2PTDA

Phosphatidylinositol-specific phospholipase c mutant d198e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQEKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 107
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2ptdA00
1QASA 2F9RA 2P76A 1T8QA 4S3GA 2ISDA 1QATA 1V8EA 3KS6A 3PTDA 1T6MA 1AODA 3QVQA 4GNKB 2OOGA 4I9MA 1ZCCA 2PLCA 3I10A 1GYMA 3CH0A 3NO3A 2PTDA 2PZ0A 1VD6A 2FJUB 3MZ2A 5T91A 3V18A 1XX1A 3V1HA 4QJ3B 4F2BA 3QR0A 4R7OA 4RW5A 3KS5A 3V16A 1DJHA 5T9BG 4F2UA 3EA2A 4I9TA 1DJZA 1YDYA 5T9CE 3RLGA 1DJIA 3EA3A 3QR1A 1DJYA 4I9JA 4I8YA 3EA1A 4I90A 3RLHA 4OECA 4RV3A 4QJ4B 5PTDA 3H4WA 4F2TA 1O1ZA 2OTDA 2ZKMX 4PTDA 3OHMB 2OR2A 4RW3A 1PTDA 1DJGA 4Q6XA 6PTDA 2O55A 7PTDA 1PTGA 3L12A 3H4XA 4QJ5B 1DJXA 1DJWA
chains in the Genus database with same CATH superfamily
3SZ8A 3VOJA 4MWAA 5LIUX 4H9YA 3NSNA 4GJIA 1KXVA 1PJ9A 3M43A 1O1HA 2ZX9A 1KFBA 3WK3A 3CUJA 3VC6A 3GUWA 2P1FA 3MCOA 4FOUA 4LEQA 3W1UA 2J24A 4FIRA 5D8ZA 2ZRZA 3UWVA 1IYXA 4HTYA 1UC4A 1N8IA 4O52A 1FWIC 3VM5A 4AWTA 5G1YA 1VRDA 2WHMA 5IBXC 3EKGA 3PTMA 4C6KA 1KCXA 3SQLA 3FS2A 4RDWA 3W74A 3O6AA 1W3JA 1KXHA 3NQCA 2DT2A 3FW6A 5CKSA 2WSQA 4PCNA 3CC1A 2JIWA 3UJFA 3K2GA 3VIJA 3IGHX 2QR6A 2BBFA 2B7NA 3VPLA 4UTIA 4EPEC 3AXIA 2A7RA 4M1RA 5L9FA 3W2NA 3NJ3A 1TVPA 4H8HA 4QE5A 2QEZA 1NP0A 1EC7A 5DCEA 1V7AA 3AROA 3QH2A 3KBMA 3UG3A 2CXGA 3LNMA 2ZZ5A 1G9HA 3E2SA 1KRMA 3AC0A 2BG5A 3MB9A 2VCAA 3IK4A 4F2BA 1Q2SA 3VI2A 1AQ0A 3TMQA 2DIKA 1JULA 4JFSA 3WNNA 1Q45A 4IL2A 4QROA 1F3WA 3UZJA 2CC0A 2I7GA 5AYYA 2P76A 1FWTA 3UR7A 5BMXA 3CUIA 2P88A 2XH7A 3EEZA 5I07A 1K8YA 5J5DA 2QAFA 2WMIB 2XH2A 3HPSA 2YR1A 5K7JA 3NFUA 3WQDA 2ZRWA 4E5TA 1V3HA 3T2PA 1BHGA 4KCVA 3N34A 4H9UA 3PBWA 3RXZA 3ABOA 2VEIA 1GOKA 3UZYA 1C9DA 5G2HA 4Q6JA 5DANA 4JIIX 1UD5A 1T96A 1KXTA 3PNUA 5J8LA 4UMBA 1JEZA 4AVNA 5HBFA 1MUCA 1G4PA 3E38A 4TV6A 3K46A 3ABRA 3IGSA 2YL8A 4ZXOA 3LD5A 3TV8A 3W6LA 2BODX 2YL9A 3KS6A 2V38A 3INPA 3PG9A 5DRIA 1CGYA 1YXCA 2GL5A 2ALDA 2ZXDA 1RD6A 3H12A 3VXGA 3PBUA 4OBRA 3KVJA 1VLWA 3S8HA 5XIAA 1UJPA 1FFRA 4XZIA 2ZFAA 2QAPA 3W28A 3BH4A 2Y7EA 4WKAA 5HDRA 2C79A 5DT7A 2WMGA 3AWNA 3S0CA 3A13A 3FGCA 3BQ5A 4QP0A 1NDVA 1E9YB 1D3CA 2BTMA 4GUGA 3ARUA 5BRBA 1XGZA 1KC7A 3FX4A 4W8LA 1OBAA 3SCPA 1SFTA 2WC4A 2Z27A 4GYKA 4XZMX 1HTIA 5C7VA 5A8NA 3GXIA 3CMGA 5CPNA 2FVMA 3KZPA 6TAAA 3VMNA 5I5RA 3EMZA 1J01A 4AX6A 4QSFA 3RR1A 1UW9A 1D8WA 1W54A 4CD6A 1I60A 1DPMA 3PUEA 1LORA 5F2LA 1KA9F 3W7HA 4LALA 1GK8A 2WYSA 5AYZA 1RH9A 1GQNA 1SQ7A 2R1PA 3ISIX 4AHQA 3ARQA 1QW8A 3WDJA 1GW1A 1H63A 4UTTA 3I7SA 2PCQA 4HZMA 1R3SA 2O56A 3IV8A 4OV9A 3MJYA 4KW2A 5PTDA 2QQ6A 3QC3A 3C4UA 3C0QA 2NX1A 3L66A 4C5YA 1R3VA 1ME7A 3TQVA 3SBFA 1HKWA 4JTTA 4HNUA 3H2NA 3GDTA 4DWDA 2FJUB 1TJ0A 1V4YA 4QG9A 3P93A 1XQLA 1M7OA 4U28A 3NQGA 2FMNA 3K8KA 3W7GA 1VC4A 1E6RA 3L23A 1YXDA 3G1RA 1W9BM 1HIZA 2NLIA 3NQVA 4DAFA 4PFMA 4MMWA 2D20A 4MPQA 5HJYA 4A2RA 1ZHAA 3SO7A 4JTDA 3RX2A 4AAJA 3LQGA 1ISZA 3QR3A 1UD6A 1UMLA 2QDDA 3GDMA 4AB4A 2WZEA 1Y5VA 4RW3A 3DFQA 4GX9A 5BWFA 3WF1A 2UY4A 5K9DA 5FEXA 4OQVA 2UY2A 4P8WA 1JQVA 5FJOA 5HOSA 5LNRA 3VIMA 4LGXA 3GG0A 3CZEA 1UBPC 2BGNE 2TRSA 3BSMA 2AQWA 4H04A 3Q37A 1QWGA 3TCEA 3GHUA 3SJ3A 3O15A 3AJXA 1GOQA 3CHVA 3BJSA 2YXXA 4JIEA 2XN0A 4C6IA 3IIOA 4MWAC 4NAFA 3JZEA 3B0PA 4J3UA 3F2CA 2WMIA 1TPFA 2Y8KA 3R58A 1BWKA 2ISFA 3KLKA 5EMJA 4AY1A 3L2IA 1VHNA 4IFKA 1UWIA 2Z00A 4JTRA 2G8ZA 1EDGA 4LCQA 1VEMA 2OYMA 4TMCA 6ALDA 1E56A 1OINA 1X7FA 4HMCA 3G1HA 2J27A 3LEPA 3PZIA 5BYWA 3HV9A 1KFKA 5CPQA 3UPBA 2YXGA 2J4GA 2ZYFA 3U2EA 4D1JA 3WYZA 2IXUA 1ADDA 3CL7A 3TSMA 1GKQA 3PB2A 1NP2A 2WPGA 1P48A 3RYSA 1LL6A 2YDRA 2WJEA 5CC6A 2QPXA 1K9DA 3UQNA 3N6JA 4WDXA 2PUZA 4GUIA 3GHSA 2X7VA 1PE1A 1VCGA 3TN4A 4JKLA 1K02A 4GPNA 2VRQA 4I9JA 1THFD 3QEZA 2ZA3A 4WOZA 2Q02A 3GD6A 4DBDA 1TQXA 2QUMA 4MVAA 3UVAA 1PHWA 1RCQA 4J4KA 4LJ3A 4ZSUA 1IZKA 3V16A 4TVUA 4AYGA 4XVDA 1SZRA 4BJHA 2RDXA 3W4RA 5KITA 2YYUA 5D03A 1C7SA 1V3KA 4KPLA 3LTYA 4OE7A 2HPMA 1YPIA 1YX1A 1EXBA 3G3DA 4YTQA 2CKRA 4JGDA 1VZWA 3WD1A 3MV11 4XAYA 3T2OA 2FHFA 4IPPA 4DBSA 3CZGA 2HZGA 1Z9AA 3WUGA 3LCGA 1EXPA 1C8QA 1T99A 4C6NA 5I2UA 3I7QA 2DUXA 3K4DA 3PNZA 2RJHA 2FH6A 3H4WA 4CUCA 4OWGA 4IXHA 3U2OA 1R9ZA 3HM7A 2QJJA 2VMFA 1BXBA 1EGMA 4ICMA 4IOTA 2A1YA 4CD8A 4DQWA 3AHTA 1S39A 3C61A 2ABAA 4WR3A 1BTMA 4C6OA 4A3YA 1Z89A 2D2JA 4UNIA 5I3JA 4BA0A 4TVCA 1ONRA 5FD0A 3M5ZA 1BRLB 5B7ZA 4JTLA 2C18A 4Z1DA 3WDPP 1JZ5A 2WQDA 2JBMA 4LNYA 3CUFA 4DYJA 5I06A 2QW5A 2XIMA 3WQFA 3H21A 5HMFA 1W3HA 3WBAA 4LUIA 1VFUA 3TK7A 1K7FA 3B8UA 1UP0A 1MNSA 1DP0A 2H3BA 5A6AA 2OZ3A 4FNSA 1HVXA 4XZBA 3BXWA 2OEMA 1EL3A 3VGGA 2NT1A 3QSTA 3SQSA 4IJRA 4GFSA 4KFNA 1AA1B 3LHYA 3KE0A 5FIPA 3RITA 2PTWA 4W5ZA 1CZ1A 2Q71A 3DC0A 5HNRA 4C1LA 4U2YA 2WVUA 3LG3A 1TFVA 3CMJA 4HCLA 3K1DA 4KH2A 1HGYA 1UA3A 4AHPA 2YKKA 3NO3A 5LSMA 4Z08A 3O05A 2GSHA 3ZVIA 2PDWA 4UFMA 1TUFA 3PBYA 1IT8A 4P7QA 1E0VA 2W9MA 3GDRA 1MUMA 1PCKA 1PZ2A 3TX9A 3IJ8A 3KXQA 3Q67A 3QV7A 5U7SA 4LT9A 1TZZA 3N29A 4DJED 2FYMA 4KWOA 2HVOA 2WPBA 2PDBA 2O9RA 1VGAA 1RD5A 3MI6A 5A95A 1A53A 3KFTA 3ITTA 3ZT7A 2Y1HA 1KWGA 3UZ5A 1DJXA 2WOQA 4GO9A 2W4XA 3GNPA 4RZ6A 3VVGA 1QTWA 2D23A 3DIPA 4L7ZA 4RJEA 1NWSA 3W83A 3L0KA 2QPSA 3UWZA 3SIZA 3K4AA 1UIOA 1KFJA 4AZGA 4NAEB 4H3DA 3U4FA 1EOMA 4Q4SA 1MQQA 1JD7A 3EWCA 4TX8A 2XU2A 4QNWA 4JTSA 3CEUA 3HV8A 1UQZA 1ZZMA 1MNZA 2JK2A 1U1UA 4AD0A 3W73A 1FQ0A 3TYUA 1UHVA 2CU0A 4J7RA 3PZUA 3KCOA 2G95A 4XD5A 1DTNA 1W9VA 4KETA 3PTKA 1M7XA 4MWAE 5A6JA 4JTHA 3LBOA 3BLKA 1ZGDA 3NDZA 2D24A 5EMLA 1VBJA 4WCJA 1R38A 3VINA 3OGVA 4F8XA 2BS9A 3OLIA 3KOFA 1QPOA 1A5OC 4D6EA 1B4EA 2Y4SA 4LS1A 4AZHA 3QZEA 1RR2A 2GK1A 3V7PA 1KBKA 3RX4A 3CLWA 3B8WA 2A5HA 3C3UA 1DJZA 2PRLA 4HMEA 1DIOA 4I8DA 4PSRA 3RCYA 4D6FA 1S5TA 2DFAA 2I14A 2HVMA 3M5VA 4A6GA 2PDHA 2XZ7A 1VHCA 4MUPA 1S1RA 1X39A 4PMUA 2XVKA 1XG4A 4CCDA 4IQDA 4JTIA 1M7PA 3CYJA 2HS8A 3EWYA 2E40A 3G6LA 4W85A 3W02A 2BOFX 1D7KA 3G1VA 4GCXA 2OVLA 3APGA 1T0OA 2I5IA 5HNTA 3CAWA 4LUTA 4N9CA 1Y5WA 4A3QA 2EG6A 2Z0IA 1AQMA 5D33A 3G1AA 3CPUA 1C8VA 1I4NA 3OGRA 5C2XA 5A69A 2YZ5A 1UQYA 1F61A 3UP8A 3W2MA 4DO7A 1J2WA 3ABSA 3AWOA 4M6QA 5EB8A 4PUWA 2CLOA 1GQLA 5LKYA 4OUIA 4Q6XA 2QMKA 1CX9A 2RJGA 3KVLA 1AL8A 3MS8A 1CENA 1A4LA 1GONA 2JEQA 1XGDA 1KM3A 2X2GA 1IXOA 4S2CA 1LT8A 1TCDA 4GXMA 1DTUA 3EPNA 3OZYA 2V63A 2BY1A 2DZTA 1YMYA 4UMCA 3RILA 1IHIA 5HWJA 1K3UA 4ZO7A 5LA2A 2CLMA 2EBNA 3W7KA 2NUYA 4YL2A 3R1ZA 4TR9A 3FNDA 3UT0A 1ZFJA 3TLLA 1GVFA 1W0MA 3E0WA 3BG3A 3A6OA 3ENLA 3THUA 4CLMA 2OWXA 1V6XA 1TTPA 2A6NA 1FHUA 5FSDC 1FKWA 4DUWA 3UGRA 4F66A 2J7BA 4O12A 3S5ZA 3M7SA 2X30A 5AC8A 2Z28A 4UNLA 2GJNA 1O68A 4AQLA 3VMOA 1VAHA 4AD4A 2OG9A 1IEWA 4FOJA 5BU6A 4UIOA 1P0NA 4EAMA 3QPYA 4PCFA 1QPQA 2C1HA 3WDQA 3G1FA 2F7FA 1QDSA 4YXGA 2UV8G 3L65A 4NASA 2G4FA 4U5KA 1KM0A 1RBLA 3IEBA 1QI0A 1H61A 1DQXA 4C7FA 5D09A 5JBDA 1UD3A 4GOAA 3WENA 1J5TA 5DRCA 4ZOAA 2ACRA 5BW6A 1BTCA 3L5LA 1QK0A 5T91A 1P43A 3U4AA 3PB0A 2OGJA 1PX3A 1EJ7L 4K8HA 4HNOA 1TV7A 1DJYA 4GABA 3NR0A 4UFIA 3CB3A 3CIXA 4ONVA 4HD5A 1DXIA 1YQ2A 2Y89A 3WJWA 4MDOA 3SADA 4JD4A 5CAKA 4N9EA 3C2OA 3VD5A 1CGVA 1J93A 4M7SA 5E0FA 3T40A 2EPNA 1OWQA 3FA4A 1RQEA 5E6YA 4EWJA 3ARRA 1TO3A 4G1NA 1WAUA 4PBEA 2WQPA 5GJPA 4K6AA 4W86A 1UUOA 1W5QA 2CLIA 2GGEA 1BF2A 1TG7A 3W7OA 1C92A 3C8NA 4H8VA 4WDWA 3EOSA 4FK9A 2WMHA 3WLSA 2DZXA 2FFIA 3P60A 2MUCA 1HJVA 4JOMA 3B03A 1V8EA 4C6PA 1GCYA 3A9IA 1W5PA 4JNMA 4ERAA 1Q3NA 5CZ0A 5AHEA 2VCCA 4B90A 3EMCA 3ES8A 1CIUA 4JY9A 1Q5MA 2OZ0A 1XDMA 2VOTA 2C16A 5LZLA 3GC2A 3TC7A 2PTXA 3BGJA 1TVLA 2GVEA 1PPIA 4QE1A 2CERA 7REQA 4JS3A 2GK1B 4H6RA 1VH7A 3F1QA 4AYSA 3BV4A 4ERIA 1OFAA 3RRAA 3DERA 1XD0A 1QW7A 2CYGA 4DRSA 3B0XA 4AMAA 3B8DA 2L5HA 4YIWA 2OSWA 1JDAA 2ZICA 2NXGA 4GBUA 1FY6A 2ZUWA 3BLPX 5CSRA 1CT5A 4FXSA 4E3TA 1A5MC 1QOQA 3ITCA 5DO8A 1NOWA 4OJYA 1YE6A 2VXNA 3E2VA 4ERGA 4JTUA 5DMLA 3VIFA 4BR1A 2NW0A 4XTDA 3N3TA 3ZJ7A 4NT0A 1LDCA 3TJXA 3DFYA 4D9PA 3DFTA 2B31A 3M0LA 1AZ2A 1DIDA 1YTEA 4AMCA 3ALFA 1DXFA 3IJ6A 3DAQA 4NI8A 3AIUA 2PDLA 3NPXA 4RDZA 4ML4A 1XGEA 3NSMA 1JCYA 4GVHA 5EL1A 1J0YA 3WBYA 2Y5EA 3NZPA 3AMGA 1KXQA 3LNPA 3DFHA 1I75A 4DWSB 5M1TA 3NQAA 4CCZA 3AU6A 3KCJA 5J04A 1E6PA 1F74A 4IMFA 1WOAA 1FBAA 2ZWZA 3V1PA 3V0UA 1KW1A 3NQMA 2WO5A 5I02A 1BPLB 3MHFA 1UD2A 3HU7A 3GKAA 4QM1A 1U22A 3GBDA 3THCA 3DENA 4J9JA 2PDXA 5A94A 2V2DA 4LYRA 3S2NA 1ZP4A 5EPDA 2DSZA 4UTHA 1UPMB 1W5MA 2OWWA 4YPJA 4JAWA 1PYMA 3QW3A 4UR9A 5C9UA 2V30A 4PUNA 5D04C 3DHUA 2X1TA 3UZWA 4P61A 3UJEA 5XINA 4DWSA 1VIZA 1V6VA 3WY1A 4Y8FA 3FK4A 4LAKA 4GNKB 3RPMA 3MU7A 3B0VC 2QCNA 2H6RA 2WM1A 3VNDA 3W38A 1QI4A 1FWGC 4R9OA 2WKLA 3I6TA 4ZFMA 5HAOA 3A3HA 4E0CA 3KP0A 4NIRA 3C5QA 5TQLA 3AU2A 1Z42A 1XUZA 4UNKA 2DZAA 1TCMA 2E9BA 3QV6A 1HO1A 1ICQA 1ICPA 3KOXA 1VKFA 3HIJA 3RPTA 2OB3A 1DXEA 2Y70A 4HNLA 3LMZA 1PVNA 4A3RA 3JS3A 2QCFA 1Z69A 4ZB0A 3GXNA 1M6JA 3AO0A 5FEWA 4DLMA 5I77A 4HP5A 1H4PA 4AEFA 3W1XA 4HA0A 3LN3A 1WZAA 3RK8A 2D3LA 5DXYA 2X05A 1EC9A 2INFA 1NIUA 4KKXA 4MB4A 3VM7A 1BVZA 3LK6A 3ZOAA 3LSBA 1Q66A 4GY0A 1LRNA 3NQBA 2XFWA 2YB4A 3TJLA 3LYEA 3TTEA 3MSDA 3GXDA 4E4FA 3LI0A 2ZX8A 1ZAIA 1YXYA 3T81A 2C1GA 3GU9A 4E8GA 3TEVA 2WXDM 3LRKA 3I3EA 3VUPA 1ITCA 3F7JA 3B9OA 5E1QA 4MJ2A 1IWBA 3ZS4A 1VJIA 1Q6LA 4NZCA 2YCLB 4G5DA 3DCPA 2H8ZA 5RUBA 2CNCA 3QBUA 1IXNA 3PF3A 4QDPA 4KCWA 1Q8JA 4I9MA 4AIUA 3LCLA 1XRTA 1YTDA 2WCSA 2CZ5A 2O7SA 4FOKA 1G6CA 1I2NA 3W1QA 2DJLA 3DU0A 2ZC1A 2A3EA 3S47A 2WB5A 3XISA 1S2TA 1Y65A 5F1VA 4O0ZA 4C5ZA 1C91A 3W81A 1I2QA 2QV5A 4AD5A 1WOBA 3SECA 3TQ0A 2WMKA 3N4EA 1P1XA 3RRXA 2WNZA 4CD4A 4Q8VA 2QUNA 2BHZA 4FEZA 5I3GA 1NEYA 2PGRA 3GZ3A 4IT1A 3WDIA 2V5BA 1A0DA 3IIPA 4AX7A 1WKDA 3CUGA 3U3HA 2NXHA 3H7RA 4FX6M 5FAJA 1A50A 3VD7A 2I9EA 2XG9A 4ZSTA 5AYIA 4AVFA 3HTWA 1CGUA 1XIDA 2XVGA 4LVGA 4LRSA 1S2CA 5DXXA 3VE7A 4RPPA 2DP3A 2TPSA 1UUQA 4LWWA 5JU6A 4NJKA 1SFJA 1KLZA 4XO6A 5LGXA 3W70A 2GQAA 3F4WA 2XGBA 1QBBA 2YW3A 1LQ2A 3ARZA 2E6YA 1F5ZA 1BWVA 3HQPA 4J3SA 3QR0A 3KX6A 3FJ4A 3A22A 1FCBA 1VBUA 1V5XA 4IM4A 3U5YA 4JKMA 1PV8A 4F0KA 1LUCA 1RZMA 4REQA 4S3KA 1BSLA 3IARA 3WLMA 3DFSA 5CQ1A 3CASA 1BFNA 1O7AA 5KZDA 4M82A 3LHVA 3IVSA 2FTYA 4I5XA 3NUKA 1M03A 3H4GA 4CGTA 2HS6A 1WKYA 2A3HA 2V2CA 5DCBA 1OFOA 2QZRA 1PKLA 4RZ4A 1SSDA 3G77A 4KFOA 1R3QA 2OOGA 2WWDA 3W7LA 4QJ3B 1HL8A 3HJZA 3MBDA 1MFVA 3QR1A 3EWWA 1RA5A 2I5GA 2P0IA 3AS1A 4L56A 4EXBA 3M0YA 1SW3A 2TODA 4D6DA 2FTPA 4AIOA 1TA3B 4LPCA 4R88A 1LT7A 2OCZA 1XLJA 5I3FA 5EBUA 3C2RA 1F8IA 1UIPA 5DLCA 3HOJA 1W9XA 4XBKA 3N2XA 2BVWA 3OLGA 4GVGA 5AYBA 3DEQA 3S46A 4MY8A 4YMZA 5JBFA 4JNZA 3PJWA 2GSEA 1LL7A 3GH7A 4JHOA 4DF0A 4JEQA 2WCAA 1DWJM 1EDQA 4RW5A 4J28A 1E15A 1YDOA 3KBWA 1Q6FA 3RFAA 4E6MA 3AMKA 3GXFA 3N18A 4H7ZA 3UWEA 3EDFA 3MQTA 5HK4A 4PMQA 4PYSA 4MIMA 1YDVA 2CPUA 5LHEA 1SJDA 3T44A 1F8MA 1FCVA 2QMJA 3GTFA 1UA7A 3LRMA 5BRQA 1J0JA 1W32A 3WQ6A 5EMUA 5I03A 3VU2A 2DZPA 3IAQA 1UZ4A 3AAMA 4RNFA 2DY3A 4B2DD 1KO0A 3R0UA 2B4GA 3IJ7A 1QO2A 3LXAA 4UFKA 5MHBA 3AISA 4GXPA 1HZYA 4DI9A 1DJHA 3IPWA 4PUMA 5DMYA 4IMAA 8CGTA 3T8LA 1UOKA 5AC4A 5K3VA 1WO2A 4QAWA 3ZT5A 1PZ0A 5GJNA 4UQ9A 5F2GA 3FHAA 1OCBA 4CVUA 1GVYA 4NKCA 1MW3A 4DJDC 1W8GA 1AQHA 1TPDA 3FHQA 4JFTA 4I8YA 3WKZA 2PP3A 2ZRYA 5HJXA 1VBRA 2HK1A 3W2UA 4GWEA 1ZBCA 3QOKA 3RNDA 3U57A 3GTIA 1XINA 3W2JA 2PS2A 8TIMA 4WGHA 2FPTA 2J25A 1XIBA 2VZUA 4J27A 2O9OA 3H26A 4M6UA 3DECA 4B3KA 3CT2A 2VFEA 4URIA 3VILA 3MP4A 1JGIA 2GPTA 3EDKA 3FYYA 3TN6A 1FWFC 4W9TA 5I78A 3RN6A 4Z1CA 1SU5A 4KCUA 1KR0A 1B1YA 1Q6CA 1XF0A 2BGSA 1FHVA 2XYLA 4HSOA 4C91A 3MSRA 1NJJA 2E4TA 3MZNA 5LGZA 1B3YA 4RCXA 2V2HA 4LTSA 3BW4A 4MOZA 2C91A 3W7DA 3H22A 2QKFA 3LSCA 5D38A 2ZDSA 3AXXA 1XP3A 3PUGA 2HJPA 5HMSA 4GD0A 2CBVA 1QWKA 3KRSA 4MWAD 2O92A 3O7UA 1L6FA 3SN1A 1Q2RA 3OVRA 1SO3A 1X96A 1CXEA 4G7EA 1YBQB 3H2FA 1F07A 3U2ZA 1A80A 2ZQ0A 4NY2A 3WH7A 5H8MA 2FKPA 2P10A 4QS5A 2CHRA 3QQ1A 1G67A 5HA7A 1NQKA 2Z2UA 4BZYA 3DN5A 2QDHA 4MAVA 2YCIX 3G0UA 2Y6ZA 4PMNA 4J3ZA 2EKGA 1HN1A 3QGVA 5ABEA 4WIWA 2ZUSA 4NX5A 4PEKA 4ZCWA 3SRFA 4Q4QA 1PCWA 3WMLA 1FP9A 3GK0A 5LNVA 4PMVA 2J47A 3DG3A 4RNIA 3T0BA 4O13A 3IGXA 3GDBA 4EANA 1QJWA 2ISDA 1UKSA 1TREA 3AUJA 1GHRA 4GA8A 3QHMA 4GIAA 4XZWA 3HFTA 1UR8A 3E5PA 3LS9A 1YE4A 3R89A 1XV8A 3B06A 2G3FA 3QQ0A 1FXPA 3QGAC 2V3EA 1RK6A 1XKJA 3T78A 2A7PA 3PANA 4UC5A 5MKGB 1P0BA 1TPEA 5HXMA 2GZXA 4KEMA 5G1MA 3LUTA 1VQTA 1SYTA 5KTLA 5K9XA 4Z2GA 4GBDA 3BAKA 3ORWA 2VZSA 3CV7A 1XIMA 1VD6A 4QLKA 4OUEA 4PMOA 2Z7KA 1AW1A 1B3OA 3WJZA 3VD9A 4DBWA 1OFEA 3RCMA 2OTDA 3W7NA 2UY3A 2VZVA 1HFBA 3O0FA 1E9IA 2Q8ZA 1EIBA 3MO4A 3GM8A 3MC5A 1TV3A 3BCFA 3BLLA 2VGIA 5IFTA 3RR4A 4JXCA 4M3PA 1E9ZB 2I9UA 1PKYA 3KBVA 5DN1A 1OHLA 4RDVA 3ITLA 4GYFA 3G8EA 4LC6A 3M0MA 1WAWA 4LVBA 2XTKA 1OD0A 1YNPA 4IP5A 5CBIA 2V3DA 1WNOA 2VUNA 4OV4A 3T4CA 1JZ2A 2QHAA 3TNBA 4Z2HA 2PP0A 1LG1A 4P7OA 4R34A 4HU3A 4F9JA 3M47A 4O17A 4E2DA 3G6MA 2D22A 4JTJA 1JAEA 2HNHA 3TXZA 1M9HA 3USBA 3VDAA 4CNSA 3TMLA 1CECA 2CBUA 2TMDA 4MNLA 1XSKA 4MYAA 2ZA1A 2ZX6A 5DBTA 4S3EA 1DJIA 5D05A 3S2LA 3S6TA 2QGYA 1JYXA 2GDVA 5C9RA 1JDCA 4C1NA 5AHFA 4J2PA 1JAKA 4BWLC 1XPGA 4QG6A 5E0KA 2D2GA 5BXRA 1IT0A 1BKHA 2BHYA 4OVXA 4XZLX 1MW1A 4TMBA 1AJ0A 4BEUA 1DE5A 3HB9A 2Y88A 2RDWA 2YXOA 3W82A 4B2DA 1WDDA 4H4IA 3SY1A 2HCVA 3F5KA 1XYZA 6REQA 3EXTA 1IT7A 2PODA 1KBBA 5HUOA 3BZGA 3MP5A 4ZTYA 2CLLA 3GBEA 3S1XA 3UA4A 2WZTA 3WQEA 1OX6A 5C2GA 4AF0A 2NWSA 4ICCX 2NQHA 2DH3A 4PTXA 3PBVA 5T26A 2HWGA 2VFIA 2VKZG 3WBWA 4ADSA 1G1YA 5I3IA 4EPBC 1US0A 1U83A 1ALDA 4JFUA 5EFDA 3WIJA 1VYRA 4G6CA 3MMTA 4JKKA 1QAPA 4YVPA 4Q4RA 3DHPA 4G7EB 4TVDA 1XYBA 2ZA2A 1D9EA 3AS0A 3QJAA 4FS9A 3UYCA 2X0HA 4Q7IA 3ZR4A 1UH4A 3VMPA 3SCRA 3ARSA 5HPOA 3PJTA 4AZ7A 2HBXA 4QQUA 1H60A 3SDOA 3I7RA 1XLHA 4XKYA 3PZGA 2ISVA 2VEFA 1KQYA 1W5NA 4ICNA 3FKKA 1ONEA 3RLHA 5H1WA 1I0BA 5LHFA 4DJEC 3W37A 3KZSA 3MSYA 2E28A 2QJMA 3PFMA 1U5VA 1MFUA 4MTVA 4P7RA 2PZ0A 2A3AA 2E25A 3FJNA 4AEOA 3HZ3A 4AY8A 3LHUA 3NO1A 4C6CA 5BXTA 2XJ7A 2J8FA 2C6QA 5TAOA 3SY8A 4Y9NA 2W3ZA 1W1PA 4D8LA 2AAMA 3WLTA 3Q4DA 1ENUA 4FMVA 2A79A 2PWUA 3EXRA 4AUBA 4GG9A 4W7WA 4R7OA 2VUYA 4D2JA 4XV0A 4EX4A 3QPEA 1LBMA 1H7XA 3GYEA 4UZUA 2IUZA 3LX9A 4JCLA 1VFHA 2D1ZA 1QT1A 4KGJA 2C8NA 5BMWA 6TIMA 1KFWA 2HE5A 3WEMA 1XRSA 3PP7A 3WQWA 4RXFA 1I2RA 3PZNA 3CTTA 1J8VA 3IUHA 5MF5A 3UEQA 4QNEA 1FWEC 4Q4PA 1V02A 4UZSA 3TFCA 4IMCA 2I56A 3QQWA 3LCHA 3TJ4A 1N7KA 2GFTA 3UCQA 3TAKA 4ENLA 3USZA 1XFBA 3RX3A 3MZ2A 4MUZA 1ADOA 1OFRA 4O1BA 4FNQA 3V3WA 3BARA 2VRKA 4QJ1A 2I57A 1OYAA 2EAWA 3BUVA 3IANA 3M0HA 3VNMA 4LC8A 4O28A 1DE6A 1NY1A 2V69A 3AS3A 3LRLA 3STFA 1W17A 4C6QA 2R94A 4GINA 3Q65A 5DQPA 5EGRA 2GQ8A 3VIGA 5D32A 4GZ7A 1MRAA 2D3NA 2VZOA 2JF7A 4K36A 2C3ZA 5LIWX 4QEEA 4XG1A 2E5CA 2J8GA 4NXSA 3GZAA 3W85A 3WO8A 3FDGA 5AHLA 1L2QA 2BY0A 2Z6IA 1XLCA 3B8TA 4GC3A 1DQUA 2DPEA 2YJQA 4CU6A 1LWHA 3VZXA 1SR0A 2YOCA 3E96A 3RLGA 2EG8A 4KRUA 3V5FA 3EXSA 3JVAA 1R87A 2R8WA 3N4FA 1GWJA 4V33A 1J6OA 3ARPA 3LCXA 4UTWC 5AFDA 4WY0B 3BOXA 3S2JA 1LBLA 3ZJ8A 3MO7A 3MWCA 3TIMA 2VNCA 4UTJA 1H51A 1TR9A 4LV9A 1QI3A 1QR7A 4PBGA 4LS2A 3B0UX 3GFYA 3PBGA 3NIYA 4B5UA 4IPLA 4MF4A 4ZQPA 3ALGA 1V6YA 4XZNX 5EYWA 1O5XA 2CHNA 2NV9A 3JW7A 3PR2A 1BG4A 3N15A 3CV2A 4QE4A 4DWSC 3UR5A 4AC7C 1XR2A 2J7GA 1IR2A 4JTEA 3NM3A 4PZVA 1AH0A 3VNKA 3UR8A 5LNUA 3C8FA 1E4IA 4G56A 1OX4B 1U30A 1ISWA 2DW7A 1UD8A 2PGEA 1T8QA 3CHFA 1JCXA 5LXEA 3CQIA 5I3DA 2VGFA 3IRDA 4GI9A 4ILSA 4CQDA 1MEHA 4W93A 4BI6A 4Y7EA 4BI5A 3BC9A 1GORA 2VFFA 3MCNA 3BAJA 1TTJA 5HANA 3SFWA 1AH4A 4ROQA 4DO6A 5AC7A 4I9AA 3PAOA 4CNNA 3P2VA 1XRVA 5KSWA 2PTZA 3JUGA 3GAYA 3EX4A 4I5RA 3DOPA 2ZX7A 1ICSA 1EP3A 2C0AA 1JPIA 4LEFA 3POCA 3GIYA 1P7TB 7A3HA 4LQ1A 1SR9A 1BYCA 3WMSA 4Z1AA 3M6YA 4NRRA 4FAMA 4JX6A 1MRQA 3W1LA 5EFFA 3KL3A 1XSJA 5CAHA 1GQKA 1R46A 1YADA 2FMOA 3ITVA 1PYFA 2R24A 1O5QA 2VEMA 4DNMA 2WJDA 1FFQA 2AOSA 1TELA 1JZ7A 3S1GA 3UETA 4YTSA 3C0JA 3GAKA 2RAGA 2ABBA 1PBGA 3UXAA 3P61A 3G22A 4QGCA 4X2PA 3FEMA 2V68A 3L2LA 5I3KA 4A8LA 3VNJA 1SO4A 3KDOA 4IPJA 4PMDA 3E2QA 2D0GA 1P6BA 1CYGA 5K4ZA 3B0YA 1SUXA 5A6BA 4HJWA 3LHZA 4H9TA 5F2IA 4F48A 3VD4A 2XIIA 3TR9A 4R5EA 4HN8A 2Q3OA 1EA9C 2QIWA 3AHYA 3O16A 1JIBA 5TD4A 3WMBA 1TJPA 3CQHA 2D0HA 4IX0A 3ZSTA 1YPFA 1F4HA 4XD6A 3OBKA 1FH9A 1V6TA 1QCWA 2BX7A 3J7HA 2QF7A 4GGHA 1UJQA 3RPDA 3H53A 3L12A 3N17A 1NWRA 4CQ9A 1O6IA 4L6HA 1H5VA 2Z2BA 2XSBA 2CW6A 1MWOA 1GJPA 3PJUA 3HN3A 4XISA 4KIRA 3PPHA 3WLKX 4E4PA 3IVTA 1QHOA 2B7OA 2P0OA 2WWCA 3BLDA 4IPNB 4XUYA 1EC8A 4L4PA 1G5AA 3TH6A 4A3HA 1PTGA 2AGTA 3A3WA 1NFGA 4GACA 3BWWA 3M5YA 1HJWA 3O9NA 3FKRA 1FWBC 3I3DA 2ACUA 4ZQRA 4NUWA 2FPYA 3NGFA 1BVWA 1IEIA 1KM1A 4P8UA 2E9LA 1BG9A 2ZXBA 3BK0A 4NZ4A 4XIAA 2DJXA 1YTKA 4NJGA 1X6NA 1TWZA 2JF6A 3NL6A 5GVJA 4L9ZA 2YZRA 3WF2A 1B90A 3TNOA 1XIJA 4W5UA 1W37A 3OO2A 3NPUA 3DKLA 1EA0A 1V77A 1PX4A 3ITGA 4YNGA 1E4LA 2ISSA 4O0QA 2IQTA 1MQRA 1FVPA 1H1YA 1L8PA 1P1MA 1VR6A 3ARTA 5KZ6A 5AHIA 2OLHA 3W3OA 4F79A 2J79A 3A64A 4UTFA 2Z29A 1ISXA 2OEJA 2W62A 1XIGA 4LY4A 3VIIA 1LUCB 2AL2B 3E49A 1XLKA 3Q58A 5G2IA 3FOKA 5FEPA 1NF0A 1ONXA 4KEVA 5T9BG 1TV5A 3R8HA 5E9XA 5I79A 1TV2A 3BAWA 6A3HA 1JFXA 3L4TA 4MNJA 2YBUA 3N2MA 1JCJA 1BLIA 1GVQA 3MUCA 4US5D 1NM9A 5C9ZA 2YDSA 2WNWA 3PTDA 4ZVJA 5CSUA 3O07A 2E6FA 3QLLA 4N9BA 1XG3A 4PRRA 2WNNA 1HW6A 3P80A 1O5KA 4WVXA 2X41A 4DZAA 1Q13A 2XFRA 2AKZA 1HP4A 1U2YA 3TYZA 3KCLA 4NZ1A 1FXQA 3THDA 2DZWA 4O4WA 1NOFA 1K9FA 2EPOA 1O12A 5A2BA 4HN4A 3IAPA 1FDJA 2KAUC 1GJUA 5FJRA 1S3HA 3ZLGA 2XIBA 2QUTA 2QUUA 3BL3A 2P3ZA 3VX1A 4JL2A 4FNRA 1EOKA 3MYPA 2PZNA 1MUWA 3NL3A 4PN2A 4E8CA 4O19A 4RUBA 3N6HA 1WDSA 1DJQA 1Z48A 2ICSA 2J7CA 3QHNA 1EO5A 4JPGA 4FPSA 4D6CA 2GWGA 3WD2A 4RNHA 1VPQA 2OXNA 1JZ6A 1HX0A 1A3HA 1PWMA 4K8GA 3LPFA 1L9WA 4IP4A 4O1DA 3G1YA 1PSCA 1VENA 3NZGA 3C2YA 4ZZ9A 4CVWA 1KKOA 3BLOA 3GSMA 3POHA 1R8LA 1I1XA 4W87A 3HG4A 1V93A 3S6OA 2YLLA 4LRTA 4Q4OA 3TXVA 2NV2A 4JQ1A 3C0LA 4H01A 4N2YA 4XUGA 5A8GA 1RCOB 5D2TA 3UPWA 1WZLA 3CPGA 3S4TA 4B91A 1OIMA 3M46A 4NF7A 3FVMA 4HHMA 3QZ6A 3ARVA 4O8RA 3M44A 3ONCA 4R85A 3UU0A 3K4WA 2OX4A 3ME3A 1L2UA 4AY7A 3UZXA 2WKGA 3C2EA 1XLLA 3GH4A 4UFLA 3SUVA 4ORIA 4GK8A 1XFCA 5F7UA 4O0KA 3E0IA 4Y9PA 4A8NA 2EXOA 1JFHA 3FFSA 4BF5A 2ZTKA 2E67A 3QKEA 3T0TA 2VX5A 4F3HA 1REQA 1RVGA 3OGSA 3UWWA 3JRKA 4KQNA 4V28A 1XISA 4GVIA 6CGTA 4H19A 1JXJA 3GC4A 4DAIA 3FXYA 2CKSA 2E1DA 1FH8A 1PEZA 1NDYA 1UCWA 1PIGA 1RK5A 3W7JA 1MZRA 4FO4A 1ZJBA 4GIYA 1RBAA 2VZTA 4AVOA 5I24A 1E6SM 1JF5A 4YCOA 4WJXA 4ZODA 3PWIA 2XH0A 2YIHA 1X7IA 4DYEA 4HYRA 1D8CA 3VCCA 3CV6A 1XH1A 2A2IA 4E2OA 5IRPA 1OGBA 3W87A 4H8UA 4KESA 2MNRA 4B3LA 1XICA 5HQEA 4HK5A 1XIIA 5ECVA 4X61A 5CLTA 4M5PA 1RV8A 3GU1A 1TV8A 2HXTA 2NQ5A 3S2MA 3TYCA 3VOCA 3KBSA 4L80A 4PFHA 2GVLA 3I65A 3O6YX 4GQGA 2WZIA 4PTWA 3BCDA 3QF0A 1LOQA 5IXEA 5GJMA 1M01A 2PLCA 4IIBA 3MKKA 3L4ZA 1RSCA 2OMAA 3LTSA 3GNXA 4L61A 1FHDA 1OM0A 2DT3A 2FZMA 5IOBA 1TJ1A 2J9YA 3M5XA 2HRWA 4LAZA 3E3HA 2I17A 1QNOA 4BCEA 7ENLA 4UMAA 4NILA 1XQKA 5JXQA 3NCOA 2I5QA 1VP5A 1HJSA 2DQWA 2Z1SA 3WQ5A 3TTOA 1XBXA 1VJZA 1EYWA 1KB3A 4K3ZA 5H2ZA 1AUSL 4AZCA 3F4VA 4C6DA 2PB1A 4U2ZA 5FL1A 2E5BA 2V5KA 3PS7A 4WKHA 3UG8A 1R3YA 2QF8A 3HA1A 1UASA 3EX3A 3WUEA 3EDDA 1I0DA 5JIWA 4JFWA 1NVMA 1OX4A 3F5LA 3CM4A 3NO5A 1A49A 2D2OA 2DVUA 3VKDA 5A8MA 5CJ5A 4O1EA 3H8AA 1JPKA 4MY9A 4C7GA 2ZCGA 4BKNA 1CNVA 4XZHA 1CXFA 5CZJA 4MJ4A 2YL5A 5GNZA 1QU4A 2BZNA 2OELA 4GKLA 1IEXA 2QGHA 1YLVA 4AFYA 2O4QA 4HMNA 3BG5A 1V0KA 1WA3A 1FKXA 2IPWA 3TUUA 3W72A 1T8XA 4JHMA 3RM9A 2VVNA 4DPPA 3CUXA 2OQHA 3H24A 3C86A 4PULA 1SGJA 3FIGA 3SIMA 3CL8A 1ME9A 2J88A 4V2XA 1F76A 2Z26A 1F3XA 1R5YA 2Y8UA 3M9YA 3WL1A 3CGTA 2OFJA 5C0QA 1QHPA 4IQLA 1VF8A 3NDYA 1BQCA 3WEOA 3GTXA 1PL9A 3WNLA 3NTYA 3IWPA 3NPWA 4PL2A 2IKJA 2WSYA 3K30A 4ASTA 3LB0A 3CH9A 3BE7A 4DJDD 3PTQA 4POCA 4RLIA 1PKMA 2ZZ2A 5BOEA 3W01A 2VP8A 1Q6OA 2HEJA 1B31A 2GUBA 3WF0A 4IIDA 2FGZA 3VO0A 4UCGA 1PWLA 3H7UA 1B9BA 4C7DA 4XKYB 3W24A 2QUVA 3P0WA 2DSVA 2DVTA 4LOCA 3W6MA 4I3GA 4FXJA 3LGDA 4O15A 2V82A 5G1TA 1JCLA 4XSMA 3ID7A 3L21A 2CETA 3S9ZA 3ANUA 3MDUA 3SCTA 1XLBA 5FF4A 3RJXA 3G5EA 2RDUA 2JKAA 5DMMA 3W0KA 3EPOA 4ATDA 2JGYA 1WUEA 2Q01A 5GNXA 5JH1A 1I8JA 1NF7A 4MDPA 4IICA 4U33A 1H7NA 3FLUA 1ODZA 3SAZA 3A9BA 4PR4A 5BNKA 3DHFA 3EX2A 1NU5A 3BAYA 3DUGA 3PSVA 5FAGA 1JXKA 4L4MA 2VFDA 3ANVA 4MSSA 1QNQA 2VC9A 4ZB5A 3TP4A 5FJUA 4RL3A 3VCRA 1H2JA 3G1XA 3STGA 3N2OA 2FDSA 2V5JA 2ZZ1A 4UR8A 3QYSA 2PCEA 3B8VA 3FCPA 5CCZA 3IK2A 2J8TA 4J3XA 2VENA 2CITA 3CT7A 3TLQA 1PAMA 1UG6A 3CL6A 2CLPA 1VFFA 1J18A 4HQVA 2XFYA 1FX6A 3GFZA 1QW9A 4DEFA 1IF2A 1T41A 1Q6QA 4OBSA 4JTFA 1DHKA 2ZWYA 1RJPA 2YCLA 3BZJA 3A5FA 5HINA 3STEA 3P81A 3MKVA 1RPKA 1N2VA 2VCBA 2YSWA 2A7NA 2VWSA 4ALDA 4QSHA 4X9SA 1LL4A 4D72A 2V8ZA 1X6UA 4HPHA 5BU9A 1SW0A 4ZL1A 3B8SA 2WVSA 3GTHA 3UXLA 2NZLA 2TSYA 2X1IA 2DSUA 4FNPA 1I9CB 3TZNA 2FZ8A 4D1IA 1NSJA 4C6BA 3P6LA 4B5XA 2FZNA 4LB4A 3EMQA 3BMWA 4G2DA 4Z42C 4FXFA 4UWMA 1DOSA 4HPXA 4HK6A 4TTGA 3CXOA 1GTEA 2EJ1A 3HG3A 1XLMA 1LP6A 4E8DA 4IZGA 2Q6ZA 3KRUA 1P6WA 3QTGA 2YGYA 1GQIA 2BB0A 1LOLA 3BLEA 1ZRQA 6XIMA 2VDHA 2ZUMA 5CEWA 2HTMA 3PPCA 3C0SA 4L9YA 3E0VA 2WLZA 5DT5A 2OZTA 2INEA 4WZHA 1XSIA 4IIGA 5D8WA 3P5ZA 4FXRA 1G7VA 5ABFB 2HDJA 1VBHA 3MJMA 3SGUA 3GQYA 4XBJA 1EZWA 2VQTA 3S6DA 3TOYA 2JGQA 4X22A 3OOQA 4X0VA 4LVFA 4W7UA 3KTSA 3DYPA 3R94A 3W84A 2VJXA 3IJQA 4C6FA 4AWSA 5G5IA 3I6RA 4DY1A 2Y63A 1FHLA 1TPWA 4UQBA 1ML1A 1BYDA 4L6OA 3R8GA 4WGXA 4XD4A 1F4AA 4OOZA 3ZZ1A 1BRLA 1PTDA 1KRAC 4D8AA 3R13A 4HGXA 3QHOA 3UWUA 3GVRA 5DEZA 1Q7MA 3EWDA 7REQB 3KL0A 1UR9A 1IIHA 1TSIA 3VDHA 3QW4B 2IKIA 1CDGA 3WLRA 3LOTA 3V4BA 3OA5A 2PDFA 1GZJA 4IGSA 3PN8A 2CWNA 1F6PA 1FRBA 3SM0A 1J0HA 5H6HA 1BQGA 1QOPA 5CPTA 1TPUA 1FCUA 1RY0A 2DZUA 3ZLHA 3AIBA 3W75A 4A35A 4O1FA 1XYCA 5CBBA 4C65A 1GQJA 1XKYA 3O3RA 4JIRA 3I4KA 1TX2A 3VZYA 5FSEC 4LYQA 3WFLA 4FLRA 3W7IA 4DO4A 3OYXA 5D2VA 3M0XA 4Q8NA 3WJYA 1YDYA 3GNOA 5CPOA 4N02A 5EU9A 2AMGA 4MZ8A 3FEQA 4NXKA 4GYPA 2NX9A 1UZDA 2PE4A 1UWAA 1IZCA 3VNLA 2PDCA 4B5WA 2JKPA 4J35A 4Z2JA 1AVAA 1YDNA 5AKQA 2CXEA 1TPVA 4D6GA 1HVQA 1RP9A 1EJVC 3URAA 1E6NA 3WDHA 2OKOA 1FDZA 3TDFA 4UTKA 3U5UA 5M5DA 3M0IA 3MBFA 5E5CA 4OOUA 2HV5A 1XC6A 1DJGA 4N0RA 2B7PA 4RE0A 4W8AA 3OPSA 3S5SA 4LXFA 3VOGA 1EGZA 1XI3A 3LCWA 3FA5A 2J7FA 5LXXA 1H1NA 2DGAA 6PTDA 2V3GA 1ME8A 1TIWA 3TQKA 2R82A 2Q8LA 2Q3RA 5TIMA 1XYMA 3WQ4A 1YIXA 1RHCA 2XN2A 3IUDA 1FWWA 3P74A 1UH3A 5DMNA 1UR3M 3K13A 4J3TA 4UQCA 4IPIA 3OG3A 4M24A 5A5WA 2J75A 3S5NA 4FA3A 2JE8A 2NT0A 3KL5A 1KCLA 3HPZA 5D2WA 1XW8A 3CU2A 5JMUA 1P4CA 1KCKA 1FP8A 1HKIA 1V3JA 1XDLA 2A21A 4G8TA 3P8IA 2RH9A 4MYXA 2HSAA 4IF2A 3IJLA 1K4GA 2HBVA 4S3AA 1JVNA 1W8SA 2XIQA 2V0TA 4CQBA 2YCKX 3UY8A 4EPKA 4ZMGA 4JIQA 2X8RA 2J13A 1T7LA 3LDVA 4C6MA 4DJFD 3XINA 4WOQA 1NAL1 1K7XA 2JEPA 2ONEA 4CN4A 3WLHA 1XLEA 4M51A 3UCCA 3U48A 2EQDA 3BPWA 3WJXA 1AMYA 2TAAA 3RM4A 3W25A 4JIPA 3KRBA 4ZTXA 2YCJA 4TX9A 2DIEA 1MO0A 5D9OA 1ZBWA 2QXWA 4EVZA 4IMDA 3ZR5A 3PVFA 3P8JA 4D6IA 1YW1A 4WXZA 5CJMA 4NRSA 1W6TA 3AYVA 4Y90A 4RR4A 5HNNA 1EJTC 1XIFA 3PUDA 4GNJA 5HMDA 3VKBA 1R7AA 1H5YA 3WCZA 1NFBA 4HIBA 3L5MA 2NSXA 1V02E 4QJ5B 1EPXA 4DYKA 5CPLA 1HO4A 3MUY1 2Z7GA 4GMEA 3UR2A 4NJIA 2FLIA 4KIEA 1P0DA 2QVNA 3W7MA 3EDEA 3RJYA 1X98A 1RQHA 1W1B1 2YCEA 4MJZA 4A8IA 3QGKC 4C6EA 4CEXC 3WF4A 2D73A 2DT0A 1XYAA 5FF3A 3SFKA 4F0MA 3MI3A 2YBTA 1KCZA 3EKLA 3S9IA 2W61A 4GH1A 2WKJA 5KINA 4WHBA 4YTUA 1B3ZA 3E02A 1ADSA 5C9WA 4BWLA 4PUKA 4QLJA 1UP2A 1H41A 3LBMA 1I45A 1CWYA 1JZ3A 1QOXA 4UFJA 4WY0F 1D2KA 1TWSA 1TTQA 3YPIA 1G69A 1VYSX 4PB5A 2EHHA 3B3DA 4ZO9A 2G0WA 3UYIA 2A85A 2PDMA 2VFGA 1GUVA 3F03K 2E8YA 1N8FA 1SFLA 3M0ZA 1IGWA 3PULA 4BQ4A 4ECLA 5DELA 3A4JA 1JCMP 3NZ1A 4YLWA 3WX7A 1JL8A 3L4VA 1KR1A 1MVYA 2X1RA 2X40A 9CGTA 3SCUA 2YFNA 3VFCA 1X38A 3I6EA 4BF7A 3HGOA 4S3GA 1J11A 2E77A 3UNDA 4CEUC 4FP1A 3L4XA 1PXGA 1H0IA 5CC7A 2WAGA 2V81A 3EX6A 3SRDA 2PRHA 2VI0A 3URNA 1JPMA 3LCFA 3NEHA 1UUMA 2A3CA 1QBAA 1FWRA 1UKTA 3BQ6A 3GIPA 3V0TA 2G37A 4HK7A 3N9RA 2XIOA 2PDUA 3QZAA 4W84A 4OT7A 4XX6A 1B3VA 3N11A 1A3WA 4YN5A 2YYTA 4NJHA 1QI2A 3LZ3A 4K1GA 4GQRA 4OIFA 3BAXA 4ZOBA 4HTBA 3HG2A 3M0KA 4HA1A 4E3VA 3MVIA 4QX4A 3TWAA 1GOOA 4XAFA 5A2AA 4DPQA 2WLYA 3T05A 3PZ9A 1AQFA 3G8RA 1QUMA 3H6OA 3KBNA 4HZ8A 4B92A 4O18A 1HKVA 1TR1A 1YKWA 3D47A 5FKYA 4L6DA 4OZOA 3RDKA 2PDJA 3EOLA 2QYGA 3RO8A 8A3HA 1IQ8A 1G4TA 3GY1A 1UB3A 2R1NA 1SSGA 3CH0A 1H09A 2ISWA 3AS2A 3BJTA 4NYUA 2P8BA 4PRTA 5KZEA 1QNPA 1H1ZA 3L5AA 4XAGA 4DUOA 5HR6A 1YNQA 2VYOA 5JH2A 1JDFA 1XCWA 1A5AA 1Y5XA 4MKSA 4DUXA 2O4MA 3KVMA 3G24A 4C6JA 1ZCCA 4L1XA 4YVXA 2BXVA 5IFPA 3GRIA 4Z1YA 1CGWA 3WQVA 3NNTA 4GY7A 4PCSA 3UPMA 3QFWA 4F0RA 1LWIA 4ZA0A 1OZQA 3Q94A 1TZ7A 5HATA 5ECUA 3I68A 4Z17A 1XWYA 4H9XA 2HISA 3HQOA 2ASHA 5C7HA 3F2BA 2IMRA 4DIAA 2QCCA 1XM3A 3H2CA 2CEQA 3ZM8A 7XIMA 2EPLX 4OBTA 1QFEA 5EMKA 4Q8MA 2PDPA 2QCLA 1OT2A 8XIMA 3LV5A 3H54A 1GW9A 2OSYA 3A23A 1B4KA 1M5WA 2ZRUA 4FLSA 5AC6A 2Q8XA 3NVDA 4WF7A 3KVKA 1RJQA 3W53A 3CEPA 1R47A 2ZE3A 3GVGA 4IMGA 3W00A 3FDKA 4D6HA 1DIKA 1NTHA 3KTCA 4I7UA 3GE7A 2E09A 1W56A 2UWFA 4GYJA 4BS0A 3PSWA 2WSRA 3ZQ9A 1IE7C 4J3WA 3W23A 4DO5A 1E5NA 1FH7A 3LMYA 3WLNA 3TZFA 1EEXA 3WLIA 4MLRA 5D2XA 4QXIA 3B05A 5C8BB 1W5OA 4WJ8A 4ZENA 1C90A 1M04A 3PZTA 5BRPA 4BEQA 4DN1A 4B15A 1W3IA 3W7QA 2FFCA 5A3HA 1RP8A 1DJWA 3OYZA 4HHPA 5I09A 2SFPA 2WZMA 3AHVA 3WLOA 1QATA 2BXZA 1KM6A 4GYPC 3VX0A 5CSYA 5DY3A 2D2HA 4M56A 5GQBA 5HJLA 3D3AA 4A4AA 1AFSA 1PIIA 1B0IA 4FSAA 2UBPC 1K77A 3T4WA 1V7YA 1VCVA 1TQJA 4NX0A 3S1VA 2NQZA 1NWTA 2CZVA 3PM6A 2H9AA 2GSJA 4L1GA 4Y8EA 3A4AA 4GHRA 3WSUA 1JZ8A 1J10A 4I7WA 3ZR6A 1J4EA 1W2PA 4L9XA 3CLMA 1REQB 4GCAA 1JYNA 1E1EA 1GVEA 1MEIA 1FWSA 4MB1A 3OZPA 1R9XA 2NUWA 3FXGA 4H8NA 4RE3A 3SW6A 3LM3A 4A8RA 3CWNA 4AG0A 1FUYA 1Y0EA 4PCTA 4MZYA 1ZU8A 3SSJA 2W91A 2FIQA 4UQDA 4IIHA 1S46A 1EIXA 4U31A 1PUDA 1OFPA 2Y5JA 3C6CA 4IMEA 4GZIA 3TC3A 5AVHA 3TVAA 1OX5A 3QVQA 4JQ3A 2FH8A 4RX0A 4PMJA 1J96A 3SCSA 2HK0A 1KV8A 2NSOA 2RGLA 4H41A 4XB3A 4CN1A 1D3HA 4UUIA 2BWGA 2ZKMX 4O8AA 4LCRA 5D02A 1J0KA 3SCNA 3R43A 4M19A 2ZXQA 3RLUA 3UWQA 4AIBA 4LUSA 3GB6A 3KW3A 5A2CA 2HXUA 2X0YA 1R2SA 3WQPA 3GR7A 4JQAA 1Q8AA 9XIMA 2ZUTA 1E51A 3PK7A 4ZQMA 5D4YA 3SN0A 1MW2A 3B4YA 1VIWA 3NSXA 3HJEA 1KFEA 3L68A 4GJ1A 3PFRA 3BV7A 4KWSA 4H7VA 2J62A 2OWCA 2R1MA 1DWFM 5BCAA 1RQBA 3APYA 5K2ZA 2GOUA 4KBXA 2P8CA 3TWBA 1DVJA 1N8WA 1E6QM 4QDWA 2VC6A 2PTDA 5BOFA 3S5YA 3LLDA 5REQA 4O11A 3LBCA 1UWTA 1J6PA 2AL2A 4LY8A 1X97A 1UYQA 4HZ7A 4AZBA 3SCVA 3RHGA 1XCFA 2G5WA 4N42A 2PGWA 2WVVA 4IQJA 3OJGA 4UTLA 4GIRA 4B16A 3ZMRA 5F4XA 4N4QA 1W1TA 4MLJA 4LUTB 4MWAB 1WYIA 3CHDA 4N6EA 3WEZA 1V6WA 4TXEA 3AUOA 4M29A 3ZT6A 2V9DA 2QNEA 3GKFA 3VNZA 1WDPA 3CIWA 4ZQCA 1H7WA 1OYCA 2ACSA 1ZUAX 3SGZA 4HNCA 2VVSA 3KOWA 4UOZA 3U0HA 3E12A 4O4VA 4MADA 4P7NA 3F2DA 3KAOA 3VTRA 4WSKA 3M41A 1FWJC 3MWAA 2JFEX 3AYTA 4NYYA 5EA9A 2VX6A 4EIVA 1TYGA 3LLFA 4FZIA 4CCCA 3R2GA 3LGGA 4QDMA 1P7TA 2ZTJA 1ZCOA 4LX4A 1SO5A 1T40A 1M3UA 1XCXA 1JCNA 3NOEA 5CG7A 2H90A 4Z2IA 4P7LA 1VPYA 4GQBA 3U8GA 1M1BA 2CWXA 1Z8AA 3MUXA 4KGLA 2C13A 1PKNA 1CPUA 4MHBA 4U5IA 2OR2A 4K7VA 1SZNA 2PDYA 2ZXAA 1HNYA 3NQ6A 4KEZA 4KMQA 1GJWA 4S39A 1M65A 4Z0SA 4GRSA 1ISVA 1HJQA 3CO4A 1G0CA 4DJEA 1J2BA 3DFPA 1E72M 1CI1A 3D46A 2Y24A 1YYAA 2CBIA 1N55A 3H4XA 3IUIA 3Q2DA 1E40A 4DNHA 1S2WA 3GH5A 1WZKA 3WBEA 3XIMA 2POZA 2C1IA 4LBSA 2QJNA 1OY0A 4GI6A 3CIVA 4TOQA 1YHTA 1XIHA 3CV1A 5D2YA 1LQ0A 1OFQA 2BXYA 3RMJA 4TTUA 4R7JA 2G50A 4JR5A 3IV3A 3HGJA 3TA9A 2OO0A 2WVTA 5LA1A 4JQ2A 3MYOA 4DBUA 3RUBL 3OG2A 2OT1A 1HL9A 3PC0A 1AL7A 3KLLA 1DKWA 4JQ4A 1UKOA 3CZ8A 1DYSA 3KWSA 2X42A 3B9NA 4O50A 3VGFA 1JPDX 2BDQA 3GVVA 3TONA 2DUZA 3P82A 4HNNA 4XAPA 2Z25A 3KS5A 5SWUA 3CJPA 2WANA 6ENLA 4UTMA 2C0HA 3R6IA 2GYIA 1MSSA 1K4HA 3BANA 1E1CA 4RKAA 1EKOA 4IFOA 3CS2A 3WH6A 3V5OA 4CQCA 1CXIA 1OF8A 2H3DA 2GDUA 2BASA 3HMJG 3N14A 3GU2A 2G4JA 2RUSA 4QITA 2XIJA 3TKFA 1LLWA 1JG9A 2HROA 2WBKA 3W1MA 3VIPA 3FN9A 4JYDA 3GG8A 1G7UA 3AZTA 4N4PA 1RA0A 4AD2A 3D6NA 4Y9MA 2G96A 4NZFA 3FJ6A 2PF0A 4NU7A 3SSZA 4DM1A 4G7FA 2IW0A 4NHVA 5DFAA 3P7YA 4PCPA 4FX8A 2A6LA 1WDRA 4NL1A 4I9TA 1EJSC 1OVDA 2EO7A 4NZ3A 4UTUA 4CU8A 2GJRA 1XLAA 1PS9A 2D0FA 3O06A 1AZ1A 3MUIA 4PMRA 3LXCA 4JICA 1V3IA 4NI3A 1H0GA 3V1HA 1QXLA 3UNTA 4JZ5A 4K8EA 2G97A 1LTDA 2B81A 1A5KC 3CUHA 4Z2KA 4CNOA 4W88A 2ESCA 2Y62A 3U7VA 4Q33A 1SJAA 3W7PA 4ZB2A 1Q85A 2AMXA 1SO6A 3PAJA 2YBVA 2W5FA 1JUBA 1E9LA 1EQPA 3NL5A 3EWZA 4Q8TA 4UFHA 2TYSA 1OC6A 4ROPA 1EJWC 3OBAA 3KOZA 2CZEA 2C71A 5LNWA 5I3HA 2DZBA 1PO9A 3NQ8A 1ONWA 1HUVA 1SZGA 3CHEA 3KP1A 4MB3A 2PBOA 4HB7A 5U4NA 3VC5A 4HOXA 1GVOA 1ZSXA 3VOIA 1W3LA 1XH2A 4NVTA 3MHUA 2E1WA 4WJEA 5HULA 3ES7A 1GVIA 4H83A 3TAOA 1QVBA 2NV1A 3LZ5A 3AXMA 3WK1A 3B9AA 3WDRA 3AXHA 4WUIA 1E71M 3CMFA 4GUHA 3CZJA 2VL4A 4D71A 3WLQA 3MVTA 5ABHA 4X9YA 1EX1A 4UQAA 1ZLPA 1GOXA 4WY0A 4AHOA 1KV5A 1E5JA 4WEVX 2NXIA 3KBJA 1AW2A 1L6WA 1Z3NA 3N1AA 4Q7NA 2WMJA 2VWTA 1I2PA 3AICA 5TF0A 5D37A 2Q09A 1EBHA 4CNTA 3OIXA 5M03A 4QJ4B 1NOUA 1B57A 1OGGA 1QMLA 4XVEA 3SRKA 3MMDA 3GX9A 4Z1BA 2PD9A 1U5HA 1XBVA 4BQ2A 4HKPA 3HPFA 1Q6GA 1I1WA 4LBUA 4W4QA 1HKMA 3L4YA 3UF9A 1L6GA 4GZEA 4OECA 4GC4A 1PHQA 2ZC8A 1IWPA 1A0CA 3MW7A 2VEPA 4C1NB 1VJSA 4H6QA 3R5EA 3VOHA 3P62A 5BXPA 4XIMA 3WD3A 4J2MA 8RUCA 4B4FA 5HQMA 1SMDA 3B97A 4DJFA 3F5JA 1KGXA 4DM2A 3N2BA 2FVKA 4BK9A 1F6KA 4B9YA 4QCFA 1MXSA 5EBAA 1OFDA 4ACZB 2XWDA 2DV0A 4AWUA 1QK2A 3NOYA 5JBEA 2HQAA 1UC5A 1OT1A 1M68A 4U4MA 1OZMA 1BXNA 1LOSA 3C56A 3FA3A 2CZDA 1H50A 2NQLA 4LAMA 4WQ6A 2OLSA 3NEVA 3ZJKA 4JDBA 2VC5A 1E0XA 1QRQA 3W22A 1WDWA 4GUFA 4EKJA 1SM9A 4Q8UA 5KZMA 1WBJA 2YDQA 5CJNA 1NWUA 2IQ0A 4JIHA 1ZY9A 2XGZA 3NZRA 3TROA 2C15A 1QO5A 1WXZA 1EP2A 3NWRA 2P5NA 4J5NA 3ITOA 3GW0A 4QEHA 3EB2A 3AIQA 2NWRA 3GR4A 1NQ6A 3B40A 4PMXA 2BVYA 4WLCA 2QIIA 3L9CA 1EP1A 2PGFA 2PLKA 2BY3A 3I10A 5EMYA 1BVNP 5HNUA 4YTTA 3EAUA 2E5DA 1YBQA 2IPJA 2Y85A 3V36A 3AZRA 1EB3A 1BAGA 3LV6A 3VKAA 1MXDA 4F0LA 4AH7A 4FHAA 3T8QA 2CZFA 2AL1A 1R9YA 4PUUA 3MMWA 4B5NA 5C55A 3OVPA 2OOFA 9RUBA 2IQDA 4JTAA 4GO8A 4IG2B 1LG2A 2AGKA 5DCDA 3E6EA 2QDEA 1KLYA 4GLEA 4H9VA 2FZDA 3W88A 1F3TA 3CWHA 4IFKB 3DC8A 4C60A 1JQXA 4A29A 3EB3A 1KD0A 2BOGX 1LWJA 3P84A 3EYPA 1J12A 3LU2A 5G4EA 1RUSA 3LCIA 3SUSA 5DX7A 3DYOA 1RJRA 5EMMA 3VOFA 4ATWA 1SFSA 4UTTC 2XWEA 5ABFA 2F2KA 4QR6A 3S9YA 4QBXA 4EACA 1V3LA 1UWUA 4H7CA 1JRCA 1AH3A 3CQJA 4BF9A 1FWNA 4LUYA 4LVDA 1EFZA 1F7BA 3WQCA 1Q7QA 2Y7GA 1O1ZA 2ZVIA 1XBYA 2V6AA 3OQ8A 1R3TA 2OZ8A 3T42A 1DQWA 3SR7A 1V6UA 4LVAA 3OLEA 1TVNA 4JN6A 2O9TA 1SVDA 4ZXLA 2XN1A 2PP1A 1BGAA 4WRHA 4C1KA 1J79A 1MXGA 2CLEA 1EJXC 1FOBA 4AC1X 3T0CA 4PODA 2GJPA 4JCMA 2E68A 4DI8A 4H00A 3W1RA 1UZHA 5F1UA 3WH9A 4UCFA 3HPAA 1WPCA 4GZJA 1Z32X 2F38A 3SUTA 5HMEA 5AB3A 1GVSA 3NPVA 2OU4A 4KWVA 1C8XA 1GHSA 1OD8A 3ZWTA 3NXFA 1IIGA 1FWHC 1JDDA 1DJNA 3N9SA 1LCOA 4JN8A 4IL0A 1E55A 4MZ1A 4NQ1A 3G1SA 2W67A 4PEEA 4DBEA 4WXYA 1AD1A 3P14A 4UBPC 1W3TA 4MKNA 1L6SA 5AECA 2ZUUA 1H7PA 1RXOB 3HQNA 1BWLA 1KFLA 3LGEA 3OLDA 3HBLA 4DB7A 4AWEA 2VTFA 1QPRA 4ZFCA 1VEPA 2ZUNA 3TU9A 2WW5A 3OBEA 1A5LC 1M7JA 1OC5A 3RAOA 2EPMX 3UY7A 2BV9A 3SN4A 1Q4WA 5XIMA 1C29A 1WE5A 3OB8A 2O9PA 3IS4A 1DL3A 4WX2A 5I6SA 5TNVA 3P0XA 3HG5A 2W6RA 2OX1A 3LPPA 3PZMA 2WBGA 1W1A1 2RFGA 3N6QA 3IRSA 5H91A 2R9RA 4B4HA 4ATLA 1X1ZA 3S1WA 3F4CA 4K37A 5E09A 4P8VA 4S1FA 3O8AA 3PHAA 4R7WA 4CD5A 4CNPA 1GTHA 1T5AA 3B8IA 3WBXA 3UXKA 4JEJA 1TMLA 4AISA 2NQ9A 5AHNA 2WC3A 1RLCL 5FJJA 4LV4A 3W7RA 4Y2WA 3AIEA 2PA6A 1RBOB 1S3TC 5BXSA 1CGTA 3ZXWA 4L5ZA 4PTVA 3IGUA 3DESA 1XL9A 4A05A 1PIFA 4K39A 4EE9A 2W63A 1E6ZA 3R0KA 2NX3A 2QCMA 1JZ4A 4ZBCA 3EWUA 1JNDA 1G4EA 5LA0A 2GGIA 4HSHA 3WUBA 5A6LA 4FLQA 3KEHA 4LCSA 5ABGA 5FL0A 2Z6JA 2ZDRA 2XH4A 4EOUA 3PY2A 4U10A 4J40A 2J7HA 3AYRA 3NDOA 4FIQA 1B5TA 4NZJA 5F4WA 3SB0A 2FZBA 4DLFA 3PBMA 1KM2A 3T2QA 2I16A 1AODA 1QHZA 4RE2A 4QS6A 2DT1A 2PDGA 2XDFA 3L7RA 5CC3A 2C7FA 1WUFA 4WSJA 1GG0A 1O66A 4HPGA 4M6VA 7TAAA 1HP5A 2Z4GA 1R2TA 3V5CA 1B9ZA 2DQXA 3GC5A 2PLMA 3RF9A 1B30A 4WSHA 1GYLA 5E0CA 2XISA 4DF2A 3B9DA 3RU6A 4HNTA 1ZBVA 3QV9A 4N9DA 3N4AA 3JZUA 3WH5A 1O5RA 1LBFA 3C2VA 3QYQA 2XVPA 1V03A 1MEWA 5D9MA 2CLFA 4NNBA 3UD6A 2V5DA 2QPUA 4OTKA 4Y9AA 1EGVA 3FYPA 4IGMA 4ZEPA 1KM5A 1A4MA 4YHGA 1AD4A 4UQEA 1E6XM 3THQA 1ZL1A 3QMTA 1CEOA 1K8XA 2QLYA 1ITUA 3DGRA 4QHRA 4PUJA 4F9DA 1F2JA 2GGHA 2J66A 3WLJA 1JYWA 2PURA 3KWXA 3OHIA 3BVJA 3T1GA 2ZZ7A 4PL1A 1ZJIA 4HYWA 2J77A 4PA8A 2PDQA 3TOPA 3REQA 4TX6A 4H2CA 2OQYA 3GYCA 2FGBA 3BOLA 4DXXA 1OCJA 2GVGA 3M64A 1OK6A 1KNWA 2W66A 2WSPA 3S42A 2FJKA 3UA3A 4L65A 1A5UA 4PTMA 1J9YA 1Z44A 3BCJA 4Q8QA 4AXKA 3ABZA 3F4NA 2ZOXA 1XIEA 2V67A 2BVDA 3R12A 4DX3A 3CAKA 1PZ3A 3N04A 2IKGA 1E1FA 4TV5A 1HJUA 1MZHA 1C9WA 3BJFA 4HPNA 2V5CA 3KM8A 4B5SA 2VD9A 3ERPA 2PDKA 5E6ZA 3V35A 1J0ZA 2YL6A 2CESA 4HBKA 3HO8A 3ZFHA 3AMLA 1BYAA 4IXXA 1FWCC 1ZJAA 4ACZA 2YA1A 3T07A 3LQLA 4MFDA 4L4OA 2VELA 2QVHA 2ATMA 1BXCA 1R7OA 4KWWA 2P3EA 4XO7A 3CZLA 1RY8A 1SZFA 4FF7A 1KRBC 4ZO6A 3BAIA 2OLAA 4DZIA 3W7CA 3UG4A 1EH9A 3BO9A 1GOIA 1QASA 4KRZA 4MGGA 1S2AA 4JY8A 3UJRA 5HWMA 1GYMA 2FZ9A 1R0MA 3SJNA 3FSUA 3QM3A 3M4HA 3WL0A 1FA2A 3EEGA 4INFA 3AI0A 5A6TC 4QIUA 3MA8A 3UG5A 2GWNA 4G9PA 7CGTA 7PTDA 4YWSA 8XIAA 4BFAA 1UBSA 4Q8WA 1H7RA 5FJIA 2JKEA 3SCOA 3R25A 1LLOA 3QY6A 3UJ2A 1VFTA 1C7TA 4H6KA 3D5HA 5T9CE 2G3NA 3BGAA 3H2AA 3WG6A 3CUZA 1WQ5A 2QCDB 3FJLA 4S2BA 1V0MA 3W29A 2ZRXA 3OODA 1VBGA 2CBJA 5HR7A 4CNUA 2VT0A 3BMXA 5IDZA 4H1ZA 1XLDA 3W7EA 4NZ5A 1K03A 3RCNA 3WUFA 3WFZA 3NYZA 3S1UA 3GNDA 2VM8A 1UR4A 3M0JA 3S3GA 3NAVA 5AHMA 4D6JA 3NYDA 4B5VA 3OVQA 5ENLA 3CAQA 3EOUA 4FLOA 4RE4A 4XSLA 2P53A 1YRRA 1W3NA 4R33A 4S23A 4AIEA 3DI1A 2RGMA 4X0NA 4LNCA 2X1SA 1XRFA 2VURA 2Z1WA 4XAZA 1TMQA 3DZ1A 3QLDA 3T55A 7TIMA 1E43A 4NNAA 1EQCA 2R1LA 1W1IE 2PWFA 4QISA 3KUMA 4ACYA 4TU1A 1TRDA 2DZSA 2B7QA 3PUOA 3VA8A 4LYKA 4JX5A 3DI0A 3M7WA 2ON3A 2DIJA 4EXQA 4CKQA 3VDCA 1JI1A 1G94A 3TTYA 4WK9A 3VD3A 4QCEA 1QI5A 2YA2A 4ADUA 4EWND 1UKPA 1VFMA 1JI2A 5AVNA 2GGGA 2F8QA 4D8ZA 1DWIM 3UJSA 1GT8A 2GVYA 4RZ5A 1DBTA 4FALA 1GEQA 2QCEA 3TSBA 2GLKA 4TUFA 4CU7A 1K70A 1E4MM 4O1AA 3W76A 3EWXA 4GJJA 3T09A 1VS1A 1B3WA 4PUEA 1XH0A 4IUOA 3H55A 2PC8A 2VGBA 4A2SA 1R6WA 3CPRA 2RKXA 1KFCA 3UGVA 5FF0A 2X7WA 1EYEA 4B9ZA 1O95A 1ZAJA 4NP7A 1HKKA 2C19A 4AZ5A 4YS1A 3ELFA 1KGWA 1GPFA 2BFGA 3ZIZA 4X63A 2PWDA 1A0EA 2JALA 5CZKA 2G3JA 4MAZA 1Q65A 2FQIA 1FDYA 1GKPA 4Y9OA 3VKKA 1HKJA 1BF6A 3W1PA 1F9CA 2XGIA 1BSIA 1P6CA 4NG3A 1SZEA 3E74A 4HSNA 4AZ6A 5A8OA 2Y2WA 2J78A 1S1PA 5AOUA 5BZAA 2EPHA 3VFLA 3QSRA 4ES4A 2Y7DA 1O94A 2D69A 2VD8A 5CSSA 2HNEA 1L8NA 4QFUA 4X2RA 3GWQA 4RZBA 5T8GA 3TQPA 2F6UA 4NNCA 3H2EA 1MDLA 3T6CA 3MHGA 2DORA 3UXDA 2XZ9A 2CCRA 3BDKA 4S3BA 3QV8A 1B54A 1ODUA 5F2MA 3SRHA 5JUVA 4DVOA 4ZQOA 1OF6A 1EJRC 3DFOA 1OC7A 3EOEA 4TIMA 3MV01 3WELA 3N12A 4B5TA 1OCNA 4O1CA 5G2WA 1LYXA 5CG0A 3NZQA 4K7YA 1CLVA 3L2MA 4AD1A 4TQTA 4WKFA 3OW1A 1Z6KA 3WLLA 4M7TA 4KS0A 2QCDA 2XM1A 3HMCA 3RIKA 1V79A 3SY5A 1X8CA 4DF1A 3G3MA 3LHWA 5CPMA 5I7GA 3O1NA 3AMCA 4O54A 3QOMA 5IDIA 3WJSA 3ARYA 3WK2A 3L4WA 4MJMA 2DZVA 4LS0A 5FI8A 4XTIA 4P5UA 4LB3A 4K1WA 3WN6A 3S2CA 4LAUA 3P3BA 4M6PA 3O6CA 2G3MA 4EF9A 2X16A 5M3WA 3V0SA 4UXDA 3VGBA 3DKJA 2R91A 2OSXA 2FPVA 3M1ZA 5A8PA 5K9CA 1PDZA 1XLIA 2GUYA 2BY2A 1TX0A 4Q4MA 3WQGA 3BLFA 1TPH1 1R3WA 4IWWA 5DF0A 3MCMA 1HF6A 1TRIA 2PDNA 4QTGA 4HA3A 1U5JA 1ZPTA 4H6EA 3LA4A 3H2OA 3FV9A 3T0AA 4UR7A 2VEKA 1EF3A 3WH8A 1FWAC 1W2VA 1AK5A 4DXKA 3AQUA 1R30A 3VKCA 2RHGA 3WMCA 2PRMA 2Y8VA 3MPGA 4LAOA 1TB3A 4NAFB 4I6KA 3LPGA 5FJTA 4LF2A 2GQ9A 4XD3A 4AU0A 1K6AA 1XUUA 1HJXA 5I00A 4WDUA 2PLJA 1WXYA 1EWDA 1GZ1A 3JR2A 3GHTA 2DU2A 4QAIA 4UB9A 2Y7FA 3ATYA 2ZZ6A 3BICA 1KBLA 1CXHA 3ABQA 4HHHA 1B2YA 2ANUA 3UZZA 4Y96A 3G2GA 1ESWA 1UWRA 1Y7VA 4N7QA 1L6YA 1H3GA 2XSAA 4I6VA 2PMQA 2XVLA 3DH7A 1UWQA 1X1NA 4QG8A 5AN7A 1KTBA 4FB7A 4Q8PA 2IXVA 1KRCC 1LJYA 2PPGA 3Q45A 1LQAA 3NURA 4G1KA 1EUAA 2VEGA 1PTAA 3W71A 2OGYA 3TA6A 4HZ6A 3VCNA 3K1GA 4GVFA 4OU1A 1JJKA 2GJXB 2FVLA 2WK2A 4DJFC 3R11A 4LW7A 2QCGA 2GOKA 4Q7BA 3W2LA 2BNJA 5CBJA 3RM8A 3TTSA 4H9ZA 4PB3A 4U3CA 4HCDA 3MTWA 4JYFA 5JQ9A 3WNOA 3LPOA 1K9EA 2QJIA 3N73A 1OCQA 1QNRA 4AZCB 3TYDA 2ZRVA 3G0SA 1ZJHA 2PFHA 2CIPA 1WCGA 3BURA 2YFOA 1EHAA 4QLLA 3WF3A 2FHCA 3WLPA 4LYPA 5A6MA 2QDGA 2GGJA 5E9AA 5C70A 3D3FA 1KWKA 2AAAA 1L0PA 3QN3A 4U3AA 3N2TA 4MKVA 4PE8A 1NELA 1V51A 4IGNA 3WFAA 1V3MA 3QC0A 3W2KA 4Z2LA 1DHPA 4HT3A 4FNTA 3W27A 3ZWSA 3VIOA 3ZJ6A 1ZNNA 3B9EA 1ZBKA 2A3BA 3WNMA 2ZE0A 4L1WA 2V3FA 1E0TA 3ARWA 2VC7A 2H8XA 3ONBA 1IR1A 3NQEA 2J6XA 4LUJA 5FESA 3VDGA 4YWIA 3THAA 2Z1VA 3B4UA 5C6MA 3V75A 1V0NA 4JTCA 1UOZA 4CQ8A 5J5RA 2W92A 4CQAA 4AZIA 1TE6A 1F05A 3E0LA 3LXBA 4PC8A 4O16A 3WD0A 2QV4A 3EOOA 5A8QA 3RG6A 1RLDA 4HCHA 2GVJA 4OFCA 4S3DA 4YYCA 4UOQA 1DIEA 1OQFA 2E3ZA 2PC4A 3TYEA 2E8ZA 1KKRA 3GS6A 3VGDA 2O0TA 1TUXA 2EF9A 1EPVA 1BYBA 2J7EA 3VYLA 4JTGA 3VKJA 1E4NA 4LF1A 2KZHA 2XSXA 1ZS2A 4JL1A 2FTWA 3R7MA 1LRQA 1CBGA 1K7EA 2XFFA 3QTPA 1KGUA 1Q63A 4PMZA 4BI7A 3TYAA 2UZ9A 4AF0B 4HU8A 2X09A 4PMYA 1UD4A 3O63A 3O0KA 1Q7ZA 2G41A 1H11A 3TW9A 4A21A 1KBIA 3FVDA 1TPB1 1UH2A 3FAWA 3RLVA 2HPIA 4DZHA 5CGTA 5A6SA 5B7YA 4IG2A 4JN7A 3P5YA 2BSLA 1GG1A 4P8XA 4V27A 3GXPA 4M81A 3ATZA 1WB0A 1GVRA 5HPCA 2REQB 3VNYA 3FSTA 1V0LA 4HOWA 2WZHA 3GIQA 1XLFA 2NQJA 1JDEA 3AALA 2XM2A 1I2OA 3ECQA 3R4IA 4ADTA 3P67A 1JF6A 4IUGA 2BVTA 2Z1BA 3ARXA 4DJDA 3TR2A 1KQZA 1W9UA 4V1YA 4Q4KA 5CLWA 3L0NA 4ZOCA 3BOFA 1XX1A 2VX4A 3EA2A 5CXPA 1UROA 1AJ2A 3QPZA 3TFXA 1GOWA 3MUZ1 3TSDA 3KRZA 3AZSA 3HFYA 1BD0A 3UFYA 4RPQA 4PUDA 3PZVA 2J9XA 2POTA 3VUSA 4DXVA 2WVVB 4OKDA 3LM7A 4ZO8A 1W9DM 4JNYA 3GXMA 2VRJA 3UW6A 1W1VA 2VQUA 2WC7A 4NAEA 1V08A 3URQA 4CCEA 5A1AA 2OPJA 2Y61A 5ABTA 3N3MA 3N9KA 3ZVHB 2ZVRA 1HT6A 1PB0A 5LIKX 3K8LA 2HVNA 3G0XA 4LBRA 2OYLA 2REQA 5CC5A 4X60A 1KTCA 2OQLA 1XYFA 3EA1A 4H9MA 1K9TA 2PBGA 3BSGA 2G3IA 4PH6A 5MKGA 1A5NC 4YU1A 2DUAA 1NDZA 2GJLA 3MMUA 2XPKA 3NQ7A 1UKQA 1US2A 3TN5A 1ECEA 3D0CA 3L0GA 5AZ1A 2R14A 3U7BA 1W31A 4Z0JA 5I23A 4GX8A 1UR0A 3OP2A 5C54A 2OODA 3W1TA 1GYNA 3FYOA 4KERA 1Y8BA 3H7VA 5FF2A 3C52A 3SI9A 3AHZA 2OT0A 3NVTA 2PAJA 3GVWA 4YYFA 3BG9A 1UMYA 5LNSA 1DORA 3DX5A 3N13A 2EPKX 2DW6A 1OJXA 2H9AB 2YA0A 1R2RA 4DUVA 1A47A 3A47A 5BROA 2ZIDA 1JD9A 2AQVA 4ZE4A 1NH6A 5L6UA 1EZ2A 1M53A 4S3CA 1IEVA 1H7OA 1JUKA 1JR1A 3GG1A 5KETA 1F3EA 3VDBA 3LY0A 1SJCA 3AHXA 4L64A 3DFNA 1JUEA 3EGJA 4KFPA 4XK2A 5IBXA 1IEQA 2J9ZA 2BHUA 4BQ3A 1OG0A 1RPXA 3GNRA 2CFFA 1LZOA 4IIFA 3STCA 3ZSSA 4IJBA 4EP8C 4PB4A 4F4RA 4MFEA 4M8UA 1B3XA 2X2YA 3KOYA 3LI1A 1TTIA 4PSPA 4EK7A 3OU8A 4F0SA 3GW3A 5LYRA 3L4UA 2EG7A 1WXJA 2XHYA 2OEKA 3TE9A 4GKTA 5FOOA 3E5BA 3GLCA 4LUSB 3UXIA 2EEXA 3TTQA 4I5UA 1S38A 3SQMA 4MNKA 2BLEA 1GOMA 1R85A 5D30A 5M17A 2BGQA 4RK8A 2F2HA 1AJZA 3A21A 4E38A 2HE8A 1GZGA 1TV4A 4YJ5A 1MYRA 3UBPC 3SEPA 3NM1A 4US5A 4PTNA 1J0IA 1JYVA 3CYVA 4DELA 4MPKA 2F9RA 5FACA 2PWGA 2B0MA 4GNVA 2NUXA 2ALRA 1GPWA 2IPGA 1GGOA 3OZMA 4M0XA 4K2SA 2DH2A 4BQ5A 2ADAA 4XKMA 3EX1A 2Z1XA 4V1XA 2UY5A 5G4HC 3COTA 3G1DA 3PZQA 3IJIA 3E2RA 5REQB 2PU1A 3T7VA 2BP1A 3M0VA 1EF2A 4OGZA 5CGMA 1R3RA 1UPPA 4R3UA 1Q4NX 3CO8A 1PZ1A 1CTNA 5M2FX 2YW4A 3QRHA 1MW0A 4IP7A 3GO2A 3RO6A 1D7FA 2XUCA 1WP6A 3ZO9A 3N2CA 1G4SA 2W79A 4GQ0A 1E3XA 2VDIA 1P0EA 1CLKA 3LHTA 3BSHA 5LIYX 3CTLA 9XIAA 1YEYA 2PEVA 3NL2A 1WDQA 3UESA 5K4XA 1VEOA 4W8BA 5TBOA 4KWUA 4E2VA 3W1AA 4FNUA 3EWBX 3OTRA 4K38A 3F4DA 1XPYA 3UWYA 5C5YA 1VFLA 3CZKA 3AMDA 4EAYA 1H49A 2WJFA 4C6LA 3TJIA 4X3ZA 2VX7A 3UCDA 2GDQA 2PU0A 1ZENA 1Q6RA 2NVCA 2NVDA 2AQOA 2PF8A 2W27A 2Z2AA 3CNYA 3R8RA 1C8YA 1WKEA 1NFPA 3S83A 3CAVA 3O2LA 3QKZA 1A3XA 1FWDC 4ZQNA 3QXBA 6XIAA 3GG7A 1K8CA 1BEUA 2E6DA 3AJ7A 4CN6A 2FB2A 4IGHA 3A12A 3M6DA 5C2CA 4PRWA 3VIKA 3GVQA 4F2TA 2E0PA 1EUNA 3AIRA 2ZBTA 5HQLA 3HF3A 5CZSA 5KMYA 4EXAA 2QJGA 2YX0A 2C14A 1N82A 1HXJA 4JX4A 5CGQA 4CD7A 5E70A 3QFEA 3NQDA 4HJFA 3DXIA 1AMKA 4ORMA 3NQFA 1JGMA 3RMEA 4BHYA 4FI4A 3FAXA 1Q6EA 3KHDA 3R0DA 4KT2A 4AW7A 1CXKA 3H2MA 1E1CB 2E7FA 1IXQA 5JVLA 5FJPA 2WNQA 4S3FA 2YDAA 3HGSA 1KM4A 3VE9A 2R1KA 3BTNA 2WJZA 1CB2A 4HU4A 2OYKA 2FHBA 3NGJA 1EX5A 5LIXX 2IKHA 5A6BD 3DDMA 1ELSA 2ZZ4A 1LM1A 3IJDA 4E2BA 4Q3MA 4KCTA 3NQ2A 5HUPA 4GE8A 1ECQA 3MKCA 1S5VA 1E70M 3OVGA 4JDYA 2BOEX 1IV8A 1W91A 1K8ZA 4YTRA 4F2UA 3U9IA 5H8UA 3SUUA 3GUGA 3SCQA 1W1YA 2ZADA 3A3XA 5CH9A 1IZJA 3CQKA 1K6WA 1KBJA 2F84A 4F0HA 3NA8A 1GEHA 5D9PA 1VPXA 3EZ4A 3T0DA 3II1A 4GI8A 4YVVA 4GFIA 3MI2A 1YNYA 5I0DA 1MMFA 1TZ9A 1TIMA 3W9ZA 1UZ1A 5BWAA 4R9XA 4O14A 3CBWA 3JU2A 3VAVA 2VGGA 2DSKA 3GTNA 1OABA 2PWVA 1GKRA 1LLZA 2VR4A 4RXGA 1NDWA 3V18A 5EY5A 5IHSA 2PWEA 1OB0A 2P50A 1EDTA 3ITYA 4J3VA 2NVAA 1S2VA 4NJJA 3T9PA 3DGBA 2FDMA 3C2FA 3ABXA 5CPSA 3GFXA 2PSNA 3UVIA 2RDTA 1XHGA 1MQPA 1NARA 1JNEA