2PTDA

Phosphatidylinositol-specific phospholipase c mutant d198e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQEKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 107
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2ptdA00
1DJIA 1T6MA 2OOGA 3RLHA 4I9JA 2FJUB 1DJWA 4R7OA 6PTDA 4F2UA 3OHMB 3EA2A 7PTDA 2F9RA 1DJZA 4I8YA 3MZ2A 4PTDA 4QJ4B 2PLCA 4F2BA 4GNKB 2ZKMX 3H4XA 1PTDA 3KS5A 1QATA 1YDYA 3CH0A 1O1ZA 3NO3A 2P76A 4QJ5B 3KS6A 3QR0A 4OECA 3QR1A 4F2TA 1VD6A 3QVQA 1AODA 5T9CE 4I9MA 5PTDA 1GYMA 1PTGA 2OTDA 3I10A 4I90A 1DJYA 1T8QA 2O55A 4RV3A 4RW5A 1QASA 4Q6XA 2ISDA 2OR2A 3V16A 1ZCCA 1DJXA 3H4WA 4QJ3B 1DJGA 3EA3A 5T91A 1DJHA 4RW3A 3V18A 3V1HA 2PTDA 3L12A 4I9TA 2PZ0A 5T9BG 1V8EA 3RLGA 3EA1A 1XX1A 4S3GA 3PTDA
chains in the Genus database with same CATH superfamily
2A2IA 3DYPA 1AH4A 1JYNA 1RPXA 3SJ3A 3FEQA 1OFBA 1W5NA 1OX4B 3W84A 2XIMA 1MQRA 2WNNA 3W6MA 1EH9A 3DFTA 1QO5A 4JHMA 4GHRA 1LBFA 2CLHA 4DNMA 4GWEA 4BWLC 2ZUUA 2VZTA 4AZHA 1OZMA 2UWFA 1EZWA 4IJCA 2A3EA 4LUSA 4DEFA 3BJTA 2QNEA 1JVNA 3U5YA 4AQLA 3MA8A 4XVEA 2QUVA 4AZ6A 1OD0A 3IIOA 3GW3A 6A3HA 4WXYA 1P0DA 3GD6A 1I8JA 3EWYA 1XP3A 1QDSA 1S2AA 3M1ZA 1ZHAA 4GX8A 5FESA 4IICA 3LMZA 2VDGA 4HA1A 2IXVA 4GINA 3NZRA 1PS9A 2Z2UA 1S5NA 4GXPA 4UQDA 3FXYA 4UFIA 2C13A 4A21A 3OGSA 4D71A 1K8YA 4MY8A 2YYTA 4EK7A 3OQ8A 4TTUA 1VENA 3P74A 4PYSA 3PZQA 4Z2HA 1I4NA 5GJPA 1SJBA 2WV8A 1EO5A 3AJ7A 4PSPA 1IWAA 1JUKA 3VINA 4I7UA 1EIBA 5GJNA 8RUCA 1FWAC 4QE4A 5TQLA 2X41A 1TV7A 4PULA 4POCA 3PAOA 4Z1DA 3WMBA 3NQ6A 1GONA 3RR4A 4NHVA 1W8GA 2D24A 2FB2A 2G5WA 1EGZA 2C16A 4NF7A 4JKLA 5GNXA 3DXIA 2FZ8A 4HCHA 1VBHA 1OCBA 4MMWA 5LXXA 2AL1A 4L4LA 1C8VA 3N14A 5HWMA 2PTYA 3ES7A 3ONBA 1DVJA 2GJXB 1UUOA 3ANVA 1G1YA 4FNUA 3UWQA 4F9JA 4I9JA 3OODA 5KZMA 3TYAA 3R4IA 4YVPA 1RK6A 1KCLA 1ZENA 2D2OA 4E2DA 1O7AA 1E1FA 1I45A 2XFYA 3BW2A 1CTNA 3FV9A 3MP5A 2GK1B 3HO8A 1OG6A 4OT7A 2HEJA 1VPYA 1TRIA 4HNNA 3SUVA 2IKGA 4DI9A 4CQAA 4KF1A 3URQA 3SN4A 5A6JA 1E5JA 4Z1AA 4H4IA 2KX9A 3WFAA 2FGLA 4QG9A 3SDOA 1LDCA 4FXSA 1B31A 1XLFA 1EGMA 1SFJA 2D1ZA 2H6RA 2VC9A 5I06A 3IEBA 4MYXA 2JIEA 2P3EA 3UJFA 4ZXLA 4C1NB 5FJJA 3QH2A 4NYYA 4ATDA 1Z42A 4FP1A 3WLLA 1HVXA 1UQZA 3HZ3A 4XUYA 3SQLA 3AS2A 1C8YA 4Z0SA 1EC7A 3KOWA 1W1PA 1JYXA 2IQDA 2CHOA 1IGSA 2D73A 3GB6A 1FX6A 3H24A 2E6FA 3BE7A 5BU6A 4M5PA 4ZOAA 3QFEA 2WLZA 1I9CB 3O15A 3VOJA 1CZ1A 2FHCA 1GVQA 1S5TA 3NSMA 3LS9A 2XIIA 3TSMA 1E6PA 3M47A 1K7FA 4ZOCA 2YB1A 4J40A 3HURA 5CLTA 2DZPA 3CPRA 3PFMA 2PWHA 2YCKX 7REQB 4FA3A 2WC7A 3WJWA 4DRSA 3DECA 2F8QA 3W71A 4LANA 3M0MA 1EA9C 2J24A 4R85A 4DO5A 4ATWA 4WY0F 2RKXA 3E38A 4P7QA 1DTNA 2UBPC 4GRSA 5CGTA 4JN8A 4Q8NA 1AA1B 4IOTA 3K30A 4ICMA 3BANA 3W6LA 2ISDA 3S5YA 1EX5A 4X2RA 4J9JA 7A3HA 5LNRA 4FNRA 1L6SA 1UJPA 2VD9A 1YADA 4AIUA 3DGRA 3PY2A 2XVPA 3TTEA 5FAGA 3VNZA 4M7SA 4PC8A 4M82A 2NVCA 3ZXWA 5FAJA 3LEPA 2UV8G 3WH7A 1XLDA 1V51A 4H9UA 4UFJA 3NWRA 2F6UA 4OUEA 4FB7A 3DESA 2AQVA 4QDPA 3LU2A 3MUXA 2P0OA 1ZL1A 4GIRA 4CQCA 4CNTA 1XQLA 1QWKA 4HVXA 4FAMA 2Q3OA 4RE3A 3TC7A 1ADDA 1ZY9A 3BAKA 2PLCA 3EOEA 4HOZA 4O15A 1YDNA 4NSBA 1HW6A 1HF6A 2BVTA 3G18A 2F38A 4BWLA 1C93A 3UWEA 2V5DA 3GE7A 1TPEA 4DWSC 3TOPA 3SQMA 4Q8PA 1KC7A 2BP1A 2V69A 2ZIDA 1VFLA 4L61A 2WC4A 1DQXA 1B3OA 4JX5A 4OBSA 5I3IA 4Z08A 4QE1A 3W7GA 5G1YA 4MY9A 4Q22A 1WZAA 5A8GA 1NFPA 4ZB2A 5M03A 1XBYA 1U30A 2NZLA 2CBUA 2VWTA 3SCUA 3VMNA 3CQIA 4XBSA 4J3ZA 2WVSA 4KWWA 4I5XA 1DJGA 2CBVA 3KBSA 3GBDA 1UR1A 4CNSA 1UR4A 1W9XA 3UCDA 2BXZA 1QATA 1TE1A 3OZOA 1BLIA 1HKKA 1M6JA 3FS2A 1E3ZA 2BODX 3BSMA 1QT1A 3M0JA 3H23A 1JUEA 4TOQA 4QX4A 1ICPA 3R79A 3T08A 1L6WA 3TNOA 4P8XA 3GK0A 2G3JA 3EOLA 4KBXA 4F2BA 1EDGA 2YIHA 2ACUA 1JD9A 4C6BA 1NDVA 3V0SA 3FGCA 2X7WA 4LT9A 1MI3A 4WSJA 4ERGA 3CZLA 3RX2A 3LY0A 3G77A 3QSTA 3T07A 4MADA 4XBKA 4H41A 3TXVA 4NI8A 1O12A 2Y8KA 4JIHA 1UWUA 2FPYA 4NX5A 1X96A 3AZSA 4HYRA 3ZT7A 3O8AA 1GZJA 4RE4A 5KZDA 3AHVA 2JQXA 4U10A 3KLKA 5IDIA 3FK4A 3OIHA 4H6QA 1ONWA 4CCCA 3VABA 3N2OA 3EOSA 2DJXA 1S46A 2J66A 1XX1A 3FJ4A 1RH9A 1K02A 2EBNA 1I2OA 3LLXA 3TFCA 3W1PA 4HK7A 2PURA 1VJSA 1JYWA 1W5MA 4P7RA 3P93A 5IRPA 1ZNNA 2ALDA 3F4NA 3L66A 2X1TA 5DFAA 3F2CA 3ZLHA 3ARYA 3R10A 2OZ8A 2OQHA 3A47A 3ME3A 1V3IA 3KTXA 5I6SA 4V15A 1UA3A 3PUEA 4WKAA 1H5YA 2ATMA 3WBEA 5JBDA 2CLLA 3NAVA 4UTLA 3WH9A 3NXFA 2PLJA 4LUTA 3CWHA 1AW2A 2Q3RA 5CZSA 3UETA 4DHGA 3B97A 1VFFA 1M7JA 1KNWA 1VR6A 3R94A 1XIEA 1F4AA 3CTTA 3HIJA 3V7PA 4QHRA 3OGVA 3RO6A 3MI3A 1DXFA 5DF0A 1CIUA 4RW3A 4ZQCA 3PBWA 3WQVA 1JCTA 3PB2A 4D2JA 2CLIA 3VZZA 5BXSA 5CZTA 4JHOA 4UMAA 3NQVA 2ISWA 3UXLA 1B3YA 2E8YA 2QJIA 3WJYA 1HL2A 2CESA 1NOUA 3S2NA 3G5EA 3CJPA 3CO8A 1FBAA 3RU8X 3I3EA 4HP5A 2Y1HA 1QK2A 3GZ3A 3CS2A 1OCQA 2PDNA 2E77A 2ON3A 3HFYA 1VFUA 4TV6A 3LZ5A 3QV6A 3QGAC 4JYEA 4A8IA 4DWSA 4JQAA 1RQHA 3MPGA 4UTHA 3L5MA 4YVVA 4KEUA 3UWUA 4JTDA 5C54A 2QW5A 2Z24A 3FNDA 4LAZA 3FKKA 1Q6FA 3U7VA 1WDSA 3WH6A 1FWBC 5JU6A 4ZTYA 5A95A 5D2VA 4WDXA 4H9YA 3ZWSA 3DI1A 2C79A 1KM6A 3PTQA 2ZA2A 2PD5A 3CO4A 3GYEA 1FWFC 2E7FA 3GTIA 1EOKA 3PG9A 1SJCA 1SO3A 4NZ3A 1W3JA 3T2QA 3B3DA 4FO4A 1CLVA 5DLCA 2FFIA 4DBEA 4QDWA 1XHGA 1BG4A 1U1HA 4GYJA 3GDKA 3WK1A 2C18A 1E4IA 2XWEA 3CV7A 2O7SA 1Q4NX 5FJIA 5CBJA 1B30A 3G1XA 2PF0A 1GYNA 1JPIA 1FUYA 6PTDA 5D05A 2VNCA 2XTKA 3G6MA 4S2CA 1LWHA 4F9DA 2Z1KA 4PUWA 3GUWA 3M16A 4C6NA 4Q8QA 4D6GA 4RKAA 1XRFA 3BTNA 1K1DA 1TV4A 1RY8A 4OGZA 1MQQA 1WKDA 3AIWA 1PUDA 3P0XA 4BR1A 2DH2A 3IJ7A 2O4QA 3K4AA 1TPUA 1WNOA 4XZIA 2W3ZA 2EF9A 3N2XA 3FX4A 4DUXA 3BSGA 1KKRA 2PGEA 4LVBA 4IMGA 4WIWA 2CHRA 4A6GA 5C9ZA 5CPLA 2J7HA 2RAGA 3GVWA 2FZDA 1Y0EA 4KEZA 4ZL1A 5C7VA 4C7DA 1J93A 4Q8UA 3SCTA 3UWYA 4W88A 1HJXA 2Y7EA 2PFHA 1ZU8A 3R89A 3OTRA 3WQCA 1IT8A 1GHSA 3A4XA 1Q6RA 4TIMA 1M03A 2XSBA 5K3VA 1VFOA 3NQ7A 1P1XA 5I09A 3N2TA 1ITXA 4FMVA 4GYKA 1NFGA 3TYBA 4L4OA 4QAWA 3EXRA 3NPVA 4HZ7A 4W9TA 5D8ZA 4IH3A 1I75A 3UXDA 3GWQA 3UZ5A 3HGJA 1DIDA 4MY1A 3L2LA 3DFSA 1LORA 2OSXA 3NL2A 4OV4A 2H9AA 2VKZG 3TZNA 3VM7A 4CNNA 2FKPA 3CZEA 1V02A 1XGDA 4JOMA 2NV1A 3MV01 4S3JA 1E6QM 1LTDA 5IHSA 4C1LA 4DLMA 1XCXA 1GOQA 5CLWA 1A5CA 5HMDA 3RRXA 2OKTA 4YCOA 2BMBA 5CG0A 1DJQA 1E43A 1P0KA 3RLUA 2NVDA 3TDFA 4M6VA 1CXIA 3FYPA 5DT5A 3WMSA 1S1RA 4XAGA 3AXMA 5E6ZA 3EDEA 1BTCA 2CETA 2PTZA 1Q2SA 4BKNA 1YXYA 2WCAA 1I60A 3OZMA 3BDKA 2X2GA 2GJLA 3BQ6A 9CGTA 1F6YA 4E5TA 4R7JA 1M7OA 4PBGA 3ITYA 2DT3A 3BAIA 4GJ1A 1DE5A 4WZHA 5G5IA 2EHHA 1HZYA 4GNJA 1RSCA 2UY3A 1KM2A 4RJEA 3W87A 3LDVA 4FR1A 2I5GA 4DQWA 3AYSA 2AOSA 1QJWA 4HTYA 3CV2A 1IQ8A 1G7UA 2H3BA 2J25A 3A3XA 4FPSA 2AAAA 1X8FA 3BPWA 1G9HA 4B92A 1AUSL 3S2CA 1M53A 2CLEA 4C1KA 1W1TA 3HPFA 1TIWA 3K5XA 5C2XA 3AU2A 2OX4A 4ILSA 3G0XA 4AZCB 1O1ZA 2PF8A 4JGDA 4MJ2A 3VGDA 2C1IA 5C0QA 5T9CE 1GHRA 4DM1A 2Z1SA 4CEXC 2ODOA 2XJ7A 3ARSA 1D2KA 4DF2A 1ZPTA 3R8RA 2ACRA 2A4AA 2W27A 1VCGA 3BW3A 1O95A 2QCDB 3PZTA 4XTIA 4FR6A 3N29A 1QW7A 3UJSA 1PCWA 4HN8A 3N19B 5BRQA 1C91A 4FHAA 3VIGA 2HPIA 1ZBVA 1P1MA 1G6CA 3C2OA 1B1YA 3LI1A 4M51A 3BLFA 2J7BA 5HATA 3DU0A 4XK2A 3C0JA 1QOXA 1WKEA 4HQVA 3QF0A 2CNCA 3ALFA 2VEMA 3QY7A 4I90A 4GJJA 1RBOB 4MYAA 1ADSA 1NELA 4HBKA 5DCDA 3MANA 2VFDA 2XSXA 4YJ5A 4O4VA 3MBDA 4N42A 4K8HA 1YXDA 4FXRA 1W1IE 3ZR4A 4AYSA 4IMAA 2DUAA 4TO8A 1YBQA 4W4QA 2WBGA 4LAKA 1XGEA 1B2YA 5F2GA 1FCBA 2D3NA 5MF5A 4MPQA 2DZAA 1FWEC 1R3QA 1Z8AA 1PCKA 1OGBA 1UD6A 3LM7A 3WLTA 3VNLA 4JBRA 1KLYA 1D8WA 4S1FA 3SCRA 4KWOA 2VMFA 2ZE3A 3O6AA 3LLFA 4D6IA 1AZ1A 3WJXA 2GDVA 5G2IA 3EPOA 4WCJA 4I7WA 3N4FA 4HCDA 1PPIA 3OZPA 3W24A 1NWSA 3PSVA 1PKMA 1UKPA 1OYBA 4D6DA 3V0UA 3CTLA 4LYQA 1H09A 3GVVA 1JIBA 3E0LA 3M0VA 1BSLA 4WJXA 3BZJA 3H4WA 4C90A 1FKXA 2HROA 4QROA 3GO2A 4ZQMA 5E0KA 3U0HA 1GJPA 4AD4A 2C7FA 1A0EA 1JQXA 2SFPA 4H1ZA 3IANA 2HSAA 3NYDA 4LCQA 1KR1A 3GKAA 3AHXA 2PDMA 2QV5A 3G1DA 3PUOA 4PCTA 5K7JA 4FZIA 4IP7A 4HSOA 2O56A 3C2VA 2ZC8A 1PAMA 3BO9A 3SZ8A 3UPWA 4AUBA 1E6SM 4Q4PA 2NX9A 2PDBA 1SMDA 2QF7A 4S23A 3NPXA 4O53A 2C1GA 3CAVA 2VFHA 1BAGA 3WKZA 3HG4A 4EKJA 1O5RA 3CMFA 3S5SA 1T8QA 1UWAA 2UY5A 1KQZA 4HNLA 4XD5A 4AD3A 3ITCA 4OIFA 2GFTA 2QZRA 2C14A 5I3KA 3UA4A 2JE8A 3UG5A 1FOBA 2G3MA 5LIXX 4WDWA 5ABFA 3QR1A 1M3UA 1XIHA 3E3HA 3ZZ1A 4FF5A 3TCEA 3V5CA 4GH3A 1SW0A 4BQ5A 1W2VA 2MANA 3GW0A 4XZHA 2WMIB 3WY1A 2E67A 1KFKA 3C2YA 3QM3A 3R0KA 2PCEA 2OOGA 5FL1A 1H62A 5HOSA 3HJZA 4LUJA 3T2PA 5EFFA 3EA2A 1H7XA 2QS8A 1QPNA 2A21A 4XX6A 3NO1A 4XKYB 3ISIX 3ZO9A 3S5OA 4GFSA 1GW1A 1YYAA 1E9IA 2VL4A 4RNIA 1ZCCA 3T0AA 3BJFA 2WB5A 2QIIA 5ABHA 4K37A 3UQNA 1B9BA 4DJFC 1ELSA 5AN7A 4IP5A 1A4LA 1S2WA 4DZAA 2OO0A 2QCEA 1R46A 5GVJA 3H2MA 3IVUA 4Y6GA 4RLIA 3WLQA 1KBJA 4LC6A 4QITA 5C71A 2AL2B 2Z4GA 4U28A 3IS4A 3W7OA 3NO3A 4LYPA 1XKYA 1TWWA 3TYEA 4C6CA 4P7OA 4UTTC 4O28A 3RGTA 5FI8A 1CXHA 5A6BA 3GXPA 2BHYA 3M0KA 2WJEA 4PL1A 2ZBTA 2OXNA 1FA2A 3FA3A 1PKLA 1K9FA 2I16A 3GU1A 1WP6A 4HOWA 3O6DA 2XDFA 3TYCA 1EO7A 1Q66A 3QTPA 1L6FA 1X38A 1ZCOA 5T91A 3W7IA 3IJQA 3BLEA 3CAWA 3MS8A 1UP0A 4RX0A 4BCEA 4IMCA 3JZUA 3POHA 1G4EA 5CPSA 4NJIA 3GH7A 3IWPA 2BFGA 1CGUA 5K2ZA 4CCDA 3QTGA 2WAGA 1NY1A 1GQNA 3QY6A 4ZMGA 3WZ0E 3WF2A 4D6FA 4BF5A 2DEPA 3THDA 4UOZA 3AS3A 1S2CA 2BGSA 6XIAA 1AQMA 3RO8A 3LTPA 4EX4A 4V28A 1GCYA 1G01A 3VCNA 1GVFA 3W82A 1W1B1 3T8QA 4GQRA 1R85A 3EWXA 3JW7A 3W70A 1BG9A 3HTWA 5D33A 1JDCA 5EMJA 1TUXA 4HHHA 3D6NA 4O1FA 3RPTA 1QW8A 1A5UA 3ZYZA 3TWAA 2CYGA 3MBFA 4BF9A 2PU0A 4ICNA 3KL3A 3BAYA 4LWWA 3AFBA 4DBUA 2ZZ7A 1JZ5A 2V9DA 4BQ3A 3LPPA 2IPJA 1K9EA 2YXOA 1Y5VA 1TZZA 3OGRA 5D9NA 4JEJA 4QFUA 3UYIA 4JDYA 1KFJA 2QUMA 5G4HC 5HUOA 3IGSA 2TSYA 1CGWA 2HS8A 4X3ZA 1ZAIA 2RDWA 2J4GA 1HKMA 3UESA 1AK5A 1XLEA 3F5LA 3W01A 1J0HA 1ME8A 3BLIA 4UQ9A 3VC5A 2F61A 4XTDA 1TIMA 2JF6A 3MT1A 4TX6A 1QWGA 3R1ZA 3A4WA 4HGXA 4EPEC 4A3RA 2O9TA 1KCKA 1C8QA 1US0A 2W0UA 3P82A 3T0CA 2GQ9A 3MQTA 5BRBA 2ZX7A 1TCMA 2PPGA 3UVAA 4ZSUA 3QC0A 4CD5A 3H53A 1RCOB 3TTYA 1UROA 3F7JA 4HSHA 1U5JA 3URAA 2BVYA 3NQ8A 3XIMA 4H2HA 1H61A 1TPB1 3ERPA 3PANA 3VXGA 2GQ3A 3E1F1 2I17A 4H9TA 1AZ2A 2J7FA 2ABAA 3VD3A 1KM4A 2WVTA 4H04A 1F4HA 4AX6A 3GKFA 1LLWA 3H4GA 2PDPA 2L5HA 1KFLA 3MP4A 2PU1A 2VEPA 3NQBA 2W63A 1UJQA 4ROPA 1Z89A 1BRLA 1FP9A 1GYLA 4Q8WA 3IV3A 3PAJA 2OELA 4RV3A 4X22A 3WDPP 4FOJA 4CQ9A 4NI3A 2HRWA 3LCWA 4OVXA 3QBUA 5D2XA 1EJTC 1NDWA 4LEQA 1NQ6A 4KRTA 3GHUA 1UYQA 7CGTA 2B4GA 3V3WA 1H0IA 4R5EA 2E9LA 1PJ9A 3NZ1A 3KLLA 1KV5A 2PSNA 3ZVIA 1P6BA 3W7RA 1BGAA 2GJRA 4XD6A 3ABZA 5CSRA 5XIMA 2WPGA 4HYVA 3VK5A 5G2HA 2CIPA 3M7WA 4TTGA 2E4TA 3M44A 2QDHA 1OX4A 3UJRA 4MHBA 2W9MA 5H6HA 2Z6JA 1BXBA 3GFZA 5BU9A 1UR2A 2W62A 1I0BA 1T0OA 4FOUA 5H8MA 1V6VA 2VCCA 4CQ8A 2VZOA 1PYMA 4IIEA 4ONVA 3VI2A 1I6NA 1ISXA 3AS0A 1H60A 3V5OA 4MFEA 1GG1A 4JFTA 2EXOA 4W89A 1RLDA 4Z1BA 1IWBA 3U4AA 1XBXA 3TH6A 3QGVA 4MJZA 3OOQA 3HN3A 2IMRA 4K1WA 4PUUA 5CJMA 3DGBA 1HTIA 4ZTXA 3OA5A 2NUWA 3BZGA 4BJHA 1ESWA 2GVEA 4HTBA 1OEPA 1MW0A 4GYPC 2WSQA 3LHZA 4FLOA 5FF3A 2QPUA 3W7MA 4GGHA 3ZJ8A 5CCZA 2ZQ0A 3VGFA 4F0RA 3ZT5A 1GOXA 2GLKA 4ALDA 4DJFD 1AJZA 2CHNA 4JR5A 1VBUA 2PDHA 4NAEA 2PWFA 5EMMA 5DY2A 2CLPA 3VE7A 2E0PA 4NIRA 3PR2A 4CD8A 1KRBC 1A5OC 4H01A 1O94A 4YXGA 2QYGA 4LSBA 2ALRA 4MAZA 1KFCA 1E4MM 2XGIA 1OC5A 3W4RA 1SO5A 1UMYA 2X05A 5AKQA 1W17A 1JFXA 2EG8A 4E38A 5D38A 1IEIA 3KVMA 1NARA 2DW7A 2Z25A 4AZBA 1R38A 2OYMA 1DWJM 3NDZA 2QPSA 3D46A 1ZAJA 3M41A 3A6OA 1A3WA 3PVFA 2QPXA 2QVNA 1XLKA 1QW9A 3NGJA 4AX7A 1RJRA 4Y2WA 3GDBA 2ZRVA 3QV9A 4DN1A 1O5QA 2OU4A 5FL0A 1Y5XA 4LEFA 4C6KA 1ODUA 3EXTA 4XSMA 3ZJKA 1PIIA 2DPEA 3GY1A 3GHTA 4LXFA 3AISA 4ZE4A 2I57A 4QQUA 2W4XA 3E96A 4XKMA 1W3TA 1VC4A 4O57A 1PZ3A 1PSCA 1PB0A 4GZEA 3IJ6A 1V0KA 4W87A 2R94A 4B5SA 2OLSA 1A53A 4MB5A 2OTDA 2XH4A 3CZKA 3LTSA 1XPGA 5H2ZA 1IXNA 4DWDA 3GC5A 5FF0A 1LG1A 1T6MA 3W7HA 3CT7A 4C60A 4XV0A 4JN7A 2ZUNA 1OG0A 3RMEA 1TX0A 1X39A 1HKIA 3CB8A 2ZA1A 2J62A 2HVNA 4U2ZA 4H6EA 3AMKA 2O0TA 5FSEC 3JRKA 3SY8A 4ZA0A 3TP4A 1JYVA 2DT1A 3PNUA 3DENA 5D9OA 5JH1A 1HP4A 5I00A 3E6EA 1ECQA 4J3VA 4ZB5A 3C56A 2EEXA 2VJXA 5F2MA 3L5AA 2B81A 1I2NA 3KOFA 2R6OA 3A23A 2BY3A 4A4AA 1QI2A 2B0MA 2YW3A 4UOJA 3OB8A 1T96A 2WHLA 1TPVA 4Q8TA 3VKCA 4DJED 1ZP3A 3QPYA 9XIMA 4QG8A 5M3WA 2HE8A 4QAIA 4S3EA 4FF7A 5BZAA 2F6KA 3FSUA 3KTSA 1VCVA 3W7KA 2GDQA 4DWSB 1MRQA 1ZJIA 2DP3A 4F40A 3ENLA 2WZHA 5CPQA 4CD6A 1BD0A 2YFNA 4U3AA 4LNYA 4W7VA 1RUSA 3HB9A 3GVGA 3WLJA 5IXEA 1JJKA 4MKSA 4B2DA 1CX9A 2OOFA 2OT1A 3PBUA 2DUXA 4JTUA 1K9DA 4P2VA 2ZVIA 1TELA 1WOBA 4X9YA 3H2FA 2E1WA 3OVGA 3VC6A 1XYMA 2QJNA 5LHFA 1PX3A 2DFAA 3W3OA 2MNRA 3M5VA 4S3CA 5D04C 2XZ7A 4N9EA 1UCWA 1PVNA 3AALA 2XVKA 1HJSA 3M0XA 3ZM8A 1UBSA 3OQEA 4Q7BA 4W8LA 2OWCA 2QULA 3EKLA 4OOUA 1V3LA 4KEVA 4Y9AA 2GVGA 3SO7A 5IBXC 1PV8A 1VGAA 4AVNA 2DQXA 4YCPA 1YIXA 3GAYA 1EXBA 1D7KA 1DWHM 1TV5A 1W6TA 3UR5A 1AJ0A 2DU2A 3DG7A 1KGXA 3PSWA 1NFBA 4ML9A 2C91A 1Y65A 3BW4A 1E73M 4R27A 1LUCB 4KH2A 3IJ9A 2C0AA 4GKLA 5C55A 3RYSA 1E0VA 3BAXA 3ID7A 3ELFA 3T4CA 4XB3A 3RHGA 1QUMA 1ZALA 5LGXA 3OHIA 5A2BA 3L0KA 1GTEA 4PH6A 2Y2WA 2D2HA 3CHFA 4N6EA 4ZR8A 4UFLA 3WQOA 2ISSA 1V7YA 5AC5A 2WMKA 5M2FX 4FX6M 2FJKA 1A5KC 1EC9A 2GK1A 3QSRA 4C65A 5DELA 2WMIA 1BF2A 1E3XA 1UP3A 1DEDA 1BQCA 4GX9A 4DO4A 5F4WA 4Q8MA 4E2OA 3VO0A 1LL6A 4L80A 1OX6A 4Z2IA 1UC4A 5AHIA 1KM1A 2CC0A 2NX3A 4CNPA 2HXTA 5A8MA 1P48A 4UTMA 1IZJA 3SM0A 5FD0A 3Q4DA 2EJ1A 8XIAA 4H9MA 3WBXA 4UNKA 1R3SA 1EFZA 2PAJA 2J7DA 4HT3A 2V2DA 3WLHA 3LBMA 4C6MA 5HJYA 3W1LA 3KCOA 4JQ4A 4V33A 3FFSA 5F4XA 5A6AA 1F3TA 1R5YA 4LUYA 3GX9A 4LBUA 1JDAA 1H7WA 3O2LA 1M41A 1XDJA 4MZ8A 3I6EA 3QPEA 3TK7A 4I5UA 1K6AA 4IPIA 3NNTA 3MCOA 1FDYA 4G7FA 1D8CA 1AJ2A 3CAKA 1YNPA 3YPIA 5HXMA 1TV2A 2CZEA 4Y9MA 2EPOA 2PBGA 2BNJA 2YSWA 5U7SA 4PN2A 4QS5A 4PMQA 4XAPA 4L9YA 3LCLA 3BL3A 1OYAA 2XU2A 4K6AA 1DXIA 3G1AA 1R7AA 4WXZA 4J3UA 3IPWA 2X09A 3WLKX 1XRVA 5H8PA 1ICQA 3UZZA 3K4DA 4REQB 5I3JA 3THQA 3URNA 4XAFA 2Q09A 2ZKMX 2R1MA 5JBFA 3N9SA 4PRTA 3S6DA 1G4TA 3KS6A 1Q85A 2NQLA 4LCRA 5HDRA 1XISA 4AMCA 3RDKA 2GWGA 1RLCL 1XRTA 5G2WA 3AOFA 3IIXA 1XV8A 3GS6A 3KBVA 3H26A 4ORIA 5HA7A 1KTNA 3ZWTA 1BYDA 1J96A 2CKRA 3RF9A 3AJXA 2EQDA 2WCGA 1FFQA 1P6WA 5A8OA 3MV11 3RX3A 3B8SA 5E5CA 3KZPA 1YMYA 1R9XA 5A6LA 1JCLA 2I9UA 4QJ4B 4OUIA 2YKKA 3O0KA 4MB1A 4DAFA 1QBBA 1FFRA 1ONXA 1SUXA 3VU2A 2EGZA 1IZKA 4BS0A 2BLEA 3LCIA 3AZTA 1EL3A 2CXGA 2G41A 2RJHA 2D22A 4LS2A 1O1HA 5A2CA 3UERA 4A2SA 1QRQA 3IVTA 2JFEX 3P84A 2QDEA 3UR2A 1UD4A 2E68A 3WK0A 1XD1A 1R6WA 1GPWA 5KINA 3W02A 1MWOA 2GUYA 2ZZ1A 3B0PA 1EOMA 3GFXA 4NT0A 3H12A 1TQJA 1VPXA 4G6CA 1EWEA 2OWWA 1D3GA 4IPLA 4A3UA 4QRNA 3E0IA 3T9PA 4W7UA 3CZGA 4K38A 1W9VA 3CU2A 1ITUA 4NU7A 1W5OA 3KAOA 3LRKA 3VZXA 1PX4A 3NO5A 3C86A 3BCFA 4ECLA 3QGKC 4IM4A 1TR9A 3CH0A 1SVDA 3H7RA 3BLOA 4JQ2A 1C92A 3M0LA 3OEXA 3PUDA 3W1TA 4AD1A 2I7GA 4BQ2A 2ZA3A 3WL1A 3C0LA 5XIAA 1SM9A 3B04A 3MDUA 1SZGA 4ZOBA 3WFLA 2YL9A 3LSCA 5CQ1A 3SCPA 1GORA 1GZGA 3MB9A 1XLCA 5CZKA 3EDDA 1MUCA 4JZ5A 4KCVA 4UTUA 1XF0A 3NR0A 4KKXA 5D2TA 3SRKA 3VIIA 3ZJ6A 3NIYA 4HU4A 3VILA 4G7EA 4HK5A 9RUBA 2Y5EA 2ZOXA 3JS3A 3KL5A 2Z1BA 3U5UA 4AHOA 3O6CA 1J6OA 4JFSA 5FJUA 5KZ6A 4M0XA 4GVGA 3LZ3A 3N25A 3VOHA 4WDTA 1I2RA 3ATYA 2PTXA 2D0FA 3GXIA 3SCNA 4HA3A 1NOWA 4RNHA 3BG5A 4AWEA 4WKHA 3WELA 4IQJA 4A22A 4TX8A 4LF2A 3PZUA 4O50A 3L4WA 3L7RA 3SIZA 2HZGA 2O9OA 1V0NA 1QOPA 5KETA 1R3WA 3QQ0A 2ZWYA 3EWUA 4W7WA 4WUIA 1RA0A 5A8PA 2HS6A 2HTMA 3M6YA 1W2PA 3GYCA 2YBUA 1K4GA 4WJEA 4U2YA 4CQBA 2VUYA 4AF0A 2WNWA 4QP0A 3IV8A 2Y61A 2I5QA 4DPQA 3KW3A 1VJZA 4JTGA 4F3HA 3E0VA 2NVAA 1VFMA 4M29A 3RJYA 2R9RA 4JTTA 1E51A 2BG5A 3OZYA 4IFKA 5CG7A 1XC6A 2WHJA 2X0SA 1DIKA 1F6PA 1TZ7A 2ASHA 3HMCA 1VBRA 3OBAA 3NFUA 3VOCA 5FF2A 2VI0A 4ZO7A 4TR9A 5EMYA 4O52A 4EE9A 3GR7A 1BYBA 4JNMA 3CC1A 1I2QA 3TYDA 3ZSSA 4CD7A 2BHUA 4V27A 3CZJA 3GU9A 2CERA 4P61A 3VM5A 5DANA 3O1NA 1L2UA 1X6LA 1BQGA 4B5XA 2QUTA 3IJLA 2I56A 3WD2A 1R30A 2J8TA 4TVCA 2FTPA 2O4MA 2IPFA 3WUGA 2A6NA 1BYAA 1X98A 4A3HA 4IPPA 3USZA 4DUOA 2DZVA 1IXQA 4O0QA 4EXBA 2IQTA 2IKHA 5L6UA 5J5DA 3OLGA 3QHOA 3AMLA 3DOPA 3F4DA 4A29A 2J9XA 4S3KA 3FGCB 1HJWA 4PMRA 4JYFA 2Y89A 3L0NA 3WF0A 2ZXDA 1G7VA 1MUMA 5GNZA 2HVMA 3A24A 2PDUA 3AU6A 3ZJ7A 4MG4A 4X0NA 4HCLA 1VFTA 4A8NA 4IMFA 3LYEA 3UXAA 4DZ5A 4JHZA 3T7VA 1DYSA 1E0WA 2E9MA 4UZSA 5FJTA 4N02A 1H51A 4DF0A 3K46A 2MUCA 4JS3A 4UOQA 3UW6A 5MKGA 3B0VC 4QNEA 3QN3A 2A6LA 1NF0A 1HXJA 4B3ZA 5FSDC 1DE6A 2HPMA 3GTFA 3R58A 1EF2A 2AQWA 4JTQA 1JULA 2YZRA 1Z69A 4IXXA 5A5WA 2Z29A 3L65A 3N6JA 3WMLA 3C3NA 3V0TA 2XYLA 1L0PA 2X7VA 4EACA 2BX7A 1UIPA 5AZ0A 1E9YB 1JNDA 3WF4A 4P8WA 2I5IA 2VX7A 3RPMA 2YB4A 5JQ9A 4KFPA 1UMLA 4XO6A 3ABQA 2V38A 3UZWA 4GABA 3W2MA 4AW7A 4AMAA 4GUHA 5E0CA 3TMQA 2DSZA 4HPNA 3T40A 4GACA 4IIDA 2QLYA 2E1DA 3DERA 3NZGA 1HKJA 1H4PA 1T41A 1NP0A 2ZZ4A 3WEZA 1PKNA 3VYLA 4B15A 1KCZA 2P50A 1ONEA 3KOXA 3EEZA 4FNTA 1CYGA 4D72A 2QCCA 5BMXA 5AVHA 2R1NA 5F1UA 3W0KA 4JTIA 3QYSA 1WUFA 1H63A 2ZXBA 3CL7A 3WYZA 3LV6A 5HPOA 3W1QA 1V03A 2XHYA 4AB4A 2FTYA 4WOZA 2OCZA 1U33A 1POJA 2GSEA 3EB2A 1JPMA 1TJRA 2VC7A 2QCNA 2QV4A 4UTKA 3B05A 2AGKA 3VGGA 1MNSA 2I9EA 1DWAM 4LB4A 1UKOA 2A3LA 3TFXA 4OBTA 3UF9A 4K8EA 1M68A 1IT7A 3PK7A 1ZJAA 3EX1A 3HG5A 1FWRA 5HWNA 5CPNA 3DN5A 2V3DA 1QFEA 4US5A 5C9RA 1PDZA 2PGFA 4PTXA 4WSKA 1W5PA 3IK4A 4JIIX 1KGUA 2WJZA 4GYFA 3UR7A 2NXIA 3UG3A 1W9PA 2ZZ6A 2VVNA 3SSJA 5CC6A 3HPAA 2J78A 3GDTA 1UH3A 3B9AA 3WIJA 2E9BA 2G4FA 4ZODA 1YPIA 1JPKA 2PBOA 3Q65A 5G4EA 4QEHA 4MSSA 1QU4A 4E4PA 5A6SA 1H1ZA 3DCPA 3FYOA 1EJRC 1P7TB 1DQUA 1TCDA 1TFVA 1FH8A 3K8LA 3R25A 3IVSA 2VURA 3QMRA 2YOCA 4XIAA 2E5CA 2BY0A 2DZXA 1LLOA 4PB3A 4N2YA 4WOQA 1WAWA 3APTA 4F48A 4MFDA 2ZXQA 1C8XA 3PPCA 3CZ8A 2R1LA 2PDIA 4PCPA 1TWSA 1V5XA 1C29A 2YL5A 5DCEA 5CBBA 1V4YA 3AROA 2XZ9A 4B4FA 4GZIA 1R87A 1MZHA 4GBUA 2WKGA 4BA0A 3DDMA 1P7TA 3PNZA 4MNKA 1FH7A 2PRMA 3HBLA 4FI4A 4R88A 3P8JA 3COTA 3REQB 3HQOA 2BSLA 3VOFA 4JICA 3M46A 3W28A 3W7LA 3MUY1 5GJMA 3O3RA 2RGMA 4R3UA 4AH7A 4A35A 4E4FA 1EP2A 3KBJA 2A3CA 3GR4A 5DRIA 1EPVA 4AAJA 1K6WA 2E5DA 2Z2AA 4PMOA 4Y96A 2CXEA 1GTHA 4Q8VA 4E8CA 3KCLA 1OC7A 3B9NA 1RJQA 3R5EA 5RUBA 1Q2RA 2KAUC 4PRWA 1J5TA 1A0DA 4RZ6A 1XLIA 2FGZA 1G4PA 3D3FA 2ZX5A 2HNEA 4UNIA 4B9YA 3MSYA 4NG3A 4ZXOA 4GIEA 2WVVB 2WMJA 2YLLA 1J0YA 2H90A 2Y8VA 3UT0A 2J8GA 2OEMA 2Z26A 3K8KA 1X1ZA 5H91A 1MW2A 2BY2A 2Q02A 3RLVA 3T1GA 2W6RA 4AF0B 2NUYA 1MSSA 4RZBA 4XG1A 4QEEA 1KXQA 1R3VA 4IX0A 1CW2A 3QYQA 1X8CA 2VWSA 3VD9A 3N18A 1A5NC 1KRMA 3RPDA 1NWRA 3R11A 4P7LA 3DUGA 4H00A 4JN6A 2VC5A 3QFWA 4H8UA 5KTLA 1E1CB 3ICJA 3RU6A 3EWBX 5LKYA 1XXXA 4K36A 3V35A 2BDQA 3LENA 3WUFA 2ZCGA 4S3GA 5CC7A 3OVQA 3AIUA 2WQDA 2VZUA 5C5YA 2V63A 1W3IA 1RVGA 1XIIA 1A5SA 2OSWA 5CAHA 3VE9A 5HR7A 1E56A 1B0IA 3GIPA 1F9CA 2HK1A 1EQCA 3LOTA 5DX7A 1TPC1 3D3AA 1TJ0A 2WMHA 3N2MA 2PDLA 4A3QA 1Q7QA 4U33A 3LBCA 1XUUA 1EJ7L 1GVOA 5A94A 1PHQA 4JIRA 4FIQA 5BOOA 1V02E 1JAKA 1XCFA 1XPYA 1WA3A 2J7CA 1P6CA 4HPJA 1J10A 3IK2A 1TTPA 5HNNA 1F74A 4G7EB 4CN4A 5G1MA 4K68A 3H2AA 2FQIA 3WNLA 3KS5A 1X97A 5AY7A 4F66A 4MM1A 3GR8A 1OT1A 1ME9A 3FXGA 5A69A 1W3LA 1GQJA 3W37A 4NAFA 3T6CA 4S39A 3W2JA 2CLFA 4GQ0A 4UMBA 3CASA 6ALDA 2LLEA 2W61A 3TC6A 3VPLA 1SR9A 3TVAA 3OVPA 5LYRA 2YLAA 2V68A 5I2UA 3U6WA 2A7NA 2J47A 1Y7VA 3W73A 1OGGA 5EMUA 3N73A 4O10A 1J0JA 2FLIA 5DCBA 5TAOA 4C91A 4BI7A 3AI0A 1ZZMA 3MWAA 2NT1A 1CT5A 2EPNA 2QQ6A 4PCNA 4L1GA 1WXZA 1FY6A 1W56A 1XRSA 2VP8A 3DX5A 3C2EA 1AL7A 1KM0A 2E25A 4TU1A 1Z44A 1LROA 1JZ2A 1SFTA 4GIYA 2VRQA 4UMCA 3TQVA 1HN1A 5GPRA 3BG3A 1HGWA 4DUVA 1JRCA 3VAVA 4PTMA 3KWXA 3ALGA 1GJWA 1LG2A 2XN0A 3VIPA 5JIWA 4YTSA 2HNHA 3D0CA 5D30A 3CPGA 5AOUA 4RDWA 1TWDA 4QISA 3CV1A 3OBEA 3IGXA 2VQTA 2PDXA 2O7QA 4PBEA 3R0UA 3BC9A 4HZ8A 4LS0A 1FCUA 4ACYA 3WNMA 5FF4A 4LCSA 3V1PA 4X60A 1RXOB 2R8WA 2P10A 1C7SA 4QSFA 1GJUA 1WXYA 2GGIA 1PZ0A 3TE9A 4P8UA 1SSGA 1XIGA 3ABRA 3ONCA 4XZNX 3UWWA 3WDIA 3TA6A 3PWAA 5I02A 2BWGA 1TUFA 3N2BA 1V6TA 4HNUA 2R82A 4M81A 3FLUA 3PG8A 4H8VA 4PZVA 3WDQA 4PUKA 3QW4B 1FDZA 3BOXA 3LD5A 2ZZ3A 1PTGA 4ERIA 2ABBA 4AY8A 3Q58A 1EJVC 2PI6A 5HNUA 3RCYA 2ACSA 3W72A 2FH8A 3NPWA 2IQ0A 1GZ1A 2YCEA 3MP3A 3SCWA 1DWGM 5A8NA 3T81A 1PIGA 4LUTB 2P1FA 1A47A 3PN8A 1X1NA 3TCSA 4PFMA 2PP1A 3DZ1A 4B3LA 3LGGA 3RFAA 1QASA 2RDTA 2Z1XA 4K7YA 4CNUA 1XICA 3KTCA 3ARVA 1PO9A 1TMLA 4GK8A 4IJBA 4YYCA 1DWIM 4MDPA 2V5CA 2CU0A 1XLAA 2DGAA 3EZ4A 2Z7KA 4MKNA 3A4JA 1K7XA 1N8WA 1RP9A 1MEHA 3P5YA 1EBHA 2P5NA 3AYTA 1J79A 3SN1A 5ABGA 3O0FA 1SMAA 3WLPA 1J0IA 1EHAA 2G37A 3DKJA 4DUWA 1Q6GA 1XLMA 1UKTA 4BHYA 3A64A 4XSLA 4FXJA 4YIWA 1XLHA 4O13A 3MHGA 2PRHA 3MMWA 2Q8LA 3BMWA 1W32A 1BXNA 3IJIA 2BBFA 1UPPA 2VR2A 4JNZA 4ZO8A 4C5YA 1JD7A 4UCGA 5BCAA 2A0NA 2YYUA 4GVIA 3CIWA 4L65A 1E0UA 1F8MA 4RZ5A 4F0LA 1BRLB 2Y7DA 2QEZA 2IXUA 4TQTA 2UY4A 2VGGA 3PB0A 1THFD 3MTWA 1RK5A 4IPJA 1V0LA 4ZO6A 3TROA 1CXEA 4W5UA 1IF2A 2RH9A 1R2RA 4HNTA 3LXBA 1P43A 2GGGA 1LRTA 3AXIA 3IRSA 2V3FA 3UVIA 3UG8A 1EPXA 3LSBA 4DXVA 4YS1A 3WNPA 3M0IA 3F03K 3N13A 4M19A 4NZ5A 3VMOA 1DJXA 5D09A 3MKKA 3N34A 1RD5A 5LIYX 2FYMA 1WBJA 1EDTA 6XIMA 3VNDA 3AIEA 2BVDA 1FWCC 2J88A 4Q4MA 4IGSA 2PDJA 2DVXA 1D3HA 2G50A 2REQB 1X7FA 3K13A 1BF6A 1J18A 3VVGA 1XFCA 4YWIA 2CWXA 2J9ZA 4LVAA 2VGFA 4CEUC 1E9LA 1GVRA 1QNVA 2YPIA 3KBMA 4GISA 3M43A 5JXQA 4OE7A 2A3AA 1TJPA 3ARRA 5DN1A 4YTUA 5LNUA 3T0TA 1UKQA 3UXIA 1GOIA 4RNJA 1IR1A 3LRLA 1HNYA 1SQ7A 1U1JA 2Q01A 3UJEA 3S2LA 3U2EA 3FSTA 3CHDA 4ADTA 2CLMA 5LA2A 3LI0A 1VCFA 3NL6A 4EVZA 5LNVA 4TMBA 4KFOA 4ZQRA 3QY8A 3NGFA 4IPNB 2YCLA 3XINA 5CC3A 2RGLA 3Q45A 2VFFA 1EHNA 1H50A 3W1MA 4H9XA 2GOUA 4JFVA 4QCFA 4W93A 1E70M 4LY8A 1TSIA 3C5QA 5FJPA 4X0VA 1QO2A 4I5RA 4JXCA 1M7XA 4OHQA 3OO2A 3NVDA 3WNKA 3CM4A 1RZMA 4UFMA 1E1EA 4HZ6A 1Z3NA 5FEZA 3UNDA 2Z28A 2CW6A 2PUZA 3LQLA 2PZ0A 1EX1A 3IUIA 4R53A 3RIKA 3G1RA 1AH0A 1Y8BA 2PB1A 2YCLB 3OIXA 1DORA 4G5DA 1RAKA 4GI9A 4AZIA 4JX4A 3P60A 3HJEA 2IKJA 2OYLA 3NJ3A 2C8NA 1C3FA 3EDFA 5FJOA 3IUDA 1AG1O 2CWNA 4DYJA 4D8AA 2PP0A 1JGMA 3AIRA 1CECA 2OYKA 4JD4A 1H3GA 2Z00A 4HPGA 1J5SA 3LUTA 4L64A 4GCAA 3N9RA 8XIMA 1UWIA 3WK3A 4KMQA 5BMWA 2X0YA 4XZ9A 1XCWA 3GC2A 1VHCA 3ZMRA 3DHDA 4XZBA 5FOOA 1VIWA 3SUSA 4KIEA 4IG2A 1J4EA 4LOCA 2WZTA 1S3TC 1B3WA 2X1RA 4CN6A 1BXCA 1UB3A 1H41A 4J1OA 5AC7A 2PCQA 2NXGA 2XH2A 4DX3A 3R6IA 3TTOA 3MC5A 3EX3A 1UD5A 3M5YA 3VD4A 1DIOA 4X2PA 4Y8FA 1LOLA 4IL0A 2X16A 5C7HA 1O5XA 4LRSA 3ZLFA 3SY5A 5MHBA 3CUJA 1Z7AA 4AISA 4Q6JA 2IPWA 3GNPA 3WQGA 2V5KA 4WSHA 3THAA 3MO7A 5A1AA 3BG9A 4D6JA 3PFRA 3PULA 1QI4A 4H3DA 4KETA 4ZFMA 4UNLA 2W66A 3SW6A 1S38A 5MKGB 3GM8A 3T55A 3W7CA 4R9OA 3B0XA 3DG6A 2QGYA 1TTIA 1XD0A 1CXKA 1N82A 2VXNA 1LJYA 2FZBA 4N9BA 4EPKA 5TNVA 3MUAA 1JUBA 4B5NA 4O0KA 2PA6A 3FN9A 1X1OA 4EOUA 3WF3A 1Q3NA 5HWJA 3TV8A 5EYWA 1Q7ZA 4NNBA 1XYFA 2FFCA 1P5BA 4GA8A 3ITVA 5I07A 4LBRA 3VFLA 2Z6IA 3P6LA 2VCBA 3OG2A 3VIHA 3CQKA 1JI2A 1KV8A 1HFBA 2ZE0A 5IBXA 3UPBA 3W29A 3MHUA 3MKVA 4U3CA 3D5HA 4J2MA 3WQWA 3W88A 5DRCA 4HSNA 1AQHA 4DM2A 3C8NA 1QHPA 5JUVA 3PBVA 1CDGA 4WQ6A 3DHPA 1HUVA 5CEWA 3KHDA 2NQ9A 3HA1A 2RHGA 2ISFA 1FWHC 3UJ2A 3CT2A 2GSJA 2FHFA 4S3DA 3TMLA 2NLIA 1TR1A 4EPDC 2Y8UA 3PM6A 3LPOA 4IXHA 3QZEA 3E5PA 5CPTA 4C7FA 3S6OA 2FTWA 3ZIZA 1U5VA 4L1XA 1LUCA 2B31A 4O1EA 4ASTA 1V3JA 5D02A 2QJGA 3RRAA 2QVHA 2BASA 2XUCA 3IJDA 4JCLA 2ACQA 3V5FA 3URBA 3MI6A 3F4WA 5G1TA 2V3GA 3TYUA 3LGEA 4JEQA 3UY8A 3VIFA 4Y90A 3C4UA 4UC5A 2Y4SA 2HWGA 1HKVA 3MJMA 3EEGA 3PC0A 1ZSXA 4H7VA 4OFCA 3ZVHA 2E40A 3MO4A 1EQPA 2H8XA 1UC5A 3GXDA 4J3TA 1KD0A 3CBWA 5HBFA 3IUHA 4FOKA 4J4KA 3O9NA 4S3FA 1G5AA 2XVLA 2WK2A 1LBMA 4CGTA 3QEZA 1V7AA 2AQOA 2OKOA 4LB3A 4MWAD 1ZS2A 3UPMA 1V6WA 3VCRA 1B3VA 2DT0A 3GU2A 1GEHA 4HNOA 4FK9A 3AHZA 2D23A 5LZLA 2ZRXA 4DAIA 1JDDA 1U83A 3M4HA 1KO0A 3R0DA 3PJUA 1J6PA 2PEVA 2AKZA 3EDKA 3PTMA 3RX4A 5CJ5A 2OEJA 3ITOA 4WD0A 4Z2GA 3HPSA 1GOOA 3MZNA 3UWZA 4L1WA 3TQPA 1NWTA 5HINA 1HL9A 1PIFA 1RQEA 4R7OA 4GI8A 1UZHA 3WK2A 1HJVA 5HMSA 4JX6A 1YXCA 3H7VA 1SFSA 4MUZA 5DXXA 5FCZA 3S2JA 3CK5A 2FDSA 3WQDA 2QUNA 3CL8A 1JXKA 4XQ6A 3BMXA 1ISVA 3GG0A 3HM7A 3I4KA 3OLDA 3CHVA 3HMJG 4PMYA 4EF9A 3DFYA 3DYMA 4ZVJA 4QQ3A 2ZX8A 2WLYA 3T8LA 1VS1A 4PODA 4W8BA 3QOKA 1JR1A 2VZSA 2FMNA 1L9WA 3P7YA 4CVWA 4UTWA 2WPBA 3P80A 4DZIA 3CGTA 1OYCA 2JKAA 4PBFA 7PTDA 1WB0A 1FWSA 3K8MA 2I14A 3UXKA 1XSIA 3G1SA 2HVOA 3APYA 3S9ZA 1CNVA 1RA5A 3ARZA 5HMFA 2GZXA 3VGEA 2DZBA 4FLQA 3N3MA 1CWYA 3NYZA 1DTUA 4I6KA 3ES8A 4GJIA 3S9YA 3Q67A 3WNOA 2NWSA 2PWGA 3CXOA 3W7DA 1Q63A 3VKAA 5H8UA 2C0HA 2PDCA 1NJJA 1JG9A 3VD7A 3SADA 4US6A 1BKHA 4TX9A 3NPUA 3WEMA 3N6HA 3RJXA 3PP7A 3V18A 1XLJA 1TA3A 2QUUA 4EAYA 2Y24A 3QQ1A 1NQKA 3Q37A 5A6KA 1R9ZA 4LV4A 3S9IA 1HQTA 3AXKA 3LHWA 4DF1A 3GZAA 5SWUA 4DY1A 1RCQA 5FF7A 4HNVA 4AHQA 2BHZA 3RK8A 3SUTA 3T0DA 1US3A 4AHPA 3WD3A 1U2YA 2OGJA 2Q8ZA 4B90A 1TZ9A 3O16A 2DVTA 4RDZA 3RUBL 1OGSA 2XISA 3E2RA 4JTFA 5HANA 5AVNA 3WDHA 2FVMA 2CZFA 1AMYA 3MI2A 3WDJA 1B4KA 3H2EA 3NM3A 3OLIA 1ZB5A 3CHEA 4C6LA 1V6XA 1UWQA 4Z42C 3QR3A 4JTHA 3GLCA 1V93A 2QJJA 1ZGDA 1XDMA 5CSSA 1IZCA 4PE8A 2A85A 2EJAA 5D2YA 3CQHA 3PWGA 4Z2JA 3L9CA 3GSMA 4JTKA 1UQYA 1VF8A 1YDYA 1KBLA 3TJLA 1OWQA 3E02A 1WAUA 3L4YA 4C6QA 4ROQA 5EFDA 1KB3A 3KWSA 4O19A 3K1DA 3AHYA 3F2BA 3EX2A 2WXDM 1UW9A 3ITXA 3GRIA 2CCRA 4O1BA 1FDJA 1XW8A 3U4FA 3O7UA 2VR4A 3R8GA 3WEOA 1TB3A 1JPDX 1QTWA 3BLLA 2YBTA 4MKVA 4YHEA 1CEOA 2OB3A 4MGGA 3BURA 2VHLA 2PDFA 3E0FA 5EBUA 2QIWA 2V5LA 5I79A 3WH8A 4UTIA 1JFHA 2HQAA 3RMJA 4NVTA 3NM1A 2PZNA 4FIRA 3O63A 4IGMA 3C52A 1VYRA 3KVJA 2V6AA 4HA4A 4JFUA 4L4PA 3WLRA 2WSKA 4LBSA 4HMCA 1DBTA 4WY0A 3WBYA 3FY1A 1LRQA 4NXSA 1W1YA 1JZ3A 5E9XA 4H6KA 2EKCA 4Z0JA 2QCGA 4LYKA 1EEPA 1XFBA 3W83A 3SR7A 1EZ2A 5BWAA 9XIAA 1H7OA 4EXAA 1H1NA 1EKOA 3MU7A 5FJRA 1GOMA 3GTHA 4U5IA 5I3GA 3M7SA 1AD1A 4NQ1A 3B4YA 2RFGA 1JXJA 2HBVA 3IIVA 4QNWA 3MUZ1 2CITA 1OJXA 4NAEB 1FWWA 1Q8JA 1OQFA 4YHGA 4CU6A 4JQ3A 3WLNA 3BVJA 4R9XA 2BVWA 3A13A 1P0EA 1UASA 1YKWA 3IAQA 2NT0A 3EWCA 3GTXA 3FVMA 2PGWA 1OK4A 2PD9A 3HPZA 4GOAA 4K3ZA 2NV9A 4JYDA 3BMVA 4RXFA 1PTDA 3RM4A 3VZYA 4G56A 4DO6A 1KLZA 2GYIA 3H21A 2WHMA 5A3HA 4DJDD 3SEPA 2BGQA 1SPQA 4PUJA 4EIVA 4KRZA 3QVQA 6REQB 1ZJBA 1AH3A 4H83A 3EMZA 4B5UA 1DQWA 3U57A 1HIZA 5HULA 4PMDA 1XM3A 1ML1A 1L6YA 1KRCC 4L7ZA 1LWIA 4P5UA 3GBEA 4RR4A 2ZTKA 2QJHA 3S8HA 1EUNA 3WH5A 1QVBA 3CYJA 3B8DA 2ZUMA 3B8TA 1R3TA 4MNLA 2DZSA 5IFPA 4IISA 1SZRA 3WN6A 4B91A 2VFIA 3TN5A 2VGBA 1SO4A 1JPHA 4E8GA 3FEMA 2V82A 1YE4A 3QV7A 4NZCA 4GQBA 1PL9A 2V81A 3TC3A 2O92A 4HNCA 1JQVA 1ICSA 6REQA 4AWSA 1PTAA 3EMQA 1REQA 4GXMA 4WGHA 3T2OA 3AMGA 2PWDA 2NSOA 2OMAA 4LC8A 1XYLA 1UD2A 3UCQA 3VD5A 4ZQPA 5CH9A 4CUCA 2GGJA 3U2ZA 2CZ5A 4IIHA 3TAKA 2ZC1A 3UY7A 4GLEA 3T42A 1Q45A 2BOEX 5HJLA 1TWIA 4LV9A 3O07A 4BEUA 3UEQA 1N55A 4GGBA 5HQMA 5F1VA 5ECVA 4O1CA 4GMEA 3AYVA 3ZT6A 2B7NA 2PWUA 4GG9A 8TIMA 4DELA 3IARA 1A80A 4LVFA 2C15A 1DV7A 1GOKA 2VD8A 5CPMA 1CLKA 4L6HA 4AVOA 4GNKB 5LIWX 4A05A 2R1KA 4H7ZA 1LBLA 4URIA 2YXGA 4U5KA 3GNRA 3WD0A 2KZHA 4PTNA 2GL5A 2HDJA 3AXXA 4FS9A 5LNWA 3THCA 3TIMA 3O05A 4HMNA 3TX9A 1W9UA 3DI0A 1C9DA 1GQIA 4HMEA 3TONA 2C71A 4LAMA 2PS2A 3RM9A 1HGYA 3VX0A 4M6QA 4RUBA 4GI6A 1WZMA 1B54A 3CMGA 2OPJA 4G1NA 3LTYA 1F3EA 2VTFA 2X30A 5B80A 2EO7A 3N4EA 5D03A 3A12A 3MDWA 3TQKA 5EKYA 5BRPA 5K4ZA 4QDMA 3W23A 3BWWA 3LXCA 3ZFHA 1K3UA 5LSMA 5HMEA 1NSJA 4M6UA 4XAZA 1E4NA 4LS1A 1H7NA 5ECUA 3ZLGA 2H8ZA 3VOIA 2Y70A 8CGTA 2VCAA 4DJEA 2E6DA 1BYCA 2YDSA 4PUDA 3FIGA 1WV2A 3G8EA 4JTRA 2YJQA 1EYWA 3WX7A 4AIBA 3E12A 1FWDC 1DL3A 2QXWA 4XISA 4AD5A 1KWKA 2HE5A 3EMCA 2INZA 3ARWA 4QLLA 4LGXA 1VFSA 3T4WA 1A3XA 3GIYA 4W86A 2F9RA 4RZ4A 1KA9F 4HK6A 1VZWA 3TW9A 4LTSA 2BS9A 2OR2A 3KFTA 3AXHA 2GPTA 3AMCA 4P7NA 3S46A 4AEFA 4C6PA 3HQPA 3QMTA 3TR2A 3UWVA 3A5FA 3LHVA 2ZZ5A 1Q6OA 1JDEA 2CLOA 4GUJA 3P0WA 3W1NA 1OB0A 1RVKA 1H7PA 4LH8A 1T99A 4LAOA 3M07A 5D9MA 2BTMA 4AZ5A 3T78A 4O12A 5ENLA 5KMYA 2XFWA 2V0TA 1Q6EA 1SGJA 4LUIA 1W5QA 1VEOA 5BROA 3JUGA 5CAKA 1XKJA 3V16A 2EPMX 3LPGA 3W75A 3S47A 5CSYA 1R3YA 1CENA 3W7PA 3QOMA 1LOSA 2GDUA 4WDUA 3RLGA 2DZUA 1IHIA 4DZHA 1J01A 3OVRA 5D8WA 3L2IA 4ZENA 1DXEA 2IUZA 3OPSA 1TPDA 3PZIA 1NVMA 5I3HA 1W37A 1EP3A 4QG6A 2DY3A 1TYGA 3AS1A 2VX5A 1TJ2A 4A2RA 3G0UA 4ZBCA 4EP8C 2V2CA 4Q7NA 4XD4A 1XYCA 3MCMA 3A5VA 2PDGA 3AYRA 3KDNA 4BFAA 2POTA 2Y62A 3QR0A 4N6FA 5AHEA 3NUKA 1WYIA 3BK0A 3ARUA 2X2YA 1VEMA 4GE8A 3SN0A 1K70A 2WANA 1LLZA 3BV7A 1LCOA 2YDRA 3QXBA 2RUSA 5EY5A 1XG3A 1ZP4A 3GNXA 5CC5A 1W1VA 4PMXA 2VEFA 4HKPA 1IEQA 3W27A 5C9UA 1TWZA 3REQA 4JAWA 1YPXA 3OW1A 1LQ0A 1W0MA 3VDHA 4ZZ9A 4UB9A 1S2UA 4QCEA 4UQAA 4B4HA 2ZRYA 3I4EA 1NTHA 1KGWA 2A7PA 4YTTA 2NV2A 3KP1A 3H4XA 4GYPA 1OFDA 2G0WA 5DO8A 2YXXA 1ZJHA 2INEA 1AD4A 3LMYA 1FCVA 1BTMA 1RJPA 1D3CA 1FWTA 3KBNA 2HJPA 4DI8A 4ADUA 1RR2A 3KRUA 4UWMA 3TTQA 1BWVA 1UWRA 3C2FA 3G22A 4EWJA 2J75A 2VQUA 2PODA 4L9ZA 5U4NA 3V75A 2YDQA 7TAAA 1K8ZA 2WKJA 3GDRA 1PYFA 4BI5A 3CUHA 3RILA 4WX2A 2JKPA 2WCSA 2QKFA 3B8IA 2AGTA 1DHKA 2NW0A 1BWLA 4K1GA 2DQWA 4O4WA 4M7TA 3ZR5A 4ES4A 3A9IA 3VMPA 1K03A 2GOKA 4DNHA 1F61A 3MCNA 1QBAA 4QLKA 3L4TA 3WSUA 3ECQA 3S42A 3M9YA 3AHTA 4PMNA 5K9CA 3GUGA 2W5FA 1NH6A 3G24A 1XWYA 1UR3M 4CU7A 2JEQA 5EMKA 1Q4WA 3R7MA 1DJNA 4IGNA 5D9PA 3P62A 3SI9A 1MFUA 2ZVRA 4LALA 1PHWA 3C8FA 2D20A 1EGVA 5T9BG 2W91A 3VTRA 1OC6A 4IG2B 5DY3A 3THUA 1QI3A 5REQB 1IIHA 5AC6A 4PB5A 3MUCA 4QR6A 3WL0A 4MJ4A 4QM1A 2BOGX 3GXTA 3WLOA 1OINA 4RPPA 5LIUX 2QCHA 1I2PA 5JIPA 4MF4A 3VUSA 2D2GA 2E8ZA 4HU8A 1S39A 2NQZA 3SJNA 4G8TA 2VO5A 3E74A 3RR1A 3VKJA 3W1AA 1XIJA 4RE0A 5C2GA 3TA9A 3WFZA 4NX0A 4QGCA 7ODCA 1DPMA 1YDOA 1JL8A 4NAFB 5EGRA 3GC4A 1Z9AA 4IMDA 5DMNA 3AWNA 5AYZA 3W81A 5BOEA 1G94A 4A8LA 4QXIA 2Y5JA 1TX2A 1HJUA 5PTDA 3BOFA 4PA8A 5TIMA 1J12A 3NQDA 4LJ3A 1RD6A 3TXZA 2TAAA 4GUFA 5I3DA 2J9YA 1E6RA 4KIRA 1S3HA 6CGTA 1MNZA 1CGYA 1IGWA 1KBKA 4MZ1A 4D9PA 2BB0A 1NAL1 5F4SA 3HGOA 5BXRA 2XM1A 4XZLX 3KUMA 3I7SA 4LVGA 5TBOA 3GNNA 5IDZA 1OZQA 1RP8A 3CAQA 4YMZA 3W25A 3INPA 3P67A 1J2WA 5CZ0A 4XD3A 2PDWA 1UBPC 3BSHA 4NILA 1IEXA 4J7RA 3GHRA 2BGNE 5B7YA 5EL1A 3VKDA 1G67A 3H54A 2CEQA 2QCMA 2V3EA 1NDZA 2JIWA 5LIKX 1W3HA 4LNCA 3M0HA 2PLKA 4L4MA 3WQPA 4GPNA 4PSRA 4PCSA 1TTQA 2PTWA 1O4UA 3OU8A 2OO6A 3S5NA 3A3HA 3L2MA 3QHMA 4QJ1A 4Y9PA 4H8NA 4XO7A 3UD6A 3QHNA 3GIQA 4MPKA 1C90A 2OQLA 2D69A 3SFWA 3GTNA 2AL2A 1BGGA 1JZ6A 2Y6ZA 5C70A 2DSVA 2Z2BA 3LHUA 4HHPA 3IGUA 1E5NA 2VEIA 1REQB 1UHVA 2GJNA 2X8RA 5LA1A 4C6FA 3DAQA 4MWAE 3CEUA 1GQKA 1FXPA 1DJZA 4KWUA 1J11A 4Z17A 5H1WA 4ORMA 1VAHA 3WF1A 2YDAA 3NCOA 3SQSA 1WOAA 3SECA 3TW6A 5AYBA 1EJXC 4GI4A 3W2KA 3F4VA 3W2UA 2AKMA 3FJNA 1XC4A 4NZJA 3MW7A 1KTCA 1AQFA 5C9XA 2PDKA 3IJ8A 1GNXA 1K7EA 1OF6A 1AODA 3N15A 1JCXA 2DIJA 5C9WA 1LL4A 5F2IA 4GO9A 3DFHA 4FX8A 2WNQA 2FZMA 1OK6A 4NNCA 1QAPA 2FVKA 3B8VA 4J3WA 1X6UA 4H19A 1PDYA 1U5HA 4HN4A 4J35A 4Q32A 4RE2A 1CXFA 1SJDA 3ABOA 5HQEA 3BGAA 1A3HA 2ATSA 1O60A 4NNAA 1OM0A 1WUEA 4GC3A 2PDYA 1MDLA 1TJ1A 4S3AA 3KDOA 4KCTA 4TVUA 1AQ0A 4DYEA 3DFPA 1A5BA 3NQGA 2QMJA 3PS7A 4JFWA 2DH3A 4AD2A 4AIEA 3WD1A 2FIQA 3WQFA 1I1XA 3FVDA 5I03A 5C6MA 1YX1A 3E2SA 1H5VA 4B16A 1IV8A 3Q2DA 4MUPA 3ABXA 3SUUA 4NZ4A 1F5ZA 1IE7C 2EPLX 3HGRA 5AHNA 3WBWA 1TV8A 3TN6A 4ZE5A 2VGIA 4DXKA 1H49A 2R24A 4M3PA 4FSAA 1QI0A 2WQPA 3VNKA 1M65A 5E0FA 1XUZA 3C61A 2GGEA 3T0BA 2JBMA 3W9ZA 3PBMA 3PUGA 5BOFA 4KT2A 4A3YA 2VYOA 1RALA 5I3FA 3S2MA 3HPXA 3AO0A 1S5WA 3L23A 1XLLA 3TLLA 3SURA 2G3NA 4E4UA 4LRTA 4AU0A 3GVRA 3PZOA 2A3BA 2YL8A 1E6NA 2HBXA 3V36A 3STPA 4PMJA 1IT0A 1XL9A 2Y0FA 1JCMP 5EU9A 3W7EA 2ZUWA 5D32A 3ARTA 3LM3A 2XIOA 1XYAA 4K7VA 4Z1CA 4IHCA 2G96A 4OBRA 1BKSA 3NOYA 1R2TA 1E0TA 1UD8A 2DIEA 3II1A 1MUWA 3BUVA 1JGIA 1M9HA 4E0CA 1E6ZA 3P2VA 5HQLA 1ITCA 4D8ZA 1UR0A 2W79A 3TW7A 2FGBA 1KFBA 3WUBA 1TMQA 1KKOA 5FEWA 3GNDA 2POZA 1FCQA 4YVXA 3I7RA 2AMGA 3BXWA 1WO2A 4UQCA 5TD4A 3SSZA 1CLXA 1OIFA 6TIMA 2PC4A 3BLKA 3A4AA 1W3KA 2YGYA 1YLVA 4N9DA 5DMYA 1XIMA 4AXNA 4DO7A 2JEPA 3MWCA 3LRMA 2WVVA 3IAPA 3O6YX 1E0XA 1TPWA 1JZ7A 3F2DA 3RITA 3W2NA 5AYXA 1KCXA 3EX6A 2WMGA 2G3FA 1XJBA 4BF7A 3UYCA 4YNGA 5EBAA 4MIMA 4E2VA 4UTFA 1SFLA 4KWVA 4S38A 1DJYA 2GWNA 1W9DM 1KBBA 1TVPA 1XI3A 3MMDA 3WG6A 2YBVA 5DBTA 3B0UX 1YTDA 4UR7A 4ADSA 3DC8A 4IF2A 3VX1A 3FHQA 1AW1A 3D47A 4F0MA 3W53A 2UY2A 3Q94A 4PGLA 2HK0A 1K77A 2YR1A 1J2BA 3MSGA 4GY0A 4AY7A 1RQBA 4HD5A 1Q6LA 4RXGA 3SRFA 4NRSA 2VVSA 3FAWA 4XZMX 4HHLA 3AQUA 4W85A 3WJZA 1KFEA 5AHLA 3N6QA 1IWPA 1QMLA 5D37A 5I78A 2HV5A 5FKYA 3S4TA 2Y85A 4JTAA 3VFCA 1VH7A 1XIBA 1CXLA 3SGZA 2VEGA 4ZEPA 4AC7C 2VX6A 4IP4A 2INFA 4KGLA 3FA4A 3LCHA 1CB2A 5I23A 4NL1A 4O8AA 3P3BA 3VUPA 5AYYA 2GJPA 3N04A 3MJYA 3L67A 3VNYA 2E09A 1J0KA 2ZICA 4M24A 3CQ0A 5AHMA 3RNDA 1MXDA 4NJHA 3IIPA 5I7GA 3EWZA 3SGGA 1OIMA 1K9TA 3DEQA 4GQQA 1V8EA 2OVLA 1M1BA 2OEKA 1UG6A 4HIBA 3KVKA 3HFTA 3KBWA 3ANUA 1V3HA 4MOZA 1WBHA 5JBEA 4E3VA 2ZUVA 2Y63A 3KOYA 1SO6A 1OFQA 3S1XA 1F73A 2XWDA 2NSXA 2P53A 3F5JA 1CB7B 3WUEA 1E40A 1I1WA 1OT2A 3HOJA 3A9BA 3N17A 2X0HA 3SCQA 1E55A 2V30A 4IQDA 1WE5A 1YDVA 3W07A 3R13A 1XS2A 2W67A 3CUGA 3B06A 3WDRA 4B3KA 5C8BB 4Q3MA 2WHKA 4I9TA 4YPJA 1QHOA 1P4CA 3NXLA 1DKWA 3PBYA 3ABSA 1XSJA 1E1CA 2JK2A 5E1QA 4F8XA 4I8DA 4U4MA 3WO8A 3KX6A 1SJAA 3TN4A 4G9PA 1OX5A 4LF1A 4CN1A 3WQEA 4JTJA 4JNYA 4QSHA 2C3ZA 2G4JA 2TMDA 1ZBKA 4XKYA 2PWEA 2ZRZA 3BV4A 5CSUA 2DZWA 2WVUA 4Q7IA 2OX1A 1UA7A 3WCZA 2WM0A 2XIJA 4IFOA 1QNRA 4GVFA 2NQHA 1FWJC 2GSHA 2E5BA 3BOLA 5EB8A 1RPKA 2GJXA 4AZ7A 3LCXA 4PTDA 4ML4A 2EAWA 2FDMA 1WQ5A 1V3MA 4FLSA 4W84A 1R9YA 4F4RA 2ZDSA 3DBNA 3HQ1A 3ITGA 1F6KA 4CCEA 3QZ6A 5IM51 1F07A 3NURA 1MRAA 3NTYA 4MB3A 3H6OA 1G4SA 4PB4A 1EF3A 3ARPA 1E9ZB 3TN3A 1PWMA 5DMLA 4QTGA 1VLIA 3WENA 3RCNA 3G1VA 3R43A 5CJNA 3PBGA 2QMKA 1DOSA 5IHRA 2AAMA 4CNOA 1OCNA 4HYWA 3L68A 1KXTA 3ARQA 3PHAA 4H2CA 4AWUA 1J9YA 1B90A 3CMJA 3E5BA 4GBDA 4FX7A 2B7OA 4GKTA 5T8GA 3KCJA 3STEA 5C2CA 1QNSA 1XGZA 1MVYA 1VFHA 3TAOA 2I1OA 4DJEC 1LRNA 2XGZA 2FPVA 4Z2LA 4GIAA 4CU8A 1QCWA 1HJQA 2TYSA 1KM5A 2VX4A 1GYMA 3HGSA 3DH7A 4Q6XA 2CBIA 1GT8A 3DKLA 1FXQA 3VGHA 3AUOA 1WDWA 1LM1A 3GXMA 3UZXA 2ZTJA 5HPCA 3I65A 1TMHA 4LPCA 3SCSA 3PZ9A 5J5RA 1OFOA 4X63A 2ESCA 1U1UA 1WZLA 1GKQA 3SCOA 4PUMA 7REQA 3TJIA 5A8QA 1BSIA 1Q6QA 4Y9OA 3TYZA 5FEPA 3M0YA 1GW9A 2P8CA 4IX2A 4TVDA 2VZVA 2WOQA 3KRZA 3G0SA 3CUFA 1UP2A 1XH2A 1OY0A 4K39A 3M64A 1VBJA 1GKRA 1Z48A 4C5ZA 3H55A 4JKMA 1TVLA 4O8RA 4FALA 1A50A 1EJSC 1XQKA 4CQDA 2QGHA 3TLQA 3F1QA 1B3XA 2OG9A 4N0RA 2VDHA 4GZJA 4OU1A 3IACA 4B5VA 3VGBA 3WMCA 1WX0A 3KOZA 5BNKA 4IL2A 3FCPA 3C2RA 3XISA 3VIJA 2JF7A 1F7BA 2WZIA 4R34A 3EXSA 3WD4A 2YW4A 3L12A 5M17A 4M80A 4CVUA 3W7QA 4WRHA 2OZTA 1KBIA 4GCXA 5CPOA 2VT0A 4H9VA 3BAJA 5LA0A 1NU5A 4RCXA 2BXVA 4Z2KA 3SRDA 4I9MA 3GH5A 4YWSA 1IEWA 1A49A 3KHJA 1SW7A 3G3MA 3MYOA 3GG1A 3N4AA 4S3BA 1UOZA 1UR8A 1ADOA 1EJUC 2BY1A 3BGJA 1IEVA 5F7UA 2VR5A 2PMQA 1V79A 2CPUA 1XBVA 4FLRA 2OFJA 3M5ZA 3QPZA 3CH9A 1OABA 4PMZA 1VIZA 4WJ8A 2GVYA 3HV8A 1FKWA 4YL2A 1IXPA 3SY1A 4YU1A 1VQTA 1GVSA 4I3GA 2QHAA 1VD6A 3CQJA 2D0HA 2ONEA 3OBKA 1M5WA 3ZSTA 3GG7A 4QLJA 1FHUA 4Q4RA 3FKRA 3S1VA 4YTRA 1OADA 3TSDA 4D8LA 5HNRA 2VRJA 3W85A 2Y7GA 3PPGA 1R7OA 3LBOA 1ITQA 1TKKA 1H1YA 4NJKA 5A6BD 1JDFA 1R3RA 3QLDA 2CBJA 2BZNA 1F3XA 4NASA 3EB3A 2NQ5A 1A5LC 4UR9A 2YL6A 3IIZA 3OA3A 1YTEA 3EKGA 2WO5A 4OWGA 1Z6KA 4FNSA 4IWWA 3STFA 4DJDA 2J79A 3SFKA 1UZDA 4BQ4A 1RBLA 2TRSA 5FIPA 2WJDA 4RW5A 1ZBWA 2F84A 1XINA 2WC3A 3MHFA 3P5ZA 5G4WA 2OGYA 5DXYA 7ENLA 3QRHA 1TE6A 1KTBA 3BLDA 3ATZA 4N4PA 2EG6A 3NG3A 2JGYA 1B5TA 4S2BA 1JEZA 1O5KA 1ODZA 2WBKA 1W1ZA 3HV9A 1FRBA 3QLLA 1WCGA 3H7UA 3N9KA 3VDAA 4D1IA 2WZEA 4C6JA 4C6OA 2FJUB 1S5VA 3W7NA 1HKWA 2HXUA 3GVQA 1U22A 3TNBA 1OSEA 4C7GA 2OJPA 3PZVA 4IZGA 4KS0A 2ZYFA 2G8ZA 2V5JA 4MNMA 1UH4A 3TR9A 3P61A 3UZYA 1ECEA 4Y8EA 3LGDA 1OBAA 1I0DA 4FNQA 3NQMA 4ZQOA 4WEVX 1F76A 2XFRA 2R14A 1OFAA 1FVPA 4K8GA 4RL3A 2XM2A 3PPHA 4XUGA 5FEXA 1D9EA 3T44A 4GNVA 1EDQA 3MY9A 1XYBA 2REQA 4UXDA 4UTWC 4GUIA 1KW1A 1YW1A 4RPQA 2GUUA 1EB3A 3DHFA 3KP0A 4KPLA 1DJIA 5I0DA 4IFRA 2DV0A 7TIMA 2EG7A 1C7TA 1FHVA 3U2CA 5BXPA 3E2QA 1H0GA 4HPXA 3QV8A 3VOGA 4NKCA 1GVIA 3PWIA 4LVDA 1VP5A 1Z32X 3SUWA 2GQAA 1BVNP 4PUEA 4L56A 1GKPA 2OODA 2PWVA 2WW5A 2Z1VA 3FDGA 3UP8A 4PL2A 4UR8A 1WPCA 3UGRA 1Q8AA 1C9WA 3CWNA 1HP5A 2CZVA 3UBPC 3U48A 3GG8A 2Z1WA 4NUWA 3S1GA 4TMCA 4INFA 5ABEA 1R8LA 1TPH1 1L8PA 1JZ8A 2X1UA 4J3XA 4UZUA 2X1IA 1F2JA 4WR3A 5DBUA 2ZRWA 4XWUA 5CGMA 1UH2A 2V8ZA 2YFOA 4NJGA 1KR0A 4H8HA 4MLRA 4IGHA 1TRDA 3SCVA 2E6AA 2UZ9A 3H2CA 4UTJA 2PGRA 3DFQA 3EWDA 4YN5A 1TPFA 5HUPA 1PE1A 3WBAA 5M1TA 2XVGA 1FTXA 1W54A 4JTSA 4GQGA 4QJ5B 2DSKA 3S0CA 3MMUA 3B9DA 5AC4A 1HO1A 1VPQA 3W74A 2XH7A 4AEOA 4R33A 3SIMA 2YCJA 3EA1A 4OZOA 4QS6A 2WSPA 3RLHA 3NZQA 1XR2A 4O16A 3SAZA 4GO8A 4BI6A 3S1UA 4GVHA 4ENLA 1XIDA 1E72M 3EWWA 4AYGA 4NZFA 1R2SA 2ISVA 3KZSA 4LW7A 4IIGA 2J7GA 1SW3A 4JKKA 3GHSA 2A5HA 5IFTA 4DB7A 2ZWZA 1H2JA 4QE5A 4AFYA 3EDJA 4XVDA 1EIXA 1V6YA 2ZZ2A 1DJWA 1M01A 4DLFA 3VIMA 3QKZA 2J74A 4JTCA 4EWND 1FHDA 4HB7A 2ANUA 1LYXA 3C0QA 5J04A 3EOUA 3I10A 1QXLA 4J5NA 4OQVA 4ACZA 4N9CA 1UKSA 1FHLA 4D6CA 2XFFA 3DYOA 2CFFA 3G3DA 1R47A 3S83A 3I7QA 1OVDA 4EXQA 1YQ2A 2EPHA 1RV8A 4O11A 4EANA 1MEWA 2QR6A 1LT8A 4PTWA 3CUIA 5FACA 5AC8A 4Q33A 5F2LA 3GQYA 3L4VA 1WXJA 4R7WA 2WSRA 2WYSA 1GWJA 2YX0A 3B9EA 6ENLA 4H9ZA 4PEKA 1KXVA 3N3TA 3TJXA 1GQLA 4KCUA 5CXPA 3STCA 1GUVA 1MW3A 5A6MA 7XIMA 1RCXB 2AMXA 1LL7A 2XGBA 3DFNA 1IIGA 5HNTA 5KITA 4YYFA 4KW2A 2PE4A 2VELA 4NY2A 4HPHA 2ADAA 1SZNA 4KERA 1JCYA 1T5AA 4NP7A 4DYKA 3U2OA 1UUQA 1A5AA 1HO4A 4I6VA 4HU3A 4Q8OA 1MEIA 5HAOA 3B40A 3VA8A 1MXSA 4M8UA 4JCMA 3GAKA 1GVEA 3F4CA 3S1WA 3EPMA 4JL1A 4LY4A 3LHTA 1ZQ5A 2ZX9A 4K2SA 3LA4A 2VEKA 3W00A 3MVTA 3AMDA 3VNMA 3NQ2A 4DPPA 2J6VA 1OCJA 3M6DA 1Q7MA 1AW5A 3GNOA 5LGZA 4N4QA 2YCIX 4QJ3B 5XINA 1UZ4A 1OD8A 4XZWA 4O18A 4AEEA 3G1FA 1VBGA 3DG3A 3NQEA 4MZYA 3B8UA 1BPLB 4GXWA 1TG7A 4AXKA 1UR9A 4KGJA 2VC6A 4KEMA 2BOFX 4ZFCA 3HQNA 1W91A 4ICCX 3N1AA 1GK8A 3W22A 3BARA 3ZR6A 1FWNA 4I8YA 4A8RA 1ZBCA 4OV9A 4DXXA 1ONRA 1IXOA 2V5BA 3VDBA 5EPDA 4LX4A 1IYXA 1FP8A 2WKLA 3N11A 1T40A 1GVYA 1ENUA 5E70A 2PC8A 3UGVA 4ZOEA 1VLWA 5J8LA 3OHMB 1LF1A 5E09A 3JU2A 2YA0A 3GDLA 1E6XM 3FAXA 3NZPA 3FDKA 2CLKA 2B7QA 1YNYA 2G95A 1S1PA 1DJHA 2XN1A 4WLCA 3CUZA 1QNQA 3TSBA 4D1JA 2QAPA 3AIVA 1V77A 5EMLA 4YLWA 2TODA 4G2DA 3GXNA 2P8BA 4WK9A 2EKGA 5B7ZA 1K8CA 2QDDA 2DW6A 3EPNA 1L8NA 2QT3A 1EYEA 1BVZA 3LV5A 2P0IA 1S5MA 1UD3A 2PDQA 1UZ1A 1YHTA 1VKFA 4AZGA 3DIPA 3WNNA 3IRDA 5T26A 4L6OA 3UCCA 3LN3A 3QJAA 1DIEA 2O55A 5CGQA 1VB9A 4PUNA 3AC0A 3JR2A 4WVXA 3AICA 1QK0A 5E6YA 2FB3A 4I9AA 1HL8A 3OYZA 1ZAHA 1O6IA 1VRXA 4IFKB 2NQJA 2Q71A 3TUUA 1QI5A 1CBGA 4MJMA 3DHUA 3R8HA 2R91A 4Y7EA 1B4EA 1DWFM 3LG3A 5M5DA 2J8FA 1P0BA 5REQA 1JF6A 3ITTA 3TEVA 4JY8A 1J8VA 2VFEA 3K4WA 1PBGA 3B9OA 5AYIA 2D3LA 1IR2A 3LCGA 3LNPA 1GG0A 3STGA 3NQCA 4AVFA 1PX8A 2FVLA 3ANYA 2ZUSA 1KWGA 2X42A 2GVLA 3AWOA 4IIBA 3J7HA 4ACZB 4IJRA 5AFDA 1O68A 3H8AA 5AHFA 3KRBA 3BJSA 3CB3A 4DJFA 3FJLA 2J27A 2TPSA 4Z1YA 4B5WA 2DDXA 1S2TA 2J7EA 1KQYA 2H3DA 2F6XA 3L4UA 3SRHA 4C6DA 3W1UA 1O66A 3RN6A 3NOEA 3NSNA 4CCZA 1WKFA 2Q8XA 1BFNA 3QMSA 3VDCA 2D0GA 4C6EA 3PZNA 1JF5A 3LQGA 4GC4A 3K2GA 4EAMA 1G0CA 5I24A 1YE6A 3DFOA 2IS7A 2DSWA 1FWGC 1WDRA 2JALA 3ZQ9A 5DEZA 1QPQA 2DVUA 5KZEA 4M1BA 3A3WA 2E3ZA 5I77A 4PTVA 2O9PA 3F5KA 3LX9A 4JIEA 1Y5WA 2F7FA 2ICSA 2FZ9A 1LQAA 1SSDA 2FZNA 2XG9A 3FJ6A 4DWSD 3N12A 3JZEA 1ZLPA 2JKEA 2YZ5A 2GUBA 4MLJA 2QF8A 1ME7A 4MTVA 4J3SA 2R1PA 3EKZA 1ALDA 3W2LA 2VM8A 5A6TC 3MUIA 1KXHA 3OG3A 2NX1A 2FMOA 3BCDA 2XIBA 2J13A 1VEPA 4NZ1A 2WM1A 4REQA 1L6GA 1N8FA 4E6MA 1YTKA 2ZXAA 1E71M 2DZTA 4JIQA 2ZUTA 4V1YA 3C6CA 4IQEA 2GQ8A 4O1AA 2DIKA 1V6UA 1JAEA 2RJGA 1NOFA 3G2GA 1JCNA 5ABFB 4AWTA 3MSDA 3W38A 1N7KA 2RDUA 3TU9A 2XINA 1GEQA 2QCLA 4IMEA 1SYTA 3LERA 2OT0A 1SR0A 2V2HA 3TZFA 3CIXA 4MWAB 3EYPA 4DIAA 3ZS4A 1TQXA 1BHGA 1LT7A 3CHCA 1Q6DA 3NQFA 4IUOA 2QJMA 5GNYA 3LCFA 3W1XA 2FPTA 1HG3A 3CV6A 1XYZA 4ZO9A 1XLGA 4HZMA 1WZKA 3W76A 2V67A 3E49A 1CI1A 4TXEA 4HOXA 4JL2A 5IOBA 1V0MA 1TTJA 1XIFA 5AECA 4KFNA 4GUGA 1OF8A 1AVAA 4B9ZA 2NLYA 4BY3A 1MW1A 1UPMB 4D6EA 5BYWA 3KVLA 3PJXA 2E6YA 2OQYA 3OJGA 4Y9NA 4V1XA 2WNZA 4ZGYA 4UTTA 2ZRUA 3RXZA 1MO0A 4KCWA 4HJFA 4UFKA 1TA3B 3NL3A 2WZMA 4DBDA 1MFVA 1A4MA 4O54A 1T8XA 4M1RA 1UUMA 1MZRA 3QQWA 4B2DD 3RCMA 1J0ZA 1BEUA 4UCFA 1KRAC 1PEZA 1BVWA 4J27A 4JY9A 4Q4SA 4GD0A 4JDBA 4TUFA 1XG4A 3OLEA 3NEVA 3KL0A 1TO3A 1WDQA 3UFYA 1B57A 1W8SA 4DVOA 2XH0A 1XH1A 4HHMA 3LXAA 3S3GA 1E15A 1TV3A 3G1YA 3TOYA 3LHYA 3L4ZA 3I3DA 4KQNA 2IKIA 2PP3A 3WLSA 1QPOA 4HA0A 3NEHA 3GFYA 3EBVA 1F3WA 5HJXA 3W1RA 3ZOAA 3QW3A 5D2WA 4F0KA 1Q13A 3FOKA 1CPUA 1XH0A 4F2TA 1SZFA 2QDGA 3UU0A 4Q4KA 1RHCA 4US5D 2Y88A 4FEZA 1PKYA 3CNYA 4LQ1A 1E4LA 4KESA 2FH6A 4J2PA 1MQPA 1CGTA 3WJSA 4D6HA 4FXFA 4X9SA 3ARXA 3NQAA 2G3IA 3H2OA 2P88A 2ZDRA 3MYPA 4J28A 4PR4A 3AZRA 3PTKA 3SGUA 3PJTA 1HVQA 2Y5SA