2BWGA

Structure of human guanosine monophosphate reductase gmpr1 in complex with gmp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
337
structure length
335
Chain Sequence
PRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP REDUCTASE I
publication title Structure of Human Guanosine Monophosphate Reductase Gmpr1 in Complex with Gmp
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 114
structure length 335
sequence length 337
chains with identical sequence B, C, D
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bwgA00
3FFSA 2WQPA 2PRHA 1TMHA 1IIHA 1KM2A 3NQVA 5K9DA 3P82A 1ADOA 4C1KA 1P4CA 4WZHA 1L6YA 3MW7A 1VCVA 3CWNA 4RXFA 1OX6A 4GWEA 4JTJA 1VHNA 1GYNA 4S2BA 4N9BA 3R5EA 3JS3A 3S42A 4H6KA 4FX6M 1OX5A 3D0CA 4OE7A 3M5YA 4PTNA 3W2UA 2A2IA 1FDJA 1VRDA 3MUXA 1I2NA 2BSLA 1M7PA 4JTGA 3VCRA 4RCXA 4ORMA 4MUZA 1ZHAA 5U7SA 4JTFA 3TK7A 4UTWA 3G3DA 3RLVA 1XDLA 2ATMA 5K9XA 3DFNA 3UD6A 1YYAA 1FWSA 1N55A 2Z0IA 2BZNA 1ME9A 1FCQA 2RKXA 1DORA 2C6QA 3SY5A 4LC8A 3WK2A 4IMDA 5BMXA 1G67A 2C15A 4UUIA 3EWYA 1H63A 2J9ZA 3TW6A 5AHFA 3TJLA 1VLWA 4OWGA 5DELA 3BLIA 4FNSA 3LHTA 4MLJA 3DBPA 3WFAA 3EEGA 4CNPA 4MYAA 1FQ0A 5G4EA 3WJXA 3UWQA 1LOLA 1H61A 2EF9A 4LOCA 3W7QA 1YDOA 3LOTA 1PVNA 1VGAA 5I3FA 1T96A 3T78A 1GVSA 3C52A 1XBZA 3I6RA 3KVKA 1UASA 5D04C 4UTLA 1F6PA 3M5ZA 5D09A 2VENA 5F4XA 3TUUA 3EWBX 3W85A 3ZFHA 1MEWA 1U5JA 4Q32A 3LHWA 3N34A 4BK9A 1TPFA 4AEOA 2P10A 5DXXA 1FDYA 1ZCOA 4EF9A 2QAFA 5LNSA 2PRLA 5D2XA 2D73A 2CLOA 4ZQRA 2H8XA 3L5AA 1KV5A 1A5BA 4XKYA 4CNOA 2CFFA 3K30A 4E2BA 3MYOA 2C3ZA 3IVUA 4YMZA 2R91A 4UFIA 4WY0B 5KZEA 1FWTA 2YW4A 3GLCA 3BK0A 5AHMA 2A7RA 3TH6A 3ELFA 4TO8A 3C56A 3RK8A 1OFRA 4K8EA 2YSWA 1L6WA 5K4ZA 1GZGA 4LWWA 2WO5A 3OBKA 3RMJA 1TPWA 3PG8A 1V5XA 2G5WA 2VEPA 3MHFA 3PUDA 1LORA 1EEPA 4QISA 4HNVA 3PM6A 1K7EA 1TB3A 4LW7A 4XBSA 5EL1A 4UTKA 2QUTA 2VELA 1X8FA 1RR2A 1LTDA 4U4MA 2GVLA 3IEBA 1I2RA 4DPPA 3W23A 1VHCA 4UTUA 4FX8A 4YLWA 4BI7A 3KAOA 2X16A 1JRBA 4LT9A 3W83A 3DGRA 3F4NA 3H54A 1QAPA 5FEWA 4E0CA 5DN1A 3SSJA 3LCLA 4ZQCA 4MJMA 1OABA 3F03K 3L0KA 5F2GA 4Z08A 3UZ5A 4DXVA 1EX5A 2F84A 1YTKA 1KFLA 1J5TA 3ANYA 3UWUA 3QSRA 3QZEA 4AWSA 2X1UA 1FWWA 3MWAA 3G1HA 1OYCA 2W6RA 2GJNA 2WKJA 3OG3A 2CZFA 2CW6A 4AHOA 2RFGA 2YX0A 1SW0A 1I2PA 1XBVA 1W1ZA 5FF7A 1GG0A 1GT8A 1ZY9A 3LHZA 1WA3A 1BKSA 1IIGA 5TIMA 3E02A 3QM3A 1IXPA 1QOPA 3G18A 3NQEA 4WQ6A 3S9YA 3O16A 2Y7GA 4M7SA 1R2RA 1OK6A 3NQFA 1TYGA 4O1DA 3PY2A 1P0NA 2DZUA 3UPBA 3C8FA 3MMTA 3QSTA 4O4WA 4O15A 3UYCA 3BGJA 3QYQA 3SGUA 3FKRA 2QCEA 2ZA1A 3RU6A 3HPSA 3MI6A 4LVAA 5F2MA 3P7YA 5I3IA 1MXSA 2CLKA 3FOKA 2I9EA 3GKAA 4FEZA 4OV9A 3HBLA 3BW2A 2XN1A 4IQLA 4JDYA 4BF9A 4O10A 1ZAIA 4RZ5A 2VXNA 4UFLA 3PBWA 3U8GA 3M1ZA 4QNWA 2NUWA 5C55A 2HTMA 3LBCA 5CZ0A 1B4KA 4UMCA 5EPDA 3W7GA 1K03A 2Q8ZA 4DEFA 5G2HA 5LNVA 4JEQA 3S5YA 2C13A 3ABSA 2XN0A 4MY8A 4DO6A 3W7IA 3LHYA 2E68A 5AN7A 3HG4A 3QC3A 2CLHA 3LTPA 4LUIA 1TQJA 3UZJA 1SU5A 2I14A 3UNDA 2QUUA 5HWJA 2ZRUA 5AC6A 1MSSA 3W71A 3O1NA 3NQ8A 3KRUA 3W9ZA 2ZZ3A 5HINA 3HMJG 3EXSA 3FYPA 3KFTA 3BARA 3NPWA 3HPXA 3LRLA 1B3OA 2AQWA 3P81A 3PB0A 2NUYA 3VNDA 1JCYA 4N2YA 1GPWA 3EX6A 1XKYA 4ZMGA 4POCA 2EPHA 3A9IA 3DFQA 3WJZA 4XQ6A 4TR9A 3O07A 3W7JA 5FF0A 1BWLA 1TRIA 5EY5A 1TV7A 3NEVA 1EIXA 4MZ1A 2QF7A 5E93A 1JR1A 3NXFA 1AG1O 4O53A 4IMCA 3KXQA 3O6YX 1TTPA 3BG3A 4HHPA 1JULA 1SO5A 5D32A 3NA8A 1KLYA 1D9EA 1K8YA 1SZNA 1N7KA 4ZQPA 3NOEA 3NPUA 3W1NA 1M7OA 5L6UA 3HG3A 1Q6QA 5KSWA 3NZRA 5LGZA 3EKZA 4UTTC 1S5VA 1JUKA 1EUNA 1DQWA 4AMAA 2DZVA 5G1YA 3STFA 4B5NA 5BRBA 1QNVA 3G22A 3HPZA 5C6MA 3NQCA 4M7TA 1OFBA 2B7NA 3HG5A 3W74A 3M7WA 5H2ZA 1YXYA 3L0NA 4FNRA 4JICA 4IPIA 2NXIA 3MP4A 3GDLA 1VLIA 5AHIA 2QJHA 3GAKA 6ALDA 1OFAA 3NZ1A 1G4PA 3ABOA 2AAMA 5KMYA 1EB3A 1ME7A 3MO7A 1W5PA 4ZQMA 1YTEA 2QR6A 4MY9A 4BWLA 3CHVA 3HQ1A 1JCXA 2Y7EA 3GAYA 3OIXA 1TSIA 3BW4A 4WJEA 2NZLA 2YYUA 3ZR4A 3UQNA 3DENA 3B0PA 1W5MA 5CSRA 1LYXA 1OK4A 1AL8A 1FWNA 1SFLA 2HMCA 2QCDB 3BGGA 4NX0A 1SSDA 1U83A 3W7LA 3W86A 5F2LA 3C61A 4GUHA 4Z1CA 1SO6A 4P2VA 3G1YA 3Q58A 4GUIA 4UTTA 5HQEA 1R30A 1W54A 1LP6A 3IVTA 5AHLA 5DXYA 4QM1A 2NWSA 3LI1A 3HGSA 3GDKA 1KM4A 3BVJA 2ISVA 1D3HA 4NT0A 2ZDRA 3B4UA 3C4UA 1HG3A 1XM3A 3HG2A 2ZYFA 2V5BA 4OU1A 3SIZA 1XBXA 3DFTA 3CT7A 5BNKA 1HL2A 2ZTJA 4DO5A 3TU9A 2DZTA 2JKPA 3LDVA 3G1FA 3PSWA 4UMBA 5J5DA 3NL6A 2ZA2A 4WY0A 4O0KA 5DY2A 3L5MA 1KM5A 3W6YA 3W1RA 3W7PA 1TQXA 1GTHA 1LBFA 3HGRA 4LRSA 4N4PA 3W7HA 4O18A 1LLZA 2QUVA 4LC6A 4AF0A 1Q3NA 2ZRYA 3T40A 5K7JA 2V0TA 1F05A 3KRSA 4EWND 1H1YA 2DZPA 3FA5A 4LVGA 1MZHA 5LKYA 1KM1A 2GVGA 3R2GA 4UR8A 3SR7A 3UXDA 3VFLA 5CPOA 3PR2A 1I45A 1LBMA 1PS9A 4IOTA 2RDUA 4HKPA 2NV2A 2OZ0A 2QCMA 4MZYA 3BG5A 1KBIA 1F6KA 2VOMA 4UTJA 2W0UA 3LXBA 3NR0A 2OJPA 5BMWA 3NM3A 1EP2A 3SI9A 4GXMA 1UJPA 3G8RA 1G4SA 5IM51 1N8FA 1SZGA 4UR7A 2WJZA 3MP3A 3SW6A 4PL1A 4ADSA 1A5SA 5K9CA 2FIQA 1H60A 2C0AA 3C2VA 3SFKA 2P0OA 3L9CA 4JTKA 5HNRA 3LLDA 1QOQA 3W1TA 3TQKA 1JUBA 5LNRA 3LCXA 2J9YA 2X1SA 2YYTA 3NDOA 1ZALA 1PHWA 1THFD 3TX9A 1SR9A 1ALDA 2Q3RA 1FX6A 5D2WA 3QMRA 4QNEA 2DJLA 1G69A 3L67A 4JN6A 1Q6RA 3STGA 3R8RA 1KTNA 1H7PA 1Q6LA 5F1VA 3KRZA 4N6EA 2ATSA 4K8HA 1W0MA 4ZQOA 5LNWA 1XDMA 4IPJA 4AWUA 1W37A 1TPH1 3OEXA 3QFEA 3B06A 3FEMA 2EGZA 1QO5A 1YXCA 5LHFA 3GDTA 5CPLA 2E5BA 1RV8A 3I7RA 5CGQA 2GQ8A 5CPMA 4JYEA 2B0MA 2CU0A 3QPZA 4N4QA 2YGYA 4N02A 2YZRA 2TMDA 4R7JA 3VKJA 3PUEA 4IXXA 3MHGA 3WJSA 4LUJA 4OGZA 2Y7FA 4N9EA 1VYRA 1ONRA 4EF8A 3KVLA 1OYBA 4ALDA 4XUGA 1KTBA 2ISSA 1YLVA 2BLEA 2C19A 2VFEA 4NU7A 3YPIA 3TAKA 4MZ8A 4GNJA 2WNNA 1ML1A 1TTQA 4JX4A 1Y0EA 3GIYA 1DBTA 1WX0A 1FXPA 3PS7A 3A5VA 3M0ZA 3LB0A 2Y62A 2NXHA 3LM7A 4PCFA 4TMBA 5K2ZA 3LRMA 1EUAA 3M5VA 5ABTA 3E12A 2QCFA 2Z6IA 2WNZA 4HSNA 1DV7A 2Y89A 5KTLA 4FO4A 4K38A 5TQLA 4O12A 3FIGA 3WJWA 4JTTA 2OT0A 1TV8A 4O50A 1DJQA 1WBJA 2CLEA 3NL3A 2DJXA 3HGJA 4DELA 3M47A 1RD5A 2ZTKA 5C5YA 1UUOA 5HR7A 3A22A 3PAJA 5F2IA 4M6QA 1SPQA 4JY8A 3B0UX 3DZ1A 4Q33A 4QJ1A 1TJPA 2ZCGA 2NWRA 3NQ7A 1TIMA 1PE1A 3O6CA 4QQ3A 4O19A 3M43A 1O95A 1DOSA 2AGKA 2ISWA 3T7VA 2E5DA 5G1TA 2VEKA 3NNTA 2VFGA 3GKFA 3N14A 2R14A 5CZSA 3S5ZA 3G1DA 4AXKA 1RQHA 5LHEA 1NAL1 3PSVA 3TW7A 4LV4A 3G8EA 3EKLA 1EP3A 4NJGA 3T55A 5HUPA 3DKLA 1SSGA 4AF0B 2FB3A 1PHQA 3GVGA 1L6SA 3W84A 3NAVA 3DHFA 2GQAA 3AJXA 1KLZA 1JRCA 1LOSA 3BV4A 4GC4A 4NZFA 3C6CA 1JCNA 3INPA 3PWAA 1SO3A 1FUYA 4FIQA 4IWWA 3WK1A 3PUOA 3M16A 2PCQA 1J2WA 4NVTA 1K7XA 5FESA 3GDRA 1C9DA 3G0XA 3W7EA 1DL3A 1X7FA 3LCGA 5L9FA 3EX1A 1BTMA 1HO4A 3C3NA 1OVDA 3I7QA 1T99A 1NF0A 2PRMA 3Q94A 3DAQA 1KM6A 2QCDA 3HJZA 1F7BA 3EX3A 4KFPA 4QIUA 3C2EA 1R46A 1JUEA 4BI5A 2V9DA 2GJLA 2WSRA 4S2CA 3QQ1A 1QPQA 4JTIA 3BW3A 2OMAA 4WY0F 3EWZA 5FI8A 4K37A 2WV8A 5AOUA 3E96A 5DY3A 1FBAA 1YXDA 1VPXA 3GR7A 2B4GA 1F74A 2JKEA 2ZQ0A 3I68A 5F1UA 1KTCA 1PCWA 1ZAHA 1ICSA 1YPFA 1B4EA 4HNTA 3NQMA 3JR2A 3IIXA 1XFBA 4Z1DA 3N2MA 4FX7A 1H50A 3QMTA 3C2RA 1IXQA 3MBDA 1O94A 3P80A 1KFJA 1P5BA 1R47A 3M6YA 4G1KA 1W56A 4A29A 2ZZ5A 1DKWA 1TTJA 5K4XA 1ME8A 3DFPA 3PVFA 1AW1A 5DCBA 1XXXA 3AO0A 5KINA 2VFDA 3NVTA 3EXTA 1G4TA 3TROA 1L9WA 5A5WA 4UFHA 5FEPA 4JR5A 3W1AA 3P60A 1TREA 1IXOA 5CKSA 4AB4A 3MHUA 2A5HA 5D2YA 4AHQA 3W76A 3MYPA 5EYWA 5CZTA 1GJPA 4HT3A 3TQ0A 4CQ9A 1T0OA 3GXTA 3QRHA 4LS0A 4O57A 3IIZA 1YADA 5FF3A 3HIJA 1WXJA 2Q3OA 3NQ6A 1TPDA 1UUMA 2GUUA 2X1RA 3HGOA 3TR2A 4Y9AA 4PFMA 1WBHA 1KA9F 3BO9A 3HF3A 2FPYA 1Z44A 4UFKA 1Z48A 4RZ4A 2WSQA 3S5OA 4ZL1A 5C54A 4UTIA 3FYOA 1TPEA 1JJKA 2V8ZA 1O4UA 4O17A 3GX9A 3NQ2A 4W9TA 3ZWSA 1O5XA 2Q8LA 3PB2A 4CNNA 1L2UA 5TBOA 2FFCA 2J6XA 3STCA 5IBXC 3TIMA 2X30A 2Y7DA 4KFNA 5CG7A 4FB7A 1OG0A 1EWEA 2JGQA 4XTDA 1PIIA 4NNCA 3S6DA 4JNMA 3KHJA 4H3DA 3TAOA 2CLIA 1LBLA 3W1MA 4O14A 1VQTA 4M19A 2NX3A 3CB8A 4TIMA 2ABBA 2DP3A 2JK2A 1Q6OA 1KFCA 2YR1A 6TIMA 3S1WA 3ABQA 4CCEA 1WDWA 1FCUA 3TC7A 3LCHA 3IGUA 3TMLA 3L68A 1NVMA 2JBMA 3TXZA 3LLFA 4JX5A 2FQIA 1H5YA 4HIBA 4ORIA 2A85A 3ZWTA 3CTLA 2PE4A 3IRDA 3SJ3A 4H4IA 2CLMA 2F7FA 1VJIA 1H7XA 1NF7A 2G97A 2Z6JA 4GBUA 2H6RA 4FIRA 3BG9A 4LS2A 4YL2A 3RLUA 1WV2A 1WYIA 4LS1A 4ADUA 1GWJA 2ABAA 4ICNA 3S5NA 1S5TA 4LVBA 2Y61A 3QW4B 2H8ZA 4MY1A 4JTLA 4PEKA 4LV9A 2V81A 3TJXA 1EWDA 1YDVA 3S1VA 3P5ZA 4GRSA 2VKZG 1MO0A 3W2KA 2ZRWA 2FPTA 1W5NA 3W7MA 4OHQA 4LRTA 2BTMA 1F76A 1GQNA 3ATYA 4LY8A 4ZZ9A 3L65A 1Q45A 2IQTA 2E6DA 1EP1A 1UB3A 1YDNA 3DU0A 3IIOA 5I3JA 1LDCA 2YDAA 1HFBA 2ZRXA 3DHDA 3TKFA 5LGXA 3W3OA 1WAUA 3EWUA 4JTEA 4DQWA 3G1XA 3FKKA 2GOUA 2ALDA 1TO3A 3E0IA 1ZFJA 5FEXA 4NJKA 4WXYA 1AW5A 4E38A 3P84A 3EX2A 3PG9A 4FNQA 3MBFA 2QJGA 1KM0A 2NXGA 4WXZA 3T44A 4ZQNA 4NNAA 3ZS4A 3U2OA 1K02A 5D03A 3DFOA 2NUXA 1QWGA 2UV8G 4CCDA 1XUZA 1CX9A 1W3IA 3QEZA 4JYFA 3L21A 3N9RA 1GEQA 1OF6A 3A21A 2ZRZA 1RZMA 1SUXA 3RF9A 4AVFA 5J5RA 2P1FA 3B8DA 2XFWA 3GB6A 4ZVJA 4A2RA 1M6JA 4IMFA 1X6UA 5AYYA 3EWXA 4JTUA 3W7KA 4I7VA 2G96A 1NFBA 2A7PA 4JTSA 1LM1A 1XUUA 1H7OA 5K3VA 1A5CA 2ZFAA 3THQA 3W7CA 1VCGA 1P1XA 4HNNA 4Z1BA 4OQVA 2TPSA 4HSOA 4HNUA 3W1UA 5EBUA 2EHHA 2PC4A 1AK5A 2BXVA 3LHVA 3L5LA 3P8JA 3S1UA 4O1CA 2ZBTA 4Z0SA 1AMKA 2QCLA 5D05A 1O60A 1E51A 1H7WA 3NL5A 3UWYA 5E1QA 4TMCA 4XWUA 1LLWA 4A2SA 1OX4A 4N9DA 4CLMA 1F73A 1Z41A 5SWUA 1X1ZA 4IX0A 4K36A 2ZA3A 1TPB1 4X22A 4ONVA 1JCMP 1PCKA 3TC6A 2E5CA 1PV8A 4FNPA 1RVGA 1LOQA 4O28A 4FXSA 5I3HA 1OFEA 1OFOA 1GYLA 5C2XA 1A53A 1OFPA 3EWWA 1R2SA 2E6YA 1WOAA 2H90A 4M6VA 4I9AA 5D33A 5I3GA 3W7DA 2DZXA 4GJ1A 4RR4A 3CWOX 3CC1A 5HUOA 2CLLA 3G1AA 4FNUA 1LRNA 2VEIA 3G0SA 1XCFA 2VC6A 3W1LA 1GVQA 3GYEA 2C14A 4NJIA 3NQGA 4UXDA 1QR7A 4R33A 2E77A 2QDGA 4OT7A 4FHAA 1VS1A 4PC8A 3NO5A 2G95A 1ZENA 2Y70A 4A21A 2EAWA 5EKYA 4MFEA 4UCGA 1DHPA 4EVZA 1GVRA 2FLIA 5CSSA 1TPVA 1OFQA 4IUOA 3GR8A 2QCNA 1GTEA 4WOQA 1OF8A 2NX9A 3W7RA 2FPVA 2CWNA 2VFFA 3WK3A 4GE8A 3P74A 4N9CA 4JYDA 4O13A 4IMEA 2A7NA 2J24A 5EMUA 1PL9A 1IF2A 1HTIA 2QCHA 3P67A 2BWGA 3NM1A 3N73A 4RJEA 5U4NA 1TPC1 2DORA 3CLMA 4MVAA 4DPQA 1B57A 3JRKA 3G3MA 4WOZA 2B7QA 4K7YA 3UPWA 4IXHA 1A50A 4YXGA 1SZFA 1HUVA 1I2QA 3NGJA 4DF2A 3TFXA 3B03A 4EIVA 1F5ZA 1K8XA 3TSDA 1QFEA 1FWRA 5CPNA 2QCCA 3P62A 2XN2A 4ML9A 3LI0A 2V82A 3N9SA 1FCBA 3G1VA 5I3KA 2VEMA 1OJXA 4MOZA 4M5PA 2YFNA 1AL7A 4Y8FA 3RFAA 2J27A 4A22A 1C29A 2C1HA 2OCZA 3W87A 2V5LA 3IGSA 5G4WA 1JQVA 5G5IA 4DF1A 2J88A 3QJAA 1SFJA 4O1BA 3IIPA 1VH7A 4UNKA 4FXRA 3S8HA 4YCOA 2RHGA 5D02A 1W3NA 1TRDA 2CZDA 1NSJA 4K6AA 3PBUA 1I8JA 4RK8A 2DZWA 1RPXA 3LCWA 1LCOA 3E9AA 2ZZ7A 3W70A 2Y63A 5AYZA 3UWZA 2V2DA 3M5XA 4JX6A 2FTPA 4I7UA 4NXKA 1R2TA 3O8AA 5G2IA 2RH9A 3V1PA 5FF2A 2DZSA 3W07A 2H3BA 5FEZA 5HMSA 4CQAA 4Y6GA 3GDMA 4J9JA 3TSMA 3C0JA 5D37A 3DFSA 2E1DA 2A4AA 1JCLA 1FXQA 3DI1A 4UC5A 3SGZA 4LVDA 1H7NA 3QH2A 4XTIA 4O54A 3W72A 1LRTA 4YCPA 1TJRA 4Y90A 5D38A 2QDHA 1OX4B 3C2FA 2E6FA 4MKNA 3KVJA 4JY9A 4I7WA 2O7SA 2JKAA 3LERA 2QKFA 1OHLA 4NX5A 4O11A 5AFDA 2GVJA 3CPRA 1DVJA 2V30A 2YW3A 4O4VA 4X9SA 4AAJA 4UFMA 3L2IA 4XBKA 3N2XA 4IGHA 2VFIA 3HB9A 4OBTA 4GFSA 2R8WA 1T8XA 3EXRA 1LZOA 2JGYA 1FDZA 4R34A 2C16A 1W5QA 3U6WA 3W1PA 3LTSA 3PC0A 3W7OA 1UCWA 1KFEA 3B05A 2RDWA 2ZZ4A 3PBYA 4HN4A 4E2DA 3BPWA 4XZ9A 2RDTA 3VI2A 5AHNA 2E09A 3OA3A 3L66A 3EB2A 1D3GA 4HPXA 5AC7A 1MEHA 2GQ9A 3KOFA 4UTHA 2ZRVA 4KFOA 4R53A 1XL9A 3FJ6A 3A24A 3Q37A 3THAA 1P0KA 3SZ8A 4DBDA 2YXGA 4LVFA 3O6DA 1W5OA 1SW3A 4UNLA 3CQ0A 3HOJA 1C8VA 1VYSX 3QW3A 3NQDA 3F4WA 4Y96A 3G0UA 1QCWA 3G24A 2CZ5A 4UMAA 2W79A 4X2RA 4D2JA 1YTDA 1FCVA 5HWMA 4JIQA 4IJBA 4PL2A 3TNOA 1CW2A 2TYSA 1GVFA 4M6PA 1BWKA 2WPBA 1UBSA 4C1LA 3DXIA 4MPQA 3LXAA 4MIMA 3M44A 1ICPA 4AH7A 1TV5A 1DJNA 4K39A 3DH7A 3WK0A 1VC4A 3IV3A 3TQVA 2YFOA 3ATZA 3CIXA 4KWWA 1XC4A 2CLFA 3TV8A 1SQ7A 1G6CA 2HS8A 3IGXA 4O16A 1OYAA 4GUGA 4O0ZA 2PURA 3TE9A 3LRKA 3PULA 1VR6A 5F4WA 3LXCA 3OHIA 4PA8A 3M9YA 5EA9A 1VCFA 1KFBA 1RQEA 3UY8A 3QF0A 2I1OA 2HS6A 3PF3A 5AC8A 3MJYA 3KX6A 3BLEA 1G4EA 1QPOA 4BWLC 2Y85A 1CI1A 4CCCA 3LHUA 3O15A 3P5YA 1VYPX 3KVMA 3NPVA 3S1XA 4NUWA 5KITA 1SW7A 1GG1A 5FF4A 3DI0A 3GXPA 3STEA 2B7PA 2FDSA 2FJKA 4QITA 4JD4A 4AWTA 3R12A 3G1SA 5DCEA 3USBA 4BI6A 1RQBA 1W3TA 2E6AA 4WD0A 3CIWA 4NNBA 1JQXA 1TTIA 4DF0A 5KZDA 1O5KA 5F4SA 1LROA 2A6LA 3Q2DA 3TA6A 3W1QA 4DBEA 5AYXA 1IXNA 3O63A 3LCFA 4TU1A 3L0GA 4QAIA 2Y6ZA 5KZMA 3UXAA 1YPIA 4XKYB 2J9XA 1EA0A 3GXNA 4KKXA 4O52A 2Y88A 4JDBA 3LCIA 4JXCA 1QMLA 5IBXA 2X1TA 3A23A 5HJLA 5LSMA 2NX1A 3R89A 1S3HA 4RZ6A 3OVRA 4UTMA 3CU2A 3E49A 4MFDA 3CEPA 3C2OA 1WOBA 3NPXA 4OV4A 2O7QA 3VE9A 2WNQA 3GNDA 1FY6A 1KM3A 2X2GA 2FB2A 3QQ0A 3GNNA 5MHBA 4O8RA 3TXVA 2ZZ1A 5LZLA 3UY7A 1SZEA 4Z1AA 3LX9A 4YWIA 3NYZA 1K7FA 2QEZA 3NL2A 4NZJA 2CZEA 4AHPA 4DO4A 2LLEA 2WOQA 5D2VA 4TX9A 5DBTA 7TIMA 4K7VA 3CEUA 2BX7A 3N19B 3S0CA 3H53A 3LGEA 2GPTA 4JGDA 2DU2A 2EKCA 1ZJIA 1B9BA 1MEIA 3OVQA 4N6FA 4WUIA 4MJZA 4CQ8A 5AHEA 3DKJA 4GUFA 5D2TA 5T26A 3OVPA 3HO8A 1X1OA 4L4LA 3PBVA 4ADTA 1BEUA 3O05A 3UWVA 3I65A 3UWWA 1ZAJA 3I7SA 3QMSA 3W73A 4MYXA 3W2MA 4Z0JA 3V75A 5BW6A 1J4EA 1XBYA 1WQ5A 3R13A 1S5WA 2Z1BA 5DCDA 3TDFA 3FS2A 3LTYA 2R94A 1TPUA 4UFJA 3B0VC 3NG3A 3W22A 3IVSA 3CM4A 1G7UA 1DQXA 1H1ZA 3EX4A 2V2HA 1QO2A 4S1FA 4MLRA 3M41A 5HWNA 3W75A 1QPNA 1GOXA 5HR6A 2A6NA 4P61A 3H55A 3MI2A 3MP5A 4U28A 3TSBA 3O06A 1Z42A 2YPIA 1KW1A 4RLIA 4QSHA 1I2OA 5BOOA 2QJIA 4GUJA 1TCDA 3W1XA 5AB3A 1QPRA 5G2WA 2QCGA 3B04A 2QAPA 4BR1A 4Q4KA 2HSAA 5D30A 3P8IA 2TRSA 1NEYA 2B7OA 5E0KA 1K3UA 3TFCA 4NQ1A 1JVNA 3GZ3A 2KZHA 3T4CA 2TSYA 1H7RA 1KBJA 3QPYA 4FF7A 4RX0A 2YCEA 2C18A 3FLUA 1M5WA 1XI3A 1K8ZA 2A21A 1H51A 3VE7A 1V7YA 2OT1A 3RNDA 4HPJA 3TCEA 3W88A 4BFAA 1I4NA 5A8GA 5HULA 3LV5A 1OFDA 3LV6A 1GVOA 3W7NA 2A0NA 4UIOA 4O1AA 4JTHA 4EOUA 4IMGA 1HO1A 1KV8A 4FNTA 4X3ZA 1LRQA 1H62A 2ZZ2A 2H3DA 4LTSA 2V2CA 4KWVA 4RV8A 2VFHA 3W2NA 1IGSA 4RXGA 3NQAA 5H91A 4PODA 3IIVA 1EPXA 1AW2A 8TIMA 3LBMA 4LNYA 1F2JA 4WX2A 4NJHA 1SO4A 4UTWC 1A5AA 2ZZ6A 2Z2UA 4A3UA 4IX2A 3ABRA 1ZNNA 3N3MA 1KFKA 2NLIA 4JIPA 5DBUA 5GVJA 2WSYA 3W2JA 1QDSA 3FJLA 5DLCA 4NXSA 5LNUA 3TMQA 4LU0A 3A5FA 5CZJA 2OX1A 1JCJA 4RKAA 1VZWA 4JS3A 1W8SA 3WJYA 4L4MA 4PH6A 3MI3A 3GK0A 2A1YA 3BLFA 1ICQA 3W2LA 3P61A 1W31A 4NJJA 2NV1A 1G7VA 3F1QA 3SECA
chains in the Genus database with same CATH superfamily
3FFSA 1EHNA 2PRHA 2WQPA 1KM2A 1HVQA 3K46A 3MB9A 5ECVA 4WZHA 1OX6A 2OSXA 3WUFA 3VIOA 1XIFA 1G0CA 2DT1A 1M41A 1OX5A 3D0CA 3TOPA 3WUGA 3M5YA 4PTNA 1BTCA 1FDJA 3A4WA 4S39A 4JTGA 4RCXA 1LUCB 3A6OA 3UEQA 3TK7A 3RLVA 1XDLA 2ATMA 4AIEA 5I5RA 3CT2A 3ABZA 3LEPA 3ALFA 4Q4RA 3Q65A 2BZNA 3ZT6A 2RKXA 3QHMA 5AECA 1QJWA 3BUVA 3BSGA 3E2RA 2QW5A 2HXUA 5D9OA 2GWNA 3TW6A 4B3LA 1VLWA 2ZVIA 4OWGA 3ZVHA 3BLIA 4FNSA 3WJXA 4ERGA 1NWUA 1LOLA 1J2BA 1OGGA 4F0LA 1YPXA 1LL6A 4U33A 1T96A 3WLPA 1IEIA 3I6RA 3VGEA 2VWSA 3SN4A 5D09A 2YCKX 3W85A 4I9TA 1B54A 1MEWA 1U5JA 4Q32A 1TPFA 1PXGA 3N2TA 1FDYA 1XRFA 2QAFA 1TG7A 1K4GA 2PRLA 4L1XA 2CFFA 3DFYA 3MYOA 4OOUA 3K8KA 3UCQA 2R91A 4WY0B 2W3ZA 1QOXA 3TOYA 2YW4A 4UOJA 2R1KA 4Q8MA 2AKZA 3TH6A 2VT0A 3ELFA 3BURA 3C56A 3S2JA 1OFRA 3G77A 1AFSA 4K8EA 5K4ZA 3GTHA 3TEVA 2G5WA 5E70A 1EEPA 2VL4A 4LW7A 3VOIA 3K1DA 4GZ7A 2VELA 4U4MA 2PBGA 3AYSA 1OM0A 1TR9A 4OIFA 3K5XA 4LT9A 3UF9A 1UMLA 3DGRA 4YPJA 4HN8A 2XH2A 5FEWA 4E0CA 4GFIA 3C2YA 4AYGA 2HCVA 4Z08A 3QR0A 1J5TA 4NASA 3QSRA 1EZ2A 3ICJA 4MKSA 4AWSA 1FWWA 1S1RA 1SVDA 2EEXA 3JVAA 2PWVA 1OYCA 2W6RA 3N2OA 1GOQA 1X98A 4AHOA 3FJNA 2RFGA 3H70A 4Q4OA 5I2UA 5D9MA 5FJTA 1W1ZA 3C86A 5FF7A 1ZY9A 4EXBA 1E0VA 2X05A 5DT5A 5FAGA 5TIMA 2VC5A 1QOPA 3RITA 2DUAA 3GXDA 4M7SA 1R2RA 1OK6A 3NQFA 1TYGA 5BZAA 3PY2A 3MMTA 5H8PA 3UYCA 2VGFA 4GCAA 1GJUA 4C6OA 3RU6A 2E25A 6REQA 2FHFA 3OGVA 4M8UA 3H7RA 1XQKA 4ACZA 3JZEA 2W61A 1CLVA 4FAMA 4RZ5A 4ZEPA 2YDQA 2WHJA 4UFLA 3VIMA 1P6CA 4P7RA 4QCFA 2NUWA 4XUYA 4W4QA 3LBCA 1XGZA 3C3UA 4UMCA 4DEFA 4MWAC 4H19A 1XLHA 4HMEA 3W7IA 2E68A 4W86A 4LUIA 1SU5A 3R94A 3BAXA 4GI9A 3CXOA 3V36A 4EANA 2QUUA 2HE8A 2ZX8A 4GO9A 5AC6A 4MB5A 3HMJG 3PNUA 4XAFA 3BARA 3NPWA 4ZBCA 1J18A 3HPXA 3LRLA 4H8VA 3AYVA 1K70A 5BYWA 4F66A 1XKYA 4ZMGA 2EPHA 3A9IA 3W7JA 1BWLA 1JZ5A 1T7LA 3HN3A 4ZE5A 4US5D 2PDKA 3BDKA 3B0XA 1JR1A 1AG1O 4PMVA 3H23A 4IMCA 3WH9A 3O6YX 3UA3A 4YHGA 2CHRA 3M46A 3Q45A 1D9EA 1K8YA 4ZQPA 3EPOA 3GH7A 1EJXC 2DEPA 2WANA 5JBEA 2FZ9A 3NUKA 5EGRA 5E0CA 4MWAA 4B5NA 5BRBA 1QNVA 4HTYA 3N04A 4WJXA 1NQ6A 2DGAA 4PSRA 4QDMA 3G22A 3QY6A 2B7NA 1KFWA 3W74A 1S2CA 4BY3A 3ITXA 4D72A 1YXYA 3GHRA 4LYKA 4D6EA 1VLIA 4M24A 6ALDA 3KP0A 4LBSA 1ME7A 3CO8A 2YCLB 4S3DA 3HQ1A 4BWLA 1DWHM 2XFYA 3OVGA 3OIXA 2NZLA 2HISA 2QJMA 3UQNA 4IFRA 4PE8A 1GW1A 8A3HA 1SFLA 4PTVA 3AIEA 3B9AA 4GACA 1H5VA 3ONBA 5F2LA 1KKOA 4Q4MA 2DQXA 1HVXA 3CHCA 4P2VA 7ENLA 4DAIA 3GDBA 4GUIA 1R30A 3EOOA 1UZDA 4JN8A 2YCJA 1QNPA 5DXYA 1OGBA 3BLPX 3HGSA 3CAVA 2ISVA 1QW9A 3KBNA 2ZDRA 1NWRA 3C4UA 1HG3A 4AD0A 1R38A 2HNEA 3SIZA 3DFTA 1P6BA 1HL2A 3OTRA 3TYZA 1XC6A 1E0UA 2OEMA 3LDVA 3U2CA 4DN1A 5J5DA 2ZA2A 4QP0A 2OGYA 2PAJA 1QT1A 3AZSA 4G8TA 3W7PA 3WY1A 4P5UA 4GCXA 3HGRA 4O18A 1LLZA 4AF0A 1QI4A 3T40A 2OYMA 1UWAA 2Z29A 2WYSA 4EWND 1UPPA 3FAXA 3FA5A 1KM1A 1E4LA 3VFLA 3BAIA 2D2HA 4F2UA 2RDUA 1DHKA 4HKPA 5T9BG 4MZYA 5DANA 4UTJA 4G7EA 3A3HA 4JKLA 5BMWA 3NM3A 1ZGDA 3QN3A 3M0XA 5HK4A 3H2MA 3RM8A 4EP8C 1SZGA 3SW6A 3DESA 3WD2A 1H60A 4HPNA 3C2VA 2P0OA 4JAWA 2HE5A 1QOQA 2Q02A 1JUBA 1PBGA 5LNRA 2OSYA 1K6AA 2X1SA 3NDOA 5LXXA 1UH4A 4MTVA 3QMRA 3AZRA 1G69A 1WZMA 4DUWA 1Q6RA 1KNWA 3STGA 5GJMA 1KCKA 1QNRA 2BBFA 4MKVA 4CN6A 4GO8A 5LNWA 1XDMA 1XIHA 1VIZA 1V77A 3FEMA 3UCDA 3FEQA 3LENA 3GDTA 4IIHA 4DHGA 1B5TA 2E5BA 5CGQA 5CPMA 2XUCA 4QAWA 2XFFA 3OLGA 2TMDA 4NAEA 3MHGA 4GD0A 2Y7FA 1VYRA 4JCLA 4XUGA 4IGNA 3IAQA 4NRRA 1HGWA 2VFEA 1JZ6A 3MUIA 1X96A 4FP1A 4MZ8A 1XYBA 1K4HA 4HPHA 1NOFA 3S2MA 4JFTA 4AZIA 4E3TA 4LUSB 3GIYA 3TTOA 1DBTA 4K68A 5HA7A 3QYSA 3A5VA 3M0ZA 2NXHA 1FFRA 4HD5A 1GORA 3KHDA 3LRMA 3WQOA 5EFDA 3M5VA 2QCFA 1W3HA 1Y5VA 1EO7A 4LCQA 4HSNA 4W5ZA 1DV7A 4JL1A 4FO4A 4DYKA 2XIJA 3I6TA 4K38A 5TQLA 3WJWA 4RL3A 4O50A 1UR2A 4GGBA 1E1CB 1DJQA 2PWHA 3NL3A 1LQ2A 4CNSA 2BY3A 1JEZA 4AZBA 1V3HA 3V4BA 3SRKA 2HVNA 2ONEA 1UKPA 4AX6A 3GNPA 3MPGA 5MKGB 5F7UA 3S83A 4HHLA 4Q33A 2POZA 2GJPA 2UBPC 3IV8A 4QJ1A 4GVHA 3M0YA 1TV3A 2EPMX 2NWRA 2ZCGA 3NQ7A 4C91A 2EJ1A 3O6CA 1D8WA 3L4ZA 4O19A 2J79A 3M43A 1XWYA 4H6RA 1O95A 1DOSA 4Z17A 2QMKA 5C71A 1E6ZA 4GPNA 1E6SM 5G1TA 4A3HA 3N14A 1R3WA 1W2PA 1CGUA 3WEZA 4WDUA 3EKLA 3ALGA 1EP3A 2WZMA 4NJGA 4NP7A 3UJEA 3WQ6A 2D0FA 3VIGA 3CWHA 1SSGA 1PHQA 1L6SA 1V8EA 3FVMA 4GI6A 4XX6A 3HQPA 3PWAA 1FUYA 4FIQA 4IWWA 3VMPA 3K4WA 4HMCA 2FGLA 3L4WA 1J2WA 2DUZA 5FESA 1C9DA 1DYSA 1PYMA 2WW5A 1DL3A 1X7FA 5L9FA 3EX1A 1MQRA 2UWFA 3C3NA 1UG6A 1CDGA 2QT3A 4B3ZA 1NF0A 2PRMA 4CVWA 3MCMA 3EX3A 3A64A 5A6JA 4QIUA 4AD3A 5M2FX 1JUEA 4QJ3B 4BI5A 4PMJA 4EXQA 3M0JA 3AHXA 1HJQA 1YE6A 2OQLA 4S2CA 3QQ1A 2Q09A 4JTIA 3VGDA 1A5KC 3BW3A 4R9XA 1FP8A 4MB4A 5FI8A 5AOUA 2HK0A 1H09A 1H49A 1ZB5A 2B4GA 1F74A 3W53A 1PCWA 1ELSA 2WMIB 3EDJA 4Q22A 2BMBA 3MA8A 4WJ8A 3NQMA 4JTRA 1RCXB 1H50A 3C2RA 1IXQA 3MBDA 2JFEX 1R47A 5C7VA 1ME8A 2F2KA 1PDZA 1X38A 4CQDA 5I0DA 1JCTA 4L56A 1E0WA 4PFHA 3EXTA 1XRSA 4JHMA 3D46A 1US0A 3RR4A 4E8CA 4QG8A 1CLKA 3SCQA 3W28A 1KCLA 2A5HA 5D2YA 4AHQA 1IYXA 3JU2A 5DMMA 4AY8A 4OJYA 3XIMA 2QJNA 3W76A 2GZXA 5EYWA 1UP2A 4US6A 3WBYA 4HT3A 4CQ9A 3TQ0A 1ZSXA 3GXTA 3QRHA 4HMDA 1YADA 1DEDA 1TV2A 2IPGA 1WXJA 3NQ6A 3DFHA 3GD6A 1TPDA 4J3WA 4GC3A 2QV4A 3FXYA 2X1RA 4Q3MA 1XS2A 4YS1A 1KA9F 1GOMA 3HF3A 1Z44A 2BGNE 3BOXA 1Z48A 4RZ4A 3R0KA 2DT2A 4JTCA 5FL0A 1V02A 5FJRA 4WR3A 5HAOA 3EOLA 4O17A 4I6KA 2CESA 1UC5A 2Q8LA 3ZSTA 1Q13A 4O1EA 1CGXA 2J6XA 3STCA 2X30A 2Y7DA 4KFNA 5CG7A 4ATWA 1PSCA 4P7NA 4XTDA 2GK1B 4LYQA 4V28A 3U2EA 1ZPTA 3QY7A 4LYRA 3KHJA 4H3DA 3TAOA 3W1MA 2XIIA 3A3XA 3S2LA 4Z2LA 4GY1A 3N2BA 4PUMA 2X42A 3GC4A 3AALA 3WQ5A 2D0HA 1HN1A 3PZOA 1SR0A 4AWEA 2V6AA 2WWCA 1XINA 3LCHA 3TMLA 4D8AA 4AU0A 1NVMA 2JBMA 3LLFA 4JX5A 4XZWA 3ZWTA 1HXJA 4URIA 2PE4A 4AD2A 3OYZA 4GX9A 3ENLA 5EMLA 5FA5A 3VDBA 3CPUA 3C0LA 3BE7A 4B3KA 1OCQA 2Z6JA 1FVPA 4GBUA 5HMFA 1D7KA 3BG9A 4LS2A 3HFTA 3KCJA 1WYIA 1TWDA 1V3KA 2VMFA 4L9XA 2UY2A 1GWJA 4FR6A 4KCVA 3S5NA 4HZMA 4KWOA 5A2BA 2H8ZA 3W27A 5JIWA 2V81A 3SRDA 3LGDA 2WVVA 1DWFM 2VKZG 2ZRWA 1W9XA 3GW3A 4MMWA 1PAMA 2V3EA 3R8HA 2BTMA 4DX3A 1DIDA 7TAAA 3ATYA 4G6CA 1V93A 5HMEA 1Q45A 4GQ0A 4JIHA 2E6DA 1EP1A 2ZUSA 3DU0A 3NZPA 3IIOA 1QU4A 1OC6A 1TIWA 2J47A 4DJFD 3VIIA 1UKQA 2ZRXA 4KT2A 2C0HA 1HKWA 4HU0A 3W3OA 4MF4A 3H2AA 4QXIA 1TO3A 3E0IA 3SN0A 1SGJA 4WXYA 3ZMRA 1B1YA 2W62A 4E38A 3FJ4A 3P84A 3PG9A 4FNQA 1IEWA 3MBFA 2O4MA 2J13A 2NXGA 1XIJA 1QWGA 1NWSA 2OWXA 3CUJA 3LD5A 3GW0A 4E8DA 3RF9A 4AVFA 3B8DA 1E3ZA 2AMGA 3NTYA 3EDKA 1US3A 1O66A 1GHSA 4U5KA 3MTWA 1E6XM 4IMFA 3CIVA 1CNVA 3QZ6A 2BGSA 4JTUA 4I7VA 2A7PA 3RCMA 3U0HA 1XHGA 1MFVA 3T42A 3SCSA 3LQGA 4US5A 1P1XA 1U5HA 4HNNA 5I6SA 3D47A 5J04A 4H6EA 1X6NA 2PC4A 2X0YA 4QE4A 3LHVA 3VZXA 4ASTA 3U57A 3CTTA 2XSXA 2ISDA 3E2QA 2CERA 3T81A 2TAAA 2ZBTA 2UY4A 3NL5A 4L5ZA 3UWYA 3JW7A 5FJIA 1SM9A 3BWWA 1OX4A 1E9ZB 5AZ1A 1NM9A 2ZA3A 1TPB1 2VEFA 3GFYA 4NRSA 1C91A 1GQKA 3EAUA 4ONVA 1JCMP 1Q6GA 3TC6A 2E5CA 4M1RA 4O28A 3MUCA 2J7DA 1UA3A 1POJA 2OEKA 3M64A 5C2XA 1HKMA 3DG3A 1OFPA 3PFMA 2H90A 1YMYA 4E8GA 4I9AA 4U3CA 2DZXA 2J75A 1KQZA 3V5OA 3LMYA 3KLLA 1TVPA 4FNUA 3FDGA 2OFJA 1GVQA 3GYEA 2CIPA 4NJIA 1GW9A 2VZSA 3NQGA 3O3RA 4UXDA 1DIEA 4KEMA 3KBSA 2G95A 1EJUC 2I7GA 2QUMA 5EKYA 3VOGA 3H4WA 1J93A 3CL8A 1GVRA 3BOLA 4MB3A 1TPVA 5XIAA 3GR8A 3N15A 3WFZA 3POHA 1BG9A 2IKJA 2FPVA 4HVXA 3B8WA 3DX5A 3P74A 4N9CA 1WXYA 1SFTA 4JYDA 2ZX9A 4IMEA 4MM1A 1ZTVA 3DOPA 3WQ8A 1IF2A 1HTIA 3P67A 3N73A 5DEZA 2DORA 3MWCA 1R86A 3JRKA 4WOZA 5B80A 5DMYA 4LAOA 3KCLA 2PWFA 5JH2A 4YXGA 2DSVA 3MV01 1HUVA 1TKKA 6PTDA 3TSDA 4HB7A 4GY7A 5GNYA 5I78A 2QCCA 4C65A 2XN2A 4ML9A 3LI0A 1YNQA 4MAVA 2V82A 3WLIA 3RCYA 1C93A 2VEMA 2PS2A 1AL7A 4GVGA 4Y8FA 3WD0A 2VZVA 1PTGA 2C1HA 4JFVA 4B92A 4HP5A 2Z2AA 3GC5A 1O5QA 1UROA 3IGSA 1ISWA 1D2KA 3SFWA 1SFJA 4AD5A 3IIPA 4YTSA 1CIUA 4Z1YA 1ZRQA 4UNKA 3A9BA 2FZBA 5D02A 2CZDA 3EPMA 5DQPA 2XU2A 1I8JA 2DZWA 1RPXA 1LCOA 3KLKA 2BY0A 1HQTA 4QHRA 3KM8A 4JNZA 2FTPA 4I7UA 4NXKA 1Q7MA 3FV9A 1V3LA 2ZE0A 1QBBA 4CU7A 5IRPA 3BLLA 2H3BA 5FEZA 4IICA 4CQAA 5JBFA 1Q6EA 3GDMA 2QLYA 1MWOA 3VA8A 2V5DA 2OZ3A 4CU8A 2XIMA 3VCNA 1W3KA 3F4VA 4HNOA 1JCLA 4HSHA 2POTA 4YCPA 1GONA 3SRHA 1V6YA 2J78A 2E6FA 2PF8A 4MKNA 1ADDA 5CLWA 3GIQA 3LPPA 1DPMA 4X9SA 3L2IA 4XBKA 4WKFA 2VYOA 1HX0A 2VFIA 2SFPA 4IGHA 4XD6A 3BLDA 4GFSA 3LGGA 4AMCA 1T8XA 1KWGA 3T9PA 1X7IA 1FWIC 3EXRA 3WN6A 2JGYA 1W5QA 3U6WA 4U31A 1VBJA 2PD9A 3VAVA 4WHBA 3B05A 4B9YA 2ZZ4A 5BOEA 1O7AA 5A95A 2E8ZA 3SCUA 4L4OA 4WDXA 2E40A 4HPXA 2GQ9A 2BOFX 2L5HA 4CD8A 3VNMA 1XL9A 5A6BD 1YKWA 4PBEA 2GJRA 4FOKA 3A24A 3Q37A 4HYRA 2VGIA 2OWCA 2YXGA 2E3ZA 3MCOA 2CXGA 1JAKA 3CQ0A 2V5KA 3AIUA 4Y96A 1J0YA 3RO8A 3G0UA 4JIQA 3BOFA 4PL2A 3TNOA 1B3VA 2TYSA 4JOMA 1BWKA 2G3JA 2WPBA 1Y65A 1HIZA 3O6AA 3DXIA 2OZTA 1CB7B 4ENLA 4Q8VA 2RJGA 4M29A 3TYCA 1DJNA 2J77A 3WKZA 3DH7A 3TQVA 3CIXA 1FHUA 3GG7A 3AHTA 1SQ7A 3CLWA 1IQ8A 1QI2A 2OWWA 4GUGA 4O0ZA 2PURA 1XRTA 3LRKA 3PULA 1VR6A 2BASA 4LX4A 1IEXA 2WLZA 3OHIA 1VFFA 4S3FA 5HJXA 5BRQA 2Y2WA 2I1OA 5AC8A 2UY3A 3KX6A 4MPKA 3ZR5A 1A4MA 4RNIA 2Y85A 1CI1A 3LHUA 4IFOA 2WVSA 4NZ3A 3AJ7A 1V6XA 2FDSA 2FJKA 4H8UA 1BYBA 1OQFA 3PTDA 3WMSA 3BJFA 4BI6A 4A8RA 4PRTA 3WLQA 1RH9A 4M1BA 4TOQA 1KR1A 4NNBA 3AHZA 1JQXA 5KZDA 1O5KA 4H7CA 1IXNA 1NOWA 4QAIA 3APYA 2Y6ZA 4XKYB 2J9XA 4IISA 5CLTA 2J8TA 5I77A 1E73M 4O52A 2Y88A 4JKKA 3OU8A 3S2CA 1QMLA 3RIKA 3A23A 1IE7C 1S3HA 3OVRA 5C9XA 3E49A 1FH8A 3CEPA 4MHBA 3QV6A 2WSKA 1XLIA 3GNDA 1RK5A 3CV2A 4HCHA 2XM1A 4DY1A 4HA0A 2DUXA 2ZZ1A 3RPDA 3DC0A 2QEZA 2VC7A 1I75A 4E6MA 1HL9A 5HNTA 1DTNA 2LLEA 5D2VA 4JGDA 2NQLA 1RUSA 3COTA 1YHTA 4FLSA 4UQDA 5T26A 2G4FA 4GI4A 4H9XA 3UG5A 1VJSA 5G1MA 2VX6A 4M56A 5REQB 4GOAA 3CL7A 3UWWA 3OA5A 3GXMA 3D6NA 2FGBA 2VUYA 5BW6A 3FGCB 4CQCA 1JFXA 1S5WA 3FW6A 1GNXA 3LTYA 2R94A 5LA0A 3W22A 3IVSA 1LT7A 5E0FA 4Y9NA 1G7UA 1H1ZA 2CKRA 3EX4A 2BFGA 2JE8A 3AI0A 4S1FA 4QE5A 4CEUC 2CBVA 3N2CA 1Q7ZA 4GJJA 3T8LA 3L4TA 4BJHA 3MI2A 4U28A 2MANA 1AQHA 4RLIA 3TJIA 3W1XA 2OSWA 4PUNA 5G2WA 2QCGA 2QAPA 3P8IA 2B81A 2P8BA 2PU0A 1JXJA 1P6WA 2KZHA 1CBGA 4FF7A 2HJPA 4ZOAA 3WDPP 4YYCA 2H9AB 3VX0A 1M5WA 1BVNP 1P0DA 1TX0A 3VE7A 1V7YA 4I8YA 3BLKA 3O0FA 4HPJA 1A0EA 3W88A 4ZO9A 4HJFA 3LV5A 1J0JA 1XSIA 2Y8VA 3E5BA 3W7NA 4UIOA 3FNDA 4B4HA 4EOUA 2JQXA 3VDAA 2OX4A 2H3DA 5H91A 3TZFA 1EPXA 4W88A 1WXZA 3WH8A 3G6MA 3LPGA 2A3LA 1XYFA 4O0QA 2QGHA 1SO4A 4UTWC 5BWFA 2P0IA 3F2BA 1O5RA 4IX2A 1ZNNA 2PDJA 3FHQA 3N3MA 3PWIA 2WSYA 1U1HA 2ASHA 5LNUA 2X09A 1DXIA 4LU0A 3A5FA 5CZJA 2VRKA 2BB0A 1VZWA 1DQUA 4RDZA 4JS3A 5T91A 4QLJA 2WJEA 4KEUA 4PH6A 3MI3A 3GK0A 2PTXA 1I1WA 4L9YA 4YWSA 1W31A 1UH3A 3W6MA 4DLMA 2GFTA 1YNYA 3PPHA 5K9DA 4J7RA 2ZADA 4GINA 4DJFA 2OU4A 1DXFA 3MW7A 4DUOA 1NH6A 2ZKMX 3LA4A 1VHNA 1GYNA 1C3FA 3PZGA 4H6KA 5A94A 3W2UA 2A2IA 3MUXA 1JNDA 2AL2A 5PTDA 1SJAA 1ISYA 1M7PA 3K4AA 6ENLA 3CO4A 4UTWA 3CAQA 3G3DA 1HF6A 1TWSA 3CQKA 3BANA 1YYAA 1FWSA 1N55A 2Z0IA 1FCQA 1DORA 1Y7VA 2C6QA 3EWDA 3RJXA 4B5TA 2WKGA 1ZCCA 4IMDA 4GXPA 1G67A 4UUIA 1H63A 3EA3A 3TJLA 1UZ1A 1R9XA 1MDLA 4GYPC 3RILA 5DELA 3LHTA 3DBPA 3EEGA 4IFKA 4G7FA 3KBWA 1GOKA 4IMAA 3IUIA 1VKFA 6A3HA 4LOCA 2X8RA 1RJRA 2PP0A 4WIWA 1VGAA 1IZCA 4BCEA 3C52A 3PZMA 1XBZA 2VM8A 2Z1VA 4H9TA 4HYWA 4Q7IA 1UASA 3UBPC 1F6PA 3REQA 3M5ZA 2EQDA 4XIMA 3TUUA 3IRSA 3WUEA 2DVUA 1UIOA 3ZFHA 2E7FA 2OQYA 1BQCA 3LHWA 1XLKA 1E43A 5DXXA 2OKTA 1ZCOA 4U2ZA 2DH3A 4EF9A 5A2CA 3TYDA 1VBHA 3H2OA 3GS6A 4ZQRA 1ZS2A 2CLOA 1ISVA 3OJGA 2NQHA 2C3ZA 4ZSUA 5FOOA 3GLCA 1K9EA 3BK0A 3RM4A 4TO8A 2G50A 3FK4A 3RK8A 3WH7A 1GZGA 3NO1A 4DZIA 3LNPA 2VEPA 4QS6A 5FKYA 3AWNA 3PUDA 1LORA 4PTXA 3QQWA 4GYPA 2IPJA 2DSKA 5EMKA 2GDVA 3IJDA 3DHPA 2WHKA 5HPCA 3IEBA 4XV0A 4DPPA 3W23A 2FH8A 4FX8A 4BI7A 1OCBA 1CZ1A 1BF6A 2CHOA 3C8NA 1V7AA 4CU6A 3SSJA 3LCLA 5A8PA 3THCA 4G2DA 3ZR6A 1OABA 4LGXA 3HPAA 5F2GA 3UZ5A 4DXVA 3LQLA 4LSBA 1EX5A 1KFLA 4MG4A 2I5IA 3ZJKA 4LCSA 1EQPA 1ZJBA 3N3TA 2X1UA 1UQYA 4C5YA 5I06A 5AY7A 3G1HA 4KESA 1RK6A 2GJNA 2WKJA 3OG3A 1KBBA 3SQLA 4A05A 4KF1A 3EOSA 5T8GA 3DDMA 2DW6A 1XBVA 2DV0A 1M68A 3LHZA 1V6TA 3L4UA 3AQUA 3WSUA 3E02A 2R82A 1GOIA 3G18A 3NQEA 3S9YA 5BCAA 2ZX5A 2XIOA 3QTPA 1KXQA 4Z42C 3MU7A 4JQ3A 3C8FA 3QSTA 3NO3A 2R1LA 4GIYA 4O15A 3SGUA 3HJEA 2D3LA 2WZEA 5I3IA 2CLKA 3GKAA 4FEZA 4J4KA 2XN1A 1PYFA 4IG2B 2YA2A 1ZAIA 1N8WA 2ALRA 3PBWA 3U8GA 3CUGA 4W89A 5C55A 1R6WA 5CZ0A 3W7GA 1ZZMA 2Q8ZA 1ISXA 3EOEA 5G2HA 2D22A 4JEQA 3S5YA 2D20A 2PD5A 3H8AA 1E9IA 1XYZA 4DO6A 5AN7A 3WLKX 2CLHA 3L2LA 1JGMA 3KZPA 5A2AA 4FR1A 2DIEA 2Z7KA 1JYWA 5HWJA 1EJTC 3WZ0E 1MSSA 3OYXA 2WC7A 3ZXWA 3NQ8A 3SQSA 3SGGA 3FYPA 3HTWA 3P81A 3PB0A 1KKRA 2NUYA 2DZAA 4G1NA 2VNCA 1GPWA 3HQOA 3EX6A 3ZVHB 1RVKA 5CBJA 5ABGA 1GQLA 1XLJA 4LAUA 3O07A 5AZ0A 5EY5A 1TV7A 1MRQA 3CNYA 4UQEA 4PULA 1RLCL 4V27A 1RAKA 4HHPA 3GYCA 4HZ7A 3R43A 3SIMA 1SO5A 4AZHA 1YDYA 4Q6XA 2VP8A 3NOEA 5L6UA 3QBUA 3N4FA 3EMQA 1BF2A 2BY1A 3MO4A 2Y8UA 2QVNA 4PCNA 1G1YA 1S5VA 4LB4A 1XLCA 1UKTA 4ML4A 1JUKA 3VGGA 1DQWA 3RN6A 5G1YA 1FKXA 3HPZA 3NQCA 1OFBA 3HG5A 3B8VA 1AJZA 2I9UA 5H2ZA 4FF5A 1UR3M 2HRWA 3SY8A 5FSEC 3N12A 2NXIA 3GDLA 1EA9C 3VABA 3LPFA 3GAKA 2AAMA 5KMYA 1N8IA 1EB3A 4X61A 1W5PA 3ECQA 4ZQMA 1OBAA 1LUCA 1MW3A 2PDBA 3NZGA 3CHVA 1CLXA 1ITUA 1IGWA 6TAAA 3BW4A 4RUBA 2PDYA 3ZR4A 4FLRA 3S1GA 3L4YA 3A13A 1W5MA 1LQ0A 2QHAA 5CSRA 1LYXA 1OK4A 2QCDB 3GHSA 3KL5A 4NX0A 3K8LA 5A6BA 1R3RA 3BQ5A 3KS5A 1U83A 1BVWA 2JF7A 3W7LA 2GSJA 3W86A 3IARA 3PZQA 2RGMA 4NI8A 4ZOCA 4Z1CA 4CD5A 3K8MA 1UD4A 1XLMA 4S3CA 3ARWA 5HQEA 3G1RA 3IVTA 2NWSA 1D3HA 2AAAA 1AVAA 2D2OA 4WCJA 4D6JA 2HZGA 1EJ7L 3CT7A 4KWUA 1FHDA 1F8MA 5A6TC 1GHRA 5AYIA 3LN3A 4DO5A 2XGZA 2DZTA 4O1FA 3PPGA 2JKPA 3G1FA 3PSWA 5AC5A 5CBBA 3NL6A 5EMJA 4WY0A 3UZZA 1XLLA 3AXKA 5A8NA 1LBFA 1OT2A 4LRSA 3GTXA 1U1JA 4F2TA 1TJ1A 2QUVA 2VR4A 1AMYA 6REQB 1JZ3A 1CB2A 2V0TA 3UWEA 1ZBKA 3WQGA 3F2DA 1H1YA 1UWTA 2PDCA 3VMOA 2J66A 4LVGA 3QGKC 5LKYA 3SQMA 3NDYA 3UZWA 3SR7A 5G4HC 4IIDA 1BVZA 5CPOA 2YL9A 4K1GA 1DWIM 4GQRA 3S6OA 3TLQA 2X7VA 2QCMA 2FZMA 2PDNA 3TVAA 2WHMA 2VR5A 1V79A 2XZ9A 3UR8A 2ACQA 4GXMA 4R5EA 5GNXA 2GGHA 4A3YA 1G4SA 1E5JA 5IM51 2QF8A 1K9FA 3UJFA 1CENA 3VGFA 1V08A 2G3MA 4PL1A 4ADSA 1K9TA 5K9CA 2FIQA 1YBQA 1IR1A 1UD2A 3RDKA 4KH2A 1AODA 4I9JA 2OEJA 4JTKA 5HNRA 3LLDA 1TVNA 1W3JA 4PBFA 3OG2A 3PN8A 1THFD 3TX9A 3I3EA 1ALDA 2Q3RA 5D2WA 5BU6A 3QVQA 4OECA 1F3XA 4FI4A 3OZPA 4IIGA 2PWDA 4H01A 4JN6A 1PIFA 2PZ0A 4N6EA 4K8HA 1S3TC 4WDWA 1W37A 1TPH1 2YDSA 1QO5A 2VCCA 5LHFA 1JYXA 5CPLA 1FWAC 1RV8A 3I7RA 4MWAB 3THUA 2B0MA 3DERA 1WDSA 2V5CA 4N02A 1QUMA 1I0DA 4S3JA 2EPKX 4OGZA 4N9EA 3S4TA 5EU9A 4RW3A 3H21A 4XD5A 3ZLFA 2BLEA 3NZQA 3TAKA 5CC3A 3WQWA 3LM3A 3I4KA 5GQBA 2W9MA 4BEUA 4IL2A 4GNJA 4D1IA 2WNNA 3VIFA 1TTQA 3AFBA 4JX4A 3NVDA 3KCOA 2PU1A 1C7TA 1WX0A 1DE5A 3GNXA 1US2A 3AMLA 3LB0A 3TTQA 3KOYA 2J62A 4TMBA 5K2ZA 2XWEA 1TZ9A 5JMUA 1JDAA 1NARA 1PKNA 4XB3A 3OBAA 1EF2A 2J7CA 3VC6A 5KTLA 4MJ2A 4JTTA 1EZWA 1PJ9A 3NSMA 4LEFA 4PGLA 4UBPC 1BQGA 1IT7A 3SURA 2OLAA 1F6YA 4RNJA 3M47A 3VXGA 1UUOA 4RDWA 3A22A 2CBUA 5F2IA 3UCCA 4U3AA 3LYEA 1Q2RA 5H8UA 1W9UA 1VP5A 3B0UX 4AZCA 1TJPA 2PTDA 4JIIX 4JTDA 1ESWA 1QK0A 3N18A 3SO7A 3I3DA 4QQ3A 4F4RA 1A4LA 3OQEA 3H2EA 1RLDA 4HOWA 3WLTA 2AGKA 3R79A 1ONEA 2ISWA 3UPMA 2E5DA 4KCUA 3NNTA 3M0HA 3T6CA 1GCYA 4XVEA 2X41A 3XINA 2ZWYA 3TW7A 2Y24A 4LV4A 3PTQA 1H11A 1CXHA 1Q6DA 4KIEA 2HVMA 2W63A 4AF0B 2FB3A 3DHFA 4Q4PA 2GQAA 3AJXA 3BV4A 4Y9PA 2GYIA 4PMYA 1DXEA 4F8XA 4GXWA 1SO3A 4HZ8A 3PUOA 2PCQA 5CGTA 4WEVX 4NVTA 3WF2A 2GJXA 1M65A 4QEHA 1TUXA 2CITA 5DFAA 1HO4A 3FA3A 3I7QA 3AC0A 3Q94A 3DAQA 1KM6A 1C7SA 1H41A 1GKRA 3PUGA 4N42A 3C2EA 4AZ6A 2PLMA 1R3QA 2V9DA 3IWPA 4JQ2A 2W92A 4Z2HA 1FTXA 4WY0F 3EWZA 3C0QA 4DZHA 5DY3A 4TVCA 4JHZA 1VPXA 2GGEA 2JKEA 5F1UA 4BF5A 1ENUA 1ZAHA 2EG8A 2FMOA 4UOQA 3JR2A 3IIXA 1XFBA 4Z1DA 3N2MA 4FX7A 4B5VA 1O94A 3OB8A 2ZZ5A 1OD8A 3K4DA 1KXVA 3CH9A 1XXXA 4HK5A 3W00A 3U4AA 1L9WA 2PDPA 4DJDD 4UQAA 5A5WA 2IUZA 4UFHA 2DQWA 2Q8XA 3P60A 3PTKA 5ENLA 3WQEA 3WNOA 1XDJA 4NAEB 3KEHA 4UCFA 4PSPA 3MYPA 3UNTA 1M1BA 2QZRA 3PPFA 1V3JA 2QV5A 5FF3A 1JIBA 3UG3A 3OHMB 1UUMA 4QS5A 2I17A 3HGOA 3TR2A 1ZBVA 2G4JA 3HPFA 4PFMA 3VINA 3BO9A 2FPYA 2YKKA 2WSQA 4UTIA 1TPEA 4MB1A 3GX9A 3ZWSA 1O5XA 1WCGA 4C7DA 3PB2A 5A8QA 3TW9A 2FFCA 2GVYA 5IBXC 3TIMA 4GYJA 1XLBA 4E4PA 1GK8A 4FB7A 1P7TB 3M0KA 5IHSA 3VPLA 3AMKA 3CHDA 1PIIA 3VMNA 1OCNA 4ZFMA 1JYVA 4IIEA 2ESCA 4TIMA 2DP3A 2YOCA 2YR1A 1XLDA 6TIMA 3S1WA 2R1NA 1Q8AA 3TC7A 4LF2A 4YIWA 3URBA 3W4RA 2F6UA 2J8GA 3QTGA 1H2JA 3L68A 3TXZA 2FQIA 1H5YA 4HIBA 1TE1A 3N4EA 1KBLA 5HBFA 1L6GA 4V33A 3AHYA 4ROQA 1H7XA 1NF7A 1KRAC 2G97A 3WDHA 4JFUA 4B5SA 4LS1A 2YZ5A 4ICNA 4LVBA 2GGGA 2DSZA 1LT8A 4MY1A 1ITXA 4JTLA 4PEKA 1EOKA 4I90A 5D9PA 1E1FA 3P5ZA 4WF7A 5LYRA 2E9MA 4NYUA 1GQIA 3ID7A 3ITTA 4DB7A 1J0KA 7XIMA 2XVLA 1W5NA 3TP4A 4NI3A 3ZSSA 4BEQA 3GHTA 1X6LA 2VX7A 4JQ1A 1PX3A 2ZX7A 2JIEA 4JIEA 1AD1A 3CQHA 1JYNA 3CYJA 2D0GA 3CMJA 4LY8A 3VDGA 3P6LA 1TMLA 4AX7A 4HA3A 5I3JA 3V3WA 3IANA 3WL0A 3OPSA 3T0BA 5JBDA 2Z26A 3KBVA 3MKCA 3KRBA 3DHDA 3TKFA 3PZIA 4GI8A 5DT7A 3SADA 2WPGA 1EYEA 3V0UA 5IFTA 4JTEA 4DQWA 1PWLA 1TX2A 3G1XA 5I3DA 2GOUA 2ZWZA 2ALDA 1QHZA 1ZFJA 5FEXA 4NJKA 2WNWA 3ES8A 5MKGA 4B9ZA 4C6MA 2OLHA 4LQ1A 1J8VA 4NNAA 3A4XA 4ZQNA 3T44A 3CL6A 1K02A 1QNQA 2E0PA 3QEZA 2VGGA 4UNIA 1TE6A 3N9RA 1B9ZA 1EIBA 1V6UA 1GEQA 3A21A 4YVVA 1K8CA 3EKGA 1RZMA 3R1ZA 3LU2A 2P1FA 1D3CA 3PZTA 3BAJA 5BXRA 2XFWA 1E6RA 3GB6A 4A2RA 1ZL1A 1XLAA 4W8AA 3S5SA 4PCSA 1M6JA 1S1PA 2PGRA 4ZB0A 2G3NA 5AYYA 1HL8A 3W7KA 1NFBA 4M0XA 1MI3A 3VIPA 1A5OC 3HA1A 4QRNA 4TVUA 3ITGA 5K3VA 1A5CA 1Q63A 2ZFAA 4LF1A 4MUPA 3W7CA 2PWEA 4N0RA 4Q7BA 5CAHA 4OQVA 5DMLA 4V1YA 4HSOA 4HNUA 4BA0A 2ZXAA 3E0LA 1RBAA 3VKAA 3L5LA 1J0IA 4QQUA 3S1UA 1FA2A 1Z6KA 1W2VA 5D05A 5CJNA 3BMVA 5E1QA 2Z1KA 4MJ4A 2XTKA 4XWUA 3FN9A 1XPYA 2WM1A 4A2SA 4CLMA 4DBWA 4TXEA 3IJ9A 4IX0A 2J7HA 4K36A 1PCKA 3KOXA 4HOXA 1LOQA 3EOUA 3SJNA 4U10A 1W1IE 2WZTA 1OFOA 4IZGA 3MDUA 3CUZA 1R3VA 3SUUA 3FHAA 2E6YA 4M6VA 5I3GA 4GJ1A 1E40A 4H8NA 3G0SA 4Q8NA 1JDFA 2VC6A 4TX8A 3W1LA 3CZGA 5JIPA 2C14A 1IZKA 3K13A 2R24A 4R33A 1J11A 1S2WA 4OT7A 4FHAA 1S38A 3UYIA 2FZDA 1FH7A 1VS1A 3URNA 2Y70A 5JU6A 4GQBA 1Q7QA 2DT0A 4YNGA 1S2TA 3SUTA 3E3HA 4J2MA 1F3WA 5CSSA 5FSDC 5CEWA 1WKEA 4IUOA 3NJ3A 1GTEA 4XK2A 4RPQA 1OF8A 2NX9A 1M9HA 2BP1A 2REQB 4FS9A 3OP2A 4GE8A 3R10A 2IKGA 4JQ4A 4O13A 1CWYA 3CMFA 3ARPA 1PL9A 4BHYA 3WNPA 2J74A 3NM1A 3U7BA 3EGJA 3PBGA 4RJEA 4CCZA 4X9YA 5U4NA 1TPC1 3CLMA 2DDXA 1Q6FA 3OODA 4IL0A 3UPWA 1A50A 3W29A 4J3TA 4EIVA 1K8XA 3O0KA 2XINA 4C1NB 2NT0A 2W91A 3P62A 3N9SA 6XIMA 3WF0A 2WBGA 1GYMA 3B0YA 3TTEA 2YFNA 4PTWA 3RFAA 2J27A 2JEQA 4A22A 2PWUA 1AA1B 1C29A 3TYUA 2PP3A 3GZAA 1VFMA 2V5LA 1VEPA 1PKMA 5E9AA 4DF1A 2J88A 1MXGA 1RCOB 3M0MA 1VH7A 3RX4A 3L12A 2EPOA 4F3HA 1W3NA 1TRDA 1V03A 8XIAA 4K6AA 1YX1A 4KBXA 1R85A 3LCWA 3MVTA 3KTSA 1UZ4A 2V2DA 3E0WA 4PUUA 4LUTA 2FGZA 3KDOA 1UWRA 4N7QA 1G94A 1R2TA 3V1PA 5FF2A 2DZSA 3W07A 3RX2A 4DAFA 4Y6GA 4KQNA 5XINA 3NYDA 4HA4A 4J9JA 3GXIA 1QK2A 2BNJA 9XIAA 3N13A 1FWHC 1V0KA 5M5DA 1LL7A 2F38A 2ZUWA 5FIPA 5DMNA 3VNLA 1EDQA 1FXQA 4FALA 4AZGA 1V0LA 4L1GA 2VUNA 3QH2A 3ZJ7A 4XTIA 4O54A 2R1PA 2WCGA 4Q8OA 3VO0A 3CZLA 1CYGA 2QDHA 1OX4B 1KXHA 3BAYA 3C2FA 4PEEA 4JY9A 3AROA 3AU6A 3WLLA 4XZIA 4TTGA 2PP1A 3LERA 1AJ0A 2QKFA 4QG9A 4ZOEA 2Z7GA 2VD9A 4NX5A 4O11A 1ZQ5A 1L6FA 2V30A 4UFMA 1XF0A 3OIHA 3UZXA 2R8WA 2O9RA 4IUGA 1BAGA 3B40A 1JZ2A 3M7SA 4NZ4A 1A3XA 3VZZA 3W7OA 1UCWA 1PZ0A 2RDWA 1PKLA 3PBYA 2CXEA 4H9YA 4E2DA 3BPWA 4KRTA 4XZ9A 3AU2A 3L66A 3EB2A 4XIAA 4S3BA 1MEHA 1WDQA 3KOFA 4UTHA 3E2SA 2ZRVA 1MUCA 3VOCA 3THAA 1P0KA 4DBDA 3P0WA 2BVYA 1CXFA 3O6DA 1C8YA 2PI6A 4LBUA 3WMCA 2WZIA 4IJRA 3F4WA 3MANA 3TTSA 3WEMA 4DM2A 4TUFA 3FDKA 1V6WA 3EMZA 2D2JA 1EOMA 4CQBA 3GE7A 1PIGA 1YTDA 1FCVA 3L4VA 4IJBA 5GJNA 4KGLA 4BQ2A 1ZJAA 2FKPA 4HYVA 4GZJA 2Q71A 3DEQA 1AH4A 4MPQA 3M44A 3MSYA 1ICPA 2P76A 1VEMA 1WPCA 2PC8A 3WK0A 3VIJA 1RY0A 3BZJA 3ATZA 1XC4A 1E6NA 1SMDA 2HS8A 4PB3A 1OYAA 4IQJA 3CJPA 4DUXA 4NAFB 3F4DA 3HMCA 4ECLA 2GLKA 2UY5A 3LXCA 2XGIA 3WBXA 4PA8A 5EA9A 1KFBA 3VYLA 4D9PA 1RQEA 3KBJA 2CC0A 4H00A 1G4EA 1QPOA 1QTWA 3OLEA 3T8QA 5CZKA 4BWLC 1TA3B 1S46A 1XPGA 1XSJA 1VYPX 4PUKA 1MW1A 4D6FA 2XPKA 1A0CA 2YL8A 3FSTA 5FF4A 1RXOB 3DI0A 1QHOA 2C7FA 5EMYA 3STPA 3VD5A 2YBUA 4JD4A 1DE6A 3G1SA 5DCEA 2PDMA 1W3TA 1UWSA 3IK4A 4WD0A 4XZNX 1E6PA 3CIWA 4DF0A 3Q2DA 1OEPA 4DBEA 3ES7A 1SJCA 5AYXA 5D8ZA 3O63A 4TU1A 1WDPA 5CSUA 1P48A 1EA0A 4KKXA 3TWBA 4JDBA 3GM8A 4JXCA 3CUHA 4IH3A 2V3DA 3LG3A 4GLEA 3KUMA 3M4HA 1ZBWA 3C2OA 1WOBA 3W0KA 3R0UA 3VKCA 1FY6A 1KM3A 1VPQA 2X2GA 3QQ0A 4QE1A 2NSXA 2DVXA 4O8RA 3MQTA 5LZLA 4B15A 2YLLA 1PPIA 2WJDA 3TN4A 1SZEA 5HNUA 3P14A 1K7FA 1W9DM 3NL2A 2CZEA 3WNLA 3V1HA 1K77A 1TR1A 2X40A 1PO9A 4TX9A 5DBTA 3KS6A 3UJ2A 3CEUA 1JF6A 2BX7A 4DJDA 3H53A 1MXDA 3GIPA 2VC9A 3LPOA 3E38A 3RO6A 4N6FA 3DN5A 4JTQA 1R3YA 5AHEA 4GUFA 3U4FA 3OVPA 4L64A 4FXFA 1X1OA 3PBVA 1I0BA 4ADTA 3EMCA 4NL1A 2PLJA 2AMXA 4EAMA 2G0WA 1BSIA 1OB0A 1ZAJA 1JZ7A 2ODOA 5CPQA 1W1PA 4MYXA 1ZLPA 4Z0JA 1UOZA 4QCEA 4MAZA 3R13A 1HJUA 1AD4A 1QWKA 2O9OA 3NG3A 3CPGA 2FYMA 1V0NA 2VX4A 3V0SA 5CC7A 3BLOA 4QX4A 5HR6A 2A6NA 4P61A 3MP5A 2ON3A 2YPIA 1KW1A 5CC5A 3H2CA 1I2OA 2PFHA 4JTAA 1I60A 2CBIA 1OADA 1REQA 3B04A 4ZENA 5A1AA 2HSAA 4MNMA 1A49A 2B7OA 4XD4A 3TFCA 4NQ1A 3GZ3A 1RCQA 1H7RA 2PPGA 2YCEA 1JZ4A 4AUBA 2A21A 1H51A 3TZNA 4XSMA 3WDJA 2OT1A 3RNDA 4DYJA 4BFAA 3NDZA 4PCPA 5C9UA 1J96A 2D1ZA 1OFDA 4JN7A 3LV6A 5ABHA 3QV8A 1HKVA 1HO1A 4X3ZA 1H62A 1T41A 3IS4A 1SZRA 2VFHA 3ARYA 3W2NA 3WX7A 1R3SA 2CPUA 4D6GA 8TIMA 3LBMA 1F2JA 5CAKA 1R0MA 4C6JA 5C8BB 2QS8A 3ZT7A 1XH1A 2O4QA 4Y2WA 2A3BA 1WZLA 1PUDA 3D3FA 3ABXA 3W2JA 4GBDA 1IT8A 4NXSA 3GQYA 5JXQA 2PGEA 3TMQA 1E4MM 3TR9A 5DO8A 2OX1A 4RKAA 4G9PA 4B16A 1GPFA 4L4MA 1UA7A 1AUSL 1IWPA 4H83A 3TNBA 3VUPA 1ICQA 3W2LA 2WJFA 2NV1A 4Q6JA 2XJ7A 3SECA 1TMHA 2G41A 1C8XA 3P82A 1L6YA 1VCVA 4RXFA 1OIFA 1JD7A 3R5EA 3JS3A 4E5TA 6XIAA 5KZ6A 4FX6M 3OQ8A 1VRDA 4UTFA 1I2NA 2BSLA 1XLFA 4H2HA 3ZJ6A 5JH1A 3VCRA 4LFYA 4ORMA 5HATA 3FAWA 3LZ5A 1ZHAA 5U7SA 4JTFA 2O9PA 2A3HA 5K9XA 3DFNA 3UD6A 3VIHA 3SY5A 1E1EA 2EPNA 4LC8A 5BMXA 1O68A 1JNEA 2C15A 3H4GA 3EWYA 9CGTA 2ZUNA 4V15A 3LSBA 1QBAA 3WFAA 4MYAA 1FQ0A 5G4EA 1XCWA 3W7QA 4IGSA 4YTUA 3LOTA 4D71A 3M0IA 2ZXQA 2VRQA 3T78A 1XP3A 5FCZA 3I6EA 3VNZA 4UTLA 4YHEA 2VENA 5F4XA 3EWBX 1WP6A 3WD1A 3N34A 4BZYA 2QVHA 4FK9A 2VGBA 4G56A 2HBXA 5LNSA 2R9RA 2ANUA 5HANA 2D73A 1NDVA 2H8XA 3L5AA 1A5BA 4XKYA 3K30A 4E2BA 3T0TA 1K9DA 4YMZA 3FSUA 4DI9A 4UFIA 4CD4A 4R7WA 3POCA 3T09A 1CCWB 4S3KA 1JPMA 4P8VA 2GDQA 4DWSD 2YSWA 4LWWA 1BKHA 5EBAA 3PG8A 3MHFA 2ZUTA 3WDIA 4HNVA 4PRWA 4QISA 3EDFA 3WBAA 3QLDA 1K7EA 1TB3A 4XBSA 3R7MA 5EL1A 1WB0A 7ODCA 3ARQA 4UTKA 2BHUA 1LTDA 2DSUA 1QI5A 4CEXC 1W9BM 3GH4A 4W7WA 2QJJA 1VHCA 2X2YA 2EXOA 3KAOA 2X16A 1JRBA 2O92A 1PZ3A 5DN1A 4ZQCA 1XX1A 4MJMA 4AIOA 2WMGA 1A80A 3F03K 1J12A 5D4YA 4IPPA 1GVYA 2F84A 4F0RA 1YTKA 3WL1A 3UWUA 4E2VA 3SUWA 3OLIA 3OW1A 3IJ8A 1P43A 3MWAA 4IP4A 1VFSA 2J6VA 2CZFA 4OBSA 1E15A 2CW6A 1GOOA 4QFUA 3IACA 2YX0A 1EJRC 1SW0A 3FGCA 1JPDX 4H9VA 1WAWA 3GFZA 1TV4A 1GG0A 1CPUA 4L6OA 1PKYA 3PP7A 3QM3A 1WUFA 3ZO9A 4WQ6A 3GUWA 1KGUA 5BOFA 1EHAA 4LPCA 2HQAA 2WAGA 2I56A 2NQ9A 3UPBA 2QGYA 4H04A 4O4WA 1WO2A 4F79A 3QYQA 2XIBA 1EQCA 4IGMA 1PZ1A 2ZA1A 4W87A 2VDGA 2D23A 3HPSA 3MI6A 2IKIA 4LVAA 5F2MA 4V2XA 3P7YA 3V5CA 3FOKA 2VZOA 1CXLA 3W02A 3HBLA 3T0DA 4IQLA 4JDYA 4BF9A 4DJED 2NT1A 1CXKA 1QNSA 3MMDA 4C90A 2YB4A 3TWAA 2HTMA 5EPDA 1K03A 1J79A 1UQZA 1BHGA 1B31A 1RPKA 3LHYA 3QC3A 2IKHA 4AEEA 1R8LA 3LTPA 4BS0A 3UZJA 2I14A 5BWAA 3UNDA 3CZJA 3ZLHA 3BJSA 2ZRUA 3O1NA 3H2NA 3ME3A 5LIWX 3BCJA 3VNYA 2IQ0A 1NU5A 1B3OA 2AQWA 4GY0A 3CBWA 2VURA 5I02A 4INFA 1V6VA 3QKEA 3DFQA 4DM1A 2C1GA 4XQ6A 3QFWA 3TA9A 1BG4A 1TJ2A 2AL1A 1TRIA 1KBKA 4XZHA 3IJQA 3NEVA 1EIXA 1WE5A 1CECA 1Z89A 4MZ1A 1PTAA 2HXTA 4EAYA 4GHRA 2WCAA 3NXFA 3KXQA 4XAZA 1WDRA 3REQB 1J0ZA 2KX9A 1TTPA 3BG3A 1JULA 2ZC1A 5AC4A 1DJXA 3NA8A 1KLYA 4ZODA 4JKMA 3W1NA 1M7OA 1Q6QA 5J8LA 5KSWA 5LGZA 2HPMA 4UTTC 1CGTA 1HJSA 1GQJA 4AMAA 2DZVA 4S3AA 3STFA 3W81A 2DZBA 3U5YA 4GVFA 3M7WA 2X0HA 4JICA 4IPIA 3AXHA 1BPLB 4RPPA 2XVKA 4ILSA 1OG6A 3GRIA 4LCRA 3RX3A 4PTDA 3MO7A 2YXXA 3UG8A 3U5UA 2QR6A 1JCXA 1HP5A 1NFGA 3B9OA 4C6CA 1ZUAX 3GAYA 3P0XA 1S2VA 1TSIA 1UR1A 1HKIA 4WJEA 2YYUA 4YVPA 1VFOA 2NQ5A 5CSYA 4B4FA 1AL8A 1UD3A 4IQEA 4CN1A 1HJXA 1JD9A 1PDYA 1SSDA 4NILA 4AIUA 3C61A 4GUHA 1DJWA 1SO6A 2IPWA 3G1YA 3WQPA 4UTTA 1W54A 5AHLA 4QM1A 3GDKA 1KM4A 3BVJA 4AC7C 1F9CA 1EC8A 2WMJA 3OBEA 1YE4A 1XM3A 2ZYFA 2V5BA 1XBXA 4LAZA 2DFAA 1MQPA 4HNCA 2ZTJA 1MMFA 3ITCA 3E6EA 4ZXLA 3TN3A 5MF5A 2CETA 4O0KA 4TX6A 1Q65A 4ERAA 5DY2A 4BF7A 1KM5A 3SCTA 1ODUA 5E6YA 3W1RA 5IFPA 3KTCA 7A3HA 4N4PA 2BVDA 3UXLA 4LC6A 1Q3NA 2ZRYA 3SSZA 3P3BA 3RAOA 2OO0A 3W82A 5A3HA 2R1MA 2QPXA 4PMZA 3GFXA 1MZHA 4OTKA 4LY4A 4WRHA 2F2HA 3AIQA 4J28A 4A6GA 1YQ2A 4C60A 2Y1HA 4UR8A 5BXTA 1W9VA 1N2VA 2G8ZA 3UXDA 2WKLA 1I45A 1LBMA 2Z24A 1PS9A 4IOTA 2Y5JA 3AUOA 2PSNA 3BG5A 1KBIA 5LA1A 2VOMA 1Y5XA 3LXBA 1V51A 2VZTA 4HQVA 2OJPA 2VDHA 1EP2A 2BY2A 3UU0A 3G8RA 3PJWA 1H0GA 3KWSA 2WJZA 3MP3A 1RJQA 1A5SA 4B90A 3S6TA 4AFYA 3MUZ1 3SFKA 4A3RA 4M81A 5A6MA 3TQKA 2WLYA 2GSEA 2YYTA 4P8XA 2DIKA 1ZALA 1PHWA 2YCIX 1SR9A 1UR9A 1FX6A 1L8PA 3TC3A 1MNSA 2O55A 2WMFA 4ZGYA 4HHHA 3L23A 4XD3A 1KTNA 1H7PA 3VNIA 1KCXA 4J3SA 2ATSA 1JL8A 3QKZA 4ZQOA 3E0VA 4AWUA 5ABEA 3OEXA 3B06A 3N9KA 3ISIX 1YXCA 1EJSC 5I00A 3EA1A 3ZM8A 2GQ8A 4N4QA 3QPZA 4OVXA 4YYFA 4IJCA 2YZRA 4PRRA 4R7JA 5E6ZA 3WQDA 1XG3A 4FOUA 3PUEA 4IXXA 3B97A 3WJSA 5FJOA 4IG2A 3HU7A 4C6KA 1ONRA 4EF8A 3B4YA 3KVLA 1OYBA 4ALDA 1KTBA 2AGTA 3AIRA 2ISSA 1W6TA 2C19A 1U5VA 4NU7A 4MDPA 1BLIA 3UFYA 1AZ1A 5HNNA 5H1WA 2YXOA 5FL1A 4ATDA 1X39A 3UW6A 1FWEC 3ANUA 3PTMA 4A8NA 1ML1A 2GL5A 1NP2A 1Y0EA 1JI1A 5LIXX 3PS7A 4HZ6A 5EB8A 5D9NA 2GSHA 2PA6A 4HU4A 2GUBA 2G37A 1FHLA 2JIWA 2RDXA 3EB4A 2Y89A 4O12A 3FIGA 3LMZA 1WBJA 2DJXA 3DG7A 4R9OA 3UJRA 4I3GA 4DELA 1RD5A 3NQBA 1OCJA 4PB4A 5HR7A 3PAJA 2XVNA 3DECA 5BROA 4M6QA 5CCZA 3NSXA 4PCTA 1SPQA 1FWFC 4XO7A 4JY8A 1IT0A 3DZ1A 4BKNA 4LAKA 5CPSA 3RR1A 1NTHA 1PE1A 2D69A 3CH0A 5I03A 1A0DA 1UD5A 3CQIA 4D8LA 2VFGA 2R14A 3H2FA 1H4PA 3G1DA 5LHEA 1NAL1 1CXEA 3G8EA 4ZE4A 3DKLA 1LWJA 3GVGA 3W84A 1AQMA 4GC4A 1KLZA 1JRCA 1LOSA 3C6CA 1JCNA 3VCCA 8CGTA 1QW8A 2VI0A 4ZO6A 3B9EA 3SCWA 1A5NC 2HDJA 2YA1A 3AOFA 3M16A 4DLFA 5JUVA 3WBEA 3SAZA 1K7XA 3GDRA 4AISA 4ROPA 3W7EA 3AZTA 1DTUA 1M7JA 3EEZA 4CKQA 2QQ6A 1LF1A 2QCDA 3HJZA 1F7BA 3FA4A 1EXBA 1R46A 1BRLB 2E28A 2GGIA 4CNTA 1Z8AA 3LBOA 2GJLA 3OOQA 3WEOA 4D6IA 1F3EA 3L2MA 4DYEA 1YBQB 2RGLA 1ZP3A 3PWGA 2DIJA 2BGQA 2WMKA 2OMAA 4NZ1A 3N11A 2ACRA 4K37A 2WV8A 3E96A 1FBAA 1YXDA 3GR7A 4ZTYA 1IWAA 3LS9A 3I68A 4I5UA 1KTCA 5E5CA 4E4FA 4HNTA 1OWQA 3L4XA 2YDRA 1YEYA 2X7WA 2EBNA 2NVDA 1XSKA 5HPOA 4QR6A 3AIVA