2BWGA

Structure of human guanosine monophosphate reductase gmpr1 in complex with gmp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
337
structure length
335
Chain Sequence
PRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GMP REDUCTASE I
publication title Structure of Human Guanosine Monophosphate Reductase Gmpr1 in Complex with Gmp
rcsb
source organism Homo sapiens
total genus 114
structure length 335
sequence length 337
chains with identical sequence B, C, D
ec nomenclature ec 1.7.1.7: GMP reductase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bwgA00
3W83A 2QCFA 3CQ0A 3KAOA 4UTIA 4QM1A 4UMCA 1YPIA 2ZZ5A 4K37A 2CW6A 4JTEA 4FNSA 3LV5A 3DAQA 3R89A 1QPRA 1EUNA 4PH6A 4K6AA 4Y6GA 3VKJA 3ABOA 3HG2A 3Q58A 4UXDA 1L6YA 3LGEA 3BW2A 2GUUA 4NQ1A 2CLIA 4N02A 1GVQA 3W7DA 4JDYA 2PCQA 4HNUA 3SFKA 5F1UA 1KM2A 1I2PA 1O5XA 3HGJA 4ZQMA 2QUTA 3HQ1A 2H3BA 3MMTA 5EMUA 2BSLA 3OVRA 4UNLA 4AHPA 4BF9A 1FX6A 3N34A 2VFIA 4WXYA 3G24A 3FJ6A 3RF9A 4O1AA 1ME8A 3I7RA 4QNEA 4IMCA 3MW7A 1OFBA 4DQWA 1IF2A 2YGYA 3G1SA 2QCDA 4WZHA 1ZCOA 3PAJA 2HS8A 3IVSA 3M9YA 4WOZA 3A22A 3HPXA 2ZA1A 1GVOA 5DN1A 5I3FA 4OT7A 4IWWA 1H7WA 3UWZA 1QWGA 1K02A 4ADUA 3ZS4A 1JCNA 5CG7A 5KSWA 3M41A 3TE9A 4LUJA 5LNVA 3NAVA 1SZEA 3N9SA 5D04C 3LB0A 5FF0A 3W7IA 3ZR4A 2DJLA 3W88A 2Y7GA 1SR9A 4J9JA 4NX0A 5AC6A 5EA9A 1IXQA 4P61A 3W1TA 2FPYA 2H3DA 4X22A 3HG4A 1VZWA 3FA5A 3STGA 3W72A 1IGSA 2HMCA 2OMAA 1EPXA 1S3HA 2VC6A 2JKAA 3ATYA 1CW2A 4X2RA 5HR6A 2ALDA 3PWAA 4Y8FA 3W1AA 4GFSA 1S5TA 2DZTA 3FLUA 4YWIA 4ADTA 3EWBX 1GVRA 3PM6A 1VQTA 2F84A 4CNNA 1IXPA 4K8EA 4LU0A 3P5YA 5F4SA 1TPC1 4ZMGA 3P60A 2Y61A 4CQAA 3L21A 4NZFA 1KFLA 4Q4KA 1OFQA 4DELA 1EUAA 1T8XA 1G69A 3HGOA 4Z0SA 2QJIA 1OFRA 3E0IA 3TSBA 5G4EA 4N9BA 5IBXA 2RHGA 5E1QA 3UWYA 4BK9A 3G8EA 1EWEA 4IX2A 4NJHA 5D09A 1RV8A 2HSAA 1KFJA 1WBHA 3W1RA 1JJKA 2BXVA 3LXCA 4OWGA 2WQPA 3TFCA 1N8FA 3SECA 3F4WA 3QM3A 4H4IA 1XKYA 1OYAA 2C1HA 3NPWA 1FUYA 1GYLA 4MJMA 2QCGA 5DXXA 3NDOA 1K8YA 2FFCA 5BRBA 3G0XA 3M6YA 3TMLA 2G5WA 6TIMA 4M7SA 4Z1CA 1OF8A 3GXPA 1XUUA 4MZYA 3C0JA 4Q33A 3R5EA 3G8RA 1AL8A 3FEMA 4AF0A 3EKLA 1VHCA 4BWLA 5K7JA 4LVFA 3W7LA 2W0UA 4NNAA 1W3NA 3W2LA 5CZSA 1SZGA 1DOSA 2V0TA 4N4PA 3S1XA 5FI8A 1P4CA 2LLEA 3MWAA 3FIGA 2J9ZA 3O6YX 3L68A 3QSRA 3WJSA 3MJYA 1GG1A 2OCZA 1FWTA 2QCEA 1I8JA 5TQLA 1F73A 2ZA2A 3HG5A 1DHPA 3C8FA 3N73A 4LVBA 3VNDA 3MBDA 4JTUA 2O7QA 1WOBA 2AAMA 5DCDA 2CZFA 2QUVA 1H61A 4UMBA 2V2CA 3KOFA 1KBIA 1M6JA 2JBMA 1J4EA 1F6KA 3VE7A 3UXAA 1V5XA 1SW0A 3TR2A 1PHQA 2V2DA 1F74A 4JS3A 1G4TA 2W79A 3MHFA 3P8JA 3QH2A 5CGQA 2A0NA 4GUIA 1I2RA 4K38A 3E12A 3QQ1A 3S6DA 3WK1A 2NZLA 1RQEA 4O1BA 1FWRA 3KVJA 3LBCA 2GQAA 4AHOA 1W3TA 3GKFA 3WJZA 4FIRA 1ALDA 4RJEA 3W7GA 4O4WA 4MFEA 4O0ZA 1SUXA 4AH7A 4UR8A 2ATMA 2V82A 3R12A 5EY5A 4RXGA 1SO4A 2X30A 3NZRA 3HIJA 3W3OA 2CLHA 3T44A 4LV4A 1R47A 5J5RA 4KFOA 1WV2A 2G95A 2CZDA 3ZWTA 4OU1A 4BI5A 3NQ8A 4MFDA 1SPQA 3P80A 1LBFA 3TIMA 1EP2A 1RQBA 2V5LA 1DQXA 3GX9A 4H6KA 1Q3NA 2FB3A 2GVJA 4JX4A 4CNOA 3MHGA 5D2TA 1EB3A 2H90A 4JR5A 3L66A 4HN4A 5ABTA 1AW1A 1VR6A 4YL2A 2VXNA 3OHIA 1R2TA 3MI6A 2DZXA 3TKFA 4UTJA 1TRDA 3TQVA 2Y89A 4TMBA 3SY5A 4JIQA 3SZ8A 4CQ9A 1FQ0A 4I7UA 4PTNA 1WDWA 1DL3A 2WOQA 4UTHA 1LLWA 1VH7A 2GQ8A 2YW4A 2X1RA 2VEMA 1KFKA 2AQWA 2Q8LA 3WK2A 1KV8A 2IQTA 4UR7A 2X1TA 5DXYA 3OIXA 3E02A 3M0ZA 3I65A 2H8XA 3EX6A 2QCMA 3C2EA 1UBSA 1GT8A 3UWUA 3W2NA 1XBVA 2GOUA 3TQKA 4NVTA 2ZCGA 3BGJA 3U6WA 4NJJA 4DBDA 3TUUA 1NAL1 4S1FA 3EWWA 2OZ0A 3UYCA 1FWNA 4Y90A 5D05A 3DHFA 3G1XA 1H51A 4E38A 5CKSA 1P1XA 3GYEA 2C18A 3P84A 1QOPA 1ONRA 1Q6OA 2Z0IA 3DBPA 2OT0A 1TV7A 4QJ1A 1OK6A 3F4NA 3KRUA 2P1FA 1KLYA 3NXFA 3G0UA 1JVNA 3THAA 3NQMA 1QMLA 3LV6A 2VEIA 4DO5A 1XCFA 3W75A 1KLZA 3DU0A 2RDTA 3DKJA 4GNJA 1GWJA 1H7NA 3DI1A 2ZRVA 3QMRA 1JULA 4D2JA 1A5CA 3QW3A 2FPTA 2A7PA 2XN1A 3MYPA 2JK2A 1JCMP 1R46A 1J5TA 2X16A 2YSWA 3B06A 1SZNA 1K3UA 3IGSA 4UTLA 1I2NA 3S5NA 4JTGA 5HMSA 1X8FA 3NNTA 4AF0B 5KINA 3BG3A 4JYDA 4AWUA 3NQCA 2Z1BA 2TMDA 1EIXA 4LC6A 3B0VC 4AAJA 2X1SA 3GAKA 3TC7A 2YX0A 1FCQA 2R14A 3B0PA 3N2XA 3GZ3A 1G6CA 5H91A 5HINA 1ZALA 1HO4A 3L67A 1TTIA 2ZZ4A 1YDNA 4JTFA 3W7NA 2VELA 2YZRA 1MEIA 5F4XA 1W8SA 4RZ5A 1A5SA 4DO6A 2EKCA 3MO7A 3O63A 3GVGA 1JCYA 5KMYA 3GDTA 3P7YA 3LTPA 1TJPA 3CT7A 5FEWA 3INPA 2ZDRA 3UD6A 1G7VA 5LHEA 3EX3A 2BWGA 1Z44A 4O17A 1I2QA 4UTTC 2GJNA 1P5BA 4KWWA 2TYSA 3WK3A 3ABSA 3U2OA 3GXTA 3LCXA 4PEKA 1KFCA 2I1OA 4JN6A 1XFBA 1IIGA 5DY3A 1RR2A 4NXKA 2ZBTA 2CZEA 1XM3A 1JCXA 2QDGA 4HSNA 4O0KA 4QITA 3CEPA 3P81A 4O8RA 4ONVA 1VJIA 4OV4A 5KZDA 2CWNA 4GXMA 3L0GA 4JTKA 2JKEA 3LCHA 4MVAA 1QAPA 4MKNA 3PSVA 1TJRA 5HR7A 1KTNA 4S2BA 3PF3A 2DORA 2E1DA 1F2JA 3RFAA 2PC4A 2E68A 5LGXA 3C56A 3TAOA 1W0MA 1SO5A 2WNNA 3N2MA 1G7UA 1B4EA 4S2CA 2FQIA 5AC8A 5AFDA 3ABQA 2QUUA 4PODA 3S8HA 2EPHA 1BEUA 1KTBA 3GIYA 3ELFA 5EBUA 4Z1BA 3MP3A 1R2SA 3W9ZA 2ZQ0A 4XQ6A 1WQ5A 5AHLA 4IMGA 2H8ZA 4JTHA 2GJLA 4BR1A 2A7RA 1VPXA 2NLIA 4E2DA 3DFOA 2Y7DA 4IXHA 3DGRA 3S42A 2OX1A 1W5QA 1NF7A 1UCWA 4QNWA 1R30A 3H53A 3HPZA 4FNUA 5G2WA 1AL7A 3QMSA 3C2FA 8TIMA 3I7SA 4O1CA 1VRDA 1IIHA 3VCRA 2P10A 5D2WA 3NM1A 3PUOA 3KXQA 3T7VA 4LRSA 3AO0A 1LBLA 4UTUA 1PCKA 4CCEA 3LTYA 4Z1DA 4TIMA 3FJLA 3LRMA 3GKAA 1JQXA 1XC4A 1VYPX 2NX3A 3EXRA 1O5KA 1SFLA 3W7MA 3G3MA 4O12A 3VI2A 5CSRA 4UC5A 2B4GA 1ICPA 1IXNA 2E5BA 3DZ1A 4N6EA 4XBKA 1LROA 2ABAA 3FFSA 3W73A 1LOSA 5CZ0A 1DV7A 3M44A 2Q3RA 5DELA 4FNQA 1Q6RA 1FCBA 3LOTA 4GUFA 4YXGA 1LDCA 2FIQA 1E51A 1HUVA 4O4VA 1LORA 3QQ0A 1F76A 5AHNA 2TRSA 1T96A 3RU6A 1XI3A 3LXAA 5F4WA 2C6QA 1SSDA 2NV2A 4I7VA 3USBA 1ML1A 4JNMA 5KZMA 3LHYA 1PHWA 1TPFA 1YTDA 5SWUA 2GVGA 4HNNA 3CHVA 2FJKA 3EB2A 2V8ZA 5DBUA 3M5ZA 1GTEA 1OVDA 3NQVA 1W5MA 1S5VA 4IXXA 3NZ1A 1WYIA 1TCDA 2CLFA 1W5PA 3R2GA 1FDYA 2ZZ3A 4MYXA 1C9DA 4NNBA 3LCIA 3SGUA 1MEHA 3UZ5A 3S5YA 5K3VA 4BI7A 1VYSX 4NZJA 3LI0A 3IGXA 3B8DA 3I6RA 3THQA 2Y7EA 1WXJA 1TPDA 2V30A 2A21A 4PL2A 1SZFA 5F1VA 3PULA 5AHIA 4U28A 5HUPA 3PB0A 4A3UA 2A6LA 4UTTA 3MP5A 1WA3A 2VEKA 3CB8A 3LCLA 4QQ3A 2V9DA 4O52A 3EXSA 5AHMA 1YXCA 5AOUA 3ANYA 1O4UA 5CPLA 4K8HA 2CLOA 4OHQA 4EF8A 3BK0A 3W1QA 3LCGA 5C5YA 5K2ZA 3EWZA 3NQGA 3C61A 1ME9A 2YFNA 2DZPA 1TTPA 3O1NA 4LUIA 3D0CA 2C14A 1KM3A 4XWUA 2YCEA 1X6UA 1OG0A 2OT1A 1FBAA 4DPPA 4NJGA 2ZRUA 3LBMA 2DJXA 3GDLA 2FB2A 2B0MA 3O16A 3PBVA 2Y6ZA 5G2IA 3KVKA 4FXRA 5D03A 5I3JA 4K36A 1KW1A 4O19A 1MZHA 3RLVA 4HNTA 1XXXA 3ATZA 1ZAHA 4ZQOA 1VYRA 1Z48A 4JY9A 1VCVA 1BWKA 3BG5A 2QEZA 5HWMA 3NG3A 2KZHA 2JKPA 1A53A 3FOKA 5FF3A 1B9BA 1LOQA 3CLMA 4MPQA 3DXIA 3FS2A 1D3GA 4YMZA 1YTEA 4IMFA 5BOOA 1W1ZA 2R8WA 5D2VA 3LCFA 4ORIA 5AHEA 4WUIA 1N7KA 1XBXA 3S5ZA 5DBTA 5FF7A 3R13A 3SI9A 1W5OA 3PUDA 4HPXA 3IIXA 4X9SA 3W7KA 4DO4A 1WAUA 3P82A 3W2UA 1BKSA 5HJLA 4G1KA 1XUZA 3W71A 5HWJA 2NWRA 3LHVA 3HOJA 4C1KA 2RDWA 1GYNA 2EF9A 3LXBA 5DCBA 1ZAJA 3HGRA 3NQDA 4OQVA 4GC4A 2ZTKA 1I4NA 3DFTA 3GNDA 3NGJA 3O06A 2QJHA 4M6VA 3W7HA 1KV5A 3TW6A 3PBUA 3KRZA 3KX6A 5BW6A 3IEBA 3BG9A 3KVMA 2BTMA 2YDAA 5F2LA 5T26A 3EWXA 1GOXA 3NOEA 1FXQA 2E5CA 3CWOX 3W2KA 3HF3A 2QAPA 2YW3A 1Q6QA 3W23A 4EVZA 4LV9A 5DY2A 1YXDA 1YTKA 2OJPA 1G67A 1HTIA 4YLWA 1LZOA 4I9AA 2ISVA 1TPVA 3W85A 4FX6M 1VLWA 3IV3A 2B7OA 4Y9AA 3NO5A 5AYZA 2C19A 3S9YA 3NL2A 4O57A 3TDFA 1LYXA 3CTLA 5K4XA 5L9FA 1DJNA 3BGGA 3NQ7A 3CIWA 3HGSA 4JGDA 4MYAA 1ZAIA 4WY0F 1W54A 4GJ1A 1Z42A 3G1AA 3S5OA 5KTLA 1O94A 1OFOA 3P5ZA 3W7OA 1ZFJA 3DHDA 2BZNA 3GNNA 4NJIA 5I3GA 2QCNA 4NJKA 2ZZ7A 4IPIA 4B5NA 1NEYA 3ZFHA 1FDZA 3B04A 4KKXA 2NUWA 5D32A 3DKLA 3NPUA 3S1UA 1EA0A 5I3KA 5AC7A 1Y0EA 3LERA 1SU5A 3UPWA 1OF6A 2QR6A 1TPUA 1TV5A 2CZ5A 4WOQA 5DLCA 4AWTA 4IPJA 5A8GA 3P67A 1TRIA 4PL1A 5K9DA 1EP1A 3QYQA 4UFJA 1O95A 4E2BA 2HTMA 3QJAA 1DORA 3O6CA 4RZ4A 3UPBA 3C4UA 1QO2A 4EIVA 4RK8A 1YADA 3N14A 4JTLA 3UY7A 1TO3A 7TIMA 3DFPA 2C15A 2BX7A 4FX7A 4A21A 2J9YA 3W1PA 5KITA 4FX8A 4XTIA 4LT9A 1UJPA 4UFKA 1EP3A 4XZ9A 3T55A 2YYUA 1KM1A 4WD0A 4POCA 1K7EA 3MI3A 4TU1A 1SW3A 3TW7A 4NXSA 4Z1AA 3EEGA 2V2HA 3QC3A 3LTSA 1G4EA 1B4KA 4MOZA 4AXKA 2VKZG 4AHQA 2AGKA 4ZQNA 4WY0B 3RK8A 3IIOA 1A5BA 4LVGA 4O14A 1KA9F 4N9EA 4FXSA 2Y88A 1SO3A 1C29A 5LHFA 4UTWC 3M47A 3NA8A 2ATSA 1L6WA 3L5AA 4JYEA 1H7PA 2RH9A 2Y63A 1H5YA 2PRHA 1RQHA 3C6CA 3TXZA 3NR0A 4CLMA 1L2UA 3PSWA 3JS3A 2A4AA 3CPRA 5LNSA 2A1YA 4W9TA 3LHTA 5D37A 3G1DA 2BLEA 3HPSA 4XTDA 3L9CA 1LRNA 1LLZA 2P0OA 1VLIA 2Z6IA 5LKYA 4DF2A 2JGYA 4C1LA 3C2RA 3M1ZA 3M5XA 1OABA 2CLLA 1W31A 3TFXA 3LHZA 2A2IA 3PR2A 2A6NA 1VC4A 4IX0A 5CSSA 2ZRXA 4Q32A 3W7QA 2RKXA 1F05A 3WJWA 2E77A 3DI0A 4U4MA 5AYYA 3EX1A 4KFPA 4IMDA 4IQLA 2WJZA 1SFJA 3O15A 3NL5A 3NM3A 1N55A 1GVSA 3C3NA 3E96A 3W86A 4M19A 2YPIA 3OVPA 4I7WA 3C2VA 2FLIA 2VOMA 1JUEA 1QDSA 4DBEA 5D33A 3W1LA 4N4QA 4FIQA 4K39A 3LHUA 3H55A 5U4NA 1JQVA 2ISWA 3L5MA 2QCCA 1QPNA 4IOTA 1H1ZA 3TAKA 5LGZA 3RNDA 1W56A 2G96A 5FEXA 4JTJA 3GK0A 4QAIA 1AG1O 4EWND 3ABRA 4JYFA 4WX2A 3EX4A 1GZGA 1ICSA 4KWVA 2ZZ2A 3L5LA 3AJXA 1PIIA 2ZZ6A 1F5ZA 1H62A 3M5YA 3PS7A 3WJXA 3JR2A 1KM0A 1EEPA 3O07A 4LVDA 2ABBA 3H54A 1H60A 3W7EA 4A22A 1Q6LA 2WPBA 1FWWA 1L6SA 3DFNA 2VFDA 3W1UA 2DZSA 2J9XA 4JEQA 5I3HA 1TYGA 1AK5A 3BLFA 3PG8A 4MZ8A 2J24A 4IGHA 3HG3A 3M7WA 3NPVA 4UTKA 3S0CA 4AWSA 5LZLA 4CQ8A 4LTSA 1M5WA 3IIVA 4M7TA 4RR4A 3TJLA 1DBTA 3SJ3A 3N9RA 3G1VA 2E6AA 4GRSA 5G5IA 3N19B 1THFD 1IXOA 1K7XA 4BI6A 4L4MA 5AHFA 1G4PA 1TV8A 1H7XA 3KRSA 4UNKA 3W1XA 1KFBA 1KM6A 4TX9A 3HJZA 4MUZA 1LCOA 2WSQA 4N9DA 4N6FA 1OFDA 2Z6JA 3CC1A 1HFBA 3TJXA 3B0UX 4ZQPA 1J2WA 4MY9A 3GB6A 2NXGA 2ZRWA 1TPWA 1TSIA 4O16A 2CFFA 4JDBA 5CPMA 4ML9A 1RD5A 4R53A 2PRMA 3BW4A 2W6RA 2XN2A 3ZWSA 1XBZA 1YPFA 2X2GA 1OFPA 1JRCA 5EKYA 1UUMA 2D73A 1QOQA 4NX5A 1JRBA 5DCEA 2C0AA 2NX9A 3UQNA 2NUYA 1KFEA 5K9XA 3KFTA 5I3IA 1GEQA 3C52A 2V5BA 1R2RA 5E93A 3RLUA 1D3HA 3I7QA 1TQXA 3G1YA 3QZEA 3EX2A 2ZZ1A 4MLJA 1DVJA 2G97A 3PBWA 5F2GA 3S1WA 1AMKA 3DFQA 3GR8A 2EHHA 5FEPA 3GR7A 5LNUA 4M6QA 4NU7A 3DFSA 1OYBA 1LRTA 1YLVA 2WV8A 2J6XA 2Y62A 1BTMA 4UTWA 3A9IA 1QO5A 2Q8ZA 5HQEA 3W07A 4EOUA 3Q37A 4GUGA 1FXPA 3W22A 4PFMA 2I14A 1OX6A 2PE4A 5BMWA 3W7JA 3GXNA 3CM4A 4K7VA 3W2JA 1H7OA 4LWWA 1M7OA 3IIZA 1U83A 5K9CA 2J88A 3GDKA 2CLEA 1SSGA 3QMTA 4RCXA 3MI2A 1KM4A 1I2OA 2PRLA 3QEZA 5D2XA 4QSHA 5HWNA 5G4WA 3L0NA 3M43A 1QR7A 3QW4B 3TK7A 2ZYFA 1NF0A 3W1MA 5GVJA 1ZNNA 2C16A 1PE1A 3TA6A 4K7YA 5C6MA 1FCUA 2Q3OA 1ICQA 1K7FA 1G4SA 4IJBA 3LHWA 2RDUA 4CCDA 1JR1A 3TU9A 2NXIA 1OJXA 5KZEA 1JCJA 1GQNA 3FYPA 1TPH1 4O1DA 1I45A 2QJGA 4LY8A 1FWSA 3TROA 4RZ6A 3W1NA 4M6PA 4AEOA 4IMEA 4XKYA 5HUOA 3A5VA 2Y85A 3NQAA 3L65A 1OX5A 1UB3A 1OX4A 4FF7A 1F6PA 4ZQCA 1K03A 4OGZA 1W3IA 4AVFA 4JTSA 1OFEA 1QFEA 1UUOA 4OBTA 2ISSA 1XDLA 4L4LA 3W2MA 2GQ9A 1LM1A 1MEWA 3C2OA 4PA8A 4FNPA 4A29A 4WY0A 3LI1A 3PBYA 2JGQA 5EL1A 3B4UA 3NEVA 4GUJA 4LW7A 4OE7A 4UUIA 4O54A 4MY1A 3CU2A 3DH7A 4DPQA 2Y7FA 3OBKA 2ZRYA 2B7QA 4HHPA 1YXYA 3O8AA 1WX0A 3BLEA 1QCWA 3STCA 3PVFA 1GVFA 4MLRA 1T99A 1W5NA 2TSYA 3YPIA 2H6RA 2O7SA 3UWVA 2F7FA 4ZQRA 4FEZA 2WO5A 3OEXA 1DQWA 5K4ZA 4OV9A 5CZTA 5L6UA 2R91A 3LRLA 3BPWA 2DP3A 5CPNA 1GTHA 5C54A 3OVQA 4RXFA 4JIPA 3FYOA 3IVTA 1UASA 2EAWA 4R7JA 3NQFA 4M5PA 4FNTA 3W7PA 3WFAA 4RKAA 1VHNA 1GJPA 3W87A 3NL3A 2FDSA 4O15A 4ZZ9A 4UCGA 4QISA 4XBSA 4RV8A 3MUXA 2QAFA 3LRKA 1XDMA 1NVMA 5A5WA 3W76A 3TH6A 1TB3A 4TO8A 3A24A 3V75A 3G0SA 3PUEA 2B7PA 4Z08A 2E6DA 2FTPA 1EWDA 1YDVA 4O10A 3L0KA 1TREA 4MZ1A 4JY8A 3IIPA 4A2SA 2VFGA 3P8IA 4HIBA 4YCPA 1DJQA 2UV8G 4HSOA 4O50A 4LS2A 4LVAA 3TSDA 2Y70A 2A5HA 1VGAA 3SGZA 1SW7A 2ZFAA 1S5WA 1YDOA 1LOLA 3VFLA 2NXHA 5LNWA 2QCLA 4MY8A 1TPB1 2YR1A 3VE9A 1GG0A 5HNRA 3TX9A 1NSJA 4ADSA 4HPJA 4JX5A 2X1UA 3R8RA 1RVGA 3MYOA 3GAYA 1U5JA 5D2YA 1DKWA 3M5VA 3MP4A 3W74A 4RLIA 2GPTA 5G1TA 1JUBA 5U7SA 1TMHA 3NL6A 4BFAA 1H7RA 2DZWA 3GDRA 4N9CA 3TSMA 3P62A 1MO0A 2VFHA 1AW2A 3NQ2A 3T4CA 1X1ZA 3UWWA 5FF2A 2EGZA 1SQ7A 3NPXA 5LNRA 2HS6A 5G2HA 1TTJA 1FCVA 1LBMA 3UXDA 5CPOA 4NNCA 3CEUA 3TC6A 3WK0A 2YFOA 5H2ZA 4O18A 1HG3A 3FKRA 2QCDB 2QF7A 1OYCA 1ZHAA 3LLFA 1F7BA 2E6YA 6ALDA 4UIOA 4XUGA 4FNRA 4DF0A 2DZVA 1K8XA 4PCFA 1OFAA 3EWYA 2C3ZA 2YYTA 1Q45A 2DZUA 4GUHA 2CU0A 3NQEA 5G1YA 4A2RA 1XBYA 5AN7A 4EF9A 5F2MA 5J5DA 3EWUA 4FB7A 4LRTA 2CLKA 4WQ6A 3IRDA 2WNQA 3G18A 1KBJA 1LRQA 1FDJA 2QKFA 4XKYB 1PCWA 3GDMA 3BVJA 3UWQA 1OX4B 3A23A 3LDVA 3CWNA 1FY6A 3O05A 1KTCA 3HMJG 4O11A 3SIZA 3B05A 3PY2A 5IM51 2A7NA 3BO9A 1OK4A 1PV8A 3BARA 3NVTA 1ZY9A 3Q94A 4UTMA 1WOAA 4LOCA 3TMQA 1KM5A 1ZENA 3MHUA 3SR7A 3T78A 1TIMA 4NT0A 4ZL1A 1ZJIA 1P0KA 3G3DA 2E5DA 2GVLA 3Q2DA 5CZJA 4R34A 2I9EA 1K8ZA 1O60A 5D38A 1MSSA 1D9EA 4DEFA 1C8VA 4JTIA 3SW6A 2NX1A 4NUWA 3BLIA 3P61A 2NUXA 1B3OA 5D30A 3BV4A 5HULA 2NV1A 5EPDA 4E0CA 5MHBA 1OHLA 3QF0A 4ORMA 1WBJA 2ZTJA 1YYAA 4ALDA 2PURA 1RPXA 4O53A 3A21A 2ZA3A 4GWEA 1CX9A 1ADOA 1W37A 5C2XA 2RFGA 4CCCA 2NWSA 4O28A 1VS1A 2A85A 2FPVA 3EXTA 3W7RA 3OA3A 3IGUA 4AMAA 5FF4A 3JRKA 3K30A 3W7CA 4MJZA 3G1FA 1TPEA 3M16A 3P74A 3O6DA 3SSJA 3OG3A 2QDHA 3T40A 4UFHA 1P0NA 3B03A 1LP6A 3UNDA 5BMXA 5FESA 3KVLA 3WJYA 3MBFA 2B7NA 3CIXA 3TXVA 4P2VA 5FEZA 1QPQA 3KHJA 4N2YA 5EYWA 4GBUA 5C55A 2WSRA 2C13A 5BNKA 1JUKA 4CNPA 4Y96A 3UY8A 4LS0A 1HL2A 2J27A 1CI1A 1L9WA 2VEPA 3A5FA 4HNVA 1TTQA 3LX9A 3TCEA 2R94A 1LTDA 1RZMA 4H3DA 4UMAA 1PS9A 1JCLA 1H50A 1PVNA 3E49A 3HB9A 2VFEA 3F1QA 1TQJA 4ICNA 4JD4A 3V1PA 4MIMA 4HKPA 1Z41A 3DENA 4JXCA 4YCOA 3STEA 4UFIA 4X3ZA 4JICA 3W84A 4AB4A 1A50A 1BWLA 1B57A 3TNOA 2DU2A 3LCWA 4LNYA 1PL9A 4RX0A 5IBXC 3QRHA 2E6FA 1AW5A 1VCFA 2XFWA 1EX5A 4GE8A 4LS1A 3GLCA 3PB2A 3NYZA 2V81A 3BW3A 4FHAA 4TR9A 4UFMA 2VFFA 4WXZA 2WSYA 4Z0JA 4DF1A 3I68A 3L2IA 1T0OA 1A5AA 3PC0A 3TQ0A 1NFBA 2TPSA 1SO6A 3G1HA 1M7PA 3QFEA 2XN0A 2E09A 1H63A 1QNVA 3E9AA 4TMCA 4JX6A 1GPWA 1VCGA 2QCHA 2YXGA 3FKKA 3PG9A 3QPYA 3TV8A 5LSMA 3NQ6A 1XL9A 3HO8A 3LM7A 4BWLC 3HBLA 5D02A 2CLMA 4DXVA 4LC8A 1QPOA 4PC8A 3STFA 1MXSA 4IUOA 3EKZA 5F2IA 5TBOA 3IVUA 3W6YA 5E0KA 3UZJA 2WKJA 5AYXA 4UFLA 2WNZA 4R33A 4HT3A 1ME7A 3U8GA 3G22A 3QSTA 3QPZA 2Z2UA 1X1OA 5AB3A 3LLDA 2VENA 4QIUA 4WJEA 3N3MA 4O13A 4ZVJA 4JTTA 1V7YA 2ZRZA 4FO4A 4KFNA 5TIMA 1X7FA 3F03K 1H1YA 3S1VA 3W70A 3RMJA 1HO1A
chains in the Genus database with same CATH superfamily
4DHGA 2PAJA 3KAOA 1GVEA 4QM1A 2CW6A 3R89A 2V3FA 1E6NA 4K6AA 4IP5A 2QUMA 4GH3A 3Q58A 3N2OA 3IGHX 1MNZA 2GUUA 3ALFA 2PDJA 5LIKX 4A8LA 4N02A 2PCQA 4P8VA 4HNUA 3SFKA 4G5DA 1KM2A 3GTFA 2XM2A 4ZQMA 2BHYA 2H3BA 5EMUA 2BSLA 5CC3A 4L9YA 1FX6A 3N34A 1HJSA 4MSSA 2VFIA 2NSXA 3ZXWA 3G24A 4O1AA 1OC6A 3I7RA 1OFBA 3VMNA 2FZ9A 1EX1A 1FOBA 1ITUA 3NCOA 3GFYA 3IVSA 4HPNA 3RCYA 3A22A 5DN1A 3PJTA 1S2CA 5I3FA 4ZA0A 2GJRA 4I9TA 1UOZA 4OT7A 3H2EA 1D3CA 4EK7A 5HPOA 1K02A 1AJZA 3UXLA 3TE9A 4R3UA 4LUJA 4XIMA 5REQA 3B40A 2RJGA 1SZEA 4F40A 4S3EA 4NX0A 3FSTA 4YJ5A 1IXQA 4P61A 2H3DA 1VZWA 1EPXA 3ATYA 2I17A 4X2RA 5HR6A 3QHOA 2H9AB 3W1AA 3ZQ9A 4GFSA 5AYBA 4ADTA 3PM6A 1UC4A 4NAEA 3I4KA 2D24A 2CXEA 2Y61A 2WC3A 4CQAA 3GZAA 3QR3A 4DELA 1OFQA 3CH9A 1MDRA 2PDKA 3VKBA 4DWDA 2QJIA 3E3HA 4CNSA 4N9BA 5IBXA 1EWEA 3AU2A 3ARUA 1RV8A 1XLIA 2BHUA 2PBOA 1JDDA 2HSAA 3CHDA 2PODA 1JJKA 4GJJA 5T91A 3E1F1 5A6SA 3I6EA 2VC7A 1K9TA 1MW1A 1UZ4A 2C1HA 1GYLA 3HTWA 5DXXA 1GQIA 1V3HA 3G0XA 4FS9A 4XZNX 3M6YA 3UESA 1EQPA 3G8RA 2OVLA 4AF0A 3EKLA 5A1AA 3AIUA 4F48A 5I78A 4H9YA 2PWFA 3VGBA 3SUUA 4E4FA 2WVVA 1GPFA 4LUSA 3POCA 1FA2A 5FI8A 1P4CA 3QSRA 1TA3B 2E67A 3WNKA 1AFSA 3GYCA 2FGBA 1W9BM 4JN7A 1FWTA 2QCEA 1F73A 2ZA2A 5BZAA 1ZGDA 3TZNA 4I9JA 5DCDA 1DIDA 2CZFA 2QUVA 1VKFA 1MUWA 1J4EA 1YDYA 3R8GA 3TN3A 1V5XA 5EFFA 4DBUA 1XG3A 2V2DA 3SCOA 1AJ0A 1RD6A 2OEMA 2PDWA 3H8AA 5CGQA 4W86A 1I2RA 2NZLA 1J0YA 3G5EA 4JZ5A 2GQAA 1W3TA 5CPQA 2Z1XA 3WJZA 3B0XA 2O4MA 5CJNA 2XISA 1OB0A 4O0ZA 4R88A 1CBGA 4W8AA 3HV9A 3R12A 1A4MA 3UZWA 5F7UA 3WBEA 3W3OA 3T44A 4KGJA 1EPVA 1R47A 4KFOA 4A8RA 2BBFA 2OSWA 1FP9A 3BLDA 3LQGA 3S9IA 2EPNA 7REQA 4H6KA 1Q3NA 3M4HA 4CD5A 1W8GA 2I5IA 2GVJA 3QPEA 4E8CA 4W84A 1J0KA 4IQEA 1EF2A 3A4AA 4JR5A 3L66A 2GWNA 1AW1A 1VR6A 2YCIX 1R2TA 3O2LA 1WZLA 4IGMA 1YBQB 3SZ8A 4CQ9A 4JL2A 3VKKA 4CEXC 4GGHA 4LY4A 3R10A 1KKRA 3UZXA 4GLEA 3WK2A 2QIIA 1RY0A 2DT3A 3M0ZA 5EMYA 4DAIA 3EX6A 3H23A 1UBSA 1GT8A 5IOBA 4PTVA 3MDUA 3TOYA 1Q4NX 1Q8AA 2DT0A 1CENA 2ZX6A 3TUUA 4S1FA 3UYCA 2WC4A 5JBEA 1FWCC 3L4TA 5FJRA 1FWBC 2WNWA 1UMYA 4R5EA 4HU8A 4E38A 3UJSA 3TCSA 4KIRA 2EPOA 3KP0A 3ZMRA 4D71A 2Z0IA 2PF8A 3DCPA 4UQEA 4QJ1A 3KRUA 3F4NA 3KBSA 1TVLA 2P1FA 1KLYA 3W6LA 3WF0A 4H9UA 1WDSA 3NQMA 3VIKA 1H7NA 1JULA 4D2JA 1PKMA 1A5CA 5EB8A 2JK2A 4KW2A 1JCMP 1Q6FA 3KL0A 4GA8A 4HU4A 1ZJHA 4UOJA 1E70M 3PAOA 2VZTA 1I2NA 3B9OA 2D69A 3LM3A 3NNTA 2ZX9A 4DJDD 2TMDA 4B5VA 3BCJA 2ZDSA 3PZUA 1QNRA 4Q8UA 1VIWA 2YX0A 1F61A 2NSOA 2WMJA 3U7BA 4AMCA 5TF0A 1B54A 5CZKA 3N2XA 2YL9A 1G6CA 1BVZA 3N4FA 4PB4A 4JHOA 2ZZ4A 3PFRA 1JXKA 5HOSA 3A4XA 1MEIA 5F4XA 2EKCA 5JBDA 1JCYA 4AU0A 1MQPA 3NUKA 3OTRA 2BVWA 2NT0A 5H8UA 3MU7A 2ZDRA 2GSJA 3EX3A 4H01A 1I2QA 1GGOA 2ONEA 4KWWA 3U2OA 2BY0A 4PEKA 1KFCA 5H8MA 2I1OA 4GO9A 1IIGA 4WGHA 5DY3A 4K3ZA 2ZBTA 5BXTA 1MUMA 1MYRA 3WD0A 1JCXA 4EPEC 2QDGA 4HSNA 1V8EA 4GNVA 1VJIA 3LLXA 4FP1A 4JTKA 5CBBA 5CPSA 1H09A 3ITTA 3DESA 1Y5WA 3UEQA 4S2BA 1J6PA 1BYDA 3GU9A 3TWBA 4LAZA 4HK7A 4B2DD 3A3WA 2QQ6A 1UKOA 2WNNA 1G7UA 2EBNA 1S5NA 4JIRA 4DZIA 4S2CA 4WDXA 5CC6A 3GVRA 3WLTA 3GC5A 1BEUA 2E40A 3COTA 3ELFA 5EBUA 3MP3A 4S3BA 2A79A 1UD2A 2P53A 1WQ5A 1XICA 4JOMA 4IMGA 4JTHA 4B9ZA 4BR1A 4J27A 3PZMA 1CLXA 2YOCA 3OZPA 4E2DA 3DFOA 2Y7DA 2HPMA 2I56A 4YS1A 1Q8JA 3W37A 4IXHA 3IUDA 1NFPA 1W5QA 3BOLA 3KTCA 4QNWA 3VFCA 3SAZA 1FFQA 1R30A 4JQ1A 3CASA 1AL7A 3LPOA 3S6TA 2XM1A 1IIHA 3VCRA 1ITCA 1QNOA 4UTUA 4M1RA 1M41A 1GOOA 4RE4A 1RLCL 3BQ6A 4HZ8A 3W24A 4RNIA 3GKAA 5ENLA 3EXRA 2NX3A 2D23A 3AYRA 1SFLA 3W7MA 3VI2A 2B4GA 5HXMA 1FWEC 2NVCA 4R7WA 2E5BA 4N6EA 1XLHA 4LJ3A 2OR2A 4LX4A 1LOSA 1OM0A 4L80A 5HNNA 3M44A 4FNQA 1Q6RA 5JMUA 1NWTA 1J96A 1LDCA 5LA0A 5AHNA 2TRSA 2Z25A 2XFYA 1T96A 3MCMA 2C6QA 2NV2A 1JZ8A 1JD9A 3ES8A 1TPFA 5C71A 3SFWA 2NQHA 4IFRA 2I16A 4ACZB 3EB2A 3UYIA 2V8ZA 3NQVA 3FAWA 1S5VA 1V6VA 3KDOA 4IXXA 1W5PA 2PDXA 3I10A 2ZZ3A 4MYXA 4IJCA 4M56A 1MEHA 4MNLA 1EJUC 3MUY1 5K3VA 1LL6A 4I90A 3K1DA 1Q7MA 3H7VA 4HYRA 3LI0A 3B8DA 2Y7EA 2BHZA 4GACA 4U5IA 4HZ6A 3CNYA 5GQBA 2CKRA 3PB0A 3QY6A 1UA3A 2A6LA 3M0YA 1WA3A 2VEKA 3CB8A 3LCLA 3ORWA 1DYSA 1PWMA 2OXNA 4O52A 1X96A 1MZRA 1YXCA 5AOUA 2QT3A 1O4UA 2VGBA 3ANYA 1VFFA 1W1VA 3TTQA 3W1QA 3LCGA 3NQGA 1S3TC 2YFNA 2GDUA 3D0CA 3KL3A 1KM3A 7ODCA 2X41A 4JFSA 2YCEA 4AYGA 3HA1A 4A05A 1M7JA 1KWKA 4KWOA 2ZRUA 2E8YA 2FB2A 3CH0A 2B0MA 3PBVA 5I3JA 4K36A 4O19A 1MZHA 2Z26A 3RLVA 4ZQOA 1ZAHA 1VYRA 4JY9A 1VCVA 4G1NA 1L6GA 1J9YA 1KO0A 3NG3A 3CB3A 2KZHA 4KGLA 3CLMA 4XD4A 1IT8A 3FS2A 3S46A 3V7PA 3U2EA 3V3WA 4LQ1A 8XIMA 4FA3A 2R8WA 5D2VA 4L9XA 1XBXA 2PMQA 4HPXA 4GY0A 1UR2A 2Z1SA 5HJLA 2QUNA 3WIJA 3LHVA 4H8UA 4QLKA 1BYCA 1GYNA 2EF9A 4ZENA 3ARYA 3KDNA 3HGRA 4DAFA 5BWAA 4GC4A 2ZC8A 1LF1A 4ZBCA 3M64A 3GBDA 2E8ZA 4S3KA 1BVNP 3O06A 4M6VA 4ZR8A 2GSEA 4WDUA 1NDZA 4HMNA 3TW6A 3PBUA 4D8AA 3KRZA 1HN1A 1ZBWA 1U2YA 2BTMA 2YDAA 3SCVA 3W81A 1AQFA 1EO5A 3OJGA 5F2LA 3EWXA 1IZCA 1GOXA 1FXQA 4ZODA 2QAPA 2GK1B 3WD1A 2VL4A 3LD5A 4NG3A 4KETA 1YXDA 5I06A 1HZYA 2D2GA 2OJPA 1G67A 4M24A 1X6LA 1LZOA 1EC9A 1KC7A 1Q2RA 4I9AA 3OLGA 5FL1A 1PB0A 1VLWA 2B7OA 3NO5A 3ECQA 2J77A 4QDMA 5AYZA 3OLDA 1CXIA 2C19A 1V77A 3S9YA 1BXNA 4P7OA 3GXIA 1L0PA 4O57A 1ODZA 1LYXA 5C70A 3LA4A 1OINA 5D4YA 3TEVA 3E5BA 1EL3A 2W67A 3HGSA 1W54A 4PMRA 1Z42A 3G1AA 1QHZA 1YKWA 1BPLB 3MUAA 5BU9A 3P5ZA 3REQA 4QHRA 4NJIA 5BXRA 4X0VA 4B5NA 3E38A 3MMDA 1NEYA 3ZFHA 2E3ZA 3B04A 4ZSTA 1W2PA 3F4VA 3DKLA 3W25A 1GZJA 2XFFA 2OSXA 1OF6A 5CJMA 1KGWA 2HVNA 1TPUA 1V0KA 4WOQA 5DLCA 3KBNA 4QAWA 3VIGA 4UFJA 4E2BA 2HTMA 5I00A 1QI4A 1XW8A 4DZHA 3CGTA 3IJ8A 2OQHA 2SFPA 3DFYA 4D8ZA 3GG8A 3RO6A 3L12A 4BEUA 1TO3A 4YYFA 2BX7A 3UR7A 2DDXA 3R58A 2PDGA 1K9FA 4XZ9A 1KM1A 1VPQA 3GO2A 2QIWA 1Q6EA 2GDVA 1E5NA 3MI3A 4TU1A 1R3VA 3IJ7A 2V2HA 3QC3A 1BSLA 3GRIA 4MOZA 1J79A 2UY2A 3ARVA 5FOOA 1NQKA 1KA9F 4FXSA 2W62A 3WF3A 3BANA 3DN5A 2J78A 2O0TA 3TA9A 1L6WA 1U1UA 3L5AA 4JYEA 1H5YA 1NOUA 2PRHA 3C6CA 3TXZA 3A3HA 1VFUA 1ADDA 3NR0A 3BWWA 3PTDA 4IIEA 3NJ3A 1E1FA 4H9ZA 5D37A 4GIEA 1V79A 2FHFA 4ACZA 1A5LC 3D5HA 4DJDC 4CN1A 2AGTA 1RXOB 3RXZA 3C2RA 3M5XA 2CLLA 2A2IA 1JGIA 2A6NA 3QFWA 1YQ2A 3AALA 4TXEA 3TQPA 2RKXA 1J0ZA 4KFPA 4IQLA 1XLGA 4Z2HA 4M19A 1PBGA 2W9MA 1PUDA 1W9PA 1N8IA 2X42A 2VOMA 4IGNA 3ISIX 4DBEA 5D33A 1DIKA 2XH2A 1PAMA 3H55A 1NWSA 3SCSA 3UP8A 1J01A 1QPNA 4IOTA 1H1ZA 5BOFA 5LGZA 3LZ5A 5I24A 4MWAD 1W56A 3B8VA 2IKIA 1J11A 1XLEA 1AG1O 3EX4A 4W89A 1GZGA 3AJXA 1F5ZA 3MDWA 4ERIA 3M5YA 3WJXA 4AC1X 4Q7BA 1F8MA 1S38A 2VX7A 3H54A 4RV3A 1XF0A 1Q6LA 1B3WA 3SQLA 2DZSA 2J9XA 3WELA 3M07A 2CCRA 1TWZA 4LGXA 3GNRA 2PDCA 1W17A 3RN6A 3PPFA 1CLKA 5E5CA 3W27A 5BYWA 3FX4A 3IIVA 1HVQA 4RR4A 3TJLA 4LEFA 3W53A 5I02A 3N9RA 3G1VA 3VM7A 1Y7VA 1IXOA 1K7XA 4BI6A 1UP3A 4U5KA 3AYVA 3OZMA 3U7VA 1AH4A 1KFBA 4WSJA 4PTDA 3CL6A 1LCOA 1RBAA 4N9DA 4I5XA 1QW7A 1OFDA 1F9CA 4N6FA 3WEZA 3IPWA 4YTTA 2IPJA 3MV11 3UCQA 5A6KA 4AY7A 3WY1A 3M0MA 2EJ1A 1TSIA 2VTFA 3H2NA 3ZLFA 5H6HA 2ZOXA 1E0WA 4JDBA 1RD5A 5CPMA 1W9VA 4R53A 2Z28A 3V0UA 3GFXA 1YPFA 2GK1A 4JTCA 3UGVA 3QLLA 4HOXA 3B9EA 1QOQA 1UR4A 3SDOA 3KCLA 3AIBA 3WMBA 4DBWA 2NUYA 3T9PA 4PULA 2E7FA 5I3IA 5A2BA 1GEQA 1J5SA 3UERA 1GQKA 3W6MA 1R6WA 1V93A 2VNCA 5E93A 4RL3A 1TQXA 3NSXA 1KRBC 1Q65A 3R0DA 3U2ZA 5F2GA 3GR8A 3BAXA 2PWGA 3APGA 5CGTA 5ABEA 1IEXA 1OYBA 1YLVA 2WV8A 1KWGA 1XIEA 1SJBA 4EOUA 2OWWA 1JGMA 4OBRA 4R27A 3KHDA 1FXPA 1DP0A 3T6CA 3W22A 1MFUA 3W2JA 3HFTA 5FCZA 1U83A 5K9CA 4GPNA 1SSGA 1W6TA 3MI2A 1KM4A 1I2OA 5D2XA 4AZGA 1ENUA 4QSHA 4YN5A 5G4WA 1M3UA 2ZXQA 2ZYFA 4UCFA 3VABA 4M0XA 1FHVA 1G94A 2QV5A 4D6IA 1ZNNA 3DOPA 2PDIA 1AVAA 5C7HA 1PE1A 4HP5A 1X8CA 3IRSA 3UWEA 1J6OA 3KZPA 1RBLA 1G4SA 3LHWA 4XAPA 1ISYA 1UD5A 3TU9A 5KZEA 1JCJA 3FYPA 4O1DA 2QJGA 4LY8A 3Q45A 2X0SA 2GL5A 3PHAA 2HXTA 3TROA 4RZ6A 3W1NA 4J2PA 4M6PA 4O8AA 3VX0A 1MNSA 2TAAA 2R82A 2OEKA 2BOFX 3R25A 1C7SA 2WZIA 3GFZA 3W26A 3VX1A 1UB3A 3H12A 1FHDA 4ZQCA 3VA8A 1K03A 1W3IA 1KQZA 1OADA 3HQOA 3EEZA 3WLOA 3FV9A 1WDDA 1OCJA 3WKZA 1UJQA 2F6UA 3AUJA 2PCEA 2WPGA 1MEWA 4LYQA 1VB9A 4PA8A 3ZOAA 4H1ZA 3PBGA 4YIWA 4UR9A 5EL1A 1V0NA 3B4UA 3NEVA 3F2CA 4O54A 3D6NA 2PZ0A 1S5MA 1D8CA 1WX0A 3MUIA 1JYXA 3BSMA 5C0QA 1M65A 4JNYA 1T99A 1W5NA 3KBVA 4H2CA 3BLKA 2TSYA 5XINA 2O7SA 1JZ3A 4B2DA 3VOFA 4DJFD 4TTGA 2DUZA 1UIPA 1ZJBA 4ZB5A 2R24A 2AOSA 3G1RA 4BQ4A 2YBVA 2WMFA 1YEYA 3WLRA 5CPNA 5C54A 1EYEA 2MANA 4ICCX 1FHLA 2EAWA 3W7PA 3GW0A 1GJPA 3NL3A 3MT1A 3F2DA 3EDJA 3CK5A 4UCGA 4XBSA 3UPMA 3NDYA 4RV8A 3QLDA 1XDMA 2OU4A 1A0CA 3W76A 3TH6A 2PLKA 1L8PA 1UWRA 3HPAA 4NKCA 3PUEA 2HZGA 4KBXA 4BJHA 1CGTA 1QASA 3LNPA 3GHRA 3N4EA 1QWKA 2E6DA 2QW5A 2ZE0A 2Q02A 4O10A 3L0KA 1CXKA 1YHTA 3SO7A 1V02A 4XUYA 1TVNA 3SB0A 1DJIA 3AROA 3EOLA 5BCAA 2ZUSA 2UV8G 4LS2A 2Z2AA 3FNDA 4LVAA 3WLSA 2Y70A 2A5HA 3L2MA 3SGZA 4GZJA 1CXHA 2ZFAA 1YDOA 4PYSA 1LOLA 3VFLA 3WH8A 4UQDA 2Z1VA 4MY8A 1TPB1 2YR1A 5HNRA 3UBPC 4FXJA 3R8RA 4TVCA 2POZA 3M5VA 3MP4A 4K68A 4RLIA 2PU1A 5G1TA 5HDRA 3EPNA 3NL6A 2GUBA 1REQB 3TSMA 1MO0A 3NQ2A 1VP5A 3T4CA 1UR8A 4GCXA 1Z7AA 2EGZA 1G0CA 3IAPA 1SQ7A 2P8CA 1VJSA 4JNZA 3VVGA 4PMUA 5CPOA 3W4RA 3WK0A 3QOMA 2XJ7A 1HG3A 1UR1A 3FKRA 1JZ5A 2O9TA 3FDKA 1RK6A 1F7BA 2VR2A 4UIOA 4XUGA 4FNRA 4IL0A 4L6HA 3EWYA 2C3ZA 2YYTA 2OYMA 4A2RA 1VRXA 4LRTA 1JCTA 2BVTA 4CEUC 1N82A 2XWDA 1TWIA 1S46A 4IZGA 1JYVA 1VFTA 4KS0A 3WNPA 2J79A 2QVHA 3VIHA 3HMJG 4O11A 4MWAB 3AZTA 6REQA 3IJIA 2A7NA 1YRRA 1OK4A 1SJAA 4LOCA 3PJXA 3TMQA 1QU4A 2HNHA 3MHUA 4DLMA 1TIMA 4NT0A 2AL2B 5KEZA 5CZJA 3Q2DA 4R34A 1K8ZA 1O60A 2VUYA 1JPHA 1J93A 1D9EA 1C8VA 6ENLA 4JTIA 2X1IA 2NX1A 3CHEA 4CN6A 4MPKA 3UJRA 3BLIA 3VILA 3BOXA 2UWFA 3V0SA 5LIWX 5HULA 2NV1A 2QDEA 5BRQA 4E0CA 5MHBA 3V5FA 2FVMA 2W91A 1YYAA 2VMFA 4HHHA 4EPBC 1ISZA 1EJVC 4UBPC 1UPMB 4KCWA 4P7QA 3IAQA 2YKKA 2RFGA 4REQA 3HQPA 4O28A 2A85A 3OQEA 2FPVA 3IGUA 4Q8OA 3JRKA 3K30A 1XLBA 3BZJA 4I6KA 3M16A 5A8OA 3SSJA 3FW6A 2WZHA 4XZBA 1XC6A 4PBFA 2F8QA 1XYBA 3CYVA 1OY0A 3NZQA 3VD5A 3TXVA 1PZ1A 3VD3A 2I57A 4LCRA 1QPQA 5EYWA 1PSCA 4GBUA 2XVLA 2WSRA 1KBKA 1JUKA 1XPGA 5A8NA 1E56A 1DXIA 3L2LA 2VEPA 3A5FA 4F0KA 4MWAC 4IP4A 1RVKA 3SCPA 1WXYA 1W1A1 1RZMA 4H83A 1QATA 5HMFA 5G1MA 3V18A 1JCLA 3M0LA 4Q8MA 3UETA 3V5OA 3WMCA 3EWDA 3ZJKA 1WO2A 2BB0A 3KOYA 2ZX8A 3DENA 3URNA 1E4MM 2PP1A 4UFIA 3MC5A 3N25A 4GQGA 4JICA 4GJIA 1FWIC 6A3HA 4E8DA 3SRHA 3K4DA 4Q8WA 3RRAA 2J74A 4KERA 3EMZA 3BDKA 4LS1A 5AVNA 3CUJA 1Q63A 3BW3A 3NVDA 4FHAA 3HN3A 1FWHC 1UKTA 5E6ZA 5MKGB 4Z0JA 3L2IA 1L8NA 3ZO9A 4DNHA 1FVPA 1QK0A 3W0KA 3WYZA 1GNXA 3G1HA 3QFEA 2E09A 5ABFA 3TYAA 3ZLHA 3KBMA 2QHAA 2VJXA 1GPWA 2OLSA 3N4AA 3PG9A 1Z89A 5LSMA 1XL9A 3HO8A 4BWLC 3AOFA 5JBFA 4DXVA 1PTDA 1HKJA 1QPOA 3KBWA 4RNFA 4MF4A 3W6YA 5E0KA 2PTZA 1JI2A 3UZJA 5AYXA 4UFLA 3UCCA 1E6RA 1M53A 3QPZA 1XH2A 2FHCA 3GG7A 7ENLA 5AB3A 2VENA 2JIWA 2ASHA 1FWFC 2ZRZA 4FO4A 3T1GA 2W66A 1POKA 1X7FA 3F03K 1H1YA 1HO1A 4UTIA 4GD0A 4C5ZA 4UMCA 1A5NC 4PTWA 4K37A 3RM9A 3CXOA 2HDJA 3DAQA 3H4GA 1BXCA 4Y6GA 3HG2A 1L6YA 3ERPA 2RAGA 2L5HA 2WCAA 4M8UA 4NQ1A 3W7DA 4JDYA 4D6EA 5F1UA 4XAGA 3VOIA 4WF7A 1O5XA 3QZ6A 1K1DA 2D2OA 4L1XA 5AZ1A 4NZ1A 3MMTA 2WZTA 4D1IA 1CCWB 2REQB 2ZXBA 4JQ4A 2WSPA 1S1PA 3RF9A 3UG5A 1ZRQA 3DBNA 3R0UA 2YGYA 1ZCOA 1Q2SA 1I75A 3VNMA 3GIQA 6PTDA 2HBVA 1AQMA 1E0UA 3GR4A 1FH7A 3UWZA 1RSCA 2P5NA 4JTQA 3DYOA 1OGSA 2ESCA 3NZPA 3EOSA 1K77A 5KSWA 6CGTA 2OPJA 4W5UA 4L1WA 4W4QA 3W7IA 3ZR4A 3S2LA 1B30A 1RH9A 4XZHA 4YVVA 5AC6A 1E43A 2W4XA 8CGTA 3ARXA 1CLVA 2FYMA 1TELA 3STGA 3W72A 4GY1A 1I6NA 3LGGA 4MWAA 2FKPA 3UXKA 3PJUA 2VVSA 4L64A 1E4NA 1S5TA 1GOMA 3EDEA 1GVRA 1EGZA 1VQTA 2F84A 5EMJA 1DJGA 2ZX7A 3P5YA 2HVOA 2VZOA 4ZMGA 4GISA 1XG4A 1G5AA 1LG1A 1KFLA 4Q4KA 3SUWA 2DH2A 1Y5XA 1OFRA 4HGXA 4H6RA 4XAYA 2RHGA 3PZVA 4ZOBA 5E1QA 2ALRA 2GGGA 3UWYA 4JIHA 4Q4MA 4NJHA 1VBUA 1UPPA 2VZVA 3QTGA 1F3EA 2WAGA 3GXFA 1KFJA 2EPMX 4J40A 2BXVA 3LXCA 4OWGA 4LF1A 3E0WA 1OGGA 3TFCA 3AMKA 3AWOA 3SECA 3F4WA 3QM3A 4H4IA 4K1WA 4DJFC 1XKYA 1TE1A 1OYAA 3A4WA 4ERAA 4S3AA 3GTXA 4UOZA 4PBEA 4HHMA 5BRBA 1Z3NA 6TIMA 3OIHA 4WHBA 4NYYA 4FZIA 1JF5A 4LANA 5CBIA 1VF8A 1UZHA 2QJMA 2VYOA 4BWLA 3B9AA 5K7JA 3WMSA 3W7LA 1ONXA 2G3IA 3WQEA 1W3NA 3WQ8A 2XIQA 3ITYA 3U57A 1SZGA 2V0TA 4G9PA 4PMDA 4N4PA 2A3HA 2LLEA 3MWAA 2J9ZA 3O6YX 3WJSA 3MJYA 1GG1A 3UA3A 4W7WA 4M82A 2UBPC 3QHMA 1D7FA 2RUSA 3SEPA 1R9ZA 4D9PA 2GLKA 4LVBA 2VGFA 1KGUA 2GSHA 3GE7A 3BE7A 1EJTC 1M6JA 1F6KA 3PZIA 2ZUVA 3C2YA 1LLOA 2BGNE 1O66A 3P8JA 2A0NA 4GUIA 4I6VA 3QQ1A 4C6FA 3E74A 1RQEA 3OGSA 3IUHA 3KVJA 2Z2BA 3LBCA 4AHOA 5EBAA 4FIRA 5FKYA 4RJEA 4O4WA 1VBRA 4AIEA 4ERGA 5MKGA 4MB5A 5GJMA 4AC7C 2ATMA 4C90A 4X2PA 4RXGA 1SO4A 2X30A 1CGWA 4MKSA 5J5RA 1P6CA 1WV2A 2HE8A 2CZDA 3P80A 1LBFA 3TIMA 2V5LA 3B9NA 2DQXA 2PB1A 4N42A 4M29A 4JX4A 1MQRA 3TW9A 4F0MA 2H90A 2OGYA 3KCOA 4QJ4B 5I23A 3OPSA 1V3KA 3BAYA 1M01A 3TQVA 4XISA 1YE6A 3VCNA 1FQ0A 4I7UA 4JFWA 4PTNA 1WDWA 2WKLA 1LLWA 1VH7A 2GQ8A 2YW4A 4CVWA 1KFKA 2V3DA 1EDTA 2VZSA 2BG5A 2ON3A 3I65A 1EO7A 2H8XA 3VUPA 1KXHA 1TUXA 3W01A 3RHGA 3W2NA 3LEPA 4C6OA 1XBVA 2GOUA 4DB7A 2ZCGA 4DBDA 3U6WA 4XSMA 5A3HA 3EWWA 1E6ZA 1FWNA 5D05A 1HJWA 1H51A 5CKSA 1P1XA 3R79A 4C7FA 2C18A 3N04A 2PZNA 1ONRA 3VGGA 4KCUA 1EEXA 4CN4A 2F2HA 1UMLA 1IQ8A 2DPEA 1V6WA 3RIKA 1OK6A 5HQMA 4M51A 1CIUA 4KMQA 1OWQA 3THAA 3G0UA 1JVNA 4DJFA 3T81A 1TX2A 3B8IA 4CGTA 2BXZA 4BEQA 3WEOA 1EJSC 1GWJA 3DI1A 5FL0A 3QMRA 2EG6A 5M5DA 2XN1A 6XIAA 3MYPA 2X16A 2YSWA 1LUCA 1K3UA 2YL8A 3S5NA 2W92A 2D3NA 2PTDA 2RGLA 5CH9A 1UOKA 4AWUA 3CUGA 2FJUB 2Z1BA 1Q6DA 4LC6A 3B0VC 4AAJA 1IT7A 2X1SA 4H04A 2VR4A 5MF5A 2WXDM 1FCQA 3L4UA 5CXPA 2PWHA 4CNUA 4LYPA 1H0IA 4J3ZA 1S2VA 4MDPA 2XG9A 1W8SA 4US5D 3W28A 1UQYA 3O63A 3GVGA 2GVYA 5KMYA 1XINA 3P7YA 2G8ZA 2OB3A 3CT7A 4Y2WA 5FEWA 5T8GA 4TUFA 5C8BB 1DHKA 1Z44A 3WLHA 4HSHA 4Q8NA 2B31A 1KXTA 3GXTA 3LCXA 4L4PA 4FOKA 1SR0A 4JN6A 5JUVA 1C9WA 4YHGA 4F0HA 1E1EA 4NXKA 4TTUA 1WKFA 3LQLA 1V3MA 4O0KA 3N1AA 3GG1A 1FH9A 3P81A 4GI4A 3BJTA 5KZDA 2CHNA 5A6TC 4GXMA 1V6XA 1XIJA 2JKEA 3LCHA 3CL7A 4MVAA 4PCSA 4CD4A 3FXYA 1QAPA 1X1NA 1KTNA 1FTXA 2DORA 2E1DA 1LG2A 1BD0A 3RFAA 2PC4A 1AA1B 3C56A 3TAOA 3UA4A 3AAMA 3V4BA 1KGXA 3SURA 2PDYA 4JCMA 4LALA 4DJED 3PWIA 2FQIA 3RX4A 5I07A 3ABQA 4PODA 1BQGA 2EQDA 2EPHA 3CPUA 4Z1BA 1R2SA 3W9ZA 4BA0A 3LBOA 3CMGA 2Y1HA 1UD3A 4HCHA 4B9YA 3S42A 3UJ2A 3AC0A 2YDQA 1XLFA 4KEVA 1NF7A 3QOKA 4XZLX 4Q8VA 5E9XA 4FNUA 4TVDA 3QMSA 3UR2A 2ZUUA 4GQQA 2XH7A 4HZ7A 3PUOA 3KXQA 3T7VA 1XFCA 1QHOA 4LCSA 1PCKA 5E0CA 4XVEA 2A3LA 3FJLA 3LMZA 4Z42C 1JQXA 1XIMA 1VYPX 1ZLPA 3WZ0E 3MY9A 4O12A 1W91A 1NWRA 4P7NA 1OD0A 1ICPA 3IJLA 1E0XA 3DZ1A 3BURA 4R9XA 1DWFM 1DV7A 2PD5A 4GUFA 1PYFA 1E51A 2VP8A 3QQ0A 3C8NA 1RCXB 3RU6A 3L7RA 1SSDA 4I7VA 4JNMA 3LHYA 1PHWA 1YTDA 1VBHA 1J0HA 3K13A 4HU0A 4PMNA 3A13A 1RA0A 5DBUA 3J7HA 3M5ZA 1GTEA 1OVDA 3CZLA 5A2AA 1W5MA 5DMLA 3ARWA 1JEZA 3NZ1A 3GBEA 1XH0A 1LQ2A 1ISVA 3R2GA 2NQJA 3GUWA 2ZWZA 4Q4OA 3HJEA 3EYPA 3T4WA 4NASA 1VFSA 1C9DA 1MW2A 1WAWA 1EXBA 3LCIA 4NNBA 3UZ5A 3GXMA 2WANA 3DGBA 1VYSX 3TN6A 1X39A 2D20A 3FA4A 1WXJA 1TPDA 2V30A 1SZFA 2WJFA 3QV9A 3PULA 5F1VA 4K8GA 4U28A 1C8XA 1VENA 1GONA 3LNMA 4KEUA 4IQJA 3MP5A 4QQ3A 3VUSA 4IGSA 3AXKA 1W2VA 3HQNA 5CPLA 4GXWA 2CLOA 1TWSA 4XX6A 4OHQA 4FLRA 4PCPA 3BK0A 4NIRA 5C5YA 3T8LA 5K2ZA 3O9NA 1ME9A 1TTPA 4EE9A 4LUIA 2C14A 1OT2A 4KEMA 3DHPA 4AY1A 1GEHA 2WBKA 4Z2LA 3THCA 4DPPA 3AMGA 4H7CA 4YTRA 4MG4A 3EB3A 4NL1A 4HOZA 1KW1A 4HNTA 3CQIA 3WQOA 4GQBA 1Q66A 4J3TA 1OEPA 5FF3A 4KT2A 2YCKX 4O1EA 5HMDA 3MMWA 3DXIA 2DSZA 4YMZA 4IMFA 3SN1A 2WQDA 4ORIA 2PDMA 5AHEA 1W9UA 2CITA 5DBTA 3S5ZA 5FF7A 1W5OA 3PUDA 4DO4A 4UZUA 3W2UA 2AQOA 3DIPA 2BOEX 5LA2A 3W71A 2YZ5A 3HOJA 4C1KA 1SMDA 2WWDA 5DCBA 2V67A 3S1GA 3VK5A 3KS6A 2ZTKA 2DSWA 3DFTA 3GNDA 1C92A 4PCNA 1KV5A 2BY1A 3EAUA 5BW6A 3GVWA 1WPCA 2G4JA 5A94A 2NVDA 1ISWA 3LN3A 2NLYA 2PEVA 1E6XM 3HF3A 4MTVA 1Q6QA 1EQCA 5CJ5A 4HNOA 4GZ7A 3W23A 4DY1A 4EVZA 4LV9A 4E3VA 3U3HA 3FA3A 1NIUA 2ISVA 4GNKB 3T0AA 3KZSA 2F9RA 3QXBA 1MMFA 3ZSSA 1E3XA 4L1GA 5JVLA 1DXFA 1NOWA 3NL2A 1MRQA 2D0HA 3TDFA 5HK4A 3DHUA 1PDYA 4XVDA 5L9FA 4F0LA 4WGXA 1TVPA 4YVPA 1ZAIA 3AJ7A 4PMZA 2FDMA 5HMEA 3CZGA 3RR4A 1QI3A 4QG6A 4GGBA 3W7OA 1ZFJA 4IPIA 3DDMA 2G37A 2E9LA 1JPDX 4KKXA 3QV8A 4QX4A 3GHTA 1E1CA 5D32A 5IHSA 3NPUA 2VDHA 1EA0A 5AC7A 2O9PA 2OOGA 1E9ZB 4ZXOA 1TV5A 4LEQA 4IPJA 2POTA 1J10A 1TRIA 4JN8A 4QCEA 5M17A 3QJAA 1DORA 3SY1A 4GCAA 3GC2A 1XYCA 4RZ4A 1P0DA 2C79A 3BUVA 2XVGA 3FSUA 4D6FA 2P0IA 2WMIB 2DV0A 1K70A 4EIVA 1YADA 2D22A 3N14A 3UY7A 1OIFA 4FX7A 4IIGA 2J9YA 3ID7A 5KITA 1F4HA 4LT9A 4ZSUA 1EP3A 4DZAA 2Q6ZA 4ZO7A 3AIEA 3T55A 2YYUA 4WD0A 2Y8VA 3IV8A 4GIAA 1DWHM 1K7EA 4ROPA 2JF7A 2XH0A 1SW3A 2GWGA 3ICJA 2QNEA 3H2MA 2D3LA 2R1KA 1G4EA 3U48A 2AGKA 3TYEA 5HNUA 4WY0B 3RK8A 1A5BA 4ROQA 3ZT7A 4A6GA 4O14A 4N9EA 2Y88A 2FH8A 3NYDA 2VC9A 3N9KA 1C29A 4PMXA 2E25A 3EOOA 3WX7A 1H7PA 2INEA 3WQ4A 1RQHA 4AD2A 3PSWA 2A4AA 1YW1A 5LNSA 4P5UA 4DYEA 3VDHA 2CPUA 3G1DA 5DANA 3HPSA 4XTDA 4L65A 3ZLGA 1LRNA 1EBHA 1VLIA 5LKYA 3KRBA 3H2FA 2QV4A 2JGYA 4MDOA 1GOQA 1ZTVA 1OABA 4I5RA 2VOTA 3PR2A 2WLZA 2X8RA 3AHVA 4IX0A 1A3XA 3TLQA 3W00A 3W7QA 4U4MA 1MW0A 2O9OA 3GH5A 1SFJA 3S9ZA 1ZBCA 1GVSA 2XSXA 3R43A 4PUKA 3ZJ8A 3CAVA 2HQAA 3MCNA 3AMDA 3V35A 5TD4A 3NO1A 4K39A 1QK2A 3AHXA 5U4NA 1JQVA 3TAKA 4FAMA 4OUEA 3VKCA 3GUGA 1IT0A 3MJMA 1V4YA 1UP2A 4BS0A 4A3QA 4QAIA 3F4CA 4EWND 2AAAA 4JYFA 2E9MA 5I0DA 2KAUC 4J1OA 4L7ZA 1ICSA 4DYKA 2ZZ2A 1PIIA 4PUUA 2ZZ6A 3WUFA 2PTWA 4ES4A 4QJ3B 3JR2A 1EEPA 3O07A 4LVDA 3LY0A 2WYSA 1E4IA 1H60A 4GABA 5TAOA 2WPBA 5A8MA 3MVTA 3W1UA 1GOWA 4P8XA 3E5PA 1AK5A 1K6AA 4S3CA 4MZ8A 4IGHA 3ZT6A 4QJ5B 1Z6KA 3HG3A 5IRPA 3NPVA 4C7GA 2EG8A 3I3BA 3SJ3A 2E6AA 2GZXA 4ATWA 2F2KA 3MSGA 3N19B 4LFYA 2G50A 4YWSA 4DIAA 1R9YA 5I03A 1Q6CA 4DJEC 1TV3A 3AWNA 4IFKB 5C9ZA 5A2CA 3TLLA 4L6OA 3GC4A 2ZVRA 1H7XA 4CNTA 3KRSA 4ML4A 1CGUA 4LYKA 1IZJA 4OBSA 1KM6A 3HJZA 2ZC1A 4YU1A 3OLIA 3OYXA 3B0UX 3T2OA 4ZOAA 4H6EA 2D2JA 1XP3A 1XS2A 1UQZA 3GB6A 2ZRWA 3UNTA 2GVEA 2V5CA 2DZBA 4ML9A 3OZYA 2J47A 2QLYA 2PRMA 2VRKA 2OO0A 3VGFA 3ZWSA 3ITVA 1W32A 1H2JA 4NX5A 4ACYA 4H41A 3RG6A 2YA2A 2NX9A 2VT0A 3FYYA 1KFEA 5AKQA 1A3HA 3KFTA 1SFSA 4H7VA 2NVAA 5B7ZA 2PGWA 2V5BA 4YYCA 3PZ9A 2FZMA 3IJ6A 3EX2A 2ZZ1A 1BYBA 1EFZA 4JPGA 3TC3A 4LNCA 3HZ3A 4KRUA 3PBWA 3BJSA 1H3GA 2EHHA 3EBVA 3I6TA 1LRTA 2J6XA 1QO5A 4MB3A 1O1HA 3ME3A 4GUGA 3VDAA 4TX6A 1OX6A 4E6MA 2CBIA 2R1NA 3CM4A 1M7OA 1QJWA 4F2BA 1QNSA 1ZS2A 3EPMA 4RCXA 4QP0A 3QEZA 1W3HA 2DEPA 4H00A 5T9CE 3M43A 1QR7A 1KXQA 3PUGA 1NF0A 4PB3A 4MAZA 5GVJA 1YIXA 4IIHA 3BJFA 4KRTA 1SVDA 1UR9A 1FCUA 1VEPA 4EACA 2Q3OA 1KXVA 1ICQA 3EOUA 4MNJA 2OQYA 1QI2A 4CCDA 4US5A 4Z2GA 2NXIA 1OJXA 1VPYA 1I9CB 4DYJA 4IPLA 4AEOA 2GOKA 1B9ZA 3RX2A 1RP9A 4IL2A 5HUOA 3A5VA 3L65A 1F6PA 3DYMA 2VGIA 3RJXA 4QXIA 1QFEA 1UUOA 1DIOA 4OBTA 1XDLA 4L4LA 3W2MA 1Z32X 2GQ9A 4CD8A 4A3HA 3LS9A 1KRCC 4MM1A 5RUBA 4WY0A 5B7YA 1E55A 1BFNA 2XU2A 2V68A 2HISA 3O3RA 4IPPA 1ADSA 4GINA 4LW7A 4UUIA 3H24A 3CU2A 4OUIA 3DH7A 3ITCA 4DPQA 5BU6A 2E0PA 1ZL1A 4PUWA 1QCWA 3PVFA 1GVFA 3YPIA 4E2OA 1BQCA 4JQ3A 5H1WA 3UWVA 1WXZA 2YCJA 2OWXA 4LBUA 5K4ZA 1IHIA 1Y5VA 4DJEA 2WM0A 3XIMA 5DF0A 1HL9A 2ZVIA 1KCKA 3SM0A 1GJWA 2QYGA 1GTHA 3CV7A 4RXFA 3FYOA 3MSDA 1YE4A 2Z00A 1SGJA 1VHNA 3MWCA 1NP0A 2XWEA 4ATDA 4ZZ9A 4W7UA 2CKSA 3WLNA 1A5OC 2WMHA 1HJXA 4QROA 1O1ZA 3VXGA 4DWSB 3PTMA 3V75A 3G0SA 3GIPA 2B7PA 4Z08A 3WCZA 4XSLA 3KBJA 2OYKA 4LAKA 1UH2A 1TREA 4JY8A 1E6PA 3MQTA 4WKHA 4A2SA 5GJNA 4NZCA 2G3FA 2DT2A 4HSOA 4O50A 4XKMA 1CECA 4AEEA 4C6NA 3TSDA 1ZQ5A 2XINA 5D8ZA 1C7TA 1QHPA 1V6YA 6TAAA 2HWGA 5LNWA 4R9OA 2O56A 1GG0A 1NSJA 4GHRA 1EHAA 1HGWA 4RE2A 4MGGA 3OP2A 1U5JA 2XH4A 1QOXA 1NU5A 4BF7A 2GPTA 7TAAA 1JUBA 5U7SA 4BFAA 1HJUA 3NOYA 4MMWA 2VFHA 1AW2A 3H7UA 1MQQA 5AECA 2C7FA 3TNBA 4ZFCA 5G2HA 3WBAA 1FCVA 4NNCA 2D0GA 3TC6A 1R7AA 1Y65A 4MADA 4B91A 2QCDB 1OYCA 1ZHAA 3OBAA 4GX9A 4DF0A 2G41A 4PCFA 1Q45A 5A6AA 4YPJA 5G1YA 1XBYA 2X05A 3BICA 1Z69A 5J5DA 1WZAA 5CLTA 2CLKA 1P7TA 3H2CA 3IRDA 2QULA 3SQSA 4UWMA 4WVXA 3G18A 4XKYB 1Q85A 3H2AA 4IF2A 3VOGA 4Q7NA 3BVJA 3UVAA 1XJBA 2XFRA 1OX4B 1B31A 3FJNA 4DN1A 2VRQA 1C8QA 2AQVA 4C65A 2V69A 1ONWA 3QY8A 4UQ9A 1M7XA 5IM51 4OKDA 1PTAA 1TIWA 1U1JA 3T0TA 1YNPA 3BO9A 3NVTA 4UNIA 1JAKA 1ZY9A 3BXWA 3APYA 1US2A 3QYSA 3SR7A 4AWEA 3A47A 1SZRA 3B8UA 5FACA 2DIKA 4DVOA 1MSSA 1J0JA 4ASTA 4GOAA 5E70A 4NUWA 4M1BA 1QNPA 4QS6A 4HD5A 4ZOEA 3S4TA 2WHKA 3S2CA 5EPDA 1TWWA 1OHLA 4ORMA 4PCTA 4ALDA 1RPXA 4Y9MA 4AIOA 2ZA3A 4GWEA 4ZGYA 4QS5A 1W37A 5C2XA 4CCCA 2NWSA 1UG6A 3S83A 1MXDA 1VS1A 2R1PA 3N18A 4J4KA 4XO6A 1GQJA 3CUXA 3W7RA 5FF4A 2GFTA 3W7CA 3RMEA 3GU1A 3AS1A 3H22A 3P74A 4AISA 1AZ1A 2OX4A 3EGJA 3OG3A 5HNTA 3T40A 4UFHA 3EDDA 1P0NA 4MB4A 5BMXA 3QKZA 4YVXA 3VOHA 3KVLA 4IP7A 5T9BG 3RGTA 3TZFA 4WEVX 4P2VA 2I5QA 3URQA 3TYBA 2J8GA 4GZIA 2YIHA 4CNPA 4Y96A 3OVGA 4X61A 3ARTA 3LU2A 1R3YA 5JIWA 2H9AA 4HA1A 3LPFA 4ILSA 5D8WA 4AZ7A 4UMAA 1PS9A 1PVNA 3E49A 3HB9A 3A6OA 3V1PA 2YLLA 1Z41A 4JKLA 3KW3A 4F4RA 4IICA 3PP7A 1BWLA 1B57A 3CJPA 4RDYA 2VVNA 1JPKA 3QRHA 1VCFA 1EX5A 4GE8A 3GLCA 3PB2A 3ITOA 4JAWA 2VFFA 2XVNA 3FJ4A 3CAKA 1GORA 3I68A 4FALA 2R6OA 1NFBA 2TPSA 1XD1A 4AD4A 1IYXA 2Z7KA 4ZTXA 3AIWA 1H63A 4A8NA 3T08A 3H26A 4UTFA 4C91A 3AIQA 4QEHA 2P8BA 2W5FA 1CWYA 1HVXA 4JQAA 1XIGA 3SRFA 5D02A 1YNQA 4PC8A 2QZRA 3H4XA 3S3GA 1TA3A 5D9OA 2UY3A 2WKJA 3JUGA 2BOGX 1ME7A 3U8GA 1RPKA 3QSTA 1X1OA 1UR3M 1BHGA 1UKPA 2OZTA 1V7YA 3NO3A 5TIMA 1RCOB 2GGIA 3W83A 2QCFA 3CQ0A 2WLYA 3QGKC 4BQ2A 2WCGA 4XG1A 1YPIA 1W9XA 4HA4A 3TP4A 1UKQA 3EB4A 2ZX5A 3LV5A 1QPRA 4PH6A 1HIZA 3QTPA 3CZJA 1DIEA 1TMLA 4RNJA 2ZXAA 2CLIA 1UZDA 2Z4GA 1GVQA 5DT5A 4PSPA 4AYSA 1F3XA 3ONCA 1I2PA 3VD7A 3V1HA 3HGJA 3VMPA 2BY3A 3FEQA 2QUTA 1HP5A 3HQ1A 2WWCA 2NQ5A 3KOXA 4BF9A 4LYRA 4WXYA 3WF1A 4GVIA 4QNEA 3IK2A 1UWSA 1GVYA 1IF2A 6XIMA 2QCDA 4WZHA 1PYMA 3PAJA 2HS8A 4RPQA 1TZZA 2GGJA 2CLPA 1WDQA 1YBQA 4IWWA 1H7WA 4Q6XA 3KCJA 1B90A 3ZS4A 4AXNA 1JCNA 5CG7A 1DWJM 4IMAA 3F2BA 3NAVA 5HBFA 3N9SA 3LB0A 2DJLA 4ZB0A 3W88A 2Y7GA 4J9JA 4NZ4A 3KM8A 1RP8A 4X22A 4MJ2A 4GIRA 3FA5A 4J3UA 4S23A 2WJEA 1DTUA 3F7JA 4W85A 1IGSA 1PXGA 1NOFA 2IKJA 2J75A 1S3HA 2VC6A 1DXEA 3SQMA 1V51A 1CW2A 1E9LA 4EKJA 3GDBA 4Y8FA 3WD2A 1WZKA 2DZTA 3FLUA 4YWIA 2WHLA 3D3FA 1IXPA 4K8EA 5F4SA 1TPC1 3CBWA 4HU3A 3RJYA 1JYNA 2J4GA 3L21A 4ZE5A 4NZFA 3HGOA 5LIYX 4QRNA 1MDLA 1QW8A 3E0IA 3TSBA 1W3JA 2IQ0A 2FZNA 4PUJA 2YDRA 1EC7A 2UZ9A 3VC6A 4BK9A 4IX2A 5FJPA 5JXQA 3TWAA 2BFGA 3NXLA 3XINA 3ZJ7A 3JW7A 2YXOA 1WBHA 3CMFA 4I8YA 3Q67A 2IUZA 2ZE3A 2C91A 1OIMA 3NPWA 4HNLA 4AVOA 1FUYA 3AHZA 4MJMA 5HATA 3WNOA 2PWUA 3UU0A 3NWRA 5DEZA 3IACA 4Q4PA 3TMLA 2G5WA 4M7SA 3MS8A 3GXPA 4MZYA 3C0JA 3K2GA 3R5EA 3FEMA 1VHCA 4PMYA 4G7EB 2CBVA 4LVFA 2EEXA 1XRSA 5CLWA 5D9PA 1ZJAA 5CZSA 1DOSA 1PEZA 4H9TA 1WZMA 3B3DA 3L68A 2HE5A 4HCDA 1C93A 3IARA 1PDZA 4CU7A 3I3DA 3HG5A 4PFHA 4G7FA 3AMCA 3NZGA 4JTUA 1WOBA 3CUFA 1WKDA 1JDCA 1H61A 3PTQA 3KOFA 3ARPA 2JBMA 2XTKA 1C90A 1PJ9A 4ECLA 2R1LA 1WUEA 3WF2A 1PHQA 1XISA 4JS3A 1G4TA 4PUDA 1PTGA 2J25A 3QH2A 4K38A 3S6DA 3WK1A 4C6EA 4O1BA 4FF5A 1FWRA 4I8DA 1T40A 1ALDA 2PD9A 3W7GA 1DE6A 1HKWA 2VQTA 1XRFA 2BGSA 3LGDA 2VRJA 1SUXA 4AH7A 4AIUA 5AYIA 1D2KA 3K5XA 3HIJA 2CLHA 4LV4A 2JALA 3GTIA 2G95A 1U22A 3ZWTA 4OU1A 5LXEA 4BI5A 1XGDA 3IJQA 4HOWA 1RQBA 4U3AA 1MVYA 1DQXA 3GX9A 5EU9A 3VNLA 2FB3A 3B4YA 5JH1A 3MHGA 1EB3A 1X7IA 4HN4A 2A3AA 3OHIA 3R4IA 4C6DA 2DZXA 3TKFA 4UTJA 1TRDA 1LL7A 3R1ZA 4TMBA 4JIQA 2PWDA 3UF9A 3SGGA 3GW3A 4XV0A 4UTHA 3THDA 5REQB 3H2OA 2X1RA 2VEMA 3RPTA 1JNDA 2IKGA 3E0FA 2Q8LA 2IQTA 4D8LA 5DXYA 3OIXA 3E02A 4U31A 2NQLA 2QCMA 5J04A 3PZGA 3C2EA 4CD7A 2VM8A 3VNJA 3ABZA 4XZIA 3BGJA 3GNPA 1NAL1 2OZ0A 3P14A 3MKVA 5G4HC 2V6AA 3G1XA 2WVSA 3WQGA 3GYEA 4KF1A 3TTSA 3WUBA 4QG9A 3DBPA 3VINA 1TV7A 3ZR6A 1F6YA 1JYWA 1B5TA 2J8FA 2A3EA 4KESA 4WSKA 1QMLA 3CPGA 2VEIA 3AZRA 2UY4A 4DO5A 3IANA 3VD9A 2OLAA 3DU0A 4NHVA 1D8WA 2XGZA 1B3ZA 1OZMA 3VDCA 4NZ5A 2PWVA 2F38A 3A64A 3ABXA 1J5TA 3TR9A 2FMOA 3B06A 2FZBA 3IGSA 4UTLA 1Q6GA 5C9WA 5HMSA 3R6IA 1X8FA 3PJWA 4AF0B 1RALA 3NQCA 1EIXA 2A3CA 3NTYA 2PWEA 3GAKA 4LUSB 4Y7EA 4V27A 3QQWA 2R14A 3B0PA 3UG8A 4Z2JA 5H91A 1ZALA 1HO4A 1TTIA 2ZWYA 1YDNA 4JTFA 3VIMA 2VELA 3W7NA 1PPIA 4U10A 5GNYA 4PSRA 3WQPA 4E8GA 4RZ5A 1A5SA 3CV6A 4INFA 3ZVHB 4NZ3A 3GDTA 4K2SA 3LTPA 2DVTA 3SJNA 3UD6A 3UCDA 5LHEA 2BWGA 3MA8A 2QGYA 1ZP3A 4O17A 2AMGA 4UTTC 4D6CA 3E2SA 4LBSA 3WK3A 4AUBA 2Z1WA 2BY2A 4EAMA 1V0MA 3R7MA 3KEHA 3Q65A 2OEJA 2YB1A 2ISFA 3S47A 1CXLA 3TYDA 5I5RA 4EXBA 1RR2A 1HJVA 1W1YA 2CZEA 1XM3A 2D2HA 4QITA 2XUCA 4V28A 2JF6A 3CEPA 3D47A 1QBAA 5GPRA 2VDGA 2BODX 1GJUA 4PTMA 1SMAA 3L0GA 1QT1A 3CYJA 2FMNA 5FJTA 3PSVA 3CV2A 4ZTYA 1TJRA 5IXEA 3KWXA 4EP8C 5HR7A 3PK7A 2FHBA 3PF3A 4C6CA 3FXGA 1F2JA 3VYLA 7REQB 2FVLA 1VFOA 2GJXB 4OTKA 1W0MA 1E0TA 4AW7A 1A5KC 3WD3A 1B4EA 1O7AA 1T7LA 3WNLA 5AC8A 1OQFA 1E73M 4EXQA 4GH1A 4HA3A 1CGXA 2PFHA 2ZQ0A 1XDJA 5BROA 4XQ6A 1A5UA 2H8ZA 1XQKA 2X7VA 1VPXA 3UR5A 2NLIA 1IEWA 2ZICA 5FD0A 2IPGA 3WDRA 1UCWA 4GXPA 3ZM8A 3OOQA 2G0WA 2I7GA 8TIMA 3I7SA 3WH6A 3EZ4A 2BXYA 2P10A 3NM1A 4PRRA 4GO8A 3ITLA 4LRSA 2DW7A 3AO0A 1LBLA 3KS5A 4L56A 3TN4A 4Z1DA 3P93A 4L4OA 2ZUNA 3LRMA 1XYZA 3K8MA 3RITA 3U5UA 3AUOA 1O5KA 4UC5A 1LJYA 1B3YA 4DNMA 1IXNA 4XBKA 3H21A 3FFSA 3W73A 4RDVA 5CZ0A 3CV1A 4YXGA 2FIQA 4NF7A 1HUVA 1AQHA 1LORA 2QPUA 1XYFA 3MO4A 2QDDA 5F4WA 5FJUA 4FPSA 4AFYA 4FLQA 4XZMX 1ZU8A 2PSNA 4KCTA 5KZMA 1JPIA 1XX1A 1XCWA 5SWUA 4XIAA 5C9XA 4HNNA 3TJIA 1PWLA 3CHVA 4FXFA 3BLOA 4B15A 3N12A 2BASA 1EIBA 3WQVA 4P7LA 2HPIA 1FDYA 3THUA 4QE4A 1Q7QA 3E0VA 3S6OA 4U33A 4EPKA 2VDIA 3SGUA 4Z2IA 1G9HA 3S5YA 4MAVA 4PB5A 3TOPA 1DJWA 2OKTA 3ENLA 1KR1A 4EWJA 3MUZ1 3IGXA 3BMVA 3I6RA 1B3VA 3THQA 1EBGA 1JXJA 3LG3A 2VCBA 2OZ8A 4FLSA 3FY1A 4J28A 1ECEA 1YNYA 4A3UA 3F5JA 4UTTA 3GHSA 4OECA 1R0MA 2QMKA 4K8HA 4IIBA 3VGHA 4EF8A 1MW3A 2GJPA 3RU8X 3QN3A 3EWZA 3C61A 4WJXA 1BG4A 3V36A 4XWUA 5JIPA 2FH6A 1ITXA 2V3GA 3WBYA 4AZHA 2OT1A 1B1YA 2AL1A 3OQ8A 4JTDA 2VWSA 4HN8A 2DJXA 1UWUA 3OU8A 3CS2A 3BCDA 1X98A 2Y6ZA 2PU0A 5E0FA 4A3YA 4X63A 4FXRA 2DSUA 3ATZA 1Z48A 1BF2A 2QEZA 5HWMA 3S2NA 4AD3A 1EKOA 1XGEA 1XQLA 4GQRA 3FOKA 3K8LA 4CKQA 1LL4A 4WUIA 5AY7A 3BMXA 3R13A 1WAUA 3P82A 1W1IE 4G1KA 1XUZA 1AMYA 5HWJA 1IEIA 5ABHA 2WM1A 5FAGA 4PUMA 4OQVA 2G3JA 1RJRA 2IQDA 1HW6A 3LYEA 3T8QA 1I4NA 3W7HA 3ZVHA 3KX6A 7XIMA 3IEBA 3BG9A 2FZ8A 5BWFA 4G2DA 1JD7A 2PTYA 5T26A 3SY8A 2E5CA 3AXXA 1U33A 3ZR5A 5XIAA 8XIAA 2CIPA 5DY2A 3W29A 3D3AA 3U4AA 4FOUA 4YLWA 3CIVA 1SJDA 4FMVA 2CZVA 4F9DA 1ZSXA 3DECA 1XH1A 5GJPA 3W85A 2ZADA 3IV3A 4Y9AA 1TZ7A 4B3KA 3GH4A 2OG9A 3CHCA 1KKOA 1MRAA 3GU2A 3WFZA 1QI0A 1TCMA 3AXIA 4Z17A 3NSMA 2VI0A 1OCBA 3NQ7A 1TV2A 4MYAA 2NW0A 2DVUA 1R3QA 2PUZA 4GJ1A 3GD6A 2W3ZA 3AS2A 1CTNA 3S5OA 3VGEA 4CQBA 5KTLA 1O94A 3LK6A 3AXMA 2I9UA 4OJYA 3TTEA 1S1RA 2GJXA 1V3JA 2DIEA 1VEOA 3DHDA 2ZUWA