2PTDA

Phosphatidylinositol-specific phospholipase c mutant d198e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQEKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
total genus 107
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2ptdA00
3RLHA 4GNKB 4I9JA 4OECA 2FJUB 4PTDA 2OR2A 1O1ZA 3MZ2A 5T9CE 3QR0A 4S3GA 3L12A 3KS6A 5T91A 2ISDA 4F2BA 4F2UA 1VD6A 2F9RA 3I10A 1DJHA 2PTDA 4QJ5B 1V8EA 4RW3A 7PTDA 3RLGA 6PTDA 3H4WA 5T9BG 1T8QA 1T6MA 4R7OA 1PTGA 3V16A 5PTDA 1DJGA 3NO3A 1PTDA 2P76A 3QR1A 1DJIA 3KS5A 1DJWA 1XX1A 1DJZA 4I8YA 4I9MA 3V18A 3EA3A 1QASA 2OTDA 2PZ0A 3V1HA 4RW5A 4Q6XA 1AODA 1QATA 1YDYA 4I90A 1GYMA 3CH0A 3PTDA 4QJ3B 2O55A 2OOGA 3EA1A 4RV3A 3H4XA 2ZKMX 1DJYA 4F2TA 4QJ4B 2PLCA 3EA2A 4I9TA 3OHMB 1DJXA 1ZCCA 3QVQA
chains in the Genus database with same CATH superfamily
1O5RA 1AG1O 1QNQA 2A3AA 4I9JA 4JTTA 5D2VA 5D32A 4KS0A 4GQ0A 5HNUA 1CDGA 1EC7A 5I3HA 3QPZA 1Q85A 1Q6EA 3HTWA 1K6AA 3SAZA 3WN6A 3G6LA 4KPLA 1FCBA 3PBGA 4K8EA 1KRCC 1HJUA 2VCAA 2CLPA 1OFPA 4UXDA 1GW1A 3MVTA 1W54A 2HRWA 4H9MA 3BCDA 3KWXA 1PTGA 3CUGA 3N04A 4O0KA 1GTEA 1VRXA 5ABFA 1HZYA 2OCZA 3CJPA 1TPH1 2DUXA 1PIGA 1UH3A 2GDVA 1OD0A 2XYLA 1OGGA 5AHEA 2IKHA 3NWRA 3VOFA 1HF6A 4UQAA 3GDTA 1K70A 1JI2A 3NPUA 1E6PA 2BOEX 1ALDA 1KM0A 5AC4A 2WW5A 1KO0A 3EKZA 4Q7BA 4NAFB 3MHUA 3GDRA 2BVDA 1XLGA 3UNTA 2GQ9A 2Y5JA 3QV8A 3IJLA 3ARUA 1LL7A 1XLKA 9XIAA 4ERGA 1VENA 3SUTA 3WLPA 3N34A 3FKKA 4DB7A 5FEXA 1U5HA 4ZSTA 3SUSA 1SJAA 2QUMA 2XM1A 4GPNA 2UY5A 3W1QA 3RXZA 1JGIA 2XSAA 4FOKA 5AOUA 3HV8A 4RZ5A 4JTEA 1OHLA 4X9SA 1RQEA 4UTTC 4RDZA 3NR0A 4TIMA 4RLIA 4M6QA 1FWGC 2W3ZA 4QX4A 2XFWA 3B05A 1Z44A 1DWIM 5FF2A 3WDIA 1PHQA 4HKPA 5HANA 1X98A 3AICA 4S38A 1WDSA 2PDIA 2J7DA 3A22A 2E5DA 2WMHA 2BZNA 1XYCA 5LYRA 1LF1A 2X05A 1ODUA 2BDQA 5JH1A 4AWTA 2QVNA 4LU0A 1MUCA 4D6CA 1TVPA 5BMXA 3EOLA 3WUBA 4C7GA 2WLZA 3TJLA 1EDGA 1XDJA 2DZBA 4CD4A 1US2A 3QN3A 1XH1A 2V9DA 3BLIA 3MI2A 3GNRA 2WHLA 3AIWA 3VD3A 3DENA 3OGRA 3Q37A 1I0BA 1ML1A 1YEYA 5A2CA 1F3WA 5J5DA 2Y8VA 3S2NA 5CJMA 5D02A 3QGVA 4ZZ9A 1A3HA 3W0KA 3PPFA 1R47A 1X38A 1KA9F 3W7IA 3IIXA 3GIQA 5CAHA 4MFDA 3APTA 1TX2A 3IJDA 3SRFA 2WCSA 4AD2A 1GPFA 1W56A 3DU0A 3PPCA 1OFRA 2GJXA 2Y5EA 4ENLA 3PP7A 2BG5A 1H0IA 3NM3A 2IKJA 3QMSA 4U2ZA 1TSIA 1E6QM 1T99A 3ARQA 3PR2A 1EJVC 3F7JA 2V81A 3WBAA 3LI0A 1JDFA 4PBFA 1H7XA 5CZTA 5F4WA 1TRDA 2WVVB 5HR6A 3E2SA 3NOYA 3TN3A 4DN1A 2E40A 1E51A 2WJFA 3GSMA 1PX4A 4IIGA 3N9SA 4AY8A 2AMGA 1P5BA 3YPIA 3W37A 1A5MC 4MJMA 1QPRA 3N9RA 4AD5A 1WA3A 4RE3A 2DZXA 3KP0A 4DWDA 2ONEA 3W82A 1V3HA 3TUUA 5F2LA 4UTHA 2TMDA 1KQZA 2ZUUA 1PYMA 3A13A 4PUKA 2D0HA 4C6MA 1MRQA 3WH7A 2ZZ7A 3B97A 2XPKA 5LIKX 1EQCA 2QCGA 4Q8PA 3WY1A 5IRPA 3VMNA 3WBYA 2Y7DA 1R9YA 3VOHA 1UOZA 4HOXA 1D7FA 3NEHA 4ZQRA 4HK6A 5FI8A 4IPIA 4RDYA 5I77A 2V5BA 3BLDA 1EO7A 2PA6A 4IT1A 7CGTA 1EFZA 1FWRA 4QJ3B 3TN5A 4WK9A 1YXCA 3DYOA 3N4FA 3C0SA 3WCZA 1ZAIA 4JQ2A 2X0HA 2HV5A 3IVSA 2W92A 4LX4A 5HUPA 4F4RA 3MDUA 4ACYA 2VMFA 1JCTA 3A4WA 3W02A 4DUWA 2QDEA 2DP3A 4UOJA 1UD3A 3DOPA 2EPHA 4Q8QA 4BQ3A 5E70A 1W2PA 3L23A 3B9NA 3VCCA 4PCTA 4JIRA 3DAQA 1TJRA 1VGAA 3EX6A 3GVRA 5LNSA 2GWNA 3TZFA 2H90A 2XM2A 2DY3A 4QBXA 2NLYA 4DNHA 4TTGA 4FZIA 1KKRA 5C7HA 2AKZA 1R9ZA 5HOSA 3ZT6A 4Y96A 3R13A 1JZ5A 3GVGA 4HHMA 3W85A 4PCNA 3BAKA 1CXKA 3GNPA 4HOWA 3P8IA 4D6JA 1M7JA 2VCBA 3HM7A 1I2QA 3PTKA 3TONA 5EY5A 3JS3A 2GK1A 1M7OA 2E28A 4QG8A 2BGQA 3LHUA 1B5TA 3IPWA 4MWAC 3WK0A 5G4HC 4R9OA 3VABA 2VWSA 3H6OA 4ZO6A 3PY2A 1MW0A 3P82A 1W31A 2GGEA 2ZRVA 3C61A 5HQMA 3KDOA 3VE9A 1XICA 5AN7A 2AL2B 3N19B 4RZ6A 5G1MA 4I9TA 5F4XA 3SM0A 4L6HA 4A05A 4S39A 1GYLA 1VFMA 1TTJA 4NSBA 1U22A 4BI5A 3NQCA 4IPPA 4WY0B 1NEYA 1HGYA 3EX2A 1WKYA 4E4UA 4ASTA 1XW8A 4LVAA 1QI5A 1QK0A 3W6MA 5AB3A 5BXSA 1QOPA 2VFDA 1J5SA 5G2IA 2C7FA 3MO7A 4O52A 4GACA 5K9XA 3NVDA 1LLWA 3VIGA 4GYJA 1H1YA 1FWFC 4GZEA 2GJXB 3WFLA 4IXXA 3DG7A 3NO1A 3UGVA 5H8MA 2PBOA 1VBUA 2XVPA 2CYGA 1RCOB 3ENLA 4UNKA 2P50A 3TTYA 1Z69A 4IGNA 2PWHA 2BP1A 4F8XA 3E96A 4AISA 3P14A 2ON3A 3VKDA 2VEGA 2HWGA 3NSMA 3VNYA 4QG6A 2DVXA 2HDJA 1I1XA 1L6FA 3PZMA 3FYYA 5DX7A 4AZHA 4I6KA 4HHHA 1RCQA 2A4AA 3PSWA 4IFRA 2B7QA 5CSUA 2YL9A 3W22A 2PLCA 3PUOA 1XPGA 4JCLA 3DCPA 4PMQA 2A21A 3U2ZA 1M65A 3P74A 4C91A 1XRFA 1TYGA 1NIUA 3W73A 2VURA 3QKZA 3CH9A 1TV3A 2QGHA 2X0SA 1BF2A 4Y8EA 4LYRA 5LA1A 2X16A 3W7GA 4KEVA 4U5IA 3T0DA 2IXVA 1TJPA 3CU2A 3W1XA 2RDXA 3NTYA 4ZXLA 3RFAA 4RNJA 1K9EA 1A5AA 5T91A 2VX6A 1GZJA 3MO4A 3LXCA 2NVDA 3UG8A 1FWBC 4DJDC 2I1OA 3HPXA 1F8IA 4QQUA 3L68A 4ZOBA 2HPMA 1KWGA 2DW7A 5I09A 4AX7A 5BOFA 3VNMA 4L1WA 3DIPA 5G4EA 3A23A 3H21A 2CHRA 3WH8A 4DLFA 1Q66A 3H7UA 2X1TA 1C9DA 2Z1XA 3CWOX 2QMJA 4S3JA 4DI8A 1W1IE 1AZ1A 1A0CA 4O17A 3BSGA 1ICSA 3EXSA 2Y85A 3SDOA 4C6QA 4O28A 3NOEA 2WSKA 3MB9A 4NZ4A 4O0ZA 3TIMA 1VFOA 4EXAA 4P8VA 5K3VA 2CHNA 1MUMA 1X6LA 4HCLA 3QV9A 1GOOA 2J79A 4M82A 1S2UA 4AVFA 5CXPA 1V3MA 4PODA 4KERA 3WNPA 4POCA 5CEWA 4UTIA 1CGTA 4HP5A 3U4AA 3CNYA 1RSCA 2GVEA 4YWSA 5C0QA 2WPGA 4CN1A 1WKFA 1O94A 3R12A 3PAJA 5HULA 1J6PA 1HKJA 2UY2A 4HSNA 1MI3A 1GVYA 3G1AA 3OG2A 4UWMA 3GDKA 1G67A 3QMTA 1TREA 3PULA 3VE7A 1IGSA 2PDKA 4JNYA 5G4WA 3E1F1 1W1YA 2OZ0A 5XIAA 1UZ4A 3OQ8A 1KBJA 7PTDA 1SW0A 2QHAA 4D9PA 1F4AA 3UXLA 3CEUA 4JTQA 2V0TA 4P7QA 2Q3RA 4P8XA 3FDKA 1F2JA 1O66A 1PTDA 1CGUA 4OGZA 4YYCA 3C2VA 3CWNA 3M6YA 5HA7A 2D22A 2IQ0A 4CUCA 3ZR4A 1PB0A 1EA0A 2WV8A 1YDVA 3ERPA 1TE6A 1ZENA 1EXPA 1TX0A 2EG7A 3D47A 3HN3A 3KVMA 4L64A 5JBDA 3PZOA 2FDSA 1GYMA 3FA5A 3KRUA 4AZCA 2VCCA 2Y6ZA 1YPIA 2H3BA 2VDGA 5C9UA 3PS7A 3B8UA 4B9ZA 1DXEA 1VYPX 1WUFA 3MANA 2YR1A 5CQ1A 1B54A 1RBLA 2C19A 2ISWA 3B9EA 5E1QA 4HPJA 4W7WA 1K9TA 2AGTA 3IGUA 4JHZA 2BS9A 4GLEA 5CJNA 2FHCA 3SCNA 1X1ZA 3HMJG 1A47A 5T9CE 3W23A 3BG9A 3N2TA 1F6PA 1VAHA 3L12A 4KGJA 3LY0A 1YHTA 4AC7C 1ZS2A 4F2BA 5GQBA 2YA1A 1XYMA 1T40A 3ZQ9A 3LSBA 3ITVA 4D1IA 4E5TA 3FLUA 3MS8A 3FA3A 4FNSA 1N55A 4Y7EA 2W91A 4UTJA 4B2DA 3BMVA 4XBSA 3E2VA 1MFVA 1EKOA 3VKCA 3GUGA 2QJMA 2VRJA 3ABRA 1ELSA 3H2CA 5KMYA 4Q4SA 2XH2A 2Y61A 2XG9A 4ZMGA 5DMYA 2WB5A 3NG3A 2X41A 3P0WA 4IP7A 3EZ4A 3O7UA 3QY7A 2XWEA 1LOSA 2EXOA 3IAPA 2EG8A 1OCJA 4M8UA 4MZ8A 3UESA 1G0CA 3GKAA 3KRZA 3AS0A 4KWVA 2E68A 3ITYA 4WSJA 2Z1VA 3RAOA 1XLCA 2ALDA 4QXIA 4H9UA 3LRKA 1CCWB 4DHGA 4ZGYA 1V6VA 5G1YA 2FFIA 1LWIA 4PMYA 3NZGA 1HIZA 1MUWA 2PDMA 3STCA 1YBQA 4LUYA 3T0CA 3C8NA 3S2MA 3GIPA 1DE5A 4IFKA 4K39A 1SO6A 3E5BA 4QFUA 3M7SA 4ROPA 4FLQA 3TR9A 1BLIA 5F1VA 4ZTXA 2O4MA 4N9EA 2WZTA 3GLCA 3SY5A 2CXGA 5FCZA 4NJGA 1YTEA 2AOSA 4H19A 3W7CA 3IIPA 4KETA 4BWLC 5GNZA 4U2YA 4C6KA 2DFAA 4XB3A 3T2QA 4K7VA 4FA3A 1SSDA 3OLDA 4FX8A 3CHVA 3W2JA 1OFEA 2INFA 3TSMA 1MYRA 4IIDA 2WXDM 1TCDA 3WMBA 1JPKA 2D24A 4JIHA 2C3ZA 4HA3A 3CYJA 1IZJA 4HU3A 1G01A 4M19A 4DO6A 1PKNA 4PYSA 3UCQA 3WL1A 4D8AA 1V7AA 3PG8A 3UP8A 2R8WA 3FJNA 2XGIA 1VLWA 2FTPA 3DHPA 1QI4A 1HL9A 1LWHA 4S3AA 2HS6A 4MJ2A 1EJRC 2F8QA 1NFPA 3PANA 1XBZA 1SFLA 5FIPA 4IQDA 4FLOA 1E15A 1OZQA 2DSUA 1LBLA 3ARWA 5KZ6A 4J40A 4A35A 4QG9A 3ARTA 4ZB5A 1AJ2A 4Q8UA 2J74A 2V5KA 3W1LA 1H5VA 1TB3A 5K4XA 3W7HA 1UWTA 1A3WA 3UG3A 3FOKA 3GZ3A 3LGDA 3AIUA 5JVLA 1EL3A 3UXKA 3PUGA 1EP1A 1XIBA 3AXHA 4NXSA 2VGFA 1H09A 3T9PA 1J6OA 1XP3A 3CZKA 2HXTA 5FKYA 4ZOEA 5HPCA 4K1WA 5BWAA 4Y2WA 1DYSA 2XVGA 4QS5A 4PB4A 2ZTKA 2HE5A 4J2MA 1FHVA 3AJXA 3FFSA 1OFBA 4EPKA 4YVPA 1BVZA 3W2MA 1J10A 3GZAA 3LYEA 4Q8TA 3XIMA 4DAFA 3ES7A 2BXZA 1MQQA 1B3WA 4JTGA 3NQMA 2JKEA 3NPXA 2R1MA 4MG4A 4RKAA 2E5CA 4ZQNA 2BXVA 4XD4A 2INZA 4IIFA 1OBAA 1LL4A 4CLMA 3OODA 3OO2A 2VHLA 3ZT5A 4CD8A 1DJXA 2WWDA 1VFSA 3C3NA 1V77A 4UTWC 3D3AA 4JQ4A 2WM0A 2FJUB 1LOLA 2VR2A 4XZMX 4DXKA 4NP7A 4IPLA 3WD0A 1OGSA 4R3UA 3GG1A 1X6NA 1Z3NA 2JEPA 2O4QA 1RK5A 4L1GA 3KDNA 1UP2A 4LJ3A 3WD1A 4W4QA 5AKQA 3AROA 1CXIA 4KEZA 3ONBA 1TV2A 1XXXA 3CB8A 3NL5A 1HXJA 1DWAM 1M01A 2DSWA 3F4WA 3NQDA 1FX6A 1AZ2A 2D3NA 1YBQB 3SB0A 3JW7A 2RHGA 1QHOA 2FHBA 1JL8A 5AY7A 4AZBA 1Q7ZA 5B7ZA 3TW7A 4MPQA 2OJPA 1J8VA 3ES8A 4GQBA 3STGA 4HU8A 1X8CA 3GH4A 4AIEA 4Q8OA 3H2AA 4C7DA 1XQKA 3R25A 4CN6A 1XYAA 1NFGA 3ZJKA 3TW9A 4NZFA 2KX9A 1KR0A 5I79A 4I6VA 3EB2A 4PUUA 3W1NA 1R30A 3N18A 2QUTA 2XISA 5C9WA 2CZDA 4NZJA 1FWJC 3VZZA 2NWSA 3WQCA 4H04A 3WBEA 5LXXA 4OWGA 4IF2A 4BEQA 4R7JA 3GXDA 3HMCA 3A5FA 4C6EA 1F3TA 3FGCA 5E93A 3T2PA 4GJJA 3BANA 5FL1A 2WO5A 4J1OA 1BQGA 3GXNA 1WYIA 1XDLA 1SVDA 6XIMA 1MWOA 1GVRA 5EMLA 4Q4QA 5HWJA 4M6VA 2VYOA 3C2RA 2R24A 3AZRA 3E2RA 4CCCA 4ZQOA 4NRRA 2G3NA 4L4MA 3UPWA 1DJHA 3SGUA 2VZVA 3URQA 2NV2A 3LOTA 3HU7A 5T9BG 5I07A 3DFYA 1IXPA 2PU1A 4KCUA 1D9EA 1E6XM 3PNUA 3UNDA 3IK2A 5AVHA 1UD5A 1DKWA 5KINA 1A5UA 4JBRA 3FEQA 2WK2A 3WBXA 1GOXA 2E8YA 1JAEA 5E6ZA 1NARA 4K8HA 5D09A 1AJZA 2MNRA 1TWIA 3USZA 5IBXC 3EDKA 3A12A 5CSSA 1GQJA 1TO3A 4DM1A 4DX3A 2QLYA 3A21A 3ARZA 3B8IA 1VCGA 2TRSA 3AHVA 4GGBA 3RX2A 4E6MA 1QTWA 3QTGA 1JUKA 1REQA 2CETA 3KVJA 4L9ZA 3DBNA 1C8VA 2XH4A 3HFTA 1TV4A 1O95A 4IGSA 3G22A 3IV3A 1J0HA 1ZAHA 3WKZA 1HW6A 4KRUA 2F2HA 1XC4A 2VX7A 5JIPA 4GXMA 2TODA 1VIZA 2H8XA 3O06A 1RJQA 2IPJA 3MU7A 1FP8A 4IM4A 4IMGA 3SN0A 2BY2A 4GVIA 3VIIA 4QITA 4O4VA 5HJXA 8A3HA 3CTTA 3MA8A 4YL2A 2FTWA 3TP4A 1K1DA 4QAIA 2GOUA 1XUZA 5EYWA 1PBGA 3TWBA 4JYDA 3V7PA 3EWXA 2J77A 2Q8ZA 3W86A 5CGQA 2OKTA 3MBDA 2GUUA 2RDWA 3MP5A 2A5HA 3TQPA 4HJFA 3HG3A 1NDVA 1IZCA 3KOFA 1ME9A 3VYLA 3SCOA 5HATA 3M7WA 4J3SA 4UFMA 2BODX 5F4SA 3MY9A 5AC5A 1ZFJA 4NNAA 4L9XA 1LCOA 2AMXA 3UXIA 1UD4A 3EAUA 1R3TA 4Q7NA 2FPVA 4Z0JA 5M17A 1QT1A 4HYVA 1WDPA 3PB0A 4V27A 3UVAA 1EH9A 1UR2A 4GBUA 4NI3A 1HJQA 3LPGA 1B3OA 1QWKA 1YDYA 1EUAA 5HJLA 3GTFA 1PE1A 4PMVA 3WQ5A 2WC4A 3CPGA 2O55A 1AMYA 1CXLA 3GVVA 3MMWA 4ZOCA 3KM8A 1R2TA 1SR0A 1V6YA 3POHA 4I5RA 4ZB0A 4KWSA 2G3IA 3V1PA 1US0A 3TW6A 3NL3A 2YCLB 4D72A 4GI8A 3P0XA 4BCEA 4ZB2A 1W3LA 1GVOA 1UMYA 1X96A 4HMDA 4DF2A 5JH2A 2WNWA 5EKYA 1PX8A 5CPQA 5CC7A 1KGUA 3TR2A 1S2VA 4UQCA 2P53A 4KMQA 5AHMA 2WLYA 2OQHA 3BAIA 2JGYA 3SUVA 3CQJA 1OADA 1MVYA 1SZFA 1IEXA 3KL5A 4FOUA 2WZMA 4JDYA 4YIWA 1FFRA 3WLMA 4HZMA 4AIBA 2P0OA 2G50A 4PB3A 1SZRA 4MMWA 3MV01 4H8UA 1DWHM 1Q5MA 3FV9A 1B4EA 3M1ZA 4H4IA 1K8YA 3IWPA 2CWNA 4PUWA 3CM4A 5FSDC 3IRDA 3S2CA 4PUMA 4C6BA 1EGVA 3AOFA 4KWOA 2NUYA 3BAYA 3AHYA 5CKSA 4ZFCA 1IR1A 2ZE0A 3KBMA 1BWKA 3OA3A 1N82A 4UZSA 1V0LA 4XISA 3EWUA 3VNZA 3IVTA 3NQ2A 5D33A 3F4NA 2PC8A 4PTNA 3L21A 5CLWA 4J2PA 3VGEA 3AI0A 3AYSA 1BYAA 1TTIA 3W7MA 4AZ5A 5BRPA 4DF0A 3OVQA 3LLXA 1VEMA 1ONEA 5REQA 5TQLA 1XLBA 5CGMA 1IXNA 3QGAC 1KGWA 2HNEA 3S2LA 3S6DA 3KL3A 2PP3A 4WCJA 4X22A 2ISVA 4EX4A 4BF5A 5DMMA 1XLAA 3B0PA 3WF1A 4DJFA 3K46A 4MZYA 4D1JA 5CG7A 4LUSA 4O1EA 5FESA 3WQDA 3PTQA 3R79A 2G0WA 3O9NA 1QPQA 3NDYA 3GK0A 2UWFA 4GVHA 4P7OA 1Q6CA 1FCQA 1R7OA 2QCDB 3PZUA 4UR8A 5EFFA 4B9YA 2NSOA 4CEXC 2PLJA 1WBHA 3CUIA 3TTSA 3BC9A 3CYVA 4F79A 1C9WA 3RPMA 3SECA 2ABBA 3HQPA 4CCEA 4C5ZA 1Z89A 1NOFA 3S3GA 3IACA 5F1UA 3MJMA 4KRTA 3UERA 3WO8A 1VFTA 3A6OA 3SIMA 3SCPA 4M29A 1XC6A 1J12A 3K8MA 1UKQA 1OC6A 5DRCA 1BYBA 1EIXA 4F40A 2DT2A 1JCNA 3GYCA 4JX4A 2ISSA 1OQFA 1QI2A 1EP2A 1WDWA 2YZ5A 1ZZMA 2Z26A 5BU6A 1IZKA 4GQGA 4ZO9A 1YXDA 3CT2A 3QXBA 3MSYA 4GNJA 3LGEA 2EHHA 4JFSA 1TCMA 2E1WA 3H2EA 4H00A 2QPSA 3DC8A 2GDQA 3CUJA 3ISIX 1W5MA 1YYAA 1V51A 2OR2A 3N6QA 3U5YA 1RK6A 4G5DA 1V02E 2DUAA 1TVNA 1UIPA 3OGSA 1GJWA 1XD1A 1KKOA 3TKFA 1R46A 1U1HA 1EJXC 3DX5A 4J28A 4HT3A 5JXQA 3LRMA 1SPQA 1SW7A 2Y8KA 1GORA 1NWSA 1HJXA 2B0MA 2EPNA 5LGXA 2BGNE 1V0KA 4B3LA 4UBPC 1QPOA 2GSEA 2NXIA 1DWFM 4Z17A 5D9MA 1AQHA 4NNBA 1VBJA 4AY1A 2NQLA 2PRMA 4K1GA 3QW4B 2HROA 5E9XA 1KW1A 2PCQA 3VIOA 3K8LA 3RG6A 2QXWA 4CQCA 2VEFA 1OD8A 2F2KA 2ZYFA 5G1TA 4O10A 4OU1A 1WP6A 4IFOA 1CNVA 1TTPA 2ZXDA 1RY8A 3KVLA 4FHAA 3WQVA 5KZDA 1DXFA 2CESA 1L2UA 5K9DA 1L2QA 2EF9A 3U4FA 1HGWA 2VFFA 1NH6A 1VEOA 1TV7A 3GX9A 5HJYA 2Y8UA 4H6KA 4LPCA 5E6YA 2PI6A 2GSJA 4N6FA 1OC5A 4L56A 3MP3A 3FYPA 4PMOA 1O5XA 2GL5A 1MMFA 2VEIA 3WJYA 2QCFA 3D3FA 4ATLA 2WMFA 1VBHA 4DPPA 4EPEC 5H8UA 2NUWA 2PZNA 3HPZA 3N13A 3T09A 3LU2A 1HJVA 1JFHA 3OB8A 4F9DA 1XIIA 3S1UA 3MV11 3ZWSA 1CGVA 3ABSA 3QC3A 2X0YA 1GQIA 3VD9A 1Q8AA 4IHCA 3W7DA 4DBDA 2JGQA 3CK5A 4MHBA 3BO9A 3G1VA 3ZM8A 1OFQA 3WD3A 4YJ5A 2P3EA 4JICA 1ZP4A 4B91A 3JVAA 3SRHA 3OW1A 3DERA 3U9IA 4O8RA 4XZBA 3ID7A 1YE6A 5I3KA 2NQ5A 3RJXA 4IGMA 3WLRA 3R6IA 2JE8A 4DYEA 5DT5A 4EACA 4O1FA 2PDCA 1E9ZB 4DJDA 3A24A 1EJ7L 2I17A 2ZUSA 3TA6A 1OX4B 2ZVRA 2ZA2A 2J7BA 2WVSA 4BZYA 2CLOA 2QQ6A 3K8KA 4AVOA 2VOMA 5AC7A 3ZR5A 1X6UA 3N17A 1IEVA 1ME8A 2FYMA 5I3DA 3W7JA 5I24A 1FCVA 3QVQA 1BEUA 2Y63A 2R6OA 3SQMA 4G8TA 4YVXA 4UFHA 4D8ZA 1JVNA 2FB3A 1GKPA 1E0TA 3H70A 2NVCA 1TVLA 1QBBA 2Z1BA 2XZ7A 1DORA 3AXIA 2I16A 3EMZA 4IQEA 1WCGA 4F0KA 5A8GA 1DIDA 2B31A 3SURA 3G1HA 1LOQA 4KWWA 2OEJA 1OSEA 4PUDA 1Q63A 2PRLA 5DY2A 4NRSA 4U3AA 3EOUA 3QOMA 2AKMA 2XH7A 5DFAA 3WF2A 1O5QA 1O1HA 2CKSA 3V5CA 2ZUNA 1IWPA 1QUMA 4DQWA 1E4LA 3OZOA 4AIOA 2I5GA 2WJDA 3B8VA 4YS1A 3O63A 3N14A 3RIKA 1ZY9A 1E4IA 1J0KA 3B8DA 1BVNP 1O12A 3TC3A 2PWFA 1EEXA 2EO7A 3ABOA 1RJRA 2OLAA 4ACZB 1QCWA 3VX0A 4GIRA 2CZFA 2KAUC 3EX1A 4MZ1A 1R5YA 1TTQA 3PBVA 5U4NA 3CV6A 4NZ5A 2D2GA 2V2CA 2VDHA 3DFNA 4Y9AA 3FEMA 2JKPA 5DLCA 2J66A 3SEPA 3TWAA 1YE4A 2YW4A 3VUSA 1QW7A 2BY3A 1SJCA 4YNGA 2HISA 1VQTA 3A4AA 3QV7A 3G1YA 4ZO8A 3UZXA 1PX3A 3SADA 2O7SA 1I45A 3MJYA 4FX6M 1V03A 3RMEA 1MXDA 1Q7QA 1I2OA 3M0IA 4DWSB 2WMIA 5A8MA 4DO5A 1QI0A 3LX9A 4O12A 2VT0A 3KOZA 1EZ2A 3W7NA 4O14A 1Z8AA 4DJEC 2RGMA 2PWEA 5SWUA 1FTXA 4HTYA 2A1YA 1YDNA 2OO0A 3GKFA 2UBPC 4G7FA 3AS3A 3RLVA 1K8CA 1US3A 4JKMA 4JIIX 1FA2A 1D3GA 4XUGA 2VGBA 2IS7A 1CXFA 1WDRA 5F7UA 4XZIA 4N42A 2ICSA 1AUSL 4UTLA 3ALFA 3CAKA 3WIJA 1JULA 1WDDA 1W8SA 5BZAA 1JRBA 3P3BA 5D9OA 1TPVA 2B81A 1PCWA 2QDDA 4HNVA 2JIWA 2Z0IA 2YXOA 3OIXA 3P60A 3L66A 2X30A 2PF8A 3JRKA 3EDDA 2DUZA 1LL6A 1IWBA 4LBUA 1PIFA 2Y1HA 2FJKA 2VC9A 1UG6A 4PA8A 2WPBA 7TIMA 3BXWA 4WXYA 1FUYA 3PWIA 1RR2A 5CC6A 1XGZA 4FI4A 5C2CA 1BKHA 3FYOA 3VDAA 1UYQA 4O15A 1LUCA 3IJ7A 2PRHA 2C6QA 4TO8A 3MYPA 4Q8NA 3POCA 4C5YA 3LPOA 2JF6A 2ZXQA 3I10A 4FB7A 2E09A 1A4MA 3FY1A 2GWGA 4HSHA 3SZ8A 2C79A 1FY6A 4R7OA 2V82A 3R8HA 4DO7A 3VIJA 5C55A 1OYCA 1YMYA 2V5LA 3QMRA 4XG1A 2P76A 1HG3A 3ARPA 3WENA 4PZVA 2OEMA 3S8HA 4IL2A 4E2DA 1XX1A 3MUY1 3F03K 2VI0A 3UPMA 2C71A 2PAJA 2OTDA 4CEUC 3F4VA 5ABGA 2E9MA 2CLHA 4XTDA 2ZIDA 2DH3A 3GS6A 3KE0A 4IG2B 5GJMA 1EYEA 4FP1A 4PCFA 1G7UA 4BF9A 2YCEA 3GHTA 3UD6A 2ZX6A 3QKEA 2HBVA 1Q6RA 1SJBA 5GJNA 3E6EA 1PUDA 5E0CA 3RO6A 3BAJA 1PEZA 1XKYA 4UFLA 2OSXA 2BHYA 2XHYA 4H3DA 3BOXA 2GQAA 4UQEA 2WMJA 2A3BA 2F84A 1I2NA 4CNTA 5FF4A 3NPVA 4HNUA 4NT0A 2OZ3A 3UZZA 1M1BA 3S83A 2OLHA 3F4CA 4E4PA 3REQB 3QFEA 3VIKA 2J4GA 4LXFA 2J7HA 2D69A 2QV5A 3I6RA 1G1YA 2OGYA 2PDUA 1JAKA 4S3BA 4C1KA 4O1CA 1A5OC 2WZHA 1DIKA 4L4PA 5D8WA 4PMDA 2TAAA 3EPOA 2F9RA 1IE7C 4PRWA 4LRSA 1HKMA 4JIPA 1FP9A 1FHUA 1W32A 3R0UA 3UCDA 1ISZA 3S1WA 3MMTA 3HQ1A 4J3WA 4D6GA 3O6CA 3I7SA 4ZXOA 4WDUA 1XBYA 5TF0A 1UP0A 1UW9A 3LUTA 4M0XA 4L65A 3H2FA 4Y9NA 5F2MA 4HNCA 2AQOA 4ADTA 3VC6A 3CZGA 5J8LA 4V1YA 2YFNA 1XIFA 3LSCA 3N2XA 2WHMA 3KP1A 5MKGA 4WY0F 4JTLA 1UKSA 3SQSA 2YBUA 3LEPA 1OFOA 4TR9A 3TFXA 1VKFA 3ITGA 3VTRA 2Z7KA 8RUCA 3DI0A 4FLSA 4S3KA 1KFEA 3P84A 4AWUA 3AHZA 4LUJA 3W07A 3ZVHA 4IQJA 3L5AA 1GOKA 1WAUA 1TPC1 5E5CA 1WX0A 2RAGA 1UH2A 3IUHA 3E0WA 4EOUA 5HAOA 4ZR8A 3LGGA 5JMUA 2WM1A 5TIMA 3UZYA 1S2CA 2VELA 4PRTA 1LYXA 1GVQA 4N9BA 2VR5A 4AWEA 1MNZA 1DP0A 3QR0A 4LS0A 5CPLA 3W76A 4O53A 4ZE5A 3UR2A 4CNPA 4GFIA 4IPJA 5L6UA 2CPUA 1JJKA 2ZA3A 2QAFA 3V35A 1BAGA 1DWGM 5HR7A 3C2FA 2PDJA 1EZWA 3UU0A 4ADUA 4GMEA 3SGZA 4H9YA 1BSIA 4GIYA 1KFCA 2BASA 3R0DA 1L8NA 2BOGX 1C8QA 1WZLA 4FXJA 1SZGA 1ECQA 1W8GA 1V7YA 3HOJA 1XSIA 1W9PA 4JYEA 4FF5A 4QE4A 5B7YA 1JEZA 3KL0A 1W9XA 1A50A 2Z6IA 5DCDA 1X1NA 3PNZA 4FAMA 4GNVA 2Y0FA 3KWSA 2CBUA 4H6EA 4WF7A 1XLLA 3AISA 1EF3A 3EWBX 2W63A 1UD8A 3KXQA 1S1PA 3GHSA 3GRIA 3LBCA 3OVPA 4XVEA 1EGZA 1W3KA 3G0SA 1XLFA 4TUFA 1RY0A 1WOAA 5BXPA 2BX7A 1UUMA 4XSLA 1OCBA 5AVNA 4GY0A 3CV7A 1BFNA 2FFCA 3I7QA 3PB2A 3KZPA 1UCWA 1VZWA 1RHCA 1VFHA 4MY1A 3L0KA 4QLJA 3DC0A 3B9DA 1L9WA 4YLWA 3DH7A 4HQVA 3CQKA 4MPKA 4MKSA 4D6EA 3QV6A 4LF1A 1BWVA 1R0MA 4UCGA 2AQWA 4KEUA 3KOWA 1G69A 2YKKA 3AXMA 2ZUVA 3JU2A 5EMYA 4H01A 3WNLA 3VNKA 3UBPC 1QXLA 4NYUA 1S5TA 1JG9A 2NZLA 1VFUA 4JGDA 1PZ2A 3VMOA 1CLXA 5CZSA 1Q4WA 2YXXA 2Z29A 2AAAA 4BHYA 1VPQA 3A3XA 2BVYA 3GWQA 4MNMA 4Z2HA 4Z2IA 1QPKA 3FAXA 3GVQA 3V3WA 1Y65A 2YA2A 4C1NA 1XISA 1OFAA 4ATDA 5LNWA 4HPXA 3B4YA 4JXCA 1AVAA 3E49A 3S5NA 2XJ7A 5BROA 3GXMA 3W29A 2A6NA 3AXKA 1J0YA 5BMWA 4TU1A 2EAWA 2V68A 4UZUA 4O54A 2J7FA 1G9HA 3UWVA 4Z0SA 4NY2A 2EJ1A 3KTCA 3AS2A 3BTNA 4O8AA 2ZWZA 1F4HA 4IUGA 2NSXA 2Z7GA 3BLKA 2J24A 3IIVA 1VHCA 3OZPA 1VBRA 2PU0A 2E7FA 3MUAA 4AYGA 4Z2JA 1UBSA 3VGDA 4QRNA 1XCWA 3B0UX 5HWNA 4ONVA 5C8BB 4NHVA 3S47A 3SJ3A 5I3GA 3ZXWA 4EPBC 5DY3A 3GC5A 4GWEA 4LAOA 3I7RA 5I2UA 1FXQA 4TXEA 3GHUA 4UTFA 3P80A 3QJAA 5FJPA 3W00A 4JR5A 2XVKA 2WNNA 3RCMA 3VM7A 3W2KA 4KKXA 1GHRA 4F0LA 3BMWA 5FJTA 1ZJBA 1E0WA 1OT2A 2D2HA 3WLOA 4IOTA 2G8ZA 4CVWA 3T55A 3GC4A 4EE9A 4E38A 2CZ5A 3WJWA 1HKIA 1E4NA 1S39A 1GGOA 3IK4A 3VGBA 3GTHA 1TPFA 3I4KA 4HMEA 1B3XA 1TPWA 3RILA 1XCXA 3U2CA 4WUIA 3EOSA 1KRBC 1MEHA 5I78A 5LKYA 2J88A 2O56A 1Q3NA 3VINA 1I9CB 3V75A 3UQNA 2WMGA 2Y5SA 1ZBCA 3N1AA 3LHZA 2CLMA 3TV8A 2AGKA 1RJPA 4Z2GA 4G9PA 3KOXA 2WC7A 4GG9A 4ORIA 4US5A 2XN1A 3N4AA 2CNCA 2DQXA 5HMEA 4AVNA 3O15A 3L9CA 3IJIA 4ERAA 1BXBA 1HQTA 1H62A 3AZTA 5XINA 3MI3A 2XIQA 1GJPA 2O92A 1YNYA 2Z4GA 2VL4A 4DY1A 2FPYA 2CERA 1SR9A 3SI9A 6ENLA 4TOQA 3THAA 1V5XA 3GG8A 3TLLA 1ZTVA 3EB3A 2GQ8A 1V93A 2RH9A 4YTUA 2YL6A 1R7AA 2YA0A 4LVBA 2XU2A 1OIFA 4S1FA 4RV8A 4PC8A 2JALA 4BI7A 3M0YA 1XH2A 5BXTA 4TMBA 3WNOA 3NXFA 2J8GA 3GDMA 1ZCOA 5D8ZA 1D3CA 2BBFA 1UZ1A 4CNOA 3NO3A 1TZZA 4GK8A 1EUNA 3C3UA 3KBVA 4DUVA 5EMMA 3I3EA 4UNLA 1CT5A 4OTKA 3GU1A 1U5JA 4C7FA 1JCLA 1UKPA 3LHVA 4MB1A 1JZ4A 3TVAA 5JUVA 2PLKA 3GH7A 3U2OA 3WDQA 2HQAA 2Y24A 1CB7B 3S5ZA 1QATA 3BLEA 3L4XA 4Z1DA 5A3HA 7ENLA 4JX5A 3KBSA 3U0HA 2HPIA 3W74A 4HK5A 3C0QA 2P1FA 3IIOA 1PL9A 5A2BA 4RCXA 2WCGA 4EXBA 2A3CA 1MSSA 3BJFA 3K4WA 2X8RA 3F1QA 4MWAD 5C6MA 1K02A 1VJIA 4A3YA 3DFHA 4UOQA 3CZ8A 3T8LA 4GCXA 3ZIZA 3WNNA 2WJZA 1W1VA 2WWCA 1X7FA 1Q7MA 3SCWA 1FDYA 1RA5A 3NAVA 3EXTA 2C1GA 3C8FA 3BCFA 3WSUA 1TZ9A 4UFJA 4R88A 3UG4A 2F6XA 3CMGA 4ZQMA 1V8EA 2HZGA 4LCQA 4ZA0A 1TMQA 1FWWA 4GUFA 2G97A 1VF8A 2CKRA 2GGGA 1CEOA 4TX9A 3OVRA 2JIEA 3MKVA 3PBMA 4D6FA 4JEQA 4B5WA 1HT6A 1HFBA 3B0XA 4HN8A 4HU4A 3DG6A 3RJYA 3WNMA 1V0NA 1GT8A 3XISA 4BQ4A 4JS3A 3WLSA 1VYSX 3UJ2A 2Y7FA 3M47A 4PBGA 5I3FA 2EGZA 2CBVA 4OOZA 3MKKA 2QGYA 4RW5A 5A94A 1V02A 3CQIA 4LT9A 2XSXA 2DJLA 5HQEA 2J7CA 3VM5A 1OEPA 4EP8C 3ME3A 1LLZA 2E6YA 2G3JA 4DBSA 4TV6A 3SY1A 4GUIA 6ALDA 1IT0A 1JGMA 3M6DA 1RZMA 3PZIA 4G1KA 2GLKA 2C14A 4WOZA 1LWJA 3FXYA 2D73A 3TJ4A 1OX5A 2WYSA 3WK2A 3FN9A 4WVXA 3I65A 5A69A 3GH5A 4GBDA 1W9BM 3HO8A 3XINA 3WLJA 3H24A 3WFAA 4W8AA 1LQAA 5LA0A 4HPGA 1XKJA 2ISDA 4PTWA 3UXDA 3A4XA 4YTTA 4X0VA 1LRQA 3NGJA 2Z2AA 1AH3A 1KTNA 4PUNA 4GC3A 1FH8A 4LALA 4D6DA 2NLIA 1O60A 2Z1WA 3T40A 1A3XA 3OLIA 3FJ6A 2WBGA 2NXHA 3C0LA 4WDTA 1H4PA 3LNMA 4QDMA 4DJDD 1VPYA 1R3VA 3M5XA 4PMJA 4NIRA 3ARVA 1TA3A 1ZHAA 4QNWA 4J3TA 2FLIA 2PDYA 3QM3A 1H7PA 2PTXA 4RNIA 1NOUA 1J0IA 4PL2A 1ZUAX 4AB4A 3PVFA 1E6ZA 2DSVA 3TA9A 2CLLA 3VOJA 3S6OA 3TCEA 1HVQA 3VCRA 2VD9A 2REQB 2J47A 1FWSA 3AMCA 1SJDA 1F3EA 1GEHA 2PDGA 4XK2A 4EWJA 4AIUA 3SN1A 1MFUA 4LAKA 1D8CA 2EPKX 2PWGA 4GNKB 3FNDA 2WOQA 2ACUA 1KCZA 1JCJA 1GOIA 2WSRA 1J11A 4QAWA 3ARXA 4AU0A 2OKOA 2A6LA 4JQ3A 1ECEA 2ZXAA 2J75A 3DECA 3I4EA 1IGWA 1PTAA 2FPTA 2VVSA 4Z1BA 1XRTA 2DORA 2VGIA 1JYWA 1LT7A 1O6IA 4EAMA 1ZP3A 2JQXA 4AZ7A 3SGGA 2H9AA 4LB4A 3ZLFA 3EX4A 1YTDA 3W6YA 3NQ8A 1LM1A 1PWMA 1MXSA 4NILA 3KAOA 2OO6A 3B0VC 4MTVA 3RRAA 1V6WA 1MDRA 3CASA 4BKNA 2ZA1A 1QJWA 3T6CA 1G6CA 5EMKA 1H50A 1OC7A 3KCOA 5A1AA 4M80A 1QBAA 1WXYA 1FVPA 1VCFA 5EMUA 2GJNA 2D3LA 3P2VA 1QO2A 1YPFA 4QDWA 4AXKA 1VYRA 4G7EB 2VKZG 3C86A 4IJCA 3MWAA 3QC0A 1C8XA 5D9PA 4TX6A 2EKCA 2XTKA 4D8LA 2DZVA 4HD5A 3ONCA 3ITCA 3HPFA 3LNPA 3N4EA 5AYZA 1NDWA 1WUEA 2GGIA 2DSZA 5I5RA 3UZ5A 4QNEA 1FWHC 3DG3A 3CAQA 3AIEA 1UZDA 3GTXA 4P8UA 1V3JA 4WD0A 3FVDA 1XV8A 3K4DA 5I23A 1XIEA 1P6WA 2PGFA 4J3UA 3LMYA 3BQ5A 3EYPA 1A5BA 1DTUA 5D04C 2HJPA 5DRIA 4TTUA 3LTYA 4Z2LA 3H2OA 1KCKA 5PTDA 3EMQA 3WD2A 4DZHA 4UMAA 3ELFA 3IUDA 1Z9AA 1Q6FA 1W1TA 4ILSA 4TVDA 1ZQ5A 3LCXA 5T26A 2YW3A 3WEZA 2X1UA 5HPOA 4XX6A 3GTNA 2V8ZA 3ZOAA 2A0NA 2Q8XA 1KCXA 4ALDA 1B2YA 1TUFA 3BW4A 3AWNA 4O16A 4X3ZA 3CBWA 4KWUA 3B8TA 4BA0A 1I1WA 2DGAA 4RE4A 3AMDA 4GI6A 5M03A 1H1ZA 3N9KA 3L2IA 3HGJA 2XDFA 3W88A 1M03A 4FALA 5EU9A 1UQYA 2YBVA 1W37A 2W5FA 4QQ3A 2B7OA 4A3UA 3M0JA 4E0CA 2NV9A 3UJFA 3QY6A 2PB1A 2E4TA 4Q4RA 4R53A 3BQ6A 1FRBA 4EF8A 3NZPA 1KXQA 1AMKA 3VVGA 4PE8A 2YPIA 2QUVA 1ZCCA 4JTFA 5CSRA 1TA3B 3LHWA 1LP6A 3TYZA 2J9XA 3E2QA 2CCRA 4URIA 2GJRA 3P93A 1NWRA 2VENA 4PEKA 2VXNA 2DQWA 3AYRA 7XIMA 1X97A 1I0DA 2E25A 4S3GA 1RP9A 4Q8MA 4KCTA 1W3NA 4GO9A 4GH1A 3WH9A 4QDPA 3PFMA 3ZMRA 2MANA 5BOEA 4WSHA 3OHIA 2QULA 2YDQA 1L6WA 3ATYA 4KF1A 1BG4A 4YMZA 1XRVA 1CI1A 4UIOA 4ICMA 4WJEA 1QRQA 2ESCA 3M43A 3F5JA 3MHGA 4RPPA 3TFCA 2HS8A 2QJIA 1MEIA 2OYMA 4XIMA 1JCXA 5ABFB 5DELA 2ALRA 4DVOA 3AMGA 2Y7GA 4WRHA 3HV9A 1HN1A 3N2CA 4GINA 3O2LA 3HGRA 1NY1A 3M0HA 4RZ4A 1ENUA 3NVTA 4JTKA 1L6GA 4UTKA 3OA5A 3S2JA 2DZUA 3G8EA 3L4WA 1AW2A 3S9ZA 1ZNNA 2WCAA 3VIMA 1LDCA 4UFKA 3WQGA 2XFFA 4LUTA 2E6AA 1AFSA 4W8BA 1QMLA 1R87A 3NZ1A 3RLHA 1JZ6A 1H49A 3WF4A 1IYXA 1P0BA 3E3HA 3WNKA 1JI1A 2V2DA 3W7PA 1GVSA 3TYUA 1ZB5A 1UHVA 2PCEA 3SCQA 2I57A 3R94A 3BOLA 4HJWA 1B0IA 1HJSA 2ZC1A 3URAA 5I6SA 4KH2A 1RXOB 1EXBA 1TIMA 4A3RA 2FVLA 1S5WA 2G37A 2GPTA 3S9IA 1UA7A 2ATMA 3NDOA 4JHMA 5CJ5A 5A8PA 5C54A 2QJJA 4S23A 4XZHA 3PFRA 3T7VA 3ZT7A 5AHLA 3P61A 1A5SA 3SSZA 3T4WA 2OOFA 1M68A 4HU0A 1XLIA 4GX8A 2QF8A 3HG5A 1IV8A 2GGHA 5BCAA 1UUOA 1XM3A 3MUZ1 2P3ZA 4PMRA 3M0ZA 5HDRA 4ZTYA 3UR5A 3TYCA 4Q7IA 4PUEA 4XO7A 1KFLA 4W93A 3C0JA 3KRSA 4I90A 1E4MM 5HQLA 3Q67A 1H51A 3L4TA 4UMBA 2NX1A 3S1XA 3KTSA 1DQUA 1IWAA 3CQHA 4RV3A 4WKAA 2O0TA 2W6RA 3LLFA 3AU6A 5LZLA 1ADOA 1U5VA 3Q94A 2DT3A 3GXIA 1W3JA 3CUZA 4LAUA 3WH5A 2QJNA 5FD0A 4ML9A 4M56A 2OX1A 3P6LA 3SQLA 2PTWA 2FKPA 2RKXA 5IDZA 1P48A 5DCBA 2VM8A 1UA3A 4HK7A 3GNXA 1K03A 1IXOA 1BSLA 1G94A 3QGKC 5DMNA 2QPUA 3WBWA 3CLMA 4C6PA 1V4YA 2G41A 3BDKA 6CGTA 4MWAE 2CEQA 1Z41A 2ZVIA 2V69A 2WSYA 5HNRA 1KTBA 5D2WA 3IEBA 5LIUX 3S1VA 2JKAA 4U31A 2Z24A 1UPPA 4MIMA 7TAAA 2VFEA 3S5YA 2CXEA 1FDJA 5TNVA 2GOKA 1KBKA 4Q6JA 4ICNA 1QHZA 5LHFA 2ZX9A 4GY7A 4AUBA 2Z00A 5CZJA 5F2GA 3LQGA 4K3ZA 2VOTA 3TDFA 1B31A 2WANA 3T2OA 1TJ1A 1SYTA 3MUIA 4RR4A 1GYNA 3N6HA 2OODA 3UG5A 5HK4A 5BRBA 4KBXA 2X09A 2OOGA 3NFUA 5LIWX 4CNSA 1Q6OA 3G1DA 4RNHA 1CGWA 3CQ0A 4XBKA 3P7YA 4UUIA 3VGHA 1MNSA 2E8ZA 1IQ8A 2XN2A 1GOWA 4PFHA 4QJ4B 1OYAA 1AQMA 4BI6A 4C6DA 4IWWA 3RDKA 1IXQA 4GKTA 1L6YA 1P6BA 4HSOA 1J0ZA 4GUGA 2QW5A 4OECA 3LXBA 9RUBA 2ZRWA 4QP0A 5I7GA 3S42A 2C8NA 4QHRA 3KRBA 4FR1A 3FDGA 3DYMA 3CV1A 3OJGA 4FXFA 2O7QA 1TPEA 4X0NA 1C3FA 2HEJA 3PG9A 1XLDA 1Q2RA 2F6UA 1IHIA 3CHFA 3TH6A 4LUTB 5FL0A 1EX1A 3DFQA 3RR4A 4LQ1A 2WBKA 4Q4MA 2BY0A 1F7BA 2Q3OA 2I7GA 2OX4A 5LNUA 1QOQA 5E0FA 2PDWA 4FIQA 1QNRA 4JN8A 1WZMA 4JHOA 1DIOA 1GNXA 4MSSA 3WK3A 3NQVA 1FWEC 1G4EA 1XLHA 1K7FA 1O68A 1DJNA 3SUWA 3OEXA 4K68A 1KFBA 4HZ8A 4AF0A 3EX3A 3MWCA 2GK1B 3OLEA 2QJHA 2DH2A 3QEZA 3RK8A 4IL0A 2X1IA 4TVUA 2EKGA 2WKLA 3EA1A 2L5HA 1XSJA 1BGGA 3UY7A 1YNPA 1TZ7A 3RITA 1TQJA 3QYQA 3RX3A 2BWGA 1R3SA 1AQ0A 2A79A 4MLJA 4JTHA 4WEVX 3LS9A 1W5NA 2PGWA 1DE6A 3GXFA 2R1NA 3PJXA 2X7VA 2DIKA 2G4JA 4XUYA 3B3DA 4AD3A 1ISWA 4J3XA 3MSRA 4CD6A 2J8TA 2F7FA 2ZRUA 3FJ4A 3WQOA 6XIAA 4QLKA 3BGGA 1YKWA 2BVTA 4DM2A 4XZNX 1ZLPA 1B1YA 3MVIA 1XIHA 3E9AA 2P8BA 4IP4A 1S1RA 3ALGA 3GG7A 3NL6A 3M64A 4ERIA 4DYKA 1JDEA 3L2MA 2IPWA 3MW7A 1Y5XA 1KC7A 4U33A 2Y4SA 4MYAA 1NVMA 2DZSA 5JQ9A 4ZCWA 4I7VA 4S2BA 3UYCA 1JYVA 3DN5A 1H7WA 1V3KA 2YDRA 3GXPA 3TAOA 4KESA 3BJSA 3IVUA 2QMKA 1KQYA 9CGTA 3LMZA 5EFDA 3TSDA 2ZUWA 1RCXB 3THQA 1W9DM 1BWLA 2OFJA 1DQWA 1O5KA 4MYXA 4US5D 3PUDA 1ZJAA 4M5PA 1W17A 1MQRA 3MCMA 1QAPA 2QUUA 3TQKA 1XFCA 4NAEA 3QTPA 7A3HA 2BSLA 3W81A 3VOIA 4ZFMA 3VGFA 4O0QA 2J9YA 3EPMA 5DT7A 3WMLA 1W5OA 3N29A 1TJ2A 2PP1A 1FCUA 1M53A 1PWLA 5FJOA 2WHJA 4DBUA 2QCLA 4IJRA 4WHBA 4YTQA 5G2WA 3B0YA 3WQEA 4CD5A 3F2CA 2BMBA 1V79A 4UR9A 1GHSA 4LBRA 3NEVA 2OU4A 4M6PA 1B3VA 3W2LA 5ABTA 1TJ0A 3CIXA 2NX9A 3VPLA 1K77A 2C13A 1GVFA 3B40A 4IQLA 1JQXA 4UTUA 4KFOA 5HNTA 1PXGA 3WLIA 3QQ1A 3EBVA 1CX9A 1FQ0A 1RD5A 2JEQA 1N8IA 1VS1A 1H41A 4DRSA 3QSTA 4DELA 3NZRA 5JU6A 1OB0A 1BD0A 1CBGA 3AIBA 1NP0A 4MNKA 3ZJ6A 2ZADA 4F0MA 3V18A 1KFWA 3ARRA 1E3XA 3RYSA 4JL2A 2FZNA 5A95A 1CB2A 2A2IA 3MMUA 4WKHA 2CLKA 4UQ9A 1B9BA 4YYFA 4HMNA 4E2VA 3W7RA 4L80A 1P7TA 4QR6A 4AAJA 1EHNA 5K2ZA 1PV8A 2ZWYA 4Z08A 2G95A 3ECQA 1FHLA 1PKYA 3CAWA 1DTNA 1XRSA 1UROA 4BK9A 2D2JA 4WKFA 3IJQA 5EPDA 1R6WA 5FF7A 4WIWA 4NZ1A 1TWZA 3D6NA 4HN4A 1THFD 3CPRA 1Q45A 4PTDA 1M41A 3GQYA 2WQPA 4AF0B 1E9IA 3S4TA 3TYDA 4U3CA 3TLQA 1RVGA 2W0UA 3KS6A 1LTDA 1R86A 2XWDA 1EF2A 5I06A 3MT1A 4F2UA 1YXYA 3L5LA 2ODOA 1EBHA 3H4GA 5IM51 3HURA 2AAMA 1I8JA 6PTDA 1Q65A 3OGVA 4QCEA 1XH0A 3TEVA 5F2IA 4MNJA 3UWUA 1GEQA 1DJGA 4C65A 1WKDA 3NZQA 2VEMA 1R2RA 1QNSA 1GKQA 2ATSA 2OGJA 3NSXA 3M5YA 1CWYA 2VZOA 5TAOA 3U2EA 1E72M 3EKLA 2PS2A 1BTMA 1XUUA 3THCA 2NQZA 2R82A 1MW2A 3H53A 1L0PA 3TU9A 1K4HA 2PURA 4YU1A 5U7SA 4V28A 4A6GA 1JYXA 5AFDA 3H22A 4EIVA 3DYPA 1PCKA 3M07A 3DDMA 3D0CA 4AZCB 1AL8A 4WXZA 5G2HA 4CQBA 4I9AA 3II1A 3OZMA 2VFGA 4QCFA 4LUIA 1GCYA 3W1UA 1V0MA 1TPUA 5XIMA 4Q8VA 4NASA 1Q6LA 3QZEA 3UZJA 3NYDA 4GJ1A 3SCTA 4QEHA 1RP8A 1UH4A 4CQDA 5K9CA 1P0EA 4B5TA 4AFYA 1YW1A 3LA4A 3C2OA 4I7UA 4QJ5B 4EANA 1Z7AA 4ATWA 2YDAA 1XFBA 3OQEA 4WR3A 2ACQA 2OZ8A 4J27A 3COTA 2WKGA 4NQ1A 4GOAA 5CBJA 4OVXA 3WFZA 1N7KA 3NURA 3UF9A 4EAYA 4HNTA 2DEPA 4IXHA 4H9VA 3V36A 3M44A 4GO8A 1KFJA 1WNOA 3WMCA 4HZ7A 4KEMA 1GQNA 3AC0A 4E3VA 2A3HA 2RUSA 3GFYA 1HL2A 1JUBA 2DV0A 2J25A 4C6OA 3WJZA 3G6MA 1Y5VA 1R3QA 1H2JA 2IQTA 4QM1A 3LHTA 5HINA 2XIIA 2FH6A 2GUYA 4JY9A 5D37A 4AC1X 1VHNA 1JNDA 3URBA 1F8MA 3H12A 2PDHA 2ZX5A 1P4CA 4OQVA 4BY3A 5A6JA 1W3HA 2HXUA 4GIEA 4J7RA 1QW9A 4HCDA 3R4IA 3W27A 5E9AA 3VIPA 2EQDA 4IFKB 2Q02A 2HMCA 2PDBA 4V33A 2Z1SA 2A3LA 3CEPA 3RLGA 4JFTA 5AHFA 1HO1A 1T8QA 3DHUA 4QSFA 4Q8WA 4LFYA 1SFJA 4J35A 4ES4A 4M7TA 4UCFA 1XGEA 3ARSA 4IZGA 5IOBA 3QR1A 1VJZA 3RCYA 4GYFA 3Q2DA 1OK6A 3M4HA 4GI4A 4RX0A 4DO4A 3EWCA 3AJ7A 3O6DA 4JD4A 1CGYA 3H7RA 1UWUA 3PZTA 3DESA 4U28A 5FAGA 1AODA 2YOCA 3LI1A 1LLOA 3W2NA 1G5AA 3HJZA 1XG3A 3V5FA 3Q65A 1ONXA 1BF6A 1ZJHA 3QZ6A 3TNOA 4TVCA 1W3IA 5EL1A 4WOQA 4J9JA 3RUBL 2DZAA 4L9YA 1RLCL 3VO0A 3ZJ8A 3FHQA 1OX6A 3USBA 1NDZA 2XINA 3RCNA 3VDCA 3I6EA 5ABHA 5D30A 5C71A 3QH2A 4S3EA 2CLEA 1TWSA 4B4HA 5FF3A 5FJRA 4IICA 1PIIA 1JIBA 3M0VA 2CFFA 3CHDA 4LVDA 4MY8A 4RW3A 1KWKA 3H4WA 4ICCX 4IUOA 1KLZA 4DZAA 2CBJA 2WNQA 5A5WA 4IMEA 1CZ1A 5DXYA 3ITTA 4KIEA 4RUBA 2GYIA 2X40A 1OZMA 1W9VA 3UW6A 2QKFA 2YX0A 2ZZ5A 4JKLA 4LAMA 3MDWA 4A8LA 1W1A1 4RZBA 2IQDA 2Y2WA 3W38A 2CC0A 1KV8A 3H7VA 4NYYA 3MQTA 1ISYA 4NJHA 1H63A 5I0DA 4LGXA 4BFAA 3SJNA 2RDTA 1YPXA 4HNNA 4AXNA 2E5BA 2AL2A 1LRNA 1MXGA 1BG9A 1H7RA 2QNEA 1E6RA 2ZKMX 4C90A 2W61A 2ZZ4A 3MHFA 4LVFA 2ZRZA 2EPLX 4BEUA 4XBJA 5M5DA 3HGSA 1JCMP 4HOZA 2NW0A 4WY0A 3CL6A 4ZOAA 2QVHA 4WJXA 3HA1A 1E3ZA 1FWIC 2ZUMA 2DT0A 2V38A 3DKLA 2WAGA 3G3MA 4BS0A 4JTUA 5D03A 1KBIA 2E1DA 2DIEA 1XYBA 3W1RA 3RM8A 1K8XA 1W5PA 1PKLA 2EEXA 1GPWA 1E9LA 2YLAA 2IPGA 4GUJA 3ABXA 4AD4A 2BY1A 3LXAA 2GGJA 1H61A 3MUXA 4AHOA 2ACSA 4AX6A 2QR6A 3MPGA 9XIMA 3QRHA 3H2MA 3O8AA 4H9ZA 1RVKA 3LCFA 3BV7A 2XGBA 3GFXA 4JTIA 1B4KA 4UTTA 3UFYA 4KT2A 3DFTA 4Y8FA 2ZRXA 3AXXA 1PVNA 1UUQA 1JR1A 2QDHA 3TN6A 4X61A 4W7UA 4JTAA 2V3DA 3WD4A 4AZGA 4NNCA 4O1AA 4BQ2A 3WDRA 2QCHA 1EYWA 2ZCGA 4DJED 1QNVA 2NQHA 2FVMA 5ABEA 2DSKA 2OXNA 1OGBA 3T78A 3WQPA 1PZ1A 1Z48A 2FVKA 1VC4A 1T41A 3LCWA 1IEWA 4FPSA 1XBVA 2QPXA 3B4UA 2NUXA 4G1NA 4PMXA 4FO4A 4L4OA 3PZVA 1LBFA 3F2BA 2GVJA 1OIMA 1GQLA 3UZWA 1TRIA 2BOFX 4E8CA 1OT1A 3JR2A 3C5QA 4UFIA 1X1OA 4FR6A 4YCPA 2VTFA 4UC5A 3GG0A 3ITXA 2YIHA 1KR1A 2WMKA 2WZIA 1UR0A 4OE7A 3H23A 3O0FA 1WQ5A 3C2YA 1WAWA 2VRQA 2INEA 1TV5A 1CTNA 3GBEA 1PKMA 3TCSA 3K13A 1MQPA 5H2ZA 4DJFC 1JDDA 3BWWA 3SO7A 3PBYA 3GE7A 5JBFA 2GVLA 1QWGA 1E1CA 1V3IA 4YVVA 4MAVA 3FGCB 3VDBA 1X7IA 1DOSA 2C91A 2EG6A 4CNNA 1PDZA 5A2AA 5A6MA 1TELA 1EJWC 1VPXA 4HYRA 4LV4A 1J2WA 1OK4A 3WLNA 2OPJA 3VKAA 3P8JA 1BYDA 4LBSA 2BFGA 3F4DA 3NQ7A 4ZENA 4O4WA 3S46A 4LVGA 3TMLA 1QASA 3PPHA 1W1ZA 4W5UA 1GG0A 3T08A 1H7NA 4GYPC 3GR7A 3SY8A 4S2CA 1M7XA 2WSQA 1F73A 1NJJA 3RR1A 4MJZA 3V4BA 3Q58A 3GD6A 1W3TA 4ZSUA 2HBXA 2Z6JA 3TOPA 2J78A 3RM4A 1VCVA 4Y9MA 4GGHA 1REQB 4X2RA 4OBSA 4YCOA 1I4NA 3TAKA 2FZ9A 1EOKA 1NOWA 2JF7A 4X2PA 4DBEA 4YN5A 3EDJA 4N9CA 4ZEPA 2A7NA 3R7MA 1RD6A 4RPQA 1H11A 3N2MA 3AHXA 1C8YA 3T44A 1UD6A 1Z32X 2W79A 3NQGA 3SR7A 1CPUA 1EC8A 2V5JA 1M7PA 1NF0A 1S3TC 1G4SA 4FS9A 3WELA 3E38A 3LERA 4EK7A 1FHDA 3NO5A 2RJHA 2ZZ1A 4R33A 4DYJA 3DZ1A 5AECA 1UP3A 1VIWA 2VGGA 4MFEA 1J9YA 4X63A 2Q8LA 2OWWA 3LZ5A 4GKLA 2FH8A 3U5UA 2ZZ2A 5AC6A 3MBFA 1AA1B 5K7JA 3KW3A 5A6AA 2VR4A 4R5EA 4CCZA 4Q4KA 3O1NA 1JZ3A 4FNRA 1F76A 3A9BA 5DQPA 5FJIA 4W8LA 2NQJA 4MF4A 1E0UA 4DWSC 4RK8A 1BPLB 4B5NA 2VZUA 1AD1A 2D20A 1D7KA 3CHCA 3VNLA 3MUCA 4IMDA 5KEZA 1JF6A 4RNFA 2J6VA 4B5SA 3TYEA 1PDYA 4H9TA 4IX2A 3AMKA 2CHOA 3GDLA 2FB2A 4I3GA 1BGAA 4GX9A 2GDUA 4P5UA 4W85A 2IUZA 3L67A 3LQLA 1JD9A 2YCIX 8XIMA 2A3EA 2C15A 4NF7A 4XV0A 5IHSA 4MWAA 1HKWA 1OG6A 1B9ZA 3WLLA 1TV8A 3HG2A 3UPBA 1S2AA 1WB0A 2OYKA 4YHGA 1UC5A 1W5QA 3MZ2A 2QUNA 4PR4A 4LS1A 4N02A 4E4FA 2PPGA 4XD5A 4CU7A 4XAGA 5CG0A 4GRSA 2QYGA 1CXHA 4WLCA 3UEQA 4DNMA 3INPA 4B92A 1PZ0A 4A3QA 3BICA 3NQEA 3B04A 3IV8A 5EGRA 3IARA 3WX7A 2QEZA 4MJ4A 1DVJA 5CC5A 2VQTA 4LEFA 2PF0A 4LCSA 3ZZ1A 2PWDA 1UWQA 1SO3A 1YQ2A 4FNPA 4HHLA 1EHAA 1S38A 3LCLA 1XIDA 1WZKA 1E1CB 1XPYA 1BRLA 3LCHA 2CLFA 2X7WA 4L7ZA 4IMAA 1GOQA 3QHOA 2OZTA 1XHGA 5IDIA 4DI9A 4MY9A 1PPIA 3PBUA 1YTKA 1H5YA 1M3UA 1B3ZA 4O1DA 2PC4A 3LRLA 3QLDA 4M1BA 1M5WA 4GD0A 4OOUA 2BB0A 1HKVA 2VEPA 2Y89A 1FXPA 1OF8A 4CGTA 3TN4A 3NPWA 3PK7A 2YBTA 6A3HA 1UZHA 1Q4NX 1ZSXA 2ANUA 2UY3A 4G56A 3ZYZA 7ODCA 4RL3A 4Q33A 3MP4A 5AYBA 2PGEA 4GE8A 1N8WA 3APYA 5C70A 1QFEA 1T7LA 3E5PA 1UKTA 3G3DA 2E9LA 4NXKA 2VZTA 1G4PA 3M46A 4LCRA 3ZS4A 4FNUA 3BW2A 2DPEA 3CAVA 3T1GA 3L5MA 3AIVA 1C7TA 3EEGA 5CBBA 1J93A 5H91A 3NQ6A 1NP2A 5FJUA 5REQB 4MKNA 3LTPA 4DBWA 2R1KA 1O7AA 1NF7A 5IXEA 3W7OA 3LPPA 2V3FA 3VI2A 1KRMA 2XIBA 2FTYA 1YIXA 3TE9A 3GR8A 3S5SA 3BGJA 3RU6A 1D3HA 3W87A 2VJXA 2PDFA 1BXNA 4LUSB 3ZWTA 1V08A 4QGCA 1N8FA 3U7BA 5GNXA 4JKKA 4YWIA 4PTMA 4CU6A 1IF2A 1Q2SA 2ASHA 3HB9A 1DBTA 4OFCA 1SMAA 4NJJA 2R1LA 1K7EA 1MEWA 2O9RA 2WQDA 3NIYA 2CZEA 5LA2A 1KFKA 1H1NA 1MW3A 2OB3A 1F07A 2VUYA 4JOMA 3E02A 3WUEA 3TTEA 1UOKA 2GJPA 2RGLA 1KTCA 4YTRA 1F05A 3CMFA 2DW6A 3M0XA 2VNCA 2NVAA 5CPMA 1ITQA 2F61A 2E6DA 2X2YA 4HBKA 1K9FA 4XIAA 3R8RA 3G18A 4LW7A 1WKEA 1E6SM 2DJXA 2ZZ3A 4K36A 1EO5A 4I8DA 1EWEA 1J5TA 1S5MA 3VKKA 1FKXA 3KHDA 4CNUA 3VXGA 3VD7A 1MO0A 3MMDA 3NQAA 3H54A 1FKWA 3W28A 3AUJA 3BZGA 4O18A 4JNMA 4ZODA 2IKGA 1NAL1 4TX8A 1H60A 3A9IA 1LRTA 3KUMA 4WQ6A 1PS9A 3WH6A 1KXVA 4HZ6A 2PTDA 4B90A 3APGA 4MWAB 3LV5A 1XD0A 1QVBA 2V63A 1QNPA 1XLJA 4IX0A 1VRDA 5DXXA 4DF1A 2ZDRA 4WSKA 5KZMA 5LGZA 2ZRYA 5KZEA 1NELA 4A8IA 1TUXA 1VBGA 1WPCA 3EOOA 3W72A 2PFHA 1VP5A 3KEHA 4K7YA 4LC8A 3M5ZA 4IGHA 3V1HA 4R85A 4U5KA 5D2TA 4H9XA 1SUXA 1XIJA 1TWDA 2IPFA 3SRKA 4LS2A 4S3DA 1ME7A 4GYKA 5CZKA 4O57A 2XGZA 3CUHA 3PUEA 1ZJIA 4H8HA 4JTSA 4X60A 3MZNA 3E0IA 1JD7A 2NV1A 4AQLA 3LHYA 2XH0A 4ORMA 5IHRA 4N0RA 4J5NA 1SW3A 1EJTC 2E6FA 1KBBA 2BHUA 1R3RA 3EGJA 1BRLB 4Y90A 3TYAA 2OSWA 2ZUTA 4OIFA 4AMCA 3SCUA 5I3IA 1XLMA 1OF6A 2VD8A 4RXGA 3VGGA 2Y7EA 3FA4A 3ANUA 3VC5A 4Z1CA 1XDMA 3GTIA 4MVAA 4JTCA 4GIAA 3CO4A 1HKKA 4DLMA 1W91A 1GUVA 3P81A 1VR6A 4QLLA 1A5CA 2HSAA 1VJSA 4FIRA 3M16A 4B5UA 2Z25A 5FJJA 1P6CA 1XQLA 3VNIA 2V3GA 4LH8A 1C29A 2VZSA 3V16A 4PTVA 2BV9A 2OWXA 3VKJA 2FGLA 1CLVA 2FDMA 1WE5A 3FS2A 4DZIA 1XF0A 1KBLA 1GZ1A 1ISVA 4RE0A 3VZYA 4CD7A 2PDPA 4LNCA 4ROQA 2YGYA 3AS1A 1G4TA 4JL1A 3FHAA 1HL8A 2TPSA 1XIGA 1DL3A 1EDTA 1EDQA 1P1XA 3TX9A 1WOBA 4NL1A 3CH0A 8CGTA 4IIBA 5EA9A 4F9JA 3GU2A 1W9UA 1MZRA 4H6RA 2R1PA 4AWSA 3BOFA 3WZ0E 3BLOA 3WUFA 3W24A 4PSRA 3LB0A 1JF5A 1POJA 1PJ9A 4HA0A 4XTIA 2W27A 3SN4A 4XO6A 4CQ9A 4HIBA 3S6TA 3G77A 2LLEA 3W75A 1WXZA 4DAIA 4ZBCA 3B9AA 4M1RA 2YZRA 2VP8A 2Q6ZA 3W1AA 1WO2A 4FK9A 2G3MA 2YL5A 3CIWA 6TAAA 3AALA 1UWRA 3FX4A 2OELA 3RLUA 4PFMA 2VC5A 3STEA 1HNYA 4P7NA 4YTSA 2HVMA 5TBOA 5FAJA 1FOBA 3ITOA 3G1RA 3GUWA 3MKCA 1EPVA 2ZX8A 1P0NA 4C6CA 1UJPA 1UC4A 5A6TC 1TFVA 3HQNA 3VX1A 2YL8A 2MUCA 4C6JA 5C2GA 4GUHA 2PZ0A 1S2WA 1E5NA 1CW2A 4BWLA 1LZOA 1R3YA 3KZSA 5BW6A 1AQFA 1PHWA 3H2NA 4ZQCA 3GR4A 3AAMA 4G6CA 3L4UA 1I2RA 3WLTA 1JPHA 2YB4A 3W3OA 3W71A 3OVGA 1Q6QA 1TKKA 1F5ZA 3NL2A 2E0PA 1WV2A 1JZ7A 3U3HA 4K2SA 1U1UA 3RNDA 3GAYA 4O50A 2C1IA 5JBEA 4PMUA 3TNBA 3HJEA 2IKIA 1A5LC 5M1TA 5FEPA 1VH7A 2C0AA 1FWNA 2OLSA 3W7QA 1RAKA 1XSKA 3WEMA 3LN3A 3I68A 3R11A 4M3PA 5ECVA 1BYCA 1DHKA 3ITLA 2GFTA 2WVTA 2WNZA 3DFOA 3BG5A 4A29A 3CZJA 3K1DA 5CCZA 4DUXA 1A5KC 2XUCA 1ZBWA 1OINA 1PO9A 3N12A 1EWDA 1FH9A 3A47A 3CL7A 3MSGA 4F48A 2WMIB 4HA4A 1I2PA 4OHQA 1HVXA 1OG0A 5E0KA 3GW0A 2WZEA 4MB5A 1KM3A 1YNQA 1RALA 2ACRA 1GQKA 3FCPA 4IPNB 5AZ0A 3CS2A 4Q4PA 1JQVA 3OBEA 7REQA 2OEKA 5CH9A 5D2XA 3SCRA 3PPGA 6TIMA 3MI6A 1W0MA 4E2BA 2Z27A 4I9MA 3QSRA 3LLDA 1UB3A 3PTMA 1J0JA 2PDNA 1AW1A 3G24A 4Q22A 1B57A 1KM6A 1RQHA 2QAPA 4LWWA 1UR8A 1ZBKA 1C92A 4FEZA 3AMLA 1HTIA 3TOYA 1EC9A 2I5IA 1U30A 2YCLA 3V0TA 4XZWA 1R8LA 1ZRQA 2YCJA 3WJSA 1JPMA 3VIFA 3KLKA 2QIIA 1W1B1 3WK1A 4HVXA 4GXWA 1QDSA 1C91A 1Q13A 1D2KA 4XZLX 2J6XA 1XJBA 3FJLA 3WL0A 3BLLA 3UT0A 3ARYA 4C6FA 2XFRA 2P0IA 3N15A 5HUOA 3CTLA 4I5UA 3LG3A 4A22A 4AYSA 3PAOA 2X2GA 1KD0A 1NU5A 5CPSA 3KBWA 1TPB1 4UTWA 3G2GA 4BR1A 1JPDX 4KFPA 1LUCB 3ORWA 4JFVA 3VFCA 5EB8A 1BHGA 1FWAC 4REQA 3K30A 3IANA 1TR9A 1JZ2A 4ADSA 4FNTA 1JUEA 4Z1AA 1LQ2A 1A53A 1S46A 1Y5WA 5RUBA 3DXIA 2ADAA 2E9BA 1KLYA 3U6WA 4MB3A 2GVGA 3KS5A 2OMAA 2BNJA 3B8SA 1SFSA 3WJXA 3AWOA 4XSMA 3W70A 3UY8A 2UV8G 4ZQPA 4GI9A 4Z2KA 4BQ5A 3CWHA 1OVDA 4XKYA 3G8RA 3VNJA 3EPNA 4Z42C 3QQWA 3JUGA 1JZ8A 3NUKA 3KFTA 4NUWA 4QISA 1J4EA 1I60A 3M9YA 3TQ0A 3PZGA 5BRQA 2WHKA 3WMSA 4PGLA 1JRCA 3V0UA 1PZ3A 4LOCA 1IEIA 2PD9A 1ITXA 1IT8A 1QNOA 3W7EA 3W26A 3ANVA 3RMJA 3T0BA 4EF9A 5BU9A 3TXVA 2VQUA 4EWND 3URNA 1Y8BA 3M0LA 1GOMA 3GVWA 3CXOA 3IAQA 3GFZA 2V5DA 5CSYA 4L61A 4LY8A 1I75A 1LG2A 1JYNA 1DIEA 1XYLA 3VFLA 4KCVA 3GO2A 4CU8A 4A4AA 1KXHA 3HIJA 3OYXA 3CLWA 3B03A 2QCDA 3OZYA 4C6IA 1M04A 3L2LA 3SW6A 2F6KA 4LB3A 3HFYA 3G5EA 2XN0A 4JPGA 2CBIA 2OG9A 5MHBA 5A6BA 5FOOA 1MW1A 1DV7A 3VCNA 3WLKX 3ABQA 1SM9A 3R8GA 4PTXA 3RU8X 2UY4A 4IH3A 2Y88A 3R10A 3R5EA 5DF0A 4MGGA 3C56A 3I3DA 2I9EA 4K37A 2C18A 3BL3A 4OBTA 4P61A 3C2EA 1E73M 5MKGB 5J04A 3H55A 4AEFA 5BWFA 2VFHA 5IBXA 2YCKX 3TZNA 1LG1A 4N2YA 3M0KA 5DEZA 3TTOA 4LYKA 4F0RA 4A21A 1V6XA 1F6YA 4H8NA 4HNLA 1MDLA 7REQB 2XZ9A 4LNYA 2HTMA 1M9HA 3BK0A 3ZVHB 2QIWA 3AYVA 4FOJA 3WUGA 4H41A 1DXIA 2XVNA 4ZO7A 2JFEX 3HF3A 1A0EA 4KQNA 4KRZA 4X9YA 2O9OA 4UNIA 4QIUA 1ODZA 3PN8A 4KIRA 4IP5A 3ANYA 2V2HA 2RFGA 3T05A 2R9RA 4LY4A 5HNNA 2X42A 3VZXA 1OABA 4W9TA 3EMCA 5KSWA 3PF3A 2POTA 2QCMA 2ZQ0A 2J7GA 4PCSA 3CZLA 4O11A 4IIEA 4MDPA 3PJUA 1VEPA 1G7VA 3M5VA 4LYPA 1H3GA 4M6UA 1E56A 2NQ9A 2D2OA 3IJ6A 2OVLA 1A4LA 3BLFA 2XIJA 4P8WA 3E0VA 3E0LA 4JTRA 5L9FA 3G0UA 4EPDC 3TJIA 3HBLA 4E3TA 4UR7A 1ZPTA 3UWYA 1C90A 4PL1A 3W25A 1OCQA 4GISA 1IR2A 2XIOA 3GYEA 1ZU8A 4REQB 3WYZA 4L5ZA 4OKDA 2YXGA 4PMZA 1U1JA 3MYOA 2NX3A 2Z1KA 1BQCA 1FWDC 2G4FA 4UOZA 3D46A 1IT7A 3E12A 3SRDA 1I6NA 3KBJA 2OQLA 3GY1A 1UR4A 2YYUA 1SZEA 1GJUA 4ZL1A 1EA9C 1NFBA 1UR1A 1P0DA 3Q45A 1HX0A 3GM8A 3TMQA 2WC3A 2B4GA 4L4LA 2H8ZA 3CB3A 3QPYA 3JZEA 3DUGA 4UTMA 5TD4A 4XKYB 1K9DA 4JIQA 1ICPA 3K5XA 4PEEA 2V30A 5HMDA 1T8XA 2AL1A 3WF3A 1K6WA 2RDUA 3VD5A 1BTCA 1XBXA 3WQ8A 3BMXA 1RV8A 4YXGA 2R14A 4JFUA 1V3LA 5AC8A 2CW6A 1EEPA 4W86A 3IJ8A 3Q4DA 4JN7A 3EXRA 1EQPA 3AHTA 4H6QA 3K4AA 1DJQA 3RO8A 4B3KA 1DJIA 1T0OA 4L6OA 4I8YA 1GVEA 4XWUA 4QTGA 1OX4A 2PE4A 4JQAA 4GCAA 1EBGA 4AW7A 4D71A 2PDQA 4S3FA 4D6IA 1CXEA 2E67A 1FWCC 2PWUA 3HZ3A 3KVKA 5H6HA 1AL7A 1YLVA 3LM3A 4C1NB 4LTSA 3R2GA 3R0KA 4NZ3A 2D0GA 3ICJA 4J3VA 3GDBA 2FQIA 3RPDA 1CGXA 1IIHA 3BW3A 3GAKA 1UJQA 3G0XA 3ZR6A 3W83A 1XINA 3BURA 4DIAA 5HMFA 4HPNA 4OUEA 5A8OA 3ABZA 1UQZA 4Q3MA 2P10A 3F5KA 1GONA 4HTBA 1SO5A 4GYPA 4QSHA 1R2SA 4JDBA 2EJAA 3AIQA 1KNWA 1HO4A 4INFA 4WDWA 3N3TA 3QF0A 1QO5A 1SO4A 1QOXA 1ZAJA 3BAXA 3PSVA 3O6YX 1U2YA 1KCLA 3R1ZA 3CZEA 3BSMA 1CENA 1TIWA 2G96A 1F9CA 4ACZA 4K38A 2ZC8A 1VFLA 3UWQA 3RHGA 1DJZA 4F0SA 4M7SA 4CQ8A 5D4YA 2HCVA 1ICQA 5CZ0A 1AD4A 3SFKA 5DO8A 1X39A 4HGXA 2G5WA 1UWIA 3W7KA 3OPSA 4LSBA 3EDEA 5AYIA 4HCHA 3TQVA 3AIRA 4H7CA 1J2BA 2C1HA 3GW3A 3H4XA 1DJYA 3GNNA 3OYZA 1F74A 1NTHA 1NSJA 1KGXA 1UPMB 1TQXA 1FH7A 4GHRA 5DCEA 4DWSA 3CIVA 2YYTA 3W1TA 1XG4A 2ZE3A 4PUJA 2CWXA 1EX5A 4V15A 4OUIA 5FSEC 3BJTA 1RH9A 4H7VA 4GH3A 4C6NA 3U7VA 2YB1A 3S5OA 3K1GA 3FXGA 4ML4A 4NU7A 1LROA 3OLGA 2DVTA 2A7PA 3G1SA 5CAKA 2FZ8A 2R94A 3ZFHA 4MLRA 1JXKA 3G1FA 5I03A 4YHEA 1S5VA 4B5XA 1RBAA 3O6AA 5DANA 2EPOA 4DUOA 4FLRA 3TC6A 4I5XA 3OP2A 1TPDA 1KM4A 4CCDA 4E8GA 3NM1A 3A5VA 4D6HA 1KXTA 3OG3A 3VA8A 4B3ZA 3SUUA 4DEFA 3AZSA 4MUPA 4ECLA 4AEOA 3T0AA 4O19A 4OZOA 3DI1A 1ZGDA 1U83A 3R58A 1VFFA 3PTDA 4AD0A 3LBOA 3ZSTA 4UQDA 4JFWA 3MTWA 1L8PA 3ZO9A 5FA5A 3VOGA 4OT7A 2TYSA 4NJKA 5CPOA 3WDPP 2BVWA 1ADSA 3PWGA 1R9XA 1LJYA 3VAVA 3QFWA 5BOOA 2FIQA 1LT8A 3UWZA 5EBAA 3RN6A 2CU0A 1OCNA 3WLQA 4CQAA 4JTJA 3LK6A 4GZ7A 1ONWA 1KB3A 3MCOA 1SSGA 1QU4A 1CLKA 2ZBTA 3KBNA 2V3EA 4FNQA 4DZ5A 3UWWA 3I6TA 2I9UA 3S1GA 5DBTA 1S3HA 4LEQA 4PMNA 3OIHA 3WLHA 3RRXA 3D5HA 4Z1YA 3QR3A 1XGDA 3C4UA 1XYZA 3N2BA 2V6AA 4RDWA 4Y9OA 4B2DD 2DDXA 1EOMA 5AHNA 5A8NA 2F38A 3B8WA 2PTYA 1Y7VA 3OBKA 1ONRA 1SFTA 4JQ1A 3BARA 5B80A 1F3XA 3PZQA 4J3ZA 3QOKA 4IG2A 3VMPA 4CVUA 3TK7A 2QCNA 4B16A 3UWEA 1AJ0A 4WX2A 4C1LA 3TC7A 1GWJA 4BF7A 4QJ1A 3BH4A 3KLLA 1XCFA 3S0CA 3T81A 3WEOA 1AH0A 5ECUA 3L4ZA 4B5VA 2YDSA 1DEDA 1S2TA 3NJ3A 1F61A 2I14A 3WDHA 2HE8A 2ZOXA 3A3HA 1NWUA 3L7RA 1S5NA 1PYFA 1C93A 3REQA 3VD4A 3HG4A 1A0DA 3CO8A 2DZPA 4XZ9A 1UR3M 3T4CA 1Z42A 4XAYA 4A8NA 2WKJA 3F2DA 4FXRA 3SIZA 3W6LA 3B06A 2YSWA 1E71M 3UYIA 3LBMA 1E1FA 4GABA 1KM5A 4M51A 3W4RA 4KW2A 2Z2BA 3AU2A 2J62A 4F0HA 3SBFA 5E09A 3IGXA 3CL8A 3UJEA 1SZNA 3NCOA 2FMNA 3HGOA 2XSBA 4MUZA 3BSHA 1UKOA 2GVYA 1GTHA 4DPQA 3GB6A 3RPTA 3H26A 1XS2A 3W7LA 4P7RA 4W7VA 2QCCA 5C9ZA 3QHMA 4US6A 1SQ7A 3VNDA 5I3JA 3WQFA 1VB9A 3A64A 2BTMA 3W84A 1JPIA 2PSNA 3VU2A 4GJIA 4O1BA 3N2OA 5DBUA 1Z6KA 2CZVA 4Q4OA 3TYBA 5HXMA 5KETA 3UJRA 1SGJA 2CITA 1QR7A 4HA1A 4L1XA 3UR7A 1RQBA 5LNVA 1E1EA 4OBRA 5FEWA 2IXUA 5K4ZA 4IJBA 3ATZA 3OU8A 5CBIA 2P88A 2HK0A 4CN4A 4F2TA 2AQVA 4P2VA 1MZHA 1R38A 3EKGA 3KOYA 2PDLA 4C6LA 4AZ6A 1E5JA 1EJUC 3N11A 5GPRA 2BLEA 4A8RA 1JXJA 3DGRA 5I02A 5J5RA 3E74A 3TXZA 5FEZA 3DHDA 5D2YA 5HBFA 4OV4A 4QE5A 3AUOA 2BGSA 1Q8JA 4O13A 4XD6A 4YPJA 2Y62A 3BUVA 4PCPA 4UB9A 4XKMA 2OSYA 1VD6A 4XQ6A 2FMOA 3SCSA 1E55A 2Q71A 1NDYA 3M41A 1EGMA 2QS8A 3LCGA 2D1ZA 3KCLA 3GC2A 4WDXA 3WDJA 3UR8A 4H8VA 5DMLA 4UMCA 4NVTA 3GNDA 3CC1A 3NNTA 2TSYA 3R89A 4DJEA 2H9AB 1KM2A 3WG6A 4A2SA 1H0GA 2PTZA 3IUIA 3P5ZA 2NWRA 2I56A 2E77A 1ITUA 2QV4A 4Q6XA 3BV4A 3THDA 3GU9A 3QW3A 3TSBA 1FWTA 2DT1A 2SFPA 3IS4A 3NQFA 1CECA 4AHQA 3JZUA 2VX5A 1A5NC 1TE1A 3HQOA 4NKCA 4FF7A 1DWJM 4PH6A 3KX6A 2ZDSA 4MM1A 4NZCA 1RBOB 1FBAA 1P43A 3L4YA 2QZRA 3KTXA 3TROA 4AMAA 1P1MA 2P8CA 4ZVJA 2R91A 3UA4A 4LRTA 1UD2A 3NA8A 2FGZA 2GJLA 3WQWA 2XVLA 1CIUA 1Q6GA 5C2XA 2ZX7A 1B90A 2VFIA 1M6JA 3P67A 3VIHA 1KV5A 1T6MA 4DXXA 5LIYX 3CPUA 1GVIA 3QYSA 3BZJA 1X8FA 1NQ6A 1POKA 1AW5A 3L0NA 4P7LA 4XAFA 3P5YA 2WVUA 4W88A 1EJSC 1T5AA 2VEKA 4XD3A 3AO0A 1J79A 1JNEA 5EBUA 5IFPA 1NQKA 2DZTA 5BYWA 2HVNA 1L6SA 1U33A 5ENLA 1E70M 1QHPA 1R85A 2YLLA 1XIMA 4TMCA 2ZZ6A 3EEZA 3B9OA 2QF7A 1E0VA 4ZE4A 4A3HA 1XR2A 2GUBA 1WXJA 3CGTA 3GIYA 3NGFA 2VWTA 1OM0A 4KFNA 1ESWA 3G1XA 4IMFA 5C9RA 4MB4A 4N7QA 3A4JA 5GJPA 4AH7A 1QPNA 2POZA 2DVUA 6REQA 4JN6A 3LV6A 2A85A 1XWYA 4N4PA 2QDGA 3BCJA 2YFOA 1Q6DA 4GZJA 4TQTA 1EB3A 4LV9A 3FSTA 5BXRA 3QHNA 8XIAA 1UMLA 5JIWA 1UWAA 1TG7A 4RJEA 4U10A 5M3WA 3PZNA 2P5NA 3SFWA 3W53A 1GG1A 3O07A 3QBUA 2VDIA 3L65A 1YDOA 4AY7A 1ZL1A 1LORA 3RX4A 2QCEA 3VILA 3UGRA 2H6RA 4FSAA 1GW9A 3PJTA </