2QCNA

Covalent complex of the orotidine-5'-monophosphate decarboxylase domain of human ump synthase with 6-iodo-ump
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
publication title Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qcnA00
5D2VA 4HNUA 1TPFA 4RKAA 4DEFA 5EBUA 5I3IA 5AYZA 5ABTA 1SUXA 3QF0A 3NL2A 1OG0A 1I2PA 1H1ZA 3FYPA 1XL9A 2ALDA 3SGZA 1Q3NA 1YADA 1QPQA 1TPB1 2RH9A 5F2LA 4O52A 4LS2A 1UCWA 3E9AA 2YYUA 3EWZA 4FNQA 4UTWA 4PL1A 2NV1A 3SI9A 3LTPA 4LVBA 2E5CA 1EA0A 3NQFA 2V5BA 3P62A 4FIQA 3H53A 3IVTA 2RFGA 3NDOA 4M19A 4IMGA 1NEYA 1TTIA 3EX2A 1DORA 3PBYA 3HIJA 2ZA2A 1ME9A 4ZVJA 2YFNA 3L0NA 4UNKA 2Y7FA 3L66A 4DPQA 3EB2A 4M6QA 4Z1BA 3SZ8A 1G69A 1PS9A 2ZFAA 3S1VA 5HNRA 1Q45A 2W0UA 2VFDA 2RHGA 1XUUA 2ABBA 1MSSA 3TCEA 3TDFA 2VENA 3OEXA 5FI8A 5AC7A 2DU2A 5F2IA 3G8EA 1TIMA 3BW4A 3P61A 3LBCA 3M0ZA 3GAYA 1UBSA 3G8RA 3W23A 1JUKA 1LDCA 1ZAJA 1LRNA 3IGXA 1X7FA 2A4AA 3DZ1A 1TRIA 5BNKA 2V2HA 3E96A 1ADOA 2RKXA 3M5YA 2V82A 1W5MA 4K36A 2GJNA 4QITA 4DBEA 4PL2A 3FKRA 5EYWA 2JBMA 4A29A 3S1UA 2ISSA 1OFPA 2QCGA 5DELA 2VFHA 3TH6A 3F03K 3BARA 3RNDA 5EA9A 3LHZA 3LOTA 4IX0A 4MY1A 1OVDA 4IQLA 1Z48A 3C2FA 3LTYA 3M7WA 4IXHA 2O7QA 3A22A 2H3DA 3MO7A 4X3ZA 3W86A 3WK1A 2CLMA 1SSDA 3W85A 1D3GA 5G1YA 3N14A 3W1QA 3RU6A 5BMWA 1BWLA 4UIOA 3OBKA 1KW1A 2HS6A 2ZZ6A 3EWYA 1K7XA 1KFLA 4MIMA 4O57A 1OX6A 1LYXA 4BWLA 4MKNA 1JRCA 5K7JA 5HUOA 1TJRA 2Q8ZA 4LVDA 5G2WA 1OX4B 2DP3A 1BTMA 2VFIA 4DF1A 1YTEA 1GVFA 4FX8A 3PBVA 4UR7A 2CLIA 2W6RA 4K7VA 5FF2A 2C14A 4Z1AA 2V0TA 3IIXA 3O8AA 4O18A 3RMJA 4BI7A 1NSJA 5DBTA 2NZLA 1WOBA 4U4MA 1TMHA 5HUPA 3OIXA 4YMZA 4O0ZA 4M5PA 5LHEA 3F4NA 3OG3A 4O1DA 1RV8A 1RR2A 2TSYA 3UPWA 4KWWA 4K38A 2EGZA 4O1BA 5D33A 1TB3A 5CPLA 2BLEA 1VLWA 5D09A 3S5ZA 2BWGA 3P7YA 3FYOA 4UMCA 1AW1A 1VQTA 1TPC1 1T0OA 2ZRVA 3BW2A 3GZ3A 1R47A 4HT3A 3GDRA 4AB4A 1QCWA 4B5NA 3TAOA 3FS2A 2Y7GA 3KAOA 4X22A 3B0PA 5DCDA 4RXFA 4S2CA 3O15A 2G96A 3W3OA 3NGJA 3L21A 4K37A 3R89A 4K8EA 3W7QA 2NX1A 1UUOA 2Y89A 1Z44A 1I4NA 1KM0A 4Y8FA 2WSQA 4UC5A 4JTSA 1EIXA 3WK3A 3P60A 3TXVA 4O13A 1MO0A 1FUYA 2Z2UA 1G4EA 4UTIA 3KRUA 2P10A 1OF8A 3PVFA 3TW7A 4HN4A 5LGZA 1C8VA 1O5KA 2Y70A 2VOMA 3TSMA 1G4SA 2LLEA 3NM3A 5TBOA 3VE7A 2C3ZA 2A6NA 3VKJA 1TTQA 3UWVA 1ZY9A 3M5VA 3G1FA 1LOQA 1IXNA 4IWWA 4HIBA 2NUXA 3FLUA 2J88A 5FEXA 3STEA 4LS0A 1VRDA 1GTHA 5F2MA 4ZQMA 1VCFA 1QWGA 1W0MA 2WNZA 4DXVA 3O16A 4NXKA 1FCQA 3ANYA 4MY8A 5E0KA 1TCDA 2C16A 4BI6A 1EP1A 3VE9A 3TMQA 3QW4B 3T7VA 2ZTKA 1J4EA 3W7OA 3G0SA 3GDLA 2J9ZA 2E09A 4LVAA 5T26A 1FBAA 3B0VC 5IBXA 2QJHA 4UUIA 3DAQA 3TC6A 5LNUA 2EHHA 2EPHA 4JNMA 2V2CA 2ZRUA 2ZZ5A 4N9EA 5I3FA 3TKFA 1L6WA 4MZ1A 1TPUA 5FEPA 1WBJA 3IIZA 3LRKA 1M6JA 3GDTA 2Y61A 3E0IA 3MI6A 1OABA 3NAVA 4ORMA 2BXVA 3B06A 3YPIA 3P80A 3PR2A 1OFOA 5DCBA 5CZSA 4GJ1A 3I7QA 4JR5A 3L65A 3CM4A 3HPSA 3C56A 2WO5A 4KWVA 4UFMA 1XBZA 3DKJA 3NL6A 3M43A 4MJMA 3TFCA 3L5LA 1R2RA 3HOJA 4NX0A 3HGOA 2A7NA 1H7RA 5D37A 2WV8A 5F1VA 2GQ8A 2QDGA 1IXQA 1IIHA 5F2GA 3W2LA 3TV8A 1PCKA 4I7UA 4O4WA 3S0CA 5G5IA 4TX9A 1N55A 3JS3A 5LNSA 4NVTA 4QJ1A 2OCZA 1NFBA 2Y7EA 5KSWA 3OVQA 1DL3A 3DHDA 4HSOA 1K02A 3W7PA 2YW4A 2H6RA 1A5BA 4LUIA 1GWJA 4WZHA 1UB3A 3NYZA 2NXIA 4LC6A 1B4EA 5DXYA 5D2WA 2TPSA 5K3VA 2ZA3A 3HG3A 1JCMP 3G1HA 1FCUA 3HG5A 4O8RA 1JUEA 3UWQA 5LHFA 2A7PA 3ZFHA 1NVMA 3W1XA 3PC0A 3SY5A 3MMTA 5HR7A 3G1VA 4N02A 1KM5A 4NQ1A 1BWKA 3O05A 3LI0A 5DXXA 5LGXA 2FDSA 5C2XA 1WBHA 1P0NA 2AGKA 4NXSA 3OVRA 2X1TA 1OHLA 1J5TA 4GE8A 3S9YA 3T78A 3HGRA 3N9SA 1W5OA 4PA8A 1H7WA 5AC6A 1CX9A 4AWUA 5H2ZA 1UJPA 5CPNA 3ABOA 1RQHA 3C6CA 3LDVA 1DVJA 4NZFA 4OQVA 4AAJA 4XWUA 3W83A 5D02A 1W31A 1FWNA 4MFDA 2BTMA 3WJZA 3BLIA 1P0KA 4MLRA 3W7JA 4XZ9A 3EKZA 2QKFA 3C0JA 1QMLA 1VHCA 2GQ9A 4FX7A 5HJLA 3UYCA 3W1UA 2WOQA 3O63A 3KRSA 4DO5A 1YLVA 4O11A 3W74A 2TMDA 4C1KA 1B4KA 4Z08A 3GX9A 4N4QA 1KFEA 1DQXA 2ZZ7A 4MFEA 3SR7A 3RLVA 1YTKA 1W3NA 2HTMA 3IV3A 3CEPA 2OX1A 3NXFA 5CGQA 3EXSA 4LY8A 1JUBA 3PBUA 4BR1A 1H63A 4JTEA 1FWTA 1KV5A 1MEHA 3LCWA 3N2MA 1Q6OA 4NJIA 5FF7A 1C9DA 3W75A 1Q6LA 4JX5A 3NQ6A 2YDAA 1AG1O 3W1NA 2NWRA 1PHWA 3KRZA 3IVUA 3LCXA 1X6UA 3QQ1A 1TV8A 2DZPA 1V5XA 2J6XA 4IJBA 2BX7A 2ZZ1A 1G7VA 1YDNA 4LVGA 1KFCA 4JTLA 5SWUA 3CU2A 2QCMA 2Z1BA 2FPYA 2QCDA 1LRTA 2B7OA 5D03A 1QNVA 3W1RA 3FA5A 2H90A 3UWUA 4R7JA 1R2SA 4AF0B 1VS1A 3DFSA 5G4WA 1YPFA 3G1YA 4ZMGA 4MPQA 1QPRA 4GUJA 4XKYA 4P61A 1VR6A 2FJKA 1W5NA 3K30A 3MP3A 2A85A 2CLEA 5DN1A 3BG5A 1AW2A 4QM1A 3P84A 1T99A 2XN2A 1RQBA 4TIMA 2FIQA 4FNUA 4PTNA 1SFLA 4MOZA 2VEMA 3O07A 4IGHA 5G2HA 2ZA1A 1B57A 2Z6IA 3NNTA 2TYSA 2FQIA 3NM1A 4MZYA 5CPOA 4WQ6A 3LV6A 1LROA 3MI2A 2X16A 1IGSA 1F73A 3SIZA 3LI1A 1K8XA 4CCDA 4MYXA 1OFRA 3HPZA 1SR9A 3BG9A 4CNNA 3FKKA 3W22A 5D30A 2AQWA 3W7EA 1F7BA 3STGA 3H54A 4Z1DA 3QC3A 2CW6A 1KLYA 4X2RA 1T8XA 5AFDA 3LHVA 1P4CA 3P74A 4K8HA 5AHIA 4IPJA 3W1LA 3QQ0A 4UXDA 1DJQA 4EOUA 1OYAA 4LTSA 3SFKA 2C0AA 4WY0A 3PG9A 3THAA 3DFTA 3PY2A 4AHPA 3GKAA 1TTPA 4BF9A 2NWSA 3BG3A 1A5SA 4M6PA 1M5WA 1LLWA 4EF8A 3P81A 4UFIA 2XN1A 2FPVA 3LERA 1JCLA 3PUOA 5KITA 1TPWA 1GPWA 4ML9A 1PHQA 2PRMA 1K8ZA 3ELFA 2YFOA 1L9WA 3E02A 3NQEA 4PFMA 4IOTA 1ZAHA 3WJSA 3SECA 3E49A 4XTIA 3W7IA 3L67A 4GWEA 3PF3A 1SSGA 4JYDA 5D2TA 1VYRA 2A6LA 4DO6A 3PM6A 4ORIA 5F4WA 3S5YA 2V8ZA 1SZGA 5FEWA 4NT0A 1I2QA 3DHFA 1WYIA 3WJXA 1PIIA 1LOSA 1ZAIA 2WSYA 1MZHA 3B05A 1L2UA 4UTWC 4UTKA 4UTLA 1O5XA 1JQXA 3LTSA 2Z6JA 3GIYA 3A21A 4A2SA 3UD6A 4JTIA 4M7SA 3M5ZA 3DU0A 5AOUA 3JR2A 1O94A 3NZ1A 4PH6A 2G97A 3W7NA 3TJLA 4JTKA 1OFAA 1DHPA 4NNCA 3LXAA 5C5YA 5I3JA 3T4CA 1ICPA 4AXKA 3FEMA 3WK2A 4K7YA 4S2BA 4UFLA 3EX3A 4JTHA 3DFNA 2EAWA 1J2WA 3UY7A 2ABAA 1YXYA 3TR2A 1SQ7A 5EPDA 1VZWA 5BW6A 3P82A 4N6EA 4TO8A 1SO5A 1DBTA 2ZBTA 2GOUA 4O19A 3SSJA 4H4IA 2NLIA 5CZTA 1XXXA 4O1CA 3RFAA 1L6YA 3U2OA 1YPIA 4FEZA 4OBTA 2QCHA 2Y63A 3FFSA 4LRTA 1O4UA 1G6CA 4GFSA 4LUJA 4UFHA 4TR9A 1GOXA 1X1OA 1LZOA 3BV4A 1M7OA 3QJAA 1KFJA 2B0MA 5AYXA 4R33A 1O95A 3HGJA 3M41A 4N4PA 2V2DA 1IIGA 3O6YX 4OT7A 3WJYA 3TA6A 2DZUA 3BO9A 4UTUA 2P1FA 3PB0A 2A0NA 3I7SA 1TQXA 4WUIA 4CQ9A 2NV2A 3ABRA 2WJZA 3M44A 4FX6M 5KINA 3D0CA 4UFKA 2V5LA 4HKPA 2YX0A 6ALDA 3IIVA 4EVZA 2GQAA 3Q37A 3DI0A 1WDWA 1Y0EA 4PC8A 5CKSA 3G18A 3DH7A 3W7LA 3GNDA 5AC8A 4QIUA 4OHQA 5BMXA 2CLLA 4AWTA 1WAUA 1VPXA 4LT9A 3UWZA 3DBPA 4NNBA 4XUGA 2VC6A 4WX2A 5FF4A 2A1YA 3DFPA 4ZL1A 4ALDA 4JY9A 2B7PA 1JRBA 3BPWA 3R8RA 1IXPA 2CLHA 4JTUA 3W2NA 3LHUA 3C3NA 5LSMA 1FWWA 2CLKA 4JX6A 1TPVA 4PODA 3DI1A 4N9DA 5D2XA 5G4EA 4XTDA 2PE4A 8TIMA 2JGYA 4AH7A 3W9ZA 3W7KA 1LCOA 2J9YA 5KMYA 2V81A 5K9XA 2YW3A 2YGYA 2DZSA 5AB3A 4JTGA 4OE7A 2YR1A 3RLUA 2G5WA 4XQ6A 5TIMA 4JY8A 1N7KA 4NX5A 3G1XA 2QR6A 4HNTA 3M1ZA 3LCFA 3FOKA 3S8HA 1CI1A 1ML1A 3KXQA 4Y96A 4O54A 3CIXA 4DPPA 1JULA 2OZ0A 2H8ZA 1THFD 3OHIA 3GDMA 4UTJA 1W8SA 3NZRA 2X1UA 1ME7A 3B03A 4ADUA 3NQCA 4RZ6A 2ZQ0A 3NQDA 3TAKA 3EXRA 3C52A 3CLMA 4JGDA 3PAJA 1H7XA 3NEVA 1DKWA 3IRDA 2YYTA 4O14A 4OGZA 4LWWA 4KFNA 3BVJA 3INPA 1P5BA 5AHFA 2QDHA 5A5WA 4AMAA 1S5VA 1IXOA 4YWIA 4QSHA 1ZNNA 5F4XA 3G1DA 1KFBA 2NXGA 4Q33A 1I45A 4UTMA 3U8GA 3R2GA 3VI2A 4FO4A 2Y88A 1XDLA 3PSVA 2C15A 3QZEA 1GJPA 1WA3A 4IMCA 3NQ7A 1VJIA 3W88A 1A5AA 4HNNA 2FLIA 4FIRA 3LGEA 1QPNA 4LW7A 4CNPA 3N34A 1MXSA 2FB2A 2BZNA 5H91A 4I7VA 1RD5A 1G7UA 4M6VA 3O6CA 3S5OA 1SO6A 4JYFA 1ZENA 2JGQA 3LHTA 4QISA 2Q3OA 3FJLA 2Y85A 1FXQA 4WXZA 1R46A 3O6DA 3QMTA 3USBA 1W5QA 3UWYA 1SFJA 3W87A 1LTDA 1F6KA 3W7HA 3N19B 3QH2A 3Q2DA 3HQ1A 2CZDA 5EL1A 1LBLA 1I2RA 4JDBA 5C6MA 3NQMA 6TIMA 1SW0A 1C29A 3IIPA 3T55A 3UXDA 5IBXC 4LC8A 2I9EA 3UXAA 1QOQA 1DJNA 5L6UA 1KM4A 4A21A 3C61A 4Z1CA 3TU9A 1FWRA 2EF9A 2NUWA 5BOOA 1K3UA 1FCBA 2CU0A 1SO4A 5F1UA 1H1YA 2Y6ZA 3BGGA 3G22A 2HMCA 3NO5A 4ZZ9A 1OX4A 4UCGA 1SO3A 1GG0A 1BEUA 4IPIA 3ZS4A 3HBLA 1XBYA 2IQTA 4UTTC 3TIMA 2NX9A 5CZ0A 4OU1A 1JVNA 2RDUA 3IIOA 3G0XA 4H3DA 2WPBA 3W70A 5CZJA 3S5NA 1YYAA 1TYGA 3H55A 2WQPA 3SGUA 5I3KA 3LRMA 4WXYA 2QUTA 1KM3A 3MHUA 5AHMA 1RQEA 3CIWA 5C54A 2AAMA 3TQVA 4AEOA 1ZHAA 3C2RA 4GUFA 3C8FA 3AJXA 1EPXA 2X2GA 1Q6RA 3V1PA 3C2OA 1FX6A 4OWGA 2O7SA 3LX9A 4CCCA 3W7GA 3QRHA 1KTNA 2FB3A 4Q32A 3AO0A 4JTTA 3EWXA 4JN6A 1FCVA 1FQ0A 3EWBX 3ZWTA 3EXTA 3I7RA 3CB8A 1KTBA 2PURA 2YSWA 1H62A 1M7PA 2B7QA 1ME8A 4G1KA 1BKSA 2DZVA 1TV7A 5HWNA 3L2IA 1EWEA 1Z41A 3GB6A 3GAKA 3ABSA 5J5DA 1PV8A 3M16A 5EKYA 4UFJA 3DKLA 3S42A 1KLZA 1OK4A 3C4UA 3QMRA 1JQVA 5CSSA 1I2NA 2GVJA 4Y9AA 3M6YA 4O17A 1VCVA 1OK6A 3NQAA 4WY0F 1NAL1 3A24A 1RZMA 1EP2A 1B3OA 2CZEA 1HFBA 2Q3RA 1QO5A 3F1QA 4LU0A 5G2IA 2HSAA 3HGSA 3LLFA 2TRSA 1F2JA 3P8JA 4JD4A 1U83A 1WV2A 3PS7A 4NJGA 1ZFJA 4ZQPA 2JKEA 1JJKA 4GBUA 5DY2A 1LP6A 3CC1A 3W84A 2E6DA 1UUMA 5K9DA 2PCQA 1S5WA 1HO1A 3NQVA 4JTFA 4AHQA 4N9BA 5LKYA 2JKAA 4UTHA 2ZZ2A 3TW6A 1VGAA 5HQEA 1YXCA 3VCRA 1KBIA 3GNNA 4JICA 1XCFA 2EKCA 3QPYA 1NF7A 3W7DA 2QJGA 1G4PA 1XI3A 1L6SA 2VKZG 3B8DA 3W2JA 1JR1A 3MP4A 1VH7A 5U4NA 5HWMA 1XUZA 1A50A 4BI5A 3LB0A 1H51A 3NVTA 3UZ5A 1TTJA 1OX5A 2QF7A 1H7NA 2ZRYA 3LCGA 3DENA 3GLCA 5FESA 4IUOA 1LM1A 3A5FA 2NX3A 3NL5A 4JIPA 5FF0A 1X8FA 3W7MA 4Y6GA 3KX6A 4O28A 5DY3A 4DELA 2ZRWA 4O4VA 3W2MA 5AYYA 2D73A 4S1FA 2QEZA 4FF7A 3ZR4A 1SPQA 3DFOA 3WK0A 5DBUA 1D3HA 3Q58A 4ICNA 4ONVA 2JK2A 5AHLA 4FHAA 3W1TA 1LBMA 1TPH1 4JXCA 3MBDA 2C19A 2DORA 4WJEA 3G0UA 3S1WA 1EX5A 2DZTA 3A5VA 3MI3A 3QPZA 4E2BA 2E6YA 3SJ3A 2XFWA 3HG2A 4XBKA 2ISVA 3GXNA 4E0CA 1TPDA 1O60A 1KTCA 1K7EA 5D32A 4O15A 4RJEA 2GPTA 2ZZ4A 4ADSA 3EX4A 4I7WA 3E12A 4RV8A 2I1OA 1ICSA 3CPRA 5KZEA 3NOEA 5K4ZA 3N3MA 4TU1A 3W1AA 2XN0A 3W07A 1SZNA 1T96A 2ISWA 3MUXA 2H3BA 2CZ5A 5F4SA 2VFFA 1JCNA 1EEPA 2NUYA 4QNEA 3B04A 4MY9A 5BRBA 1RPXA 5C55A 3ATYA 3UY8A 3NQGA 3PUEA 3T40A 3NL3A 3O1NA 3TJXA 2GUUA 3F4WA 4KFOA 5D05A 4KKXA 3I6RA 2YCEA 1QDSA 1GG1A 3TMLA 4YCOA 3QFEA 1LRQA 4WOQA 1WXJA 1ICQA 2R94A 3V75A 4UMBA 1GTEA 4MUZA 4C1LA 5MHBA 4JS3A 5DCEA 3A23A 4PEKA 1GVQA 1W56A 3GXPA 1XFBA 1JCXA 4O53A 1OF6A 1YDVA 2NXHA 3NPXA 4YL2A 2V30A 3TFXA 3ATZA 4L4LA 7TIMA 3G1AA 4A2RA 4EIVA 3NPVA 2WNQA 4XBSA 1GVOA 1GZGA 4MVAA 3W6YA 1K03A 1YTDA 1XBVA 1GT8A 2R8WA 3CWOX 2J24A 1VC4A 3CQ0A 4U28A 3L5MA 1W5PA 5DLCA 3BLFA 1HL2A 4Z0JA 2CFFA 2OT1A 3C2VA 2QUVA 2OT0A 1AW5A 3S6DA 3CTLA 1VHNA 1FDYA 3HB9A 4K6AA 4NU7A 4BFAA 3EWUA 1V7YA 3HPXA 3CT7A 4NJKA 1EP3A 1AL7A 1DV7A 1AK5A 1XBXA 4O12A 4FNTA 2E1DA 1SZFA 4D2JA 5E1QA 2Q8LA 2WSRA 1HTIA 4LV9A 2VFGA 1EWDA 3MHFA 1EUAA 1IF2A 5TQLA 1ZCOA 3PULA 3QM3A 1MEWA 5G1TA 1H61A 1LOLA 1S5TA 4GRSA 3FJ6A 4AF0A 5HMSA 2VEIA 4MYAA 3NPWA 1W3IA 1FY6A 4E38A 4FB7A 1B9BA 5KZDA 3PG8A 4GUIA 3W76A 1NF0A 4JX4A 3FIGA 3MBFA 3EX1A 4H6KA 1GEQA 4HHPA 1WOAA 2QCCA 1F76A 3KOFA 3Q94A 5I3HA 4QQ3A 4DBDA 4TMBA 4JEQA 4ZQNA 3NA8A 3TXZA 4BWLC 3W73A 2VELA 3KVJA 3CWNA 1XDMA 3JRKA 4NJHA 3MYOA 1H50A 4FNPA 3M5XA 3UZJA 1N8FA 5K2ZA 5AHEA 1GVRA 3B4UA 3W72A 2R91A 4Y90A 3R13A 1FDZA 1OFBA 3GXTA 4LV4A 2C1HA 1LLZA 3LHYA 1X1ZA 3TQKA 5HR6A 2RDTA 1CW2A 3KFTA 4N9CA 1D9EA 1QO2A 2QCEA 4A22A 4R53A 3QMSA 3VNDA 3UPBA 2QJIA 4A3UA 4J9JA 1TV5A 2F7FA 5FEZA 3G3DA 5HINA 2YZRA 3B0UX 1ONRA 3HG4A 4OV9A 3GR8A 5CSRA 1U5JA 1W3TA 3EKLA 1VLIA 3UQNA 4GNJA 4E2DA 3TSBA 3SW6A 3UNDA 4LVFA 2UV8G 3W1MA 1H5YA 1RVGA 3W71A 4O1AA 1AL8A 4JYEA 3GDKA 5FF3A 1SU5A 3P5ZA 1JCYA 5EMUA 5EY5A 2ZZ3A 2X30A 2YPIA 2B4GA 3P67A 3O06A 3TK7A 4AHOA 1TO3A 3LCLA 3T44A 2I14A 4HPXA 4FXRA 3MP5A 4NNAA 3LXCA 4MJZA 3RF9A 5D2YA 1UASA 4DF0A 4NZJA 1FXPA 4W9TA 3R5EA 2OMAA 3HJZA 3LV5A 1F6PA 2A7RA 4FNSA 1F74A 4FNRA 1OFDA 4AVFA 3W7CA 3TX9A 3P5YA 4BK9A 1ZALA 4CNOA 2QCDB 4JDYA 3LRLA 2E6FA 1W1ZA 4LOCA 2A21A 3QW3A 4O10A 1DQWA 1A5CA 1MEIA 3MJYA 1QOPA 4XKYB 4I9AA 4N2YA 5LNWA 2CWNA 4YLWA 3U6WA 3TE9A 3DGRA 3PWAA 2KZHA 2FFCA 3WJWA 4CCEA 4YCPA 2R14A 5HULA 3DXIA 2E5DA 1FDJA 1LBFA 3HF3A 2QUUA 3A9IA 3IGSA 4L4MA 4RX0A 4EF9A 1VYSX 2E5BA 2Y62A 3QEZA 2PC4A 1SW7A 3KVMA 1R2TA 5AHNA 2QCFA 3C2EA 4MZ8A 2QAFA 4UNLA 4CQAA 3CHVA 3S1XA 2F84A 1F5ZA 4CQ8A 4UTTA 4WOZA 3L68A 3M9YA 3UWWA 4RCXA 4UMAA 2YXGA 1H7PA 5HWJA 2Y7DA 4QNWA 5L9FA 1YDOA 1QFEA 3KVLA 1KA9F 1KM2A 3MWAA 5J5RA 1TREA 3L0KA 2QCNA 3TUUA 3MW7A 2ZTJA 2J27A 2WNNA 4GUHA 1SZEA 1XC4A 4UR8A 3LXBA 4RZ4A 1OYBA 4DO4A 3ABQA 3LCIA 4K39A 3LLDA 3TC7A 4LS1A 2DZWA 2QCLA 3TSDA 5D38A 1VYPX 2VEPA 2CZFA 5IM51 2VXNA 3MYPA 3HMJG 4ZQCA 4RK8A 2CLOA 3P8IA 2E77A 1H7OA 3L0GA 3L5AA 5CG7A 2RDWA 3WFAA 4WY0B 3LCHA 3CEUA 4GUGA 4RR4A 3PB2A 3GVGA 2DJLA 2P0OA 3G24A 1HO4A 2ZDRA 4Z0SA 2GVGA 4NUWA 3R12A 1PE1A 1S3HA 4ZQOA 3M47A 5GVJA 4YXGA 1LORA 3W7RA 2C13A 1VCGA 3GYEA 4TMCA 3HO8A 2CLFA 3W2UA 1K8YA 2C18A 2X1RA 1TRDA 2FTPA 2A2IA 4POCA 3QSRA 1E51A 2GVLA 5E93A 4N6FA 4LNYA 4EWND 3QYQA 1KM1A 1TSIA 5A8GA 4RXGA 1WX0A 4CLMA 5U7SA 1QAPA 3TNOA 1G4TA 2BSLA 3NG3A 1R30A 1KBJA 3NQ8A 4ADTA 4AWSA 4JIQA 2DJXA 3QSTA 1GVSA 2H8XA 1QR7A 2X1SA 5CPMA 3BW3A 1XKYA 4GXMA 2V9DA 3PSWA 3STFA 3NPUA 1WQ5A 4HNVA 1A53A 5KTLA 2HS8A 3EEGA 1W54A 1OFQA 1K7FA 3BGJA 4IX2A 3VFLA 3N9RA 5I3GA 1AMKA 3IGUA 3NR0A 4LRSA 3RK8A 1DOSA 1QPOA 4NJJA 1FWSA 3NQ2A 1I2OA 3I65A 4GC4A 3GK0A 4RZ5A 1TQJA 4R34A 4MLJA 3OA3A 3LM7A 2G95A 3DFQA 4RLIA 2C6QA 3I68A 2ATMA 1HG3A 4P2VA 1GYNA 2DZXA 5LZLA 1OYCA 2QAPA 4WD0A 5K9CA 3G1SA 3TQ0A 1ALDA 3LBMA 3OVPA 3W1PA 3N2XA 1H60A 1P1XA 5LNVA 1EUNA 4O16A 4KFPA 3MHGA 3BLEA 3GKFA 3G3MA 4HSNA 1KFKA 1KM6A 1F05A 4PCFA 1I8JA 1W37A 2J9XA 1TPEA 2ZRZA 2VEKA 4IXXA 3ZWSA 1TJPA 3EWWA 4X9SA 4Q4KA 2JKPA 3PUDA 4DQWA 2ATSA 1OJXA 4DF2A 2E6AA 5KZMA 2FPTA 3IVSA 3LHWA 2ZCGA 4ZQRA 1OFEA 2GJLA 2B7NA 3EX6A 1ZJIA 2E68A 5LNRA 2VFEA 3KHJA 3KVKA 1XM3A 1SW3A 4M7TA 4HPJA 2WKJA 4O50A 2Z0IA 4IMFA 4IMDA 4O0KA 3IEBA 3BK0A 1PL9A 2OJPA 2W79A 3GR7A 3L9CA 4FXSA 1HUVA 2ZYFA 3TROA 1YXDA 1GYLA 3THQA 5K4XA 4IMEA 1EB3A 1JCJA 2PRLA 4JTJA 3W2KA 1PVNA 2ZRXA 1PCWA 1GQNA 4OV4A 4QAIA 2A5HA 3PBWA 2PRHA 1Z42A 3N73A 5D04C 1Q6QA 5AN7A 3STCA 1G67A 1KV8A
chains in the Genus database with same CATH superfamily
5D2VA 1TPFA 2ISDA 3PZNA 5EBUA 5I3IA 4H01A 3KBJA 2PDIA 3FYPA 2ALDA 4JHMA 3SGZA 4L1XA 1TPB1 3BLOA 5JXQA 3WUBA 5F2LA 1GPFA 2FZMA 4PMZA 4C6CA 3FN9A 3AWOA 3II1A 3R25A 4XZMX 5CPQA 3NQFA 3F4DA 3CWHA 5HNNA 1EIBA 1LL6A 3H53A 3IVTA 4E4PA 3NDOA 4BQ5A 4M19A 1SFTA 1EHAA 3OBEA 1DWGM 1DORA 2X05A 3PBYA 2FDMA 1ME9A 1Q6DA 4ZVJA 3L0NA 2Y7FA 3DESA 3PZOA 3CMFA 3EB3A 1MRQA 1RP9A 3SN1A 1BVNP 4FZIA 4CCZA 1VKFA 1Q8AA 1ZJHA 4PUUA 4V15A 5CCZA 5IRPA 2PDJA 3TCEA 5AC7A 3BAIA 3OEXA 4IH3A 5I07A 4G7EB 4DWSB 4AU0A 3G8EA 1PX3A 1UBSA 4GXWA 1JUKA 1E5JA 3LPGA 3ISIX 2A4AA 4XAPA 3ZOAA 3ICJA 1TRIA 1AODA 4ZO7A 4QE1A 3MT1A 2JQXA 1W5MA 5A8NA 4QITA 2FHCA 1E3XA 2DT0A 4PL2A 2P8CA 2NVAA 2NQJA 2JBMA 4F79A 1JYWA 2QCGA 4D9PA 1ZBKA 3F03K 2GDQA 3BARA 3RNDA 2FH8A 5EA9A 3LOTA 4IX0A 1BAGA 1UWTA 4IQLA 3C2FA 3M7WA 2Z00A 4O8AA 2POTA 4DLFA 4FR6A 3POCA 3N14A 3W1QA 2HQAA 1BWLA 2F6KA 2ZZ6A 1KFLA 3WUFA 4O57A 1OX6A 4GKLA 1LYXA 4H9VA 3VD9A 4BWLA 4MKNA 1UYQA 1JRCA 5HUOA 1TJRA 4MDPA 5G2WA 1OX4B 2DP3A 5C9XA 2VFIA 3PBVA 3POHA 5DRCA 4H6QA 3T2OA 4IF2A 4K7VA 2W6RA 2X09A 2B31A 5FF2A 2V0TA 2OKTA 3MCOA 2DIKA 1NSJA 3GC5A 2NZLA 1WOBA 3WQOA 3GRIA 1Q2RA 2DSKA 1TMHA 5HUPA 3OIXA 4O0ZA 5DMLA 4M5PA 5LHEA 4JTDA 2TSYA 5HMDA 3UPWA 1U33A 2EGZA 5D33A 4IGNA 1Q6CA 5HPCA 1PDZA 5D09A 5HBFA 3U4FA 3P7YA 4CD6A 2O9RA 4DJDA 3WLNA 1AW1A 2OR2A 1TPC1 3O6AA 1T0OA 4QLJA 2ZRVA 1F6YA 2E8YA 4HT3A 4D6IA 4AB4A 3TAOA 5E0CA 3FS2A 1U5HA 3KAOA 5DCDA 2G96A 2X40A 2Z7KA 3L21A 4IIFA 3T09A 4K8EA 4Y8FA 1UC4A 2WSQA 3VDGA 4JTSA 1EIXA 1WKYA 4O13A 4W8LA 2Z2UA 4UTIA 4N42A 4KT2A 1OF8A 4I8DA 2V3GA 1JZ8A 1C8VA 1ODZA 6REQB 3CAWA 2OSYA 5TBOA 3VKJA 3HZ3A 3G1FA 1LOQA 4JN8A 2WNWA 3GG1A 2AQVA 5TD4A 1GCYA 4ZSUA 4FSAA 4LS0A 2PDCA 3PUGA 3FNDA 4ZQMA 1E1FA 2I56A 2DIJA 1FCQA 3VMOA 4JQ4A 1P0EA 4D8LA 1O7AA 3IPWA 3LK6A 3AC0A 5A6AA 3UCCA 2J9ZA 1C7SA 2GK1A 5T26A 1FBAA 2OEMA 3M64A 4UUIA 3RRAA 3TC6A 5LNUA 4F0KA 3VNKA 2V2CA 1RY8A 2ZZ5A 4N9EA 4AIUA 1L6WA 2C8NA 1WZLA 3GFXA 5M1TA 1TPUA 1WBJA 4S39A 1T40A 1M6JA 3UESA 2Y61A 2D3LA 3MI6A 2PDPA 3OGVA 1OABA 3FXYA 3NAVA 2BXVA 3R7MA 4P8XA 3UEQA 3GO2A 2O0TA 3CJPA 3L65A 2WO5A 1HGYA 4KWVA 4U33A 2HK0A 3FGCA 3IV8A 3HOJA 2VNCA 3WQCA 2A7NA 4HK6A 3UP8A 1H7RA 1IEXA 3TYBA 4CNUA 1H3GA 2VCAA 5A69A 4GVIA 3CXOA 3SB0A 4JIIX 1K70A 1XKJA 1PX8A 2DEPA 1OSEA 2FZ8A 2QDGA 3GVVA 3W2LA 1V6TA 1JL8A 3TV8A 1PCKA 3AWNA 3WLTA 4I7UA 5G5IA 4UOJA 4QJ1A 2OCZA 4D6DA 3OVQA 4HTBA 3DHDA 4HSOA 4Q4MA 3W7PA 1EF2A 2YW4A 4WZHA 3SN4A 2ZE3A 2QV5A 3B0YA 3WDIA 4TV6A 1NU5A 1BF6A 1JCMP 1NELA 3T2PA 3GNPA 5LHFA 4FOUA 1KRBC 4P7RA 1GQKA 1OCNA 1AH4A 3W1XA 1R87A 3B9AA 3JVAA 3PC0A 3MMTA 4EXBA 3PZQA 4N02A 3K1GA 1E72M 1FFQA 4NQ1A 1FWGC 1A5LC 1BWKA 1K9FA 5AY7A 4HNCA 2FDSA 5C2XA 4M56A 2V3FA 2OX4A 2X1TA 1OHLA 1J5TA 4FXJA 3RPTA 1TR1A 4MWAD 5FJIA 1J2BA 4PA8A 3AHTA 5LIKX 1CX9A 2WM0A 3KTSA 4PEEA 1ODUA 3R4IA 4NZFA 4FK9A 4OQVA 2WZTA 1EC8A 2VUNA 3CZJA 3AIUA 3W83A 5D02A 2BTMA 2VVSA 4EWJA 1IZJA 1JCTA 1H11A 4XZ9A 2QKFA 2BNJA 3C0JA 1ZRQA 1VHCA 4CQDA 4FX7A 5HJLA 2EG7A 1KBKA 3KRSA 4DO5A 1MW1A 4PULA 2OVLA 3W74A 3O0KA 3EMCA 3GS6A 4PUWA 3ECQA 3H23A 2PDMA 2PDKA 1YEYA 3NWRA 4L56A 2DH2A 3IV3A 5CGQA 1XH0A 1JUBA 3PBUA 3RM4A 1DXEA 3MTWA 3N12A 1R38A 2J7GA 5FF7A 1Q6LA 2C1GA 3KOZA 3W1NA 2NWRA 3QZ6A 3LCXA 4EK7A 1AMYA 2IKHA 3BAKA 3I4EA 1V5XA 4IG2B 3EKGA 2ZZ1A 1G7VA 1FRBA 4NG3A 1KFCA 3R43A 1UKQA 2QCMA 4F0SA 2QCDA 4F2TA 1LRTA 3ZZ1A 3W1RA 8A3HA 3RRXA 3AMKA 3UWUA 1CLXA 3G1YA 1POKA 4XKYA 1UIPA 3B8TA 3MP3A 2OTDA 3KTCA 2PS2A 3ITLA 1J9YA 3P84A 2DVUA 3URNA 5E9XA 4C6JA 5G2HA 3QTGA 2TYSA 2FQIA 1M41A 3LV6A 3G1RA 1IGSA 1JDAA 2BASA 1F73A 3CUXA 3LI1A 4B9ZA 3WQVA 1OFRA 1JD7A 1SR9A 3GIPA 1HKJA 3I10A 4BQ3A 4IT1A 4BF7A 4JIHA 2XIIA 1F7BA 3H54A 4Z1DA 3WZ0E 3QC3A 1WCGA 1KLYA 4X2RA 1XJBA 1P4CA 3KBMA 2GDUA 1O12A 5E6ZA 3QGKC 5C9ZA 4PMQA 3W1LA 3TEVA 1J12A 4LTSA 4AVOA 1EJWC 9RUBA 4L64A 2DGAA 3S9IA 3HQPA 1LUCB 3DFTA 3PY2A 4HU3A 3SCSA 3IJ7A 3V18A 3WMSA 4S3JA 1TTPA 3BG3A 4M6PA 3ZJ7A 1LLWA 4EF8A 4UFIA 4MG4A 1XLLA 1FHDA 1JCLA 3KP1A 2PRMA 2OO0A 1CZ1A 2YFOA 3NQEA 1TA3B 1O1HA 2WQDA 4U2YA 1UWSA 2PTXA 1GVIA 4AY7A 1XYBA 2WCGA 2Y0FA 5F4WA 3S5YA 3CPGA 3PANA 4H83A 3H21A 5A8MA 4D6JA 4FAMA 3K4WA 3VXGA 3WJXA 3VIIA 3AROA 2OPJA 2WSYA 4Q7IA 4YTUA 4UTWC 2PODA 4UTLA 1JQXA 5JMUA 3S4TA 2YDRA 3DU0A 4U5IA 4ZB2A 1O94A 3NZ1A 2C91A 5JIWA 1DHPA 5DX7A 3FSTA 5FJRA 5I3JA 4INFA 1ICPA 1PZ1A 1FWCC 2GJPA 2XGBA 3D3FA 5HK4A 1OD0A 1J2WA 2ABAA 1YXYA 4WJXA 4HSHA 5BW6A 2J8GA 3GBEA 2ZBTA 2GOUA 4F9JA 2PWUA 4H4IA 3A13A 5CZTA 4CN4A 2WM1A 1L6YA 5HJXA 3U2OA 2PFHA 1YPIA 2BBFA 4OTKA 4UQ9A 2WXDM 2BVWA 3KDOA 3W27A 1NP2A 3VM7A 4HZMA 4UFHA 3FGCB 4ZTYA 2A3AA 2B0MA 4AZIA 2CNCA 3OZYA 1OC6A 3O6YX 3WJYA 4Z2HA 3TA6A 3BO9A 4UTUA 3I7SA 1TQXA 3M0HA 3R79A 2WJZA 3M44A 1PZ3A 3D0CA 3HM7A 4UFKA 4HKPA 1UD5A 3BCDA 4I6VA 3Q37A 3DI0A 3BMXA 2HROA 2ZKMX 3G18A 5CKSA 1GW1A 1IV8A 3WF2A 2V67A 5BMXA 1BYBA 1VEPA 4LT9A 4PSRA 4WKHA 2ODOA 4NNBA 4HHMA 2XWEA 3H2AA 6CGTA 5FF4A 2A1YA 2WZHA 4L9ZA 1E1EA 2OB3A 3W2NA 4JTUA 3LHUA 1SVDA 4EKJA 3H4XA 4JX6A 3DI1A 2VX5A 4LYPA 2JGYA 4AH7A 4XG1A 3VOFA 4GJJA 3EWDA 4DWSD 2J9YA 2V81A 3T42A 1EJVC 2YW3A 2Y5SA 2DZSA 1OQFA 1PBGA 5AB3A 4OE7A 4RE0A 5I09A 1XPGA 1QW7A 4GI9A 1OC5A 1LQ0A 2EG6A 3EWCA 3B97A 4MNJA 3VX1A 1UH4A 3QBUA 2DPEA 3FOKA 4Y96A 4H9UA 4B2DA 1THFD 2PSNA 1W8SA 4GY0A 4JEJA 3B03A 2VT0A 2J7FA 2D3NA 2UY2A 4NF7A 4HQVA 4AD0A 4JGDA 1T41A 1RLCL 4DYJA 3NEVA 1DKWA 2PB1A 1GKPA 2Q71A 4OGZA 2QHAA 4WEVX 4DAIA 5AHFA 3AHZA 2QDHA 4AMAA 1S5VA 1IXOA 1XYAA 3RLGA 2ZXQA 2WVVA 3B8IA 3G1DA 1UWIA 1PAMA 4Q33A 3U8GA 3U7BA 3VI2A 3TA9A 4PB3A 2EBNA 3HU7A 1XDLA 1P0BA 4PUNA 1BD0A 1FWEC 4IMCA 1VJIA 3W88A 1A5AA 2OYLA 3KTXA 4FIRA 4CNPA 2WCAA 3EYPA 3BZGA 1MXSA 1BVZA 5I7GA 4HD5A 3O6CA 3A3HA 1SO6A 4JYFA 3H4GA 3LHTA 1V6VA 1LTDA 3CUHA 3VMNA 1WO2A 1YE6A 3QH2A 3Q2DA 3PZVA 3LBOA 1I2RA 2JALA 3M0IA 3B8UA 1C29A 3GHUA 3T55A 5IBXC 4XIMA 2F9RA 2I9EA 2IKGA 2R1KA 5B7YA 1QOQA 2FTYA 2WVTA 2A79A 3VOIA 4Z1CA 1J0ZA 1FCBA 4M81A 3JZUA 4QE5A 1CB2A 2NT0A 1SO3A 3KWXA 1OBAA 3LM3A 2IQTA 4OJYA 4UTTC 3QV7A 3TIMA 3BAWA 1N8IA 4OU1A 3HFYA 3WLKX 1MDRA 3G0XA 3LN3A 1BQCA 4KH2A 3S46A 4RNJA 3RJXA 1KGUA 3VGEA 5CZJA 1NDZA 3GTXA 4KWSA 1XG3A 1TYGA 3SGUA 3CK5A 1C8QA 1K4GA 4YTSA 3U57A 3R8HA 4NAFB 1ONXA 4S3AA 3MHUA 1XIJA 3EA3A 2BY0A 5CXPA 3ZVHB 3LENA 1Q7MA 3GU9A 1ZHAA 4KQNA 4XUYA 3TQVA 4AEOA 4B5VA 2INFA 1UR1A 2INEA 5J8LA 2AMGA 4B4HA 3WO8A 1RPKA 1A5MC 4PFHA 2OLSA 1KTNA 1QI0A 2FB3A 2DH3A 1Q4WA 1JZ5A 4JN6A 1FCVA 1FQ0A 1GEHA 4DNHA 2L5HA 3EXTA 1GK8A 1KCKA 2PURA 2ZXBA 1H62A 2KAUC 1M7PA 4KGJA 3WH7A 5HATA 4G1KA 3VIHA 3M0JA 3R58A 1TV7A 1EOKA 2VQUA 3QHOA 4F8XA 1FWBC 3GB6A 3WBEA 5LIUX 3GYCA 3M16A 3CB3A 1KLZA 2MANA 3K2GA 1SJCA 1AH3A 5CSSA 2G8ZA 4JHOA 1OK6A 3NQAA 5IDIA 4HA4A 3NO3A 4WY0F 3QYSA 2CXEA 3ZT6A 2GUBA 2CZEA 2Q3RA 3TOPA 3MMDA 5G2IA 1F2JA 4FOJA 3P8JA 3UBPC 4JD4A 1U83A 1LWHA 4NJGA 2R1NA 2JKEA 4U10A 1JJKA 1MQPA 4GBUA 5DY2A 3ARRA 3W84A 3WD4A 4S3CA 4E8DA 1PPIA 2PCQA 1S5WA 1FP8A 3NQVA 4JTFA 4AHQA 2F6UA 4HTYA 2RUSA 3TW6A 2XGZA 4IUGA 1YXCA 2RGLA 2EKCA 1NF7A 4I9JA 3FW6A 1Q2SA 2VKZG 1OZQA 2AMXA 3B8DA 4L1GA 5A2CA 3W2JA 1JR1A 1XUZA 3VIJA 2PWGA 1H41A 3HTWA 4Q8VA 1W32A 1XQLA 1Q5MA 2OZTA 4KF1A 1DJGA 5FESA 1S2UA 4IUOA 2FGBA 1LM1A 4AIOA 1X8FA 3WH6A 5BZAA 3KX6A 3T6CA 5DMNA 1H0GA 5C70A 3W2MA 2PDFA 4M51A 3M46A 3R0KA 3RM8A 1J01A 2HNEA 5DBUA 1D3HA 3Q58A 1V6YA 3WX7A 4ONVA 1UWRA 5AHLA 3W1TA 4FHAA 1FWAC 2PEVA 2PDHA 1TG7A 2DORA 4WJEA 1AQHA 1EX5A 1XIEA 3MI3A 3QPZA 4E2BA 2R6OA 4XBKA 2ISVA 3VNMA 1LWIA 1A0EA 1O60A 1K7EA 4PTXA 1XLAA 1XSJA 3WLLA 3VO0A 3UZYA 4PTVA 3EX4A 1W2VA 4RV8A 1ICSA 2FZNA 5K4ZA 4B5UA 2XN0A 4MKVA 3W07A 2VURA 4KRTA 2VFFA 2XH7A 2HEJA 3GD6A 5BRBA 3AS3A 2BG5A 3V0TA 5KZ6A 1CBGA 1DJZA 2GUUA 1P1MA 5D05A 4C60A 4XBJA 3AMGA 1FKXA 2A3HA 1CTNA 1VIWA 3BLLA 1GG1A 5J04A 3R8GA 2ZE0A 3QFEA 4GLEA 2CHOA 3V75A 4WGHA 2R9RA 2J62A 4MUZA 4JS3A 5DCEA 1EJRC 3U5UA 3GXPA 1JPDX 4RPQA 2P8BA 4W7WA 5BU6A 3SAZA 3BSGA 1MW2A 4J3ZA 2VDHA 3VIMA 5AC4A 4JTCA 4H1ZA 1PKYA 3TFXA 3HMCA 4KWUA 4L4LA 5CGMA 3G1AA 4EIVA 2VI0A 3NPVA 4HMEA 1QNOA 4MVAA 4C7DA 1K03A 2DSZA 3BDKA 1US3A 4LYKA 1VC4A 1TJ1A 4U28A 1EDTA 1JD9A 1R3TA 2QUVA 3WG6A 4FS9A 2OT0A 4CQCA 3S6DA 2J75A 3CTLA 4K6AA 5CZKA 2CERA 4NU7A 3EWUA 3WQ5A 1EP3A 4ICMA 4O1EA 2DFAA 4X2PA 3OYXA 1V0NA 8CGTA 2OU4A 4D2JA 4KCTA 5E1QA 2WSRA 4LBSA 1HTIA 2VFGA 1EWDA 3SUVA 1C91A 4DJDD 3PULA 2WJEA 3QM3A 1GZJA 1TZZA 5HMSA 2E4TA 3CZLA 3TN4A 2P53A 1RK6A 1N2VA 1E0VA 1CNVA 1DIEA 3OQ8A 2YJQA 4JPGA 3PPHA 4BZYA 1YHTA 1WZKA 4GQ0A 4JX4A 3NZGA 3I6EA 1WOAA 3LG3A 3GIQA 5CAKA 3CZGA 3ZSSA 2QCCA 1MVYA 3PAOA 2E9LA 4F0MA 3K8LA 5I3HA 5CGTA 3TXZA 3AZSA 3T0CA 2VELA 4LCRA 4WDTA 1H50A 4AY1A 4R5EA 4FNPA 2AKZA 4PBEA 3TOYA 2XDFA 1ZBCA 5K2ZA 1GVRA 1M7JA 1DWHM 1RH9A 1DIKA 1FDZA 4E6MA 2PLMA 1D7KA 4PRTA 1X1ZA 2QDDA 2YZ5A 3KFTA 4R7WA 4CN6A 1D9EA 1J6OA 4A22A 4HU0A 4QCFA 3VNDA 4IPLA 4J9JA 5C71A 1Z69A 2XZ9A 5CEWA 3N18A 4OV9A 2G4JA 1U5JA 1W3TA 2YIHA 3UQNA 1XINA 1DTUA 3SW6A 5M3WA 3P14A 3HURA 3CUIA 3W1MA 3W71A 5DO8A 3OA5A 4A4AA 3GDKA 4QLKA 5FF3A 1SU5A 5T8GA 2W9MA 1AFSA 3P5ZA 3ARUA 1JCYA 1TWDA 1XYZA 3BJTA 1OGGA 1RVKA 1YIXA 4X0VA 4AHOA 1WDRA 3KS5A 1EZ2A 1E6ZA 1HJQA 5HXMA 2I14A 7XIMA 3KBSA 1SJDA 3T0TA 2QT3A 1G01A 4WVXA 3BLDA 5GNXA 3FEQA 5D2YA 1UASA 4DF0A 3PP7A 3GFYA 3ITXA 3R5EA 4KRZA 2YCLA 1EXPA 2VC5A 2PDYA 2QF8A 2AL2A 3HJZA 4JL2A 1F6PA 1AQMA 4FNSA 1F74A 1OFDA 3W7CA 4LAUA 2Z28A 4MNLA 3P5YA 4V28A 3RCYA 2EKGA 1F3TA 3SUUA 2REQA 1W3HA 1B3ZA 2A21A 1RCOB 3QW3A 1V0KA 1DQWA 1A5CA 3MJYA 5BROA 4I9AA 4N2YA 1TE6A 2CBJA 1PWLA 3TE9A 5ABEA 4KEMA 1EO5A 2E5DA 4NYYA 3EZ4A 2CWXA 3MSRA 1VYSX 4HA1A 3CV6A 3UG5A 3EDEA 5AHNA 3AYRA 2PBGA 4CQAA 3A4WA 3CHVA 3S1XA 2F84A 1BYDA 3L68A 2Q09A 3M9YA 4RCXA 3RITA 3RPDA 3UWWA 3CQKA 3CAKA 1KM2A 4L9XA 5J5RA 1TREA 2UY3A 2ZTJA 4J3SA 3OBAA 1SZEA 4UR8A 4TVUA 4RZ4A 1OYBA 1S2AA 3ABQA 3DFYA 3LCIA 3LLDA 3TC7A 1HNYA 3V5FA 3WQFA 4BF5A 2DZWA 4KIEA 2NSOA 3MUY1 1FVPA 3A4JA 3HMJG 1G1YA 3A47A 1V7AA 4RK8A 3PFRA 1W6TA 1Q13A 3QKZA 1JDEA 4WY0B 3T8QA 2VUYA 3AS2A 3CEUA 4GUGA 3TTQA 1TV3A 4RR4A 3PB2A 1E9YB 3GVGA 4W7UA 1W9BM 3PPCA 4Q4PA 1HO4A 3E74A 2V68A 1KR1A 3R12A 1C7TA 3K46A 3RPMA 3SFWA 1H49A 1NFGA 1XR2A 5CLTA 1LORA 2R1LA 3GYEA 2FMNA 4A3QA 4TMCA 3HO8A 2CLFA 3W2UA 3BJSA 2C18A 2FTPA 3QSRA 5E93A 4N6FA 3W81A 3CV2A 4EWND 5A8GA 5U7SA 3CZ8A 1K1DA 4S3FA 2NQ9A 2FVMA 4LYQA 1A3WA 3NQ8A 3MU7A 2AAAA 2CPUA 4W8BA 4WHBA 3QSTA 1F3EA 2ACSA 2D69A 3P0WA 3AMLA 4XD3A 4PMNA 3NPUA 4F66A 1AZ1A 1E1CA 4NILA 1UD6A 1AMKA 3NR0A 3N17A 1XLCA 3LMYA 4RNIA 1G0CA 4B5XA 2H9AB 2OSWA 1YE4A 4FLOA 5HQLA 4HYWA 1L2QA 4L5ZA 3KDNA 3GHSA 1SMAA 3LBMA 1JZ3A 2Y8UA 7A3HA 3FCPA 4YIWA 3CUFA 1H60A 4AFYA 3WYZA 3DYOA 3MHGA 1MZRA 2OFJA 1XIHA 3RHGA 4XD4A 3WDRA 2J9XA 3L2LA 1NM9A 5FAGA 5KEZA 3CYJA 2DQXA 4AG0A 3EWWA 4DQWA 3F2DA 1NOWA 2E6AA 3ID7A 5KZMA 3WFZA 3IVSA 1EL3A 4X63A 1OFEA 2Z4GA 1E0WA 1OADA 2E68A 3TTEA 5LNRA 2CITA 4PYSA 3KVKA 1XM3A 2YOCA 2WKJA 4IMFA 4PMRA 2OJPA 2W79A 5I6SA 3L9CA 1HUVA 4MSSA 1HJWA 1GYLA 1W1YA 1M68A 1LLOA 4IMEA 3M0YA 2ZX6A 1QPKA 2PRLA 5FSDC 1K4HA 1HP4A 3VIGA 1GQNA 1EGMA 5HQMA 2PRHA 4Q3MA 3VPLA 1KV8A 4GGBA 5A8OA 5H1WA 4EAMA 1KXHA 4GY1A 1BQGA 3QF0A 2D1ZA 1DXFA 5JBEA 1Q3NA 3WDJA 3NQBA 1YADA 1PUDA 1J0IA 1UWQA 2FJUB 4XZLX 3E9AA 3ZT5A 3U48A 4H6RA 4ZB5A 2XHYA 2IXVA 4UTWA 4WDWA 4W5UA 3WF3A 3KE0A 1VJZA 1H09A 2E5CA 2Z1VA 2PDXA 4NAEB 5DQPA 4LUTA 3DYMA 4B3ZA 5HJYA 3UVAA 3VAVA 1P0DA 4GQGA 3O3RA 4IMGA 4Y9MA 1NEYA 1TTIA 3LSCA 3EX2A 2QV4A 3R10A 5DFAA 3L66A 2OEJA 1XWYA 2ZFAA 1Q45A 1UHVA 4AYGA 2ZADA 1EDGA 1G5AA 3TDFA 1HKKA 5F2IA 3L12A 3Q4DA 1JFXA 3LBCA 3M0ZA 4IP5A 5TNVA 3G8RA 3CYVA 2AL2B 1LDCA 1MNSA 3WEOA 3R0UA 4DZ5A 1LRNA 3IGXA 1S2TA 3TCSA 1S46A 2FH6A 2V2HA 4AWEA 1ADOA 2E9BA 3M5YA 3P2VA 4C6BA 3LPPA 4H8UA 4K36A 4QQUA 2ZDSA 2YL9A 3SRHA 3FKRA 2DY3A 3W00A 3I4KA 1KFWA 1OFPA 4RL3A 2VFHA 3B4YA 3VC6A 1DPMA 3WF0A 2Q8XA 3LU2A 3LTYA 4G9PA 3TR9A 1Y65A 2O7QA 3A22A 1QI3A 2PMQA 3CAVA 3W86A 4BQ2A 3VIOA 1XCXA 2CLMA 3VFCA 1SSDA 3SN0A 4MKSA 4D6FA 5D9NA 5H8UA 1B54A 2HS6A 2J7CA 1JZ2A 4A05A 4TX6A 3R0DA 1ADSA 1W9PA 1WAWA 3NGFA 4D8AA 4CGTA 2MUCA 4GGHA 4ZO9A 4JQ3A 3OW1A 1J96A 1TELA 1BTMA 4DF1A 1YTEA 4UR7A 2CLIA 4C5ZA 4Z1AA 1JNDA 4B2DD 1AJZA 2CZVA 4IFRA 2Z2BA 1V0MA 4U4MA 3MUCA 3F4NA 3NUKA 3BCFA 3QY6A 1KXVA 1JZ7A 3UG4A 1TB3A 2BLEA 2FZDA 4E4UA 4ZOEA 2W66A 1VQTA 3WNKA 3V0UA 1GOMA 3BW2A 3GZ3A 1R47A 3C5QA 3G6MA 2QJJA 1QVBA 2Y7GA 3SCRA 4RXFA 5A95A 2P88A 3NGJA 2NX1A 5C2GA 3W37A 4UC5A 2O9PA 4NZ5A 5HA7A 5A8QA 5HOSA 2P10A 4L4PA 1EYWA 3ALFA 4DJEA 1JG9A 2ZC8A 5LGZA 2F38A 1FWFC 1EZWA 2Y70A 3TSMA 5AKQA 2C3ZA 1GOKA 1Y5WA 3S6TA 1S1PA 4WSKA 3UWVA 1W3LA 4E8CA 3M5VA 4UQCA 3ARSA 3AZRA 5AVHA 2VZTA 1IXNA 5BXSA 1JEZA 4HIBA 4K3ZA 3FLUA 2J88A 3EOOA 1NWSA 1TMLA 5FEXA 3LY0A 1HVXA 1QI5A 3TP4A 1QWGA 1W0MA 2WNZA 4DXVA 1RK5A 4UOQA 1DP0A 4MY8A 5E0KA 3WD1A 4CEUC 1TCDA 2C16A 4BI6A 1EP1A 2G3NA 5EGRA 4WF7A 3T08A 3QW4B 3T7VA 1R9XA 4BS0A 2FTWA 2C7FA 3W7OA 3G0SA 1E73M 3MDUA 4LVAA 5IBXA 1BHGA 4JNMA 2ZRUA 2HVMA 3TKFA 3VZXA 4JFTA 3LRKA 3GDTA 1WZMA 3VIPA 3GVRA 1OZMA 5DT5A 3B06A 4HPNA 1A3HA 4WKFA 4R3UA 1OFOA 5DCBA 5CZSA 4GJ1A 3E5PA 4H41A 3MKVA 3C56A 1Q85A 1XBZA 4MJMA 3L5LA 4NX0A 3KW3A 2ICSA 4QS5A 2X7WA 1JDDA 5A6BA 1S2WA 3RAOA 1U1JA 5BU9A 4MJ2A 2UBPC 3JS3A 5LNSA 4NVTA 1WPCA 5KSWA 4QS6A 2H6RA 1A5BA 1GWJA 1SMDA 1UB3A 2W27A 3MCNA 3NYZA 4IIDA 4LC6A 2TPSA 4BEQA 1FCUA 1JUEA 5FL1A 2A7PA 2X1IA 1TUXA 2IPJA 1FHVA 1A4MA 1EC9A 5HR7A 1NDVA 1KM5A 4ZSTA 3O05A 5KETA 5DXXA 5LGXA 1X38A 1B3YA 1ISXA 2AGKA 5BRQA 2PD5A 2WAGA 3VGHA 3T78A 4B4FA 1X98A 4H7VA 1H7WA 5AC6A 2A3EA 4AWUA 7REQA 4LUTB 4JIRA 3EGJA 3C6CA 5ECVA 1DVJA 4PN2A 5EMMA 3TYUA 2NW0A 3WLOA 4L6DA 1UPMB 3WJZA 3S9ZA 2GVYA 1P0KA 3W7JA 2VGIA 3IAQA 1QMLA 3DC0A 1TWWA 4CU6A 2PU0A 5GPRA 3C3UA 1YLVA 4C1KA 5MKGB 1GOOA 3GX9A 4N4QA 1Y5XA 3HA1A 2ZZ7A 3RLVA 2FFIA 1CIUA 1W3NA 3DHPA 3AAMA 1UR0A 3H2OA 1LQAA 4BR1A 1K8CA 4JTEA 1FWTA 3LCWA 4DZIA 3N2MA 1XF0A 3HFTA 4W88A 2W67A 3W75A 4JX5A 2YDAA 1AG1O 1YRRA 3PTKA 3KRZA 3IVUA 4N0RA 1Z9AA 3UWEA 4JAWA 1MQRA 1X6UA 4LSBA 4G6CA 4UQBA 4DI9A 3VILA 3QLDA 3S1GA 2YL6A 1TV8A 2DZPA 2HBVA 1ZP3A 4AZ5A 3HPAA 1VJSA 3OLDA 4JQAA 2B7OA 1L0PA 3FA5A 4J3XA 5IHRA 2CBUA 4MWAC 5A3HA 4MAVA 4AF0B 5G4WA 1MDLA 1E70M 1QPRA 4IPNB 3PTQA 4P61A 4QLLA 4QSFA 1VR6A 1KRAC 4IQEA 2WZMA 3K30A 2CLEA 1AW2A 3PTMA 1E15A 4XB3A 1T99A 1K9EA 4UR9A 1RQBA 3G2GA 4TIMA 4Q8PA 1LT7A 4A8IA 4FNUA 3ARVA 1SFLA 4FA3A 4C7GA 2VEMA 3O07A 2Z6IA 3UXLA 3N4EA 5CPOA 2PU1A 1GQIA 1LROA 4OVXA 3S2NA 2D2HA 4GABA 5BCAA 4MYXA 3HPZA 4ZA0A 3BG9A 5D30A 2ZXAA 4F48A 3AJ7A 1XCWA 5LA1A 1EHNA 4O0QA 5AHIA 3DHUA 3WNOA 4UQAA 4AD3A 1DJQA 5A6TC 2FGZA 1V3MA 1TV4A 5C7VA 1VEOA 5FL0A 9XIAA 3ONCA 3THAA 3UJ2A 4QP0A 7CGTA 1MUMA 3GKAA 4WGXA 3IAPA 3NXLA 2GJXB 3VDBA 3B9EA 5KITA 4DM2A 1TPWA 4IGMA 1L9WA 1RCQA 4PFMA 4CD8A 1PJ9A 1NWTA 3E49A 3FA3A 4P5UA 4R7OA 4XTIA 3W7IA 3L67A 1NWRA 2I5IA 3PF3A 5D2TA 3VD4A 1VYRA 1E43A 3NFUA 1QW9A 2OKOA 4ORIA 1ONWA 5FEWA 4NT0A 2WMGA 1REQA 1I2QA 3DHFA 1WYIA 4AZCB 1XLHA 1PIIA 4AISA 1LOSA 1UW9A 1W1A1 1L2UA 1PZ2A 3M0LA 3EPOA 4CD4A 2Z6JA 4XZBA 1W8GA 1F9CA 3W38A 4EE9A 3M5ZA 1PYFA 3QPEA 2DUZA 3E5BA 5AOUA 3JR2A 2ZUSA 2R82A 5E09A 4HK7A 2QUMA 4ZTXA 1TR9A 4ECLA 4UFLA 3DG6A 2WSPA 2E0PA 4GI4A 3AXHA 2R24A 3GC2A 3U2ZA 3V0SA 2EAWA 4OBSA 5EFFA 5A8PA 3QGVA 1V6UA 2VZOA 3GTNA 2XG9A 3BMWA 4QDMA 1FP9A 3MPGA 1GNXA 4OKDA 3P82A 4N6EA 3SSJA 4HZ7A 3S5SA 4O1CA 2J79A 3NEHA 4LGXA 4AZ6A 4GKTA 3SEPA 1O4UA 1HN1A 4Q7BA 5I0DA 2WWCA 1UH2A 5GJPA 4BJHA 1LZOA 3BV4A 1MRAA 3QJAA 5LXXA 1KFJA 3COTA 2F8QA 1VFLA 2ASHA 4D8ZA 2P1FA 3PB0A 3C8NA 4WKAA 4WUIA 3ABRA 1BYAA 1EXBA 5HDRA 6ALDA 3IIVA 1P7TB 3CHEA 3W7LA 3FA4A 1OCBA 5AC8A 1X39A 1K77A 4QIUA 4DX3A 1KWGA 4AWTA 4F0RA 2QPXA 1VPXA 2XFRA 3U7VA 1Q8JA 3OOQA 5D9OA 1ISWA 4WX2A 3WNPA 4GG9A 3EMZA 1BTCA 1FWIC 3E3HA 3HN3A 3DFPA 4ZL1A 2B7PA 4DUOA 3W24A 4MNMA 1SYTA 1IXPA 2CLHA 1KGXA 2DUAA 3C3NA 4RNFA 1FWWA 4W5ZA 2VZSA 4PODA 2YXOA 4N9DA 5D2XA 5G4EA 1TVPA 1Q63A 3PBMA 3ZIZA 1PXGA 4AQLA 4HYRA 5K9XA 4REQB 2ZUWA 3ENLA 4JTGA 4Y9NA 3GTHA 3TVAA 2UY5A 3ITYA 2P3EA 1E0UA 3GUGA 4XZNX 3KLKA 4JFVA 1IGWA 3T8LA 3OIHA 4GIEA 2V38A 2J8FA 2WHLA 3G1XA 4W84A 3LCFA 5FD0A 1CI1A 3KXQA 3BLKA 4O54A 4ZENA 4DPPA 5HPOA 4HN8A 2VVNA 1XD0A 4HZ8A 3RJYA 3GDMA 4IMAA 3EBVA 3TJIA 5IOBA 1ME7A 4H9XA 3MMUA 1UZHA 3B3DA 2ACUA 3SRFA 4PUJA 3WMLA 1DHKA 4XSLA 3PAJA 4L6HA 1UR8A 5GNYA 4FALA 1QXLA 4LWWA 4KFNA 1XRVA 3VINA 1CWYA 3IJDA 2WKLA 3ITCA 1ZNNA 5F4XA 4MB3A 3N2BA 4G7EA 3VCCA 4FO4A 1OB0A 4GIAA 4X61A 2Y88A 1E40A 1AH0A 4I90A 2XIBA 1K6WA 3E2VA 5DF0A 3N13A 2XVPA 4Z42C 2PGRA 5H91A 3A6OA 2RJHA 3THCA 4GY7A 1W9XA 3V7PA 3BMVA 3OLIA 3S5OA 4IQDA 3RX4A 2GGJA 4QX4A 3FJLA 2Y85A 3QMTA 4LAZA 1W5QA 3UWYA 1SFJA 3W87A 3OGRA 6XIMA 3KBWA 1IR2A 2OOFA 1DJYA 4UBPC 3IJQA 8RUCA 1YBQA 1LBLA 5C6MA 6TIMA 4AD2A 1ZSXA 4MB1A 4LC8A 1DXIA 3UXAA 1DJNA 4A21A 4D72A 2J7BA 2VO5A 4HOWA 2QGHA 4LCQA 2NQ5A 2Z27A 2VMFA 3RILA 2HBXA 5F1UA 3REQA 3BGGA 1UMYA 1HL8A 2HMCA 5G4HC 5I3DA 3NO5A 1OX4A 1V8EA 1BEUA 1JAEA 5JU6A 1XBYA 5AZ0A 1NH6A 3NZPA 1MWOA 1C93A 4WDUA 3U2CA 3NTYA 2GWNA 2DSVA 1YYAA 3AHYA 1XG4A 5EMYA 2WQPA 1EFZA 3W0KA 5I3KA 3LRMA 2QUTA 3SRKA 2OLHA 2ZUNA 2PDNA 5AHMA 1RQEA 3WMBA 5C54A 3LZ5A 2AAMA 4J2MA 3VZZA 3C2RA 3C8FA 1EPXA 3S47A 1EOMA 1Q6RA 3VUSA 3C2OA 4JKLA 2XFYA 4F0HA 4IIGA 3VOJA 4YYCA 5CC5A 3LX9A 4CCCA 3VZYA 4AIBA 1ADDA 3W7GA 4A3HA 4Q32A 3E0LA 3EWXA 1NDYA 3EWBX 3NIYA 4Z2IA 1KTBA 1IHIA 3KUMA 4GQBA 4F2UA 2B7QA 5LA2A 1BKSA 2DZVA 1P6WA 3CASA 4KCUA 5HWNA 1PX4A 4NSBA 3OVGA 3SADA 3ABSA 5JBDA 1V0LA 1VBRA 5EKYA 4UFJA 1Z32X 3K8KA 1P43A 6REQA 3QMRA 4GD0A 1JQVA 1I2NA 4PUDA 3WBYA 3EEZA 1TVLA 3OLGA 5M2FX 5C9UA 1NAL1 1EP2A 4UCFA 3S3GA 1L6FA 2DSWA 3HGSA 3EDDA 3LLFA 4B91A 3VUPA 4ACZB 2PGWA 4HU4A 3CC1A 3VNZA 1ZU8A 4PTDA 4PBGA 4UTHA 2ZZ2A 5BYWA 2DDXA 3GWQA 1KBIA 4ROPA 2D22A 4JICA 1VD6A 3EOEA 2I9UA 1MFUA 1G4PA 1QHPA 1VH7A 4S38A 2D0GA 5A6JA 3VNYA 3GR4A 4AZ7A 3GXMA 3ZVIA 3TW9A 1UZ1A 5CPSA 3UZ5A 1TTJA 1L8NA 2Y8KA 2ZRYA 2OZ3A 1BSLA 1FHUA 2NX3A 2WVUA 1BKHA 5FF0A 4ZO6A 3W7MA 2BODX 4Y6GA 4O28A 4DELA 2D73A 2QEZA 4FF7A 3ZR4A 3T07A 3M4HA 4Q4QA 3R1ZA 4ICNA 2VGGA 1VEMA 1QK2A 1CLKA 4AMCA 3T81A 2OELA 4C6QA 3MBDA 2C19A 3G0UA 3S1WA 4XAGA 1M1BA 3IUHA 2E6YA 3CBWA 3SJ3A 3KP0A 3HG2A 4H9TA 4V33A 3VX0A 2VR5A 1E55A 4O15A 1WUEA 3VD5A 1HP5A 1U1UA 2I1OA 3CUJA 1GUVA 3N25A 6A3HA 2CZ5A 4HPGA 1JYNA 3CT2A 3U0HA 5FSEC 3N2CA 1EPVA 2NUYA 4QNEA 5FJJA 1UQZA 3NQGA 3PUEA 2HVNA 1KD0A 1L6GA 1CCWB 3F4WA 4KKXA 4G56A 3FVDA 4Q8MA 4XVDA 1Z6KA 4M29A 3I6RA 2QPUA 3CUZA 1PDYA 1QDSA 4US5A 4YCOA 1DQUA 1PYMA 1XLJA 1WXJA 3LSBA 1EQCA 4C1LA 5B7ZA 5MHBA 3DYPA 1W56A 1XFBA 4CNSA 4LY4A 3WDQA 1JCXA 4JCLA 3GTFA 1OF6A 1M7XA 5DEZA 1UWAA 1X6NA 4R9OA 1XW8A 2GWGA 3LD5A 3ATZA 2EPOA 2WMFA 7TIMA 3N04A 2WNQA 1GVOA 4GH1A 4WCJA 4HPHA 1GT8A 3CWOX 2J6VA 1IWBA 1K9TA 3MSGA 4GK8A 1TJ0A 1BXCA 5DLCA 3L4XA 4Z0JA 2CFFA 1FFRA 4YTQA 3DERA 3W82A 3UGRA 2VR2A 1VHNA 1FDYA 4NL1A 3BQ5A 3N4AA 4NJKA 4IG2A 3KHDA 1DV7A 1AK5A 1LG2A 3S2CA 1FWDC 2Q8LA 4BCEA 6TAAA 3ZMRA 4LV9A 2R1PA 1IF2A 5TQLA 3K5XA 4C6FA 1YBQB 2I5GA 5G1TA 1LOLA 1S5TA 4ACYA 3FJ6A 1ONEA 4MYAA 1XYLA 4AXNA 4Y9OA 5KZDA 5LXEA 4MB4A 3PG8A 2OYMA 3W76A 3REQB 4GQRA 4HHPA 2X8RA 3LMZA 3D5HA 1ITQA 2QDEA 3QLLA 2J78A 2J7DA 3KOFA 2HXUA 4TMBA 2O9OA 4DJED 4BWLC 3EOLA 2J25A 4XX6A 1WKEA 4MDOA 3KVJA 3CWNA 1XDMA 3JRKA 4Q8WA 3QC0A 3HJEA 1DEDA 1JDCA 1QI2A 4ZBCA 2B81A 3GNOA 4ICCX 3UZJA 3FVMA 3W72A 2WANA 2R91A 4Y90A 3R13A 4MJ4A 3GXTA 4LV4A 3WY1A 4DYEA 2RDTA 4N9CA 3A4AA 2ALRA 2GDVA 4U31A 2QJIA 4A3UA 1TV5A 2F7FA 4AD4A 1LUCA 2YZRA 3B0UX 2YB1A 2ZUUA 1VLIA 3EKLA 1T5AA 1KGWA 4DJDC 1QK0A 3AXKA 3BUVA 1C90A 1H5VA 3TC3A 1X97A 1E6RA 1ECEA 3GW0A 3AYSA 3H2NA 4NI3A 1TA3A 2OZ8A 3D46A 2ZIDA 3K8MA 4ERAA 3WQWA 4WLCA 4JFUA 1S39A 4FXRA 1PTDA 3DEQA 3MP5A 3LXCA 4F2BA 1X7IA 1UOZA 5A6BD 1IT8A 2C79A 1R3RA 4W9TA 4GJIA 1DE5A 2A7RA 4AVFA 2PF8A 1M03A 1SFSA 3U4AA 1GOIA 3TX9A 4BK9A 4GH3A 4ZGYA 1ITCA 2YBTA 1HW6A 4TX8A 4F4RA 1W1ZA 1AVAA 4LOCA 5E9AA 4J35A 1MEIA 1UROA 1QOPA 1BGGA 3QR0A 3GNRA 1E5NA 3P3BA 4PTMA 3U6WA 4LB3A 1W17A 2XH0A 2FFCA 4YCPA 4LF1A 1KQYA 3DXIA 3WQEA 1FDJA 1OGSA 2X2YA 3HF3A 2J13A 4PUEA 5TF0A 2O92A 4W86A 3KVMA 3GXIA 1MXDA 2GLKA 4OFCA 4CQ8A 1G94A 4LUSB 5BXTA 2XVGA 2W62A 1E4MM 2Y7DA 5L9FA 1QFEA 4AZGA 3KVLA 1VFHA 2QCNA 3TUUA 3QOKA 1WKFA 1XC4A 4C6EA 4K39A 4LS1A 3FAWA 5PTDA 3GHRA 4S23A 2E77A 1YPXA 3L5AA 3ZT7A 2RDWA 3DN5A 2WLYA 3M7SA 1OCQA 3C0SA 4GI6A 2DJLA 3G24A 2ZDRA 4NUWA 1S3HA 1EH9A 3M47A 5GVJA 4BY3A 3EB4A 3B8VA 2FVLA 3W7RA 5FCZA 2JIEA 1VCGA 4MB5A 1NTHA 1VPQA 2Y8VA 1K8YA 2X1RA 1RHCA 4POCA 3HPFA 1UUQA 2Q6ZA 1E51A 4J3UA 1BXBA 2BY3A 2UZ9A 1XLIA 3BCJA 2J74A 1KM1A 4B5SA 2F2KA 4RXGA 2WPGA 3KWSA 1WX0A 3B8SA 1QAPA 1G4TA 4AX7A 1SM9A 5IXEA 4JFSA 3WFLA 1Q6EA 2W3ZA 5CBJA 5HMEA 1TWSA 4JIQA 4O1FA 1LT8A 4C1NB 1XKYA 2V9DA 4PMOA 4Z2KA 1WQ5A 1XLDA 2HS8A 3EEGA 5IFTA 1OFQA 2VEFA 3BGJA 4G8TA 1VIZA 3VFLA 3XISA 4PMVA 1OWQA 5I3GA 3GU2A 3RK8A 4UNIA 4MF4A 3GK0A 4RZ5A 4DRSA 2QLYA 2XUCA 3OA3A 3LM7A 2G95A 1W1PA 3URAA 1TWZA 2XPKA 4P2VA 3A12A 1TWIA 1UIOA 1YQ2A 4DIAA 1OYCA 2QAPA 3V5CA 4KGLA 4CKQA 1A0CA 2EXOA 3OVPA 3W1PA 3AOFA 3KL0A 5BOEA 1P1XA 5LNVA 4O16A 4KFPA 1W1B1 2PP1A 2XSXA 4LX4A 1CGXA 3GDBA 1TPEA 3VKAA 3WNNA 3ZR5A 1V77A 4ZFMA 1AJ0A 2NQLA 4IXXA 3ZWSA 2VD8A 4X9SA 2PLKA 2ATSA 5CG0A 5LA0A 3IJ9A 1R9YA 3B0XA 3KCJA 3RG6A 2GJLA 3EX6A 2GVEA 3TYCA 4KEZA 2Z0IA 4IMDA 1FH9A 3KS6A 4KBXA 1CLVA 2OODA 3KLLA 4GMEA 3MSDA 3F2CA 4ATWA 2YA1A 4TV5A 2JEQA 5K4XA 1EYEA 1GKQA 4C6NA 3APGA 1JCJA 4MAZA 3N3TA 1CPUA 3W2KA 5CBBA 4HMNA 1DIDA 5DRIA 4RV3A 2PTZA 4WDXA 2P0IA 2ZUVA 4NIRA 1H1NA 3WF1A 1Z42A 2AGTA 4AEEA 1Q6QA 1G67A 3B8WA 1I0BA 3BOFA 1IZKA 2IKJA 4RKAA 3WLIA 3ES7A 5AYZA 1SUXA 1I2PA 3LQGA 3UJEA 1QPQA 4NAFA 1UCWA 2OGYA 4PL1A 3L4TA 2OEKA 3C2YA 3ZVHA 4KETA 4B5WA 4RZBA 1XRFA 2PI6A 4S3EA 2CCRA 3VKKA 4QJ3B 3P62A 2O4QA 1JI1A 2CHNA 4FIQA 5MF5A 1JAKA 4V2XA 3UYIA 5CH9A 3MSYA 3RCNA 1VFTA 3MV01 5GQBA 4UNKA 5AZ1A 2WZEA 4DPQA 1YNPA 4M6QA 4Z1BA 4C91A 4QG9A 1PS9A 3LPFA 2Q02A 4ZOCA 2VEGA 2W0UA 2VFDA 4LNCA 1MSSA 3TN3A 5LIYX 1QBBA 5FI8A 4B5TA 2DU2A 3VA8A 3KBVA 3BSMA 1XC6A 3GAYA 4M3PA 3W23A 4I9MA 1V3JA 4A8LA 1FTXA 4Z2JA 4KCWA 3E96A 1B3VA 3N6QA 3ARXA 4JTRA 2C1IA 2E7FA 2Z24A 4M6UA 1QNQA 4Y8EA 3WQPA 2GJNA 4DBEA 1HJXA 2X7VA 5EYWA 5FJTA 3GG0A 4A29A 4DJFA 3S1UA 5DELA 3M0VA 4HZ6A 3DCPA 2BOGX 3SUWA 4PTWA 4XD5A 4MY1A 3TNBA 4PRWA 2IPFA 4X3ZA 3IANA 1GYMA 4QXIA 3WK1A 3H7RA 2PA6A 2VWTA 3RU6A 5BMWA 4UIOA 3EWYA 1K7XA 3DDMA 3OGSA 4S3BA 2I17A 4H9MA 4YJ5A 4LVDA 1IE7C 2GGGA 1GVFA 4FX8A 3GUWA 2WMIB 1XFCA 4HMDA 2C14A 1UPPA 3O8AA 4O18A 4WJ8A 3RMJA 5DBTA 4YNGA 1V6WA 1X1NA 4YMZA 3UA4A 3VVGA 3I3BA 1DWIM 4XZIA 3DC8A 4O1DA 3OG3A 3DFHA 1RV8A 3BAYA 1UZ4A 1JGIA 4ZO8A 4RDVA 3WBWA 4K38A 1OT2A 2DW7A 2J47A 1X96A 3S5ZA 1PZ0A 1BG9A 1PKMA 2BWGA 4UMCA 3QY7A 3A4XA 3BH4A 2D0FA 4QEEA 2UY4A 3BE7A 3W6MA 4GX8A 3U3HA 1QCWA 1ESWA 3LGDA 4MMWA 4K37A 3R89A 1JPKA 3T05A 2Y89A 1Z44A 1I4NA 2BFGA 3LGGA 3WK3A 4HOZA 4KMQA 3UNTA 4KS0A 4M1RA 4B3KA 4PMXA 2VOTA 3E2QA 4GNKB 1VB9A 3TW7A 1R3SA 3H4WA 4AD5A 4W85A 1V3LA 1KKOA 4HN4A 1O5KA 4RDWA 4H8VA 4Z2LA 2HDJA 1G4SA 2LLEA 4F9DA 1Y5VA 3V36A 5HANA 3W25A 4YPJA 2A6NA 4M1BA 4IJRA 2QJNA 4IWWA 3WLQA 2NUXA 1KKRA 5BOFA 5DMYA 4MWAB 2ZVIA 3STEA 2I57A 1GTHA 5CC6A 5F2MA 1ZP4A 1ZJAA 2BOEX 1FA2A 2CHRA 2A3BA 3O16A 3ANYA 3TZFA 1CGUA 1E3ZA 3AXIA 3T0AA 1I1XA 2ZTKA 1J4EA 2ON3A 1XLKA 5BWAA 2BGSA 2PDLA 2WHMA 3PZIA 3B0VC 1QT1A 1P6CA 3DAQA 3UR8A 2EPHA 3FDGA 1U30A 1UWUA 5FEPA 4J3TA 3ARYA 3E0IA 4TOQA 2OYKA 3T0DA 4E8GA 4MUPA 3CL6A 4JR5A 5I02A 3HPSA 4H2CA 4UFMA 3DKJA 3M43A 3NL6A 4KEUA 2PGFA 3EPNA 1R2RA 2BVYA 3HGOA 1UP0A 2WV8A 3GZAA 4GZ7A 5F1VA 1NOUA 1D8WA 2GQ8A 3VYLA 1IXQA 1IIHA 2D0HA 4O4WA 1W1VA 3SCOA 3QGAC 4TX9A 1N55A 1E6NA 4Y7EA 1NFBA 2XSBA 2POZA 1DL3A 1K02A 5C9WA 4Q6XA 1VFMA 1WZAA 4NY2A 1S2CA 3RU8X 2CKRA 2NXIA 5DXYA 1B4EA 5TAOA 3AIEA 4OUIA 5K3VA 1K6AA 2O4MA 2CETA 3G1HA 1S5NA 4E2OA 4O8RA 3UWQA 4J3WA 3H7VA 1W91A 1NVMA 2OWXA 4QROA 1YX1A 1HL9A 3SY5A 2DV0A 3SUSA 1R5YA 3G1VA 1KBLA 5I5RA 1QTWA 3A3WA 3LI0A 1B5TA 4EPBC 4MGGA 2I16A 4RE3A 2ISFA 1J0HA 2BY2A 3VIFA 3HGRA 3N9SA 3XIMA 1W5OA 1IYXA 5H2ZA 4LAOA 1RQHA 4KCVA 2XTKA 2ACRA 1JNEA 4J28A 4LFYA 4XWUA 2PP0A 3R6IA 2OG9A 2GGHA 1FWNA 4OECA 3TTSA 3BLIA 1J5SA 5BRPA 3EKZA 4PRRA 3W1UA 2WOQA 3O63A 1ECQA 4H04A 3DIPA 3MUAA 1WDSA 5M5DA 2TMDA 3MY9A 4Z08A 1CXFA 5CBIA 2WJFA 3L7RA 3RDKA 3SR7A 4MFEA 1YTKA 1UP3A 3W01A 3QFWA 2HTMA 3CEPA 2OX1A 3PZMA 1QATA 3EXSA 1M9HA 1KV5A 1MEHA 4YN5A 4NJIA 3N4FA 3NQ6A 1PHWA 2VRKA 1WUFA 1HXJA 3MV11 4I5XA 4M24A 5ABFB 4GYPC 1QJWA 3L4WA 2QIIA 3LS9A 3WL1A 1B90A 2XVLA 2DVXA 2J6XA 4TUFA 5FKYA 4JTLA 5SWUA 3EOSA 3FJNA 5D03A 2HCVA 1QNVA 4JIEA 1AA1B 2H90A 4NZ1A 4LJ3A 4R7JA 1VS1A 4ZMGA 1YPFA 4GUJA 4WSJA 1HF6A 2A3LA 3IRSA 1W5NA 1MYRA 2A85A 5DN1A 1EDQA 3BG5A 4QM1A 2QW5A 1XYMA 4IJCA 3ME3A 2G50A 2V6AA 4H00A 4PTNA 4MOZA 1U2YA 3AS1A 2ZA1A 1B57A 3WF4A 4E2VA 3NNTA 3IK4A 2Z1KA 3MI2A 2X16A 5A6MA 3SIZA 3MC5A 1OINA 2Z1WA 1J79A 1HKWA 1O5RA 4CNNA 3PZTA 4UQDA 3W22A 2OQYA 1OD8A 4P7LA 3K13A 3STGA 4H6EA 4US5D 5DT7A 1T8XA 3F5KA 3BQ6A 1T7LA 2EPNA 3P74A 4K8HA 2PTDA 4IPJA 1T6MA 3QQ0A 4UXDA 3WSUA 1JYXA 1GOWA 2AQOA 3OG2A 3W29A 2C0AA 3E0FA 4WY0A 3H26A 3OJGA 1IEIA 1A5SA 1HX0A 4QCEA 3SY8A 3GH5A 3P81A 2XN1A 2XJ7A 3ARQA 3LERA 3KCLA 3PUOA 4ML9A 1PHQA 3ZLGA 3E02A 5GNZA 4IOTA 1AD1A 4BQ4A 4N7QA 1SJBA 3F5JA 1DJWA 4LBRA 2CIPA 4HMCA 1YMYA 4JYDA 2OLAA 1E6QM 4DO6A 1NDWA 1X6LA 3PPFA 3CQJA 4IIHA 1SZGA 4HCHA 3F5LA 4C7FA 3THDA 2FYMA 3AUJA 3QV9A 4EP8C 3B05A 1RAKA 4NP7A 4UTKA 1O5XA 2BOFX 3LTSA 1E4LA 3VTRA 3WH9A 3GIYA 4A2SA 3MZNA 4M7SA 3UPMA 3PJTA 5EMKA 1XRTA 4JL1A 1LWJA 3TJLA 1KRCC 3IJ8A 4NNCA 3VD7A 3T0BA 5C5YA 3T4CA 4AXKA 3FEMA 3WK2A 4K7YA 3EX3A 2PZ0A 3RGTA 2H9AA 3WL0A 1DTNA 2KX9A 3FY1A 3AQUA 2F2HA 4DUVA 2Y4SA 2WMHA 1UP2A 2FMOA 2XFFA 1D7FA 3U9IA 1SO5A 3WBAA 2NLIA 1DWAM 1XXXA 2DVTA 5ABHA 4JKMA 2Y24A 3UERA 1A5UA 1G6CA 4LUJA 1ZTVA 1BRLA 3BURA 4TR9A 1GOXA 2X42A 1PTAA 1M7OA 1PKNA 3MDWA 4ASTA 1US2A 3WQGA 3HGJA 3M41A 4N4PA 2V3EA 2DZUA 3ARPA 2A0NA 1QHOA 3I3DA 4CQ9A 3VD3A 2NV2A 2YL5A 4FX6M 2DQWA 3GBDA 3QV8A 4EPEC 1UKOA 1Y0EA 4PC8A 3DH7A 3H2CA 4HU8A 3OHMB 4OHQA 2QULA 3B9OA 1MI3A 1O1ZA 3PFMA 3LZ3A 4GOAA 3RUBL 4GIRA 1R7AA 2XYLA 2QGYA 1O6IA 5FA5A 5E5CA 1W1TA 4JY9A 1BGAA 1JRBA 1QHZA 1RP8A 3BPWA 2F6XA 2E25A 3SCQA 1VAHA 4URIA 2WHKA 8TIMA 5EFDA 3W9ZA 4PUKA 4HP5A 5KMYA 4H2HA 2IMRA 4DBUA 2YCKX 4QEHA 4FF5A 2BB0A 2DIEA 4I9TA 1U1HA 2VTFA 3SUTA 3RLUA 1OT1A 3WIJA 2G5WA 3SQMA 4V27A 5TIMA 4JY8A 1NP0A 3N29A 4HNTA 2IXUA 3M1ZA 3S8HA 4XSMA 2ZOXA 4W7VA 3ZM8A 1NOFA 3N15A 1JULA 2H8ZA 4NAEA 1EEXA 4GA8A 5F7UA 2X1UA 1V3KA 3AZTA 3N9KA 4ADUA 3GH4A 3NQCA 4RZ6A 1ZGDA 3QZAA 3KRBA 4H9ZA 3VMPA 3SBFA 2WLZA 4IL0A 3EXRA 4AUBA 1V6XA 3EA2A 1H7XA 3CHCA 3VGDA 3E0WA 5JUVA 4AC7C 4J27A 3BXWA 4P8UA 5A5WA 2XVKA 2VCBA 4YWIA 5E70A 4TXEA 1KFBA