2EJAA

Crystal structure of uroporphyrinogen decarboxylase from aquifex aeolicus
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
337
structure length
337
Chain Sequence
PKNDLLLRSLRGEPIGRFPVWLMRQAGRYMPEYRKIRNRVKNFLELCKNVDLATEISLLPLKILGVDAIIIFSDILVPLEPLGVKVEFVEGEGPKLSWSGKVSDLKKYDPSQNAYVYEIIKRVKEAQDEVPVIGFAGAPFTLLSYLIEGGASKDFKSTKLFMWENPKEYKRLMDILTETVLAYLKEQIKAGADVVQIFDSWVNNLSLEDYGEYVYPYVNYLISELKDFSDTPVIYFFRGSSSFIDLAVDYRADALSVDWSVDIPELFKIYDKGFQGNLEPAVLYASEEVIEEKTLGLLRRIPVKTRYVFNLGHGLAPDMELEKVKYLVDLVKSFPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Uroporphyrinogen Decarboxylase From Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
molecule keywords Uroporphyrinogen decarboxylase
total genus 128
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2ejaA00
3GVVA 2Q6ZA 4L5ZA 4L64A 4L61A 3RPDA 3BQ6A 4L6OA 1JPHA 3PPHA 3CYVA 4AY8A 1T7LA 3GVWA 2NQ5A 1U1HA 2Q71A 1R3TA 4L65A 3L7RA 4ZR8A 1R3QA 3GVQA 1U1JA 4L6HA 4EXQA 4AY7A 1R3SA 1UROA 1XDJA 4ZTXA 3PPFA 3GVRA 4QQUA 1YPXA 2INFA 3GW3A 1R3VA 2EJAA 1J93A 1U1UA 4WSHA 4ZTYA 3PPCA 3T0CA 1XPGA 1R3RA 1R3YA 3BQ5A 1JPKA 1U22A 3GW0A 3PPGA 1JPIA 1XR2A 1R3WA
chains in the Genus database with same CATH superfamily
2Z1BA 5DO8A 1E0VA 2FGZA 1TWSA 2E25A 1EDGA 1FH9A 4JEQA 1Q13A 1GG0A 4W7UA 4ENLA 4KKXA 1F6PA 3VOHA 4EWND 4AXNA 4GLEA 2WCSA 3RN6A 3RRAA 1ZB5A 2E67A 3C0SA 4LAMA 3M46A 3H4XA 2R1PA 4U3CA 1E56A 3CZ8A 4FXSA 4FS9A 4M3PA 3S4TA 3H6OA 4CNUA 1PSCA 5LHFA 1BD0A 4J2PA 3S0CA 3UWEA 1NF0A 1IZCA 4JAWA 4E4FA 2QJGA 1OVDA 3EMCA 2I5QA 2QUUA 4A22A 3PUDA 4RX0A 1H63A 2ATMA 3H4GA 4C6QA 3HPZA 1Y5VA 3IUDA 3OP2A 4YVVA 5FJRA 1W2PA 3E2VA 1ADSA 4WDWA 1CBGA 4PE8A 1A0CA 6REQB 1M03A 4IWWA 2YLLA 4CD6A 4YTSA 4HSHA 2WHKA 4PMUA 5LSMA 1KQYA 2VQUA 3H2CA 1FY6A 1JVNA 3PUOA 2BY2A 1XD1A 3FNDA 1ISXA 3SY1A 1DE5A 2IS7A 3WLKX 5DANA 4JICA 2DDXA 1FRBA 1NFBA 2QJMA 3WLOA 4DZIA 5IHRA 2BLEA 1CWYA 1PTAA 4XZ9A 1NWUA 4N0RA 4HQVA 1QCWA 4QAWA 2QZRA 2FZ8A 4B9YA 3HPFA 2WSQA 3B0VC 2HVNA 3B8IA 2QCHA 3LENA 3A13A 1SJBA 2WJZA 3DFNA 1RA5A 3N2CA 4LH8A 5HNUA 2WLZA 1ENUA 1EA9C 4ZGYA 3WLMA 4CD7A 7REQA 4Z1BA 3IGUA 2FHCA 4W84A 2W5FA 4DQWA 2LLEA 3WLJA 2YSWA 3OVGA 2V3DA 1JDEA 3ABOA 1LUCA 2PUZA 2YR1A 3XIMA 2YL6A 5IDIA 1FWTA 2PDFA 3CL7A 4Q4QA 4FHAA 2PWHA 5HNNA 1JDFA 1XWYA 4ACYA 5DY2A 4HCLA 4HCHA 4GY1A 5EFDA 3BAXA 1VEMA 4S3KA 5JBDA 4KCUA 1KXHA 2A4AA 3QVQA 3S1XA 4ZB2A 4DJED 1PZ0A 3D3AA 4ERGA 2BG5A 1EL3A 3CHFA 1REQB 3MCNA 1FXQA 1OGGA 3B8VA 5K9CA 2PTZA 3SQMA 1DJXA 1ZAIA 4DPPA 3WJYA 1UWQA 3TOPA 3W74A 4AZ7A 2NX1A 1H0IA 1K4HA 2OLHA 1HT6A 3UGRA 4RCXA 2DSVA 1PHQA 3R0DA 3VIMA 1B3ZA 1ONRA 3HGJA 4MZ1A 4L1XA 1RY8A 4XO7A 5JBFA 4QLJA 4L6OA 1NH6A 4DRSA 4UNIA 4RDVA 2DT0A 3LI1A 3LG3A 2P0OA 3R89A 4RE2A 1M3UA 3PZOA 4Q8TA 2VEIA 2J74A 1SSDA 2AGTA 4B3ZA 1XRFA 3QLLA 2PWUA 4MPQA 1I0DA 4KIEA 1W9DM 3D47A 3WX7A 3W1RA 3LERA 1W1YA 3AXKA 4B5WA 5J5DA 2VVSA 2E77A 4PUKA 1CGUA 3THCA 3GWQA 3PTKA 3NZQA 5TNVA 4DBUA 3C61A 4JDBA 2XN2A 3BXWA 1OEPA 3CT7A 1GCYA 3VMOA 5LIKX 1ZJBA 2OOFA 1XIFA 4GABA 1EHAA 1KFEA 3HG5A 1TZ9A 3KBJA 1QJWA 1OFDA 4H2HA 1LUCB 3L4XA 1GYMA 3BAKA 3LXBA 1UQZA 3FIGA 1EDQA 4GWEA 4OV4A 4HU8A 1V0NA 1P0KA 3N11A 2DH2A 3E2SA 3HMCA 2PC8A 3VIHA 1QI0A 4DUVA 1XS2A 1NWRA 2J88A 3UR5A 3THDA 2V82A 1GKPA 3YPIA 3NEVA 4QNEA 1W9BM 4H6QA 4IP5A 3URQA 3WD2A 3HA1A 1UWIA 1VRXA 3U6WA 3UFYA 1T99A 2YJQA 3SBFA 4RPQA 1BWKA 3VDHA 1H61A 2PBGA 3XINA 2ZXQA 1J0IA 2P3EA 1BHGA 3SCQA 1VFFA 1VBGA 4AW7A 1MUCA 4JTJA 5EBUA 4P7QA 2V3FA 3TNOA 2V2DA 3NOYA 1O1HA 3DIPA 3CQJA 2I17A 3AS1A 1VPQA 2G5WA 1UUQA 1PB0A 1MW0A 1T8XA 2TSYA 4CEXC 5H8PA 2YYTA 2G4FA 2QW5A 1IEVA 3C2RA 4FF7A 4YCPA 2NQLA 3VXGA 4ZENA 4GYKA 2G41A 4HPGA 5LNRA 2HNHA 4WSHA 5C54A 4KF1A 1W3JA 2IQTA 1A53A 3GM8A 1D8WA 4HPNA 2BOFX 2J7FA 4RZBA 3CZKA 5T9CE 3BANA 3ZT5A 1J0JA 1QXLA 4YVPA 1TTPA 1XJBA 1JZ4A 2ICSA 1YDOA 3TAOA 1AMKA 1R3QA 1DHPA 3D0CA 1RPXA 1EC9A 3H70A 1DJQA 3ES7A 5CKSA 5C70A 5G2IA 4MIMA 3PM6A 1L8NA 1CTNA 5MKGA 3SRFA 3UXKA 1GOXA 1FP8A 4HIBA 3U4AA 3WF4A 3WO8A 2HK0A 4Z2IA 8RUCA 1JR1A 2R1LA 3UY8A 1XLIA 4FSAA 4FLOA 4HMEA 3SURA 3C3UA 3CMGA 3W82A 3ERPA 4MOZA 3CUXA 4PL1A 4W7WA 2EKCA 3F4CA 3CK5A 3TTQA 3TJXA 3VNMA 5J5RA 3CQ0A 3VNDA 1JAKA 1L9WA 4F9DA 1KO0A 2NSXA 1B54A 3V36A 1Z7AA 1ZGDA 1Q6GA 1V08A 2VDHA 2F6KA 3EEGA 1BVZA 4NJHA 1TTIA 4DUOA 4KIRA 2QF7A 1NAL1 1X96A 3HPXA 4GISA 2ACSA 2PI6A 3HTWA 2F38A 1EF2A 2YXOA 1RJQA 2YB4A 4GY0A 4A8LA 1E6NA 1KCXA 4NP7A 5TIMA 1G7VA 1DQWA 3DECA 2CXGA 1HP5A 4E6MA 4E38A 1PIGA 4QQUA 3ARYA 4X60A 1W3NA 4O1DA 1FWIC 2ISFA 1TTQA 1VCFA 4XTDA 5D8ZA 3UW6A 1FWWA 2JKEA 4PYSA 3OYXA 4HOWA 3N18A 2OYLA 2FZNA 1M7XA 3N4EA 1M9HA 5E9AA 3GXNA 3FX4A 4MB3A 4W8LA 3CTTA 9XIAA 4GUFA 5AC4A 3U4FA 2J7HA 3R0UA 5D2WA 4OBTA 2YZ5A 1ZJAA 3L23A 3IAQA 1HKJA 3TLQA 3WQEA 1QNRA 2OPJA 2XJ7A 2XN0A 4XO6A 2F84A 4NZJA 4MPKA 5D9MA 1ECEA 4S3EA 4XUYA 3GB6A 1UP0A 2HEJA 4CEUC 3KZSA 2OCZA 3KP0A 1QR7A 1CGYA 1S2TA 4E8DA 4D6JA 2NXHA 3WK1A 1NVMA 4D2JA 4MADA 5BXRA 4JYEA 4DZAA 2BGNE 4IPJA 1EP2A 2GL5A 1BTMA 2PRHA 5I78A 5AHMA 3EX1A 1QNOA 1QPQA 4A21A 5HQEA 1Q6LA 4D71A 4JHZA 3P61A 3BH4A 3VDBA 4L7ZA 1MXSA 3WG6A 3WQGA 5FAJA 4FAMA 1DIKA 1QW9A 3HV9A 4QJ5B 2JALA 1TJRA 3KTCA 1B3VA 4QHRA 1VGAA 1EP1A 4N2YA 3CMJA 1CZ1A 4AEFA 4EXBA 2G3JA 3R13A 3CNYA 1LP6A 1ZPTA 3A4AA 3V35A 3VI2A 4DX3A 4WXZA 4NZ3A 4B5SA 4UMCA 1JZ8A 4ZE4A 3SCTA 1BF6A 4D6IA 1EXBA 5BNKA 4H9MA 1UR3M 3PUEA 3P0WA 5E93A 3FGCA 1WDSA 2SFPA 4GC4A 1U5JA 4NAEA 3BURA 2AQOA 1EP3A 1TZ7A 1OHLA 3VABA 2VFHA 4FXJA 3OEXA 1JDAA 4LYQA 4M80A 1W0MA 3LCGA 4NJJA 3USZA 1AQHA 1TYGA 3UJ2A 3FKRA 3WDQA 3C5QA 3GR7A 3WQOA 5HULA 3GX9A 4RW5A 1K6WA 2O4QA 3VPLA 3WLSA 4KWSA 4F4RA 3VTRA 3A47A 1H11A 3B03A 1ME7A 1RPKA 4NI8A 4NZ4A 4Q6JA 2ZZ2A 4XZIA 3RNDA 3V3WA 1B90A 1B30A 4BWLA 2GGEA 5C9RA 3ATYA 1MMFA 5JIWA 3ZSSA 1OYBA 4M6VA 5A95A 4X22A 3DN5A 3R8GA 3VGGA 5C8BB 2O7QA 1GONA 1UJQA 2OZ0A 4IMFA 4MYAA 4C5ZA 4H9ZA 1FH8A 4JGDA 4GCAA 4QJ1A 4PA8A 4WLCA 3AICA 3SFWA 1E15A 3VZXA 4UC5A 1S39A 2PDGA 1C8QA 4J5NA 1SZGA 3MVTA 4O50A 4I3GA 4UQBA 4Q4MA 5BWFA 1DP0A 3NO1A 1GOMA 3BMWA 3UCDA 1KM1A 3WQ4A 4S3CA 2GGIA 3MV01 1DWFM 3SFKA 4IFRA 4N9BA 3VZYA 2I14A 2C0AA 3KOFA 3MSGA 1AG1O 1TPH1 2PDBA 3MI3A 5E09A 5I7GA 2CKRA 2OWWA 2R82A 1OK6A 4BI6A 1PX3A 4DWDA 3P84A 3BW3A 3HJZA 4L4PA 2W0UA 4JTIA 3MU7A 3N6QA 3GW3A 2ZA1A 1SZEA 3G5EA 3G1AA 1R3YA 1KCZA 2BV9A 4HMNA 3V1HA 2BY3A 4KWWA 1A0DA 1EEXA 2AMXA 4PFMA 3ZIZA 1ICPA 3L5MA 2VEFA 1FFQA 1BG9A 1X6LA 2C6QA 2P76A 2H9AA 2YFOA 2FTYA 1BSIA 3BJFA 1XYLA 3W84A 2GUUA 4MWAD 4ZQNA 4K38A 3SR7A 1EUNA 4L80A 1JCNA 4CQ8A 3ONCA 2POTA 4YS1A 1UR8A 5H8UA 5IFPA 2ALDA 2Z25A 3CHVA 3WDJA 2EBNA 1U83A 3ZXWA 3PNZA 1LRTA 4MDPA 1X1OA 5H8MA 1ZBWA 3PUGA 1UC4A 5AB3A 2EF9A 4MZYA 2A1YA 3HO8A 3BAYA 2VENA 4R9OA 5BXTA 4IIDA 2UV8G 3TAKA 5IRPA 2ZDRA 5CZSA 4AY8A 2A85A 3GE7A 1Y8BA 1EOMA 2WSRA 1JCTA 4LRSA 1V77A 1W3HA 3G6MA 3TIMA 3KUMA 3EZ4A 3G1HA 2VMFA 3QZAA 1LDCA 2VD8A 5HR6A 2QGHA 3IJDA 3GTNA 4ZOBA 1DHKA 5AKQA 1ZCOA 1HW6A 3BDKA 3TXZA 5C9ZA 4H7VA 1M1BA 4GIEA 3QXBA 1S2VA 1H41A 2IQDA 3W7KA 1BXBA 4YWSA 4FOKA 3W81A 3W22A 3O15A 2CCRA 3VOFA 2J6VA 1CECA 2B7NA 2X2YA 3QBUA 1GTEA 1YE4A 3BW4A 3IJLA 3U2EA 2Y6ZA 3JR2A 1Q8AA 4AD5A 2BHZA 2DVUA 4DYKA 5T91A 3LHTA 1KM6A 2PMQA 4HZ7A 4HK5A 4GK8A 1KRMA 3UF9A 2FVMA 3T08A 5TF0A 5HBFA 3P62A 3UZXA 3W6MA 1RBAA 3SRKA 2PFHA 3GDKA 3JZUA 2J4GA 4F2BA 2ZUNA 3V4BA 1W17A 2Y5EA 4DZHA 4KH2A 4H19A 2OX4A 1YBQB 3K8MA 3G22A 2Z7GA 3GIPA 4TTGA 3BUVA 3TV8A 4RR4A 3DU0A 1AH0A 1O94A 3UETA 1LF1A 1RHCA 3NWRA 3VM5A 3K13A 3VGDA 2AL2B 1UH3A 2IW0A 5H91A 3LUTA 4CQBA 3NL2A 3P80A 1B9BA 4JIRA 2R14A 4ML4A 4FOUA 4LY8A 4Q8OA 1ZP4A 4Z2LA 1S5MA 4REQB 3QV9A 4N9DA 3PZ9A 4PBEA 3M5XA 4FNSA 1UR9A 2WVSA 4KCWA 3EB4A 3AMGA 5D2YA 3VIJA 2ASHA 3EMQA 3LLFA 3TTOA 3GBEA 1EJ7L 1CYGA 2FPYA 3LU2A 2VFIA 4XAZA 2XGZA 1P6WA 4Y9OA 4JXCA 3S42A 5D30A 5FI8A 2QCLA 4RNIA 2X0YA 5DMLA 3F4VA 1WDWA 2YL9A 3AUJA 3WBXA 2XYLA 3UNTA 1JZ5A 4B2DD 3VNKA 1BSLA 4HNUA 2J6XA 1GVEA 4FNPA 2AKMA 3S1GA 3NQCA 4FA3A 1ML1A 2WMKA 2DP3A 4O10A 3UG8A 3QHOA 3WH5A 3KW3A 1FWNA 5FIPA 4QEEA 2W6RA 4ZQMA 3RJXA 5CH9A 3FHQA 4B2DA 1JDCA 4AC7C 4FF5A 3WDRA 1AQMA 2Y24A 4L6HA 2VRJA 3R8HA 1TUXA 3KVJA 4N42A 5I3KA 1KXQA 2INEA 1D3CA 4AD2A 2G37A 4ZFCA 2WVVA 2GJXA 2ZWYA 1N8WA 3N9SA 3LBMA 4A35A 4QITA 1FWSA 1GOQA 4D6FA 3CZLA 3C86A 4TMBA 1TA3B 4LUSB 2WB5A 4QFUA 5EYWA 4BQ2A 4Y9PA 4M6QA 2E8ZA 4B5TA 4JDYA 4AD1A 1AW1A 3TE9A 5FEPA 3W37A 3A22A 4YTRA 1QNQA 1W3LA 3MYPA 4H41A 4PODA 3GYCA 2ZRUA 2YBUA 3MUXA 1M5WA 1SW3A 5AVNA 2OGYA 5CPSA 3ITGA 4MJMA 3FGCB 3HZ3A 2KX9A 1M01A 4INFA 4MNJA 1Z41A 3UWQA 4XAGA 3RRXA 3BQ6A 1LTDA 3O16A 5D9PA 1IR2A 3IJIA 1O7AA 4Q7BA 2FH8A 2Q8LA 3W1XA 4A8RA 4POCA 4W7VA 3QMTA 2F6XA 1SGJA 1XRTA 4UTWC 1VFHA 4O14A 3NQDA 2V30A 1HF6A 1EJWC 1QK0A 3BICA 4LS2A 2DORA 5CPNA 4ZZ9A 4IMDA 4PB3A 2E68A 4X63A 1I75A 6TIMA 2Y89A 1YMYA 4EVZA 2HE5A 2C91A 8A3HA 1YX1A 4PTNA 2HISA 1MQPA 1OGBA 3EOOA 4EIVA 2VD9A 3LLDA 4ZO8A 4GJJA 4X9YA 2WPGA 3AIBA 3VIKA 4S3FA 1VBRA 2ZUVA 5HPCA 4XD4A 3URAA 1WZAA 5CPTA 5C9XA 1OM0A 4XISA 2JF6A 3W7PA 3ARXA 4MB1A 4MAZA 2WKGA 3RDKA 3NDZA 4LUTA 2WMIA 3AIUA 3HPAA 3LCHA 3AHVA 2ZUTA 2GGJA 2OKOA 2EKGA 2X16A 5BOEA 2YZRA 4A3RA 1N8IA 4E4PA 3K1DA 4JX6A 1YNQA 2QT3A 3MP5A 3IIXA 3WF0A 1O1ZA 4FP1A 4C6LA 1XIEA 2NZLA 1UCWA 1EC7A 5LXXA 2ZZ3A 5A6KA 1YPIA 2J13A 3NZPA 4U5IA 2OEMA 4IQDA 3G1FA 1CXFA 2DUAA 3FXGA 3B04A 4YIWA 5AFDA 4LY4A 3BOLA 1RQHA 4DUXA 1JEZA 6TAAA 4BY3A 4I7UA 4IG2B 2HZGA 3JZEA 4Q33A 4TXEA 3NNTA 4BF9A 1TWDA 1BGGA 3LGEA 3GIQA 2PPGA 2PWVA 1JI2A 1P43A 3OHMB 2ESCA 3BJSA 3UWWA 1XIJA 3G0SA 3BZGA 3GBDA 3MUY1 3AMCA 3P5ZA 4MYXA 1LLOA 4RPPA 3CS2A 4K6AA 3VNIA 1BTCA 4PSRA 4S2CA 4IXHA 1SFLA 4GE8A 5HMEA 1KW1A 2A7PA 3GC5A 1XFCA 3IK2A 3GDLA 4MUPA 1PCKA 3SUVA 1E0UA 1UUMA 4L4OA 5A1AA 5HWJA 3H54A 4X0VA 1JZ2A 3CWHA 3UJEA 2A3CA 4M6UA 2WQDA 3KS5A 4OUIA 4ZTXA 1F8IA 4O1FA 1L0PA 3GUWA 2UWFA 3NFUA 4J3XA 3S5YA 3T42A 4JTGA 4Y8EA 1NTHA 3M44A 3N9KA 4TR9A 1V3MA 2DJLA 3DFTA 2HVMA 3UR7A 5I3IA 3GXFA 2XM1A 3PJUA 4EKJA 4JHOA 3ZVHA 4PTXA 3PN8A 4DM1A 4A05A 3EDDA 1AZ2A 3KLKA 2J24A 3L68A 1J0HA 2ODOA 2PSNA 1VS1A 4M19A 4K68A 2PP3A 4AMAA 3LPPA 4AIBA 4JN8A 3TQPA 4F0MA 1KM3A 2PODA 3SUTA 3VAVA 1YLVA 3R0KA 3GXTA 1E40A 3A6OA 1XW8A 2QIIA 3G3DA 4JIIX 2VZTA 3FCPA 3TW6A 1O12A 3Q58A 2ZZ4A 3LTYA 1FHDA 4Q4RA 3OZOA 4DEFA 3G0UA 2V2HA 5D2XA 2GWGA 1A47A 1XYZA 2R24A 2X30A 3GLCA 4OT7A 1MZHA 4PR4A 2O92A 2Y85A 4OKDA 3VOCA 3LXAA 2WVTA 1XLFA 3UZ5A 3TX9A 5K4ZA 4UCGA 2XH4A 2DIKA 2ZX6A 1J01A 3PTQA 3ZLFA 1QBBA 1TFVA 3P74A 5GNXA 3ANVA 3AXIA 4CCCA 5DMYA 3PBMA 3PC0A 2YCKX 3WFAA 4KW2A 2XU2A 1J79A 1P1MA 5CAHA 2DVTA 1XX1A 5FESA 4E5TA 7CGTA 3WFLA 3LPGA 1M68A 3VGBA 2XVLA 4HA0A 4UWMA 4AWSA 1L6YA 1QPOA 4UNKA 4PBGA 3H24A 3IUHA 3CHDA 2IMRA 5DEZA 2BHUA 1ZTVA 1V0LA 3TOYA 1F7BA 2F8QA 2H3DA 1IYXA 6ENLA 1H7XA 1HTIA 4CLMA 3E3HA 5E9XA 4G5DA 1TV7A 4J3WA 1QWKA 4PGLA 1K9DA 5EMKA 1XP3A 1Q65A 2E7FA 1LROA 2D3LA 4M24A 3TONA 3VKKA 3BV7A 3LZ5A 3CH9A 3P14A 4OWGA 2FLIA 2QPSA 3B4YA 3KL3A 3N19B 1WV2A 1TV8A 1L8PA 3ANYA 5A8QA 4U33A 4XZHA 4E3VA 1KBIA 3VCNA 1TUFA 3E2RA 4N9EA 1Q85A 3R6IA 3WQWA 4CNNA 4ICCX 1OBAA 4W86A 4JN6A 3T81A 3T0DA 3PULA 3GDMA 4J2MA 1G5AA 2VX6A 2E28A 3HFYA 3ZFHA 2XSXA 4LCSA 4RNHA 1X6UA 5F2MA 5HQLA 3KOYA 4CQ9A 3W2UA 2X1UA 3UP8A 4DIAA 4BKNA 3C3NA 3CUHA 4H7ZA 3ZS4A 1EJTC 4B90A 1JXJA 5KINA 2FGLA 2A2IA 5M1TA 1KGXA 4GXWA 1V79A 5IBXC 2BXVA 1GW9A 3PNUA 4NRRA 1XLDA 3N15A 1X1ZA 2QF8A 1C91A 2DZVA 4CNSA 2CLPA 5M2FX 4HHMA 4BI5A 2JK2A 1MUWA 2OGJA 3RLUA 3MMTA 3UG4A 1O6IA 1NQKA 3ARRA 5JH1A 3LM3A 1SSGA 2W79A 1LYXA 2DZPA 2NLIA 1S3TC 1VBUA 2WNWA 2Z26A 3GR4A 1O95A 4YLWA 3CXOA 4C6MA 1FWCC 4MY9A 1PAMA 2J8GA 1D8CA 3OQEA 1RQBA 2IPFA 2W27A 1YXYA 1NF7A 4RE3A 2RJHA 1HKMA 2ZUMA 5AHIA 3OA5A 2B31A 1BFNA 2YXXA 2FZMA 1ICQA 1M7JA 3S83A 4DXKA 1IGSA 4K2SA 3KHDA 3S5NA 1H7PA 1I2OA 1HIZA 6CGTA 3EWUA 4PTDA 1JUEA 4E2BA 3NYZA 1AW5A 3DBPA 3M5VA 3UPBA 1FHVA 2PWGA 2XG9A 3MA8A 1TV4A 5BZAA 4G8TA 1DIEA 3ZLGA 4JTKA 2NVAA 2ZA2A 3GDBA 4JQ1A 4R27A 3RO8A 3BZJA 1S5NA 2DSUA 3VILA 3IACA 2OO0A 2QDDA 2IQ0A 1Z9AA 4XKYA 1A5NC 4TVUA 3H22A 2MANA 3N29A 1R85A 2G95A 1P6CA 3KCLA 2WJFA 1Y0EA 2FMOA 4NX0A 3T2OA 2DZAA 2HDJA 1N7KA 1S5VA 8XIAA 2QUNA 3C4UA 2QV5A 2Q8XA 2ZRWA 2JIEA 1TJ0A 1WAWA 3CUJA 2YW3A 2PRMA 6REQA 1UD6A 2C79A 3EDJA 2CIPA 3V5OA 2GVYA 1HKVA 3WBWA 5JUVA 3CH0A 1NOUA 1W3IA 3AS0A 1VHCA 3OJGA 2VCBA 1KFCA 2HXTA 3DHUA 4AIUA 1O5XA 3OG3A 4PUUA 1QU4A 3KWXA 2YL5A 3GTXA 4P7OA 2VR5A 4TV5A 2I57A 4LALA 1X97A 4AX6A 3W7DA 1B4KA 3W1LA 4DJDD 1H50A 3TQKA 3H4WA 3USBA 3IRSA 2G50A 3AS3A 3MO7A 5I24A 2OQLA 1WP6A 4LNYA 1U1HA 1F74A 1XPYA 1XXXA 3MBDA 1ZENA 3LV6A 1ITCA 1ZJHA 4UR9A 3LM7A 5I00A 3LV5A 4WKAA 1Y5WA 4C91A 4S3DA 2QDHA 3CPRA 5I06A 4D72A 3C0QA 2NQ5A 4RL3A 2VGGA 3ABRA 2XGBA 1Q6DA 1TVPA 3FA3A 1B3OA 1KWGA 5TAOA 3FYOA 3NOEA 5J8LA 3B8SA 3GAYA 1C90A 1JPIA 2YDRA 4PUDA 4AYSA 1VJIA 2PDIA 4LB4A 5I3FA 3QZEA 5A8MA 3O8AA 1WDQA 3IJ9A 1KNWA 2XFWA 3P60A 3PHAA 4PMYA 3VX0A 4NAEB 4AVFA 2OLAA 3QMRA 4I6VA 5G2HA 2PLKA 4Z17A 1UOZA 2DZSA 2C1HA 4MWAE 4WVXA 1J4EA 1OFAA 4KWOA 3QGAC 5AC6A 1NSJA 3S9IA 1YDNA 3NPXA 1EGMA 1EBHA 2W3ZA 4Q6XA 2EPMX 1KXVA 4MAVA 3UY7A 2Z1WA 4AHQA 1XRVA 3N2MA 1VAHA 4ACZB 3LHVA 4PMNA 5DT5A 1UMYA 3L2LA 1H60A 2ZRVA 3RM9A 1B57A 2ALRA 3O63A 3M0JA 4K8EA 1TV2A 1EWEA 4H6EA 3VUPA 4LYKA 1N2VA 2WMFA 4P7RA 4A8NA 4IQJA 4C1LA 1IIGA 3DFPA 3U2ZA 4PUNA 3M0HA 4C6OA 1UKSA 5BW6A 4H3DA 1XSIA 3BPWA 1KBJA 1F8MA 1WYIA 4C1NB 4DBDA 4IFKB 1DPMA 1XLEA 4O28A 4G9PA 2GYIA 5FJPA 3VOGA 4ML9A 1JGIA 3PF3A 2CZVA 4GUJA 3EXSA 1C92A 2BWGA 1RBOB 4OUEA 1MDRA 1KCKA 4JCLA 4O12A 1UR0A 3W7IA 3O0FA 1V7AA 1OFPA 3UWUA 4ZFMA 1YTDA 3VNZA 4UTTC 2Q3RA 2P0IA 4I9JA 2XTKA 1GVRA 4LQ1A 2EPHA 1W1IE 2WKJA 4Q4KA 5CGMA 4GI8A 2W67A 3B3DA 4GKLA 1IEIA 3W73A 1GHSA 2OT1A 5E0CA 3U3HA 3L66A 4MB4A 2FTWA 3WEZA 4GI4A 3SCOA 3U57A 1AH3A 4LOCA 1E9LA 1XSKA 4QTGA 3N3MA 4ORIA 1R5YA 3LPFA 4PCSA 1A5KC 2XIMA 4F48A 5LNWA 1DKWA 3TJ4A 4R85A 4HMDA 5JU6A 4MM1A 5LA2A 1XIMA 4WY0B 2PDWA 3VIFA 4CKQA 1I9CB 4LPCA 3E9AA 3PSWA 4WD0A 2GVLA 4EK7A 3SCNA 1K8CA 4E3TA 5IOBA 3QLDA 3A24A 3EBVA 3BARA 4MWAC 1REQA 1SO3A 5D8WA 5A94A 1A50A 1B4EA 4XKMA 3VE7A 5KZMA 3TUUA 3N04A 3RJYA 4NZ5A 2Z29A 4AIEA 4HNTA 5REQA 1Q7QA 1O5KA 3XISA 2XIJA 1I2NA 3KRBA 1DVJA 2XINA 3VIGA 1J5TA 4L1WA 5IFTA 1UWTA 1UH2A 2CW6A 2YGYA 1X6NA 3NAVA 1FA2A 1YE6A 3LNMA 1EJSC 4UTIA 5C9WA 2DZTA 3LTSA 4GUHA 4Q8PA 1P5BA 1A0EA 1NP0A 3WF2A 4S39A 2QJNA 1CXHA 3W1NA 5F4XA 3MBFA 2V3GA 3EWDA 4EPBC 9RUBA 1Y7VA 1OCQA 1RP9A 2FDSA 4TX9A 4Z2KA 5E0KA 1XBXA 4BQ5A 1S1RA 1WXJA 3WEMA 3CL6A 4GVIA 3TC6A 2GQ3A 5M17A 3UXAA 3PSVA 1AJZA 5L9FA 3OZPA 1BEUA 1TVNA 2CHNA 4H9UA 4E2VA 4M29A 5D02A 3TA6A 4B5UA 4G7FA 4LAZA 1JUKA 3DFOA 1HJSA 3U7VA 2EPLX 3BLFA 3MY9A 2V68A 3QZ6A 4J3UA 4PH6A 3UPWA 4AF0A 4ERIA 2AAAA 3U5UA 1IZJA 3ARUA 1TKKA 4AUBA 1HUVA 4UTKA 4YMZA 3C8FA 4ADSA 5A8PA 3T09A 4IPIA 4RUBA 3AALA 1QRQA 1NDYA 3BSMA 1E3XA 3AIWA 3VFLA 3UU0A 1H7WA 3KBVA 1FWEC 5CCZA 2VFFA 3HN3A 3R94A 3NM3A 3LY0A 2BMBA 1R9YA 3VMPA 4X2RA 5BXSA 2CXEA 3CL8A 3GYEA 3V75A 3K1GA 3NVTA 1QI5A 3AZTA 4LAUA 2Y0FA 3W23A 2J27A 1PKLA 3KX6A 4L6DA 1Q6CA 2E9MA 5A3HA 1XISA 2WZHA 3W9ZA 3VO0A 2FQIA 1E9IA 3ITYA 4E2OA 3W72A 2PWEA 3OLGA 3S2NA 1GZGA 3SSJA 3LX9A 4A4AA 2DH3A 4A3YA 1XLJA 2PA6A 1LL4A 3O07A 4MGGA 2FVKA 4NJKA 1QHPA 4FNUA 1KR0A 1P6BA 2EJAA 5EU9A 3D46A 3SUWA 1BPLB 1LOLA 1B3YA 3U2OA 1Z44A 2C71A 1O66A 3QJAA 2OG9A 3TYUA 1FWGC 3MSYA 2BXYA 3NTYA 3E38A 4XV0A 2VZSA 3G1DA 2WHMA 2J8FA 4JFSA 3SEPA 5ABFB 4DO6A 1V0KA 3C0JA 1IXOA 2FB3A 5TD4A 1OYCA 3QV8A 4L5ZA 3BSHA 2CZFA 3L9CA 4MLJA 2RUSA 2H8XA 4KESA 3PY2A 3THQA 3W7CA 2OO6A 3GU9A 3HG2A 2NUYA 1LORA 5AYIA 3B0PA 3G0XA 2X1RA 1KRAC 1PL9A 3Q45A 1QOQA 3CAWA 3DC8A 3LCLA 3SJNA 3WY1A 1TWWA 2GQ9A 2O7SA 2YKKA 5C5YA 5JBEA 1M41A 1DIDA 2IXUA 3CYVA 2EJ1A 2Y7GA 3A9BA 2FPTA 2PU0A 4CCZA 4D6GA 4Q8VA 4YNGA 5FOOA 3DI0A 4GYFA 1BVNP 1P7TA 1UP2A 4XVEA 3B8DA 1KM0A 3OLDA 3M6YA 1JPMA 3IVUA 3T2PA 3LZ3A 3DGRA 1NOFA 4TVDA 4UCFA 1EGZA 1R0MA 4NASA 1A4LA 1VRDA 3M5YA 2Y88A 4LVDA 4KGJA 4O57A 3KOXA 3GXDA 4HZMA 5BROA 1U1UA 4GYPC 1LJYA 4QG6A 3NA8A 4K8GA 1THFD 1D7KA 1IEXA 4IISA 3SCWA 5A6SA 1E6PA 3W6LA 1H1YA 2DJXA 1S5TA 4PBFA 1GGOA 4UOZA 3C2EA 3APYA 2GSHA 2WMHA 1I45A 4IIHA 3O7UA 4DWSA 5LIYX 1KR1A 5LKYA 4RV8A 3BMVA 2G97A 3QYSA 2ZZ6A 4JQ2A 3MKKA 2CHRA 1XBZA 4J4KA 4PCNA 4AHOA 1BG4A 4HYWA 3M7WA 4CD5A 1WOBA 3RAOA 1NU5A 2CZ5A 1XUUA 2BODX 1Q7MA 3GS6A 1QUMA 2VEGA 1XIIA 3H21A 5G1MA 2YFNA 3OGVA 4WIWA 1KFJA 4RK8A 5C2GA 2EG6A 1LOQA 5EMYA 4BF5A 1XYCA 1H7RA 3CHEA 3GH4A 1KLYA 5FL0A 5M3WA 4XWUA 5AHNA 1RZMA 1OYAA 1UB3A 5F1VA 5AZ0A 1S2WA 2PDKA 3IGXA 5FF4A 4IUGA 5D37A 4IX0A 3UWZA 4C1NA 4DNMA 1UD3A 4AZIA 4BCEA 4Q4SA 5LIXX 3TXVA 2Z1SA 4I8YA 3VIOA 2ZBTA 3KBSA 2ZOXA 3BTNA 2VYOA 4DI9A 1G1YA 1QASA 5CZ0A 4F0KA 3MKVA 1OF8A 2ZTKA 1CPUA 2I5GA 3SQLA 5HPOA 3P81A 1A3XA 1TCDA 3K4WA 1OG6A 3ALGA 3THUA 2B7QA 3O6CA 4LBRA 1HJQA 1K9EA 1RAKA 1HGYA 2GDUA 2J77A 5AHEA 4JEJA 3QPEA 3UR2A 2VCCA 3KRZA 3RPDA 1OX4B 3T07A 4Z1AA 1I8JA 1T7LA 4G1KA 1ZFJA 1H1NA 1LBLA 1OQFA 1VFMA 1WXYA 1WX0A 5HANA 4Y9NA 5D03A 1PWLA 3NQMA 4NX5A 5KITA 2D20A 1FP9A 1PCWA 1BRLA 4H8HA 3UZWA 1RP8A 2NV2A 2J78A 2YL8A 1BYAA 3ZT7A 1N8FA 4QE5A 1V8EA 2Z7KA 3WQCA 1VFLA 4IIGA 2CITA 3W1QA 2J9XA 4U10A 3VD9A 3L12A 3AXXA 3NDYA 2A79A 2EEXA 1PDYA 1D9EA 1PTGA 1W32A 3MUIA 2Y63A 1WDPA 2XFYA 3W07A 3W26A 6A3HA 3K2GA 4YWIA 3KAOA 1K7XA 4DAIA 2I9UA 3AOFA 3W1MA 3DKLA 1B0IA 2REQA 2NV9A 3RYSA 1XYFA 2X09A 3F4NA 1GK8A 3GZAA 4PL2A 4PMXA 5C6MA 3WLPA 2WM0A 1K4GA 5C2CA 4F8XA 1DQUA 1MVYA 1IIHA 1A3WA 3NXFA 5XIMA 1I6NA 3LHWA 2EAWA 3EOSA 3N6HA 4M1RA 3ZQ9A 1JRCA 2HRWA 2NUXA 4ZOAA 3TWBA 2YPIA 4GFSA 3N12A 1S2CA 2JGQA 3M43A 3OA3A 4Y9AA 3S5ZA 1YTKA 5KZ6A 4WX2A 2PLMA 1F3EA 2W61A 3M9YA 4GYPA 2BFGA 2WZTA 1UD2A 2CLMA 5A8GA 5A6LA 1Z6KA 4HPXA 3AFBA 2DSWA 2QVNA 4FO4A 1MUMA 1R2RA 3W76A 1UC5A 3ATZA 5JIPA 5LNUA 4F2TA 4GOAA 1YIXA 1KWKA 4DWSC 1BRLB 1GQIA 3E0FA 4N7QA 5CPQA 1JL8A 3LS9A 3O9NA 3FJNA 5FKYA 3AHXA 4OHQA 2E6YA 1AJ0A 4DNHA 1E6QM 3Q4DA 3VGEA 4BFAA 2VUYA 2B7OA 2Z2AA 3L4YA 1AJ2A 2D73A 4WY0F 3TKFA 1YRRA 5ENLA 3VE9A 4YTUA 3CUGA 3HG3A 1FHLA 4N6FA 4ZBCA 3AUOA 3GNXA 4U2YA 1R2TA 3V1PA 1E5JA 1SR9A 2PURA 3PBWA 4UTTA 1IEWA 3O05A 4GZJA 4B3KA 1OCBA 4MJ4A 2RDWA 1LL6A 1SYTA 3W2KA 4L56A 1AD4A 1QK2A 3MHGA 2DSZA 2WZEA 1DXEA 3HQ1A 1A3HA 3GNOA 1ZY9A 4IUOA 4C6CA 1UMLA 1XH1A 1MQRA 2BY1A 1EPVA 1QT1A 4KT2A 5I0DA 1W5PA 1KRBC 2QGYA 3PP7A 3VZZA 4UUIA 2FIQA 4QE1A 4FI4A 4Q8QA 2Q8ZA 2HPMA 3H2AA 2J9ZA 3UERA 3ITXA 4ZQPA 3W7EA 1TRIA 1Q4WA 4P8VA 4JTLA 2QEZA 4GQQA 1XYAA 3M5ZA 7TAAA 3HM7A 1J2BA 3S6OA 1J0ZA 2Q6ZA 1KM2A 5HQMA 1LG1A 3SCUA 1B1YA 2UY2A 3W7MA 3L4ZA 5TQLA 3W24A 5KSWA 5HJYA 1R3TA 4GHRA 1QHOA 4NYUA 3PBGA 3GVRA 1FCVA 1YYAA 5CSYA 3M41A 2CLIA 4ZTYA 4EXAA 2ZC8A 2XPKA 1EHNA 4LVGA 1UD5A 7A3HA 4GH3A 3BK0A 2DT3A 4MWAB 3W1AA 3M47A 3BCDA 5A2AA 3A9IA 4DO7A 4UMAA 1XFBA 1BQCA 1UP3A 2J7DA 4NZFA 3DFQA 1POKA 1RCQA 4HA4A 5LIUX 4XIMA 4WJ8A 3FW6A 4NIRA 3NQVA 2AQWA 3FVMA 4AXKA 1X98A 4B5NA 1R7AA 4D6CA 4MKVA 4DB7A 3PS7A 2QQ6A 2QS8A 3C2OA 5DQPA 3P67A 5LGZA 4CNPA 3STEA 4BK9A 3MKCA 4OU1A 3PFRA 2ZDSA 2Y7EA 3H2MA 4B3LA 1TJPA 3OZMA 3WN6A 1DJIA 1SFTA 3QHNA 1SPQA 3GVWA 4ZA0A 4V2XA 4IPNB 5IBXA 3KEHA 4FNRA 4XSLA 2VELA 1FWJC 2INZA 5AZ1A 1K6AA 4QLKA 3RM4A 4U2ZA 1DXIA 3PPGA 2DVXA 3ZLHA 5FEWA 1A80A 3TN4A 5JVLA 1JYNA 4F0RA 2X7WA 4OGZA 1CLKA 2W66A 1DE6A 3AYVA 3NZGA 4DUWA 2XDFA 1JG9A 2ACQA 1GKQA 5HWMA 2ZXAA 3E1F1 5G1YA 1YXCA 2GWNA 2XGIA 1KTNA 1TIMA 4G2DA 3ZT6A 5JXQA 5I77A 3FJ6A 3V0SA 3KVKA 1E4MM 1W5MA 2CNCA 3NGFA 2V81A 4LS1A 5JH2A 1XLAA 1GQKA 3NURA 2C3ZA 2PAJA 4PC8A 1LT8A 4LANA 8TIMA 2PDLA 4C6KA 1EX5A 4JHMA 1FH7A 5T9BG 1HKKA 2HJPA 4H8VA 4O0ZA 4UXDA 3IS4A 4YVXA 4R7WA 3ONBA 1JGMA 5AECA 3SN0A 3SY8A 3G1XA 3LRLA 1JZ3A 2ZRXA 3S46A 1VPYA 3PZGA 2ZXBA 4ICNA 2E5DA 4JX4A 3WLIA 1J0YA 1HN1A 3CAKA 4QJ4B 5XINA 5HUOA 4NG3A 1RY0A 2X0HA 1QFEA 1KFBA 3WYZA 4KCTA 4XUGA 1ZS2A 6XIMA 4C90A 2Z1XA 3ELFA 1PZ2A 3KTXA 4IOTA 3THAA 3PZMA 1EWDA 3STFA 1PKMA 3TR2A 3HGSA 2F2KA 4FIQA 4D9PA 1KKOA 4JTEA 3QV6A 1W1ZA 1YKWA 2FDMA 1YNPA 3BL3A 3NJ3A 2OVLA 2YXGA 3CQIA 2C15A 2HCVA 1GVFA 3S1UA 5AYZA 3PPFA 4TV6A 1HJWA 3BAWA 2GQ8A 1NQ6A 3H2FA 3V5CA 1OX4A 3HPSA 1L2QA 3M0ZA 1ADDA 4ZO7A 1MXGA 4AWEA 2ZFAA 4MKNA 3QHMA 1MEHA 1QHZA 3VDAA 2GJRA 2GDQA 4AWTA 1OC7A 1ZAJA 2RJGA 4BQ4A 5LIWX 1DV7A 4IQLA 4NXKA 4KCVA 2OX1A 3APGA 2TAAA 3W28A 5CPOA 3SZ8A 2GLKA 4PZVA 2P53A 1HKWA 2XFRA 1QWGA 3EOEA 3VKAA 3EDEA 4HNOA 9CGTA 1QW8A 4DO5A 2WXDM 1ME8A 5HINA 1RQEA 5G4WA 1OWQA 2ZZ7A 4JKLA 4S38A 3UNDA 2Y8KA 4IF2A 1KV8A 1W1A1 3AO0A 4QISA 4CN6A 4CU8A 1U30A 2WW5A 3L0GA 3M1ZA 4UTMA 2VUNA 2OR2A 2V3EA 1LL7A 3I6RA 3MP4A 4R9XA 2REQB 4H8UA 2FYMA 5G1TA 1EIXA 3GG1A 1I2RA 3BE7A 1F9CA 1MRAA 3NPWA 4M1BA 4IPLA 2J79A 4B91A 4H00A 4L9YA 2BOGX 1OADA 1EJUC 3DUGA 4NKCA 4AAJA 3A12A 3W53A 3VKJA 4J1OA 4RXFA 5EGRA 2P8CA 3OHIA 2PTDA 3L5LA 1XBVA 5LYRA 4JN7A 1FDYA 5BOFA 4AU0A 5LA1A 3I65A 4ACZA 3N2BA 1C9WA 1YPFA 5D9OA 7ENLA 2Z1KA 3NUKA 3T8LA 4UFLA 3PR2A 1MW1A 3WDHA 1TPDA 4DJEC 3S9ZA 1G4SA 4GY7A 1A4MA 3UBPC 3VNJA 4ICMA 2FFCA 1TQXA 4IQEA 3LLXA 1OZMA 3IRDA 1KKRA 4KRZA 3E49A 3RU8X 3S5SA 1O5RA 2QCFA 1VJSA 4PMOA 1F4AA 2TYSA 5D4YA 4LJ3A 4IHCA 2Z6JA 4LS0A 1V03A 1ECQA 3MCOA 4NAFB 3GDRA 3I6TA 1WDDA 3LMYA 4O0KA 2VX4A 2A6LA 3CV1A 5FF7A 4XQ6A 1M7OA 1R86A 1MEIA 3RU6A 1NARA 1Q6QA 2POZA 1V6TA 1ONXA 4UFJA 5FF3A 1TSIA 2XVKA 1B3WA 3LI0A 7REQB 3UGVA 4ZOCA 2E6DA 3LRMA 1J10A 3AIQA 4NQ1A 3ICJA 4NZCA 1SFSA 1O60A 5CLTA 1MQQA 4MB5A 4Q8UA 1IWAA 3TW9A 1AVAA 3B4UA 5CZTA 4AZBA 4V15A 3G24A 1E6RA 2GQAA 3F03K 2EGZA 3LSBA 2Z0IA 3RUBL 4OOUA 3L67A 2WBKA 4O13A 4GI6A 3AISA 1PDZA 2B0MA 1QI3A 1QNPA 1PKNA 3SGGA 1W54A 2FFIA 3M0KA 4UTUA 2GJXB 3P2VA 3EGJA 4RW3A 3TROA 2XISA 1PZ3A 4JTSA 4B16A 3FV9A 3JRKA 3TA9A 3LD5A 3QEZA 5FJIA 2Z00A 4AY1A 5CPLA 1LRQA 2A3HA 3PWGA 2VC7A 3QY6A 2Y62A 1JXKA 1RK6A 4WK9A 3RG6A 2J47A 1BYBA 5CBJA 3C56A 2V5CA 2ABAA 2J7EA 3TW7A 3CLWA 3ABZA 5EMMA 1UR1A 2I7GA 4V27A 4L4MA 3TYCA 2QPXA 4HNVA 2QCMA 1Z48A 4JTUA 1J12A 3R11A 3GY1A 2NT0A 2AL2A 5B7ZA 1H2JA 4PCFA 1JYXA 5CJMA 3AIVA 2DT1A 2PWFA 2X05A 4CN4A 3VKCA 4EAYA 4W8AA 4PB4A 2OYKA 3HJEA 2E40A 2PS2A 4YYFA 3ISIX 5I02A 2GVEA 5ECVA 1WZLA 4H6RA 1PKYA 5ABEA 3CPUA 3FSTA 5BRQA 3WENA 1BKHA 2OWCA 3CAVA 3PG9A 3GHRA 4UIOA 1W9XA 4HMCA 3M0YA 3TYBA 1NFPA 5ECUA 3E0VA 1NM9A 1XICA 1RSCA 4WF7A 2WYSA 3L2MA 1IXQA 3EX4A 3N6JA 2PLCA 4DXVA 2CLFA 2E3ZA 3W7NA 2WOQA 1EUAA 1KBKA 2BNJA 2Y4SA 3IVTA 1KFKA 1ADOA 4HNNA 3N14A 1UHVA 3VGFA 3KXQA 3NL5A 2V2CA 3C8NA 3OTRA 1TVLA 1GTHA 4FR6A 1LM1A 4UFHA 3TYDA 3ABXA 4AD4A 3PBUA 4O8RA 3WJSA 1BWVA 2PRLA 4Y9MA 1HO4A 2OSYA 3LA4A 2J75A 4E0CA 4HBKA 1TRDA 3W0KA 4QDPA 1ITXA 1TWIA 3TQ0A 1A5CA 3WH9A 1XG3A 1U5VA 4DWSD 4IMAA 5D33A 3WL0A 1TPFA 1XYBA 1HNYA 5SWUA 4GIYA 4XBJA 3KP1A 4CQCA 1PEZA 3TQVA 4U3AA 3QQ0A 5H2ZA 4FEZA 3AXMA 3EPNA 1IT0A 5I5RA 3D6NA 2WWDA 3OOQA 1GJUA 1QI2A 1ME9A 1FQ0A 4LC8A 3QR0A 2QKFA 2FZ9A 1UIOA 1L6WA 2H3BA 1G9HA 3F2BA 4Q32A 3G1SA 5GPRA 1UROA 5BMWA 1GPWA 5K2ZA 1YW1A 2QPUA 1C93A 1JAEA 4PCPA 3SY5A 5A8NA 1BKSA 4KRTA 4BS0A 3IK4A 3DGBA 4B9ZA 2QUMA 3QYQA 3VGHA 2E09A 1LQAA 3M4HA 2Y7FA 1S38A 1FWBC 3QV7A 1MI3A 6PTDA 2CZDA 2Q3OA 3BGJA 4C6IA 4YCOA 3ZR6A 1R3RA 5FEZA 2DIJA 4LF1A 4LRTA 1JCXA 4H4IA 4W8BA 3T55A 1FWRA 4MY8A 2Z28A 4XZLX 4ERAA 4E4UA 4XZNX 3NQBA 3P3BA 3SDOA 3MT1A 3UWVA 2C0HA 3B97A 4Q8WA 3BJTA 1GKRA 2WMJA 1VFUA 3BLLA 1PO9A 1SR0A 4IL0A 1NDVA 1ZQ5A 1F73A 1YNYA 2QMKA 1MSSA 1VJZA 4HSNA 2CC0A 4QE4A 1L6FA 3B9AA 2GVGA 3U48A 1D2KA 2IKHA 2Y8UA 2ANUA 3U7BA 1BAGA 1RCOB 2YBVA 1H1ZA 3Q65A 3RIKA 3QY7A 5HNTA 1N55A 3EEZA 5CSSA 3URNA 5CEWA 1TX2A 1X8FA 3WD3A 4ZXOA 4WUIA 1GVQA 1IV8A 1E3ZA 1DJWA 4Z42C 1V6VA 4FNQA 4R53A 3WMBA 4GCXA 4KEZA 4WDXA 1C8XA 3LTPA 3ZJKA 2FGBA 2XIOA 3RCNA 3II1A 3DG6A 1LT7A 3DG7A 5K4XA 1T96A 2W92A 3Q37A 2PBOA 3WQPA 1GOOA 3KBNA 1WKYA 3VA8A 4DY1A 2QUVA 3R79A 5B7YA 4JFUA 5IXEA 4DWSB 3ID7A 3SN1A 1SO6A 3NYDA 1O68A 2PGFA 1UBPC 4IFOA 3QN3A 1V02A 2HQAA 3MUAA 3ZWTA 4YL2A 1SZFA 2VVNA 2E6AA 1XLMA 5C2XA 1XDLA 3PWAA 2BGSA 4ZB5A 3V16A 2XSBA 3LQLA 3GHSA 1SUXA 1IWBA 3ITVA 2PDNA 3AMDA 3H2OA 2C14A 2JEPA 3MYOA 4BWLC 2PDJA 1R46A 4WRHA 1E51A 3QMSA 1QAPA 2EPKX 3HIJA 1OJXA 3EXRA 3W4RA 2RHGA 2PDPA 4GPNA 4JTAA 5KTLA 4UTWA 1F07A 1W91A 1E72M 3BLOA 4TX6A 1H4PA 4UZSA 1JRBA 4GQRA 2YCLB 5GJNA 3KS6A 1GZ1A 1JZ6A 4MKSA 5E6YA 4Z08A 1NDZA 1V3HA 5DF0A 5DT7A 5XIAA 3WD0A 1Q4NX 3TN5A 3GTHA 3OU8A 3FEMA 3GDTA 2HTMA 3L0NA 3LXCA 5M03A 4OECA 2GOUA 1V3KA 2J66A 4O18A 4R34A 4A29A 3I68A 3VVGA 1A5SA 1R8LA 1CENA 4R88A 1QW7A 3VMNA 2HK1A 3A3HA 1HJXA 4RV3A 1T8QA 4EPEC 5L6UA 1FHUA 2D3NA 3TR9A 2Y5SA 4L1GA 2BXZA 3GKFA 2E6FA 4PUWA 3EOUA 2DZBA 2R94A 1TV5A 1OCNA 5EY5A 5GQBA 1QPRA 1Q6OA 2R91A 4JS3A 2XUCA 4JTDA 1XKJA 2WSPA 3H55A 4XK2A 2VCAA 4O4VA 1XGEA 3NQ8A 3SO7A 3KL5A 3MVIA 2O9RA 4H2CA 4P8UA 3UQNA 4JKMA 2V5KA 4GQ0A 3R43A 1C8VA 4P5UA 1DWAM 4TO8A 4H1ZA 4KMQA 3MC5A 5I79A 2G3FA 1FWHC 2DY3A 3NQFA 1M6JA 5EMUA 2P8BA 5GJMA 2B81A 1C8YA 1CXKA 2NQ9A 2V9DA 2OZ3A 4M0XA 4JIPA 4JFVA 4Q8NA 1KM5A 4RNFA 1XR2A 2WNZA 1VBHA 4FALA 2DZWA 3GIYA 2RKXA 3I3BA 3IARA 3K4AA 1ZJIA 8CGTA 3N2TA 1HVXA 4DHGA 3BMXA 4ZE5A 2H8ZA 5FA5A 4HK7A 1UH4A 1AODA 1UG6A 3LRKA 2QLYA 4N02A 1FWDC 4BJHA 4DJEA 3GQYA 4GVFA 2D2GA 3RXZA 3NPVA 4QSHA 1YXDA 1C7TA 1RVGA 1HP4A 4IIEA 3KLLA 4UFKA 3EPOA 4JY8A 5BXPA 3OLIA 2YCJA 5FCZA 1DWIM 1F5ZA 9XIMA 1ZUAX 7ODCA 3AYSA 3WK2A 1R2SA 2BVTA 1UZDA 2AGKA 3SUUA 2VR2A 1ZLPA 2V8ZA 4OBSA 3B9OA 3OBEA 4PTMA 3LN3A 1I2QA 1Q6RA 1XSJA 4F0SA 1IR1A 2PB1A 4WOQA 2AL1A 4HN4A 1R38A 3DOPA 3GTFA 1Z8AA 3EX2A 3OW1A 2YCEA 4P7NA 4C7FA 3NSXA 1OD0A 3U0HA 4O1AA 4K37A 1E5NA 3DC0A 4JQ3A 4QLLA 2CESA 1US3A 3R2GA 1F4HA 2WMGA 3EYPA 1JPKA 3GW0A 4P61A 1R3WA 4WZHA 5KMYA 2QCCA 2VEKA 3R8RA 4HU4A 2CBJA 1G4EA 1UKOA 4BF7A 3RO6A 2OODA 1DEDA 2RDTA 5M5DA 4BZYA 1FFRA 3O0KA 1RLDA 4KGLA 3QF0A 1V3IA 3NQEA 3S3GA 1V3JA 3I3DA 4XBKA 3GUGA 3MS8A 3EWWA 5MF5A 3BAJA 3SIMA 1WBHA 4XD5A 2HV5A 3PZQA 2PZNA 5HWNA 3DHDA 4AZHA 4ZR8A 4O8AA 1M04A 1WKEA 3AROA 3UA4A 1R87A 5F1UA 1UIPA 3MHUA 3T8QA 2NW0A 5HAOA 3A3XA 3DXIA 3JS3A 1EA0A 1GJPA 2BVYA 4Z2JA 2HVOA 2OZTA 2NX3A 2QVHA 3INPA 2OOGA 2OMAA 1K8ZA 2QIWA 3KZPA 3R5EA 3NG3A 3OQ8A 1F2JA 4LVFA 4A2SA 3UYCA 2YIHA 2MUCA 2OTDA 3HFTA 1CNVA 3W7GA 1H7NA 1EYEA 1ZBCA 5A5WA 1V4YA 4UQ9A 3W01A 3ITLA 3SJ3A 1HL2A 3UWYA 1GVIA 1JCLA 3N2XA 5CLWA 2OT0A 1EB3A 2OLSA 1GOKA 3QOMA 3S2MA 5DXXA 3FN9A 2ON3A 3O6AA 2WAGA 1LQ0A 4DLFA 2A5HA 3W7JA 1AFSA 4JY9A 4IIBA 2IXVA 1L6GA 3W2MA 2HPIA 3UEQA 1WZMA 2DU2A 4H9XA 1A5AA 1ITQA 5DY3A 3OGSA 4FPSA 5I2UA 3WQ8A 1NJJA 1H3GA 1I60A 1JJKA 4LUTB 4H7CA 1A5BA 4F9JA 1G94A 1XH2A 5CSRA 1EXPA 3MUCA 3MI6A 1XV8A 1OFEA 4M81A 3QM3A 1K77A 1KB3A 2R1KA 2ZA3A 4MMWA 4KRUA 4TTUA 1UKPA 3L5AA 2WHJA 1S2AA 4PMVA 1EZWA 1NEYA 2OJPA 2WVVB 2QJHA 4N6EA 3B40A 4YTTA 5D09A 1BYDA 3OIHA 1E4IA 2NVCA 3F2CA 4U28A 3ABSA 3WLQA 1GYNA 1R9ZA 1W9UA 2YW4A 1ITUA 4S3BA 2WPBA 2OB3A 2OQYA 1ODUA 2PDHA 3OLEA 3GXPA 2O9PA 2QCEA 4K36A 4ORMA 3HMJG 2NXGA 3WNNA 3OIXA 4LW7A 1V3LA 1DL3A 2NWSA 1V51A 1DWHM 1AMYA 3H26A 4AYGA 3HQOA 1IHIA 3RK8A 1XG4A 2PGEA 2WZMA 1TELA 2BDQA 3A4XA 1UZHA 3BLKA 4XAFA 1IGWA 3R12A 5DCDA 5HMDA 4YTQA 1XC4A 3BV4A 3M0VA 3MB9A 1DWGM 2ZC1A 4KPLA 4DJDA 3CYJA 3E12A 1A5MC 1PWMA 3T44A 3WF3A 3GU2A 4GNVA 4LAKA 1GYLA 3STGA 5HR7A 2D0FA 3TYAA 1O5QA 2QJJA 1SZRA 3W02A 3HGOA 1GOIA 3L7RA 4EXQA 4FX8A 1U1JA 3CZJA 3CIWA 1O4UA 4NSBA 4QP0A 2C7FA 4YYCA 4BHYA 3L4WA 5BU9A 1GVOA 3HBLA 3S1VA 2C18A 5CGQA 4JIHA 1I0BA 1TX0A 5FJUA 4KQNA 4X61A 1C3FA 2ISWA 2C1IA 4QG9A 3QQ1A 2Q71A 5I3GA 2ZX5A 1TO3A 2FHBA 1RLCL 2A7NA 4F2UA 2Z24A 3DX5A 4AZ5A 1XF0A 3TC7A 3H2NA 3MP3A 4ATWA 1UUOA 1TV3A 4KFPA 4FNTA 3WLRA 2I16A 4HNLA 2W63A 5BU6A 1W2VA 4L61A 3EMZA 1TB3A 4QG8A 5BWAA 1EO7A 1SW7A 4O1BA 1IF2A 5AOUA 4NRSA 5KETA 3N25A 3VKDA 3W1PA 2X1SA 2XIBA 2Y2WA 4IMCA 2QMJA 3KDNA 3AXHA 3RILA 3L0KA 2CHOA 2P5NA 2PWDA 4C7GA 3B0UX 2EPNA 2A21A 2PP1A 2P1FA 1MZRA 1U2YA 5HDRA 4KBXA 3P6LA 2GZXA 3GVGA 3BLPX 3KOWA 4KWUA 3QGKC 1JI1A 3PZUA 3E5BA 3N1AA 5FJJA 2X8RA 1OK4A 1M65A 4V1YA 3T78A 3DAQA 4FB7A 3MQTA 2W62A 4CD4A 5DELA 2G3NA 4IX2A 3WJWA 3ARQA 4YPJA 3EKGA 3GKAA 3POHA 1RCXB 1KTCA 4AZ6A 3G6LA 2Y61A 1FCUA 1JYWA 3SGZA 1PUDA 3ALFA 1FVPA 1TCMA 3B9EA 3H7RA 4AG0A 3ZWSA 2PDQA 2H6RA 4RZ5A 4JQAA 3WJZA 3W87A 2IPJA 4DJFD 1HL8A 1UZ4A 1EC8A 1G4TA 4LEQA 4OTKA 3EWCA 4LYRA 4DYEA 4Q7NA 3JW7A 4V28A 3VCRA 4F3HA 1VEPA 4EACA 1UKTA 4US6A 3VD5A 4MNLA 4WR3A 3UZYA 3LBCA 2XSAA 1QI4A 4UMBA 1ESWA 4RJEA 4MVAA 3D3FA 1XD0A 3KOZA 4AQLA 4DF0A 4Z0JA 3WH6A 3EWBX 4GZIA 4XZWA 2QAFA 4NY2A 2GGGA 3KRSA 4DLMA 3GVVA 4NUWA 2ZVIA 4WSKA 1LZOA 3FHAA 2VFGA 1RR2A 1D3GA 2Q09A 4BEUA 3F1QA 1HX0A 5FF2A 3L21A 2J25A 3T0BA 4E8GA 1ZSXA 5ABHA 1A5OC 5A69A 1R47A 1JCJA 3MSDA 1J8VA 3A5FA 4LNCA 4NJGA 3P0XA 4IICA 4OVXA 3TU9A 4R7JA 2VFEA 3CUFA 1CXEA 3W70A 2ZZ5A 5A8OA 2G8ZA 3CLMA 3E6EA 4DBWA 1XPGA 3H2EA 4ZQCA 4HB7A 2QULA 4IJBA 3KWSA 3M0XA 1MW2A 5I23A 3P8JA 3I4EA 3VNLA 1HJUA 1WBJA 1XRSA 3OZYA 2XH2A 3M7SA 1W56A 3G18A 3N17A 4GBDA 3RR4A 5IM51 4MF4A 3LGGA 4MSSA 2E1WA 2PZ0A 2GDVA 4N4PA 1MWOA 4D6EA 2XHYA 1UKQA 5J04A 5CC7A 4GQBA 3EB2A 1H49A 3AMKA 4ZSTA 1OIFA 3ME3A 4AVOA 2WO5A 3IPWA 4ZCWA 4IZGA 3W7QA 1QNSA 4UZUA 4EPDC 2JBMA 4IG2A 1TPB1 4H8NA 3QPYA 1J9YA 1PIIA 3H7VA 3L4UA 4XZBA 3WDIA 5MHBA 1TQJA 1Y65A 2DT2A 1CX9A 3BG3A 1TMQA 3WMLA 4L65A 2WCGA 5F2IA 3FFSA 1CGVA 4UOJA 4IGHA 3ZR4A 3Q67A 3SQSA 5EBAA 3SN4A 3CZGA 1JCYA 2BX7A 3W85A 3L4VA 4LCQA 3BLIA 5LA0A 3SIZA 2KZHA 4JTFA 4MTVA 4L9XA 1XQKA 3FS2A 2WBGA 1CB7B 1YPXA 3TSBA 4UTJA 4A8IA 1W3KA 3CPGA 4WY0A 1P7TB 5GNZA 2QCDA 4Q3MA 2Q01A 4Z1YA 1IWPA 3KL0A 1DJNA 4GJIA 3CM4A 4C5YA 2AMGA 4XAYA 1V02E 3MMUA 4ALDA 4EPKA 3GH5A 4PSPA 3TDFA 2F9RA 4HJWA 4KEVA 3CTLA 5I3HA 1VIWA 1ALDA 1LG2A 3WQVA 1OT1A 4YJ5A 4YN5A 1VKFA 1E0TA 4CUCA 3ANUA 4JTHA 4Z1CA 3UZZA 2YA0A 3C6CA 2ZKMX 3BG5A 1CCWB 5LGXA 2CLOA 1Z32X 4KEUA 3RR1A 3WNMA 1Z89A 1OD8A 4FLQA 3SW6A 2OXNA 4LC6A 4A3QA 1WXZA 2GUYA 1GWJA 3P7YA 2WJDA 3NZRA 3VFCA 4HZ8A 4C6EA 1X8CA 1ELSA 4DM2A 4BI7A 1HFBA 2WNQA 4AY7A 4RXGA 1VC4A 3PTMA 1SO4A 3BQ5A 3BWWA 4NZ1A 1WDRA 3WBEA 2OZ8A 1OB0A 1P1XA 3CIVA 5DFAA 1RALA 5KZEA 2DSKA 4ROQA 3CWOX 4PRTA 3OBAA 3PFMA 1GEHA 3DI1A 4NNBA 4WEVX 3WNKA 3FVDA 2VX5A 4EF9A 1J6OA 3QSRA 3PZIA 2ZCGA 4P8WA 1V93A 3ITCA 3MW7A 3GK0A 4XD3A 5AC8A 5ABTA 2WC7A 3NGJA 4QJ3B 3KVMA 4GBUA 1TPEA 5MKGB 3ZJ6A 2VDGA 4ES4A 4HVXA 3WBYA 2DZUA 5BRPA 4BQ3A 3NXLA 2XH7A 4WJEA 4S3AA 2BBFA 1I4NA 4XB3A 3KHJA 3B9DA 1EJRC 4WOZA 3REQB 5LNVA 3IV8A 2A0NA 4OFCA 3C2FA 3T1GA 4L4LA 4RDYA 4MLRA 4PCTA 1VLIA 4EX4A 5F4WA 1T41A 3QTGA 2PGRA 4CU6A 1NWSA 1ZP3A 4UQAA 3TMLA 4QAIA 5C55A 4ZO6A 3GG7A 3EA3A 2CPUA 2NSOA 1LCOA 3CB3A 2I5IA 4MY1A 1J11A 2D24A 2WLYA 1JF6A 1SFJA 4OQVA 1CLVA 2HXUA 3GC2A 4HKPA 5E0FA 3VOIA 4M56A 1GEQA 2BSLA 4O1CA 4PFHA 4XAPA 4Y90A 4O4WA 3KCOA 2VNCA 3I7RA 2WZIA 1VFSA 4ADUA 5C7HA 2A3BA 3GXIA 4CNTA 3SB0A 1EOKA 3ARWA 4GUGA 1Z42A 3ZVIA 4Y7EA 5I09A 1RUSA 2B7PA 3P93A 3B0YA 2DUZA 1Q6EA 4ZL1A 3E0LA 1GW1A 1H0GA 3EPMA 4CD8A 5K3VA 5K9DA 2XWDA 1XLGA 1KTBA 3FJLA 3FLUA 3F4DA 2CBVA 3AIRA 3CBWA 4XSMA 1IZKA 1KV5A 1H5YA 1VP5A 5F4SA 4HOZA 4RDWA 5U4NA 5ABFA 4GVGA 1K8XA 4LYPA 2GUBA 2E5CA 2YCLA 2I1OA 1XCFA 2QV4A 2A3LA 4HD5A 4KS0A 1Q2RA 1UR2A 1ZHAA 3QSTA 5AHFA 1BXNA 4J3SA 4QRNA 1P4CA 1X39A 1DTNA 1KC7A 3TSMA 3KBWA 3IV3A 1LLWA 2R1MA 2ZZ1A 1H5VA 3B9NA 4CU7A 2ONEA 3H8AA 2HE8A 1EGVA 4UR8A 5FAGA 2X0SA 1XIGA 1JDDA 5A2CA 3PVFA 3B8UA 3VIPA 3DFSA 1NELA 1J93A 1HZYA 4I90A 2ATSA 4J28A 3ZM8A 1XLHA 5C7VA 3MZ2A 2ZUUA 2B4GA 4Q4OA 1OCJA 4M8UA 2ZTJA 3U2CA 2FB2A 4NHVA 5I3JA 4Q7IA 4D6DA 4LEFA 4EANA 1VCGA 2ZQ0A 1RK5A 3NDOA 1IT7A 5CC6A 4DXXA 3W27A 2HWGA 4J27A 2C8NA 2P88A 3GTIA 2DGAA 3MUZ1 1KBBA 1ONWA 2FJUB 1XIDA 3B8TA 2X1IA 3OYZA 1R6WA 4S1FA 4PUJA 3ECQA 3QW3A 2ISSA 4MJZA 1W9VA 1CGTA 1E0XA 4A6GA 3ZR5A 4LUYA 2A6NA 3MTWA 3WNOA 2DZXA 3IAPA 5DX7A 2A3AA 4Z1DA 1OC5A 2J7BA 2X42A 4JTQA 4C7DA 4ZB0A 4IJRA 3PJXA 2D23A 5D9NA 3EA1A 1I1XA 1UWSA 3HF3A 4LUJA 3VK5A 3WLNA 3FY1A 3UPMA 2CFFA 3UXIA 2BY0A 3Q2DA 4MG4A 1R3VA 1ISWA 2CBIA 4JQ4A 2IUZA 3EX6A 1XGDA 2WM1A 3CWNA 4FIRA 4S2BA 4GJ1A 3PTDA 3GHTA 4LVBA 4D8AA 3LNPA 3QC0A 2NV1A 4I5UA 2WC3A 2PD9A 2D0HA 4HN8A 2F6UA 2OKTA 3A4WA 4QXIA 5TBOA 3PPCA 1OG0A 2VZOA 5FSDC 4D8LA 3DHPA 3DYOA 5AYXA 3VX1A 3QGVA 2V63A 4LF2A 5EMLA 2W4XA 3T7VA 1F3XA 2PU1A 5DRIA 4BEQA 4JCMA 1W5NA 5BCAA 4WQ6A 1JUBA 4B15A 4K8HA 1E1EA 4ZO9A 5A6BA 3UCQA 2IKJA 1CI1A 2JFEX 4W5UA 4JL2A 2DEPA 3QQWA 1E4LA 5H1WA 2DW6A 5FL1A 3SM0A 1W5OA 4B5XA 3GAKA 3RPTA 4DYJA 4IP4A 2VO5A 2PTWA 3WQ5A 3CUIA 3RMJA 3U8GA 1EYWA 1HXJA 5LXEA 3JVAA 5GNYA 2MNRA 1HG3A 4DZ5A 1RV8A 3M0MA 4GO8A 3NSMA 1PS9A 2DUXA 1SMDA 2XZ7A 3LSCA 4M6PA 4LT9A 4R7OA 1VYRA 1TTJA 4UQCA 3CZEA 3AU2A 4A3HA 1FX6A 1S2UA 3B8WA 4GGBA 2QUTA 2L5HA 2DW7A 4MNKA 4KERA 3S8HA 2WANA 3N4FA 1C29A 4CVUA 3H23A 3WMCA 1P48A 3LCFA 4MFEA 5HUPA 2O9OA 4KFNA 3Q94A 4IPPA 4AB4A 3R25A 3DCPA 3AIEA 1XC6A 1ODZA 3PJTA 3WF1A 5A6AA 1NIUA 2QCDB 4EWJA 3OVPA 3WUEA 2VJXA 3VNYA 3NR0A 5EKYA 4OJYA 2IKIA 2VXNA 2YB1A 4CNOA 1C7SA 2HMCA 3G1VA 3IGSA 3SAZA 3JUGA 3VM7A 1RBLA 2ZRYA 4U4MA 1MYRA 2ZX7A 3M16A 3QY8A 3FYPA 2NXIA 1UJPA 4Z2HA 1PBGA 1WO2A 4WKFA 5HJLA 1GOWA 1US2A 2NX9A 3LBOA 2WWCA 3LEPA 3EDFA 2Z2BA 4K3ZA 4IT1A 4W88A 3HG4A 1XCWA 1YDVA 2J7GA 4DPQA 2ISVA 2QNEA 2QAPA 5FF0A 4DF1A 5LNSA 3VD3A 1I2PA 5CJ5A 4W5ZA 2CLLA 4HTYA 1XI3A 1ZL1A 2UY3A 3G2GA 2ZX8A 3G1YA 4DJFA 3AC0A 4RKAA 1TREA 1SO5A 5U7SA 3MV11 4HGXA 4ILSA 2PC4A 1ZU8A 2VURA 1KA9F 4GGHA 1ZCCA 3A3WA 4W87A 2EHHA 4WCJA 4HHLA 1G0CA 4OBRA 1QBAA 3E02A 4PUMA 4QM1A 3CC1A 2NWRA 3S2JA 2HROA 3IVSA 4AH7A 2NLYA 4QNWA 2CYGA 1MEWA 4A3UA 1ISYA 1XUZA 1W8GA 1TZZA 1UPPA 3MWCA 1FKWA 3PB2A 4IGMA 4JZ5A 5A6TC 3ZJ8A 4DVOA 1OX6A 4G1NA 4DF2A 3EDKA 4EF8A 5D32A 4GIAA 1FDZA 3F5KA 3GVQA 2ZE3A 2QCNA 2NQZA 1VENA 3TK7A 1K3UA 4J35A 3TN3A 3TTEA 4A2RA 3REQA 4IMGA 2D2JA 2VGIA 4OIFA 1YBQA 3TVAA 5AN7A 5I3DA 5BOOA 3CU2A 2C1GA 4GC3A 1FBAA 5DXYA 3ZOAA 1GT8A 2AOSA 2O55A 4OE7A 2X40A 1JF5A 1W1B1 4QGCA 1QOPA 4HPJA 4HSOA 5C9UA 1ISVA 1RD5A 3FJ4A 1VF8A 3NQ7A 3C0LA 3SRHA 5CC5A 4DO4A 3T6CA 1P0EA 3U9IA 3NCOA 3TH6A 3MWAA 3WLLA 1XIHA 4NNCA 3VC5A 4AISA 3WQ6A 2P3ZA 1U5HA 1VHNA 1PPIA 3R7MA 1EX1A 3T4CA 3EKZA 2VRQA 3CV7A 4C6FA 1A5UA 5CGTA 3E74A 2CBUA 4GMEA 4WGHA 3LHUA 4CVWA 1E6ZA 2OWXA 1POJA 5CPMA 4XKYB 4RLIA 2A3EA 4M82A 4AEEA 5D04C 2YDQA 4N4QA 1R3SA 5DMMA 4TIMA 4JIQA 3TNBA 4K39A 2VTFA 2J7CA 4AWUA 2FTPA 2GSJA 3NL3A 2E8YA 3TYEA 1F6YA 3RLVA 1K9FA 1UR4A 4IIFA 3ZYZA 1Z69A 4HK6A 3CMFA 1DJYA 4Z2GA 2DQXA 2ZYFA 3GH7A 1PVNA 3WNPA 1DYSA 4GI9A 2ZUSA 4H04A 2RFGA 2VRKA 3BLEA 1TPWA 3TLLA 2A7RA 1BQGA 2UZ9A 4PB5A 1B5TA 2WHLA 3EX3A 2WVUA 1AZ1A 4JX5A 5D2VA 4DJDC 2NUWA 3B06A 3WUFA 4GX9A 2HBVA 4N9CA 4QDMA 2JF7A 3F5JA 1W1VA 3T4WA 1H62A 3WKZA 3ARVA 2KAUC 1TE1A 2PTYA 5I03A 4MFDA 3ZSTA 3CHCA 3TCSA 3PBVA 4WDTA 4RZ4A 3GRIA 2OQHA 3M0LA 3WDPP 4G7EA 1P0NA 4XIAA 5A6BD 1W1TA 3W7LA 1TA3A 4H6KA 4LUSA 1ZBKA 1E6SM 3ARZA 1RD6A 3WZ0E 3I6EA 1RJRA 1QPKA 3UJSA 3A4JA 4OOZA 3S2CA 4PMRA 2PF8A 1JQVA 1FWAC 5DLCA 3O6DA 3RF9A 3K8LA 1UZ1A 3VD7A 2CKSA 1EZ2A 3PK7A 2BTMA 4IGSA 3TJLA 1NY1A 1OF6A 3TTYA 4K1GA 2RGMA 2NVDA 3TZNA 1XDJA 1ZALA 1EPXA 4W93A 4WDUA 4Y8FA 4Y96A 3AHTA 4WHBA 3RX2A 1MW3A 3ITTA 1M7PA 3PZTA 4US5D 3R58A 5EL1A 1X7IA 2Z6IA 4GA8A 5HJXA 1WE5A 1WB0A 2ABBA 4AZCB 4C65A 1QATA 2YA1A 3SECA 2GJNA 3EAUA 3BW2A 4LV9A 1VCVA 2GJLA 5RUBA 4AEOA 1K70A 4AD3A 1JQXA 4PMZA 3CEPA 3NL6A 5I07A 3GFYA 2R6OA 2E1DA 4XVDA 2ZX9A 1H7OA 2PCQA 3LOTA 3R1ZA 1V6XA 5H6HA 4ZMGA 2RAGA 3T2QA 2G96A 4YHEA 1RJPA 4ECLA 3CV6A 1F6KA 1TPC1 4US5A 2C16A 3WL1A 4LU0A 1WPCA 3D5HA 5G2WA 1XBYA 3MDUA 2VKZG 3L65A 4HYVA 1LWJA 2XVNA 2Z2UA 5EA9A 4NT0A 1DJGA 3DFYA 4M7TA 3RCYA 1WOAA 2PDYA 3TWAA 4GNKB 2CETA 2JGYA 2C19A 4O0QA 3BOXA 4LFYA 5E6ZA 1UBSA 3GD6A 3GC4A 1OFQA 3ES8A 3NEHA 2Q02A 3K5XA 4AMCA 4MNMA 3MANA 2ACRA 1BYCA 4PEKA 3C2VA 2NQHA 2VWTA 2Y5JA 5CG0A 3C2YA 1Q3NA 4GXPA 2VGFA 3V5FA 1DJHA 1VEOA 4EE9A 1FCQA 3A23A 1JYVA 1OIMA 3QR1A 5A6MA 1EO5A 2YCIX 3GNNA 1K9TA 1FOBA 4JNMA 3OO2A 1UWAA 3IWPA 1UD8A 4HU3A 3KM8A 2BVWA 5AVHA 2VC9A 4RE4A 3IUIA 4PTVA 4XTIA 1J2WA 4IP7A 3W6YA 2J8TA 3RLHA 5EPDA 3AAMA 1CIUA 4LBSA 3NIYA 3AZSA 2ZE0A 5D05A 3LB0A 1UWRA 1DWJM 3UG5A 2BB0A 4NYYA 3P5YA 1KLZA 2V5DA 2VOMA 1WKFA 3B0XA 2TODA 1YHTA 2GSEA 3TYZA 1UPMB 2EG7A 5IDZA 3M0IA 3WBAA 3WK0A 3RPMA 1U33A 4U5KA 3AU6A 3FKKA 4DN1A 4HHPA 1FDJA 3PB0A 4PULA 1KXTA 3FA5A 5FD0A 4FLSA 3H12A 1X1NA 1Q2SA 5HMSA 3QC3A 1R30A 3TMQA 1UA3A 1JPDX 5D2TA 3WUBA 2QYGA 2G3MA 1LQ2A 1M53A 4CQAA 3WJXA 1E73M 4PN2A 1IT8A 1KBLA 1E0WA 4C6PA 1B31A 4B4HA 3W7RA 2XIQA 1KD0A 2PD5A 5HNRA 4F40A 1AUSL 2GPTA 4O53A 5PTDA 1EJVC 1G7UA 3AS2A 1F61A 4C6NA 1LOSA 3MSRA 3SCPA 3K8KA 3QPZA 4D1JA 1WA3A 1OY0A 3I7SA 1CEOA 3T0TA 3DEQA 1OSEA 1TMHA 1E4NA 4RNJA 2YYUA 3GNRA 4AIOA 5IHSA 4KEMA 2D2OA 3WD1A 3W2LA 4CCDA 1SW0A 1LBFA 5A2BA 2HSAA 4HT3A 1XIBA 2ZUWA 4TOQA 7XIMA 4FLRA 1KM4A 3UESA 4LX4A 4UTFA 4LUIA 3UYIA 3OGRA 3RX3A 1E43A 2Y70A 1W31A 1IQ8A 1UWUA 4Q22A 7PTDA 2P50A 3IJ8A 4FOJA 3S1WA 3WK3A 1QVBA 5BYWA 1S1PA 4UR7A 3WLHA 1JNDA 3LMZA 4J9JA 1PYFA 3O2LA 1ZZMA 2JE8A 1VFTA 4LTSA 2PEVA 3HQNA 4GD0A 1MO0A 4QS5A 3W00A 1J18A 3EWYA 1J96A 3VINA 3AHZA 3IGHX 3W75A 3UD6A 4QR6A 3A21A 4REQA 3I3EA 4O52A 1PX8A 2WSYA 3CAQA 4Z0SA 4K1WA 2RGLA 3ITOA 4GIRA 3UVIA 1TR9A 4JTRA 4EOUA 3RM8A 2WNNA 3PZNA 2GK1B 1PXGA 2PDMA 3EB3A 1K7FA 3GZ3A 3I7QA 4NNAA 2FHFA 4L64A 2VZUA 2FJKA 4OV9A 1EJXC 4XD6A 1GUVA 1NFGA 5CXPA 1DTUA 2BVDA 4GNJA 4GACA 3GG0A 4I6KA 2GGHA 3KBMA 1GPFA 4QEHA 2JQXA 3G1RA 1GHRA 3TTSA 1F76A 1SZNA 3SCRA 3DYMA 4ZQRA 2YA2A 4QROA 2V0TA 5CBIA 1VYSX 3R4IA 3FYYA 1RH9A 3K30A 5AYBA 4ASTA 1D7FA 2VT0A 3PJWA 1W37A 1D3HA 4K7VA 1QO5A 3FA4A 3UXLA 4TU1A 3AZRA 2O56A 1OZQA 3N13A 1F3TA 1E1CB 3P8IA 3DENA 3N2OA 1SJAA 4LBUA 2OEJA 3QTPA 3NPUA 1X7FA 2ZXDA 4JFWA 1H09A 3GFXA 4GKTA 4MHBA 5G4HC 2D69A 1GNXA 4GUIA 3T9PA 2VC5A 3WQFA 4O1EA 2H90A 2OYMA 5CQ1A 1UASA 4R33A 1Q7ZA 3UG3A 1WCGA 5JQ9A 4HYRA 3KTSA 1KQZA 4PTWA 1CB2A 2PDUA 2FPVA 3GR8A 2QDGA 2VOTA 3F5LA 4NI3A 1TG7A 3S6TA 1PV8A 2QCGA 3RITA 1TJ2A 4I7WA 1G4PA 4JYFA 1C9DA 1JNEA 3WELA 1CGXA 3KRUA 1MRQA 1TMLA 1KRCC 3IIPA 4MJ2A 3VYLA 5G5IA 2FMNA 1E70M 4IGNA 1AL7A 2HS6A 3TSDA 4DBEA 3DZ1A 1S3HA 1KFLA 3G8EA 1Y5XA 1NP2A 2WK2A 2I56A 5HOSA 2ACUA 1AH4A 2WJEA 3UCCA 3BCJA 4HA1A 3W3OA 2E9LA 1FKXA 3CO4A 3WLTA 3RX4A 1KGUA 3GO2A 1VH7A 4ONVA 4NILA 4G56A 4IM4A 1P0DA 4I5RA 2D1ZA 3GG8A 1XGZA 1IXPA 5FEXA 2YDSA 4HZ6A 3S9YA 4CQDA 1NOWA 1DIOA 1SJDA 3AYTA 4ZOEA 2Z27A 2VX7A 4WKHA 4MWAA 2YDAA 4TUFA 3P82A 3U5YA 5CAKA 4B92A 2IPWA 4LWWA 1CT5A 4AVNA 1E9ZB 2VDIA 2F7FA 4LCRA 2G3IA 1SVDA 3QKEA 1PHWA 2WMIB 2PE4A 4C6BA 3V0UA 3W83A 4I9TA 4RE0A 4UTHA 4ATDA 3SSZA 1N82A 2I9EA 4PMJA 5BMXA 1BXCA 4GVHA 1ZAHA 2PF0A 5T8GA 1WUEA 4ZXLA 1ZNNA 4AX7A 4UBPC 3F2DA 1A5LC 1T40A 3RGTA 1DXFA 1H51A 1T5AA 1FXPA 1BWLA 2GOKA 4CCEA 2VFDA 2CLEA 1T0OA 3T05A 1OX5A 4O54A 3N4AA 2YLAA 3DG3A 4QQ3A 3TZFA 1XM3A 1F05A 2V38A 3J7HA 4CN1A 2QJIA 1W5QA 4GZEA 3WFZA 1MDLA 1OFOA 2VM8A 4C6DA 4X0NA 4TVCA 3T0CA 2HBXA 3IANA 1Q6FA 3KVLA 3NQAA 1DBTA 2G4JA 2DFAA 3EOLA 3IJ6A 4ROPA 4LSBA 3I10A 5HXMA 4JFTA 1VD6A 4W89A 2X7VA 4EP8C 2E9BA 1EFZA 1K8YA 1LBMA 4NU7A 4DJFC 1E55A 4TQTA 4O17A 4U31A 2VHLA 4HTBA 3QOKA 1JCMP 2Y7DA 1V6YA 3PPHA 3BOFA 1SM9A 3WMSA 3OPSA 2Z1VA 4HOXA 5HA7A 3EXTA 3PAOA 3LGDA 3CUZA 3WQDA 2WV8A 5EB8A 3ZO9A 1PX4A 3CGTA 4D8ZA 3CV2A 4I9AA 1ONEA 2BHYA 1A49A 2CLHA 2QXWA 2OU4A 3W29A 3FOKA 3M6DA 3ZMRA 1VQTA 5KZDA 3ARPA 2IPGA 4Y6GA 2ZWZA 3KFTA 3M64A 5CSUA 4PUEA 1XDMA 2V5JA 4EAMA 3FDGA 3CEUA 3DFHA 4FR1A 2FKPA 4GX8A 1QTWA 3FDKA 3W7OA 1RXOB 3F4WA 1ZRQA 2ADAA 3OVRA 1AK5A 1VB9A 2Y1HA 3G8RA 2AAMA 1X38A 4HCDA 3NQ6A 2R9RA 1S5WA 1TWZA 3VDCA 4V33A 1XLKA 1OFBA 4JBRA 4B5VA 1GQLA 3O6YX 3FAXA 3BG9A 2QR6A 3LQGA 1V0MA 1AW2A 1FWFC 4IFKA 3E5PA 2PTXA 3DH7A 5A6JA 3GXMA 1XYMA 1GQJA 3F7JA 2CEQA 1K02A 2ZIDA 3VIIA 4TMCA 3OBKA 4G6CA 4H83A 4UNLA 4I5XA 3QRHA 4O16A 4RZ6A 4NAFA 3SI9A 4AZGA 5DCBA 4W85A 1BVWA 4JYDA 2UBPC 1W3TA 1AQ0A 4ZEPA 4R5EA 1VR6A 1XHGA 3K46A 2VL4A 3EWZA 1E6XM 1G69A 5GVJA 1GJWA 3SCVA 1QNVA 2VC6A 1G01A 1YEYA 2XM2A 5DN1A 3CT2A 4UQDA 4GH1A 3E0WA 3HGRA 3NM1A 2J62A 2NQJA 1MFUA 1Q63A 4ZODA 3HOJA 4BA0A 4DBSA 4UQEA 4QSFA 1J0KA 1GVSA 4HP5A 4V1XA 2CLKA 4NJIA 1CW2A 3SADA 4AFYA 2J9YA 2Z4GA 1I1WA 5DBTA 3M07A 2AQVA 3IEBA 4GYJA 4IMEA 4LV4A 4S3GA 3WIJA 5EMJA 2F2HA 3QH2A 3T40A 3IJQA 5K9XA 2ZICA 4PRRA 1JULA 3B05A 1HO1A 4P2VA 1IEQA 4GG9A 3LHYA 3WEOA 1WUFA 5AC7A 2UY4A 1UW9A 2XIIA 3DDMA 1KGWA 4NVTA 3ZVHB 3IIOA 1ICSA 3R10A 5FJOA 1MNSA 3FAWA 4O19A 5AHLA 5REQB 1Z3NA 5EFFA 3STPA 2DPEA 3GHUA 2TRSA 1DOSA 1E71M 3S2LA 3MPGA 3QR3A 3UT0A 4MZ8A 1U22A 1SU5A 2BGQA 5CG7A 3APTA 2CERA 3CASA 3GNPA 1VLWA 2CU0A 1EKOA 3WD4A 3AYRA 1PIFA 2BS9A 1XCXA 1YDYA 2X2GA 1XQLA 3MMDA 3W2JA 1W8SA 4HHHA 4AC1X 4D1IA 2BP1A 5DMNA 4ATLA 2EPOA 3W86A 4DI8A 1Q66A 2VEMA 2HNEA 4Q8MA 1UQYA 3V7PA 3IJ7A 3PWIA 4QCFA 2Y8VA 3ABQA 4JTTA 1E9YB 4CGTA 3VC6A 4PEEA 3WH8A 4JOMA 2EG8A 5CJNA 1W9PA 4F0HA 1VFOA 3VOJA 4AF0B 5DRCA 4I7VA 4FK9A 1B3XA 1JFHA 2QDEA 4X2PA 1CDGA 2VR4A 2OSWA 1DORA 3V0TA 1RA0A 4DELA 4X3ZA 1L6SA 3VU2A 2OELA 1Q5MA 1TE6A 3QFWA 5C0QA 3VUSA 2W91A 3SRDA 1JD7A 2RH9A 4M7SA 4AHPA 1FUYA 1PJ9A 5HATA 3GFZA 2VZVA 5C71A 1EQPA 4JPGA 1XINA 2E0PA 4GXMA 1K7EA 1J5SA 2XVGA 1DJZA 2EO7A 1QPNA 1VIZA 2RDUA 3TCEA 5E1QA 2WCAA 4FX6M 5K7JA 1IE7C 1PYMA 1HKIA 2AKZA 1SMAA 3HV8A 4FMVA 2ZRZA 2IKGA 4QIUA