA 3ARVA 1ITXA 3VM7A 4IISA 3K4AA 3KEHA 2W66A 2YBUA 1XH1A 1IV8A 3W81A 4PMXA 4CVUA 1WP6A 1CGUA 4WF7A 1OD0A 1WKYA 4PYSA 3UG5A 3FN9A 2YDSA 4TTUA 1ISXA 4M1RA 1E55A 2F8QA 3NSXA 1CXEA 5HPCA 1C8XA 1W9UA 1WCGA 3M46A 1G9HA 3WQWA 5I5RA 4OBRA 2HVMA 2PWEA 3IJ9A 5BXTA 1B1YA 1NOUA 1W9DM 1GVYA 5I78A 2BY2A 4BQ2A 3SUVA 1GOQA 3UEQA 2G3IA 2WWCA 5D4YA 3DHPA 1HKKA 2XM1A 1J0JA 3PZIA 4B3LA 2ZX9A 3W25A 1UD8A 1KR0A 1V6UA 4IUGA 5D9MA 5A6SA 1FHDA 3BLPX 4OZOA 4OBSA 4RE4A 2QV4A 3AZSA 2WKLA 3ZO9A 1K6AA 3W24A 1US2A 3ZQ9A 1Y7VA 4BZYA 1UWRA 1FH9A 2X8RA 2ZUUA 2XSAA 1OWQA 3VD3A 2J62A 5BYWA 3CUJA 3I3DA 3MMDA 1V0NA 3GXMA 3GTNA 1UG6A 5IHRA 3VM5A 2X0HA 3AMGA 1GHSA 1E6PA 3QHMA 2ZUTA 4J28A 3VINA 1K9EA 4W84A 2D20A 3WMCA 4QAWA 2PC8A 3AMCA 3THDA 2CBVA 3L4XA 1KB3A 4W5UA 1ZU8A 5E0FA 1W2VA 1WB0A 4AD0A 1M04A 1NH6A 1LL4A 1Q6FA 1WDSA 2YKKA 3KE0A 4EAMA 1C8QA 1H0IA 1PX3A 5A6MA 1QOXA 2BHZA 2WBKA 4ZEPA 1LJYA 2OWXA 3AOFA 4TXEA 3L4UA 4GZEA 3CZLA 2ZXAA 2FDMA 2YA0A 4OOZA 1EO7A 1UZ4A 1E6XM 4JFTA 4MJ2A 3NSMA 4QLKA 5A95A 2WC3A 1HJSA 1AQHA 5BROA 2ZX7A 4CD5A 4JFSA 3AHTA 2VQTA 3NJ3A 5JUVA 1FA2A 5DO8A 4R5EA 4FMVA 1B3YA 2VUYA 3DYMA 3EMQA 4AC1X 1IT0A 3AZTA 1QNPA 5IFPA 4P8XA 1JI1A 3K4DA 1O7AA 1CGWA 4J3WA 4YHEA 4DWSD 2VX6A 3CZ8A 3B9AA 3WKZA 1KGUA 3NIYA 4GO9A 4UCFA 3GXFA 2ZIDA 4HA4A 2FH8A 1B3XA 1W91A 2VJXA 1PBGA 4M80A 1BLIA 3VGBA 5A8MA 4PEEA 4TUFA 3PN8A 1K9TA 2DH2A 3SUSA 4ZENA 2XVGA 3BCDA 3OLDA 1WDRA 3WL1A 2CKSA 2Y24A 1KWGA 1OT1A 2C8NA 4MJ4A 4U2YA 1J12A 2VVSA 3L4TA 4PMNA 1E70M 1XD1A 2ZUWA 1ECEA 1O6IA 4XUYA 1TFVA 2EPOA 3OB8A 3K8LA 4LYPA 5FL0A 3BAXA 1EDGA 4MPKA 1OGGA 5ABFB 2GK1A 5HOSA 3TTYA 5IHSA 4KWUA 5EB8A 1JD9A 1PZ3A 2CHNA 3O6AA 3W53A 2FHCA 1QBBA 2YIHA 1UWSA 2IXUA 1VIWA 2EBNA 1D3CA 1HX0A 3WIJA 2FGLA 3W37A 3AROA 4MNLA 5IFTA 1I1WA 1WAWA 4GI9A 5BXRA 1JDDA 3OZOA 4TVDA 4EK7A 3ARPA 3VDHA 1E0WA 2V5CA 1P6WA 2XYLA 4LX4A 4BQ5A 1B9ZA 3CHEA 4KRUA 1H11A 3UR8A 4XV0A 3N12A 1J0IA 2BNJA 2XFRA 2XVPA 1VFFA 4OIFA 4M29A 4ACZA 4IPLA 1TA3A 3WF2A 1UD2A 5E9AA 1OB0A 4D6GA 1PX8A 1MW3A 2DH3A 2YLLA 2JF6A 1OD8A 3WF0A 3J7HA 4GO8A 5A2BA 3WF4A 1QHZA 5ABGA 1BVNP 5JBFA 1E4NA 3QHOA 3SCNA 1JYVA 1E0XA 3AXIA 4CVWA 2VRQA 2BY3A 2D23A 1E0VA 4D6JA 4W88A 2AOSA 5D8WA 3LPFA 1XYZA 3T2PA 4LYQA 5M03A 4MADA 2WKGA 3WDJA 3M7SA 3NDYA 3QR3A 4JKKA 3BH4A 1KXVA 3VDCA 1VBRA 5CGMA 2OWCA 7A3HA 3DHUA 4BCEA 1SMAA 2YL5A 2WHJA 1RP9A 2VCBA 3PZUA 4CN1A 3ZJ6A 4NF7A 4V27A 1GPFA 1H41A 1E4MM 1U33A 3WDQA 1W3LA 4DUWA 1MW2A 1NWRA 2A3EA 1US3A 2CEQA 4A4AA 4TX6A 4KH2A 1JZ6A 3ZR5A 1BF2A 1AVAA 1UH3A 4XZWA 3W38A 4ZE4A 1G1YA 3G6MA 5BWFA 3BMWA 4CN6A 2JALA 1V3LA 2XPKA 5D9PA 1GVIA 4AXNA 1H09A 1PAMA 3ARZA 1KGXA 1MW0A 1SFSA 4W89A 3AMLA 3BAYA 1MFVA 1M53A 2Y8KA 4XZBA 1GONA 1QNOA 1MXDA 1IZJA 4EKJA 1Z32X 3BAWA 4UFIA 3SCQA 4D6HA 2DPEA 1UD6A 2W5FA 1GHRA 3POHA 4UQCA 5E6YA 3I3EA 4ZE5A 1EDTA 1CNVA 2VX7A 3WFZA 4AZBA 5A2CA 1MW1A 1HIZA 2ZICA 4QP0A 5AC4A 3WNKA 2PF0A 2YDRA 3IK2A 4J3XA 2BVDA 4E4PA 2Y4SA 1MQPA 3ZJ8A 3VD9A 5BXSA 3WELA 1RH9A 1GOIA 1BAGA 1HKIA 4K68A 1CDGA 3CHCA 1PIGA 2QPSA 1EOKA 5CZKA 3WNNA 3VTRA 3VO0A 1VEMA 1FP8A 2BFGA 2XG9A 5TD4A 5A3HA 4WKAA 2OLHA 3OA5A 4NRSA 3WDRA 5BRQA 1YHTA 4UFKA 2VURA 1AQMA 3POCA 3WEMA 4HU0A 4MDPA 3VU2A 3RPMA 4AY1A 1G94A 4PUEA 1JIBA 1BGAA 1GNXA 4JHZA 2ZUVA 3W29A 2VQUA 5GNZA 3AIUA 4HA3A 3CZJA 4ZXLA 1E6NA 4MTVA 5FD0A 4AISA 4ATLA 5AYBA 1CLVA 1LWHA 3LPGA 2GUYA 2WMIB 1UHVA 4D6EA 3A3HA 5LA0A 1XHGA 2QF8A 3OLEA 4FLQA 1KQYA 1V02A 1UQYA 3PZNA 4M82A 3SCRA 3ZOAA 3PBGA 3NSNA 1XCXA 2XSBA 3K8MA 2MANA 1BPLB 3GM8A 2EPMX 1OM0A 2EEXA 1CIUA 1UQZA 2J47A 1G01A 2BVTA 3GH7A 4AMCA 4AD4A 1KWKA 1OINA 3DYOA 5AC5A 2X09A 1GORA 1M01A 2BHUA 1GW1A 1XRVA 4JKMA 4ZFMA 1CENA 2XIBA 3HN3A 4H8HA 4PBGA 1HL8A 5A8PA 4FLRA 3L4YA 4Z2IA 2WPGA 1W3HA 1IZKA 4CCDA 3CZGA 1BSIA 3EDDA 3THCA 3ARYA 1DWHM 4HOXA 2CPUA 3CMGA 4WSJA 2FH6A 3ZIZA 3AS3A 5F7UA 4DUXA 3VILA 1EOMA 2EPKX 3WMBA 5HPOA 3T2OA 3AIWA 4S3KA 3HJEA 1HVXA 4JZ5A 1OGSA 1SMDA 1X1NA 5BXPA 3S2CA 3ARQA 1KXQA 4HTYA 1LF1A 2WW5A 2G3NA 4D1IA 4HOWA 3TTOA 2BY1A 3RM4A 6CGTA 5CPQA 4JL1A 5A8NA 2YL8A 4MNJA 1HN1A 4MAZA 2EQDA 3AIRA 4IPNB 4Z2LA 2WK2A 3WNMA 1K9DA 3SCTA 1BGGA 2VC9A 3VIMA 3WBEA 4P8WA 2AAAA 5A8QA 4EE9A 1RD6A 4WJXA 2XM2A 4J3UA 5I6SA 1UA7A 4JL2A 2Y2WA 1JI2A 3UETA 2WHKA 2JF7A 2YBTA 1JNEA 1JL8A 1JAKA 1Q6DA 4NRRA 4RL3A 3U5UA 1WZAA 2CKRA 1UR2A 1UD5A 1ITCA 5I79A 4AZCA 1HXJA 1HJQA 3EDJA 3A4AA 3ARXA 3F5LA 4AZIA 1AQ0A 2VZTA 3W82A 4AEEA 1VJSA 4QDMA 2X1IA 1XSKA 2YDQA 3AS2A 4W87A 4UFLA 1C7SA 2J7BA 1V6VA 4EANA 1BG4A 4HMEA 1PEZA 4QLJA 1GZJA 3GBDA 3CUHA 2WVUA 4AZHA 3UG3A 4PMYA 1X6LA 3WH6A 1UKSA 4KGLA 3TP4A 1NM9A 1QHOA 3MUAA 4HU8A 1ZBVA 3BAKA 1C7TA 2WVTA 2UY4A 2W67A 3ARUA 5ABHA 1EHAA 2OYMA 3AMKA 3M07A 1E6ZA 4Y7EA 1NWSA 4CCCA 4F9DA 1FFQA 3E1F1 3IJ8A 1V3HA 4V2XA 3ARRA 1QI5A 2J7DA 1DWFM 5CGTA 1UZ1A 3VD5A 5A6BD 3B8SA 5D9NA 3MU7A 5A6LA 4PCTA 1DWGM 2A3HA 3ZR6A 1QNRA 3VIHA 2DSZA 4B9YA 2QMKA 1EQPA 1GOKA 4HP5A 3IAQA 5LA2A 1H2JA 4U3CA 1JF5A 1OSEA 4N0RA 1R7OA 1W1PA 3CIVA 4AWEA 4ACYA 2PWGA 1GOMA 4CU7A 3EDKA 1PJ9A 2G3JA 1XYFA 3RCNA 7CGTA 1FP9A 2E40A 3TTQA 5CSUA 3WEOA 2E4TA 5CLTA 4GINA 4J3SA 4XB3A 3VIIA 1JXKA 2BVYA 1E1EA 3AHXA 3ZT6A 4PRWA 1C3FA 4D71A 1J0YA 2Y5EA 1E6QM 2E8YA 3CO4A 4PMOA 3CHFA 1N82A 5E0CA 4UTFA 4D72A 2OSXA 5CPSA 2CHOA 2VRKA 5HBFA 2VVNA 1LG2A 1GQJA 1QNSA 1EHNA 4CU6A 4WLCA 3AS1A 2BV9A 3AHZA 1BQCA 1E43A 2G8ZA 1L8NA 2EJ1A 1E72M 4GKLA 3SCUA 1J9YA 2WC4A 1G5AA 3FAWA 1CECA 1TG7A 4S3JA 4X0NA 3U5YA 4H41A 1UR1A 3CGTA 5CSYA 3BSGA 4Q7NA 1V0LA 4CD7A 3ARWA 1OCQA 3MUY1 5I2UA 4OUEA 4DM2A 3W28A 4J3TA 2YOCA 5CQ1A 5HNNA 4J3VA 5BRPA 4R27A 5M3WA 1KBKA 2WAGA 4C7DA 2WNWA 4PUDA 1B90A 1CBGA 2GK1B 3MKKA 4GQQA 1NQ6A 1W1YA 5I23A 4W7WA 2WMHA 4PSRA 1JYWA 3VIKA 1HT6A 3UR7A 3VGDA 1BYAA 5M5DA 2DQXA 3CBWA 1R8LA 1E5JA 2OYLA 4A3YA 1WPCA 5LA1A 2J7CA 3VIJA 3B9EA 3SEPA 4DWSA 5A94A 2ZOXA 1GUVA 1UH4A 1FOBA 3ALFA 1NWUA 3TONA 2ZX6A 3WQ5A 2J77A 1UKQA 4WKFA 2VCCA 4AD5A 2D2OA 2XVNA 1C90A 4E2OA 4H8VA 2WSPA 1UWUA 2J7HA 1QI0A 1C8YA 1XD0A 1DP0A 3N9KA 3EYPA 5A6KA 2VNCA 1E1FA 4ACZB 1TA3B 4JFUA 2DT0A 5EMYA 1RP8A 4W5ZA 1M03A 2NSXA 2VO5A 3QHNA 3AFBA 4D6DA 2J75A 1R7AA 2WHMA 3MMUA 3DECA 3VGEA 3AI0A 2A3AA 3ARTA 1ZBCA 1QPKA 5HXMA 2WMFA 2FHBA 1FFRA 1PPIA 2J7EA 2ZUMA 3PTKA 4CGTA 3VKKA 4TTGA 2ZE0A 1MXGA 2WBGA 2XVKA 4YPJA 3VGFA 2VX4A 1ZJBA 3NCOA 2VZUA 1NP2A 5FKYA 1MQRA 2XUCA 3VD7A 2X0YA 2BXZA 1JZ4A 1E4LA 5E70A 4MB1A 1HP5A 4AZ5A 3GH5A 3WH7A 4HZ8A 4MAVA 5DEZA 5I24A 3MUIA 2WMKA 1KQZA 1M7XA 4AD1A 2O9OA 2VI0A 4DWSC 2D22A 5E09A 3WH9A 5BCAA 5I77A 3WD0A 2DSVA 1WZKA 2FGZA 3N18A 4UZSA 3PZGA 2GDUA 2YA2A 3VIFA 1ZS2A 2VMFA 3WD1A 4CU8A 5E6ZA 1KGWA 3WDHA 3ZT7A 2J78A 4AIOA 4W93A 1B31A 3UESA 1E6RA 2PB1A 3ALGA 3BAIA 3NDZA 2W62A 4WK9A 3ZM8A 1CYGA 1KBBA 1LG1A 1BHGA 4L4PA 4HA1A 1PZ2A 1QBAA 1EH9A 2RGLA 5A2AA 3WBAA 3ZJ7A 1CTNA 3RMEA 2DIEA 3AIVA 3L2LA 1C93A 2C7FA 1UR4A 2D0GA 2CNCA 1GOWA 2F2HA 2PWHA 2D0FA 4F66A 1H3GA 1W1VA 1UR0A 3SUUA 4GI8A 5CJ5A 1UD3A 2J8FA 1D7FA 4QLLA 4UNIA 1QW9A 1E40A 4LXFA 3CTTA 2JE8A 1ODZA 4U33A 1CZ1A 2PI6A 1JGIA 1G0CA 1ZBWA 3VX0A 1W2PA 1ZJAA 2ZXQA 3N13A 1E56A 2WXDM 4UQDA 4TVUA 4FK9A 2WLYA 3UG4A 3CZKA 2DSUA 1GJWA 4PMDA 2WHLA 3MSGA 1B3VA 1V0MA 2VZVA 1V6YA 3NYDA 4JAWA 1Q6CA 2WSKA 5ECUA 3GBEA 3VGGA 1MVYA 4AW7A 2NT1A 4D6IA 4GXPA 3VD4A 3OIHA 2WVVA 1HJVA 1MWOA 3AIBA 4DUVA 5EBAA 1HJWA 3AIQA 2IXVA 3QGVA 3PHAA 1R87A 2GVYA 3U7VA 1XCWA 5DFAA 4M81A 3OGSA 5I3DA 3AIEA 1OIMA 2XFFA 1A47A 1TVNA 3GYCA 3CLWA 3N04A 1ODUA 1UKTA 2WWDA 1BYCA 5FCZA 1XV8A 1BTCA 2CBIA 1JZ5A 1B0IA 3BAJA 2V3EA 1WE5A 4GZJA 2XIIA 3W0KA 4QFUA 3PTQA 3A4XA 4PTMA 3WNPA 2A3BA 1WDQA 4AZ7A 8CGTA 1EA9C 1CGYA 4H04A 3WNOA 4GZIA 5DMYA 2WM0A 3BC9A 3AISA 3WD3A 2DSWA 1H1NA 5I0DA 1LQ0A 3GXIA 1SR0A 3VOCA 1EO5A 1WO2A 8A3HA 5FIPA 1DEDA 2W4XA 1W32A 1C91A 2CIPA 1J0KA 4UQBA 2YL6A 1W9XA 1TUXA 2GJRA 5IDIA 1ESWA 1TVPA 4AD2A 1ISZA 3ZSSA 1CXHA 3GDBA 1OGBA 3VIOA 4HMDA 4AZGA 3KZSA 2DIJA 1CXKA 4AIEA 2V3DA 4BA0A 4MNKA 4IM4A 4P7LA 3VNZA 4PMVA 4W86A 3EMCA 4KGJA 1VEPA 1BYDA 3MMWA 1I1XA 3UCQA 1J01A 1HP4A 4B16A 5A6AA 4JFVA 3WUGA 3WQ8A 2XGIA 3SCVA 1V02E 3WDIA 3VIGA 2Z1SA 2WZIA 1V03A 1CXIA 1QI4A 2OWWA 4F9JA 5GNXA 3WH8A 2J25A 4C7GA 4H8UA 1VFOA 4LPCA 4Z2KA 2BXYA 3A6OA 1E6SM 2VOTA 1V6WA 4M56A 1QNQA 3A47A 3CH9A 1CXLA 2CETA 4QCEA 3HU7A 2WCSA 4HMCA 3PZOA 3O9NA 1DWAM 1MYRA 1KCKA 1Q6GA 4MB5A 3WD2A 9CGTA 1VB9A 4YN5A 3RM8A 2J7GA 2J7FA 3M6DA 4D6FA 2VT0A 3DC0A 2ZWZA 3L4ZA 4HPGA 1UH2A 4H2CA 1U30A 4BF7A 2BHYA 1JYXA 2O92A 2UY2A 1X6NA 3AHVA 3K1DA 2D3LA 3T2QA 1HJUA 1E5NA 3KL5A 4AZCB 1LWJA 1H0GA 4XX6A 4C7FA 2CITA 4PMZA 3SCOA 4LYRA 3WF1A 4TX8A 1B30A 2W61A 1PIFA 4RE2A 4YHGA 5FOOA 1HVQA 4Z2HA 4UFMA 3OLIA 5GQBA 2XWEA 4E8DA 4W7UA 1EQCA 3GZAA 3N15A 3SIMA 3VMPA 3N1AA 1J0ZA 4LQ1A 5CPTA 1KCLA 1JF6A 2GJXA 3PZVA 1J11A 1CEOA 1E73M 3T0DA 3MSDA 3W27A 1DHKA 3GH4A 1JZ7A 2PWFA 3BGAA 4N42A 1JNDA 2GDVA 1YQ2A 3ARSA 4W8BA 1TE1A 2WMGA 1B2YA 3VUPA 1BFNA 4P7QA 1B3ZA 1QI3A 2AMGA 5DT7A 3OLGA 4P7OA 3FHAA 2XJ7A 1F4AA 4WKHA 1OIFA 1VENA 1E15A 1JFXA 1CPUA 4D1JA 1B3WA 5GPRA 3WUBA 1WDPA 2J8GA 1JYNA 1CWYA 4HPHA 3AICA 4D6CA 1W3JA 1H49A 3JUGA 3L4VA 1W3KA 4V28A 3OGRA 3SUWA 1NOWA 3CUGA 3AZRA 2D24A 3GNOA 1L0PA 1UUQA 1C92A 2WANA 3AQUA 6TAAA 1Q4NX 3T09A 1I75A 3SCSA 2VL4A 3ZT5A 1NWTA 5LYRA 1FHLA 3WQ4A 4W7VA 3D3AA 4X0VA 3VIPA 1UR8A 1LL6A 1EGZA 2QHAA 3AYRA 3WNLA 5CLWA 1A3HA 2RGMA 3LPPA 3PZMA 3N11A 4J27A
chains in the Genus database with same CATH superfamily
3CQIA 2OSWA 1XUZA 3MYOA 1NP0A 1D3GA 4LW7A 1XQLA 2RAGA 5LHFA 3E0VA 3M43A 4QG9A 4AIUA 3NR0A 4BS0A 2NXIA 3THAA 1CLXA 4CNNA 4WY0A 3ENLA 1W8SA 4W8AA 1T7LA 4GQ0A 2YBVA 3MUXA 2EG6A 3QYSA 4UUIA 3VCRA 5GNYA 2ZUSA 1KCZA 3LHZA 4HOZA 2ZVIA 4KKXA 4XIAA 5A6BA 2XFYA 3VNLA 4O52A 1VFMA 4IP4A 1P6BA 1FH7A 4US5A 4F8XA 3OODA 3EWXA 2GWGA 3NGJA 2HISA 2ZC8A 4P8VA 3G1HA 2F84A 3B0YA 1L2QA 2ZBTA 6REQB 1KW1A 1SZRA 1BYBA 5A8OA 3PJTA 3TYCA 3U2EA 2ZUNA 2GSHA 2O9PA 4PL2A 1H7NA 5BNKA 4DJEC 3W1UA 4WXZA 4YVXA 2NVDA 3DFOA 4GLEA 3OBAA 4XAPA 4FNSA 2V2HA 3LLDA 2NW0A 4GUIA 3CH0A 3NL5A 3KX6A 4MY9A 2ZZ5A 4MKNA 4QGCA 4XG1A 5C54A 1DJHA 2OYKA 2Q09A 3N3MA 1VS1A 3A13A 2PBOA 3L5AA 3Q65A 5C2GA 3EB3A 3FW6A 1DIKA 1JCNA 3MI3A 3DXIA 2I57A 3QOMA 5C70A 4AAJA 4PB4A 1BTMA 4PH6A 3MO4A 1SYTA 3HMJG 1WZLA 1XR2A 4JIEA 3AUOA 4JTLA 3EDFA 3QSTA 3SRDA 1IE7C 3MP5A 1W9VA 3GFXA 5IBXC 3LU2A 5M17A 4Q8TA 2VD9A 2QR6A 4LUTA 3LCGA 3IJQA 3VE7A 3SCWA 1YKWA 1ZZMA 5D09A 1X6UA 2J4GA 5DT5A 2QCHA 3TTSA 3WFLA 4GVGA 1JQVA 1H7RA 3BICA 2FTYA 1JRCA 4IFKA 3CO8A 2ZWYA 3LB0A 3BGJA 1YIXA 3GDRA 2NT0A 2ZKMX 4DJDC 4NSBA 2OQYA 3RMJA 1JAEA 3URQA 3MUZ1 3VGHA 4IP5A 3WLLA 3GC2A 4OV9A 3COTA 2PLKA 3RCYA 3BG9A 1W6TA 3HPZA 3WD4A 3G8RA 4KT2A 1UA3A 3T55A 2GJPA 1M7PA 2IQDA 2C0HA 3W85A 3UCCA 1YNQA 2KZHA 1TX2A 1A5OC 2R1MA 4LCQA 2Q71A 1V6XA 4EF8A 2AQWA 2Y7DA 3TCEA 3IJ6A 4EAYA 1PHWA 1VRDA 2VDGA 3VMNA 2IUZA 2DUZA 4NT0A 2UY3A 3W26A 1HL9A 4Z1AA 1LROA 7XIMA 3WBXA 2WQPA 5J5DA 4F3HA 4RPPA 3SZ8A 1NTHA 3M6YA 4ALDA 5E1QA 5FL1A 3BLDA 5KEZA 2DT3A 1QHPA 2D3NA 3LMYA 3PJUA 1UR9A 3QQWA 3CHDA 2V30A 1V08A 3NQDA 4N6EA 3BXWA 5LXXA 1UP0A 2VC7A 2R6OA 2O0TA 2QJMA 3SI9A 2X40A 1Z42A 1LUCB 2WCGA 2QUMA 2R1PA 4XD4A 3F4WA 4N6FA 5AZ0A 2WVVB 3JU2A 1THFD 1JD7A 3LPOA 3L5LA 3KRUA 1OT2A 1F3WA 3GNPA 2DZWA 4U31A 4KWWA 2EXOA 5J04A 1W5PA 4XWUA 3D5HA 4ZQPA 3UCDA 3VNDA 3QW3A 4UC5A 2WZHA 2PWDA 4A3QA 5JMUA 2X42A 3TA9A 4C90A 5FF0A 2A0NA 1YYAA 4CN4A 1ITUA 4PTXA 1LQ2A 3VVGA 1DHPA 4RE3A 3ANYA 3FJNA 5A69A 2BGSA 1FH8A 1FWCC 4P8UA 1H7WA 4A6GA 4RLIA 4GI6A 1JZ3A 3CB3A 4N02A 2OSYA 3LY0A 2YZ5A 3WH5A 2Y1HA 2B81A 2GOKA 3BMXA 4ZB5A 3I65A 4LY8A 2EPNA 3GS6A 3FHQA 3FNDA 3W86A 1IT7A 1QPOA 3EZ4A 3AXXA 3MBFA 5C9WA 3MANA 2TMDA 3TSMA 2Z24A 1PHQA 1KXHA 1EF2A 1DXIA 5HDRA 3W2UA 5KTLA 3HFYA 1ZRQA 3RITA 1XH0A 4MNMA 3IJIA 5A1AA 4ECLA 4TOQA 2DZVA 4L9XA 3A4WA 1G67A 5C9RA 2QUNA 4M24A 4FXSA 4U3AA 1MFUA 4FR6A 4UOJA 2YL9A 4UZUA 4W85A 1GQIA 3GR7A 2E9BA 4HJWA 4URIA 1NARA 2JFEX 4PN2A 3C2YA 2FMNA 2WZEA 4MB3A 4M8UA 1SJAA 1EIBA 1XIEA 1GVFA 3MV01 3TH6A 2QXWA 4W8LA 3LNPA 4WJ8A 3KM8A 4UMAA 2XWDA 3V0TA 2R24A 1FVPA 1WAUA 3WN6A 1HJXA 2Y7GA 3N34A 2F61A 4TQTA 2BY0A 3T7VA 1R85A 1Q6EA 3O6YX 1OF8A 1IXNA 1SM9A 2WLZA 1RPXA 3O7UA 4MSSA 4U5IA 2QZRA 3QV8A 4XZIA 3BZJA 3Q2DA 1MQQA 5HWNA 4DN1A 4AD3A 3E0FA 4LAKA 4MLRA 2QUTA 3II1A 4PSPA 4Q4PA 4DF1A 1TMHA 3EWDA 4FAMA 1QK0A 3M5XA 4PUNA 3AJ7A 1FY6A 2HSAA 3N25A 4KEZA 1X8FA 2Z1KA 1FXQA 4G2DA 2CBUA 4IGHA 2ABBA 3KVJA 1SW0A 1E4IA 2WC7A 3HGSA 2DT2A 4X9YA 2EAWA 2GJXB 3ARVA 1M68A 1ITXA 1R30A 3WQDA 3KEHA 2W66A 1TRDA 3S4TA 1KA9F 3VC6A 1E51A 4B2DA 4PMXA 1D8CA 1OD0A 1WKYA 1T96A 3L65A 2HJPA 3UG5A 4M6PA 2V5LA 1H1ZA 5HJXA 4DO5A 3M44A 2QAPA 3A5VA 2C1HA 4AFYA 1G9HA 1JCJA 5I5RA 5G1YA 1ME7A 4KWVA 2PWEA 2YCJA 5FEWA 5I78A 4H6EA 1Y0EA 4ZO8A 4TR9A 3GG0A 3R94A 1O68A 2BVWA 2WWCA 4NG3A 2WNNA 3DHPA 5D4YA 2XM1A 1J0JA 1YPXA 1RBAA 4AY7A 4GJJA 4MG4A 3W25A 8XIAA 4IUGA 3VFCA 1AH3A 3CQHA 2Z0IA 3GHTA 4OZOA 3IUHA 4D8AA 2IPFA 2D69A 3GR8A 3ZQ9A 3GE7A 2ZYFA 4PBFA 4CCZA 2Z1VA 5BYWA 4QIUA 1XLLA 3JVAA 3MMDA 2QCEA 4DZ5A 4WY0B 4EPDC 3VM5A 1M7JA 1XPYA 5FJOA 5HWJA 1W5OA 3MKCA 3QHMA 2Z00A 2D20A 2WQDA 2PDWA 4XAFA 3L4XA 1WB0A 1A5AA 3RGTA 4EAMA 3KHJA 1KFBA 4IQDA 1PX3A 2XN0A 1ZGDA 4ROQA 1A5KC 4ZO6A 5GJNA 1XLBA 4TXEA 4GUHA 3AOFA 1Y5WA 3E74A 3PBUA 3W7JA 3HTWA 2FDMA 3C86A 4OOZA 1EO7A 2XINA 2E5DA 4ZQNA 4QLKA 3PPCA 2WC3A 3SY5A 2CU0A 5BROA 2ZX7A 4CD5A 1J96A 1EX5A 3AHTA 4Y96A 5DMLA 5KZEA 1XISA 2J13A 4JEQA 1IT0A 3AZTA 1XLDA 1O66A 3NQEA 4HSHA 1O7AA 4J3WA 1PVNA 3GIPA 3M0JA 5HMEA 4POCA 2HK1A 4RNJA 3TW6A 1FCBA 2RHGA 3OVPA 2FZMA 1N8WA 1ZQ5A 2NLIA 3G3MA 1B3XA 2P8BA 3FSUA 3GW3A 4GIEA 4LV4A 1DYSA 3PN8A 5LGXA 1K9TA 1LOSA 2IS7A 4G56A 4ZENA 3T9PA 5HNUA 4KRZA 3MTWA 1WDRA 4ADUA 4LUTB 1KWGA 1OT1A 3B4UA 4WDWA 1HUVA 1V77A 4MJ4A 2JQXA 1E70M 1GT8A 1XD1A 4MKSA 1XIMA 3SO7A 1Z41A 4XUYA 5CSRA 2EPOA 4DBEA 3OB8A 1HZYA 2DZSA 1MDRA 2PDKA 1OGGA 2ATSA 3TYBA 4KWUA 2Z28A 4IFKB 1VCVA 1JD9A 4ZMGA 1PZ3A 1VKFA 4YTRA 3O6AA 1DBTA 3CAWA 4MOZA 3C2VA 1QBBA 3DFPA 2CHRA 5HMFA 2EBNA 1H7OA 3E2SA 3W1LA 2FGLA 4IHCA 4MNLA 3IJDA 1I1WA 3URBA 4O16A 1UROA 1R47A 2HPMA 4TVDA 4EK7A 2HROA 2V5CA 3QR0A 1FWJC 3VOFA 1B9ZA 3LYEA 3ANUA 5C55A 3QQ0A 4WY0F 3KDOA 3R8HA 2XFRA 3TYZA 2XVPA 4LRTA 4MLJA 2FQIA 3AUJA 4NHVA 1UC5A 1KRAC 4FNPA 3RLUA 1AQFA 1UD2A 3Q67A 5A6TC 3V5CA 3IIVA 4H6QA 4JTFA 2JF6A 4J3ZA 4ZOEA 3WF0A 4DHGA 2Y0FA 1EL3A 3UFYA 1SO4A 3GXNA 1TJ1A 1E0XA 1QPQA 1RCXB 5HK4A 2NV9A 2D23A 1K8XA 4W88A 3W1TA 5LIKX 2I9UA 1XYZA 4RXFA 5M03A 1O1HA 2QDGA 3IVSA 2C6QA 1A5LC 2CW6A 3QR3A 3LXBA 3VDCA 1LP6A 7A3HA 4BCEA 3DESA 2VCBA 4NF7A 4XZHA 4V27A 2GGJA 2VFHA 1ZFJA 3WDQA 4XKMA 4DUWA 1US3A 2NWSA 4A4AA 4KH2A 3CM4A 1ZENA 1BF2A 1UH3A 3W7IA 4KEVA 4NQ1A 1G1YA 3C61A 4M7TA 4CN6A 2JALA 1V3LA 2XPKA 4AVFA 1Q2RA 4AXNA 1IXOA 4I9MA 1KGXA 1SFSA 1P0DA 4R3UA 3PSWA 4EPEC 2X30A 1GONA 3LEPA 1QNOA 3EA2A 3PP7A 1I4NA 2BX7A 2AGKA 1Z32X 1Q7ZA 3DG3A 1KTCA 1SZGA 5H6HA 5C9UA 3PY2A 4JYFA 1R3TA 3W7RA 7ODCA 3TJLA 2OKTA 4ICNA 4AZBA 1W31A 1AW1A 3UGVA 1MW1A 1PB0A 1OYBA 3LD5A 2ZICA 4QP0A 5BMXA 3IK2A 4GBUA 3QW4B 4J3XA 1ZP4A 2BVDA 4E4PA 4LBRA 4XQ6A 3ICJA 4K68A 3FVDA 1CDGA 1FUYA 5CZKA 1QU4A 1NY1A 3VO0A 1FP8A 2BFGA 2ISFA 4A2SA 4WKAA 4LYKA 1AL8A 4UFKA 4YTQA 4YCPA 3POCA 2P10A 3CPRA 3LI0A 4HU0A 5G5IA 1PDZA 4PUEA 3N3TA 1BQGA 1FWBC 2GOUA 4Q6JA 5F1VA 2ZVRA 3S5ZA 2OLSA 4HA3A 3CZJA 1FHVA 1E6NA 3R79A 4HHHA 2Z6JA 2C91A 3SN0A 1CLVA 3BJTA 1UHVA 3A3HA 1V79A 1XHGA 3OLEA 2I56A 1FWWA 2OT0A 4FLQA 1KQYA 3UU0A 3RCMA 1VBHA 5CPLA 3IRDA 2BODX 3NSNA 2PDHA 2XSBA 3K8MA 1BPLB 1TWSA 2BBFA 4O10A 1JPHA 3GVWA 3BW3A 3CWOX 2OGYA 2BVTA 3B0PA 1OINA 5AC5A 4O54A 2XH4A 3E5PA 4DIAA 1NAL1 3UWZA 8RUCA 3F2DA 3SADA 3C0QA 3I68A 3M64A 3DDMA 4ZFMA 2XIBA 3S2NA 3HN3A 5DXXA 4H8HA 3EXTA 3IIPA 3A22A 3NOYA 1IZKA 4CCDA 1GEHA 3EDDA 3THCA 4QE4A 1DWHM 4LAMA 2FH6A 3ANVA 5F7UA 3PM6A 3ONBA 3M0YA 3M41A 2EPKX 4IF2A 3WMBA 2ACQA 1OGSA 1SMDA 1X1NA 1AJ2A 4LY4A 4NU7A 5FEXA 3OYZA 1TRIA 4JN6A 3GR4A 2YL8A 4DJFC 4RW5A 3DIPA 1IIGA 1W0MA 3EOLA 4IPNB 3BK0A 2WK2A 4FALA 1G4EA 3LERA 2W6RA 4S3CA 3E0IA 4DLMA 5A8QA 5FEZA 4YWSA 1PDYA 1W54A 2XM2A 2OVLA 1U5VA 4HNNA 4KEUA 5DY3A 2JBMA 3UETA 3BW4A 1G6CA 2QV5A 1JAKA 1Q6DA 1VBGA 3CMFA 4QS5A 4PTDA 4L56A 3GUGA 4AZCA 1HXJA 2PDIA 1I2RA 1AQ0A 1P1XA 3PR2A 1S39A 3W82A 3FK4A 4DJED 4B5SA 2KAUC 2WPBA 3BUVA 1XSKA 3AS2A 4ZOAA 2J7BA 1BG4A 4QLJA 1XYAA 1D8WA 2Z27A 3CUHA 3KBMA 5DN1A 1X6LA 4KGLA 1NM9A 3C56A 1DE5A 2NX1A 1QMLA 4F2UA 5ABHA 3QPEA 3OHIA 3TK7A 1V3HA 4F2BA 1QI5A 3EXSA 3PJWA 4WRHA 1RQEA 1UZ1A 1KD0A 3WX7A 3C8NA 4S2CA 1DWGM 1LWIA 4LVGA 4ZCWA 1M9HA 3PUEA 3GXPA 3HBLA 3TNBA 1B3OA 1H2JA 1JF5A 4DX3A 3CIVA 1A5CA 1IT8A 4PTNA 4I7VA 3RCNA 2FFCA 3NQVA 2E4TA 4RDYA 3VIIA 5M2FX 3ZT6A 3P14A 4REQA 1TJ2A 4JN7A 1XJBA 4N7QA 3CO4A 4NJGA 3TUUA 4N2YA 3MVTA 2OSXA 3OOQA 2VRKA 3W07A 1RLDA 4L6DA 4DJDD 1KBLA 1EHNA 1OYAA 3U2ZA 4WLCA 3AS1A 2HQAA 1MMFA 3AHZA 1ZSXA 1E43A 1TPUA 1OCNA 4Z1YA 3SCUA 5CG7A 4J1OA 1G5AA 3LHYA 3TIMA 2VP8A 3IIXA 4S3JA 3EX2A 3TROA 3RLGA 4Q7NA 2IPJA 4KCVA 4OUEA 1DTNA 3KTSA 2YOCA 1Z44A 1A4MA 5HNNA 4K8HA 3LHVA 4W7WA 2OZ3A 2WMHA 4I7UA 3BL3A 1J5SA 5I3GA 3WK1A 4O4WA 3CBWA 3FFSA 1E5JA 4A3YA 2VDHA 1WPCA 4GC4A 5LA1A 1ZLPA 2X1TA 1KFKA 2X7WA 4KFOA 3SEPA 4JTSA 1A0EA 1GUVA 1N2VA 2O56A 3TONA 3AU2A 3H24A 2ZX6A 5FJJA 1UKQA 3EPNA 4X3ZA 4AD5A 1N8FA 2D2OA 2XVNA 1C90A 3KLKA 3NEHA 2VEGA 1UWUA 2Z29A 3UNDA 3EPOA 1L6GA 3EYPA 1RSCA 2DT0A 5EMYA 3N2BA 4D9PA 4QROA 1RP8A 3QGAC 1XBZA 1RJPA 2NSXA 3B03A 2VO5A 4HD5A 4Q4OA 2WHMA 4B91A 3DECA 3A4JA 1UUMA 5HXMA 2GVGA 4L1XA 5F1UA 4RCXA 2RH9A 2J7EA 2XH0A 3CT7A 4UTWA 4DWDA 4CGTA 2ZE0A 4TTGA 3VGFA 2VX4A 3ITTA 3OTRA 1NP2A 4L9ZA 4MFDA 3FX4A 1KRMA 4JR5A 5C9XA 3ATZA 5E70A 4XZ9A 3U4FA 3WH7A 2D2JA 4JY8A 4ZBCA 1LBFA 2A7PA 4H9MA 4DWSC 1UPMB 3WLSA 5E09A 2VEFA 3WH9A 5I77A 5BOOA 2OO0A 1E0TA 1RBLA 3PZGA 4DEFA 1ZS2A 3QZEA 3M0IA 3WD1A 2E68A 4FF7A 5I3IA 5E6ZA 1P0NA 1KGWA 3WDHA 3ZT7A 1F9CA 3BJSA 3W1QA 4AIOA 4W93A 4G7FA 1CW2A 3KTCA 1RZMA 4BR1A 3R4IA 2Q02A 2PB1A 3ALGA 3GFYA 3NDZA 2FVMA 4WK9A 4A3RA 3WLQA 1CYGA 1KBBA 1LG1A 1QBAA 1Q6RA 1W5NA 4IIEA 1CTNA 3AIVA 3TQPA 4Z1BA 1GOWA 5EMJA 1UR0A 3SUUA 4GI8A 4LUYA 4CQ9A 5B7ZA 4QLLA 4UNIA 1E40A 4NXKA 4WUIA 1EKOA 3KFTA 5FJTA 1O5KA 1ICQA 1CZ1A 2QJJA 4IIFA 3S2JA 3VX0A 4WX2A 5DBUA 1ZJAA 2Y7FA 3UZXA 2PDPA 5AECA 1XDJA 4TVUA 2DSUA 4FNQA 4GA8A 4TIMA 4PMDA 1B3VA 1JRBA 2BOFX 1BKHA 2NSOA 2H3BA 1YXCA 2W79A 5ECUA 5FJRA 3HB9A 2HE8A 4TU1A 1OFRA 4GXPA 3VD4A 3PPHA 4ZOBA 3S3GA 1YMYA 2QQ6A 3DKLA 3QGKC 5T91A 1XQKA 3U7VA 3KVMA 3CV1A 5HR7A 3V16A 4M81A 1JDEA 3F03K 3OGSA 1M6JA 5I3DA 2EKCA 1MEIA 1AMKA 4H01A 2VR2A 4RDZA 4UR7A 4R33A 5AHNA 1GVQA 2HMCA 5M1TA 3N04A 4LANA 3P0XA 4H1ZA 4GFIA 4JICA 2YFOA 5G1MA 3NQMA 3MDUA 3TNOA 4KPLA 4GZJA 4UMBA 4O17A 4O1FA 3E49A 3NQBA 4PTMA 4GIYA 1R38A 3O0FA 3QN3A 1XLHA 2X1RA 2WM0A 3BC9A 3ZVHA 3WD3A 4DAIA 1WOBA 2DSWA 1H1NA 5C7VA 4WSHA 4CQCA 1XYCA 3VOCA 1DXEA 1AFSA 1EO5A 2C18A 1DEDA 3WLOA 2CLLA 3TAOA 4LS1A 2PDCA 2CIPA 2HS6A 1QXLA 1W9XA 1JQXA 1V8EA 1FWAC 1MZHA 3K1GA 4FXFA 2ZFAA 1CXHA 3GDBA 3MCOA 4HMDA 4OQVA 4AIEA 3P0WA 2V3DA 3TJXA 1OABA 3UJRA 4K6AA 1F73A 3CL6A 4MWAA 4IGNA 3VNZA 4W86A 3W7DA 4LEFA 3EMCA 4JHMA 1BYDA 1QWKA 1HP4A 3N29A 5CZTA 4WCJA 3BLOA 2XGIA 1J5TA 1CXIA 1ICPA 1F3XA 3I4KA 1GG1A 4GYFA 3WK3A 1D9EA 3CXOA 4F0SA 2OKOA 1E6SM 1IEQA 1UP3A 2AQOA 3NNTA 4HMCA 3O9NA 1DORA 3PUGA 4GISA 1LOLA 3U48A 4MB5A 1XLKA 1R9XA 1XW8A 8TIMA 4OTKA 4D6FA 3C0LA 3V7PA 3OG3A 1PYFA 4LCRA 3H55A 4GXMA 3B04A 3GKFA 4TV5A 3QTGA 4QG8A 4DYKA 1JYXA 2O92A 1K8CA 3T07A 1LDCA 1NFPA 5G2IA 3AHVA 3K1DA 5CBBA 2D3LA 1HJUA 1E5NA 2XH7A 1ZPTA 4AZCB 4MY1A 4EACA 1X97A 3S42A 4TX8A 3W2JA 2PP0A 1WQ5A 1TTQA 4B4HA 1KNWA 3QY6A 5DQPA 4E8DA 1Q65A 3DFTA 3W7NA 3H26A 3N1AA 4LQ1A 5CPTA 4CQAA 4QS6A 1KCLA 1SSGA 2PS2A 2QNEA 1J11A 2DW7A 3T0DA 2V6AA 3WJYA 2A2IA 4XKYA 4N42A 4O14A 3ZXWA 1W1IE 2OX1A 4LNYA 4HNOA 3S1XA 3EWBX 1B3ZA 4GHRA 3OLGA 1DE6A 3GQYA 1WKEA 3W76A 1YDYA 2CLIA 2PUZA 3UWWA 4PB3A 2XJ7A 1OIFA 1JFXA 3FJ4A 3OA3A 4HPHA 3KW3A 2BZNA 2QT3A 3L4VA 3P6LA 3DOPA 2HK0A 4YS1A 1NOWA 4GIRA 2F6XA 3CUGA 3AZRA 2D24A 5D37A 3GNOA 1UUQA 1C92A 2WANA 3SCSA 1JUEA 2V5BA 5L6UA 3C4UA 3WQ4A 3REQA 1QRQA 2DU2A 4REQB 1OVDA 1UR8A 2O4QA 1LL6A 3MW7A 1P0EA 2QHAA 4AY8A 1A3HA 3LPPA 2Y89A 3N11A 4O1EA 2CWXA 1EGMA 4WJEA 3W7HA 4J27A 1FWRA 4PMQA 5TBOA 4FF5A 4Y9AA 2UY5A 1VHCA 2PCQA 3LHWA 2E9LA 4S3AA 1EJUC 3SURA 3GG8A 3WFAA 2P8CA 3T4CA 2YCLA 2CXGA 4QHRA 5I3KA 3PVFA 4I6VA 4NILA 1TWDA 1WKDA 2J79A 3FLUA 3PSVA 3R10A 5FAGA 3TSDA 3RRAA 2PGWA 4NI8A 5CPMA 2DDXA 3LHUA 4H00A 4AWUA 4NX5A 1K4GA 1GCYA 4UR8A 1EC8A 5AVNA 5IXEA 3B0VC 2VRJA 3VDAA 2DVTA 1TPB1 4JCMA 1HF6A 4UQ9A 1J18A 5KZMA 1AA1B 4IIHA 3QPZA 2A6NA 3PTDA 2WYSA 4ML4A 2JGQA 3H22A 5AY7A 4KF1A 3EDEA 5D02A 9XIMA 3I6RA 3E3HA 4W9TA 4HB7A 4ZTXA 4YTUA 4HQVA 1NJJA 5BMWA 4QJ5B 1JFHA 2XHYA 4GX9A 3R8GA 3DFQA 2QLYA 3LCIA 3T44A 4DQWA 5SWUA 4UFJA 1XH2A 1VFUA 4DO4A 2D0HA 1VAHA 3EOUA 3L7RA 3TQ0A 3O2LA 1AZ2A 4LVBA 4M6UA 3WY1A 2PWUA 1IGWA 4GVIA 3G1YA 4JIPA 4JQ4A 4AUBA 1JDFA 2XIOA 1ISWA 3MC5A 5I3JA 6XIMA 1K77A 1ITQA 1BWKA 4FSAA 3QMSA 3T0AA 3IARA 2PZ0A 4GY0A 2TAAA 3OVGA 3QEZA 4FB7A 1XKYA 3B8TA 2ALRA 3NGFA 1MZRA 2QW5A 4DRSA 1G4PA 1UMYA 4L64A 1HNYA 4A29A 2CYGA 3E12A 2CZFA 3A3WA 3U57A 4WDTA 1LL7A 3BOFA 3RO8A 3G6LA 3KWSA 1Y5XA 4WD0A 5CJNA 3LM3A 1R3WA 3W2MA 3BE7A 1DJZA 3HPSA 3WK0A 2XIQA 2C1IA 5ABFA 3TAKA 5FJIA 3PZ9A 4XBSA 4WSKA 4PR4A 1XC4A 3JR2A 3OG2A 4BY3A 1S2TA 3CNYA 4OWGA 3HGRA 3KOFA 3U7BA 3T08A 2ZX5A 2Y88A 4GQGA 3EB4A 4GJIA 3DGBA 4UR9A 3GDLA 1UKOA 2FZBA 3RO6A 3G77A 1WNOA 2RDUA 3FXYA 5DXYA 4EWND 4B15A 3CPUA 4HHLA 4A3HA 1XICA 4C6BA 1R86A 4QCFA 3N6QA 3W1RA 2FKPA 1JULA 3DX5A 4IP7A 4Q3MA 3W74A 4AC7C 1SO5A 4XVEA 4IIBA 1FDZA 1VBJA 4BQ3A 5BRBA 3MCMA 4O8AA 4KBXA 1UASA 3G1XA 4B5WA 3WUFA 1KR1A 1FRBA 3TW9A 4FLSA 3HPFA 3IGSA 3UF9A 4BK9A 4LS2A 4JGDA 3DG7A 2WKJA 1K9FA 3TQVA 2J66A 1S5VA 3S6DA 3NQGA 2GYIA 4P7RA 1E9IA 1XLAA 1EZ2A 3CT2A 2QPUA 3AALA 3W1AA 4IG2A 3AXHA 1HFBA 3A21A 3VZYA 2QS8A 3RIKA 4NNAA 4O0KA 2NX9A 2D73A 4NYYA 3QSRA 3ZMRA 1TQJA 2QPXA 2V5DA 3IWPA 4QXIA 2CBJA 4PMUA 4N4QA 3ZWTA 3UERA 5LGZA 5D9OA 5ABEA 4PCSA 3BMVA 3MPGA 1S3TC 4U5KA 4CKQA 2HEJA 2RDXA 2YA1A 4FOUA 3RM9A 4CCEA 1W1A1 3OVQA 2H6RA 3DHDA 1JDCA 1ZL1A 2X0SA 1R3RA 3ZVHB 1F5ZA 2DZTA 3RJXA 3GHRA 4AEFA 2QGYA 2C3ZA 3PZTA 4NNBA 4OKDA 3F5JA 1XINA 3PTMA 3TU9A 3WQFA 3OZYA 1GKPA 4IMDA 2JK2A 3TLQA 4Y8EA 3KWXA 1HKJA 1SJDA 2JIEA 5REQA 1ZCOA 1ME8A 3CQ0A 1A0DA 2PPGA 3RPDA 1EF3A 4QITA 4DJFD 5HMDA 3BCFA 1KBIA 1EPVA 2B7OA 3KL0A 3AYVA 1RPKA 1VJZA 4MWAB 3BZGA 1QI2A 2I5IA 5HAOA 1S46A 4JTGA 2YB1A 4UQEA 1C29A 1U2YA 3VPLA 1A0CA 3LCLA 1CGTA 2V38A 4WGHA 2V63A 2WB5A 2XZ9A 3B3DA 4PTVA 3XISA 4L4MA 1D2KA 2B7NA 4YXGA 2RJHA 3SY8A 2P5NA 1O5QA 4GFSA 3M5VA 3OGVA 1TQXA 3UJFA 3O6CA 1Z89A 2WMIA 1OX4A 1UC4A 2FHFA 4F0MA 1T0OA 1ZBKA 4JTKA 3VNYA 3SUTA 2NUWA 4J2PA 4GNVA 4F48A 5CEWA 3TXZA 3W1NA 2D1ZA 2QMJA 1DXFA 1J4EA 4KRTA 3TOPA 2ZZ6A 2UWFA 2E0PA 4BI7A 2WZMA 4LUJA 3ISIX 1TX0A 4MWAE 3TX9A 2VOMA 3PNUA 5DF0A 1CGVA 2RUSA 3UZJA 1CT5A 3UPMA 4GPNA 3GK0A 3TKFA 4UOQA 5F4WA 4AQLA 3AHYA 1VH7A 4C5YA 4HSNA 3I3BA 4ZO7A 2NUXA 3C2RA 5LNWA 4MB4A 2DIKA 5DLCA 3RHGA 4M51A 6A3HA 1XSIA 2VX5A 3L2MA 3GC4A 3WLPA 4JY9A 2PU0A 3NQ8A 1EXPA 3U6WA 1AW2A 4BWLA 1H5VA 1OC6A 1WXYA 4C6MA 3B8DA 3KOWA 4IISA 1T8XA 3K4AA 5HQLA 2IQ0A 4XKYB 1IV8A 4ZSUA 4K3ZA 3W81A 1QWGA 3WQPA 4CVUA 3ABRA 1WP6A 3KOXA 1TR9A 4PYSA 4HYVA 2YDSA 2QAFA 4TTUA 3FJ6A 3MY9A 4O11A 4AX6A 3IVUA 2F8QA 3NSXA 4UTJA 1CXEA 2WJDA 4JTIA 1C8XA 2E77A 1W9UA 3TYDA 1QO5A 3M46A 1DJYA 2EJAA 4OBRA 3DC8A 3PBVA 4P2VA 1B1YA 1GVYA 3A5FA 2BY2A 3FYOA 1MSSA 5F2MA 2PD9A 4K39A 2GGEA 4RX0A 4DBDA 1SQ7A 4NX0A 4ZZ9A 5BZAA 1HKKA 3URAA 2QUVA 1DQXA 1YDNA 3REQB 4F0RA 2QF7A 4AXKA 1F74A 5D9MA 3BLPX 1FWIC 3IVTA 4DO6A 3GDMA 3VNIA 2WKLA 3ZO9A 3F4CA 2A21A 5CAHA 1US2A 4C6IA 2YXOA 4BZYA 2FPYA 1UWRA 2X8RA 3PB2A 4J4KA 2ZUUA 3VD3A 4HBKA 3CUJA 2YCLB 1TVLA 2W0UA 3FA4A 2CLKA 1V0NA 1UG6A 3ZVIA 4HK7A 5IHRA 4NZ4A 1DQUA 1GHSA 5I07A 1X1ZA 3VINA 4HMNA 4PL1A 3WMCA 3LG3A 3ZLGA 4GC3A 2PC8A 4QAWA 3THDA 3EOEA 5T9CE 1KB3A 1W2VA 1M04A 1BD0A 4Z08A 3HZ3A 4ONVA 1XUUA 2PGFA 1WDSA 2PSNA 2FJUB 5A6MA 4LVDA 3OYXA 4CQBA 1SFTA 4GYPC 2YCEA 2OWXA 3K4WA 4IWWA 3L4UA 4GZEA 2Z7KA 2GGGA 3BURA 3QM3A 3DI1A 2Z2AA 2WNQA 1MNZA 1VR6A 3HG3A 3S1VA 3NQFA 4U28A 1FX6A 5DELA 2IPWA 5AYYA 4JFSA 1JPDX 3ITVA 3NJ3A 3WQEA 4XTDA 3MA8A 4K2SA 1B3YA 3NO3A 3KCJA 3JS3A 3EMQA 5FJUA 4PA8A 1OFQA 5IFPA 5GJMA 1WDDA 1JI1A 1CGWA 4YHEA 3STGA 3H7UA 4DWSD 2VX6A 3CZ8A 2FYMA 4RZ6A 4DYJA 3GTFA 1KGUA 3NA8A 3UYIA 2A1YA 4J5NA 3S1GA 3L0GA 1W91A 4HK5A 2VJXA 4PUKA 3VGBA 4A3UA 4Y9OA 3OP2A 3HGJA 2ZZ4A 1TV4A 5EMLA 1PWMA 2YFNA 1J2WA 3SN1A 3MJYA 1AJ0A 4DF0A 4ORIA 3GU1A 3WL1A 2Y24A 3B9OA 3BLLA 5F4XA 4F40A 1G7UA 1T99A 4PMNA 1CX9A 1FBAA 1RAKA 1QO2A 3LQGA 3B06A 2R82A 1KLYA 2ZUWA 3C2FA 1TFVA 3FS2A 2J6VA 4LYPA 5FL0A 4C6FA 4MPKA 4BI6A 3NTYA 5ABFB 3W7GA 3TTYA 5IHSA 3SRKA 1K7XA 2AMXA 1X1OA 3FKRA 3G1RA 3W53A 1DOSA 4I5XA 2DUAA 2VC5A 2QDEA 1VPXA 4ZL1A 1UWSA 4S3BA 2F6UA 1PZ0A 3WIJA 3GHUA 2ZZ7A 1JCMP 5IFTA 1POKA 1GVRA 2NQLA 4OVXA 3JZEA 1RQHA 3OZOA 5H8UA 1TKKA 1UIPA 3VDHA 3TSBA 3S47A 3M4HA 1P6WA 4LX4A 4KRUA 1S1RA 3GG1A 2V5JA 4XV0A 2NLYA 2BNJA 1XIGA 3LZ5A 3P61A 1RCOB 1TA3A 2O4MA 3V0SA 1XIDA 4XVDA 1QAPA 3QTPA 2HRWA 4C1KA 2AKZA 1HO1A 3KRBA 2YLLA 3U3HA 3FA3A 1IR2A 3R11A 1OD8A 2O55A 4GO8A 2ACSA 5A2BA 4MPQA 3WF4A 3G1DA 3H2CA 1TSIA 3DFYA 2YGYA 5JBFA 1E4NA 3P8IA 3QHOA 3EKLA 3SCNA 4CVWA 3S8HA 2VRQA 4D6JA 3T2PA 3SGUA 1EB3A 1JCXA 1GOXA 5HWMA 1PZ1A 1NQKA 1MRQA 2WM1A 3NG3A 3CV7A 4JKKA 1S3HA 3BH4A 2OWCA 3UPWA 1SSDA 3UP8A 3H8AA 3DHUA 4IQJA 1NEYA 3O06A 3PZUA 1E4MM 4IG2B 1MW2A 2CEQA 2YSWA 4GI4A 4E4UA 3ZR5A 2AKMA 3E5BA 4JQ1A 4Q8WA 2OXNA 3B8UA 2AAMA 3ATYA 2PC4A 1GVIA 1H09A 3ARZA 1MW0A 1EP3A 3BVJA 4AG0A 4W89A 3AMLA 4HNTA 2PU1A 1W5MA 3VKBA 4H6KA 2ZCGA 4EKJA 4UFIA 3SCQA 5B80A 1Q4WA 1UD6A 4UQCA 4XIMA 4I9AA 3JZUA 1SVDA 3FGCA 2YR1A 5HUOA 3AC0A 2VX7A 1I60A 5EL1A 1QFEA 5A2CA 4L7ZA 3C6CA 3K5XA 1CB7B 4UTKA 1J6PA 2X41A 3UJ2A 4AU0A 3NWRA 3WNKA 3CC1A 2PF0A 2YDRA 5REQB 2PTWA 4K1WA 3T8LA 2AL1A 3ZJ8A 3VKJA 5H1WA 3VD9A 3QC0A 5BXSA 1GOIA 1HKIA 3EXRA 1W5QA 4F4RA 3MBDA 5CGQA 4S23A 4DZIA 1EOKA 3WNNA 3GW0A 1YNPA 4TMBA 3URNA 2OLHA 3WDRA 1TPFA 4NRSA 3B8WA 4QQ3A 4KCTA 1RY8A 2JKAA 2VURA 1NSJA 3KBVA 3WEMA 2XH2A 2A4AA 4GD0A 4AY1A 4PFMA 1GNXA 1CLKA 2IKGA 4PRTA 2VC6A 1O5XA 1WKFA 4JIQA 2JGYA 4NXSA 4MTVA 4ATLA 1LWHA 2IW0A 1M65A 3MHUA 2WMIB 4D6EA 1XIJA 3CEPA 1IWBA 1S5NA 4ML9A 1UQYA 1SZFA 4KCWA 2XIJA 4FNTA 4N9BA 1VPQA 4M82A 4C1NA 3SCRA 3OQ8A 2E6DA 1N7KA 4FP1A 1K03A 3OU8A 3GM8A 2EPMX 1OM0A 1CIUA 4O53A 2XSXA 4HU3A 5AKQA 2J47A 3PFRA 1G01A 4B90A 3GH7A 1W56A 4IFRA 4AD4A 1KWKA 2Y85A 1M01A 3ZLHA 1GW1A 4WXYA 4FS9A 1MO0A 1J6OA 4LBUA 2ZTJA 4XD6A 1SO3A 3L23A 1CENA 3LGEA 3LV6A 3KP0A 3OBEA 3CUXA 4O4VA 5A8PA 4FLRA 3L4YA 4DNMA 4HIBA 1RJRA 1HTIA 5G2HA 4XK2A 4A2RA 2YCKX 2CPUA 3N19B 3ZIZA 3BLIA 1EOMA 1EUAA 1W1B1 1ML1A 4IMAA 1UZHA 5BXPA 3NXLA 4YVVA 3Q37A 2G3NA 4FXRA 4HOWA 1BVWA 1ADSA 6CGTA 4RPQA 3G1VA 3NPVA 4QSFA 5HJLA 1EBGA 4NJJA 3LTSA 3PBWA 1SW7A 1VIZA 1HN1A 2EQDA 3AIRA 4IMCA 4BKNA 2ZADA 3WNMA 3UXDA 2ZRUA 4OUIA 5HQEA 5BU6A 5HNRA 3WLNA 2VC9A 2TPSA 3N14A 3VIMA 4P8WA 2FGBA 4EE9A 4WZHA 1RD6A 2PDNA 3W84A 4J3UA 1UA7A 3NQ7A 5G4WA 4JL2A 4EXQA 2TSYA 4MJZA 4GCXA 1JL8A 3GZ3A 1A5UA 3LBOA 1UD5A 5I79A 3NURA 2VEPA 5DCEA 1HJQA 3UYCA 3ARXA 4BJHA 3WQOA 4IOTA 1VJSA 2TODA 4QDMA 2DV0A 2R94A 2YDQA 4W87A 4FHAA 1C7SA 1V6VA 4HMEA 1PEZA 5EU9A 3TYAA 2YXGA 2HZGA 2WVUA 3UG3A 4LB3A 3TP4A 1QHOA 5AHIA 1ZBVA 3S46A 1C7TA 1ONEA 1EHAA 3L66A 4CCCA 4F9DA 1FFQA 2G96A 3IJ8A 4GY7A 4H9TA 3VNMA 2J7DA 2OZ0A 1DWFM 5CGTA 4E6MA 1GTEA 3NO5A 3B8SA 1I6NA 3CU2A 5D9NA 3MU7A 3Q45A 5A6LA 2A3HA 3ZR6A 3VIHA 5L9FA 3QLLA 2DSZA 5E0KA 3QVQA 2QMKA 1EQPA 1US0A 3IAQA 4TX9A 5LA2A 4KS0A 4XD3A 2DORA 4JTEA 4C6LA 4U3CA 3APTA 4ERAA 3SW6A 4LUIA 2EHHA 2HBVA 2E1WA 3IJLA 3IGHX 5C6MA 7CGTA 1L8PA 2E40A 2HXTA 4XB3A 2BVYA 1C3FA 1J0YA 3W02A 1E6QM 1H61A 2E8YA 3BDKA 3P8JA 1N82A 4UTFA 4D72A 3MKVA 4IJRA 5B7YA 3TR2A 2J9XA 4FEZA 5HBFA 1EJRC 3BARA 5ECVA 3O6DA 3SFKA 4GYJA 5D30A 4Z0JA 3VI2A 3INPA 4HU4A 1BQCA 1PWLA 4LF1A 5G1TA 1PKLA 3NZQA 4IH3A 4GKLA 2GPTA 3F4NA 2WC4A 4QG6A 1F7BA 3DFHA 3FAWA 1CECA 3G1SA 4H7CA 4X0NA 4PRRA 3U5YA 3C0JA 6ENLA 1UR1A 3CGTA 5CSYA 4X63A 4CD7A 3R13A 1OCQA 1R2RA 3MUY1 1POJA 4J3TA 5FA5A 4F0HA 3QMRA 2VUNA 1KM0A 5T9BG 4GABA 4RV8A 2WNWA 4PUDA 4IICA 1B90A 1CBGA 5BU9A 4GQQA 1W1YA 3S2MA 1T41A 1GEQA 1U5HA 1FWFC 4NAEA 3VIKA 2V68A 1HT6A 6TIMA 3W88A 3WLMA 3DUGA 4MZ8A 5M5DA 1R8LA 3TCSA 3HQPA 1EZWA 3VIJA 1A5MC 5JH2A 1EBHA 4ZFCA 3UWEA 4FOJA 2FVKA 1UH4A 3CEUA 1XLMA 2J77A 3B97A 5DCDA 1LQAA 1C9DA 2VFGA 2VCCA 5HA7A 5XIMA 4UTTC 4RZ5A 4E2OA 3LCHA 4H8VA 3QMTA 2J7HA 4PCNA 4INFA 3SDOA 3N9KA 1KC7A 5C9ZA 1E1FA 1TA3B 3RUBL 4UTHA 1ZJIA 3GYEA 3CHVA 3AFBA 3H54A 2I1OA 1R7AA 4HSOA 3RF9A 3AI0A 4PULA 1ZBCA 2WMFA 2FHBA 3STEA 1EJVC 1RD5A 3VKKA 3KCLA 2VZUA 3PG8A 5FKYA 3NZ1A 1MQRA 2H3DA 3VD7A 3EX4A 3NPXA 5XIAA 3FEQA 3DG6A 4DZAA 1E4LA 3TXVA 2NUYA 4AZ5A 5HUPA 4MAVA 5I24A 1KQZA 3E38A 2OEMA 1GK8A 4AD1A 2VI0A 1PIIA 2JKEA 2GWNA 2I16A 4AYGA 2DSVA 4UZSA 2PTYA 1R3YA 2GDUA 2VMFA 5EGRA 2IMRA 1GW9A 3TN5A 1Q7MA 5KETA 3VOHA 2F7FA 3NEVA 5RUBA 4MHBA 2Z1XA 1UCWA 2QJGA 3ZM8A 2NV1A 3P60A 3GTIA 4QE5A 1EH9A 1OCBA 3MUCA 1L2UA 2DIEA 1OG0A 4Q8OA 4QJ1A 3GVRA 2F2HA 2PWHA 2ZRVA 4DUOA 4AEOA 3FGCB 4XTIA 1SGJA 5CJ5A 4O0ZA 2Q8LA 4N9CA 1QW9A 4NYUA 3FSTA 4LXFA 3CTTA 2JE8A 1ODZA 4U33A 3ITYA 1JGIA 4L80A 4MJMA 1ZBWA 3IACA 4Q8VA 4QSHA 1W2PA 3KUMA 3V4BA 2ZXQA 4C6CA 3QFWA 3LXCA 4OHQA 4Y9MA 3TZNA 3W2LA 1RVGA 1C8VA 4FK9A 2WLYA 3O63A 4MY8A 1GJWA 3NQAA 1V0MA 2VZVA 4IPIA 4QTGA 4JAWA 4HT3A 2NT1A 4D6IA 1YNYA 4B5VA 2PRLA 1HJVA 3I10A 1HW6A 3W7PA 3AIBA 5LSMA 5EBAA 3N9SA 2IXVA 4MMWA 3PHAA 2IKHA 1XXXA 4J2MA 1R87A 2GVYA 4EPKA 4O57A 3WLTA 4GG9A 5EMKA 4IX2A 4QRNA 5AC8A 1TVNA 3GYCA 3CLWA 1FWEC 1ODUA 1EWEA 5D2YA 1BYCA 3F4DA 1JZ5A 1BTCA 4ZB0A 1WE5A 4XBJA 4ZOCA 3BWWA 1XLIA 3W0KA 3WNPA 1B57A 4C1NB 4AZ7A 1WDQA 1KTBA 3AISA 3NQ6A 1RA5A 1S2CA 1JCTA 2VXNA 3GXIA 1SR0A 1KM5A 6ALDA 4CNPA 4JTUA 5FIPA 2QCNA 1W32A 1MDLA 1C91A 4UQBA 4JIHA 1ADDA 1ESWA 3WLKX 1TVPA 2C1GA 1ISZA 2PMQA 1OGBA 3KRZA 3VIOA 2ABAA 1CXKA 5TAOA 4BA0A 3QZAA 3DI0A 4PMVA 3MSRA 3UCQA 1J01A 3KVKA 3THQA 1M1BA 3MWCA 1TZZA 3WUGA 2Z1SA 3A64A 1DL3A 3AU6A 4F9JA 4YMZA 1KM6A 3PWIA 4H8UA 1QK2A 1L6FA 4Y90A 4TO8A 1S5TA 1ZAJA 3A47A 3THUA 5DMMA 2CZ5A 1VPYA 1CXLA 3GC5A 2GLKA 3HU7A 4QCEA 1YLVA 3GTHA 4QJ4B 2POTA 1MYRA 3NYZA 3WD2A 2ICSA 2HTMA 2BTMA 2OX4A 3M0XA 4IGSA 3M6DA 5CC6A 2VT0A 3UY7A 1OYCA 2WZTA 3DC0A 2ZWZA 3DN5A 3R0UA 1PYMA 1IXQA 1U22A 1DVJA 1YPFA 4H4IA 1IQ8A 5D03A 3UR2A 3WF1A 1B30A 2G50A 4YHGA 4NJHA 4UFMA 2NXHA 1EPXA 1XYMA 3GZAA 4LBSA 3SIMA 3VMPA 4O1BA 1IZCA 1LLZA 3NL6A 1EYWA 2HS8A 1JZ7A 2PWFA 1ENUA 3R8RA 3H7VA 3BSMA 3LS9A 3BLEA 1KRBC 1TE1A 4AHPA 3VCCA 4P7QA 5DT7A 5I03A 1BXNA 1JGMA 5LHEA 2R9RA 2PFHA 1NFGA 3WLRA 4QBXA 1YE4A 1F4AA 1RJQA 4WKHA 1IYXA 2C16A 2NZLA 1SUXA 1F05A 4RUBA 3S9IA 1SZEA 1CWYA 3TN6A 2O7SA 4D6CA 1H49A 4CQ8A 3LTPA 2J24A 2C14A 4QR6A 4HVXA 3WZ0E 4JQ2A 4DNHA 3SUWA 4UTIA 1R3VA 3ZS4A 1Q4NX 4C6PA 3T09A 1MXSA 1XDMA 3BGGA 3HA1A 3LA4A 3D3AA 1B5TA 4J9JA 4DPPA 2NQ9A 3VIPA 4DJEA 1TUFA 3AYRA 1W1ZA 2PTXA 1RR2A 5CLWA 1P43A 2PODA 2D0FA 3P84A 1VYRA 2FB3A 4HN4A 3PS7A 1GYMA 1MEHA 2VZSA 2YLAA 3IAPA 3LSCA 4PUJA 1R6WA 2Q8XA 4MUZA 5C2CA 1ONWA 2YJQA 2P53A 2FZ9A 1IR1A 5CPNA 3L21A 3W4RA 2Y62A 4JFWA 4B9ZA 3A12A 2E5CA 3EEZA 3VMOA 3LBCA 3JW7A 2CCRA 1UPPA 3USZA 3ABSA 1Q45A 1JG9A 3W7QA 5IBXA 5ENLA 1QNVA 3R7MA 5IM51 2XTKA 1TYGA 3UVIA 4NAEB 4FX8A 1R46A 4GQRA 1XSJA 2VCAA 2ZA2A 4X2PA 3WJXA 1GKRA 5A6JA 3D3FA 1EA0A 1IHIA 4CUCA 1UWTA 3PAJA 2A3CA 3UA4A 2IPGA 1UJQA 4G7EA 3CWHA 5LIWX 3IIZA 1DIEA 4AVOA 4JHOA 3W6LA 4PTWA 4DJDA 2ZX8A 1FCUA 4CQDA 3ABXA 4GYKA 2WJEA 4C6NA 1JPKA 4IUOA 1TZ7A 4ZXOA 4GBDA 1K4HA 1QATA 2E8ZA 1GOOA 3ECQA 3GU9A 2PDMA 3PWGA 3MI6A 1OFBA 3DYPA 3S5SA 2UV8G 4GIAA 2ESCA 3V1HA 4LVFA 4L61A 4MF4A 3MWAA 1VQTA 1E3ZA 3CPGA 1EUNA 1YX1A 1I2PA 3T0BA 2GFTA 2F38A 1LBMA 1N55A 4GRSA 1PX4A 3DU0A 3EMZA 3U2CA 4NZCA 3GO2A 5HQMA 1GQNA 2BOEX 5JIWA 2OPJA 3LXAA 1QPRA 1VRXA 2VD8A 4V33A 3TC6A 3WLJA 5BW6A 3WLHA 3LGGA 3TWBA 4OJYA 1VFSA 1XGZA 2RJGA 1KFWA 2ZXBA 1X8CA 1FDJA 1YPIA 5D2WA 3WJSA 2CZVA 1J10A 3QC3A 3LRLA 2VTFA 3KL3A 3H2AA 3QKZA 1W8GA 1K8YA 2O9RA 4IPJA 2OJPA 5C8BB 1MNSA 1Z48A 4MM1A 4V1YA 5HJYA 3FYPA 3M0KA 1Q3NA 4OFCA 1TJRA 2A3LA 4G8TA 4GNKB 5TF0A 2ANUA 4NJIA 9RUBA 4HCDA 1F4HA 3DCPA 3HG4A 4NZ5A 5CC5A 5FACA 4Q4RA 1FQ0A 2VFIA 3GWQA 3E02A 3B40A 5KZ6A 5JXQA 2Y7EA 1TCMA 1TREA 5D8ZA 2W3ZA 4R9OA 1VBUA 4B4FA 2W63A 4P7NA 3T4WA 3GVVA 2G37A 3VDBA 1ZB5A 1R5YA 5AC6A 1TR1A 3APGA 3G18A 3UZWA 1BVZA 3T6CA 2VHLA 3WQVA 4WR3A 2G41A 5I02A 1UWQA 3NM3A 1SW3A 4OOUA 3A23A 1L6WA 2WSRA 4RXGA 4H7VA 4J7RA 5KZDA 2GSJA 4HZ7A 1QVBA 2JEPA 1GGOA 4XZLX 4WDUA 3TOYA 1S1PA 3CUFA 1AMYA 4B5XA 1ZAHA 4A22A 2DVXA 2VR4A 4UMCA 3SB0A 3W87A 1TMQA 4CLMA 1LLWA 1FKXA 2CESA 1W9PA 2EPLX 1T40A 3H4XA 1EJXC 1JDAA 1LLOA 3ITOA 2WVSA 4Z2JA 3G8EA 3QOKA 2A7NA 4U2ZA 3NUKA 1XCFA 3RR4A 3EBVA 1V3JA 1EWDA 3CL7A 3NOEA 4GMEA 3I6TA 3RPTA 3QXBA 4XO6A 3RU8X 1XKJA 2VR5A 1HKVA 1LCOA 4FLOA 3M0LA 2EO7A 2RKXA 1V7AA 4QDPA 3KOYA 3U8GA 2V5KA 3VOGA 1H7PA 4Q4QA 1V3KA 4JPGA 2B31A 1VF8A 2INZA 1RXOB 4FIRA 5CC7A 1ME9A 4WOZA 7TAAA 1IWAA 1XIFA 2AL2A 3N6JA 4L6OA 3WMSA 3GUWA 1M7OA 4ATDA 1JXJA 1LRQA 2QCMA 4FX6M 3WQ6A 5AYIA 1AL7A 3T40A 2C13A 3TA6A 4A8NA 4AB4A 3UZ5A 3BSHA 2OCZA 2A85A 1XYLA 3WDPP 2ZXDA 3W2KA 3NL3A 3OZPA 1ISYA 5MF5A 2PDQA 1I8JA 4X61A 2E6AA 4K8GA 2I5GA 4JYEA 3VAVA 1UKPA 3H23A 3UPBA 4IXHA 3IANA 1XC6A 1DWIM 3VOIA 3W7OA 4UOZA 1I45A 1M5WA 3AYSA 3PK7A 4PODA 1NOFA 3RRXA 4LVAA 5D38A 1IGSA 1LT7A 3IIOA 1I2OA 4IQEA 3R0KA 4GGBA 2XGBA 1REQA 5JIPA 3N9RA 1F6YA 2QKFA 4E8CA 2VGBA 2OR2A 3BLKA 1GQKA 3WBWA 2DT1A 4UTLA 4PCPA 3FA5A 3CZEA 3GNRA 4OU1A 1V3MA 3IJ7A 3SJ3A 3H2EA 1OFPA 2ONEA 3S1WA 3OVRA 1P0BA 1GZGA 4NJKA 3QR1A 1NDVA 3GG7A 3W1MA 4S3DA 2P3EA 2WCAA 4XZMX 4PMRA 2QJNA 3SY1A 3L68A 2FB2A 3KBNA 4LB4A 3W1PA 2NQHA 2NV2A 2YBUA 1XH1A 2VEKA 1TV2A 1JPIA 3C52A 4F0LA 4WF7A 3SAZA 4F2TA 9XIAA 1ZNNA 2Q01A 3R5EA 4A8IA 3UBPC 1ISXA 4M1RA 2DP3A 4FXJA 1VC4A 4XAYA 4EIVA 3E9AA 1TWIA 3CUZA 1WCGA 2J9ZA 1GTHA 3CQKA 3WQWA 3QRHA 4IFOA 1NOUA 1W9DM 4X22A 3UZYA 4Q7BA 4Q8MA 3UEQA 4C6QA 5C5YA 4QNWA 1HL2A 3PZIA 1XG4A 2ZX9A 3W7KA 4IXXA 2HVNA 2L5HA 1UD8A 1GYNA 1V6UA 4LF2A 4H2HA 5A6SA 4OBSA 3TMQA 4RE4A 3HO8A 4GVHA 2QV4A 3AZSA 4I8DA 2PRMA 3CIWA 3GHSA 2ZTKA 3GU2A 3RR1A 3W24A 2ACUA 3G1AA 1FH9A 1W3IA 4HK6A 3CB8A 3N2OA 3IGXA 3W00A 1KFEA 2J62A 3LCXA 3I3DA 1WOAA 2GSEA 1VFTA 1QCWA 4NL1A 1TTPA 4KIRA 2X0HA 3MI2A 4K37A 4W4QA 1E6PA 1TV7A 3H7RA 4J28A 3M16A 4MYAA 4X60A 3U9IA 1K9EA 4W84A 4G1KA 3AMCA 4W5UA 2B0MA 3Q4DA 1Q6FA 3P93A 1H0IA 2BHZA 2WBKA 4RZBA 5G4HC 1Q7QA 4ZEPA 1LJYA 3RLVA 3CTLA 3VZXA 4Y9NA 3CZLA 3L2IA 3FDGA 3H4GA 3JRKA 1UZ4A 4S38A 2XU2A 4MJ2A 3IEBA 5A95A 4D2JA 1Z6KA 2HWGA 4M19A 2VGGA 3PULA 3CK5A 5LZLA 2VQTA 2P3ZA 5JUVA 5DO8A 5EY5A 1TPH1 4G7EB 1SO6A 3DYMA 3P74A 3D0CA 4AC1X 2P76A 2PD5A 4HNCA 4I5UA 1OX5A 4P8XA 1A3WA 2ZZ3A 1S2VA 3S9YA 3BANA 2GQ8A 1BWLA 3TWAA 3WKZA 4GO9A 4A8RA 4E8GA 1SPQA 3GXFA 3OZMA 4XZNX 1Z8AA 4HA4A 4IMEA 2FH8A 2G97A 1WA3A 4M80A 1PBGA 4AWSA 3DH7A 1EEPA 4I9JA 3P81A 4PEEA 1O60A 3D46A 3ITXA 3R58A 2XVGA 3FOKA 3BCDA 3OLDA 1OZQA 1XLGA 1JPMA 5MKGA 4L4LA 2C8NA 4U2YA 1J12A 1WBJA 4NAFA 3IV3A 3L4TA 2PE4A 1OX6A 1PXGA 3G1FA 1V6TA 3PJXA 4Q8UA 1O6IA 3T81A 5IDZA 1EDGA 4XAGA 2GK1A 1W3TA 3ONCA 5EB8A 2CHNA 1P4CA 5DY2A 1PV8A 2E28A 2FHCA 2X1UA 2YIHA 2PLCA 1LM1A 1VIWA 3XINA 4QM1A 2ZDRA 4PCFA 2AGTA 4GI9A 4R9XA 5AZ1A 5BXRA 3LBMA 1AK5A 4U4MA 4IJCA 1QOQA 1E0WA 4YJ5A 3GNDA 4BQ5A 1YDVA 3CHEA 1H11A 3UR8A 1X98A 2B7QA 5CAKA 4UB9A 5IOBA 1VFFA 5GJPA 4QE1A 3P5ZA 4ACZA 3WF2A 2VELA 1DJXA 1OCJA 3UW6A 4JNZA 1PX8A 1CB2A 4RW3A 4TV6A 4JTTA 3J7HA 3QF0A 3TV8A 5ABGA 1XX1A 1BVNP 1ICSA 2YW4A 4O0QA 3AXIA 3ID7A 2ZRXA 2PDGA 1XBXA 1PTGA 3PUOA 1E0VA 5XINA 3SM0A 2ISSA 5D8WA 3LPFA 4LYQA 4MADA 5I09A 1H5YA 2P0IA 3TVAA 2VEMA 5CZSA 3CV6A 4PUWA 1SMAA 2WHJA 1RP9A 5PTDA 1G69A 2WSYA 1GPFA 3TN3A 1B4EA 1U33A 1J93A 2CLEA 1NWRA 4TX6A 1JZ6A 1PKNA 2G0WA 5A5WA 3W38A 3G6MA 5BWFA 2PP3A 4L1GA 3TJIA 4AHOA 1PAMA 3HV8A 4EWJA 4XZBA 3KXQA 4ZQRA 2PDXA 1IZJA 2GUBA 4GK8A 3BAWA 2DPEA 5AYZA 1GHRA 4EXBA 3POHA 4FPSA 3EOOA 5E6YA 3I3EA 4ZE5A 1EJTC 2IQTA 3UGRA 1S2AA 1CNVA 3KLLA 3N6HA 2AL2B 3W72A 3H2MA 1ZHAA 3LHTA 4KETA 3WJZA 3W7EA 3M0ZA 4YYFA 1OF6A 1MQPA 1KM1A 3WELA 2C0AA 1RH9A 2OEKA 1BAGA 2ACRA 3UR5A 5LNSA 3Q58A 3EA3A 3W71A 4ZQCA 2VFDA 4PBEA 2XG9A 1PL9A 5A3HA 1OFOA 2PLMA 3R12A 2PWVA 3VKDA 2E67A 3BOLA 2PDLA 3VCNA 1KM4A 4C6KA 4MDPA 3VU2A 1E1CA 5EPDA 1JIBA 3ZZ1A 3LENA 3N73A 3SECA 3S83A 2GUUA 4EF9A 1EC7A 2CLMA 5GNZA 3AIUA 4I3GA 2PDFA 1TTIA 4HHPA 3SJNA 4WDXA 3AJXA 2BSLA 2Q3OA 3ZR4A 2XGZA 3LPGA 2GUYA 1A4LA 1L6SA 1KFCA 3KCOA 3MYPA 2QF8A 4ZSTA 2DZPA 4IQLA 1REQB 5K9DA 3N2MA 5E5CA 2R1NA 1OK4A 3ZOAA 3PBGA 2Z1BA 4K1GA 4FOKA 1XRTA 4DJFA 5LNRA 1UQZA 3HV9A 2DZXA 3R6IA 2F6KA 4JXCA 4AMCA 3CL8A 3DYOA 2X09A 2OODA 4S3GA 4ERGA 3FEMA 1YTKA 2BHUA 1XRVA 4PC8A 3NQCA 4PBGA 2V69A 4GACA 4O50A 1NIUA 5HNTA 2NX3A 2WPGA