2EJAA

Crystal structure of uroporphyrinogen decarboxylase from aquifex aeolicus
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
337
structure length
337
Chain Sequence
PKNDLLLRSLRGEPIGRFPVWLMRQAGRYMPEYRKIRNRVKNFLELCKNVDLATEISLLPLKILGVDAIIIFSDILVPLEPLGVKVEFVEGEGPKLSWSGKVSDLKKYDPSQNAYVYEIIKRVKEAQDEVPVIGFAGAPFTLLSYLIEGGASKDFKSTKLFMWENPKEYKRLMDILTETVLAYLKEQIKAGADVVQIFDSWVNNLSLEDYGEYVYPYVNYLISELKDFSDTPVIYFFRGSSSFIDLAVDYRADALSVDWSVDIPELFKIYDKGFQGNLEPAVLYASEEVIEEKTLGLLRRIPVKTRYVFNLGHGLAPDMELEKVKYLVDLVKSFPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uroporphyrinogen decarboxylase
publication title Crystal Structure Of Uroporphyrinogen Decarboxylase From Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
total genus 128
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2ejaA00
1R3VA 3PPFA 4ZR8A 3L7RA 1R3WA 1YPXA 3GVQA 1R3SA 1R3QA 3GVVA 3RPDA 4WSHA 4EXQA 3PPCA 2NQ5A 1UROA 4ZTXA 1J93A 1JPHA 2INFA 1XR2A 1XDJA 2Q71A 4ZTYA 2EJAA 4L65A 3CYVA 2Q6ZA 3PPHA 4AY8A 1R3RA 3GW3A 4L6HA 4QQUA 1U22A 1R3YA 4AY7A 1U1UA 3GVRA 4L64A 3GW0A 1U1JA 4L6OA 1T7LA 4L5ZA 3BQ6A 3GVWA 1JPIA 1JPKA 1XPGA 3BQ5A 4L61A 1R3TA 1U1HA 3PPGA 3T0CA
chains in the Genus database with same CATH superfamily
4IM4A 3CT2A 3DFHA 3HOJA 1MYRA 1ISWA 4XD5A 3BCDA 3HFTA 3W53A 2ZC8A 1OFOA 4HZ8A 2G96A 3NOEA 5A8PA 1TWIA 1DJNA 3AIVA 1F6KA 1UMYA 4IUGA 2D22A 2Y7DA 1UWSA 3GDTA 1O5KA 3SURA 1HNYA 4KFPA 4Q33A 3WQOA 1XH2A 3AICA 1W17A 3MI3A 1ZL1A 1F7BA 3QRHA 3DHFA 2FMOA 2QCDB 3VD5A 2Q8ZA 2PDXA 3K4WA 1K9DA 1VPYA 1SR9A 3VIHA 4V28A 1F9CA 4D6JA 4U33A 3NL2A 2NLIA 3CH0A 1C7SA 3CV6A 3W7PA 5C6MA 3G1FA 2EJAA 2Z1WA 3M5ZA 4HU0A 3NUKA 3U5YA 4MZYA 4H2HA 1TPDA 1FH9A 1T0OA 3WDQA 3RPTA 4Z0JA 2VX5A 1TA3A 4ZVJA 3NYDA 1EPVA 1A5AA 2J8FA 5JBFA 4LTSA 2XISA 1JZ4A 2I5GA 3A6OA 3KBNA 2E3ZA 4UTTA 3CV1A 5U7SA 4OHQA 4FLSA 5DY2A 4C91A 5LNSA 2PWHA 3IIZA 2BY3A 1YDNA 3O7UA 3L7RA 5D02A 2YBVA 5GJMA 3AUJA 1H1NA 1UBSA 3R94A 1N2VA 4UBPC 3GDLA 3SR7A 1VRXA 3BAXA 2HEJA 3UCCA 3H26A 1JZ2A 2PP0A 3COTA 4AX7A 1UJPA 3PWAA 1TPB1 1KNWA 1KLZA 4AAJA 1YW1A 2PTXA 3OHIA 5PTDA 4RV8A 1W9VA 4JTRA 5LIXX 4F79A 3RO6A 3CMFA 1TV2A 1O95A 1HT6A 3PBYA 1I1WA 2NQ9A 3DKJA 4H1ZA 1OQFA 4XBSA 3WQFA 1G1YA 3ARRA 4AZCB 2AMGA 4AW7A 1XYAA 3SCVA 3MV11 3LHZA 3QHOA 1CGXA 1XLAA 2J9ZA 1HJQA 4XD3A 3KVMA 3IJ7A 2HWGA 3R43A 1TR1A 1OT1A 1YDOA 1UKSA 2GOUA 1JXKA 1KA9F 2CLPA 1UZ1A 1ZJHA 1J5TA 3ZIZA 1K7XA 1ZENA 4GKLA 1W1ZA 3K2GA 3G77A 1LBMA 3WLTA 3R25A 3TK7A 1X7IA 2X0SA 1JAKA 5M1TA 4PL2A 1OWQA 2FGLA 3M07A 3RO8A 4H00A 3VOJA 4B4FA 3AXHA 3TW9A 2C71A 2C7FA 2R6OA 1XD0A 4A6GA 5M5DA 3TA9A 3MU7A 3RXZA 1VC4A 2ZRZA 2RFGA 5J04A 1ZPTA 1VS1A 1JVNA 3T9PA 1ME8A 1OT2A 4BQ5A 3FX4A 4MKVA 3PUDA 2QJMA 1DEDA 1IZCA 1POJA 4TVCA 3TNBA 3V5FA 1KM0A 1Q6OA 2ZICA 4QE4A 1W9UA 3GB6A 1IWAA 1J18A 5A94A 1XH1A 4GNKB 3POCA 1UR9A 5EMJA 2WHJA 5DEZA 1VBUA 3KCOA 3PY2A 2FVKA 4O8AA 3WJSA 1TA3B 3IUDA 3G0UA 1O68A 2UV8G 2J27A 2ZRWA 3SADA 4RNHA 2FMNA 4PMXA 2BMBA 2O9PA 1KBJA 3UBPC 3KX6A 1WDPA 1OFBA 1US0A 5JIPA 1EL3A 1CPUA 1H7XA 3EOUA 3QV6A 5HINA 1C3FA 4KESA 2FJKA 4DELA 4R7JA 1J0KA 4KGLA 1TKKA 3GVWA 5KMYA 1E6XM 4BJHA 5CLWA 2Z24A 5JMUA 4AZ5A 3MUCA 3IGXA 4CN6A 3P60A 2JF7A 4MJ2A 7CGTA 2PI6A 3FN9A 2Z1XA 1HF6A 3O6DA 1DWJM 2Z2UA 4XAYA 1GYNA 5DRIA 2HBVA 2Q3OA 4O50A 1JCMP 3MZNA 1V7YA 1YIXA 1E73M 4ZSUA 4AUBA 1X8FA 3PZUA 5ABTA 2Y0FA 4UUIA 2DUAA 4J3VA 4PUJA 5E70A 2B7QA 1TE1A 3PB2A 3TZNA 4FLRA 4J3SA 2C1GA 4LAOA 3U8GA 3NQ2A 3W7OA 3V7PA 1U1HA 4PB4A 1QUMA 3G1HA 3W1MA 1SZFA 4ROQA 3M4HA 3QBUA 1HGWA 1UR1A 1UZHA 1WDSA 3D6NA 3LEPA 3WO8A 4KEVA 3WUEA 2ZXAA 1U1UA 4KW2A 5DT5A 4UQ9A 4QP0A 1E3ZA 4QSFA 3ONBA 2RDXA 4TTGA 3P61A 3BCJA 3CNYA 4Y8FA 4GH1A 3W1NA 5C9RA 1AH3A 1IEWA 3GXPA 2BODX 1SZNA 1YMYA 4N4PA 3VCRA 4EXBA 5K9DA 4AWTA 3CLMA 2EGZA 3FAXA 5I6SA 1JQVA 3HFYA 1ZAHA 3AU6A 1MDRA 1EJTC 5A3HA 2ZRVA 5HQLA 4ZA0A 1PDYA 1UR2A 4IQDA 4O1EA 2UY5A 4WX2A 3TROA 3EXRA 1ICPA 2WBKA 2BV9A 3OOQA 4F2UA 1CXEA 4MIMA 1ODZA 3UZ5A 2J7FA 4D6IA 3CIVA 4K8GA 3VOCA 3HTWA 4JXCA 1KCLA 3LHTA 3KWXA 3L0NA 3W81A 2YA0A 2OT1A 3R8GA 2V82A 4EACA 3MBFA 2V5BA 3B0UX 4RW3A 1DIKA 4A3YA 3C2YA 4XBJA 1V6YA 2ZOXA 3WNPA 4JCLA 3WLHA 3ITOA 1WXZA 1TTQA 3EWUA 3CO4A 2XIQA 4RV3A 3Q2DA 4GI4A 5FOOA 4UOZA 2IW0A 3REQA 3N25A 3N14A 4WLCA 4I8DA 2DZVA 2BXVA 1CXFA 3UG4A 2NV2A 1FXQA 3HZ3A 3U4AA 4JTTA 3PZTA 2UY3A 4P8UA 1RH9A 2VC9A 1A5KC 3F4VA 1O1HA 3BAIA 4H9TA 3M0VA 2EO7A 3RX3A 3W83A 3GHSA 1E4IA 1DE6A 2PD5A 2HNEA 5H8UA 3KP1A 3BGAA 4LVAA 3KTXA 4UB9A 1OEPA 2BFGA 1PAMA 4PMZA 1PKNA 3BL3A 5FIPA 1NWRA 2PTDA 1E6ZA 3MJMA 2YXGA 3BC9A 4HPNA 3DI1A 3KBMA 2QPSA 5CJNA 2UBPC 2ISWA 1FWHC 2QCFA 2D23A 3BK0A 2V5CA 1EJXC 3RN6A 4WGXA 4UFJA 4JIQA 3P67A 4FNUA 1TJ1A 4YIWA 2VCAA 4B5UA 4EF8A 3ARXA 3PNZA 4YXGA 3I7RA 1XFCA 1XKJA 2QUMA 1T96A 3HQNA 3STGA 2J7DA 1W1A1 1B1YA 1JF6A 1JGIA 3GTNA 3AROA 1OF8A 2PRMA 3QH2A 3L4TA 6CGTA 4H7CA 1DJIA 2E5BA 3R2GA 5HMDA 3MDUA 2PP1A 2CWNA 3WQ4A 1OM0A 4XAZA 3HV8A 5TQLA 1W9DM 3QMTA 5CH9A 2YB1A 2WSQA 3ONCA 4LC8A 4LV4A 1XUZA 1V0KA 2OQYA 3OZOA 4NYYA 4KCUA 4M24A 2QJHA 3AXXA 3NQMA 1NQ6A 3FJ4A 4F0LA 3UR8A 5EGRA 3TTSA 1RD5A 3MB9A 4DJEC 3AS1A 5I7GA 3T4WA 3AWOA 3LD5A 4IFKA 2DZSA 1SZEA 3URNA 2ADAA 3OIHA 3ZYZA 1A49A 1TRIA 1MEWA 3HF3A 3GR7A 4CN4A 1UKPA 1XIIA 1W3TA 2PDWA 3GNOA 1MW0A 4A05A 3BURA 3MJYA 2VCCA 1E70M 4M3PA 5AC8A 5E9XA 2A5HA 4C5YA 2HE5A 3BE7A 4JTEA 4DI8A 4Y9NA 4DJDD 4D6DA 3GS6A 1XCFA 2F61A 1GKPA 3F5KA 3KRBA 3C52A 2ZVRA 3W7JA 2CLLA 5J8LA 7PTDA 3H22A 2ZVIA 5H8PA 4RE3A 7ENLA 4UQAA 3KTSA 5K2ZA 4LVGA 3EWXA 5CC6A 3FEQA 4JZ5A 3UY7A 3LHYA 1I6NA 4NRRA 2E6DA 1QTWA 4MM1A 4QS6A 5CGQA 3W1TA 4ZMGA 1RBLA 1KCXA 3P8JA 2J6XA 3N18A 2HSAA 4JTLA 1J0HA 3T55A 3NJ3A 1QPNA 3WLOA 2E67A 4L7ZA 4S3DA 4CQ8A 4B9ZA 3MO7A 3QC3A 5DMNA 1UKOA 4QDWA 2CLOA 3PZQA 4HCDA 2F2HA 2BZNA 4Q3MA 2PP3A 1Q6EA 3WFAA 4POCA 2BDQA 1QNQA 4GA8A 4AEEA 4ZO7A 4AEOA 2DIEA 3CB8A 1J6OA 1V0MA 3OA3A 1TTPA 2VENA 4Q8QA 2R1KA 5C9UA 3CPGA 4WJ8A 3TN4A 4UQBA 4ZB0A 3L0GA 4S2BA 3FV9A 1XYLA 4ZSTA 4L65A 1QPQA 4OVXA 1B3VA 2QDHA 5CPOA 5FL0A 1D3HA 4F0KA 1I60A 4IISA 5CZKA 4JEQA 4GZJA 3RIKA 4AYGA 3STEA 1BKHA 1B54A 2X1IA 3L2MA 2JF6A 5D9OA 4D9PA 1JJKA 3CUGA 5TBOA 5I77A 4LVBA 1UWIA 2WHLA 3SW6A 1ZAJA 1A0CA 5E5CA 5ABHA 3RCMA 5FSDC 1K8CA 3B8IA 4HNTA 3N3TA 3BJFA 1SZRA 3E0VA 1NDWA 1V6UA 3W26A 2F8QA 2QJNA 1A3WA 2ZBTA 3A4WA 5CZ0A 3W22A 5D09A 1P1XA 3VKJA 4GYJA 2QKFA 3ZVHB 1FWDC 3SB0A 2VCBA 5JVLA 2DUXA 1TQJA 5HBFA 3VDBA 3ITTA 2MUCA 1ISZA 2BVWA 4A29A 2NV9A 3TE9A 2I14A 1E6NA 4IFKB 4IMAA 3MI6A 3W00A 4NT0A 3NSNA 4S3GA 2FIQA 2Z2BA 3WKZA 2DZTA 1CBGA 5A95A 1HXJA 5B7YA 4G56A 5FESA 3W88A 4Q32A 3V0UA 5I3GA 3H2AA 2A7RA 5A8NA 1XPYA 4HA0A 5AKQA 1O5QA 1DXIA 5T26A 4EP8C 3NM3A 1VFUA 4DF1A 1L6FA 4KWVA 3E2VA 4PCTA 3TWAA 5FEPA 3WLLA 4C6OA 4LAMA 1MUCA 3ES7A 5D4YA 1R9YA 2ZX8A 2ZRXA 1HVXA 3QVQA 2IPWA 1QVBA 2P8BA 3RM8A 2GJNA 2FHCA 1DWIM 1O5RA 3BSGA 2X30A 3T09A 3NZQA 4FXSA 1TWWA 3VE7A 4KH2A 3FY1A 1B5TA 3MMUA 1UKTA 4PTWA 3GTIA 4W88A 1AG1O 2ALRA 3BDKA 5DT7A 1R7OA 2ASHA 4O17A 3N04A 3DFSA 4C65A 9RUBA 5JU6A 2A7NA 4WOQA 1GVQA 1XS2A 2DV0A 4IP5A 1U22A 3VD4A 3L66A 3GTXA 2NVCA 2BTMA 2WM1A 4J9JA 3NR0A 2IS7A 3S1VA 1N82A 4REQA 2GVYA 1XSJA 1SU5A 4JTAA 3WY1A 2VQTA 4FIRA 4CQ9A 2JIWA 3OODA 2Q71A 4WD0A 1R87A 1VBHA 2WPBA 1LTDA 1H7WA 3GBEA 2GQ3A 3I4EA 4S23A 3NQEA 2PDQA 5I79A 1GKRA 2YDRA 2ZUTA 4HBKA 4R3UA 4GY0A 3G0XA 4KCVA 4LUTA 4I9JA 3H24A 4WJEA 2X41A 5D04C 4S3EA 4DBEA 4RDWA 5FF0A 3AYTA 3VZYA 4UQCA 4AB4A 1TE6A 3BO9A 2B7OA 4U28A 5AYZA 4LH8A 1XINA 3VGGA 3EX3A 4HPGA 1QOPA 1Y65A 2XN0A 1KO0A 3HGOA 1BG9A 2C0AA 3M0IA 4X9YA 5T9BG 1XIEA 2PDFA 4ROPA 3ZR4A 4B91A 4ZXOA 2OVLA 3VOGA 1VPXA 2CKRA 2ZC1A 3N15A 2YFNA 5FAJA 4HHPA 1DQUA 1E56A 5A2BA 1HJUA 1O12A 4OZOA 4A22A 4C6JA 3KRSA 1XLBA 5I09A 4QR6A 1IEVA 2ZUMA 2WNZA 3ARQA 3VGFA 1AW1A 4Q4SA 3WQWA 4JYDA 4YYFA 3UT0A 1MFUA 2CESA 3BOXA 5DELA 1W1TA 2OLSA 4G1KA 4O4WA 4XD4A 1WZKA 3NQCA 4ES4A 3ZZ1A 4ZOAA 4K36A 4QJ1A 3QC0A 1XRVA 2W5FA 4W5UA 4Z2IA 2X42A 3C2EA 4AXKA 4UFMA 2E4TA 2RH9A 3W3OA 4A3RA 1NEYA 3VILA 3FYPA 3RJXA 2ZWZA 3GY1A 1VJSA 2GGIA 5EFFA 3WLRA 1VB9A 2DQWA 3VM5A 2G3JA 1W5QA 1LLZA 4DJEA 1EJRC 4WF7A 5FJOA 3TQPA 4JIHA 2ZUWA 1NDZA 1CB7B 3O16A 4ZFCA 3GH7A 5EMYA 1KFWA 2WAGA 1PKYA 4MDOA 4RKAA 1IV8A 2EAWA 1XIBA 4HT3A 4FA3A 2P1FA 1JYXA 2Y4SA 2OGYA 3GIPA 4YVPA 2P0IA 2X7VA 4DNHA 1XD1A 3M0HA 2D0GA 2HK0A 4XKMA 1QI0A 5BU9A 3KOFA 3RM9A 4H8VA 4C90A 2ZZ3A 4REQB 3TYZA 2A85A 2OSWA 2PGFA 3EWWA 4O8RA 4Z1BA 3CZ8A 1YHTA 3UJ2A 2V2DA 3ITYA 1EUAA 1F3WA 3OG2A 1KBIA 3SRHA 3SCTA 3WDIA 3DERA 4OUIA 1BXNA 2CLEA 4LUTB 2FPYA 4L6HA 1ZAIA 1WOBA 3QF0A 1CDGA 3NGJA 2WZHA 3A9BA 4UNIA 1SFTA 5FACA 2WPGA 3L2IA 4JIEA 4O16A 2VYOA 2PDKA 3M7WA 3BXWA 2OWXA 5JQ9A 1XKYA 2JGYA 1R6WA 2P3ZA 4GFIA 3TUUA 1VFFA 1TB3A 3LTSA 4LEFA 1X98A 1YTKA 4GIAA 4L5ZA 3M44A 4UTWA 3CZJA 4KGJA 2EPNA 4JNMA 1WKYA 5HUPA 3GDMA 4N4QA 1H7RA 4UR9A 4MWAB 3W25A 4NRSA 2XIOA 1W2PA 5DF0A 1F3TA 1E6QM 1IQ8A 3NXFA 1G4EA 5BROA 1LT8A 3MQTA 2R1LA 3CJPA 4WY0A 4TTUA 2BGNE 3ISIX 1G6CA 3NWRA 1SQ7A 3M6DA 1VLIA 1JAEA 2WMJA 1X8CA 2I9UA 3E0WA 3VX0A 2W92A 2AMXA 3VVGA 2EPHA 3HG4A 2A1YA 4UR7A 4QBXA 4IMCA 1FWBC 2OKOA 5FJIA 1FCQA 3BLOA 1VBJA 5D38A 5EMLA 3ALFA 1KB3A 1HVQA 1GHSA 5HWNA 1W1B1 4BA0A 1UC4A 1TJRA 2DEPA 1EYWA 2G41A 3FHQA 4U2YA 1Y0EA 3VOFA 2VEPA 2ABBA 3I3DA 2AGTA 1MW1A 5GJPA 3C61A 1R3VA 3EX1A 3G1VA 5LGZA 3CAVA 2AAAA 2E1WA 3EWZA 3WJWA 1XJBA 3AXKA 1W91A 3QR0A 3H53A 1X1ZA 7TIMA 3RLGA 1UH3A 4TX9A 4BCEA 5BMWA 4C1KA 4CNNA 4NJGA 2QF7A 3IGSA 5HJYA 4EXQA 3LBMA 4HMEA 1MSSA 1WDWA 2AL2A 4C1NA 2F7FA 2AAMA 3WH8A 3R8RA 2QAPA 4GIYA 2DVTA 1OD8A 4K8EA 1K9EA 1FQ0A 3CZGA 3UR2A 1PIIA 3BLPX 1KFKA 3GX9A 2INEA 4GVFA 5KZMA 2ACUA 3WH7A 1XLLA 2G0WA 3GUWA 3EMQA 4ENLA 4E38A 2BY2A 3GXIA 4XV0A 3GDBA 2V3EA 3P81A 4Y8EA 3UA3A 2PLKA 5D30A 1UD3A 1EA9C 3KXQA 4JOMA 4ZOBA 1O94A 1QAPA 3VMPA 1WKEA 2ZRUA 1TVPA 3WJYA 1V6VA 2Z2AA 2FZ8A 4R88A 3FVMA 1UH2A 4O1DA 5EY5A 3RUBL 4AY1A 4Q7BA 5EMKA 1NU5A 3KVJA 5CJ5A 1BQCA 4UNLA 1S38A 4IPPA 4YPJA 5C7HA 1I0BA 1UW9A 2WZMA 4L9ZA 3WH5A 1IWPA 1YNPA 1OF6A 3HPSA 4GJIA 3DCPA 3RAOA 1YRRA 3DENA 5G5IA 3U7BA 1HKVA 4M6VA 2WMGA 4YTQA 3H21A 3UEQA 4O0KA 1VEMA 1NFBA 4MB5A 3T81A 5G2WA 3W02A 1KTCA 1W31A 3E12A 4FS9A 2GQAA 3CK5A 5IRPA 2WZIA 1JRBA 1JDAA 4B5SA 5FJTA 4OIFA 4XAGA 4D72A 3LHWA 1LUCA 3HV9A 1LM1A 4HGXA 3TMQA 1AW5A 4XB3A 4C6LA 1UP0A 1KRAC 1NSJA 1LRTA 3WK2A 1YPIA 3GC5A 3ARYA 2WVSA 4ZE5A 3VKAA 4FI4A 4B15A 1TPVA 3PG9A 3MUXA 4NZ4A 3RHGA 2QS8A 1NAL1 2QCNA 1ICSA 8TIMA 4LC6A 3BAKA 1KQZA 2XSXA 1G7VA 9CGTA 3WX7A 4BF9A 2O9RA 3PZIA 3I7QA 2ZZ1A 3UWQA 2NSXA 4KRUA 3C3NA 3H2OA 2DDXA 3SIZA 3K5XA 3GU1A 4FX7A 3NDYA 1D3GA 2E0PA 1XP3A 3BSMA 3EDKA 3MMWA 1R7AA 2WW5A 2YL8A 1TPUA 3I6TA 4F9JA 5A5WA 1W3HA 3A5FA 4UFLA 1SO4A 1EXBA 5IDIA 4LUIA 4NZ5A 4P61A 5E9AA 3VZZA 1EJUC 4C1NB 2HJPA 8A3HA 3R10A 2PEVA 2ZXDA 1H49A 1NWSA 1P48A 4W8AA 4W7UA 4E6MA 3TU9A 3S0CA 1MWOA 3JW7A 3VD7A 2H8ZA 5C55A 2DU2A 3CAWA 1ZU8A 4DI9A 2CEQA 3CM4A 1OYCA 2NQJA 5HQEA 2OTDA 4K3ZA 2DIKA 1TV4A 1Q6RA 3G2GA 3SIMA 2FZMA 1AQFA 3W9ZA 3VDHA 2EJ1A 2PS2A 2YZRA 1VJZA 2CYGA 1DOSA 3S46A 3GYEA 2EPLX 3E96A 4MF4A 3DBPA 1WV2A 2PSNA 1TPEA 1OGGA 3AS2A 3U6WA 4MB4A 2QCGA 2YX0A 3HA1A 4AD0A 3ALGA 4MB3A 1H60A 5LGXA 4HMNA 2PPGA 3A9IA 1ZCOA 2G37A 3LSBA 2NX9A 1E9YB 3WDRA 5HPOA 4MNKA 4AF0B 1Y7VA 2ZZ7A 3CUHA 1V02E 2X8RA 1RUSA 5HPCA 4MFEA 4KWWA 3SN1A 5I3IA 5F1UA 4ACZA 1E6RA 5DANA 5C71A 3GAYA 5D2YA 1S5WA 8CGTA 4RLIA 4I9TA 4Q8PA 1EUNA 2CLMA 1VEOA 4PUMA 5KZEA 3IAQA 3WBYA 3A24A 4EIVA 3F5JA 1Z32X 2P8CA 3E5BA 1PEZA 3DFYA 3AUOA 2O9TA 2A0NA 3GNDA 1QWGA 4QEEA 4C6EA 3DN5A 2X1SA 3G5EA 4LAKA 4DAIA 2O4QA 5F4WA 3ORWA 2YL5A 2Q09A 3W71A 4H3DA 4K68A 1CGUA 2J7HA 2I9EA 4C7GA 4MMWA 3LV5A 4XZIA 1GGOA 3OGVA 2ZX7A 4O28A 2J66A 1F3EA 3WZ0E 5IHSA 4DUWA 4E3VA 4C7FA 3CHDA 5K7JA 2P0OA 3W85A 5CPSA 1MXGA 2WM0A 1TVLA 2GZXA 2XH7A 4LJ3A 2GUYA 1W6TA 3RR4A 4UTIA 1V4YA 1HN1A 3FJNA 3HJZA 3VOHA 3KVLA 1UWQA 5LNUA 2DJLA 3PJUA 3CUXA 3UERA 1ITQA 3CUJA 2A3BA 1SYTA 2PTWA 1WUFA 3THQA 4NNCA 3NPUA 2HQAA 3DYMA 3SCQA 3PG8A 4HA1A 1FWNA 4Z2HA 1WP6A 1ZQ5A 2Q3RA 1VFLA 3UWZA 4QCFA 3PTQA 4CCEA 2QUNA 3FGCB 1D7KA 3UP8A 1IIGA 1RHCA 4QE1A 2GQ9A 3CHEA 1H7PA 4NJKA 1PSCA 3VC6A 1X97A 5DMMA 1C91A 2CERA 1AVAA 4QDMA 3QSTA 3JVAA 5SWUA 2WMFA 3UCQA 2W91A 4LNCA 2TODA 1F05A 4N7QA 2C14A 3IUHA 3SCUA 5CCZA 1HKMA 2R94A 2ZDRA 3QN3A 1HP4A 1NY1A 3TC3A 1MQRA 5AFDA 2FQIA 3UZZA 4GINA 1U2YA 4PE8A 2P5NA 1LRQA 5DBTA 2EKGA 3AIRA 4JQ1A 2WSRA 1TIWA 3KOXA 1AQ0A 1JR1A 5CAKA 3MHGA 4RNFA 1PTAA 4GY7A 4MJMA 3NIYA 1EJWC 4BI5A 3S9ZA 2ONEA 4HK7A 1UASA 4ZOEA 3QEZA 3THAA 1GWJA 1DJGA 2PLCA 3BMWA 4O13A 4MKNA 4FEZA 4J2PA 4X2PA 3BMXA 1E1CA 2ISVA 2RHGA 5CPTA 2Z25A 4R7OA 3TTQA 3NM1A 1E15A 5MHBA 3KLLA 5F2GA 1EDQA 2BOEX 2W3ZA 3PS7A 2VFDA 3BGGA 4C6NA 3UNTA 4HYWA 4LAZA 3LU2A 3ZLHA 4RXFA 3WFZA 1PKMA 1IEQA 4HU4A 5AN7A 1S5TA 3QLLA 4PTXA 1Z7AA 2KZHA 4MWAE 3K30A 3DECA 2DZWA 4U2ZA 3DG3A 2IPGA 2P76A 4H6RA 1JYVA 4TV6A 2DZXA 3GYCA 1JZ3A 1JYNA 4KEMA 3G3DA 2QPUA 1F6YA 1LJYA 4H9YA 4AVOA 5LNRA 3SJ3A 2VNCA 2PZ0A 4WSHA 1XIGA 1YTDA 2KAUC 4I6VA 3B9OA 5I03A 1EOMA 3HG2A 4MAZA 1J0YA 1ADSA 6XIMA 1J6PA 4X0VA 4FMVA 3WD1A 1V6WA 4F4RA 2R14A 2J7EA 1SO6A 3GG7A 1X38A 2CZEA 3KP0A 4HSOA 3LNPA 3TYBA 4X63A 3BGJA 1WDQA 4DLMA 2ZUUA 3TMLA 2DZPA 2FGZA 3H2EA 4IP7A 4H6QA 4GQ0A 2GYIA 1O4UA 2TYSA 4X2RA 2OX4A 4NJHA 3CEPA 3GVQA 3GH5A 3DIPA 1O60A 1QPRA 4P7QA 3S1WA 3O9NA 1H62A 3F5LA 2PF0A 1ZZMA 3UZYA 2WC4A 1JIBA 5CBJA 1F4AA 2CFFA 1ZP4A 1RPXA 2OEJA 5AC7A 1YXDA 5DY3A 5LA1A 1KFLA 4U4MA 3W2LA 5AY7A 5FAGA 2W9MA 2FHBA 3TXVA 1DXEA 1VKFA 1Q2SA 2RDUA 1M41A 5JIWA 3RX4A 1EKOA 1Y5VA 1PX8A 2G95A 2VEMA 2XSBA 3ATYA 3BSHA 2IKGA 3ITLA 1I2OA 4L4OA 1XL9A 2GUBA 4M80A 1AQMA 4GCXA 3BVJA 3MY9A 4WKHA 3ANUA 5CG7A 4RX0A 2VP8A 1SJDA 3KW3A 1E0VA 4ECLA 2PWUA 3TKFA 3OJGA 1Q6DA 5A6SA 3QV7A 5LXXA 2B81A 3POHA 1EZ2A 2Y7EA 1D7FA 1TX0A 1H11A 1BSLA 2YGYA 1XIJA 1OC6A 2Z6JA 1WNOA 3A3XA 5D9MA 4GYKA 4GO8A 1L2UA 1DL3A 3U2CA 1KM1A 2QDDA 1VZWA 3W72A 4QDPA 3Q67A 4H8UA 1TCMA 4B3KA 5A6LA 3ZQ9A 5CSRA 1EWEA 1G69A 3TFXA 2YLAA 4KS0A 2F6XA 4YHGA 4AYSA 4EVZA 5FEWA 4JNYA 1X6LA 2GVEA 1L2QA 2GJXA 1CZ1A 3VXGA 1WQ5A 4KQNA 4FOJA 2OB3A 5BNKA 1S2TA 2DZBA 1TMLA 1W5OA 3DOPA 1YLVA 3PJWA 4RZ4A 1EWDA 2XVKA 4MJZA 1JDDA 3MP3A 3MUIA 1D2KA 4PCPA 1GQLA 2X16A 4AWUA 1ZY9A 3WJZA 1LYXA 4ZE4A 1KGXA 4UTMA 3W2NA 2HV5A 1KFBA 1SSDA 2VTFA 4HA4A 2V6AA 3EKZA 5K9CA 2WVTA 3WNKA 4L80A 1UP2A 1BSIA 3EEGA 1MNZA 4PA8A 5CXPA 1OX6A 3O07A 4GVHA 4NAEB 2D24A 3BAJA 1FWCC 1KBKA 3SN0A 4QFUA 2XGIA 4IMEA 1LRNA 4CD5A 1TMQA 4ZTXA 2HROA 1Q6LA 1IR1A 1O66A 2GGGA 1XYZA 1ZTVA 1PCKA 3W6YA 3LLDA 3DHUA 2Y8UA 3U4FA 3URAA 4DJED 2GDUA 5C7VA 2QUTA 3V1HA 1Q45A 1QU4A 3DBNA 4PMJA 3UJSA 4P8XA 1LG1A 2PE4A 1A5LC 3TTEA 2EBNA 1ONWA 2AKZA 2FHFA 3IV8A 1FKWA 2NT0A 3FNDA 4AQLA 3F4NA 4LF1A 5JH1A 1E1EA 1OJXA 2E6AA 5HJLA 4AC7C 3PSVA 1MO0A 1S2CA 2XGBA 4PODA 2YSWA 1XGEA 3GZ3A 1DJZA 3SN4A 1ALDA 4YYCA 3WQEA 2I57A 1EZWA 3HPZA 1Q3NA 2F38A 1SJCA 4QX4A 2JEQA 1DIOA 3H4GA 2OLAA 4O15A 1VCVA 4PMRA 1ESWA 1R30A 3R7MA 4P7OA 3M0MA 2OZ3A 1FH8A 2G97A 3ZS4A 2F2KA 1JZ5A 1GPWA 2VWTA 1M68A 4AZIA 1XICA 3CASA 2IKHA 4JX5A 2DSZA 4QLKA 3EA1A 4WDTA 3GLCA 4XSMA 1SFLA 1U33A 3VNLA 3W7KA 1V93A 1XIMA 1U30A 1YE4A 3IJ9A 4EWND 3LRMA 4JTQA 3PJXA 1TPWA 5HQMA 1UPMB 3LBCA 5B7ZA 3LPPA 3UJRA 3B4UA 1Q13A 4QCEA 2I7GA 3AISA 2VQUA 5AC4A 2Z29A 3SGUA 1CWYA 3W74A 1CENA 1U1JA 5EPDA 1ZBWA 4ADUA 2C13A 4DM2A 3CL6A 1SFJA 2HCVA 5DFAA 3V4BA 1MDLA 1X6NA 3TYEA 4ML9A 1G5AA 3OHMB 3GAKA 4YVXA 1UR3M 4H4IA 3O3RA 4MPKA 1QW8A 4IIEA 3AXMA 2FH8A 4S3FA 1BYDA 4EWJA 1UWRA 3KHJA 4UTJA 4IGMA 4OV4A 4CU7A 4DO6A 4NAFA 1R3QA 1VFSA 1QNVA 3EYPA 4JX6A 1GQJA 1ZJAA 4WEVX 2VOMA 4F48A 1U5HA 4H7ZA 1F07A 3EX6A 1V0NA 4NXKA 3TTOA 1I0DA 4HYVA 5FJPA 1HIZA 5MKGA 3MANA 2OYLA 4FPSA 3D0CA 1DKWA 3NZPA 5LNWA 3EMZA 4TMCA 4LU0A 2AKMA 3U9IA 3G1SA 2NVAA 1BAGA 3AHTA 3UA4A 4IX2A 5DRCA 1ZCCA 4YCPA 1DWHM 4JD4A 4FZIA 1JPKA 2BHYA 3T2OA 3UPMA 1KV5A 4H8NA 4PBEA 5C5YA 3LQGA 3RCNA 2VGBA 4S38A 1CI1A 2ZQ0A 1E6PA 2VC5A 1KRCC 4ATLA 4RZ5A 1P6CA 3O15A 1R38A 1IYXA 3LXAA 3AJXA 4GVIA 1GOIA 4Y9AA 2B7PA 3CS2A 6REQA 1A0DA 3N2XA 2E5CA 3EA3A 3HB9A 3THDA 4LBRA 2ISFA 4IX0A 3CWNA 3GG0A 4QLLA 1LF1A 2DORA 2HVMA 4AIOA 4UWMA 4WDXA 3VIJA 4RXGA 1UCWA 4QRNA 2H9AA 4H7VA 3DX5A 3PBWA 2QEZA 4V1YA 1KBLA 3ZVIA 1OB0A 4MB1A 2WWDA 1TTJA 2V5JA 4GZIA 4OU1A 3QQWA 2G3MA 1UWTA 4XKYA 2XFYA 5GJNA 2A3AA 1O7AA 3S2CA 2GGJA 3M46A 1K6WA 2WV8A 1X7FA 1ZJBA 4V2XA 1A5CA 1GVFA 5DXXA 3M0LA 3TDFA 1FWRA 3GXNA 1DP0A 1W8GA 4GZEA 4AZHA 1XR2A 2ICSA 2R1MA 1E4NA 1TUFA 3FEMA 1HTIA 1TVNA 4LF2A 5I07A 2HDJA 4GUHA 4IP4A 3AWNA 3APTA 3PUEA 4GFSA 4I3GA 2VURA 3H7RA 2YCKX 1X1NA 1SR0A 4UMBA 3KOYA 4D6GA 4TQTA 3B0VC 1OABA 3FK4A 3N17A 2OX1A 3LM3A 5F7UA 2PB1A 4L6DA 3ERPA 3FKRA 4LQ1A 2TMDA 3B9NA 4HKPA 4XWUA 4ZR8A 1M03A 4BEQA 2DP3A 3M5XA 1Q85A 4CCZA 4LS1A 4NAFB 2FFCA 2HTMA 3AHZA 4JDYA 1I2NA 1A5MC 1S5VA 1Q2RA 4DJFC 4FNQA 4PMOA 4EF9A 1W8SA 1J0JA 4LFYA 4RK8A 3VIFA 3WF0A 2NXHA 4GACA 1E9ZB 2HMCA 4Y6GA 3VUSA 1WPCA 1JDEA 1YEYA 2NWSA 1ITCA 3S2NA 2E8YA 5BZAA 3PZ9A 1FCVA 2V5LA 5HATA 3NFUA 4UTTC 3T8QA 4K38A 1VBRA 3ARWA 1JNEA 5AHNA 3N3MA 5D2VA 3E0FA 1W1YA 1ZBCA 5BYWA 2GWGA 5I3HA 1C93A 2AGKA 3ZJKA 4Y7EA 3MT1A 1XLHA 3ARSA 4QJ4B 1QO2A 3WQ8A 3QKEA 2W62A 1T7LA 3HQOA 3M7SA 1PX4A 2ZUNA 4IUOA 4XZWA 1OHLA 3LGDA 1NQKA 3P8IA 1OZQA 6REQB 5C54A 5ABGA 3ZWTA 1GW1A 1W9BM 2A7PA 3OZYA 4ICCX 4YLWA 4PMYA 3VNIA 3FHAA 5I78A 1TV3A 1QHZA 3KTCA 3M6YA 3PF3A 1VHCA 2Y70A 4ZQCA 3OLDA 5DCDA 3FA5A 1TWDA 4UOQA 4HJFA 2FB3A 4ADTA 1OX5A 2PTYA 1R8LA 3DDMA 1R0MA 1IEIA 3CEUA 4O11A 3VNZA 4BEUA 4CKQA 1WZAA 1XBZA 2AQVA 4XKYB 2PFHA 4DPPA 3BOLA 3DGRA 4S3CA 2G3IA 5AZ1A 4CCDA 4XO7A 3OTRA 4H2CA 3PPFA 4GUGA 1K1DA 4O54A 4GBUA 4MOZA 1XRSA 2VFFA 3WCZA 3MSGA 2OXNA 1H0GA 1HW6A 2B4GA 1HKIA 1Q66A 5LKYA 4UQEA 3PZNA 4CNOA 1VIZA 4PFMA 3B8SA 1JFHA 3G1AA 3GG8A 3H23A 2R1PA 3XIMA 3TJ4A 5EKYA 2VRQA 2VZSA 3GD6A 3L12A 3TAOA 3M0KA 4YL2A 1CXKA 2E9BA 3KEHA 1K77A 2DZUA 3G1DA 4N0RA 1DBTA 3UXAA 1QPOA 1XDMA 1TCDA 3VKDA 2VZVA 2VEFA 5HAOA 2E68A 2XG9A 4FLQA 2V81A 5KINA 3F4CA 1R46A 5EMUA 1KFCA 3THUA 3WD3A 1P0BA 1XF0A 1NARA 4M1RA 1FFRA 1XFBA 2WQDA 4XK2A 5BU6A 1XIDA 3QMSA 4ZODA 3EX2A 4F0RA 4OGZA 3CC1A 3CGTA 5CSUA 3MKCA 3KS5A 5H2ZA 3MWCA 2QV4A 4TIMA 3OVGA 4MYAA 3F1QA 5HULA 1VENA 1NF7A 1A50A 3W2KA 4GCAA 4XSLA 4MLRA 1PHQA 1Z69A 1LDCA 2INFA 3AO0A 3UXIA 4V33A 5D9NA 3IV3A 3KBJA 4QJ3B 4YVVA 3W1UA 3XINA 4INFA 3SY8A 1MNSA 3MUY1 3CLWA 3AALA 3W7LA 4NKCA 3L4YA 3Q65A 3A3WA 1WA3A 1REQB 1EYEA 3S83A 2CHNA 5AHFA 1PO9A 3MMTA 3FDKA 3N34A 4KIRA 3OZMA 4WY0F 4IXHA 3VK5A 4AWEA 1K8ZA 3MVTA 1ZHAA 3VNDA 3VIMA 4BK9A 2QJGA 1QW9A 3ABQA 1KTNA 1N7KA 3O1NA 2XH2A 4QHRA 4V1XA 2Q01A 3ZSSA 1ITXA 1FUYA 2WC7A 2WZTA 4YTRA 5D33A 4FK9A 5LHEA 1JXJA 3B40A 2QZRA 3I10A 3GFYA 2QF8A 3S6TA 2Y85A 4ORIA 5K9XA 2PDIA 3H2CA 2C15A 1JD7A 1XUUA 3P14A 5CPQA 2H90A 5EU9A 2XH0A 4URIA 3W7HA 3UZJA 4UNKA 2PODA 1DJQA 1GVYA 4JL1A 4YU1A 1ISVA 1AODA 3ABSA 3TW6A 1YYAA 1CLKA 5AC5A 3O0FA 1S3TC 1XM3A 4JICA 7A3HA 1DWFM 3JUGA 3GVRA 3WNLA 1XWYA 1UP3A 3VPLA 1V77A 3KDNA 1XGDA 3N13A 5EB8A 3QJAA 4LY8A 2DW7A 4MPQA 1KR0A 4OT7A 2EXOA 1YNQA 2PRLA 1CW2A 1GT8A 5LIUX 3B4YA 3T40A 3FYOA 4YJ5A 2VFGA 2HS8A 4WGHA 4Q6XA 3ARZA 2C0HA 3W01A 1M7PA 1PJ9A 1UQZA 2GGHA 1G67A 2VFEA 2LLEA 2JKAA 4G7FA 3OA5A 4JIRA 3WF3A 3MBDA 2Y2WA 1A5NC 2H3DA 3RRXA 2XIBA 4NYUA 1XRFA 2OGJA 1P43A 1H7NA 4DM1A 3M1ZA 1K3UA 4JS3A 4M29A 3R58A 1NELA 1XH0A 5FF3A 1R3SA 4IJRA 2FVLA 1EEPA 2WK2A 4DN1A 3RJYA 2HNHA 3NO1A 2VDGA 1FVPA 3M0ZA 4KBXA 4YCOA 3WH9A 2WCSA 3GKFA 2PWDA 5I3FA 1UD4A 1WZMA 2E7FA 3G8EA 2VD8A 4BQ4A 4US6A 5U4NA 2V30A 2Y63A 3QPEA 1SPQA 1HUVA 6ENLA 3G1YA 3SQMA 4GRSA 2PC4A 1UH4A 3LERA 1JRCA 1SMDA 1GJWA 1PIGA 1FP9A 1RQHA 2A6NA 4FXFA 1XDLA 3QQ0A 1HO1A 2WO5A 5EA9A 1YADA 4X61A 3CQHA 3CWHA 1KM5A 1QNOA 4FLOA 4CD6A 2VR4A 2RGLA 2I1OA 1J11A 4ICNA 3EX4A 5HMSA 4QIUA 3NQAA 3BLIA 4DJFA 4NNBA 3FCPA 1E40A 3WF2A 3CZKA 5A6KA 1W3LA 3CAKA 2WXDM 4K1GA 3VNMA 3IANA 4J27A 3NDZA 1G9HA 2OFJA 4W85A 3UWUA 1OIFA 4CN1A 1FA2A 2OZ8A 3OYXA 1AZ2A 1CB2A 1M01A 2WC3A 3WQVA 4F0HA 3O0KA 3OW1A 4WHBA 2QGHA 4HTBA 1B2YA 2TPSA 5AVHA 4DYEA 3E9AA 2V3FA 4DZAA 3W1QA 2DZAA 1OCJA 3LK6A 1RV8A 3U2ZA 4FALA 1F61A 1UKQA 3UW6A 4S3BA 4QTGA 4D6CA 4PTDA 6XIAA 4CD8A 1HKKA 4HU3A 3W70A 3XISA 3ZJ8A 4ALDA 4MYXA 4ILSA 4M6UA 3TNOA 3W0KA 2NXIA 2CW6A 1UD6A 2PBOA 4KT2A 4C6KA 3N4FA 4GI8A 3LHUA 1AMKA 3EWCA 4GD0A 3V0SA 3D3AA 1RK5A 1XW8A 2C6QA 5AVNA 5CC5A 1TJ2A 1P6BA 4GO9A 4W7WA 2OO6A 3WLQA 4LOCA 3DKLA 4MNJA 1E9LA 2Y8VA 4H9XA 2J25A 2TRSA 4OBTA 4BQ3A 1NWUA 3C86A 3NOYA 4FNPA 1YBQA 3R8HA 3ECQA 3MI2A 1GONA 1IR2A 3PK7A 1Q65A 1G4TA 3S3GA 3R4IA 3PPGA 2P3EA 2ATSA 3USZA 1O6IA 2EF9A 3QTGA 3SJNA 4ATDA 1XLEA 3AC0A 1GPFA 4IHCA 5CGTA 3T0AA 4BY3A 3DI0A 3C3UA 2VX7A 1R2RA 3PULA 1GTHA 3R12A 1Q5MA 3EDFA 2GVLA 3BOFA 4G1NA 3DFTA 3KLKA 1B0IA 1M1BA 1UUOA 3S2MA 4QG6A 4NNAA 2PDBA 3UXKA 4I8YA 1MW3A 1NFGA 3PZVA 5I3KA 1LOSA 2YCLA 5A6JA 4JEJA 4Y9MA 5ABEA 2HRWA 4WXZA 3NO5A 3SY5A 1BHGA 1HJWA 4IG2A 3G18A 3TVAA 5D2WA 3DEQA 3B9EA 2V0TA 3FLUA 4RZBA 4NZJA 3WDJA 2VHLA 3BLKA 3LCLA 1V6XA 1EHAA 2TSYA 2ZZ6A 3KS6A 3PAJA 4F40A 4DBSA 2IUZA 1GVSA 4IXXA 4C6FA 4EE9A 4JTCA 2QGYA 3NURA 2ZDSA 1JL8A 4ZQNA 3AS0A 3CYVA 4GXPA 4DVOA 1PWLA 4W8LA 5EYWA 2ODOA 4DY1A 3CQ0A 4PC8A 4BS0A 3LGEA 1B57A 2VZTA 5A2CA 1V3HA 3WK1A 3S47A 2C3ZA 4NP7A 5CQ1A 1CECA 4JGDA 4GYPC 1A4MA 4UZUA 5LXEA 2XHYA 3FDGA 3DGBA 1W1VA 1X6UA 1JCLA 4HNOA 5BW6A 4AISA 4L4MA 3WLMA 4AD4A 1Q6CA 4H6KA 4MJ4A 4HHHA 4TU1A 3T44A 4UTKA 4DPQA 1SW0A 3V3WA 2WVVA 5TIMA 3P74A 4K7YA 4F8XA 4TMBA 2VRJA 2X2YA 1YXCA 1ONEA 1LOQA 2VFHA 1EJSC 1DTNA 4J28A 1ZGDA 4O1FA 3LCHA 3M64A 3ZXWA 1RZMA 1XV8A 1AH4A 4UQDA 2ON3A 4DUVA 3ARUA 5FL1A 2HE8A 2G4FA 2V63A 1UMLA 5AZ0A 1TV7A 1W37A 3LI1A 1G7UA 4DZ5A 3UF9A 3KOZA 4BR1A 4KCTA 2WANA 5F2LA 2YCEA 3P5YA 2YLLA 3LS9A 5FF7A 4ZO8A 5D8ZA 1OK6A 3RITA 1QI4A 1OZMA 2QUUA 3AI0A 3RLUA 4UTHA 4R7WA 1WKFA 1T5AA 4GNVA 2B0MA 1ECQA 2CLHA 3ZR5A 3S9YA 3SGGA 1M6JA 4DUOA 4OKDA 4DO5A 1UG6A 4RL3A 4ADSA 2EKCA 2O4MA 4UXDA 4YS1A 3A5VA 3JRKA 3SQSA 3NZ1A 4L1GA 3MHUA 4IH3A 1CIUA 4EPBC 4YHEA 5HWJA 2J75A 4XZBA 4JY9A 1QXLA 3GNRA 3IK4A 2D2JA 3JS3A 4RJEA 4ZENA 3INPA 3BW3A 4DBUA 1RBAA 3VTRA 1TRDA 4R27A 2YJQA 3ARTA 4RDVA 4TXEA 5DX7A 1EO5A 3UPWA 4EAYA 1EBGA 1O1ZA 5C2GA 4HPXA 2YCLB 2E9LA 3SRKA 1JG9A 4LB3A 1BWLA 3I6EA 4DXKA 4JFSA 1EB3A 2Z6IA 3CUIA 4JTHA 3EA2A 2PA6A 5FI8A 4IG2B 4YWSA 4C7DA 4HZMA 5G2IA 3N1AA 4CVUA 1A3HA 2XINA 3V0TA 4KWSA 4IIFA 4AMAA 1QK0A 3S5ZA 3OYZA 3AIBA 2RDTA 3BH4A 1XG4A 3KBWA 3FFSA 3PWGA 5AB3A 1PIFA 4GQGA 4IFOA 5KSWA 1TZZA 1M3UA 4UTLA 3EDJA 1A3XA 3LXCA 3K8KA 3G6MA 3G1XA 3UD6A 3R6IA 1R9XA 3AMLA 2BVYA 1EGMA 2NUYA 2PRHA 5HA7A 3DYPA 1AUSL 4X9SA 4LX4A 4U5KA 2NX3A 4WUIA 6PTDA 3N2MA 3A4AA 1E5NA 5EBUA 4Q4MA 1TZ9A 4Z0SA 2FFIA 3EPOA 4S3AA 3H55A 9XIAA 3MW7A 2YBUA 2Y1HA 1PDZA 1SVDA 3BLLA 4CD4A 2FVMA 1JCTA 2WVVB 1W3NA 1DJXA 2VUNA 3IGHX 1L6SA 3KCJA 3WBEA 1KRBC 4DO4A 5AYBA 2C79A 1KFJA 3LY0A 3VYLA 2Z0IA 1F73A 1FP8A 5LA2A 1Y5WA 4O53A 4A3UA 4JFTA 1TPH1 5DXYA 4GI6A 4JAWA 3S2JA 4WIWA 3GU2A 4NIRA 4IIDA 3PBVA 3OBAA 2PDJA 3MS8A 3V5OA 4CNSA 5LHFA 1DXFA 2ZX6A 5G4WA 2IPJA 3MCMA 2QYGA 5I00A 4QAIA 3QPZA 3RG6A 3W37A 3A47A 3WNOA 5RUBA 4PMUA 3C6CA 4NX5A 1C8XA 3A64A 1F4HA 3WLNA 4PTVA 3VO0A 4U5IA 2D2OA 2DT0A 5CJMA 4LYQA 1TFVA 4FNTA 2WNNA 1TIMA 1ADOA 2NUWA 1E4MM 3OPSA 3AJ7A 3NO3A 2XM1A 3PR2A 4Z1DA 3WQ5A 4HVXA 1FWTA 4KF1A 1EQCA 3NQ6A 3WK3A 2BBFA 3MSRA 3SSJA 1EFZA 4P7LA 5CEWA 4GUFA 1W9XA 3H2FA 4HN8A 5M17A 1OFPA 2GDVA 3MYOA 4HSNA 4TVUA 3QZ6A 2O55A 3C0LA 3TJXA 1SJAA 3FJ6A 2X1TA 4M8UA 1HJVA 1A4LA 5DCEA 4DB7A 1H4PA 1JCNA 2FZDA 1JDFA 3REQB 4H9MA 4AHPA 2CETA 3SCOA 3UJFA 3VFLA 3WENA 4L61A 3RNDA 1G01A 2PBGA 3WMLA 4WR3A 1LWIA 1YE6A 4FX6M 2OYKA 6TAAA 2V67A 2W79A 4Z42C 5A8QA 5FA5A 3S1GA 1FHLA 1UR8A 2J74A 1SJBA 3W1XA 3USBA 4KWUA 3MA8A 3UR7A 4OBRA 4XVDA 2C1IA 3TH6A 2VXNA 5FJJA 4IT1A 4Q7NA 3VI2A 1ZNNA 5HR6A 3PFRA 4NJJA 1OG6A 1NOFA 3P2VA 4UTWC 2ISDA 1FWIC 4LRSA 1VPQA 4BQ2A 2ZX5A 2PURA 2XFWA 3TFCA 2GJLA 3C4UA 2HISA 4A3QA 2OELA 3O63A 2RKXA 3BZJA 4IPLA 1LLOA 3QTPA 4KWOA 1OSEA 3H4WA 5XIMA 1TO3A 3IAPA 2C1HA 1JF5A 3BW4A 1OY0A 1JPDX 3QOKA 2WMIA 4D1IA 3W7QA 3GTHA 4JKLA 4XZ9A 3E1F1 2XJ7A 4IMDA 4AIUA 1C90A 2WJFA 2FTYA 4GGHA 2PDLA 1TTIA 3KDOA 1QNPA 3T1GA 1LL6A 4B5TA 3TW7A 2OMAA 3GTFA 4LAUA 4E2OA 1RK6A 3ITXA 1XQKA 3T05A 4GYPA 2WKLA 1ZBKA 1CGVA 4MSSA 5EL1A 4I5RA 5E0CA 1JULA 1D8WA 5HOSA 2VMFA 3LQLA 3UYCA 4PTNA 2OU4A 3QOMA 4BF7A 3W7GA 3S6DA 2OR2A 5JBDA 3PM6A 1QO5A 3C56A 5IDZA 3L21A 3HG5A 1EX5A 2FGBA 2I5QA 4LYRA 4PMVA 1BGAA 1R3TA 3GHTA 2A3HA 4W84A 5G4HC 3BWWA 1T6MA 1U5JA 3GDRA 2QULA 2VUYA 3HM7A 4HMDA 3L4VA 3P84A 4DZHA 5IM51 2VRKA 1SUXA 3WBWA 4R9XA 1XPGA 1J96A 4J40A 1VFHA 3UR5A 1F3XA 2ZUSA 2WLZA 1OX4A 1JZ8A 2ZZ5A 3ELFA 4PCFA 1UWAA 1Q63A 3WFLA 2G3FA 4ZQMA 3KBVA 1UC5A 1QHOA 3VKBA 3G3MA 2DSVA 1GCYA 1N8FA 3LCWA 3LTPA 2PLJA 4J3XA 4XIAA 5A8MA 1EF3A 1C9DA 3KL5A 1V5XA 3OGRA 1ME9A 5I0DA 2CU0A 1DJWA 3GNXA 4KRTA 4DYJA 3BAYA 1I1XA 1B3XA 2ZZ4A 2XVPA 1X96A 3SO7A 5KETA 4OUEA 4PL1A 2REQA 1AZ1A 1SO3A 5A1AA 1MUWA 3CV7A 3EOOA 1KXQA 4MVAA 1BVNP 2WOQA 3VU2A 4UMAA 3CBWA 1JNDA 3LCXA 3QLDA 2MNRA 3WQCA 2HPMA 1HX0A 2A21A 7REQA 4GZ7A 1KKRA 4CLMA 1RA0A 3RPDA 1BVWA 3W73A 2W66A 2WVUA 1GKQA 1OFAA 1P0EA 4QAWA 3CHVA 1ME7A 3ANVA 1V51A 4O57A 2PWGA 3RPMA 4D6EA 3B0XA 4G7EA 2ATMA 5JXQA 5C9ZA 1CGTA 4JX4A 1LT7A 3HPAA 4NASA 2QCDA 3JU2A 4HYRA 1ZALA 3OLIA 4OE7A 1M04A 1AL7A 2ACRA 1V8EA 4D8LA 1KCZA 4PUDA 3S5OA 3GBDA 1HGYA 2VGIA 4E4UA 3O05A 1OC5A 2QCMA 4WRHA 1Q4WA 2X0YA 1ZUAX 3W2JA 2YBTA 1OFEA 3R79A 3B06A 1BLIA 3KZSA 1M7XA 1YQ2A 3HQPA 5A2AA 1RJRA 1AJ2A 4YTUA 1OFDA 5I24A 3W82A 3Q4DA 3ABRA 2PU1A 3UWVA 1CX9A 3I6RA 2WCAA 2XWDA 2D69A 1EEXA 3LHVA 1KCKA 3UZWA 3C0JA 2VEKA 1F5ZA 1Z48A 4GJ1A 4PTMA 5M3WA 1B31A 2VVSA 1AK5A 2JBMA 3R1ZA 4HK5A 2OEKA 1QMLA 5D05A 3T2QA 1THFD 3OIXA 3W7DA 4KPLA 3WQ6A 4BWLA 1T41A 1JI2A 1K9FA 5JBEA 3TSBA 3DZ1A 2CZFA 5FSEC 3RMEA 1UQYA 3V1PA 3WLJA 4IICA 1KXTA 2Z1BA 2C18A 2NWRA 5K3VA 3WNNA 3IJ8A 3MKKA 3EOEA 3TX9A 4JBRA 1XSIA 3VNKA 3CMJA 1NDYA 3WDHA 3W1LA 1B30A 5CZSA 4E2BA 1XG3A 3VE9A 2XN1A 3TR2A 5ECVA 3WYZA 1TV5A 4AZCA 4JTGA 4Q4PA 2OODA 1QPKA 2ZXQA 3DHDA 1S5MA 4S3KA 2J78A 3IIPA 1RY8A 2QHAA 4PRRA 3DHPA 1BWKA 4XAPA 4PUEA 1CT5A 3FIGA 3A4XA 4DJFD 1E0UA 2YXOA 4W89A 3GNPA 3HPXA 5D37A 3WD2A 1MXDA 1QK2A 3MSYA 1WDDA 3K46A 3TC7A 2VC7A 5GNYA 3H70A 2Z7GA 2EHHA 4IGHA 4W8BA 1UA7A 4E4FA 2ZWYA 5DMLA 4B3LA 3A12A 3W87A 7ODCA 1MEIA 1OD0A 2H3BA 7REQB 4JTFA 2E25A 1JUKA 1DV7A 2INZA 3MMDA 3U2EA 4FP1A 2WBGA 1XRTA 4V15A 1MEHA 2FTPA 1TUXA 1KTBA 3CAQA 4GI9A 3MTWA 2PDYA 4QEHA 4G7EB 4D6HA 2ISSA 2P10A 3C8FA 4F3HA 5KTLA 4HZ7A 2BG5A 4B90A 4LUSA 4AY8A 3GFZA 1TPFA 1ITUA 5A6BA 1LWJA 2YYUA 4NUWA 4GQBA 3ZWSA 2FYMA 2YKKA 1F8IA 2G5WA 3MPGA 3TIMA 3F4WA 4FIQA 1C8YA 1UROA 2VI0A 2Y5SA 2ZXBA 2NSOA 2VWSA 1QNSA 4FX8A 1PZ2A 4W9TA 3S5SA 3EOSA 1W5MA 4PCSA 2PWFA 2QUVA 4HA3A 4MLJA 2R91A 3MCNA 5F4SA 2GUUA 4S3JA 3H12A 3S8HA 3SECA 3FA4A 2DGAA 1RJQA 2BHZA 1E72M 1Y5XA 1Q8JA 4O4VA 1FWEC 2WHKA 3OB8A 2GOKA 4H8HA 4HOXA 1ECEA 1KXVA 2VL4A 3L68A 4G5DA 4LT9A 2PF8A 1K9TA 1KV8A 2BHUA 4MDPA 4N9CA 3TYCA 2FDMA 2Z27A 1K8XA 5C9WA 3KE0A 1RLCL 4XZMX 4FXRA 4BHYA 1KQYA 5FEXA 3W7NA 4IMGA 3TSDA 4Q4OA 2P88A 5A8OA 1G0CA 2D0FA 4J5NA 1NJJA 3WMSA 3GU9A 1B9BA 4I7WA 2NVDA 3N29A 2YFOA 3DFQA 3AIEA 3R0KA 4IJBA 4XBKA 3W84A 2R8WA 1UIPA 4HN4A 4JHOA 5GVJA 4Z1AA 1SZGA 2RJGA 5EBAA 4RE4A 5LA0A 3N12A 3CPUA 1D9EA 3TC6A 1PZ3A 1PTDA 4PGLA 4JN6A 2WSYA 3M0XA 1TJPA 4C5ZA 1W5NA 3TAKA 4JQ4A 3FW6A 4R34A 4B5VA 1DORA 1K8YA 4J3UA 2WZEA 3M9YA 1J9YA 3IRDA 1N8WA 2XDFA 4I9MA 2NUXA 3UXDA 2MANA 4I5XA 1P0DA 1VR6A 3CQKA 4Q8NA 4Z2JA 2ZADA 3UVAA 1X1OA 3H2NA 3UG5A 3L65A 4PBFA 4B5WA 2RGMA 1F8MA 2YR1A 3ITGA 5G1MA 1C8VA 4TVDA 4WVXA 1YDVA 2Y6ZA 3GE7A 4E2VA 3QGKC 4D1JA 4AD1A 1QHPA 2J62A 2OSYA 5C2XA 5BWFA 1DJHA 3GO2A 2PDHA 1EF2A 3OQEA 3UWWA 1BTMA 2ZA3A 4K39A 3O2LA 1R2SA 1K03A 4ZL1A 1BPLB 2PC8A 2WSKA 4PFHA 3LG3A 3O6CA 4E2DA 3KBSA 4PUWA 4LUSB 1WB0A 2IKIA 3I3EA 4XUGA 1XLJA 4PEKA 2P53A 1UZDA 1P1MA 2GQ8A 4PH6A 3VCNA 3WDPP 2VGFA 3L67A 3VD9A 1K70A 1OYAA 4GJJA 5FEZA 1XXXA 3ANYA 3THCA 4DRSA 4X3ZA 3UZXA 3U57A 1VP5A 2X40A 1DE5A 4F66A 3MHFA 4NF7A 2X0HA 4Y2WA 5BXTA 1S3HA 1Q6QA 2I56A 4LB4A 5HNTA 2NQHA 4L1XA 3ABXA 1QRQA 3KVKA 2QV5A 2YIHA 1VEPA 2J7BA 5HNNA 2POTA 4M51A 4BF5A 4NXSA 3NL5A 1GZJA 3GK0A 2YW3A 1P4CA 4WY0B 2WJDA 2V2CA 4PRWA 3WJXA 3W2MA 3WL0A 1H7OA 1EPXA 4GQQA 3QW3A 3ZJ6A 4RPQA 4AH7A 4NSBA 2QVNA 4RR4A 2G8ZA 5C2CA 2PGRA 4WKAA 3BICA 3E6EA 3AIWA 3TP4A 1CXLA 4NI3A 1FRBA 2AQOA 2JQXA 2VZOA 1RLDA 1S39A 2V2HA 3N2CA 4IWWA 4DF0A 1TJ0A 1RP8A 3MV01 4O14A 3AZSA 1WX0A 1NP0A 2YYTA 1S46A 2EPMX 1W5PA 2QAFA 3C5QA 4E4PA 5F1VA 1QATA 4UC5A 4IIHA 1SMAA 1YPFA 4IGSA 1XLGA 1XLKA 5BRQA 4DUXA 3CB3A 3U0HA 4P7RA 3C2VA 5AECA 1W3KA 2B31A 2Y88A 4CNPA 3PHAA 3F7JA 1ZB5A 2ZRYA 3W2UA 3WN6A 1E3XA 5FF4A 3W27A 1CTNA 1US2A 1EDTA 3F2CA 4HPJA 3VGBA 3R5EA 3KRUA 1A5OC 2WQPA 1WDRA 1JZ6A 3QY6A 2BY1A 2AL2B 3HU7A 1AW2A 1VJIA 3HGJA 2CKSA 1A47A 3PZMA 2DIJA 4YN5A 1UR4A 3N9RA 3A22A 5A69A 3M43A 3NVTA 4EX4A 4ONVA 5L9FA 5AHMA 4LALA 3O06A 3IIXA 1D8CA 4E5TA 2BWGA 1DWAM 4IOTA 4J3TA 3UXLA 4DZIA 1RSCA 2PCQA 4GX9A 3HGRA 1VRDA 2DJXA 5MF5A 2ZX9A 3HG3A 4UIOA 1SW7A 3CZLA 3S1UA 1T99A 3EWYA 4KETA 2WMHA 5IFPA 4GG9A 3WUBA 4AC1X 3NG3A 5T8GA 2WNQA 5E1QA 1A80A 4UFIA 4R85A 2VFIA 4FSAA 3JR2A 1O5XA 3IWPA 2VD9A 3SRFA 1XYFA 8XIMA 1KD0A 3CUZA 5DCBA 2Z1VA 4C6PA 3E74A 3LLXA 4EPDC 3BTNA 4WQ6A 4NZFA 2XIMA 3CT7A 2CITA 2QMKA 3BW2A 4HCLA 1LQ2A 2CWXA 3W24A 4K8HA 4PMDA 3MVIA 5G2HA 2XSAA 1LUCB 3NQVA 1ZFJA 1H61A 1EH9A 4XQ6A 2PDUA 2PGEA 5H1WA 5IFTA 2E6YA 3VMNA 1EIBA 1B4KA 5LIYX 1QFEA 4EPEC 4BI7A 3OQ8A 2PWVA 4JQ2A 3U2OA 1UZ4A 2PMQA 4J3ZA 4E8DA 3N2OA 2DFAA 1OK4A 4CQAA 4LCSA 4E3TA 2NQLA 3NZGA 3WF1A 4JFVA 3TLLA 2GWNA 3N2TA 3BG5A 4LUYA 3F2DA 3B97A 1I75A 2EG7A 2PU0A 1FDJA 1SFSA 4ZEPA 3GQYA 4ZGYA 4S39A 1OFRA 3PSWA 3UU0A 4AHOA 2Y61A 3E38A 4DLFA 2D2GA 3VIOA 4MWAC 2WJZA 4B9YA 4QJ5B 1OADA 3VC5A 4WK9A 4JTDA 4Z2GA 3L0KA 1QOQA 4JTIA 1HQTA 2PDMA 2RAGA 3RF9A 2D20A 1LL7A 2GFTA 5EFDA 2I17A 2QW5A 4JFUA 1R3YA 3BLFA 1QBAA 2NV1A 2FJUB 4ZFMA 3LRKA 1ZLPA 1KW1A 1ZJIA 2FZNA 3LRLA 4UCGA 2PGWA 3WUGA 2CBIA 4EKJA 5CSSA 1H50A 3HURA 1UUQA 4ZQPA 4O1BA 3DC0A 1E43A 2XVGA 1BYAA 2XIJA 4R5EA 3I7SA 2AL1A 4ML4A 3W28A 3GR8A 5GNXA 4A3HA 4HNCA 3TXZA 3KM8A 2GDQA 1OCBA 8XIAA 1UOZA 3EB2A 3T07A 3I68A 1TV8A 1WXJA 3W1RA 4DXVA 4A8RA 1ELSA 3P7YA 1C7TA 1PKLA 1W1IE 2J8GA 1PXGA 3LPFA 1AL8A 2V68A 3ZVHA 1KM4A 3KUMA 2OJPA 1B3YA 3C8NA 1QR7A 3ZFHA 5E6YA 2ZCGA 4BI6A 3RDKA 4MG4A 3VGHA 3P5ZA 4D8AA 8RUCA 1Z44A 4O1CA 3H7UA 3GXTA 4ZBCA 1DJYA 1UD5A 4H01A 3EKGA 1OFQA 3NDOA 1AA1B 3KL3A 3UFYA 4NU7A 3IJLA 3A23A 4W4QA 1RQBA 1C9WA 4AEFA 2DQXA 4WDUA 1CNVA 2NW0A 4LS0A 2HXTA 3ATZA 3N6HA 3CU2A 3V5CA 2NZLA 2CZVA 4ACZB 2PUZA 1UJQA 3TN5A 1V3JA 1RP9A 1CXIA 1IF2A 1D3CA 1L0PA 1QNRA 2VGGA 5BMXA 3CO8A 1YPXA 3TA6A 3QXBA 4MZ1A 3H54A 2E9MA 4PRTA 1WKDA 3OVPA 5G1TA 4XD6A 3G24A 3QFWA 4PMQA 1AMYA 1E51A 3GW3A 4KCWA 5IBXC 2PWEA 2E1DA 4H19A 4Y90A 4YMZA 3SZ8A 1OBAA 3RLHA 3A21A 1V3MA 4EK7A 2A3CA 3K1DA 3TCEA 4AD5A 2IQDA 3WEZA 2EPKX 1UHVA 3UQNA 1XHGA 4M5PA 1ZS2A 3E2SA 3QY7A 1DQWA 1QI3A 4IPNB 4KFOA 3LBOA 5GPRA 3SRDA 2O0TA 2OT0A 4CQCA 5G1YA 1KR1A 5C70A 5HWMA 3NEHA 1V02A 1EC8A 3I4KA 4IQJA 3P0WA 3CL7A 1M9HA 3AS3A 1I2QA 7XIMA 1Z41A 2EEXA 5BCAA 4PEEA 2IMRA 2IXUA 4Q8TA 3BJSA 1MI3A 1T8QA 4NHVA 1ONXA 2BOFX 1XSKA 3LYEA 1NH6A 1NIUA 4RNJA 5E0FA 4IL2A 2Y89A 2PDPA 4RE2A 3AFBA 2IXVA 3I65A 3GC4A 2XN2A 1CLVA 3VINA 2NQ5A 3NQ7A 4PB3A 3RFAA 5BOFA 3V18A 2NQZA 1OYBA 3SM0A 1PL9A 4RDZA 1PX3A 1W3IA 3DC8A 4FR1A 4XX6A 4UMCA 2CLKA 3L4UA 3QV9A 1HFBA 1I9CB 2XIIA 4NILA 4Z1CA 3UVIA 2OQHA 4JTSA 3ITCA 1XC6A 4TOQA 4JN8A 4ZQRA 1RALA 3D3FA 2XZ7A 3FJLA 4ACYA 3EXTA 1NOUA 2VDHA 1QDSA 4QSHA 1GW9A 1BXBA 3CTTA 1FWAC 2NX1A 4B5NA 1G4SA 4GQRA 3WIJA 3M0YA 2WMKA 4MAVA 1R47A 4FAMA 3N2BA 1LORA 4DO7A 1UD2A 4KKXA 1BGGA 1MZRA 3HQ1A 3L4XA 5TAOA 4GABA 3AXIA 1HJXA 3B8UA 3QW4B 1ISYA 1S5NA 3GHRA 1AH0A 2A4AA 3NZRA 6A3HA 3H4XA 2BVTA 4MNLA 3R0UA 2Z1KA 1UYQA 1BG4A 3MP4A 4HQVA 1LLWA 2DSUA 1AD4A 3W75A 4N9DA 1PZ0A 3DXIA 1GQIA 1ICQA 1K4HA 5KZDA 3WQPA 1PB0A 1E1CB 1QWKA 4UFKA 2KX9A 4Z2LA 2ZYFA 4F2TA 2POZA 1F2JA 1KBBA 3CIWA 1CYGA 3G6LA 5KEZA 1UB3A 5T91A 4CEXC 1OG0A 1TG7A 4GUJA 4K6AA 3KWSA 5I2UA 2J13A 4GH3A 3SCNA 3VMOA 4Y9PA 4MY8A 4WSKA 3R89A 1OINA 1XBXA 3SUVA 1KWKA 3QFEA 4TX8A 3WLSA 1UBPC 2E5DA 2E8ZA 4NQ1A 4GWEA 4R9OA 2QNEA 3GDKA 1RY0A 1E55A 3P6LA 5FCZA 4ZQOA 4R53A 4CU8A 3L5AA 2Y5EA 3TCSA 1OCNA 1IHIA 1GQNA 2VELA 1X39A 4RZ6A 1SW3A 1R85A 4PZVA 3PPCA 1J93A 2HXUA 2OEMA 1XYCA 2DW6A 4RW5A 1LP6A 3DESA 1M7JA 5XIAA 1IWBA 3OO2A 3W23A 5BXSA 4UZSA 2OOGA 1P7TA 2R1NA 4XZLX 1G4PA 3TR9A 3HN3A 1M5WA 5HUOA 2Y8KA 2QVHA 3A13A 3NQDA 4M56A 3BLDA 1XCXA 4EPKA 1HO4A 5D9PA 4QXIA 4ERAA 2X1UA 3T6CA 1IZJA 1ZP3A 3RRAA 3OZPA 4B2DA 2RDWA 4CNUA 4QS5A 4PR4A 5I3JA 4GXWA 2VEGA 3GVGA 4HD5A 3F2BA 3L5LA 3E49A 4LCQA 2VR5A 1TSIA 1NFPA 3VABA 1MFVA 4GHRA 3GRIA 4K37A 4QQUA 2V5KA 5DLCA 3WUFA 2W6RA 5F4XA 4PUUA 3CTLA 1C29A 3AMKA 2JGQA 4MTVA 4MWAA 3PTMA 1J5SA 3RGTA 4K7VA 4O1AA 2UZ9A 3HJEA 5JUVA 4LY4A 4DXXA 5ABFA 1XCWA 3APGA 3M0JA 4TO8A 1Q8AA 2FH6A 2BSLA 4MY9A 1GVOA 1VYSX 3WLKX 1OCQA 3NQ8A 3NTYA 1YX1A 1GVIA 2RJHA 2FKPA 1XYMA 3E2QA 3CQJA 4QLJA 1XLCA 4NG3A 4US5A 2QCHA 4Q8MA 3W38A 4RUBA 3QHNA 1PTGA 1S2WA 2YW4A 2R9RA 3RLVA 5A6TC 2EQDA 3W7EA 4N02A 4Q22A 3BV7A 3LI0A 2VO5A 1GVEA 4C6QA 3GVVA 2F84A 3LB0A 3I3BA 5TD4A 4XAFA 3GXMA 1QOXA 5A6BD 2D3NA 1VLWA 2L5HA 4Q8VA 4QNEA 1A5BA 1JUBA 3EOLA 4YWIA 3QPYA 3GSMA 3ITVA 3ZO9A 1HKJA 5AHIA 3CHCA 3QGVA 4D6FA 4AG0A 3UGRA 1W1PA 2HBXA 2GJXB 4P8VA 1TELA 1A53A 1IXNA 1VQTA 4F0MA 3PBGA 4QM1A 3RM4A 3W1PA 4LVFA 3L9CA 2Y7FA 1XLDA 5REQA 1EDGA 1I2RA 2FB2A 1BKSA 3LTYA 1GZ1A 4Q8WA 4AXNA 1XI3A 3WL1A 4ZXLA 2QCCA 1QBBA 3OBEA 3T42A 1RD6A 4J3WA 2O7SA 1Z6KA 3LN3A 3WQDA 3VKKA 3GW0A 3ZMRA 3QYQA 2V69A 3FAWA 2J7GA 2RUSA 3N4AA 4DF2A 4BKNA 1JCXA 2CBJA 4D2JA 4LVDA 4DWSC 2CC0A 3DG7A 1DHKA 4UR8A 1P7TB 3CZEA 1XLIA 4ORMA 1LBLA 1VFOA 1IT8A 5IBXA 5T9CE 4IPJA 3NPVA 1LL4A 3VNJA 2JKPA 3OG3A 3D47A 3PWIA 4CD7A 2WJEA 2GJRA 1LQAA 1PVNA 3U7VA 1EXPA 1RBOB 3URQA 4RCXA 3OLGA 4Y9OA 3FSTA 3NAVA 5E93A 5AHLA 1NF0A 2PDCA 2CNCA 4CGTA 5LNVA 2FZBA 3WELA 4JKMA 2QMJA 4MY1A 1RVKA 3Q94A 3MUZ1 3B8DA 4LYKA 3QZEA 4GIEA 4P5UA 5IXEA 2D1ZA 3ME3A 1P0NA 4E0CA 4QE5A 1E0TA 3S42A 1LCOA 4M81A 2V9DA 1AJ0A 4WXYA 3TQKA 1WAUA 3VKCA 2DUZA 5HMFA 1B3ZA 3ICJA 5ABFB 4L64A 4NI8A 2X2GA 3VUPA 3T7VA 1IT7A 5CZTA 1TREA 1MZHA 2GJPA 4OECA 1ML1A 4H9ZA 4C6CA 1P0KA 4FHAA 4NVTA 4W86A 4KRZA 2YA1A 5D8WA 1FWSA 5CPLA 3B0YA 2VEIA 2Q8LA 1E1FA 3PPHA 1J10A 3K13A 3ZT6A 4O18A 5AC6A 3MKVA 3PJTA 2R82A 1FDZA 1OGSA 2YCJA 3NL6A 5AYXA 2YXXA 3TOYA 5TF0A 3DFPA 1JEZA 3N73A 1Z3NA 5DMYA 4M82A 1C92A 1GOWA 4HPHA 4HCHA 5JH2A 3UGVA 4X60A 3CL8A 3VIKA 4NZ1A 5GNZA 1RVGA 4U3AA 4LBSA 1E6SM 3SSZA 1JGMA 2NT1A 4ATWA 1US3A 3PFMA 1GUVA 4DAFA 4HOZA 3NGFA 1BWVA 3SGZA 2V3GA 2GVGA 1B4EA 3QY8A 4B16A 4GISA 1V3LA 2AQWA 5REQB 3BG3A 5CKSA 1TX2A 3IJDA 3LENA 3LUTA 4LV9A 3VFCA 1RCXB 2ZA1A 3FS2A 4DIAA 4L6OA 4HU8A 3E2RA 5ENLA 1ONRA 4Z2KA 2IQTA 2GSJA 2XUCA 3CH9A 4G9PA 4KERA 5L6UA 4EANA 2PTZA 4CEUC 1GOXA 1J12A 3PUGA 4AIEA 2XFRA 3RMJA 5F2MA 2WWCA 3GNNA 3EZ4A 6ALDA 1UUMA 5MKGB 1F74A 2O7QA 1LQ0A 4LEQA 1EO7A 5E0KA 1CEOA 2HZGA 3D5HA 4DBDA 1LOLA 1ISXA 1JI1A 1LG2A 3W07A 1BYBA 2J9YA 2VKZG 2V8ZA 3GR4A 4JN7A 5A8GA 3AMGA 3MP5A 4B92A 2Y24A 4NJIA 4AF0A 1F76A 1ZSXA 3VZXA 3QGAC 4CVWA 3ZT7A 4C6MA 1H3GA 1FWFC 1LZOA 2JFEX 3L23A 4ERGA 1KM2A 3DAQA 2QPXA 3SI9A 4FXJA 1HZYA 1JCJA 3GUGA 5C0QA 3K4DA 4BZYA 4LUJA 1HL8A 3M41A 3LV6A 4ASTA 1EA0A 1WBHA 1JPMA 3OVQA 2FTWA 4N42A 4F9DA 1GORA 3V35A 3LXBA 1KWGA 4O10A 5BXPA 1P6WA 2VOTA 3SUUA 1W54A 4L9YA 3KAOA 1EIXA 1FHDA 3IS4A 3LX9A 5M2FX 1T40A 2H9AB 1P5BA 3P80A 3TEVA 1IXQA 2J9XA 1NWTA 3AZRA 4I6KA 4QG8A 5EMMA 3W4RA 4MUPA 5I5RA 3DH7A 1TR9A 5I3DA 3DYOA 3CV2A 3MUAA 3VIPA 2QIIA 1PYMA 5F2IA 2NXGA 3LPGA 3TJIA 1XLMA 4OBSA 4KMQA 3SUWA 5I23A 1OIMA 2PD9A 2D3LA 1QW7A 3HMCA 1NP2A 3T0BA 1M7OA 2XH4A 3N6JA 5CZJA 2DH3A 3P62A 3SAZA 1B9ZA 3APYA 4DEFA 1L6WA 3CHFA 1Q6GA 1DYSA 3ZR6A 4LNYA 4PB5A 4WJXA 4AMCA 2P50A 1UPPA 3M5YA 3NEVA 2OZ0A 4A8LA 3HO8A 4WZHA 4GKTA 3MZ2A 1PE1A 3GIYA 4HP5A 1ADDA 1TZ7A 4S2CA 3OP2A 1KXHA 2YDSA 1DVJA 4FF7A 4AX6A 4UFHA 1AJZA 3C0SA 1EQPA 3N11A 3IIOA 2UY4A 4O0ZA 4Z1YA 2BXZA 2DH2A 5CC7A 4N9EA 1XLFA 3VNYA 3ZSTA 3FGCA 4CQDA 1BF6A 1ODUA 4Q6JA 2J4GA 1AFSA 1M53A 1WOAA 1W32A 3RU8X 1Q6FA 3SCPA 3M47A 4LYPA 3V16A 1W0MA 2OCZA 4DHGA 2QDGA 5FJRA 3TN3A 1GEQA 2CXEA 4JIIX 3PP7A 1KM6A 1LROA 5D03A 2BASA 3W7RA 1K7EA 3QYSA 3GIQA 2G4JA 2XYLA 3C2FA 2PDNA 2O92A 2FLIA 4AZ6A 3WEOA 3EWBX 5LZLA 3ZOAA 3SCSA 1ZRQA 1XDJA 5J5RA 3LLFA 3VX1A 2J77A 1FWJC 4J2MA 3NXLA 4I9AA 3BQ5A 1QASA 1WO2A 4HIBA 3GFXA 2HS6A 4DWSA 5CLTA 3H6OA 3WBAA 2BGSA 3C0QA 3S9IA 4GX8A 2CPUA 3GXFA 2VZUA 3U3HA 1BXCA 2OQLA 3LZ3A 3T0TA 4P8WA 3WD0A 2WB5A 3A4JA 1EHNA 2ZTJA 2OSXA 3ZLFA 4HHLA 1FTXA 2B7NA 1Z42A 2QJIA 3D46A 3AMCA 1L8PA 3QMRA 4M19A 2Z7KA 2ALDA 3E02A 3NNTA 4GMEA 3E0IA 4GIRA 1FHVA 1BRLA 4K1WA 4LRTA 4YTTA 1WAWA 1SM9A 5HDRA 3BUVA 3R13A 2YCIX 3QZAA 1FXPA 1JCYA 3ZLGA 4A35A 3L4ZA 4C1LA 3E5PA 1S1RA 4Q4RA 1R2TA 2QLYA 1TWZA 4MGGA 3WMCA 4DNMA 4KIEA 5G4EA 4H41A 4IQLA 3QR3A 2XFFA 4PYSA 3P0XA 3UESA 1B90A 3P82A 4JIPA 3N19B 5HK4A 1RQEA 4L4LA 4HZ6A 2VR2A 4NZCA 1HP5A 3GXDA 3UG3A 3VDAA 6TIMA 4OOZA 1CCWB 4U3CA 4LWWA 3PUOA 3O8AA 3AYVA 3GHUA 2UY2A 2EG8A 2ZE3A 3WEMA 4RNIA 1GQKA 1QCWA 3BZGA 1I45A 3RYSA 2VT0A 3EKLA 1DTUA 1IXOA 3VD3A 4X0NA 1EJ7L 1H2JA 4GBDA 1W56A 4HNNA 4DYKA 5LSMA 1BYCA 1YNYA 2Y62A 3BARA 3PTDA 5E09A 3EWDA 1XC4A 3EB4A 2DT3A 3GKAA 1FH7A 2J88A 3IJIA 1QT1A 1Z8AA 3KCLA 2OZTA 1S1PA 2ANUA 4XTDA 3MWAA 4LBUA 3IPWA 5GQBA 3U48A 3AOFA 2WCGA 3BJTA 3Q58A 3BLEA 1T8XA 3RR1A 4IGNA 5IOBA 3PB0A 2J24A 3UWYA 3NVDA 3VDCA 3WD4A 3KOWA 5BOOA 1KKOA 4DBWA 3OU8A 2DT1A 4QQ3A 3EB3A 3LGGA 2GSEA 4Z08A 4CU6A 4G6CA 3FXYA 4PUKA 4ZO6A 3WG6A 4WSJA 2CHOA 1PYFA 1V08A 4LSBA 3VM7A 2CZ5A 4A4AA 2V5DA 4H83A 2QDEA 1CLXA 3UYIA 5DO8A 1GG1A 4DWSB 2ZFAA 2Z28A 3PANA 2X7WA 4EOUA 2YDQA 1NOWA 3VIGA 3B3DA 4FNSA 5HR7A 1K6AA 1XGZA 3W29A 1QJWA 2HPIA 4GVGA 1SSGA 2OLHA 1U5VA 2OPJA 2GK1A 1BD0A 2QCLA 4IMFA 2CLIA 1BTCA 4E8CA 4ICMA 4YNGA 2BXYA 4XIMA 4HMCA 1JD9A 2XU2A 4J1OA 1G94A 4LCRA 3VCCA 3KL0A 2O9OA 1MXSA 4I90A 1ZBVA 3R0DA 1BRLB 3TYDA 1A0EA 4FOUA 2YA2A 2TAAA 3K4AA 3GZAA 3T78A 3BCFA 1VD6A 2HK1A 1XISA 2VVNA 4N2YA 5I06A 4AFYA 4CNTA 2QIWA 3HPFA 4GK8A 2BY0A 1VH7A 4GGBA 4PMNA 4A2RA 1R5YA 2F9RA 3VDGA 3O6AA 4JTUA 4AU0A 2C19A 4OJYA 4O0QA 1Y8BA 3N4EA 3PC0A 4ZB5A 3PAOA 4L9XA 1W2VA 3CUFA 1TWSA 3CQIA 1L6GA 4C6BA 4HNLA 2OWWA 3II1A 1Q7MA 1M65A 4UCFA 1XBVA 2DSKA 5E6ZA 2R24A 4NAEA 1J79A 4K2SA 1YKWA 2GL5A 3F4DA 3P93A 2A6LA 2H6RA 3KRZA 4G8TA 4L4PA 4M6QA 2WHMA 1VIWA 1UA3A 3G0SA 3AU2A 2X1RA 1J01A 4GY1A 3W6LA 3FA3A 5D2TA 1JYWA 3UETA 4W87A 4OOUA 2YZ5A 3TZFA 4C6DA 2DVUA 1PPIA 2GGEA 4WCJA 4XISA 4J35A 5C9XA 2BGQA 3B9DA 1Z89A 1BEUA 2BVDA 3S2LA 1FY6A 1FWWA 1Z9AA 5K4XA 1XQLA 5FKYA 1V3KA 1XIFA 1IGSA 3AQUA 1DIDA 4UTUA 2J79A 3LNMA 3WF4A 1WBJA 1HL9A 5HMEA 3K8MA 5HJXA 4GXMA 3L2LA 2OWCA 1QI2A 1GHRA 3SY1A 4LPCA 4OV9A 2C8NA 1EC7A 1TPC1 1PS9A 2GVJA 2ZKMX 3FVDA 1AQHA 1DWGM 4PCNA 5BWAA 4Y96A 3ABOA 1OGBA 4AY7A 3MC5A 3OLEA 1EGZA 1GEHA 1GK8A 4FNRA 4QROA 3QV8A 3W1AA 3T0DA 3GM8A 2HVOA 2YPIA 4S1FA 1POKA 2WNWA 3LM7A 2GK1B 2PDGA 4M6PA 4IIGA 4B2DD 3H2MA 3IK2A 2O56A 4H9UA 5HNUA 1HL2A 1VGAA 4IZGA 1FHUA 3O6YX 3LMZA 1N8IA 3WMBA 3TYUA 2E6FA 4GC4A 4DJDC 4L1WA 3ZM8A 2Q02A 4AHQA 3UCDA 5H8MA 4MWAD 3PN8A 1GOQA 4D71A 4WOZA 5BOEA 5CAHA 3LCGA 3BPWA 1S2VA 2ESCA 1E9IA 2FPVA 4Q8UA 3PZOA 4LGXA 3STCA 1WCGA 2WKJA 2DPEA 1KM3A 3TN6A 4B4HA 4H04A 1GYMA 1VBGA 3EEZA 4US5D 3EMCA 3AHXA 1MMFA 3U5UA 5CG0A 4NX0A 2BX7A 5CBBA 1L9WA 2DT2A 1LBFA 3SUTA 5CC3A 1WXYA 2NLYA 3FYYA 2WKGA 2WSPA 2A2IA 1IXPA 1Q4NX 1L8NA 3AHYA 4JHMA 3LZ5A 3LA4A 1A5SA 5AYIA 2XM2A 4JFWA 3C2RA 2ZTKA 1PHWA 1B3WA 1E71M 4JYEA 4RE0A 3S5NA 2PZNA 5CSYA 3M16A 3P3BA 2A3LA 4OTKA 1RJPA 3NYZA 2XPKA 1YBQB 1FWGC 3ARPA 1OC7A 1GVRA 3PTKA 1YXYA 4M1BA 3T2PA 1MRAA 1XIHA 4MUZA 4WDWA 3W7CA 4ZZ9A 4JQ3A 5AOUA 5XINA 4JTKA 3EPNA 3AYSA 4MHBA 3GH4A 3AAMA 2C16A 4JTJA 2WYSA 1V6TA 3LCFA 5DN1A 1R86A 4UOJA 3H7VA 3UWEA 1B3OA 1KGWA 1J4EA 4LS2A 2YL9A 2J8TA 4U10A 1Q7QA 3GG1A 4IL0A 1I8JA 1TYGA 2F6UA 5HNRA 2ZUVA 4FO4A 1PWMA 2CCRA 3GC2A 1J0ZA 3SCRA 2HVNA 3L4WA 2EG6A 3QHMA 5ECUA 2YB4A 1E5JA 1J2WA 1MQPA 1U83A 3ZT5A 4Q4QA 1TQXA 1L6YA 4CUCA 5HANA 4DX3A 3Q37A 2PLMA 3MSDA 4QISA 1E0XA 1N55A 1R3WA 2D0HA 2VX4A 4AZGA 1MW2A 4LANA 5D2XA 2SFPA 2BLEA 1BF2A 4HOWA 4IF2A 1EJVC 3LMYA 1EX1A 4BFAA 3ENLA 4F0SA 3ES8A 4E8GA 3LCIA 3G8RA 3IEBA 4O12A 2VX6A 2E28A 4XG1A 3QR1A 3S6OA 2FZ9A 1XYBA 3IVSA 3NPWA 4DWDA 3G1RA 3FOKA 4JNZA 4MNMA 5D32A 2XZ9A 1GYLA 4QGCA 2A3EA 3NSMA 4NL1A 1RR2A 3UG8A 3WQGA 4XVEA 4G2DA 1YDYA 1SO5A 4KEUA 1K02A 2VC6A 4QG9A 4GOAA 5AYYA 4HTYA 2QJJA 4W5ZA 2G50A 2W4XA 1RXOB 4H9VA 1EP2A 4B3ZA 1IEXA 3SCWA 2QQ6A 3MCOA 1DQXA 3UPBA 3DFNA 3NL3A 3WK0A 1AD1A 3VOIA 3AHVA 4AIBA 1YTEA 1JZ7A 4F2BA 1VHNA 2ABAA 2C91A 4A21A 3IRSA 3TQ0A 4JL2A 3WNMA 4KFNA 3BG9A 1GG0A 1HG3A 3TYAA 2XGZA 2X05A 4I5UA 4GPNA 4HNUA 2V38A 3E0LA 1OVDA 4JR5A 2QT3A 4XZNX 1KRMA 4BWLC 4ZO9A 2W63A 3UJEA 1RAKA 2BB0A 2XWEA 4JKKA