2QCNA

Covalent complex of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase with 6-iodo-ump
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
total genus 96
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qcnA00
2BSLA 4CQ8A 4NXSA 4FB7A 4HHPA 2B7PA 2VFIA 4OBTA 4UNLA 4N4PA 3NM3A 3CB8A 4JTFA 3UD6A 4C1KA 1K7FA 3C3NA 3S9YA 3DBPA 1GG1A 1F05A 3KVMA 4O4VA 2QCMA 5FEWA 1BWLA 2YFOA 3USBA 3OA3A 5BRBA 5LZLA 1TJPA 1LOLA 3EX3A 2JGYA 3T4CA 4O54A 2X1UA 4HIBA 3BO9A 1WDWA 2C0AA 4UTKA 2NUWA 3HBLA 3UQNA 2RDTA 3PULA 2YPIA 3C61A 3TAOA 1QNVA 1H62A 3NG3A 3LOTA 2R94A 1SSGA 3IV3A 1RPXA 4UTJA 1QOQA 3M5VA 3PY2A 3W85A 2Y89A 1DORA 1NF0A 2A85A 4RZ4A 4FXRA 5D03A 4RK8A 2WSRA 4MY1A 2QDGA 1TPDA 3B0UX 2YW3A 1I2PA 4FNRA 3CEUA 1HL2A 2O7SA 4RLIA 3HG5A 3C2RA 3W7CA 2HS8A 3LTSA 4EF9A 1XDMA 1TIMA 4IMDA 1JCXA 4GUIA 5F2IA 1W56A 2G5WA 3LB0A 4XKYA 4Q33A 1KM1A 5HINA 1TV7A 1TPVA 1OFDA 1NF7A 1IF2A 3U6WA 3W7EA 1J2WA 1ZCOA 3FA5A 3QMRA 2CZDA 1OK4A 3M44A 3M41A 5LHFA 1FWTA 3W2KA 6ALDA 5KZMA 1SZFA 4RCXA 1OX4B 3TW7A 4PFMA 4S1FA 3QSRA 3QMTA 2WSYA 2NX1A 3UWYA 1L6SA 5E0KA 1B57A 3C2EA 3OVPA 3G3MA 3LXBA 3BK0A 4FNUA 3TW6A 4WY0F 1Q6OA 1QAPA 3UXDA 1A5CA 4UCGA 1LYXA 3DHFA 3MP5A 4UC5A 3G0SA 3LHZA 4LTSA 5AC6A 3STGA 1SFJA 2ZTKA 5K2ZA 4AWUA 1IXPA 4IMGA 4NX0A 3DKLA 3RF9A 5LNSA 3PR2A 2QCEA 1U83A 1JRBA 1THFD 1PVNA 1YLVA 5HNRA 1VCFA 1NVMA 4BI7A 3IGSA 4FO4A 3NQ6A 4HNVA 1JCNA 5AYYA 2QKFA 4ZQPA 2CLIA 4Z0SA 2A2IA 2RKXA 3F03K 5HUPA 2YGYA 2TMDA 1U5JA 3NQGA 3WK3A 5CPLA 3OEXA 2RDUA 2HS6A 1OG0A 1HG3A 2ISSA 4HKPA 5K9DA 1I45A 3PF3A 3P5YA 4ML9A 3B04A 1R46A 2GPTA 1KFCA 1B4KA 4FNTA 4O15A 1FCVA 4IPJA 3QH2A 1XI3A 1VYRA 3I7RA 3P80A 4IQLA 5DCDA 5FESA 5HR7A 1QR7A 3CEPA 3TQVA 1UB3A 1P5BA 3M47A 1K7XA 2J24A 4UFMA 4M7TA 3G1VA 3E12A 1RR2A 1SZNA 3RNDA 5DLCA 4LV4A 1YTKA 2ZRXA 1ZAHA 4JR5A 3FJ6A 1G7VA 3EWXA 5F1VA 5AC7A 5GVJA 1KFBA 4NXKA 1GVSA 4UUIA 1UCWA 1HTIA 4IWWA 3DFSA 2TYSA 3M16A 1CW2A 3G1XA 1TMHA 1VGAA 5DN1A 1DQWA 4JYFA 3TJXA 1SPQA 4BWLC 1JQVA 4DF1A 3BW4A 3DI0A 3QPYA 1HUVA 1R30A 2AQWA 4S2BA 4B5NA 6TIMA 4JEQA 3GXTA 3GDLA 3UZ5A 1G67A 3E0IA 5J5DA 1P4CA 1T8XA 4OU1A 1TRDA 3EX6A 4O1DA 1PCWA 1OVDA 1FDYA 4UMAA 3NQ8A 1PL9A 3H53A 1LLWA 3NL2A 5LGZA 2C1HA 3W7OA 2VFFA 3NVTA 2DZUA 1H51A 4YCOA 1SFLA 4FIQA 2B7OA 5AB3A 1GVFA 1O4UA 2QCFA 4GWEA 1KBIA 3W23A 2Q3RA 4N9EA 1CX9A 3O8AA 2ZZ1A 4Q4KA 2NX3A 3TNOA 4TIMA 3LI0A 1QPNA 5D2XA 3GKFA 4MZ1A 1PE1A 1JUEA 3NQ2A 3F4WA 3I7QA 1Z41A 3GVGA 4LV9A 3W84A 1KFJA 4POCA 1SO6A 3ELFA 2H8ZA 3NM1A 1DJNA 1X6UA 4NZJA 1EP3A 4U4MA 4PEKA 3O1NA 3NDOA 1M6JA 2RDWA 4AAJA 4RZ6A 4UFLA 1JCJA 4I7WA 2CZEA 2E6FA 1OX5A 3GDMA 1PHQA 3NO5A 3N73A 4PL1A 3DFPA 3W7GA 1W37A 1SZEA 4K8EA 3P62A 4LS2A 3W88A 2FDSA 2YDAA 2R8WA 5DCEA 2UV8G 3W1MA 2P0OA 1TCDA 3UXAA 3CC1A 4WXYA 2J88A 4I7VA 3S0CA 3LV6A 1LLZA 2BLEA 3DENA 3I68A 4CNNA 4GRSA 1Q3NA 3Q37A 4HNUA 4QM1A 1H7XA 1KM2A 3TFCA 2C14A 3W1QA 3O15A 1A5AA 3EX4A 1VCVA 3STFA 1G4SA 1XUZA 1IXQA 3PSVA 5G2HA 5SWUA 7TIMA 4MLJA 3D0CA 1H7PA 4DBEA 1ZNNA 3T78A 2A1YA 4Z1BA 5LSMA 4KKXA 1XDLA 5CKSA 4Q32A 1WXJA 4GXMA 5I3JA 2DZTA 4NVTA 4RX0A 1P1XA 3MMTA 2R91A 3KVJA 4XUGA 1A5BA 4AEOA 4PH6A 5AHNA 5BMXA 1TPB1 4LVAA 3EEGA 5F1UA 5MHBA 4GFSA 1P0NA 1TPEA 5F2GA 2PCQA 3N3MA 3GR8A 4UMCA 2I1OA 1RV8A 5CSRA 4PODA 3W1RA 5CPOA 4MJMA 5CZ0A 8TIMA 5IM51 3STCA 5KTLA 3N14A 3FEMA 1VRDA 1W0MA 3O06A 4O11A 2E6YA 3NL6A 2Y88A 3NL5A 1EWDA 1UUOA 3PSWA 2EHHA 1SO3A 3L66A 5EBUA 5CG7A 2ZZ4A 5D33A 5AFDA 3H54A 1OYCA 1HO4A 2YSWA 3NQFA 3YPIA 3KRZA 1WQ5A 2GQ8A 3PBUA 4L4LA 3W7DA 3W22A 3GDTA 2CW6A 2WV8A 2V30A 4E2DA 4X9SA 2VFGA 3LGEA 2ATMA 1MSSA 2JGQA 3W3OA 1QMLA 3P74A 2PRMA 2HTMA 2CLEA 4ZQNA 4O18A 1F6PA 2KZHA 2I14A 1TRIA 2VXNA 2J9YA 3DGRA 1GJPA 5D04C 2CLMA 1BKSA 2Z6JA 1H60A 3QRHA 1PS9A 5FF2A 1VH7A 4WUIA 4N6EA 5DY3A 4R7JA 4ORIA 1T0OA 2JKEA 4M7SA 2FB3A 3IEBA 1KA9F 1FCQA 4GUFA 1IGSA 1NEYA 3G18A 1KM4A 1I2NA 4UMBA 4LU0A 3EWZA 3LM7A 2CLKA 4O17A 3WJZA 3KVLA 3W2MA 5ABTA 4M6VA 4MZYA 2R14A 4Z1AA 3UNDA 3S5ZA 3W2UA 3R8RA 2ISWA 1G6CA 1S5TA 3LCGA 2WKJA 3QEZA 2ZDRA 3UZJA 4CLMA 3W76A 2Y7EA 3TXVA 1OX6A 4CCDA 4I7UA 3S42A 2QJGA 3W7RA 3OBKA 3G1SA 4O8RA 5HMSA 4AWTA 1EEPA 1FUYA 5D2TA 2H8XA 4MY9A 1LBLA 4MVAA 2WPBA 4DO4A 1X1ZA 1L6YA 4JX4A 4YLWA 1Z42A 3STEA 1MEWA 3S5YA 1BWKA 3QSTA 1SO4A 3G1FA 3M1ZA 4UTIA 3GLCA 1KFLA 1VHCA 4O16A 5BOOA 4RR4A 4IMEA 3B8DA 3PAJA 3QMSA 5HQEA 3W2JA 3PB0A 3E02A 1GQNA 4JDBA 1FWNA 1OFEA 1XBZA 3PWAA 3UY7A 4WD0A 3S8HA 3PG9A 4OV9A 2QCCA 1LOSA 4JYDA 3G0XA 2BX7A 1SUXA 3UYCA 2Y70A 4L4MA 1KFKA 3VNDA 1R2SA 2WNZA 2ZRUA 4LVDA 3ABSA 1OYBA 3TAKA 4OWGA 5HUOA 4JIQA 3SSJA 3C2VA 3SIZA 5HJLA 1DV7A 5D30A 4HSOA 4UIOA 3S1UA 2EKCA 4N9DA 5IBXC 5AHEA 1KTCA 3QPZA 1R2TA 1GVQA 1F7BA 4LOCA 1KTBA 4JTTA 4WY0B 5CSSA 4JDYA 2HSAA 1KBJA 1DL3A 4R53A 3W74A 5H91A 1T99A 4H6KA 3QW4B 2FIQA 1G4EA 1PHWA 5C54A 1H7WA 3HIJA 4WOZA 2VKZG 2WO5A 2X1SA 3F4NA 1FX6A 1YTDA 3W1LA 1I2RA 3UPWA 1KLZA 2H3BA 3QW3A 3TMQA 4JTGA 4O14A 4UTWA 4ZMGA 3W83A 3KXQA 1RVGA 2NWRA 4LRSA 1PV8A 4NNCA 5BNKA 5G1TA 2OT1A 3M43A 3NZ1A 1ML1A 4AHPA 3BW2A 1DVJA 4A2RA 1OFQA 2NZLA 3E96A 5CZJA 3W1XA 1LDCA 1QPRA 4CQ9A 4O10A 1M7OA 2W6RA 4BF9A 3G8EA 5EY5A 1SO5A 3T44A 3A21A 3M0ZA 3P60A 3SJ3A 4JTLA 4GUJA 4HPJA 3EXTA 1XKYA 1MEHA 4O1CA 5HULA 3EKLA 1WAUA 4WQ6A 3MW7A 3QM3A 3UWVA 4AB4A 1VR6A 1K03A 4N9CA 3DAQA 5DBUA 2V2HA 3EWWA 2W0UA 5EL1A 5CZTA 1Y0EA 4XBKA 1XBYA 1LP6A 4AWSA 1RQEA 1YDNA 5CPMA 2G96A 1H1ZA 4X22A 4BWLA 1Q45A 1ME7A 2X30A 3IIXA 3W1NA 3ZWSA 2IQTA 3L5MA 1ME9A 3WK2A 4CCEA 4KWVA 2VOMA 3VE9A 2ZA1A 3TSBA 4UTMA 3ABOA 2JBMA 2GVGA 4M6PA 3LRMA 3DFOA 3AO0A 3C56A 1FWSA 1VYPX 4LY8A 1QO5A 4A2SA 5KZDA 2DU2A 5G1YA 5L9FA 4XTIA 3GB6A 1W3NA 4O1BA 5A8GA 1VZWA 4NQ1A 4RKAA 1LRTA 2E68A 1N55A 2EF9A 3DFTA 5LNWA 1SSDA 1L9WA 1YPFA 1ICSA 2B7QA 3O16A 4AF0B 3BLEA 3A24A 2ZTJA 4GJ1A 2Z2UA 2E09A 4UFHA 4ZL1A 3LCFA 4KFNA 1AG1O 2NXHA 1GOXA 3LHTA 4Y90A 2Z1BA 3LHUA 1RZMA 1QO2A 4JTIA 2ZA3A 1GEQA 1L6WA 1ZAIA 3LLFA 3R89A 3S5OA 4FNSA 3INPA 3LLDA 2YCEA 4UTWC 3KVKA 2GUUA 2PC4A 4E2BA 2BTMA 3UPBA 4K6AA 3THAA 3PBVA 1XBXA 3A5FA 3TK7A 1N8FA 4O0ZA 4EVZA 1O5KA 5D2WA 4LS1A 3E49A 2BWGA 1ZFJA 2CLOA 1JULA 3IIVA 3IIZA 2FB2A 1TPUA 1W5MA 2Y7DA 4PTNA 1EP2A 5K4XA 3DU0A 5J5RA 1GVRA 2OZ0A 1RD5A 1X7FA 3BLIA 1W31A 4MYAA 3L5LA 4ZQCA 4X2RA 5C5YA 3HGSA 3FYOA 3EKZA 2YX0A 2ZYFA 3C2OA 2E77A 4MLRA 5DY2A 4LT9A 4NJGA 2CZ5A 2A5HA 3LCXA 5LHEA 1TO3A 1W3IA 2VEPA 2X1TA 4UFJA 1K8XA 2J9ZA 3HPXA 5D2YA 3DI1A 5F2LA 3MUXA 2P10A 3LTPA 3LX9A 4JY9A 3W07A 1S3HA 1E51A 2NUYA 2O7QA 4M5PA 2YYTA 1D3GA 3W2LA 5BW6A 1FXPA 1ZENA 3NPUA 2RFGA 2NLIA 5C55A 4Z08A 2QCLA 4AMAA 3M5XA 1O95A 2GJLA 3G1AA 1AL7A 2QAFA 3A23A 5EKYA 5EYWA 3I65A 4FNPA 5TIMA 4Y8FA 2QCNA 2E5BA 3M5ZA 1SQ7A 4FHAA 1FQ0A 3RK8A 3HB9A 2FPYA 4OV4A 3NGJA 1UASA 4EOUA 2YYUA 2GQ9A 1VLWA 4FEZA 3A5VA 5T26A 2VEKA 4MOZA 2XN1A 3HG2A 4NT0A 2DJXA 3GYEA 5D37A 2A4AA 4DF0A 1B4EA 1S5WA 3LI1A 3L68A 4O19A 5A5WA 1EUNA 3MI2A 5G2WA 4EIVA 1KLYA 1XC4A 1N7KA 3EX1A 5KITA 4O52A 3PVFA 2CLHA 3VKJA 1IIGA 2QUUA 3NR0A 3PUDA 4TO8A 2TSYA 3GAKA 4LC8A 4C1LA 3IGXA 3SGZA 3NQ7A 4TMCA 2ZZ7A 2CFFA 3W1AA 4LNYA 5E93A 2OMAA 1XCFA 4XZ9A 2OT0A 3S6DA 1YADA 3NQMA 3R5EA 2QDHA 1EX5A 1LROA 3G0UA 5AHMA 5DXXA 1TPFA 3M9YA 1C8VA 3WJWA 4DPQA 1LRNA 1GT8A 2JKPA 1H7OA 4N6FA 1EB3A 1LCOA 2YW4A 2Y62A 3L5AA 4RZ5A 5BMWA 1PIIA 3N9RA 3NPVA 4BI5A 1JUBA 2TRSA 3BV4A 5FEXA 3FJLA 3S5NA 1FDZA 5FF4A 2ZZ5A 3GK0A 1MXSA 1VS1A 3GDKA 2EPHA 5FI8A 3EX2A 2QJIA 4ZVJA 3MP4A 3LRLA 4NNAA 4GC4A 2A7PA 5F4WA 4JIPA 3WK1A 2VENA 4M19A 4UTHA 1YXYA 2XFWA 3C4UA 4FNQA 4PC8A 1FWRA 4AF0A 1DHPA 4XWUA 3LCIA 1GZGA 2WNQA 4H4IA 2GVJA 2Z6IA 4N9BA 1OFPA 2DZVA 3U2OA 3VE7A 3TQ0A 4Z1DA 2ATSA 3DHDA 1LOQA 3FIGA 3ZS4A 1GWJA 2QAPA 3BPWA 4OE7A 3W72A 5U7SA 3S1XA 1QCWA 3MYPA 4NJIA 3W7JA 4QQ3A 4DO6A 2Y7GA 3JS3A 4O28A 5C6MA 3KFTA 3P82A 4Z0JA 2PURA 4UFIA 5D05A 2FLIA 1I2OA 2NX9A 3ANYA 4O57A 2B0MA 5IBXA 2X1RA 1SW7A 2Q8LA 3TC7A 4MPQA 4XTDA 3T55A 3WK0A 4WY0A 3ATYA 4HN4A 1Z44A 5FEPA 3HO8A 3GDRA 1XBVA 3GX9A 1F76A 4JNMA 2D73A 3MHFA 4UTUA 4YMZA 3GXNA 4QITA 1KTNA 3W7NA 3TKFA 2JKAA 4OGZA 4UFKA 3PBWA 3W70A 3W7KA 3MO7A 4JX6A 1IIHA 3UY8A 1TQJA 1W3TA 2XN0A 3LCWA 1TTPA 1O5XA 2QUTA 2ZZ3A 3RLVA 3TMLA 4QIUA 1Q6RA 3JRKA 3DFNA 4LVGA 2ZRYA 2W79A 4YWIA 4R34A 5FF7A 1OFAA 1GPWA 3MP3A 3RFAA 1SU5A 1G4TA 2YZRA 2ALDA 4JD4A 2V82A 3ZR4A 1BEUA 3QYQA 3CIXA 4TR9A 4RJEA 3W7HA 2I9EA 3OHIA 1OFBA 2NUXA 1WOAA 2CZFA 4JXCA 1GTEA 2ZRVA 4MUZA 1UBSA 1VHNA 2Y85A 1OFOA 3O6YX 2EGZA 5TQLA 1WBHA 3UWUA 5F4SA 1K7EA 5AHIA 3KAOA 4UR7A 1SZGA 3LV5A 1VPXA 2A7RA 2VFHA 3LDVA 4EWND 1O94A 2P1FA 1OHLA 1KW1A 1JCLA 2Y7FA 3HJZA 4LC6A 3HGJA 3HG3A 5DELA 4ADSA 3NL3A 1LBFA 3PM6A 4KFOA 4JS3A 1MO0A 1QOPA 1ONRA 3EWYA 4NJHA 4EF8A 2DZXA 1T96A 1LM1A 1OX4A 3Q94A 1FDJA 4AXKA 4JYEA 3L0GA 4UNKA 2VELA 1DKWA 2E5CA 4O13A 3PG8A 3TROA 5AHFA 3O63A 5LNRA 2A21A 4S2CA 3L0NA 3KRSA 3BARA 3G8RA 4JTJA 2DJLA 3KOFA 3W1UA 3G24A 1AW2A 3CHVA 1YYAA 4AVFA 4HNNA 1VYSX 3QQ0A 1ZAJA 5U4NA 2HMCA 5AHLA 2C15A 4BFAA 3MHUA 1KM3A 1YXDA 4BR1A 5AN7A 4YXGA 3TUUA 1JVNA 4OT7A 2ABBA 2H3DA 4JGDA 2PRLA 1H1YA 5G4EA 3NQEA 3N19B 1JCMP 3P67A 4MIMA 1TTIA 5FF0A 1X1OA 5E1QA 4N02A 1F73A 3FFSA 2YXGA 1DJQA 5LKYA 4JN6A 2NXIA 3DKJA 3TC6A 5KZEA 4FIRA 4CNOA 3TXZA 3DFQA 1V7YA 2AGKA 1R2RA 1TV8A 3IVUA 2OCZA 2ZRWA 4FX7A 5DBTA 1WBJA 3IIPA 4UTTA 1H5YA 5AC8A 3HOJA 2CLFA 3TQKA 2DZPA 3NQAA 4GUHA 1AW1A 4BK9A 4DELA 1TQXA 4HT3A 4R33A 1W5QA 3MBDA 2CLLA 4J9JA 1OABA 4Z1CA 3CM4A 3W7IA 2QCDB 4WXZA 4KWWA 5I3GA 3I7SA 1QPQA 1H7RA 3L67A 1MEIA 4MY8A 1TREA 5DCBA 4AHOA 3ATZA 4O12A 3QC3A 5I3HA 1OF6A 2B4GA 4QJ1A 2AAMA 4NJKA 1W54A 2C3ZA 3N34A 4LWWA 1JR1A 4LVBA 4W9TA 5G4WA 2ZCGA 2ZFAA 4MFEA 2VFDA 3Q58A 2Q8ZA 3CQ0A 1TB3A 4QSHA 3NQCA 4A22A 3IVTA 4I9AA 2ABAA 3PUOA 4LS0A 1ICPA 3T40A 5F4XA 3THQA 2XN2A 1AL8A 3NPWA 3W6YA 4PL2A 1VCGA 2ZBTA 2V5BA 4NZFA 3FOKA 2WSQA 3GIYA 1K8YA 1A53A 1AK5A 2BZNA 2NWSA 3P84A 4WJEA 3IVSA 3P5ZA 4UXDA 3MWAA 3O6CA 1H61A 5LNUA 4OHQA 1YPIA 1O60A 3TSDA 3ABRA 3HG4A 2QCDA 3W75A 4JTUA 3QZEA 3LTYA 4XKYB 4ADUA 1YXCA 3L0KA 5LGXA 4IMFA 3NA8A 2B7NA 3SECA 3RU6A 4ZQMA 5D32A 5G2IA 4H3DA 3NAVA 3SFKA 1H50A 3TX9A 1GG0A 1TJRA 3RMJA 2C16A 4P2VA 4A29A 2Q3OA 1FBAA 4AH7A 3BGJA 3CLMA 5H2ZA 1G69A 2V81A 2ZRZA 3EWBX 3VCRA 3EB2A 4ZZ9A 1GYLA 4U28A 2OJPA 3W86A 3W7QA 3C8FA 4ICNA 4FXSA 4WX2A 1K02A 5C2XA 3OG3A 1UUMA 1G7UA 3P61A 3B06A 3SW6A 3W7LA 2ZZ6A 1JJKA 1YDOA 2J27A 5F2MA 3BW3A 3BG5A 1JUKA 3TFXA 4FX8A 2A6LA 1TTQA 3R12A 4AHQA 3FKKA 4QNWA 3FKRA 1EIXA 4O50A 1EP1A 2GVLA 3NZRA 2F84A 3MI6A 1IXOA 2E6DA 2J9XA 2C18A 4IPIA 3TU9A 2QUVA 1WA3A 4A21A 4K36A 5HWNA 3P81A 3CU2A 3QF0A 2EAWA 3PS7A 1LBMA 1WV2A 5G5IA 1NAL1 4FF7A 4OQVA 3DZ1A 4JX5A 4E0CA 2E1DA 4MFDA 3V75A 1CI1A 3CWOX 4BI6A 4IX2A 3BGGA 1FWWA 1WOBA 1ZALA 5EMUA 3BG9A 3R13A 5CPNA 2QJHA 3R2GA 5CZSA 5AYZA 3ZFHA 3G22A 4XBSA 3W9ZA 3MJYA 4LVFA 1SW3A 4K8HA 3OVQA 1NSJA 5I3IA 3ZWTA 1VC4A 3JR2A 1EPXA 3MI3A 1KM6A 4P61A 1MZHA 2DZWA 4ONVA 1TYGA 5KSWA 2H6RA 4Y96A 3LXAA 1RQHA 3LRKA 1GYNA 4NU7A 4IUOA 5HWJA 2TPSA 2WNNA 1J4EA 1ADOA 1XXXA 3MHGA 1D3HA 3GAYA 4IOTA 1GVOA 3UWQA 3C0JA 1ME8A 3HPZA 1H63A 4DPPA 2PE4A 4K7VA 5D09A 3W87A 1TV5A 5KMYA 4DQWA 1KM5A 3EWUA 1Z48A 3ABQA 4LUJA 5TBOA 5LNVA 5AOUA 4Y9AA 3WFAA 1OJXA 1JRCA 3HQ1A 3L65A 4M6QA 4PCFA 1BTMA 3MBFA 3G1YA 3I6RA 3A9IA 3IRDA 3PUEA 1TPC1 1DBTA 3GZ3A 1D9EA 1VQTA 2YFNA 3HPSA 4NJJA 3NQDA 4Y6GA 1XFBA 4NNBA 4DEFA 1WX0A 3P8JA 3B0PA 1P0KA 3KHJA 4A3UA 3TDFA 1QDSA 2C6QA 1ZHAA 5AYXA 1UJPA 1XL9A 4UR8A 2FQIA 1F5ZA 2V0TA 2VEMA 4WZHA 4JY8A 3PB2A 1YDVA 4D2JA 2WOQA 4IGHA 2A7NA 4LW7A 2C19A 3M7WA 3E9AA 5K3VA 3K30A 3Q2DA 1IXNA 3CT7A 4DF2A 4UTLA 1LRQA 4DXVA 1F6KA 4N4QA 5HR6A 2WQPA 3KX6A 3G1DA 2PRHA 3EXSA 1QPOA 1LORA 3EXRA 5K9XA 4O0KA 2H90A 3P7YA 3LHYA 1K8ZA 3A22A 1W8SA 5KINA 3C2FA 4IX0A 4JTSA 3IGUA 3WJSA 4WOQA 1NFBA 2GQAA 2FFCA 4O53A 2GOUA 2A6NA 1RQBA 3FYPA 4IXHA 4HSNA 4HNTA 4MKNA 1FCBA 3W73A 5D02A 1Q6QA 3FLUA 3H55A 1VJIA 1QFEA 5EPDA 5EA9A 4G1KA 3GNNA 3V1PA 4LRTA 4CQAA 1JCYA 1KFEA 3VFLA 3VI2A 2A0NA 3SY5A 5K4ZA 3DH7A 2ZQ0A 5FEZA 2C13A 1OK6A 2ZA2A 2DP3A 3B4UA 3LBMA 4XQ6A 4CCCA 2V2CA 2FJKA 2GJNA 1EA0A 2FPVA 3LXCA 1F74A 3AJXA 3B05A 2X2GA 1W1ZA 2Z0IA 3W7PA 3BLFA 1W5PA 5D2VA 5D38A 2QCHA 4ZQOA 3WJXA 4X3ZA 5I3KA 3W7MA 5HWMA 2BXVA 1A5SA 2NV2A 3B0VC 3T7VA 1H7NA 1DQXA 1OFRA 1PCKA 1YTEA 1OYAA 4JICA 1KM0A 5K7JA 2QR6A 2QF7A 4IMCA 1WYIA 2FPTA 4K39A 4QNEA 3OVRA 4GUGA 1XUUA 3LCLA 2RH9A 1JQXA 1KV8A 1LTDA 4IXXA 1AMKA 2OX1A 3G1HA 3S1WA 4DO5A 5CGQA 1AW5A 2Y61A 4RXGA 1K3UA 4YL2A 3SGUA 2FTPA 3F1QA 3TR2A 3TE9A 4E38A 4JTHA 4K7YA 1Q6LA 3FS2A 1EUAA 3LHWA 3HF3A 3MYOA 1A50A 1S5VA 1B3OA 3TJLA 3UWZA 2J6XA 1M5WA 3GNDA 1FXQA 3CWNA 4IJBA 3TA6A 3GXPA 2E5DA 3BG3A 4GNJA 4HPXA 4GE8A 4RXFA 3QJAA 2Y6ZA 4DBDA 4GBUA 3NEVA 2NXGA 2V2DA 1X8FA 1ZY9A 3W71A 3O6DA 3SI9A 3S1VA 4JTEA 3SZ8A 3G3DA 3IIOA 3OIXA 1SW0A 1DOSA 4FX6M 1QWGA 3L21A 1B9BA 3HMJG 3TSMA 3HGRA 1HO1A 2G97A 5K9CA 3C52A 4ZQRA 1W5OA 1ICQA 4UTTC 3UWWA 1KV5A 1TPWA 4ALDA 2E6AA 3N2MA 2Y63A 1GTHA 4QAIA 3NYZA 4ADTA 3GR7A 3PC0A 5DXYA 2DZSA 3N2XA 3QFEA 3B03A 5FF3A 2ZZ2A 4NX5A 3KRUA 1C9DA 3QQ1A 3LBCA 4TX9A 3HGOA 1V5XA 3CIWA 1ALDA 2VFEA 3TCEA 1I4NA 1R47A 4K38A 3W1PA 4NUWA 3LHVA 3DXIA 3BVJA 2QCGA 3PBYA 2LLEA 2RHGA 4N2YA 2WJZA 2DORA 3C6CA 2V9DA 1ZJIA 2NV1A 2CU0A 4PA8A 1F2JA 4MJZA 1C29A 4TU1A 1I8JA 2ISVA 4O1AA 3M5YA 1TSIA 3TIMA 2JK2A 1W5NA 3O07A 4MYXA 2CWNA 1TPH1 3O05A 3TH6A 1LZOA 1I2QA 1M7PA 1OF8A 5L6UA 4CNPA 1VLIA 1G4PA 4TMBA 2QEZA 3SR7A 3M6YA 3RLUA 1FY6A 4QISA 4RV8A 1TTJA 4O4WA 4KFPA 2V5LA 3WJYA 4K37A 3W2NA 1SR9A 3U8GA 3NQVA 2G95A 3NXFA 2YR1A 2X16A 3L2IA 3LERA 4JTKA 4ORMA 2VEIA 3CTLA 3CPRA 4LUIA 3P8IA 1FCUA 4MZ8A 3L9CA 2F7FA 1J5TA 3TV8A 3N9SA 1EWEA 1XM3A 1HFBA 2V8ZA 3NOEA 3NNTA 3W1TA 2VC6A 5I3FA 3NPXA 4YCPA 1L2UA 3LCHA 3GKAA
chains in the Genus database with same CATH superfamily
2BSLA 4LNCA 4CQ8A 1EQCA 1VIWA 2OXNA 4JTFA 1K7FA 5FJRA 3CYVA 1K4GA 4Y9PA 2V63A 3DBPA 1LQ2A 4GI4A 3DUGA 1GVYA 1F05A 3KVMA 2QCMA 3KBNA 4YTUA 5FEWA 2IKJA 3USBA 3U0HA 1I6NA 3GG7A 1LOLA 3O7UA 2WPGA 1CXIA 4BJHA 3EX3A 2V3FA 3T4CA 3GBEA 2WB5A 4OECA 5I09A 1H49A 3DYOA 3F2BA 3EB4A 4HIBA 4P7QA 3F4DA 2C0AA 4ZO9A 2NUWA 1DTUA 4OUEA 3T09A 1QNVA 1H62A 3XIMA 1SSGA 4ZOBA 4UTJA 5T9BG 4L6OA 4F8XA 1TCMA 2Y89A 3M07A 5D03A 2WSRA 3GYCA 5LIXX 1FKWA 3UJRA 3CEUA 2O7SA 4RLIA 3HG5A 3IUHA 2VC9A 1XF0A 1F3TA 4IMDA 1UP2A 1JCXA 5CH9A 1TMQA 4GUIA 1WAWA 1O6IA 1X7IA 3DECA 3U6WA 1OK4A 3M44A 4LH8A 3FNDA 5KZMA 1R3RA 1GOMA 3N2OA 4C1NB 1H11A 4JTQA 1U22A 2ZXQA 3UYIA 2VRJA 3QSRA 1AZ1A 3CAVA 5EMLA 4PUKA 1L6SA 4QROA 3OVPA 3G3MA 3BK0A 4R9OA 4Y2WA 3TW6A 1NWTA 5A8OA 1QAPA 4W8LA 3Q4DA 3REQA 4UCGA 4AY1A 3DHFA 4UC5A 2OOFA 2Z29A 4AWUA 1R3QA 3ARQA 5LNSA 3OP2A 1U83A 1YLVA 4DJFA 4BI7A 1XCXA 3GU9A 4I9JA 4RNHA 2GUYA 4WVXA 2FKPA 3J7HA 3U2EA 1H3GA 1NP2A 1DWJM 2RKXA 3VGHA 2OLHA 4ACYA 2XZ9A 2TMDA 1XGEA 4B2DA 4JHZA 4UQEA 2YCJA 1A4LA 4CKQA 1XYAA 3GH4A 1KKRA 1TV2A 1OG0A 3W4RA 2WHJA 3WBYA 1CXEA 2VD9A 4ML9A 1A5NC 1B4KA 1DE6A 4AQLA 4JQ2A 8XIMA 4S3EA 3QC0A 1XI3A 3P80A 5HR7A 5DCDA 3P93A 3CEPA 4IM4A 1UB3A 3AS1A 1K7XA 4JNYA 5H1WA 3D5HA 4M7TA 3G1VA 1Q63A 3GE7A 3VOJA 5DLCA 2ZRXA 1H2JA 4KQNA 1RJRA 3FJ6A 4U31A 1TUXA 4AZGA 3MUAA 3UU0A 4P7RA 4D1IA 1KFBA 3EOLA 1AODA 2ZUWA 4IWWA 4C5ZA 1ADSA 3M16A 2WANA 3BJTA 3G1XA 2CBJA 3KTCA 1DQWA 3ITCA 1YIXA 4NF7A 1YNYA 4DF1A 4ACZA 1GVIA 2X09A 3DI0A 3QPYA 2AQWA 4I9TA 6TIMA 4US5A 4B5NA 1UKSA 3UZ5A 1G67A 3E0IA 1VBJA 2RAGA 4C6OA 3TLQA 4PMRA 1TRDA 3ZZ1A 3PZMA 3BTNA 4O1DA 1UZDA 3PBMA 4J3WA 4GYJA 3WEOA 3LPFA 1Q8AA 4UMAA 4KWUA 3H53A 1XLBA 3CH0A 2Y5EA 1WPCA 3R43A 2WZIA 3NVTA 1KCXA 3PZ9A 4XAFA 2YDSA 1XSJA 3MUCA 1O4UA 3GHRA 4GYPA 1U1UA 1XIEA 4N9EA 3O8AA 3LLXA 3WENA 4Q4KA 1SFTA 1DIDA 1KQYA 1UR0A 1XLKA 3JZEA 3GVGA 3UCCA 3ZLHA 3W84A 4POCA 1SO6A 3HFYA 3VVGA 1EP3A 3O1NA 1UUQA 4U2ZA 3NZQA 3LD5A 4IL0A 4AAJA 2VUNA 1JCJA 4I7WA 4L5ZA 2YCIX 3CZEA 3NO5A 3W7GA 1P0BA 3F5JA 5LIWX 4K8EA 2G0WA 4LS2A 2FDSA 2WC3A 1V0LA 2YJQA 4W8AA 4F0LA 3W1MA 4ZTXA 1SJAA 3UXAA 2ZUSA 4WXYA 3CC1A 2J88A 4DBSA 3EOSA 4EWJA 1TMLA 4I7VA 2CXEA 3GHSA 1LLZA 2BLEA 2DT2A 3DENA 1ZL1A 4XZBA 4I90A 1LUCB 1KWGA 2D0FA 3Q37A 1XRTA 3W1QA 2WMFA 3EDJA 1G4SA 2PLMA 2VZOA 1CGXA 1V6TA 3MWCA 1ZNNA 1Q6GA 1UROA 2YBUA 5LA0A 5FL1A 5I3JA 1P1XA 1GOOA 1JDAA 1KQZA 1EIBA 2W92A 1GONA 2OGYA 2NLYA 1NWUA 1TPB1 4HMEA 4LVAA 4IHCA 2PFHA 3EEGA 3EA1A 2WHKA 1V6YA 3EDEA 1PJ9A 5A8MA 1GK8A 1YQ2A 1P0NA 2W63A 5BXRA 3IUDA 2Y2WA 1MFVA 2PPGA 4CVUA 1NOFA 3GR8A 3L2LA 3WF0A 5CSRA 3VM5A 3W1RA 4GG9A 4MJMA 1GOKA 2WWCA 4TVCA 4TUFA 1UIPA 3O06A 1CWYA 3QV6A 1PO9A 1E0WA 5EBUA 2ZZ4A 2ZXBA 5D33A 3WBAA 3EAUA 1HO4A 2YSWA 2OLAA 3GNOA 2BY0A 4PMDA 1Q6DA 3UR8A 1WQ5A 5JU6A 2PD9A 3L12A 3W22A 2CW6A 1E3XA 3EDDA 5FSEC 4E2DA 2ATMA 1O1ZA 1MSSA 3TYEA 5BOFA 4GI9A 3VX1A 2XGIA 2QUMA 4ZQNA 4O18A 1F6PA 5HNNA 4D6JA 2KZHA 3PHAA 2QIIA 1IHIA 2FYMA 4PULA 4AEEA 1H60A 3OLGA 1WZMA 2INZA 5FF2A 4MG4A 1GUVA 4WUIA 4R7JA 1T0OA 2JKEA 2FB3A 3U5YA 3MMDA 1NEYA 1KM4A 1BPLB 2HDJA 1CCWB 2Z1XA 3S9IA 3WEMA 5CXPA 1AQ0A 1F3EA 4BQ4A 1NIUA 3T0AA 3WFZA 4KCTA 3GG8A 4PCTA 1EF3A 4M6VA 3HPAA 2R14A 4Z1AA 1UP0A 3R8RA 3TTYA 1G6CA 1W1B1 1JDCA 5I3DA 1EEXA 4E3TA 3W76A 3NURA 3N6JA 1OX6A 3ITOA 4GXPA 3WMCA 1XLGA 5BU9A 4QG6A 2D0HA 1FUYA 2H8XA 3QV8A 1EGVA 1L6YA 3KOXA 4JX4A 3STEA 2CYGA 2ZE3A 1MEWA 1Q7ZA 2O9TA 4FXFA 4GMEA 4AZCB 2XJ7A 1PIFA 4Z2LA 1SO4A 2YLAA 3VPLA 1KFLA 4O16A 4G5DA 4IMEA 3PAJA 5HQEA 4URIA 3NDYA 1M3UA 1E0TA 2VJXA 2VWTA 4TV5A 1E0XA 1J79A 5LXXA 3PG9A 2A3LA 3GBDA 5AECA 1LOSA 1TR1A 3GXFA 3BXWA 3MA8A 5HMDA 3STPA 3OYXA 2I57A 4DZHA 5G4HC 1Q8JA 3TZNA 2WNZA 2ZRUA 1NM9A 4X9YA 5E09A 2C0HA 1XLHA 1ITUA 3IJQA 3CHCA 1IQ8A 4HA3A 4UIOA 4S3GA 4N9DA 5AHEA 1R2TA 4GO8A 4JTTA 5CSSA 4G56A 4A3RA 1A5KC 3VINA 3GRIA 2GYIA 3IJ9A 4QDMA 1SJBA 3MKKA 3H21A 5A6AA 4JQAA 1C93A 1EQPA 1KCKA 1YRRA 1U2YA 1PHWA 1H7WA 1J0HA 4TV6A 4CN4A 3S3GA 1YNPA 3F4NA 1FX6A 4J2MA 1YTDA 1KLZA 3V36A 1CNVA 4O14A 2J7EA 3KXQA 4HOXA 2NWRA 3U57A 3CUJA 3BCDA 4PEEA 4REQA 4XVEA 4YNGA 1ML1A 2B31A 3BW2A 1PZ3A 4A2RA 4JFTA 2NZLA 3W1XA 3TOYA 4GY7A 5A6TC 4BF9A 5HJYA 4HHHA 3QPEA 3A21A 3EKGA 3NQBA 4JTLA 1CENA 4GUJA 1B5TA 3MVTA 3EKLA 1JGIA 1NOUA 4WQ6A 2HISA 4HPNA 3QM3A 3ZVHB 1V0MA 1VR6A 2PU1A 4AWSA 1HXJA 1A0DA 2NV9A 5LIYX 1RQEA 1YDNA 1FWIC 5CPMA 4A3HA 1B1YA 2WNWA 3K13A 4BWLA 4MAVA 1Q45A 2NQJA 2IQTA 3L5MA 3WK2A 4CCEA 3SCPA 4LAKA 4KWVA 2GJPA 3VE9A 2HVMA 4PMJA 4UTMA 4U3AA 3ABOA 4M6PA 3C56A 1S39A 1KO0A 3LSBA 4DB7A 5EBAA 5L9FA 1NP0A 4O1BA 1VZWA 4NQ1A 4RKAA 4WDWA 2E68A 1N55A 3RGTA 2EF9A 1KBBA 2WW5A 5E5CA 1V6XA 3K4AA 1YPFA 2F6UA 1O1HA 2YCLA 4KWOA 3BLEA 3M4HA 2Z2UA 2E09A 3OW1A 4B3ZA 3TTEA 2BG5A 2Z1BA 4PYSA 1QO2A 1XH2A 4JTIA 1ZAIA 1L6WA 5JVLA 1BYDA 4RDVA 5CSYA 3LLDA 1E9IA 3QGVA 3OHMB 4DAIA 4H8UA 2GUUA 2GSJA 4K6AA 1BYAA 2NVAA 3UESA 3D3FA 1Z9AA 3IIVA 1TPUA 3WQ6A 4DIAA 1TIWA 2Y0FA 3M7SA 2OZ0A 3WDIA 3L5LA 1HKMA 5BZAA 1EGMA 2Z1WA 2PLKA 2A3BA 3C2OA 4QG9A 3CNYA 1C7SA 2PZNA 3WD2A 1W3IA 4Z17A 3WLLA 1K8XA 4PTDA 3RHGA 2J9ZA 3HPXA 3MUXA 3FX4A 3RU8X 2ANUA 3VX0A 3VDAA 1R3VA 3W24A 3W07A 1E51A 2WJEA 2YYTA 3WO8A 1XYZA 1QBBA 2QDEA 3NPUA 2NLIA 4XZNX 5C55A 3VDGA 4Q8NA 1M03A 1O95A 1FHLA 2QAFA 1PTDA 5EKYA 3AHZA 2YDRA 1QASA 4Y8FA 4FHAA 4FPSA 4A8RA 2JALA 2FPYA 2HPIA 3NGJA 4DWSA 2PDWA 4EOUA 3QFWA 1D8WA 3A5VA 1DJGA 3URNA 5IHSA 3GYEA 3BLPX 2QGHA 1W6TA 4LAOA 4DF0A 1S5WA 2FGLA 2IKHA 1IEQA 2WJFA 5G2WA 4EIVA 1KLYA 2XIQA 1XC4A 1Y8BA 2GUBA 3PVFA 3VKJA 3VZYA 1IIGA 3NR0A 3GAKA 1XKJA 2QPSA 3ARSA 4TMCA 2V3DA 5C70A 1UA7A 4F0MA 1NDYA 4AY8A 1JPHA 3EYPA 4JL2A 5E93A 2OMAA 4XZ9A 1UQZA 3NQMA 5AHMA 3CQJA 4DPQA 4FF5A 1GT8A 3XISA 1KBLA 1EJWC 1LCOA 4GC3A 2Y62A 4IICA 3PK7A 2WBGA 3NPVA 1XGDA 2TRSA 3ONBA 3S5NA 3B8SA 1MXSA 3CZ8A 4PZVA 4BF7A 3UCDA 5I0DA 3EX2A 2QJIA 3MP4A 2QF8A 1HX0A 5F4WA 3ICJA 4HD5A 3USZA 3VKCA 4YJ5A 5C9WA 1A5OC 1DHPA 5CC5A 2ZUNA 2F6XA 4C91A 4H4IA 1V02E 2Z6IA 1OFPA 2DZVA 3TQ0A 4ZCWA 1J18A 4J3TA 1GWJA 3W72A 4AYSA 1BKHA 3MYPA 4NJIA 4QQ3A 4DO6A 4CVWA 4NRRA 3L4VA 4GZ7A 2P0IA 2PDMA 3N3TA 3P82A 3N4FA 3UPMA 4D1JA 1KRMA 1V0KA 1I2OA 2NX9A 2Q8LA 3TC7A 3WK0A 1UWSA 1XRSA 1KXQA 1E6ZA 3B8WA 3GDRA 2CNCA 3BWWA 3T0TA 4AFYA 4QX4A 3UCQA 1ZP4A 2UY5A 3DDMA 3WQEA 1V6UA 3MO7A 2A3CA 1IIHA 2OO6A 4FOUA 1UD3A 3QZAA 3S2NA 2AMGA 3CWHA 2OYLA 4NYYA 3BOXA 1Q6RA 4C6QA 3DFNA 2ACQA 1VEPA 4FOKA 4DLFA 3LGGA 1OFAA 3MP3A 3RFAA 1SU5A 3WQ4A 2YZRA 2ALDA 1TJ1A 3S2JA 3TJ4A 3BV7A 1JPDX 2I7GA 2DUAA 4Q8PA 4TR9A 3W7HA 5IOBA 2NUXA 2AL1A 4AX6A 1XIIA 4XG1A 4MUZA 4G7EB 1VFLA 5AY7A 4JTAA 2VX6A 2EGZA 1K7EA 4UR7A 2D3LA 2XYLA 2Z00A 2XVKA 2A7RA 3I4EA 4NAEB 4C6MA 2VFHA 3RN6A 4LC6A 1XG3A 4ZSUA 4QRNA 4M80A 3N17A 3M64A 4JS3A 3EWYA 3EDKA 2C91A 3UWEA 4IQDA 5DQPA 4UNKA 1US2A 3SN0A 4HB7A 3KBMA 1DKWA 4KBXA 5IDZA 3ZOAA 5AC5A 1FH8A 1KRAC 2A21A 3L0NA 3LYEA 1XYFA 3GFXA 1VBGA 4IZGA 1PDYA 1XLDA 4DHGA 2GJXB 2DJLA 4R88A 2CPUA 1AW2A 3CHVA 4WCJA 3SUTA 4UTFA 2ZWYA 1VYSX 1JD9A 5U4NA 2W91A 2HMCA 4PUMA 3W01A 2OZTA 3HA1A 4OT7A 4LX4A 2H3DA 1RY0A 2GGGA 2ZX6A 3WG6A 1G94A 1Z8AA 1O66A 3T0BA 4AZCA 3N2TA 4DBWA 5FF0A 1P7TA 4RDWA 1XLJA 3W81A 4JN6A 5KZEA 4RW3A 2ZX8A 3WLKX 1V7YA 4XIAA 1EJSC 1TV8A 3IVUA 4PR4A 1BF2A 4JHOA 4FX7A 3HOJA 4H9ZA 4MNMA 2FZ8A 5E6YA 3NQAA 1B90A 4KIEA 1HKIA 1B3WA 3EEZA 1ONXA 3MSDA 4HT3A 2EEXA 2RJHA 3U2ZA 4Z2JA 3SCRA 4NP7A 3MBDA 3QKEA 3CM4A 3F4CA 4M56A 2ON3A 1TREA 2X7WA 4A8NA 3KTXA 1EJRC 1UZHA 1MNSA 2G3IA 4NJKA 5E70A 1N8IA 5E6ZA 4CEUC 1M7XA 2BDQA 4DZAA 1JR1A 2WLZA 3S2CA 2WVVB 2BVWA 1V3JA 4HTYA 2CCRA 3BDKA 1TB3A 5HMFA 2X40A 3B9EA 3BC9A 4J3ZA 3DBNA 4ZO8A 1R5YA 3C0LA 4KW2A 2WSQA 4YWSA 3A4AA 2XZ7A 2W61A 2OEKA 4BS0A 4AD2A 4LJ3A 3ISIX 3IVSA 3K1DA 4UXDA 3MWAA 4UOZA 2GGIA 5LNUA 1UD2A 4EPKA 3EZ4A 3HG4A 2QJMA 3LTYA 3EA3A 5LGXA 3QLLA 1LG1A 3TOPA 1DQUA 1UWUA 2PDHA 3UA4A 3EPNA 3NAVA 1H50A 2V3EA 4M6UA 1GG0A 4P2VA 4PCNA 3BGJA 4JCMA 1MYRA 1ISYA 3EWBX 4PMXA 3VCRA 4GCAA 4ZZ9A 3B9DA 5JXQA 3W86A 1ZQ5A 3GC4A 1G7UA 3MVIA 3W7LA 1MDRA 1UHVA 5E9AA 1JJKA 4M82A 3BG5A 4ZO7A 1U5HA 1HVQA 1V08A 2A6LA 2P50A 1TTQA 4JPGA 2OTDA 4UOJA 1CGUA 2WC4A 1EJ7L 4GY1A 4O50A 4U2YA 1QJWA 4W4QA 1IXOA 3KZPA 1RHCA 5ENLA 5XIMA 2X0SA 2C18A 4Q4OA 1X1NA 2QUVA 3N4AA 3V0UA 4K36A 3POHA 3G5EA 4RDZA 3S6OA 4MTVA 3NFUA 2DW7A 2FHCA 1E4NA 1NAL1 1XPGA 1S2CA 3V75A 4BI6A 1V51A 1WOBA 5EMUA 4IQJA 3CHEA 3R13A 3WQFA 2WYSA 4CCZA 5HK4A 3ZFHA 4XBSA 3W9ZA 5HJXA 1NSJA 1DHKA 3GWQA 2FVMA 3JR2A 1KM6A 4P61A 3PTDA 1MZHA 1LL7A 1D3CA 3AZSA 1NH6A 4ATDA 4JKMA 1T8QA 1GYNA 3S5SA 2WNNA 1J4EA 1ADOA 1W1YA 3VCCA 2YB1A 1EOMA 1D3HA 4IOTA 3ZJKA 1EBHA 3ZM8A 3BURA 4GI8A 3G2GA 4OTKA 2PE4A 3VDCA 2Z1VA 1G0CA 4K7VA 2PC8A 2VGIA 2PDFA 3OZYA 4HMCA 2QMJA 3TONA 4DQWA 3ABQA 4H8VA 2C7FA 1IT0A 3F2CA 4MNJA 4BQ2A 1JRCA 4B5VA 3QBUA 3G1YA 3I6RA 4W87A 1RBAA 1GW9A 3A9IA 3IRDA 3PUEA 5CC6A 5A3HA 7CGTA 2IXUA 2R6OA 2FGBA 4O8AA 1P0KA 4A3UA 1QDSA 1TX0A 3L4XA 1UC5A 1UWIA 4JKLA 2ZKMX 4S3KA 2V0TA 4JY8A 1Z6KA 3MCMA 1EJXC 3V5CA 4IGHA 4H6EA 4HU0A 3SGGA 5AYIA 1RPKA 3LS9A 2PP1A 5MF5A 4NILA 3IACA 4YN5A 1LRQA 4DXVA 1F6KA 1ISWA 4WR3A 3KX6A 3G1DA 2PRHA 4ZXOA 3EXRA 4O0KA 3P7YA 4JKKA 3A22A 4S3AA 1EJUC 1W8SA 5XIAA 3EPMA 2PDJA 2GOUA 5C9XA 2X2YA 3FLUA 1VJIA 3VKKA 3SB0A 3UW6A 5EA9A 3UERA 3VFLA 5K4ZA 5FEZA 4AVOA 4LAZA 4Q8UA 3IV8A 3RJXA 2V2CA 5FJUA 1EA0A 3H2CA 1GQIA 3N9KA 3LXCA 3B40A 1BHGA 3SRFA 3AJXA 2DT3A 1WP6A 3B05A 3T9PA 1W1ZA 1HGWA 4H2HA 4ZQOA 2CBUA 3AXXA 4QR6A 1MQQA 3UP8A 1P7TB 4GGHA 1EDTA 2ZOXA 3GFZA 3TN6A 4FI4A 1A5SA 2ISDA 1X8CA 1H7NA 1ONWA 2PEVA 3WQGA 1XIMA 1VJZA 5I03A 3QQWA 2BOFX 2CIPA 3GTFA 4US6A 1KM0A 1GJUA 3N12A 4Y9MA 2QF7A 4IMCA 3B8UA 3DFYA 3OVRA 5EFDA 4RNJA 4GUGA 5M03A 1JQXA 3ARUA 1KV8A 1LTDA 2BHZA 4IXXA 3WF4A 3G1HA 4L9XA 3S1WA 4HQVA 1OGSA 5CGQA 2J7GA 1OC5A 2Y61A 3CJPA 3WD0A 1K3UA 3F1QA 4KESA 3TE9A 4K7YA 3PJXA 3W26A 1S5VA 1BFNA 3TJLA 1PX4A 3UWZA 2J6XA 1M5WA 5A69A 3TEVA 1TWSA 1JD7A 3CWNA 3TA6A 3RAOA 4HYRA 2GJRA 3IPWA 3SSZA 5CSUA 3KZSA 4YPJA 4RXFA 3UG8A 1JYWA 1ZY9A 4NZ5A 4GQRA 5C2GA 2QUNA 1W9VA 3OIXA 1QWGA 3HMJG 3TSMA 4UCFA 1HO1A 3ABZA 2QJJA 1MFUA 3NVDA 3C52A 2ZWZA 5K9CA 3R94A 1W5OA 1M53A 1FOBA 2E6AA 1BXBA 1FP8A 3L4UA 4ADTA 1J0ZA 3OLIA 3E6EA 1PUDA 3R0KA 5DXYA 3CQIA 2VL4A 4ZB5A 5FJJA 2DSUA 3LBCA 2POTA 4TX9A 4K38A 3W1PA 4NUWA 3LHVA 3BSMA 2BBFA 5MKGA 2QCGA 3PZTA 3PBYA 2LLEA 3VIMA 2BXYA 4N2YA 1U30A 3LQGA 3ONCA 4AZ7A 1WUEA 4MKSA 2Y8UA 2DORA 1QTWA 3KCLA 4F9JA 4EPEC 2NV1A 2CU0A 1EHAA 4XSMA 3QZ6A 2I5GA 2JK2A 3AWNA 1T5AA 1XDJA 2HNEA 1OF8A 3IJ6A 3N1AA 1CXHA 4IGSA 2FVKA 1WE5A 3RLUA 4L1WA 4QISA 4G2DA 1TTJA 4O4WA 5HANA 2F38A 3VOIA 3W2NA 4MDOA 4HOZA 1E6XM 4UWMA 3G1RA 4JTKA 3EMQA 4MZ8A 3QHOA 3L9CA 2F7FA 3M46A 2Q01A 1BGGA 1Q5MA 4DX3A 1QHOA 2VC6A 4LBSA 2XINA 3GKAA 1OG6A 3A3WA 4JOMA 4HHPA 3VC5A 2VFIA 4OBTA 2OG9A 4MADA 1E9LA 1SM9A 4UNIA 2WHLA 1VFUA 4O4VA 4DJDD 7XIMA 1L8PA 1DJYA 2YFOA 2C1IA 3OA3A 5BRBA 5LZLA 1TJPA 3ALGA 5D9NA 1US0A 2XIJA 3D3AA 2JGYA 4O54A 2X1UA 1V3HA 4AZ6A 2ZC1A 1IEWA 5KETA 1H1NA 3BO9A 3AHTA 1WDWA 3IWPA 3AXIA 4GJJA 4UOQA 5CGTA 2RDTA 2YPIA 3C61A 3POCA 1EFZA 3NG3A 5A6JA 3IV3A 3BSHA 4AIEA 1UR4A 2DSZA 3SCSA 3REQB 1DORA 5FA5A 2A85A 4FXRA 4JIEA 1SJCA 1TPDA 4FNRA 1I2PA 1ZGDA 1HL2A 2WC7A 3QY8A 1V6VA 4NKCA 3K8MA 3W25A 1TIMA 3UF9A 2HXTA 1IWPA 2G5WA 1QI0A 1QXLA 3MV01 1TPVA 3VOFA 3DC8A 3GM8A 1J2WA 3FA5A 1DWAM 4JFWA 2CZDA 3T2OA 1S5NA 1UKQA 1EZWA 5LHFA 3W2KA 1OX4B 3TW7A 4Q8VA 3LPPA 1YEYA 1LL6A 2XG9A 3CMJA 5DANA 5HQLA 3NCOA 2J8GA 2WSKA 4DYJA 2NX1A 5FACA 5E0KA 1B57A 3C2EA 4GIAA 3LXBA 3UZYA 2IPJA 1UMYA 7TAAA 4WY0F 3M0MA 3IANA 3BJSA 1W2VA 5AC6A 1SFJA 4JTRA 3DKLA 1SVDA 1Q65A 1V77A 5HNRA 1VCFA 3NQ6A 4W93A 5EGRA 3SCNA 4EE9A 5AYYA 4F0RA 3JW7A 1BGAA 1R6WA 5FAJA 1C7TA 3F03K 3P3BA 1E1FA 3BAIA 1ODZA 3W28A 3RILA 4R27A 4MJ2A 5REQB 5CPLA 3OEXA 1RJQA 3ECQA 4KRTA 2HS6A 3LSCA 1HG3A 1I45A 3P5YA 2GPTA 2OSXA 5CGMA 4O15A 1KGUA 5CLWA 1VYRA 5FESA 4YVXA 4WRHA 3B8VA 3TQVA 5IHRA 3M47A 3OVGA 1UD5A 4UFMA 1RR2A 3WEZA 3C5QA 4P8VA 1ZBCA 1PIGA 1OCQA 3SY1A 2XDFA 4PSRA 3EWXA 3VD5A 4A05A 2G3NA 3BZGA 4PB5A 5GVJA 2C79A 3CZLA 4NXKA 3HURA 4AD4A 3DFSA 4AZHA 4PUJA 1HVXA 4WLCA 4WSHA 4W88A 4BWLC 3PZVA 4JNZA 1NDVA 4JTDA 4S2BA 4FZIA 4B5WA 4MWAC 2E7FA 4W84A 2YKKA 1CLKA 1T40A 2REQB 2P8BA 4H19A 2VEFA 3SCWA 1L6FA 1FDYA 9RUBA 3W02A 5C0QA 1QW8A 1LLWA 5LGZA 3W7OA 2VFFA 4YCOA 1SFLA 3OQEA 1OCNA 1REQB 4GCXA 3W38A 2QCFA 4GWEA 4H7CA 2EG6A 3W23A 2YDQA 1CX9A 4LUSB 2NX3A 3TNOA 3A4WA 4TIMA 3TYCA 2OYKA 2BV9A 5D2XA 1PE1A 1J11A 1JUEA 2CBIA 2VZTA 3AHXA 3F4WA 3I7QA 1KFJA 3UFYA 2VO5A 3T05A 1HQTA 2XH4A 1DJNA 1X6UA 3PZIA 4NZJA 4PEKA 1J8VA 5LXEA 4WDXA 3KDNA 4I8YA 1AJ0A 3BZJA 4RZ6A 2E6FA 3GDMA 6PTDA 1PHQA 3N73A 1WUFA 4K1GA 2WMKA 1W37A 2BHUA 4J3XA 1A5MC 3THUA 2UV8G 4L9ZA 1TCDA 1I1XA 1XYBA 4DAFA 4K8GA 3I68A 4GRSA 4S3BA 2DSKA 2OWCA 2X0HA 3PNZA 3TFCA 3QV9A 3O15A 3EX4A 1XUZA 2DT1A 7TIMA 3D0CA 4NZ4A 3T78A 3NEHA 1X6NA 5LSMA 5CKSA 3K2GA 1PXGA 4Q32A 1NWRA 3OQ8A 1DP0A 3R1ZA 2GZXA 4XUGA 3SRDA 1A5BA 3CUHA 4PH6A 5AHNA 1E71M 5F1UA 3UJSA 5MHBA 1PYFA 4QSFA 3WZ0E 4KIRA 1I9CB 2PCQA 1D2KA 4UMCA 1RV8A 1X39A 3UR5A 2ZDSA 4PODA 2GLKA 5CPOA 3TYBA 5H8MA 7REQA 2BP1A 1VEOA 2GDVA 3UG4A 3GZAA 5IM51 3STCA 5KTLA 1W0MA 2HEJA 2E6YA 2W67A 1L8NA 2XWDA 3ARRA 1EWDA 4L4PA 2EHHA 1IZKA 3MUIA 1TWIA 3WMLA 3AICA 1OYCA 2VDGA 3NQFA 4ZSTA 3YPIA 1UW9A 1QNOA 1ZB5A 2GQ8A 3PBUA 3W7DA 3GDTA 3HM7A 4HHLA 4EPBC 1AVAA 4X9SA 4W7VA 3DG3A 2JGQA 4P7NA 3SUVA 4UQAA 2NW0A 3P74A 1RVKA 3ZJ7A 1Y65A 4RW5A 4TX6A 3VOHA 3WD1A 4D9PA 2VDHA 2VXNA 2YBVA 5D04C 4YS1A 1BKSA 2Z6JA 4QFUA 1GNXA 4X0NA 1JPMA 3OODA 5DY3A 4IPPA 4ORIA 1WZLA 1OD0A 2A79A 1FCQA 4S38A 1QT1A 3EA2A 3G18A 1I2NA 2J62A 2DQWA 3WD3A 4E5TA 3DC0A 3LM7A 4ZR8A 2YL9A 2JE8A 3WNOA 3KBVA 2EKGA 3D47A 4NAFA 3WQWA 1FWAC 1JNDA 1P6CA 1FA2A 2BGNE 4GIRA 1S5TA 1E55A 3OZOA 3QEZA 1Z3NA 1ELSA 2J4GA 2QJGA 3W7RA 4PSPA 1E73M 4O8RA 5D2TA 5DT5A 4MY9A 4DO4A 1H0GA 2OU4A 2BY1A 3S5YA 1BWKA 3QSTA 3EMZA 2WZTA 3T8LA 1M68A 3CQKA 3M1ZA 1RP9A 1JDEA 5BOOA 3B8DA 1LQ0A 3NO3A 4JDBA 2PWVA 4FLOA 3LPOA 4QBXA 4LBRA 3S8HA 1Q6EA 4UQ9A 1DEDA 4JZ5A 2QCCA 2X42A 1DWFM 3G0XA 2GGJA 2BX7A 4OVXA 2BOGX 4CD6A 1KFKA 1OT1A 3SO7A 1R2SA 2D22A 4LVDA 2XISA 3TAKA 5HUOA 4H6RA 3ABXA 3SSJA 2HE5A 3SIZA 4I5RA 3KOYA 1SFSA 3A47A 1F7BA 2BS9A 4LOCA 3U3HA 3F2DA 2PS2A 1RSCA 1T41A 3U4AA 4J4KA 4R53A 3OJGA 4H6KA 3HQOA 1W9PA 2QHAA 5D4YA 3QW4B 3SCVA 3UR2A 3WN6A 4HTBA 2QIWA 3N6HA 4D8ZA 4HZMA 3HIJA 4WOZA 4B3KA 5IRPA 2VKZG 4KEVA 2WO5A 4KH2A 3PZUA 1I2RA 4FR6A 1FWGC 2Y8VA 4NY2A 3QW3A 2YB4A 4JTGA 4WSJA 2INFA 4UTWA 3E0LA 1PEZA 3ZJ8A 5BNKA 2OT1A 3M43A 3NZ1A 3KL3A 1DVJA 3AHYA 4B3LA 3E96A 5CZJA 1LDCA 2OWWA 4CQ9A 4TXEA 4O10A 1M7OA 3B0XA 4ICMA 2W6RA 5EY5A 4HJFA 3ZT6A 1SO5A 3T44A 3M0ZA 2VX5A 3BQ5A 1MEHA 4LQ1A 4AZIA 3AHVA 5DX7A 3ZSSA 4AB4A 1K03A 4YVVA 3UNTA 2W0UA 1ONEA 5EL1A 3T2QA 1Y0EA 1X6LA 2WZMA 2VEGA 2G96A 2JIWA 3W1NA 2X30A 1ZUAX 2TODA 4QGCA 3ZXWA 1OIFA 2VOMA 3H7UA 3KCJA 3CL6A 3TSBA 1B3VA 4PMQA 3VNMA 3HFTA 3AO0A 4ZE5A 1FFQA 1JPIA 4GX8A 2PDLA 3TC3A 2VWSA 4A2SA 5BXPA 5KZDA 1SJDA 3VKBA 4FK9A 1W3NA 4XAGA 3UA3A 2I56A 4HNCA 2WQDA 2GL5A 3RCYA 2B7QA 4W8BA 1S38A 1E0VA 3W6LA 3AYTA 4Q8WA 4ZL1A 2J66A 1EX1A 1JDDA 3MQTA 1GOXA 3WQDA 4IPNB 3EB3A 4H9MA 3S5OA 1LT8A 2YCEA 4ZB0A 4E2BA 2BTMA 3UPBA 4AZBA 3THAA 3ZSTA 1UD4A 3B3DA 2PI6A 3A5FA 1N8FA 4A6GA 4EVZA 1O5KA 3E49A 1ZFJA 4KMQA 1NWSA 3IIZA 2FB2A 4PTNA 1EP2A 1O12A 2Q6ZA 3MSYA 1X7FA 3BLIA 4MAZA 4MYAA 4ZQCA 4Y9NA 2EPKX 3KTSA 5AZ1A 2TAAA 4JN7A 1E1EA 4FAMA 3CMGA 1KRCC 1WKEA 3KP1A 4MLRA 1QNQA 4NJGA 2A5HA 4GQGA 5LHEA 4LUYA 1TO3A 3L4ZA 1FWBC 2VEPA 4UFJA 1HNYA 2DVTA 1AUSL 4NG3A 4YTQA 5HDRA 2QV5A 5C7HA 3ZMRA 1R3SA 3CV2A 3OGRA 2NUYA 2G3FA 5JH1A 4XK2A 2GK1B 1CLVA 1D3GA 4EXQA 1XR2A 2A3AA 4IP5A 2RFGA 4Z08A 2J6VA 2Z27A 4AMAA 3G1AA 5TIMA 3QR3A 2QCNA 1SQ7A 1E6RA 3HB9A 1EYEA 4E2VA 3BOFA 2EG8A 1W1PA 4UZSA 2J8TA 2PWUA 2VEKA 1K9EA 2XN1A 2ZX5A 4J1OA 1IR1A 3GY1A 5M2FX 2WVSA 5EB8A 4NYUA 2ZE0A 4EXBA 2ZUVA 3AIBA 5A5WA 1Q66A 1JGMA 3ZQ9A 3BCFA 1W2PA 5KITA 4CNUA 3HV9A 4H9VA 4CN1A 4L7ZA 1MW2A 4C1LA 3L2MA 3AYVA 3IGXA 2P3ZA 2CFFA 3W1AA 4KWSA 3L4YA 1XCFA 2PGFA 2QDHA 1W1TA 3AMGA 3M9YA 1C8VA 3WJWA 4L9YA 2FJUB 3LK6A 4MWAB 4J7RA 3TYDA 1PIIA 1R9ZA 4BI5A 4YVPA 1JUBA 1MW1A 5FEXA 5ABFA 1TZ7A 3DG6A 3GK0A 1VS1A 2E28A 3SCTA 3AZRA 4M81A 4CN6A 4GC4A 2A7PA 4M19A 3AC0A 3R11A 4AD1A 3C4UA 3S2LA 1JCTA 3ITXA 4AF0A 2OQLA 3LCIA 1XQKA 2YCLB 1GZGA 3KBWA 2WZEA 2GVJA 2OVLA 3M0JA 3N04A 4Z1DA 3PJTA 1XYLA 5I24A 1XHGA 1PDZA 4DBUA 1C9WA 3URBA 1PWMA 4Q8MA 5TD4A 5U7SA 3ARZA 3MMUA 3PWIA 4BQ3A 7ENLA 4HZ8A 3W7JA 1CEOA 1XLCA 4OOUA 4R9XA 4V1YA 4D6IA 2WSPA 3C0SA 4ZFCA 3KFTA 3UXKA 3WDRA 4Z0JA 1M1BA 2XTKA 3MUZ1 2O92A 4UFIA 2E40A 1J6OA 5IBXA 2B0MA 1SW7A 2E8YA 1ITQA 4JFVA 3H2NA 4XTDA 1TE6A 1Z44A 2VHLA 1EA9C 1TWDA 1XBVA 3VTRA 2QVHA 6A3HA 4UTUA 1QI3A 1BRLA 4QITA 1KTNA 1WB0A 1JF6A 2XSAA 2MNRA 2Z4GA 3W70A 2XN0A 4LXFA 4I9MA 2QT3A 4G9PA 1O5XA 2DVXA 2QUTA 4C6PA 3RLVA 2WMHA 2E9BA 2J77A 1W9DM 5A6KA 2W79A 4DRSA 1XH1A 3O0KA 5BROA 3RRXA 1GPWA 4P8WA 3C0QA 4EKJA 3RCMA 1UQYA 3ZR4A 3WFLA 3JVAA 3WD4A 3CIXA 1LQAA 2KX9A 3LUTA 1XRFA 1TA3A 2Z1KA 4JXCA 4V1XA 2BY2A 4C6LA 3D6NA 1VHNA 3O6YX 3OGSA 5TQLA 2OSWA 3WCZA 5CJ5A 5AHIA 3KAOA 3LV5A 1Q13A 1B2YA 4LBUA 2XVPA 3G6LA 4QEHA 2PA6A 3LDVA 1PWLA 2Y7FA 3B9AA 3WNNA 3H23A 3HG3A 4LEQA 3NL3A 3PM6A 2VZSA 4KFOA 4LAUA 2WVUA 5J8LA 1MO0A 2BNJA 4NJHA 4EF8A 1E5NA 1CECA 2DZXA 1T96A 1LM1A 1OX4A 3QXBA 1FDJA 5FSDC 3R10A 4NZ1A 3PG8A 3TROA 1EYWA 1AJZA 1MWOA 2GSHA 3KRSA 2CZVA 2H9AB 1PPIA 1Z69A 2FGZA 2DSWA 4HNNA 1HP5A 4JIHA 1KM3A 4BR1A 4YXGA 3AJ7A 1EDGA 4NIRA 4V2XA 3TW9A 1PKNA 1MZRA 2WKLA 5G4EA 4H41A 1JEZA 4D6GA 1TTIA 2BASA 1X1OA 5E1QA 4FLSA 4N02A 4AZ5A 1F73A 3FFSA 2YXGA 1DJQA 3H2OA 3AU2A 3R7MA 1TVPA 2NXIA 4FIRA 1S46A 3GXIA 2WAGA 1EC7A 2AGKA 1IGWA 2OCZA 1WBJA 3IIPA 1H5YA 5AC8A 1EZ2A 2DZPA 4GBDA 4GUHA 4KCUA 4PTVA 1AW1A 3P14A 4GNKB 4BK9A 1TQXA 2VC7A 3WNPA 3AS2A 2P76A 1BQCA 4J9JA 3UGVA 2G37A 3KBJA 1QNRA 2QCDB 3FXGA 4WXZA 4YTRA 4KWWA 1H7RA 3L67A 3WMSA 2DUXA 3V0TA 1K4HA 5I3HA 1OF6A 2B4GA 3I4KA 1UH4A 5BWAA 1FTXA 2C3ZA 3SN1A 1AJ2A 1QK2A 3M0XA 4LWWA 4LVBA 4ZODA 5G4WA 2ZFAA 1UKTA 3NZPA 5ABFB 2PGEA 2VFDA 3Q58A 4QSHA 1VRXA 5CC7A 2XFYA 3IVTA 4I9AA 2ABAA 3PUOA 3ZLFA 1ICPA 1VPQA 3T40A 5F4XA 3THQA 3VNJA 2AQVA 2V5BA 3FOKA 1NQKA 1V3LA 1MI3A 1ZPTA 4R85A 1A53A 1AK5A 2BZNA 2NWSA 2YLLA 3P84A 1V7AA 3WLIA 1MXDA 1H61A 1B54A 1TFVA 4PMYA 3CLWA 3QHMA 4F4RA 1JZ8A 4WKFA 2PF8A 4P5UA 2ACRA 3SECA 3RU6A 2QYGA 1V3KA 4MB3A 4K3ZA 4ZQMA 3TX9A 3KCOA 1TJRA 1TVNA 1E43A 4A29A 2FDMA 2Q3OA 3TWAA 3CUXA 3WH9A 4IGNA 3VUPA 2FZNA 1G69A 2V81A 4U5KA 3EB2A 3PAOA 1UKPA 4U28A 3XINA 1G01A 5CJNA 4FLRA 2ODOA 1TZ9A 4WX2A 4F48A 3OG3A 2QGYA 3MKVA 3B06A 3VGDA 2ZZ6A 1P6WA 2J27A 4DZ5A 2GK1A 3V0SA 3TFXA 4FX8A 4DJEC 1EXBA 2O55A 1HJSA 4AHQA 3FKRA 1XLMA 1EIXA 2GVLA 3TTSA 2BY3A 2F84A 3TNBA 2E6DA 1QK0A 3SDOA 3TU9A 2HNHA 5EMKA 4TVUA 1WA3A 2PDNA 2X1IA 4PUDA 3MDWA 1HJWA 3H4WA 3PFMA 1A5LC 3P81A 4OZOA 4XZHA 3PN8A 3PS7A 1BSLA 4FF7A 2Y24A 5ABHA 5HNUA 4E0CA 1CYGA 2E1DA 1CI1A 3RJYA 4H7VA 2PP0A 1ZALA 3FDGA 4LPCA 4FMVA 3AALA 9XIAA 3LY0A 3HJEA 2QJHA 1TKKA 4L56A 3R2GA 2BFGA 5CZSA 1XLIA 3MJYA 4Z2HA 3N25A 5DRIA 1RAKA 1NFPA 1IEXA 2DZWA 5KSWA 2H6RA 3TYUA 1UWAA 3F5KA 3LXAA 1RQHA 4EXAA 4NU7A 4LF1A 3CV1A 4B4FA 4C6KA 1XXXA 3K4DA 1SYTA 1PX3A 4CD7A 3GAYA 1EGZA 1VFHA 2VCCA 1ME8A 4F3HA 3VD7A 4JIIX 3CZGA 4ZA0A 5KMYA 1H09A 1BQGA 1LUCA 4LUJA 5TBOA 4HA0A 3VIFA 4GINA 5AOUA 3VM7A 3WFAA 1OJXA 3HQ1A 3L65A 4PCFA 1BTMA 1KNWA 2GGHA 1RA0A 4GABA 2Z2BA 2CC0A 5LIUX 4O1EA 4D72A 3OO2A 1ISZA 4AY7A 2ZUTA 2YFNA 3HPSA 3EGJA 4NNBA 3H8AA 3WDJA 4DEFA 4XB3A 1IEIA 4JBRA 3RPDA 1SMDA 1OB0A 3W6MA 1JZ6A 2FQIA 2I16A 4WZHA 1WKDA 1YDVA 4D2JA 2I17A 4LW7A 2C19A 2RGLA 2ZC8A 3E9AA 3GDBA 3K30A 1K6WA 3T81A 4UTLA 4AIOA 1LORA 1RK6A 1AD1A 1QU4A 2H90A 2G4FA 2CESA 4ERIA 5KINA 3BCJA 3C2FA 3UJFA 6CGTA 3IGUA 3WJSA 1NFBA 4MB4A 1S1RA 3CASA 4FA3A 5CJMA 1FCBA 3KW3A 2UY2A 4QG8A 4RNFA 2PWFA 4V15A 1M7JA 2CITA 1DXEA 1Q6QA 1UZ1A 1FHDA 1UJQA 3H55A 4HU4A 4NSBA 2XIMA 4AMCA 3V1PA 3GNNA 4LRTA 2AQOA 2FTYA 5GNXA 1KFEA 3SY5A 5GJMA 2ZQ0A 4QS5A 4XVDA 2ZA2A 3B4UA 5I7GA 2HVOA 4XQ6A 3COTA 4CCCA 2GJNA 3L7RA 3WBEA 4HU3A 1IV8A 1JG9A 1GKQA 3BLFA 3NZGA 1RBOB 5D38A 2OOGA 3F5LA 4X3ZA 3N4EA 2FZBA 3WSUA 3ARYA 2VX7A 3T7VA 1DQXA 2DVUA 1HJUA 1FVPA 1HKKA 3KM8A 1OFRA 5A8PA 2YL5A 4ROPA 1A80A 4JICA 5K7JA 4GKTA 2AKZA 2HK0A 4GA8A 4W85A 4QNEA 4AU0A 2J7CA 1GOIA 1XUUA 4M51A 3V7PA 4K2SA 3QVQA 3SGUA 2FTPA 4E38A 4JTHA 1UYQA 6REQA 1NDZA 1LLOA 3FS2A 1A3HA 3MCNA 1B3OA 3GNDA 4B15A 2XIIA 2YL6A 4Q4RA 2E5DA 1U1JA 4GE8A 2W27A 3LU2A 2IS7A 2Y6ZA 4QJ5B 3NEVA 4GBUA 2NXGA 5C7VA 1X8FA 5GJNA 3UBPC 3W71A 3QYSA 1AH3A 3VIIA 4WF7A 1ESWA 1BXCA 1DOSA 4FX6M 1GQJA 1F9CA 3VIOA 4LUTB 3ZVHA 4UTTC 3UWWA 1TPWA 1F8MA 3GUWA 1E0UA 3G77A 3ERPA 1JI1A 3NYZA 1OSEA 2D69A 2FHBA 4AVNA 2QS8A 4GLEA 3BLLA 1QI5A 3CIWA 4F2TA 2VFEA 3TCEA 3NJ3A 2QMKA 3OGVA 3BVJA 4IFRA 5F7UA 1UPMB 3LNMA 3CUFA 4ICCX 4H8NA 1D8CA 1B0IA 2RHGA 5E0FA 3PZGA 3PPHA 3QGKC 3C6CA 2V9DA 2B81A 2R1PA 1ZJIA 4PA8A 5B80A 1F2JA 1C29A 2VR2A 3I6TA 1I8JA 3M5YA 3M0VA 1QNPA 1W5NA 1J01A 3O07A 3T42A 1XD0A 1I2QA 3FDKA 4JIRA 3FGCB 1NOWA 4CNPA 4RE3A 1G4PA 1R0MA 4TMBA 1RY8A 2QEZA 3TWBA 4U5IA 3SR7A 3M6YA 1EC9A 1FY6A 3TJIA 4KFPA 2V5LA 2CKRA 4K37A 3N2BA 4C6NA 3U8GA 3NQVA 4LYQA 4B16A 3TN3A 3LERA 4QLLA 4LUIA 3CTLA 1V6WA 1UOZA 2WLYA 5JBEA 1J5TA 3AIQA 4Z2GA 3N9SA 1FH7A 1EWEA 2HCVA 3SM0A 5FOOA 4ZENA 5EMMA 3E0FA 3NOEA 1DE5A 4I6KA 3NNTA 3W1TA 5I3FA 4YCPA 4R3UA 1B3ZA 2E8ZA 4NXSA 3AMLA 2B7PA 3SCOA 2AGTA 3AYRA 4JQ4A 2EJAA 3CB8A 4C1KA 1X38A 3C3NA 1GG1A 2QXWA 3CUZA 3S83A 1BWLA 1F3WA 3SFWA 1LWJA 1YX1A 3VGFA 1ZCCA 3NDZA 4H8HA 1MW3A 1ZJBA 4MWAE 3M0IA 3RMEA 4UTKA 4D8LA 3PULA 3H4GA 3TAOA 4JFUA 1RPXA 1QOQA 3M5VA 3PY2A 3W85A 2OX4A 3MY9A 1QATA 5DO8A 3GU1A 4WHBA 3GW3A 4GO9A 4RK8A 4MY1A 2WCSA 2QDGA 4U3CA 4I3GA 3BUVA 3C2YA 3W7CA 2HS8A 3LTSA 4EF9A 4ZEPA 3N11A 1P6BA 3GTXA 1Q2RA 4S3FA 3NWRA 5F2IA 1W56A 3V3WA 2C71A 4XKYA 5HINA 3MT1A 3T4WA 1TV7A 1OFDA 1IF2A 3W7EA 3AS0A 4GI6A 3BSGA 2WKGA 1RCXB 1XRVA 2EG7A 4H9TA 1FWTA 3SY8A 1LWIA 8A3HA 1BSIA 3VGEA 2YA0A 3JU2A 3QMTA 5TAOA 3NXLA 1A47A 5C9ZA 4C65A 3B8TA 1W3HA 3HZ3A 3UVIA 4IIBA 1Q6OA 1OT2A 3UXDA 1UH3A 1GYMA 3GH5A 3MP5A 3G0SA 3LHZA 4LTSA 1RLDA 2WVVA 1ZBVA 3NTYA 5K2ZA 2ZTKA 1IXPA 4IMGA 4XZWA 4EACA 4RPPA 3RM8A 3N2CA 4NX0A 3PR2A 1JRBA 2XH0A 1PVNA 2YA1A 1WXZA 3IGSA 2VX4A 3M6DA 4HNVA 1JCNA 4KCVA 2QKFA 2OLSA 3VCNA 1EXPA 4Z0SA 2A2IA 4N0RA 4QE4A 5HUPA 2YGYA 1CIUA 1JZ2A 1U5JA 3NQGA 4H9UA 4OFCA 4GZJA 3APTA 4FSAA 5CPQA 7PTDA 2OSYA 2ISSA 4HKPA 5K9DA 3PF3A 5GPRA 3B04A 1R46A 4FNTA 2VGBA 2ALRA 1P43A 3CZJA 3QH2A 1R38A 4IIFA 4IQLA 3I7RA 1E6NA 1QR7A 4XKMA 1P5BA 1Y5XA 3BMWA 3CZKA 1SZNA 1ZAHA 4JR5A 1BAGA 4B90A 4P7LA 1I1WA 1G7VA 1XLLA 1CT5A 3FAWA 1QPKA 1DJHA 3RX4A 5F1VA 3BLDA 4UUIA 3KBSA 4HA4A 1HTIA 5GJPA 1VGAA 3C8NA 1SPQA 2OWXA 1R85A 3GW0A 1EO5A 1E4LA 1RUSA 1R30A 4J35A 4JEQA 4IF2A 3GDLA 1AH4A 4S3CA 2XM2A 4TTGA 2FH8A 5J5DA 1P4CA 1T8XA 5M17A 4OU1A 4W7WA 4GOAA 3EX6A 4S3DA 3OLDA 1OVDA 4HCHA 1CGTA 3NQ8A 1KR1A 4XZMX 3H2FA 3NL2A 2C1HA 2G4JA 5EMYA 4QS6A 1DJIA 4KRUA 2F9RA 2O4MA 3AROA 4FIQA 1WDSA 2B7OA 3PANA 4DI9A 4EAMA 3E2SA 1QI4A 2OYMA 2Q3RA 4A8IA 4MF4A 2BB0A 3APGA 4MZ1A 3NQ2A 1Z41A 3BQ6A 3ELFA 4MUPA 5E9XA 1ISVA 2H8ZA 1DJWA 4U4MA 3MS8A 1TA3B 2XVGA 4X0VA 3NDOA 1UBPC 4AIUA 2ZIDA 3SUUA 4C90A 1KFWA 3TYAA 4UFLA 5D8WA 4FALA 3DFPA 1OGGA 1KXTA 3GNXA 2DFAA 1SZEA 3PNUA 3WELA 4J3UA 3W88A 3LNPA 2R8WA 5DCEA 2PDKA 5LA1A 3S0CA 2F2KA 4CNNA 1ECQA 3T0DA 3RPTA 4HNUA 1H7XA 3KWSA 5DEZA 3F4VA 1A5AA 1VCVA 3STFA 3PSVA 1KXHA 4RPQA 5SWUA 1WZAA 1H7PA 3VIJA 4QJ4B 1JZ5A 2A1YA 3QY7A 4Z1BA 1XLEA 1T6MA 4W7UA 1XDLA 4PUUA 1GZJA 2V67A 2Z26A 1XSKA 2DZTA 4NVTA 4RX0A 5CPSA 5CAKA 3MMTA 2R91A 2ADAA 3KVJA 3VZXA 5CEWA 4NI3A 4AEOA 1RH9A 5BMXA 1N2VA 1CTNA 1TV4A 5FD0A 2WM1A 1UR9A 1I0BA 4GFSA 4LY4A 1W8GA 1QOXA 1ZU8A 5F2GA 3N3MA 1R3YA 3A3XA 1GQKA 4DUWA 4KETA 3NSMA 4L80A 5JQ9A 8TIMA 3WMBA 4WJXA 1T7LA 2PDQA 3FEMA 3GVVA 2MUCA 4Q4SA 5HBFA 1UUOA 3PSWA 4A4AA 3QV7A 5CG7A 5AFDA 3H54A 1WDPA 1TE1A 4B4HA 3WLHA 5BRQA 2WV8A 4F2BA 1DXFA 3VGGA 3W0KA 1XIHA 2I5QA 3MC5A 2PDBA 2CLEA 4EK7A 3AXHA 5IDIA 1GJPA 2AOSA 4G7EA 1U1HA 3R25A 3FVDA 3QRHA 2Z2AA 3AYSA 1PS9A 3Q65A 1JI2A 4CQCA 4E6MA 2W4XA 1V3MA 2P8CA 5DMLA 4GQQA 1F6YA 3R79A 4HYWA 2J25A 4M7SA 3IEBA 1KA9F 1IGSA 4UMBA 4UB9A 3EWZA 4GKLA 2CLKA 5LA2A 3WLRA 3DHPA 1ECEA 1L6GA 1J2BA 3WH7A 3S5ZA 3W2UA 2ZXAA 5I02A 2ISWA 2IKGA 2YL8A 3LCGA 2WKJA 2E3ZA 2ZDRA 3UZJA 3CHDA 3TXVA 3OA5A 3G1SA 4A35A 4AWTA 1IR2A 3AUOA 3OB8A 2VD8A 1TWWA 1H0IA 1ZBKA 2WPBA 4KGLA 1FWDC 1O7AA 5FJIA 4YLWA 1Z42A 3CH9A 4BZYA 5RUBA 3G1FA 4UTIA 4Z2IA 3GLCA 1VHCA 3QMSA 3IK4A 5JMUA 1WKYA 7A3HA 3QTPA 3W2JA 3PB0A 1ZJHA 3E02A 1GQNA 4M1BA 2VVSA 4NL1A 1IZJA 2FVLA 1OFEA 2V3GA 3UY7A 3PWAA 3QTGA 3S46A 2OQHA 4WD0A 2PGWA 4OV9A 4B5XA 4JYDA 2Y70A 3H22A 4ZGYA 3U7VA 3T1GA 4Q8TA 3W82A 2HWGA 1DV7A 4HSOA 3S1UA 3LBOA 2EKCA 5HXMA 3CV6A 3QPZA 4PMOA 1KTBA 1BLIA 4HZ7A 4D8AA 4Q7IA 4C6CA 3GVWA 4LF2A 3LQLA 3W74A 2IPFA 2V5DA 3QGAC 1GHSA 4FP1A 3WLQA 3MJMA 3IK2A 3AIVA 1IE7C 4XO7A 3WUBA 5C54A 2DPEA 1P1MA 1EBGA 2GWGA 2V38A 3A13A 3VZZA 1Q7QA 1EL3A 2DUZA 3W1LA 4LCRA 3UPWA 4KERA 3UVAA 3TMQA 4GJIA 4ZMGA 1OWQA 1RVGA 5HNTA 4LRSA 3WNKA 1PV8A 3DOPA 5EFFA 3CO4A 4CD8A 3DG7A 2J7DA 4PTWA 4LB4A 1V02A 4AHPA 3UJ2A 1OFQA 1QPRA 3G8EA 3PPFA 4HK7A 2ZADA 4HPGA 3SJ3A 1MXGA 1HJVA 4K68A 1QWKA 4Q22A 1XKYA 5DFAA 4O1CA 2PTYA 3AIUA 3V5OA 1N82A 3PTKA 3WDPP 3TN5A 3LG3A 4N9CA 5I6SA 3DAQA 2PTDA 4HPHA 4XBKA 2G3MA 1XBYA 1LP6A 2E9MA 3RR1A 4Q8QA 3MTWA 3ARPA 4LSBA 1MUCA 3B9NA 3BANA 1LF1A 2SFPA 2Q71A 1XWYA 1ME7A 3IIXA 1Z89A 2IUZA 4CNSA 4IQEA 3ZR6A 1E70M 1BVZA 1XC6A 4LAMA 4ZBCA 4JFSA 3VMPA 1KRBC 5JBDA 3B97A 3NGFA 5C71A 2GVGA 3DFOA 3FJ4A 2PCEA 2DV0A 4LY8A 2AL2A 1QO5A 1J12A 4WSKA 5GNYA 1JZ3A 4G1NA 2PDCA 2DU2A 2EPOA 2CXGA 4XTIA 4PRRA 3GB6A 2JEQA 4A3YA 3TN4A 3MANA 4TOQA 3DFTA 4B92A 5LNWA 1SSDA 3E0WA 4AF0B 3A24A 2ZTJA 3G6MA 4UFHA 3LCFA 3TZFA 4E3VA 4KFNA 1K1DA 3BH4A 4CD5A 1AG1O 2NXHA 4Y90A 4IL2A 2DDXA 2F61A 3LHUA 2ZA3A 3R89A 3L4TA 2IXVA 3INPA 3N6QA 3KVKA 5IXEA 2QZRA 4YTSA 5EU9A 1EH9A 3BLKA 4O0ZA 3W00A 2OEMA 1ISXA 2CLOA 4AD5A 2E67A 3A12A 1JULA 1W5MA 3AAMA 3LA4A 2Y7DA 4H01A 2D2GA 5J5RA 3BJFA 1Y5WA 1RD5A 3VOGA 1HKWA 4XZLX 4KEMA 1MRAA 2JF6A 5BOEA 5C5YA 4PBEA 1S2TA 3EKZA 2YX0A 3V16A 2E77A 5DY2A 3CTTA 4LT9A 2WMIB 2CZ5A 2WVTA 3LCXA 4IP4A 3ENLA 5C9UA 2XUCA 4L6DA 4V27A 3WYZA 1IWBA 5F2LA 2XIOA 1AD4A 4MNKA 1S5MA 2FFIA 4K1WA 2P10A 3LTPA 3LX9A 4X61A 4JY9A 4XAYA 2O7QA 1PSCA 1XIDA 4M5PA 4O1FA 3W2LA 4HNOA 1ZENA 3WDQA 3FHQA 4PBFA 5TF0A 4QXIA 2P5NA 2QCLA 2PB1A 3M5XA 2GJLA 3R8GA 4KF1A 3BAYA 3DN5A 4FNPA 2E5BA 4B5SA 4OV4A 1PKLA 2E0PA 4WKAA 2I9UA 2YYUA 4FEZA 2GDUA 1TJ0A 1YNQA 4NT0A 2DJXA 4JHMA 4RDYA 4DN1A 3FW6A 3SCUA 1W9UA 5D37A