2QCNA

Covalent complex of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase with 6-iodo-ump
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 96
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qcnA00
1VYRA 2C3ZA 4B5NA 1JQXA 1RVGA 5TBOA 3W1TA 3LB0A 3W22A 1F7BA 5I3GA 3QC3A 2FPTA 3G1VA 3PR2A 3KVKA 2V2HA 4MLRA 3HG5A 1KBJA 4GUIA 1GYLA 4ALDA 1LP6A 1SZGA 4FNSA 4O12A 1FWSA 1BTMA 3ZS4A 1OFAA 2E6YA 4A21A 3EX4A 2YYTA 1GG1A 3G0SA 5KITA 3OVRA 2YX0A 4S2BA 3Q94A 3QEZA 1H7XA 2Y85A 1GVRA 1SSDA 3W88A 1M6JA 3L0GA 4R7JA 3M41A 4GUFA 1QPOA 3TXZA 4LVFA 3QSRA 3W7KA 3L5AA 1VYPX 3NQFA 4Z08A 3LRMA 3KX6A 3DXIA 4U28A 5I3JA 4FB7A 3W2UA 4NUWA 4DBEA 2DP3A 1R2SA 1QWGA 4AMAA 3GR8A 4I9AA 3MYOA 5AYYA 5AHEA 4TX9A 2RHGA 4UFLA 1VZWA 3MMTA 1VLIA 1VHCA 1ADOA 4UMCA 3WJXA 3U6WA 2Z0IA 2KZHA 3ABQA 3SY5A 3VE9A 1OVDA 3R89A 3TW6A 1EIXA 1THFD 4O4WA 3BG5A 4JTKA 4LNYA 4UTKA 2GVJA 3LLFA 4HNVA 4LT9A 3C2FA 4XKYB 2A7PA 1F6PA 3R12A 5F4WA 1P5BA 1JRCA 2CW6A 3LCWA 1EUAA 1XBZA 1TTQA 2ATSA 2F84A 3QMRA 1JQVA 4Z1BA 2B4GA 3FOKA 3TROA 3TAOA 4FF7A 4LC8A 1AW1A 1A50A 3HPXA 1GZGA 4JDYA 1H50A 1SFJA 3OBKA 3E96A 3TQKA 3IRDA 1DJQA 2WSYA 4N02A 3EX2A 1SR9A 4TO8A 4LW7A 3E02A 3NZRA 3ANYA 3KRUA 3C56A 3HBLA 2JKPA 4GC4A 2QCCA 4O0ZA 4DF2A 4NX0A 4DBDA 1DKWA 5AC8A 1C8VA 1KM4A 4LY8A 3THAA 4QNWA 4M6QA 3Q58A 4O52A 2A1YA 5BNKA 2WNZA 3DGRA 3LHTA 5TIMA 1O5KA 1A5SA 5DBTA 3CC1A 3W2NA 1H61A 1X1OA 3NO5A 3WK3A 3EKZA 3W9ZA 4PCFA 4Z0JA 5E93A 3GR7A 4ZVJA 4Y8FA 4ADTA 3HG4A 3A5FA 3N14A 5HR6A 2BWGA 1UASA 3G24A 4O28A 2J9XA 3KOFA 5D2YA 3LXAA 4YMZA 1LRTA 2ABBA 1QCWA 4CCCA 3W2MA 1Y0EA 1P1XA 2QF7A 3F4NA 4P61A 3LHZA 4CQAA 3G1HA 1R46A 4RX0A 3G8RA 1G69A 1W1ZA 2EAWA 4Q33A 2BLEA 4JIPA 4UMAA 2Q8ZA 1WV2A 2NXGA 2VFEA 1PCWA 3LDVA 3CIXA 3P81A 1Z44A 4UTMA 1VCVA 4ADSA 3UWYA 4ZL1A 1TV7A 3TUUA 3TKFA 3F1QA 4Q32A 3LCIA 1NVMA 4NJJA 1GVOA 2B0MA 1L9WA 5D38A 1OX4B 2Y7FA 1FDZA 1GWJA 3QRHA 3KHJA 4CNNA 3OEXA 5AYZA 4RZ6A 4Q4KA 2DZWA 3TXVA 4HPXA 3EXTA 4QITA 4JTSA 1BEUA 2ZZ4A 4O0KA 4ONVA 4UTHA 1L6SA 1WX0A 4AH7A 3FKRA 3SGZA 1SZEA 4FX6M 2CZFA 3M0ZA 2V9DA 3C2OA 4N6EA 4UTLA 2FJKA 4FIQA 2YFNA 3QMTA 4UFKA 3TDFA 5C5YA 4YCOA 4JR5A 3VNDA 1G6CA 2RKXA 2Z6IA 2D73A 1TMHA 1U5JA 4QM1A 1FQ0A 2UV8G 2VFFA 2JGYA 3EX3A 2WOQA 1DQXA 4YL2A 4W9TA 3W2KA 1NF0A 4DELA 5G2IA 2FFCA 4E2DA 1RQEA 2CZDA 2FB2A 4WY0A 1IXPA 5EL1A 3MJYA 1NSJA 3LHWA 4AWSA 3W75A 2NZLA 2AQWA 4LU0A 4UTWA 5DCDA 4GUJA 3TFCA 3LOTA 4Z0SA 4TMBA 5LNUA 4UTUA 1AW2A 1D3HA 2VFGA 1XI3A 5G5IA 3TJLA 4CQ9A 1GPWA 4AHQA 1R2TA 1MO0A 1WQ5A 5DELA 1OFPA 1K03A 3W2LA 1GTHA 1QNVA 1SW3A 1XBYA 1ZAJA 4XZ9A 3W72A 3T78A 3BPWA 5L9FA 4I7UA 4KFOA 3NG3A 3NQMA 4NZFA 1WBHA 2EF9A 4K36A 4ZQCA 2CLMA 3IIXA 5AHFA 5A8GA 3DFQA 3NZ1A 1GYNA 5HQEA 1VJIA 2F7FA 3KRZA 1Q6RA 2V30A 4JTIA 2VELA 2A6LA 3FA5A 4O16A 1T8XA 1NF7A 2ZFAA 4LUIA 1LTDA 4UNLA 4JY9A 6ALDA 3NPVA 5EKYA 3O6YX 3O63A 1VR6A 1G4SA 3QJAA 2PCQA 3A21A 3CB8A 2HS6A 3H54A 4GNJA 4KFNA 1SW7A 3MBDA 4MFEA 4LVBA 2QR6A 3NQ8A 3W7QA 2B7NA 2R8WA 4KWVA 3NA8A 3P5ZA 1FCVA 1V7YA 2X1UA 4UR7A 1DV7A 3BK0A 2ALDA 5DLCA 4NU7A 4NXSA 4YCPA 3BVJA 3HGSA 3TC7A 3W07A 3NNTA 3ABOA 4WY0F 3UPBA 3CT7A 4LRTA 2OX1A 2YFOA 2ZRXA 3NPWA 4RXGA 1RD5A 2C16A 4IXHA 3W7EA 4M6VA 3RFAA 4TMCA 1B3OA 2QCMA 3W76A 3TQ0A 1KFCA 1HFBA 3A9IA 3STCA 2GQ8A 1A5BA 1LYXA 4JX4A 1E51A 3F03K 2QKFA 1EUNA 1QR7A 2QCDB 4NX5A 1TTJA 2PURA 5CZSA 3B03A 3IV3A 4JTJA 2R14A 3PBUA 2I14A 2YW4A 5F4XA 1GTEA 1OX5A 2ATMA 3W7DA 3UQNA 3KVMA 3DBPA 4HHPA 3GZ3A 4NQ1A 3A5VA 3G1SA 4X9SA 3W74A 2PE4A 5FF3A 3VFLA 4UFHA 5CPLA 2YW3A 3O15A 4KFPA 2VC6A 1OFEA 1FCQA 1M5WA 3I68A 4MLJA 4UXDA 4JTHA 1HL2A 2Q3RA 4PL1A 2ZZ7A 1H1ZA 4AWTA 3LBCA 4PODA 1PVNA 2QJGA 5EY5A 5BRBA 1BWLA 4RXFA 2CLIA 4S2CA 3ATYA 1OFDA 3LHYA 3SSJA 4IMDA 1ZJIA 1F73A 3DAQA 3NEVA 3UWVA 2QCGA 3O8AA 1MSSA 3N3MA 3IIOA 2J9YA 3VE7A 2C15A 2ZYFA 1OF8A 1YXDA 3LCXA 3PUOA 1SZFA 5A5WA 3UY8A 2NWSA 3NQ2A 3NL3A 3RLVA 4JYFA 1YTKA 3PSWA 2ZZ2A 5D30A 1S3HA 5EMUA 1D9EA 2DJXA 3PBVA 1TJRA 1SFLA 2V5LA 1TREA 3PM6A 1XBVA 4MOZA 4L4MA 5DY3A 4M19A 1TPVA 3N73A 3SW6A 4Z1AA 2YDAA 1OYBA 2WNNA 3KVJA 3MHUA 1W3NA 3W7PA 5AC6A 1TO3A 2RDWA 3QMSA 3STFA 3GNDA 4FNPA 5EPDA 1WOBA 3G8EA 2E6FA 5K9CA 3EWZA 4C1LA 1A5AA 1K8XA 3EB2A 2JGQA 3I7SA 5G4WA 4GUGA 4NNCA 3B04A 4WQ6A 2C1HA 2C6QA 4PH6A 3FJLA 3E0IA 1F2JA 1TPC1 2NXHA 3S8HA 4K7VA 4PL2A 2EPHA 1KTNA 4WOQA 1R47A 2WNQA 3LCHA 3TU9A 1SPQA 1ME8A 3YPIA 2EKCA 4A29A 1LRNA 5KINA 3S42A 4TU1A 1TIMA 3HMJG 1DL3A 5K7JA 1AK5A 4FXRA 4BR1A 3EWUA 2ISVA 5DY2A 1KFLA 2FIQA 4QJ1A 5HNRA 1G7UA 2ZRVA 1XUZA 3CHVA 3DU0A 1B9BA 4QAIA 4I7WA 2E77A 3AO0A 3PAJA 1LZOA 1TQXA 4K6AA 1UUOA 3C2VA 3W1RA 1SO4A 1TPWA 4MUZA 4YWIA 1KFJA 2Y6ZA 2RH9A 2GPTA 2PRHA 4NJHA 4PA8A 1HO1A 1PHWA 3JS3A 2ZZ3A 2ZRUA 4HNTA 1LOLA 1DORA 2ZRYA 1JULA 5KZDA 3LHUA 4JX6A 4O53A 1J4EA 4A2SA 5I3KA 1M7OA 2BTMA 3GAYA 1F5ZA 1J2WA 4OU1A 3RNDA 2E5BA 1EPXA 3W83A 2R94A 1S5VA 1KV8A 4RZ5A 4MZ1A 4R34A 3NQCA 1VQTA 2R91A 1XCFA 3NL6A 5DXYA 3L68A 1VHNA 1KTBA 3MW7A 5IBXC 2V2CA 2Y7DA 1MEWA 1FWWA 3USBA 2WO5A 4WD0A 3CLMA 1ML1A 4AEOA 4O11A 1AMKA 4FEZA 2VEPA 1AW5A 3GDMA 1Z48A 4UTIA 5FEPA 1LLZA 3WFAA 1BKSA 4AAJA 3P84A 1W56A 4GRSA 4ZMGA 4JN6A 1JR1A 5CG7A 3M9YA 3M44A 2YCEA 4OHQA 1I2NA 2QJHA 2ZZ5A 2FLIA 4LUJA 4O15A 1EP2A 1SO3A 1PS9A 5TQLA 1B4EA 2HSAA 3WJZA 3MP5A 4CNPA 3EX6A 3I7RA 3FLUA 5HWJA 1W8SA 1W3TA 3LGEA 1JCYA 1L6WA 2VEKA 3K30A 5I3FA 5D2WA 2CLOA 2PC4A 4FNRA 2LLEA 3OIXA 1Q3NA 3UWWA 4N9CA 2RDTA 2DU2A 3PS7A 2VXNA 4IPIA 4IXXA 3IGUA 1KA9F 4MJMA 1TTPA 3SECA 3C2RA 2H6RA 3N34A 1GOXA 4IX0A 3LV6A 4EWND 2DZSA 4O50A 1XUUA 2YR1A 4IMFA 2X1TA 4DXVA 4XKYA 1WAUA 2X16A 5K3VA 4UNKA 2QCFA 4UUIA 3HG2A 1TPUA 1O60A 1R2RA 1A5CA 3BGGA 1OG0A 1TQJA 3D0CA 4PFMA 1IXQA 2YXGA 2DZPA 2J88A 1DJNA 4N6FA 1K7XA 2CLFA 1MEIA 3RU6A 4LC6A 3C2EA 1I2RA 2A0NA 5CPMA 1ICQA 3WK0A 5DBUA 4HNUA 5J5DA 2C14A 4JTEA 2AAMA 3G1DA 3M6YA 1GVFA 3S5NA 1KW1A 1SU5A 2C19A 4IJBA 4JNMA 4BI5A 3L5LA 4HKPA 3R8RA 1ZAHA 1AL7A 5T26A 3MP3A 4O10A 5HMSA 2VOMA 5EBUA 1OK6A 2GOUA 3ZFHA 3B4UA 4O1DA 5FEZA 3MO7A 1FCBA 5CSSA 4YXGA 4M5PA 4RZ4A 4MY9A 2XN1A 2YZRA 1GVSA 1W5QA 3U8GA 1YDOA 3GB6A 3N19B 2DZTA 4BWLA 1B57A 4IMGA 3EWXA 3W1XA 2B7OA 3B8DA 3S5OA 3IIZA 5SWUA 4PEKA 3B05A 4Z1CA 3W6YA 5G4EA 3TMQA 2IQTA 4X2RA 1VGAA 3QQ0A 3L21A 5F2MA 1ZY9A 3C61A 4RKAA 4Y90A 3NXFA 4RR4A 1KM3A 4MJZA 5K9XA 5E1QA 1XXXA 3W7OA 2PRLA 1F74A 3BLFA 3IIVA 2Y70A 1G4EA 3NQ7A 2Y62A 4O57A 5AC7A 1OX4A 1QMLA 4X3ZA 3FFSA 3L66A 5EA9A 1Q6LA 1ME9A 2EHHA 3PSVA 4JTGA 4ORIA 3MHGA 1ZFJA 4HIBA 3DHDA 1FWTA 1VH7A 2ISSA 2QAPA 2A7RA 4M7SA 1JCLA 1W5PA 4E0CA 4GXMA 4LVAA 5CSRA 1YDVA 2NXIA 2NV1A 4MYXA 2GQ9A 2GVLA 3M43A 3W7GA 1UCWA 1O94A 2BZNA 3P8IA 5K4ZA 4O1CA 4XBSA 2WJZA 5H91A 4AHOA 3UNDA 1FY6A 2DZUA 3F4WA 1XL9A 8TIMA 5HWMA 2FTPA 1I2PA 2V5BA 5F4SA 3MI2A 2BX7A 3LI1A 1FWRA 3O16A 3UWZA 4OT7A 3B06A 3NL2A 4N9DA 4Y96A 5BMXA 1SO6A 4IMCA 1JCNA 4FX7A 3B0PA 2DORA 4FNQA 1JRBA 3ATZA 3QM3A 3GDLA 2WSRA 3G3MA 3BW3A 1OABA 4I7VA 3W85A 1D3GA 1JUKA 3G1YA 5D2VA 1O95A 1EA0A 5F2LA 2ZA1A 2QCLA 4XTIA 5C6MA 4R53A 3TC6A 3PBWA 3GKFA 3P67A 1P0KA 3P5YA 2NV2A 2E6AA 3H55A 1GVQA 3OHIA 1XDLA 4EVZA 4OQVA 1WBJA 2C18A 5CPOA 1G7VA 1KLYA 4XBKA 2H8XA 4IUOA 4TR9A 4O54A 3DI1A 1XC4A 4WUIA 1FX6A 4KKXA 2XFWA 4QQ3A 3BG9A 3C52A 1B4KA 4MKNA 1NAL1 4MZ8A 3TSMA 4LS2A 2NUWA 1H7WA 3GX9A 4XUGA 5HUPA 4ZQRA 3RLUA 1UB3A 1FUYA 3QH2A 3MYPA 2QCEA 3G0XA 4FX8A 3HGOA 1WDWA 1QPQA 3HOJA 3ABSA 4NNAA 5F2IA 3IVSA 1PL9A 2O7SA 3DH7A 7TIMA 2QDGA 5HWNA 3CQ0A 4DQWA 1IXNA 2GJLA 3UPWA 2VFHA 5H2ZA 3FJ6A 3SFKA 3QPYA 1EB3A 1DBTA 3W7RA 1KTCA 3BLIA 2NUYA 1K02A 1A53A 4NJGA 1RQBA 3STEA 3DKLA 3PB2A 3GYEA 2DJLA 4OGZA 2DZVA 1YADA 3HG3A 3FEMA 4N9BA 2YSWA 1PV8A 3BGJA 2BSLA 1O5XA 3O07A 5LKYA 1GG0A 3C8FA 3QFEA 4UR8A 4WZHA 3NR0A 5LNRA 5AHNA 1RR2A 3TMLA 1FBAA 1R30A 4JTUA 2ZRWA 1T99A 3T7VA 3G3DA 1QO2A 3PB0A 2Y88A 5GVJA 1GQNA 5CZTA 3BG3A 5HR7A 3GKAA 1P0NA 3LTYA 1N55A 6TIMA 2QUTA 2XN0A 4N2YA 1WA3A 4ORMA 5CZ0A 1TYGA 3E49A 2QCDA 1VC4A 3DHFA 4LV9A 2CZ5A 2QAFA 4TIMA 1GT8A 3G1XA 3R2GA 2J9ZA 2TYSA 2W79A 1TJPA 4FIRA 3V1PA 3QF0A 3W7NA 4A2RA 5G2WA 4OBTA 2JKEA 2J6XA 4O4VA 3W1MA 3NQAA 2WV8A 1PHQA 5J5RA 2YPIA 1YYAA 1ONRA 3OVQA 5IBXA 5FESA 5HUOA 3LTPA 4PTNA 1KFKA 3JR2A 4WOZA 3W1LA 1S5WA 1OFBA 4G1KA 3LERA 3UXAA 3UXDA 3HPZA 1OF6A 1N7KA 1QFEA 3NM1A 3TR2A 1TTIA 4BI7A 2QDHA 3W1UA 3HF3A 4BFAA 3S9YA 5D04C 4HN4A 3BV4A 3TAKA 3TW7A 3TV8A 5AN7A 3W1AA 4FXSA 3LRLA 3LI0A 1ICSA 4UTJA 3GDRA 4DEFA 1I8JA 3BW4A 3A24A 5MHBA 2OT1A 1TPFA 3SI9A 5AFDA 1RQHA 4ZQMA 3GXPA 2JK2A 3LCLA 3NL5A 4UCGA 3TSDA 4N4QA 3CM4A 3LRKA 3PC0A 1BWKA 1IIGA 2ZZ6A 3KFTA 1KM0A 3TCEA 4GE8A 2ZTKA 3SIZA 3WJYA 3CEPA 3A23A 3Q37A 3KXQA 4O18A 2NUXA 3CTLA 2ZBTA 2Z6JA 3S5YA 4JY8A 1JCJA 2Z2UA 4ICNA 1I4NA 4AF0B 5AHLA 4U4MA 3FKKA 2WKJA 4JXCA 5FF4A 1X6UA 1W5NA 2WSQA 1LBLA 5CKSA 1K7EA 4E38A 4HNNA 4LV4A 1IGSA 2GUUA 2NX3A 2B7PA 3M7WA 4EOUA 5AB3A 3NGJA 4GFSA 1G4TA 3U2OA 3TQVA 2G96A 2CLLA 1KBIA 4LVGA 2AGKA 2ISWA 3GDKA 2XN2A 4DF0A 5HJLA 3HQ1A 2I9EA 3W7IA 1QOPA 5L6UA 1J5TA 4IWWA 2QEZA 2GQAA 4XTDA 3VI2A 3M1ZA 1OFRA 1TPDA 3S1VA 3VKJA 3TX9A 2V8ZA 1EWEA 5C54A 2V82A 4JYDA 4O13A 1KM2A 4HT3A 1W0MA 2CWNA 1CI1A 1KFBA 1VLWA 1ZHAA 5D09A 3W87A 1VRDA 3UZ5A 1PIIA 1XKYA 1UJPA 1OYAA 4HPJA 5DXXA 3R13A 1LM1A 1H51A 4IX2A 2H3BA 1NEYA 1XM3A 2DZXA 5D03A 3KRSA 3W70A 3W1PA 3C4UA 3DFNA 1MXSA 1ZCOA 4MZYA 3FYOA 2C13A 3T4CA 2Z1BA 3TE9A 3QQ1A 4M6PA 3GXTA 2ZA3A 3RF9A 4N4PA 5KSWA 3PG9A 2Y63A 4MVAA 2E1DA 2HTMA 4UFMA 4AVFA 3T40A 1F6KA 3N2MA 5BMWA 3GAKA 3E9AA 4R33A 4QIUA 1LOQA 1OK4A 3FYPA 3TK7A 3UD6A 3GXNA 3LV5A 3O6DA 4ZQPA 2VFIA 1O4UA 1H63A 3BLEA 3RK8A 3W7HA 2EGZA 3H53A 2X1RA 4QSHA 1I45A 2Q3OA 4MY1A 3GDTA 2JBMA 4IPJA 1ICPA 3AJXA 5LNSA 3G1FA 3DFSA 1OX6A 2ABAA 3EEGA 4K39A 4CCDA 5FI8A 4X22A 3PVFA 1TV5A 1SO5A 3GIYA 4CCEA 3KVLA 2PRMA 4K7YA 3WJWA 5D33A 4RV8A 1G4PA 3IEBA 2P0OA 4UFIA 5K2ZA 1LBFA 3M16A 4N9EA 4E2BA 4OE7A 1VCGA 3M5ZA 5G1TA 4NZJA 2X30A 2NX9A 3HGRA 4HSNA 5G2HA 2G5WA 3L9CA 1YPIA 3NDOA 1LORA 1EEPA 2FPVA 3NQVA 4JYEA 1L6YA 5E0KA 1W54A 4AWUA 2P10A 4FNTA 3OG3A 4NNBA 1VS1A 3S5ZA 2H8ZA 1LOSA 1QDSA 4JTFA 2W0UA 5C55A 4NVTA 4LOCA 4WX2A 4LRSA 3W7JA 3W7MA 2WPBA 4K8EA 4H3DA 2V2DA 3SR7A 5LGZA 1OFOA 4UTTC 1JJKA 5D2TA 3P8JA 1ME7A 1MZHA 1SQ7A 4MPQA 3EWWA 2NLIA 5AHIA 4MY8A 4NXKA 2Q8LA 1ZAIA 2Y61A 3BW2A 1KM5A 3LBMA 3EXRA 3PUEA 3O6CA 1PCKA 2CLEA 2TSYA 3O1NA 5FF2A 4A22A 1XFBA 1TV8A 1SSGA 1W31A 1ZALA 3NOEA 3N9SA 3DZ1A 4P2VA 1FXQA 4GWEA 4DPPA 2E09A 3LCFA 1LLWA 4OV9A 2ZCGA 1FDJA 1H60A 3S6DA 1JCXA 3W23A 3MI3A 3EX1A 3OA3A 3QW4B 2A21A 2A5HA 3Q2DA 3LXCA 3P7YA 4M7TA 5CGQA 2Y7GA 4JEQA 1T96A 1FCUA 4PC8A 1H62A 1FXPA 3LLDA 3ELFA 2ZRZA 3G1AA 3HGJA 4UC5A 3QYQA 3TSBA 3STGA 2OZ0A 1XDMA 4H4IA 1V5XA 2ZDRA 5AHMA 4OWGA 2I1OA 3L67A 4FO4A 3MUXA 3LHVA 1MEHA 1QAPA 3BO9A 3M5YA 3M5VA 5DN1A 4RK8A 3CEUA 3UY7A 1KM1A 2A7NA 3I7QA 1WXJA 2JKAA 1Z41A 3JRKA 1VYSX 4EIVA 1UBSA 3M5XA 1YXCA 1ALDA 2NWRA 4IGHA 2CFFA 2CU0A 1P4CA 4WXYA 1WOAA 3W7LA 2CLHA 3PF3A 3S1WA 4JTLA 5K9DA 5KMYA 4POCA 3GK0A 1W37A 2C0AA 4O19A 3IGSA 1N8FA 5D05A 4GJ1A 1YTDA 3PULA 4DPQA 3O06A 5AYXA 1DQWA 4FHAA 4JGDA 4WY0B 4EF8A 2ZQ0A 3SGUA 1HTIA 2NX1A 5LNWA 2OJPA 4O17A 5G1YA 3L0KA 1TCDA 3CIWA 1EP1A 3B0VC 2FDSA 3P61A 5DCBA 4HSOA 1H1YA 3ZR4A 4FNUA 4NT0A 5KZEA 3N9RA 3NPXA 2W6RA 3DI0A 4JTTA 1H5YA 3NPUA 1GJPA 3P82A 5I3IA 2HMCA 2E68A 1LROA 4LVDA 2QCHA 2G97A 3PG8A 5HINA 1U83A 2B7QA 2E6DA 4MIMA 3FIGA 3LXBA 3TNOA 3DENA 1X7FA 3I6RA 1Z42A 5D02A 1TRIA 4RCXA 2P1FA 3FS2A 2CZEA 2TPSA 3W73A 1HG3A 1Q45A 1QPRA 4AHPA 1X1ZA 5LHEA 1OYCA 4JS3A 3HJZA 4D2JA 1QPNA 1VCFA 1TPB1 3GVGA 3RMJA 4LTSA 2VEMA 1FWNA 5LSMA 2FPYA 1EWDA 4UMBA 3M47A 1LRQA 2ZTJA 3GLCA 1H7OA 1JCMP 3P60A 5BOOA 4A3UA 2CLKA 1H7NA 2ZZ1A 3W1QA 3IVTA 3QW3A 3W86A 4O14A 3EWYA 1HUVA 1SW0A 1GEQA 1DHPA 5FEXA 4DO6A 3EXSA 3UZJA 3L2IA 1W3IA 3W3OA 2A85A 4LS1A 3CWOX 2VEIA 2X1SA 3CWNA 4KWWA 3G0UA 5BW6A 2BXVA 4IQLA 1OHLA 4K8HA 2VFDA 3V75A 3THQA 3NYZA 1C9DA 1LCOA 2OCZA 5KTLA 2J27A 1TB3A 3A22A 4IMEA 2QUVA 4GUHA 3DFPA 5FF0A 4Y9AA 4LWWA 2V0TA 1OFQA 1YXYA 4ML9A 1DOSA 1W5OA 3NM3A 4BWLC 1TSIA 4MFDA 3G22A 1ZENA 3I65A 4CNOA 5AOUA 3TJXA 4CQ8A 1NFBA 4JDBA 1RPXA 5D37A 4ADUA 4WXZA 2QJIA 1F05A 4GBUA 1I2QA 2TMDA 3O05A 5LHFA 3HO8A 4K37A 1VPXA 5CZJA 3CU2A 4LS0A 1KFEA 5LZLA 3WK1A 1RV8A 3MHFA 3PUDA 1IIHA 2Y89A 4XWUA 1W5MA 3NVTA 1AL8A 1L2UA 3WJSA 4UFJA 3TA6A 2E5DA 5U7SA 2FB3A 1TRDA 3UWUA 3SZ8A 4NJIA 1JUBA 5C2XA 1AG1O 2H3DA 1TPEA 3MWAA 4AB4A 5CPNA 3LM7A 4O8RA 3HPSA 5FEWA 4O1BA 4AXKA 1LDCA 2A4AA 3KAOA 1JVNA 3IIPA 2Y7EA 1SZNA 1FDYA 4O1AA 4DO5A 1T0OA 3ZWTA 5LGXA 3L65A 4C1KA 1TPH1 3R5EA 4IOTA 1X8FA 1SUXA 4UTWC 5LNVA 3TFXA 3UYCA 1K8YA 4UIOA 4NJKA 1LBMA 3VCRA 3DFOA 2TRSA 4JX5A 4L4LA 4BF9A 1CW2A 3C0JA 1H7PA 4H6KA 2VKZG 1EX5A 4DO4A 3EWBX 4CLMA 2A6NA 1S5TA 3BARA 3NQGA 4YLWA 1YDNA 4K38A 5FF7A 2QUUA 3NQDA 4S1FA 4JIQA 4RLIA 3C3NA 3MP4A 3W84A 1DVJA 3B0UX 2OMAA 3HB9A 3UWQA 5ABTA 3N2XA 2G95A 2A2IA 3S1UA 1CX9A 1KLZA 4XQ6A 1KV5A 1IXOA 1WYIA 3NQEA 1RZMA 1PE1A 3IGXA 3L5MA 1F76A 4EF9A 3LTSA 4ZQOA 1I2OA 1C29A 3G18A 3LCGA 4RJEA 1EP3A 3W7CA 1M7PA 3T44A 2RDUA 5D2XA 3S0CA 1YPFA 1K7FA 5I3HA 2RFGA 5EYWA 5HULA 3W2JA 2J24A 3LX9A 1Q6QA 4QISA 4Y6GA 3P62A 3PBYA 4BK9A 3ABRA 3HIJA 3C6CA 3MBFA 3SJ3A 3IVUA 5F1VA 4Z1DA 3W71A 1YTEA 1H7RA 5K4XA 2FQIA 1IF2A 2O7QA 3NQ6A 4QNEA 3S1XA 1UUMA 1HO4A 3DFTA 3P80A 3WK2A 4ZZ9A 5KZMA 1QO5A 1YLVA 2ZA2A 1ZNNA 1KM6A 2X2GA 2V81A 2GVGA 3CPRA 4UTTA 3INPA 2E5CA 4JD4A 1JUEA 2HS8A 5U4NA 3PWAA 5F1UA 4AF0A 3EKLA 4J9JA 2GJNA 1G67A 2H90A 2VENA 1XBXA 3NAVA 5DCEA 1QOQA 2YGYA 5D32A 3TIMA 4BI6A 2WQPA 2OT0A 3TH6A 3PY2A 1Q6OA 3L0NA 5F2GA 3QPZA 4JICA 3GNNA 3OVPA 4OV4A 3ZWSA 5IM51 3T55A 3QSTA 4DF1A 4ZQNA 3P74A 1K8ZA 4WJEA 2YYUA 3W1NA 3MI6A 1K3UA 3QZEA 3E12A 4MYAA 3DKJA 1OJXA 2QCNA
chains in the Genus database with same CATH superfamily
1TA3A 1VYRA 4MDPA 5BU6A 4B5NA 5FJIA 1E1CA 3LB0A 3W22A 5I09A 1HJQA 4QJ3B 4CD4A 2OU4A 5EMLA 1UA7A 2FPTA 2D3LA 4CD7A 3VMPA 3UZWA 5C0QA 3RM8A 3HPFA 1BRLA 2GJRA 3IARA 1B2YA 1GYLA 4O12A 1FWSA 1W2VA 1BTMA 1OFAA 1HX0A 3TC3A 4A21A 4AZ7A 3AIVA 4DY1A 1GG1A 3F4VA 5KITA 4NAEA 4CQCA 3Q94A 1BVWA 3GDBA 4M81A 3WUEA 2G4FA 2GWNA 2J7DA 5DMLA 1B30A 1XX1A 2VEGA 3V5CA 3SCSA 2VI0A 2W27A 1QPOA 2D69A 1VYPX 4Z08A 3CL6A 5I3JA 2PF8A 3W2UA 2GDVA 4QGCA 3RO6A 4AMAA 1NH6A 4I9AA 5AYYA 4TX9A 1JF6A 1VZWA 3H26A 3MMTA 1ADOA 3WJXA 4AG0A 1US3A 1ODUA 2VQUA 1OVDA 3VTRA 1UWAA 1RBLA 4JTKA 4UTKA 3C2FA 4BF5A 1WP6A 1P5BA 1I75A 1JRCA 1ONWA 4C7GA 3DHPA 2ATSA 4Z1BA 4Q7BA 4PUUA 3FOKA 3TROA 1QNSA 4KESA 5HMFA 5MF5A 1A50A 2R1PA 2ZUVA 1H50A 4XZLX 3VIMA 4FI4A 4DNMA 1CZ1A 2JALA 1DJQA 3IRDA 4XD5A 1ZPTA 2PBOA 3GNPA 4TO8A 3NZRA 4UOZA 2JKPA 2XVGA 4O0ZA 3RJYA 3SURA 1G1YA 4ZR8A 3ABXA 4DWSB 4C1NB 5AC8A 4ZOCA 3EPOA 4LY8A 4QNWA 2ACRA 1ZTVA 1O5KA 3FXYA 3W2NA 1H61A 1X1OA 1UPMB 3EKZA 2C71A 4JFSA 1AH4A 1ZUAX 3I3BA 4YWSA 5HR6A 2EPMX 1UASA 3G24A 1D3CA 3LXAA 2QQ6A 4MMWA 2VX5A 2JQXA 4CCCA 4MAVA 3F4NA 2G3MA 3G1HA 3VGBA 1H09A 4D1JA 1EQCA 3G8RA 4L7ZA 2EEXA 4S3DA 3HMCA 3VKKA 2Q8ZA 1WV2A 2NXGA 3VINA 3MUCA 1P48A 3RLGA 1Z44A 1J11A 4UTMA 2DT1A 3TUUA 1C90A 4Q32A 4GY0A 1CXKA 3FJ4A 5GNZA 4L56A 2B0MA 2Y8KA 3LEPA 5REQA 3B8TA 3HFTA 2PDNA 2Y7FA 5DRCA 1PKLA 2PB1A 2DH2A 1OEPA 5CC6A 1R3RA 1OINA 2DZWA 2VTFA 4Z2GA 4Q8MA 3TXVA 1GVYA 3SQMA 5JBEA 3EXTA 4ONVA 1XYAA 3FVMA 3EEZA 2FHBA 4AFYA 1WX0A 3MUZ1 1SZEA 2OLHA 2WLYA 4FX6M 2CZFA 3ZVHB 4N6EA 3GTHA 2J78A 3K4AA 3H2CA 4UFKA 3GFXA 4YCOA 4JR5A 3V5OA 3CHEA 1G6CA 2Z29A 4PUMA 2BDQA 3EX3A 4ZFCA 2ZX7A 2FGZA 1NF0A 3ZR6A 1OD0A 1AJZA 2FFCA 2CZDA 3GNOA 3ZSSA 3MJYA 4AWSA 2ZDSA 3ITYA 3SCNA 4UTWA 3B0YA 5FIPA 1GVEA 4GUJA 1KWGA 2ZVIA 2CBIA 2VFGA 4ZB0A 1XLLA 4XX6A 3CO8A 4AIEA 3PTDA 3KL3A 4B5SA 4AHQA 4OTKA 2NQ5A 1K03A 1QNVA 1SW3A 1XBYA 1O1ZA 1ZAJA 2DSVA 3T78A 3BPWA 1O68A 3BOLA 5GNYA 1CDGA 4HNCA 3AIBA 3NG3A 3QBUA 2KAUC 5ECVA 4ZQCA 5GNXA 1UD3A 4X0NA 3SRKA 5A8GA 3DFQA 5A6AA 1AQFA 3NSMA 3NZ1A 1GYNA 1XF0A 2F7FA 3KOXA 3EOOA 1FHLA 2VELA 2A6LA 3FA5A 2ZFAA 1LTDA 3UXIA 4PRTA 2ASHA 2R1LA 4JY9A 3ALFA 1KC7A 5EKYA 3BANA 4F0SA 4GINA 3B9AA 4WJXA 1G4SA 2PCQA 3A21A 4IGSA 1V3IA 4GD0A 3MBDA 4MFEA 1GZ1A 3M0LA 3CAQA 1WDPA 3S5SA 2VRKA 2R8WA 1IWAA 1R8LA 2ODOA 3ARQA 4CNUA 1KQZA 3BZJA 4UR7A 1DV7A 2XWDA 4NU7A 4A35A 4IQJA 4YCPA 3U5UA 3C5QA 4PCPA 3W07A 3SADA 1W1TA 3A9BA 3TN5A 5BU9A 3UPBA 1K8CA 1CGVA 2VEFA 3DYPA 2PDUA 4TMCA 3GC2A 3S83A 1KFCA 1B31A 1CWYA 3ALGA 5A1AA 4JX4A 1QR7A 1DWAM 3B4YA 4GABA 4HD5A 3SRFA 4YVVA 5HANA 2PWVA 2R14A 3EAUA 3CIVA 5F4XA 3O2LA 1GTEA 4K3ZA 3W7DA 3IV8A 4J4KA 3DBPA 2QYGA 1S1RA 3G1SA 2A3HA 4ZO6A 4UFHA 2VC6A 1FCQA 4R9OA 4JTHA 1HL2A 2Q3RA 2OWWA 4HMNA 2QJGA 5DRIA 4C6OA 3UP8A 1XGEA 4D8ZA 2Q02A 3RRAA 3AZRA 4UZUA 1KKRA 3ATYA 3LHYA 2PWEA 4CN6A 1BXBA 1RUSA 1MSSA 4YJ5A 1IEVA 3N18A 1TJ2A 4PMJA 1YE4A 1EXPA 1SZFA 5A5WA 4BJHA 3WIJA 3RLVA 4JYFA 1CGXA 5CAKA 2BFGA 2VM8A 4IP7A 3VIKA 3V0SA 5EMUA 1S3HA 1U1JA 3AHYA 3IJDA 3VD5A 5IFTA 2G50A 1XBVA 3WMCA 4GZJA 5DY3A 1TPVA 3LYEA 4Z1AA 2WNNA 3KVJA 1TMQA 1E72M 3POCA 2DT3A 3HV9A 1GCYA 3WLNA 3ZM8A 4C6MA 2RDWA 1CXLA 1S39A 4FNPA 3B40A 2ACSA 4DBUA 4C1LA 1A5AA 3UJ2A 3WH7A 3WLJA 4M6UA 1JD7A 3I7SA 2OYLA 3BSGA 3OZOA 5E70A 4NNCA 1DJXA 3AFBA 1LUCB 4PH6A 5T91A 1EYEA 1H4PA 2JEQA 2NXHA 1ZCCA 3CL8A 3S8HA 4PL2A 1XH2A 2XSBA 3BLOA 1G9HA 3VNLA 1A3XA 4AYSA 3YPIA 4A29A 2PTWA 5KINA 4DM1A 1TIMA 1BTCA 4XAPA 3E0LA 4TVUA 5K7JA 3EWUA 2ISVA 5DY2A 4QJ1A 4YTSA 1JYVA 3DU0A 4DJFA 4RNHA 2E77A 4JTAA 2NQLA 4HSHA 2DVTA 1HVXA 1UUOA 3VPLA 2AAAA 1TPWA 4MUZA 2WK2A 2RH9A 3AS2A 4NJHA 2D2HA 2O4QA 2ZRYA 1JULA 1MXGA 3KBSA 1J4EA 2G3JA 3PZIA 1ITQA 3W01A 4K2SA 2BTMA 2OYMA 4FOJA 1F5ZA 2IQDA 1KCZA 4EAMA 3EKGA 4RZ5A 4R34A 3CPGA 1JYWA 2R91A 1VF8A 3MW7A 3KBJA 3GHRA 2Y7DA 1MEWA 1FWWA 1PYFA 4NYUA 3LS9A 4JCLA 3CLMA 2XHYA 4IZGA 2OODA 4JHZA 1AMKA 4FEZA 1AW5A 5FCZA 4UTIA 4PB5A 4B2DD 1BKSA 4AAJA 3P84A 4KQNA 2CPUA 2X40A 3MJMA 3BURA 4S3EA 1JR1A 3M9YA 8A3HA 4WDWA 7XIMA 3GBDA 4RE3A 2QJHA 3UGVA 3R1ZA 1EGMA 3ZR5A 3AXXA 2WKGA 3BCJA 3VNKA 2A3BA 1XLGA 3EX6A 3I7RA 5HWJA 2X09A 4JN7A 5I2UA 1L6WA 2HRWA 2GGHA 2EKGA 5DANA 5C9XA 1V0KA 1FWGC 3UJEA 4HPNA 3UWWA 2DU2A 2ZKMX 1S2WA 4IPIA 4KT2A 4I8YA 4J35A 3BQ5A 3SECA 4AZ6A 3AOFA 4GI6A 2H6RA 2W92A 1GOXA 4IX0A 3LV6A 4EWND 4MB4A 4DB7A 1K4GA 1UH2A 1C8XA 4O50A 2VMFA 5JH2A 1B3YA 3N4FA 4F2TA 4DXVA 4PTDA 3T0AA 5K3VA 4UNKA 1LQ0A 3HG2A 3BGGA 1TQJA 1PKMA 2J88A 1E0UA 2PGEA 1K7XA 2CLFA 4H7VA 5FJTA 2X42A 3VIGA 1I2RA 4L9ZA 3WK0A 1RCQA 5DBUA 5J5DA 2C14A 4JTEA 3AS3A 1B5TA 1EHNA 4P7RA 2E7FA 3W26A 3S5NA 1UWSA 3EMCA 3KW3A 4XVEA 3CUFA 4YU1A 3ZZ1A 3KTSA 1XQLA 3WBXA 3R8RA 4DWSA 4C1NA 1ZAHA 3MC5A 5HMSA 3V35A 2CKSA 5EBUA 1AFSA 4NYYA 5CSSA 3E0WA 1JZ3A 3CMFA 1W6TA 4RZ4A 4XD6A 2YZRA 3U8GA 4GGHA 4S3FA 1EJVC 1XQKA 4NRSA 1PZ1A 4JZ5A 1FVPA 1XW8A 4GFIA 2WANA 2P76A 2WHLA 6XIAA 1XIMA 4IIEA 5EFFA 1ZZMA 3B8DA 5SWUA 1UWQA 4MJ2A 2G0WA 1F9CA 3W6YA 2QDDA 5G4EA 3G77A 3TMQA 1RA0A 3QQ0A 2C79A 2P8CA 1TWZA 1ZY9A 1LQ2A 4Y90A 3NXFA 3N4EA 5GQBA 1XXXA 4AISA 3QY7A 3JUGA 1G4EA 5JIWA 3NQ7A 3WD0A 4D72A 3G5EA 5AC7A 4CEXC 3DDMA 3L66A 3VVGA 1Q6LA 4EKJA 3PSVA 1UZ4A 3MHGA 2YDSA 4I9TA 1RXOB 1CPUA 1XIEA 2ISSA 2A7RA 4Z2KA 2E1WA 4M7SA 2Z27A 3VZYA 4JCMA 1U33A 1O5QA 4AEEA 2GQ9A 2QULA 3ZVHA 3UVAA 1UCWA 4HNOA 3GH5A 5H91A 4IL2A 4AHOA 1S2TA 1WKDA 3UNDA 2DZUA 4S3BA 1XL9A 5HWMA 3A12A 2G3IA 1I2PA 5F4SA 5I7GA 4KPLA 3MI2A 3QTGA 5C2GA 3GXIA 3VOHA 1FWRA 4KIEA 3QHOA 1R7OA 2AGTA 4JIEA 5AKQA 4LBSA 4FX7A 4FR6A 3EB4A 1XLAA 1UH4A 3UU0A 5I06A 1OABA 4I7VA 4NF7A 2WKLA 4LYRA 4OBSA 1XPGA 1W9VA 1FWJC 4H8HA 3TC6A 3RMEA 3PBWA 3GKFA 3P5YA 3LNMA 2E6AA 1M7XA 5JVLA 1TG7A 3C3UA 3USZA 3D46A 1WBJA 2WC3A 1G7VA 4XBKA 5H6HA 1HP4A 2BHYA 3EWDA 5H8PA 3VDCA 3A3HA 1OGBA 1R5YA 4MF4A 1B4KA 4E6MA 4LS2A 2WZIA 1GOKA 1H7WA 4PGLA 4NILA 4RW3A 2VR2A 1UB3A 2QCEA 1NM9A 3GHTA 3HGOA 3NO1A 1DJWA 2EO7A 1FWCC 3HOJA 4JNZA 3IVSA 1E1FA 2QDGA 3RYSA 2GGJA 2GJLA 3OTRA 4CD5A 3COTA 1TJ0A 5A6TC 3SFKA 2E8ZA 3QPYA 1J01A 4KWUA 1K02A 4GIYA 4GH3A 3PB2A 1OCNA 1WZKA 2DJLA 3T0BA 2DZVA 3HG3A 4N9BA 2YSWA 3BGJA 1RHCA 4MNKA 1I6NA 1EKOA 4CU8A 4ZCWA 4PCSA 5CJMA 5LKYA 3IAQA 4PTXA 2HV5A 1UYQA 4KCVA 4E3VA 2PD5A 1VPQA 4WZHA 5G1MA 3TMLA 1FBAA 3VAVA 3VO0A 1T99A 1QO2A 3BSMA 3PB0A 4L4PA 4TX8A 5GVJA 2VCBA 4OOUA 1JXKA 3ZQ9A 4G2DA 3GKAA 3LTYA 1N55A 4P8VA 3WQ6A 1TX2A 2FFIA 1I0DA 4ORMA 3E49A 3OLDA 3WYZA 3DHFA 3SRDA 2D0GA 1OIMA 3FX4A 1UPPA 2W79A 1TJPA 2I9UA 2VHLA 3MSDA 1GZJA 2DIJA 3W7NA 1DWIM 3NQAA 1VEOA 3QV6A 1UBPC 3WH5A 3MMUA 4I3GA 1C8QA 2YPIA 3LTPA 1F3XA 4OECA 1NELA 3PPHA 4D6HA 3ARVA 2BVYA 2UY4A 3UXDA 1OF6A 1N7KA 2HBVA 3T8QA 5D8WA 4W5ZA 2A79A 3BL3A 3NM1A 4QLJA 4BI7A 4ATWA 4NASA 2J74A 4HN4A 3TAKA 4EXAA 4NKCA 3TW7A 4GXWA 3WLOA 2WVSA 3W1AA 5DX7A 4CD6A 4XAFA 1JZ4A 2WVUA 1ELSA 3LI0A 1UWRA 4DEFA 4EE9A 1D2KA 2OT1A 3MUAA 3SI9A 3CUHA 4V2XA 1RQHA 5E0FA 1JZ7A 3APYA 3TSDA 3CM4A 1BWKA 3S47A 3KFTA 3TCEA 1KM0A 3WQDA 2ZTKA 3SIZA 2Z1SA 4DUWA 2PWUA 4A8IA 3V16A 1W1VA 3EZ4A 3WF0A 3WQEA 4YIWA 3LSBA 4A8NA 1JCJA 3L4YA 4HZMA 4U4MA 4RNJA 3LPFA 5JIPA 2ZADA 4OUIA 5CC7A 2JF7A 3V36A 4XAYA 3VILA 1W5NA 1LBLA 4WIWA 4HNNA 4CU7A 1IGSA 2FYMA 4E2VA 2CLPA 5HPCA 3SCWA 2VT0A 1UR1A 4GFSA 1G4TA 3AIWA 4NRRA 4BZYA 2AGKA 1EL3A 4E8GA 2XN2A 4JQ4A 5HJLA 3S9ZA 1XC6A 4AMCA 3W7IA 1S38A 4IWWA 2QEZA 1LUCA 1OFRA 1TKKA 4MB3A 3O9NA 1XYZA 2V8ZA 3LZ3A 2PU1A 2V82A 4O13A 2YBUA 4HT3A 1WAWA 4LFYA 1EHAA 1W0MA 3L4XA 1L6GA 2CWNA 1DTUA 1KFBA 1PWMA 1VLWA 4GZEA 3BCFA 1ISWA 1UJPA 4HPJA 1LM1A 3WX7A 4WEVX 1KXQA 1NEYA 1XM3A 3VZZA 3LGGA 3HTWA 3WDIA 3W1PA 1FWEC 1JZ8A 1ZCOA 4MZYA 3FYOA 1N2VA 3CZGA 2EPKX 3SM0A 5AC5A 4BS0A 1BQCA 3W82A 4MWAD 4GX8A 3GXTA 3LENA 3PP7A 3RG6A 5A2CA 4N4PA 3RX2A 3RN6A 2Y63A 2E1DA 1S5NA 3T40A 1F6KA 1JFHA 4XZNX 5BMWA 3GAKA 4R33A 1T6MA 3FYPA 3GW3A 3LPPA 3FAWA 3GXNA 3C86A 3RM4A 3WLHA 3GNXA 2VFIA 1O4UA 3CQIA 3BLEA 3KOWA 2EGZA 3H53A 2VCAA 4BY3A 4QSHA 1I45A 4DX3A 3DG3A 2Q3OA 4UTFA 2JBMA 2MUCA 5LNSA 5IHRA 3DFSA 3EEGA 2ABAA 5FI8A 1R3WA 2PP0A 1TV5A 4REQB 3KVLA 3KWSA 2Z1VA 5DF0A 5LIUX 3TYZA 4HU8A 3XINA 5K2ZA 4JHMA 4OE7A 3M5ZA 4NZJA 3L9CA 1RLDA 4F40A 1QNOA 1X1NA 4FNTA 3OG3A 1UROA 4CNTA 3S5ZA 3H6OA 1LOSA 4WX2A 1ISXA 3OYXA 3TYAA 4K8EA 1E6SM 1S2CA 2CIPA 2V2DA 1JJKA 3VNZA 3P8JA 1SQ7A 4OKDA 2QGHA 1TVPA 4ZB5A 1ZAIA 1UD6A 1DWHM 1Q85A 3K1GA 3LBMA 1F4HA 4U3CA 3AYVA 1PCKA 3O1NA 1TV8A 4DYJA 3K1DA 3S2MA 1KKOA 4GWEA 4IIFA 3C0QA 3T6CA 2E09A 4C6JA 5HQLA 4QP0A 1V08A 1PX3A 4ATDA 3W23A 3KRBA 2A21A 4NZ5A 4HA0A 4KMQA 3WQCA 3BLDA 3GIQA 2OEMA 3RITA 1FWDC 6ENLA 2R82A 3H21A 1V51A 1IT0A 4HK6A 3WLTA 1XIHA 3HGJA 4UC5A 1V0NA 2PMQA 3QYQA 4XB3A 3TSBA 2ZDRA 5AHMA 3RCYA 2O4MA 3B8IA 3LHVA 1DJHA 4RK8A 2PWDA 5IHSA 4I6VA 4R5EA 2DGAA 1KM1A 4ASTA 2A7NA 2ZXQA 3I7QA 2W3ZA 1WXJA 4NAFB 2JKAA 3JRKA 3BGAA 5HOSA 4EK7A 3B0XA 2NWRA 1P6WA 1P4CA 3UG5A 1QTWA 2BV9A 2CLHA 3RIKA 3I4EA 1E4MM 4O19A 5GJMA 3GVVA 1YTDA 3EDKA 3PULA 4GIRA 2X05A 1ZP4A 1ZJAA 4FHAA 5BWAA 2YLAA 3AHVA 4LF1A 1HTIA 5FKYA 3VDHA 2OJPA 2ZX9A 3L0KA 7CGTA 4KCTA 4UQAA 3P61A 1VFUA 5DCBA 1H1YA 1W3HA 3AYTA 3RDKA 4DYKA 4X63A 1AA1B 2D24A 4LVDA 4QEEA 1JZ6A 4MIMA 1UJQA 3LXBA 3I6RA 2CZEA 1HG3A 1Q45A 4HK5A 3VIIA 2FVLA 4NSBA 3FA3A 1BGGA 1VCFA 1BYAA 3SBFA 1EQPA 2VEMA 2CNCA 1LRQA 1SZRA 3TVAA 4A3UA 3M0MA 3AICA 3IUDA 1H7NA 5BZAA 1C3FA 4D6DA 3N29A 2ZZ1A 3QW3A 3EWYA 4B3LA 4P8WA 3FJNA 1GEQA 4Q8OA 1DHPA 5FEXA 3EXSA 3IJ8A 1M3UA 3GH7A 3W3OA 2A85A 3CWOX 4UQBA 2X1SA 3CWNA 2FTWA 3ZVIA 1EPVA 3QQWA 4W4QA 6A3HA 5BW6A 2AL1A 3N1AA 4IQLA 4HU3A 1C9DA 1LCOA 1MMFA 2J25A 2QUVA 4GUHA 1XWYA 4HCHA 2X0SA 2D3NA 2WNWA 1GONA 1DOSA 4HOZA 4P5UA 3NM3A 1TSIA 1NWUA 3A4JA 3V7PA 1NFBA 1RPXA 1AQMA 4MWAC 1UIOA 4WXZA 3VU2A 2QJIA 3URNA 2TMDA 1QI5A 5LHFA 3GUWA 1V3MA 3XIMA 3CU2A 1IEWA 3PUGA 5LZLA 3WK1A 3PUDA 1ZGDA 2Y89A 4XWUA 4HN8A 3CHDA 3WJSA 4C5ZA 1JYNA 2E5DA 5U7SA 3WQPA 4CQDA 1RJPA 1AVAA 4MNJA 3SZ8A 4NJIA 1AZ1A 1AG1O 2BHUA 2H3DA 3F7JA 4IFRA 4AB4A 3URAA 1E0XA 2ZXDA 1O7AA 4RZBA 5FEWA 1MUMA 4AXKA 4QCFA 4C5YA 3KAOA 3TYBA 2ACUA 1KRAC 1B0IA 3ZWTA 4C60A 3M7SA 3L65A 1HXJA 1CTNA 3AIEA 4IOTA 1JCTA 2WWDA 1SUXA 1FHUA 5C9RA 1LQAA 3TFXA 3RPDA 1WXYA 3VCRA 3R79A 3DFOA 3EA2A 1XLHA 2HPMA 3BMWA 3U7VA 2FVMA 2VKZG 4C6KA 1Z9AA 1UWUA 1S5TA 1Y5VA 4EPBC 1Y65A 3NQGA 1P0BA 5BYWA 3UYIA 4ERIA 3NQDA 4TV5A 3AISA 3W84A 2E25A 4ZFMA 1VIZA 3HB9A 2A3CA 3S1UA 2PGWA 1CX9A 1CECA 1M01A 5I78A 5FJPA 1CXHA 3URBA 5XINA 3LTSA 2Q09A 4ZQOA 1H49A 1M7PA 2RDUA 4V1XA 2GK1B 3OLGA 1K9FA 1YPFA 1YKWA 5HULA 3W2JA 3P62A 1WDDA 4BK9A 3MBFA 1EJXC 1GQKA 3W71A 1H7RA 2PTYA 5K4XA 4JL2A 4QNEA 4MJ4A 3S1XA 1UUMA 8RUCA 3RCMA 2VOTA 3H70A 1R3VA 3P80A 5KZMA 1LF1A 2V81A 2YXXA 4DVOA 4JAWA 4W86A 3EKLA 4J9JA 3RGTA 1VBRA 3WELA 2OFJA 1XBXA 1GNXA 2PDBA 3NAVA 1ADSA 5CPSA 3H4GA 1E6ZA 1HJUA 1OC7A 3CMGA 4W5UA 3TN6A 4JICA 4IIBA 1UP2A 3LUTA 1CNVA 3QSTA 4ZQNA 1EJTC 5HA7A 2DW7A 4WJEA 3W1NA 1K3UA 4KH2A 2PWFA 1LL6A 1OCJA 1W9BM 3UA4A 3DG6A 2C3ZA 3EDDA 1W9UA 3W1TA 3ITXA 3QC3A 3PR2A 1K6AA 4Q22A 1B3WA 1DIOA 4MLRA 3N4AA 3RPMA 2WHKA 1NQKA 2OTDA 4GUIA 3ZS4A 3AHZA 4R7WA 2YYTA 2PDFA 3VC5A 3NSXA 3QEZA 4DZ5A 3WDHA 2E28A 4H04A 2Y85A 4AX6A 5G4HC 3AZSA 1SSDA 1PAMA 1T8QA 5FACA 3TXZA 4LVFA 4LB3A 3FSUA 3LRMA 4PRWA 1X6NA 4DBEA 1Q5MA 1V93A 1QWGA 3W28A 5FAGA 5LIKX 4ICCX 1J0YA 2DVXA 5JH1A 1E9IA 3AALA 5HXMA 3LPGA 4UR9A 3AXIA 2OQLA 1PTGA 5E5CA 3U6WA 1HJSA 2FKPA 4L9XA 1NU5A 3BG5A 3EPNA 4LNYA 3V18A 4DJDD 4HNVA 5C9UA 4REQA 1F6PA 5F4WA 4AW7A 3Q4DA 2CW6A 3LCWA 1XBZA 1TTQA 1JQVA 4QHRA 4FOUA 1RJQA 4PUNA 1AW1A 4RL3A 2CWXA 4P7QA 4JDYA 2UY3A 1TWWA 3QV9A 2FZBA 2Y8VA 2FDMA 4LW7A 4WSKA 1K4HA 2IS7A 4DF2A 4DBDA 4G9PA 4D8AA 1NFGA 1Q2SA 3NQBA 1FKWA 1LLOA 5LIXX 5BNKA 3Q58A 5TIMA 4QLKA 4H6RA 3UJFA 5DBTA 5E9AA 4ZXOA 4HMCA 4K1WA 3HG4A 3A5FA 2CHRA 1DWGM 2BWGA 4AD4A 4YMZA 1LRTA 2QV5A 1Y0EA 4NY2A 4ZODA 2POTA 2V5JA 1R46A 1G69A 1W1ZA 1E40A 2BLEA 2VFEA 1PCWA 3CIXA 3P81A 5E6ZA 4JNYA 4ZO9A 4M1BA 4NJJA 2QLYA 1TVNA 3CPUA 1L9WA 1QHPA 4D9PA 3RM9A 4F3HA 3DECA 3PJTA 4IP5A 4XZMX 1HF6A 3EOEA 4CNNA 1XYFA 4RZ6A 3VNYA 4Q4KA 3O7UA 3WF3A 4H2HA 4DJEA 2VD9A 4JTSA 2ZZ4A 4O0KA 4UTHA 3WFLA 3CUGA 4B92A 4NAFA 1R87A 4AH7A 3FKRA 3SGZA 1SMDA 3ANVA 3C2OA 4IT1A 2FJKA 1UUQA 2PLJA 1TE1A 3VNDA 4ZOEA 1OGGA 1N82A 3W81A 3MU7A 5HATA 1ONEA 2YL5A 5FJRA 4W9TA 3BMXA 2XIOA 2Y24A 3B9EA 1Q65A 4ML4A 4IIGA 5D9NA 5CJNA 2E40A 3II1A 1DYSA 3TFCA 3QOMA 3LOTA 4Z0SA 4TMBA 3MWCA 2OOGA 2NT1A 1XYBA 1XI3A 5G5IA 4CQ9A 3VD9A 2PDGA 2PI6A 3SCRA 1MO0A 1XGZA 3OU8A 3VCNA 1OFPA 1T40A 3GR4A 1VENA 1HKMA 4QG6A 1RSCA 4I7UA 3U2CA 4MDOA 4KFOA 3KCOA 5DEZA 4BQ3A 4FSAA 4NZFA 1WBHA 4LYQA 1XLBA 4IPPA 4O16A 1T8XA 3O0FA 1NF7A 3WQGA 3WLLA 3N04A 3IJ6A 2O0TA 3O63A 1UKQA 2Q01A 2ON3A 3APTA 1OZMA 4GNJA 1SW7A 1MQQA 4LVBA 3GH4A 2QR6A 4J40A 3CJPA 5M17A 3QR0A 1ODZA 3H7RA 3FCPA 1TV4A 1TZZA 3JU2A 4KRUA 1ZJHA 2X1UA 3J7HA 3BK0A 5M1TA 3NZQA 4NXSA 4FXJA 4D6CA 4FLOA 3BVJA 2J77A 3ABOA 3E3HA 3L4ZA 2OX1A 2YFOA 3NPWA 4RXGA 1RD5A 2C16A 3W7EA 3U4FA 2XG9A 4DUVA 4M6VA 1JZ5A 4JQ2A 3WMBA 4CN4A 2I5GA 4B9ZA 1BYDA 4A3YA 4V15A 1YQ2A 1XDJA 3F03K 5TAOA 4KWSA 2KX9A 1P6BA 4MTVA 1UC5A 1YNPA 2J6VA 3VGHA 4JTJA 2I14A 4PUEA 4J7RA 2ATMA 2BY1A 3ZMRA 2IPWA 3UQNA 3BJSA 4NQ1A 2V3DA 3A5VA 2Z7KA 4C7FA 3ITTA 3K8MA 3VFLA 2YW3A 1VBHA 4C6PA 1M5WA 1R9YA 3G6MA 2R24A 3PN8A 4DJDC 1XLIA 5EY5A 4DLFA 1BWLA 1DXIA 4DWDA 2DSZA 4IMDA 4TUFA 3DAQA 4AZIA 3UESA 3O8AA 3N3MA 2XGIA 3KUMA 3SB0A 2P3ZA 1A49A 2C15A 1OF8A 4Z42C 3SGGA 5I00A 3CZJA 1HGYA 2NWSA 2WVVB 2Q6ZA 1A5OC 3N6QA 4M29A 2F2HA 4Q7NA 2YIHA 1TJRA 3S2LA 1EF3A 1TREA 4DBSA 4DI8A 3BTNA 4MOZA 1KQYA 3EOUA 4L4MA 2RGLA 3DEQA 1MUCA 1QK0A 3XISA 1JXJA 4M8UA 1UD4A 3LSCA 3A64A 1WKYA 4DUXA 3W7PA 2PFHA 4ZB2A 3WQ5A 3STFA 5I03A 5EPDA 3G8EA 1MW2A 3FV9A 2VJXA 3EA3A 4H00A 3EB2A 1IZKA 2JGQA 5H8UA 2GK1A 3B04A 1DQUA 3CUZA 2C1HA 5ABEA 1VIWA 3FJLA 3E0IA 1F2JA 3UZYA 2E0PA 2INZA 1KTNA 2ACQA 1NDYA 1E6QM 1R47A 2WNQA 3AXHA 4J5NA 1SPQA 2EKCA 4QSFA 4TU1A 5IFPA 4I5XA 4FXRA 4BR1A 2YDQA 1KFLA 5HNRA 1G7UA 2ZRVA 1IWPA 3W37A 3WF2A 4HVXA 1TQXA 1TE6A 3MVIA 2ZUSA 3D6NA 5BRQA 2OEJA 1VAHA 2UY5A 1SO4A 1CB2A 1KFJA 2Y6ZA 4XD4A 2G41A 4PA8A 1HO1A 1PHWA 3URQA 2E9MA 2ZZ3A 2VDGA 4CEUC 3T0TA 2ZRUA 1CEOA 4P8UA 3LHUA 2DSWA 3MO4A 1JI2A 3TONA 1XIJA 4A2SA 1AUSL 3QVQA 1J2WA 2OOFA 1C93A 3RNDA 2E5BA 1EPXA 4H9TA 3W83A 2OG9A 2R94A 1UQYA 4MZ1A 1VQTA 2G4JA 5DXYA 5IBXC 2X0YA 2XVNA 2XJ7A 4B9YA 1ML1A 4AIOA 4MUPA 3SCPA 3KOZA 1JGMA 3MY9A 4O11A 1UKSA 3F4DA 2BVTA 1FWIC 1IZCA 1WDRA 3KTXA 3C0SA 1QI3A 4BQ4A 5FEPA 1E73M 1LLZA 3WFAA 2BP1A 4PEEA 1W56A 4I6KA 1N8IA 1KR0A 4GRSA 2GGEA 5CG7A 2YCEA 4E4UA 4H6QA 4XSLA 4C6IA 3GU2A 3EA1A 3DBNA 1EP2A 5PTDA 5TQLA 3MZ2A 3WJZA 3MP5A 4CNPA 3FLUA 2V5KA 3AMLA 1WNOA 1LT8A 2VYOA 4IQEA 2VEKA 3K30A 3SEPA 1W17A 5I3FA 3GU9A 1AH0A 4L80A 4J2MA 1OCQA 3OIXA 2YDRA 4GZ7A 1Q4NX 1QW9A 3PS7A 2VXNA 3ARYA 3M4HA 4PBGA 5DFAA 3IGUA 1XIFA 1KA9F 4MJMA 1TTPA 5ABHA 5HAOA 1IQ8A 4RDZA 3C2RA 5A6SA 2HNEA 3DN5A 3PJUA 1ZLPA 1KGUA 2DZSA 3UEQA 1Q63A 2CZVA 2YR1A 4IMFA 3WFZA 4EAYA 1NDZA 2BVDA 2X16A 3FXGA 1E70M 1D7KA 4UUIA 1O60A 1R2RA 3D0CA 1IXQA 2INEA 2YXGA 1I1XA 4IIDA 1DJNA 1KRBC 4IL0A 3CS2A 3C2EA 3CZLA 2A0NA 5LYRA 3CASA 4HNUA 4P7LA 2GDUA 4S38A 2AAMA 3ABZA 4Q8UA 3G1DA 3WQ4A 3ITGA 4CQBA 6PTDA 3DFYA 1SU5A 1HKKA 1MRAA 4DXXA 3HA1A 4B5TA 2AMGA 5T26A 2I5IA 3MP3A 4O10A 2Y0FA 3AI0A 5A95A 4GACA 1JL8A 2GOUA 3B4UA 5AZ0A 5FEZA 1FCBA 2W67A 1CXFA 2XN1A 1JNEA 1GVSA 3S6TA 3VFCA 1YDOA 2Z28A 3GB6A 1XRVA 1UH3A 2F8QA 1R3SA 3THCA 3Q65A 4L1XA 3PZGA 2B7OA 2NV9A 3S5OA 3IIZA 4PUJA 2NVDA 2AOSA 4LJ3A 2IQTA 3KEHA 1KXTA 3ZT5A 2CETA 2CEQA 1BQGA 5F2MA 3T2PA 3T4WA 4RKAA 3GQYA 1XIIA 1KM3A 4FMVA 4MJZA 4F66A 4H9YA 3BLFA 3IIVA 4JFWA 2Y70A 5ECUA 1LJYA 2Y62A 1BSIA 4AIBA 1Y7VA 4QJ5B 2YB4A 4X3ZA 3FFSA 3E1F1 2B81A 1OIFA 3UCQA 3R8GA 5BXSA 5A8MA 4HIBA 3TYUA 1FWTA 4RNFA 3E5PA 4HU4A 3AUJA 1JCLA 1MDLA 1RVKA 3B9NA 4DRSA 1NTHA 2NXIA 1NDVA 4JFTA 5I3DA 2FMOA 1K6WA 1QOXA 3P8IA 5K4ZA 3PZMA 2PTZA 4QS5A 1FY6A 3C2YA 1Q4WA 2WSKA 3F4WA 2FTPA 2VP8A 2EG7A 4JKMA 3MUIA 3UWZA 3B06A 3OGVA 5BMXA 3IS4A 2VRJA 1SO6A 4IMCA 5DT5A 1PKYA 3ATZA 4JL1A 1E43A 3QM3A 2WSRA 4M0XA 2G8ZA 3BW3A 1YHTA 1JUKA 1X97A 1ZB5A 1KBKA 3VOCA 5F2LA 2ZA1A 2QCLA 5A2AA 4C6BA 4EANA 4HCLA 1PDZA 3MVTA 1FWAC 1IEIA 3MCOA 1P0KA 2WSPA 1IWBA 1BVZA 4IGNA 1PIFA 3OHIA 3VZXA 4EVZA 3AMDA 2C18A 1KLYA 1JPHA 4W87A 4TR9A 3UG3A 5KEZA 1KNWA 1XC4A 4GOAA 4WUIA 1BXCA 3UR2A 1KGWA 2XFWA 4QQ3A 5BRPA 1R3QA 4MKNA 4F79A 1BAGA 2NUWA 4XUGA 3WBYA 3SQSA 4IPNB 3SCTA 3O6AA 3G0XA 7ODCA 2XFYA 3E38A 1WDWA 1NARA 5F2IA 1PL9A 4AD3A 2EPOA 1MNZA 3VMOA 3V5FA 1GVIA 1IXNA 4DQWA 1E4IA 2VFHA 3FJ6A 4J3UA 4PBFA 3W7RA 4NL1A 1A53A 3WD1A 2C0HA 1OC5A 2QZRA 1Y5WA 4OGZA 1YADA 3H7UA 3WQWA 1KCLA 1Z69A 3QFEA 5LNRA 1EF2A 1R30A 2ZRWA 4L5ZA 3V1HA 2F6UA 2Y88A 1GQNA 4F0LA 4GI9A 1P0NA 1E5NA 6TIMA 2FJUB 5F7UA 2QUTA 4N2YA 3T2OA 5FL1A 1NOUA 2CERA 1EZ2A 3Q67A 1FH9A 1A0CA 3PPFA 3M6DA 4LV9A 4E4PA 1Q6DA 1GT8A 2BHZA 3GVQA 1T7LA 2J9ZA 2TYSA 3K2GA 1HNYA 3QF0A 4RUBA 3KBWA 3QC0A 1E5JA 5C7HA 2EG6A 2JKEA 6CGTA 1OSEA 4O4VA 2WV8A 1ZJBA 4Z2HA 3U9IA 1K1DA 2Y4SA 3MT1A 4YVXA 1KFKA 3GS6A 5EMKA 1XICA 3WNKA 5CGMA 5EGRA 4C91A 1I9CB 4O0QA 2QDHA 3W1UA 4BFAA 4GCXA 4DZHA 3CB3A 3WMLA 2D20A 1ITXA 5B7YA 4W7UA 2OZ3A 4LPCA 1NWTA 2WXDM 1B3VA 3T08A 2YA0A 3BDKA 3A24A 5MHBA 3EB3A 3GNRA 3N2CA 4PMOA 3LCLA 4N4QA 2F9RA 3GTFA 1IIGA 1ADDA 4GE8A 2WVVA 4ENLA 1QT1A 4PMNA 1V6WA 4ICNA 4QCEA 2WKJA 1HGWA 4JXCA 1X6UA 1CLKA 4O1EA 1K7EA 2GUUA 2NX3A 1A0EA 2B7PA 4EOUA 3TYEA 3MKVA 5AB3A 4OJYA 3NZPA 5A8OA 3FSTA 3IGHX 4Q3MA 2OR2A 1KBIA 1R86A 1EXBA 2OKOA 2XVPA 2V5CA 3P93A 4I9MA 4DF0A 4YS1A 3HQ1A 4HZ6A 3VKCA 1GQIA 3TLQA 3VA8A 3VI2A 1E6NA 1TPDA 1UA3A 5HBFA 4HB7A 4FPSA 5C54A 2GWGA 4PR4A 3CV1A 4I90A 2XGZA 1VRDA 3UZ5A 1OWQA 1PIIA 3R13A 2D2JA 2H3BA 4M51A 3KRSA 1A5UA 5ABGA 1DPMA 3C4UA 2EPNA 3DFNA 3UCCA 1V4YA 5LA0A 4C6EA 1J6OA 3QOKA 5A6MA 4GNKB 2GYIA 3R8HA 1MI3A 4UZSA 1GORA 1TELA 3CGTA 4NZCA 4MVAA 3N2TA 1DWJM 2HTMA 2O56A 1OM0A 4XK2A 2AL2B 1V6UA 1UMLA 1FWBC 2E9LA 2DUAA 2I56A 3GYCA 3LV5A 4YPJA 3O6DA 5DO8A 2XIBA 2D22A 1H63A 3ZLHA 2AKMA 3S4TA 1GEHA 1XSKA 2WCSA 3BAXA 3W7HA 3VYLA 4KCWA 3T2QA 4PTVA 4S3JA 4ECLA 4MY1A 3GDTA 3U7BA 2PLKA 1DP0A 1ICPA 4S3KA 4UQEA 4X60A 3NWRA 3AXKA 1OX6A 4GI8A 1SO5A 4AC7C 3PPCA 4HYWA 3ARTA 1W8GA 2PDXA 2ZE0A 2WJEA 1ZBVA 3T07A 2IW0A 4N9EA 5CQ1A 4O1FA 3LPOA 2XZ9A 1UC4A 4HSNA 5G2HA 4E5TA 3RXZA 1YPIA 1EEPA 5C9ZA 3F2BA 1Q7QA 1L6YA 2HVMA 1A3WA 4D6EA 4RPQA 1W54A 4Q4PA 4W89A 1YE6A 4H1ZA 4C6DA 4NI3A 4JTFA 3K13A 4QG8A 3NTYA 4ROQA 2W0UA 5TF0A 1LWHA 4LRSA 3QHMA 3N6JA 3W7JA 4AZGA 1V8EA 7ENLA 3SR7A 4UTTC 1ITCA 1J0JA 1ME7A 1NFPA 3CUXA 4UB9A 5AHIA 2ZOXA 4MY8A 5AYIA 3EXRA 2F6XA 1E71M 2VX6A 2CLEA 3VGGA 3HJEA 3GXDA 3AIUA 3NEHA 1M68A 4DPPA 2TODA 1CXEA 2CXGA 1LLWA 2ZCGA 1FDJA 2OGYA 1H60A 3S6DA 4E4FA 1UKOA 4H9ZA 1OZQA 1LWIA 5CBIA 2VDIA 1OCBA 1FRBA 4KIRA 2PGFA 2ZUWA 3P7YA 5CGQA 3W02A 2WM1A 4G7EB 4ZO7A 4E8CA 3SRHA 4AX7A 4JEQA 1T96A 2QJNA 4GIEA 1L6FA 1H62A 1M9HA 3B97A 3ELFA 2ZRZA 3G1AA 2HCVA 3WDJA 5CJ5A 1E6XM 2OZ0A 4H4IA 1V5XA 3L67A 3WCZA 1BKHA 3WKZA 3M5YA 3M5VA 1G01A 2VWTA 4LY4A 3GFYA 1W9PA 4IHCA 5DQPA 3UY7A 1PB0A 1O1HA 1XSIA 2DVUA 1H3GA 3B8VA 4TTUA 1VYSX 4F0HA 4EIVA 3OQ8A 3M5XA 1ALDA 2FTYA 4WXYA 1WOAA 1H2JA 4IIHA 3W7LA 1L8NA 4R27A 4H7CA 5HNNA 3TTSA 1XYLA 3ITCA 3VKDA 3VKAA 3W4RA 3PZOA 3R43A 2GOKA 4JTLA 4U3AA 3T9PA 4JN8A 1PTDA 4POCA 1W37A 2V67A 5JBDA 2ISFA 5D05A 4GJ1A 2DW6A 3O06A 5AYXA 4DHGA 2J8FA 1A5LC 5LNWA 3L4UA 2EG8A 1C7SA 3I10A 4O17A 5G1YA 3U48A 2XZ7A 5C2CA 2HDJA 4IH3A 5A8QA 2Z1WA 3VGFA 1C8YA 2QF8A 3DI0A 4JTTA 1H5YA 1R85A 2VNCA 1EJUC 4EX4A 2HMCA 1R3TA 4H8UA 5HINA 2G97A 3PG8A 1U83A 1MW3A 3FIGA 2CBVA 3DENA 1X7FA 5D02A 1TRIA 2CESA 3W73A 4PMRA 3AMCA 3GFZA 3H2MA 3GVGA 3AJ7A 5AZ1A 2QMJA 4LTSA 1FWNA 2FPYA 1TV3A 2ZTJA 3GLCA 4IJCA 1JCMP 3PWIA 2VC7A 4MAZA 4WVXA 2IKIA 4QTGA 2WJDA 1EOMA 4HOWA 3WD3A 5LA2A 1XLMA 4AY8A 1FOBA 2QVHA 3L2IA 2IPFA 4LS1A 3DC8A 3LU2A 3QFWA 4KWWA 2YJQA 5A2BA 3TR9A 3GRIA 4K8HA 3TTOA 3AC0A 2DY3A 2J27A 1A0DA 3QGAC 2I5QA 3DFPA 5FF0A 1W1IE 3ERPA 4CCZA 4Y9AA 4KCUA 4R85A 1V6TA 3H2EA 3E2RA 2TAAA 2OB3A 1TUFA 1JFXA 4WHBA 3CYJA 4BWLC 5AOUA 3NSNA 1OBAA 1KGXA 3TJXA 4ADUA 3KS6A 1F05A 4GBUA 2DZAA 3N12A 1I2QA 2XH7A 3HO8A 2PDQA 4K37A 5CZJA 4DJFD 3L4VA 2OWCA 1RV8A 3MHFA 3L4TA 3THDA 1W5MA 2MNRA 2YCLB 2XSAA 4GY1A 1XJBA 3SCUA 2X0HA 2FB3A 1JIBA 3KDOA 3CQJA 1JUBA 4EXQA 3MWAA 3NZGA 4N42A 3LM7A 3HPSA 3KCJA 5CSUA 2QXWA 1VKFA 5D9MA 3IWPA 2A4AA 2E8YA 1Q6EA 1P7TB 3WNOA 3ITOA 1CLVA 5M5DA 2QJMA 4ACZB 4MNMA 4UQDA 3ZO9A 1EEXA 3MV11 3WUBA 2PTXA 4FLQA 1B3XA 1I0BA 2ZC8A 5FSEC 1BXNA 4UTWC 3VOJA 3UYCA 4DXKA 1K8YA 2J47A 4GI4A 2ZXAA 2Y8UA 4GGBA 4XZHA 4F0KA 4JX5A 4OBRA 1HW6A 1H7PA 1UWIA 1EX5A 2ZICA 4UBPC 2FZ9A 5HMDA 2I57A 4MB1A 2UBPC 1BVNP 2GSEA 1HL8A 1E0TA 4JIQA 3C3NA 2X2YA 1RK5A 4F2UA 1V77A 3T09A 2OMAA 2F61A 2GVEA 4PMYA 1H41A 2G95A 1IEXA 4XQ6A 2X8RA 2WJFA 1RCXB 3K4DA 4XBJA 2X41A 3L5MA 4EF9A 2BY2A 2L5HA 4M80A 4DO7A 3N13A 3TW9A 3G18A 3LCGA 3QZAA 1JNDA 3T44A 3UJSA 4FLSA 2RFGA 1OD8A 1UR0A 2GZXA 2JIWA 4IUGA 4IISA 2XFRA 3THUA 1BWVA 3PBYA 4H9VA 3ABRA 3IVUA 5F1VA 4Z1DA 1YTEA 2PDJA 2PTDA 3QKEA 1IF2A 2REQB 5LXXA 3H2AA 5CAHA 1CB7B 4MB5A 1ENUA 3VD4A 3GM8A 4ZZ9A 1EA9C 2ZA2A 1ZNNA 2ALRA 1KM6A 1LL7A 4CNSA 4W93A 3CPRA 3KZSA 4JD4A 1JUEA 2HS8A 3TWAA 1YMYA 3TJIA 3PWAA 4IFOA 1A5MC 1JAEA 2H90A 4U33A 4WDTA 3REQB 4U31A 1QOQA 4PCNA 2A3AA 5D32A 2WM0A 4DWSD 2WQPA 1HL9A 3L0NA 2NW0A 3AIQA 3GNNA 1F3TA 3OVPA 2FZMA 3ZWSA 3T55A 5A6JA 4JIIX 3L4WA 3MI6A 3VK5A 3E12A 3ONCA 4MYAA 4NAEB 1PX4A 1EZWA 1JQXA 4HTBA 1RVGA 5TBOA 3AXMA 5I3GA 2J4GA 3C8NA 2P3EA 3BWWA 3CZKA 3G1VA 3M0HA 4WKHA 3KVKA 3KP1A 1SGJA 3WF1A 6XIMA 3HG5A 5A6LA 1KBJA 1W3KA 5AYBA 1KR1A 5IDIA 4ALDA 4Q6JA 4FNSA 5ENLA 4C7DA 5IOBA 2VGGA 3OVRA 5JXQA 2YX0A 1H7XA 3M0XA 1GVRA 3VKBA 1M6JA 3L0GA 3M41A 2P8BA 5FJJA 4CKQA 3W7KA 3HQNA 1HT6A 4LAOA 3PAOA 4U28A 4FB7A 3AU2A 4TOQA 4NUWA 1P43A 2DP3A 3A4AA 2BOGX 3GR8A 5IDZA 3MYOA 4G6CA 3PZVA 3V0UA 1VHCA 2VDHA 3PZUA 1Q8AA 2Z0IA 3DOPA 3ABQA 3SY5A 4CVWA 2D0FA 5LIWX 1GW1A 4J3ZA 2ANUA 5GJPA 3TW6A 1EIXA 4O4WA 3S2JA 2GVJA 4ZSTA 4XKYB 1C92A 2G3FA 3R12A 3OG2A 3S3GA 3TNBA 1EUAA 1HKVA 3BLKA 3QMRA 4ROPA 3GTNA 3ES7A 1S1PA 2B4GA 3TAOA 3OBEA 3E6EA 4W8LA 4U10A 1GZGA 4H9MA 2IXVA 3W24A 3E2QA 3DESA 4NIRA 2QPXA 3OBKA 3E96A 4LEQA 4DJFC 1SR9A 3EBVA 3R11A 4JTQA 1A4MA 3E02A 3ANYA 5GJNA 3HBLA 2XM2A 3PTKA 2VWSA 1UD5A 3N17A 4D6GA 2G3NA 4ICMA 1C8VA 3RLHA 3N2OA 3THAA 4O52A 2A1YA 3D3AA 1XG3A 4NI8A 3CC1A 4Q8VA 3NO5A 5E6YA 5IXEA 3DC0A 3WK3A 2ZUTA 4PCFA 4Z0JA 4ZVJA 4Y8FA 2WAGA 1OC6A 4O28A 3OZMA 3KOFA 5D2YA 4HP5A 1KBLA 4PUDA 3VOIA 2ABBA 1QCWA 4GC3A 3PBMA 1E9YB 2QF7A 1PYMA 1A80A 4P61A 3RJXA 3LHZA 4XUYA 1XS2A 4RX0A 4TVDA 2C1IA 4E2OA 4Q33A 4JIPA 4UMAA 4G7EA 2VRQA 3B3DA 3LDVA 4ADSA 3SN0A 1TV7A 3ZLFA 3TKFA 3U2EA 2XSXA 3ITLA 3F1QA 3EYPA 3WY1A 3LCIA 1GVOA 4MKVA 3P2VA 4HTYA 5I0DA 1JZ2A 1FDZA 1BF2A 3QRHA 4J3SA 3BCDA 2FH8A 4JTRA 3OEXA 5AYZA 2QVNA 1HN1A 9RUBA 1QUMA 2QNEA 3KLLA 1WKEA 4QITA 2PCEA 1KRCC 3AWOA 3E5BA 2O92A 3BJTA 4X61A 3WD2A 2VX4A 3M0ZA 2V9DA 4UWMA 3H4XA 3QMTA 1Z7AA 1W9DM 3GY1A 2VGBA 3PZNA 3U57A 2RKXA 1VFOA 5CG0A 1AJ0A 4QM1A 1FQ0A 2VFFA 2JGYA 2WOQA 2H9AB 4YL2A 4AD5A 1FA2A 3W2KA 3SO7A 4N7QA 4DELA 2HPIA 1RQEA 1QJWA 1IXPA 5EL1A 1NSJA 2HVOA 2AQWA 2ZUNA 4LU0A 1QXLA 1U5HA 3H7VA 2GUYA 5FD0A 4PB4A 4UTUA 3T0CA 3B8WA 3H22A 1GPWA 4BEUA 1R2TA 4MKSA 5DELA 5FJOA 3BAJA 3W2LA 1GTHA 8XIAA 3W72A 5A8NA 3VDAA 1XH0A 5L9FA 2GQ3A 4J3VA 8CGTA 2CLMA 3QXBA 4LYPA 1SFTA 3QV7A 2B31A 3KBVA 5HQEA 4DWSC 4JTIA 3KL5A 5KETA 4FF5A 2YOCA 3UR5A 1GW9A 4GBDA 2HE8A 3QJAA 2OYKA 1RY0A 3CB8A 3GXMA 3H54A 4QDMA 4KFNA 1CXIA 1WZMA 4ZEPA 1I60A 3FDKA 2CKRA 2HXTA 2B7NA 4KWVA 3NA8A 3BXWA 1UHVA 1FCVA 3MMWA 2E9BA 1V7YA 4GJIA 3OO2A 2ALDA 4TV6A 3SUTA 4AY7A 3HGSA 5J04A 3CT7A 4IXHA 1EO7A 2XIQA 3RR4A 3RFAA 1XIDA 1B3OA 4QFUA 1RJRA 4BA0A 1HFBA 3A9IA 3STCA 2Z2BA 2GQ8A 1A5BA 1E51A 1EUNA 3VIJA 2QCDB 4NX5A 3K8LA 5CZSA 1XCWA 2YCLA 3B03A 4KF1A 3QKZA 4PSRA 4U5KA 1AJ2A 3PBUA 2YW4A 1RP9A 4AU0A 3ZLGA 5AECA 3A3WA 3U4AA 1XV8A 3KVMA 4HHPA 3GZ3A 4FA3A 4EPDC 5AVNA 4X9SA 3W74A 1ISYA 5FF3A 5CPLA 4S39A 1OFEA 1P7TA 3I68A 4MLJA 3W6LA 4B15A 4PL1A 1H1ZA 4AWTA 3LBCA 4PODA 1AZ2A 4ACZA 5BRBA 3ZJ6A 1QVBA 4JFVA 2ZIDA 3PTQA 4S2CA 1TX0A 3WEOA 1PZ3A 1AD4A 1Q8JA 1XLJA 3E0FA 1ZJIA 1F73A 2V69A 2XU2A 4Q8TA 2GVYA 1GHSA 2QCGA 1X39A 1B3ZA 3IIOA 4XZIA 2AQVA 1WE5A 5BXTA 3GTIA 3VE7A 3QLLA 1YNQA 1YXDA 3TP4A 5LIYX 3VOGA 1YTKA 5I24A 5D30A 1VP5A 1D9EA 1V79A 5ABFB 2DJXA 2P50A 3PBVA 3KS5A 2V5LA 4S3CA 1X6LA 1V3KA 3PM6A 1UR2A 3PTMA 4WRHA 4M19A 3N73A 3SW6A 3WLMA 1OYBA 3O0KA 4QQUA 1KCXA 3WNNA 3MHUA 4WGXA 1PX8A 3WZ0E 4IGMA 4L6OA 3QMSA 1WOBA 1BYCA 1GQJA 5K9CA 2WHJA 3EWZA 2EJAA 2HZGA 3WBEA 5G4WA 2VD8A 1UD2A 4GUGA 1O12A 1PXGA 4W8BA 4ATLA 4AZBA 3R94A 2QHAA 4K7VA 2EPHA 1NJJA 4WOQA 4S3GA 3LCHA 3TU9A 3LM3A 3OHMB 3BV7A 3SSZA 1LRNA 3WEZA 1AK5A 4US5A 3QN3A 2REQA 1Y5XA 3P3BA 2FIQA 3OVGA 2Q71A 7PTDA 3CHVA 5A69A 4QAIA 4I7WA 4KWOA 3AO0A 1D8CA 1LZOA 4LH8A 4K6AA 2BXZA 1TV2A 1GKQA 4I5RA 3C2VA 3W1RA 1BGAA 1J96A 4GQRA 3U5YA 4YWIA 5A6BA 2PDLA 3Q45A 4GISA 4PCTA 2GPTA 2PRHA 2WZHA 5EFDA 3JS3A 4HNTA 1DORA 3REQA 4JX6A 1XPYA 3WD4A 2WMKA 5I3KA 3ZT7A 1M7OA 4OU1A 2WZEA 2ZX8A 4FLRA 4TVCA 3NQCA 3UZZA 3N6HA 4N0RA 4GLEA 1XCFA 3L68A 2ZX6A 1KTBA 2V2CA 5M2FX 4OOZA 1XD1A 3USBA 2BASA 4WD0A 2WMFA 2HK0A 4ZOAA 3WQOA 4AEOA 1EO5A 2VEPA 5J8LA 1Z48A 1B90A 1Q7ZA 4M82A 4WKFA 4IF2A 4ZOBA 5TD4A 4GQGA 1FH7A 1CLXA 4PBEA 4JN6A 4ZMGA 3E2SA 3ZYZA 2XYLA 1J9YA 4PE8A 2VVNA 4OHQA 3UXLA 4LAMA 2HJPA 2FLIA 2IMRA 4EPKA 5E09A 3LA4A 1OADA 4O15A 4U2ZA 1SO3A 2Z2AA 2YA2A 1B4EA 2YL6A 2CCRA 1QATA 5D4YA 3WH8A 3TZFA 1EH9A 1W3TA 3LGEA 3DHUA 3F5JA 5D2WA 3EMQA 2CLOA 2PC4A 2LLEA 3TLLA 4U5IA 3SFWA 4N9CA 2RDTA 5CLTA 1EDTA 4IXXA 2UWFA 1IYXA 4F9JA 1GOOA 3N34A 1AMYA 1CGUA 1PSCA 4Y9NA 2O9RA 1E0WA 3TWBA 4JIHA 2A3EA 4J2PA 1MW1A 5D9PA 4HPGA 1VRXA 4A3QA 4EXBA 4XKYA 3ZJ7A 3C0LA 4R9XA 1UOZA 2QCFA 1TPUA 4GQQA 4PFMA 1OG0A 4AVNA 2D1ZA 1MEIA 2XH4A 3CMJA 1BF6A 2NQZA 3R25A 4LC6A 4XO7A 4NZ4A 4GH1A 3KLKA 3GU1A 4GYJA 4UNIA 4YHGA 1HKJA 4LEFA 1EIBA 1NOWA 4C6QA 1KW1A 4JNMA 2C19A 1U2YA 4HYRA 3BOXA 3HURA 4BI5A 3G6LA 3L5LA 4HKPA 2J7BA 3H2NA 1AL7A 2VOMA 2GJPA 3S9IA 4O1DA 4C6CA 4EACA 3DCPA 3MO7A 4DAFA 2OKTA 5CCZA 3TA9A 3R0UA 3IJ7A 3N19B 2DZTA 4BWLA 1B57A 3TTQA 3EWXA 3QTPA 2J75A 4IPLA 4LAUA 1BYBA 1KXHA 4F8XA 2WC7A 4I8DA 2GFTA 1UZHA 2XH0A 4PEKA 3B05A 4TX6A 2NSOA 1VFMA 3F5KA 2VZVA 1VBJA 2YCIX 3AWNA 3ARUA 2D2GA 4GYPC 4HMDA 4RR4A 5K9XA 5E1QA 1TR1A 3HZ3A 3W7OA 3QY6A 2PRLA 3HV8A 1JDFA 3CO4A 2YB1A 4HA4A 3MCNA 3TTEA 2DIKA 1XH1A 2NVAA 1QMLA 4G7FA 5EA9A 1ME9A 4JTGA 4ORIA 1ZFJA 3QGVA 4JEJA 1R6WA 4PMDA 3DHDA 1RY8A 3DERA 2OSYA 4B5XA 2QAPA 1W5PA 4IM4A 1P0EA 3QLDA 3IJLA 5CSRA 1X8CA 1J93A 1YDVA 2JIEA 2NV1A 4MYXA 2V3EA 3M43A 3W7GA