2PTDA

Phosphatidylinositol-specific phospholipase c mutant d198e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQEKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 107
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2ptdA00
1DJGA 3OHMB 4R7OA 3EA1A 2OOGA 3CH0A 5PTDA 4F2TA 4RW5A 1DJHA 1DJZA 2ZKMX 2OR2A 1T8QA 3EA3A 3EA2A 3L12A 4I8YA 4GNKB 5T91A 1PTGA 1GYMA 3RLGA 3KS5A 4RW3A 1O1ZA 4PTDA 4F2UA 1DJIA 2PZ0A 1QATA 2F9RA 1V8EA 1QASA 2ISDA 4F2BA 1T6MA 4QJ5B 3PTDA 3V1HA 4I9TA 5T9CE 2O55A 4QJ3B 3QVQA 1XX1A 3V16A 3RLHA 5T9BG 2P76A 3I10A 3H4WA 4Q6XA 2PTDA 4I9MA 2FJUB 4I90A 3QR1A 1AODA 3KS6A 4OECA 4S3GA 1DJYA 3V18A 3H4XA 6PTDA 1PTDA 3QR0A 4RV3A 2PLCA 3MZ2A 4I9JA 1DJWA 4QJ4B 1VD6A 1ZCCA 3NO3A 1DJXA 2OTDA 7PTDA 1YDYA
chains in the Genus database with same CATH superfamily
1S2AA 2E5BA 2ZVIA 4F66A 3WMBA 4LQ1A 5HR6A 3PK7A 4HMEA 3CQIA 2EF9A 1H1YA 2YA0A 3GHSA 3CWHA 1TWIA 4L61A 3GDBA 2VEPA 4JTRA 3Q65A 3MO4A 1JCNA 1F73A 3GXIA 3CB3A 1D8CA 3LPFA 2AOSA 1VIWA 1Q2SA 2V6AA 4NZ4A 3B0PA 4C7GA 1TPC1 5LNSA 4QAIA 1PKLA 1KM5A 1UOZA 4ZQNA 1LRNA 1E0WA 1I2NA 4UQAA 3PBWA 3FNDA 2QPXA 2VCAA 2WNZA 4PA8A 3S5SA 3W7KA 1U30A 3CL6A 1J0ZA 4PMQA 4JN8A 3MWCA 2PI6A 4K8HA 1JEZA 1GG0A 1YNQA 3SFWA 1TIWA 4LY4A 2VX6A 3AXHA 1KXQA 3N2TA 1SFTA 2QUVA 3VKKA 5KZEA 3WEOA 3WD2A 3EAUA 4US5A 2VFEA 3MO7A 1V0MA 5AOUA 5F4SA 4DF1A 3VTRA 3B0XA 4KWUA 1FWRA 1JAKA 4FS9A 3L4YA 3UEQA 3GIYA 3TYBA 3I6EA 4PZVA 5CPLA 1KRBC 1MMFA 4N9EA 1OCQA 2QKFA 4FNTA 3S8HA 2X0SA 3NEVA 1V0KA 4LC8A 3W1LA 1BEUA 1UJQA 4DPPA 4S3FA 3W73A 4RXFA 4LB3A 4EANA 1PZ1A 2C16A 1NDYA 4BF9A 2D1ZA 1ELSA 5I2UA 3DUGA 1OVDA 2HEJA 3DKLA 1X7IA 3MHGA 1QO5A 2V5LA 3MKVA 1U5VA 2WVUA 3RPTA 4GGBA 4QEHA 2BHUA 2BTMA 4YL2A 1UHVA 4IGHA 4H6EA 2E9MA 1XH1A 1QMLA 2Q01A 4WR3A 4ZOEA 1EJVC 4R53A 4E3VA 4LUTB 3IVTA 2W66A 2XM2A 1GZ1A 1H0IA 4NT0A 3WMSA 1K6AA 3CQJA 1UIPA 1W6TA 4JX5A 2Q8LA 3B97A 3W7NA 2VEGA 4UCFA 3ZOAA 2HS8A 5KMYA 2DQWA 3AIBA 3FVMA 1J4EA 3OA5A 3CUFA 4DJFA 1LROA 3MUAA 3WKZA 3G0SA 2DUAA 5K9DA 2V3EA 1F5ZA 4AZ7A 4DJFC 1R47A 5HOSA 2CETA 1PB0A 4O0KA 4B3ZA 1W56A 4PH6A 2INZA 4FOUA 1TSIA 3SCVA 5C9RA 3E12A 1MZRA 2ZCGA 3ARRA 3JZUA 4H41A 5HWJA 3THDA 2DVUA 1TPH1 4PTVA 3W1PA 1XLEA 1CXEA 2PBGA 5FD0A 2W0UA 2ZRVA 4NY2A 3VMNA 3TVAA 4UFIA 2V5CA 2F61A 1V6WA 4AC7C 3FSTA 2PZNA 4Q22A 1FH7A 2ABAA 4NAFA 2DJXA 4C6DA 3RO6A 2FHCA 2QHAA 3GTXA 2Y4SA 3EXSA 3TW6A 2R1KA 4M5PA 5FJIA 5M5DA 3QGKC 4TVUA 3G77A 1HJSA 4PCFA 3HQNA 3WEZA 4Z2HA 4OUEA 3LBMA 2V63A 1NWRA 3BSMA 1LZOA 3EWWA 4ZQMA 2YDAA 3GVGA 2TRSA 3HGJA 2QJJA 1F2JA 2KX9A 3BC9A 4D6GA 4ZGYA 3VVGA 3NPUA 2YYTA 1AH3A 3WY1A 1ZCOA 4AVFA 4O1FA 5XIAA 3FKRA 5DY2A 4A8NA 1Q85A 4O14A 5DCEA 1NQKA 1JD9A 5D38A 5BOOA 1UROA 3GD6A 4H1ZA 5AYZA 2GL5A 2NQHA 4ML4A 3D46A 5CZ0A 4B15A 4UTIA 3NQGA 1VR6A 5EMJA 5HULA 5AY7A 2WHMA 2WCSA 4KWSA 4M6PA 2PD9A 1Z9AA 2QR6A 1XG3A 4YTRA 4LAUA 4PTNA 2GSJA 4W87A 3E5BA 1FWFC 5K7JA 3LCXA 1TV2A 2BGQA 4K2SA 2OQYA 3P2VA 2J7FA 4ORIA 9XIAA 1BYAA 4UC5A 3TA9A 1KGXA 1THFD 2ZZ1A 2ZRUA 4JIQA 2FVKA 3VNZA 1Z32X 4Y90A 3LMZA 2I16A 1ICSA 1JF5A 3VOHA 2PWHA 3WLOA 4HPNA 1JJKA 3NOEA 4DJEA 1JZ5A 2QV4A 1ZALA 1L6YA 3AC0A 1W8SA 3KBSA 1TB3A 3BO9A 4DJEC 3ZR6A 2G37A 5F7UA 3UD6A 3FGCB 5JXQA 2YB1A 2WMIB 5IFTA 1OYBA 3CHCA 2NQZA 3W71A 4K7VA 1H09A 1HVXA 2FZBA 4J3XA 2FGBA 2PTYA 1LLWA 3KZSA 1NWTA 3FXGA 4XSMA 1Z3NA 4MWAE 2AKMA 3QC3A 1MRQA 2P76A 1SO6A 8TIMA 3WH5A 3BE7A 1R2RA 5LKYA 2QGHA 2I14A 3KS6A 4V15A 5CPMA 4S3GA 2EO7A 3CUJA 3S6TA 1KLZA 1NQ6A 1CENA 4DJDD 1WAWA 4MUZA 4GFSA 3H7RA 4DUOA 1EXBA 4W7WA 1UIOA 4O0ZA 3TXZA 3MDWA 1DJWA 2PU0A 3WK2A 4C6QA 3M44A 5H1WA 2VC7A 3WLRA 1TJRA 1CW2A 2YFNA 3DGRA 4B5VA 4GXMA 4ACYA 4U2YA 3UWEA 3L9CA 2O7QA 3HQ1A 4RW5A 2HVNA 4LALA 2UY4A 4H83A 1FWWA 3HO8A 5HK4A 1SQ7A 3LK6A 1EP1A 1FHVA 1A5BA 5LA1A 1DIKA 1YBQA 1DTNA 1FWCC 3BANA 1EH9A 3P3BA 1ML1A 4K36A 2DUZA 4YMZA 3LEPA 2V69A 2ZZ5A 2NWRA 3KOWA 4DVOA 3F2BA 3KCJA 3EB4A 1TFVA 3S2CA 4DBWA 6CGTA 1HP5A 5FEXA 1DIDA 2Z1WA 3GAKA 1W1ZA 3SUTA 4HP5A 3DERA 4OHQA 4A3UA 5AFDA 3CHDA 1V3MA 1QOXA 1ADDA 1YBQB 4QQUA 4MNLA 4BI5A 5CGMA 1E43A 4F0RA 2VZVA 4LY8A 5DO8A 4IH3A 3N1AA 1OFDA 1XLCA 3SN1A 4JOMA 4O52A 3I65A 4C1KA 3SIZA 1V0NA 4JS3A 1LOSA 1AZ1A 3HZ3A 5LGXA 5A95A 1EGMA 3IRSA 1MEHA 2OEJA 1JFXA 1LUCA 2PWUA 4GUFA 5EMYA 2D69A 2PDXA 1QUMA 5FOOA 3C4UA 1EJWC 4L4PA 1D7KA 3OO2A 3EGJA 3OGRA 4H00A 3FS2A 2YBTA 1P4CA 4A2SA 1UZ1A 1UA3A 4IFOA 1FWNA 1NM9A 4XD3A 2QVHA 4ZTXA 1MW2A 1P7TA 4WSJA 3Q4DA 3IGXA 2CLFA 4MPKA 2GGIA 3MQTA 1TELA 3GTIA 1GOXA 5G4EA 4MNMA 4ZE5A 4J27A 4HGXA 3EA3A 1XIIA 4HVXA 1EQPA 4GE8A 1TPFA 1TKKA 3MYOA 1Q7MA 5EMUA 3VKAA 2ZRZA 4MAZA 1ODUA 1XRVA 5HBFA 3PZTA 4PB3A 4QM1A 1A5SA 1I2PA 1P7TB 2XU2A 4JTFA 2PWEA 4F2BA 2ATSA 1XKJA 2X16A 2H90A 4GRSA 4AQLA 3KTXA 1KCKA 3MC5A 4GIAA 1G4TA 4OGZA 4WIWA 1V4YA 3ITLA 3I4EA 4AX6A 2XSAA 1XBZA 4K1WA 2NW0A 5HUOA 5E09A 3VM5A 4DLFA 2AL2B 3B0VC 3SW6A 3NO5A 4DO6A 5I06A 2RAGA 3H21A 5C6MA 4XBJA 4MZYA 4UTMA 4KT2A 2J66A 1A3HA 4GISA 5H6HA 1Y65A 3OYXA 3WUGA 1GHSA 4OIFA 1GG1A 1K9DA 4ZA0A 2OQLA 1CXIA 3UCDA 4GZIA 2OYMA 3TU9A 4AD1A 2XSBA 2WLYA 4NSBA 4FNSA 3GRIA 3R8GA 4D8AA 1KFJA 4WK9A 3SR7A 1WKDA 1TMLA 3H24A 4F0MA 3B9DA 2PRHA 2C91A 3M0VA 4EXAA 3VIGA 3ES8A 4MJMA 3FKKA 1Q63A 3Q67A 3QOKA 2IKJA 3O6CA 4WLCA 1OX6A 1VC4A 4HZ6A 1NH6A 3BMWA 4MY9A 1XRSA 5F1UA 1C8VA 3NOYA 1NWUA 2ACUA 4LVFA 3HFYA 1DE5A 2GQAA 4AZHA 2NX3A 4JCMA 3WL1A 3H6OA 4KERA 1BKHA 1H7NA 4MY1A 1X98A 1YE4A 2PTXA 3FLUA 5JBDA 3ELFA 2DSUA 1HJWA 3GBDA 3AMKA 3WENA 3W3OA 3OGVA 5TNVA 4Z2IA 3W4RA 1G4SA 4QX4A 4PMRA 2E0PA 1ZCCA 1QHZA 3SO7A 1IT0A 1O68A 3STFA 3GG7A 3MHUA 3DOPA 4IL2A 3S9YA 1PX8A 4E0CA 3ZVIA 2J9YA 4LAMA 3SBFA 1PXGA 1ZJBA 1JCJA 3EXRA 1WZMA 4E4FA 2BOEX 1R8LA 1BVZA 3WBYA 4ZQOA 5DXYA 1H49A 1OYCA 1A5CA 1XYCA 1GOQA 3TZFA 4PODA 1ZZMA 5HNTA 2HDJA 3VIIA 3AXIA 3VNDA 3KOZA 2ZUSA 3LCWA 2TYSA 3THAA 3BLPX 3G6LA 1K9TA 3L0GA 2ACRA 2G8ZA 1FWIC 4NU7A 2BY3A 3R43A 3V7PA 3KBMA 2VCCA 3CPGA 3WLMA 4AF0A 4UQCA 5I79A 1W9VA 2VXNA 2ZYFA 3L4VA 2BVTA 4NASA 3ISIX 1S2TA 3LSCA 4D8ZA 1AA1B 3CPUA 3JVAA 4ZOCA 3LCHA 2OZ8A 2ISSA 2OELA 1G94A 3TCSA 2ACSA 1DWIM 1A0CA 4YCOA 4YS1A 5C54A 1XRTA 5CGQA 2VZSA 4DNMA 2ZRXA 1TO3A 3M5XA 1CCWB 1UJPA 2D2GA 1HF6A 3SUUA 1REQB 1XHGA 3QLDA 3N34A 2J7BA 1MSSA 3EDKA 1SZGA 1GYLA 1E3XA 3U2OA 2EJ1A 5HAOA 4JTCA 4OWGA 2WMHA 1ZSXA 1V08A 4NIRA 4B5NA 4WY0F 3QZ6A 1R9ZA 1CI1A 4MYXA 1V6TA 3SN0A 3VNKA 3DESA 2DW7A 3WD0A 4PUDA 4ENLA 4D6CA 4F0LA 2FMNA 2PA6A 3SY5A 3L0KA 4GJ1A 2PRMA 1OG0A 3MANA 3E2SA 1M41A 3UA4A 4H9UA 1UKSA 3IUIA 3NZGA 3KWXA 5IDIA 2JFEX 1RD5A 2YR1A 2DVXA 4DLMA 1RCXB 4Z1YA 3UU0A 4N6EA 3LZ3A 1XLMA 3ZJ6A 1DKWA 2DSWA 3TTOA 3T81A 1TE6A 4UNIA 1W5NA 2CYGA 3PZNA 1KM3A 4CQAA 3GIPA 5I3KA 2CWXA 1DWJM 3VYLA 1IXNA 4GVIA 3TUUA 3AZRA 2FIQA 1OINA 4D9PA 1E5JA 2PGWA 5L6UA 1HKJA 1P0BA 2QLYA 2X1RA 4AXKA 3WBAA 5I3IA 2PGEA 4DBDA 1J9YA 3CTLA 3MB9A 2GFTA 3WQOA 3CEUA 1VFOA 5CSSA 2CBJA 4H6KA 3QYSA 2D2HA 2VJXA 4ZBCA 1AJ2A 3PJTA 3P82A 4D6FA 5FL1A 4IQJA 2Z25A 2ZZ3A 2J8GA 2QAFA 2BGNE 1EC8A 4U4MA 2HE8A 4G6CA 1E1EA 1OFPA 3DHUA 4CU8A 4D6IA 2NT1A 2PP1A 4M80A 1EJXC 2EKCA 4ZTYA 5MKGA 4BS0A 1XRFA 1B1YA 3STPA 5FJUA 3G1HA 5IFPA 4ZE4A 3GG8A 2GSEA 3ITCA 3VD9A 3V3WA 2QT3A 4RE3A 4JTJA 1SMDA 3ZO9A 3P6LA 3IK2A 4MB1A 3URQA 2CIPA 3S6DA 1NP2A 1CGYA 3EZ4A 3E02A 2VRKA 3UT0A 4CD5A 3S2JA 5HXMA 5MKGB 4HK7A 2XIMA 3UERA 4ZB2A 1TPEA 4KEMA 2OKTA 5EFFA 1E6SM 1E70M 4K8EA 2XWEA 2WZTA 2W79A 4GMEA 3VMPA 1T41A 2CKSA 1VBHA 2EHHA 1YPFA 2RDUA 3VX0A 4P7QA 1UP0A 3UZ5A 3S2LA 4UQ9A 4BCEA 4IWWA 5AYIA 3NSMA 3VNYA 4J3WA 6PTDA 2AAAA 2GDUA 1TZZA 5LHEA 1M7JA 3CPRA 3C0SA 1A5LC 1ZFJA 3IJ6A 2FYMA 4ZO8A 4NXKA 1LRTA 4L6HA 1E56A 1ZENA 3UZYA 4IMGA 4Y9OA 4NILA 5XIMA 3AISA 5C55A 4AWEA 2XINA 5TAOA 1P43A 4UTWA 3RX4A 4O57A 4HMCA 2V38A 4JCLA 4UTWC 3GNPA 1J12A 1QOQA 2GK1A 3CT7A 2X1SA 2WYSA 1XICA 1IEXA 4ACZA 4IMCA 3NURA 4Z1BA 4HSHA 1YDOA 2YLAA 3DBPA 3VDCA 1WDDA 2CHOA 4E2OA 1UBPC 3NFUA 2Y8VA 3RCNA 1EJRC 2Z0IA 1YXCA 4UB9A 3NXFA 1ECQA 3V0TA 2GQ8A 4NAEA 1G1YA 3MVIA 4G9PA 1OSEA 3T9PA 1TX0A 3UG4A 4L4OA 4LCSA 1GW9A 3E9AA 2YYUA 3R8HA 3VGHA 3RIKA 3BLDA 1OFBA 4C7FA 1S39A 1XD1A 1E6RA 1KCLA 4GO8A 4LGXA 2XISA 3UG3A 4AZIA 4ZCWA 1F61A 4EWND 4DAFA 3T8LA 2QUUA 1VYRA 5FF7A 4AZCA 4WRHA 7CGTA 3DU0A 2YA2A 3CHVA 4KWOA 3PG9A 3AFBA 2PTZA 3EMZA 4J4KA 4PBGA 4EWJA 1MQRA 1W9DM 2MANA 1S5WA 2DT0A 4GK8A 2R94A 8A3HA 1IEIA 1FWAC 3LYEA 4Q8OA 3MMUA 3MSGA 2UY2A 2WKLA 4UFKA 3IJ9A 3KRBA 4XV0A 3OBKA 2VX7A 2GZXA 4HMDA 5FEZA 5FSEC 2Y7DA 1VENA 3H2EA 1TTIA 3PB0A 5C5YA 1I9CB 2OO0A 1UB3A 2INEA 2QJMA 8CGTA 1KWKA 5AYBA 2X8RA 4AEFA 3KVKA 1VFTA 4WD0A 2F6KA 2DZXA 5CH9A 4GC3A 1ZP4A 3IV3A 1QJWA 1UYQA 3TKFA 4NRRA 4JYEA 2RDTA 2Y61A 3V1HA 4DO5A 5DXXA 4MB3A 2H8XA 2YPIA 1R3QA 1FP9A 3RLHA 4JFTA 5CBIA 2DQXA 4WCJA 4M19A 4OQVA 3N14A 5FEWA 2QS8A 3WQGA 3TP4A 3PUEA 3L4WA 1PEZA 2Z1XA 3QW4B 3HV8A 4QTGA 1ZUAX 4GXWA 1JD7A 3RM4A 4O1CA 3BCJA 3ZJ8A 2A2IA 2DH3A 3UWVA 4KIEA 3GU1A 1Q7ZA 1XIEA 3GKAA 4C65A 1GVIA 2CZ5A 2BOGX 1T40A 3GHRA 3E38A 4H2HA 2QDDA 1NDVA 2HNEA 3DGBA 1K8XA 1PV8A 2V2CA 1LQ2A 3IJLA 4ZR8A 1XIBA 3E5PA 3MV01 4Z1AA 5FEPA 3K1GA 1MYRA 2BVWA 5I6SA 3CMFA 4A4AA 2TAAA 4FF7A 4QSFA 2WC4A 2V3FA 1R7OA 3FYPA 4E4PA 3QGAC 5IHSA 1OF8A 3CHFA 2QUTA 4I3GA 5DCDA 3QJAA 1XCWA 1OCNA 2FDMA 4LS1A 3N6QA 3BVJA 4DQWA 4OTKA 1JCMP 1QW7A 3UZJA 2PAJA 1E0TA 2B7QA 1TE1A 3M16A 2WSQA 1QCWA 4DHGA 4HN8A 5CZJA 4BJHA 1GORA 1AJZA 5HNNA 1GKRA 1ONEA 2E25A 4B2DD 3AS1A 3LI1A 3F4NA 3W87A 1RQBA 2QJIA 1UR3M 3VDGA 1GOOA 2BDQA 3W85A 1D3CA 3CUGA 3OJGA 2W91A 3WJWA 4LEFA 1JYXA 1PTDA 3QR0A 5ECVA 3VA8A 1S2WA 2WOQA 3A21A 2Q3RA 4L56A 3SURA 3WNKA 4AD5A 2FQIA 2O9RA 3IGHX 2YZ5A 3TQPA 2XZ7A 3MSRA 2WQPA 1NEYA 3CH0A 3GVQA 4QNEA 4RX0A 5A94A 4ICNA 3U8GA 3NQDA 3VIPA 4I6VA 3UJRA 3M7SA 3NEHA 1SPQA 1LCOA 3E2VA 5D4YA 3QFEA 3IUDA 3QEZA 4FR6A 4JTTA 5F4XA 3VDAA 2E1DA 1OZQA 1PHQA 3KHJA 1K4HA 1XSKA 4IP7A 3LCFA 4UMBA 5BNKA 4HKPA 5GJNA 5C9UA 1KA9F 3U7VA 2DZPA 4E8CA 4D1IA 1WXYA 2ABBA 2XJ7A 1BWVA 3DN5A 4EIVA 3AYRA 1TTJA 3FIGA 3HPXA 4RNFA 4F40A 3THUA 5HPCA 3PZIA 4P7NA 2VEMA 3UWQA 4CNNA 1Q8JA 1GVYA 1J6OA 4I9TA 4S2CA 1RVKA 3UWYA 1WKFA 2DEPA 3OOQA 4QISA 2QCGA 2J6VA 4Q32A 1SZNA 3Q45A 3R79A 1C7SA 1G7UA 1IEVA 3DH7A 3H26A 2Z6IA 4FHAA 1LBLA 1VFLA 1HL8A 5FL0A 3T6CA 1DJYA 5HWNA 1XYMA 3IJ7A 3ABOA 1TR9A 1A47A 3GBEA 3PULA 2GVEA 3H55A 2G4JA 2WSYA 4Q33A 3HMCA 3WSUA 4GKTA 4OZOA 4F79A 3NO3A 3T2QA 2OWCA 1HO4A 4ERGA 3BAJA 4IL0A 3GNOA 2Z7KA 3GTNA 1HJQA 2X0HA 4P7LA 4UTUA 3FA3A 5JMUA 4BI7A 5GJPA 1W54A 2A7PA 2J9ZA 3CL7A 1QNSA 4AZBA 1GQIA 4W7UA 3PAJA 4UZSA 5JBEA 4AC1X 3NZRA 1KBIA 2PPGA 3ZLGA 4PGLA 3UG5A 3GH5A 3YPIA 5C9XA 5H8PA 3W7OA 3C0QA 3REQA 3AROA 4JQ3A 5BXTA 3N2MA 4GG9A 3GY1A 3GK0A 4GWEA 5CC3A 1C8YA 2FMOA 2O55A 3HQOA 3FSUA 3IAPA 4WOQA 4XZHA 5BW6A 2FZNA 4AH7A 1XBYA 3QM3A 2JKEA 3K30A 3GHUA 1JDEA 1AH0A 1KTCA 2BSLA 2P0OA 1GKPA 4RNHA 1UMLA 2W67A 1WKYA 1ZAJA 4J7RA 4GA8A 1RXOB 3LD5A 3MP3A 1GPFA 1BWKA 1PCWA 3UY7A 1EP2A 2PF0A 4CCZA 4ZXOA 3I7RA 5A2CA 3TLLA 4JZ5A 4X22A 3T05A 3R58A 3CZEA 1YW1A 3A64A 3WEMA 3WF1A 2J62A 1GOIA 2VQUA 1AQFA 1L8NA 3ARYA 3GWQA 3SQLA 4YTSA 4FX8A 2PGFA 1PPIA 2NUWA 3VE7A 1IEQA 3R1ZA 5I00A 2ZFAA 2GVJA 5K3VA 1NSJA 2W63A 3XISA 3QZEA 3KRSA 4RE0A 4I7UA 5FJOA 2ZX6A 3VFCA 3UW6A 2F7FA 4FNUA 1B4KA 4P5UA 2P53A 4UFJA 1EOKA 5CC7A 2I9EA 1PKYA 3F1QA 4LX4A 1W5PA 2WBKA 4AMAA 4DYKA 2Y6ZA 5FJPA 4NNAA 4NUWA 3A12A 1QNQA 3DHDA 5DN1A 1O6IA 5D9NA 3K46A 2WVVA 2E6FA 1VJIA 4GQRA 4AG0A 4FIQA 8RUCA 1NFPA 4B5XA 2VYOA 2BS9A 1FHUA 1K77A 4ZOAA 1K03A 5E70A 5HQMA 2PDUA 4GNJA 4RL3A 4AD4A 1S2VA 1GW1A 4IHCA 1NELA 1OCBA 4DXKA 3A23A 2PE4A 1M1BA 1VCFA 2REQB 4GI4A 4L65A 2V5BA 3A4AA 1GYNA 4LBRA 1QBBA 2J24A 5AVHA 3LTYA 1JDCA 2IXUA 1HFBA 2QDEA 2DZUA 2ZVRA 5DBUA 1UD3A 1JAEA 1PZ3A 4P8VA 4UUIA 3UCCA 5KTLA 4EACA 4PC8A 1DPMA 2P10A 1EQCA 3HU7A 4BY3A 5LA0A 3E49A 4XAZA 4FZIA 2QYGA 3TZNA 4ADUA 1MZHA 2IS7A 1XBVA 1E0VA 1OB0A 4U33A 3CO4A 2VEIA 4M24A 3GHTA 3HPZA 5AKQA 1DQXA 3V35A 4JY8A 4ZEPA 3T8QA 2OYLA 1XFBA 3L5MA 1OC5A 3DFYA 4UQEA 3SUSA 2NQ9A 1N8WA 4AD3A 3VXGA 1VCVA 4LUSA 5DT7A 4NYUA 3B9AA 3CQ0A 3EWZA 3M64A 3RLVA 3DAQA 3RGTA 1RPXA 1E1CA 3SN4A 4EP8C 2OXNA 5D2TA 3W0KA 4BEUA 3A5VA 1OF6A 1FFQA 4JX4A 2VZOA 2Q6ZA 1JULA 3PZOA 4BFAA 1R46A 3C2RA 3PTMA 4QP0A 1XLAA 1QNVA 1RY8A 1M5WA 6TIMA 1V79A 4LUSB 4C6LA 2HBVA 2XZ9A 2BY1A 4JY9A 3WLIA 4K39A 1J0JA 3CV1A 2WB5A 1V8EA 2PP0A 2D22A 3GH7A 3STCA 3WFLA 5KSWA 4DB7A 4PUEA 3PFMA 4OFCA 1Q6OA 4DWSA 2KZHA 1UZHA 3MW7A 5G1MA 4HHLA 3PTKA 1POJA 4DWSC 3IVUA 6REQA 1YPXA 3GH4A 4QROA 4DZIA 4IUGA 2O9PA 3F03K 4MLJA 2C8NA 5T91A 5CG0A 3GDKA 1EGZA 1JUBA 4BKNA 1GYMA 4KWWA 4ADSA 4MB5A 1FCUA 3AMLA 1DJIA 3EMCA 5KEZA 2RJGA 1C7TA 3M0IA 4QNWA 2YB4A 1NY1A 1S1RA 5A6SA 4GQQA 1F6PA 3IUHA 2BY2A 2IUZA 4GI9A 2GDVA 4KIRA 4UQDA 4ZB5A 4X9YA 1Q4WA 4S3AA 1ECEA 1RVGA 1W91A 3TNOA 1UKPA 3APYA 3UGVA 4PL1A 4YHEA 4OBRA 1E51A 1PDZA 3O6YX 1X7FA 4RZ6A 3LXBA 4JQ4A 3GNXA 1SJDA 1K8ZA 1JFHA 2VMFA 1CIUA 3VZYA 1F07A 3PB2A 1AQ0A 3N2XA 3ZYZA 3T0AA 5EMLA 3LA4A 3W7JA 3WH7A 1NFGA 3HFTA 5IOBA 4GHRA 3OHMB 5IBXC 4JNMA 4ICCX 1H7PA 3VAVA 3TMLA 4AX7A 4J5NA 3AMDA 4IG2B 3QPEA 3DFPA 1FH8A 1O4UA 2J7CA 1NARA 2V0TA 1TCDA 3SECA 1KFWA 2XVKA 3L2LA 4IT1A 1J2BA 4HCDA 4QDPA 4MDPA 2BV9A 3WLTA 4AIOA 4HK5A 1IWBA 1G69A 2VD8A 2E8ZA 2D24A 3VPLA 3SJNA 1UG6A 3RR1A 4AY1A 5HR7A 2HS6A 4JICA 5I23A 4PEKA 1UR0A 1XLIA 4LYRA 1TPDA 4XK2A 2D3NA 4XBSA 4UMAA 1ZHAA 4X2RA 3H4WA 4Q6XA 1L6SA 2IKHA 3GQYA 2PBOA 3PWAA 1RBLA 4Q8QA 5BXPA 4UXDA 5FAGA 4JQAA 1SGJA 2D3LA 3S5ZA 3EOLA 4WJEA 1PAMA 2HXUA 3KCOA 4HHHA 1D8WA 4K38A 4Z2JA 3FA4A 3I6RA 4X61A 2W4XA 4FI4A 2VCBA 4PUNA 3TOYA 1VEMA 1KM0A 4QLKA 2OOGA 4XKYA 2AQVA 2OSYA 3OQEA 2Z2AA 1HVQA 1DTUA 4OUIA 4C5YA 1W32A 5J04A 4JPGA 1VFFA 2XM1A 4CGTA 4AHPA 3E1F1 1K7XA 4LAZA 4DWDA 1PIGA 3W9ZA 5A3HA 5I3HA 4XTDA 3W2UA 4V1XA 1PBGA 1YE6A 2FTWA 1N2VA 3ID7A 3VCCA 4OOZA 1W17A 3UXAA 1BRLA 1HUVA 3L4XA 1QWGA 3WFAA 1ITCA 1OK6A 4HNCA 3P84A 4Z08A 1KGWA 2XIBA 5HMSA 4J3TA 2GJXB 3NQFA 3AIRA 3WUEA 3BL3A 5DMMA 5AHFA 3CJPA 4US5D 3WNOA 3C8NA 3SCRA 2I56A 4FP1A 4MM1A 4DO7A 3M5YA 4A05A 1O66A 2F2HA 1Q6QA 4F0SA 1BRLB 3SFKA 1IF2A 3LB0A 4HJWA 5FCZA 1TWWA 4ML9A 1PJ9A 1P0NA 3M0KA 1ZS2A 3C61A 1VAHA 3CO8A 1I0DA 4GPNA 4Y7EA 3URBA 3ZT5A 1UR4A 4PTMA 3SRFA 3M0MA 4NVTA 3DENA 2ACQA 4LVBA 3AXXA 1MNSA 3VOCA 1S46A 3CAKA 4XO6A 3W2JA 4KKXA 1EIXA 3GB6A 5DELA 1SW7A 3ATZA 1ZB5A 1VLIA 1XQKA 2EPNA 2PUZA 4WKFA 5DCBA 4G1NA 3BLEA 3S6OA 4NXSA 1QFEA 1XUZA 3K4WA 3OVQA 3TWBA 3BZGA 1DL3A 4WZHA 5AZ1A 3LLDA 1JDAA 2J7EA 4JHMA 2D2JA 3GFYA 4UOJA 1IYXA 1BD0A 4WKAA 2OQHA 5A5WA 3I68A 1FOBA 3NVTA 2Q8XA 3OVGA 2WMKA 4JNZA 3SCTA 2OLAA 3PBYA 1A5NC 4KCWA 1W3LA 3LNPA 3SZ8A 4I5UA 1JI2A 2GOKA 4B3LA 3ABQA 3EWYA 2ZOXA 2CZEA 2FPYA 3G1SA 3K4DA 4WJXA 1EB3A 2G50A 2I9UA 4H8VA 5L9FA 4DJFD 3TR2A 1M6JA 3MUIA 2BG5A 4GVHA 1BXCA 4PSRA 5K2ZA 3BDKA 2D0HA 3WF4A 1YDNA 5AZ0A 2PDBA 3QSRA 5A8OA 1T96A 1JI1A 1V77A 5K4XA 4C1LA 5I7GA 3GNDA 2BY0A 3WLJA 4U5KA 3IIOA 3CUHA 1EDTA 4GI6A 4AHQA 5B80A 1SMAA 1OABA 3N11A 3WUFA 3WF0A 4GUHA 2DZSA 5F2MA 2YXGA 5AC6A 1DJZA 2PDIA 2YW3A 3TTSA 1WAUA 5K9CA 4F8XA 4ADTA 3V0UA 4EKJA 1YTEA 1UR2A 4YTTA 3INPA 4Z0JA 4UNKA 2IQDA 4IXHA 2A5HA 1QI0A 4DAIA 1GVRA 3DG7A 1CDGA 4WDTA 2V5DA 1ITQA 4M0XA 2QAPA 1KRCC 3D47A 2CWNA 2BP1A 4ZOBA 5E9AA 4B5TA 2ZA1A 4MSSA 2E7FA 1HZYA 4WSKA 3FAWA 5F2IA 1KV8A 3QQ0A 1W31A 1I45A 4LBUA 4MAVA 1AG1O 3ICJA 4F4RA 2L5HA 3VNIA 5IM51 1C8XA 1LG1A 4M3PA 3PZ9A 3TN3A 1KFBA 4OECA 1E4IA 1TV8A 3W00A 3AS0A 3C0LA 4MMWA 3H2OA 3TTEA 2VFHA 4YVVA 4JIRA 4RJEA 1TG7A 3NJ3A 4HSOA 3NGFA 4HMNA 3ZLHA 2AKZA 2OZ0A 3NQ7A 1NOWA 1B3XA 3VCNA 2ZUMA 4WF7A 1EPVA 2C19A 1IQ8A 2ZZ6A 3W7HA 2EPKX 3OBEA 3ZFHA 3R89A 1P48A 5G1TA 4PEEA 1OFOA 4EAYA 1CXLA 4DJED 4MF4A 3LBOA 3ZSSA 4QGCA 1TZ9A 3CS2A 2PMQA 2YCIX 1LL4A 4X60A 4KW2A 3O07A 4ONVA 2IPGA 1KM2A 1CT5A 4GCXA 4LPCA 1SU5A 1A49A 3ALGA 3V5OA 5K9XA 1V7YA 3M0XA 1E73M 3QTGA 4JIHA 1CZ1A 1E1FA 1MDRA 3UBPC 5A6BA 3CIWA 4KFNA 1KBLA 3MP4A 1KBKA 4LOCA 3CK5A 3TFCA 2Z7GA 2FHFA 3T7VA 1D9EA 2VWSA 4PL2A 3VOGA 3WO8A 4C6JA 3VIMA 4RR4A 3PBGA 3C6CA 5B7ZA 2R9RA 3WK0A 1R3SA 3QPZA 1XX1A 3I3DA 4LVGA 2J7GA 3IK4A 2YL5A 3W2LA 2HQAA 4JIEA 1PYMA 3IWPA 5AYXA 3LDVA 4CUCA 2PB1A 4FNPA 3FK4A 3ZR4A 1ONWA 4CNTA 2OVLA 1X6NA 4ILSA 5KINA 2RFGA 1CXKA 3GIQA 3BLFA 3WFZA 3FHAA 1QNRA 2TMDA 4JBRA 3SUVA 3ABZA 3W27A 1B54A 1TUFA 5FJRA 1HL2A 1Q65A 1RLDA 4QIUA 4KESA 1JZ7A 1HG3A 4IF2A 2JGYA 1DJHA 1BVNP 4O8AA 1YPIA 3ABSA 1VQTA 3W2MA 4EE9A 3W84A 4IUOA 3J7HA 7REQA 1LRQA 4MHBA 3A47A 3UWWA 2FZMA 5G1YA 3EA2A 3B8TA 3B9OA 4IQLA 2E6DA 2CLKA 4G8TA 2QJGA 4AISA 1G6CA 2XSXA 5MHBA 5I07A 2CHNA 3ANUA 4FB7A 2ISFA 3L4ZA 1M7XA 2R91A 1R2SA 2QXWA 4B5SA 4QS5A 4UCGA 1KCZA 2YJQA 5I3DA 3ARWA 1US2A 2E4TA 5LYRA 2XIIA 4XZMX 3IIXA 2D2OA 3WLSA 7REQB 4TVCA 3NDYA 3T2OA 1JCTA 1WYIA 3I10A 1SYTA 1P0KA 3GSMA 2NQ5A 3SGGA 1V5XA 4U2ZA 3KDOA 2OO6A 1N55A 1K70A 3STEA 2HMCA 4LYPA 4CN1A 5J8LA 3C2YA 2BODX 3VUPA 4E5TA 4DBEA 1G01A 3VUSA 1B0IA 5GVJA 3IPWA 2PDHA 1AFSA 3O0KA 3DIPA 4W7VA 3NQCA 1DQUA 3NR0A 3VGBA 3WQCA 1M04A 4U3CA 2EPOA 4HD5A 4S39A 4PCNA 2B0MA 2YCEA 2J7DA 2QVNA 4OJYA 1B30A 3VABA 3WJZA 3C2VA 3HM7A 3EA1A 1FP8A 1SSGA 1FXPA 4C1NB 3H7VA 4BWLA 4PN2A 3OA3A 4BQ4A 3HGRA 4PCSA 3VOIA 3B8WA 4GZ7A 2AL1A 1X97A 4H9ZA 3FFSA 4BWLC 2C15A 4KETA 5A8GA 2NV1A 1EYWA 4FOKA 3AICA 3GU9A 2UWFA 4AWTA 1XYBA 1ALDA 5CG7A 4HPHA 4YPJA 1WZKA 1OFRA 1BXBA 4HPXA 2ZZ4A 4MOZA 4P8XA 2DVTA 3AHYA 2GVLA 1PWMA 3A6OA 3GFZA 5LXEA 4FMVA 2H6RA 3NQ8A 5HMDA 3ARQA 3NIYA 2C71A 2DZBA 1VZWA 3KBWA 3O2LA 3UJSA 2UV8G 3KOYA 2PC4A 5BWAA 4W93A 1MXDA 3MBDA 1YTKA 2BXVA 4TOQA 4JN6A 5D8ZA 4HB7A 1MXSA 1MDLA 2ZXQA 4S3EA 3L4TA 4GINA 2H3BA 4YVXA 2DGAA 4CCCA 1TPB1 4J3SA 3V0SA 2ISVA 4S3JA 4XO7A 1HJXA 3OZPA 2CERA 4W84A 4I7VA 4ZENA 4GH3A 3LPGA 3E0IA 1IZCA 2X05A 3ARZA 3S0CA 2E8YA 4HA3A 4AYSA 3VO0A 1GPWA 4Z0SA 5HUPA 2BXYA 1EF2A 2FZ9A 1N8IA 1P0DA 2E9LA 4PYSA 1JZ2A 1EWDA 2LLEA 3WQ8A 3W26A 4UTFA 4CN6A 1F74A 2P3EA 5LNVA 4PMDA 3CBWA 3W1TA 3RCYA 4JTAA 4XD6A 3TW7A 1JQXA 3G8RA 4FX6M 1W9PA 4L4LA 4NI3A 3W82A 2DORA 1SJAA 2ON3A 2ZC8A 5A2AA 3F4CA 3WLHA 4XZ9A 3GO2A 3MWAA 1XL9A 1IEWA 3CEPA 3D3AA 3CTTA 4UR8A 2OPJA 1BTMA 1LDCA 2CEQA 3GG1A 4AEOA 3DG3A 3TE9A 4F2UA 2Y5EA 2YFOA 4H6RA 4ZQCA 4DF0A 1BQCA 1C91A 1A50A 4Q6JA 3DFNA 1LG2A 4KCUA 3MCOA 1G9HA 4JTSA 1H3GA 1K9FA 3B9EA 4Y96A 3WX7A 2BNJA 3QKZA 1XPGA 5A2BA 3FN9A 4Q4OA 3PZVA 3W88A 4GH1A 1DXFA 3CV2A 3L2IA 4OU1A 3S4TA 4PRTA 1ICPA 4IM4A 3FJ4A 3USZA 2YL9A 8XIAA 3TA6A 2Y8UA 1EBHA 1F05A 1MEWA 1TWZA 1UC5A 2CBUA 2Z2UA 3AZSA 1AW5A 4MUPA 2WSPA 4NX5A 2NQJA 2EKGA 3VU2A 1E6QM 1W8GA 1BYCA 2FPTA 3O06A 3LHWA 3N2OA 4XTIA 1BFNA 3M4HA 5E0FA 2H9AB 1HKIA 2WC3A 2F84A 3KZPA 4LSBA 2XDFA 1UH2A 1QPRA 2EPLX 4IICA 4A8IA 4DO4A 5E1QA 1YKWA 2QMJA 3K13A 4UFLA 5CSUA 1YMYA 1BXNA 1KRMA 2GQ9A 2PS2A 3KAOA 2VURA 4IPIA 1RP9A 3A4JA 3KTSA 1P6BA 1WO2A 3TSMA 2CZDA 3AO0A 1ONXA 1W3TA 4O12A 3ONCA 4N7QA 4LT9A 3CAWA 2YX0A 2XH0A 1YLVA 1TQXA 4ZXLA 4UNLA 3M43A 3SJ3A 3U48A 2ZZ7A 4WY0B 1R3YA 4V1YA 2CLOA 1OCJA 4L6DA 1CLXA 4M1RA 5C2XA 2C79A 2G3MA 2HVMA 3SEPA 4CQ9A 1Z42A 3B8VA 1B90A 1W1B1 3DHPA 1UBSA 1EA0A 4J2PA 3F2CA 1CLVA 5G2WA 1QK0A 1C8QA 1FWJC 2WW5A 4NNCA 5CKSA 3SGUA 1IWPA 4RCXA 1YQ2A 3EWDA 2VDHA 4D6HA 1HXJA 2E3ZA 1EBGA 1UUOA 3QH2A 1V6YA 1W3KA 4P8WA 1CGVA 1EWEA 1WDPA 2DV0A 4N02A 4GJJA 2YW4A 1UCWA 1E55A 2ZKMX 3SCSA 3SCNA 3TN6A 1RQEA 3P5ZA 3ALFA 3LNMA 1LTDA 1SM9A 2FFCA 3G1VA 3NZPA 2A6NA 4NZJA 1WP6A 2YCLB 4DN1A 1UD2A 1RR2A 3N9SA 3DCPA 3II1A 3S83A 1Y5WA 2E6YA 3VC5A 2DH2A 2G0WA 3DKJA 5CPTA 3F5JA 5B7YA 4LVDA 1KW1A 4RE4A 6TAAA 2EQDA 4YLWA 2OT1A 2XH7A 3E6EA 4GY7A 2X2GA 1O5KA 4DZ5A 3NM1A 1BWLA 1SJCA 1WB0A 2I7GA 4O1EA 5BMWA 3P81A 1IIGA 3FEMA 4PR4A 3P93A 7A3HA 3M07A 3LV5A 3NTYA 2Y24A 1S2CA 2QUNA 4KMQA 3BH4A 2J8FA 2WNNA 4LUIA 4QXIA 4TTGA 3OU8A 4M6VA 3AXKA 1MWOA 1VHCA 2XHYA 2NZLA 4EPKA 5HNUA 1BG9A 4LUTA 3BJTA 1R87A 3ZR5A 1JNEA 2EXOA 1HIZA 3IARA 4M7TA 2DZTA 4F2TA 3NAVA 5TBOA 1LM1A 2QZRA 3OVRA 3SCWA 1EC7A 3G2GA 4N42A 4PMXA 3UZWA 3VE9A 3IJ8A 5DRIA 3U0HA 3EDFA 3IIPA 2UZ9A 2UY3A 3L5LA 1PIIA 5JUVA 4HT3A 4RKAA 1ESWA 1H7RA 1K1DA 3M46A 1LF1A 1KNWA 3DZ1A 4JDYA 3UQNA 1K9EA 3K1DA 2WXDM 4Y2WA 3WD3A 4H01A 3B40A 1CX9A 4HPGA 4RNIA 4C6NA 2G5WA 2NQLA 1FCVA 3R12A 2VVNA 4X9SA 3A24A 3OZYA 4FXFA 1XINA 4J1OA 5A8QA 1W1IE 5DFAA 1WNOA 2GUYA 4NRSA 4X3ZA 3HOJA 2A3AA 1C93A 4XVDA 3B8DA 4TU1A 3AJ7A 3KLKA 4GUJA 3TWAA 2DFAA 3HGSA 4KRTA 2VFIA 2VGBA 1E3ZA 3PHAA 3MZ2A 2O9OA 2J7HA 2ZUNA 4QJ4B 3JUGA 1GKQA 3I3EA 1Z44A 2RGMA 1O5QA 4ROQA 4MJ4A 1E9IA 2IPFA 3R0DA 5PTDA 2WM0A 2FZDA 1DQWA 2DT1A 1TV3A 1FHLA 3A3XA 5FSDC 1XDJA 2GYIA 3QV7A 3OW1A 3I7QA 1QWKA 3KM8A 4GC4A 1JYWA 1GCYA 1VFSA 3LRMA 1PVNA 2O4QA 3VNLA 1FQ0A 3PBVA 4LCQA 2G3IA 3GDMA 4IX0A 4GYFA 2PODA 1J0HA 4MVAA 2C1GA 5BRBA 4QG8A 4ALDA 3QKEA 1XGEA 3S46A 4HK6A 3NM3A 3AJXA 5CZKA 1QPNA 3AU6A 4QFUA 2PWVA 3R25A 4Q8TA 1R2TA 1QW8A 1W37A 3RX2A 1BSLA 2CLEA 2NVAA 1IT8A 3V4BA 2G96A 4UOQA 4IFKB 1H5YA 3N2CA 4RE2A 4ZQRA 1OYAA 1KM6A 3F5KA 1A5UA 2V2HA 3G1RA 4HNOA 3FGCA 3QBUA 2WMIA 4N4QA 1RA0A 4O19A 4LU0A 4LYQA 2WC7A 3WQFA 2VTFA 2VHLA 1TMQA 1W2VA 2FFIA 4HU3A 1T99A 4YCPA 2VL4A 2PTWA 1S3HA 3NYZA 3USBA 3NYDA 4HCHA 1DXIA 1M3UA 1SJBA 1TTQA 4MNJA 4OBSA 1A5MC 4REQB 4H8NA 1OZMA 3ZT6A 3LRLA 2O9TA 4HNUA 3VIOA 3OODA 3HV9A 4LCRA 1XXXA 2YIHA 3A4XA 4H7CA 3KCLA 4JTHA 4D1JA 3QSTA 4G1KA 5AVNA 4MWAA 3CZJA 2V5JA 4RDZA 4QHRA 2OJPA 1Q6FA 3PFRA 1JNDA 2X1IA 5GPRA 3KP1A 3HTWA 4MWAC 4LV4A 1GQNA 1DE6A 3H22A 5C9WA 4IGMA 3E0LA 3UETA 4KH2A 3UJFA 3GXPA 4L9ZA 4CQDA 4E2VA 3VD3A 1J18A 2BASA 1QHOA 2B7PA 4MWAB 3DDMA 3LG3A 3U2EA 3N9KA 3AYSA 2E68A 3BGAA 4GY0A 2QCLA 3DFOA 3NQAA 5JU6A 1EO5A 1AODA 4LWWA 1IXOA 1C90A 3G6MA 4FXSA 2XFFA 4RK8A 3RYSA 3SDOA 1KM4A 1V02E 3VFLA 1AL8A 2G41A 3P62A 3W24A 1BVWA 3VOFA 5D9OA 1X1ZA 4P7RA 3DECA 1CB2A 3P0WA 1DEDA 2GJLA 2CXEA 2OGYA 3V36A 3LM7A 5U7SA 1RALA 3VILA 2BHYA 3QV8A 3BCDA 3STGA 5HJXA 1HKKA 1WX0A 4F0HA 3GVWA 1D2KA 5D30A 4R9XA 1RJRA 3LN3A 3SSZA 3C52A 2DSZA 4WVXA 5AYYA 1HT6A 2HXTA 3WJSA 2YL6A 4XZNX 1GONA 1KR1A 3G3DA 4PTXA 2PU1A 2JF6A 4I8YA 3B8IA 1YEYA 2AGKA 3SRKA 2OU4A 3KS5A 3BOXA 3T0BA 2G4FA 5HPOA 4KPLA 3AHVA 1FWHC 3AIEA 1PCKA 3EDEA 2GJRA 1ISZA 3E96A 2OLSA 2XVLA 3W53A 3S5OA 3PAOA 3GLCA 2IXVA 3ES7A 4E4UA 2YL8A 4LTSA 1L8PA 2QCCA 1V0LA 1TA3B 2EGZA 4HNVA 2VM8A 4AAJA 3QQ1A 3POHA 4GJIA 1QI2A 3CIXA 1HJUA 1EHAA 1XIHA 4NKCA 5D32A 2YOCA 3W28A 2Z26A 3KOXA 5JH1A 1LWHA 3B8SA 1LWJA 4AD2A 4HPJA 4XIAA 3M6DA 7TIMA 3WL0A 5G4HC 5DMLA 1KGUA 3QMTA 3G3MA 1ISYA 5GNXA 1R3VA 2E28A 4IISA 3AIQA 2RHGA 4HN4A 4M82A 4W9TA 1W9XA 4A8RA 2OEKA 3R0UA 3JW7A 2PLJA 3CC1A 3CXOA 2AL2A 3KDNA 5ABGA 2PLKA 3AQUA 4MIMA 4N6FA 3TTQA 4QLJA 3QF0A 5I3JA 2WHLA 5G2IA 4WXZA 3HJZA 1UWRA 3VIKA 1ADSA 1RJQA 3OG3A 5AC5A 2PDLA 3L66A 1DVJA 4B3KA 3WQ6A 3IAQA 2P5NA 4H8UA 3K8LA 1T8XA 2Z29A 1B2YA 4C7DA 1YTDA 4DUXA 3P60A 4H6QA 3T55A 3NSNA 2ZA2A 2DSKA 1C9WA 4G7EB 2PDFA 4TX9A 1RP8A 3ENLA 3ARSA 5H91A 3H2FA 3WDQA 3OZMA 5AHEA 3O15A 3MUCA 1SZEA 4B5WA 2FKPA 2GGGA 1WZLA 3KP0A 4JGDA 4CD6A 4WEVX 5FF0A 4V28A 4XQ6A 5ENLA 1ZY9A 4JTDA 3FW6A 1V51A 3O63A 2GLKA 4DXXA 1CWYA 4O4VA 4PULA 2DPEA 3LHTA 4C6BA 1RCQA 3RITA 2OWXA 5D2YA 4Q4QA 4R88A 4CD8A 4POCA 2INFA 3N2BA 4GX9A 4JXCA 1GTEA 2D0GA 3G8EA 2VENA 3QLLA 2IKIA 1FKWA 1F7BA 1LBMA 1QPQA 4AY7A 3OGSA 3CQKA 2VC5A 1EPXA 2YXOA 1VPQA 1CB7B 3BLLA 2PGRA 4KFOA 4R7WA 2WMFA 3MZNA 1OIFA 4YIWA 2F9RA 4XAPA 3KVMA 2VOMA 1EUAA 3D5HA 5CBJA 1RK6A 3TQVA 4Q8WA 1QDSA 2VGGA 4GCAA 1ME8A 5C2CA 4LANA 2F6XA 1UPPA 1QPOA 5CGTA 1UD8A 1VHNA 2PTDA 4ORMA 5C2GA 1ZBKA 5IXEA 1W9BM 2W6RA 4Q7IA 2R1MA 3AOFA 4ZSUA 1OFAA 1PTAA 1L9WA 1XDLA 3TONA 3O1NA 3P67A 1JZ8A 4IZGA 4IGSA 3W7LA 2PLMA 4NG3A 4Y8EA 3O0FA 1EO7A 2ZUUA 3U5UA 1T5AA 3PZGA 1JPMA 3K5XA 4IQEA 2PLCA 4TMBA 4FIRA 3ZJ7A 3PNUA 2CPUA 2AGTA 2QULA 1QI3A 2XIJA 3ZS4A 4US6A 1R0MA 4MDOA 1W2PA 4LRTA 4HZMA 3WNMA 2A21A 4W8BA 3WDHA 1R30A 3RLUA 5DLCA 1XLGA 1UP2A 5JIPA 1VGAA 3W23A 3T07A 5BRQA 4GNKB 3NL5A 1H7WA 3CZKA 2BOFX 1REQA 1BF6A 3W1XA 3ORWA 1E0XA 3PPFA 1OG6A 3R5EA 1CECA 4ZB0A 4P7OA 3BSGA 3SY8A 3UNDA 2XFRA 2NSOA 1MVYA 4TO8A 4C6MA 4YWSA 5KZMA 1CGXA 1EA9C 4FA3A 3BV7A 4UTKA 3TYAA 3IIZA 3PJWA 3B8UA 3AUJA 1M9HA 4AWUA 3ITYA 3CYVA 1IXPA 3NPWA 4XZWA 3BPWA 3N18A 1I1WA 3O6DA 2J8TA 5GJMA 3A9BA 1EX1A 1ISVA 3PNZA 3F5LA 4YXGA 1WKEA 4ROPA 3C3NA 2NT0A 1PE1A 2J88A 5CPNA 2FPVA 3AXMA 3GKFA 1W5MA 2OEMA 3UGRA 2YDRA 1RD6A 4FSAA 1CXHA 3NL3A 1RBAA 3OIXA 1SFLA 3CZ8A 1TWDA 3WK3A 4CEUC 3G1AA 5A69A 1XWYA 3LLXA 3BAYA 3V5FA 2JGQA 2NVCA 2P8CA 3AMCA 2ZRWA 1Q2RA 4TVDA 3TMQA 4N4PA 3ZIZA 5CC5A 5G4WA 2O92A 1PIFA 2PDWA 3PBMA 5H8MA 4NJHA 2CZVA 4UFHA 4KEVA 4LVAA 1FY6A 2R8WA 1S3TC 3LGDA 2VR2A 5FACA 5CSYA 1GQLA 3FAXA 1TVNA 4JTEA 4CD7A 3IJDA 1X96A 2OT0A 2VT0A 1TZ7A 2NX1A 4OBTA 4O10A 1O12A 3BXWA 3LCIA 3W25A 3EX1A 4GIYA 4HHPA 1P5BA 3O05A 1VIZA 4BQ3A 1HKVA 3AU2A 5C71A 5EU9A 1J0YA 2HZGA 2DJLA 4ATWA 1KXTA 2VR5A 1QPKA 1QNPA 1OT2A 1GOKA 3BMXA 4CN4A 2JBMA 2WKJA 3BCFA 1XLFA 3GXFA 3IS4A 3LQGA 3PWGA 2QCEA 2QCFA 4B9YA 3UG8A 2WAGA 4R33A 5LIUX 2Y85A 2HPMA 2F8QA 1NVMA 4DWSD 1CTNA 3PUDA 1K3UA 3P14A 3RU6A 3IEBA 1I1XA 3W01A 2XGZA 1FH9A 1JUKA 2VGFA 4J3UA 4KBXA 3VM7A 2AMGA 2X1UA 3RCMA 4I5RA 3KFTA 3GX9A 3MJYA 3G1XA 1WUFA 7ODCA 4MZ1A 3KVJA 2PRLA 2I1OA 1EUNA 3RPDA 4Z17A 4XD5A 3HPSA 3ZVHB 3ITGA 3S2MA 3S1VA 2B7NA 3ZZ1A 2C18A 3B9NA 3FEQA 1VFUA 1R6WA 4IPJA 1EL3A 2PD5A 4IP4A 1W3IA 1X8CA 5LIWX 5EGRA 3CH9A 1HNYA 3VGGA 4HCLA 1IT7A 3CM4A 3PWIA 3TW9A 3VK5A 4HYRA 3AS2A 2GWNA 1ZL1A 2OX4A 3WYZA 1NDWA 1UR1A 4Q8NA 5D2VA 5BU6A 1U83A 2AMXA 2OOFA 1TJ0A 3APTA 2NUXA 4MADA 4AFYA 1KQYA 2ZUTA 4UR7A 1W1PA 2W27A 1JDDA 3RO8A 3WIJA 4EXBA 1L6FA 2Y8KA 1AMYA 4D72A 1GJPA 1XLHA 3DHFA 1TV5A 3DFQA 3VX1A 1IIHA 5ABHA 4EPDC 4O50A 4L6OA 1TWSA 4A35A 3W1MA 4C5ZA 1CBGA 1QBAA 3HGOA 3AIWA 2PEVA 2QJHA 3NDZA 4WDUA 2TPSA 3GYCA 7PTDA 4JTKA 4R9OA 1XDMA 1DHPA 1NFBA 3LM3A 3ITVA 4PMJA 4UTHA 1P6WA 4LH8A 2Z28A 2WPBA 4Q8MA 2VZTA 4W5ZA 2CNCA 2WLZA 1RSCA 1Q8AA 4MYAA 1ITUA 4BQ5A 2XVGA 2FVMA 2EJAA 3WDJA 3WG6A 2Y7GA 2I57A 3FYYA 1X1OA 1OC7A 1VPYA 1Q7QA 2D0FA 1V93A 4Q7NA 4HZ8A 4DI9A 4KGJA 1MW0A 1R3WA 3CZGA 3WDRA 3HG2A 4H9MA 2FVLA 3PPHA 2XGBA 4GIRA 2RDXA 1Q5MA 1PSCA 4AZGA 4I90A 4YTUA 2WCGA 3L2MA 2PDKA 4Y9NA 2B7OA 2PDGA 1I75A 4JTUA 3BTNA 1OADA 3I4KA 3M5ZA 5CEWA 3TYCA 3W70A 2F38A 3C8FA 1PX4A 3JZEA 1IGSA 3ZM8A 3UA3A 1LOLA 4KRUA 1GZJA 3IIVA 3G0UA 4YTQA 3NO1A 4UR9A 3TJLA 1QK2A 2HROA 1U2YA 3H4GA 3QHNA 4Q4KA 3PZUA 1XSIA 4HA1A 3BK0A 1G0CA 3NG3A 3C56A 5AC7A 7XIMA 1XIJA 4XBKA 3TDFA 3BJFA 2ATMA 3MJMA 4TUFA 1V3JA 1RBOB 4R5EA 3TK7A 4IIEA 4FNQA 5D02A 1GQJA 4M6UA 3A9IA 4JKLA 4IJRA 1TJ1A 4K8GA 2ALRA 4PB5A 4WUIA 1UWSA 5D2XA 4UZUA 3NPXA 1E15A 1L6GA 2J79A 4JDBA 4X0NA 3WLQA 2QQ6A 3RX3A 2WMJA 2WHKA 3PY2A 1VCGA 2PCQA 3KRZA 4RPQA 5HMEA 2TSYA 3MI3A 5A6LA 3HBLA 3HG4A 3RPMA 1PZ2A 1Q4NX 4X2PA 1NTHA 4O8RA 2HTMA 4FF5A 2HSAA 1UW9A 3MP5A 5TD4A 1DWAM 3H2NA 2ZZ2A 4NNBA 4DUVA 5E6ZA 4H04A 2WPGA 2ZIDA 1OC6A 4EF8A 3WH6A 4K6AA 1FWBC 2VVSA 1XYFA 5EL1A 3TV8A 3TYUA 1A5AA 4IIGA 4M6QA 4NJGA 3B4YA 1H0GA 4EPBC 2BVYA 4JQ1A 3WELA 3FA5A 3NVDA 3TYDA 1ZAIA 2YKKA 1DJQA 2CLPA 1US0A 1V6VA 1LL6A 3MCMA 3LXCA 5BZAA 3R94A 3GM8A 3PSWA 2J78A 3QTPA 1XGZA 3U7BA 2QJNA 2W61A 3IVSA 1XPYA 1IWAA 2ZE0A 1C92A 1K7EA 3R2GA 3UWUA 4MY8A 1SUXA 1V3HA 1K6WA 3W38A 5H2ZA 2ZDSA 3VD7A 3WNNA 3UXKA 4OVXA 3UYIA 3EMQA 4GVGA 3ZWSA 3TFXA 3UJEA 2C7FA 4GOAA 3UY8A 4DELA 5M17A 1WDRA 1T6MA 3ZWTA 4XG1A 2FH6A 1VPXA 2XFWA 1UOKA 1KQZA 3PSVA 3BZJA 3VINA 5KZ6A 3NQ6A 4W86A 3NSXA 2XGIA 5A6TC 3TIMA 5CZTA 1MW1A 2CKRA 1AUSL 3EEZA 1VS1A 3OG2A 4K7YA 2C1IA 1ZTVA 2ZX7A 2WWCA 2ZTJA 1E0UA 4URIA 2P50A 4LNCA 2OLHA 4NAFB 4XZLX 4HSNA 4JFVA 1WDQA 1G4EA 2Y7FA 4DNHA 5DQPA 3EOUA 1VD6A 2I5QA 3THCA 3BSHA 2XG9A 5A1AA 1XJBA 3R13A 3M0LA 3CWOX 1IXQA 1H1NA 1MUMA 1WBJA 2W62A 1J11A 1Q6RA 3T4CA 1IV8A 4JN7A 4PMYA 1JCLA 2DT3A 4F0KA 3BG5A 1SW0A 4N9DA 2X2YA 2ZQ0A 3M7WA 3W7MA 1O95A 5IHRA 5CPSA 4HIBA 3E2QA 3IJQA 2ZUWA 4UOZA 2Y5JA 2HCVA 4XSLA 3W83A 3WCZA 2VC9A 4O18A 1EKOA 4GIEA 4PFMA 3AZTA 2V3GA 2Z6JA 2WQDA 3VNMA 4CNPA 3H2AA 2O4MA 1NF0A 5I09A 1Q66A 3UNTA 3VZZA 4KWVA 1O1HA 3AHXA 4MZ8A 4PUJA 1B3ZA 3E0WA 3F7JA 1NP0A 3N4EA 4F9JA 1KBBA 2FTPA 3RN6A 3W7GA 3U4FA 4M8UA 5LA2A 4TQTA 3RUBL 1OBAA 3EX4A 4L9XA 2A7NA 4PUUA 4Q7BA 2EG8A 4TX8A 1JL8A 4TTUA 4EX4A 1QVBA 4YYFA 3RHGA 1PHWA 2FTYA 4Z2KA 2DSVA 3FCPA 5LIYX 5A8NA 1EJSC 1TVLA 1R9YA 4GNVA 4W4QA 4H8HA 2JKPA 4B90A 2G3NA 2XN1A 1TV4A 3TQKA 1GVEA 4I9AA 2EG6A 3EOOA 2QEZA 4JL1A 2WZMA 1DJGA 5EKYA 3ABXA 2WCAA 1UP3A 3G18A 1NOFA 4LEQA 5LHFA 3D0CA 1AD1A 4O54A 3CU2A 1JR1A 4H7ZA 2CC0A 3NA8A 1O7AA 3EYPA 2DIEA 1SO5A 2VX4A 1U1JA 3HIJA 5A6BD 5HJLA 4GX8A 4IPPA 2XPKA 3EB2A 2J9XA 2XWDA 3B03A 3SQSA 3RRXA 3W1UA 3OLIA 3EWBX 2JQXA 1TUXA 2PDQA 3S47A 2WNQA 3E2RA 5CLTA 1XSJA 3O9NA 3T2PA 4E8GA 1JXJA 2RKXA 5A6JA 4BHYA 2ZA3A 4PMVA 3RM8A 4PMOA 5HNRA 3CYJA 3NQ2A 3G22A 3T0DA 1AJ0A 2DZVA 1WOBA 4X63A 4ZL1A 3RJYA 2C14A 1BHGA 1O5XA 1B3WA 3UZZA 1RQHA 1QRQA 2QCHA 4ERIA 5LGZA 4HQVA 5CLWA 5I5RA 4KRZA 4NJKA 2DZWA 4PE8A 2VGIA 3F2DA 2ZX8A 2F2KA 4KCTA 3V18A 1DIEA 2HBXA 2WV8A 2J27A 4R27A 4WOZA 2XYLA 2ADAA 1XUUA 2RUSA 1XIGA 2VP8A 3W2NA 2ZX5A 2ICSA 1XLDA 4Y8FA 2BWGA 1DJXA 3CNYA 5D09A 3U2CA 2OSXA 3BAWA 1B31A 1SFSA 3GNRA 4AZ5A 3O16A 2W5FA 1KFLA 1XLKA 5DT5A 3G24A 3ZXWA 4CD4A 3QXBA 4GGHA 1O5RA 4DM2A 5GQBA 1TPUA 3FV9A 4D6DA 2OCZA 3S1UA 4XUYA 1JUEA 4XX6A 4GABA 3W75A 3R6IA 3KE0A 3UR2A 3AIUA 2CHRA 2MUCA 2REQA 4DZHA 1FDZA 3TC3A 1UD5A 1KCXA 2VC6A 1LUCB 5D33A 2Y63A 2X7WA 3N13A 4DF2A 1TVPA 3W1RA 3NZ1A 1GOMA 4GUGA 5C7VA 1H1ZA 1LQ0A 3N04A 3S9IA 3WQPA 3P8IA 1XV8A 1KWGA 5LIKX 3TQ0A 2WSRA 1OM0A 1U1UA 4MKVA 5BXSA 4HJFA 4JX6A 3BICA 4H4IA 3WZ0E 2DU2A 4S2BA 5M03A 4BR1A 4LFYA 3EX3A 3M0HA 3A3HA 3QRHA 4A3QA 2WVTA 4TV6A 3NPVA 4MPQA 3E0FA 1H62A 2EPMX 3W7EA 1BG4A 2Q3OA 2I5GA 1EP3A 2R1PA 1KO0A 1J2WA 2GPTA 1NAL1 2BFGA 3H8AA 4G5DA 3S1GA 1AQMA 2V2DA 1H63A 2PF8A 4BF5A 1AH4A 1OD8A 2YZRA 2OTDA 4GLEA 3V75A 3CUIA 1F9CA 3RK8A 4IMEA 3UYCA 2BBFA 4JQ2A 1B5TA 1VBRA 3KHDA 4R7OA 2R82A 1IE7C 1GQKA 2WZHA 2ZE3A 1BGAA 1ITXA 4A21A 4CNSA 3H70A 4FPSA 2JIWA 4GACA 4YHGA 2GQ3A 3FY1A 4WGXA 3QHOA 2G3FA 1XIMA 3W7RA 1E71M 3VKCA 2OX1A 4QJ1A 3W1QA 1XCFA 2ZC1A 1ZLPA 1JQVA 1DBTA 1AD4A 3FDGA 3KUMA 2OKOA 3GW3A 4AVOA 3XIMA 1F3EA 1IGWA 1A53A 1E6ZA 2HPIA 2PWDA 2QF7A 3HN3A 1GZGA 3GC4A 5C0QA 1J79A 4LNYA 3CAQA 1VLWA 1BYDA 3GUGA 1R85A 2J13A 3R0KA 3M0YA 1J10A 4Z42C 4Q8VA 1TIMA 4A3HA 3KVLA 5HQEA 3EWUA 4KEUA 1SW3A 3DXIA 1HKMA 2V30A 2VDIA 1EGVA 1R5YA 4FO4A 5REQA 1CGUA 2OWWA 3TNBA 4FLOA 1UKOA 4S1FA 3TJIA 3DEQA 2QV5A 2Q09A 3UWZA 1GNXA 4GD0A 3TC7A 3QYQA 4Q4SA 1AW2A 1ZP3A 1H7XA 1MI3A 4Q4RA 4QAWA 1LORA 1H11A 2VX5A 1TTPA 1OQFA 3GVRA 1E6NA 4A3YA 4AIEA 4MB4A 4FLRA 5HQLA 1H7OA 1JZ4A 1W5OA 1BTCA 1I60A 4N2YA 2NUYA 5REQB 4CCEA 3MU7A 8XIMA 1N7KA 1L0PA 3PG8A 1BKSA 3B0UX 2WJZA 5HA7A 1MXGA 5CBBA 4LAKA 4KF1A 1G67A 2OGJA 3BQ6A 3QV9A 2GGEA 1XKYA 3SCPA 5EFDA 5F1VA 3BLKA 3OP2A 2GGHA 2ZX9A 1X6UA 1WCGA 1K02A 2OR2A 4NL1A 1JIBA 2FZ8A 2CFFA 1POKA 4B4FA 4JHZA 5BWFA 4QCFA 1MNZA 3VGFA 1S5MA 4O15A 3C5QA 3W6MA 3CT2A 2CLMA 4M7SA 3W07A 3LS9A 4YNGA 4RW3A 3BWWA 3M0JA 4C6EA 3TH6A 3WD1A 4IG2A 2ZADA 4AIBA 4HU0A 3OLEA 3HA1A 3P7YA 3ITOA 2V82A 1XQLA 1QI4A 4EK7A 3KL0A 1YIXA 3TROA 5LZLA 1FX6A 3ATYA 4G56A 4M51A 4XUGA 2EG7A 1UPMB 5C8BB 3APGA 3GZAA 1GWJA 4C91A 5IBXA 3BAIA 1D7FA 1AZ2A 2DIJA 2J6XA 1J5SA 3LCLA 4BK9A 4DBSA 4A22A 3DI0A 2XH4A 4RUBA 4GBDA 2POZA 4J35A 4XVEA 3WBXA 1MO0A 2R24A 3QY6A 3LBCA 1H51A 3O6AA 5ABTA 3UXIA 2FB3A 4CQ8A 5I02A 5D8WA 5FI8A 1H60A 1JXKA 2GGJA 4PTWA 2NVDA 3U9IA 1KR0A 5AHNA 3WMLA 5FF3A 1KFKA 4RLIA 2E5DA 2DP3A 1Q13A 2XVNA 2NV9A 1KKOA 3AMGA 3FJNA 3FJ6A 2O7SA 3U4AA 2Q71A 2F6UA 4E3TA 4H2CA 1XR2A 1VFMA 1Z48A 4AF0B 1ZRQA 1U1HA 2J77A 4JKKA 4IPLA 4PUKA 5BROA 3KL5A 1E6PA 3WNLA 3HMJG 3HURA 4FALA 4GXPA 4LF1A 4R3UA 1ONRA 3HPFA 4JFUA 3ONBA 4QSHA 4H9TA 1PKMA 1RZMA 2ZRYA 4GZEA 1KFCA 3SM0A 3UXLA 2QGYA 3IJIA 1VBGA 1FTXA 3AUOA 3GC2A 4ERAA 2E09A 1HTIA 2J4GA 4BEQA 2QMKA 3V16A 4HNTA 1LWIA 3OVPA 4IJBA 3UFYA 4JKMA 4PRWA 3GNNA 1Y7VA 3C2OA 2C6QA 2PDCA 3S2NA 3M0ZA 3S3GA 4EVZA 3VIFA 5DY3A 4GUIA 4AU0A 3URAA 5HMFA 4QLLA 4OOUA 4Y9PA 5FF4A 5E9XA 5FA5A 3VDHA 4LUJA 4DX3A 5F2GA 2FHBA 4IQDA 1DIOA 3L65A 3VKJA 1XW8A 1UWAA 2GJXA 3A4WA 3PP7A 1TRIA 1A3WA 1D3GA 5EYWA 3L23A 2H8ZA 2Z4GA 3B04A 5CQ1A 2HWGA 3VD4A 2A3EA 2WHJA 4O11A 1LLOA 5F2LA 3EEGA 1DORA 1XYZA 1B4EA 1V7AA 1G4PA 3VI2A 1KLYA 4E2BA 1OD0A 1ODZA 4GBUA 3FX4A 3OYZA 1XLJA 3OQ8A 1XIDA 4MJ2A 3L12A 4ATLA 4DYEA 1RLCL 4LJ3A 3CIVA 4R85A 3KX6A 2JKAA 2X1TA 3PBUA 2VQTA 4F9DA 3AIVA 5D9PA 2MNRA 3OB8A 2ZWYA 5F4WA 5T9CE 3TN4A 4QEEA 5AHMA 1N8FA 4CVUA 2AAMA 3O8AA 2VEFA 2Y7EA 3DG6A 1SZFA 2IQ0A 3VIHA 5IDZA 3KLLA 4JFSA 3I6TA 1GVOA 2X42A 1UKTA 2E40A 1V6XA 2CBIA 3M47A 3UR8A 1TCMA 3JS3A 2JE8A 2WJEA 4DEFA 4ZZ9A 4E38A 5M3WA 1FUYA 1ZNNA 5D03A 1EJUC 2BHZA 1OJXA 1JGIA 1X39A 1MUWA 1W1TA 3ERPA 4XD4A 1A4MA 4IPNB 1JRCA 1OGBA 2XH2A 1KXVA 1XLBA 3T09A 1GOWA 4P8UA 3VDBA 4FLQA 4J3ZA 3SAZA 2A0NA 3UXDA 4B92A 5EMKA 3RNDA 1HN1A 4PSPA 1ME7A 1ZBCA 4HU8A 1TPVA 3OEXA 1M01A 4MGGA 1BF2A 3WF2A 3PPCA 4C6KA 3AWOA 4ICMA 3RXZA 3VIJA 3BW2A 1O1ZA 1BSIA 3KL3A 1U5JA 4KGLA 1JVNA 4GQ0A 3GC5A 4QJ5B 1GVSA 2X0YA 5A8PA 1H5VA 3QVQA 3GXMA 2B4GA 4GY1A 1A5OC 3MMDA 3C0JA 1KTNA 3G1DA 3F4DA 4B5UA 4CVWA 4HOXA 4ZFMA 2WSKA 1P6CA 2GK1B 4Q4MA 4CNUA 1SR9A 5H8UA 4WXYA 1XG4A 3BUVA 4ACZB 1Y5VA 4LC6A 5KZDA 1T0OA 1Z8AA 3BJSA 2PDJA 2Z2BA 2Q02A 4NAEB 1B57A 3PPGA 1M03A 3WF3A 1BYBA 1UWQA 2XN0A 3T40A 2CLHA 3DFHA 1PKNA 2ONEA 2J75A 3BG3A 4BF7A 4PMUA 5LSMA 3OPSA 1C3FA 1SZRA 3SADA 3GR4A 3S1XA 3ZQ9A 3MMWA 1XLLA 3TAKA 4H9VA 2R1LA 3I7SA 3Q94A 1WZAA 3WUBA 3BAXA 4YN5A 2QW5A 4ZO7A 4A8LA 4AZCB 1XS2A 3TYEA 1UH4A 4H19A 1U33A 4QG9A 4K3ZA 5LXXA 3M1ZA 3W7PA 1M7OA 2DY3A 4PB4A 1UUMA 1PDYA 3AWNA 3EKGA 1GGOA 5JBFA 4JAWA 4Z1DA 3K8MA 4JL2A 3D3FA 3T08A 3WQDA 2HNHA 1EHNA 4UTLA 1J0KA 4ZMGA 3VGEA 1DXEA 2XIQA 1WBHA 4M56A 3KEHA 2Z1VA 5M2FX 3PJXA 2CESA 1LT7A 1WDWA 4JEQA 1CGWA 1X38A 3M5VA 3C2EA 2V68A 3W6YA 4RV3A 1SFJA 3OBAA 1H4PA 2NLYA 3LY0A 4B91A 1VEOA 3S1WA 2VRQA 3G0XA 4HBKA 3THQA 3WQWA 2OB3A 1ZJAA 4R7JA 4RNJA 4DJDA 1A3XA 2PDPA 4O1AA 3GTHA 3WBEA 3K8KA 1I2QA 4HTBA 4QRNA 4NI8A 5E0KA 4DJDC 1F3TA 4MWAD 1UWTA 5A6KA 4V2XA 3MI6A 2VFDA 6XIMA 1AK5A 4UBPC 4CKQA 3R4IA 4PFHA 3FXYA 3KBNA 9XIMA 3T42A 2VI0A 3UCQA 3IRDA 4FXRA 1NDZA 2YBUA 2P88A 4WHBA 2J25A 1B3VA 2WK2A 2V5KA 2FDSA 4N0RA 1KBJA 3GDTA 5SWUA 4RDWA 1QHPA 2PZ0A 4JIIX 5HDRA 5KITA 1EJ7L 1FBAA 4C90A 3M41A 3KBJA 2A1YA 3U6WA 4D6EA 3WBWA 1QT1A 4L5ZA 3N4FA 1W9UA 4TR9A 4EXQA 3MS8A 4PUWA 2ESCA 4I9MA 2AQWA 4LXFA 1WV2A 3UPMA 3NNTA 3WLKX 2A85A 2OZTA 3WH8A 5FJTA 2E77A 2RJHA 4CEXC 1FCQA 5XINA 3MVTA 3TLQA 4UIOA 3JRKA 1K8CA 5IRPA 4GQGA 3LTSA 4HA0A 4HZ7A 3P61A 4C6IA 3RF9A 1EFZA 1PO9A 4AY8A 4FK9A 3T78A 1KTBA 1JZ3A 2VEKA 1VYSX 1YDYA 3OHIA 4DYJA 3UJ2A 1S5VA 1JYNA 3B05A 5CPQA 5C9ZA 3CZLA 4AZ6A 6XIAA 3K4AA 5FIPA 3KWSA 4HYWA 1P1XA 1PYFA 3ME3A 3H12A 3GZ3A 3GFXA 4PBEA 3QMSA 4TXEA 3ABRA 3B4UA 5T8GA 3OTRA 1S5NA 1ZBWA 1J6PA 1MQQA 4I6KA 4XKMA 3VC6A 1VEPA 2A3CA 2HJPA 3I3BA 3N15A 4G2DA 1TREA 4D6JA 4C1NA 3T1GA 3U5YA 4YVPA 1ME9A 3P5YA 3IACA 2PCEA 2RH9A 3CUZA 3WH9A 4G7FA 1H2JA 2DT2A 1GEQA 2I5IA 1RPKA 7TAAA 1LYXA 1TX2A 2QIIA 1Q6LA 3S5YA 3T4WA 2YLLA 2VOTA 3C86A 5A6MA 1IZJA 1CYGA 2Z24A 3CGTA 1BQGA 2CLLA 3L7RA 1MFUA 3UVIA 2OFJA 1XD0A 3KBVA 1J96A 1EEXA 1VB9A 3H4XA 4J28A 4PMNA 2H3DA 2WO5A 3GAYA 4FXJA 2ZICA 1P0EA 1ZPTA 3EWCA 3LZ5A 3UPWA 1F8MA 1TR1A 3DX5A 4PBFA 3VNJA 1TV7A 3O3RA 3W02A 3PVFA 3SRDA 1A5KC 4A2RA 4FNRA 2ZDRA 5BYWA 2WNWA 4K1GA 3RAOA 3CAVA 5BCAA 1BLIA 1FVPA 1W0MA 2G95A 4Q8PA 2VKZG 4WSHA 1I4NA 4IMFA 2NXIA 4DUWA 5G2HA 1VRDA 5EA9A 3VKBA 3DFSA 1G5AA 3HG5A 2YDSA 1V03A 2PDNA 1UH3A 1WXZA 1E4LA 3H54A 3R7MA 2E9BA 3W22A 5I3GA 4O1BA 3IGSA 3Q58A 1AMKA 1VBJA 1M7PA 3MUY1 4KFPA 2J74A 3PF3A 3ZT7A 4A29A 1JPHA 2PDMA 5D04C 1Y0EA 4ES4A 1QXLA 1DWHM 3RJXA 3WNPA 1E6XM 1UZDA 2GSHA 3W2KA 1D3HA 1HX0A 1ZJHA 3ECQA 3QV6A 3DC0A 5FKYA 1GTHA 3C3UA 3MCNA 3WQ5A 3MY9A 3AALA 4TV5A 4Y9MA 3MPGA 1V6UA 2FJUB 4QG6A 5HJYA 2CITA 2BX7A 1LJYA 3RMEA 3N4AA 1DWFM 2YBVA 3UR7A 4NYYA 4WKHA 3N6JA 3LQLA 1QI5A 3UESA 3LSBA 3G1YA 3N12A 4QE1A 2IKGA 4HYVA 3LGGA 2VO5A 4YU1A 3LXAA 2DW6A 1ZGDA 3R10A 1QR7A 4NJJA 3SQMA 4KQNA 1GK8A 2RDWA 3EX6A 9CGTA 1C29A 4L1WA 4MNKA 1YX1A 2C0AA 3REQB 1R9XA 3S5NA 3PR2A 5M1TA 3PZQA 3RILA 1Q3NA 5C7HA 3BV4A 4MG4A 4PRRA 4EOUA 4LBSA 3M6YA 4FAMA 1RV8A 6ALDA 1NJJA 3RM9A 1UR8A 2NX9A 3W74A 2V67A 4S3DA 1GHRA 2D23A 3OLGA 1OK4A 1UD4A 1SR0A 2VUNA 1ISXA 1R7AA 4AUBA 4FR1A 4O1DA 4AMCA 1ICQA 4UWMA 4PUMA 4FOJA 3RG6A 3GTFA 3DYPA 1B3OA 1GUVA 3LERA 2SFPA 2YXXA 1JPDX 1FKXA 1XFCA 1Q45A 4TX6A 3A5FA 2VD9A 2H9AA 4XAFA 3WD4A 4IIFA 1VKFA 5LIXX 1I0BA 3U2ZA 1VFHA 3E3HA 1DP0A 2XVPA 4I7WA 3JR2A 4MLRA 3GG0A 4P2VA 4L4MA 4C60A 3LPPA 3LENA 1DV7A 5TF0A 3W76A 3AS3A 1O94A 2XN2A 1GEHA 3ARVA 2WWDA 1UQZA 4U10A 4AXNA 2OZ3A 1PWLA 3GXDA 1DWGM 1JDFA 4S3BA 3W1NA 3BURA 2WZEA 3SUWA 5CSRA 1DOSA 2PC8A 2Y88A 1S5TA 4ZODA 4D2JA 1FWSA 5TQLA 4WY0A 4U28A 4Y9AA 2YCJA 1FXQA 1AL7A 4O53A 4MFEA 2V8ZA 1Z89A 3W7DA 1IR2A 4D71A 3S42A 3W7IA 3MTWA 2JEQA 2WVVB 1B3YA 3PANA 1FWEC 3NDOA 1UWIA 3NZQA 3ZJKA 4NX0A 4S38A 2E5CA 3GR8A 4L1XA 1JCXA 2BZNA 3DFTA 1KRAC 4IIDA 4GFIA 1F8IA 4Q4PA 2C13A 1FA2A 3A13A 1XH0A 3RFAA 3FOKA 1W5QA 3LCGA 4IFRA 2G3JA 3NL6A 3E0VA 1UQYA 5HWMA 1EC9A 4C6CA 1XCXA 1E9LA 4HHMA 3BG9A 4HA4A 3EX2A 3R8RA 3IANA 3WK1A 4OE7A 2YDQA 1K8YA 1AQHA 2YCLA 3FVDA 5CAHA 1FWTA 1HQTA 4ZVJA 1I8JA 1RJPA 3N3MA 2XTKA 2UY5A 1EOMA 2Z1BA 3TJ4A 1OFEA 2ZUVA 3W6LA 2VWTA 1H50A 1VP5A 2Y1HA 4NP7A 3HF3A 5HANA 5BU9A 2V9DA 3GDRA 1X6LA 4U5IA 1KV5A 2O0TA 1A4LA 1AVAA 3QOMA 4LV9A 4O17A 4XIMA 1XYAA 3MYPA 1A0DA 1Z41A 4J9JA 4AEEA 3EB3A 3MUXA 3MV11 5DF0A 3HPAA 4M29A 1YNPA 4RPPA 5J5RA 3KRUA 1E4MM 3WMCA 3SCUA 3FJLA 4OV4A 2POTA 6ENLA 3EKLA 1QNOA 2R6OA 5CJNA 1K7FA 1EDGA 4R34A 2Q8ZA 1E1CB 1B9BA 1XC4A 4IMDA 3EPNA 3CLWA 3QY8A 3VD5A 2BGSA 2R14A 1ISWA 3SSJA 1FDJA 3NWRA 3ITXA 4K68A 1Z7AA 5MF5A 1FCBA 5A8MA 4I8DA 1J01A 4PMZA 5JVLA 2FB2A 2W92A 1WUEA 1RA5A 4CQCA 1RH9A 3AHTA 4WQ6A 1W1A1 1H41A 4IJCA 4NJIA 4B16A 2VDGA 4C6OA 5J5DA 3GDLA 4H3DA 2BMBA 5CPOA 1DJNA 3MT1A 4Q8UA 1R38A 1KC7A 1UWUA 4MTVA 1SVDA 1FRBA 3QHMA 1V3LA 2QCMA 3EPMA 3N19B 5E5CA 3LLFA 4L80A 3W72A 2BB0A 4W85A 1Z6KA 5CCZA 1OHLA 4DWSB 3BMVA 3GS6A 1NF7A 2WJDA 5CJ5A 1GJUA 5AN7A 2QIWA 2DIKA 4DPQA 6REQB 4JHOA 4QITA 2Z27A 3VOJA 2WBGA 3H23A 2FGZA 1Q6GA 5EBUA 1SO4A 5DRCA 1A80A 1I2RA 3SY1A 4C6PA 2A6LA 1GVQA 4JTLA 4F48A 4LS0A 9RUBA 1NIUA 3EXTA 1Z69A 3V5CA 5AHLA 2NXGA 5A6AA 1EDQA 4NZ5A 3ARXA 4S23A 2QNEA 2HVOA 4S3CA 3ARUA 2NXHA 2Z1KA 2ZXBA 1UUQA 3ZSTA 1UKQA 1W3JA 1U22A 1WA3A 2XFYA 4HNNA 2WZIA 1YADA 2DZAA 5LNWA 2P3ZA 4AHOA 1J93A 5DMYA 4YJ5A 3PTQA 3CV6A 3WJYA 3L5AA 3AI0A 1LL7A 1I6NA 3AYTA 2WANA 1K4GA 4H9YA 2GWGA 3HB9A 3M9YA 4W8LA 2ANUA 1X8FA 3OZOA 4MKSA 3ITTA 4ZO9A 4QDWA 4WDXA 4JYFA 3T44A 1L2QA 3QR1A 1JG9A 4QCEA 3GXTA 1KD0A 1NOUA 5CZSA 6A3HA 1W3HA 2UBPC 4HOZA 4RDYA 2D73A 1T7LA 5DEZA 5I0DA 3TOPA 4AYGA 1OIMA 5G5IA 1CLKA 3ZLFA 5BOEA 3LHUA 4UMCA 1YHTA 2W9MA 3SCOA 4U3AA 4JR5A 3DYMA 2PWFA 1KXHA 3W81A 4YYCA 2JEPA 1R3RA 3MSYA 1OEPA 3PN8A 1Q6EA 3MKKA 4IFKA 3TJXA 2HK0A 4JNYA 2QDGA 4NZ1A 2GJNA 1EXPA 4W5UA 2PSNA 4RZ5A 4XZBA 4AW7A 4RXGA 4WX2A 2Y2WA 3TXVA 5EMMA 4Q3MA 4RDVA 3PJUA 3P80A 2YGYA 1LLZA 3L4UA 4IX2A 2PWGA 3EKZA 1GVFA 1UD6A 1L2UA 4WDWA 4DXVA 4REQA 2HISA 3VKDA 1LP6A 1OX4A 2PFHA 4A3RA 2ALDA 3LGEA 4ECLA 4XB3A 1QOPA 5HINA 1UASA 3PTDA 5I77A 5D9MA 1P1MA 1EIBA 2WKGA 3L67A 1S38A 3PM6A 3JU2A 1ZU8A 1R3TA 5E0CA 4XKYB 1EEPA 3Q37A 4NF7A 2ZWZA 1ZQ5A 3NL2A 3UVAA 2OG9A 2VUYA 1QW9A 1OX4B 3WN6A 3E74A 1JYVA 3UP8A 5I24A 1RY0A 5AHIA 1KFEA 1HGWA 3PUGA 3DBNA 1N82A 2W3ZA 4B9ZA 3TCEA 1S2UA 1MQPA 1YNYA 1XYLA 1OWQA 3WQVA 1M65A 2QPSA 2VFGA 4XAGA 2A79A 1JCYA 3U57A 3NQVA 4NZ3A 3L0NA 3WLLA 4AVNA 3N17A 1X1NA 4L9YA 1Q6DA 2Z1SA 1NWSA 3GUWA 3G5EA 3LHYA 3LRKA 3A22A 5BRPA 1BGGA 1MFVA 4L64A 1XM3A 3N3TA 3BW3A 3N6HA 4QQ3A 3A3WA 1PTGA 1KM1A 2B81A 1E40A 1VRXA 1B9ZA 1XF0A 4M81A 1V02A 3H53A 3VMOA 4DIAA 1VF8A 1BPLB 1PL9A 3F4WA 3RR4A 4PCTA 4W88A 1OFQA 1PX3A 3BLOA 3QPYA 1M53A 2I17A 1O60A 1HW6A 1CNVA 2QCDA 1MW3A 3S9ZA 2CLIA 4E8DA 4XAYA 4OT7A 5AC4A 3CQHA 4L1GA 4B4HA 5E93A 3LX9A 2DDXA 3BARA 2KAUC 3QMRA 1MEIA 3Q2DA 3MI2A 4RV8A 1HP4A 4J40A 1F4AA 4B2DA 2YSWA 4Z2LA 2Z00A 1EX5A 1LT8A 4FEZA 4LRSA 1E4NA 2VNCA 2VELA 2P1FA 4IOTA 3VGDA 1R86A 2QCDB 4LF2A 2X30A 3NQBA 5EY5A 3CL8A 3CHEA 2EPHA 1U5HA 3QFWA 4E2DA 2B31A 3CMGA 1PS9A 2OODA 4UQBA 1TA3A 2ZXAA 2IMRA 2IQTA 3TC6A 3POCA 5DBTA 4CNOA 4EAMA 1M68A 2BVDA 3CV7A 1OY0A 4EPEC 3DYOA 4P61A 3TSDA 3LPOA 5BMXA 3P0XA 1WQ5A 1E72M 4GQBA 4NZCA 5EPDA 1ADOA 1AW1A 2FH8A 1TPWA 1XH2A 3TTYA 4C6FA 1QAPA 4M1BA 2X40A 1DHKA 4IMAA 1TQJA 1OGGA 4QS6A 3GU2A 3QZAA 1MUCA 1US3A 2CBVA 4CQBA