2EJAA

Crystal structure of uroporphyrinogen decarboxylase from aquifex aeolicus
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
337
structure length
337
Chain Sequence
PKNDLLLRSLRGEPIGRFPVWLMRQAGRYMPEYRKIRNRVKNFLELCKNVDLATEISLLPLKILGVDAIIIFSDILVPLEPLGVKVEFVEGEGPKLSWSGKVSDLKKYDPSQNAYVYEIIKRVKEAQDEVPVIGFAGAPFTLLSYLIEGGASKDFKSTKLFMWENPKEYKRLMDILTETVLAYLKEQIKAGADVVQIFDSWVNNLSLEDYGEYVYPYVNYLISELKDFSDTPVIYFFRGSSSFIDLAVDYRADALSVDWSVDIPELFKIYDKGFQGNLEPAVLYASEEVIEEKTLGLLRRIPVKTRYVFNLGHGLAPDMELEKVKYLVDLVKSFPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen decarboxylase
publication title Crystal Structure Of Uroporphyrinogen Decarboxylase From Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
total genus 128
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2ejaA00
3BQ5A 1R3SA 3CYVA 1XPGA 4AY7A 1R3YA 4EXQA 4L61A 4QQUA 4L64A 2Q71A 2INFA 1XR2A 1U1HA 1J93A 2Q6ZA 3PPHA 3GW0A 3T0CA 3GW3A 4ZR8A 1U22A 1U1JA 1JPKA 1JPHA 4WSHA 4ZTYA 3GVVA 4AY8A 2EJAA 1JPIA 1XDJA 1YPXA 1R3QA 1U1UA 1UROA 3GVWA 3PPCA 3GVQA 3RPDA 3PPGA 3PPFA 4ZTXA 3L7RA 2NQ5A 3BQ6A 4L65A 4L6HA 1R3TA 1R3VA 4L6OA 4L5ZA 1R3WA 1R3RA 3GVRA 1T7LA
chains in the Genus database with same CATH superfamily
4QE4A 3M6DA 3DKLA 4C6OA 3TTYA 1MFVA 3WQCA 4AEFA 3TYUA 2DH2A 3N18A 9XIMA 1W31A 1GEQA 1I75A 3BAIA 3VTRA 2Y2WA 1LBLA 5KZ6A 3WH7A 1KBLA 3LI1A 3SSZA 1L2UA 1F8IA 1WYIA 2G50A 2BGSA 1K70A 4Y9OA 2Z27A 3P60A 3PTKA 4DJEC 3NQ6A 5FL1A 1SO3A 2QDDA 2W6RA 4XZ9A 1GG0A 4JTHA 4GQBA 1DOSA 1BYDA 5AHFA 3UZYA 1GNXA 1JZ2A 1XH2A 3S5OA 4PB5A 1AD4A 2PWUA 1OYBA 2NQZA 4IP5A 1SW3A 3HA1A 4GXWA 5T9BG 4FAMA 2DZSA 5DRCA 3GXDA 3KBSA 4OUIA 3BOFA 4O57A 4C6NA 4Q4PA 1VBRA 4GO8A 4B3KA 2C18A 2RAGA 1A4LA 1UG6A 1QRQA 3CH0A 1F74A 4LY8A 3STEA 3UVIA 4NZFA 1JGIA 3EB2A 2C7FA 1BSIA 4QIUA 3N17A 1UBSA 2ZDRA 1QXLA 2Z1XA 2CKSA 3BGJA 2E68A 2Q8XA 3TLLA 2ODOA 1UB3A 4X9SA 1DWFM 1RD5A 1W5OA 1RLDA 4RJEA 4F0RA 1EJSC 1GZGA 2Y5EA 1NM9A 2D2HA 3DFTA 3BAXA 2CIPA 4GNKB 3BSGA 4E6MA 4H41A 1KW1A 3XIMA 4UFMA 1KXVA 3R2GA 1UUMA 2PDHA 3CUJA 3VKBA 3KUMA 4Q7IA 4UQDA 3FHAA 2JKAA 3L4XA 5DCEA 2FPTA 1VFMA 2GJLA 1Q45A 3NQFA 2HBXA 4QHRA 1XIDA 1VHCA 3QC0A 4DI8A 5CQ1A 5HANA 1OD0A 3L65A 2WCSA 3TX9A 1NU5A 4GVFA 4GE8A 4I9AA 1K9TA 1G4SA 3CAWA 5I06A 3B4YA 3CMFA 3UCQA 1EP1A 5I77A 1VFUA 2INFA 1G94A 2Y63A 3NZRA 3C2VA 4I6VA 2O9OA 5A6AA 2JGQA 3DCPA 1ZENA 1RK5A 3KFTA 4GI6A 1ZP3A 2ISFA 3N1AA 4LV4A 3GU1A 1BWKA 1TUXA 3QTGA 2Y62A 4F48A 4CGTA 1M04A 2G4JA 4YWSA 1JZ5A 3PJWA 4ERGA 1OC5A 1CT5A 1OZQA 4MG4A 1R3QA 1XFBA 4M82A 2ZRYA 5ECVA 3EB3A 3FCPA 4QG8A 4NAFA 2WHLA 3DGBA 1EGVA 3QQWA 4RR4A 3VNZA 3ES8A 3FYOA 1YPIA 3AHVA 1QPRA 1VPYA 1OCQA 1UUOA 3GKAA 1IT0A 1KR1A 2DZWA 3WQPA 5JH2A 1K03A 4FLSA 3HN3A 4ASTA 2ZX5A 3LHYA 3SCWA 1X6LA 3ERPA 1U1JA 5LIWX 3PG8A 2Z1WA 5C70A 2VVSA 2Q01A 4C1KA 2WHMA 3O3RA 2A1YA 3SCSA 4HA3A 3F2BA 2HISA 4GXMA 2NUWA 4AW7A 1JDDA 2CZFA 2OPJA 4XZBA 1KCZA 5JUVA 4FF7A 3RR1A 3WG6A 3PZOA 1JIBA 4A22A 5LIUX 3MUCA 5EMLA 3CUXA 2R1PA 4LB4A 3R10A 2NX3A 3WLSA 3U2EA 3L23A 3ID7A 1Q6FA 4Q4OA 1BTMA 3DFQA 4HIBA 1TPWA 4TQTA 2E1DA 1F3XA 1VFLA 3QH2A 4UOQA 5AC6A 4FLOA 4N4QA 1M65A 2HRWA 4YL2A 1OF8A 1I1XA 3GTNA 5FF4A 3W7GA 1PV8A 5I3IA 1ITQA 3O63A 2WO5A 1R2RA 2WAGA 3G0UA 1HJXA 5BZAA 2F2HA 3KZPA 3VD9A 2EPNA 2WSPA 1SZFA 4BI7A 3VDCA 1LDCA 4WRHA 5HJXA 4LVBA 3F4WA 3R13A 2QUUA 3EWBX 3A4XA 3KL5A 4BF9A 1H0IA 2G8ZA 4RNHA 5MKGB 1H1YA 4R9OA 1GJUA 1PO9A 4L4LA 3CTLA 5I79A 2WMJA 1WO2A 4WJ8A 4F9JA 2OO6A 4GRSA 1UROA 2PU1A 3IANA 2XWDA 2QDEA 2ZRZA 3W85A 2GQ8A 3OLDA 2E0PA 1DWAM 1VBGA 3B8TA 3N2TA 4EF9A 5H91A 1R3YA 4DUWA 3LV5A 3LCXA 2HEJA 1FHLA 3UZWA 4KPLA 4CQ9A 2RDWA 1A47A 4M8UA 4G6CA 3TSMA 1M7JA 1LQ2A 3W2LA 1SMAA 1XKYA 2NV2A 4V15A 4C6LA 1AQHA 4Z2JA 4MKNA 2GPTA 1V4YA 4RV3A 1VD6A 4A8LA 1Q3NA 3TAKA 4TX8A 1GYLA 3P93A 2W91A 2FFIA 4JQ3A 3QLDA 1NFPA 4MAVA 2DZXA 1XYBA 1Z41A 3P82A 2Y88A 3SW6A 2V5LA 3FA5A 1DQUA 2YBUA 3F1QA 3GS6A 1Z6KA 1SO4A 3V16A 2DUAA 2VURA 2I16A 2XINA 3A21A 3Q4DA 4H9UA 1NWRA 4AY1A 2ZX6A 1LG2A 3WK3A 2WCAA 3GYCA 3VO0A 4B5XA 1VP5A 1UWTA 4ICMA 3T0DA 3VNYA 4YTTA 4PTXA 3DC8A 1MUCA 4WD0A 3HMJG 2DT0A 5AHIA 2FZ8A 5M5DA 1DTNA 3IIOA 5C5YA 4PUKA 3IIVA 1JD7A 3L4VA 1A4MA 4G5DA 5AB3A 3DBNA 3QFWA 4GINA 3T4CA 3SDOA 3A64A 2Y4SA 2Y0FA 3EPOA 3L2LA 3CHFA 4IMFA 4J5NA 4C5YA 1XYZA 2H8XA 4FI4A 5EMYA 3QR1A 4WUIA 3D3AA 1JJKA 3QSTA 3W2NA 2OB3A 4QLJA 3LI0A 3W1NA 2HNEA 2RUSA 2BGNE 4AZ5A 3OEXA 1PYMA 4BQ5A 5IDIA 2Y8UA 3OOQA 5AHMA 4PC8A 3BQ5A 1IV8A 5AC4A 4ENLA 1VFOA 1GVOA 2VOMA 1H0GA 3OA3A 1K3UA 3RF9A 1BKSA 4ZE5A 2I5GA 2PDKA 4LUJA 3S5NA 4CD7A 1OGSA 1W32A 2BHZA 4C65A 3QPZA 1OCNA 3PAOA 1NAL1 3SFWA 4D71A 2QULA 4KCVA 3W01A 2H9AA 3UQNA 4JKLA 3G3DA 4W7VA 4GMEA 1OX5A 5TIMA 4JHMA 3TN5A 2VX7A 4M81A 5A2AA 3M5YA 3SUTA 4IPJA 3PSVA 4LUTB 4LRTA 1WOAA 3LN3A 1CBGA 3LQLA 4NAFB 3LLXA 4CN1A 2Z2AA 3THQA 3APYA 2RFGA 3PZQA 1ZLPA 5H6HA 3KLLA 1CX9A 2W66A 1NH6A 3WQGA 2V5KA 5FIPA 3GFXA 4P61A 3N13A 3M44A 4MY9A 4ZBCA 3LM3A 3ZQ9A 1OWQA 4Z1CA 3AI0A 4KRZA 1VJZA 1KBBA 1U83A 1R2TA 2ALDA 3S0CA 1UOZA 4US5D 3A9IA 2UWFA 4EVZA 1NFGA 4QRNA 4JIPA 1BXBA 4QISA 4XAZA 2YZRA 1BWVA 4L9YA 1VRXA 3I7RA 1OCBA 3CEPA 1UQZA 2GSEA 2POTA 1C92A 1MXGA 2E1WA 2J25A 1CXKA 1W8GA 1R47A 4FXJA 2PP0A 2GJNA 3ITVA 4Q8TA 4OBRA 4B5VA 3NA8A 4MY1A 3FSTA 2GVEA 3K1DA 1PWMA 2AKMA 2HZGA 4LAUA 3PULA 1F3WA 4GPNA 5A8OA 1EP3A 4YIWA 2BOFX 2QCLA 3NYDA 4DVOA 1P0BA 1SR0A 4Z0JA 2WNNA 3ZR5A 2MUCA 1LL7A 3NL3A 1M03A 5KEZA 4MWAC 4UQCA 4HOXA 2ZZ1A 2DVXA 2X41A 3IIPA 1FWHC 3GG8A 3IGSA 4K38A 5J5RA 3KZSA 5IXEA 3H4GA 1WV2A 3MMDA 1OFRA 3AMLA 1MO0A 3RJYA 5CC5A 5HQEA 1XF0A 2R1KA 1UASA 1FCUA 2OGJA 4LFYA 2CITA 2J6VA 2X1IA 1DXIA 3MI6A 5CJNA 3NQDA 4S3AA 3W7DA 2WSKA 1R86A 1XH1A 2ICSA 4M7TA 4GUIA 5G4EA 3MZ2A 3WQFA 3V5CA 2Z7GA 5LNVA 2NWRA 2CLFA 3MBFA 4U5IA 4HYWA 3QMSA 4NJJA 2H3DA 2ABAA 1VBHA 4NZ3A 3CZKA 3IAQA 4WCJA 3EWZA 4ZOBA 4DO6A 4E2VA 4ZQRA 2EG8A 3BURA 3TOPA 1NOUA 4XKMA 3ZT7A 4Q3MA 5FESA 4UZSA 3V75A 3S1VA 1CGVA 3E5PA 3E6EA 4BI6A 1EC8A 1DWGM 3P6LA 3VC6A 3K4WA 4B92A 3GVVA 4V2XA 4P5UA 1FCVA 5A8GA 3CQIA 1G0CA 1DL3A 3IARA 1MW3A 5ECUA 4F0LA 4UOZA 1BGAA 4U3AA 1H49A 4GQGA 1E9IA 4S3FA 4W8AA 3LSBA 1XQLA 1GGOA 2GQAA 4JD4A 5DY3A 2WANA 1D2KA 1TZ9A 3GY1A 4HK5A 4BF5A 2XYLA 1QCWA 3M46A 1HL8A 2XIJA 3NZGA 3M7SA 3I3BA 2V67A 4AXNA 3MP5A 1FVPA 3C0LA 2YOCA 2QUMA 2ADAA 1QTWA 4MB1A 4AB4A 4CKQA 4PMNA 4HOZA 3TV8A 3VIHA 2QV4A 3EOEA 3FX4A 3H24A 5C2CA 1MEHA 3TAOA 4Q8PA 4WY0F 3FKRA 3R4IA 2EO7A 1BGGA 3BAYA 4XVDA 1Q7ZA 1UR1A 2WVUA 5CPNA 1MW2A 2OVLA 3P84A 4S3CA 2D23A 1LZOA 3CAKA 1CGTA 2ZFAA 1DIDA 2XM1A 4QJ3B 3B40A 3I65A 1H60A 2SFPA 1W5MA 4PTWA 2PF8A 1MRAA 3L12A 2NUYA 3QOKA 5D32A 1E40A 3THAA 3FW6A 2VYOA 2YJQA 4NNBA 3BMXA 5I7GA 1P4CA 2XU2A 3KDOA 4GISA 4MNJA 1WUEA 2QV5A 4L4PA 1KM4A 3HPSA 4RX0A 2WKJA 1WP6A 3HQ1A 4CNSA 4C1LA 3RMJA 2GQ9A 1AG1O 2GVYA 1OCJA 4OOZA 1V6UA 4IPLA 4J3UA 1D9EA 4P7RA 4UCGA 3HG2A 4H04A 3UBPC 1RP8A 3NPWA 1UD6A 3STCA 1Q66A 2PWHA 5E9XA 1RH9A 2ZUMA 3GLCA 4HHMA 3OYZA 5ABTA 1HVXA 4H00A 4LANA 2XIBA 1X7FA 5AYXA 3W02A 2QPSA 1G67A 2V3GA 4UR7A 4AZCA 4JY8A 3TYAA 1UA3A 4LS2A 2D69A 1JPHA 3NO1A 1GW1A 1WDRA 1IXQA 3IVSA 3EPNA 3RGTA 3PVFA 3IGUA 3RNDA 4EXAA 2AQVA 2H9AB 4F79A 1OINA 3D46A 3GM8A 3QC3A 3P5YA 4XX6A 2OKOA 1A5KC 5EBUA 4P8WA 3TW9A 1S1PA 2VEMA 1US0A 3GUWA 1MYRA 2ISSA 5KZEA 3ISIX 3M5XA 3ZFHA 1DHKA 4WOQA 3KTCA 2PGFA 1GQKA 3T55A 4P7OA 2P88A 2BXZA 4QE5A 1TZ7A 1GTEA 2X1UA 3TZFA 1HFBA 3CEUA 1ICSA 1QW9A 4C6FA 1OSEA 2HVNA 1AH4A 2H90A 3WD1A 2EPMX 4HA4A 1ODZA 3EMCA 3PWIA 3IGXA 3KBNA 3KCJA 2ZWYA 5DF0A 3H2EA 3BMVA 4HZ6A 2F6UA 3BLOA 1JNEA 4NT0A 4G8TA 3TN4A 3GW0A 2PTWA 4MZ1A 5BWAA 3UPMA 2IMRA 1LWHA 3W25A 3MHFA 4AD3A 1XIHA 5H2ZA 2RKXA 1LWIA 3WF4A 3BH4A 1JGMA 3IUHA 1QNRA 1SFLA 2OXNA 5M03A 1OFBA 4K8GA 3GR8A 3LHVA 4H9TA 3I7SA 5CKSA 2EGZA 3M41A 5CBBA 2F6XA 3LG3A 3ALFA 4EWJA 3NQVA 5D2WA 3W72A 1PTAA 3UWVA 1HL2A 1EOKA 4EKJA 1V7AA 3TH6A 1FP8A 1J93A 3QZEA 3EDJA 1JDEA 2BVWA 5RUBA 3C2YA 2QCCA 1JQXA 1K6AA 4CVUA 4HQVA 3NURA 3H2NA 2HV5A 2J9XA 3O0KA 3VOHA 2YZ5A 4N2YA 5F1UA 1HKWA 3ZJ7A 1W9BM 4A3YA 1MMFA 3QY6A 3FDGA 4E2DA 3FXYA 2YIHA 3SCNA 4PTNA 4HNUA 1XCWA 1FDYA 1V3HA 2WBGA 3PK7A 1VGAA 1XLJA 4DWSA 2X1RA 3W00A 3WYZA 1F76A 1NWSA 5A6BD 1W17A 4NXSA 3ZLGA 4DBEA 2XISA 1HKJA 4Q4KA 1KA9F 1LTDA 2DEPA 1LL6A 1Z7AA 3EPMA 1EHNA 2XVNA 3PBWA 5FKYA 2WM0A 3VX1A 5BU9A 1UP2A 4NKCA 3QHOA 4MJZA 2QS8A 3RX4A 3KHJA 3MJYA 2I1OA 4RUBA 1NQKA 2ACUA 1V6WA 4DAFA 1ZAIA 3GG0A 1ZHAA 3KCLA 1CLVA 1K8XA 1P0KA 3TMQA 1RPXA 1A5CA 4Q8WA 3T0TA 4KCUA 1B9BA 3VI2A 3V35A 5AYBA 4GFIA 3PZGA 1PX4A 1TMHA 2YDSA 1J0HA 3ZJ6A 4GX9A 1SJAA 2FGZA 4E0CA 3VXGA 1MSSA 4D6JA 4Q8NA 4C6DA 4KWUA 5ABFA 3D0CA 4U33A 3UCDA 5HQMA 1GKQA 1VBJA 2DORA 3DBPA 3IUIA 1XP3A 3B8WA 4C7DA 3AZRA 3QGKC 1ODUA 3E2SA 4XZWA 3ABQA 2YA2A 3UCCA 3RFAA 4PUWA 1HGWA 4KETA 4KH2A 3S2NA 1FWCC 2Y7EA 1RV8A 1YX1A 3B8IA 2GWGA 2XIQA 2QIIA 2VX4A 3ZLFA 2WC3A 2WSYA 3CYJA 1X97A 2YXOA 5EMUA 2BSLA 4XAPA 4YNGA 1W3HA 1BQGA 4JBRA 3OZMA 3TA9A 1VC4A 2WJZA 3NR0A 2HS8A 1K9EA 2UY5A 4ZSTA 5HXMA 3AMGA 2NLIA 1HP4A 1E6RA 3AHYA 2VC6A 3URQA 1I0DA 3R5EA 4UTTA 4H9XA 3SGZA 5E0CA 4JTUA 1S38A 3U3HA 1H5VA 3BZGA 3PTQA 3G1FA 4X2RA 4RZ5A 2YL8A 3BW4A 1KBJA 1CCWB 4IFRA 4Z1AA 4XD4A 1F6PA 1RALA 2ZUVA 4LVFA 5D8WA 2PDXA 3DG7A 2DPEA 2Q3RA 4ERAA 1WZKA 1JXKA 5XIMA 3H22A 1OFQA 4HPNA 1OG0A 1JI2A 2Z6IA 5AY7A 3EDFA 3M47A 5DBUA 3MZNA 1OJXA 1LJYA 3KVKA 3ZJKA 4AZCB 2HBVA 2FMNA 3H8AA 3SJNA 1IT8A 2Q6ZA 2QCFA 4JR5A 2ZUTA 3QEZA 5EFFA 2YYUA 2OU4A 4EK7A 4GZEA 2XSAA 2QXWA 1WXYA 1LWJA 2TRSA 2ZOXA 2VZSA 1W2VA 3E02A 5AN7A 4DEFA 4QEHA 1KQZA 3QKZA 4XV0A 1RCOB 4QJ1A 3UESA 2DVUA 4K7YA 3LRLA 4XTIA 1A3WA 3GNDA 1TVNA 1JCMP 1PDZA 2GLKA 3G0SA 3GHTA 3L66A 2R1LA 4BCEA 3UR8A 3MMTA 1DIKA 1Q13A 1FBAA 2EEXA 1QNVA 3D47A 4CN6A 1XLHA 1WAWA 3KBJA 3T7VA 2ZTKA 5D9OA 3HZ3A 3SECA 3I6EA 3OLEA 4PMZA 1XYAA 1TWWA 1XYLA 2D22A 2IQTA 3T0BA 4PL1A 1K7FA 3L0NA 3CTTA 3M07A 4ZB2A 3M0LA 1YDVA 1B57A 2X05A 2PODA 1F6YA 3PJXA 3BC9A 1XGZA 2ZIDA 1XLLA 1KTBA 4UTFA 3ONBA 2YCLB 1KR0A 1XJBA 4GACA 4KCTA 1WUFA 3V0TA 4NIRA 4M7SA 1VQTA 1BXCA 2HTMA 3ZR4A 2J7FA 1UCWA 3W24A 3B0XA 4JTLA 1E71M 3W7HA 3TYZA 2CLLA 3QZ6A 1D8WA 4IF2A 2X1SA 5E9AA 3WJSA 4PEEA 1LBFA 2BY3A 2Z2BA 3UY7A 2PDFA 1O4UA 2FZNA 4UQEA 2BTMA 4MUPA 2YW4A 2WNWA 5ABHA 4NNCA 4BY3A 4O19A 4Q4MA 3W6LA 4RE0A 4HK7A 4ZO6A 3HJZA 1BEUA 1P0EA 5EGRA 4AUBA 3VIGA 3R25A 4A3RA 3PPGA 3ZT6A 3VC5A 4B5TA 3GZAA 1EIBA 3NQBA 3BLLA 4PMRA 4DBWA 4QR6A 4AHQA 1B3VA 2OFJA 2A4AA 4D6GA 4BA0A 1GOIA 1DWIM 1EF3A 1UR2A 2C0HA 3WO8A 2TODA 2PGRA 2WK2A 2PPGA 4LC8A 1UJPA 1VIZA 1EUAA 4DWSB 2PLKA 2C79A 4DNMA 3GHSA 5LZLA 2RGMA 4Z0SA 3CUZA 1PZ0A 2A2IA 3OLGA 2JF7A 3RCYA 1L6FA 4DXKA 2CZ5A 4AVOA 3M16A 3TE9A 5LSMA 3WDRA 3S9ZA 2I9UA 1XCFA 4MIMA 3OO2A 3W37A 2F7FA 2DSKA 4WIWA 3V1PA 1L2QA 1LM1A 1EDTA 1KCXA 3KTSA 2A7NA 1KQYA 3HIJA 4OGZA 2D73A 3NPXA 2ABBA 3TN6A 3MP4A 2O4QA 1OIFA 3I68A 3NGFA 3NVDA 1ML1A 2PCEA 4H6EA 3BGGA 2FZ9A 1JXJA 3FGCA 4AAJA 1S2VA 1UH4A 4UB9A 2Y8KA 5EMMA 3WLLA 5D9PA 1BF6A 1SFJA 3A13A 3AIBA 4TTUA 3T9PA 1E4MM 1PS9A 3GAYA 3E12A 1QBAA 2QMJA 1BTCA 4B3LA 4W93A 4R53A 1ENUA 2C1IA 3MY9A 4CU8A 5ABFB 1SPQA 2D24A 3GIPA 3TYBA 3H12A 4FZIA 2VFGA 2VDIA 4BFAA 3IJ8A 1TR1A 4JAWA 1KRMA 2OX4A 3Q2DA 2ZXBA 4PTDA 2CEQA 3SO7A 4GVIA 1J0JA 2YCKX 2BXYA 3B8VA 4HCDA 1NF7A 1DJXA 4C7FA 4CEUC 5CBJA 2GUYA 1HL9A 2VEPA 3IJLA 3TQVA 1O5RA 3HGRA 1I45A 1XIJA 1H7RA 4DO4A 4ADTA 1W3IA 3WF0A 4CU6A 1ADDA 3PWGA 2TMDA 1FWNA 1S5TA 3PZUA 3TSDA 4E8CA 4IGSA 2Y61A 4QJ4B 2FTPA 2VVNA 5G1TA 2R24A 1C9DA 3M1ZA 4ZOEA 4W8LA 1XG4A 2I17A 4XK2A 1EJRC 3DI0A 3BSMA 4KT2A 1IR1A 4UMAA 3FYPA 3EWYA 1TMLA 2AL1A 5FOOA 3RCNA 3R0DA 4LAOA 4KMQA 3QV8A 1X8CA 1GONA 5J8LA 1ZB5A 3CPUA 1D7FA 4UFIA 1OY0A 3S6TA 3VGHA 1DJWA 1GOMA 2PA6A 2OOFA 1B90A 4EAMA 3OIXA 2P50A 1JPMA 4W86A 1HO1A 2IKJA 5CSUA 3NZPA 2OYLA 4CU7A 4E8GA 5GNXA 4Q8QA 3RR4A 3DENA 1XD1A 4ORMA 1QI5A 1ME9A 1PZ3A 1REQB 2I5QA 1R87A 1R5YA 4IIEA 2WJEA 1GVQA 4GVGA 3NZ1A 1A5NC 2R8WA 1AZ1A 4JKKA 5A6SA 4AXKA 4WGXA 4TU1A 4X60A 3CV2A 1B3WA 3FJ4A 1W3LA 1EOMA 3WKZA 3IPWA 3OVRA 3R11A 1KNWA 3WFAA 4GLEA 1QPNA 3PBGA 3WJXA 3VZXA 2CLOA 3HBLA 2PDCA 3II1A 2G95A 1ISWA 2R6OA 1HJUA 3BJTA 4YTUA 1R9YA 2Y70A 1M7XA 3G6MA 4A05A 1OX4B 3P74A 3RO8A 1YKWA 1E6SM 1PSCA 4Y8EA 1YE6A 1UIPA 3LY0A 1B30A 1DWJM 2TPSA 4U2ZA 1FWEC 2OWWA 4CQCA 2O7SA 1T99A 5I2UA 1WAUA 1X1NA 4OHQA 1OABA 3T8QA 1ME8A 1XYCA 4N9CA 1OFEA 4Z42C 2VZTA 1ITUA 4US5A 1RR2A 1CXFA 3DAQA 4W84A 1FA2A 2I7GA 3AHTA 1P7TB 4J3XA 3ZJ8A 1E15A 2DQWA 2V5DA 3BO9A 1XC6A 2QIWA 1KM6A 3F4NA 2LLEA 2P0IA 5HUOA 3CWNA 3E2VA 4C90A 4PYSA 1OZMA 3UYCA 3PZIA 2HVMA 5EBAA 3W1QA 4MPKA 1IE7C 3AMCA 2WMIB 4WR3A 4H8NA 4J2MA 2ZXQA 4OQVA 4S23A 4RPQA 4GZJA 1XLCA 1M7OA 4P8XA 2BV9A 3EKLA 2AAAA 3NFUA 3GDTA 3RLHA 4XSLA 3CV1A 3UGRA 3K8LA 3GX9A 1Q8AA 3WH8A 5AYIA 1M41A 1UKSA 4ACZA 3FDKA 3NL5A 3W7IA 3UWZA 2HPIA 2X0HA 3WMLA 4D1JA 3DFOA 3H21A 3UETA 2WBKA 3RRAA 3SY8A 5AYZA 2AL2A 3NXLA 2Z26A 3BICA 1J5SA 4PUEA 1EJTC 4NASA 1UWAA 4PTMA 4FLQA 3AZTA 1W1A1 4P8UA 5I3KA 4Q7BA 3WNLA 1J6OA 7CGTA 3AIUA 2E9MA 5D4YA 1LYXA 3IUDA 4G1NA 2INEA 2FHFA 3L4UA 4LAZA 2NX9A 3VM5A 1E6XM 3PC0A 4L1WA 1R7AA 4K68A 1UR3M 1UD8A 5G1MA 1TR9A 2VEIA 1E3ZA 1JPDX 1UWQA 1PYFA 1MVYA 1QMLA 3FGCB 2OCZA 1JZ8A 4A2RA 5IFPA 1TWDA 3V1HA 4MB4A 2PMQA 4S3GA 2V69A 2BODX 1G01A 3WL1A 2YCJA 5CPQA 3WH5A 1WKEA 4Q7NA 3MB9A 3I4EA 3UXIA 2J88A 1E6QM 1XXXA 5A95A 1UJQA 3VNLA 5BYWA 3C3NA 4J3WA 3GH4A 4FX8A 5DMMA 1KXQA 2IKIA 1IGSA 5EA9A 1QOXA 3U2CA 3M0MA 5AFDA 3BGAA 1ONXA 5GPRA 4XD6A 3FXGA 3R12A 4JTEA 3WJZA 1EZ2A 5G1YA 3LGDA 1C8QA 1YTDA 3MV11 3OPSA 3QY7A 1QW8A 1RD6A 1JZ4A 3ARSA 2GK1A 1DP0A 2V30A 3D3FA 3H2FA 4GX8A 3CQJA 4HGXA 1PKYA 4FXRA 2XH7A 1O66A 1QPQA 3L9CA 1TZZA 2ZZ7A 5AZ0A 2V3DA 1HKKA 1KTNA 1OGBA 3FFSA 4ZA0A 4PMOA 4B5WA 3SR7A 3IAPA 1W1IE 2ATMA 4BHYA 1FWIC 4IQJA 1EJVC 4I9MA 2QPXA 2XVKA 3APGA 3IVUA 1SO5A 3LERA 3WNPA 2DZPA 3C56A 3DG3A 4R27A 1TA3A 1XLEA 2AMGA 3M0JA 3SY1A 2OZ3A 3VGFA 2ZC8A 5HWNA 2CKRA 4EPDC 1OFOA 4DI9A 1YQ2A 1R85A 1E6NA 1JZ6A 1JUEA 2E9BA 1Q85A 3TJ4A 3N25A 1ITCA 2WHJA 5LYRA 3W0KA 1CYGA 2DIKA 2OGYA 5LNSA 4KIEA 3DH7A 3BV7A 3ZZ1A 3HMCA 1XINA 4BQ3A 2BZNA 3CUFA 1G69A 1PJ9A 5EFDA 1MZRA 3O06A 3HJEA 1AUSL 4JYDA 2NQHA 4DN1A 4JIRA 3SQMA 3LGGA 4X9YA 3FJNA 2C91A 5CXPA 4DZIA 3OA5A 2NWSA 4IWWA 1GJPA 4KWVA 3TTQA 4EX4A 1FUYA 4MHBA 1J11A 3PB0A 4RPPA 1W1TA 5FJJA 3CMGA 3O8AA 4RZBA 4H9ZA 1OC6A 5ABGA 3CPRA 4DM2A 4HK6A 4OECA 3NQMA 3EX3A 3EWXA 3N14A 3IWPA 2YXGA 4CNUA 1QVBA 1JULA 3CHDA 5E6ZA 1T6MA 1BWLA 3EWWA 3WK0A 1P1XA 1HKMA 1TTIA 3CLMA 3H4XA 1YE4A 2GOKA 1ZP4A 4M56A 2DH3A 3G1VA 4F2UA 1XX1A 1V79A 1QOPA 3U0HA 1VFHA 1PKNA 4R3UA 2PLCA 4LF2A 5D9NA 2OSWA 3KEHA 4GD0A 3W7NA 3W81A 4EAYA 2E77A 4JQ2A 5CPTA 5C6MA 3BAWA 1DVJA 4B4HA 1R7OA 3WDIA 4V27A 3RCMA 5H1WA 3WLRA 4J9JA 1EUNA 3KAOA 3TR9A 4KGLA 3CB8A 1FQ0A 4DYJA 1PCWA 1MXDA 3HQOA 2J7EA 1JFHA 4DRSA 4MKSA 4RE3A 3W1PA 3WMSA 4FIQA 3PAJA 3HO8A 1ZBVA 1V3IA 1M1BA 5A94A 1GORA 1EWDA 5CBIA 4HYRA 1S2CA 1HGYA 3AAMA 2DVTA 1UKOA 5BOOA 4LNCA 3N6HA 4XZMX 4W89A 1B4KA 1EO7A 4FO4A 3GR7A 3DYMA 3Q67A 4NJGA 2J27A 5CPMA 2QAPA 4EANA 2NT0A 2V6AA 1NP0A 3MUIA 3WEMA 3CAVA 4QAWA 4QDWA 4QEEA 3ANVA 1GZJA 4I9TA 4O1BA 3OODA 4GYFA 3HM7A 1VF8A 2NQ9A 1E5NA 4H7CA 1G6CA 4GY7A 4H6RA 2BHUA 1KWGA 3NG3A 5MF5A 1PVNA 4MM1A 3C2FA 2DSUA 3L4TA 3L4YA 2HXTA 4WJXA 3L0KA 1DPMA 2AL2B 1NOFA 3U7BA 1P0NA 1TV5A 3PBMA 1XICA 1JCNA 1FHUA 1CENA 3M6YA 4O12A 4FEZA 2XFRA 3EX1A 3AOFA 2CFFA 3WDPP 1K9DA 1Z32X 2X0SA 4MB5A 4DNHA 1Y5WA 3U8GA 2V81A 2CHOA 1V93A 3M5VA 1JEZA 1YDOA 1KFCA 1FWWA 4H2CA 5A6BA 3RXZA 3RITA 3N3TA 2NXHA 4RZ6A 2YSWA 4HJWA 2NQLA 1ISVA 1K1DA 3OGSA 4EXQA 1KFKA 5IRPA 2A5HA 3EYPA 3LEPA 3B03A 1FWSA 4XBJA 1ZBCA 1GKPA 3M0IA 5I3FA 4PODA 2C1GA 3SN4A 4BEUA 4F0KA 3M43A 3POHA 3NDYA 5D09A 2Z29A 1L6GA 3V4BA 3G5EA 3VNKA 4WQ6A 1MDLA 2A85A 4F8XA 2PU0A 4HHPA 3A3HA 4IIHA 5GVJA 2OYMA 5D8ZA 2C3ZA 4XVEA 4XAYA 3BAJA 4JFUA 3C0QA 2ZC1A 3MKKA 4FNQA 3OIHA 1TREA 1AZ2A 1E0XA 3TROA 2IUZA 3NUKA 4YYCA 1TV4A 4UTTC 1WDWA 4AZIA 2QCEA 2EPHA 4IFOA 2E4TA 4Z08A 3VPLA 3NSMA 2MNRA 5E5CA 2BY0A 1PDYA 2GK1B 4A6GA 3AUOA 4JX6A 4ADUA 4J1OA 4F0MA 1W1ZA 4O15A 3ITGA 1ONEA 4WJEA 2PDBA 2FJUB 3T2QA 5F7UA 3LRMA 3A9BA 3MSRA 2A3AA 1EPXA 5U4NA 4GOAA 4JFSA 3WUEA 2WQDA 3MV01 1FTXA 4ZB5A 3PS7A 1JF6A 4JNZA 4YTSA 3CJPA 1N2VA 3ANYA 3AC0A 3EDKA 4TVUA 3MCNA 1RA5A 1OF6A 1TA3B 3SCVA 3U9IA 3THUA 1CEOA 3EWUA 4O16A 3VIOA 5K4ZA 4QM1A 1HG3A 4E2OA 5IHSA 1UC4A 1Y7VA 3K13A 1SJCA 2ZZ4A 5LGZA 1QR7A 1FH8A 4N02A 1DXEA 2O9PA 5F4XA 1F3TA 3CNYA 1IEQA 2VEGA 1C9WA 5HA7A 4IIFA 3RG6A 3BSHA 4XBSA 4GJIA 4M6VA 1I2RA 3EWDA 3RPTA 4GIEA 2X2YA 1R38A 3NO5A 3WIJA 3UZZA 1XLFA 2Y7DA 1Q6EA 4LVGA 1XWYA 3FK4A 3NQEA 5D2YA 2V63A 2XVLA 4RW5A 3MUZ1 1PB0A 3UZJA 3TN3A 4RNIA 1W1PA 4Q33A 4UCFA 3I10A 4HCHA 1QK2A 4XWUA 4D9PA 3DI1A 4JTFA 2V5CA 4M6UA 3CASA 4JQ4A 2C14A 2VP8A 5FAJA 4WKHA 1JAEA 2G96A 4AEEA 1WBHA 2QHAA 1VHNA 1YTKA 3U4FA 1JVNA 1VR6A 5BRPA 1E0UA 1S5NA 2IPFA 1VYSX 4DAIA 3NOEA 2R1NA 2VDGA 1VAHA 1XH0A 5HULA 4H01A 3C61A 5C54A 1X38A 4H8UA 5CH9A 3U6WA 4WKFA 2VHLA 3WLMA 1Y5VA 2V68A 1H7WA 1B9ZA 4XTDA 1EWEA 3AU6A 1D3CA 4L61A 1XW8A 5A3HA 3N9RA 2Y7FA 2EJAA 2I56A 6CGTA 1XIGA 2J8FA 1Y5XA 4MWAA 1E51A 3DXIA 1OX6A 1JDCA 3LZ5A 3B3DA 3S8HA 2X16A 4O54A 4UNKA 3S5SA 1U30A 4GI9A 1HQTA 2CLHA 2VTFA 2IXVA 1BQCA 3CH9A 3W7LA 2XFYA 3IGHX 2PTDA 4ADSA 2A3CA 1HXJA 4ZO9A 3VGBA 3LPFA 4TUFA 2HJPA 1GHSA 3AO0A 1LLOA 1VCFA 4JFTA 4F40A 4QGCA 1WXZA 1GVEA 3LNPA 1TTPA 4BR1A 4IPPA 3IJ7A 3FIGA 3UR2A 5HMDA 5CZTA 2P3EA 2WMGA 4X22A 3IACA 1GVYA 1M53A 5BOFA 4PFMA 6ENLA 2QCDA 2IS7A 1AJ2A 3T05A 1TV3A 1W0MA 2IW0A 2D2GA 3O16A 3ICJA 7XIMA 4DXXA 3A24A 5IM51 1JCXA 3DERA 1AMKA 5HNNA 3V5FA 3A12A 1KKRA 2XN0A 3GAKA 3RU6A 3BLIA 1A5BA 1D7KA 3EWCA 2W5FA 4Q6XA 4LRSA 1LLZA 4AZHA 4YU1A 1XIIA 1FWAC 2FGBA 4E2BA 3W83A 4GYPA 6A3HA 1GOKA 1K6WA 1V0NA 5HOSA 1XD0A 1OHLA 3E2RA 5FEWA 1J0KA 1KM3A 2E40A 1NTHA 3UPWA 2YCEA 3PBUA 1H5YA 3R0UA 4BEQA 3ZSTA 3C86A 1X6UA 4LF1A 1SJBA 4JGDA 3T07A 4Z2KA 2GDUA 3MWCA 3LBOA 3HQPA 4D8ZA 2VXNA 3CZGA 2ATSA 2W61A 5T91A 3PBVA 4PMQA 3EOOA 3Q37A 1A0DA 5D9MA 4XZHA 5FA5A 3V7PA 2RJGA 3H53A 3KL0A 4X0VA 3GYEA 4UTKA 2BVYA 4XD5A 2WKGA 3QXBA 4ICCX 2GGGA 3S2MA 4TXEA 2B31A 8CGTA 4D6FA 1H62A 4PE8A 3LHWA 1EBGA 5LKYA 1KGXA 1H7PA 3RU8X 3EEGA 3SIMA 1LUCB 4ZO7A 4CN4A 4AF0B 3W3OA 1YNQA 3MO7A 2GUBA 4GUFA 1AJZA 3RDKA 2CBVA 5H8PA 4GG9A 3EX6A 1VH7A 3VGEA 2RDUA 1ONWA 1XQKA 1LCOA 3BTNA 4N6FA 1EEPA 3OLIA 3KOZA 1F4AA 2Y89A 2CCRA 3NOYA 3GXIA 1M5WA 4TMBA 3WQEA 1F6KA 4LS1A 4PMJA 3W2UA 4ERIA 3LCFA 2A3LA 2IKHA 3BLEA 3N11A 4Z1BA 3TC6A 2G5WA 4V1XA 3FN9A 5BWFA 4L80A 5A6MA 1H61A 3PUOA 4DPQA 3VD7A 4FOKA 2GGJA 2VCCA 3LTSA 3T6CA 2B81A 3QLLA 2WSQA 4JTSA 1R3VA 3TFXA 2QGYA 2BVTA 7ENLA 5KETA 1A0EA 4LUYA 5C7HA 3QW3A 1TTJA 3LCIA 1LBMA 1J9YA 3N2BA 5BXRA 3ARUA 3UZXA 3EDDA 2FYMA 3PBYA 4ONVA 5BXPA 1KFBA 3S1XA 3HG3A 5FI8A 1V3JA 2E25A 4PB3A 4S38A 3S4TA 3W70A 3ABZA 2GSJA 1VRDA 4CCEA 2RDTA 4A3QA 3RM9A 3P7YA 1A49A 4ZCWA 2QJNA 4G9PA 2VZOA 3RM8A 4KWSA 4MDOA 3LTPA 1X39A 2AOSA 5AVHA 3BZJA 5BXSA 1M9HA 2HQAA 3W1MA 3MI2A 4I7VA 2EKCA 1K4GA 5DANA 2RH9A 1JYWA 3N15A 4H4IA 1QJWA 4ZFCA 1BVNP 4FSAA 5CGMA 3W22A 2FZBA 3TKFA 1ADSA 3MU7A 5LNRA 3SFKA 5C55A 4O10A 5IBXA 4Y7EA 4I7WA 4QCFA 1DQWA 3ZYZA 1TPEA 1ZAJA 1VLWA 4WXZA 1KRCC 4Q32A 3QGAC 5HPCA 5KMYA 4WXYA 1XR2A 5AC8A 4EPBC 3EGJA 1GCYA 3QMTA 3GXTA 4C6IA 1UW9A 4JL2A 1TIMA 3UWQA 1H7XA 1ELSA 4TV5A 1AH3A 1IWAA 4IISA 3L7RA 2RDXA 4Q6JA 4IH3A 4GHRA 2QAFA 4UR8A 4JXCA 1GKRA 3KCOA 2PF0A 3IJ9A 4NYUA 4AX7A 3LCGA 4AISA 2NW0A 4LCRA 2BVDA 4A2SA 4MWAB 4K8HA 1EQCA 5JBEA 1WXJA 5K9CA 4LH8A 2DDXA 4LX4A 1CPUA 3C0JA 2C13A 3LHZA 3FVMA 1VYPX 4EWND 2ZXAA 2WMKA 1GOXA 3B8UA 1Q7QA 1X6NA 1FWDC 1C7SA 3B9DA 2QDGA 4KFPA 1WA3A 1O5QA 1XLAA 1AL7A 4C1NB 1VCVA 2FPVA 3HURA 5DO8A 3L21A 1JZ3A 2QCGA 3TVAA 3WLKX 5F2MA 4S3EA 5E0KA 5A2CA 1R9ZA 2AQOA 4DZHA 5D38A 4AU0A 4B2DD 1XKJA 5T8GA 3TCSA 2DJLA 3LCHA 5CZKA 4E4PA 4LYKA 5DN1A 2EG7A 2QCDB 3MUXA 1DORA 1C8YA 4UTUA 1ZPTA 3COTA 1WZMA 1IZCA 3AROA 4A21A 4PEKA 3ITCA 4P8VA 1BD0A 2FHBA 6XIMA 1QUMA 2FB3A 3KWXA 1UPPA 3W71A 1I4NA 2PGEA 5AHEA 1V0KA 4IIDA 1V5XA 4F0HA 1UA7A 2VT0A 4HHHA 2GGIA 2G3MA 4LEQA 1B3OA 3UJFA 1Z42A 2EKGA 2CXGA 1WDQA 2P3ZA 2DQXA 4O28A 1W9UA 4KERA 5EMJA 4IIBA 5LNWA 1TVLA 3WF3A 3R7MA 2IPGA 3Q94A 3T2OA 2OWCA 5CG0A 2XDFA 2BP1A 3LXAA 4G7EA 3B8SA 2GDVA 1F3EA 4PMXA 1ZSXA 4CLMA 4AMAA 2ZWZA 1C93A 2ZUUA 3L4WA 1UWRA 3CWOX 4HSHA 1N82A 1TFVA 1JNDA 5L6UA 1O5XA 4IP4A 4Q8OA 3SURA 1TQXA 1W5QA 3MSYA 4GGHA 3TYEA 1JYXA 4FR1A 4ZTXA 3ZMRA 1GQIA 1WOBA 3BOLA 5M1TA 3EAUA 2VD8A 1SO6A 2QVHA 4QQUA 4UC5A 1A5AA 2VCAA 2ZVIA 1J0IA 4JTRA 4EACA 2NQJA 4PA8A 2R82A 3S47A 2CU0A 2NUXA 5G4WA 4XISA 2PB1A 3H2CA 3IRSA 4FOJA 4PSPA 1UMLA 3A22A 2Y8VA 1H63A 4DO7A 2PDPA 2BDQA 4M0XA 4HPJA 5CJ5A 3TQPA 4DF2A 1C8VA 3WK2A 2BOEX 2OZ8A 3OW1A 2DUXA 3CO8A 2CWXA 3CXOA 3O7UA 1EX1A 1KTCA 1V6TA 1I8JA 3ECQA 3AICA 4U4MA 3GDKA 3VE7A 1FXPA 1U33A 1VFSA 2V5BA 1XUZA 3TNOA 1J4EA 4HTYA 2Y5SA 3W2JA 3P61A 1JAKA 3NVTA 4Z17A 2O92A 3KBMA 3STGA 4DJFD 1YYAA 1TJ0A 4CNOA 3K2GA 2O7QA 1LP6A 1QK0A 4AYSA 1QBBA 3LD5A 4FK9A 4N4PA 2HWGA 4IHCA 5PTDA 5BCAA 3DN5A 2PBOA 2F2KA 2Y5JA 2D20A 5HDRA 3SM0A 2QDHA 2XPKA 3T44A 3E1F1 1J79A 1N8WA 3WJWA 3TR2A 4I8DA 1AQFA 3S2JA 2QJGA 3S5ZA 1M6JA 2IXUA 1YNPA 1Q6DA 1XSJA 4ATWA 1SSDA 5AHLA 4FNTA 1GK8A 1JF5A 3GXMA 2F6KA 2PCQA 2VDHA 2QZRA 3EKZA 3T1GA 3HPXA 2VZVA 1G4TA 3ALGA 2GVJA 4X0NA 2VEKA 1E6PA 3ZWTA 5GQBA 4FNSA 1EXBA 1OB0A 4URIA 4G1KA 4O18A 1U2YA 7ODCA 2HMCA 2PZ0A 4NP7A 2O9TA 4KWWA 5A6LA 5B80A 1TTQA 4FOUA 3OP2A 4GZ7A 5FF7A 1DJYA 4IUOA 5IFTA 1R6WA 1E0WA 1OC7A 1WPCA 5EMKA 3VD3A 4XG1A 2ZZ6A 4J40A 4JL1A 4AEOA 4CD6A 7A3HA 1WDSA 2JF6A 2ESCA 4QDMA 2PDMA 3VUPA 3G3MA 2WKLA 4MB3A 4PR4A 2C16A 4AD5A 4HMEA 4MTVA 5F2LA 5FJIA 2J75A 1ECEA 4MAZA 4Y9AA 4GH1A 3W28A 3BV4A 5I00A 1JYVA 4TTGA 3VFLA 4J35A 3ELFA 3BE7A 3QSRA 1TJRA 1EH9A 4LU0A 4K2SA 3BDKA 1WNOA 4ZR8A 4EP8C 5LA0A 5B7YA 1MRQA 2E8YA 2BHYA 1HJVA 1IF2A 1F7BA 3DECA 3PHAA 3H7VA 4PBEA 4LALA 2ACRA 1TX2A 2G97A 3W1AA 2DZAA 3IRDA 1E72M 4K36A 1XLDA 2E3ZA 3QHMA 4JS3A 1GQJA 2B7PA 1TSIA 1CGUA 5DCBA 2OLHA 3SUSA 5D2XA 5KINA 2E09A 9XIAA 4AVNA 3SRFA 4ZE4A 2OQHA 1HVQA 1QATA 1E9ZB 1UMYA 5DX7A 1I2QA 2AKZA 2P5NA 1NJJA 3QV7A 3ABXA 4DUXA 1O6IA 5DXXA 4FX7A 3WLJA 4WF7A 4K3ZA 1GPWA 1F4HA 4H83A 3RLUA 5C9WA 1XYMA 3KE0A 1JZ7A 4YXGA 3BPWA 2Z25A 2GFTA 4BJHA 2NZLA 1EIXA 3GWQA 4K37A 3LRKA 5LGXA 2X0YA 3S9IA 4HMCA 4JIHA 2PD5A 2XH4A 2Z7KA 3MANA 3DG6A 1KLYA 4BI5A 3BLKA 2DIJA 4L65A 3V5OA 3J7HA 2PC8A 3M0YA 2J8TA 3R58A 4L1GA 4R33A 2VGGA 4MOZA 3GIQA 2PDNA 1R0MA 1XDLA 1IXPA 3NJ3A 2DZVA 3WCZA 3WH6A 2C0AA 1IEVA 1XDJA 1ZBKA 4HJFA 2WYSA 2VC5A 2E7FA 3RN6A 1PL9A 4R5EA 3NYZA 1F07A 1EQPA 1XSIA 3LPOA 4IP7A 1DIOA 4IXXA 5DMNA 4GIYA 1CB2A 1UZHA 3WNNA 5TNVA 1SU5A 2HCVA 4TVCA 2DSZA 3VYLA 3O6AA 3NXFA 3UYIA 3ARVA 5DRIA 1XS2A 1IWPA 4QBXA 4G7EB 3WBAA 5C9XA 3E49A 4HHLA 3RLGA 3B0PA 2XGZA 1BF2A 3DZ1A 3KP0A 2W79A 3K8KA 3WQWA 3N2XA 1XIMA 4M6PA 3CT2A 4UIOA 4WX2A 4AIUA 4V33A 4OTKA 4NZJA 4IZGA 3UA3A 5U7SA 2YL9A 2P1FA 1QFEA 1J0ZA 1P5BA 3KVLA 2G3FA 4AD2A 2CLIA 2VCBA 4PCPA 2TAAA 1RY8A 1M01A 3EA2A 4DHGA 1F9CA 4FNUA 3VOCA 4M51A 4Q8VA 3S6DA 2CLEA 1FXQA 4TOQA 3ARQA 1TPC1 3HGSA 4JN7A 1TPFA 3WQOA 4O17A 4YHGA 2Y24A 4UTMA 4ZGYA 4EF8A 2DUZA 1S2WA 4ZZ9A 1X8FA 1GVIA 5A6KA 3K30A 1PX3A 4C6JA 3DFYA 1A5LC 1BYBA 3FVDA 3ZXWA 2RJHA 4AC1X 4UQ9A 1ME7A 4UTWA 2O9RA 1XG3A 4OJYA 1HKVA 3GHUA 4NAEA 2Q02A 1IT7A 2PWFA 1RVGA 4HBKA 2AQWA 4GNVA 1OYAA 4U28A 3P80A 5A69A 2X42A 2XIOA 3SCPA 4DPPA 4D72A 2OT1A 2G3NA 5GJNA 2PEVA 3ARZA 3UWWA 4ALDA 4NHVA 1LRQA 2I5IA 1V7YA 1YDNA 3O6CA 2ASHA 3FKKA 3UZ5A 4FB7A 2V5JA 3FLUA 4GFSA 4UFJA 1UZ4A 1CGWA 1F61A 1B1YA 4PL2A 1EJUC 1CIUA 5KSWA 4GNJA 3NM3A 1SGJA 3VDAA 5I5RA 3MVTA 2ZRVA 3AFBA 3ARRA 3LSCA 4HPXA 3TQ0A 4Z1YA 4L5ZA 3LENA 2PSNA 1XV8A 4GUHA 3RRXA 4HMDA 3SIZA 3UNDA 3B9EA 4XZNX 4XIMA 3N2MA 2FQIA 1H41A 3VGDA 1AODA 3U2OA 2DZTA 1AD1A 4OBSA 5K9DA 4DY1A 1TRDA 3P8IA 3PUDA 1DYSA 3S2LA 4AFYA 5IDZA 4L56A 2W62A 2XFFA 1OADA 4I5UA 1MZHA 4JIEA 1NDYA 3P5ZA 3UG8A 4DYKA 2Z2UA 2ON3A 4FPSA 3TW7A 7REQA 5FJUA 1GWJA 2REQA 3GDBA 2BMBA 5CC7A 4DWDA 4O0QA 1V0MA 1X1ZA 2UZ9A 1DE5A 3BJFA 3FNDA 1JR1A 1GOWA 4GKLA 1NELA 5DXYA 3VNJA 5C0QA 4L6HA 4YCOA 1GHRA 4XIAA 5CLTA 1XBXA 2X09A 4ILSA 2AGTA 3CV6A 4KF1A 3U57A 3VIPA 2QNEA 1E4NA 2VD9A 4IQEA 2FH8A 3T8LA 3A4WA 1LF1A 4NZCA 3LHUA 4F3HA 2J7HA 3MSDA 4E4UA 3H55A 4M24A 3W27A 3H6OA 3W73A 5EB8A 1K8YA 3BLPX 4ZB0A 2DT2A 1VB9A 1R3RA 3M7WA 4PMDA 4WLCA 3DDMA 2QLYA 1BVZA 3STFA 3UG4A 5HBFA 4QNEA 3E0VA 4AX6A 2A3EA 3EEZA 4ATLA 4JZ5A 1YXDA 4QE1A 1S2TA 3P81A 2QKFA 4UR9A 1EBHA 1A0CA 3L67A 3HPZA 1QNSA 4LBRA 1A3HA 1FH9A 5JU6A 3PUGA 2IQ0A 4GYPC 2Z1SA 2VELA 4FNRA 3M5ZA 3SEPA 4QAIA 3SJ3A 3KRSA 3WY1A 3QM3A 1JPIA 4DZAA 4J28A 3B0YA 4JY9A 4C5ZA 1HO4A 3OG3A 2J8GA 2XSXA 3VMNA 1W9XA 4JHZA 4PSRA 5F4SA 4XKYA 4HN4A 3TTOA 3VD5A 5I6SA 3SUWA 1KFLA 5GNZA 1C91A 3CS2A 4ORIA 2PWGA 3L2IA 2V3FA 3KXQA 3H7RA 4Q4SA 4LUIA 4NILA 4MLRA 2CHNA 3MW7A 3VKAA 3ITOA 3T08A 3RIKA 1RAKA 2Z0IA 1XLIA 3TP4A 1PZ1A 5DELA 3GNXA 1R30A 1UP0A 3TFCA 2A79A 3CZEA 3T81A 1JL8A 1IYXA 1H51A 3CQ0A 2C71A 1JUKA 3PPHA 1VJIA 1KO0A 4DLFA 3DYPA 3LPPA 3ZM8A 3LLDA 1XISA 3E0FA 4ECLA 4OV9A 1OIMA 3DFNA 3QRHA 4M3PA 2C19A 3NQCA 2ISWA 1B4EA 2VM8A 4O13A 2XWEA 2VRJA 3EA1A 3UJSA 1UP3A 2D0GA 3GVRA 5M17A 2PLJA 4UOJA 4YMZA 4RKAA 3OHIA 2QUVA 3RX2A 2H3BA 2PZNA 1V02E 4LT9A 5DMLA 2PRLA 2Y7GA 3DOPA 2FVKA 4KKXA 3QHNA 3PUEA 2GVLA 3M0HA 4NX0A 4UUIA 4NRSA 1RBOB 1UR4A 1US2A 1E1EA 3W86A 8RUCA 3CLWA 1TIWA 3K1GA 5H8MA 4LB3A 4MNKA 5L9FA 2VJXA 5ABEA 4R7WA 3QPEA 4H2HA 5JXQA 3MA8A 1O12A 1YHTA 2BOGX 1YLVA 1Z8AA 2WQPA 4NAEB 4QNWA 2Z1KA 3WLNA 4O14A 1ZS2A 3QV6A 3GH7A 1UD4A 1UWIA 4NI8A 3F2DA 3WK1A 1V0LA 2J4GA 2FPYA 1CGXA 2TYSA 1A3XA 3LDVA 4QX4A 1VKFA 2NSOA 1VFFA 5G2HA 3SQLA 3C8NA 4F2BA 4JN6A 1RBAA 4HTBA 1H11A 5MHBA 3RILA 4B5UA 3WNKA 1Q6OA 4H9MA 3NCOA 3EXSA 3G6LA 1W5NA 5I3HA 1AQ0A 2KX9A 2WLYA 1B5TA 4ZTYA 1MEWA 3VUSA 4LCQA 3EB4A 3NO3A 5KTLA 4US6A 3OJGA 2G41A 4LAMA 5BMWA 4J3VA 1LOQA 2EF9A 1US3A 1HT6A 1UOKA 4QLKA 3OTRA 2J9YA 5IBXC 1DIEA 4HNTA 1OG6A 3LGEA 2WPGA 3W82A 3KOXA 4LC6A 2XHYA 3AYVA 4HN8A 5TF0A 5K2ZA 1L6SA 4EPEC 3FA4A 3KLKA 5I0DA 1H7NA 4GBDA 4NG3A 4LVDA 3M0ZA 1R8LA 1RJRA 4BS0A 1P6BA 4Q4QA 2PRMA 5HNTA 3B97A 3N29A 1CWYA 3G22A 4ATDA 1W6TA 6TAAA 1H50A 2ZA3A 3NSNA 4HU0A 4HU3A 3RO6A 3ME3A 2AMXA 2REQB 1HIZA 3VA8A 2PWVA 1E73M 3WMCA 4GVHA 4H9VA 1U5HA 3WUBA 4JN8A 2XGBA 4HMNA 4HZ7A 4IOTA 2FTYA 4ZQMA 1XIEA 4RV8A 3W26A 2J7DA 3VU2A 1XBVA 1J5TA 3MDUA 3GNRA 4I5XA 3KP1A 1B2YA 1KFWA 4LNYA 3IIZA 2FMOA 4TX6A 4DWSD 4IMDA 1QNPA 4J2PA 4PRWA 4JIIX 1U5JA 4E38A 2CESA 5FD0A 1UR8A 3PFRA 4RNJA 4O53A 3QZAA 4YLWA 3MJMA 4LYRA 3NAVA 3WUGA 1UYQA 4TX9A 1GPFA 1SFSA 5G4HC 2A21A 3WLPA 1PTGA 1NDZA 4RE2A 4AHOA 1N8FA 2XFWA 2L5HA 3IS4A 5AC7A 3GSMA 1OK6A 3IV3A 3REQA 3W07A 1E55A 3SN0A 3SI9A 1TCMA 3WENA 4P7QA 4KRUA 2ZDSA 3DHPA 3N3MA 1W3KA 3KWSA 3NZQA 4D6CA 1T5AA 2WCGA 2BWGA 2WC4A 4AZ6A 2GL5A 3CPGA 1DTUA 3BWWA 5LXXA 1K77A 4B2DA 4CQ8A 2QPUA 4PBGA 1KFEA 2YLAA 1EZWA 1LG1A 4UNLA 2EPOA 1F5ZA 1LOSA 5XINA 3ATYA 4XKYB 2PLMA 1DWHM 3LXBA 5AYYA 4QQ3A 3WQ8A 3E2QA 1RQBA 1FH7A 1WZAA 3APTA 5FACA 1TO3A 3RMEA 1XLBA 4JTGA 3TNBA 4H19A 4LBUA 2RHGA 2W63A 1IEWA 2YCIX 2WVVA 1SJDA 2QVNA 1P1MA 3FY1A 3MCMA 4LCSA 2FVMA 3MMWA 1RVKA 5BU6A 4D8AA 1ZBWA 4PCTA 4OOUA 1XM3A 1W1VA 2OSYA 5FCZA 2VC9A 4UTIA 4Z2IA 6ALDA 4I6KA 3ARYA 4FX6M 1XI3A 2OG9A 2ISVA 3MPGA 2Z24A 3JZUA 3MS8A 4GCXA 4KCWA 3LUTA 3SQSA 5I3GA 3TC3A 1LOLA 4ZL1A 3MCOA 3S42A 1EYWA 3OG2A 1XRFA 2NXGA 3GVQA 4YTQA 2A0NA 4HU4A 2XTKA 4JOMA 2NVAA 2QJIA 3IV8A 2J74A 3GDLA 1HP5A 1BYAA 5C9UA 1IEIA 1VJSA 2E6YA 3E3HA 3QV9A 2VEFA 5CPLA 3W1UA 5IHRA 3N34A 4F0SA 2BX7A 4NU7A 4ROPA 4CNNA 2HE8A 1XBYA 3E0IA 2F38A 2VENA 3LV6A 4IICA 1Y0EA 4V1YA 3QTPA 4W8BA 3AIQA 4XBKA 4GJ1A 2DGAA 2GJXA 1U1HA 4J4KA 1LRTA 2OQLA 4YWIA 4NNAA 3ZO9A 1X1OA 1BHGA 3DEQA 3M4HA 3UA4A 1I1WA 1DJHA 1DEDA 3CIVA 4LUSA 4HP5A 1UWUA 3GTXA 3K4AA 2HPMA 2D0FA 1BVWA 3D5HA 1N7KA 1SZNA 4DJDD 1QOQA 4INFA 4PZVA 1C3FA 3FJ6A 4ACYA 1PX8A 5D03A 4LUTA 1RQEA 1AMYA 3GFZA 2YFOA 1Q6QA 3VZYA 3W4RA 3W75A 4N6EA 3VIMA 4DJFA 2MANA 3F5KA 3KOFA 3POCA 3N04A 3AS3A 4MKVA 2DFAA 1KM5A 3V36A 1A5SA 1GJWA 1NP2A 3OZPA 1BXNA 1Q4NX 1V08A 4Z1DA 2EPLX 2PS2A 2A3BA 2J47A 2OSXA 3G1AA 3SAZA 2BBFA 1KV8A 4F4RA 2VGBA 3UG5A 2VFEA 5I78A 2D3NA 5KZMA 4A8RA 5CSRA 3LM7A 4Y8FA 1QW7A 3KHDA 3PF3A 4PUNA 2VUNA 3PPCA 3UJEA 2YLLA 5AC5A 1UBPC 1OQFA 4K7VA 1VZWA 1KM2A 4POCA 3WQ5A 1WZLA 3U4AA 5DBTA 4K8EA 3LXCA 1CW2A 4AWSA 4GGBA 1D3GA 1QU4A 1V6YA 2CNCA 4HNLA 1TCDA 3R94A 2V2DA 1EPVA 3GZ3A 1S5WA 3UPBA 1HZYA 3VCNA 5J5DA 4WSJA 5EL1A 4DUVA 1K02A 1WCGA 4JFVA 5FL0A 3MUY1 4IQLA 4GIRA 3UERA 3DX5A 3H2OA 3KRUA 1FCBA 3WBEA 4HNVA 1BRLA 3RJXA 5BRQA 2OR2A 3W84A 1PPIA 1ONRA 2O55A 4NQ1A 2GJPA 2E5BA 1RSCA 2P10A 1XGEA 2OEMA 3MI3A 5TAOA 1P0DA 3WX7A 4A3HA 4WOZA 3C2OA 3TONA 2DSWA 4LW7A 3O9NA 3SZ8A 1S2AA 2PGWA 1EKOA 6TIMA 2CWNA 1FX6A 2EG6A 3GTFA 3QYQA 5CPOA 4E3TA 5BMXA 1ECQA 2NT1A 2ZX8A 2UY2A 4MMWA 3I7QA 3QJAA 2PTXA 3BMWA 1V03A 5H8UA 2PP3A 1TE1A 3C8FA 4KEUA 1KC7A 1P48A 4AZBA 1POJA 8XIAA 2ALRA 4JTKA 4ZODA 3A23A 4IPIA 4H3DA 3MHGA 8XIMA 1SZEA 3BQ6A 1I60A 4O1EA 2JIEA 3CL8A 3GDMA 5DCDA 3SRDA 1JG9A 3REQB 1NIUA 1JPKA 2Z1BA 3WD2A 5FJPA 3W2MA 4O8RA 4GZIA 5JQ9A 2HNHA 5HR7A 1I0BA 3VMPA 1DJIA 2VL4A 4GUGA 3QKEA 4MYAA 4C60A 4PCFA 1V8EA 4W4QA 1WB0A 3G8EA 2KAUC 4L9ZA 3QOMA 4RDVA 4M19A 4HCLA 2EXOA 1KD0A 3H54A 3TUUA 4LGXA 2I57A 4IL0A 9RUBA 1PAMA 2GUUA 3T42A 2ZUWA 5JBDA 5HJYA 2NV9A 3AUJA 1YXCA 1NWUA 3MMUA 5FSDC 1IXOA 4HA1A 4Y9MA 4Y9PA 3W7EA 4XO6A 3CT7A 3UT0A 5LA2A 1U22A 4HNOA 2JKPA 4N42A 3CK5A 3SBFA 3O05A 1ZJAA 3ZR6A 2YW3A 1T0OA 5I09A 1QNOA 1W9VA 1T8XA 4JQAA 3BW2A 3MC5A 2WVVB 4IGNA 4WSKA 3CMJA 3UEQA 4H7ZA 2UBPC 3SGUA 3OHMB 2WC7A 3VDBA 3TC7A 3HV9A 3HF3A 3PM6A 3PZ9A 3RX3A 3OYXA 3QYSA 3PJUA 3MTWA 4X63A 2GWNA 2QW5A 3E38A 1G4PA 1BAGA 1B54A 1UH2A 3R89A 3G1RA 7TAAA 2WJDA 1SM9A 1M7PA 3ANUA 2XGIA 4H6KA 6REQA 4Z2GA 1Y8BA 4ES4A 4UTWC 3CQKA 1EJ7L 5E09A 1H1ZA 4D8LA 2PURA 3SSJA 4QFUA 4RDWA 1Q4WA 3NEVA 3A47A 1THFD 4BWLA 1RLCL 3L5LA 1B31A 2O0TA 3WBWA 2J6XA 1BYCA 2VFHA 3HGOA 4G56A 1SZRA 2Y1HA 3W29A 3R6IA 4O0KA 4WDUA 2BG5A 4A4AA 1W37A 3MDWA 4J7RA 3ABOA 2VQTA 2FB2A 2PDUA 4J27A 4WZHA 1CI1A 3UWUA 2GJXB 2PTZA 4ROQA 3ABSA 3TYDA 3NIYA 5FAGA 3DKJA 4K1WA 1EJXC 4AD1A 1ZRQA 4Q22A 3GK0A 1O1HA 3USBA 1L6WA 3EXRA 1SW0A 4ZXOA 2E67A 4LUSB 4HT3A 3VCRA 1W1B1 2O56A 1FOBA 3VKJA 5DEZA 1AW2A 4GBUA 1QO2A 1G7VA 3EOSA 4DLMA 4D6HA 5D05A 1AW1A 4UZUA 1NDVA 3HFTA 4AYGA 4CCZA 3I3DA 1D8CA 2ZZ5A 3VOGA 3N4FA 1R3TA 4UFKA 3RM4A 1TE6A 1TYGA 1E4IA 2E5DA 4XUYA 1N55A 4QITA 4HSOA 3CIWA 3GO2A 2X1TA 4RK8A 1UZDA 1CGYA 4UNIA 5ENLA 5EYWA 2WZHA 2YA0A 3M0XA 2WSRA 2VX5A 1GOOA 4GCAA 2VO5A 4UTLA 1EC9A 3WD0A 4JDBA 1KCKA 1EX5A 2ONEA 4OE7A 4O4WA 3TCEA 4XZLX 4IM4A 3AIEA 3WZ0E 4IJCA 4A8NA 4XO7A 4ZFMA 4OUEA 1NARA 2J77A 3B8DA 3RYSA 3DC0A 1BPLB 3B0UX 4WY0A 4QJ5B 5JIWA 4YVPA 1GT8A 4QP0A 2I9EA 4LTSA 2I14A 3I4KA 3T40A 3UW6A 2Y6ZA 1RJPA 5LXEA 3CWHA 4NYYA 5LHEA 5JH1A 1FFQA 4AZGA 1BRLB 3B9AA 1YRRA 1IHIA 3R79A 3TMLA 1QI3A 5C8BB 4DF0A 1HKIA 1VEOA 1AVAA 1KV5A 3TK7A 3OZYA 1LLWA 2PWDA 2EBNA 1Q5MA 1LRNA 2PI6A 4IGHA 1FWRA 3UVAA 4DJED 2IPJA 4AY8A 4J3TA 2Q8ZA 3GXPA 1ZJIA 3PB2A 1K9FA 1SW7A 5K9XA 1TJPA 3VILA 2BNJA 1NEYA 3PPFA 2YPIA 3NEHA 1J96A 1E9YB 2H6RA 3CBWA 1PXGA 3BARA 1EEXA 1ZJHA 1S5VA 2HROA 3W7CA 2B7OA 3S5YA 1V51A 3RK8A 4IX2A 1XYFA 5DQPA 1H2JA 2ZX9A 1JQVA 3H70A 2JALA 1K7XA 3AISA 1NDWA 2OTDA 4HPHA 4MUZA 2WMHA 4GUJA 4QG9A 3JZEA 2RGLA 2F61A 3D6NA 5CGTA 3C52A 3GW3A 3H26A 2DP3A 3ARWA 3G1XA 1FY6A 1ZFJA 1Q6GA 1I6NA 2ZE3A 5D2VA 2TSYA 2J7CA 3KRBA 1Q65A 1DKWA 4ZQCA 1KRBC 3C3UA 5C9ZA 1K8ZA 5M2FX 3W7KA 3ZVHA 2JEPA 4PMYA 1XL9A 1MFUA 4JIQA 1ZALA 1ISZA 3XISA 3NQAA 4AD4A 3W9ZA 3GFYA 2OQYA 3DESA 3JRKA 1EGZA 4OBTA 1MDRA 1KLZA 1R3WA 2YL6A 3UY8A 1MI3A 4JTCA 3CC1A 2OYKA 3VKCA 3CIXA 3O15A 3P0WA 5BOEA 4PFHA 2PP1A 4I3GA 1XRVA 4RDYA 1FWBC 4ZMGA 1KM0A 1VPXA 3SCUA 4UTJA 3I6TA 4HZMA 1W54A 4I7UA 2OT0A 3MO4A 4D6DA 4JTAA 1R3SA 3TIMA 4OVXA 4QS6A 2OKTA 3VABA 3EA3A 2EAWA 3N6QA 1JFXA 2E6AA 3AQUA 2NVDA 1KGUA 5DT7A 1S5MA 3HTWA 1P6CA 3MBDA 5A5WA 5DLCA 2XH0A 6REQB 1S1RA 1JYNA 3VD4A 1EB3A 4GQRA 3E0LA 4FS9A 2G4FA 2DJXA 1WDDA 4QLLA 2QEZA 3PFMA 4O11A 3PWAA 1TKKA 3GBDA 1ICPA 2CLKA 1EFZA 3H4WA 3PZNA 2XZ7A 1QDSA 4MNMA 2XN1A 2J7GA 4E4FA 1YIXA 2W3ZA 2INZA 2WMFA 4IMEA 4AIBA 3KBWA 3VFCA 3NSXA 3G1YA 2OJPA 4N7QA 2CXEA 4HB7A 4S1FA 1EP2A 4ZSUA 2OZ0A 2WNZA 5GNYA 3U48A 4AWTA 3CU2A 4C6QA 5T26A 4M6QA 3TZNA 4CEXC 4ZEPA 1XDMA 4OU1A 2IPWA 3LNMA 4EPKA 3AWOA 2DW6A 3AWNA 3G8RA 5IOBA 3HOJA 3N12A 4HD5A 1OM0A 3PY2A 1OT1A 3BK0A 3K8MA 1FWGC 4W87A 2FJKA 4IMAA 4NY2A 2OEJA 3UXDA 1MWOA 3WF2A 3B4UA 2W0UA 2O4MA 1DJZA 4R9XA 2JGYA 4JTTA 3PNUA 5J04A 2QJHA 3CUGA 1JI1A 3MWAA 4TO8A 3GQYA 3QPYA 2DV0A 4NUWA 1GVRA 3B05A 4AHPA 1DJNA 1E1FA 4CD4A 4HZ8A 1R46A 2PAJA 1RQHA 2QF8A 3ITYA 3DYOA 3WF1A 2VMFA 5E70A 1W1YA 4G7FA 3OBKA 4PH6A 1QHOA 2PDJA 1AW5A 1CDGA 1PIIA 3AU2A 5F2IA 3UR5A 3W53A 3P62A 6PTDA 5EY5A 2FGLA 3BANA 1RHCA 4FXFA 3ZOAA 3VVGA 1A5OC 3QBUA 3H7UA 4MLJA 3LBMA 3OVGA 1IEXA 1XRTA 3LB0A 4IFKA 4LXFA 2YCLA 4Y96A 4MWAE 4WY0B 3IK2A 1GQLA 1FKXA 1XLGA 4X2PA 4ZQPA 3SCQA 3VIJA 3FYYA 2Z00A 3F5JA 1AK5A 1LT7A 2FKPA 3G24A 1GTHA 1PIFA 1BLIA 1EF2A 1MEIA 2FZMA 4DBUA 5CAKA 2OMAA 3SB0A 2FTWA 3V3WA 1BG4A 3FAWA 3GU2A 3WELA 2PDYA 2YA1A 3BUVA 3QQ0A 1I9CB 3MT1A 1QT1A 1L8PA 3BXWA 4AMCA 4ACZB 4ZQOA 2P76A 5M3WA 3QGVA 1OGGA 3MKVA 3FEMA 2DT3A 1OEPA 3AJXA 4IJBA 4GI8A 1Y65A 3GRIA 1P6WA 3KS6A 4N9EA 1RA0A 1DJQA 1J10A 4FALA 3OQEA 4FA3A 4JPGA 1GVFA 4B9ZA 3NNTA 3Q58A 3W6YA 3EOUA 1YADA 3LTYA 2QYGA 3A3XA 3VNDA 3TLQA 3CAQA 2ACSA 1PEZA 5LIXX 5CPSA 3GC5A 3L5MA 1HJWA 1I2NA 2CW6A 4DYEA 2YB1A 3TJIA 4N9DA 3MP3A 2VRKA 4H9YA 4NXKA 2ISDA 3O6YX 5JVLA 5CZ0A 5HATA 1JCYA 2D0HA 2Z1VA 3AXIA 4PMVA 2ZYFA 3P14A 1J01A 2YBVA 4AC7C 2OX1A 3ZVHB 1ISXA 1MQRA 1FWFC 5CSYA 3O0FA 5G2WA 3H2MA 4JICA 3IJ6A 3S83A 1O60A 5FEPA 4LBSA 3HQNA 1EDQA 3M0KA 2V2CA 4ML4A 2WB5A 4DX3A 1SQ7A 2ZXDA 1WQ5A 4GQ0A 3AYRA 3M9YA 2CC0A 3RPDA 1FWJC 4M1RA 2PWEA 1GYNA 2J13A 3GTHA 2GSHA 2FDSA 2VR2A 3R8RA 2WJFA 1TPH1 1IZKA 3KVMA 5AVNA 1CB7B 1UD5A 3GUGA 3AYTA 1PUDA 4AVFA 2D1ZA 3PTDA 1J6PA 5C7VA 2OZTA 2JE8A 1CZ1A 5HPOA 2HVOA 2WW5A 3CL7A 3Q65A 3VOFA 2D2JA 1JDAA 4NRRA 5AKQA 1SZGA 3FSUA 3P0XA 3VZZA 1UD3A 1BSLA 2VR5A 3WNOA 1VENA 4CNTA 4M29A 3VM7A 5A2BA 1V02A 3WLOA 2JQXA 4UFHA 1FDJA 4EOUA 5JBFA 1T7LA 4I8YA 4E5TA 4ML9A 3WNMA 3QR0A 3OGVA 1XLMA 2CZEA 4AG0A 1KXTA 5EPDA 3PJTA 3V0UA 5I23A 2YB4A 1TMQA 1XGDA 4RW3A 4IX0A 3SY5A 2YR1A 1U5VA 4D1IA 3F7JA 3CHVA 1QWKA 5A6JA 4B16A 2W4XA 1T41A 4L64A 1JCJA 2YYTA 4KW2A 4B5NA 3LMZA 3TA6A 5HMSA 5FJRA 1ISYA 4IGMA 1E9LA 3CUHA 4DJFC 3BG9A 3GHRA 5K3VA 1MNSA 2YFNA 3F4CA 4WDTA 3GC2A 1VYRA 5CEWA 3BCJA 4H8HA 1QI0A 3BJSA 3FS2A 1EA9C 1A80A 5KITA 3JW7A 3EKGA 2BLEA 1REQA 2VGIA 2E8ZA 3GTIA 3QMRA 1V6XA 3VOJA 5CCZA 5JMUA 4UMCA 1O7AA 1X98A 4V28A 3MHUA 1E70M 5HNUA 2HSAA 4FXSA 3BLDA 2POZA 1O94A 3AS1A 1V3KA 4Y6GA 1AQMA 4OV4A 1SFTA 4RZ4A 4B90A 1UR0A 1ZAHA 4CD5A 1GW9A 2A7RA 2BASA 2XN2A 4DJDA 5BW6A 4TVDA 1G9HA 3QY8A 4GABA 1XLKA 3VDHA 1WBJA 3AHXA 4OFCA 3TTSA 3TSBA 4MWAD 3W76A 1XC4A 2E6DA 3N2CA 4KGJA 1OX4A 3YPIA 1V77A 3NPVA 4JYEA 3SCRA 1F73A 3KOYA 3AJ7A 4O0ZA 4W5UA 2A7PA 4IQDA 2F9RA 3GH5A 3LQGA 1EC7A 3ATZA 4ZOCA 4TMCA 4JDYA 3G1DA 3TW6A 1SUXA 4PUJA 3CZJA 1H7OA 4S3JA 1EDGA 1CLXA 3CZLA 4S2CA 1DQXA 4IFKB 3BG5A 3OZOA 1E0VA 1TB3A 3DIPA 4L4OA 2YL5A 3T2PA 3K4DA 2OO0A 3KBVA 1C29A 3INPA 1PZ2A 3CHEA 1DV7A 4CCCA 3FOKA 1P7TA 1B3ZA 4MYXA 4M5PA 3K5XA 4D6IA 3UU0A 3LA4A 4L4MA 2W27A 2E28A 3KOWA 5HK4A 1EYEA 1G7UA 3WDHA 3TEVA 2E9LA 2FH6A 4TR9A 4S39A 1OT2A 1MW1A 2VNCA 1NWTA 1J0YA 1MNZA 3NQ8A 3CQHA 3UG3A 2YKKA 4HSNA 4EE9A 4GI4A 3R8GA 1OVDA 2WMIA 3BL3A 3GVGA 3UD6A 5A8QA 1KBIA 3IEBA 3NDOA 5FSEC 4MVAA 1CECA 1VFTA 8A3HA 5F2GA 4DBDA 3WD3A 2VFIA 2BB0A 4DM1A 4YTRA 4O52A 3L4ZA 1Q2RA 2DW7A 2WNQA 3MYOA 4GH3A 4U3CA 3QQ1A 1B3XA 1H09A 1U1UA 3JU2A 2NQ5A 3DHFA 3S3GA 3ZIZA 4Z2HA 1MUWA 3STPA 4JTJA 1ZY9A 4DZ5A 4OZOA 4W88A 5HINA 1YDYA 3JS3A 3QVQA 5E1QA 1PBGA 1YXYA 3VGGA 2BY1A 1FFRA 3W7QA 1X96A 3GDRA 5CZJA 5LHFA 4QG6A 5E93A 2DSVA 5G5IA 1PCKA 4MJ2A 2G3IA 4KFOA 1YEYA 1FWTA 2XIIA 3TWAA 2VWSA 4GK8A 3A3WA 4GC4A 3CV7A 1UZ1A 2HDJA 3FV9A 3NM1A 4REQA 3T4WA 2ANUA 3EX2A 3GNPA 1TPUA 1FDZA 1UH3A 3RHGA 2WHKA 1L6YA 1TELA 1QNQA 5CSSA 3W2KA 3HGJA 3MYPA 3GIYA 5KZDA 4O8AA 4B4FA 4H6QA 1AJ0A 4XB3A 2D3LA 3P8JA 2C1HA 3TOYA 3HB9A 3CUIA 2GYIA 2YBTA 2ZICA 1QI2A 4UMBA 3OVQA 3GKFA 4ZVJA 3P67A 1XIBA 4BWLC 1E6ZA 4XQ6A 2QF7A 4DQWA 3FJLA 5D33A 2WXDM 3PZTA 1XFCA 4QTGA 1UR9A 4PUMA 2C15A 4WK9A 4WDWA 4NZ4A 2XIMA 2WM1A 5FF3A 1GVSA 3Q45A 2VFFA 2G37A 4KFNA 5SWUA 4U31A 1K4HA 1QWGA 3AMDA 3KL3A 2FDMA 3UWYA 1T96A 1AL8A 1WKYA 3W74A 3E96A 2G0WA 2XVPA 1XIFA 2CPUA 2E6FA 3EMQA 1VBUA 4UQBA 6XIAA 3VNMA 1EA0A 1Q8JA 3LYEA 3LBCA 4YVVA 4DB7A 3SRKA 1NVMA 3TJXA 3TU9A 1CXLA 1TRIA 1RZMA 4I90A 3EZ4A 2XG9A 3G1SA 4DELA 1QO5A 3I3EA 3B0VC 1T40A 3R8HA 1B3YA 2DIEA 2P8CA 4C6PA 1GG1A 4HA0A 3LCWA 3N73A 4H1ZA 3S6OA 5C71A 3WH9A 1UIOA 5C2XA 3LU2A 1TPVA 1E1CA 4LVAA 3EOLA 3IK4A 1TV7A 1SYTA 3A4JA 2J62A 2OLAA 1HW6A 3VIKA 1ZL1A 1ZJBA 1HJSA 1J2BA 2UY3A 3PG9A 5HAOA 2CLMA 2J7BA 4JYFA 4WHBA 3WFZA 1DXFA 4HNNA 2ZA2A 3THCA 1Q63A 1Q7MA 1Q6CA 2W9MA 3EXTA 3SRHA 2VQUA 3W38A 4NI3A 4U10A 3W87A 2P8BA 2QQ6A 2Q3OA 4B5SA 4K1GA 4S3DA 2BS9A 3QFEA 2HXUA 3VKDA 2VFDA 4NZ1A 3KW3A 4JTQA 3QN3A 3WBYA 2NLYA 3BAKA 4U5KA 5E6YA 3RAOA 1H1NA 4J3SA 3VCCA 3LS9A 4K6AA 4KEVA 1GOQA 3MVIA 5EKYA 1T8QA 3G77A 1ZU8A 1RBLA 1XUUA 2VGFA 3KDNA 1DE6A 3N4AA 4XD3A 3WLTA 4JHOA 3PSWA 3NL2A 5BXTA 3HG5A 5D30A 2V82A 2X2GA 5AECA 3QW4B 4IUGA 1XPYA 3UFYA 4DXVA 4IJRA 1TPB1 3C4UA 3B9NA 4BK9A 4B15A 3L2MA 4YYFA 3TJLA 1G5AA 1Z48A 3O2LA 3E0WA 1UKTA 3IIXA 3PN8A 4GXPA 2Q8LA 4PGLA 2XZ9A 5BROA 4QCEA 1J12A 1YTEA 4H8VA 2OWXA 3MKCA 3VE9A 3AIVA 2IKGA 3R43A 7TIMA 3HPFA 2JIWA 4AWUA 1YMYA 5DT5A 3EBVA 1YPXA 1GYMA 2WWDA 3GVWA 2F84A 2X40A 3CL6A 2CBUA 3OU8A 3W23A 4OIFA 1XRSA 4EXBA 5A8MA 4MF4A 2OODA 4W85A 1OFAA 4GJJA 4L1XA 1ZGDA 1W8SA 4GYJA 3GG7A 1ZCCA 4EIVA 5LNUA 3GXFA 1VEMA 5I02A 3C6CA 3LOTA 3H23A 3UF9A 4ZQNA 1VCGA 5FJOA 1FCQA 3O07A 1RP9A 4JEJA 3CHCA 3VAVA 5HWJA 3KTXA 1GUVA 3URBA 4HNCA 1F05A 1PKLA 4IMGA 4GO9A 2ZKMX 4DJEA 1C7TA 2J78A 4PCNA 1TWZA 1ALDA 3PZMA 1LORA 4L7ZA 2VZUA 4W9TA 4IG2A 4WGHA 1VLIA 4U2YA 3WQ4A 5D04C 3GBEA 4JX4A 4S3KA 3T0AA 1CLKA 3VOIA 3WBXA 4JCLA 1O68A 3WMBA 1G4EA 3UXAA 2WV8A 1M68A 4ICNA 1VEPA 1TV2A 1VS1A 4HVXA 4LEFA 4AQLA 2Z4GA 1TJ2A 1N8IA 3TYCA 2GQ3A 3U5UA 5DFAA 3FA3A 3DU0A 5TQLA 3W6MA 4DO5A 3RUBL 4MADA 5F1VA 3TQKA 2JBMA 3VMOA 3WSUA 4REQB 4PN2A 5HNRA 3VK5A 3RLVA 4B3ZA 1MQPA 4S2BA 1IQ8A 4W7WA 2DT1A 3CZ8A 1EO5A 4QSHA 4NZ5A 4A3UA 3S1WA 1UWSA 3PZVA 3WJYA 3ARPA 5C2GA 1CXEA 4MSSA 3MUAA 3ABRA 2DU2A 3PP7A 1OD8A 1SMDA 1E3XA 3SGGA 5D37A 2OLSA 3EDEA 3GC4A 1IWBA 3F4DA 4ZENA 4K39A 2CLPA 4O1AA 3AYSA 4R7JA 3BW3A 2CETA 3WDJA 2WWCA 3WQVA 4IL2A 3AMKA 2DY3A 1F8MA 3E9AA 4PUUA 1KCLA 3ITLA 2QJJA 4M80A 5I3DA 1Z9AA 4C6BA 4W5ZA 1V6VA 3ENLA 5E0FA 3C5QA 3OGRA 3LMYA 5LA1A 4PTVA 3UJRA 2QUTA 3UP8A 4YHEA 2QMKA 8TIMA 1W56A 1QPKA 2CYGA 4RL3A 3N9SA 4FF5A 1R2SA 4NVTA 1S46A 1HX0A 2Z6JA 4N9BA 2R1MA 1EGMA 4LPCA 3TTEA 2GVGA 3HFYA 2V9DA 4MFEA 1J2WA 2X7VA 1UHVA 3AXKA 3WN6A 2NSXA 4B9YA 4UWMA 4Q8MA 4MDPA 1HF6A 2IQDA 3W7JA 1S39A 4LSBA 4PMUA 2KZHA 5HWMA 1UUQA 4MGGA 4LY4A 2QGHA 2F8QA 3R1ZA 2J24A 4DIAA 3SCTA 2FFCA 1FP9A 3URNA 1CXHA 1PKMA 3AZSA 1ZNNA 3M64A 1YBQA 1WDPA 1E1CB 3I6RA 2D2OA 4YCPA 2NV1A 3PANA 1AH0A 4NJIA 3S2CA 4E3VA 1E56A 4ZXLA 3W7RA 2B7QA 2NVCA 3G18A 2OEKA 3B06A 2ZCGA 3T0CA 2NXIA 2XVGA 4TIMA 1DJGA 4O1FA 1TUFA 4DF1A 2DZUA 2DZBA 4X61A 1D3HA 5BNKA 4Z2LA 3UNTA 4F2TA 3DFSA 4RNFA 2ZVRA 3U5YA 3NPUA 4PRRA 1E0TA 3HPAA 9CGTA 1TWIA 3AALA 1EL3A 3FHQA 1J8VA 5FEXA 1TJ1A 1ITXA 4UFLA 3WL0A 4JTIA 5BRBA 2C8NA 1IGWA 1GQNA 1QPOA 3MSGA 3RPMA 4GWEA 2Q71A 2YDAA 1BKHA 1DBTA 2FIQA 4R85A 4BQ2A 3MQTA 2GGEA 2XH2A 1HN1A 5I03A 3JVAA 2UY4A 3F03K 3OVPA 3OBEA 2BXVA 4IMCA 1EXPA 2H8ZA 3GD6A 2Q09A 3WQ6A 1E5JA 1YW1A 1A53A 3IVTA 4QS5A 3TDFA 4A35A 2JFEX 1PWLA 5F4WA 1IIGA 4GKTA 4MY8A 2WOQA 1QAPA 1ZUAX 4O4VA 2QJMA 1F2JA 4CQAA 4LQ1A 1Z3NA 4P2VA 4Y9NA 1SVDA 1HTIA 3BLFA 4FLRA 5FF0A 5LIYX 3VIIA 1MQQA 4CQBA 4LYQA 4DWSC 4B91A 2V3EA 1HNYA 1L9WA 4XUGA 1SR9A 5G2IA 2XSBA 4L9XA 2VR4A 4D6EA 3AIWA 3PR2A 1JRCA 3ZT5A 1O1ZA 4BF7A 1NSJA 3OBAA 4D2JA 4R34A 2YGYA 2JK2A 4JNMA 3S9YA 2YDRA 4CQDA 1W5PA 2ACQA 1W3NA 5A6TC 2HE5A 1S3TC 4UQAA 1R9XA 2WLZA 3SADA 2BGQA 1I2OA 2VX6A 4HOWA 1ZTVA 1OBAA 1OYCA 4JNYA 2ZQ0A 3UGVA 4IG2B 4CNPA 1GEHA 2VRQA 2E5CA 1TV8A 5D02A 1POKA 2BFGA 4GY0A 3KRZA 3SCOA 4BQ4A 1UD2A 5REQA 3LPGA 3SUUA 1RCXB 1QASA 2B0MA 2ZE0A 1KGWA 2P53A 2YX0A 4GYKA 2R91A 5A8NA 5TBOA 4C7GA 5D2TA 2G3JA 3F4VA 3JR2A 2X8RA 2VC7A 3ZVIA 2VUYA 3TXVA 1WX0A 5I3JA 4MPQA 2GZXA 3NWRA 2V38A 1L8NA 2EPKX 4Q4RA 4QSFA 4AIOA 4CD8A 3WUFA 3UXLA 1MUMA 2CERA 3M0VA 4XZIA 3JUGA 1JRBA 2WPBA 3N6JA 3ZS4A 4JTDA 4BKNA 4S3BA 1KWKA 1X7IA 3E5BA 2P0OA 5HMFA 3S46A 3T78A 5DY2A 4A29A 1FRBA 1LUCA 4AF0A 3UXKA 4OT7A 1IXNA 2R9RA 1JD9A 4C6MA 3BCDA 3NQ7A 2CZVA 3WFLA 3LK6A 4CUCA 3GNNA 4MJMA 1IZJA 5A8PA 3V18A 3BVJA 4QXIA 4GY1A 4FMVA 4AD0A 2J66A 3A5VA 2Z28A 1Z89A 2AAMA 2WVTA 1MXSA 2QR6A 2HK0A