2BWGA

Structure of human guanosine monophosphate reductase gmpr1 in complex with gmp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
337
structure length
335
Chain Sequence
PRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Guanosine Monophosphate Reductase Gmpr1 in Complex with Gmp
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GMP REDUCTASE I
total genus 114
structure length 335
sequence length 337
chains with identical sequence B, C, D
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bwgA00
1DQXA 1XC4A 1W5MA 2V0TA 1JCJA 3UY8A 3C2FA 2R14A 1SO6A 1AW2A 4AAJA 3Q37A 3QEZA 2QCGA 3G22A 2V81A 5G1YA 3S5OA 5FEWA 3EWZA 5FF2A 1M6JA 2AQWA 2VC6A 3C2VA 3KVKA 1F05A 4DPPA 3TNOA 3NEVA 3G18A 3I7RA 1DV7A 3LM7A 4NXKA 5LNWA 3LCHA 1AMKA 4GXMA 3SJ3A 5DCBA 1ZNNA 1LORA 3PF3A 3LHWA 4ALDA 4UTHA 4LC8A 4OE7A 1GWJA 3IGXA 2R94A 1X1ZA 4XKYB 4ONVA 3I6RA 2YDAA 5EPDA 1RD5A 1M5WA 3R2GA 3PUDA 1OHLA 1VYRA 3W2JA 3BLEA 3KHJA 3TJXA 1TQJA 1GZGA 1VHNA 1G4EA 1O5KA 2QEZA 3MHGA 4FNRA 2HTMA 2NX1A 2Y7DA 3O1NA 4BI6A 4BK9A 1IIHA 3OEXA 4R7JA 2WV8A 1TJPA 1KFJA 2Q3OA 5KZDA 3DXIA 5I3FA 2RDTA 3N73A 2JK2A 4ML9A 2WOQA 1PS9A 1EX5A 1VPXA 4NQ1A 2E77A 4LV4A 1G4SA 3W7IA 3LRMA 4NNAA 3DFSA 1Q45A 1GJPA 4QSHA 2EGZA 3IRDA 1IGSA 2HS6A 4U28A 3V75A 4A22A 2BWGA 5D2VA 1VCVA 3W85A 2CU0A 1TPC1 3NL2A 5TQLA 3SECA 4IMGA 1SSGA 3L67A 2C0AA 1GYNA 4JYFA 3V1PA 1QMLA 3VNDA 1XKYA 1T8XA 3BK0A 4LWWA 3DFQA 3NL5A 3HGJA 1NSJA 4OWGA 3CWNA 4JTGA 1KLZA 3W2NA 5CSSA 2QAFA 3WK1A 4MLJA 1KM1A 4AWSA 4AHOA 2BSLA 2Z1BA 1JCLA 1WBJA 1TPEA 2E5BA 2EHHA 3BPWA 4K39A 4XQ6A 3GXNA 2I14A 1YDNA 2E09A 3UWQA 5U4NA 1KTBA 4IGHA 3Q94A 3MYOA 4K37A 5CZ0A 2G5WA 4IMEA 4CQ9A 1I2PA 3LLDA 1JUKA 3PAJA 3W7JA 2TMDA 3M5ZA 1HO4A 1P1XA 3BARA 3EX1A 4NU7A 4M7TA 3UPBA 1TQXA 4O16A 4BF9A 2DZXA 1U5JA 3LDVA 4RZ6A 4IQLA 3CIXA 4LVDA 3LHTA 3M0ZA 3HO8A 4JIPA 4NUWA 1FCQA 3NQ6A 4PFMA 4AWTA 3ZR4A 4YCPA 4QAIA 5BW6A 1SO4A 3EX6A 2W79A 4UTKA 2H8ZA 3NQGA 3CB8A 5T26A 4N02A 4UFJA 1X8FA 3W7DA 1T0OA 4QM1A 1BTMA 3IIVA 4L4MA 4N9DA 2QAPA 3FYPA 4XUGA 3W73A 1ZFJA 3SSJA 3TQ0A 4ADTA 1YXDA 1F7BA 3W83A 1JCYA 3HGSA 5CG7A 1TTPA 4ZQCA 4MYXA 4K7YA 1EPXA 1RZMA 4O1DA 2JGYA 2ABAA 1TREA 2FB2A 5K9DA 4LY8A 2X1SA 3LCIA 2FFCA 5IBXC 3G1HA 2XN2A 8TIMA 3USBA 2VXNA 2DJXA 3IV3A 2GVGA 4RZ4A 3HB9A 5AHLA 1W3NA 1OFEA 4DF2A 5LNVA 4IXXA 4PL1A 3TXVA 3S6DA 2A85A 4N9BA 1IXNA 1FDJA 4GBUA 1FY6A 3FS2A 3B04A 3C56A 3CIWA 3SI9A 3IVSA 4DO5A 3T55A 1K3UA 1SR9A 1Q6LA 3LHVA 1ZALA 2DZSA 5AHNA 4AXKA 5K9CA 3EX4A 2J9XA 1ZAJA 4BR1A 4ZQPA 4TMCA 3FOKA 1NFBA 1WXJA 1OJXA 4LRTA 1W5PA 2Y85A 1VYSX 3STGA 1QPNA 1VH7A 1KM3A 4AVFA 4B5NA 1QO2A 3LTPA 2QCCA 1FWRA 5D05A 2H90A 1XBXA 2WQPA 5HJLA 3GZ3A 1O60A 4YCOA 3LTSA 4ZL1A 2BZNA 3QM3A 4GUFA 1LTDA 2E68A 1JCMP 4N4QA 4IJBA 4Y6GA 1OYAA 1CX9A 3P80A 4X2RA 3RNDA 1L6WA 4EF8A 1M7OA 1DVJA 3A9IA 3C2EA 2ZZ7A 1TMHA 2QCDB 3TSBA 5C55A 2FDSA 4IMDA 2PRLA 3P7YA 3MP5A 1EA0A 3MI2A 1EUNA 5EA9A 4M7SA 3I7SA 3HG2A 1OX5A 3BW2A 4MUZA 2EPHA 1B9BA 4CLMA 3QRHA 2PURA 3JS3A 2O7SA 3QSTA 1H7RA 3FEMA 3W1NA 3UNDA 4NJKA 1IXPA 3QW3A 1KA9F 4FIQA 3W71A 4AF0A 5KTLA 4A2RA 1BWKA 3GXTA 3W1UA 3TAKA 4O1CA 2QJIA 3PUOA 3GVGA 3S1WA 4GC4A 3EXSA 1OVDA 2B7PA 4RKAA 3DH7A 2NZLA 5MHBA 3EX2A 4OU1A 3LV5A 5KINA 3HJZA 4NJHA 2QCDA 2D73A 3RLVA 4M5PA 3NXFA 4RLIA 4XTIA 1PCWA 1I2OA 4WQ6A 3S1VA 4YMZA 3IGSA 5AB3A 4KFOA 1UCWA 3S9YA 4UMBA 5EKYA 4WY0F 3Q58A 5KITA 3LLFA 1LBLA 3KXQA 4RXFA 5CZTA 3NPWA 3DHDA 2ZBTA 1OG0A 1R2RA 2VFIA 5D2TA 3NQ2A 3NQMA 2YFOA 3NOEA 5D30A 2Y7FA 2C16A 4JTSA 3UYCA 2J88A 2OMAA 4DELA 5D09A 4PCFA 1DJQA 3MBFA 3E02A 3ZWSA 3G1SA 3NG3A 2E6AA 3G1FA 2NWSA 4RXGA 3H55A 1SZEA 1W37A 3W6YA 3K30A 3I68A 1FWNA 2QDHA 1EP3A 1K02A 1ICPA 2GVJA 2Y88A 3BGJA 4DF1A 3I65A 5FF7A 3M5VA 2RDUA 1I2NA 3P5YA 5LHEA 4AF0B 1MO0A 1H1ZA 4GE8A 1JULA 3IVUA 2Y61A 3YPIA 2HMCA 3KRSA 3O05A 4NX0A 5F4XA 5EMUA 2A4AA 1WOAA 3CU2A 2ZRXA 3ANYA 4MY9A 3W7LA 4UNLA 3TV8A 3TDFA 1ZENA 1TPUA 4A3UA 4MJMA 5C54A 2FTPA 1WV2A 1TTQA 4O0ZA 3GK0A 1C29A 1K7FA 3MO7A 2ZZ5A 3WJSA 1G7UA 1YYAA 2GUUA 3GDLA 3F4NA 3TW6A 1E51A 3WK2A 3GDTA 3CLMA 3UZ5A 5KZEA 5F4SA 2ATSA 1GTEA 4I9AA 3PS7A 4Z0JA 1X7FA 3EWWA 3PUEA 3PM6A 3QYQA 3MI6A 4PL2A 2WKJA 1B57A 4JTIA 3SR7A 3G24A 4HT3A 4LT9A 4FXRA 4UTTA 3NGJA 3BG9A 3HF3A 3F1QA 2GVLA 3P74A 3PULA 1G6CA 4WZHA 3DBPA 3GR7A 5EY5A 1FDYA 1J5TA 2JKEA 4HPJA 3U2OA 1TO3A 3LXAA 4UMCA 2Z6IA 2XN1A 4K7VA 4UTJA 4O19A 3FKRA 3SIZA 2DZWA 3STCA 1PIIA 1PHQA 4LS2A 4XTDA 2H3DA 3TIMA 3W1XA 3FFSA 2V9DA 3NAVA 2CLLA 3UQNA 5DXXA 4HNVA 1XI3A 2OCZA 3L5LA 4HNTA 3N9SA 4I7WA 1L2UA 4MZ8A 5LNUA 2TYSA 3WJZA 1VCFA 2FPVA 2AAMA 2DJLA 3O63A 1EUAA 3MJYA 3FJ6A 3TSDA 2C18A 3L65A 5EL1A 1QCWA 1OF6A 5D04C 4DQWA 5I3GA 2GQ9A 2ZFAA 2P1FA 1AK5A 4DO4A 4WY0B 1JCXA 3GXPA 5AYXA 3W7PA 3UWWA 2VEKA 1IXOA 4PC8A 3STEA 3E9AA 3DI0A 3SGZA 3IIPA 2VEPA 3MWAA 2DP3A 4AHQA 3WK3A 4UCGA 1GVFA 3BV4A 4E2BA 5CZSA 1B3OA 1KM5A 4OT7A 3IIZA 2OX1A 3QH2A 3GLCA 1W5OA 2IQTA 1TPVA 3LCXA 1H50A 3GNDA 3BVJA 4FNPA 3ATYA 4Q33A 2V2HA 1HL2A 2E5DA 3EB2A 4MPQA 2B0MA 5K9XA 1Q6QA 1LOQA 3P84A 4FIRA 1ME8A 1W1ZA 4O12A 2W6RA 5F1VA 5J5DA 3GB6A 1K8ZA 2VEMA 3TE9A 1DKWA 2V5LA 4JTFA 2WNQA 3TFXA 4K8EA 3W75A 1FCUA 1RQEA 5CGQA 4OGZA 4Q4KA 3W23A 1TPFA 4WUIA 3TW7A 3P61A 2B7NA 4ADUA 3PB0A 1TRIA 3C2OA 4NXSA 4XKYA 3IIXA 1ZHAA 3KRUA 1LRNA 1JRBA 2V8ZA 5FEPA 1LDCA 1PL9A 1A5CA 1QR7A 3T7VA 1A53A 1LRQA 4UTUA 4LW7A 4DBEA 3NQDA 4JTHA 1RPXA 1MZHA 2VFGA 3NDOA 3W7OA 5I3IA 4JDBA 1ZJIA 4FX6M 1AG1O 1WQ5A 1WAUA 3B05A 5DCEA 3B0PA 3GKFA 4IWWA 4O28A 3H54A 2E5CA 4O52A 4O13A 1F5ZA 4O10A 3S1XA 1YLVA 1HUVA 2YZRA 1WOBA 1TTIA 5LGXA 1SZFA 1XFBA 1RVGA 3LCLA 2DORA 4DBDA 2BLEA 2ZZ2A 2NUYA 1BWLA 2BTMA 4XBKA 3OIXA 1UB3A 5BRBA 1ME7A 3W22A 1DORA 4CCDA 1J4EA 1JRCA 3TR2A 3NR0A 1FQ0A 1P0KA 4IPJA 2GJNA 3NM1A 3P81A 4LRSA 4K8HA 4UTWC 2V30A 4NZFA 1TPDA 2WPBA 1H7NA 4UUIA 3TQVA 2NV2A 4MYAA 3LV6A 3TAOA 2TPSA 4IPIA 2ZTJA 5AC8A 1ICQA 3PBUA 5BOOA 3TROA 5F1UA 4WJEA 5AN7A 1EP1A 1KFEA 2Y70A 3NL6A 3EWBX 3B8DA 4QITA 1V5XA 1NEYA 2GPTA 3A21A 2F84A 2Q8LA 3O16A 3MMTA 3WJXA 2YCEA 1XXXA 1OYBA 1H51A 3ABRA 1DBTA 3EX3A 5I3KA 3LTYA 3WFAA 1JCNA 2A7RA 1W56A 4WY0A 3IGUA 1R2SA 4JD4A 3W7KA 1F73A 3R5EA 4UTWA 2QUUA 5AYZA 2A7PA 4IOTA 1BEUA 1S5VA 3GDRA 1DOSA 3MI3A 3W1RA 2HSAA 2X2GA 4POCA 3EWYA 4NNBA 2NXGA 5G1TA 4ZZ9A 3LBCA 3C2RA 4UFKA 5E1QA 3N2XA 3INPA 2FLIA 1FUYA 3L0GA 4NX5A 3C8FA 4MVAA 4IMFA 4FXSA 3NVTA 3RMJA 1KFBA 5CPOA 5AC7A 1OFAA 2QCLA 4PEKA 4LV9A 2NUWA 3RFAA 3IIOA 4A2SA 3AO0A 5G4WA 3PBWA 2YX0A 3W88A 2PRMA 4Z08A 3W1QA 3SW6A 2QCMA 1OK4A 4UR7A 5AHIA 5SWUA 3PB2A 3LRKA 1KV8A 5HINA 3LI1A 3QQ1A 4N9CA 2ZZ6A 1T99A 3W9ZA 1HTIA 5D02A 2BX7A 4UTIA 1ALDA 3KOFA 1NF7A 1MEHA 4FNSA 3OVRA 4GUJA 3TK7A 1W8SA 3PWAA 3SZ8A 3PR2A 1F6KA 4UFMA 2VOMA 1KM0A 1VHCA 4JN6A 3QF0A 2ATMA 3SGUA 3LB0A 2VFFA 2YPIA 3ABQA 4LVBA 3W2LA 3W7RA 1DL3A 3P8IA 3ZFHA 1FWTA 4W9TA 2VFEA 3W84A 2EKCA 4MOZA 1FBAA 3N2MA 3NYZA 1B4KA 4Y9AA 5HUOA 2ISSA 3TFCA 3NPXA 5FF3A 2R8WA 2ISWA 3G1AA 1JQVA 1VGAA 2VEIA 1TRDA 5LNSA 3NNTA 2Y7EA 1XDLA 1R47A 4I7VA 2I1OA 5FEXA 3UWVA 3OG3A 4A21A 1NVMA 5L9FA 4CQ8A 4O15A 2FB3A 3MYPA 3D0CA 3B06A 3BGGA 1QO5A 1EB3A 3KRZA 2ZA3A 3W7QA 1S5WA 2YW3A 3L66A 4ORMA 4CCCA 4DEFA 1ADOA 3W7EA 4MZ1A 3C0JA 1I4NA 2RHGA 3LCFA 2ZRWA 3DHFA 3A24A 3P62A 4O1BA 3GYEA 2X1RA 4OV9A 1KTCA 1LOLA 4N2YA 2ZQ0A 3KX6A 1P0NA 2ZTKA 1FXQA 1SW3A 2CZ5A 4KFNA 3LBMA 1WYIA 3DENA 3P82A 5HWMA 1TTJA 3FYOA 3PSWA 1SU5A 4CCEA 4GWEA 4JTEA 1THFD 4UIOA 4DXVA 1KTNA 4KWVA 1QDSA 1WDWA 4Z1BA 3NM3A 3CQ0A 2QUVA 1L6YA 3RK8A 1YDOA 3W07A 5U7SA 1LLWA 4FB7A 5DN1A 1XUUA 1RQBA 1N7KA 2VFHA 4UFLA 3GAKA 3MP3A 4O57A 3HG3A 3C61A 4JTJA 4JX5A 5KZMA 4S1FA 1VRDA 3DFPA 1HO1A 4O4WA 5LHFA 2V2DA 3L68A 3MBDA 1X6UA 1Z48A 3A5VA 4H6KA 1LYXA 2V2CA 3QQ0A 5TIMA 3ZWTA 3QPZA 4O4VA 1LBFA 4GFSA 2Z6JA 2ZCGA 4CNPA 3O8AA 4PA8A 2A6NA 3HOJA 2WSRA 3QMTA 2OZ0A 1OFPA 2Y62A 2ZRUA 1UJPA 1EEPA 1KV5A 4FHAA 3T44A 3F4WA 5K3VA 2UV8G 4MFDA 1O95A 4HSNA 2RFGA 4FX8A 2QCEA 5L6UA 3RLUA 3HQ1A 1YXCA 2P10A 1VYPX 3QPYA 4GRSA 3G8EA 3OVQA 5DY3A 4X3ZA 3RU6A 2GQAA 4NT0A 5LGZA 2O7QA 5F2GA 4E38A 2FJKA 4Q32A 2WNNA 4J9JA 3UXAA 1C9DA 1ME9A 1GQNA 4YL2A 2XFWA 2OJPA 3W87A 1JR1A 2ZZ1A 2WSYA 4JYEA 5AHEA 4GUGA 4HNNA 1TPWA 5DY2A 3L2IA 3O15A 2H6RA 1YPIA 4JYDA 3THAA 3FA5A 5CPMA 3KVJA 4EIVA 3H53A 4R34A 1PCKA 4WXYA 1MXSA 4LUIA 2FPYA 5FESA 1KBIA 4XZ9A 4LOCA 1TCDA 3L9CA 1HG3A 2CLHA 1OF8A 1PVNA 5D32A 1GPWA 3CEUA 5F4WA 2G95A 1LBMA 1AW1A 2NLIA 2JKPA 2QUTA 2HS8A 1H62A 4OQVA 2A21A 3DI1A 1KM4A 4M6QA 4FNTA 3TQKA 1G4PA 4U4MA 2B7QA 4RZ5A 4RK8A 4FX7A 2CWNA 3TX9A 1QFEA 3AJXA 5DCDA 3DU0A 5G4EA 1B4EA 1I2QA 2QCFA 2ZZ3A 4M19A 3EEGA 3DGRA 4JXCA 5IBXA 4UTMA 3B03A 1UBSA 2X1TA 1A5BA 3S8HA 1TV8A 4ZQNA 4ADSA 4HHPA 4GNJA 5KSWA 3ATZA 4IXHA 3EWXA 3PG9A 3LHUA 1SUXA 4LU0A 1KFLA 2C1HA 1XL9A 5IM51 5D2XA 3L21A 3B0UX 3SFKA 5FEZA 1K8XA 3UWUA 3TJLA 3DKJA 4LVAA 4AH7A 5BNKA 2QKFA 3EKZA 3GR8A 4LTSA 3O06A 4M6PA 2TSYA 2Y89A 3W2KA 4ZVJA 5HWJA 5C5YA 2GOUA 1ZAIA 1GVQA 3LHYA 4Z1CA 3BLFA 3M43A 3TXZA 5F2IA 3G8RA 4AEOA 1VQTA 3VE9A 4JDYA 4Y90A 1T96A 1SW7A 2PE4A 1O94A 1S3HA 7TIMA 3OBKA 4JY9A 2ZRYA 3R89A 3LGEA 5I3JA 3G1DA 4O11A 4JNMA 5AC6A 2YXGA 4MIMA 1L6SA 3UZJA 3M5XA 2ZZ4A 1ZAHA 2CLEA 2ZRZA 1MEIA 1TPH1 1XM3A 3HG4A 3HBLA 1QPOA 3G3MA 3U8GA 1LLZA 3A5FA 3W7GA 4LUJA 5GVJA 1JVNA 1WA3A 1K7EA 1OABA 4UNKA 4HNUA 5K4ZA 1XDMA 1L9WA 4K6AA 3WJYA 1VS1A 1GEQA 3O6YX 2BXVA 5C6MA 2VFDA 3L0NA 1H1YA 3CWOX 3HGOA 1QOQA 3KVLA 3R13A 5KMYA 1P4CA 4CQAA 2NX3A 3TC6A 1SW0A 4WX2A 2DZVA 5CPLA 1FDZA 4BFAA 1Z42A 4PH6A 1FCBA 5EBUA 1G67A 4WD0A 3O6DA 1Q3NA 5FF4A 1AL7A 1OK6A 3NL3A 2FIQA 3GKAA 3L5MA 4X22A 4TO8A 5G5IA 2Y63A 2DZTA 1H61A 2WJZA 2CLFA 4E2DA 3JRKA 3THQA 3G0XA 1I2RA 2NV1A 4FNQA 3ELFA 3KVMA 4H3DA 3UY7A 2G96A 1H7XA 2NXIA 4UMAA 4NJJA 3L0KA 1N8FA 1XBVA 2GQ8A 1J2WA 3BG3A 2NWRA 3C52A 3PG8A 5LZLA 2E1DA 1YDVA 4GJ1A 3M5YA 3P60A 1XCFA 3MHFA 1TYGA 3RF9A 4G1KA 3JR2A 4AMAA 4JS3A 2C15A 4S2BA 1H5YA 4JR5A 2Y6ZA 2X16A 3OHIA 4AWUA 1SPQA 3GX9A 5E93A 1YXYA 3HGRA 5HULA 3W72A 5H91A 4MKNA 2ZA2A 3G0SA 4O0KA 3NQVA 3G1XA 1PV8A 1TV7A 1W5NA 5D38A 5D2YA 3N9RA 3W76A 2CZDA 1LP6A 3WK0A 1YTKA 3BW4A 3NPUA 3NQEA 4O8RA 4XWUA 1FWWA 1MEWA 1W3TA 4UFHA 2DU2A 1D9EA 5AHFA 3NQAA 4TU1A 3E12A 2W0UA 3BW3A 1XBYA 1H7OA 4Z0SA 3VKJA 3L5AA 1OFQA 3M44A 5H2ZA 3TMLA 1ML1A 3DFTA 3VE7A 4UXDA 3QSRA 1R2TA 4P61A 2Q8ZA 1FWSA 1IF2A 2ZA1A 3G0UA 3NQFA 1TSIA 4WOZA 3GDKA 1LOSA 2RKXA 1WX0A 2B4GA 4AB4A 3ABSA 1AW5A 2YR1A 4TR9A 1TB3A 3ABOA 1OX4A 2ZYFA 3NZRA 2H8XA 1GOXA 4PTNA 1P5BA 4LVFA 3IEBA 1EWEA 5DLCA 2JKAA 1OFBA 6ALDA 4N6FA 3TU9A 1H60A 2V82A 2LLEA 4UFIA 3N34A 1QAPA 3E49A 4M6VA 3EXRA 1D3GA 2QJGA 5LKYA 2E6YA 3STFA 3R8RA 2QF7A 1HFBA 5HUPA 1K7XA 5F2LA 1OFOA 4JGDA 1IIGA 4ICNA 3PBVA 4UTTC 1Y0EA 2Z2UA 5TBOA 3G3DA 1KM2A 1OYCA 1AL8A 1Q6OA 2GJLA 4DPQA 5FF0A 1CW2A 2VENA 3W1PA 5LSMA 1A5AA 4GUIA 2X1UA 4MZYA 3E0IA 3T78A 1QNVA 4K36A 1H63A 4NJIA 3GIYA 1KBJA 1A50A 3PC0A 1A5SA 3S0CA 1OX6A 1GTHA 3CPRA 2CLOA 3NQ8A 1EWDA 1YADA 3TUUA 1M7PA 3EKLA 3CC1A 2R91A 2I9EA 2ISVA 3QMSA 4NVTA 2CLKA 2A6LA 3KFTA 6TIMA 3PY2A 3UWZA 1O4UA 3W86A 1XUZA 4N4PA 5D03A 2NXHA 2J9ZA 5HR7A 1SZGA 3F03K 4JTTA 1N55A 1TJRA 3BG5A 1GVOA 3BO9A 4O17A 4C1KA 5HR6A 4LC6A 4QQ3A 1FCVA 3HIJA 1SSDA 4HN4A 1F2JA 4BWLA 1KW1A 1FXPA 3HPXA 2CLIA 4BI5A 3TKFA 2FQIA 1TV5A 2QR6A 1JQXA 4R53A 3BLIA 2PCQA 4MLRA 3TA6A 4KFPA 2RDWA 2VKZG 4O1AA 2WO5A 4HIBA 2DZPA 1Z41A 3NQ7A 2CFFA 3DKLA 4O54A 5CKSA 2A2IA 3CEPA 1R46A 1V7YA 4RX0A 2CZEA 4YLWA 3W1MA 4LNYA 4BI7A 2H3BA 3C3NA 3S5NA 1ZCOA 2YYTA 3R12A 1JUBA 2YW4A 1VCGA 4Z1AA 1TIMA 3I7QA 4E0CA 1IXQA 4FEZA 3HPZA 4MY8A 1QOPA 4O18A 3P5ZA 4C1LA 1EP2A 1VR6A 3ZS4A 4I7UA 3U6WA 4HKPA 1Q6RA 1G4TA 3W7MA 3W1AA 3PVFA 4CNOA 2V5BA 4D2JA 1PE1A 4JTKA 2ALDA 2CZFA 3IVTA 3CT7A 2P0OA 4JEQA 4KWWA 4PODA 4LS0A 5K2ZA 1OX4B 1MSSA 3NZ1A 4HSOA 4TX9A 3FIGA 1X1OA 3DFNA 5I3HA 3S42A 2A1YA 2QCNA 2PRHA 3W7CA 1VLWA 3A23A 4Z1DA 3FKKA 3CM4A 3C6CA 4FO4A 3OVPA 2AGKA 1H7WA 4LVGA 3DZ1A 1QPQA 4A29A 1F76A 3VI2A 1ICSA 4UC5A 3LCGA 3FJLA 2QDGA 2NX9A 4OV4A 5D37A 1EIXA 5ABTA 4ZMGA 1I45A 5AHMA 5BMXA 3W2UA 1GT8A 1I8JA 3A22A 5DBTA 4EOUA 3M1ZA 1GVSA 1QWGA 1ONRA 1VZWA 4YXGA 2NUXA 3LHZA 3DAQA 1LM1A 2C14A 1VLIA 4UR8A 4RV8A 1UUMA 2YGYA 2C13A 1LCOA 3M6YA 5G2WA 3TMQA 5DXYA 1C8VA 4JX4A 5C2XA 1R30A 5K7JA 2J27A 5D33A 3VFLA 5HNRA 1RR2A 1W31A 1KM6A 4JY8A 3QC3A 2WNZA 2E6DA 3KAOA 5A5WA 5G2HA 1W5QA 4QIUA 1U83A 3HG5A 4ZQRA 1PHWA 3UPWA 1OFDA 2DZUA 4OHQA 2YFNA 5D2WA 3W7NA 3NPVA 1FX6A 3CTLA 1SO5A 1SO3A 3TC7A 3QJAA 3T40A 3C4UA 5HMSA 5G2IA 4QNEA 4RCXA 2JBMA 4EWND 4TIMA 4IX0A 4NNCA 3QW4B 5DELA 5CZJA 2QJHA 3S5YA 3MW7A 4MY1A 4O53A 1CI1A 3LXBA 5CPNA 3P8JA 1UUOA 1KFCA 4N9EA 3W2MA 1NF0A 2PC4A 4IX2A 1SFLA 4TMBA 1G7VA 3W74A 3LXCA 4OBTA 5F2MA 1XBZA 3TCEA 2J24A 4EVZA 4EF9A 2TRSA 4KKXA 3O6CA 3LERA 5CSRA 1D3HA 1S5TA 2OT0A 4N6EA 4JICA 1LROA 1F6PA 2FPTA 3QZEA 1SFJA 1K03A 4L4LA 2YYUA 3MP4A 5A8GA 3GDMA 2ZRVA 3B4UA 5DBUA 3FLUA 4O50A 4QJ1A 3EWUA 1YTEA 3NQCA 1DHPA 4JTUA 1W3IA 3LOTA 4XBSA 3NO5A 4H4IA 3W1TA 4DF0A 1GG1A 2CW6A 4ZQOA 3W7HA 4WOQA 3N19B 5HWNA 3MUXA 1OFRA 4P2VA 2J6XA 2KZHA 1JUEA 2VELA 3E96A 3LCWA 1YTDA 3DFOA 3SY5A 5BMWA 1VC4A 2YSWA 2Q3RA 5LNRA 3NA8A 3PBYA 1ZY9A 2Y7GA 3OA3A 2EF9A 5AFDA 2JGQA 5AOUA 3CHVA 1GG0A 1LZOA 1SQ7A 1TPB1 1W54A 1UASA 2CLMA 1DJNA 2F7FA 2OT1A 4MJZA 3LX9A 5K4XA 1O5XA 4S2CA 3PSVA 4JX6A 1F74A 3QFEA 5EYWA 3LRLA 2ABBA 1KLYA 3EXTA 3M7WA 2Z0IA 2C3ZA 1W0MA 4UTLA 3UD6A 3LI0A 4MFEA 2C6QA 2X30A 1BKSA 2E6FA 2A0NA 3M9YA 4WXZA 4IMCA 3W3OA 5E0KA 2ZDRA 5J5RA 1GYLA 3QMRA 4QISA 3B0VC 2C19A 3S1UA 4NJGA 1Z44A 2WSQA 3M41A 4LS1A 1GVRA 3WJWA 1G69A 3Q2DA 4CNNA 3TSMA 3T4CA 4IUOA 4Y96A 1LRTA 3W70A 4JTLA 1YPFA 4JIQA 3UWYA 3S5ZA 3M47A 1RQHA 3N3MA 4X9SA 3GAYA 3MHUA 4FNUA 3VCRA 3UXDA 4AHPA 4HPXA 4K38A 5AYYA 2XN0A 4NZJA 4ORIA 3W1LA 4R33A 3TH6A 3G1VA 1QPRA 2G97A 5FI8A 3P67A 1WBHA 4Y8FA 3M16A 1NAL1 1SZNA 2B7OA 1DQWA 3G1YA 3HMJG 3O07A 3HPSA 1H7PA 4O14A 2A7NA 1JJKA 5HQEA 4QNWA 1RV8A 2RH9A 4FF7A 3GNNA 4GUHA 4RJEA 1K8YA 3N14A 4BWLC 1KFKA 2A5HA 4ZQMA 4DO6A 2J9YA 2EAWA 2QCHA 1VJIA 4RR4A 4YWIA
chains in the Genus database with same CATH superfamily
4AUBA 1KRBC 3K1GA 1XJBA 4QLLA 3UY8A 4Z17A 2R14A 1AW2A 5DEZA 1US0A 3QEZA 2XGIA 1CIUA 1A47A 1RBOB 5FEWA 5FF2A 2VC6A 3WBEA 4HHMA 3K46A 3NEVA 4PCPA 2ZXBA 1DV7A 3LM7A 3LCHA 4KRUA 1AMKA 1JZ4A 2X09A 1Q8AA 1HKMA 1ZNNA 1EEXA 5A1AA 3K4WA 1GQIA 3ZR5A 3UGRA 3R8HA 4LC8A 1GWJA 3IGXA 2R94A 1X1ZA 4E2VA 2IXVA 4G5DA 4JCMA 3R2GA 2PBGA 2Z1XA 1TQJA 2O4MA 1GZGA 1VHNA 1X6LA 1O5KA 4FNRA 2HTMA 2NX1A 2Y7DA 4BI6A 3OEXA 5HQMA 2Z7KA 3WL0A 1TJPA 4JQ3A 2IKIA 4GFIA 3RU8X 4PUKA 1V0NA 2DY3A 3DXIA 5KZDA 1ITUA 3UNTA 4TTUA 4Q4QA 1FH9A 2E77A 4J3SA 5I02A 4QJ4B 1R0MA 3VMPA 1TMQA 3W7IA 1GJPA 1ZCCA 3IRDA 4QSHA 4U28A 2W67A 2BWGA 4C6DA 1OZQA 3SCWA 2CU0A 3WLPA 5C9WA 4IGNA 1GYNA 5FSEC 3CAKA 1HT6A 3MVIA 1BG9A 5I24A 5FD0A 5JVLA 2ZKMX 4JTGA 4H7ZA 3DC8A 5CSSA 2QAFA 1FA2A 3WLJA 5J8LA 3BQ6A 1CYGA 3WBXA 1ZBCA 3ISIX 3F5JA 3GUWA 1M9HA 4GVHA 1WBJA 2EHHA 3BMXA 3T8QA 1HKIA 1BQGA 4IGHA 1F07A 5CJMA 5CZ0A 4GH3A 3KWSA 2G5WA 3T2OA 3I4EA 1C93A 1P6BA 1VBUA 5A6AA 4NU7A 3UPBA 4M8UA 1U5JA 3LDVA 4IQLA 4S3KA 5E09A 5IFTA 5DF0A 1EO5A 5A2AA 4PFMA 5T8GA 4KESA 4FR6A 3ZR4A 3KBVA 4QAIA 2EJAA 3OYXA 5BW6A 5MKGA 1QOXA 4UTKA 2VGGA 2F61A 2Z1VA 4ZOAA 4N02A 3VIPA 2BHYA 5G1MA 4QM1A 1BTMA 2VCCA 6XIAA 1UD4A 1PZ2A 2OB3A 5EBAA 4N9DA 3S1GA 1ISVA 3FYPA 3W73A 1ZFJA 1PUDA 1SJCA 2F2HA 5CG7A 3QOKA 5GNZA 3OGVA 2VQUA 2ABAA 2UWFA 3AICA 4IPNB 2X1SA 3LS9A 2F38A 1EJUC 3VD3A 5IBXC 3G1HA 2UY5A 1Y7VA 2ZX7A 1UR3M 4J3XA 4FP1A 4X0VA 3A3XA 3ARPA 4NZ1A 1AH4A 4PL1A 3A4JA 3TXVA 4UQEA 4I5UA 4QGCA 5CBIA 4N9BA 1IXNA 1XYAA 4Q8NA 5CGTA 4N7QA 3FX4A 1V6YA 1HXJA 3CIWA 2CKRA 2IMRA 1Q2RA 3IUHA 2VM8A 3GU2A 2NVDA 5AHNA 4DJEC 1QBAA 2A3EA 2Z26A 1W3JA 4TMCA 1NFBA 2O9PA 3WBWA 4NRSA 4MAZA 4LEFA 2GJXA 3QHNA 1UMLA 4CKQA 1KM3A 5JBFA 3OHMB 2WQPA 3GZ3A 1GVIA 4YCOA 2X0SA 2BZNA 3QM3A 2HEJA 3O7UA 1LTDA 3H21A 4MJ4A 1OYAA 3RNDA 3FYYA 1XYBA 4HMCA 5TNVA 4ROQA 1JGMA 3KBWA 2ZZ7A 3JZEA 1MXGA 4PTMA 2GJXB 2CXGA 1Y65A 2PRLA 4XIAA 4GCXA 3MP5A 5EA9A 5B7ZA 1OX5A 2VRKA 4MUZA 2EPHA 3QRHA 1QI2A 2O7SA 4MKVA 1RHCA 2QXWA 3R43A 3EOEA 2XGZA 1LL6A 3VGDA 4NZ4A 3GHUA 4AD0A 1PX4A 4OIFA 1HJWA 4GQ0A 4OU1A 2QVNA 2QCDA 4XZNX 4XTIA 3VA8A 1PCWA 1VKFA 4GY1A 3UETA 4YMZA 3IGSA 5CCZA 4KFOA 5CZKA 1FWEC 3CMGA 4WY0F 3MB9A 3Q58A 5KITA 3NEHA 4H9TA 1KRMA 3VU2A 2P5NA 3TA9A 5CZTA 3NPWA 1VFMA 4C6CA 1OG0A 1REQA 1R2RA 4US5A 3NQ2A 2ZX8A 1UR0A 4LANA 5A6JA 1QHPA 5CC5A 3TN3A 2J88A 1MW1A 3WNLA 3SQLA 3LPPA 4PCFA 3EB4A 3LA4A 3MBFA 3ZWSA 3G1SA 4IFKB 3WH7A 4MB5A 4QDPA 4PUMA 3SRDA 4RNHA 5B80A 4BEUA 5LA0A 2BVTA 3W6YA 3K30A 1CT5A 1FWNA 4C6IA 2NQHA 3ZLHA 1EZWA 3FV9A 4M29A 2X41A 9RUBA 2Y88A 3BGJA 1SYTA 4DF1A 5LYRA 2E28A 3AROA 4L1GA 1UW9A 3ZT7A 1I75A 3C3UA 1MFUA 2DZBA 2GDVA 3M5VA 4D8LA 2EXOA 4H6QA 3ITYA 2W27A 3R94A 1PX8A 3UXLA 4DWSA 3IVUA 4NX0A 2GGHA 5EMUA 1REQB 1HL9A 3GS6A 2WMIA 3RGTA 3TV8A 3TDFA 5C54A 5CBBA 4MWAA 2GGEA 2J25A 1MUWA 2YJQA 3UESA 1UH3A 1G7UA 3B8TA 3F4NA 2MNRA 3DDMA 2GWNA 3CLMA 5FOOA 2YBTA 1H49A 2ATSA 2ZUNA 3UG5A 4Z0JA 3CHEA 5JXQA 3W38A 3MI6A 2WKJA 1LLOA 1L8PA 4JTIA 3SR7A 4LT9A 1TV3A 4Z42C 1E1EA 3A9BA 4TVDA 1UR4A 2GVLA 2Z7GA 1G6CA 3L4TA 5EY5A 2FJUB 1DIDA 1FDYA 4KGJA 1TO3A 3LXAA 4Q8VA 1D3CA 3BMVA 1DJXA 1VF8A 2E8ZA 4L6OA 8XIAA 2OSXA 1JZ7A 3SB0A 3SIZA 1EOMA 2P50A 4AY7A 3FFSA 3LPFA 1D8WA 3UQNA 2OCZA 3L5LA 3UA3A 1L2UA 4IIEA 2P8CA 2TYSA 2OWWA 1U1JA 1NARA 2XHYA 2DJLA 1EUAA 4LPCA 4D72A 2HBXA 1EXBA 4HU4A 4LAOA 3B8SA 5EL1A 1QCWA 2H9AA 1WZLA 5XIMA 2P1FA 1AK5A 4XB3A 4PMOA 1VBRA 4DO4A 1VPYA 3MCMA 1J6PA 2QGYA 2V6AA 3MSRA 5A6BD 3FA4A 2R1NA 1VJZA 2VEPA 3IIPA 1BD0A 5EFDA 4AHQA 1LUCB 3AUOA 4UCGA 3SN0A 1GVFA 3G5EA 4E2BA 2E9MA 3GLCA 1V0LA 2FMNA 1DTNA 3FA3A 4HYRA 4UQDA 1M01A 3S47A 3B8VA 3RO8A 2Y0FA 2BXZA 1H50A 3R7MA 1A49A 1NWUA 3EB2A 1HL2A 2E5DA 2B0MA 3HA1A 1Q6QA 2YCIX 3ME3A 1BF2A 4S3GA 7REQA 4PE8A 5A69A 3TE9A 2VGBA 1Q7ZA 1HKKA 2YCJA 3WQVA 1FCUA 3G77A 3S4TA 2C71A 1RXOB 2Y4SA 3NDYA 1XLLA 4DBWA 3EA2A 1NWSA 4R85A 1NDZA 1R3WA 3C2OA 4NXSA 4XKYA 3IIXA 1F3WA 3KRUA 1JRBA 4P7LA 3OLIA 1PL9A 1A5CA 4PMVA 4GHRA 4LW7A 3TONA 3DCPA 1GVEA 2PDUA 4JTHA 2ZWYA 2QF8A 4FR1A 3FDGA 1AA1B 1TWWA 4MPKA 4W85A 4FX6M 1AG1O 4KWUA 4DZ5A 3OQEA 1KKRA 3N6QA 3B0PA 5DCEA 4B9YA 4F9DA 5A3HA 1F5ZA 1V6XA 1XC6A 1ISZA 3S1XA 1CZ1A 4NI8A 3G1RA 1TTIA 3STPA 5LGXA 1XFBA 2DORA 3P0WA 5BXSA 2WAGA 4O0QA 3OVGA 2ZZ2A 2NUYA 1I1WA 2PLKA 3AS1A 4GO9A 1ME7A 3GU9A 3WF4A 3TR2A 3F7JA 1FQ0A 1P0KA 4IPJA 4J3ZA 3S9IA 2HDJA 3P81A 4K8HA 3R1ZA 2BY0A 2V30A 1BYCA 3RMEA 3WMCA 4WGHA 3CUIA 4MWAE 3SQMA 4UUIA 3TQVA 4IPIA 3JU2A 5BOOA 3TROA 5F1UA 2WCSA 4WJEA 5AN7A 1RY8A 1EP1A 3LGGA 2E4TA 1VJSA 1FH8A 2J8GA 5M1TA 2GPTA 1E9IA 1F3TA 2OLHA 1S2TA 2P88A 3WJXA 4YTQA 2PTDA 1H51A 3PNUA 3ABRA 1DBTA 3EX3A 2A7RA 4WY0A 3WLSA 1R2SA 4JD4A 4P7NA 2QUUA 1BEUA 1I0BA 4F2TA 4POCA 1XRFA 4ICMA 1XSIA 2NXGA 2VZSA 3FW6A 1DWHM 3C2RA 1GCYA 4LXFA 3N2XA 3INPA 3B3DA 1TUFA 4NX5A 3TYZA 2ZICA 4IMFA 3LU2A 3N2TA 3RMJA 3VGHA 1Q85A 5AC7A 4H8NA 3CB3A 4LV9A 3L12A 3RFAA 1K6AA 3EWDA 3PBWA 1IV8A 3EPNA 3W1QA 2Y5EA 2YB1A 5AYIA 3KLLA 5AHIA 1RPKA 1FHUA 5CC6A 2G3FA 5HINA 4N9CA 1JNDA 1T99A 4PCSA 1OY0A 3W9ZA 4Z2LA 1HTIA 1V3LA 5D02A 4UTIA 3SFWA 3KOFA 1R86A 3D5HA 4AEFA 3M0VA 5AC5A 4FNSA 3OVRA 5CJ5A 3UU0A 4IQDA 4XIMA 1OM0A 4UFMA 4Y9PA 4W88A 1VHCA 1IEXA 2ATMA 2WBGA 3SGUA 5HAOA 2NVAA 4H9YA 3ABQA 3MV11 4DJED 3W7RA 4UQAA 3CUJA 1DL3A 5IDZA 3AIQA 1I1XA 3WLKX 3AHVA 4W9TA 3W84A 1ZQ5A 3NYZA 4MOZA 5HPCA 5BWFA 4HPGA 3E0VA 4B9ZA 1XLJA 5FF3A 2R8WA 2ISWA 2VO5A 3HURA 2BASA 4JTAA 3WDQA 3NNTA 2X42A 4I7VA 3UWVA 4A21A 2FB3A 4RE3A 3BGGA 1QO5A 2Y8VA 1EB3A 2C8NA 3KRZA 1EZ2A 1ITQA 3V7PA 3L66A 4AMCA 2IKHA 3CV2A 1AD1A 1BGGA 3C0JA 4UZUA 3IJ8A 1S2CA 2ZRWA 1HW6A 1TX0A 3A24A 3VAVA 1JXKA 1E55A 1KTCA 4AZHA 2ZQ0A 3AMKA 1LQAA 3U5UA 1FXQA 2CZ5A 7REQB 3M4HA 1WYIA 5HWMA 3CUZA 3FYOA 4ZO8A 4GWEA 4UIOA 3N04A 1MVYA 3FAWA 4Q7BA 1QDSA 3B8WA 4Z1BA 4HZ7A 1UR1A 2QUVA 3RK8A 1YDOA 1OSEA 3W07A 1LLWA 3ZJ7A 1XUUA 2WHMA 2WWDA 5HPOA 2VFHA 1HNYA 4JN8A 1H0IA 4QQUA 3VDHA 4WF7A 2PDBA 4AZBA 3LQLA 3HG3A 4JX5A 3JZUA 3E0LA 1VRDA 1OT2A 3P93A 5LHFA 5LXEA 4Y9OA 1ISXA 2GYIA 1X6UA 3A5VA 1R87A 4GIAA 3CO8A 4JNYA 3QQ0A 5TIMA 1L6GA 1UH2A 2OOFA 3QPZA 3ZWTA 2Z6JA 2ZCGA 4CNPA 4PA8A 2WSRA 2Y62A 2WVTA 3BH4A 3THDA 4YN5A 1KV5A 1EL3A 4V28A 3T44A 5K3VA 2UV8G 1DJIA 3AALA 1S1PA 1CLVA 4JTQA 2HNEA 5L6UA 3RLUA 3HQ1A 3EMCA 5F7UA 4GGHA 4NY2A 3H4WA 5DY3A 3RU6A 1RY0A 4DWSB 3U48A 3WFZA 3G6LA 4E38A 1EF2A 2ZX5A 2WNNA 4J9JA 1MXDA 2WMKA 1ME9A 1XLKA 4B16A 2ZE0A 1OIMA 4F2UA 1DWJM 4W7UA 4MJ2A 5AHEA 1GNXA 4GUGA 4HGXA 2ZXAA 3IJ7A 3O15A 3U2EA 2V38A 2D2OA 3GU1A 5CPMA 4EIVA 3AHTA 4R34A 2HVNA 3IS4A 5M5DA 4WXYA 4AX6A 1MXSA 2EPLX 1KBIA 1PVNA 1W3HA 5F4WA 4ZB5A 2G95A 2WW5A 1AW1A 4XZIA 2NLIA 4IIDA 2JEQA 2Q6ZA 1RA5A 5BCAA 1H62A 3GIPA 2F2KA 4FOKA 2GLKA 2A21A 2J7HA 3KHDA 1KM4A 4JIIX 4M6QA 3ORWA 4YHGA 1EDQA 4RK8A 4FX7A 1GKRA 1AQHA 3AJXA 1KKOA 1B4EA 1I2QA 1UR8A 4GI8A 2PU0A 2RAGA 1UBSA 2X1TA 2PDWA 1XV8A 3BZJA 1XFCA 4OZOA 3KL0A 5I79A 3IPWA 3ATZA 2G0WA 2VMFA 2YCLB 4PTDA 4DWDA 1KFLA 1DXFA 3DERA 3VKAA 3TJLA 3DKJA 4LVAA 3WNMA 2QKFA 5DMNA 3EKZA 3GR8A 6REQA 4M6PA 4HMEA 1MMFA 1SVDA 3I3BA 2D2HA 2GOUA 1ZAIA 2WZMA 4JTCA 3LHYA 4Z1CA 1NH6A 5KETA 3BLFA 5HATA 4AEOA 2IQ0A 2OODA 2PE4A 1O94A 3W02A 4GA8A 4LUYA 2OGJA 3EWCA 3ENLA 1CGUA 1TJ2A 1XLMA 2R1MA 4GIRA 4JNMA 1ZSXA 3D46A 3U3HA 4MIMA 1L6SA 4ROPA 3MT1A 2ZRZA 1QNQA 3HBLA 3G3MA 3U8GA 4LUJA 3BLPX 1K7EA 4UNKA 3HMCA 5K4ZA 2FZMA 4K6AA 1NWTA 1AH3A 3K2GA 2ZWZA 3AWNA 2J62A 1H1YA 1B30A 3HGOA 4GZEA 1H2JA 3GVQA 5EFFA 2INFA 5KMYA 8XIMA 2NX3A 4BZYA 2G3MA 1FDZA 1Z42A 3B8UA 1G67A 4WD0A 3KBSA 1KRCC 1AL7A 2NQJA 2FIQA 4FI4A 4TO8A 4C6OA 5G5IA 2HVMA 3FDKA 3H8AA 3C86A 3KCJA 2YBUA 3JRKA 1TJ0A 1XIGA 1YRRA 2DVTA 4P8XA 2EG6A 2YBVA 3LM3A 1MW0A 3FNDA 4B3ZA 3UPMA 1H7XA 4GJJA 3L0KA 4S39A 2QQ6A 1ISWA 2E1DA 5AY7A 3GIQA 3CYJA 4RDWA 4S3AA 3P60A 2O9RA 4C6EA 1JG9A 1XCFA 4G1KA 4H19A 4S2BA 3T1GA 4AWUA 1SPQA 3PWIA 5E93A 3OODA 3W72A 1A5NC 5H91A 2ZA2A 1ZJAA 2R1KA 1PV8A 4OECA 2ACRA 2X0YA 4UQBA 3QR1A 1BVNP 3VX1A 5I7GA 3W76A 4XVDA 1LP6A 2W92A 3NPUA 4L9XA 4B90A 2ESCA 4XWUA 1FWWA 1MEWA 1CEOA 2BMBA 1E6QM 2XIMA 5HOSA 3WLHA 4AVOA 2AL2B 3E12A 3IAQA 4KEZA 3VKJA 1VBGA 5B7YA 3L5AA 5H2ZA 3F2CA 3LPOA 4C65A 3VE7A 3QSRA 4P61A 2Q8ZA 4ZB2A 5KEZA 2HBVA 4INFA 3VNKA 3WL1A 1AW5A 3BJFA 4TR9A 3WNOA 5GPRA 3NZRA 1K8CA 4Z2JA 4LVFA 3IEBA 4P5UA 4Q8WA 4G7EB 3VVGA 3WQ5A 1WDDA 3ARVA 3MKKA 4UFIA 3N34A 1QAPA 3H23A 2P0IA 1D3GA 2QJGA 2E6YA 4D8AA 5HUPA 2DEPA 5F2LA 1J96A 4ICNA 2OYKA 4UOJA 1ECEA 4AY8A 3G3DA 4L4OA 4BCEA 1R3TA 3LNMA 4W84A 4HCDA 3ITLA 1UIPA 1WKYA 5LSMA 1EJWC 1S3TC 4C6BA 3E0IA 4FLSA 4NJIA 1A50A 1GOIA 3LG3A 3EDJA 3CPRA 2PAJA 1EWDA 3TUUA 1M3UA 1S2VA 3EKLA 3EOUA 3SCNA 4AD4A 4TX8A 1B1YA 1CTNA 5PTDA 2OEMA 1A0CA 1Z9AA 3UWZA 1O4UA 5BXTA 1NDVA 1XUZA 5D03A 2OZ8A 2ISDA 5HA7A 2J9ZA 5HQLA 1ZJHA 4H04A 4CUCA 1MW2A 3ZIZA 2X7VA 4JTTA 1N55A 3BG5A 3U2ZA 3O0KA 1Q4WA 2PZ0A 4OJYA 3BO9A 4I5XA 2WPGA 1X38A 1WDSA 2IPFA 3REQB 2INZA 4M24A 4AIBA 4DUOA 3HIJA 1QBBA 2PD9A 4Y2WA 4G9PA 1NU5A 1U5HA 4YHEA 4HJWA 4HA3A 1XIMA 3VD4A 2XH7A 1MWOA 3BLIA 2FHFA 2PCQA 4GX9A 4MLRA 4KFPA 4PUNA 3A6OA 3NFUA 3WEOA 3NQ7A 4L1XA 4JTDA 1A3HA 4U3CA 4U5IA 4DAIA 3E0WA 3IARA 4RX0A 2XH2A 1P7TA 1ZCOA 2J74A 3SUTA 2PWFA 3KS5A 2DH2A 3KTSA 3VMOA 2YW4A 3D3FA 4FK9A 4OTKA 4D6JA 1TIMA 3I7QA 1PX3A 4FEZA 3HPZA 4MY8A 1IZCA 3Q67A 4C1LA 1FWFC 1EP2A 5REQB 3DN5A 1RP8A 2GJPA 1VR6A 1UZ1A 2OELA 1Q6RA 1TWZA 3PVFA 3NWRA 1IT7A 4C6JA 4C1NA 3N11A 2J78A 2ALDA 1FP8A 2P0OA 3MUIA 2YA0A 3VZYA 4UQCA 3XISA 4TV6A 1V51A 4TX9A 2O92A 3SBFA 3DFNA 3N9KA 2PEVA 1NP0A 3W7CA 1ZL1A 4RNJA 1MI3A 3GFYA 4GPNA 3LMYA 2AGKA 3KDNA 3WUEA 4A29A 1Z7AA 2ZC1A 4UC5A 3KOZA 1NY1A 2NX9A 5D37A 4DZIA 3W6LA 4JPGA 5HMDA 3W2UA 2UY3A 1QWGA 1KO0A 3QN3A 2NUXA 1O5RA 1LM1A 2DSZA 1ZBKA 2NQZA 2ON3A 5ECUA 1LCOA 3M6YA 3N17A 1M68A 3TMQA 1KR1A 3EKGA 4S3CA 1JI2A 1C3FA 5HNRA 1XD0A 1RR2A 1KM6A 3QC3A 4URIA 2WNZA 1T7LA 4MGGA 4W89A 4PUWA 4E4PA 4ZQRA 1XIDA 2VR2A 1PHWA 1OFDA 4Z2GA 4JIHA 4OHQA 7XIMA 4ZXOA 1K70A 1BTCA 5HMSA 3OTRA 4RCXA 1E6RA 2JBMA 4IX0A 4U31A 3QW4B 4V1XA 3L4VA 1E40A 3W00A 3S5YA 3QV6A 2HZGA 2AL1A 3OO2A 3GG7A 1E4MM 2VI0A 3B8IA 2R1LA 5CPNA 3WD2A 5IOBA 4YVVA 3AQUA 1B0IA 3B97A 4N9EA 2OX4A 3H7VA 4IX2A 1KWKA 4U5KA 1G94A 1XBZA 2HE8A 3GDBA 4EVZA 3EGJA 5EU9A 4KKXA 1NDWA 3PBGA 4HJFA 4WJXA 5FJIA 4XO7A 3S9ZA 1F6PA 2FPTA 1EBGA 1SFJA 1LT7A 5DMMA 3LMZA 4NAFB 1BYAA 3ARSA 5A8GA 1UWAA 1W9PA 3MP4A 2BNJA 4XK2A 3B4UA 4O50A 2OWCA 1YTEA 3NQCA 3GH5A 3NO5A 1OADA 1W2VA 4EPDC 4CGTA 1HP5A 4XG1A 2BODX 3IUIA 1R9ZA 3L2LA 1GG1A 1RD6A 2DH3A 1TZ9A 5LIWX 1UWQA 3BWWA 4GCAA 4P2VA 4GQQA 2KZHA 4DUWA 3D47A 1I6NA 2D3NA 4V15A 6ENLA 2Q3RA 1ZY9A 5AFDA 4F4RA 3RCMA 1LZOA 1SQ7A 4CD8A 1GYMA 3TCSA 2PP1A 4UOQA 8CGTA 1PBGA 1GKQA 4JEJA 4H2HA 3CIVA 2X40A 3DG7A 3KBJA 3LRLA 2ABBA 3KZPA 3CZLA 3WH8A 2Z0IA 4C7GA 3GTNA 3C5QA 3IK2A 3OZOA 1Q7QA 3OBEA 5HJYA 4UTLA 1SR0A 3EEZA 4WXZA 4Q22A 3AS3A 3B0VC 1GJUA 3VM7A 3VC5A 2ZX6A 1Z44A 2CYGA 4LS1A 2I9UA 5D8WA 1G69A 3QHOA 4JIQA 3UWYA 4Q4MA 2O9TA 4UWMA 1F6YA 3S5ZA 2R82A 4X9SA 1ZU8A 4LQ1A 4K38A 1EJRC 3Q45A 3CL8A 1QPRA 2E9LA 1ZBWA 4Y8FA 4KRTA 1SZNA 4C91A 3RJYA 4LY4A 3HPSA 1J18A 3RYSA 5HQEA 5TF0A 3CV1A 3GNNA 1BYBA 4RJEA 1WKEA 1K8YA 1XYCA 3RAOA 4BWLC 1KFKA 2A5HA 2J13A 4ZQMA 3AWOA 2QCHA 3VIHA 1EBHA 5HANA 1DQXA 4ZOBA 1W5MA 4QS5A 5BWAA 2P53A 4EXBA 2E7FA 3K8LA 1JCJA 1MQQA 1OWQA 1J0JA 3RX2A 1W17A 1H4PA 3GG0A 2GQ3A 3EWZA 2AMGA 5KZ6A 1OZMA 3H2EA 3ES8A 3G18A 3I7RA 3H7UA 3RILA 2Y5JA 5AZ1A 4H2CA 3PFRA 2QPXA 1GQKA 4ALDA 3KL3A 4OE7A 2J66A 2YDAA 1AZ1A 1OHLA 1VYRA 1RK5A 3TJXA 1G4EA 4MDOA 2QEZA 3O1NA 4BEQA 4BK9A 4KWSA 4R7JA 2WV8A 4ZB0A 2CLPA 2RDTA 4XVEA 4ML9A 2WOQA 1EX5A 1V0MA 1VPXA 4ENLA 1GZJA 3FK4A 2OR2A 4JHMA 2PA6A 1J01A 1GOKA 1GOMA 2V5KA 3DFSA 3N4FA 3V75A 1IGSA 2HS6A 2YDQA 4A22A 3QFWA 4EE9A 3MCOA 5D2VA 3T0TA 4AZGA 4LYPA 4MF4A 3L67A 4A3HA 4JYFA 4AG0A 5E0FA 3V1PA 2VP8A 1E1CB 1QMLA 3PAOA 3BAXA 3DFQA 4ZFCA 4OWGA 2PCEA 1K9TA 1KLZA 3W2NA 3WK1A 2CXEA 2WVUA 1JCTA 1TPEA 1I0DA 3VD9A 1UMYA 1WZKA 1XLIA 1F8MA 2XVLA 2I14A 1YDNA 3KBMA 5JBDA 4AIOA 2IPGA 3URNA 5XIAA 1IEVA 3GVRA 1S5NA 2F6XA 4W87A 1I2PA 3LLDA 3M5ZA 3P3BA 3CPGA 4WVXA 4ACYA 1AQFA 4BF9A 3VDBA 1FCQA 2VWTA 4AWTA 1CNVA 1VIZA 2Z1WA 4IM4A 4Q8TA 1RJRA 2OZTA 3EX6A 3KOYA 5AC4A 5EMJA 1Z6KA 2H8ZA 3CB8A 2VCBA 1T0OA 3CO4A 2PS2A 4L4MA 1RJPA 1IEIA 1L2QA 2CERA 1M41A 4K68A 3HGSA 1K4HA 2GZXA 4MYXA 4K7YA 1EPXA 1CGXA 4LY8A 4PSRA 1S1RA 3H7RA 4EWJA 3LGDA 4Q7IA 4MADA 1CXFA 2VXNA 1XD1A 5CAKA 2DJXA 1LQ0A 1DXEA 5EGRA 3HB9A 5AHLA 4DF2A 4HNOA 3UGVA 3A4XA 4IXXA 3TZNA 3M0KA 2GJRA 5AECA 6TAAA 3OA5A 2QGHA 2ZDSA 2XZ9A 3BAYA 1PKYA 3IVSA 1K3UA 1I60A 3GNXA 1Q6LA 3KZSA 3BSGA 3LHVA 2DZSA 2OEJA 2DUXA 3CS2A 1MUMA 1ZAJA 4A35A 4I90A 1WXJA 1OJXA 2PGFA 4HYWA 1HKJA 3MPGA 3ALFA 1VH7A 3R0DA 2QCCA 2H90A 3KL5A 1OIFA 5E9XA 1GQLA 1EC9A 3LTSA 4ZL1A 1VEMA 3AXMA 2NT1A 2E68A 1JCMP 4Y6GA 1XS2A 3P80A 4X2RA 4EF8A 1DVJA 5ENLA 4L64A 4MDPA 4L9YA 1B3VA 3T07A 2DT0A 5BYWA 2AQVA 2QCDB 3TSBA 3WLOA 3UEQA 2OQYA 1EOKA 1EUNA 1RSCA 3GNOA 3BW2A 4UZSA 3IWPA 4WDXA 4CLMA 3JS3A 4DI8A 1FWCC 3QSTA 3FEMA 3W1NA 1YBQA 3UNDA 3GNPA 4AF0A 3QW3A 1S2AA 4FIQA 5KTLA 4A2RA 2D24A 5I3DA 1BWKA 3W1UA 3ICJA 1QVBA 3TAKA 4O1CA 2J47A 4GC4A 1DXIA 2BOGX 3EXSA 1OVDA 3E6EA 3HV9A 1AQMA 1Z32X 1KXTA 2AAAA 4KCWA 4DHGA 2OSYA 3DH7A 2ZUUA 2HE5A 5MHBA 3LV5A 2QV5A 3BJSA 3F2DA 3HJZA 2QPSA 3OBAA 1SJBA 3PTKA 4M5PA 4RLIA 3CGTA 2Y1HA 1I2OA 1NELA 2OO0A 4WQ6A 4H6EA 4XZHA 1Z89A 1D2KA 3S9YA 4J27A 4O8AA 1W91A 3UFYA 3PWGA 1QUMA 3NZQA 2VFIA 2YFOA 3NOEA 3K8MA 4YIWA 1W1TA 3KTXA 1F3XA 3E02A 2FGLA 4EX4A 3GM8A 2E0PA 2NWSA 1S5MA 3H55A 1UBPC 3FJNA 3OGRA 2UZ9A 4B92A 1W37A 4MM1A 4MAVA 1J0ZA 1K02A 1OCJA 1ICPA 4J7RA 3IV8A 1FVPA 3I65A 3AMCA 3P5YA 4NZCA 1R7OA 1E1CA 3IJ9A 4AQLA 4J3UA 1MO0A 1TX2A 3WKZA 2Y61A 3QPEA 3KRSA 1MNZA 2R24A 2A4AA 1WE5A 3BJTA 4QEEA 2FTPA 4F0RA 1RK6A 4UNIA 3GXIA 3NURA 3WJSA 2QMJA 2J7BA 4MNMA 3GDLA 3WK2A 3GDTA 4WSHA 4IPLA 3GY1A 1GTEA 3PS7A 1X7FA 3VC6A 1NFGA 2XIJA 3QYQA 4I9MA 1UWSA 1B57A 1B5TA 4FXRA 1QXLA 3BG9A 2C1IA 2ZUMA 3HF3A 3F1QA 3NZPA 3PULA 4WZHA 3DBPA 1QNSA 4AIEA 4HZMA 1RAKA 5D9OA 2XN1A 1AMYA 4K7VA 1AD4A 3STCA 1PIIA 1UKOA 4XTDA 4JKLA 1IT8A 3CUXA 4HNVA 4PUUA 3WJZA 3POHA 3H70A 1XGEA 3MJYA 3L65A 1OF6A 1QWKA 3PZTA 3V18A 1PKNA 4HZ8A 4A8IA 3TYUA 4IHCA 3ZQ9A 1W1VA 1QI4A 3GXPA 6XIMA 3UWWA 2VEKA 3E9AA 3DI0A 1JNEA 3O0FA 1GEHA 1J0KA 4TQTA 2WJFA 3GUGA 2DP3A 2E1WA 2DT1A 3LSBA 2OXNA 3AFBA 3TN6A 5IXEA 1KM5A 1YMYA 2WC3A 3PJXA 4P8WA 3VOHA 1W5OA 4REQA 3WQ4A 3LCXA 4XD5A 3GNDA 4KWOA 4FNPA 3ATYA 4MPQA 1F8IA 1G0CA 3DUGA 4YJ5A 1CWYA 3WQOA 4AY1A 1LOQA 3REQA 1IQ8A 2W6RA 5F1VA 5J5DA 1CXIA 3WLIA 5A6KA 3GB6A 1OCNA 4DJFC 1DKWA 1XG3A 2WNQA 4CN1A 3CQIA 1BXNA 4K8EA 2BY3A 2YDRA 5CGQA 4OGZA 1BRLA 1W3KA 4Q4KA 1ONEA 3T81A 3W23A 5EMLA 1TPFA 2FHCA 4Q4SA 4NI3A 2FGBA 2HCVA 3OGSA 3GC4A 4GZ7A 3V5CA 1A53A 3B9DA 3H24A 5IFPA 3QGKC 1UKSA 3NQDA 4KS0A 2ADAA 1MZHA 2VFGA 3NDOA 3W7OA 4ACZA 5DRCA 3EB3A 2EPKX 4JDBA 2PTXA 4PRRA 9XIMA 4W7WA 2CBVA 3DEQA 3GKFA 3WQGA 3OQ8A 1JF5A 1HVXA 4O52A 1V6UA 3VIJA 1QNOA 4MNJA 1ZRQA 3F4VA 4PCTA 1WOBA 3MJMA 3RRXA 1O1HA 1EA9C 4PR4A 3HV8A 4DZHA 4DBDA 4DY1A 4XBJA 5CC3A 4XBKA 4GVIA 4R3UA 1E56A 3OIXA 4R7WA 3W22A 1DORA 4CCDA 1J4EA 1JRCA 3PPCA 4AD5A 2DUZA 1DHKA 3COTA 4M82A 1W9XA 1W1IE 2QHAA 1FWBC 2QULA 2RUSA 3NM1A 1W9UA 3M6DA 4LH8A 2NLYA 2JALA 5JUVA 4XAYA 2NV2A 3TAOA 3BANA 1ICQA 3PBUA 3RM9A 4NAEA 3PZUA 4JAWA 5E9AA 3EWBX 3E2VA 1XIIA 4GQGA 1NEYA 3PZMA 3VIFA 2Q8LA 5JIWA 5FACA 1XXXA 4WEVX 3SIMA 3ARTA 3ZJ6A 1FHLA 1CDGA 2VURA 5I3KA 1RH9A 3LTYA 3WFAA 2ZUWA 3IGUA 3UG3A 4KH2A 3M0MA 3R5EA 4UTWA 3DFYA 2QZRA 4JZ5A 1E4NA 3RJXA 1E15A 2OYMA 3GDRA 1HJQA 1Q6DA 1WUFA 5CAHA 3EOLA 2HSAA 1BHGA 3EWYA 4NNBA 2A3LA 5A94A 1R6WA 1CXLA 3L0GA 3C8FA 1N8WA 1GJWA 1FHDA 1DWGM 1YE6A 2I56A 3NVTA 2WCAA 5CPOA 4DJFD 2FFIA 5D9MA 1XRSA 2NUWA 5G4WA 2YX0A 2FVKA 2CWXA 3SW6A 2QCMA 1OK4A 2OTDA 4MB3A 1PWMA 3MANA 5IRPA 3QQ1A 2CIPA 4PSPA 1AZ2A 5TAOA 4TXEA 2ZXQA 4KEVA 3PWAA 1K1DA 4QROA 1J10A 2Q02A 4QBXA 4HCLA 1TA3B 1ECQA 2VFFA 3BV7A 4LAUA 3W2LA 2VX7A 4U33A 3V5FA 2VFEA 2VGFA 1B4KA 1EIBA 2C91A 3NPXA 1JQVA 1AUSL 4TX6A 4F3HA 2EQDA 3SRHA 1UPMB 3AMLA 2Y7EA 1R47A 2I1OA 2UY2A 4TUFA 3SRFA 3HN3A 1E71M 4XD3A 2PDQA 1SFTA 2DUAA 1XGDA 4RNIA 3W7QA 1S5WA 2DIEA 4EP8C 4DEFA 4DJEA 4MZ1A 1I4NA 4HD5A 3LCFA 3DHFA 1U5VA 1XSJA 3P62A 1CGYA 2D0HA 3GYEA 2X1RA 3O2LA 5D9PA 3KX6A 5BZAA 1P7TB 3GFXA 2DV0A 3DENA 4NAEB 1V03A 4CCEA 1E6ZA 4BS0A 1KTNA 4KWVA 3CQ0A 1L6YA 3SUWA 1YNYA 4EACA 1N2VA 4FB7A 2WZIA 3I4KA 4XAPA 3VDCA 4GZJA 3GAKA 3MP3A 1CGWA 4O57A 1DYSA 4ATLA 1LG2A 3RN6A 4S1FA 3KP0A 3V5OA 1HO1A 4O4WA 4DJDA 2WJEA 4G1NA 1K9EA 1IR2A 4B5WA 5GJNA 1SM9A 4W8BA 4D8ZA 2WWCA 3O8AA 3HOJA 2YZ5A 3N4EA 3CUFA 2VZUA 3QMTA 1OFPA 5FCZA 1GQJA 2ZRUA 2WJDA 1UJPA 1V3JA 3WH5A 3WF3A 1O95A 2XFYA 1KCKA 3B40A 1V93A 1EGMA 5C70A 4QR6A 3ITTA 1J9YA 4Z1YA 3VX0A 4ICCX 3KW3A 2J75A 2OEKA 3L7RA 3G8EA 4GRSA 2EPMX 5CBJA 3DG6A 4KT2A 3QZAA 3PTMA 2FJKA 4Q32A 4UR9A 2CZVA 3UXAA 1C9DA 2I5IA 1A5MC 5DFAA 4YL2A 3WLTA 4YTUA 3GC5A 1IEWA 1WZMA 4JYEA 1R8LA 4AD1A 3A3HA 3A12A 3L4XA 3L2IA 2FTWA 4FOUA 2PP0A 3UCCA 4M6UA 1YPIA 3SY8A 4HK6A 4JYDA 3THAA 4GIYA 2PSNA 3KVJA 1VP5A 1KBBA 3F4DA 2BB0A 1TR9A 2WVSA 1V77A 3CEUA 1QNPA 1JF6A 3VKKA 2WM0A 1E0TA 2JKPA 4TVCA 3MMWA 4XAGA 2HS8A 3FEQA 5GJPA 2XTKA 3DI1A 1Q6EA 1OC6A 3TQKA 1NDYA 4RZ5A 3VABA 4RDVA 1QFEA 5DCDA 3DU0A 5T9BG 2QCFA 4M19A 3WLQA 4MB1A 3EEGA 3DGRA 4JXCA 5IBXA 4HU3A 4ZE5A 2CESA 2Z24A 1ODZA 7CGTA 3B03A 2KX9A 1J93A 1A5BA 3S8HA 1DE6A 2G4FA 4GYKA 1WPCA 3FVDA 4GNJA 4C6LA 1KD0A 1WKFA 6CGTA 2VHLA 1LWHA 3PG9A 3A4WA 1V6WA 1EDGA 1XL9A 2GDQA 1D7KA 1QNRA 4HTYA 4RE4A 4JHZA 3MKVA 5BNKA 1HGWA 2VT0A 4YYFA 4LTSA 2TSYA 2OVLA 3WFLA 4ZVJA 3N2OA 1NWRA 3L2MA 4G2DA 3NOYA 3G8RA 3CNYA 4IGSA 2BS9A 3WG6A 1VQTA 3ONBA 3VE9A 4PB3A 3H2CA 2HXTA 1T96A 1XINA 4CQBA 3XINA 5JIPA 3LGEA 1UA7A 5C7VA 4HCHA 3VOFA 1DJHA 4O11A 5AC6A 1TVLA 2YXGA 3MCNA 2ZX9A 4DYEA 2NSXA 4ATDA 1PDYA 3EDDA 1TPH1 1E3XA 3CPUA 3HG4A 1QPOA 5FL1A 1WA3A 3TOPA 1LG1A 1A80A 3G2GA 1BF6A 2POTA 4K1GA 3WUBA 5C7HA 4XZMX 4Q8UA 1FKXA 2VFDA 3SSZA 4S3DA 1QOQA 3KVLA 3CMJA 3CJPA 2PTZA 3TC6A 4RDZA 3BL3A 4WX2A 4MUPA 3WUGA 4H00A 4PH6A 5EBUA 3ZO9A 2VX6A 2DZAA 3SURA 3GKAA 3N18A 4L6HA 2DSKA 2WJZA 4E2DA 2AL2A 1LUCA 3THQA 3WX7A 1I2RA 3ELFA 3KVMA 4ZFMA 1TWIA 4QG6A 4GH1A 3UY7A 2G96A 3Q4DA 2NXIA 2PDJA 2YL6A 4NJJA 3DG3A 2PZNA 1XYZA 2GQ8A 1J2WA 3BG3A 3PG8A 1YDVA 4IF2A 4X63A 3GC2A 2PP3A 1S38A 3E5BA 1T5AA 4R7OA 4JS3A 3URAA 1VPQA 1H5YA 1C7TA 2X16A 3CAQA 3OHIA 1PIFA 3GX9A 1Q6FA 3HGRA 4KMQA 1UKQA 2W91A 1EQPA 3NQVA 3OPSA 5I06A 3IJLA 2AQOA 5D38A 2J7GA 2CZDA 3W25A 4DLFA 3T8LA 3TYDA 1W3TA 3VD5A 2PD5A 3LSCA 4UFHA 3U0HA 2DU2A 2FH6A 4KCVA 3PZNA 4TU1A 1OT1A 1XBYA 1H7OA 2G50A 4FOJA 3PZQA 4WRHA 2VZVA 3F5LA 2EKGA 2ZVIA 4IQJA 4X61A 3TLLA 3M44A 4J5NA 3TMLA 2BFGA 1R2TA 4ZOEA 1FWSA 1IF2A 3G0UA 4DWSD 4AD3A 1TSIA 1IWBA 3GDKA 4GXPA 1LOSA 2RKXA 1WX0A 2JF6A 3ABSA 1E72M 3RCNA 4OOUA 1OX4A 2F6KA 3CXOA 2ZYFA 3RX4A 2H8XA 3ARXA 2IXUA 4H9XA 2QIWA 1EWEA 5DLCA 1JDDA 2JKAA 4A3RA 6ALDA 2VTFA 3JW7A 1BRLB 3E2RA 1TE1A 2V82A 3AMGA 1YX1A 1VEOA 4M6VA 4QDMA 3EXRA 4S23A 5LKYA 5ABEA 2QF7A 1HFBA 3A3WA 1K7XA 1K9DA 4JGDA 1GW9A 1AJ2A 4UTTC 2CBUA 3UZXA 4OFCA 5TBOA 5LXXA 1KM2A 1OYCA 3CYVA 3A47A 2GJLA 1PJ9A 2BP1A 2A3AA 1CW2A 4FLRA 1A5AA 1E6NA 2X1UA 4NSBA 4IFKA 1LWIA 4J2MA 1QNVA 1XLHA 4GYPA 1AH0A 3PC0A 4H9ZA 3N2BA 1A5SA 1JPHA 3N15A 3PNZA 3S0CA 1YADA 1RBLA 1M7PA 4IQEA 2WVVA 4HVXA 3CC1A 3NIYA 3BLOA 5ECVA 2CLKA 2A6LA 3BLKA 6TIMA 2J79A 3CAWA 4AW7A 3W86A 2ODOA 5CH9A 4HOXA 1W9BM 2FMOA 4N4PA 4YTRA 3BTNA 1EJXC 2QUNA 3CK5A 1XX1A 2VC5A 1ZUAX 4DN1A 1QATA 1UOZA 4K2SA 1Z69A 5HR6A 4LC6A 4QQ3A 4FXJA 2G3NA 1VFFA 3ZLGA 1C8YA 1SSDA 4HN4A 5T9CE 3HPXA 2CLIA 2WKGA 2FQIA 1TV5A 1JQXA 3KDOA 1Y5XA 3AHZA 3NQBA 4HB7A 3D3AA 1M7JA 4MWAC 3IJ6A 3UW6A 4ASTA 1H0GA 3BOFA 4AZ7A 2WMFA 4IJCA 4M1RA 4IPPA 2CBJA 1KNWA 1R46A 5XINA 1UWIA 4YLWA 2CZEA 4YYCA 2QDEA 3VD7A 3R12A 1XSKA 1JUBA 1K6WA 2EPNA 2ONEA 5I03A 2V67A 5MKGB 4E0CA 1IXQA 4AVNA 2L5HA 2CETA 3QGVA 3P5ZA 4X0NA 4XD6A 2J8TA 1V4YA 3SO7A 3W1AA 3FXGA 1YW1A 1PE1A 4JTKA 2O56A 2Z4GA 3WBAA 2CZFA 4IL2A 3CT7A 3CTTA 4JEQA 3WZ0E 1OX4B 3NZ1A 4HSOA 1X1OA 4KCTA 3WQCA 2A1YA 3ARQA 4MNLA 2ISFA 4JKKA 4V27A 4FO4A 1ZP3A 3OVPA 1VBJA 3DZ1A 1C8QA 5E6YA 3VI2A 1ICSA 1D8CA 1N82A 2NT0A 4L56A 4GLEA 4OV4A 1CGVA 1PIGA 1V02E 4ZMGA 3ZZ1A 5AHMA 1ITCA 1GT8A 1I8JA 3EZ4A 4PTVA 4YXGA 2VL4A 3DAQA 1VLIA 2XIQA 4RV8A 1E9LA 4GQRA 1UUMA 2E3ZA 1QK2A 3MSDA 3VUPA 4F48A 4W5UA 3H4XA 1C8VA 4E6MA 2WHJA 1GZ1A 4AC1X 4IFRA 2EG8A 1W9VA 5D33A 2WVVB 5DT5A 3WLNA 3VFLA 2RDXA 4KIEA 3H2FA 1NP2A 1AJZA 1W31A 4JY8A 2DSUA 2BBFA 2W3ZA 2E6DA 1X97A 4M81A 1W5QA 4FLOA 3MZ2A 3WQFA 3GFZA 1UD5A 3NPVA 3CTLA 1SO3A 3H2NA 3V1HA 3QJAA 4YVPA 3T40A 4C6PA 5G2IA 2GL5A 1DWIM 4EWND 4HK7A 2ACUA 2OWXA 2WMHA 4MY1A 4O53A 2XIBA 4HA1A 1EF3A 3P8JA 2W61A 3NO1A 5FJTA 4P7QA 1NF0A 4GQBA 1TWSA 5F2MA 3MUAA 3WSUA 3HQPA 3TCEA 2O9OA 3ANVA 1CCWB 4EF9A 3V35A 3SCTA 5M2FX 4N6EA 3Q65A 4B5XA 4CEXC 1UJQA 4JICA 3QZEA 1HL8A 3M46A 1FOBA 1TV2A 1U30A 4AWEA 2YYUA 3MS8A 2ZRVA 2JE8A 1XISA 4HN8A 4QJ1A 4L1WA 1ENUA 3EWUA 1JPIA 1W3IA 3BE7A 4XBSA 3BDKA 3ITXA 3M0IA 2V5DA 1GGOA 4DF0A 4WCJA 2OOGA 2CW6A 2X8RA 4ZQOA 4H7VA 3T0DA 1B3YA 5HWNA 3MUXA 1OFRA 2VELA 4L4PA 1M03A 4CVUA 2WZEA 3TTSA 5BMWA 4QG9A 3VIGA 2E40A 3K4AA 2YSWA 4AZCA 4RL3A 5LNRA 2Y7GA 3OA3A 2JGQA 5AOUA 4AC7C 3CHVA 3R6IA 3MV01 1L8NA 1PTAA 5H8UA 3A64A 2OT1A 4MJZA 2F7FA 3LX9A 5K4XA 1UD6A 2YCLA 4JX6A 3T9PA 3T42A 3VGEA 1EXPA 1KLYA 1PTDA 3EXTA 3GNRA 3M7WA 3DESA 3VUSA 4Q8MA 3WNNA 1PAMA 1NIUA 4MFEA 2C6QA 3W3OA 2ZDRA 4IUGA 1XPGA 4FAMA 3TZFA 1GPFA 3ARYA 3T4WA 3W70A 4JTLA 2EBNA 3OJGA 3M47A 4ZEPA 1RQHA 3GAYA 1U1UA 2D69A 4J3VA 1IZJA 4HPXA 4A05A 5AYYA 2XN0A 3TW9A 4AYSA 4R33A 3EOSA 3TH6A 3G1VA 2G97A 2PMQA 5FI8A 4XZLX 3WY1A 2Q09A 2GSHA 4BQ5A 3G1YA 3HMJG 4ERGA 2JEPA 3CWHA 4JN7A 5HMFA 4QNWA 1RV8A 4JQ2A 4FF7A 3WNPA 1KCXA 4H83A 1KXHA 1XLFA 3N14A 2UBPC 3BGAA 2EAWA 1VJIA 1XC4A 4MG4A 1XH0A 1CPUA 3C2FA 3PZGA 5GNYA 4AAJA 3Q37A 2PB1A 3AHXA 3MQTA 2V81A 5G1YA 3S5OA 3I6EA 4A4AA 1M6JA 2NSOA 3KVKA 1Q6GA 1F05A 1MQRA 4C5ZA 4DPPA 3B9AA 3TNOA 3ABZA 5LNWA 3SJ3A 5DCBA 3W28A 3PF3A 3ZM8A 3KS6A 1JYNA 5AYBA 4O1FA 4GKLA 4XKYB 5EPDA 2XPKA 1M5WA 2BXYA 1UQYA 3WEZA 1JD9A 1XYMA 3BLEA 3KHJA 3VNMA 3ZSTA 3MHGA 5C71A 1M65A 3AXHA 1K77A 1GOOA 4M56A 2JFEX 4DJDC 4CD4A 1KFJA 2Q3OA 3LZ5A 5I3FA 1IWPA 3N73A 2JK2A 2PF0A 4NQ1A 1PPIA 3AUJA 3WQPA 2HPMA 3MSGA 4LV4A 1G4SA 4S3FA 1XHGA 2CBIA 4NNAA 1OGBA 3UERA 1VCVA 3R4IA 4NIRA 1TPC1 2VX4A 4B2DD 3SECA 2FDMA 1SSGA 2C0AA 1O6IA 3IK4A 2ANUA 1L0PA 3VNDA 3BK0A 4LWWA 3GWQA 3NL5A 3HGJA 1NSJA 1POJA 4BQ3A 1NOFA 1VRXA 3N6JA 4HYVA 4BQ4A 1UROA 3LK6A 3PPGA 4AHOA 4M3PA 2Z1BA 1VAHA 3UZWA 5D8ZA 5C9XA 4K39A 4HBKA 4GGBA 5JU6A 4J40A 3UWQA 1OG6A 1W1A1 3MYOA 4K37A 3KWXA 2VOTA 2WSKA 4IMEA 4CQ9A 2E8YA 3M64A 3PAJA 3PP7A 3W7JA 1L6FA 2TMDA 1EC7A 3S46A 1P1XA 3MDUA 2EEXA 3EX1A 4TVUA 3IRSA 4M7TA 4N42A 1TQXA 4O16A 2XDFA 1ZGDA 4RZ6A 3CIXA 4LVDA 4QJ5B 5BOEA 1PKMA 2VEFA 2DVUA 3FSUA 1PO9A 3NCOA 4JL2A 1ISYA 3ES7A 3C2YA 3W7DA 4ERAA 3IIVA 4QXIA 4CU7A 6A3HA 2QAPA 4CN4A 3WD3A 4XUGA 3SSJA 1E0VA 4ADTA 1YXDA 3W83A 3P0XA 4GC3A 1JCYA 1TTPA 1TE6A 4O1DA 2JGYA 2FB2A 1TREA 2PWUA 1GUVA 2C7FA 3RO6A 2FFCA 4IG2B 3URBA 1ESWA 8TIMA 3USBA 2GUBA 4JTRA 1A3WA 3WQ8A 4RZ4A 1W3NA 1OFEA 3GHTA 3ECQA 2HPIA 2GGJA 2FTYA 3S6DA 4LAKA 2A85A 1FY6A 3B04A 3C56A 5CEWA 4ZO6A 2WLZA 3OZPA 1VFLA 3T55A 1SR9A 5K9CA 1HGYA 3TYEA 3W01A 3FY1A 3ITOA 1HJVA 2D2GA 2J9XA 4W7VA 4BR1A 1G5AA 3LYEA 2Y85A 2F6UA 3STGA 4J1OA 1O5QA 4AVFA 4RZBA 3S2MA 1QO2A 1BYDA 5D05A 2IUZA 1B3WA 4DM1A 4L7ZA 4W8LA 1YDYA 3UG4A 1O60A 4OUEA 3WN6A 4GUFA 3TTEA 2A3HA 3LLXA 4IJBA 1CX9A 1TV4A 1M7OA 4MHBA 1MNSA 3QV7A 3A9IA 2GDUA 4U2ZA 4ZOCA 2VRJA 1JD7A 1LT8A 2PDFA 4DLMA 1QI0A 4JL1A 5H8MA 4IMDA 4RE2A 4DNMA 3H26A 3P7YA 3UVAA 3MI2A 3AYSA 3I7SA 1XKJA 1XGZA 3MC5A 1B9BA 2VZOA 3GTHA 4Q7NA 2VEGA 1ONWA 1ODUA 1U22A 1H7RA 2PFHA 3NDZA 4NJKA 3W71A 4HA4A 3E2SA 5CPSA 3UA4A 4KQNA 3S1WA 3FHAA 4C6FA 3OB8A 3SCSA 3PHAA 4UBPC 1UQZA 3GH4A 3S2NA 2D23A 3W26A 5CXPA 1ZJBA 2YOCA 4L65A 5KINA 1Q66A 3W4RA 3LBOA 2VWSA 1Q65A 3S1VA 2REQB 1F4HA 3RUBL 2OZ3A 4UMBA 1QI5A 4JFUA 2XIIA 5C0QA 4RXFA 3WDHA 2VDHA 2HV5A 5D2TA 3NQMA 5FIPA 1XLBA 2VX5A 2OMAA 4WSJA 3H2MA 1C90A 3HZ3A 3B4YA 1MFVA 3NG3A 3BXWA 4RXGA 1IZKA 3PK7A 1OCQA 1Q4NX 5CPTA 3E1F1 2W9MA 4ZXLA 3I68A 1FP9A 2QDHA 1EP3A 2GVJA 1EJVC 4GXWA 5CGMA 3T2PA 3AIBA 3E38A 3OZYA 4XO6A 5FF7A 2ZUVA 5I5RA 3B0XA 1I2NA 3AYTA 4QSFA 4A8LA 4AF0B 3CV6A 4NRRA 2NW0A 1SJAA 1UC4A 1RALA 5F4XA 1E9ZB 3GSMA 3VKBA 3I3EA 3ANYA 3W7LA 4ZE4A 4UNLA 4DYJA 1TPUA 1ZENA 3KRBA 4A3UA 1MQPA 1WV2A 4O0ZA 3GK0A 1V6VA 3KEHA 1C29A 1K4GA 1K7FA 3MO7A 1YYAA 1MUCA 2AKMA 4KW2A 1E51A 1LF1A 3CQJA 4NASA 4P8UA 3UP8A 4BKNA 4NKCA 4UB9A 3UR5A 4PL2A 4QAWA 2R6OA 3G24A 3WYZA 3IJIA 3NGJA 1XYFA 1Q2SA 3APYA 4Q3MA 2D22A 3GR7A 4HPJA 2WLYA 4UMCA 1FFRA 1QK0A 1HZYA 3IJQA 1R3QA 3AC0A 2GK1A 4UTJA 4O19A 4A3YA 4ZO9A 2DZWA 4LUSB 1XW8A 3W1XA 4NL1A 3QC0A 1N8IA 2V9DA 3DC0A 2CLLA 5DXXA 1XI3A 4WDWA 1ZP4A 1VCFA 2PTYA 2AGTA 3O63A 3FJ6A 1CENA 2C18A 1J79A 3CZKA 3UYIA 2VGIA 2GQ9A 2ZFAA 4QDWA 3WQWA 4WY0B 1EGZA 4KPLA 3B9EA 3W7PA 4C1NB 2I7GA 1ZB5A 4HNCA 3SGZA 4LYQA 4QFUA 4KIRA 4J35A 1PZ3A 2DIJA 1RCXB 1HJSA 3WK3A 1T6MA 1B3OA 4OT7A 3IIZA 4GNKB 2OX1A 4PCNA 3W82A 2HNHA 3SQSA 5LIXX 3RIKA 2V2HA 4B3KA 2VUYA 3GG1A 3WH6A 4FIRA 1H1NA 1ME8A 2PDIA 4IIGA 4RW5A 3ZJKA 4BQ2A 2VEMA 2V5LA 2QJMA 4JTFA 4V2XA 3U5YA 3W37A 1XG4A 1R5YA 1RQEA 2V3EA 1V0KA 3F4CA 2J8FA 4WUIA 3TW7A 3FGCA 3ARWA 3PB0A 4LCQA 1TRIA 4BA0A 4PB4A 2V8ZA 5FEPA 3VNJA 1LDCA 3UCDA 3T7VA 4I9JA 4DBEA 1E4IA 4DX3A 3GE7A 5ABGA 4Y8EA 1RPXA 5I3IA 2ZADA 1XQLA 5JMUA 4C6KA 1WQ5A 1WAUA 4L80A 1XICA 8RUCA 4IWWA 3VOCA 4O28A 3H54A 2INEA 3ERPA 2E5CA 2HWGA 4NG3A 4O13A 3IANA 1P6CA 1E1FA 1XLGA 1YLVA 1HUVA 5LIYX 2YZRA 1O12A 1AFSA 2XM1A 1JFXA 2BLEA 4PULA 1BWLA 3UF9A 1KC7A 5BRBA 2I5QA 2W66A 3E2QA 2C79A 3QV9A 4LRSA 3V0SA 1OEPA 4UTWC 3AAMA 2E67A 3ANUA 1TPDA 2TAAA 1EYEA 1H7NA 1W8GA 3LV6A 2TPSA 4PMUA 2ZTJA 2GSJA 4AU0A 4LBRA 3RRAA 2Y70A 2A3BA 1JI1A 3B8DA 1W1YA 3A21A 2OQHA 3O16A 4ZBCA 2ICSA 1DWAM 3MMTA 4JQAA 2YCEA 4PYSA 4JIEA 2GGGA 1E0UA 5CC7A 2V3DA 3RITA 1WB0A 5FJOA 3ZSSA 3DYPA 1E5NA 1HJUA 5AYZA 2CEQA 2A7PA 2W63A 2HQAA 4IOTA 4GI6A 1UYQA 1DOSA 3W1RA 2DVXA 3DOPA 3VIKA 4JFWA 4DIAA 2X2GA 3C0SA 1W3LA 3GYCA 3RM8A 4YPJA 4ZZ9A 4UFKA 5E5CA 5E1QA 1ZS2A 1OGGA 4HU8A 2WBKA 1KFBA 4LNCA 4LGXA 3AYVA 1OFAA 2QCLA 3EDKA 4PEKA 1LL4A 4WSKA 4GI9A 3S5SA 3IIOA 3W88A 4GX8A 3RLHA 5C9RA 1UWUA 3TTQA 4UR7A 2WMGA 5SWUA 3B0YA 3LI1A 4QE4A 2ZZ6A 1PTGA 1DE5A 2BX7A 1ALDA 3WF1A 4GUJA 5I07A 2GK1B 3WDIA 4LF1A 3PR2A 5A2BA 3RDKA 2VOMA 1KM0A 5FSDC 4JN6A 3NYDA 2YPIA 4E3VA 4V33A 1EJTC 3ABXA 4LVBA 2J4GA 3UWEA 4FSAA 2HJPA 1JEZA 4F40A 1FBAA 3N2MA 1T8QA 4Y9AA 1F61A 4F9JA 3G1AA 4GZIA 1QASA 1VGAA 1TRDA 3T0BA