2PTDA

Phosphatidylinositol-specific phospholipase c mutant d198e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQEKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 107
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2ptdA00
4QJ3B 4QJ5B 3RLHA 3QR0A 2OOGA 3PTDA 4I8YA 4GNKB 1VD6A 3QR1A 3EA3A 7PTDA 4I90A 4F2BA 1YDYA 1AODA 3V16A 1QASA 4OECA 2PZ0A 3V18A 2ISDA 3H4WA 4F2UA 3QVQA 2O55A 2P76A 1XX1A 2FJUB 3EA2A 3OHMB 2PTDA 3I10A 4F2TA 4I9JA 3CH0A 5T91A 3H4XA 3RLGA 3NO3A 1T6MA 4Q6XA 1T8QA 6PTDA 4I9MA 4QJ4B 4PTDA 2OTDA 3EA1A 2OR2A 1DJZA 1V8EA 2ZKMX 4S3GA 3L12A 1DJGA 3KS6A 4RV3A 1DJYA 4I9TA 4R7OA 5T9BG 3KS5A 1DJHA 2PLCA 4RW3A 4RW5A 1DJIA 1QATA 1DJWA 1ZCCA 1DJXA 5T9CE 1O1ZA 2F9RA 3MZ2A 1PTDA 1GYMA 5PTDA 3V1HA 1PTGA
chains in the Genus database with same CATH superfamily
3LQGA 2XVPA 2AOSA 4AZIA 3BZJA 1EA0A 3GS6A 3URAA 4GWEA 4IGMA 3SUVA 1TJRA 1JFXA 2EF9A 2ZWYA 2IXUA 2Y4SA 2DDXA 2G41A 2R1NA 9RUBA 3WUGA 1QOXA 3G6LA 4F2BA 1S5TA 4B3LA 5TIMA 4L6HA 1KM4A 1V3KA 4H41A 2GSJA 3WQFA 1Q8JA 1QPQA 4GFIA 1FWFC 2V3GA 5JMUA 3LK6A 3OG2A 4QJ1A 1XI3A 2D2HA 4IG2B 3B0XA 3WLPA 3CHFA 5XINA 2BOGX 4RNIA 1YIXA 5JU6A 1TPWA 3GDTA 3VZYA 1UQYA 3A3XA 2QCFA 3R7MA 1S2UA 1W5OA 3BJTA 1MRAA 3VGDA 2FZ9A 2JK2A 5AC8A 4JN7A 3BC9A 1XFCA 3WNMA 3TN6A 3SQSA 1TRDA 2WHJA 1K9FA 4GXWA 3MHFA 3GIPA 5LXEA 2ABBA 4QX4A 3ZJKA 3KP1A 3GXTA 3MUY1 4UMAA 2PD9A 1DWJM 4EP8C 1US0A 1UJQA 4KF1A 4RDWA 4IXHA 1M53A 2YFOA 4BEQA 4EIVA 1GOQA 4O1BA 4LV4A 3IACA 3LLDA 3AIEA 1WE5A 1CXKA 5A6SA 1V3LA 1KTBA 3W1QA 1FWAC 3STGA 1C8QA 2VC7A 1UD3A 4OV9A 2PAJA 1ZRQA 4TIMA 1ESWA 3WNKA 3S1WA 3PHAA 4DY1A 2WPBA 2X7VA 1YNQA 4A3RA 3W7CA 4OJYA 2WANA 4CD7A 2XFFA 4TX9A 3CZJA 1GVSA 3ARZA 4LY4A 2GJXB 2OGYA 3KCOA 4UFKA 4IMFA 1AFSA 1VBGA 1ZS2A 1SJBA 5HJXA 4IL0A 3ZYZA 3UG4A 5D9OA 5E9XA 1YDVA 4PFHA 3V0TA 4AD5A 5BNKA 1KM1A 4LJ3A 1A5KC 3RGTA 3EA1A 3W6MA 2PLMA 3B8DA 3A9BA 2H8XA 3GAKA 3KLLA 1CGTA 4H19A 3KUMA 5G1YA 3K8MA 4Q4RA 4QCFA 1ISYA 3MWAA 3ARSA 4UTWA 3BSGA 2GGHA 4Z1DA 5HNNA 3TA9A 5LA0A 3HJEA 1OGGA 2QCMA 4MHBA 5J8LA 1V79A 3VGEA 3W7IA 5IFPA 3MMWA 4PB5A 5AHEA 4FK9A 1JZ4A 5F4XA 1GVIA 1DJXA 4FLRA 4DJFA 2DUXA 1TUFA 3AOFA 1OF8A 3OA3A 3WD4A 1OM0A 3S6DA 1RSCA 4DUVA 1KQZA 2ACUA 1A5NC 3TW7A 1OVDA 2RHGA 3UU0A 4AHQA 3RO6A 3KL3A 4W84A 3RU8X 3A21A 3F2BA 4FR6A 1WO2A 4RDYA 3QKEA 3LNPA 3P8JA 4GQQA 4HMCA 3DGRA 1DWGM 3VZZA 2JFEX 4N9CA 4R88A 3UG8A 1REQB 8TIMA 2CLIA 4WUIA 3GFZA 4MY1A 3CUIA 4IISA 3TOYA 4JTHA 5FSDC 2XTKA 3K1GA 4ERIA 4G7FA 4YNGA 3DHPA 1GONA 4KQNA 3EEGA 3MJYA 3TJ4A 2VC9A 4WX2A 1VYSX 3WBAA 1GZGA 3CZEA 3VPLA 4YTUA 3C2EA 3EPNA 2REQA 3OBKA 4ZL1A 4M82A 3TYCA 1GOIA 4ZZ9A 1QOQA 2QAPA 1BG9A 4D2JA 1GHRA 5FF3A 3TYEA 3QQWA 4LYQA 3M5YA 4BQ5A 3N2XA 2CZFA 5M2FX 2QJGA 3AS1A 3AXXA 2E40A 2J75A 8XIMA 1C8VA 1W32A 1OY0A 3R11A 2GUBA 2X1SA 4IMGA 3OVRA 2I7GA 5E0CA 3S47A 1QVBA 3V0UA 4L56A 1LT7A 2POZA 3JR2A 1AH4A 2X41A 3QPEA 3F4WA 3N18A 3RLUA 3VKCA 1AODA 2QCCA 1DIOA 3PPGA 1ODUA 1BXCA 1PIIA 5B7YA 4QLJA 4DZHA 1OFAA 2CIPA 4GBUA 3VNLA 3AO0A 3ARVA 5F2LA 4HNUA 4R33A 3Q2DA 3QZ6A 1AL8A 4XTDA 1TX0A 2HQAA 3RU6A 3NGJA 4Y90A 4C6LA 2HJPA 3NYDA 1N7KA 2HDJA 2F84A 1Q2SA 3BH4A 3GDRA 3VIJA 4DEFA 3GG7A 3ZQ9A 2Q71A 2INFA 2HNHA 4HA4A 1JPIA 2YSWA 3IVUA 4L1GA 5C70A 1XC4A 4Q32A 1E4LA 1C8YA 3VM7A 1XQKA 1Q7QA 1P48A 5HJYA 1DKWA 1RAKA 2YCEA 1HTIA 1UH3A 3WFLA 3URNA 5LNWA 3AMCA 1I2NA 5FJUA 2VJXA 1SW7A 5MKGA 1ONEA 3W7QA 5DBUA 4GX8A 2V30A 5BRQA 5CKSA 3IGHX 3MW7A 2F2KA 4P61A 3W26A 1GQLA 1RD5A 2DZXA 2V67A 4OWGA 4BHYA 3W2JA 3QTPA 4TMCA 1XFBA 3NXFA 5CG0A 4YTTA 1I6NA 3AXIA 4W93A 3S4TA 3AMLA 4ZTYA 2JKEA 4RZBA 1XIBA 2QCDB 1AUSL 3OP2A 3T07A 4JY8A 4W5ZA 1QPKA 3TAOA 1RV8A 1UD4A 4LRSA 3NOEA 3N2BA 2AGKA 4JXCA 1AMKA 3VOIA 3LCXA 1J6OA 3A47A 1EOMA 4HD5A 4BS0A 5AYBA 3P62A 1XRSA 4H9TA 3VNZA 2EPLX 4ZO9A 3HPSA 4OU1A 4J7RA 4LUJA 1OBAA 2ZA1A 3CZLA 3KLKA 2ADAA 4JKMA 1K9DA 1RD6A 3GIQA 1XPYA 3TQ0A 4JFSA 4DUOA 4AXNA 1V03A 4J3ZA 3MANA 5EU9A 4EPBC 1UMLA 3TMLA 5I3JA 2PDUA 2V2CA 5HMDA 1FWEC 2HBXA 1NEYA 4QLKA 2D0HA 4HZ8A 3NPVA 5DCBA 4WKHA 3O05A 3EWUA 1UP2A 3EDJA 1IR2A 2GVYA 1DJIA 4RX0A 1A3WA 1UUMA 4K3ZA 3G1VA 1JPDX 2NLIA 3ZVIA 4L1WA 3LXAA 2DY3A 1QPNA 5IRPA 1TQJA 2W61A 3SCNA 3VDBA 3A9IA 5G1TA 3B9OA 3PZUA 4NI3A 4HZ6A 1EDQA 1GNXA 2EBNA 3S2NA 4YCOA 1WYIA 1G4PA 2PFHA 2NT1A 1XLGA 3TNBA 2PDYA 1OABA 4L9XA 2ACSA 3WQCA 2CWNA 3V3WA 3IGUA 4H83A 2VX4A 2DZTA 2JBMA 1KBIA 2NX9A 4UTLA 3P0WA 1JDFA 4GZ7A 2C3ZA 2ZRXA 4W7WA 4DF1A 1VCVA 4LC8A 3E6EA 4P8WA 1XRTA 3OBAA 3WK3A 1LBLA 3KEHA 3TEVA 2ZVIA 4JN6A 2V81A 2Y7EA 4J2PA 3VD3A 3O6YX 1L6FA 1S1PA 3FOKA 2BY1A 4DUWA 4DPPA 2UY4A 4W9TA 2MUCA 2BMBA 4H04A 3L4TA 1R3RA 4B4HA 4LU0A 3EX2A 2IKJA 1LG1A 5DMYA 1UWQA 3LY0A 3R10A 2G3NA 4GK8A 2G3IA 2R6OA 3DXIA 3H2OA 4RW3A 4LBSA 2XDFA 4EPEC 3KWXA 3QMRA 3OZYA 1E0XA 1BQCA 4D9PA 4B2DA 3T1GA 3P60A 3IJ8A 4I5XA 3RPDA 1SW3A 1TPUA 4HOWA 3W82A 1OHLA 3MJMA 4CEXC 1LOQA 1ZENA 2VDHA 1E43A 1W37A 2Y5JA 1EJ7L 1AJ0A 4LAZA 4O57A 5FJRA 1RH9A 1UD8A 3LM3A 2XHYA 4GGHA 1GJPA 2NUWA 3ONBA 1FBAA 3UVIA 4GZIA 1HUVA 5DO8A 3CPGA 4HNNA 5BXRA 4ALDA 3DC0A 1W3IA 4CCEA 2ZICA 1TCDA 4WR3A 1CWYA 4O11A 4JKLA 2EO7A 2ZADA 1E0WA 1EGVA 3NSMA 1M3UA 5CPLA 1XGZA 4CN6A 5LKYA 4L4MA 4M3PA 2CHRA 1I0DA 2C6QA 4GACA 4CVUA 3MDUA 2DSVA 3LYEA 4FXFA 4AH7A 4MNLA 4MVAA 2ZA2A 5ABFB 3QOKA 4CCCA 5BOOA 4QS6A 1FWIC 4HHHA 2A85A 3RAOA 4GVGA 1WZLA 1PHQA 2Y7FA 2YKKA 2G4JA 5I6SA 1HP4A 1PZ3A 3OLIA 3VDAA 4HNTA 3S1GA 4FZIA 4QE5A 3K13A 2ZBTA 2Z1WA 3TDFA 2BGSA 1QATA 5ABHA 4PUUA 3D47A 2PDFA 2F9RA 4W8BA 3WLRA 1CXLA 5FKYA 3QGVA 1H61A 4O1CA 4F0SA 2XIMA 4QJ5B 3S9ZA 2PDLA 4GYJA 3M0IA 3TE9A 3URBA 5BYWA 4TQTA 4P2VA 3PAJA 4V33A 4QAWA 1P6WA 3H4GA 3WUEA 1E9LA 3FVDA 4Z1AA 1TV7A 4JTFA 4PL1A 3KW3A 4IHCA 1YDYA 1W8GA 1FWBC 1ZL1A 1CGYA 4XZMX 3BG5A 3PBYA 3WQDA 1WDPA 4Q4SA 2RDWA 3WUBA 4F2UA 2I5IA 2QCDA 3OLGA 1XX1A 3DHUA 3EA2A 4KWOA 2ON3A 2V3EA 2DVTA 2DIKA 2J88A 4FAMA 4C6FA 4U2ZA 4A3YA 2PWFA 3PG9A 1T8QA 1O66A 3GU2A 1HKMA 2X2YA 3B8WA 4NVTA 3AIWA 1UZHA 4CNSA 3RM9A 2VO5A 2ISVA 3E49A 3BOLA 4JTCA 2QR6A 3TV8A 4TVDA 2EG8A 1MDLA 4NZFA 1CPUA 1RUSA 2D3NA 3T0AA 3VVGA 1X38A 2A3CA 4NZCA 5T9BG 1JI2A 5CSUA 3C3UA 1H63A 2VFEA 1VFSA 3SM0A 1W9BM 1UH2A 1JZ5A 4N42A 4JNYA 4ZQRA 3RXZA 1VYRA 3PS7A 3R43A 4DPQA 5AN7A 3F4DA 3QOMA 4RKAA 3GW3A 4NJJA 3MUXA 2E68A 4W87A 1X39A 3HZ3A 4FX6M 3AHZA 2BXVA 1UH4A 3WY1A 3P80A 1DWIM 2Z28A 3H22A 5E93A 3PTQA 4PRTA 4QM1A 3CL7A 3MUAA 5JVLA 2O7SA 3EX6A 4DXVA 4JQ2A 1NTHA 3PM6A 1AD1A 2V3FA 1E70M 2P76A 4V27A 4Q6JA 1XGEA 3D46A 2E5BA 3LZ5A 4D6JA 3VNJA 4ZO7A 2A1YA 3R1ZA 1EZ2A 2V0TA 3V1PA 4RDVA 3M16A 3E38A 4P7NA 2D0GA 5D9MA 2O0TA 1Q6GA 2FGBA 3ITCA 2BY3A 3RITA 4H8UA 1W91A 1EX1A 3LHZA 3ALGA 1P0NA 2Y89A 4W7UA 3G0SA 4MLRA 1YBQB 4MJMA 4LH8A 3TKFA 4P8VA 4WQ6A 3NURA 1FFRA 4HSHA 5REQA 3SUUA 4U28A 3ITXA 3N1AA 3T44A 3TZNA 4MZYA 5A2BA 2VT0A 1XLJA 3NQ8A 2C1HA 4O54A 4ATDA 4HOZA 3W2KA 4Q8PA 8RUCA 3MI3A 4D6DA 4ONVA 3VD9A 3O3RA 4YN5A 1RXOB 4CNTA 3KCLA 2C0AA 3BUVA 3L5MA 1GQKA 4NAFA 3PTDA 4L9YA 3M43A 1XHGA 3GR7A 3LHUA 2YJQA 3B9NA 3G1AA 1SW0A 3CV1A 1M01A 3SGUA 4Z1BA 2OKTA 1LTDA 4NY2A 5FL0A 3AYRA 4A8LA 2DT2A 4DBUA 2ZX5A 2Y7GA 3CH0A 3A4JA 1EXBA 3NQ6A 3FSUA 2ZOXA 1F4HA 2GGJA 1CB7B 2ZKMX 1EF2A 1UKPA 3HJZA 3MI6A 4UFLA 4U10A 3DBNA 3S2MA 4C6JA 1EGMA 3L66A 2NT0A 2PB1A 5FEZA 4AW7A 5SWUA 3N3MA 3I6RA 4MB1A 2VQTA 4HU3A 2VC5A 3FGCB 2VGBA 5ABFA 2XGBA 1KXTA 3P84A 1F3WA 2HPIA 1MUMA 3CNYA 4AC7C 5EBUA 5EMJA 3AZSA 1R2SA 1PKYA 5CJNA 3GHUA 2EPKX 1DVJA 4HIBA 1EZWA 5HQMA 4GQ0A 3IUHA 1YX1A 1RY0A 3A3WA 1M65A 3AMKA 5G4WA 3RIKA 2E8ZA 1W9PA 1L6SA 3VZXA 2E77A 4I8YA 3H2EA 2V38A 3ARUA 1UP0A 3AWOA 3QR1A 1XYCA 3AU6A 4DQWA 1PX8A 1B57A 4PUJA 4XQ6A 4ZQMA 1Q4NX 2VFHA 3SCSA 4EACA 2CZ5A 3MVTA 1ME7A 2WNWA 2EG6A 3KCJA 1EJTC 3TXVA 4L9ZA 4PODA 1VEOA 4GCXA 4F2TA 3IIOA 3RLGA 2OG9A 3SY1A 1JDDA 2YB4A 4B4FA 1HO1A 2J7HA 5LYRA 1TWWA 4W86A 5HMSA 3HPXA 4JTLA 1YEYA 2OX4A 1LQ2A 3ZR5A 1S2TA 1LUCA 5D9PA 1Z48A 2YGYA 3OZPA 5HNUA 4AEFA 4ZBCA 2GZXA 5A5WA 4J35A 3I7QA 2QCLA 3HPAA 3UWYA 4DF0A 3T2QA 3V35A 1FQ0A 1P0BA 1PIGA 3SZ8A 1NIUA 4LAUA 1PKLA 2ZX9A 2C1GA 3GNPA 3DN5A 3PZVA 1LP6A 1UWUA 3W7KA 1PV8A 4O4VA 4AD0A 1FWSA 3OVGA 1PYFA 1JD7A 1UD5A 1FOBA 1NU5A 3S2CA 3T78A 5H2ZA 3BLKA 2HE5A 3WIJA 4GKLA 1VIWA 4PRRA 2CPUA 4E4FA 2JF7A 1ECQA 4KCWA 2PDKA 3W81A 2P0IA 3UYIA 2FHCA 1M7OA 4LGXA 3CMFA 3ZXWA 4WDUA 2JIWA 4GHRA 1JCYA 5L6UA 1AH3A 3DHFA 2YBVA 4DJEC 1OX6A 2PGRA 1IE7C 2QUVA 3E1F1 5E9AA 4HMDA 1T0OA 3I3BA 4D6CA 4XZBA 3LTYA 3JUGA 1SR9A 1KC7A 1Q7MA 2BX7A 4WXZA 3LCWA 2NWRA 2PDCA 2QAFA 4W89A 3UETA 1IR1A 2E09A 1DQXA 3DI1A 1F3EA 4S2BA 1DJZA 1IZJA 3UJFA 4Z42C 2D20A 2ZRUA 3P74A 4GUIA 3FV9A 2EKGA 2Z2UA 4LUYA 4F0HA 5D03A 5A8MA 3W84A 3POCA 3J7HA 2V9DA 1SSGA 4UC5A 4HKPA 1GW1A 4LUTB 4S39A 3R8GA 4BY3A 1K8CA 3FDKA 3BW3A 3VXGA 1T96A 1PIFA 5AB3A 3NZPA 1QK2A 2D23A 3M7WA 4Q8VA 1O7AA 3T05A 3IAPA 4R7JA 6TIMA 5FJOA 1V7YA 3F7JA 3NPUA 2WZTA 1YBQA 3W70A 2H90A 3LV6A 4ZE5A 2GWGA 3HV8A 3W7MA 5DELA 4K6AA 3BV7A 3WELA 2XISA 3PBWA 1WKFA 3W1MA 2WSQA 3SAZA 3LPOA 3OJGA 1KFEA 2QVNA 5CZJA 3T55A 2HK1A 4IMAA 2OEMA 1UR9A 2W0UA 5T8GA 1DQWA 3BG3A 1BSIA 1SM9A 2X40A 3TYZA 3HFYA 4EVZA 5KTLA 3UESA 3FXGA 3M44A 3OHIA 5XIMA 4UTJA 3WQOA 2ZXAA 2V2HA 1TKKA 3LPPA 1H7PA 3KL5A 3COTA 2W62A 3NZRA 2TSYA 1U5JA 1TPEA 3WLKX 4ACYA 3ITLA 4LS2A 1KWGA 3H24A 4NQ1A 1EPVA 3QGAC 4HYRA 4QRNA 4YLWA 3U9IA 4M6QA 5JH1A 4R7WA 1QK0A 5LIYX 3LGEA 2QS8A 1C93A 3W1NA 3PP7A 3SCVA 4Y9AA 3SI9A 4UFJA 3WQ6A 3BLPX 1LLZA 2O9PA 2Q01A 1KRBC 1XICA 2NVAA 3U8GA 3WQPA 3G6MA 5BU6A 2J13A 4HYVA 5FEPA 4AF0B 2XUCA 4FHAA 3MZ2A 5I77A 4N4QA 3EKLA 2P8BA 4O16A 2FHFA 2DZBA 4PB4A 5JUVA 4V15A 4IQDA 4S3BA 3UVAA 5AY7A 4IZGA 3QV7A 4YL2A 3G77A 2OKOA 5DT7A 4GNKB 2IPJA 3THAA 1QNSA 5C2GA 2HXUA 4FF7A 2ZX6A 1JDEA 4AIOA 3E0LA 1S46A 2WSPA 4B3KA 3W86A 4F4RA 1E9IA 4WIWA 1KBLA 2YCIX 4NZ3A 1X96A 1SVDA 1J2WA 1ZHAA 4H01A 1WXJA 5D05A 5CH9A 4YMZA 3GD6A 2YXXA 4QQ3A 1H0GA 4GIEA 4O8RA 3UFYA 3LU2A 2J78A 2KAUC 1CIUA 2O56A 3E2VA 1GEQA 3NEHA 2Z00A 1OZMA 2PRLA 3A24A 2YOCA 4C60A 2WB5A 3GG0A 3BLIA 4EKJA 1G69A 4DJFD 3HTWA 3W7JA 2OQLA 3CL6A 3IGXA 1KBKA 3L9CA 3UWZA 4QE4A 1JVNA 1UIOA 1EYEA 3KOXA 4K68A 1E6PA 4ACZA 3KTCA 2PTZA 3QRHA 4UQCA 3N11A 1J11A 3VOCA 3EWDA 1Q6QA 3SRDA 3HPFA 5EMYA 3WF2A 4ATWA 2BP1A 2R1KA 1YNPA 2YA2A 5J04A 4C65A 4DBEA 3PZOA 3VE9A 1Z89A 3ABOA 3VUSA 2VGGA 4HGXA 3V4BA 4DHGA 4HB7A 2Q02A 1YPIA 5LXXA 3KP0A 3TTQA 1FRBA 4Q8OA 2HXTA 3IJIA 3UERA 1E3ZA 2PURA 4CVWA 1NP2A 4X9YA 3VK5A 2Z27A 4DVOA 4UTKA 2O92A 4NG3A 2Y85A 3V18A 3TW6A 2OT1A 2YPIA 4KMQA 3UY7A 1JR1A 3G8EA 1UR1A 4HU0A 4C6PA 2PDBA 2ZE0A 4WJ8A 3GH7A 3KAOA 3PSWA 4HPNA 1PSCA 4KS0A 1IYXA 1M6JA 1OYAA 3BPWA 3WD0A 1KFKA 2P0OA 3VD7A 1IXPA 4ZXLA 3VABA 1Q6LA 2Z6IA 1VJZA 1B4KA 1IXQA 3FAWA 3DCPA 3O0FA 4RXFA 6XIAA 4V1XA 1NF7A 2J6VA 1MI3A 4JAWA 5AC5A 4IQEA 4E2OA 4J1OA 3NQVA 4J3XA 3FYYA 1B31A 3FLUA 1A3HA 2G3MA 5I09A 4KERA 3LRKA 5I3IA 2W27A 3WF4A 3NZGA 4ZQNA 4JIRA 4M81A 3VOGA 3M0XA 4MWAD 4OBTA 2YLAA 4LUTA 4HA0A 1ADOA 3HGSA 3P5YA 4JIQA 2W9MA 3H2AA 4XZWA 1FWHC 1Q85A 4K1WA 3AUJA 2OOGA 4Q22A 1GOOA 5E6YA 2QPXA 1R2RA 2CW6A 3B40A 1EA9C 5GNXA 4E2VA 2IQ0A 1J18A 1SZRA 1ZJIA 4IWWA 2CESA 4RE3A 2E6AA 2V63A 3P2VA 3LEPA 2QZRA 2A3HA 1A53A 3TTYA 3BCDA 3G3MA 1PKNA 2A3BA 3NQGA 4NJIA 2WMGA 3JS3A 1W3KA 4V28A 1Q6EA 1B3XA 3WK0A 4A05A 2WVVA 4IQJA 1Q6FA 4PBEA 4UMCA 5I07A 3QSTA 1LL4A 3CAKA 1TTIA 1QNRA 1NDWA 3WJYA 3V75A 2JKAA 2ZXBA 4HPXA 1KTCA 2WNZA 3PZGA 3T09A 2G8ZA 2WMIB 4GI6A 1RPXA 2VX6A 2VD9A 3T2PA 4NAEA 3T81A 2HS8A 4B5NA 2NX1A 2QDDA 3VIMA 2VX5A 3ECQA 1D9EA 1FHLA 3P3BA 4QDWA 2WMJA 3I4EA 3PWGA 3MO4A 5CEWA 1MFVA 3USBA 4AZCA 4O18A 1X1OA 5AVNA 3GZAA 3KDOA 2WKJA 3O9NA 2BHYA 3AIRA 3BMXA 4H8HA 3EOSA 1A0EA 3AIUA 1JCNA 2V5BA 4DXKA 4AF0A 1TMQA 3GDKA 1JPMA 3WH6A 4HVXA 3Q4DA 3N34A 4BQ3A 3GNOA 4Q7BA 3GNNA 3IV8A 1KCZA 4GZJA 1O68A 4F8XA 4OBSA 1O12A 2VR2A 4OTKA 2UY2A 1E73M 4LYRA 1P1MA 1Z69A 1IEWA 1AQFA 3WMLA 4UQEA 4I8DA 3AZTA 4PEKA 1XDLA 2V2DA 2YL5A 3I65A 3OGRA 6PTDA 1X1ZA 4AZHA 4EOUA 3DFNA 4Z2LA 5GQBA 1XV8A 3KOYA 1F4AA 3S8HA 3UYCA 3THDA 5A6JA 3CMJA 7TIMA 1TV8A 3RCNA 3K4WA 1AMYA 4F0KA 1PVNA 1WZKA 3CEUA 4RE2A 4C6BA 4IPJA 2GJNA 3BO9A 3MPGA 3G2GA 4HA3A 3KOZA 3FJNA 1XYLA 4UFIA 4BA0A 4BZYA 1EL3A 5K4XA 3RILA 1MUWA 4UR7A 3IIPA 2D22A 5KETA 1V0KA 2EKCA 4I6KA 4M56A 4M7SA 4AEOA 4ZQOA 4ZOEA 2PWGA 1J6PA 1KBJA 3FYPA 3WK2A 3WDQA 3CQIA 2WAGA 4XBKA 4HNVA 2ZWZA 3PBMA 3AHTA 1DXFA 1FX6A 3DFTA 4F0RA 1XLIA 2VELA 2PRMA 1LM1A 3ABQA 1Q45A 4BF9A 2ZUVA 4Y9NA 1DXEA 5CAKA 1E5NA 3PANA 2DFAA 3GC2A 5CGMA 5EMUA 2BOEX 4YXGA 2C16A 1RY8A 2NXGA 5BXSA 3DBPA 3KXQA 4XAGA 1JZ7A 3HBLA 1W54A 4QFUA 2Q8LA 3LHVA 2NV1A 1Z44A 4L4PA 4WGHA 7A3HA 3SJ3A 4UOQA 1NM9A 1CXFA 3IJ7A 3S5OA 4B2DD 2PLKA 3MP4A 4PULA 2ZCGA 5AYXA 1OYBA 1X6UA 2TMDA 3L67A 2UBPC 1KGXA 3ICJA 3BJFA 1PS9A 1ZJBA 1JL8A 4MY9A 1IEQA 3EKGA 1ICSA 3H8AA 3MS8A 4AU0A 1AW1A 4QLLA 1IIHA 1HKJA 3N6QA 1FXQA 5D30A 4O0KA 4CLMA 4LVGA 4LY8A 1TV2A 1K7FA 3PULA 4KIEA 2ZIDA 3EBVA 4W5UA 4US5A 5I0DA 1XR2A 2I16A 6A3HA 1OK4A 4M6VA 4RXGA 3KBSA 3GB6A 2JALA 1H49A 1MDRA 3LSBA 3GH4A 2BLEA 3WLMA 4WXYA 4C1NA 4GRSA 1EX5A 4GVHA 1TPB1 3LPGA 1N8FA 1U30A 1NF0A 3GFYA 4A29A 3N6JA 2G3JA 1WOBA 1XYBA 3GXFA 5BU9A 3SN0A 1L8NA 5IDZA 1OGSA 4NASA 1SPQA 3LPFA 1G94A 2Z4GA 2EG7A 3UBPC 3VYLA 1SO4A 4P7LA 2XJ7A 1G1YA 1EPXA 1ZLPA 4MUZA 2GVLA 4PTDA 1KR1A 5KZDA 1AH0A 4KFPA 3ATYA 4IIEA 4QNEA 4Y9PA 1KFJA 4LUSA 3YPIA 3A64A 2FZMA 1J96A 2ZX7A 1MFUA 3MT1A 2BZNA 3ZR4A 1SZFA 4L65A 1LBFA 2GK1A 2J24A 3UJSA 2W92A 4DZ5A 4JTAA 2VX7A 4WF7A 4DRSA 1DJWA 1LCOA 3OA5A 4IJRA 2XN0A 2WJDA 3S5SA 1KWKA 2Y8KA 3G1DA 1Y65A 2HMCA 3SCWA 3W1XA 4EPKA 1FUYA 1HNYA 2E7FA 1TRIA 4UOZA 1U1HA 2Z1KA 1EJWC 3FXYA 4FNRA 2DZAA 5GJNA 4IPPA 3BAXA 4I5UA 2ZZ1A 1OJXA 2UY5A 4GC3A 4JGDA 3Q94A 4Q8QA 3T6CA 3U3HA 5DY3A 1RR2A 3CXOA 4GQGA 2GQ8A 4JFWA 1V02A 2F61A 2DT0A 1PBGA 2ZZ3A 2OMAA 2FFIA 3EX1A 1R30A 3WG6A 1JUEA 4IGSA 2QMJA 3L2LA 5DMNA 2RGLA 4P7QA 3M6YA 3WD3A 2OTDA 3CV2A 2VRQA 2WM1A 3S1XA 1GVFA 1V3JA 4B5VA 3KTSA 1H0IA 1XBVA 4GYFA 1OFOA 2YBTA 4UUIA 1H50A 1MZRA 1U1JA 1GTHA 3VU2A 1R46A 4GINA 3CUFA 3W72A 3CV6A 1JQVA 4A2SA 4G9PA 3K8KA 1XLFA 1HGWA 1MUCA 2FPYA 3UJRA 1JCTA 4E3TA 2EAWA 3KRSA 2DEPA 4UWMA 1J12A 3BAIA 2DUAA 1UD2A 3NQBA 2OLAA 4RR4A 3S2JA 1MWOA 3L23A 4WD0A 1WNOA 4GBDA 3BWWA 1YLVA 3TUUA 4J28A 1PE1A 4IFKB 3R2GA 4JFTA 4CCDA 1C3FA 1JRCA 1IT7A 4X22A 2Y1HA 3K2GA 3W53A 4B9YA 3KFTA 2CFFA 4H00A 3XIMA 3IK4A 3QY8A 2RJGA 3L0GA 1L2QA 3C0QA 5D04C 1OX4A 5D8ZA 1TMHA 3E2SA 3QMSA 4AVFA 3CB3A 4B5SA 1HG3A 4YYFA 2ZUSA 4MB3A 1WQ5A 4MKVA 3I68A 3ZT7A 1MO0A 3QV8A 1K03A 3FVMA 1KNWA 3B8IA 1OT1A 3GNDA 1LBMA 3RNDA 4DWDA 1ZZMA 3HIJA 4W88A 3FN9A 4MB5A 3REQA 4B9ZA 4DWSD 4PMOA 2HVMA 1UWAA 5A6MA 5HDRA 1ZJAA 4GUGA 4DN1A 1GZ1A 1E6XM 1S5VA 3AALA 4KGLA 4CU8A 2VD8A 4K2SA 4S3KA 4F3HA 4TTGA 1DJYA 4OKDA 1VBJA 5D8WA 3W7GA 3W3OA 1RP8A 3TWAA 4KEUA 4ORMA 1HVXA 3LERA 4WDTA 3NL5A 1XINA 5ECUA 3DG3A 4H8VA 3SCTA 3UPMA 1VQTA 2CBIA 4IIGA 1V0MA 3IRSA 3GDBA 2FVLA 5FD0A 2MNRA 4Q4QA 3VDGA 4N9DA 4O19A 1J9YA 4C6CA 4RNHA 1GHSA 1NWRA 1BVWA 3RX3A 2OLSA 1NJJA 2WZEA 4FB7A 4IGHA 3C0JA 4RNJA 1ZY9A 3N2CA 3A13A 3S0CA 2ZUTA 1C91A 4A22A 1JYWA 4FLSA 2NWSA 4LAMA 5DT5A 3QLLA 3LDVA 3CZKA 1IHIA 3TYDA 3WF0A 4YVPA 3AU2A 3MUZ1 1SUXA 1W1YA 4H6RA 1MXDA 1R0MA 1VYPX 4KEVA 5FA5A 5HMEA 3WUFA 1BD0A 4WOZA 4B15A 5JXQA 4WSJA 5CPMA 5AHLA 1ZCOA 2OWXA 1EF3A 4I6VA 4Y8EA 1LZOA 1KM6A 2PF8A 1HKVA 1UYQA 3PBUA 1OGBA 2HK0A 1XKJA 1CLXA 1PDYA 6REQA 5BWFA 4O8AA 1S2WA 2PBGA 2E1DA 3W37A 3I3EA 8A3HA 1Y7VA 1UKSA 3CIXA 3GDLA 4H9ZA 1OFBA 3MO7A 1OIMA 4FALA 2BY2A 1AJZA 3QY6A 1GOWA 2QIIA 3K4DA 1F07A 4A2RA 2R14A 3T9PA 5AC6A 2FH8A 1VZWA 3PZNA 2C18A 1QI2A 4UTUA 3CWOX 1C9DA 3TSBA 4FXJA 3GY1A 2FFCA 2QCEA 1H7OA 2F6XA 3VGGA 3HU7A 4EXAA 4OOZA 1TG7A 3UR7A 3LENA 3SDOA 4LS1A 1P6CA 1QNVA 3FAXA 1XLBA 1EEPA 1M1BA 5E0KA 1I2OA 4XZHA 1AQMA 3DENA 5FJTA 2DT3A 3MWCA 1FCUA 2B0MA 1FWCC 3OIXA 5GJPA 2CLHA 2OZ3A 4OE7A 4UR9A 3STPA 2ZRYA 3BGGA 1NDZA 2ZC8A 3WLOA 2Z1XA 3GTFA 5K2ZA 3BGAA 1ZBVA 4F48A 1EP3A 3PNUA 3UZJA 5G5IA 1EB3A 3LS9A 1UJPA 4PYSA 1CT5A 2QDEA 2TAAA 1RA5A 1XIFA 2DH2A 3DYOA 4EAYA 3BAKA 1NOWA 2QT3A 4HOXA 4WY0A 3VIOA 5CPTA 5HULA 4MPKA 2OJPA 2A4AA 1ONXA 1Z7AA 5E70A 1KM5A 3MB9A 2ACRA 2PP3A 1HQTA 4Q8MA 3F4VA 2PF0A 1H11A 2B7PA 1UKOA 1M68A 3TJLA 4Y2WA 4AX7A 3LG3A 3FS2A 4DJEA 2PDPA 4PC8A 2H9AB 3QJAA 4ZFCA 4XG1A 2ZX8A 1XDMA 3N9RA 2XIIA 2CITA 1KXQA 1QO2A 3CQ0A 1WXZA 1W8SA 4G7EA 1K8XA 3UA4A 5C0QA 3GVVA 3I6TA 4ES4A 2QJIA 1LJYA 1BRLB 1WDQA 1JZ6A 4ORIA 2E6FA 3VOHA 3WNPA 1VFFA 1DORA 1JZ3A 1VFUA 3A5FA 3HB9A 1XLDA 1TV4A 1WZAA 4JNZA 1BYAA 2YL8A 5EL1A 2G37A 3ANUA 4FPSA 3PZMA 4DLMA 5JIPA 1WUEA 2XFRA 1ZPTA 3VIHA 4IFOA 1P7TB 2VVSA 4YIWA 3ZVHA 1QBBA 3CQJA 1WKYA 1P5BA 3G3DA 3H2FA 3WEOA 3WZ0E 3AMGA 3L5LA 3FSTA 1Z9AA 1NDYA 3VC6A 4GH1A 4IUGA 2OYMA 3RMJA 3GVGA 4B92A 5BXPA 3H7VA 2BG5A 1VLIA 1V02E 1YTEA 4GUHA 5HQEA 2NXIA 2CYGA 2PTXA 4GY7A 3RUBL 7XIMA 3WN6A 4ZFMA 4JR5A 3B4YA 3I6EA 1PAMA 4A8IA 3C2OA 3UXIA 1OQFA 3PN8A 4RW5A 1DTUA 1TJ1A 1A5CA 2X0HA 4JDYA 3SQMA 1E1FA 1B90A 5G2HA 1PZ2A 1Q65A 2VENA 4ZVJA 1W1ZA 1CCWB 3WK1A 4YTRA 2Q8XA 1BKSA 5L9FA 3ERPA 3B0UX 3H2CA 3HGRA 1W3HA 5JH2A 4MMWA 3M5VA 4OVXA 3S1VA 5ABTA 2F8QA 2WSRA 1SMDA 3CL8A 2BASA 2O9TA 4S3CA 3LCGA 2P50A 2ANUA 3LBOA 3GNRA 2YCKX 1JDCA 4PBFA 1UWRA 2VFFA 1OYCA 4IM4A 4QG6A 1TIWA 2WWDA 3VNIA 4UNKA 1N82A 4URIA 1O4UA 7REQB 1H7XA 1BVNP 3T42A 1E9YB 4QNWA 2GGIA 4L4LA 2I56A 3ARWA 1MW0A 5KZ6A 4PA8A 3M0MA 2VEKA 3TR9A 4ERGA 5E5CA 2G4FA 3BMWA 2Q6ZA 2WXDM 2W79A 3S1UA 4X2PA 1E1CB 2YZRA 4H3DA 3LX9A 3ZLHA 1YE4A 2AL1A 5ENLA 3NNTA 2VZSA 1XUZA 2DZVA 3IK2A 4QXIA 1HX0A 1I60A 3WYZA 1JULA 1WKEA 5GPRA 1UZ4A 3HF3A 4G5DA 3MVIA 3SJNA 5RUBA 4WLCA 2XVLA 3L4XA 2FVMA 1J0HA 3E74A 3UJEA 4C6NA 2OEKA 4LF1A 4WK9A 2Y62A 4AB4A 2D24A 3FCPA 1TZ7A 3EB2A 4Z0JA 4HQVA 1KR0A 3C0LA 2GUYA 2XVKA 2FVKA 1RA0A 5GVJA 2EHHA 5FACA 3VI2A 2DU2A 1DIKA 1XYMA 3FEQA 1GVRA 1QR7A 2FJUB 5DFAA 2WMHA 3NCOA 4FIQA 5FAJA 4IOTA 2GQ3A 4K8GA 4LYKA 1VENA 3MC5A 2VC6A 4AZBA 3PNZA 5BRBA 2E9MA 3DI0A 3E9AA 1KRCC 1MSSA 4ZSUA 4ZO6A 1V8EA 5CGQA 1MQQA 1E6ZA 4JOMA 3Q65A 4PUMA 4XVEA 4QAIA 2YCLA 4DNHA 4PUWA 3PUOA 3QV6A 3BVJA 4KIRA 4CGTA 1VH7A 4M1RA 3WD1A 4O1EA 1RK5A 4ADSA 4LC6A 3UWUA 1GORA 4LW7A 2DPEA 3NL3A 2VTFA 4KRTA 1EYWA 3W1AA 3O2LA 3TOPA 3LLFA 5HWJA 1RQBA 3L4VA 4LS0A 3CK5A 1P6BA 2I57A 4REQA 3DFQA 2E5DA 1GQIA 4HHPA 1NWTA 3KOFA 1K4HA 4DYKA 1RK6A 1TO3A 3GKFA 4FO4A 2DZSA 4ASTA 5HWMA 4YCPA 5D02A 1QFEA 2BVWA 3ID7A 4G6CA 3GC4A 3RLHA 3A22A 3G1XA 5CSSA 5A6LA 1JCLA 1XCWA 5AC4A 2F7FA 1JD9A 1EJSC 3AUOA 5DX7A 3IAQA 3NVTA 3NL2A 3PB0A 2AMGA 1XKYA 3QMTA 4J4KA 1CXIA 4Z0SA 4EF8A 2WV8A 1RLDA 2PZ0A 3ITOA 1AQHA 3WF1A 2BNJA 4FOKA 1XPGA 3T2OA 3NA8A 4NX0A 2J8GA 2QVHA 1LRNA 3FJLA 1XLMA 1ZAIA 4JQ1A 1BRLA 1IXNA 1ADDA 3PZIA 2I5QA 4LOCA 2RDXA 2X1TA 3WDJA 1TX2A 3VGFA 3W7DA 4AVNA 1CTNA 3GHTA 1XCFA 1UASA 2NW0A 4GUFA 4XD4A 3ES8A 3OLDA 3D3AA 5DY2A 4LV9A 4A8NA 1PPIA 1PCWA 4NF7A 2IKHA 4DM2A 4D8LA 2R82A 2WVSA 1H3GA 3DFPA 1UG6A 2J77A 1R6WA 1Q4WA 4AX6A 1NWUA 2DW6A 1GJWA 3UP8A 2BHUA 1TR1A 1J0JA 3HGJA 1J0IA 1XDJA 5DRCA 3GXDA 3FA3A 4XUGA 2CBUA 3FHQA 1E55A 3DYPA 3KBJA 2V68A 1D8CA 4F40A 4FEZA 2XZ9A 1BQGA 1NFPA 3ZLFA 5HR6A 4QJ3B 2A7PA 4BR1A 4UTTC 4MPQA 1M5WA 1YKWA 2XIOA 2WKGA 1O1HA 1OC7A 3P7YA 1DWFM 2CHOA 2YL6A 1WDRA 4E4PA 2WNNA 3PPFA 5HUOA 2DIEA 4F9JA 1KO0A 1K7EA 6TAAA 3SUTA 2PTYA 3SRFA 1PJ9A 1W5QA 1UA3A 4U3CA 2HV5A 3BV4A 2BVDA 2PA6A 2J7FA 2QJHA 4IIFA 3VD4A 3CM4A 3L4ZA 3VCRA 1VAHA 2VWTA 3RCYA 4DJFC 4JTRA 3TSMA 1G67A 1ME9A 3POHA 1EC8A 3WQEA 4A8RA 4IIDA 3LN3A 3UEQA 2E25A 1DHKA 3NM1A 3UXLA 3T8QA 1FTXA 2EXOA 4PZVA 3IJ9A 4GC4A 4XK2A 5I3DA 4XSMA 1Z41A 1XRVA 2IKIA 3PPCA 5DCEA 9XIAA 3KBWA 1V77A 1HFBA 4MNJA 7REQA 2BSLA 2A21A 4S1FA 3N2MA 1VLWA 2DSWA 3W83A 3DX5A 5LIWX 1XIJA 3C3NA 5CXPA 5B80A 4WDWA 4B3ZA 3HM7A 1Y0EA 3UY8A 3EPOA 2V5CA 3BARA 4C6QA 1E56A 2WC7A 3QC0A 1R9XA 2R1LA 4KRUA 1G5AA 1LORA 5H91A 3V5CA 2G97A 1TWDA 4QQUA 1EP2A 2D3LA 3VKKA 4DELA 4JICA 3UNTA 4JTGA 4OQVA 3UWWA 5DANA 1X8CA 1T5AA 1R3QA 3IGSA 1UUOA 3UR2A 2BXYA 4Q4OA 4AYGA 5A8QA 2JE8A 1SJAA 4IP5A 1FWRA 1QASA 1MQRA 4RUBA 4JIHA 3EOEA 2WLZA 2DQXA 1ODZA 1J79A 4JNMA 2OPJA 3H7UA 5FSEC 3L4WA 4XD3A 1H60A 3NIYA 3SR7A 1KCXA 5K3VA 3EXTA 1E9ZB 5DEZA 2CCRA 3A4XA 1T6MA 1LG2A 1P43A 1QCWA 1QI5A 3LXCA 1UB3A 1AW2A 4E2BA 3GR4A 5CC3A 3ZWSA 4A3QA 3ZT6A 4KETA 4AWSA 3E0WA 4YU1A 3G1YA 2VMFA 1AW5A 1ICPA 1G0CA 3AS3A 2QF7A 4X3ZA 3RYSA 1CLKA 1TWZA 3FNDA 5LA2A 1I2PA 1Q66A 1SMAA 3BDKA 4MJZA 2DZUA 3GQYA 4BFAA 4MWAC 4OGZA 4XAFA 1HW6A 2VOTA 3W0KA 2PEVA 4LB4A 3EPMA 3W88A 1RCXB 4PCPA 4L6OA 1NQKA 3NEVA 1ZALA 3NTYA 3OTRA 2VI0A 1EO7A 2CKRA 4U3AA 4XTIA 1NAL1 5PTDA 3GK0A 3E2QA 4TV5A 1JG9A 3MI2A 4AISA 2PZNA 2HS6A 2EPMX 4AXKA 1TZZA 1TPVA 1IEVA 4CQ8A 1X6NA 3HO8A 4RV8A 3HQ1A 4AIUA 3CO4A 4Y9MA 3S6TA 1W17A 3TVAA 2GDQA 4HNOA 1RBLA 1H41A 1BYDA 1NOUA 4L4OA 1JEZA 1X97A 2XH0A 5CQ1A 3ZJ7A 3PJXA 4K8EA 3OOQA 4K39A 1GJUA 1UZ1A 3QSRA 5AECA 4RNFA 4O13A 5D2TA 1EDTA 3FK4A 5G1MA 3NZQA 3K8LA 3SY8A 1OEPA 4FMVA 3EWWA 2WKLA 4AIBA 3VIPA 3Q37A 2Z7GA 4D72A 4GXMA 3W4RA 5CCZA 2DH3A 1QAPA 2RGMA 5EA9A 3B9AA 3FFSA 1PXGA 1TPH1 4NXKA 5DQPA 4GYPA 4UQ9A 1LRTA 5M5DA 3B9DA 3G0UA 2HSAA 1XP3A 3ANVA 2Z1VA 4I5RA 3R79A 2G0WA 3KRUA 2EJAA 3MUIA 4AD3A 1JRBA 1ZP4A 3OPSA 4O15A 4AIEA 3R4IA 4JL2A 1EFZA 1PYMA 3F03K 1GQJA 2HROA 2PI6A 2FGZA 4BK9A 4RE4A 3PBGA 4Z1CA 3O1NA 1TE6A 1CLVA 3P0XA 4ZR8A 4Z2IA 1JFHA 3H2MA 3N19B 4BWLC 2QGHA 3ELFA 3IVTA 4ADTA 2Y8VA 4JEJA 2IQTA 1LOLA 3SQLA 1LT8A 3QXBA 1E6QM 1YTKA 3C8FA 3M6DA 1SO6A 4TO8A 1TYGA 3IWPA 1AL7A 5BMXA 4UBPC 1JGIA 2C79A 3I7RA 2WJFA 4TX8A 4J9JA 3DFYA 5K9XA 4EWND 6ENLA 1JYNA 4AZGA 3M47A 2QV5A 4LAKA 4GE8A 3U2EA 3SUWA 2CKSA 4JN8A 4HA1A 2VHLA 1PTAA 3N12A 4IG2A 5D2YA 4FX8A 2Y70A 2E6YA 1P0KA 4HZ7A 3EKZA 4PTMA 3B3DA 2J9YA 3UR5A 1FA2A 4A3HA 4EXQA 4L1XA 3BJSA 1HKIA 5E09A 1RBAA 2E8YA 5BROA 4XBJA 4S3AA 2WCGA 3KL0A 2VZTA 3VCNA 1QW9A 4EX4A 1CGVA 2Z6JA 4G8TA 1FWTA 2OOFA 2YL9A 1K1DA 3BOXA 2P3EA 3TZFA 5F2GA 2ZE3A 2GJPA 4Z2HA 3EWXA 2VDIA 3G0XA 2Q8ZA 4DBDA 4YYCA 3T40A 1DJHA 4XKYB 3SCPA 4GY0A 4MOZA 3OBEA 4Y9OA 2Q3OA 2WHMA 3VIKA 1J5TA 3ZT5A 2CNCA 3SW6A 5IHSA 4YWIA 4L5ZA 5T9CE 2PWDA 1A5AA 2GYIA 3W02A 4S3FA 4R53A 3BSMA 3GUWA 4GX9A 4FF5A 2VL4A 1I8JA 3ZSSA 1DXIA 2R94A 3UGVA 4D8AA 3CJPA 4JQAA 2IKGA 4QP0A 2GGEA 4FI4A 2GWNA 5AYIA 1SU5A 1H7NA 2ZXDA 2YZ5A 4E6MA 5AC7A 1KB3A 5JQ9A 3TMQA 1FWJC 4HK6A 4OIFA 3GLCA 1ZFJA 1K7XA 4GIAA 1A4MA 2GJXA 2X05A 3CAWA 4AEEA 3W1PA 3ZIZA 3S9YA 5C8BB 1TIMA 4GQRA 4IPNB 4KW2A 4HTYA 1T41A 1BF2A 1JAKA 3K46A 4AMAA 3AHVA 4LALA 4MGGA 1S2CA 1UCWA 3NAVA 5M03A 3W01A 4AD4A 3LI0A 3HURA 3LV5A 3U4AA 4ZO8A 4RJEA 2HWGA 4TOQA 4OFCA 4PMVA 3D6NA 1UIPA 3FJ6A 3ANYA 2TODA 3EWCA 3A4WA 4XUYA 2JF6A 1SR0A 5EB8A 1XLLA 3MKKA 4J2MA 3WJXA 3QW4B 4LYPA 4LVFA 5BOFA 1SFSA 3SB0A 2W5FA 4GIYA 4HSOA 2PDMA 3R89A 1QDSA 2PDJA 2X1RA 3AICA 1LOSA 3M0ZA 1A0CA 4KKXA 1PX4A 2CLOA 2GVGA 1AZ1A 3EYPA 4LCQA 4WJXA 5CAHA 1H5YA 1GG1A 2QUUA 4LVDA 1HP5A 4JPGA 2QJJA 1PEZA 3MSGA 2XSAA 3STCA 1UOKA 3BTNA 4H9UA 2VRKA 1REQA 2OEJA 3ZJ6A 1KTNA 2C1IA 1DOSA 3ZJ8A 4XD6A 3PC0A 3WDHA 2XYLA 1Q5MA 4XAYA 3B0PA 2XN2A 4C1KA 1GGOA 4IX2A 3KVMA 4DZIA 5CLWA 1QHZA 3S2LA 3IJLA 1G6CA 3UG5A 1OD0A 5H8MA 1E0TA 3DOPA 2C7FA 3ARXA 3AYSA 4UFHA 4Q8WA 3U5UA 4YTSA 3II1A 3NDYA 4O4WA 2PWVA 4WKAA 1G7UA 2AGTA 4HSNA 2HZGA 3EX4A 4PUKA 2GUUA 3WNNA 3LQLA 2HCVA 3L4YA 1JXJA 4MKNA 3CPRA 3WDIA 4ENLA 4ROPA 4RDZA 2R1MA 4H7ZA 1WPCA 3U2CA 3HG2A 2RFGA 3BAWA 4E8DA 1XWYA 4W8LA 4DYEA 2GPTA 3VGBA 3DFSA 4YS1A 3ZMRA 4AWUA 1B3OA 1D7FA 3FKRA 3TFXA 4OV4A 2GVJA 1S38A 1JIBA 2VWSA 1OX5A 4GUJA 4GJIA 4MLJA 1OCBA 2J7GA 3H7RA 4LEFA 3KVKA 5I5RA 2RDUA 4G1KA 1ZSXA 4UQBA 1MEWA 2HVOA 2ISDA 5BZAA 1IEXA 4TX6A 5BOEA 3KZPA 3THUA 3TC7A 4OOUA 3C56A 3VC5A 1NSJA 1MEIA 5AHFA 4D8ZA 2QUNA 3VCCA 4H1ZA 4PMYA 4IIBA 2G96A 2PDHA 2FYMA 2QXWA 4DM1A 3AC0A 1SO3A 5CJMA 1B5TA 2PWUA 2FDSA 4IMEA 3B0VC 1VFHA 2QQ6A 2P1FA 4WZHA 1VJSA 4PRWA 3XISA 3QY7A 4E0CA 3ES7A 1BG4A 2BTMA 1M04A 3ZM8A 1XCXA 4HJFA 1EBGA 3RM8A 4ZB0A 1V6YA 5LSMA 4HP5A 3AFBA 4D71A 1CZ1A 3TR2A 3ZFHA 3FHAA 3R0DA 4RL3A 4INFA 4R9OA 1TA3B 1V0LA 4UR8A 3FX4A 4KFOA 2F2HA 3DESA 1F6PA 4U33A 3EMZA 5I78A 2ODOA 3SRHA 4LT9A 3G1RA 5C9RA 2AQOA 3WJWA 3LA4A 1VCFA 4CNUA 4WVXA 5K9CA 1SFTA 2HBVA 4O0ZA 2OSXA 4DWSC 3SUSA 1WZMA 1S5MA 4H6EA 1E51A 3D3FA 3HOJA 3CHCA 5CLTA 2OODA 2OFJA 1Y5VA 1R3WA 3DFOA 2D1ZA 5CG7A 2O4QA 3GSMA 4AVOA 3E5BA 4IXXA 1GT8A 4A4AA 1KM3A 4LCSA 4DJED 3C86A 3LMZA 3VFCA 3FY1A 4K7YA 3PG8A 3B05A 2OQYA 1X6LA 3GZ3A 3M5XA 1TREA 4QHRA 2WZIA 2VRJA 5CSRA 1A80A 2FIQA 4ILSA 3B03A 4P5UA 1A47A 3P5ZA 1H09A 2V5KA 2NUYA 3EB3A 3WQ8A 1IV8A 1I4NA 2OCZA 2GVEA 3VM5A 2XFYA 4QEHA 3AXHA 1GK8A 4ZCWA 3QBUA 5IOBA 1CXEA 3TTOA 4XZ9A 3E96A 2XIQA 5HWNA 1C7TA 4JIPA 2XGIA 5DCDA 1TVLA 3WH7A 4PMDA 1B9ZA 1HL2A 3VX0A 1XBZA 3CAVA 3GHSA 4GI9A 3QPYA 2WVTA 3NQDA 4DB7A 2WBKA 3VDHA 5D38A 2J47A 4NL1A 1MQPA 3TWBA 3UR8A 1UZDA 4JTQA 1XLHA 5F2IA 1KV8A 1CYGA 4D6GA 2O9OA 4HNCA 2XN1A 3WQGA 3BAYA 3MDWA 4JEQA 1WCGA 3WFZA 1BSLA 5G2IA 5EY5A 3KVLA 3UZYA 4J3UA 4AYSA 2WVUA 3VINA 2Y7DA 1VHNA 4DI8A 3F4NA 1GYNA 1FFQA 5C2XA 2VM8A 3U57A 3CHVA 3MCOA 4TMBA 1W5PA 1QI4A 2R24A 4XAZA 4PSRA 3CC1A 2HNEA 3VFLA 2W67A 4LRTA 3EDDA 5HNRA 3ZO9A 4JTSA 2ZDSA 3MMTA 1XLKA 2XSBA 3OZOA 4Y6GA 1N8IA 2O9RA 4QBXA 2BHZA 4KT2A 3NOYA 1GWJA 4NYYA 3UT0A 1IEIA 3BCFA 4WY0F 1R47A 2OXNA 3VNKA 2J27A 4HN4A 2JQXA 1C9WA 1ZAHA 3ZOAA 3I4KA 1R3SA 1VB9A 3OZMA 1FY6A 1DQUA 5ABEA 1OC5A 2WK2A 2MANA 3T0CA 4GKTA 3MUCA 4CNOA 4ERAA 1ECEA 2OO0A 4C5ZA 4DO6A 3H55A 4AAJA 2QPSA 3GAYA 2CBJA 1TPFA 1WBJA 1M41A 3CV7A 2XG9A 4YVXA 1EIXA 4D6EA 2ISWA 3NO5A 5MF5A 5CPNA 3KRBA 2B31A 2PUZA 4KESA 5CZSA 1EC9A 4DAFA 1BF6A 4KWSA 1QW7A 3N17A 5H8PA 4LUIA 5TF0A 1EWDA 3NPXA 4DJDC 2DJLA 1ZTVA 3OHMB 1XS2A 3TC6A 1H1ZA 1QJWA 4GI4A 1YXYA 3OGVA 2H6RA 1JZ2A 3F5KA 2A7RA 3HQOA 5EYWA 2Y8UA 3FEMA 4LXFA 3TFCA 2SFPA 2QMKA 2BGQA 3PFRA 4HMNA 5HBFA 3MYPA 1EXPA 4Q8UA 3B97A 3GFXA 4KWWA 1JUKA 1VFOA 2I17A 2R1PA 4IIHA 3EMQA 4NSBA 3WQVA 4AHOA 1C90A 3EMCA 4IFRA 2REQB 3UNDA 1AA1B 3NGFA 5DXXA 4ZA0A 1LLOA 5D2VA 3UXAA 1ZBCA 4GQBA 4AD2A 4JCMA 2V6AA 1K8YA 4KEZA 5FF7A 2PC4A 1LF1A 1O1ZA 3NDOA 5I02A 2X42A 5IFTA 3W25A 3V1HA 1OADA 3W73A 1OWQA 2A6NA 4KWUA 5FF2A 1VPQA 4C90A 1K6WA 1NP0A 2FKPA 3HQPA 3DG6A 2CXEA 4R9XA 3BMVA 4I7UA 1W1PA 1Q63A 1TTJA 4MZ8A 1XRFA 4MWAB 3WJZA 2WZMA 2D0FA 3HGOA 1M9HA 3P81A 4M0XA 1B2YA 1EOKA 5D32A 1TA3A 3P93A 4LNYA 4PEEA 1SQ7A 1TWIA 1KRAC 4LANA 1TQXA 4GG9A 1J8VA 2YXGA 5EKYA 1TVNA 3EOLA 4JKKA 3GDMA 3E0VA 2C91A 1XYAA 5J5DA 5A1AA 1KLYA 1O95A 1KGWA 4QE1A 4O0QA 5A6TC 1JPHA 4IP7A 1IZKA 4JTIA 1ZNNA 1VKFA 3V5FA 4LX4A 3INPA 2ZUUA 4DI9A 4POCA 3R58A 4PMZA 1W9XA 4Q3MA 1KW1A 3M4HA 4GJJA 1ALDA 5MKGB 2NQLA 1TUXA 3O06A 5D4YA 3I3DA 4NX5A 4M80A 4GI8A 1BTCA 2VFGA 1F61A 3W2MA 4ZMGA 3OVQA 3U2OA 1T8XA 3FYOA 3AHXA 4JS3A 1CBGA 2ZRZA 3M41A 4GNVA 1GYMA 5D09A 4Q4MA 1H1NA 1RZMA 1M7JA 5A69A 4O50A 2FH6A 3PUGA 2WJZA 4K7VA 2BXZA 4US6A 5C5YA 3G22A 1KM2A 1MNZA 4M8UA 4K1GA 3VNYA 3T4CA 3A12A 5XIAA 1GPFA 3M7SA 4IX0A 3V7PA 2XZ7A 3AI0A 4M6PA 1AK5A 3LRMA 2Y2WA 3O8AA 3PAOA 3QTGA 1VR6A 2GSEA 3PJWA 1L9WA 5LNRA 4MM1A 2B7NA 2DORA 3CTLA 2WSYA 1YXCA 2BFGA 4H7VA 1U2YA 2X0YA 2C0HA 2XPKA 3D5HA 4QJ4B 3GVWA 2J7BA 2BODX 3LHTA 1VCGA 4DBWA 4HT3A 1TB3A 1W9DM 1RVKA 4KCVA 1W5MA 1R87A 1ENUA 4FOJA 1HJSA 1GTEA 4XKMA 4A21A 3QC3A 4CN1A 4N9BA 1TTQA 3KRZA 1VJIA 5A94A 3C6CA 5C55A 3BZGA 2PDIA 5A6BA 2X7WA 4UTTA 4E5TA 2J6XA 2CLLA 3M0HA 4IGNA 1HL8A 4CNPA 4UOJA 2CEQA 3T0TA 1WP6A 2E67A 3M9YA 3SFKA 4JY9A 4GZEA 5AFDA 4NP7A 3OIHA 2ACQA 3DDMA 4IQLA 1W1IE 1B3YA 5H6HA 3AXKA 1B3VA 1ITXA 1JDAA 5DLCA 1V3MA 2QHAA 2WW5A 1M7PA 4ZB2A 4U31A 3OG3A 3S42A 5D9NA 3VKJA 2RH9A 4KCTA 1O5KA 3TQVA 4UMBA 3GBEA 4OECA 3L21A 1TV5A 3KX6A 1OB0A 2WMFA 3BLFA 3QHNA 4BQ4A 3W1UA 1TJ2A 3UWVA 3A3HA 3AIVA 1IGWA 4QR6A 2QLYA 3BK0A 3HMCA 1C8XA 4FA3A 4B91A 2CLFA 2UV8G 3H54A 2DUZA 3E02A 4FLQA 3DHDA 3N9KA 4UNLA 1Y8BA 3MBFA 3R8HA 2Y5SA 3QR3A 4DO7A 1OD8A 4R34A 3CWNA 2FB2A 4I3GA 4S3JA 1KLZA 3W22A 3W76A 3ITTA 4P8XA 3HA1A 4JZ5A 3IUIA 1UR3M 3C2FA 5CBIA 1XH2A 2X16A 3VX1A 4M7TA 1EC7A 5CPSA 3NYZA 2EPHA 1IWPA 3AAMA 1W3TA 4XBSA 4UZSA 1JYVA 2EPNA 2HEJA 3NQCA 3LBCA 3F1QA 3G5EA 3FGCA 5TNVA 3GTXA 1U5VA 5FEXA 1F7BA 1FWGC 1XSIA 2V5JA 1V6WA 1EQCA 5CBBA 1UPPA 4DO5A 4DX3A 3QV9A 5DMLA 3JW7A 4IF2A 2XVNA 2HTMA 1A50A 4NRRA 3SBFA 3BL3A 1VPYA 3K30A 5FJIA 3UWQA 3AROA 5F4SA 3TYAA 3DFHA 1EHNA 3CO8A 1Y5WA 1MEHA 3ME3A 1HJWA 1THFD 3MP3A 1HKKA 2QGYA 2EJ1A 2V69A 5I79A 3WBWA 4N2YA 1E0VA 4EF9A 3W1TA 5BXTA 3L5AA 5CBJA 3NXLA 1D8WA 2JIEA 1DL3A 2VEMA 2VFIA 3KOWA 3P8IA 1EJUC 1QTWA 4MWAA 1E4IA 3H26A 4Q4KA 5LIXX 4I9MA 5I3GA 1TTPA 3WH5A 1K8ZA 5LZLA 3QW3A 4OZOA 3LCIA 3NFUA 1DJGA 2ASHA 4HHMA 2IPWA 1B3WA 1LQ0A 4K37A 4HU4A 3RJYA 1VBHA 3E12A 3AXMA 4LBRA 1N8WA 3DKLA 3H12A 3O6AA 2D73A 2R8WA 5C7HA 5AHMA 3RO8A 3GXPA 1LL6A 4U5KA 4GABA 4QTGA 3DYMA 4CQDA 1XYFA 1GVOA 2YIHA 3LM7A 1JJKA 4AUBA 3E0FA 1PTGA 4PMJA 5AHIA 3S46A 4D1IA 2PDXA 3CLWA 3RPTA 4XWUA 1EO5A 3LGGA 4FIRA 1R3YA 3C2YA 2P5NA 1N2VA 4TV6A 3SIZA 4KGJA 3URQA 1POJA 3LGDA 3R0UA 4BKNA 2HPMA 5D37A 1OCJA 2ZZ7A 3TU9A 1FP9A 1KXHA 1Z3NA 2WO5A 3PZQA 2ZRWA 3B0YA 1KFBA 4MY8A 1ISXA 2KX9A 1MNSA 1SYTA 4Z08A 2OYKA 3GE7A 3B9EA 3TYUA 3L7RA 3RFAA 1E5JA 1KKRA 1J01A 3NQEA 2CERA 4QDMA 3OYXA 3W71A 5AYYA 5HK4A 4C6EA 3QEZA 3UWEA 3RMEA 1BTMA 2OR2A 3TTEA 5EFDA 2QNEA 1FXPA 2PC8A 3RHGA 1X1NA 4W4QA 1KM0A 1HZYA 4NUWA 4C6IA 2BWGA 3CHEA 2GSHA 1PKMA 3PB2A 4BWLA 2VYOA 2VCBA 5GNYA 4B5TA 5DRIA 2NQ5A 3RX2A 4PE8A 2POTA 1NARA 1P1XA 3QYQA 2Z26A 5TD4A 2AMXA 3UQNA 3WO8A 4QITA 4UQDA 1G01A 3S83A 1C92A 3W2LA 3SGGA 2ESCA 1I75A 3VOJA 5DN1A 4UB9A 1I9CB 4KH2A 3KHJA 2YB1A 3WH9A 2VP8A 1F76A 3W2UA 1TWSA 1EJRC 1YRRA 4MTVA 3OO2A 1QW8A 1NH6A 1QOPA 3KZSA 3BQ5A 2PDQA 1B54A 3QN3A 4WSKA 3M0YA 1BKHA 3JZUA 4JTEA 4L80A 3GW0A 3QVQA 4ICMA 3VD5A 3TNOA 4TVCA 1V08A 2ICSA 4H8NA 4JHZA 3O6CA 2VGFA 1Q6CA 4X2RA 4BEUA 3WQWA 3W9ZA 2ZZ2A 2ONEA 1Q2RA 4NILA 2XH2A 4H2CA 3CBWA 5C9XA 1F74A 3MSRA 4S3GA 3N3TA 1DHPA 3U0HA 1XL9A 4JCLA 1H2JA 2W3ZA 3KS6A 1K9EA 3VGHA 1NFGA 2DQWA 2EPOA 4PCSA 4N6FA 1E6SM 1VIZA 2PDNA 4F9DA 3MBDA 5REQB 1AD4A 3M1ZA 4DWSB 3CYJA 5DBTA 1A5OC 2VR4A 3OGSA 1KGUA 3SFWA 4ROQA 1YHTA 5D33A 2XINA 1UWSA 3SCRA 2TPSA 4NAFB 3R13A 4KCUA 3G18A 2PCEA 4PGLA 5I24A 1EGZA 3WLJA 1R7OA 7PTDA 3T08A 2BVTA 2H8ZA 2VFDA 2WLYA 4O14A 3ARRA 6ALDA 1IWBA 4R3UA 3CZ8A 5I3KA 3B8UA 5FI8A 2WOQA 3H4WA 3PUDA 2IPGA 4AD1A 3O6DA 1WDWA 3S5ZA 2WPGA 4OHQA 1MMFA 1YPXA 1K6AA 3KTXA 9CGTA 2LLEA 1V6XA 3LB0A 3W6LA 3TIMA 2DW7A 1W3LA 2DP3A 2I5GA 3K1DA 3KHDA 1LWJA 4ZE4A 3CEPA 3MMUA 4O52A 3LCFA 4E38A 5LGXA 2FTYA 1VFLA 4JX5A 1NVMA 1O6IA 3NZ1A 3MKVA 4QIUA 1R38A 1NFBA 2E28A 2FGLA 3TLQA 4L6DA 2GDUA 4QEEA 1A5BA 3KS5A 3R5EA 1V6UA 3QLDA 4S3DA 5C71A 4MDPA 1QI3A 2YX0A 4ICCX 3H23A 2EQDA 2GGGA 2PWEA 1GYLA 4CU6A 3ARYA 4PUNA 2VNCA 3UZ5A 5A95A 1LWHA 4LWWA 2F6KA 5G4EA 3GX9A 4CN4A 1FWWA 3CQHA 3MP5A 3TCSA 3LZ3A 2ISFA 5I7GA 2WC3A 2Z1SA 3SSZA 1FH7A 5HR7A 3WQ4A 5EPDA 1UP3A 1KFWA 4AQLA 3SSJA 2EEXA 1XG3A 1PHWA 1E40A 2Y88A 4HZMA 3A5VA 3AWNA 3LMYA 4DAIA 2J79A 1S5WA 2CWXA 2X2GA 2Y5EA 2DGAA 1BGGA 1YTDA 3BGJA 4XAPA 1UW9A 2WCSA 3BCJA 4RZ5A 1HJQA 1F8MA 3THQA 4QROA 4F66A 1RCQA 5HPCA 3CUXA 4J3TA 3QKZA 2DSZA 2INZA 1OSEA 4PB3A 1TV3A 1EEXA 1UR2A 1LRQA 4NT0A 3STEA 4BF5A 3DC8A 1MZHA 1XJBA 3LCLA 2IS7A 5H1WA 4AWEA 1LUCB 4B16A 3FA4A 2V3DA 5HXMA 3WL0A 2OT0A 3U5YA 9XIMA 3W75A 3DGBA 4MWAE 1W2PA 4I9TA 4ZTXA 3GG1A 5C54A 3C52A 3ZSTA 4JD4A 2C19A 3JVAA 3R94A 2FLIA 1W1B1 2ATSA 3N6HA 2ZXQA 4NYUA 1ZGDA 4CQCA 4JTUA 2J7EA 1E3XA 2C8NA 4NIRA 1GOMA 1GKPA 1PWLA 4XVDA 1LL7A 3B4UA 1OINA 2Z2AA 1L6WA 1TPDA 4CD6A 3ISIX 4OUIA 4S38A 2OQHA 3E0IA 1F2JA 1QRQA 1KFLA 4O1AA 4XX6A 3W7LA 5LNVA 1X98A 2FPTA 2GJRA 3LSCA 3QH2A 1D3HA 2A3EA 4ZGYA 4WOQA 2GQ9A 3HV9A 3W28A 4GVIA 2ATMA 1QHPA 1OK6A 2B7QA 3RF9A 4C7DA 4ECLA 2OO6A 3LCHA 3QHOA 1SSDA 1TZ9A 1CENA 3M0LA 3VKAA 1IIGA 4PSPA 1QHOA 4HMEA 4Z1YA 4E3VA 4GCAA 3TLLA 1I0BA 3MCMA 1YW1A 1XIEA 4MZ1A 2XVGA 4GXPA 1FHVA 3GXMA 3OQ8A 3QQ0A 3DEQA 1UMYA 3PUEA 2WMIA 3VOFA 2YBUA 3NR0A 1VFMA 2QCHA 4WCJA 5AKQA 3TH6A 1ZQ5A 1J0KA 5LNUA 5CZTA 4HN8A 4YPJA 1FKWA 2QCNA 5IBXC 1PB0A 1BWVA 1ZP3A 3VKDA 4H9XA 3QFWA 3SURA 1KCLA 3E5PA 1FCQA 4ZENA 4HPJA 4J40A 5A2AA 3RN6A 1MW2A 2ZZ6A 4FX7A 3UF9A 1H7RA 3W24A 2FZBA 3G1FA 5A8GA 4DWSA 4NJKA 1XISA 1PWMA 2WMKA 1E15A 3H6OA 3NM3A 5KITA 4HCLA 1KKOA 5A8PA 5T26A 4I90A 1KCKA 1F05A 2ZTKA 4U5IA 4FNUA 1CGWA 4S23A 3WBYA 4H9VA 5DF0A 3MV01 1RCOB 2QKFA 5FCZA 1FWDC 4N7QA 3NSXA 2D2JA 3UGRA 3K5XA 4DUXA 4M6UA 1QWKA 4IICA 3DH7A 1U5HA 2OELA 2WQDA 2YR1A 1W0MA 3CUGA 3CHDA 3O0KA 2DSUA 4JX4A 3OYZA 3QYSA 1XM3A 5LGZA 4C1LA 4AY7A 2UY3A 1ZB5A 1XIMA 3Q58A 2GFTA 1JNDA 1CNVA 2GL5A 4FXSA 2NQJA 1WAWA 4GISA 3F2DA 4C7FA 1V4YA 3UXKA 1E6NA 1EJXC 2OZ0A 3CQKA 2ALRA 3S5NA 3LHWA 4IP4A 3TN4A 1ZUAX 1CGXA 4H7CA 3JU2A 2UWFA 4P7OA 4UTMA 3GBDA 5D2XA 2ZA3A 4F79A 2VXNA 3B8TA 1E72M 3V16A 1A5UA 3LOTA 2G3FA 4LNCA 1L6GA 3VUPA 2J8TA 3WD2A 3ITVA 3LHYA 3R25A 1W9UA 2JEQA 1HO4A 4I9JA 1XIIA 3TSDA 1EIBA 4B90A 1NOFA 5G2WA 3APGA 1D7KA 4X61A 5IXEA 4AFYA 1S1RA 4EPDC 3AS0A 2TRSA 3HPZA 5HQLA 4P8UA 1Q8AA 1BEUA 4U4MA 5CZ0A 4RV3A 2OU4A 1WXYA 4L7ZA 3A6OA 3CB8A 2I14A 4J3WA 8XIAA 5FAGA 1HIZA 1YDOA 3CIWA 4JYFA 4ACZB 1UC5A 1QMLA 1GZJA 1X7FA 4PMRA 2WJEA 1TMLA 4TU1A 2WSKA 3N2TA 1ZBKA 1J4EA 5CJ5A 2Q09A 4YTQA 3KBNA 1EHAA 3G8RA 4O10A 5U7SA 4GD0A 3WLSA 3VIGA 2ZRVA 4DJDA 5HOSA 3KDNA 3M07A 1E71M 5TAOA 1F5ZA 2QULA 2FMNA 1H51A 1OFEA 5AZ0A 1XQLA 3E3HA 1U83A 3M5ZA 1LROA 1DP0A 2PD5A 4G2DA 1SO5A 2BY0A 2R9RA 2J4GA 1O5XA 3V5OA 1RP9A 3BLDA 4UIOA 3EXRA 4DLFA 3L0NA 4HYWA 3UD6A 4AY1A 4C5YA 1DBTA 4LCRA 1QT1A 3BLOA 3PZTA 2QYGA 1MRQA 1XBYA 1UBSA 3R0KA 3M64A 5AOUA 1JQXA 3CMGA 1W3NA 1ML1A 5KINA 3FJ4A 3GO2A 3BICA 3H53A 2V5DA 1QNOA 1RQHA 1ADSA 4QDPA 3U7BA 1V5XA 4BF7A 2Y6ZA 2ZUWA 2E4TA 3NQ7A 4JIIX 4V1YA 4GLEA 4B5WA 1S2VA 4XISA 4GIRA 2WCAA 4GOAA 2NQ9A 2YDSA 2ZUNA 1R8LA 1HT6A 3GHRA 3STFA 3ATZA 2INEA 3QPZA 4A6GA 3KVJA 1GKQA 5EMKA 1GOKA 1QUMA 2IPFA 1V6TA 1R3VA 4JQ3A 2NSOA 3P82A 1K9TA 3NDZA 1IGSA 3S3GA 3AMDA 4MUPA 3N14A 4RCXA 3U7VA 1R86A 1UC4A 4CQ9A 3AYVA 3UXDA 5IDIA 2YDRA 1TFVA 4D6HA 4NI8A 1SJCA 2GDVA 4RPPA 2OWWA 3L0KA 3WBXA 1C29A 1T7LA 1IT0A 5MHBA 3GH5A 4FNQA 2PU0A 2J8FA 3GTNA 2OZ8A 4A35A 3RR1A 3W2NA 4CQBA 1ZAJA 3GTHA 3MZNA 2P53A 1W2VA 2IQDA 2WVVB 5C9WA 4Z2KA 3SCOA 5EBAA 4CEUC 3BW2A 3PR2A 3OODA 4DYJA 4N0RA 3QM3A 1B4EA 2O7QA 1S2AA 1ZJHA 2CXGA 3IANA 3MV11 3OB8A 1UPMB 4UXDA 1BWLA 1YADA 3N4EA 3C5QA 1UR8A 4PUEA 4UNIA 3NO1A 4DZAA 5ABGA 4NAEB 4XO6A 2J62A 2WQPA 2X30A 5FJPA 2Z1BA 5EMMA 3U6WA 2YDAA 2NSXA 3R12A 1T99A 4N6EA 3UW6A 1VEPA 4AZCB 3F2CA 4HCHA 1XG4A 3T4WA 1CEOA 1GPWA 3PJTA 2QJMA 4MJ2A 1RJPA 3F5JA 2YCJA 3T7VA 2ZVRA 2BGNE 1XIDA 4QG9A 1F6YA 3RPMA 4W85A 1TSIA 3EWYA 4IFKA 1XH0A 1HGYA 4NHVA 1BXNA 1H4PA 1VD6A 2PE4A 1I1WA 1ONRA 1F3TA 3PTKA 2VZVA 3TAKA 4JYEA 2D2GA 2VEGA 1GG0A 3WDPP 3W1RA 3GXIA 4BJHA 1XH1A 3LI1A 3AIBA 2FHBA 2O55A 1G4EA 1PZ1A 2PMQA 4DBSA 4XIAA 1G9HA 1JCJA 1QWGA 1V0NA 2BOFX 1EQPA 3N04A 1YQ2A 1W1TA 2NV2A 2VVNA 1V7AA 4MIMA 2XIJA 2VDGA 5A6BD 1U33A 1QPOA 1IXOA 3EDKA 4M24A 3TCEA 1EUAA 2YFNA 1V6VA 2VCAA 3EZ4A 1FHUA 3M46A 1BAGA 1UWTA 4KEMA 3SECA 2NLYA 1H1YA 1Q7ZA 4PMUA 4EWJA 3BE7A 1FH8A 1SFLA 1R2TA 3GRIA 2J66A 3ARTA 5KZMA 1K4GA 2GOKA 1DJQA 2YLLA 3UZXA 4X0VA 5CGTA 2VEPA 4C6DA 1JGMA 4PTWA 3CASA 3S6OA 4Z17A 3SIMA 3VAVA 1C7SA 1VHCA 1W56A 1YE6A 3CU2A 4PCNA 1E1EA 2HVNA 3QZAA 4CCZA 4G56A 3WEMA 1YYAA 1FVPA 3JRKA 4KWVA 1DV7A 1U1UA 3W7HA 1GOXA 1X8FA 4N4PA 4HBKA 1EJVC 3LUTA 1JCMP 3NVDA 3DUGA 3ZWTA 4NU7A 3W00A 3EOUA 4WRHA 1XXXA 1DEDA 2OYLA 2ZUMA 3AJXA 4W8AA 1LYXA 3SEPA 4LF2A 4UCFA 1A5LC 3AQUA 3EXSA 1FDJA 3KBMA 3PWIA 1CB2A 1XLAA 2OSYA 1TR9A 3FKKA 4QGCA 1DJNA 4DF2A 5BCAA 3C8NA 4D6IA 7ODCA 1WUFA 4XZIA 1CDGA 4IPIA 4LFYA 1J10A 3DECA 3GU9A 3W6YA 2O4MA 4N9EA 3N4AA 5T91A 1XC6A 1UA7A 4GY1A 4Q6XA 4HJWA 2H3DA 1GEHA 4AY8A 1K02A 3EAUA 4F0LA 5M17A 2G50A 3B04A 3HMJG 2YYUA 3PY2A 4MDOA 4E8CA 1YDNA 3MMDA 2Z0IA 1F73A 3RK8A 2PGFA 1Q6RA 4PR4A 3R6IA 4R27A 2PLCA 3EEZA 3GXNA 2PODA 1VBUA 4UTFA 1P0EA 3WLQA 2QUMA 1DTNA 3NJ3A 2G95A 1JI1A 3FDGA 4E8GA 2XU2A 1HJXA 4Q33A 4I9AA 1MXGA 3G24A 2OVLA 4NZ5A 1KA9F 4IL2A 1Z8AA 3VNMA 2H3BA 1O5QA 4A3UA 2NZLA 3ORWA 3OLEA 3B8SA 2GLKA 3M0JA 2V5LA 2AKZA 3IV3A 2YW3A 3W27A 2I9EA 4Q8NA 2Z2BA 1RJQA 1VPXA 2ABAA 2FZNA 1P0DA 5CC5A 2FB3A 5DMMA 4C1NB 1UKQA 1W6TA 2NVDA 1W1A1 3BURA 3GIYA 4J3SA 3LTPA 3T8LA 3C2VA 2WC4A 2X1UA 3UPBA 3UCQA 3VNDA 1A4LA 4MNKA 5GJMA 4MFEA 4RK8A 4MADA 2P10A 4PCFA 2DT1A 2G5WA 8CGTA 3TA6A 3UG3A 2GJLA 3CH9A 4O12A 3W29A 2W91A 4B5UA 3WBEA 1QU4A 4GO9A 3CS2A 4E2DA 3TX9A 3OEXA 3RDKA 3TN5A 4CD4A 4LUSB 5BMWA 1XLEA 1T40A 3VIIA 5HUPA 3BLEA 4LSBA 3W1LA 1RBOB 3GM8A 1XYZA 3MQTA 5LHFA 4JDBA 1FKXA 2GK1B 5HATA 4PTXA 1FWNA 1NELA 3PPHA 5I23A 3BQ6A 3KWSA 1WAUA 1B30A 3DZ1A 4ZQCA 3L2IA 4KPLA 3TONA 5J5RA 1ZCCA 2PGEA 2H9AA 3NSNA 4GYKA 2PU1A 2Y24A 3NPWA 4KBXA 3A4AA 3MKCA 3IS4A 4NKCA 4R5EA 3VILA 4ATLA 1IQ8A 4JQ4A 4DO4A 4MAVA 1KRMA 2YA0A 4JBRA 1X7IA 3WFAA 3S5YA 4Q7IA 3WNLA 3GC5A 5HINA 4CNNA 3L4UA 7ENLA 2NQZA 4H6QA 1F6KA 3PBVA 1CI1A 2BS9A 2PDGA 3WSUA 3MYOA 1GUVA 1QNPA 4MYXA 3RM4A 1BPLB 1I2RA 3IIVA 4LB3A 1I2QA 4PTVA 1P7TA 5I03A 1ELSA 1W31A 4MJ4A 4Y7EA 3BXWA 3VMOA 4DIAA 3TC3A 2VKZG 4OT7A 4QSFA 1KD0A 5I2UA 5E0FA 3L12A 1A0DA 1OFPA 4QS5A 3HG5A 4WDXA 4PL2A 1KV5A 3EOOA 4FNPA 1G4SA 3QGKC 4R7OA 2Q3RA 4H9MA 3WX7A 1Q13A 4S3EA 1TE1A 1Y5XA 4RLIA 2X09A 1LQAA 3JZEA 3WKZA 2ZC1A 3QZEA 1OG0A 4JFUA 1WDSA 4X0NA 1JNEA 3THCA 1WDDA 2J7CA 3V36A 4UTWC 4PMQA 4H4IA 3CIVA 3AS2A 3C0SA 2GOUA 3BLLA 4HK5A 1M7XA 1RJRA 2A6LA 3ZLGA 1DWAM 3RRAA 2BV9A 3O07A 1RALA 2NX3A 2I1OA 3QQ1A 3CYVA 1VRDA 2CC0A 4XZNX 1TELA 5GNZA 3HN3A 4AHPA 1AZ2A 3QHMA 5C9UA 1OX4B 2X1IA 1R85A 4YJ5A 4FNTA 3WENA 2VZOA 2X0SA 1JF5A 1B9BA 4V2XA 3W85A 4O17A 5BWAA 2PTDA 1EUNA 4TUFA 1GVEA 2JGQA 2QDGA 1XIGA 4GNJA 2BB0A 4JL1A 4UTHA 3Q45A 3HG4A 2FZDA 4NJHA 2AQVA 1CX9A 5HMFA 3REQB 4ZXOA 4O28A 3ENLA 3TROA 3MU7A 4GMEA 1M03A 3ONCA 2WZHA 4TXEA 1KFCA 3CGTA 3OW1A 2VURA 1OZQA 3W7OA 4MSSA 1E1CA 1EBHA 4UQAA 1FH9A 3SN1A 1MXSA 2CZDA 1BYCA 3K4AA 1NDVA 3IJQA 4O1DA 1CW2A 4PMNA 4RZ4A 5KMYA 2OLHA 1GCYA 1W5NA 1J0YA 3RCMA 4YHEA 4MYAA 1MVYA 3CT7A 1K70A 2IXVA 4N02A 3PTMA 4WHBA 1QPRA 4IH3A 3IIXA 3N73A 4X63A 2ZDRA 4GYPC 1SZNA 3HQNA 1S3HA 3ABZA 2AL2B 3N2OA 4FP1A 4PCTA 1XSJA 2WM0A 2CU0A 1E4NA 1EWEA 1ICQA 6CGTA 5JIWA 3FIGA 4KRZA 4M29A 1OCNA 2GQAA 3XINA 3DG7A 3AHYA 3NUKA 1J2BA 4JHOA 1ISZA 4H2HA 3M0KA 2RJHA 3VKBA 1E4MM 4BI7A 2QJNA 2DV0A 5E1QA 2FMOA 1EDGA 3O63A 1YXDA 1VRXA 3SO7A 4ICNA 4FSAA 3N29A 1XBXA 2YA1A 4NNCA 6REQB 3EB4A 3EWZA 4IMDA 3GVQA 3GUGA 5H8UA 4MF4A 2P8CA 1PUDA 5KSWA 5FOOA 3OVPA 3WLHA 2WBGA 4ADUA 5A2CA 1SJDA 2WHKA 2Y61A 1PX3A 2BDQA 2IUZA 2W6RA 2WNQA 5C2CA 1E0UA 2PS2A 3RRXA 5F4WA 3PF3A 5FF0A 1VBRA 2XSXA 1J5SA 2J7DA 5G4HC 1VEMA 3PJUA 4J3VA 2FQIA 4HK7A 1CGUA 1V93A 2QCGA 3HG3A 1VFTA 3GKAA 3R8RA 3GYCA 1HL9A 1ZU8A 1RVGA 3TTSA 2E5CA 1H62A 3M0VA 1EH9A 1OG6A 2NXHA 3DKJA 3WLIA 3UJ2A 2FJKA 1Q3NA 3IARA 1H7WA 2QUTA 5CPOA 4CD5A 2E3ZA 4JIEA 1I1XA 4FLOA 2DZWA 1BXBA 3CUHA 3NO3A 2TYSA 1QXLA 2CETA 3MCNA 2DVUA 1R3TA 2V8ZA 2CLKA 7CGTA 4C6MA 1WOAA 2B4GA 5LHEA 4US5D 2VOMA 5F1VA 3TW9A 1R5YA 5B7ZA 4BQ2A 1V51A 4P7RA 2A0NA 1UHVA 4WY0B 3CT2A 5A6KA 4C6KA 2W63A 5K4ZA 1V3IA 1XD1A 1JXKA 1QI0A 4UCGA 4I7WA 4MKSA 4TVUA 1J0ZA 2F6UA 3QF0A 1AG1O 5AZ1A 1WA3A 4IJCA 2XH7A 1OF6A 4JTKA 3N9SA 3AJ7A 4ML9A 3TJIA 2A2IA 3G1HA 3MTWA 4ZOCA 3KBVA 2JGYA 3ITGA 3TN3A 3BW4A 1XSKA 3H2NA 4G7EB 2Z24A 1IT8A 1PL9A 2NV9A 1O5RA 5JBDA 3ZR6A 3Q67A 4HHLA 1OFDA 5LA1A 2UZ9A 3WH8A 3NG3A 3ABSA 1HXJA 4ML4A 3ABXA 4PUDA 4S2CA 1QO5A 2ISSA 1Q6DA 1GVYA 3LD5A 5EFFA 2AAMA 3ZVHB 2YXOA 1FDZA 4JTJA 2A3LA 3WMCA 3DERA 3BOFA 2PGWA 3VMNA 5A3HA 1Q6OA 3WNOA 2RUSA 4M51A 1US2A 4WJEA 1FCBA 3IPWA 1SZGA 1F9CA 3EGJA 1BYBA 2P3ZA 2PBOA 5I06A 4M5PA 5CC6A 1YPFA 5HA7A 1UUQA 2A5HA 5A8OA 2D2OA 1D3GA 5IBXA 5A8NA 5K7JA 1UKTA 2ZFAA 4Q7NA 3CZGA 3B06A 3W7PA 3SGZA 4JTTA 4RE0A 5KZEA 3AYTA 1AJ2A 3EWBX 3RG6A 2HE8A 3DIPA 3KE0A 3PZ9A 3TK7A 4GFSA 4MB4A 1L2UA 4GVFA 2DVXA 2QDHA 5BW6A 4QG8A 3VMPA 1XW8A 1IWAA 4HNLA 3H70A 2XFWA 3VE7A 4LVAA 4Z2GA 5HPOA 4RZ6A 3V0SA 3TQKA 1MW3A 4Y96A 1HJUA 1E6RA 2PCQA 1P4CA 3O15A 1JUBA 1W9VA 2J74A 3QR0A 4GA8A 1FDYA 4EE9A 4EK7A 2QW5A 5HNTA 3UZWA 3OU8A 4BI5A 1OC6A 2JKPA 3WDRA 4G1NA 2BBFA 5HANA 5AVHA 5TQLA 3P61A 2D69A 1L6YA 2PWHA 5IM51 4ZOBA 4GJ1A 4JYDA 3CLMA 2VUYA 4TR9A 3PK7A 2XH4A 2YW4A 4JHMA 2ZZ4A 4E4UA 4AZ6A 5I3HA 5FIPA 3ARQA 3DU0A 3A23A 2RKXA 3GWQA 2Y63A 3UZZA 3L2MA 1A5SA 1W1VA 1G7VA 2AL2A 5FJJA 5LNSA 1RPKA 5LIKX 5C7VA 3ARPA 4GPNA 2FDMA 2PTWA 2DZPA 4PTNA 1TVPA 4AWTA 4O53A 2A7NA 5JBEA 3O16A 3WMSA 4GO8A 3LXBA 1LWIA 3GYEA 2C14A 1VS1A 2OSWA 5A6AA