2EJAA

Crystal structure of uroporphyrinogen decarboxylase from aquifex aeolicus
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
337
structure length
337
Chain Sequence
PKNDLLLRSLRGEPIGRFPVWLMRQAGRYMPEYRKIRNRVKNFLELCKNVDLATEISLLPLKILGVDAIIIFSDILVPLEPLGVKVEFVEGEGPKLSWSGKVSDLKKYDPSQNAYVYEIIKRVKEAQDEVPVIGFAGAPFTLLSYLIEGGASKDFKSTKLFMWENPKEYKRLMDILTETVLAYLKEQIKAGADVVQIFDSWVNNLSLEDYGEYVYPYVNYLISELKDFSDTPVIYFFRGSSSFIDLAVDYRADALSVDWSVDIPELFKIYDKGFQGNLEPAVLYASEEVIEEKTLGLLRRIPVKTRYVFNLGHGLAPDMELEKVKYLVDLVKSFPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen decarboxylase
publication title Crystal Structure Of Uroporphyrinogen Decarboxylase From Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
total genus 128
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2ejaA00
1JPKA 1U1UA 1JPIA 2INFA 1U1HA 3CYVA 3GVRA 4L61A 3PPCA 1R3RA 1U22A 1JPHA 1XDJA 3GVVA 4L6HA 1R3TA 3PPHA 3PPGA 2EJAA 1R3SA 3GVQA 1R3WA 1J93A 1XPGA 3BQ5A 3GW3A 1R3QA 3GW0A 1R3VA 1YPXA 3T0CA 3PPFA 1R3YA 4AY8A 4L6OA 2NQ5A 4ZTXA 3L7RA 4ZTYA 2Q71A 4L5ZA 1U1JA 2Q6ZA 4AY7A 1XR2A 4QQUA 1UROA 4L65A 4ZR8A 1T7LA 3GVWA 4EXQA 3RPDA 4L64A 4WSHA 3BQ6A
chains in the Genus database with same CATH superfamily
4DF1A 2PC4A 3H24A 4CQ9A 5JU6A 3GAYA 1HGYA 3EWBX 3VIGA 4LU0A 1W9VA 4MNLA 3S42A 4D1IA 1UWAA 3RR4A 4GC3A 1EA9C 3UPBA 1NAL1 4GUGA 1ISWA 1GUVA 2OEKA 4Q4OA 2FVKA 2VFIA 1OFAA 4HSHA 1WAUA 4PYSA 4EIVA 4UFLA 5MF5A 3EOLA 1BWLA 2XGZA 3BPWA 4ADSA 4IH3A 2E9BA 3LHZA 3IAPA 1MXSA 1W3KA 2OGJA 1T7LA 1VZWA 2QYGA 4RDWA 3C52A 1P6WA 1E4MM 3QPYA 4ZO7A 1AMYA 2Z7KA 3UXIA 5D05A 4GVGA 2UY2A 3E9AA 4Y9AA 3C2RA 4FB7A 4JNYA 1L6YA 1US0A 4FS9A 1I2NA 3QF0A 4MZYA 2P8BA 4O14A 3H12A 4TTGA 1MUWA 1CGWA 1OF6A 1G6CA 1MZRA 2DSVA 3UF9A 2X1SA 2B0MA 4AFYA 3MUZ1 3RU8X 1HUVA 5HNTA 4EF9A 5CZSA 2QQ6A 5K9CA 1DIEA 4R88A 1L6FA 2JQXA 3H2EA 3ZT7A 4F48A 3N2OA 2Z1XA 3ZLFA 4DBWA 1QXLA 2ZE3A 3CV7A 2OSXA 4TMBA 1K9DA 4YCOA 1XH0A 3PZQA 3PFRA 1WDWA 3PTKA 4XO7A 3SN1A 3D47A 1KM4A 3SBFA 4L56A 2C1IA 4LTSA 4XD3A 4MVAA 3HN3A 1W6TA 5HULA 3WK0A 1GQLA 4J9JA 2R6OA 3MY9A 2I9UA 3UGVA 1KM0A 3ARPA 3PZTA 4FXJA 3SAZA 1ZBCA 1ZJAA 4I6KA 3VMPA 2J75A 1TPFA 1V93A 3SW6A 1A47A 2QV5A 4ONVA 3A22A 3LCLA 1VRDA 4HPXA 5FD0A 1FH8A 4YS1A 2VDIA 1NDWA 1GEQA 1BYBA 3ZJKA 3B3DA 1OY0A 3NXFA 4OBRA 1XL9A 4Z0JA 1I75A 3IJQA 3EWYA 1X1NA 3MA8A 3W2NA 2FB2A 1TV5A 4LUSA 3EA3A 4DNHA 3CUIA 4HPNA 4A3UA 3V16A 3VNMA 3UG5A 1E1CB 1UJQA 2C14A 1BPLB 2OWXA 1V6YA 3CL7A 4UTWA 3BJSA 4NXSA 3DFPA 3GLCA 4D8LA 5CC7A 5BMXA 4LVAA 6XIMA 3AISA 2VP8A 3GDTA 2O9OA 5C8BB 1S5VA 4O8AA 4R9OA 4GYPC 1W3JA 4QRNA 4PL1A 2VCAA 1NWUA 4LCQA 1FH7A 3SECA 2DT0A 1K7EA 1TZ9A 1CZ1A 3WIJA 4WOZA 1ADDA 2RKXA 1V02A 3IVTA 2CLMA 5D04C 2VEMA 4IIHA 2V5JA 4Q32A 4QLJA 1H7RA 2EKGA 3EX1A 4R53A 4QDMA 3EMQA 3I7QA 2OSWA 4D71A 1U22A 4TTUA 2NUYA 2YXOA 2QZRA 1BWKA 1I1XA 4W88A 2IXVA 1F6YA 4Y9NA 2GGGA 2WCSA 4AD5A 4B3KA 1LRTA 1PIIA 2D0GA 3NM1A 2QUMA 1KCZA 1BFNA 1UB3A 3HQPA 3VC5A 1FWCC 2DQXA 1R47A 1GPFA 1HKMA 3F7JA 7REQB 3NQVA 3AXIA 5EYWA 4DJDA 4QXIA 1NWTA 4UR8A 4ZODA 2JIWA 4JQ1A 3ZJ8A 3WBYA 1W5PA 4HA1A 1E3XA 4K8EA 3HG4A 4UTLA 3EDDA 3P62A 4XZIA 3S8HA 1R87A 3EXSA 3WLPA 1J4EA 3TA6A 5H8PA 4R7JA 3ARQA 4NYYA 4O1AA 1YQ2A 3VGEA 3M16A 3W7HA 3NXLA 5HR7A 4WXZA 3WLRA 2OPJA 4GUFA 4NVTA 3TROA 4A22A 3O1NA 4JHZA 4NRRA 5SWUA 2VNCA 3KS6A 5CGMA 4TIMA 4Q6XA 1IV8A 1H50A 4ML4A 1XPYA 4LVBA 1LQ0A 2FYMA 3BGJA 3WD3A 2YCKX 1XLMA 2BOGX 3CYVA 3MVIA 4YU1A 3ALFA 3NGFA 5I7GA 5JVLA 2HPIA 3B0XA 2G3JA 1EHAA 3VOIA 3H2NA 4MUZA 1OC5A 2AMXA 1IXPA 2J8TA 3BAYA 3WQ5A 1GONA 1EDGA 2GDQA 3OLDA 2X0HA 3A3XA 1K9TA 4PUEA 5C7VA 3W4RA 4E3VA 4L9ZA 3H70A 1BYCA 2GOKA 2V81A 4IMCA 3KL5A 3WJZA 1D7KA 5DEZA 5KZMA 7A3HA 1R9ZA 2O9RA 1JAKA 3DG6A 5T8GA 2IW0A 3WH8A 3SCVA 1NU5A 5JIPA 2CZDA 4LSBA 2J47A 3MCNA 1A5KC 5CBBA 1I60A 1ICPA 3IV8A 1HFBA 2ZUMA 1DJYA 5A6JA 4D6DA 4H7CA 5A8GA 3V4BA 3M47A 2QMJA 4BF5A 1B9ZA 3QV7A 2YB4A 2DW7A 3LS9A 4WEVX 3W72A 3QY8A 3JVAA 2POTA 3G1HA 2VFGA 3EGJA 1L2UA 4PRRA 2V3GA 2NQ9A 2FPYA 1BTCA 2QCLA 3SIMA 4ZENA 4UXDA 4JL1A 4K6AA 3PBUA 1W2PA 3OIHA 1C9DA 5HQLA 2OX4A 4UFHA 4XD4A 4B16A 4JX5A 5HR6A 2ZOXA 2C8NA 5LXXA 5DY2A 1F3TA 4HU3A 3RUBL 3VK5A 3CZLA 4LC6A 4ZOEA 2GUUA 2E25A 3W22A 2B81A 5ABTA 1XBYA 4RNIA 4Q8QA 4S3GA 1AK5A 2BGSA 4ZVJA 4DN1A 4BZYA 1MDRA 4PN2A 5A6MA 1BVNP 3W0KA 1GQKA 3HV8A 5D2VA 1WO2A 3OQEA 1DXEA 3RIKA 1ZP3A 2PS2A 1QI5A 3WJYA 4E38A 2ON3A 4EWJA 5C55A 1UROA 1SW0A 3N18A 4DXVA 2CBUA 1S2CA 1TREA 4V33A 1E0VA 1OYCA 4WY0F 3ABQA 5CSSA 4NAEA 3TYAA 5CG0A 3DOPA 3U0HA 4MKNA 4D2JA 3W1AA 2VURA 5DANA 4FXRA 3VGFA 3BMVA 5FSDC 2WVVA 4UMCA 2CBJA 1RH9A 2VEKA 5LNWA 2D24A 2DSUA 4XBSA 5FF2A 3B97A 3UA3A 5AYIA 4MB5A 1QOQA 1MYRA 5G5IA 1UC5A 2JEPA 1I1WA 3OG3A 4RNFA 5IM51 1GOOA 2VXNA 4XVDA 4P8UA 3NQFA 3LHTA 3SCSA 3ITXA 3LLXA 4HK6A 1JZ5A 2REQB 3LRKA 3IGXA 3H54A 5H1WA 3T1GA 3LQGA 4YMZA 2XSXA 4GZIA 2WBKA 4NZ5A 2XGBA 4IP4A 1GYLA 4CQDA 1ISXA 4AU0A 3R25A 1OCQA 2QAPA 3PWIA 2C71A 2WMJA 4UBPC 3W1NA 4IMAA 2VR4A 2YCEA 1EP2A 2J74A 1TPC1 2VQUA 2ACUA 2YXGA 2RDXA 5G2WA 2ZRUA 2PSNA 5EMLA 4IP7A 3P82A 4LVDA 2XIJA 3W02A 3OU8A 3KVJA 3LTSA 4YTSA 1LWHA 3EXTA 2PP3A 3TFXA 2CIPA 2W66A 3B9EA 4IL0A 1XP3A 2EEXA 2HS6A 2A6NA 2CEQA 3QTPA 1EBHA 1KBBA 2J9YA 1P4CA 3LENA 3NVDA 3GUGA 5I02A 3OIXA 4IGHA 3G1RA 4LRSA 1Q2RA 4S1FA 3CQJA 3GB6A 5A95A 1FHLA 3GU1A 3R7MA 1PDYA 3GQYA 3L0NA 4IJCA 2DPEA 4DO4A 3UVAA 4GNJA 2WCAA 3E74A 1JULA 3RM9A 1LP6A 2FZBA 3K8KA 3TN5A 5CH9A 4ZQCA 2FJUB 5KITA 5I3KA 4I7WA 1MNSA 1FHDA 4WUIA 3AMLA 3CZEA 3CWNA 3WH9A 1SJCA 4X9SA 4L9YA 4GCAA 3TW7A 1VEOA 3M41A 3GH4A 2E8ZA 2RGMA 1AG1O 4GI8A 3SGZA 1XUUA 5GNYA 3P0XA 2CETA 2RUSA 1T6MA 4X60A 1JUBA 3KOXA 3WQCA 3WZ0E 4V2XA 3VMOA 2EO7A 3GG8A 3UESA 1FWBC 2NT0A 3VO0A 2QVNA 5BXTA 3URBA 3PBVA 1ONRA 1R7OA 1TWIA 4TVCA 2FGLA 4HP5A 3I68A 1VH7A 1J6PA 3BTNA 1WUFA 2WOQA 3CQ0A 3GIYA 4Z17A 2QW5A 3IUDA 4OKDA 4GKTA 1RY8A 1XIDA 4DI9A 4AC1X 5CPSA 3CL8A 1NDZA 3GVGA 4H2HA 5D2WA 3LRMA 3E96A 5K4ZA 1KCXA 1I8JA 4LUSB 4JTDA 4QJ4B 2J62A 1A3HA 1Q6QA 4XZWA 1PCKA 4HTBA 3ARSA 1NEYA 2ZVIA 1QRQA 2L5HA 2VGIA 3K8LA 2HK1A 3MP3A 4S2BA 5L9FA 4C6MA 3B4UA 1DIDA 4I3GA 1KD0A 4RPQA 1Q6GA 4CEXC 1W91A 4DZHA 1O94A 2F6XA 3BV4A 1EYEA 3BSHA 4LUIA 3I7SA 3VOCA 1YTKA 3UERA 1UOKA 4DRSA 1QWGA 3T07A 1I9CB 4GNKB 1WXZA 3TWBA 4GIAA 5FESA 3OVRA 2H8XA 3VD5A 3Q94A 5K2ZA 1Q8JA 2WYSA 1SR0A 3E6EA 3LCHA 4IMFA 5A5WA 3WQGA 3MB9A 5CC5A 4JQ2A 4HT3A 2D2JA 3GG1A 1OADA 2CLPA 3G6LA 3UJ2A 2GGEA 4UNKA 1NVMA 2PD5A 1CGYA 2GYIA 2GQ3A 3AS1A 3N1AA 3AYRA 4S23A 1NELA 3TNBA 4CEUC 3PY2A 4PODA 1DKWA 3HGSA 4LS0A 3VVGA 1YX1A 3GBEA 3LM7A 3ZQ9A 4DHGA 2X1UA 3PHAA 3GD6A 4C6BA 2WK2A 1OC7A 3HJEA 1VFSA 2QCCA 3PTMA 3QGAC 4PB4A 1N8FA 1I45A 4GOAA 1TIMA 4GY0A 3DEQA 3WUBA 2GJNA 3KBJA 1Z8AA 1WZMA 1PKLA 2VC6A 3IJ8A 3QRHA 4HD5A 2DZBA 1UJPA 1JZ6A 1X96A 1QW9A 1MVYA 3KRSA 2E6YA 2WMFA 1V3MA 3Q2DA 4O13A 3ZWTA 1YPFA 5IBXC 1TG7A 1FDZA 1K7XA 1KFCA 2A7PA 1UA7A 4RZ5A 3DKLA 5EMJA 4FLRA 1TJ1A 3ABXA 3COTA 1PKNA 3EOUA 1NIUA 1X98A 5AHMA 1ONXA 4ASTA 2YSWA 4E4FA 3NL3A 1XKYA 3TX9A 4W7WA 3W1PA 2NX1A 4G6CA 1Q8AA 3SCWA 1JF6A 2Y24A 2XN0A 2ZX8A 4MHBA 1IEQA 1BYDA 2P0OA 3VKKA 2PDUA 1GJWA 2Y0FA 1TVLA 5JMUA 3M5XA 3V7PA 4ZB5A 4FNRA 4RZ4A 3VGDA 3DKJA 1OK4A 1D3HA 3A3WA 2CERA 1GQNA 4B4HA 4GJ1A 3E0IA 1VHCA 3IVSA 1EEPA 4WRHA 5I2UA 3DC0A 1UQZA 4GXMA 2Z6JA 3DIPA 5D9PA 4CLMA 2QJNA 1IR2A 1XRFA 1UZDA 3B05A 4KRZA 1J93A 3ITTA 3W75A 3N11A 3NNTA 3T55A 2JGYA 3M0LA 4C1NA 1RAKA 1KLZA 4FALA 3HPFA 4HCHA 3KOZA 2YZRA 4B4FA 1QPNA 1TPWA 2P3EA 4J40A 3CHEA 4A8RA 4CQBA 4XISA 1CTNA 3GG7A 2CU0A 4JEJA 1THFD 2DU2A 1BF6A 2WHMA 2PA6A 4XBJA 4F8XA 4ZCWA 1BLIA 3LSBA 5LHEA 1XBVA 3L7RA 3IRDA 1VPQA 2CKSA 1L6GA 2PLMA 2W6RA 1GNXA 1JYXA 1XF0A 4JGDA 2VC7A 3W7QA 3CUHA 3W76A 4FZIA 2XU2A 1YDOA 1BXNA 3IEBA 1IF2A 5EMUA 2B7OA 2R8WA 4AISA 4AMCA 3WK1A 8RUCA 2J7DA 2CLIA 1KGUA 2WZMA 4A3QA 3N29A 4MY1A 2I14A 4QJ3B 2WQDA 3GO2A 2WVVB 1RA0A 1UD8A 3BG3A 2AQVA 3LLFA 4GYKA 3AO0A 3CM4A 3BE7A 3CAWA 2P5NA 2AQOA 4C60A 3KBNA 1TZ7A 4R85A 3T2OA 3SRDA 2ATSA 3MKKA 4BY3A 1XYZA 4GUIA 5KSWA 5HNUA 3GRIA 1X7FA 1AH3A 1EFZA 1GW1A 4JTUA 1B31A 2CW6A 4B5UA 2ASHA 3GVVA 4Z1AA 5I24A 5D38A 4B91A 4F79A 4I8DA 4OUEA 3O2LA 1QW8A 2A1YA 3T08A 4H04A 2C91A 4WDWA 2JKEA 3BAJA 1KV8A 1LCOA 2Z2AA 1A3WA 1EWEA 5AC8A 2AOSA 3VIHA 3H7UA 3AXHA 1PZ3A 1BWVA 1KBKA 5FACA 3VDCA 1JZ4A 1S2VA 3LLDA 1XIIA 4TR9A 4BF9A 2DJXA 1HO4A 1M7PA 3KDNA 1JPDX 2HDJA 3O8AA 4NSBA 1U5VA 4AYSA 3QYQA 4D72A 1LZOA 5JBEA 3NJ3A 2PGRA 4H9XA 1E6SM 3M9YA 3WEZA 3A64A 4XK2A 1E0WA 1ZAIA 4PUNA 4IGSA 3M4HA 3AICA 4Z1YA 1UKQA 3TJ4A 4H1ZA 1CXFA 4W9TA 3BICA 1O4UA 3S4TA 3CU2A 4B5VA 4YTTA 3GX9A 4GQGA 2CLKA 2QCHA 1B57A 2VVSA 4PTMA 4PCFA 3U7BA 3CV6A 1H3GA 3C3NA 3RM8A 1BYAA 3R13A 1IZCA 3V18A 4I7UA 1DEDA 1ODUA 1S39A 2PBGA 1ZENA 1JGIA 3UWZA 4C6PA 3P84A 1EGMA 7TIMA 2OQHA 4C5YA 2DY3A 3R11A 2DGAA 5H8MA 3WKZA 4W8LA 2D3LA 1QI4A 1U1JA 1A49A 1H1NA 2Q8XA 3AIUA 3MS8A 1MEHA 1ZGDA 2Y89A 1R8LA 1EOKA 1SO6A 2OU4A 1DHKA 4GFSA 5LZLA 3VXGA 1HNYA 4F0SA 1GG1A 2G4JA 3HG2A 4Y8FA 2Z27A 4AF0A 1UC4A 1PBGA 2WHKA 1EGVA 1N82A 5DN1A 3DERA 3LEPA 2OLSA 1D8CA 1O95A 3A3HA 4DVOA 3C2EA 2DSZA 4JZ5A 1UZ1A 5D32A 1K8ZA 4FX8A 1OT2A 3LCGA 1E4LA 4RW5A 6REQA 1DTNA 3L68A 1DV7A 2ZRYA 1KB3A 4JTCA 5AC7A 1JRCA 2CCRA 3S5NA 1XCXA 2PDJA 5C9RA 3N04A 5JBFA 1HX0A 3ES7A 1TCDA 2A3EA 3OZOA 3UU0A 5D8ZA 3K4WA 3XIMA 4AHPA 1B4KA 1JDFA 3PPFA 3MHFA 4V28A 4B5XA 1H51A 4H9VA 2J7CA 1Z7AA 5BXPA 1XLKA 5I0DA 2ZE0A 4Q8NA 1LQAA 1E51A 5HOSA 3W1MA 2BODX 4HB7A 3Q58A 3T0AA 2VFEA 1PYFA 3W88A 4AWEA 3ARVA 1QI0A 1H4PA 2R14A 4R34A 5AZ1A 2P50A 3UXKA 3GTHA 1JZ8A 3UJFA 3KW3A 3V35A 3TUUA 3Q4DA 3APYA 1N55A 4RL3A 3P3BA 1HJWA 2R24A 2XWEA 3FK4A 3CEPA 1GQJA 3VD4A 3TQPA 3FJ6A 3ZVHA 3CGTA 1OD0A 3EB4A 1ONWA 3CV1A 1QOPA 4EWND 2WSYA 2FVLA 3RR1A 1KW1A 5AHIA 2OB3A 4MJZA 2ISDA 3MQTA 3E2VA 4MZ1A 3E3HA 5U4NA 1H41A 1HL2A 1VCGA 3UPMA 4GWEA 1N8WA 3SSZA 1P5BA 1WB0A 4IPLA 1KFJA 2HMCA 1XLHA 4LPCA 2WWDA 1BF2A 4JFUA 2D69A 3RF9A 1E5JA 4PEKA 3L21A 2OWCA 1OK6A 4M51A 4EX4A 3A4XA 1Q45A 3S5SA 5F2LA 4A4AA 2ZWYA 4QQUA 3F5KA 1OYAA 3WENA 2FKPA 3BUVA 3WDQA 2OO0A 2BG5A 3OW1A 5CJ5A 1PKMA 4HNLA 4J28A 1A5UA 3GNXA 4G2DA 1TRDA 2KX9A 1H61A 3VIIA 4OHQA 5A2BA 5BMWA 3BCFA 2PF0A 4DNMA 1QHOA 3C6CA 2EG8A 4AD4A 4IOTA 4XB3A 3AWOA 5JIWA 3BW2A 2BVWA 5AY7A 3SUTA 1AJ2A 3QZ6A 4J27A 1DXIA 1J0ZA 2FIQA 2WV8A 2QNEA 2Q01A 3UFYA 4FXFA 4DZAA 1IQ8A 3ARTA 3CB3A 1A5LC 1C8VA 1UD2A 2E1DA 2WVTA 5I23A 1K1DA 4NP7A 4L64A 4QAIA 5AHEA 1WDQA 4LS1A 4KKXA 1GOIA 3F5LA 1O66A 1LT7A 1NWRA 2D1ZA 5TBOA 2PUZA 4C1KA 4QEHA 1NQ6A 1LRQA 3NCOA 4AYGA 5AN7A 3C5QA 1QPQA 3UP8A 1OX5A 3NQAA 3D3FA 4LCRA 4ZSUA 2WKJA 1UP0A 3NL6A 4MDPA 5HQEA 1X6NA 2NWSA 3MZ2A 1E0UA 1D3CA 2ONEA 1GZ1A 1SU5A 1J79A 3KXQA 5IHRA 1KLYA 3TSMA 3N17A 4KCVA 2Z25A 1XLEA 3T8LA 3V5FA 2O0TA 2VRKA 2OKTA 3FJ4A 3RAOA 3W01A 4P8XA 4LFYA 3E0LA 1KM3A 1GOQA 4AEFA 4I5UA 3DGBA 3QR0A 1GHSA 4HCLA 4NJJA 1E6ZA 4PA8A 2AL2A 2OR2A 1QI3A 4RKAA 3WMBA 1HKIA 4QSFA 1KFEA 1I2QA 1Y5XA 2F8QA 2OQLA 1FHUA 1GYMA 4AD3A 1YYAA 1J12A 4IPIA 3ORWA 3VFLA 4BWLC 3ZVIA 3B8VA 3QOKA 3E5BA 3W29A 1KR1A 2QUUA 3FSTA 3DG7A 3QW3A 2J88A 4GNVA 4J2PA 1TTPA 1VYSX 5LNUA 3KDOA 1TCMA 1H2JA 2Y61A 4CD7A 4JDBA 4M24A 2A3LA 1AD1A 1V3HA 1K8YA 5HJLA 2VO5A 4GI4A 3O6AA 4LRTA 1AMKA 3NO1A 3LHVA 2X0SA 1JRBA 4H6QA 3GDLA 1C29A 2VZUA 1LL7A 1H0IA 4RZBA 1WBJA 3TN4A 4WXYA 4QG9A 5DRCA 3CAVA 3WY1A 4OGZA 5FJJA 2J27A 1IWPA 4PMOA 1UPPA 4YCPA 2XN1A 4REQA 2GWGA 2PTWA 2FTWA 2G41A 1CGXA 1JDEA 3IGSA 1UBSA 5K4XA 2W3ZA 2XH2A 3P60A 4ZL1A 2PFHA 1XYCA 1EXBA 1QNPA 4E3TA 3CTTA 1MQPA 4X0VA 4XQ6A 2PWEA 4PMUA 3NUKA 4U2YA 4W86A 5F2MA 4HNTA 1DE6A 3VU2A 4O15A 3ES8A 4L4MA 4LYRA 5DCEA 1HIZA 2DVXA 4O1BA 4E4PA 3PC0A 1WZLA 4ZTYA 3GDBA 1VEPA 2WKLA 2PLKA 3L4VA 2BXZA 2XFRA 4V15A 3R94A 3VDBA 4V1XA 4K2SA 2E7FA 5AYBA 3AS3A 3FS2A 4IFKA 3U4FA 2BTMA 3ZXWA 3T2QA 4AUBA 2C0HA 1IT7A 4HMEA 1TFVA 4MJMA 1PTDA 3DHPA 5RUBA 1R86A 5HUPA 2WZHA 1SMDA 1C8QA 4CNPA 1VGAA 1O1HA 4FLOA 2CNCA 3QY7A 2D2OA 3CMFA 4P7LA 4LF2A 1V3IA 5BOFA 3DFNA 1HTIA 4NJHA 1POJA 5C2CA 1OWQA 2F9RA 1A5AA 4QG8A 2X2GA 5KEZA 3O0KA 4EACA 5TF0A 3PSVA 2FB3A 4UTHA 1KKOA 1T41A 4GBUA 2V68A 2Z1WA 3U48A 4U3AA 1FWWA 4I90A 4XAPA 4M1BA 2NV9A 1QNOA 3SY8A 1Z48A 4CNOA 1YTEA 1HL8A 3WG6A 1ITCA 2VKZG 1RXOB 1E55A 4GY1A 1NJJA 2EKCA 1S1RA 2PP1A 3UY8A 4I9MA 3MSGA 3VOFA 1SO5A 1AZ2A 4UQ9A 1NARA 3RILA 1I0BA 2ACRA 3NPUA 4AF0B 3L4YA 3W25A 1AQ0A 4ZO9A 3B4YA 4IM4A 1OZQA 1SZNA 4OTKA 4AAJA 3CH0A 4EPKA 4GQQA 4M81A 2ODOA 3A4AA 4RLIA 3MPGA 3W70A 4DXKA 4JYFA 1EQPA 1Q6RA 2OMAA 1R3WA 1CLKA 1XXXA 3WDIA 3LCIA 3ZLGA 3AMGA 1FCBA 1OGSA 1QU4A 4EAMA 1UKSA 3AS2A 3W1XA 1MZHA 1F61A 1XISA 9RUBA 2INFA 5JUVA 1FA2A 2BXYA 3W00A 1AH4A 3KUMA 3SSJA 1M7OA 4NT0A 3PUDA 4XKYA 1JI2A 5A6AA 4S2CA 4U3CA 1NQKA 2Q3OA 4B15A 3HGOA 3FNDA 2QKFA 1IE7C 5IHSA 1LL6A 1CXKA 1OYBA 5AECA 3S9ZA 4MJ4A 1W1VA 4Q22A 2ISVA 3D0CA 5CSRA 1OJXA 1U33A 1X8CA 2XPKA 1A0EA 4BWLA 2Y62A 4WGXA 2E0PA 3KOYA 3LTPA 4WSJA 2XJ7A 3ZVHB 2ICSA 3TYZA 4YN5A 3S5OA 1FWIC 2F61A 4I8YA 2YLAA 3ARUA 3KFTA 3LCFA 3G6MA 5AHLA 3QSTA 3DYOA 2J79A 1C7TA 4GYJA 3EWWA 1VR6A 4OV9A 1CWYA 1Z41A 4IF2A 2Z29A 4U31A 3AROA 4POCA 2NX3A 1HJQA 1WUEA 2E5BA 3TYUA 1OZMA 3OA3A 2YCLA 2XGIA 5M2FX 3G1XA 1L6SA 1GHRA 5LYRA 1XI3A 3FVMA 4YYCA 3LGGA 3ZJ6A 2ZZ5A 3INPA 5MKGA 4ZOAA 4BCEA 1AL7A 2PLJA 1XLBA 2VHLA 1TPH1 3MWAA 3BH4A 4R33A 4DJFC 2J24A 1VHNA 1K7FA 3PTDA 5I3DA 4PUDA 1A5SA 3AS0A 2QUNA 4NZCA 4L4LA 3GY1A 2BY0A 4ZQNA 3JZEA 1KO0A 1JF5A 4JN6A 3JU2A 4HMNA 2PURA 3O15A 1MW2A 4PMZA 5CPTA 3KZPA 4L9XA 4A6GA 3GHSA 1M65A 4K36A 3O63A 3QKEA 4LYKA 3ZR5A 3DFQA 4US6A 2XINA 3DFSA 3NSNA 2FTYA 4S3KA 3C0LA 4ES4A 5BRBA 1VFFA 4P7OA 1PKYA 4OUIA 1QR7A 3S5YA 3WH5A 4MJ2A 4HCDA 4AMAA 4E6MA 5JH2A 2QHAA 4Q8UA 3KHJA 1NDYA 4QNWA 4NJIA 5E6ZA 2W5FA 4V1YA 3TOYA 1ECEA 4OFCA 1ZAJA 2FZ8A 2BMBA 3UY7A 3R8HA 3L4UA 1F3EA 5AHFA 1SMAA 3RMJA 3N15A 2WNQA 1EOMA 2GWNA 2OQYA 3PUEA 3STEA 3IARA 3QV8A 6PTDA 4GH3A 2POZA 2ZX6A 1RQBA 2QCGA 4ZQRA 3OTRA 3WQ4A 4UOZA 3S2MA 3WD4A 1GVSA 3ELFA 2F2KA 3FX4A 2FJKA 3MI6A 2OT1A 4HSOA 4C6NA 3S83A 4LC8A 1AQFA 2YFNA 3TW9A 3OLGA 2H8ZA 4U5KA 1H1ZA 1TMQA 3MMWA 5G2HA 1D7FA 3L4TA 1JPMA 3NQ8A 4GO9A 1S5WA 5C70A 3B0VC 4F9DA 1M53A 3KTSA 3T09A 2ABBA 2RHGA 4WK9A 1WKDA 4M19A 3WJSA 1V8EA 2VMFA 4L80A 2I1OA 1EO5A 1CB2A 1QCWA 4DF0A 3EKZA 3BOLA 4XO6A 3VCNA 1FWNA 2VENA 1BKSA 1B1YA 5G1MA 1AZ1A 2HNEA 3QMSA 1XGZA 2R91A 3QHNA 1R3QA 2FZMA 4CNTA 1DJNA 5H91A 2HSAA 3PN8A 1Z9AA 4KEMA 4RZ6A 4YTUA 3WLQA 1FY6A 1GZGA 3W71A 4MOZA 4REQB 3ME3A 3NL5A 3SY5A 1NFGA 4JIIX 4HTYA 3I3BA 4GE8A 5HMEA 3UZXA 1CGUA 2HZGA 3S1UA 5CAHA 3DHDA 2GJPA 1J0KA 1EEXA 3OBKA 3STGA 1EX5A 2GGHA 3M07A 3ANYA 3CAKA 4Z1DA 2J25A 4EANA 4Q8OA 4B3LA 4B9YA 1EIXA 5BNKA 5CGQA 1UW9A 3AXKA 4HA4A 3HG5A 4HNOA 1VD6A 4XAYA 1FWGC 1HP4A 1KCKA 2INZA 2NSXA 3NR0A 1RCXB 4LJ3A 3GFZA 2OZ3A 3URNA 1IXOA 4MLJA 2E9MA 4OZOA 1EP1A 3AOFA 2CXEA 2O9PA 4GBDA 4IFKB 3W7OA 3QHOA 2DFAA 2I57A 2ZZ7A 4AXKA 4ZA0A 4OVXA 4MAVA 3CJPA 1CDGA 4M5PA 3N25A 2P10A 4JN7A 3ID7A 2ZA2A 4PMDA 5C7HA 3CQHA 1VFHA 2Z0IA 2VM8A 3TH6A 1ZY9A 1F74A 1XICA 3TJLA 1PIGA 1VYPX 2A85A 3IS4A 2Z1BA 3WCZA 1JYWA 4V27A 4M6VA 4IXXA 3RCNA 2VZSA 1JPHA 2J9XA 3CIVA 3KS5A 1VEMA 3G0SA 5FAGA 4P8VA 3QMTA 1V3LA 3C86A 1OSEA 4L4OA 3L4WA 3W2LA 4W5ZA 1HJSA 1T8QA 2O55A 3KLKA 5C0QA 3IGHX 1RQEA 3ITCA 2D3NA 3W3OA 3BK0A 5LSMA 2PDLA 2E6FA 2QCNA 3LTYA 1YPXA 1DWIM 3VNYA 4TQTA 1CXLA 3W7KA 3AIQA 1QHZA 4LX4A 5BZAA 3MYPA 3TTYA 2AMGA 1WCGA 5M1TA 3K30A 3A23A 1G0CA 2H90A 2NQHA 3AMKA 1SJAA 3VM7A 3DESA 3FXYA 4O18A 2PDIA 5TQLA 3F03K 5H6HA 3SO7A 4WKHA 5CZTA 2WZTA 3QOMA 2HWGA 4DYJA 2P53A 1X7IA 3MWCA 1TELA 3LNPA 1MQRA 2PGEA 4PE8A 3U57A 3CL6A 3RDKA 3IK2A 4MIMA 4AW7A 3OZPA 4L6DA 1GPWA 3B8IA 5F4SA 4MDOA 3QJAA 2GJXA 1J5TA 3W84A 5ECUA 2DZXA 2Y88A 5DMLA 3HFTA 2BOEX 3R2GA 3TWAA 4WX2A 3CZGA 1BQCA 3S2JA 4URIA 2PI6A 4GZ7A 4MWAE 1VBRA 3G24A 1MWOA 4NILA 2PDMA 4F2BA 1W3HA 4FX6M 2ZX9A 4FMVA 4J3UA 5LGZA 3LG3A 4C6IA 2IPFA 3HMCA 4DJFD 5EB8A 1BHGA 3KAOA 2Q8LA 1Q4NX 3KRBA 1B54A 3P8IA 4GZJA 2OKOA 1UR8A 3W7RA 2VC5A 2QT3A 3JZUA 1YADA 2MANA 3IACA 3N3MA 3M0IA 3AZSA 3NZPA 2PPGA 3GIPA 1H7PA 2GL5A 1BGGA 1RP8A 1BXCA 3KLLA 3AIRA 3GC5A 3VABA 1S3HA 1W1YA 4HPHA 1ZUAX 1ISVA 2GVEA 4DEFA 4N4PA 3HF3A 5AVHA 3A6OA 3LI0A 5D33A 3MV11 2ZZ2A 1ODZA 2EHHA 2YCLB 4R5EA 1W3IA 3AQUA 1HJXA 1GZJA 1UIOA 3SQSA 5BWFA 2X42A 4IX2A 1Z44A 5MKGB 6A3HA 3UQNA 4WDTA 2BP1A 4XD5A 1ADSA 3CPRA 4N7QA 4KERA 3W7CA 3IUHA 3THUA 3GVWA 5CC3A 5DMNA 1TPB1 3W2KA 1V0NA 1RY0A 3ABOA 1KA9F 1J9YA 2D20A 3SGUA 3WQWA 1IYXA 1FWSA 2WLZA 3SCRA 1UUMA 3QQ1A 1XIFA 1G4SA 1EC8A 5FEXA 1JPIA 3QV9A 4KEZA 4LT9A 3P81A 2NQJA 3UETA 4W85A 3VGBA 4P7RA 3TOPA 4KIRA 1XPGA 3Q45A 2R1PA 1UA3A 5FL1A 1WDSA 4BQ4A 4JBRA 1LROA 3C61A 2PBOA 1UR1A 3W73A 1W9DM 1I4NA 5LNRA 3W74A 3P93A 1YDNA 3UG8A 3MHGA 3AHZA 3CT2A 3HOJA 3WLLA 1NF0A 5BU9A 4WHBA 1SFLA 2EPNA 3TIMA 1PCWA 5HMDA 3S6OA 4US5A 5LHFA 3ITOA 2XG9A 3A9IA 3T05A 3CAQA 4WIWA 1RBLA 2V3FA 2XVNA 2ZKMX 4FAMA 1R3SA 3HU7A 1JQXA 4S38A 1EIBA 1UD3A 7REQA 3GS6A 4DO5A 3BG9A 2OG9A 1PV8A 3WBWA 3ITVA 3S6DA 3W1RA 4GC4A 3EWZA 4KT2A 4QE4A 4CKQA 4CQ8A 1AODA 4NXKA 2HRWA 1XYBA 3PPGA 4H3DA 4MPKA 2Y7FA 4J4KA 4MY8A 4MPQA 4ZQPA 4XX6A 1UWRA 3ANUA 2X09A 3UA4A 2F6KA 3WDHA 3V0UA 4TV6A 4LAOA 3KL3A 1TB3A 8XIMA 2XFWA 4MY9A 1K8XA 3APTA 2I17A 3W28A 2CZVA 2E3ZA 1XH1A 1XC6A 1ZFJA 1A0DA 2UZ9A 3ARWA 1W3LA 2Q3RA 1ESWA 3N4FA 1Q2SA 4QISA 4J35A 3KWXA 4FEZA 1P0KA 3H6OA 3VD3A 3W6YA 3UJRA 4O1FA 3SRKA 3TTEA 1V08A 2FGBA 5HQMA 2Q02A 3TTQA 3AXMA 4JN8A 2YB1A 1EXPA 5CSUA 1F5ZA 1WE5A 1J5SA 4WOQA 2FPTA 2VOMA 3TYDA 1GVRA 3EOEA 3V0TA 3RJXA 4GGBA 4QSHA 3EPOA 3RO6A 1TRIA 2HVOA 4FNUA 1AL8A 1OFBA 1L9WA 4NU7A 1XUZA 3VUPA 1XCFA 3GVQA 2BVTA 3EAUA 4WF7A 1W1ZA 8TIMA 4TVUA 1CBGA 4LCSA 3FW6A 1GVEA 2FQIA 3IJ7A 2VC9A 4RUBA 2EPLX 3OA5A 1H0GA 4U33A 4OJYA 3W1LA 4KWWA 3G1AA 1UR0A 4FF7A 4JPGA 1VPXA 4C6FA 1TZZA 4M80A 1SSDA 4M1RA 4UFJA 1GT8A 1IT8A 3WX7A 4IFOA 3QVQA 1X6LA 2F6UA 1VRXA 1PS9A 2W0UA 4LB4A 3F4VA 4L6OA 1LLOA 1XDLA 4IQLA 1TTQA 1SR9A 3CUGA 3L2LA 1M03A 2WM1A 2WWCA 2X1RA 3S0CA 5DMYA 1H5YA 1L8NA 1P1XA 2XH0A 3H2FA 1DE5A 3SGGA 2PDCA 1J0IA 2NWRA 3FEMA 3Q65A 2ZTJA 3IWPA 3VNKA 3W83A 4RE3A 1V0KA 2ZQ0A 5J5RA 3WH7A 4GQBA 1HW6A 3P2VA 4IXHA 4KWOA 3FXGA 2D0HA 3CK5A 3WEOA 3N2TA 3QR1A 3T4CA 4FHAA 4XVEA 3RLVA 4GUHA 4RV3A 4IUGA 2VZVA 5FIPA 3A4WA 3H4WA 3E2RA 5I06A 1RVKA 2C3ZA 1EDQA 1JI1A 5A6SA 3ITLA 3PUGA 2DIJA 1KC7A 1IEWA 5FOOA 4PZVA 1QNRA 1S46A 3BARA 5FJPA 4IL2A 7ENLA 4HK5A 4E8DA 2B7NA 2DIEA 2UV8G 5CPNA 2I5QA 3WK2A 4QS5A 5AHNA 1E0TA 3KWSA 5FCZA 2VD8A 3ZSSA 1UR2A 2PDPA 4DBEA 1UKOA 1QFEA 1GVOA 2X7WA 1DIKA 5AYYA 5A3HA 1OEPA 3CO4A 3DN5A 4OWGA 3GW0A 2WJDA 2CYGA 3KTCA 2H3DA 3GU2A 3GR7A 5ENLA 1J10A 1FXQA 2V6AA 3NEHA 4N6FA 3MP4A 3UWQA 3NPVA 3GHUA 4O57A 3W7JA 3T2PA 3T4WA 1XRTA 3GYEA 4Z08A 3QTGA 4GJJA 2YL8A 2REQA 2QF7A 1S5MA 1OGBA 4X2PA 2QV4A 3SZ8A 1TPVA 4LQ1A 2RGLA 7PTDA 3UVIA 1S2AA 4OOZA 3MUCA 1WAWA 3B8UA 1M7XA 1TPEA 3VX1A 4D8ZA 1NWSA 1S2WA 3PZ9A 2VFDA 3M7SA 5IFPA 4QDPA 5BWAA 3IVUA 2FZNA 1R3YA 5CG7A 2VX6A 3I7RA 4ZFCA 3IJLA 3IJDA 1YXYA 4ATWA 3N13A 4MB1A 5F4XA 3WNPA 2D2HA 3PJWA 2HVNA 1VBGA 3MANA 4IG2A 4PTWA 1H63A 2GJXB 1TMHA 1H7NA 1Z3NA 3PJTA 4I5XA 1I2PA 2HV5A 4GVIA 2JK2A 1K4HA 4B2DA 2DV0A 2YYTA 3KCLA 4AD2A 4LH8A 1JZ7A 5ABEA 4LF1A 2D2GA 4AZ6A 3EWDA 3M0VA 3W86A 4GX9A 1W8GA 1DWFM 3PJUA 2IKGA 2WVSA 4H19A 4KFNA 4QIUA 3FDKA 3HIJA 4BHYA 1RPXA 4DWSC 3CHCA 1J11A 1W9BM 1LF1A 3OZYA 2SFPA 4HNVA 4QJ1A 1P6CA 3PBWA 3WQEA 3IIVA 1DXFA 2NVDA 4QP0A 1F4HA 3EXRA 3FYOA 1F8IA 2XDFA 2TRSA 1W5NA 2J78A 3RPTA 5I07A 2GUBA 3B04A 3KRUA 3PK7A 3VGHA 4HU4A 3B0PA 3L0KA 4W8AA 1RBAA 1A0CA 5HWNA 2G3IA 3CMGA 5DQPA 4F9JA 2HE8A 3SUUA 4M3PA 1CB7B 3FGCA 1UZ4A 2C18A 1FUYA 1EUNA 4DJEC 1TO3A 4JNZA 4JTAA 4JR5A 5GPRA 2HJPA 4GXPA 3L12A 3PZVA 4I9TA 3QEZA 5IDZA 1KFKA 2NVCA 4FLSA 5AC6A 1Y8BA 4O10A 1TE6A 3CIWA 4XG1A 3ANVA 4G7FA 3DYMA 4KFOA 4AWTA 1B5TA 4Y9MA 4GISA 5HPCA 5HJYA 2QDDA 1WDDA 8CGTA 4B2DD 6CGTA 5E9XA 1QBAA 3AIBA 1WXJA 3S2LA 4Z2IA 1SFSA 1XRSA 3RX2A 4AZIA 4D6CA 4JAWA 4M6PA 3EWCA 3RPDA 1E3ZA 4L1XA 4CUCA 3NGJA 4EE9A 1WKEA 4GIYA 4L6HA 4P61A 4N6EA 2OXNA 4INFA 2NQ5A 2XVPA 4Q4KA 4PUKA 3FKRA 1WA3A 1KNWA 1J0HA 1M41A 3WLJA 4B5NA 4NZFA 1M68A 4B92A 4Q7IA 2BZNA 3W7LA 1PX3A 4AX6A 5DY3A 1POKA 4D6IA 2PWUA 3BQ5A 4M0XA 4ZEPA 4D6GA 1XIBA 1Z6KA 4MUPA 1JUEA 1J0YA 4YTQA 1DJGA 3WMSA 2PTXA 4YNGA 3WSUA 5GJMA 3NM3A 3EKLA 3M0HA 3MUY1 1RP9A 2JF6A 3WBAA 1Q3NA 1JXKA 1UH2A 3F1QA 3VKDA 4GLEA 4KS0A 1A5OC 1U83A 4K8HA 2WMIA 4TXEA 4XV0A 3WQ8A 2YX0A 3T40A 1JEZA 4EXQA 1KQZA 5E93A 4MM1A 4EXAA 3CC1A 1UQYA 1EDTA 4PSPA 4W89A 1AQHA 1JGMA 3B40A 4OIFA 2BGNE 5HBFA 5HATA 5F4WA 2YL6A 3PB0A 2TMDA 3LERA 3QW4B 2DVUA 1NFPA 4JOMA 1SW3A 3GYCA 1M5WA 1E1FA 4ADUA 1CXIA 4LVGA 2BB0A 3KL0A 4E8GA 3GXDA 3WLHA 1ITUA 1Z89A 2XFFA 1MI3A 2BS9A 2Z24A 3DC8A 4HN4A 4GHRA 4NX0A 4S3DA 1PTAA 2WMHA 4LGXA 3EYPA 1FP8A 4AG0A 1AVAA 4FR6A 3BVJA 2FGZA 3MHUA 1V79A 2QCDA 1XQKA 3M64A 2FH8A 3GHRA 4QX4A 5GJPA 1DORA 5K9DA 4LEQA 4GIRA 3BOFA 3G0UA 3IUIA 3N9SA 2R94A 4U28A 3DXIA 5JBDA 3AZTA 3VI2A 4LOCA 2HBVA 1VBJA 4DXXA 1ME9A 4X63A 4LBSA 4Z2GA 2W91A 2NXIA 3W85A 3HZ3A 1ZLPA 5B80A 2PE4A 4J3ZA 4O8RA 4U4MA 1V5XA 4PRWA 4H9MA 4D6JA 3W53A 2RJHA 1XLAA 4ZXLA 3P5ZA 4JQ4A 4JTLA 1ADOA 3SFKA 3RRXA 2I5GA 2IPGA 2OFJA 3VX0A 4FIQA 3TLLA 4O53A 3W2MA 3MO4A 1K70A 3O06A 3NG3A 3TR2A 4DM2A 3GR4A 3PPCA 4DWSA 1H11A 3MSRA 4UOQA 1JYNA 1XBZA 1MSSA 2C6QA 2ZFAA 2GK1A 1VENA 1W9UA 1TVNA 3LQLA 3FIGA 1XLFA 4ZO6A 4AC7C 5KMYA 1VF8A 2PWVA 3BLOA 4XBKA 3VOGA 4RJEA 4NZ1A 3PG8A 4W5UA 2HTMA 4UNIA 4R27A 3HGJA 4H7VA 1XLCA 3AALA 4H8UA 1EP3A 3HURA 5HMSA 3MKVA 3TP4A 2V63A 2VEFA 3VKAA 4B9ZA 3H53A 3BOXA 4BI5A 5C2GA 2BFGA 1EO7A 4RE0A 1NP2A 3I6TA 3DBPA 1VFUA 2QAFA 3ZR4A 5DF0A 1V6UA 3W82A 3LPFA 3C0SA 1F2JA 3N6JA 4UR9A 3W7MA 1F6PA 3DBNA 1W56A 1K3UA 3W1UA 1TR1A 3ONCA 4NF7A 2XISA 1VPYA 4Q4QA 1U30A 4GA8A 3HPXA 1UP3A 2PWGA 1G7VA 2ISSA 4OECA 4PCSA 3NQ7A 1OD8A 2EPMX 1IGWA 3DFOA 4MNMA 1UKTA 2Y5JA 2YL5A 4HHPA 2O7SA 3ZFHA 1PZ0A 1YE4A 2B31A 4GX8A 1OGGA 1LBMA 2TODA 3S3GA 2OZ8A 3DDMA 5DXXA 4AZGA 3N2XA 1T5AA 3H2CA 3NO3A 1FHVA 2VX5A 3WJXA 1FRBA 1A5NC 1EL3A 3NVTA 3BZJA 5JH1A 3D6NA 4L1WA 1S3TC 4DWSD 1ZS2A 1SJBA 3AWNA 3E49A 3EWXA 1UOZA 5A94A 5I79A 3IIPA 4F2UA 4GYPA 4GZEA 2WO5A 3AMDA 9XIAA 3N6HA 1LOSA 1RUSA 3NFUA 1TTIA 1DYSA 1Q6EA 2V5DA 3P67A 4PMVA 2ZXAA 3GXFA 4J2MA 3WO8A 1DIOA 9XIMA 1QNSA 4AH7A 5G1YA 1DL3A 4JY8A 1B4EA 2DSWA 3WLSA 3F2DA 2FMOA 5JQ9A 3I4EA 3KOWA 3I65A 4OBSA 4UQDA 3RGTA 3MUXA 2VOTA 1TIWA 3L23A 3R79A 3OVPA 3HGRA 2DZWA 4PBFA 1GVQA 4IG2B 4OBTA 4DJED 3VM5A 1PE1A 1H62A 1YW1A 2PF8A 3BJTA 3HFYA 2PP0A 4KWSA 4F3HA 3VC6A 3GTNA 1AA1B 4DIAA 5LIXX 3VAVA 1LLWA 3G1YA 2ZVRA 1CIUA 4QHRA 1KRAC 3E12A 3WH6A 2V3DA 2QEZA 4KRUA 4NYUA 3QYSA 3HPZA 3V5OA 3G77A 3ZOAA 4J3WA 1W1A1 4UFMA 4MF4A 2BOFX 3LX9A 3VYLA 3MCOA 1SUXA 4B5SA 4QCEA 1WX0A 5C6MA 2R9RA 3I6EA 4LBUA 3BC9A 3WNKA 1U1HA 4Q4MA 2XTKA 4WDUA 2ZBTA 3S47A 1S1PA 4ZQOA 4G7EB 4WVXA 3EWUA 4IGMA 1GOXA 2DUAA 1A5MC 1MXGA 1I2OA 5EY5A 4UQEA 5KZEA 2VGFA 2GQ9A 4HYWA 3FGCB 3C3UA 3F4NA 2G3MA 5FF7A 3T0BA 1R9YA 3KP1A 4CQAA 5XIMA 2PU1A 3K5XA 3WNOA 1XD1A 4N9EA 4J1OA 4ATDA 3NSMA 4P7NA 1EF3A 2NSOA 4A8LA 3FFSA 4OOUA 3LMYA 1FVPA 1J2WA 1O12A 3LUTA 1GKQA 4QITA 1W37A 2YA0A 3LXBA 3TZNA 2IKJA 1C8YA 3W7EA 3LBMA 2H3BA 4FXSA 1JFHA 1R3TA 3N9KA 3WDJA 1J01A 3FA4A 3SQMA 2EGZA 2VGBA 1MO0A 2V9DA 4K39A 5E9AA 2AGTA 1YNPA 2A4AA 3UCCA 3XINA 1E70M 1P0DA 2HXTA 3RX4A 5AZ0A 2GFTA 4GACA 4Y2WA 5M3WA 1CNVA 1Q63A 3S5ZA 4AVOA 2Y8UA 4YLWA 1BTMA 3VNZA 4F0HA 3NSXA 3TXVA 3OVQA 1FKXA 4L1GA 1OFPA 1JPKA 2V82A 2OX1A 4QG6A 4Y9PA 3FA3A 3H4GA 1A3XA 1TA3A 3FLUA 1GOWA 2BBFA 2OWWA 3ZR6A 1JIBA 3R8RA 4WSKA 2F7FA 5DO8A 4CN4A 5HJXA 2Z4GA 3VNLA 1E72M 4ZO8A 3BG5A 1DPMA 1EJTC 2PD9A 4FSAA 4HZ6A 2GVGA 5E1QA 4C1LA 3HMJG 2OODA 3NPWA 2ZDSA 4PH6A 2XIOA 3RCMA 4UTTC 3TDFA 1G4EA 4BFAA 1LORA 2YW3A 3E1F1 4GI9A 1QVBA 3M0KA 3NZQA 2BHZA 4NJKA 3BANA 3NO5A 4D8AA 4JTEA 4W84A 3M5YA 2GGIA 2WMIB 2BWGA 3PANA 2QLYA 3FJNA 4EKJA 2BVYA 2VZTA 2PDHA 3FV9A 2YA1A 3CNYA 2DZAA 4E8CA 1PPIA 2XFYA 3THQA 5HPOA 1PAMA 1KTCA 3NQCA 1LQ2A 4ADTA 1PL9A 2BY1A 1RR2A 4I9JA 4A35A 3BLFA 3VPLA 2HROA 5C71A 1LBFA 3P8JA 3BCDA 3T8QA 3WF4A 4Q8WA 4HNUA 4QNEA 2E77A 3WDRA 1GVIA 4H7ZA 4H41A 2VTFA 2EG6A 3V5CA 4AX7A 1H09A 2ALRA 2WAGA 1W17A 5DFAA 4WZHA 1ZRQA 3SRHA 2QS8A 5JXQA 4LEFA 5IOBA 2H9AA 1XIGA 1FX6A 2W63A 3B03A 2QCDB 1E71M 2PC8A 1XW8A 1OG6A 3NQ2A 3Q37A 3VIKA 3I3EA 3ZT5A 3VZYA 4UNLA 1JCMP 4Z1BA 3GW3A 4GG9A 5EMKA 3V36A 4UMAA 3VKCA 3W7NA 4H9YA 3WDPP 1TJ2A 2YBUA 3E0WA 5FJOA 6ENLA 4J3SA 2PDGA 2BVDA 5T91A 1XGDA 3STPA 2Z6IA 3T7VA 2WPBA 3MUAA 1R30A 1SQ7A 5IFTA 1C91A 5D9OA 3V75A 1VFOA 1KM1A 4KCTA 3AHYA 1B30A 1PJ9A 1N2VA 1FQ0A 4DPPA 1G7UA 3VIMA 2FFIA 1FWFC 4PRTA 1OBAA 4UC5A 1CXEA 1HL9A 1PHQA 5A1AA 1A5BA 4ACYA 3A5VA 5FL0A 1E5NA 3MU7A 3OOQA 3SCTA 3ZM8A 3OVGA 1MFVA 4JFWA 1YBQA 4HQVA 5C54A 1LUCB 4DWSB 3KCOA 1M6JA 1ME8A 3EX4A 1JZ3A 4EPBC 4JQ3A 1E6NA 1FKWA 4O11A 3TW6A 3FA5A 3TMLA 4QM1A 2GK1B 3PAOA 3CLWA 5CQ1A 3FEQA 1H60A 1AJ0A 2Q8ZA 1US3A 3LD5A 2CC0A 4EF8A 1XX1A 1GQIA 2VEGA 3WD2A 4AWUA 3WQPA 1K77A 5DCDA 5G4HC 1OFQA 5K7JA 3PBGA 2XSAA 3FAXA 1IXNA 4E2OA 4IQDA 4UTWC 1XLDA 4FNSA 4PFHA 1BEUA 2Z26A 1OIFA 2IKHA 2NUWA 4JIEA 2MUCA 1VQTA 1J2BA 3S9IA 3V1HA 2JBMA 1XC4A 4C6OA 3QC0A 3BGAA 1UCWA 2QJJA 2A7RA 1MQQA 2XVKA 2VUNA 1ZJBA 2J13A 3AYVA 3GXNA 2ZDRA 4AQLA 5LKYA 1VFMA 2BNJA 3LN3A 3TR9A 2YDSA 3EOOA 3K1DA 2YGYA 3A24A 3KRZA 1C8XA 1ML1A 1OT1A 1UR4A 4H6EA 3LGEA 3IIZA 1H7XA 3W6MA 3ZYZA 2PGFA 2XH4A 3M0YA 1ELSA 3T9PA 3QKZA 1QHPA 3UR8A 4YHEA 1D9EA 1TVPA 3VINA 2C0AA 2QPSA 1QK0A 3KBVA 5TNVA 1E73M 3A5FA 3W6LA 2E8YA 3MYOA 1R85A 3G3MA 4NIRA 3GSMA 3USBA 4RPPA 3IGUA 2VD9A 3AUJA 3IJ9A 3MBDA 4WSHA 4DJDC 3Q67A 3C0JA 5AVNA 3SCPA 1REQA 4FI4A 3B8SA 5CJNA 2Y85A 3DG3A 5GNXA 1EC9A 2Y8VA 3EPMA 3UG4A 5LNSA 1V4YA 4UTJA 3SUSA 3VNJA 1B3XA 4CCCA 1G1YA 4K3ZA 1X6UA 3TQVA 1DJZA 3LV5A 2JFEX 4LNCA 2J77A 1HVXA 1YLVA 1VJSA 2DP3A 2ZZ1A 3CXOA 4RE4A 2G37A 2ANUA 3QC3A 1EC7A 4X0NA 1E6PA 4UTTA 2QGHA 1R2RA 2DQWA 3RLUA 1LWJA 1DOSA 2UY5A 3WK3A 3GC2A 4I5RA 3RLHA 3M46A 4NJGA 3WUGA 3JRKA 1UMLA 2F38A 1ME7A 4KGLA 2VR2A 3WQDA 1TX0A 1CW2A 5DRIA 5F7UA 1VP5A 3N6QA 3O0FA 4KF1A 2NV1A 1J6OA 1ZP4A 3U6WA 1BRLA 3PFMA 4PGLA 4C6JA 1UWUA 4DO6A 3VOHA 3LXCA 4F2TA 5KETA 4HHMA 3LRLA 1TMLA 3P74A 5GVJA 2DT1A 2Z1SA 3GZAA 1DJXA 3QGKC 3AU6A 3TQKA 3EMCA 4JTSA 3GVRA 1V7AA 5ECVA 4QROA 4O52A 3DGRA 1JYVA 2TPSA 5EA9A 4YHGA 3PBMA 4Y96A 1E1EA 2P88A 4UR7A 3MVTA 2ZX7A 4WR3A 3PBYA 1SZRA 3LY0A 3B06A 4E2DA 3TNOA 1FXPA 2BASA 3MBFA 3QY6A 4WKAA 1UBPC 3LNMA 5IBXA 1CLVA 2PTZA 1WOAA 1Q85A 4L7ZA 3NQDA 3M0XA 3TYCA 3WLIA 5K3VA 3U5YA 4C6DA 4HYVA 2NXHA 4C90A 2W92A 4PSRA 4NAFA 2FH6A 4JTGA 3ZWSA 1G69A 3VD7A 4GI6A 1A50A 2OYMA 1A53A 3W81A 3EB3A 1AJZA 4DF2A 1U5HA 3SN4A 2E6DA 3UD6A 3TSDA 3FHAA 1T40A 3POHA 3C2OA 1CXHA 1J8VA 1O5RA 4NKCA 2P0IA 3UXLA 1J96A 4O28A 3ZO9A 3ARZA 4CD6A 1RHCA 1WBHA 1LOLA 3PNZA 4BQ2A 1PZ1A 3QV6A 4F0LA 3HPAA 5TIMA 3KOFA 4WY0A 1SPQA 1XH2A 3M7WA 3SR7A 4WQ6A 3DU0A 1ZNNA 3QQ0A 1YEYA 4N9CA 4NZJA 2EBNA 2IS7A 3PR2A 2J9ZA 1IHIA 2AAAA 2OGYA 4ZOBA 4O54A 4NG3A 3OYZA 4P5UA 1YXCA 2VCBA 4JS3A 5G4EA 1TA3B 3XISA 5I3JA 1RZMA 1YTDA 1MFUA 2VEPA 4PUWA 4CVWA 4S3BA 3AYSA 2C7FA 2PDXA 1S5TA 2TSYA 4R7OA 4Q7BA 2PTYA 5A6KA 3UWEA 3SJNA 2ZXBA 1ZBKA 4FX7A 4LV4A 4DLMA 5A69A 4QCFA 3N19B 1A4LA 5LIYX 1C93A 4NASA 3F4DA 3W1QA 1Z32X 2I5IA 3L5AA 3S1GA 1T96A 3HQOA 4F40A 1I0DA 3GH5A 3C4UA 4IIDA 1PTGA 2JE8A 3TQ0A 3NQMA 3CO8A 1PVNA 1V3JA 3DAQA 4BI7A 2OEJA 4JKMA 2C19A 5CXPA 2YL9A 2C16A 4U5IA 5DX7A 2WHJA 3KTXA 3VE7A 1ZBWA 2J4GA 3QLDA 1XLIA 4I6VA 3AIWA 3MKCA 1FFQA 2HCVA 4A3RA 2OJPA 5I3IA 5CKSA 4LW7A 5FEZA 3NA8A 3LU2A 1UG6A 1DP0A 2J6XA 4KGJA 1NTHA 3DH7A 5G1TA 2G50A 2GQ8A 1LG2A 4LY8A 4GJIA 3RNDA 5EPDA 2C1GA 2PDFA 4DQWA 1Q7MA 3ITGA 1SM9A 3EDEA 3WFAA 4DBDA 1V51A 4LNYA 3S1VA 1PYMA 3AMCA 1KV5A 2DUZA 3GNOA 3GH7A 5B7YA 4LUYA 1W1B1 1DJIA 1KFBA 4A8IA 4HSNA 2H9AB 1RCOB 1LRNA 2RH9A 5K9XA 4JTKA 1XDMA 3G1DA 4CN6A 2B7PA 5M17A 1Q65A 1V02E 1OFEA 3MT1A 4ZFMA 2O4QA 1UP2A 1GW9A 1DWGM 1JCTA 2XVGA 1ZPTA 3WF1A 3OHMB 3GE7A 1JVNA 5AOUA 3SCOA 4MMWA 2WC7A 5LIWX 2W9MA 2GDUA 3U2CA 2Z2UA 2G0WA 2OT0A 2VJXA 3L4XA 1O68A 1P7TA 1KBLA 5C9WA 1GOMA 1LT8A 3R0DA 1QJWA 4N0RA 1XR2A 5DXYA 4L65A 4H9ZA 1NM9A 2G5WA 1ITXA 1RA5A 1EJUC 1U1UA 2OO6A 4UIOA 4M7TA 5HWJA 4JTTA 2BSLA 1CECA 1TWWA 2WSKA 3A21A 4P8WA 3VE9A 1JD7A 3EX2A 1Y5WA 2YXXA 2CFFA 4AZBA 4UWMA 3QZAA 2AKZA 3TMQA 4EK7A 4PMJA 4RV8A 1EF2A 3EBVA 3B0UX 1YBQB 1W9XA 1JCJA 2B7QA 5F1VA 3GNNA 4TMCA 4CU7A 1KTNA 3H26A 3TC6A 5D9MA 1G4TA 3IJ6A 5MHBA 4OT7A 4FF5A 2W79A 4ACZA 5EL1A 2WNZA 2AGKA 3KBWA 3LI1A 3SIZA 1EYWA 1RVGA 3EZ4A 1YXDA 4ECLA 1XLJA 5T9CE 3KX6A 1GYNA 6TAAA 5LA2A 4M29A 3E0FA 2PDQA 3SCNA 3LBOA 4H83A 4DJDD 3TN3A 1LOQA 4ICMA 2CKRA 3WQ6A 3ZMRA 4U2ZA 4Q6JA 2AAMA 1DVJA 1EB3A 1VC4A 4XZMX 4IZGA 4DB7A 4D9PA 1ZHAA 2OEMA 3QXBA 5AC5A 1RD6A 3SI9A 4EAYA 4CD5A 3FVDA 3E2QA 4ZGYA 3LDVA 1JNEA 5BCAA 1RQHA 3NZ1A 1HT6A 1TWZA 4GUJA 4W93A 3MDUA 3TTSA 1W1IE 1C9WA 3MSDA 1D3GA 5FA5A 2XWDA 3SDOA 2CZEA 2I7GA 2WW5A 4XUYA 4JX6A 2GVYA 4AWSA 3H7RA 2EPKX 4C6KA 1XFBA 4KIEA 1WV2A 4N4QA 3EDJA 3NAVA 4NL1A 5C9UA 4BQ3A 4H9TA 5BRQA 3G0XA 1R9XA 3GXIA 1JCYA 2CHNA 4ROQA 1REQB 2DUXA 2X16A 3K1GA 3RX3A 3LHWA 1KWKA 3GC4A 1RLDA 1CGVA 4JXCA 3VIPA 3T0TA 3DENA 3MV01 2A3CA 2DVTA 4O19A 4C6CA 3IANA 3CB8A 4NZ4A 1KM5A 3K4DA 4JTQA 1EPVA 3RFAA 1WKFA 4GFIA 4C5ZA 5A8OA 2QGYA 4Y7EA 1EZWA 2D22A 4GH1A 3AXXA 4GIEA 5CAKA 1N7KA 3GTXA 2OZ0A 4P2VA 3VMNA 3A13A 3PTQA 1W2VA 4ML9A 2YCIX 4Z2JA 4CCDA 2Y4SA 2PAJA 4ZB0A 3VKBA 2X40A 3NIYA 1E15A 2XM2A 2OTDA 2W62A 4FNPA 3WLTA 1GKPA 3A12A 5D8WA 2J7EA 3MUIA 1W3TA 4UZUA 1R3RA 3IK4A 2G4FA 1H5VA 5LA1A 1JCXA 1GJPA 4GINA 4IISA 4XTDA 4KRTA 3CIXA 4DY1A 1BRLB 7TAAA 3L2IA 4JEQA 3U2ZA 1WYIA 4IX0A 4K38A 3OJGA 3AI0A 4W4QA 1XSKA 1MXDA 2JKPA 4F66A 3MMDA 3O7UA 4ORIA 3TN6A 2O9TA 3ONBA 5A6LA 2YBTA 2DIKA 4Y6GA 1XSJA 2ZUVA 3FAWA 4B5TA 3V1PA 3PULA 3ICJA 3NOEA 4DWDA 3AFBA 1B0IA 1UASA 3UYCA 4PCPA 3K4AA 4E2BA 1KGXA 1ZB5A 4QQ3A 3TV8A 4Q8TA 1T8XA 3PZNA 1FOBA 2J7HA 4ICNA 4FOJA 4LANA 1UWQA 4IIBA 1V6VA 2X2YA 4NUWA 1QBBA 1F3XA 1WPCA 8XIAA 3LPPA 3VA8A 3B8TA 1O5XA 2A0NA 3IIXA 1UR3M 1U5JA 3THDA 4AIUA 4BS0A 2XZ9A 3G1SA 1LG1A 2VCCA 3SUVA 3OQ8A 3RN6A 2PU0A 4NAFB 1XRVA 1L2QA 1QNVA 4H4IA 4WJEA 5EMMA 2PRMA 3TCSA 2YR1A 3ZZ1A 4C7FA 1BG4A 4HKPA 3NQEA 2WHLA 4A05A 1VLIA 1LDCA 2CLEA 1T99A 3R0UA 3CEUA 4EOUA 4KBXA 2DEPA 1F7BA 3NOYA 1G9HA 1SZFA 4HJWA 1DQWA 3E0VA 2QMKA 1PB0A 2V38A 1UWTA 4Q8MA 4PR4A 2E67A 1Y5VA 4K37A 1M01A 1XIHA 4IQJA 2NW0A 3UR7A 3M43A 1B3WA 4KETA 3CS2A 3CYJA 3MJMA 3SUWA 2PDKA 3L67A 1SZGA 5F1UA 4XTIA 4H6KA 2V5CA 3O6YX 4WY0B 2V2CA 2HVMA 1Q7ZA 3L4ZA 1UUQA 1QO2A 3NZGA 5I77A 3NQGA 1TQJA 2O56A 1R2TA 2JEQA 1EBGA 4PTDA 5AKQA 2NVAA 2QULA 3OO2A 5T26A 2ZUSA 4ZTXA 4E0CA 4K7YA 3CHFA 2HXUA 1KWGA 2V5BA 3EA2A 4H8NA 1ICSA 1V03A 3QHMA 1OCNA 2OCZA 1AW2A 3REQA 1TYGA 1UD4A 2ABAA 3LV6A 3W38A 1RSCA 1ZJIA 3N4EA 3I6RA 4QJ5B 4LS2A 1O7AA 4FOKA 5CPQA 1IXQA 1XG3A 1QASA 2D73A 2AKMA 3FY1A 3T81A 1V0MA 1VFTA 3AU2A 5CPOA 4ERAA 2WZEA 4WJ8A 3SQLA 3TU9A 3BWWA 2GGJA 2NT1A 1RK5A 3C0QA 4JKLA 3O6CA 1E9LA 3CUZA 5KZDA 2QCFA 1V3KA 1OCBA 2G96A 4GPNA 3URQA 4G9PA 4CCEA 2WC4A 4BEQA 4JY9A 3WMCA 1PO9A 3B9AA 3CWOX 4AB4A 3W87A 1GTHA 4AIBA 3UJSA 2PRHA 3WUFA 2YOCA 3C2YA 1NF7A 3UWUA 4DUXA 2G3FA 2P1FA 1YNQA 3B9DA 1WNOA 3J7HA 4GMEA 3PWGA 5I78A 3OG2A 4RXGA 3GBDA 1ZQ5A 4MWAC 4AVNA 2E5DA 1AQMA 1ISZA 2ZRXA 3EOSA 1DQXA 3QN3A 5HWMA 1QNQA 2VWSA 1W32A 3ZT6A 1OINA 2QR6A 3W7PA 5I00A 1K03A 4N9BA 4QFUA 3IIOA 3KZSA 4QLKA 2NZLA 1TPUA 3TK7A 2WMGA 2J6VA 1O6IA 2CXGA 3I3DA 2BV9A 3VILA 1VFLA 1H1YA 1MEWA 3AYTA 1ZALA 4QTGA 5CCZA 4FIRA 4O16A 5ABFA 4O12A 1ZAHA 3BJFA 2WQPA 2OLHA 1ZSXA 2E6AA 3FJLA 4R7WA 1NFBA 1JCNA 3TTOA 5BW6A 1Q6CA 1PIFA 4YWIA 4DUVA 4CU6A 4ZE4A 5E09A 2C79A 2P8CA 3WMLA 2WM0A 1WDPA 3H7VA 4KESA 4Q8VA 3PP7A 4HOXA 1P7TB 4L61A 2V0TA 1MUCA 4M8UA 1EUAA 1SGJA 2J8FA 1FP9A 1TWSA 3R6IA 4MB3A 2G97A 2YCJA 9CGTA 5E0KA 4MZ8A 3UJEA 3BXWA 1QO5A 3I10A 1R46A 3TC3A 4XZ9A 4D6EA 2Z00A 3QZEA 5LNVA 1WP6A 1OF8A 3PPHA 4AD0A 3MC5A 3LYEA 2GLKA 2DORA 2NQLA 1UD5A 4ACZB 1UH4A 2E4TA 4L5ZA 4AY7A 1C3FA 4O1DA 2V69A 1Q66A 3L5MA 2YKKA 4PC8A 3G3DA 3MDWA 2CHRA 3LOTA 3AC0A 3WQVA 1KKRA 5DT7A 3IV3A 3UWYA 1V0LA 4DPQA 4HBKA 1PDZA 5D30A 2UBPC 2J66A 2WVUA 1TSIA 4R9XA 3WLMA 4YVVA 2LLEA 2FFCA 2E5CA 4UTUA 4J3XA 1RBOB 4ZR8A 3M1ZA 3MTWA 3P7YA 2OOFA 1IWAA 1E4NA 2Y7GA 2ISWA 2Y8KA 2ADAA 4HPJA 3TKFA 1VIWA 3T44A 3ITYA 2PDNA 4C6EA 4RNJA 3U5UA 1K6WA 2DDXA 3MZNA 3QLLA 1S5NA 4PTNA 1JAEA 2EPOA 3U2OA 1BKHA 2XIIA 5DELA 2VVNA 2VRQA 1M7JA 3MI3A 3NTYA 2ZZ6A 2WLYA 3BW4A 4MTVA 4QE5A 3AUOA 1MRAA 3TA9A 1L8PA 2GSJA 3W7IA 1C92A 2GVLA 1J18A 5IRPA 4BK9A 1DTUA 3ZS4A 1AW1A 3W2JA 3N9RA 4C6QA 4MFEA 2E68A 4ZBCA 1ZCOA 4KEUA 2TYSA 3VUSA 1KRMA 3O16A 5LXEA 1P0NA 2KZHA 4PCNA 2ESCA 4NAEB 1FH9A 3SFWA 3KVKA 2QUVA 4CNUA 2ACQA 1KBIA 1B3ZA 1FCUA 3IRSA 4YYFA 1XDJA 1TQXA 2DZVA 4D6HA 1W31A 2QDHA 1OVDA 4PMQA 5HK4A 1X38A 1JZ2A 4DBUA 3TE9A 3T0DA 3U9IA 1V6WA 5FF3A 5DCBA 4QEEA 2PWHA 1QK2A 5H2ZA 1HZYA 4XIAA 1YKWA 5E0FA 1RV8A 2FDMA 3BAWA 1EJWC 4RCXA 1NDVA 2CESA 5AYZA 1N8IA 4M6UA 3WLOA 2PCEA 1TJ0A 3WLKX 2DT2A 1EJRC 2Y7EA 2NUXA 2V30A 5IXEA 5D2YA 5EMYA 2G8ZA 3GAKA 1FWTA 1RALA 1QDSA 4AIEA 1A5CA 4H8VA 2Y5SA 2NX9A 1V6XA 3TAKA 1AUSL 1MEIA 1QUMA 3QMRA 3UCDA 3OP2A 3URAA 2VT0A 2JALA 4IJRA 1PX4A 4PTXA 5M03A 2CLHA 1RCQA 3BZGA 3CT7A 1MRQA 2PRLA 5A8MA 4DJFA 3BSGA 3M0ZA 4AVFA 4DO7A 3BO9A 2R1MA 4MWAA 4QR6A 3CUFA 4UQAA 5TAOA 1DBTA 1ZCCA 3M0JA 2A7NA 5CPLA 5FJIA 4G56A 5D2XA 3FSUA 2CZ5A 2Z28A 5FEPA 5D2TA 1US2A 3WUEA 2A3HA 2VEIA 1TJRA 1XSIA 4RXFA 1HKWA 4LAZA 2OYKA 3TEVA 4AHOA 3TFCA 5AFDA 4JIRA 3G2GA 1V77A 4PUMA 4CD8A 5D09A 1JCLA 3GFYA 3HM7A 4QLLA 2C13A 4HN8A 1W0MA 3FN9A 2EJ1A 2ZUTA 2OSYA 3W2UA 3CBWA 2WSRA 5F2IA 3BURA 1UHVA 1QI2A 2F2HA 1W1TA 5D02A 4HZ8A 5FF4A 3ZLHA 4IIEA 1EQCA 2YJQA 4Q4RA 4W8BA 2XM1A 1ZU8A 1XYFA 2OVLA 4DZ5A 2E1WA 2R1NA 3R5EA 5BOEA 2QXWA 3OBEA 4IP5A 2IQ0A 3S6TA 3STCA 5E5CA 4IMEA 4CGTA 2QCEA 1XGEA 1D8WA 3DCPA 1KXHA 1OABA 3RHGA 3P0WA 3GWQA 4LVFA 5CBJA 3M5VA 4IMGA 1E56A 3PWAA 4NRSA 3DUGA 3VZXA 1WOBA 3GHTA 3AHVA 1FCQA 4LB3A 3OLEA 4BF7A 1PXGA 1UUOA 2DW6A 1XLLA 2ZIDA 4QS6A 3S1XA 3RM4A 2VGGA 1YHTA 4XAGA 3ZSTA 1G01A 3REQB 1QTWA 4B5WA 4O0ZA 4JTIA 4MWAD 1Q6FA 3VIJA 5FJTA 5BOOA 3LSCA 1IR1A 1V6TA 4OV4A 3SCQA 2WZIA 1HN1A 3RG6A 2VX7A 3W23A 4JCLA 2O92A 3N2MA 5DBTA 4A2RA 1X39A 6XIAA 4JCMA 3EPNA 2I16A 3W7GA 1JXJA 3OYXA 4TOQA 3VKJA 1DWJM 2CWXA 3O05A 2EG7A 4PMYA 3WL0A 3BAXA 3FKKA 2VDGA 3HQ1A 1FWAC 3TVAA 1ISYA 1TE1A 1EPXA 4MYAA 2QCMA 4ENLA 1YDVA 3PAJA 5FKYA 1LWIA 3AAMA 4BJHA 2A2IA 3UZZA 4RDZA 3VNDA 2INEA 1UIPA 4IUOA 3SM0A 2GJRA 3GR8A 4UTFA 2DZPA 2V2HA 3N73A 1E0XA 1XLGA 3PUOA 1IT0A 3UG3A 4G8TA 2NLYA 1VBUA 2OELA 2UY4A 3LHUA 5U7SA 1S38A 1XKJA 5D03A 1Y7VA 1BG9A 3AJ7A 6ALDA 3EEZA 1DWHM 4YJ5A 1GKRA 4NQ1A 3U7VA 1GJUA 2IMRA 1UH3A 2GOUA 4UQCA 2Y5EA 1EJSC 2FVMA 3F4WA 4PUJA 3STFA 4XKMA 4CVUA 4YIWA 3D5HA 3CHVA 3B9NA 4QAWA 1JFXA 1UMYA 3RLGA 5CPMA 1DHPA 1OG0A 2ZWZA 4JKKA 3MW7A 4A29A 1KRCC 4Q7NA 1L0PA 5IDIA 1ZTVA 4O50A 2CLFA 5ABFB 2YPIA 4TU1A 1P43A 4PBGA 3UGRA 4Q4SA 2HQAA 3UCQA 2DZUA 1TV3A 2D0FA 5BU6A 3BAKA 3GG0A 1TKKA 3C2FA 3PZIA 3KBMA 3P80A 3GIQA 3QPEA 3WEMA 3PSWA 1E6QM 4QDWA 1HKVA 4PL2A 3VFCA 1WKYA 4K1GA 4LUJA 3ABRA 4UFKA 3D46A 3HBLA 1F76A 2ZXDA 1O60A 1IZJA 4HYRA 1TUXA 4AY1A 1OM0A 3TC7A 2EAWA 3VD9A 4AZHA 1J0JA 4DBSA 2BXVA 1XQLA 4HK7A 1SJDA 2P3ZA 2FDSA 3RITA 2QDGA 1BVZA 3H23A 3PNUA 1ZBVA 1H49A 3H8AA 4MYXA 2HNHA 4NNAA 4Z2LA 3G1VA 4O17A 1TUFA 1GCYA 3GNPA 5GNZA 1KRBC 1XIEA 1XFCA 2IUZA 2QJMA 4LWWA 4AZ7A 2WNWA 4AHQA 1GTEA 2QJIA 4BA0A 1XHGA 5KTLA 5A6TC 3E38A 4DYKA 1BD0A 2WMKA 3ENLA 4HU0A 2XIMA 1KM2A 1VAHA 4UB9A 3HTWA 5A6BA 3K8MA 3OHIA 4W7UA 2EPHA 2HISA 2IXUA 1BGAA 4JYDA 2ZZ3A 4Q8PA 4GKLA 1KCLA 3CUJA 1EGZA 4GVHA 4C6LA 5HINA 2XSBA 4EPEC 2J8GA 3R43A 3G8RA 5H8UA 3MO7A 5E70A 1JG9A 4TUFA 1YRRA 1GVFA 3HO8A 3SURA 4ZQMA 2VDHA 4C1NB 1PZ2A 4KWVA 1F05A 3AIEA 3GXMA 1EJVC 5C2XA 2Z1KA 3VIOA 3VDAA 1RK6A 2PDBA 3ECQA 3ZJ7A 3ATZA 4RW3A 3KBSA 1UKPA 1E6RA 3GKFA 4KMQA 5FSEC 3WF3A 1Z69A 2EF9A 4TX8A 4HNCA 1MUMA 4JQAA 4YVXA 3EMZA 2BY3A 2J7FA 4KEVA 1GOKA 4DZIA 1G5AA 1B2YA 3CQKA 1LLZA 2A3AA 4F0MA 4IIFA 1D2KA 4UZSA 2ZICA 1QPKA 3OZMA 4BR1A 1YE6A 2W61A 1IEXA 4S3JA 3GUWA 2FMNA 4ORMA 2NQZA 4DI8A 4IPJA 1L6WA 1DJHA 2R82A 2I56A 3N14A 4XAZA 3UT0A 5FJUA 1TR9A 1A80A 2IQDA 4QE1A 3S1WA 2OZTA 3HQNA 1GGOA 4TO8A 1OC6A 1AW5A 4UTIA 1EHNA 3WD1A 3BLKA 2TAAA 4K7VA 4FP1A 4PBEA 5HAOA 1ECQA 1AH0A 3GDKA 3U2EA 4F0RA 1W1PA 4GVFA 4CD4A 1QT1A 5I3HA 3WELA 1WQ5A 1XS2A 3GK0A 4P7QA 1JDCA 5A6BD 3W27A 4OQVA 2ISFA 2V2DA 3CWHA 1FDJA 5EBAA 3MP5A 3WFZA 1HKJA 4GXWA 1TJPA 4K68A 1NY1A 1K9EA 1Q5MA 4O0KA 3WNMA 4GO8A 1NOFA 4PB5A 1IZKA 3FYPA 1UWIA 3R4IA 1CENA 1SO3A 1HGWA 1WZKA 4JTFA 2QDEA 1XBXA 2R1KA 5ABHA 4LAMA 3LGDA 4DAFA 3SCUA 3OBAA 2VI0A 2XIBA 2Y2WA 4A3HA 2G3NA 4Z2KA 5I03A 2A79A 1IIHA 4W7VA 1IEVA 1FBAA 1XWYA 3MMUA 3NPXA 5C9XA 2PDWA 2W67A 3W9ZA 4HA0A 3GTIA 3OEXA 1HP5A 2V67A 3MMTA 6TIMA 1U2YA 3CASA 2CHOA 3KVLA 4DUWA 5FF0A 3TJIA 3IPWA 1HQTA 4MWAB 2XH7A 5J5DA 2X1IA 3C2VA 4JNMA 3UXAA 4ZMGA 3WNNA 3UR5A 3GNDA 4HMCA 2XIQA 4HZ7A 1T0OA 3LMZA 3B9OA 1H7WA 1R6WA 4LBRA 2YDRA 3RCYA 5XIAA 2VUYA 2GUYA 4IWWA 4O1CA 1RD5A 1Y65A 1Z42A 3IJIA 3NURA 3USZA 5HXMA 3GDRA 3SJ3A 5EBUA 3SRFA 3WBXA 2XN2A 1CEOA 4MG4A 2RDUA 3KP0A 1A4MA 5LGXA 3KHDA 3I4KA 3OLIA 1FCVA 2F84A 1CI1A 4O1EA 3LK6A 4ZOCA 1PWLA 2ZUUA 1O1ZA 2GSHA 3GFXA 5PTDA 4A3YA 1EH9A 1KBJA 3ZIZA 1OFDA 7ODCA 2ZADA 4JHOA 4WKFA 2V5LA 3TJXA 4LUTA 3AIVA 4FK9A 2GJLA 4GY7A 5REQA 4KCWA 2IPJA 3O9NA 4Q4PA 4CNNA 4Q33A 5AYXA 3QH2A 5DMMA 1P48A 6REQB 1Q13A 2YDQA 3GXTA 1XJBA 2JF7A 2J7GA 2YLLA 3T42A 1TX2A 3BV7A 3POCA 3BLEA 2NXGA 5B7ZA 5I3FA 1FWHC 1MW0A 3D3AA 1VCVA 3DZ1A 5CZ0A 3CHDA 1XINA 2ATMA 3HA1A 3BAIA 3N2CA 3EKGA 3GU9A 1WDRA 3M0MA 2DH2A 4LAUA 4YWSA 2D23A 4NNCA 1F73A 2Y7DA 4JIHA 4LALA 4X2RA 1F07A 3S46A 4FPSA 2A21A 2Q71A 5DT5A 4G7EA 1FWDC 4A2SA 1F4AA 3K13A 3L5LA 1CT5A 3NQBA 3UNDA 1KR0A 1E4IA 1MNZA 4UMBA 3T78A 3H55A 3ARYA 2A3BA 4KPLA 2EQDA 3W1TA 3R0KA 1R7AA 4X9YA 4UQBA 3WF0A 2ZZ4A 2QVHA 4MLRA 3CUXA 5J8LA 1K6AA 4PB3A 4WGHA 1GEHA 1K02A 2ZC1A 5I09A 5J04A 1VS1A 3VOJA 3A47A 2QPUA 1OX4A 4XZHA 4AEOA 2ZUWA 2RDTA 3SADA 2XUCA 4JIPA 2WNNA 3CZ8A 1OQFA 4KWUA 3ABSA 2AL1A 4MNKA 4KH2A 2WSPA 4RK8A 3ATYA 4R3UA 3G5EA 1ITQA 3QR3A 5CC6A 1PUDA 4DELA 3NDOA 1W5MA 4S39A 4AZCA 3DHFA 1XV8A 3CZKA 1ZZMA 4C7GA 3U3HA 4FNTA 1KTBA 3SB0A 3VDHA 3AJXA 4N02A 5CEWA 4XSMA 3VCCA 1ALDA 4MADA 4B3ZA 4Y9OA 3O6DA 1PWMA 3FHQA 1QOXA 1TV2A 4NY2A 3BMWA 3E02A 4RE2A 1VJIA 3EEGA 4YXGA 3VNIA 3DHUA 1R2SA 3TONA 4JTHA 4J5NA 2I9EA 2OLAA 2QF8A 4GQ0A 1EZ2A 4IT1A 2VZOA 4MKVA 3RXZA 4M56A 1FFRA 3QPZA 3U4AA 1OIMA 4XZNX 1YIXA 5G2IA 3OGVA 5HMFA 1HXJA 1KM6A 2WJFA 4M6QA 4E2VA 3FDGA 2WPGA 4L4PA 1HO1A 5L6UA 2Y70A 3NWRA 3TYEA 1E9IA 3BGGA 3UYIA 3DX5A 4NI8A 4ROPA 2B4GA 5HANA 5HDRA 1UWSA 1HJVA 2WANA 3WBEA 4ALDA 4F0KA 1TTJA 4AD1A 3ARXA 1K9FA 1E9YB 2BX7A 4IICA 3U8GA 5CBIA 4KCUA 1FWRA 3GM8A 3GDMA 3LZ3A 2PCQA 5TD4A 4QGCA 4Z2HA 1X97A 3WF2A 4M82A 1XCWA 5BRPA 3PG9A 1LTDA 4J3VA 4JD4A 4XAFA 3KEHA 4ILSA 1F6KA 1CGTA 2V5KA 3G22A 3KE0A 3LZ5A 3M5ZA 1JUKA 4PEEA 2FHFA 1UD6A 5KZ6A 1I6NA 1GWJA 4WJXA 4RNHA 3UZJA 2FLIA 3LCWA 3M6YA 2YZ5A 2V8ZA 1TV4A 4HOZA 2QUTA 4FR1A 1HF6A 4CN1A 3LXAA 3L9CA 4HOWA 2P76A 4NZ3A 2HEJA 3WYZA 5D4YA 2ZA3A 3QBUA 3CV2A 2AL2B 3BCJA 4JTJA 2ZRVA 4MNJA 3NDYA 4AEEA 4FA3A 4HVXA 3RMEA 4N2YA 5I5RA 4RDYA 3N12A 4C65A 5CLTA 1QPOA 4Y8EA 1DQUA 3CTLA 1K4GA 4TV5A 3VGGA 2HS8A 1JQVA 4LYPA 4X61A 1G67A 1W5OA 4JL2A 1NH6A 3EA1A 3A4JA 3NYDA 3APGA 2Y63A 1UR9A 2RFGA 2GQAA 1XIMA 3QGVA 2PB1A 3ALGA 2X7VA 4AXNA 1TV8A 4CNSA 3THCA 4GRSA 4IPPA 2WB5A 3W7DA 1OCJA 3F2CA 1LYXA 3W37A 3JW7A 3LHYA 3R1ZA 4TX6A 5CZJA 3UZ5A 2WKGA 3CLMA 3WN6A 3H2AA 4H6RA 1W5QA 4FNQA 3BLPX 3TYBA 2DH3A 3RRAA 1JNDA 3LM3A 2WCGA 2DZTA 3UW6A 1VJZA 2V3EA 2BLEA 2ZX5A 5HA7A 1LUCA 3NZRA 4D1JA 4BI6A 1HJUA 2PMQA 2XHYA 4DAIA 4LXFA 3GZ3A 2O4MA 1XYAA 2OOGA 1OHLA 3CPGA 4C7DA 1SVDA 3PZUA 4AY8A 4GQRA 4CQCA 1VB9A 4GCXA 1QWKA 3HV9A 1SZEA 2YFOA 4I7VA 3PF3A 1W9PA 3DI1A 3BQ6A 2UY3A 3PB2A 3M6DA 3OGRA 5FAJA 4EXBA 5F2GA 4BKNA 3B0YA 1E9ZB 1XYLA 4MB4A 2BHYA 5GQBA 2C15A 3DECA 2BHUA 1KGWA 1YPIA 5G4WA 4JFVA 2RJGA 3RJYA 3N2BA 4DJEA 1EWDA 4MSSA 3R58A 5C5YA 2VL4A 1S2TA 5CSYA 1NSJA 1SFJA 2UWFA 1OFRA 1X1ZA 3F4CA 3DI0A 2RDWA 1B9BA 1TPDA 5I3GA 3FYYA 2QIIA 1SO4A 1O5KA 1XG4A 3L2MA 2HBXA 4RR4A 5EU9A 3TLQA 2X0YA 5FEWA 1ONEA 4TVDA 4MAZA 4H9UA 3G1FA 3GTFA 5HUOA 4YTRA 3V0SA 3NDZA 1JDAA 1QPRA 4K8GA 2CZFA 3F5JA 4N9DA 1E40A 2W27A 3NEVA 2JGQA 2XZ7A 3ERPA 1M3UA 4HIBA 3LBCA 4WLCA 1K8CA 4S3AA 4H01A 3BLDA 2W4XA 5HNNA 4ICCX 2ZRWA 3RYSA 3AHTA 4G1NA 4RX0A 4C91A 2PWFA 3S2NA 5A2CA 2VYOA 2ZCGA 4GABA 5HNRA 4J7RA 4XD6A 3H2MA 2DZSA 3F2BA 1CX9A 2E9LA 3CQIA 1Y0EA 3EDFA 2ZXQA 5LIUX 3UBPC 2ZRZA 4KFPA 3W07A 2GSEA 4UOJA 3UXDA 4LYQA 2Y1HA 1EJXC 4K1WA 4PMNA 2PEVA 1BSLA 2PTDA 1YMYA 3ISIX 1CCWB 1Q7QA 2DJLA 1LBLA 4GD0A 1LJYA 1C90A 3R89A 4LUTB 4W87A 3SN0A 3KVMA 4X3ZA 1FWJC 3NL2A 4PULA 5REQB 4UUIA 3S2CA 3SY1A 3H4XA 3H21A 3UEQA 1XM3A 3OODA 1FDYA 3T0CA 4ERGA 3EB2A 1IIGA 1UZHA 3RPMA 2A6LA 2X05A 1P0EA 4HA3A 1VLWA 2X30A 1BVWA 4M7SA 7CGTA 2BGQA 4DUOA 3CMJA 3N4AA