2BWGA

Structure of human guanosine monophosphate reductase gmpr1 in complex with gmp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
337
structure length
335
Chain Sequence
PRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GMP REDUCTASE I
publication title Structure of Human Guanosine Monophosphate Reductase Gmpr1 in Complex with Gmp
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 114
structure length 335
sequence length 337
chains with identical sequence B, C, D
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bwgA00
4GUFA 4JY9A 3A23A 3PUEA 1O5XA 2CZEA 3PY2A 3WJZA 5D30A 5TBOA 4O0ZA 4UTWC 3UPBA 5I3JA 5EBUA 2VFEA 1RZMA 1D3GA 2VXNA 3NQ2A 4M7TA 5CSSA 3C8FA 3LDVA 5AYYA 1Q6RA 1KTNA 3Q58A 4QAIA 4H6KA 3O6CA 2VC6A 3OEXA 1XUZA 3UYCA 4GJ1A 5CPNA 3C3NA 3LBCA 3GXPA 3STCA 3GVGA 4FX8A 3O63A 1FUYA 4WOZA 1WBHA 1QPOA 5EKYA 3F1QA 1BWLA 3TSMA 3W74A 1H63A 5F2MA 3HG2A 3P74A 2C1HA 1TO3A 3L21A 2V8ZA 3QZEA 3O6YX 4N9CA 2RDWA 3CWNA 3LX9A 4JTFA 1Y0EA 5E93A 3LV6A 4MZYA 2GOUA 1H1ZA 4R34A 3S5YA 4Z1CA 3BV4A 1F6PA 4P2VA 3NPVA 3QW3A 4UTTA 3O15A 5DY3A 1XBXA 4MY8A 4QIUA 2P1FA 2HSAA 2YFOA 5C55A 3DFNA 3W2LA 1S5TA 1TTIA 4UFMA 1NFBA 5HUOA 3LHTA 3R12A 2YYUA 4OBTA 3NL3A 4O57A 3QQ0A 4UMBA 4AWUA 3OIXA 1SZEA 1P1XA 3B04A 1LRNA 3O8AA 5DCEA 1LCOA 1H7RA 1J5TA 6TIMA 4UC5A 3B06A 2A7PA 4HPXA 1K7FA 4HN4A 3LHZA 3DI1A 4LVFA 1G4PA 2QKFA 5BMXA 3NAVA 1TRIA 2Y7FA 1JQVA 1WDWA 1VLWA 2V9DA 1CI1A 1OX6A 4E2DA 5D04C 1YYAA 1S5WA 2PCQA 2X16A 4BI6A 4CNNA 4XBKA 2ISVA 2FB3A 5D03A 4K8EA 2J24A 4ORMA 1GTHA 1RQEA 1SO6A 5AC6A 2C3ZA 4HSNA 1UUOA 4WY0F 3DFPA 3OVRA 4ORIA 5DLCA 3TDFA 1B4EA 1MEHA 3DFQA 4G1KA 3LGEA 1DORA 4ZQRA 1XDLA 3CM4A 3PC0A 1ZNNA 3NPXA 1ZAJA 1RPXA 2OMAA 4CQ9A 1SZFA 1EB3A 1D3HA 3FS2A 3G1YA 4MY1A 3LRLA 3KOFA 3USBA 2Z1BA 1A5CA 3FYOA 4HNVA 4TMBA 1EP2A 3IIPA 3T40A 3QPYA 4EWND 6ALDA 3DHDA 3L0NA 1B9BA 1A5AA 3PBVA 1AMKA 3OG3A 4XTDA 3R13A 3LHVA 1JCLA 3QSTA 4O16A 5D02A 4AXKA 4EF8A 4O53A 3IEBA 4A3UA 4E2BA 4WX2A 3QF0A 2J27A 3DFOA 3C6CA 2BWGA 2QCDB 3M6YA 3W7KA 3TU9A 4TO8A 3HF3A 2Y6ZA 2TYSA 3RF9A 1K8XA 1GVFA 4CQAA 3MP4A 2GVJA 4OHQA 2XN0A 1L9WA 4UCGA 3D0CA 2QDHA 3KRSA 1D9EA 5K3VA 2CLLA 1TRDA 1TTQA 4K38A 1TREA 1YDOA 1LM1A 4MIMA 5BRBA 2A85A 2ZTJA 3SZ8A 4EOUA 2G5WA 1ML1A 3ABRA 5LNUA 3TC7A 4ZQNA 4Z1BA 1P5BA 1ME9A 3UY8A 2VEIA 3MHGA 5D37A 3T78A 4AF0A 5K2ZA 3C52A 4OWGA 2CLFA 1UJPA 3W9ZA 1KV8A 2H6RA 4XQ6A 3LHUA 1KTCA 4GC4A 2QAPA 3DENA 4LVGA 3TROA 4GUHA 4RZ6A 4JICA 2P0OA 3DFSA 1YDNA 1QDSA 4N02A 1W3TA 4J9JA 3SIZA 4PODA 1EP1A 1SO3A 3NOEA 2YW3A 4LVAA 3A22A 3EB2A 4WY0A 4UMAA 1QPNA 1UB3A 3L67A 3NPWA 4EF9A 5H2ZA 3NL6A 3O6DA 1VYSX 3QM3A 4I9AA 2Z6IA 2Y63A 4RJEA 3GDMA 1FCQA 2VENA 1NVMA 1WYIA 2ATSA 1YTKA 4ONVA 4RZ5A 4Z1DA 4YMZA 5CZSA 1Z41A 3WJYA 4O10A 3P7YA 3W1XA 2YW4A 3P81A 1ME7A 2BX7A 3HBLA 1TCDA 3NPUA 1R47A 3LCXA 4IMFA 3MYOA 1KM2A 2H3BA 1LDCA 2NX9A 4Y9AA 2Q8LA 5ABTA 2DORA 4UTKA 3S5OA 3GYEA 1B4KA 1EEPA 5EMUA 1Z48A 2ZYFA 4LU0A 4I7VA 3KRUA 1KM6A 1PVNA 2DU2A 2DJLA 4LUIA 2BXVA 4KFPA 3DHFA 5C6MA 3QMRA 1UCWA 5F4SA 2E5DA 1FDZA 1T99A 3M5VA 2YFNA 1GOXA 4O19A 4MVAA 1YDVA 3BLIA 4GWEA 4DEFA 3W2KA 1LLZA 4A22A 1FCUA 2C13A 3RK8A 1F5ZA 3N34A 1LRQA 4HT3A 3W2JA 4DXVA 3ABQA 4LVDA 2X1TA 3G24A 1X1ZA 3S0CA 1VLIA 2H8XA 1KW1A 3UWUA 1XCFA 3UWQA 2RHGA 2EAWA 3E96A 1SSGA 4O1BA 5C2XA 3S9YA 2ZRZA 2GUUA 1ICSA 5HWMA 1FQ0A 1BTMA 4GUGA 4IPIA 1OX4B 4DQWA 1DKWA 1B3OA 3A24A 3KFTA 1GT8A 4KFNA 4JY8A 1FCBA 4WJEA 4O8RA 1TJPA 3W70A 4GBUA 2ZZ3A 5EYWA 1E51A 2A6LA 4Y96A 1TPEA 3MI6A 1PCKA 3IRDA 3L68A 4FNQA 3EWBX 5HMSA 4QNWA 4XBSA 2B7PA 3R8RA 2GVLA 2DZUA 1LOSA 4GXMA 4MY9A 1OHLA 1A5BA 5I3IA 1GZGA 1S5VA 3CHVA 4JS3A 1EUNA 1SFLA 1C29A 3BARA 2FPVA 2TSYA 3C2OA 1W3NA 1DV7A 2V82A 4YL2A 1ICQA 5G2IA 3EX3A 1SW0A 4BI5A 3W7DA 5EA9A 1TQJA 4QQ3A 1Q6QA 5KSWA 1VRDA 2FJKA 3UY7A 4AWSA 4NQ1A 4JTIA 4ZQMA 3HMJG 3PBUA 1SO5A 4UTMA 1EX5A 3W1UA 2C19A 3EXTA 2Y7EA 3F4NA 3PSVA 3LXAA 3C2EA 4NX5A 3HO8A 3FOKA 3W7OA 2QAFA 3KRZA 2YYTA 3NR0A 3DBPA 4M19A 2QCFA 2V81A 1PV8A 5FEZA 4CCDA 2W0UA 5FF2A 3G3DA 2NLIA 4WOQA 3PB0A 3DKJA 3NQ8A 3W76A 1GYNA 3GZ3A 2WNZA 2UV8G 3W71A 3O1NA 1TPFA 1TPWA 2BSLA 3TIMA 3NQFA 4M6QA 4UIOA 4S1FA 5KITA 1TTJA 5D2WA 4LVBA 2NX3A 2ABAA 1U83A 3HJZA 1ADOA 3PF3A 3W7PA 1OJXA 1ZAIA 3LCFA 4LRSA 4NJIA 3FYPA 3FEMA 2HTMA 3NQMA 1GYLA 2WJZA 1OK6A 4DF0A 2VOMA 1NF7A 1QR7A 1QWGA 1VHCA 3UWZA 2VFHA 3T55A 3G22A 2VKZG 4FO4A 1JUKA 1XBZA 2FFCA 3IGUA 4XTIA 2AQWA 3CEPA 1OVDA 1VC4A 1BKSA 1VQTA 3BW2A 3C56A 3G1HA 3W88A 5A5WA 3E02A 2CZFA 5AHNA 1SFJA 7TIMA 1B57A 4BWLA 1DOSA 1W5OA 3OVQA 1K8ZA 1KFLA 4L4LA 1YXDA 3LOTA 1WAUA 4LS0A 3EX2A 2EKCA 5BMWA 4NXKA 3ZR4A 1A53A 2G95A 2XN1A 4ZQPA 3IIOA 1TB3A 2ZZ5A 1ICPA 2V2CA 4O17A 1XXXA 1X6UA 3TMQA 1VZWA 1QAPA 3DXIA 3TQVA 5AHEA 3M0ZA 3I7RA 1HUVA 3CC1A 3W7HA 1H62A 1DJQA 3HPXA 1LTDA 4A2RA 3GR8A 1MXSA 2PRMA 4FF7A 4MYAA 4IXXA 5AHMA 3W1QA 1XC4A 1WA3A 5FESA 1MO0A 3TH6A 1H60A 3NQCA 4NU7A 4XZ9A 2VELA 2ZA2A 4LUJA 1WQ5A 2TPSA 3Q37A 3SFKA 2NV2A 2QCGA 4ZMGA 2X1UA 3GAKA 1QPQA 3BW4A 3EXSA 4UFLA 4PCFA 4LC8A 3MWAA 1ZHAA 1YXYA 2YCEA 3FLUA 5DCDA 1TTPA 4LV4A 5FEXA 5LNSA 1YPIA 3W1MA 3QW4B 1AW1A 1VJIA 1VCVA 4AWTA 1Z44A 2J9YA 1W5NA 2Y7GA 3TA6A 2J9XA 2TRSA 2DZSA 2E6DA 4O15A 1OFQA 5H91A 2CZDA 2FTPA 4WZHA 3PBYA 3THAA 3AJXA 3EX1A 1RQHA 3BO9A 2Z6JA 3MW7A 1FX6A 4QM1A 1H7PA 2A0NA 1JRBA 4DO6A 2B4GA 4RLIA 4NVTA 2NX1A 3GAYA 4QITA 3GR7A 4IWWA 4IQLA 5HQEA 3E12A 4JEQA 5AFDA 1VYRA 5BW6A 5MHBA 3B0PA 3HG5A 4PH6A 4WXYA 2YDAA 1LYXA 3QPZA 3LTSA 5DBUA 5KZDA 3W84A 4Z0SA 4RCXA 3TAOA 4UTIA 3W86A 5DXYA 4FB7A 4O0KA 4TX9A 1K02A 1LOLA 3MI3A 2R91A 1C8VA 1SPQA 4QJ1A 4Q4KA 2PRHA 1PIIA 2WNNA 1SW3A 1W37A 3JS3A 4FNSA 3IGSA 4UFIA 2Q3RA 3TV8A 5K4XA 3MHFA 1OYCA 4YLWA 4RK8A 4DO4A 3DAQA 2HS8A 3KVLA 2ZZ4A 2FQIA 2ZZ7A 4HNNA 3LBMA 3GDRA 1U5JA 3N14A 2VFDA 1XL9A 1H5YA 2GJLA 3BLEA 3JRKA 3W75A 3PBWA 2X30A 3STFA 3BLFA 5FI8A 5DXXA 3W7EA 5AC7A 1THFD 3F4WA 3PB2A 3M9YA 2C6QA 1DL3A 4OU1A 2P10A 3O07A 2GQAA 4N6EA 1TIMA 4S2CA 2Y62A 1JCXA 3WFAA 4HKPA 2VFFA 1GVOA 4JDYA 1YXCA 1EPXA 3MO7A 3W6YA 4WXZA 3TW6A 2NXHA 1LP6A 1IF2A 2E77A 2ZCGA 4JYDA 1H51A 4O14A 1G7VA 5KINA 3IVSA 2NZLA 4NZFA 1EA0A 1H7NA 4AVFA 3QYQA 3N9RA 4ZQCA 4X22A 5IBXC 4UFJA 3GDLA 4JTGA 4O1CA 3RFAA 5D32A 2DP3A 1RVGA 2QJIA 3NGJA 3TX9A 4NNCA 5F2IA 4C1LA 3KX6A 5LNWA 1SU5A 3G18A 3QJAA 1N8FA 1K7XA 1P4CA 3OVPA 4HPJA 1KM3A 1XDMA 3CB8A 1K03A 2AGKA 1HL2A 1ZCOA 2VFGA 4NT0A 3N2MA 3BGGA 4MFDA 1SQ7A 5CPMA 3P60A 3PR2A 1RQBA 1OX5A 1UUMA 2A5HA 1FWSA 5F4XA 4LNYA 1G4EA 3LI0A 1W54A 1LRTA 2Z2UA 4H3DA 4L4MA 5D2XA 3NYZA 4K8HA 3P62A 5AHFA 3NXFA 3GNNA 3R5EA 3LCHA 2TMDA 2OCZA 2QUVA 4O11A 1WOAA 5G2WA 1ZY9A 2DZTA 1I8JA 1R30A 1GVSA 3C4UA 3LCGA 4DBEA 3INPA 3S1UA 3HB9A 3B4UA 1JQXA 3HG3A 4LRTA 5E0KA 1MEWA 3FKRA 3A5FA 4TR9A 3P5YA 4O13A 3N73A 1QFEA 4FHAA 4JTJA 4CCEA 3UWVA 4FIRA 5SWUA 2OT0A 2XN2A 1KM1A 1W5QA 1NSJA 4XKYA 5K9CA 3UXAA 4JTSA 4R7JA 4KFOA 4YXGA 4RKAA 3NG3A 4U4MA 3Q2DA 3ATYA 4KWWA 3UZ5A 3MHUA 1T0OA 1KV5A 3G8RA 5HR7A 3AO0A 4NJJA 2X2GA 5LHEA 3W72A 1H7WA 1ZALA 1C9DA 5F2GA 1LZOA 2QJGA 5HULA 3ABOA 3PWAA 2ZRVA 4IOTA 3VFLA 2B7OA 3LLDA 4Q32A 4ALDA 3UQNA 3E0IA 1QCWA 4BF9A 5FF4A 1WOBA 4M6PA 2ZRYA 5U4NA 4IMCA 3W2UA 2QUUA 1SZNA 4Y8FA 1I2QA 1QO2A 3LRMA 3TSDA 2NWSA 1M5WA 2BZNA 3LI1A 4IMEA 3K30A 4K7YA 5DCBA 2ZQ0A 4UUIA 4JGDA 2G96A 5HWJA 5TIMA 4UTTC 4NXSA 1HFBA 2CW6A 1Z42A 4O50A 2BTMA 3QSRA 1WBJA 4LY8A 3M44A 3LTYA 2YXGA 1W56A 2RKXA 2GQ8A 4DF1A 3NL2A 3FA5A 3W22A 3EWUA 1KLZA 3W7MA 4ZQOA 3B03A 2EGZA 2WQPA 4MJMA 3DH7A 4HSOA 3CT7A 2YSWA 1X7FA 2CLIA 1BWKA 4X2RA 3MI2A 3M5XA 4ML9A 1AW5A 4I7WA 2YGYA 2NXGA 2C16A 1O94A 3CQ0A 4AF0B 1PS9A 3U2OA 3NM1A 1AL7A 3PUDA 5AC8A 1TPC1 3G1XA 4TU1A 2JBMA 3FKKA 1SZGA 3NO5A 5D2YA 4ZVJA 1J4EA 4Q33A 2IQTA 1QOPA 3TAKA 1TYGA 1OX4A 2W79A 3TK7A 5LZLA 1KFJA 1P0NA 2O7QA 4WY0B 3P67A 3QQ1A 4FX7A 1F73A 5CZTA 1AL8A 2C18A 3G0SA 4MFEA 4O18A 1F76A 1R2SA 5DY2A 1VPXA 2V2HA 4POCA 1VGAA 3U8GA 1M7PA 3G1DA 3M5YA 1OYBA 5CKSA 1F05A 1KTBA 3NL5A 1CW2A 4ZL1A 1SUXA 4E0CA 1VS1A 3HOJA 2Y70A 4DO5A 1FWRA 1W8SA 5HR6A 2E1DA 2X1SA 3BPWA 4UTLA 4RV8A 4DF2A 5IM51 3UZJA 3WK2A 2EF9A 4JTLA 3VE7A 1YTEA 4NJHA 3QMTA 5LKYA 3LCIA 1QOQA 2WSYA 4YCOA 1KBJA 1XBVA 3GDTA 4IXHA 3SR7A 2PRLA 4E38A 2DZPA 3SECA 2DZVA 4O54A 2Y88A 1YTDA 3LHWA 3STEA 1DVJA 1HO1A 1R2TA 1KM5A 1OABA 1GJPA 1FWTA 3FJLA 2Z0IA 2CZ5A 3S8HA 1OFDA 3L0KA 2NXIA 4O1AA 1GWJA 3HPSA 4UTWA 4JX5A 3EWYA 3P82A 3B0UX 2G97A 4FNPA 3TXVA 3MP3A 4DELA 3SGUA 1GTEA 1GVQA 1IIGA 4JIPA 3RLUA 1FWNA 1JUBA 3KHJA 2OZ0A 3LHYA 1JUEA 4Y6GA 3P80A 3C61A 5K4ZA 2ZZ2A 5F2LA 2A1YA 2EHHA 1LBFA 5DELA 2B7QA 3EWZA 1V7YA 1M6JA 3V75A 3W23A 4MYXA 5F1VA 1H1YA 1GEQA 1UBSA 3H53A 4FIQA 2VEKA 1L6YA 4M7SA 4GRSA 2GQ9A 5D2VA 2CWNA 1HO4A 4HIBA 4R33A 1L6WA 3UNDA 5LSMA 3W3OA 4O4VA 4NX0A 5BOOA 1LBMA 1H50A 1JR1A 4MLRA 4AEOA 1AK5A 3EX4A 3GDKA 3TJLA 1LLWA 3PM6A 2H8ZA 1XM3A 3TW7A 1EIXA 5LNVA 4OT7A 1VH7A 3HG4A 5LGZA 3BG5A 3QFEA 4N9DA 5D05A 4XWUA 3BVJA 4Y90A 2E5CA 2ZBTA 3IIZA 2NUYA 3IV3A 3SW6A 3EXRA 4QNEA 2E68A 3FJ6A 4FNRA 1OF6A 5CZ0A 3W7NA 3N2XA 4BR1A 2A6NA 2WSRA 3DI0A 4U28A 4MZ1A 1X1OA 1ZENA 3I6RA 3WK3A 5K9DA 1RR2A 2C0AA 1JULA 1JJKA 3PVFA 1GPWA 3MMTA 4O52A 5I3KA 3GX9A 4TIMA 2V2DA 2WOQA 3C2VA 5CPOA 5G4EA 3NQ6A 4AHOA 3CWOX 1L2UA 4Z0JA 1LBLA 3KAOA 3PSWA 3JR2A 4GE8A 2DZWA 5D2TA 3W73A 2VEMA 1TQXA 1W0MA 3HIJA 2ZRWA 4JX4A 1FCVA 3N19B 3W2NA 1ALDA 1OFRA 3TMLA 3B0VC 4OQVA 1XUUA 1SO4A 4WUIA 2CU0A 2DJXA 4TMCA 4B5NA 2Q3OA 3A5VA 5AN7A 4GUIA 4UMCA 2JKEA 4IUOA 3T7VA 3W1NA 4M5PA 3TXZA 4ZZ9A 3EX6A 3W7IA 4D2JA 2A7RA 5FEWA 2OT1A 1SSDA 3OHIA 2ABBA 4CNOA 4ADSA 1WX0A 2PC4A 1IIHA 4UTHA 1PHWA 5I3HA 1A5SA 1JCYA 3H54A 2NUWA 4IPJA 3GLCA 2RDUA 3LXBA 3EWXA 4WQ6A 4QSHA 1OYAA 1TPUA 3E49A 1QMLA 2GVGA 1IGSA 3PG8A 4PEKA 4UXDA 3OA3A 4GNJA 4CLMA 1FXPA 4JTUA 1HG3A 4IX0A 2R14A 3WJSA 2WKJA 3ZWSA 2E6AA 4UTJA 3BK0A 4JTKA 2RFGA 1TMHA 3T44A 2H3DA 3P61A 3EEGA 4FNTA 4JN6A 1TPB1 1TV7A 5LHFA 4NJKA 5EY5A 2QCNA 1K3UA 3SJ3A 1KFBA 1VCFA 3W1RA 3CIWA 1A50A 4O1DA 2JK2A 3W7JA 5KTLA 3W83A 1R2RA 2WV8A 4LT9A 4MLJA 2QUTA 2ZRUA 4N4QA 4IGHA 2A4AA 1RV8A 3GNDA 2CLEA 2QCLA 2X1RA 1TSIA 4GFSA 4EIVA 3NQVA 2B7NA 1XBYA 4PC8A 3A9IA 3M5ZA 1QNVA 2ZFAA 3M41A 1OFBA 2D73A 2ZTKA 5D09A 1DQXA 3NQEA 2FPYA 1ONRA 3TFXA 1F74A 5AB3A 2YR1A 4BK9A 1LROA 3L66A 4PL1A 3I65A 4LOCA 2WO5A 3SSJA 1DHPA 5CGQA 3W85A 2PE4A 3NQGA 3W7QA 1MEIA 3DFTA 3P8JA 4RXGA 2NV1A 1G7UA 3BG9A 3SGZA 3S1VA 3SI9A 3I7SA 3N3MA 3L65A 3TSBA 3L5MA 5K7JA 1GG1A 2EPHA 1DJNA 2HS6A 4PTNA 3RU6A 3TKFA 4K6AA 3ATZA 1AW2A 3UWWA 4W9TA 4HHPA 3IVUA 3L0GA 1I45A 2J9ZA 3PAJA 1X8FA 5CPLA 5A8GA 3RMJA 4FXSA 5EL1A 3N9SA 2V0TA 4OE7A 2WPBA 3O16A 5KMYA 3O06A 4RXFA 3LRKA 3QEZA 5F1UA 3C2FA 3SY5A 3VI2A 4IJBA 4BWLC 2E6YA 1P0KA 4O28A 4MUZA 4P61A 4MJZA 1JCMP 3S6DA 4K36A 3L5AA 1KA9F 1O4UA 1OFOA 2QCDA 3TNOA 3KXQA 5FF0A 3CLMA 3BG3A 2QR6A 3ANYA 1GQNA 4KKXA 4X9SA 3W1LA 3NVTA 4IMDA 2V5LA 1JVNA 3U6WA 4ADTA 1TPDA 1QPRA 3LXCA 2QCHA 3HPZA 3TR2A 3TQKA 1KFCA 3CTLA 3LCWA 3S5NA 1Q45A 1YADA 2LLEA 5AYXA 1W31A 3L9CA 4DPQA 4S2BA 3ABSA 2C14A 3GK0A 4K39A 1FBAA 2A21A 3UXDA 4OV9A 4NJGA 5G1TA 1CX9A 5GVJA 4JYFA 3M47A 4AHQA 1FWWA 1H7XA 5FF7A 2FPTA 3S1XA 4R53A 4HNUA 4FX6M 4JTTA 3M43A 1JRCA 1IXNA 1K8YA 4LC6A 4RZ4A 3HGOA 3H55A 2QCEA 3BGJA 4FXRA 3G3MA 2ISWA 4IMGA 4M6VA 5HUPA 1I4NA 2VEPA 4JIQA 5HJLA 4A21A 1UASA 1WXJA 4UTUA 4I7UA 1XKYA 3DZ1A 3B05A 3DU0A 1H7OA 3OBKA 4MKNA 1M7OA 1Q6OA 3GXNA 5CSRA 3A21A 1YLVA 3NDOA 5KZMA 2JGYA 2QCCA 3O05A 3THQA 3HGRA 1FY6A 3TC6A 5G4WA 3R89A 4N6FA 2RH9A 4UFHA 2C15A 2J88A 2YZRA 4AH7A 2OX1A 4CQ8A 3PG9A 1NAL1 4CNPA 3NA8A 1G69A 5EPDA 2Y7DA 3S1WA 2BLEA 1N55A 4Z1AA 1G6CA 4UNKA 4WD0A 3I68A 1ZAHA 1KLYA 1XI3A 2Y89A 2FDSA 3MP5A 1KBIA 2I1OA 3M7WA 3TQ0A 1FDYA 2PURA 3WJXA 1F2JA 5C54A 4XKYB 3GXTA 2CLKA 3LCLA 4CCCA 2QJHA 5F4WA 3CEUA 2W6RA 2FLIA 1OFEA 4XUGA 2ZA3A 5AHIA 3NQDA 3WJWA 5HWNA 1W3IA 3QRHA 2O7SA 3NQ7A 3TUUA 4QISA 3ZWTA 3NNTA 4UFKA 3LTPA 3TE9A 2E6FA 2OJPA 1OF8A 2HMCA 3V1PA 2VFIA 4KWVA 2NUXA 3KVKA 5E1QA 5HNRA 2JKPA 3TFCA 1S3HA 1G4SA 3W1AA 3LERA 3FIGA 1W5PA 4JDBA 3MBDA 2CLMA 4LWWA 1O95A 1PCWA 2E5BA 2WSQA 1MZHA 1PE1A 3GB6A 2R8WA 1G4TA 2ZRXA 2A2IA 2CFFA 4PA8A 4JXCA 1NF0A 1IXPA 2GJNA 4AHPA 4MPQA 3F03K 4JD4A 5CZJA 3ELFA 4K37A 2QF7A 3RLVA 1ME8A 3T4CA 4LW7A 5G1YA 4JR5A 3P84A 4BFAA 3UPWA 2I9EA 3DKLA 3EKZA 1TV8A 4A29A 3GKAA 3ZFHA 3GIYA 4ICNA 1L6SA 4OV4A 3LV5A 4K7VA 4NZJA 1EWEA 1QO5A 1ZJIA 3PULA 2XFWA 5C5YA 4LTSA 4BI7A 4FEZA 1JCJA 5LNRA 3NQAA 2CLHA 1RD5A 3G8EA 1W5MA 3PUOA 3CPRA 1R46A 4UNLA 3G1SA 3DGRA 3PS7A 3MUXA 3W1PA 2YX0A 2ZZ1A 4JX6A 2H90A 3W07A 1I2NA 2FIQA 3W7RA 1O60A 4HNTA 1OG0A 1N7KA 1I2OA 1TPVA 1I2PA 3WK1A 1I2RA 3NEVA 1DBTA 4JYEA 4NNBA 2WNQA 4Z08A 1F6KA 4O12A 3W7CA 5AYZA 5LGXA 5DBTA 1PL9A 2F7FA 3GKFA 3IVTA 3B8DA 1T96A 3G1AA 5FF3A 1AG1O 1BEUA 4DBDA 3P5ZA 1ZFJA 5BNKA 4C1KA 3EWWA 3HQ1A 5KZEA 1EWDA 3NM3A 3QC3A 2E09A 4N2YA 1G67A 1GG0A 4O4WA 1KFKA 4AAJA 1HTIA 1WV2A 1GVRA 3VKJA 3MBFA 1OK4A 2QCMA 3L5LA 1V5XA 2B0MA 1YPFA 1LOQA 2V5BA 3W2MA 2YPIA 4PFMA 2JKAA 4IX2A 5I3FA 2KZHA 3QH2A 8TIMA 3C2RA 4X3ZA 4A2SA 5K9XA 3MJYA 1MSSA 1O5KA 3L2IA 2I14A 4MOZA 1OFPA 3MYPA 3QMSA 5D38A 1T8XA 5L6UA 2A7NA 3W7GA 3VNDA 3Q94A 3VE9A 1F7BA 3G1FA 2ZA1A 1FDJA 4RR4A 2Q8ZA 2QEZA 4EVZA 4NNAA 1FXQA 4N9EA 5J5RA 2JGQA 4JTHA 1TJRA 2ATMA 3HGSA 3LB0A 5HINA 2AAMA 4JNMA 1H61A 4LS1A 5AHLA 3E9AA 1NEYA 3NZRA 3I7QA 3TJXA 5CG7A 4AB4A 2CLOA 3FFSA 1OFAA 4NUWA 3C0JA 3CIXA 3UWYA 1EUAA 2ISSA 1TPH1 2DZXA 3G0UA 1DQWA 1XFBA 2NWRA 3ZS4A 5T26A 3LLFA 2ALDA 2GPTA 1VR6A 3G1VA 3STGA 1IXQA 1Q6LA 1IXOA 4N4PA 1KFEA 3R2GA 5I3GA 4RX0A 1TV5A 3W87A 1LORA 1PHQA 2V30A 3NZ1A 4JTEA 3W7LA 5L9FA 3UD6A 1K7EA 2FB2A 4N9BA 2ZZ6A 3IIXA 2QDGA 4FNUA 2ZDRA 3WK0A 4YCPA 5AOUA 4ADUA 1JCNA 3M16A 3S5ZA 2F84A 1W1ZA 3VCRA 2RDTA 2Y85A 3HGJA 5TQLA 4UR8A 3S42A 4AMAA 3CU2A 1VHNA 5IBXA 3YPIA 3RNDA 4GUJA 1SW7A 1SR9A 1VYPX 3EKLA 3IIVA 5U7SA 1KM0A 3M1ZA 4LS2A 5FEPA 5DN1A 5G2HA 3TCEA 3KVMA 3P8IA 3KVJA 4LV9A 3LM7A 2J6XA 3BW3A 5J5DA 5D33A 3IGXA 4YWIA 5G5IA 4DPPA 1VCGA 2R94A 1J2WA 4MZ8A 4H4IA 4PL2A 1KM4A 4OGZA 3W1TA 3G0XA 1EP3A 1Q3NA 2Y61A 4UR7A
chains in the Genus database with same CATH superfamily
2ZUMA 1KGUA 3S4TA 4KESA 2CZEA 1VF8A 2Z2BA 3WJZA 3ARWA 5TBOA 4O0ZA 4RE2A 5AY7A 4UTWC 2YL6A 4URIA 3FDKA 3IPWA 2FZ8A 5BROA 1RZMA 1EBHA 3FVDA 3WLPA 3F4VA 2XVLA 3IANA 3PZUA 5CSSA 5ABGA 3QPEA 2VWTA 2WB5A 2QPXA 4H6KA 2XUCA 5CAHA 1CDGA 4GJ1A 5CPNA 3C3NA 3SN0A 3GXPA 3O63A 3IJ8A 4WOZA 3EWCA 3SURA 1WBHA 1QPOA 4JEJA 3GVVA 2E8ZA 2XPKA 3ZJ8A 4W84A 1TO3A 4FOJA 3EYPA 1YKWA 4HTBA 3HFTA 3CL7A 2JALA 1FVPA 2VGFA 4S3AA 4I6VA 1Y0EA 3OB8A 2OWWA 3LV6A 2AAAA 1ZBCA 3S5YA 4Z1CA 3T42A 1QW9A 4TVDA 3WLLA 5JBDA 2D0FA 3WQVA 1QTWA 5M17A 1XBXA 2A3HA 3R43A 2ZICA 2HSAA 4GIRA 2YFOA 4XIAA 3BOLA 4JQ4A 1X96A 1K8CA 1CXEA 3LHTA 5CGTA 3NL3A 5JQ9A 1SZEA 3CWHA 4QE1A 3B04A 4V1XA 1UQYA 1LCOA 3RCMA 1EH9A 3EOLA 3RCNA 3NTYA 2A7PA 4HPXA 3SCSA 3WLTA 4V1YA 3ZLFA 1TE6A 2VCCA 1G4PA 3CNYA 5DQPA 4AY8A 1TRIA 1WDWA 1BWVA 1WDSA 5D04C 1B30A 2BY3A 1UP3A 1SO6A 2AGTA 1JDDA 4Q8PA 1UUOA 1F07A 4HZ6A 3SB0A 3QY6A 4ORIA 4QLJA 2OWCA 4YYFA 3UERA 4MWAB 1J0YA 1DORA 1XDLA 2WBGA 3PC0A 1ZNNA 3CH0A 4HZ8A 2A3CA 2D69A 3T6CA 4K68A 1SZFA 3N1AA 4PTMA 3KLKA 1QJWA 1REQB 3DDMA 3WH7A 4J3UA 3T40A 1OIFA 2YA1A 2Z1VA 4QGCA 3ZT6A 1L0PA 4C1NA 3LHVA 4QHRA 1GYMA 1BVZA 2PDJA 4QR6A 2ZX7A 5A3HA 4EF8A 4O53A 3KCJA 2CKRA 4TV6A 4E2BA 3VIIA 3KTXA 3DFOA 4D6IA 2QCDB 4R27A 4KF1A 2VZUA 1H0GA 4YN5A 2Y6ZA 4WIWA 1GVFA 4CQAA 2GVJA 3FHQA 4XV0A 2DVUA 2VQTA 1L9WA 3RR1A 1F3EA 2OLSA 2W3ZA 1TTQA 1S2TA 3GNRA 6TAAA 4L9YA 1EJVC 1Q7QA 5BRBA 4AD2A 1HQTA 4H9MA 4QBXA 1X39A 1RD6A 1XLAA 4EOUA 2VMFA 1ML1A 5DRIA 2YBUA 3UY8A 5ECVA 5K2ZA 4LAMA 4PUMA 4Y9PA 5HNNA 2BXYA 1KTCA 4L6OA 4QJ4B 2QAPA 1K9FA 3DENA 4Q8MA 5CJNA 4GXWA 1JNDA 4GVGA 1GKQA 2P0OA 3N6JA 4Q6XA 2C1IA 1QDSA 3LGGA 3PJTA 4N02A 2IXUA 3SIZA 4PODA 2WCGA 3QVQA 4GQBA 4LVAA 3EB2A 3S2JA 1RALA 3FYYA 5BOFA 1QPNA 3LZ5A 5REQA 3L67A 2OLAA 2GGGA 1P7TA 4RNJA 4TXEA 1KBLA 4YHGA 5CBJA 1XD1A 2VENA 2UZ9A 3O0FA 4MWAC 3H4GA 1WYIA 2HVOA 2GDVA 5RUBA 1RP8A 1BG9A 3CS2A 2J7BA 3N4FA 4RZ5A 3B3DA 4YMZA 1XIHA 1Z41A 3BAKA 3P7YA 4IIEA 1IWBA 2XIMA 3AIRA 1XS2A 1LJYA 4IMFA 1Q2SA 4V27A 3MYOA 2H3BA 2NX9A 1RY0A 1QWKA 4UTKA 4C91A 1EEPA 4P8XA 1Z48A 2HNEA 3KRUA 1YDYA 5BWAA 4LSBA 3DHFA 4US5D 1T99A 3QGVA 1HKWA 4RPPA 3OGVA 4O19A 2AMGA 2NV9A 5DEZA 2A3LA 1E56A 5D9NA 2DIKA 3BLIA 4MB4A 1ITUA 4N7QA 1TJ2A 1LLZA 4A22A 4U10A 1E70M 3R7MA 1F5ZA 3TOYA 4DZHA 1Y5XA 3GQYA 2PBGA 5I23A 3G24A 4B3LA 1VLIA 3B9EA 1ZQ5A 5A95A 2EAWA 1SSGA 1LT8A 5BXSA 2C79A 5KETA 4E8GA 2WWDA 5HWMA 1JI1A 1QASA 1BTMA 3W4RA 1DKWA 4JFSA 1NDZA 3A24A 1W1YA 4JY8A 1U2YA 1JYNA 2ZXDA 4CD8A 1FP8A 1IEVA 2ZZ3A 2A6LA 4NF7A 4GBDA 5EBAA 1R3RA 4JHMA 3TR9A 4WEVX 4LJ3A 1I60A 1TR1A 4I5UA 4FNQA 3N2CA 3CMJA 1M03A 1A0CA 1UC4A 1SM9A 3MZ2A 1XP3A 2QMJA 4FA3A 1SFLA 4DX3A 3T07A 1PKNA 2TSYA 3ABXA 1ONWA 4GCAA 3BCJA 1XSIA 2J7FA 5EA9A 3CO8A 2OU4A 1VRDA 2FJKA 1DWGM 2DFAA 3MSGA 4CU7A 2PWGA 2QVNA 3EMQA 3H2EA 4C7DA 2C19A 3EXTA 1GVYA 1NU5A 4Q4PA 2QVHA 1TV3A 4KRUA 4JAWA 2E28A 3KRZA 2VDHA 4QJ5B 1US2A 4RUBA 2V81A 4AYSA 3G3DA 2NLIA 3UR2A 3N15A 2OEMA 3WMBA 1EOMA 1ZSXA 4C6NA 1EKOA 3B0XA 3GFZA 3WD2A 4W89A 3CUGA 3RGTA 3O1NA 3AI0A 2FZ9A 5FJIA 3TIMA 3BZJA 1FA2A 4A3QA 4A05A 4LVBA 2O9TA 2ABAA 4DM1A 3W00A 1OJXA 7ENLA 1UD2A 1KXHA 1WNOA 3CV7A 3NQMA 1OK6A 1FHLA 3R8HA 4UOJA 3ZQ9A 3AUJA 1QWGA 2I7GA 1VHCA 2VX5A 4R88A 3G5EA 3UWZA 3II1A 2PTWA 2VFHA 3T55A 3S46A 3EB4A 4FO4A 3VZYA 4IISA 3CEPA 1EJUC 1R85A 1OVDA 1BKSA 1OBAA 1SMAA 3C56A 1QPKA 2CZFA 5AHNA 4DZAA 1SFJA 1RLCL 1MMFA 4H9ZA 2V67A 4JTAA 3L12A 4KBXA 4AX6A 1K8ZA 4L4LA 2QV5A 3BSMA 1KXTA 1QW8A 3ZR4A 1A53A 2V3EA 4DBWA 2WZHA 2V2CA 1SMDA 2VURA 1VZWA 3WNKA 1E6QM 4CVUA 2BNJA 1VB9A 3CC1A 4MMWA 1DJQA 3HPXA 2YIHA 2UY2A 4FF7A 3GTFA 1XC4A 5FESA 3CV6A 3TH6A 3CHEA 3GNPA 2NV2A 2QCGA 1EZWA 2DT2A 3I10A 1QPQA 2QULA 3EXSA 1C7TA 1MDLA 1KB3A 2E4TA 4EP8C 3N6HA 4IIDA 1S39A 2NLYA 4KGLA 5LNSA 2Q09A 3QW4B 3WQFA 1VJIA 2NQHA 1E3ZA 2J9XA 2TRSA 2ACRA 2Y8KA 2I16A 2F61A 3RIKA 3PBYA 3RM8A 4B9ZA 3ZIZA 3KP0A 3AQUA 3W53A 3VNJA 4IMAA 2R9RA 4RLIA 3PNZA 3BXWA 1BYAA 2RAGA 3R0UA 2RDXA 2QIWA 4XZMX 1AMYA 4IWWA 3TJIA 5HQEA 3ITOA 3E12A 7ODCA 3APGA 4R5EA 1CBGA 4UWMA 4PH6A 3UJEA 4YU1A 4S3GA 4AG0A 2J13A 4DLFA 5DXYA 1B3VA 4TX9A 4U5KA 1G01A 3WNMA 1SPQA 4Q4KA 3JS3A 2Q01A 2ZE3A 4YLWA 3T05A 2HWGA 3POCA 1XCXA 3AYTA 2XG9A 1XCWA 2ZZ7A 3OQ8A 1PX3A 4Q7IA 1A3HA 3GDRA 3KZPA 4MKVA 4NAEB 2VFDA 1H5YA 2GJLA 3W29A 3W75A 3PPCA 4BS0A 1QRQA 2WMIB 2X30A 1JFXA 1YNQA 3IJIA 5FJPA 3GHUA 5AC7A 1THFD 3F4WA 4PGLA 4ZO7A 3M9YA 3P2VA 3IV8A 4R85A 4HD5A 1PYFA 4N6EA 1TIMA 4GIAA 3F4CA 2PS2A 4S2CA 1BQCA 1WE5A 3AXIA 1YW1A 3CUHA 1YXCA 3VGHA 1E5JA 3VZZA 1V08A 2VL4A 3WH9A 2FGZA 1R8LA 1E43A 1LP6A 1IF2A 4PBGA 4JYDA 7XIMA 1V77A 3NYDA 2NQ5A 2WMKA 1H7NA 3QYQA 3WL1A 3FGCA 3GDLA 4KS0A 2DP3A 4HK5A 3KX6A 1SU5A 3QJAA 3UG4A 3ARYA 1P4CA 4W8AA 1O12A 4M1RA 1K03A 2AGKA 4I9TA 4R9OA 1ZCOA 2ISFA 3BGGA 2CBJA 4J4KA 1XJBA 3VO0A 2FFIA 3PR2A 2XFYA 1CGVA 4D1IA 1H3GA 1W54A 1Q4NX 5CH9A 1R3TA 3VKAA 1YE4A 1W3JA 2WVTA 4BEUA 3LCHA 3B8WA 4O11A 1X8CA 4NASA 4DVOA 1ZY9A 4IP7A 1I8JA 3RO8A 1CLXA 3FHAA 3V7PA 3HB9A 3EKGA 5TD4A 3A5FA 2IXVA 2X42A 4JTJA 3ENLA 4FIRA 4W7UA 5SWUA 3VFCA 2XN2A 4CD6A 5IDZA 2G41A 1NSJA 5K9CA 4YXGA 4RKAA 1EEXA 3NG3A 2WLZA 3EDKA 3MPGA 3BJFA 1X6NA 4DUXA 1RH9A 1W9XA 1W6TA 2BP1A 1C9DA 3KDOA 1J10A 1WKDA 3K1GA 3B40A 3UQNA 4ALDA 3E0IA 3CYVA 2VVSA 4G9PA 3URAA 1V4YA 1SZNA 4Y8FA 4GVFA 1QO2A 5BZAA 2NWSA 2BZNA 3K30A 3WH8A 5DCBA 2ZQ0A 4JGDA 3CLWA 3A4WA 4NXSA 1HFBA 4O50A 2HDJA 1Z7AA 1XH1A 4FLRA 2WC4A 1W56A 1EC8A 1HJVA 4FPSA 4DF1A 2WMGA 2VD8A 3SQLA 3SUTA 3OVGA 2WBKA 4A8IA 2X8RA 2PDPA 2YSWA 1TWDA 2R6OA 1BWKA 4GZIA 1A5UA 1US0A 4GQ0A 4JTQA 2MANA 3UXKA 3U2OA 3RM4A 3NM1A 3EDDA 3VKKA 3RPTA 3THCA 3WLNA 2PDWA 2EQDA 3TWAA 5FJTA 2JBMA 1IEIA 1SZGA 2IQTA 4XAPA 4WY0B 4JCLA 3SY8A 2ZWZA 1NWUA 2PGWA 3TLQA 5CZTA 1AL8A 4O18A 3BGAA 5DY2A 1VPXA 3PZGA 3TW9A 4H9TA 3U8GA 3DGBA 1NWSA 1WZAA 3M5YA 2V69A 1KTBA 4NI3A 2OSWA 3UZZA 3VGGA 4AIOA 4L6DA 4E0CA 1VS1A 4WKAA 2Y70A 2E1DA 4DZIA 4PMJA 4UTLA 5A2BA 1F3WA 2EF9A 4FR1A 4JTLA 2O9PA 4JTDA 3QMTA 5LKYA 4YCOA 3R79A 4ATLA 3GDTA 1X6LA 2Z28A 4IXHA 3WENA 2PRLA 4E38A 3F5KA 5FJRA 3ICJA 1H11A 3N2OA 3QQWA 2AOSA 3PTDA 5E9XA 4ATDA 3FJLA 2HK0A 3L0KA 3D5HA 3TLLA 3HPSA 3N4AA 2GGHA 4E4FA 4UTWA 3VNIA 4ZENA 5AZ0A 3EWYA 3B0UX 4FNPA 3CXOA 2YDRA 4KPLA 1GTEA 2WZEA 1GVQA 2Q71A 3RLUA 2VC7A 1JUBA 3KHJA 1TMQA 5EMJA 1JUEA 1W9VA 1UWSA 4Y6GA 1MI3A 1TELA 4OIFA 3EA3A 2ZZ2A 5F2LA 2HVMA 4F0SA 3EWZA 1V7YA 3W23A 1TG7A 2VEKA 4G7EB 3KBNA 3WDJA 2BY2A 4ZEPA 3NURA 2MUCA 4R33A 4Y9OA 4JL1A 1R7OA 3W3OA 3WF2A 4WDTA 4O4VA 1OCJA 4NAFB 2XZ9A 4MLRA 4RNHA 2VGGA 3ZJ7A 3R8GA 3GWQA 2H8ZA 3TW7A 4KCTA 2JIEA 1VH7A 4LBRA 3HG4A 1CGWA 4XWUA 3V1HA 2NUYA 4JIRA 3ITYA 2WJEA 4G8TA 4FNRA 1DJIA 1OF6A 4O0QA 2YLAA 4BR1A 2A6NA 3N3TA 1X1OA 4Q8UA 3WK3A 4CNTA 1J12A 1RR2A 3CHFA 1JULA 4B9YA 1GPWA 1TVLA 1U22A 2UY5A 4IL0A 1VENA 4AZHA 3GX9A 1QBAA 3Q67A 4AD1A 5CPOA 2CIPA 5A6MA 2GL5A 4AYGA 2WC3A 3CWOX 3VD9A 1ZBWA 3K46A 4GE8A 2DZWA 4YVVA 2PDYA 2W67A 1TQXA 3HIJA 1XYAA 4XK2A 5FIPA 1ALDA 3TMLA 3ZVIA 4WUIA 2FZBA 1PTDA 4B5NA 4QCEA 3FVMA 5C9UA 4IUOA 1EPVA 1NQ6A 3LD5A 4RDYA 1F3XA 3AU2A 4PTXA 1U30A 2WKLA 2ABBA 1WX0A 1K9DA 1IIHA 1TMLA 4AZ5A 4H9XA 4E6MA 1JCYA 2D3LA 3GLCA 3LXBA 2G4JA 4IPJA 3EWXA 4QSHA 5I07A 1E0XA 1QMLA 2GVGA 1IGSA 3PG8A 4YJ5A 4PEKA 3GU9A 4GNJA 4CLMA 3SQMA 1HG3A 4IX0A 2CESA 1CWYA 1YHTA 3ZWSA 4QLLA 3BK0A 2XSXA 3T44A 4GY0A 2H3DA 4PRWA 3P61A 3EEGA 4FNTA 4JN6A 1XV8A 3TOPA 5I7GA 5EY5A 2QCNA 3LZ3A 1K3UA 2CYGA 1KFBA 3O3RA 4O1DA 3AXMA 3W83A 2BHYA 2WV8A 2QUTA 1I0BA 4N4QA 4IGHA 3QTGA 3KWXA 2X1RA 1QNQA 3H7RA 1TSIA 2XIOA 4XZWA 5E70A 4PC8A 3A9IA 1HJQA 4GCXA 3TTOA 1OFBA 1UP2A 2ZTKA 4TX6A 3VIFA 4A3YA 4A8LA 4BK9A 3GC5A 3AIWA 2WO5A 1DHPA 5CLTA 1E15A 3W85A 3W7QA 3DFTA 2NV1A 2GDQA 3AYVA 4B92A 4H19A 3IJ6A 3S1VA 1U33A 1DIOA 3L65A 2E8YA 4MWAA 3VAVA 4B91A 1DJNA 3TKFA 3WLOA 4W9TA 4HHPA 3ITVA 1XGDA 4PCSA 5AKQA 5CPLA 4FSAA 2AQVA 1REQA 4IFOA 5EMYA 3O16A 1PXGA 3APTA 4QDWA 1TX2A 4RXFA 2WMHA 5F1UA 2EO7A 2XVKA 4C5YA 1Q13A 4C6JA 4TOQA 3E0VA 1T40A 3PZNA 5GQBA 3M46A 1OFOA 4DJEC 2QCDA 4HPGA 3TNOA 4GMEA 2VUYA 4DYEA 3BAJA 4KKXA 3W1LA 3NO1A 4W7WA 3U6WA 1QPRA 3F7JA 5T9CE 3LCWA 3S5NA 3F2DA 1Q45A 2LLEA 3TA9A 2UBPC 4S2BA 1V3MA 3GK0A 1VPQA 4GABA 3MUY1 1R38A 3UXDA 1JYWA 4NJGA 3PUGA 2L5HA 3NXLA 1HJXA 1IYXA 5GVJA 2VWSA 3WCZA 1DJYA 1FHUA 1H7XA 3VGFA 1NTHA 3WD1A 4R53A 3ZR6A 1V03A 1TIWA 3UXIA 4B5SA 3R10A 5A1AA 4IUGA 1QNOA 2VCBA 4O1FA 1XSJA 2ISWA 4GK8A 4M6UA 3WZ0E 1I4NA 3AISA 5A6KA 2VEPA 4JIQA 1UH2A 3WLIA 1IT7A 4Q22A 3OYZA 4WF7A 1Z6KA 3CL6A 2BG5A 3B05A 3OZMA 4ZFMA 1QK2A 3NDOA 5KZMA 2QCCA 3TC6A 3LA4A 4MTVA 2C15A 7A3HA 4UQEA 2OX1A 3PG9A 4ERAA 4LH8A 4HU8A 3NA8A 1G69A 2Y7DA 1N55A 3V5CA 4Z1AA 1XI3A 2Y89A 3VUPA 2FDSA 3MP5A 3M7WA 3QFWA 3IAQA 1G94A 2INEA 1FDYA 2V6AA 3T4WA 3VK5A 5C54A 4XKYB 3GXTA 1BYBA 2QJHA 2OOGA 5F4WA 2DW7A 3V16A 3ITXA 2JIWA 2CERA 5AHIA 3QRHA 2GVEA 4PSPA 4QISA 5CJMA 3LTPA 2BY1A 1JZ3A 2OJPA 1OF8A 2VFIA 3UP8A 4MADA 7REQA 3TFCA 1HVXA 3LERA 1VBJA 1ZCCA 1W5PA 4JDBA 3MBDA 2CLMA 1ZJHA 2QMKA 5M03A 2HXTA 1MZHA 2Q02A 1MYRA 2OGYA 4MAZA 1UIOA 4WGHA 1IXPA 1L8NA 3TEVA 3BAXA 4MPQA 5CJ5A 4WDXA 5CZJA 3ELFA 2PAJA 4S39A 1ME8A 4LY4A 3T4CA 4FK9A 4JR5A 1V6XA 3VU2A 1DIEA 3WQ5A 5CQ1A 1CXIA 4CN1A 3SN1A 3ZFHA 3CZEA 3GIYA 4ICNA 4Q4SA 4OV4A 4K7VA 1EWEA 1GOKA 4IFKA 1S5MA 4DYJA 1I1WA 4PN2A 2EG8A 2PDGA 1NWTA 3WYZA 3G8EA 4UNLA 3G1SA 3A13A 3VILA 4ZGYA 3KOZA 1OWQA 2EG6A 5GNYA 3B9DA 1UMLA 3W7RA 1JEZA 1I2RA 4IG2B 2QIIA 1DBTA 1F6KA 1RCOB 3W7CA 1OC6A 1QI0A 3MMUA 3WUEA 5DBTA 5LGXA 1FTXA 2F7FA 3GKFA 4W87A 3UPMA 3DG7A 5FJUA 2YB1A 1GNXA 1JPMA 2WVUA 4DBDA 5C2CA 1NY1A 2C7FA 4JIHA 3EWWA 3HQ1A 1NELA 4ROPA 4Z2IA 1KFKA 3KDNA 4Q8OA 1HTIA 1XGEA 3HN3A 3VKJA 4YHEA 1GHRA 3SN4A 3MBFA 3WMLA 1POKA 3L5LA 4J27A 2VRJA 1CYGA 1UWAA 5A6BA 2JKAA 3C2RA 4Y8EA 5CPSA 4UZSA 1LUCB 2HBXA 4L7ZA 3QHOA 3MJYA 3VOCA 5L6UA 2A7NA 3EWDA 1UJQA 2QGHA 3VKDA 5H8UA 2YB4A 3GHRA 6A3HA 2ZA1A 4EVZA 3SCOA 3MCOA 2HNHA 1LL7A 2Y5SA 4N9EA 3OYXA 2JGQA 1UZ4A 4BZYA 2ATMA 1D2KA 1GOWA 3GU2A 3VNKA 3MMWA 4LS1A 1H61A 4HU4A 1ENUA 3TJXA 3FFSA 4JNZA 1GOMA 1WZLA 4L56A 3CIXA 3PFMA 1EO7A 3UWYA 4IICA 2PDUA 3M0LA 3VDHA 2QT3A 3VKCA 4XX6A 3LLFA 3AIEA 1LG2A 1VR6A 3STGA 1J2BA 3G1RA 2ONEA 3H4XA 1TV5A 3Q65A 1PHQA 3NZ1A 5L9FA 5IFTA 2FB2A 2G50A 4NRSA 2ZZ6A 2YL9A 2ZDRA 3WK0A 2HEJA 4IIBA 2WZMA 1W9BM 2F84A 4KIEA 1W1ZA 4ASTA 1UD4A 2O56A 3H70A 1JYVA 1CGTA 1XLEA 1VHNA 2OSXA 5LIXX 2OODA 4GUJA 1SW7A 1VYPX 1HGYA 3U9IA 4L61A 3EKLA 5FEPA 3QOMA 3TCEA 3P8IA 2CNCA 2FMOA 2V5JA 2PU0A 5D33A 1VJSA 1U1HA 4YWIA 1T7LA 3RRAA 2D2HA 3VD7A 3S2LA 2IKHA 4A3RA 4D6CA 4MZ8A 1EJ7L 3V0UA 1KM4A 1CCWB 2W4XA 3VC6A 3W1TA 3OBEA 4F4RA 4ZR8A 3UYIA 1EP3A 3T7VA 5HMFA 3GXFA 3A23A 1X1NA 3VMOA 3PUEA 1HIZA 1O5XA 3WBYA 1PJ9A 3EDEA 3VOFA 1IEXA 1FKWA 3WD0A 2VGIA 3ZJ6A 3V36A 4AU0A 3CAKA 3BOFA 4NZ4A 5JBFA 5EFDA 1EZ2A 3GZAA 2BMBA 1XF0A 4ZXLA 1KTNA 3Q58A 3MCNA 4QAIA 1VFOA 2DPEA 1XHGA 2YL5A 3OEXA 5AECA 1XUZA 1C8XA 1ZL1A 3LBCA 1RP9A 4WVXA 1VFUA 2WMIA 2VZTA 5D9PA 5DF0A 2XGZA 1TJ0A 2OG9A 5EKYA 3BC9A 3F1QA 3TSMA 1F3TA 4LB3A 3LN3A 4DJDD 3LNMA 1C8YA 1R3QA 1UR3M 3QZEA 2DZBA 3T9PA 1R9XA 1O5QA 3LX9A 3K5XA 4JTFA 4UTFA 4GG9A 3ZJKA 1SVDA 4DO7A 2XH0A 3TN5A 3BV4A 2XVPA 4JTCA 3OIHA 3QW3A 3ARXA 5DY3A 4MY8A 4QIUA 1LL6A 4B3KA 2V3GA 5C55A 3DFNA 1S5TA 4UFMA 5HUOA 3OQEA 1U1UA 1BRLA 1Q85A 2DT1A 4S3FA 4UMBA 1UUQA 1XPGA 1NOFA 2O9RA 4J3VA 1LRNA 5JXQA 1XINA 1W9UA 3I6TA 2X0YA 4UC5A 1EX1A 3DI1A 2VNCA 1R0MA 1B2YA 1E4LA 2FVLA 5C8BB 3ZM8A 3WG6A 4HYRA 2V9DA 1RAKA 1OX6A 3GW3A 4E2DA 1HN1A 4XSLA 2X16A 4CNNA 4YVPA 2VOTA 2CCRA 4ORMA 5BCAA 1RQEA 4H7ZA 4PMDA 4HSNA 3DFPA 4QTGA 1B4EA 4P7NA 1FWFC 3LGEA 1XG4A 1W1IE 3SUVA 3NPXA 1MUCA 1JG9A 1EXBA 3G1YA 4MY1A 3LRLA 3NCOA 3FYOA 4TMBA 2IPGA 4HPNA 3BCDA 4EWND 3DHDA 3L0NA 3OG3A 3FEQA 3S6OA 3K4AA 3R13A 1Q6EA 3PPFA 1BPLB 4GIYA 3QSTA 4O16A 4D9PA 4I3GA 3IEBA 4A3UA 1W1PA 3TZFA 3QF0A 1OSEA 1U5VA 4F0KA 4XKMA 3P0WA 4YPJA 3TU9A 2A79A 4TO8A 3CZLA 1CPUA 3HF3A 4EACA 1WUEA 2P3EA 2TYSA 1BXNA 3UZYA 4OHQA 2J77A 1UD8A 5A69A 4EPBC 3SCUA 3VOJA 3D0CA 2BHZA 1V0LA 1IT8A 3GC2A 2CLLA 3RU8X 4C6EA 1YDOA 2OWXA 4XAGA 2CEQA 4US6A 2AKMA 4MNMA 1W9PA 4DI8A 8CGTA 5LNUA 3BJTA 2BOFX 1XLLA 4XAYA 2FH8A 2XZ7A 1GQLA 2CKSA 2VEIA 3F5LA 3MHGA 5D37A 3T78A 4J3XA 3U3HA 3C52A 2GJXB 4OWGA 2CLFA 1ADDA 1Y65A 1MXDA 4IM4A 2XTKA 4P8UA 4NL1A 1KV8A 1J93A 4XQ6A 1B3WA 3LHUA 1P6BA 4GC4A 4JKMA 1XLJA 1W3TA 4H9UA 4IL2A 1TE1A 3KCOA 3OLDA 3TYCA 1SO3A 3LMZA 2YW3A 3NOEA 4WY0A 4HN8A 2FJUB 5H2ZA 3NPWA 4GY1A 3O6DA 2Y63A 4RJEA 3GDMA 4BQ2A 1FCQA 3WNNA 4C60A 3NO3A 1XYMA 4M29A 1XRSA 1YTKA 4ONVA 3DYMA 4Z1DA 5CZSA 3WJYA 4XVEA 3P81A 3BMWA 2HRWA 1KM2A 3BAYA 1LDCA 1L6FA 2Q8LA 1B4KA 4B5WA 1TUXA 1CGYA 2DU2A 2DJLA 4WDUA 4KFPA 1TWIA 2I9UA 1UCWA 2E5DA 8RUCA 4CNUA 3M5VA 3E0LA 4MWAE 1GOXA 3QTPA 1DXIA 2PD5A 3MKKA 4DBSA 5E6ZA 3CZJA 5M3WA 3W2KA 5DT7A 2ACUA 4HA0A 2C13A 4PTDA 1D3CA 5AYBA 4EAMA 4GLEA 5C9RA 1RVKA 1AA1B 2XVGA 1VFTA 5FCZA 3S0CA 1OD0A 4PMYA 4M82A 1XCFA 4O1BA 2V5DA 1KD0A 2GUUA 1ICSA 3M0MA 1XSKA 3WF1A 2INZA 3RJYA 4DQWA 1F9CA 4QS5A 4KW2A 3KFTA 2XWDA 3KP1A 4KFNA 2X7WA 1QVBA 1FCBA 4TV5A 3OO2A 4WGXA 1TJPA 4G7EA 4HHMA 1KGXA 4G56A 1TVNA 4GNVA 1MQQA 3EPMA 1TPEA 3S9ZA 4E2VA 2WW5A 3IRDA 3OGSA 1J79A 5HMSA 1SYTA 4QNWA 3IJ9A 1BGAA 3CTTA 2B7PA 3GG8A 2DZUA 1DQUA 4NAFA 4GXMA 2I57A 1OHLA 1D7FA 5I3IA 1S5VA 3CHVA 1EUNA 3C2OA 1W3NA 4X2PA 3BL3A 4PMZA 4BI5A 3W7DA 1GOQA 3N11A 1TWWA 4HSHA 3GG0A 1KRBC 4AWSA 4ZQMA 3S5SA 3PBUA 3A47A 3AZTA 1Q65A 1MNZA 3W1UA 4GACA 4IJCA 2Y7EA 3MV01 4Z1YA 5AC5A 3C2EA 4ES4A 8A3HA 3DBPA 5FEZA 1DJZA 1BLIA 5FF2A 1J9YA 4AZBA 4WOQA 2CBVA 3DKJA 4B2DD 3QV6A 4G6CA 3CBWA 3L4WA 3GZ3A 3W71A 5BWFA 5LYRA 1V3KA 3NQFA 4H6EA 5KITA 1TTJA 4B5TA 3AHTA 1E40A 3SUSA 3PF3A 3VIHA 1ZAIA 5CC5A 1OADA 4CKQA 1GYLA 4DF0A 3CZKA 1NF7A 1HP4A 4QS6A 1DXEA 3E38A 2J7HA 3GXMA 4PCNA 3ZLHA 4XTIA 2AQWA 2PP0A 1V6YA 3OOQA 4RW3A 3W88A 1EF2A 5CBIA 1B57A 1DOSA 1JPDX 4OTKA 3ORWA 4LF1A 3URBA 3EX2A 3DIPA 2EKCA 4DJEA 4NXKA 4M51A 2G95A 2XN1A 3IIOA 3VVGA 4RV3A 1XXXA 3WLKX 1MUWA 3WH6A 1O7AA 3RHGA 3EGJA 1QAPA 2OPJA 3TQVA 5AHEA 2QPUA 2XISA 1HUVA 1H62A 3AMKA 5JH2A 3T08A 5A94A 4B5UA 2QF8A 1E1EA 4QLKA 2Z7GA 4GOAA 3LLXA 3VNMA 4UOQA 4XZ9A 2VELA 2ZA2A 3WFZA 4Z2JA 4H8UA 4IPNB 4HNCA 4CEXC 3GDBA 1TFVA 1UH4A 1XQLA 3BW4A 1C91A 4H00A 1Q4WA 3MWAA 4BHYA 3TYBA 3O9NA 4KT2A 3FLUA 4K8GA 3DFYA 5FEXA 3NFUA 1AW1A 2OOFA 1Z44A 3H2AA 3DERA 5D9MA 2DZSA 2VX6A 4CQCA 2D2JA 5H91A 1W9DM 3THAA 4FXJA 3AJXA 3BO9A 1Q63A 2Z6JA 4XG1A 1VKFA 2B4GA 1LQ0A 3GAYA 2RGMA 3G6LA 4KCWA 4IQLA 3JU2A 1VYRA 3QXBA 2OX4A 4HCHA 4WXYA 1LYXA 3QPZA 3LTSA 3QN3A 4JL2A 4Z0SA 4RCXA 3TAOA 2D2GA 1DWHM 4UTIA 4CU8A 3P0XA 3APYA 4FB7A 5HAOA 1CZ1A 4D6DA 3MKCA 2R91A 1C8VA 2PRHA 2WNNA 1W37A 2Q3RA 1NFPA 1RA5A 5K4XA 4KERA 3ZVHB 3DAQA 5G1MA 2ZZ4A 2EPNA 2WM1A 4OUEA 1QK0A 1XL9A 3BLEA 2GDUA 4PMOA 3JZEA 2PGFA 1E0TA 1V6WA 3STFA 1AH0A 3ZT7A 1OIMA 3BLFA 2AMXA 5DXXA 3HPAA 4PEEA 3W7EA 1DL3A 4OU1A 4PMQA 4JN8A 2F38A 3F5JA 4EE9A 2Y5EA 1PTGA 1PZ1A 2VFFA 1GVOA 5CGMA 2X1IA 2IQDA 1EPXA 3KOWA 2HQAA 3KRBA 4WXZA 4K1WA 3TW6A 5I09A 2NXHA 4JKLA 4J5NA 2E77A 2R1NA 4IP4A 3EZ4A 1PEZA 1G7VA 5KINA 5FA5A 3R94A 5E0FA 1GQKA 2XIIA 2YBTA 3UVAA 4AVFA 4J3WA 1D7KA 2P3ZA 4JTGA 4O1CA 4CN4A 4D72A 5D32A 5D8ZA 4UQAA 3TX9A 4NNCA 5F2IA 5I79A 4AIBA 4DIAA 2CWXA 1K7XA 3OVPA 4QCFA 3ZXWA 4HPJA 1KM3A 1NWRA 3XISA 1HL2A 4F9DA 4NT0A 3GG7A 3N2MA 4PB3A 1RQBA 1UUMA 1FWSA 4LNYA 3BQ6A 3LI0A 4H3DA 1LRTA 2Z2UA 5D2XA 5CAKA 2VM8A 5AHFA 2G3JA 5LXXA 4QEEA 3ZYZA 1JDAA 2TMDA 1WOAA 5G2WA 2DZTA 2VTFA 3C4UA 3VD5A 3DOPA 4DBEA 3S1UA 3B4UA 4JQ3A 1MEWA 1XLCA 1MFVA 3FKRA 2X05A 3C0SA 3P5YA 4O13A 1QFEA 3EOUA 4IGNA 3UWVA 2ODOA 4GQRA 2OT0A 1H49A 1KKOA 1KM1A 3W02A 1AQMA 4AXNA 2ZX8A 4XKYA 2XU2A 3OPSA 3UXAA 4R7JA 4FS9A 1DE5A 3Q2DA 4ROQA 3UZ5A 3VINA 5I77A 1KV5A 2Y4SA 3AO0A 4LUSB 2X2GA 5LHEA 3L4XA 3W72A 3RM9A 1E73M 5HULA 3ABOA 2B7OA 3LLDA 3VMPA 1ITXA 1JCTA 3WLQA 2WWCA 4CU6A 4DUVA 1ECEA 4M6PA 3QY8A 1E6RA 2VX7A 1W17A 4B15A 3FX4A 4O8AA 3TSDA 2J8TA 3LI1A 4J3TA 5HK4A 1NOUA 6ENLA 2XJ7A 5HWJA 4UTTC 2B81A 2CW6A 2BTMA 4AZ6A 3B8SA 4LY8A 3M44A 3KBVA 3D46A 3W37A 3SCVA 3NL2A 1GVEA 2FHCA 4LQ1A 3W22A 3W7MA 2DIJA 4HSOA 1HL8A 1W3HA 1U1JA 1O66A 1FKXA 1XWYA 1VBHA 4I7WA 1F4HA 2C16A 3CQ0A 1UR0A 2J74A 1K70A 4U33A 4L1XA 3PUDA 5AC8A 2YXOA 1PKMA 3FKKA 5D2YA 3CZGA 3HFYA 2ADAA 1M3UA 4GYJA 1TYGA 1OX4A 4IP5A 1P0NA 4HYWA 3P67A 4FX7A 3C3UA 2BBFA 1F73A 4YTQA 2C18A 3G0SA 4MFEA 4DJFC 3PANA 4POCA 1VGAA 1M7PA 3AROA 4GNKB 3GUWA 3UJ2A 3CB3A 4ZL1A 3XIMA 5A6SA 2J4GA 1XIJA 1UWUA 4QG6A 1HKIA 4IZGA 1W8SA 5I78A 2DW6A 2X1SA 4RV8A 4DF2A 4HOZA 5IM51 1NJJA 1YTEA 4GVHA 4H2CA 4F0RA 3VOHA 4V33A 3SR7A 1BF2A 2DZVA 4W93A 4F48A 1J8VA 1LUCA 1UQZA 4FF5A 5FJJA 1VBGA 5HNUA 4QEHA 5HJYA 3ME3A 1R2TA 1KM5A 1OABA 3U4FA 4TTGA 3P93A 3BH4A 4DWSD 2ZWYA 2Z0IA 2J7EA 2CZ5A 3S8HA 4X9YA 4O1AA 2QDEA 4J7RA 1SJDA 1DXFA 3F2BA 3P82A 2GK1A 2G97A 3KS5A 1Q7MA 2DQXA 4DELA 4HNLA 4MHBA 4E4PA 4ATWA 4ML4A 3W81A 2QJNA 3VOGA 4U31A 2OZ0A 3NJ3A 4XD5A 3P80A 1FHVA 2O92A 2RUSA 1XYLA 1LBFA 4FZIA 5DELA 3SIMA 4XD3A 2B7QA 1R7AA 4YTSA 4ZO8A 3H24A 1M6JA 3V75A 4Q8WA 5F1VA 1UBSA 3U2ZA 4FIQA 2V5CA 1FRBA 3W0KA 4UNIA 2EXOA 1N8IA 4NKCA 4OBSA 4HIBA 1V0MA 3L7RA 1C8QA 2BODX 3GTXA 2CPUA 1B0IA 1QATA 3QGAC 3U2CA 4DB7A 5CSYA 5E0CA 1ZLPA 3O6AA 1H50A 4OBRA 1HT6A 1OT2A 4JFWA 4FI4A 2P8BA 1EIXA 4Z42C 2Z1KA 1J96A 5LNVA 4HVXA 3BCFA 3BG5A 4Y90A 5E6YA 2ZBTA 1M7XA 3R11A 3RILA 3AIUA 2Q8XA 2HK1A 3P6LA 3VC5A 3MVTA 2G3MA 3NVDA 1RK6A 5CZ0A 1YBQB 3AIBA 3E5PA 3I6RA 8XIAA 4L9ZA 3PVFA 1AD1A 2OZTA 4ICCX 4O52A 4P7QA 1E3XA 2V2DA 3UJSA 3CQIA 4GA8A 3PPHA 3MY9A 3QLDA 4Z0JA 1E0VA 3W73A 2VEMA 2WANA 1FCVA 3VD4A 3N19B 1A4MA 2PWHA 4F66A 3DC0A 2DJXA 3KE0A 3LPFA 4TMCA 1CB2A 1B54A 4NG3A 1XYCA 5AN7A 1XH2A 2JKEA 4ZZ9A 4M5PA 3TXZA 3EX6A 4D2JA 2A7RA 1SSDA 3OHIA 4QG8A 3NZGA 4CNOA 3LK6A 1PHWA 4R7WA 5IFPA 4CEUC 2NUWA 1S5NA 3E49A 4M1BA 3CGTA 2Z29A 4EPKA 3DC8A 3OA3A 3CIVA 1BVWA 1VBRA 4DY1A 2PP1A 1FXPA 2J75A 2QJMA 1K6AA 5XIMA 2WKJA 1TZ7A 1IGWA 2E0PA 2RFGA 1GOOA 1MW0A 3TN4A 1C9WA 4NJKA 3UU0A 3SJ3A 2WHKA 1NP2A 1U5HA 3W1RA 5HANA 4WK9A 1AFSA 4MM1A 1ISZA 3JW7A 1R2RA 3KL3A 1IEQA 4EXQA 3F4DA 1BF6A 2EKGA 3M0HA 1OCQA 2CLPA 4GH3A 4KRZA 4GFSA 3PPGA 5H6HA 3NQVA 4GI8A 1QNVA 3M5ZA 3OGRA 5DMNA 3I3BA 3K8LA 2D73A 2ZVRA 3MDUA 3NQEA 1TVPA 3TFXA 4BQ5A 1F74A 1LT7A 6CGTA 1XKJA 4G5DA 3I65A 4GKLA 1B3XA 1GQIA 5CGQA 3CYJA 3PAOA 3P8JA 4RXGA 5LIYX 1G7UA 3BG9A 4CVWA 3SI9A 2VD9A 5LIUX 2JF7A 1VEMA 1BVNP 4K6AA 3VNZA 1AW2A 3VIPA 3BUVA 5A8GA 1M68A 2ZC8A 2DT0A 4OE7A 2HVNA 4IQEA 2EPMX 4EPDC 4C6LA 5FD0A 3LRKA 3HV8A 1EJSC 4S23A 1B90A 2X41A 4IJBA 2E6YA 1VRXA 2CHOA 1P0KA 4O28A 4P61A 3CASA 4ECLA 1JCMP 1O4UA 2Y24A 1B3YA 3CLMA 3ANYA 1GQNA 1DPMA 4J2MA 1UMYA 2V5LA 4ADTA 4AQLA 3ARVA 2O4MA 4D1JA 3WD3A 3MVIA 1OCNA 2IPWA 1YADA 1XIGA 3RX4A 2V3DA 4K39A 1QUMA 3T0AA 2UY4A 2XIBA 4ZB2A 1CX9A 1NIUA 3SRDA 4LNCA 4OFCA 1VAHA 3FW6A 5BXRA 4JYFA 5JU6A 3HU7A 3MSRA 1MZRA 3CHDA 1E4NA 5FF7A 2GJXA 4ZE5A 1R87A 4X60A 2PZ0A 1WDPA 3M43A 4NILA 1JRCA 4LC6A 2PDNA 2J8GA 4PMRA 1D8WA 3MC5A 4DRSA 4M6VA 4QXIA 3CMGA 5HJLA 2HPMA 3B8VA 3EPOA 1XKYA 1TX0A 3T81A 4DN1A 3DZ1A 4H2HA 4MKNA 3H26A 3WEOA 4G7FA 2DVXA 3A21A 2JGYA 3OW1A 4CQDA 1A0DA 3O05A 3THQA 3DUGA 3STPA 5G4WA 1PWMA 3S2MA 2GVYA 1TKKA 2RH9A 1JPIA 4UFHA 2YZRA 1EQPA 4AH7A 1WKEA 5EMMA 1ELSA 3KOYA 1ZRQA 1SZRA 1P48A 5EPDA 4W88A 3S1WA 2BLEA 3JUGA 3HA1A 3E1F1 1KBIA 5XIAA 3N2BA 1A5OC 1WXYA 3W28A 3DG6A 3QHMA 1NH6A 2CLKA 4CCCA 2W6RA 3WUGA 4PFHA 3HV9A 2E3ZA 2EBNA 3OHMB 2FLIA 3EAUA 4CD5A 1OFEA 2NVCA 4QROA 2D2OA 4I6KA 1QU4A 1JAKA 1W3IA 4LFYA 2O7SA 3R4IA 3NQ7A 4L4OA 3VGDA 3NNTA 2JQXA 4KEZA 4LBSA 4KWVA 1GJUA 3KVKA 1MNSA 3UETA 1S3HA 1G4SA 3W1AA 2F6KA 1FWCC 3RG6A 1IR1A 1RLDA 1O95A 1PCWA 1M1BA 5ABFB 1KWKA 1PE1A 3BTNA 2R8WA 3BMVA 1P7TB 4H01A 4PA8A 4JXCA 1NF0A 3N18A 4ZTYA 1P6CA 4JD4A 4E8DA 4K37A 3BSHA 2A3BA 3N6QA 4ILSA 4QFUA 3RLVA 4GO8A 1MW3A 1PZ0A 1UR4A 1P1MA 4PBEA 1TWZA 3BOXA 3P84A 2I9EA 3WF0A 1FWIC 3DKLA 1PZ3A 3NDZA 3HTWA 1L6SA 2YCLA 1QO5A 3D47A 3EOOA 4AZCA 2VC5A 5DRCA 2I5IA 2PODA 4HQVA 5C5YA 1E9ZB 3GTHA 4BI7A 4AEFA 2CLHA 3CPRA 1K4HA 3QKZA 2WKGA 3LSBA 3PS7A 1A3WA 1BYCA 1EC9A 3BAWA 2IKJA 3LY0A 1F4AA 4HNTA 1OG0A 1N7KA 4HA1A 4LPCA 1TPVA 5IRPA 4NNBA 5LA2A 2YKKA 2FKPA 3A4AA 3B8DA 4UBPC 1T96A 1F61A 4XUYA 4AY7A 1OT1A 3PZTA 3PBGA 1ZFJA 3EB3A 5BNKA 1EWDA 3NM3A 3QC3A 4N2YA 1MQPA 1ODZA 3VA8A 1M41A 2BVWA 2GSEA 2XFRA 4AW7A 2FGLA 2TODA 4M3PA 5H8PA 4GXPA 2B0MA 3W2MA 4PFMA 3LQGA 3QH2A 8TIMA 1Z9AA 1POJA 2XM2A 4EAYA 1PIGA 1TJ1A 2GFTA 4PTWA 1W32A 4GHRA 5C9WA 1CXKA 4QAWA 9XIAA 3RPDA 1O5KA 3DEQA 1OFPA 3MYPA 1T8XA 3TVAA 3WQGA 3Q94A 3KHDA 3W27A 5C7HA 3G1FA 4JFUA 4RR4A 5EU9A 2WXDM 5ABHA 1HGWA 1AH3A 2OYKA 3RYSA 4NNAA 2X40A 2ON3A 1JZ8A 3LUTA 4JNMA 2KAUC 3ARUA 1DIDA 1NDYA 5AHLA 3NZRA 1BGGA 3I7QA 5CG7A 2CLOA 3TYEA 4NUWA 3C0JA 4IPLA 1EHAA 1RBOB 3K1DA 1I0DA 5JMUA 2OO0A 1DQWA 2D24A 2NWRA 3LEPA 2GPTA 5JH1A 4N4PA 1IXOA 3QV9A 4LEQA 4JTEA 2JEPA 1V0NA 1W8GA 1K7EA 3IIXA 3CUIA 2QDGA 4FNUA 4JBRA 1JCNA 1RBLA 3S5ZA 4LANA 3GBDA 2VP8A 1R9YA 2Y85A 4PUEA 5TQLA 4AMAA 3S42A 2ICSA 1PDYA 2FH6A 1UKOA 1SR9A 2ZIDA 2XVNA 1V3HA 3C2YA 3N25A 3M1ZA 1V79A 4BF5A 4AC1X 3W24A 7TAAA 5HQMA 4LV9A 2J6XA 1DWFM 3USZA 5J5DA 5BYWA 3WMSA 4XAFA 2R94A 2OYMA 1E0WA 3RPMA 4O1EA 4OGZA 4UQ9A 4ZSUA 3LU2A 2WZIA 1JF5A 2J79A 2Y61A 3GRIA 4GUFA 4JY9A 2ZKMX 1OC5A 2RJGA 9CGTA 3E0FA 1UOZA 3EA2A 3UPBA 4OKDA 4DWDA 5EBUA 3KWSA 3QYSA 1EJXC 6REQB 3C8NA 2VXNA 4HNOA 3ZVHA 2HISA 4ERIA 3C8FA 3LDVA 3SCPA 1BAGA 3AWNA 4JCMA 4ZTXA 1JNEA 3WDPP 3UYCA 1PWLA 1LF1A 3A9BA 3C0LA 3STCA 3GVGA 5A8NA 4C65A 4F9JA 1QT1A 1BWLA 3B4YA 4E4UA 4GH1A 3T0CA 1H63A 3P74A 2C1HA 1JIBA 2E40A 1TUFA 3L21A 4J1OA 1H09A 3O6YX 2HV5A 5C0QA 2V5KA 3T8QA 5E93A 1V0KA 4WSHA 2GOUA 1H1ZA 2WNWA 3VM7A 3MANA 1F6PA 1X7IA 4P2VA 3NPVA 4UTTA 4R3UA 1X38A 3SRKA 2P1FA 2VI0A 3ALFA 1DJXA 1NFBA 3SAZA 3R12A 1H5VA 4O57A 3QQ0A 4AWUA 4GYPC 2VX4A 4KCVA 4EK7A 1P1XA 4Q8QA 3O8AA 5DCEA 4UZUA 6TIMA 4F0LA 4F3HA 1AJ2A 3UFYA 1SJCA 1K7FA 3LHZA 2DY3A 3OJGA 5BMXA 4HMEA 3FJ4A 1JQVA 4FLQA 1VLWA 3TYDA 3IJLA 4AEEA 4P5UA 1KC7A 3AS2A 4DAFA 1YYAA 3H2FA 4MPKA 2PCQA 5A8OA 2ISVA 2FB3A 5D03A 5DT5A 2J24A 3PZMA 2GWGA 1GTHA 3UGRA 3PFRA 1HNYA 2C3ZA 4H41A 4WY0F 1KRCC 1PSCA 4H6RA 3OVRA 4DJFA 5DLCA 3UA4A 3OBAA 1PTAA 1CNVA 4G1KA 5CG0A 3CM4A 3MB9A 9XIMA 4E8CA 1ZAJA 1RPXA 4CQ9A 1O5RA 1EB3A 3ITTA 4S38A 2IS7A 3KOFA 3USBA 4LUSA 5MKGB 1EP2A 5B80A 3MQTA 4GQQA 3KS6A 3SRHA 4C6FA 6ALDA 1B9BA 2OEJA 4LX4A 5GNZA 1GVIA 1AMKA 2D23A 2XFFA 4XTDA 3OP2A 5HJXA 4B4HA 1EJWC 3KLLA 1JGMA 4MDPA 1JCLA 5C9ZA 4AXKA 1KWGA 3UR7A 3KOXA 3DBNA 3C6CA 2WHJA 2BWGA 3FGCB 3M6YA 3W7KA 2FTYA 3IK2A 1EGZA 3RF9A 3MP4A 2DDXA 4JFVA 3UNTA 2O4QA 3DX5A 4PB5A 2WVVA 1EOKA 4UCGA 2E9MA 4GGBA 4LUTA 1E55A 2QDHA 2DUAA 3ZZ1A 1TRDA 4KGJA 4K38A 4REQB 4ACZB 1TREA 1Q66A 1LM1A 4EX4A 2DT3A 3V18A 2A85A 4M24A 2ZTJA 4CNSA 2G5WA 3ABRA 1P5BA 3FAWA 1UWRA 3CHCA 2ASHA 4WKFA 5D4YA 1UJPA 4MB5A 3W9ZA 2H6RA 1XIEA 4AZIA 2BV9A 1VEOA 4LVGA 3TROA 1R3WA 1PB0A 3CT2A 4RZ6A 3DFSA 1T6MA 2BB0A 2IPFA 3M0YA 4BKNA 1OB0A 1JXKA 3A22A 3HURA 3WLHA 3CK5A 5LA0A 1UB3A 4EF9A 4Q8VA 3QM3A 3MU7A 1YMYA 3GNOA 1EHNA 4XB3A 2WAGA 1Q6GA 3U48A 1NVMA 1M9HA 2ATSA 1UR9A 3AHYA 1FFQA 4O10A 4MF4A 3W1XA 4ZE4A 2YW4A 2I56A 2BX7A 3HQPA 3VM5A 3UR5A 1IHIA 4AVOA 3HBLA 1TCDA 3NPUA 1R47A 1FWAC 3LCXA 3PZQA 1RBAA 4EXBA 5HBFA 4Y9AA 3SGGA 4XIMA 3VPLA 3KZSA 2ZYFA 4LU0A 4I7VA 5EMKA 1AZ1A 4W7VA 4EXAA 1DTNA 5C6MA 1JZ7A 3AS1A 1WO2A 5F4SA 3GFXA 1FDZA 4L1WA 2YFNA 3IRSA 2DEPA 1FWHC 1CGXA 3MMDA 2FTWA 3LYEA 1UA3A 4DEFA 1GW1A 2IPJA 1CEOA 5CCZA 1FOBA 2R1PA 1FCUA 2EPKX 3RK8A 4H9YA 3PWIA 1LRQA 4HT3A 4DHGA 3B8TA 1X1ZA 2Y8VA 3UWUA 3MV11 3T0BA 3ABZA 2ZRZA 2PZNA 2QS8A 4IPIA 3GIPA 2WZTA 2IMRA 1A47A 4I8YA 1DWIM 4EWJA 3TQPA 1JZ4A 1GT8A 1V6UA 4O8RA 3W70A 1EF3A 1J18A 4Q4RA 4DUWA 2P53A 4TUFA 2VR2A 4Y96A 3TONA 2PBOA 3MI6A 1XR2A 3VYLA 3L68A 1H4PA 4P7LA 3Q4DA 4XBSA 3R8RA 3I4KA 2GVLA 3M6DA 2DH3A 3S2CA 1UZHA 2P5NA 1GZGA 1DTUA 1FWDC 2QJJA 1C29A 3BARA 3WDRA 1E71M 4YL2A 4C6OA 5G2IA 3EX3A 5GJPA 4HJWA 4HPHA 4QP0A 4U3CA 1QI5A 1TQJA 3GY1A 4QQ3A 5KSWA 1ZUAX 1TA3A 2WSPA 4NQ1A 4KQNA 2F8QA 1JYXA 1YBQA 1KR0A 3RR4A 3CQJA 1JXJA 3R0DA 4LYQA 3PSVA 1AD4A 4AC7C 3LXAA 3HO8A 3W7OA 1VFSA 2QAFA 2YYTA 3NR0A 4P7OA 5CPQA 3U7BA 1A5KC 4M19A 2QCFA 1PV8A 4CCDA 2W0UA 3TWBA 3AIVA 4RZBA 2BOGX 3W76A 1E1FA 5I03A 3AUOA 1GYNA 8XIMA 1BKHA 2WNZA 4W85A 2UV8G 4KMQA 2BSLA 4D6EA 1R5YA 1BQGA 4M6QA 4UIOA 4S1FA 3PNUA 5D2WA 1E1CA 4A8RA 1U83A 2XH4A 3AMDA 4IQJA 2OELA 2W27A 5FKYA 3LCFA 4LRSA 3FYPA 4NP7A 3LQLA 4H04A 2WJZA 3S9IA 2VOMA 4F8XA 3POHA 3UWEA 4PMXA 5E9AA 1RJRA 3L2LA 1JUKA 1XBZA 3IGUA 1GUVA 4W4QA 1GK8A 1XRVA 1VQTA 3G1HA 4NSBA 5A5WA 2G3FA 1K1DA 3OVQA 1SFTA 1KFLA 4I9JA 2YXXA 3LOTA 3CUXA 1MUMA 3TP4A 1ICPA 4O17A 5LIWX 1X6UA 3TMQA 3IARA 1SFSA 3CV1A 4PUJA 3H23A 3HMCA 4PYSA 3DXIA 1XYBA 3TTSA 3WFLA 3SCWA 3CO4A 4ACYA 3H2OA 2DH2A 3A64A 4A2RA 1EFZA 1PX8A 1MXSA 2PRMA 4GIEA 4KRTA 1MQRA 1DEDA 4IXXA 4MYAA 3V5FA 1WA3A 2VGBA 2A3EA 2NQ9A 4PMNA 1MO0A 4YYCA 4NU7A 4AX7A 2F6XA 4PTVA 2TPSA 3SFKA 3LSCA 2PB1A 3ZSTA 4CUCA 4PCFA 1OGBA 2DSKA 4LC8A 1J0IA 2Y2WA 2YCEA 3J7HA 2VUNA 1TTPA 4LV4A 2QLYA 1KRAC 4LYRA 1YPIA 4KCUA 1Y5WA 4MB1A 5M1TA 4I90A 1VCVA 1DP0A 4H9VA 1KO0A 2J9YA 3AYRA 4WJXA 3TA6A 3GTIA 4WCJA 2W63A 4HCLA 2PPGA 1OFQA 4FXFA 2CZDA 1UPPA 1A4LA 2G37A 5B7YA 3EX1A 1RQHA 2ZX6A 3NQBA 4FOUA 2CHNA 4ZXOA 2A0NA 2PWUA 1CT5A 4QQUA 4NVTA 3KCLA 1Q6FA 4GGHA 3KW3A 3PJWA 2FGBA 4KETA 2BS9A 3FA3A 4JEQA 5AFDA 5BW6A 3IAPA 4KH2A 5MHBA 3VCCA 1DJGA 2YDAA 2XDFA 4JPGA 4YNGA 5DBUA 4IPPA 4AISA 3SCNA 3W86A 4JIIX 4IIGA 2NSXA 4O0KA 1LOLA 3WDHA 3MI3A 4QJ1A 1E6SM 4FNSA 1SW3A 3TV8A 4U5IA 1DJWA 3MHFA 1OYCA 4DO4A 5IDIA 2HS8A 3KVLA 2CITA 3V5OA 2FQIA 4JKKA 3AZRA 4UR9A 1GZJA 1U5JA 2GJPA 1TZ9A 2TAAA 3N14A 3R6IA 3UG8A 3T09A 3JRKA 2QQ6A 3PBWA 3PTQA 1K9EA 1XPYA 1HKVA 2YOCA 3E2VA 2PU1A 1RXOB 5J8LA 4US5A 3AS3A 2P10A 3O07A 5I02A 5AVHA 4HKPA 3SCRA 2VO5A 4JDYA 3MO7A 1JZ5A 2Z24A 5BRPA 7PTDA 5FL0A 1H51A 3B0YA 4NZFA 1EA0A 1C93A 1V3JA 2EJ1A 4C7FA 5IBXC 4UFJA 2PWFA 1YNYA 1RVGA 4C1LA 3G18A 4B90A 1N8FA 1RA0A 1LQ2A 1GKPA 2VT0A 2GYIA 3D3FA 3K13A 4MFDA 1E4MM 2DV0A 3P60A 1C7SA 1OX5A 5A6JA 1RHCA 1G4EA 2J7DA 1XLMA 3NYZA 4HOWA 4K8HA 3LMYA 3NXFA 3H22A 3MTWA 3GIQA 3GNNA 3DHUA 1HKKA 2QUVA 1EQCA 3WBEA 1R30A 1GVSA 3LCGA 2PFHA 2D22A 3INPA 5E0KA 4WKHA 1IT0A 1GPFA 4FHAA 4FP1A 2BXZA 1N82A 4QE4A 3NWRA 4HU3A 3CUJA 1HF6A 5LA1A 5GNXA 3VXGA 4K1GA 3SCQA 2WVSA 1X98A 4KFOA 3NSXA 4U4MA 3ATYA 3MHUA 1T0OA 4RE0A 3SUUA 3FY1A 2AQOA 1ZALA 3W38A 1ZP4A 2QJGA 3PWAA 2GGEA 4DM2A 2ZRVA 4LYKA 3VFLA 1AZ2A 3AC0A 5GPRA 1QCWA 2VCAA 1AQFA 3ANVA 3URQA 1WOBA 1OY0A 4NYYA 2D0HA 4HMCA 3W2UA 3ZLGA 1Y8BA 3D3AA 1I2QA 3LRMA 4LXFA 3W25A 4B16A 1M5WA 3MKVA 4IMEA 1ODUA 1ZB5A 1H2JA 4K7YA 5ABFA 3EMCA 1QHPA 4A4AA 3E0WA 3AALA 4GI6A 5TIMA 1Z42A 4EKJA 3QSRA 1WBJA 2X7VA 1CENA 3KL0A