5I2UA

Crystal structure of a novel halo-tolerant cellulase from soil metagenome
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
296
structure length
296
Chain Sequence
SIVAQNGRLQVIGTQLSNEKGEPVVLRGASLGWHNLWPRFYNKNAVQWLADDWKCTVVRAAMGLEIEDNYRENPEFALQCITPVIESAIENGIYVIIDFHAHNKYTEEAKTFFAGMAEKYGEYPNVIYEIWNEPDYFEWEEVKTYSEEVIAVIRAIDPDNIILVGSPHWDQDLHLVAEDPIRDVSNIMYTMHFYAATHEAWLRDRTDEAIAKGIPVFVSECGGSEANGDGRLGIEEWKTYVDWMESRKISWVAWSVSDKNETCSMLLPRASADGNWTEDLLKPWGKLTRNSIRNAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cellulase
publication title Biochemical and structural characterization of a novel halotolerant cellulase from soil metagenome
pubmed doi rcsb
source organism Soil metagenome
total genus 119
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i2uA00
5ECUA 1WE5A 2QHAA 2DGAA 1ZB5A 4OIFA 4PMDA 2W66A 3WMCA 1JYNA 4FLRA 3BXWA 4LX4A 1R7OA 2QLYA 1MXGA 3AHZA 1DWGM 3T09A 4HOXA 3NYDA 3APGA 3PHAA 5A8OA 5TD4A 3RM8A 2WMIA 1S46A 1CXHA 1XD0A 2OWCA 1W9VA 3A4XA 3FAWA 4ZENA 4KH2A 4TUFA 1HX0A 2PWGA 1Z32X 4WK9A 5M03A 1I75A 3ARXA 5FOOA 2O9RA 3NSXA 2CPUA 1X6NA 1A3HA 4BZYA 2B31A 3BAKA 4IPLA 4P7OA 2IXUA 1UD3A 3VIFA 1FHDA 4OOUA 1Q4NX 3VILA 2VI0A 3AYSA 3PZ9A 1JXJA 2WVTA 1JZ3A 2J8GA 1UG6A 2WMKA 2UWFA 5E0CA 4NRRA 3AZSA 3SCSA 2PF0A 1CXKA 1KQZA 4HPGA 3DHPA 1V3IA 4U33A 1FA2A 5FL0A 3VDCA 2VZTA 3F5LA 1EHAA 4CD7A 4W84A 1GW1A 3VIMA 3W25A 4BF7A 3BSHA 4PTMA 3AFBA 3DECA 1V6WA 3W0KA 5CPTA 1QHOA 3AS2A 4D71A 5I24A 5I23A 4HMDA 1BAGA 1UWUA 3RM9A 4BQ3A 5M3WA 3RDKA 2PWFA 3AMCA 3VGGA 4MB5A 4KMQA 1EDTA 1CWYA 1UKSA 3AIEA 1UKPA 4CU8A 3GH5A 2CBJA 1NH6A 1YQ2A 5EFFA 4P7NA 3GBDA 3L2LA 4JCLA 3VX0A 1CXIA 2WKLA 4OUEA 3ZJ8A 1JZ2A 1MWOA 2DT2A 4W7WA 1LWJA 4TX6A 5DEZA 4RE2A 1BQCA 1K9EA 1G01A 5M17A 2ZE0A 4QCFA 1FP8A 1GHRA 1WZLA 1J0IA 3WD3A 3PZQA 4BQ2A 1FP9A 2WCAA 1TZ7A 3KL3A 3WH8A 5A2CA 3UEQA 2QF8A 3RO8A 1CNVA 2WC4A 1NWUA 3PZNA 4MAZA 1V3LA 4BA0A 2YLAA 2JALA 2DSVA 2QV4A 3IJ7A 5CLTA 1B2YA 3VKKA 2V38A 5I0DA 3GDBA 1CXEA 3VGFA 4MNKA 3W81A 2YBUA 1ODUA 1LG1A 1LLOA 1XH2A 5HPCA 1XD1A 2VX5A 4B16A 4B9ZA 1GPFA 3N1AA 4ZFMA 4KGJA 1RPKA 4HA4A 1WB0A 3U5YA 2J7HA 1BYCA 4ML4A 1C91A 5C8BB 1W32A 1ZJBA 1NWTA 2WBKA 1PAMA 1UKQA 3OGSA 3BCFA 1RH9A 5D9MA 2EXOA 3PZGA 2ZX5A 3AS0A 1JYWA 1QHZA 1C93A 1U30A 3MUZ1 2QPSA 1EA9C 4AY1A 4N42A 2EBNA 1KWKA 2BXYA 3ARRA 3OB8A 3SIMA 3AI0A 1TMQA 2XG9A 3NCOA 4ZXLA 4CD8A 1GQKA 1EH9A 1J10A 2E9BA 2UY4A 4M24A 3VD9A 3ZJ7A 1C7SA 4Z2IA 2XVKA 2E8ZA 1ISXA 2GFTA 1MW1A 4JFUA 2WKGA 4CU7A 1ZL1A 3SUWA 1MYRA 3SCQA 3LPOA 3L4TA 4V28A 3THDA 2YBTA 2W63A 1EQCA 1V0LA 2OYMA 5JBEA 5A2BA 4GINA 3CPUA 4S3KA 3IK2A 5LA1A 3ARQA 4PMVA 1E9LA 1R7AA 2CCRA 1KCKA 2DT3A 3SUSA 1CBGA 4H04A 4AMCA 1F4AA 4M82A 3SCPA 1ODZA 1PZ2A 2Y8VA 2VR4A 3PTQA 2J7EA 4L4OA 1JYXA 1XCXA 3M07A 4JFVA 4MPKA 3CMJA 2OSXA 3MS8A 4U3AA 5C70A 1HIZA 1M53A 3BCDA 3EMZA 1UD8A 3PZMA 3TONA 2UY5A 1H4PA 4W8LA 2DQXA 4TVUA 2CITA 3MMWA 3ZO9A 3FHQA 4D6GA 4ACZB 2V3FA 2ZUSA 4F79A 3AXXA 1QVBA 5FD0A 4Q7NA 2X8RA 5GNZA 5CPQA 1VEOA 1GONA 1V6YA 1KCLA 1J0HA 4UOQA 1KQYA 2PWDA 3WBAA 2GDVA 2VX7A 1V08A 4CU6A 2XYLA 3MV11 2DH3A 3W29A 3G6MA 2VQTA 4PCTA 5BRQA 2XVGA 5KEZA 3VGEA 2J7GA 4MJ4A 1JDAA 2ESCA 5GPRA 1GOQA 3WNOA 7CGTA 1NP2A 5ABHA 2WK2A 3WD1A 4AWEA 2X09A 4QLJA 1U2YA 3CGTA 2EPMX 3CHDA 4P7QA 1OGSA 1VB9A 2ZX8A 3S6TA 3ZSTA 4U2ZA 3RPMA 1K9DA 1G0CA 1QI0A 1E43A 1JGIA 3DHUA 4HA3A 1EO7A 2WC7A 3FXYA 3EMQA 1CLXA 3K46A 2G3JA 3G6LA 6TAAA 2VCBA 3EDFA 1OIFA 4DUXA 2VOTA 1LWHA 4JHZA 1HVQA 1OGBA 4ATWA 3AICA 2WB5A 3PN8A 1V02A 1BFNA 2J4GA 2WVUA 5E6ZA 4UZSA 2GUYA 5D4YA 5ABFA 1E4IA 1ZS2A 2J77A 3WF4A 7TAAA 2CYGA 1B0IA 4UFMA 4CVUA 4HOWA 2BHUA 4FLQA 1WKYA 3VIOA 2DSKA 2ZX7A 4PMQA 5EFDA 1SMAA 1W9XA 4D6JA 1C8YA 3AMGA 3EDJA 1DHKA 4AZ7A 5A6JA 1C8QA 4D1JA 1WDSA 1DWFM 1UR4A 2WHJA 1WO2A 5I6SA 2D3LA 4V27A 2JF7A 1KXVA 5DMYA 4WSKA 2VQUA 1TA3A 5A69A 3VDHA 5D9OA 5DT5A 2PB1A 4XZBA 3SUUA 1F4HA 3GH7A 1E55A 2DSWA 2VZSA 4YPJA 3AYRA 3AOFA 3QGVA 3AIQA 1JDCA 1BLIA 2FH8A 5HNNA 1XGZA 4CVWA 2J79A 1BHGA 1PX3A 4M8UA 3WH9A 2YA0A 4AZCA 1JZ6A 4R5EA 4KWUA 1VJZA 1HP4A 3VMPA 2BS9A 2D24A 2YIHA 2BHYA 1B3WA 3UG5A 1JAKA 4Q22A 2EPKX 4F9JA 1QI4A 4JFSA 3KWXA 3GNOA 4UQAA 5A1AA 1TG7A 3T2OA 1EXPA 3WD4A 2CBIA 3OA5A 1OIMA 3WENA 4LYQA 1XCWA 1EHNA 2W61A 4ATDA 3IJ8A 3JUGA 4J28A 3POCA 1J9YA 1W9BM 1UKTA 1QNPA 2V3DA 4W5UA 4D6FA 4DWSD 2GJRA 4HTYA 1BYDA 4UQEA 3RM4A 3VIHA 2BHZA 2J47A 2DT1A 1UZ4A 3WL0A 8A3HA 4AZGA 4U5IA 4GKLA 2E9MA 2O92A 5CGMA 3T0AA 3DC0A 4UFIA 1E6PA 4Z2HA 4OZOA 2D0GA 3HU7A 4HPHA 3WNNA 3WL1A 1NOWA 4UQCA 5A8NA 1GVIA 1FOBA 4CCEA 4TOQA 3HMCA 1DTUA 4J7RA 4HZ7A 4P8UA 2JFEX 1SMDA 3CHEA 1HJXA 4J3XA 3A47A 4GI9A 5ABEA 4MDOA 1PZ3A 2VL4A 3TOPA 4QAWA 3VGDA 3SCWA 2XIIA 4P8XA 3MUY1 1VFUA 4LXFA 3MMDA 2BVYA 3SCVA 1J0YA 5DFAA 2Y5EA 1DWJM 1EOKA 4W7UA 3UERA 4H41A 3NIYA 4C7FA 1GQJA 1AVAA 1MQPA 1JZ8A 2DDXA 3TTSA 1JIBA 4D1IA 2EQDA 2QPUA 2CHOA 1E1EA 4ZE4A 4W85A 3B9DA 1BG4A 4JZ5A 2XSAA 3TTOA 4TTGA 3DYOA 3AHXA 3VGBA 5IHRA 3QHOA 5HPOA 2OWXA 2J62A 3AS3A 4Z2JA 3MSDA 1HXJA 1WZKA 4E8DA 2OSYA 1W91A 5D8WA 2YJQA 2VRKA 4L4PA 4P8VA 2XM1A 4HZ8A 3BC9A 3WF1A 3UG3A 1PIGA 2JE8A 5E70A 1FHLA 4WJXA 2XVPA 2FH6A 5LA2A 3WNLA 3WF0A 3OLDA 4BS0A 5C71A 3O6AA 1JI2A 1BSIA 1KXHA 5CGTA 1YHTA 1BGGA 3BMWA 3ZR6A 4LYRA 1GOOA 5IFPA 1VRXA 2WXDM 2ZX9A 3UR8A 2V5CA 3VOCA 5DT7A 3SCTA 1B3ZA 4XX6A 1CXLA 4TVCA 3GNRA 4FLOA 4D6DA 1UWQA 4DWSB 1JF5A 3CUGA 2CEQA 2FDMA 3WFLA 4OOZA 2VCCA 4AD5A 1QNRA 3OGRA 3FHAA 1HKKA 1CGUA 8CGTA 1KR0A 3F5JA 3WNPA 1JZ5A 1NP0A 1JD7A 4PMRA 4TX8A 2XSBA 1UUQA 3LPGA 3FY1A 1EDGA 2J8FA 1E15A 2CETA 4CCDA 3NUKA 5A94A 3WH6A 1MVYA 2BY3A 4U3CA 2O9OA 1U33A 5JUVA 3N13A 3AXHA 1K9FA 3GM8A 4JHOA 1OWQA 4E2OA 2YA2A 2G3NA 1GNXA 4YN5A 3L4XA 4ATLA 2ZWZA 3FN9A 1CEOA 2ZX6A 2EJ1A 1CGWA 1E6NA 1XSIA 3VO0A 1CDGA 4AD2A 1GOKA 1Q6CA 3AIUA 3LPFA 3DYPA 4PSRA 2ZUUA 4F66A 4MNLA 5HBFA 2PWEA 3W6MA 2Y24A 1ITCA 1H0GA 3AIVA 4H8HA 2BV9A 3L2MA 4J3WA 1MQRA 1WDRA 5BRPA 2YLLA 2D22A 1GUVA 1XV8A 1H5VA 1UR1A 2PBOA 3CO4A 2WAGA 4JKMA 2W92A 4XB3A 3WMSA 2VC9A 4V2XA 1KR1A 5CSUA 4PMNA 4P7LA 2WWDA 1ISYA 3N9KA 2CHNA 2EPLX 3VNZA 3VD7A 3WDQA 1WP6A 3VPLA 1XYZA 3EYPA 3WQWA 4GO8A 3OZPA 3VIJA 3KEHA 2GK1B 2JEPA 3PZUA 1SFSA 4PBGA 3VTRA 3RJXA 2WLYA 4PMYA 1PX8A 2E40A 5LA0A 1LG2A 4HZ6A 4AZBA 4H8VA 3D5HA 1VBRA 1OD0A 2VZVA 4OJYA 1VF8A 3MKKA 4AISA 4CGTA 4IUGA 1R85A 2ZIDA 1X1NA 1CENA 5CG0A 3QOKA 2YDQA 1PX4A 4MB3A 1MFUA 2J7CA 1H41A 2V3GA 3MO4A 3U7VA 3W38A 3ZQ9A 1MW3A 4U31A 3T08A 3GXFA 1E4LA 2EO7A 1UOKA 1GORA 1M01A 5EBAA 4GIAA 1UH2A 4QFUA 5BYWA 3PBGA 2GJXA 4AZHA 4PTWA 1E6XM 5A6BD 4MB1A 5E6YA 4MADA 3WDJA 3T0DA 1B30A 4QLLA 3RILA 3CUHA 3NSMA 4BQ4A 2PC8A 1NQ6A 2XGBA 3UR7A 3AISA 3PZOA 3W28A 1ZU8A 1E3ZA 1OT2A 2OSWA 4JKLA 1E70M 1UH3A 3RCNA 5CQ1A 2XFYA 4DM1A 4FK9A 3PTMA 3W53A 1FH7A 1CYGA 1NOFA 4JFWA 4PRWA 3EBVA 2CBVA 3MV01 1FFRA 3WY1A 1Y7VA 2VX6A 2VTFA 1AQ0A 4WIWA 4GQQA 4J27A 3MANA 4A3YA 3OZOA 3VIIA 4PTVA 2PWHA 4CUCA 1V0NA 2RGLA 2AMGA 6A3HA 1J12A 4MAVA 2AAAA 3WNMA 5CPSA 3L4VA 4UCFA 2WZHA 3W24A 4C7GA 1H09A 2VZOA 2MANA 2XVNA 4Z2KA 4AEEA 1KFWA 1CZ1A 1QHPA 3AHVA 3WFZA 1JZ7A 5A6KA 4J3SA 4QCEA 2RGMA 4HU0A 1R86A 5BXSA 2WCGA 2WVVB 3AXIA 3KZSA 1H1NA 2VRQA 3VVGA 3T2QA 3GTNA 2E0PA 1TFVA 2BY0A 2V3EA 2DIEA 3AROA 2X0HA 3L4WA 4JIEA 1HJVA 2GSJA 4GZJA 1QOXA 3SUTA 3BAIA 2WMJA 1UD2A 1JXKA 1V02E 4JL1A 4AZIA 4UQBA 1WAWA 2D20A 1V3KA 3VDAA 1J0KA 2NT1A 4OKDA 3BGAA 1O6IA 4GPNA 3UCQA 5IFTA 1JI1A 1UR2A 2XTKA 1XH1A 2Y4SA 3TTYA 3WEOA 1AQMA 2YL9A 5JBDA 1JFXA 2JEQA 1BG9A 2G3IA 3B8SA 2J74A 1NOUA 1G1YA 1G94A 1HVXA 1W3LA 3L4YA 5IDIA 2CXGA 2VO5A 3IJ9A 2G4FA 3MUIA 3IANA 4X0NA 2WMIB 1OINA 4BCEA 1MQQA 1US2A 3CBWA 3K4AA 1K9TA 4JFTA 1V6XA 5A2AA 4CN1A 4U5KA 4W5ZA 5AYBA 3WDIA 2WM0A 1QW9A 2ZUWA 1E6QM 3GNPA 4J3VA 2X2YA 5D8ZA 2D0FA 1CGTA 1K6AA 2Y8KA 1UQZA 1JFHA 1QNOA 4MJ2A 5JIWA 1GHSA 2ZXAA 3CH9A 2CERA 1JF6A 3HJEA 3WN6A 2GK1A 3M6DA 1DWIM 4JKKA 3GXMA 2WHMA 4EAMA 5BXRA 3RMEA 5CLWA 3UETA 1FH9A 4CN4A 1E5JA 1H2JA 2E3ZA 2VX4A 1SYTA 1ISZA 2XJ7A 1NWRA 3K1DA 4J3TA 4F9DA 3ZT7A 5BWFA 1QNSA 1QPKA 2EPOA 4PEEA 4H7VA 4RL3A 1B3VA 3VMNA 2YDSA 3WD0A 1US3A 3ARPA 1QI3A 1HKIA 3VGHA 1C8XA 2BVTA 1UQYA 1CXFA 3CUJA 2CNCA 4D6CA 1BF2A 4B3KA 1BGAA 1WNOA 5I77A 2J7FA 1EO5A 3VU2A 5BCAA 2NW0A 3WBEA 1B1YA 1D2KA 2VZUA 3GXIA 4HP5A 5I79A 4D6EA 1UWTA 5JIPA 4PMOA 1WDQA 3VINA 4A3HA 1TUXA 2WMHA 4UFLA 3AIBA 5AC4A 4XZWA 2VRJA 2ZUNA 1UD6A 4DM2A 1KB3A 4OBSA 3O2LA 4URIA 1ITXA 1RD6A 2J7BA 2ZOXA 2YOCA 1WZAA 2FHCA 4P7RA 3WF3A 4QLKA 2VVNA 2F61A 3IAQA 3EMCA 3VDBA 4GQRA 3I3DA 4NI3A 4W86A 4W88A 2DSUA 2G8ZA 3W82A 2NSXA 4ZEPA 2WHLA 4DWSC 2FGZA 3PTKA 4AIOA 1E4MM 2WVSA 3SURA 2VNCA 2HISA 4AIEA 2BY1A 5D9PA 2EEXA 3A3HA 4FF5A 4W93A 3VD5A 3BAWA 3POHA 1UKOA 5CJ5A 4EK7A 1W9DM 4QP0A 5LYRA 3ZOAA 2YDRA 3E1F1 3BSGA 1ZBKA 1QBAA 2D0HA 2WVVA 2WSKA 4ACZA 5IHSA 3W4RA 1KBKA 1Q6DA 2CBUA 1XSKA 2E4TA 3F5KA 1HKMA 3KL5A 1QNQA 4MTVA 4UQDA 1E0VA 2E8YA 4NSBA 4PN2A 2XWEA 1OSEA 3N18A 4H2CA 2YL5A 5DO8A 3IAPA 1CLVA 1E5NA 2CIPA 1MXDA 2G3MA 2W91A 4W87A 1XYFA 2Z1KA 4KRTA 2ZXQA 3ZJ6A 4GZIA 2J25A 2Y2WA 1M04A 5A3HA 1P6WA 3QOMA 3LPPA 4S3JA 1UR0A 1GCYA 1MW0A 3GXDA 2BY2A 4LGXA 1G9HA 2G41A 1ESWA 4CKQA 1KBBA 5I78A 3BMVA 1TR1A 4NF7A 1FFQA 2WWCA 1E56A 2VCAA 3SUVA 1DWHM 5A6BA 3BAYA 4F8XA 2GJPA 3OLIA 4UOZA 4BQ5A 1KXQA 3WH7A 3CZ8A 1BTCA 1E6ZA 2VVSA 4PMXA 3WNKA 4UQ9A 4EANA 1W9PA 3AMLA 1J18A 3II1A 2D3NA 1XRVA 1UYQA 1KGXA 4PYSA 3SCRA 3ZT6A 3NSNA 1V3HA 1E0XA 4B9YA 1HP5A 3OBAA 5I5RA 2Q8XA 4JAWA 2A3BA 2BNJA 2C7FA 3N17A 4NZCA 2O9PA 3K8KA 3BAJA 3WDHA 4D72A 3BLKA 1EGZA 2WBGA 3CZEA 1Q6GA 4UNIA 3T0BA 4LQ1A 4Z2GA 1E6RA 1IZJA 3CZJA 4H8UA 1HNYA 4AD0A 3OG2A 3WEMA 3AQUA 1V6VA 3RJYA 3WEZA 3WMBA 5DF0A 1RP9A 1MW2A 3GYCA 4NRSA 2WSPA 3T2PA 9CGTA 2VURA 4GXPA 4R27A 2PI6A 3DYMA 3VD4A 2VT0A 2E9LA 2CKSA 1KGWA 4HMCA 4X0VA 1V03A 2ZXDA 3SCOA 4A4AA 2XHYA 4PCSA 1MFVA 4MDPA 1XC6A 3ARUA 5EB8A 3N11A 5FL1A 4Y7EA 5EMYA 4HU8A 1ISVA 2CESA 3CMGA 1OBAA 1LF1A 5FCZA 5I3DA 3KE0A 1HJUA 1OGGA 3ARZA 2W62A 1DEDA 1W9UA 1PJ9A 3B9EA 4PMUA 2XFFA 3QHMA 3TTQA 1OB0A 5AYIA 3ARWA 2ZUTA 1GOMA 5GNYA 1XHGA 1C7TA 4C7DA 2DH2A 1OCQA 3WUBA 2XVLA 1VFMA 2WYSA 1B3XA 3I3BA 3EDKA 4W7VA 3AJ7A 2HVMA 1B90A 3AS1A 4AZ5A 4DUVA 3A4AA 2YA1A 3GH4A 1JNDA 1XSJA 4ACYA 1GQLA 4PUEA 1BVNP 1I1XA 1EIBA 2OLHA 1VENA 2UY2A 3ECQA 3ARTA 5FKYA 1KGUA 3CUFA 3VM7A 4CD5A 2EPNA 5ABGA 3CTTA 5ABFB 3EDDA 1M7XA 2GDUA 3K8LA 2VMFA 1GJUA 1GVYA 3BLPX 4UFHA 3LMYA 3FNDA 1R8LA 1H49A 2A3CA 3PZVA 5E09A 3UESA 4M81A 3VIPA 1HL9A 1L8NA 1NARA 3N15A 4FMVA 3VIKA 2ZXBA 1IT0A 2C0HA 2XUCA 3ARSA 3S2CA 1OT1A 5GQBA 3AZRA 5HXMA 1W3KA 4WKAA 1C3FA 3L4UA 1UA3A 1UWIA 4AW7A 3K4DA 1TA3B 1HT6A 1Q6EA 3MUAA 5HDRA 1V3JA 1QBBA 3EDEA 1O7AA 2WCSA 2XIBA 3NDYA 1E4NA 4IM4A 1EOMA 4ZE5A 2DPEA 5BROA 1UZ1A 3N12A 1PIFA 3SCNA 1UH4A 3J7HA 3CLWA 2DT0A 2BVDA 3CZKA 3RIKA 4AZ6A 3NDZA 4MB4A 1NWSA 1W2PA 1X6LA 3K8MA 4HOZA 3VMOA 2ZICA 2WZEA 3THCA 3SCUA 4WKHA 4AZCB 1G5AA 1TVNA 1WDPA 2A3EA 3NJ3A 1ECEA 3L4ZA 4AD4A 3U5UA 2J78A 3WH5A 1A47A 5HOSA 2J75A 1KWGA 1UD5A 1JG9A 2FHFA 2NT0A 4OBRA 1GQIA 1V0KA 3WF2A 4IPNB 1HJSA 1H3GA 4ZXOA 3VUPA 2GVYA 4YHGA 2FHBA 3WQVA 5FIPA 5A8PA 2QMJA 5A95A 5F7UA 5E0FA 5I2UA 2OYKA 5A6AA 3WUEA 3CUIA 3CZGA 3WUGA 1TE1A 3OGVA 3PZTA 1E72M 2WC3A 4WLCA 1VBUA 4TVDA 2ZUMA 3AMDA 4E8CA 2VJXA 2FGLA 1UWSA 1HJWA 4DWSA 7A3HA 2O9TA 3QR3A 2VR5A 2IUZA 1AQHA 4B15A 1ISWA 4RE4A 1VEMA 3W27A 3WQ6A 1IV8A 1KXTA 4AD3A 1LL6A 5BXTA 2JIEA 1UHVA 4D6IA 3AMKA 5E9AA 3TA9A 5BXPA 1JYVA 1EQPA 2WMFA 1LJYA 1E1FA 2WPGA 1UR9A 3CZLA 4TXEA 4P8WA 3SEPA 1VAHA 3M46A 4CD6A 5M5DA 3OIHA 1HN1A 1WZMA 1D3CA 5A6LA 4RE3A 4FLSA 1WPCA 4N0RA 3BH4A 3D3AA 1IZKA 4JL2A 2WLZA 3WDRA 2F8QA 4K68A 1WCGA 1C92A 1I1WA 3WQ5A 1E40A 2IXVA 1SR0A 1HF6A 1E0WA 4UTFA 1ZJAA 2X05A 4UFKA 4IISA 4PSPA 1Q6FA 4GI6A 1LL7A 4PUDA 3ALFA 4YHEA 4J3UA 3U7BA 1JZ4A 2DEPA 1E3XA 4AC1X 3CIVA 2YL8A 1J0ZA 4WSJA 4X9YA 4W8AA 3ZR5A 3QHNA 1M03A 1VEPA 4M1RA 2JF6A 3WD2A 2WMGA 3TP4A 4GI8A 2Z1SA 3ZMRA 3O9NA 5A8QA 3ZSSA 1VIWA 5CZKA 5JBFA 2DSZA 3CHCA 3CHFA 4B3LA 1EDQA 1VFFA 1XH0A 3U57A 1UWRA 1B31A 1CIUA 2CKRA 1CGXA 4AXNA 4PTXA 1E71M 2WZIA 4PMZA 4HMEA 1B3YA 2WANA 4UZUA 1GOWA 4KGLA 3F4VA 2X1IA 1E73M 3PZIA 1JNEA 4AEFA 3FAXA 1FH8A 3W26A 4CN6A 2W4XA 3BAXA 4XV0A 1H0IA 2UY3A 3B9AA 5AY7A 2WHKA 2D1ZA 4LYPA 3ZJKA 5IXEA 4LPCA 2XPKA 2F2HA 3ALGA 1J0JA 2BXZA 3I3EA 4WKFA 5A6SA 1QW8A 1CTNA 4TTUA 1E6SM 3MSGA 2W67A 1BVZA 6CGTA 1JDDA 5A8MA 1OD8A 3AHYA 1JAEA 2JIWA 3WQ8A 2QMKA 2A3HA 3OLEA 3AZTA 1ZBWA 1TCMA 3VM5A 4E4PA 1W1VA 1CECA 2VUYA 1PBGA 2XGIA 3GBEA 3GZAA 3AIRA 4MNMA 3UG4A 1JL8A 4GZEA 1DWAM 1QI5A 1AMYA 3WELA 3VNYA 1D7FA 1PPIA 1ZBVA 4MNJA 5GNXA 2PBGA 5D9NA 4QDMA 3ZT5A 1TVPA 4M29A 4UOJA 1CGVA 1CGYA 3ZM8A 1L0PA 3WSUA 2C8NA 3VX1A 3WIJA 3W37A 1UD4A 3ARYA 2D23A 2WNWA 1H11A 2XM2A 2W5FA 1C90A 1W3JA 3HN3A 4W89A 4AD1A 5AC5A 3W6LA 1W3HA 4WF7A 1BPLB 1UA7A 3M7SA 4CCCA 4HA1A 4UR9A 1W1TA 2X0YA 2ZWYA 1UR8A 3ZIZA 2AOSA 1R87A 3AHTA 4JCMA 1CPUA 1VFOA 1LL4A 1ZBCA 1GOIA 1RP8A 4UFJA 4Z2LA 1J01A 1N82A 1OM0A 3WDPP 1B9ZA 2WW5A 2J7DA 3A4WA 4KRUA 1W2VA 4DUWA 4GO9A 1PEZA 1VJSA 1JD9A 3MMUA 4XUYA 1BYAA 3WUFA 2A3AA 1W1PA 4AIUA 3N04A 1V6UA 3VD3A 4M80A 3WKZA 1W1YA 1NM9A 4EE9A 3OLGA 2DIJA 1LQ0A 1QI2A 4W8BA 2TAAA 1GJWA 4CD4A 1BYBA 3A6OA 1HKJA 2D2OA 5A6MA 2V5DA 1J11A 1GZJA 1V3MA 1HL8A 4D6HA 2ZUVA 5CXPA 1DP0A 2XFRA 2XWDA 2YKKA 2GJXB 3VIGA 4AYSA 2YL6A 3MU7A 5KZ6A 5CSYA 2OWWA 3AIWA 4U2YA 2OYLA 2BFGA 1HJQA 4M56A 3KL0A 3WQ4A 3ARVA 4EKJA 3FW6A 1V0MA
chains in the Genus database with same CATH superfamily
3UXDA 5ECUA 3NYZA 3SECA 2PODA 2W66A 2DZWA 3WMCA 1SUXA 5C9ZA 4JTAA 3MVTA 4AVFA 3AXKA 3W71A 4LX4A 4WR3A 3A13A 1DWGM 3T09A 1A5SA 3NYDA 1EJVC 1EC8A 5A8OA 3LHYA 2WMIA 4BEUA 1TTJA 4NG3A 3TJLA 5C9RA 1XD0A 3QKZA 3S1GA 4KH2A 4TUFA 1HX0A 4Q4MA 1M5WA 2EAWA 2NWSA 2O9RA 1A0DA 4DRSA 4I8YA 3C0QA 1UD3A 1M9HA 3TQVA 3VIFA 1OFAA 1MSSA 1FHDA 2WZTA 2HE5A 4OOUA 1XLJA 3K1GA 3VILA 4IJRA 1ZRQA 1XKJA 4FR1A 1JZ3A 4B4FA 2ADAA 1UBSA 3E0IA 4S1FA 1KFLA 1TUFA 3B97A 2W3ZA 2HS6A 3GNXA 3QTGA 4FNTA 1FA2A 3F5LA 1UW9A 1EHAA 2YSWA 3IUHA 3W01A 1ICQA 3KOZA 3DECA 3LDVA 4LUIA 4HNNA 4IG2B 5I24A 3EAUA 4GWEA 1MMFA 2C19A 1EX1A 4BQ3A 5M3WA 5K9CA 2Z26A 1G6CA 3MUCA 3PUOA 3Q94A 5G4WA 4XKYB 4Z1YA 1UKSA 1A5UA 1Z44A 1QK2A 2I5IA 1W8SA 1NH6A 1YQ2A 4DEFA 4L9ZA 3L2LA 2KAUC 1BSLA 4O1BA 3U2ZA 3G5EA 3LHWA 4JCLA 4NZ5A 4X61A 4OUEA 1QO5A 2ISDA 1LBLA 2DT2A 4J5NA 1DQXA 4TX6A 2ZE0A 1EYWA 1W5PA 4QCFA 1FP8A 4B90A 1WZLA 1Z42A 3WD3A 3SBFA 3NA8A 4BQ2A 1FWRA 2BLEA 2QCDA 2WCAA 3W2MA 3UEQA 4MAZA 1TJRA 2E77A 4S3AA 4BA0A 4EXQA 2JALA 3BUVA 4AYGA 3H7RA 1OJXA 3JZUA 2V38A 1BKHA 3GXTA 1M1BA 2V5BA 3OBEA 3TQPA 5J5RA 4KEMA 1GGOA 1WX0A 1UC4A 2VX5A 3URBA 3N1AA 4B9ZA 1RPKA 4G1NA 4HA4A 4JNYA 4RJEA 4CNOA 1IZCA 4ZODA 1BYCA 1W32A 1NWTA 3ITOA 3TZFA 1PAMA 1UKQA 2ABBA 3OGSA 5DRCA 2QJIA 2OCZA 2O0TA 1TJ2A 3W85A 2Q3OA 5D9MA 2ZX5A 1QHZA 3BARA 3MUZ1 3GTXA 1A0EA 1EA9C 4AY1A 3RG6A 2EBNA 1KWKA 3TN3A 3ARRA 3BW3A 3W88A 3NZPA 3NL2A 1TMQA 1EX5A 4G6CA 3G1SA 3H8AA 4ZXLA 4CD8A 1OFEA 3V16A 1I9CB 3ZJ7A 4NIRA 1C7SA 1FWWA 1ISXA 3NO5A 3C6CA 4IMAA 2WKGA 4IIGA 4O10A 1TPDA 3SCQA 3L4TA 3N6QA 4MKNA 4DO4A 4GYJA 2B0MA 1Q2RA 2G97A 3UZXA 4DF1A 3CEPA 2VGIA 5EMMA 4ZR8A 3CPUA 3VC5A 3ARQA 4V33A 1R7AA 2CCRA 1KCKA 3A5VA 3SUSA 2JKPA 2FZMA 4AMCA 4Z42C 1IXOA 4M82A 3SCPA 2HK0A 1XIFA 5AB3A 3PTQA 1KFEA 1NQKA 4HHPA 4K8HA 2VGBA 3HQ1A 3BL3A 4MPKA 1W1ZA 1Q13A 2XN2A 4U3AA 4OUIA 2E5CA 3BCDA 3NWRA 3TONA 1UD8A 2UY5A 4LS2A 4W8LA 2DQXA 4TVUA 4QDPA 1P6BA 4L9YA 2SFPA 4P5UA 2V3FA 4H9ZA 3IIPA 4Q7NA 5EMJA 1PKLA 3LGEA 3LGDA 5CPQA 4MPQA 1EGMA 4UOQA 1KQYA 3ZR4A 1KC7A 4DWDA 1XLDA 3MJYA 4PR4A 1YDNA 4IG2A 2DH3A 5JMUA 1BWKA 3QYSA 2OMAA 4AU0A 2J7GA 3UF9A 5I3GA 4ICCX 4XKYA 4G1KA 3RR4A 5GPRA 2NV2A 1GOQA 2BGSA 3NOEA 5K9DA 3WNOA 3PWIA 4JQ3A 1IE7C 2E1DA 3WD1A 4P7QA 1OGSA 3JZEA 1VB9A 2ZX8A 3P6LA 3G22A 3LCGA 2HNHA 5IBXA 2YR1A 1G0CA 4E3TA 1QAPA 4ROPA 1E43A 1JGIA 1WXYA 3DHUA 7REQA 5HNRA 3PPFA 1X96A 1CLXA 4KWWA 1AFSA 1UP2A 1O60A 4GNKB 2VOTA 3EPNA 4XG1A 4JHZA 1HVQA 4L6DA 2P8CA 5D33A 5IOBA 3WLSA 3T07A 4GVHA 1RSCA 1T7LA 1LWIA 3PN8A 2ZA2A 2J4GA 3LHTA 3FX4A 1ZS2A 2J77A 5I02A 4LAZA 3SQLA 1PZ1A 2CYGA 1B0IA 4CVUA 1ADOA 1G67A 4EIVA 3KWSA 1H5YA 1WKYA 4NUWA 1Z3NA 3N19B 1H1ZA 2NUWA 3I4KA 4KEZA 2YXOA 1W9XA 4D6JA 3SY5A 3AMGA 3MP4A 3CTLA 4C6QA 4E38A 2P76A 3MP3A 4YTSA 1WDSA 4HYRA 1RQBA 2WHJA 1Z69A 4NAEA 4IFKB 4PB3A 3N2MA 4WSKA 1BXNA 4MUZA 2VQUA 1EJTC 3SRFA 4XSMA 3GSMA 5IM51 3N73A 1Z6KA 3SUUA 3GH7A 3TAOA 2DZUA 1XLIA 4YPJA 1GVRA 3AYRA 1QR7A 3N4EA 4DPPA 2HVOA 4GX8A 4HK6A 3OTRA 4DXKA 1JDCA 3R8HA 1ONWA 3W00A 4CVWA 4BI7A 4GC4A 1BHGA 2QCMA 3GYEA 2YA0A 1LT8A 3I65A 3BG9A 4DLFA 4KEUA 2E09A 3O6CA 4E4UA 1SFLA 3HV8A 1IQ8A 5D09A 3IVUA 2P5NA 3GNOA 2A2IA 3W1XA 5A1AA 3EX1A 5FJJA 4JNZA 4GCXA 5CPNA 4LYQA 1XCWA 3N2BA 2RKXA 2RDXA 4OV9A 1WXJA 1QNPA 4W5UA 2GJRA 4HTYA 3RM4A 3KLLA 2DT1A 3DGBA 1XIBA 4AZGA 4FS9A 4GKLA 4Q8WA 3QY8A 5CGMA 4Z2HA 2GWNA 2D0GA 3HU7A 2YDAA 3WL1A 3QN3A 1NOWA 1GVIA 1H63A 5FESA 4TOQA 3UY7A 4IUOA 4PB5A 4HZ7A 3DG3A 3EWDA 1JPHA 4Z08A 4C60A 2VFDA 3A47A 4GI9A 4X22A 5ABEA 4DNMA 3TOPA 3LEPA 3S5ZA 3HOJA 3SCWA 4MIMA 2RJGA 3H55A 3N9RA 1J0YA 2Y5EA 4L7ZA 2I5QA 1EOKA 4W7UA 1TQJA 2GPTA 3UJEA 4GI4A 4FP1A 4DI8A 4JTJA 1JZ8A 2EG6A 3IUIA 3TTSA 1JIBA 1VJIA 2QPUA 4ASTA 2CHOA 3W7OA 1E1EA 1H61A 3B9DA 2WM1A 5HAOA 1BG4A 4XK2A 1VRDA 3QJAA 5FJRA 2EKCA 2OT0A 4WRHA 1SSDA 3QGAC 1EF2A 5EMLA 3VGBA 2IPFA 4L1WA 4P8VA 4L4PA 4ZOEA 2JE8A 5LZLA 2F9RA 4XO7A 5A6TC 1H1YA 3OLDA 4ILSA 3S4TA 1B3OA 3H2MA 5C71A 2HTMA 3HB9A 3O6AA 3ZXWA 1JI2A 4Q6XA 4OT7A 1J2WA 3ZR6A 2W9MA 1GOOA 4RE0A 5IFPA 1GWJA 3SIZA 4DNHA 4S38A 2L5HA 2WXDM 1IXPA 1N8IA 3HTWA 2HQAA 3SCTA 3EOUA 3P93A 3TC7A 4I9AA 1Q5MA 6REQB 1RVKA 4FLOA 1UWQA 4AHOA 4DWSB 2VXNA 2FDMA 1NJJA 4M6VA 3HM7A 2ZZ2A 5LSMA 1QNRA 3M0ZA 3M7WA 3S6OA 3WNPA 3AXMA 3ME3A 1JZ5A 3Q65A 3BLIA 4AUBA 2HBVA 3CLMA 3A4JA 4UTTA 3R89A 4CCDA 3BLLA 1MVYA 1TJ1A 4O15A 3MCMA 4JD4A 3EXSA 3GUWA 3N13A 3TWAA 1FQ0A 4RCXA 3WLJA 4RPQA 1F8MA 3C3NA 2G3NA 3M0LA 4FX7A 1I2NA 3ES7A 3TYCA 3A3WA 3N29A 3OU8A 3UVIA 3ITLA 4H7CA 3F4WA 3FN9A 3KOXA 3HGRA 1Q7QA 2OJPA 1EZWA 3RHGA 3LPFA 5BZAA 4PSRA 2PLJA 3D47A 1G4EA 1ITCA 5FF7A 1JCYA 4QQUA 3GR4A 3MZ2A 3LA4A 1BWVA 4G5DA 5J5DA 1GTEA 5KITA 1WDRA 2D22A 7PTDA 1GUVA 3LUTA 4LRSA 3LS9A 1GVOA 3TX9A 3CO4A 2W92A 4Q4OA 2VC9A 3W6YA 1YXYA 3OQ8A 4RNIA 4P7LA 3V3WA 2WWDA 2CHNA 2EPLX 2YCLB 3WDQA 1WP6A 4HD5A 3T81A 1PKYA 2CU0A 1GZGA 3MP5A 4HK7A 1QATA 2X2GA 4G2DA 4EOUA 3KCJA 3RJXA 4WJ8A 4JY8A 2E40A 4H8VA 2VZVA 3W1UA 2FVMA 4IUGA 2QT3A 3MKVA 3CB8A 3QOKA 4NNCA 4BKNA 3ABOA 3MCOA 3OPSA 1FKWA 1MFUA 5LIUX 2V3GA 1WA3A 3N2XA 1MW3A 4U31A 3T08A 5EBAA 3RX3A 1I4NA 3S0CA 1E6XM 3NQ6A 5E6YA 1ZGDA 1GW9A 2Z6IA 4MADA 3WDJA 3G1HA 3HF3A 5HNTA 3EWBX 3RILA 2OX4A 3CUHA 4MF4A 3EEGA 5CPMA 1NQ6A 2XGBA 3AISA 2R6OA 1ZU8A 3WG6A 5CQ1A 1TO3A 2BSLA 3MV01 1Y7VA 3ICJA 1DJIA 1H51A 1TIWA 4A3YA 3OZOA 1L6YA 3SFWA 4CUCA 4JNMA 1RV8A 2AAAA 4GG9A 4MKSA 4O57A 5HJYA 4TR9A 2GDQA 2QEZA 1H09A 3S83A 4A3UA 1OX5A 1K8ZA 4Z2KA 1YLVA 3VC6A 2YB1A 2PDMA 4J3SA 2DW6A 2YZRA 4QCEA 2XIOA 2HDJA 3MC5A 4JIHA 3S1UA 1R86A 5C9XA 3ZVHB 6REQA 4XAGA 2VRQA 2Z4GA 3T2QA 4O8AA 5CG7A 1YNYA 1BVWA 4KIRA 2QQ6A 2BDQA 2A6NA 2DIEA 4KCTA 2A79A 1KTBA 3SN4A 2PU0A 1S5TA 4WDTA 3GUGA 1DJHA 4XUGA 2WMJA 2CLMA 1JXKA 1O68A 1AMKA 2D20A 1V3KA 2PPGA 4M6PA 2NT1A 4N7QA 4C6JA 4L56A 4GPNA 4J3ZA 3UCQA 1UR2A 2Y6ZA 3UCCA 1FDZA 3TTYA 1K7EA 1OFPA 3BJFA 2YL9A 1JFXA 2Y7GA 3QQWA 3E2RA 3FSUA 3CO8A 3CAVA 2VFHA 2YW3A 2HV5A 3L4YA 5IDIA 3LRLA 2P50A 4JGDA 2ZCGA 3GIQA 2EJAA 2QJNA 1QPNA 2BXVA 4PBFA 3IJ9A 1OZQA 1W1A1 2Q6ZA 4KWSA 3ENLA 4RNHA 3CBWA 3K4AA 3VNMA 3GW3A 1A49A 1V6XA 4I9JA 2ZYFA 2QJMA 3W7HA 1E6QM 2X2YA 5I3KA 3H12A 3REQA 2EG8A 1CGTA 3QVQA 2J66A 1UQZA 4N9EA 1YPFA 2CERA 3WQGA 3HJEA 4I5UA 4JY9A 3K2GA 4Q32A 2PTYA 2P3ZA 3P74A 4S3FA 1BXBA 4HNOA 1HFBA 3ZT7A 5B7ZA 5BWFA 1QNSA 1XBVA 5CKSA 4LEFA 4RL3A 4H7VA 4C65A 4WDWA 3WD0A 2ISFA 3ARPA 2OZ0A 4H9XA 1OABA 3PC0A 2BVTA 3MSRA 4EPBC 4D6CA 3BWWA 4B3KA 1KV5A 4LAMA 1FWBC 3UZJA 3KRZA 2NW0A 4Z1CA 1QU4A 1B1YA 4DB7A 1E0TA 2HXUA 3GXIA 5I79A 1UWTA 4GNVA 1QPRA 3O3RA 1WBJA 3E38A 1TUXA 2WMHA 3VKBA 5AC4A 1SFJA 3HPXA 2GWGA 2ZUNA 3QM3A 4ZTYA 2P8BA 3EOSA 1RD6A 2ZOXA 2BGQA 1K8XA 4GXWA 1WZAA 4P7RA 3L0NA 3GAYA 1XR2A 4XBKA 2DZAA 3EMCA 4QIUA 2BP1A 2Z00A 3I3DA 4FX6M 1YPXA 1P0KA 4I90A 3KW3A 2DSUA 2G8ZA 3W82A 3A3XA 3IIVA 4ZEPA 4DWSC 2FGZA 1NDYA 3LQGA 1XRTA 3PTKA 4BJHA 2BTMA 2WVSA 2VNCA 1VYSX 2BY1A 2EEXA 2ANUA 3PG8A 2R1KA 1UKOA 3NQ7A 2X30A 3KM8A 4RUBA 1QK0A 3LTSA 3USBA 3VCRA 4H4IA 4O1DA 1QBAA 2D0HA 4QEHA 2V67A 5AVNA 4B91A 2PTWA 4NL1A 5AHMA 3S2NA 4LAKA 2G50A 2CBUA 3VXGA 1DVJA 1SW0A 2X1RA 1K02A 4MTVA 3V5OA 1E0VA 4NSBA 4PN2A 3L7RA 3NQCA 3P8JA 4EAYA 2FQIA 2OLAA 1WV2A 1E5NA 1MXDA 2G3MA 4W87A 2AMXA 1SO6A 1LBMA 4L4LA 2Z1KA 2ZTJA 4KRTA 2ZADA 2Y2WA 5A3HA 3GDRA 3MW7A 2Y7DA 4M7TA 2VYOA 3IARA 3BMVA 1FFQA 3V0TA 4H6KA 3SUVA 5A6BA 4G8TA 4UOZA 4BQ5A 3WLLA 3CZ8A 1BTCA 2VVSA 2YCJA 3WNKA 1SSGA 3LOTA 1O4UA 1J18A 4ROQA 1XRVA 3VCNA 4NZJA 3SCRA 3ZT6A 1F3EA 3OBAA 5MHBA 3GXPA 1TWZA 4LALA 4S2BA 2Q8XA 4L1GA 2A3BA 2Y85A 3GDKA 3GIYA 3I6EA 3PM6A 4C6CA 4DUOA 4K37A 3HPAA 3K8KA 5T26A 3UXKA 2Y7EA 3BLKA 3T8LA 4C6DA 4GY1A 3CPRA 4HBKA 4Y9MA 4Z2GA 3CZJA 1EWEA 4AD0A 4ZBCA 1Z89A 5DF0A 1MW2A 2Y62A 4L64A 3GYCA 4ENLA 1A4LA 1QXLA 2YCEA 2VURA 3ONCA 3HA1A 3WLRA 2CKSA 4HMCA 4X0VA 5EBUA 2ZXDA 4A4AA 3JR2A 2VWTA 4PCSA 1MFVA 5EB8A 2ACRA 3N11A 5FL1A 4K2SA 3NQVA 4HU8A 2CESA 4EXBA 3E2VA 2D73A 3G18A 3BJSA 3QV6A 5CGQA 1B9BA 5FCZA 1H7WA 3HO8A 1K4GA 4M7SA 4LVBA 3T55A 4UMCA 1V51A 3LY0A 1IEXA 2W79A 1W9UA 2DVTA 4IPIA 5AYIA 3ARWA 3S42A 3FCPA 4ORMA 4ICMA 3NQEA 2OG9A 4DZIA 2FTPA 2GQ3A 4CEUC 1EUAA 2E25A 4W7VA 4LVAA 4FIRA 2Z6JA 1LROA 3C2FA 3AS1A 4NILA 4UMBA 4MWAB 3GH4A 1YW1A 3LBCA 1JNDA 3FGCB 1XWYA 4ACYA 2QV5A 4DY1A 4IP7A 1I1XA 1EIBA 1VENA 2UY2A 4M0XA 5D2WA 1KGUA 4CD5A 1MUWA 3BLOA 2EPNA 5ABGA 3BPWA 2VMFA 3A12A 2Z28A 1DE6A 1GJUA 1EJWC 4HK5A 3BLPX 3ABQA 4IIDA 4MZ8A 3FNDA 3RRAA 3RAOA 1H49A 4DO7A 3MZNA 5PTDA 5E09A 3UESA 3R12A 1EL3A 3PPGA 4S2CA 4N02A 3A23A 1L8NA 3ITCA 2ZRVA 3IS4A 3LBMA 3H6OA 1XCFA 1KRBC 3IIZA 1T8XA 5CZSA 4O4VA 4M1BA 2TPSA 3GU1A 5HXMA 3TN5A 3QH2A 4DI9A 3R0UA 3WX7A 1UA3A 2YYUA 1V3JA 3LU2A 1O7AA 4O16A 5BOFA 4QEEA 4U4MA 1TPWA 2H8XA 3NDYA 3GRIA 3C2VA 5EYWA 3UW6A 1PIFA 1VKFA 1UH4A 3NQMA 4ZVJA 2BVDA 3CZKA 3DXIA 3PP7A 4HN4A 6TIMA 1X6LA 1XYLA 1M65A 2NUXA 5EA9A 1K3UA 4WKHA 4ZQRA 1K70A 3W1LA 2HZGA 4KWVA 4GFIA 4K8EA 3AC0A 4GXMA 4PULA 3CV7A 1X1ZA 3U5UA 2AL2B 2REQB 5HOSA 1ME9A 1U5JA 1ALDA 4XIMA 1UD5A 1KM1A 1JG9A 1GQIA 4W4QA 1V0KA 3WF2A 3FIGA 4CQCA 3VUPA 3TVAA 4Q8TA 2P53A 2FHBA 3WQVA 5A8PA 3WJYA 3FSTA 5E0FA 5I2UA 3DGRA 3S1XA 4CNPA 1MUCA 1TE1A 3PZTA 1JJKA 1FTXA 4TVDA 3O1NA 4ERGA 1LBFA 2PDGA 3L5LA 3W1PA 1F07A 2FGLA 1JEZA 3EKLA 3QR3A 2IUZA 1AQHA 4RE4A 4YL2A 1VEMA 3O6DA 3W27A 4NXKA 1IV8A 1F7BA 1UHVA 1W3NA 5E9AA 3S9IA 4PA8A 5BXPA 1E0UA 4S3GA 3TC6A 3TQ0A 1EQPA 2WMFA 3KOYA 3CZLA 4NZFA 3GC4A 4GQBA 4O17A 4P8WA 3SEPA 4E2VA 4LFYA 3GDLA 3BMXA 5F1VA 5A6LA 4XZLX 2X1TA 1YNQA 4AIBA 3ELFA 3MQTA 3BH4A 2QAFA 4A05A 1IZKA 4JL2A 2WLZA 2F8QA 1Y0EA 4L65A 3WQ5A 1E40A 1KTCA 2NX3A 4E3VA 1ZJAA 2NQ9A 4DO5A 2J9ZA 3RLVA 2VP8A 1FHVA 3GVWA 1J0ZA 4WSJA 4X9YA 4W8AA 3ZR5A 4Y2WA 3QHNA 1VEPA 4IIFA 4BWLA 3TP4A 3ZMRA 2Z1SA 5A8QA 3ZSSA 4DO6A 5EMUA 4YVXA 5JBFA 5EGRA 1VPXA 4GNJA 1VFFA 1QWKA 1Q65A 3PBMA 1B31A 2Z7GA 1VBHA 2CKRA 3WK2A 4GIEA 3W84A 2FTYA 3LZ5A 4PTXA 1TV5A 1G69A 1B3YA 4J35A 5KETA 1Q7MA 4HVXA 2HPIA 3PZIA 4AEFA 1FH8A 2I7GA 4CN6A 3D3FA 3WLMA 3BAXA 4GOAA 4GQ0A 2VFGA 2Z25A 2PDJA 2YXGA 3B9AA 3RFAA 3OBKA 1EXBA 3DU0A 1XP3A 1XICA 4LRTA 2BXZA 4WKFA 4TTUA 3MSGA 3P0WA 2P10A 3NL3A 6CGTA 3TA6A 3TYUA 3FDKA 3MYOA 9RUBA 1DXEA 1SM9A 3VDGA 3IRDA 3AHYA 5BMWA 1O94A 2PLCA 4M6UA 2A3HA 1XDMA 4HPXA 4AWSA 3VM5A 1W1VA 3OZYA 2VUYA 3SSZA 5HANA 2ZRXA 1H7RA 3CB3A 4AF0B 3NZQA 1TQXA 3PG9A 2XH2A 3UG4A 1Y5WA 4S23A 4DJDA 1QI5A 3C0LA 3FYYA 1D7FA 1OG0A 1LZOA 4MNJA 3ANVA 4H1ZA 1GQNA 5D9NA 3CYJA 3M0MA 3IPWA 1CGVA 1L0PA 2IPJA 3KCOA 1BTMA 2QDEA 3SI9A 1US0A 2AL2A 2WNWA 1H11A 2GJLA 1U5HA 4MSSA 4W89A 4AD1A 3M16A 1XLMA 3N25A 2QPXA 3HFTA 1BPLB 3M5YA 2FMOA 3EKZA 3M7SA 4Q8NA 1HKVA 3N2CA 4IX0A 5KINA 1EGVA 1W1TA 2X0YA 2ZWYA 1R87A 3AHTA 4DXXA 3IJDA 2XN0A 2A6LA 1VR6A 1ZBCA 1GOIA 1YDOA 4HJWA 5I3HA 4ZOBA 7ENLA 5DLCA 2J7DA 4KRUA 1W2VA 1HZYA 5CZJA 1AQFA 1YMYA 4XUYA 1BYAA 1W1PA 4AIUA 3E0LA 4MMWA 1V6UA 3UXAA 3VD3A 1KM5A 4M80A 1W1YA 3OLGA 3KUMA 2I17A 3EX2A 1LQ0A 2PDHA 4Q8QA 3EGJA 4GIYA 4LAOA 1TWWA 3XIMA 1J11A 1GZJA 3W76A 4TMCA 3H53A 2ZUVA 5CXPA 4ZA0A 3LSCA 3NQ2A 5KZ6A 3AIWA 2WSRA 3G8RA 3S46A 3L9CA 3KL0A 3WQ4A 4LBUA 3ARVA 4L9XA 4MWAD 1NU5A 4EKJA 1RA5A 3W7GA 3OVPA 4NNAA 3CL8A 2IMRA 2DGAA 4FI4A 4MWAC 4FLRA 3BXWA 1WKFA 4WCJA 5D38A 2QLYA 3PWAA 1RD5A 3KCLA 2V5LA 4HOXA 2B7NA 3APGA 4KW2A 5CC7A 4H3DA 1RBLA 5HWMA 2DIKA 3A4XA 4F3HA 4ZENA 2WSYA 5M03A 3E96A 2XN1A 3ARXA 6ENLA 3G77A 3P82A 1FCUA 1I2OA 5FEPA 3BAKA 4BFAA 4P7OA 2IXUA 1F61A 1ICPA 1OY0A 1CI1A 2A1YA 5BU9A 1Q4NX 1SPQA 4JIPA 3ZLFA 1S1PA 2DQWA 3V35A 3UY8A 3AYSA 2WVTA 1UG6A 1OC7A 2O55A 4HPNA 1LRQA 2ZRUA 2PF0A 1RJRA 3ZLHA 2WO5A 1A3XA 1ZY9A 4A3RA 2CLFA 4U33A 1VHCA 1TYGA 1ZTVA 2O4QA 1TRIA 3UGVA 1W54A 2CLIA 3FEQA 3W25A 1OK4A 3BSHA 3ITXA 4PTMA 3AFBA 1R3QA 2ASHA 1V6WA 3OG3A 5CPTA 3W0KA 2VDHA 3AS2A 2CHRA 5I23A 4HMDA 3MMTA 4YLWA 4LUSA 3RDKA 2PWFA 1CT5A 1EDTA 4TQTA 3BGGA 3KDOA 3AIEA 3WQDA 1MEIA 4TX9A 3VNIA 1X98A 4P7NA 4HTBA 1QT1A 1CXIA 1AUSL 3ZJ8A 2VDGA 4RR4A 1KW1A 1LWJA 2OEMA 4N9CA 3F7JA 5M17A 3FJ6A 1VGAA 3EOLA 1DJNA 1GHRA 3G2GA 3BW4A 4Y96A 1XKYA 1J0IA 4JYEA 4NP7A 1U22A 3KL3A 3UGRA 4PUUA 5E1QA 2QF8A 2V82A 1CNVA 3PZNA 1Q6QA 1V3LA 3H54A 4WZHA 2OEKA 4I7VA 3KFTA 2DSVA 2QV4A 3IJ7A 1B2YA 4DHGA 3H4XA 2RH9A 4Q4KA 4QQ3A 4MGGA 1A53A 4L1XA 5CZ0A 3VGFA 4IGMA 1ODUA 1LG1A 2ZZ1A 3KBWA 1LLOA 4JTQA 1XH2A 1XD1A 2NLYA 2DJXA 4FO4A 3U5YA 2TMDA 3SGZA 2QJHA 2OQHA 4ML4A 1C91A 5CC6A 3TNBA 2WBKA 2ZRZA 3E74A 1YTEA 3BCFA 1ONXA 2I5GA 1JYWA 1F8IA 2V2HA 4FOUA 1C93A 1U30A 3DAQA 1JUBA 1GVFA 3D0CA 1O5XA 3OB8A 3SIMA 3FEMA 3WLQA 3NCOA 1H62A 5GJNA 1GQKA 3KP1A 1J10A 2E9BA 3QW4B 3CWOX 3HV9A 1AW5A 2XVKA 2E8ZA 2GYIA 4IXXA 1MW1A 4XZHA 3GTFA 4JFUA 4PMJA 3MSYA 1LOQA 4GYPC 3SUWA 4ZQMA 4XZIA 1MYRA 3BOXA 4V28A 2W63A 3PBUA 1F3TA 1R3TA 2OYMA 1O66A 3M64A 3IWPA 2DZTA 1V7YA 1MEWA 3IK2A 1E9LA 1IWBA 4JHMA 3LYEA 1F4AA 4Q8PA 2Y8VA 4D8ZA 1JYXA 1UIOA 4WEVX 1S3TC 1JULA 4QBXA 3CMJA 5LHFA 3LNPA 3CL6A 3LLDA 2ATMA 2XH7A 1HIZA 3H4WA 1Q2SA 3PZMA 1RCXB 3EA2A 5BWAA 2C6QA 1O95A 4C6MA 3FHQA 2CLEA 2I14A 4XQ6A 1QVBA 5FD0A 4RNJA 2X8RA 1EUNA 4FNUA 1GONA 1W37A 1V6YA 1X1OA 1J0HA 3DBNA 2IKIA 1WOAA 1YBQA 3URNA 4CU6A 1EF3A 2ACSA 2E5BA 4V15A 3SADA 2VQTA 4PCTA 2XVGA 5KEZA 4G9PA 3F2CA 1DIOA 4MJ4A 4FNSA 4LOCA 7CGTA 1J96A 2WK2A 1XBXA 4Q6JA 3GKAA 3ZSTA 4RZ4A 4U2ZA 3CK5A 3IJIA 2IKJA 3FFSA 1QI0A 4DJEC 4L6OA 3NPWA 3MA8A 2B81A 2YZ5A 2KZHA 4HA3A 3FXYA 3AYVA 1I6NA 2VCBA 3KOFA 1E1CA 1W6TA 1MDLA 3H4GA 1K8YA 1OGBA 3PNZA 4ZCWA 4C6EA 3MPGA 2PD9A 2OZ8A 1V02A 1BFNA 2WVUA 3P61A 5E6ZA 4UZSA 2GUYA 5D4YA 1E4IA 5K7JA 3WF4A 7TAAA 3E6EA 1H50A 2FJUB 4UFMA 1XI3A 5C5YA 4G7EB 4FLQA 2G96A 1A5CA 3TYZA 1F6YA 4CCZA 4DJFC 3GVQA 1DHKA 3DERA 4N4PA 4D1JA 4XZNX 4FPSA 1WO2A 3TIMA 2OB3A 1J93A 5I6SA 4WDXA 4V27A 3WK1A 4DX3A 1KXVA 5DMYA 4ZSTA 3MHGA 1TA3A 4E2BA 2FFCA 5D9OA 1FDJA 2PB1A 4XZBA 2DSWA 2YFOA 3RXZA 1ZQ5A 1UMYA 4L61A 3AOFA 1QMLA 3QGVA 3AIQA 1BLIA 2NX1A 3MJMA 2J79A 1PX3A 4AZCA 3SB0A 1Z9AA 4YYCA 1VJZA 4IGHA 1PWLA 1XYCA 3B4YA 1W1B1 3TW7A 3VMPA 4QAIA 1KM3A 3K4WA 5XINA 1YNPA 5J8LA 2EPKX 5LKYA 1QI4A 4JFSA 3CIXA 4UQAA 3W73A 2Z1BA 3T2OA 1UUOA 3ITGA 4A8IA 1YTKA 2ZKMX 1KCXA 4ATDA 3IJ8A 4KFOA 3JUGA 1EPXA 1R3SA 4UQEA 4B5XA 2W6RA 8A3HA 4U5IA 3MBDA 1JRCA 4B4HA 3BV7A 4HPHA 3C61A 1L2UA 4UQCA 1EB3A 4CCEA 4FALA 1LT7A 3MB9A 1W0MA 1XGEA 4PE8A 2JFEX 3UJSA 3L21A 2WKJA 3CH0A 3OIXA 3VFLA 4D8AA 2CLPA 4EWND 3B05A 3I68A 1PZ3A 1OX4B 4C5ZA 1JR1A 2XIIA 4P8XA 3MUY1 3MMDA 2BVYA 5DFAA 4JTUA 4R88A 5REQB 3SFKA 3TYDA 3UERA 2Z2AA 4HU3A 1SZGA 3NQ8A 3R0DA 1MQPA 2WJDA 2WQPA 4RXGA 2DDXA 3W70A 2QVNA 1UR3M 1IEVA 2UV8G 2E67A 4B2DD 4W85A 1SZEA 2X1UA 4J9JA 4JZ5A 2XSAA 1S2UA 4WXYA 2YFNA 3DYOA 4JIQA 5IHRA 1X8CA 3QHOA 3TTEA 2RHGA 4QE5A 4Z2JA 4LANA 3PULA 1HXJA 3CAQA 4E8DA 2OSYA 4GH3A 3LM3A 5D8WA 4RLIA 2XM1A 3WF1A 2JQXA 1PIGA 4PUMA 4ONVA 3B0PA 1D3HA 4M19A 3NPVA 4N9BA 2CC0A 2V9DA 4QSHA 3LRKA 1EWDA 1B5TA 4PRTA 2UBPC 3NEVA 1Q85A 1YXDA 1GYNA 3T78A 3URQA 2ZX9A 5DT7A 1B3ZA 3RLHA 3ORWA 1CXLA 1POKA 1XG4A 1SZNA 4IMCA 1Z41A 3CUGA 4IMDA 4Z1BA 2Y5JA 3PB0A 5J04A 5I7GA 3O07A 3OGRA 3GR7A 1KR0A 5T8GA 2J88A 1JD7A 3IEBA 4PMRA 2XSBA 3OOQA 5E0KA 1OFDA 2PDFA 4OU1A 4DN1A 3ITTA 3WH6A 2BY3A 1S2TA 4F0LA 3GG7A 1RALA 3QV8A 5JUVA 3FOKA 5K3VA 3N3MA 4I3GA 4HCDA 3AXHA 3QR1A 4N6FA 1XGDA 3RO6A 3CU2A 1GNXA 1KKOA 3S1VA 2D69A 3RK8A 3L4XA 1A50A 3C2RA 3FVDA 4MLRA 4ATLA 5JQ9A 1BF6A 4DBWA 4KCUA 3V36A 1CEOA 3THQA 2DVXA 4XVEA 1DQWA 2ABAA 1E6NA 3N3TA 3FLUA 3L0GA 1GOKA 4AEOA 1EBGA 2YCKX 5HBFA 4NQ1A 2Y24A 2OLSA 1H0GA 1TJ0A 5TQLA 4GJJA 1IWPA 2CLKA 2ISSA 3L2MA 4GHRA 3EPMA 4I5XA 3BLEA 5DMLA 2V68A 1XIHA 3LHZA 3SN0A 1XV8A 1FWFC 5EY5A 1K1DA 1UR1A 2WAGA 3WLPA 4WGHA 4XB3A 4PUNA 4V2XA 2NX9A 1ISYA 3VD7A 3KS5A 1GVEA 2P0OA 3BSMA 1XYZA 3EYPA 4GO8A 1LM1A 1QWGA 3AU6A 2GK1B 4PBGA 1L6FA 3WJZA 3U4AA 4PMYA 1KFCA 2EF9A 2QJJA 1OFQA 1OZMA 4OJYA 4AISA 4CGTA 1R85A 1ADDA 5FEWA 4XD5A 4IHCA 5DELA 2YDQA 1XUUA 3I7RA 4MB3A 4CNSA 2GGEA 1EKOA 3U7VA 3QLDA 3W38A 3UD6A 1WDWA 4XISA 1HL2A 4A8LA 2EO7A 1TWIA 2GJXA 1SVDA 3EXTA 3VKAA 3DFYA 3IUDA 3E0WA 4PTWA 4ZO8A 3DI1A 5TAOA 1B30A 1RXOB 2AQOA 4BQ4A 1TPB1 3NR0A 1H7OA 3PZOA 3W28A 2CW6A 3B8WA 3S5YA 1E3ZA 1OT2A 4JKLA 1KRAC 1E70M 3RCNA 2KX9A 4DM1A 3W53A 4YTTA 4S3DA 1CYGA 3PPHA 2CBVA 1FFRA 2VX6A 1ZFJA 2E68A 1AQ0A 4KRZA 1SQ7A 1Q4WA 4GQQA 5BOEA 3MANA 3VIIA 2BODX 1EEPA 1V0NA 2OR2A 3QMRA 3MHUA 3JW7A 2QAPA 2AMGA 1XDJA 6A3HA 4MAVA 2GQ9A 3G24A 3L4VA 4RPPA 1F76A 3IK4A 1VH7A 2BG5A 3W24A 3LCHA 2YXXA 4C7GA 2Q8LA 1TPUA 1I0BA 3S2MA 2MANA 3FXGA 1WUEA 2TODA 1PSCA 2EHHA 1QHPA 1IT7A 2HBXA 5K4XA 4UTJA 3W7NA 5AC6A 5BXSA 4FOKA 2WVVB 3WBXA 1DJYA 3KTXA 3H2AA 2PP3A 4YVPA 3KZSA 3HIJA 3W1RA 2JBMA 4LTSA 1TFVA 1G4TA 1EPVA 4JBRA 5C55A 3LD5A 3HGOA 5G2HA 2X0HA 5AHIA 2CWNA 4MWAE 3L4WA 3UQNA 1HJVA 4ERIA 3BAIA 4HNLA 2C79A 4YVVA 1XLHA 4JL1A 4UQBA 1WAWA 3PUGA 1L6WA 3OHMB 3TW6A 1ZP4A 5AYXA 4OKDA 3BGAA 5IFTA 4HMNA 4B5WA 3I4EA 2HPMA 5JBDA 5HA7A 3M41A 2JEQA 3LV6A 1OEPA 1H7NA 3GNDA 3Q45A 1XQLA 3EA1A 1DJGA 2PEVA 2CXGA 2B4GA 2VO5A 3R8GA 1S5NA 3IANA 2WMIB 3SGUA 1R9XA 1P0DA 1NVMA 2Y70A 2ZVRA 1K9TA 4JFTA 5A2AA 4M6QA 2QCHA 1GYLA 3WDIA 2WM0A 4LCQA 3GNPA 2GOKA 4J3VA 2J8TA 4XAFA 5CH9A 4MJ2A 4RDWA 1JF6A 2GK1A 2YW4A 4REQA 4JKKA 1YKWA 4EAMA 5BXRA 3RMEA 1FH9A 3KBNA 2E3ZA 4FXSA 1SYTA 1OG6A 1ISZA 1NWRA 2V30A 1OYAA 5AC7A 4PEEA 2A7NA 1NF7A 3C8FA 1LYXA 3SO7A 1AJZA 2RDWA 1VD6A 1QI3A 1C8XA 3NL5A 1CXFA 1PCWA 4HHHA 3NXLA 2ZRWA 5DY2A 1TE6A 1IEWA 1BGAA 1UIPA 1WNOA 3VK5A 3W87A 4S39A 2NV9A 3M0JA 3O6YX 5HMSA 1DQUA 1F74A 2PCQA 1OHLA 2VZUA 4D6EA 1EA0A 4JTLA 2HROA 3BDKA 1WDQA 3DZ1A 2I56A 3AIBA 4XZWA 3L65A 3TYAA 3LCXA 1PV8A 3PB2A 4DM2A 5HMFA 1KB3A 4HU4A 5HNUA 1A0CA 1V77A 2FHCA 3BOLA 2VGGA 4K36A 5I3IA 2QCDB 4GQRA 1TZZA 3TUUA 1XIGA 3UCDA 3QXBA 2NSXA 3C86A 2RDUA 2GSEA 1EEXA 1E4MM 4N4QA 1RBOB 1MNZA 4E4FA 2HISA 4W93A 3W7IA 2ZFAA 4GZ7A 3VNLA 3VD5A 4N2YA 3TCSA 1R46A 4JTKA 4QP0A 3LGGA 3PJTA 4ICNA 3ZOAA 2GUBA 3L68A 4H19A 3E12A 4O19A 4O0KA 4UC5A 2NQHA 1ZBKA 2WSKA 1HTIA 3BSGA 1P6CA 2WVVA 3SDOA 4ACZA 2YYTA 5IHSA 1KBKA 3YPIA 1YYAA 5LGZA 2OZTA 4QNWA 4UQDA 5CPOA 1FWTA 2E8YA 2FJKA 1NIUA 3KZPA 2CIPA 3RF9A 4QE4A 1UZHA 3DX5A 2QR6A 4PH6A 1J8VA 3EWWA 1FWHC 3AWOA 3BZJA 1U5VA 1ZLPA 2BY2A 4BEQA 1G9HA 3S3GA 3RYSA 4JQ4A 4CKQA 2ISVA 3CYVA 2J13A 4IIBA 2Y7FA 1W31A 4NF7A 3E49A 1E56A 2VCAA 7ODCA 1DWHM 2E6AA 3BAYA 3IGXA 4AB4A 4F8XA 4UTWC 4MG4A 3SY8A 3LTPA 3TSMA 4EPDC 5AZ1A 2PU1A 3E2SA 5DMNA 3WJXA 3L67A 1PKMA 3R11A 3P0XA 3W2KA 4C6PA 2D3NA 4JTFA 1UYQA 3T7VA 4LNCA 4PYSA 1AA1B 1V3HA 4B9YA 3P80A 5I5RA 1RA0A 1I0DA 5F1UA 1E51A 1JUKA 4O0QA 1XLGA 4GGHA 4EVZA 4LAUA 3ID7A 2FIQA 3N17A 4LT9A 2DUAA 1PZ0A 3BAJA 1LCOA 2PGFA 4HHMA 2V5KA 1OVDA 5TNVA 1VBJA 4UNIA 4C6OA 4LQ1A 4OHQA 1GVSA 1E6RA 3WEMA 3AQUA 1V6VA 4FX8A 2PSNA 3RJYA 4O1CA 3COTA 3WMBA 3THAA 1XBZA 3NVDA 1T96A 1EP1A 2FMNA 4NRSA 1ENUA 1EP2A 9CGTA 4GIRA 1GEHA 4WSHA 4GXPA 3HPZA 1FCBA 3L12A 4US6A 1R3RA 2ZZ4A 4R33A 2VT0A 1KGWA 4KT2A 4PCFA 1LRNA 3DFHA 2MNRA 3E5PA 4O1AA 3ARUA 1Q6RA 2A3LA 4GCAA 5EMYA 3SRKA 1W3IA 2VUNA 4F40A 1LF1A 2HXTA 5I3DA 3CNYA 4S3BA 3PS7A 4J40A 2J24A 3SZ8A 3DFNA 2DZSA 3MBFA 1OGGA 1K7XA 2X1SA 1S3HA 4LBRA 5HQMA 8XIAA 4PUJA 4PMUA 2XFFA 1Q3NA 1K6WA 3QHMA 1OB0A 4AY8A 4NY2A 2Z0IA 7REQB 1B54A 1OCQA 3WUBA 4K38A 2DVUA 3CT2A 4ZB2A 3I3BA 3ZS4A 4AZ5A 1REQA 4DUVA 4R9XA 2YA1A 2PFHA 1XSJA 5AN7A 2IPWA 3HJZA 1BVNP 2VD9A 4RW5A 3GE7A 3ARTA 3CUFA 3VM7A 1Q6LA 2E6YA 1M7XA 2HK1A 3D46A 3K8LA 3QV7A 3HG5A 3O06A 4R9OA 2PAJA 2HNEA 4UFHA 4O1EA 3I6TA 3LMYA 3R13A 2E7FA 2PD5A 2A3CA 1XPGA 4GUGA 4H01A 4D2JA 4ZQPA 2DV0A 3G1XA 1HL9A 1NARA 2INFA 3P81A 3R6IA 5AFDA 4GUJA 4O13A 3DIPA 4US5A 1IHIA 4YIWA 2C0HA 2HEJA 4NAEB 3S2CA 1OT1A 5GQBA 4NAFA 4TO8A 4QISA 1W3KA 4LW7A 1C3FA 1C9WA 5HDRA 2UZ9A 3U3HA 1QBBA 1XFCA 3EDEA 1UZ1A 1QPQA 3N4AA 4WY0A 3J7HA 1T99A 1ZUAX 4NNBA 3RIKA 4JTRA 4IP4A 5LNWA 4O1FA 3NDZA 3ZYZA 4FNRA 3BICA 3H2EA 2ZICA 3THCA 1QFEA 4QG6A 1Y5VA 3NVTA 1RVGA 1WDPA 2V69A 3GTIA 1ECEA 4AD4A 3RCYA 3LG3A 4FXFA 1R2RA 2J75A 4OBRA 2PLMA 1AW2A 1EYEA 1HJSA 1NY1A 5U4NA 3M43A 4YHGA 3W74A 4P61A 5H6HA 5A95A 5LNVA 3S5OA 2OYKA 5CSRA 2QCLA 3CZGA 1T41A 1SJDA 2ZUMA 4E8CA 2VJXA 1OC6A 1JCNA 3JU2A 1DBTA 1UWSA 4HNCA 4IPJA 3H21A 7A3HA 3VNKA 2VR5A 1KM4A 4B15A 1ISWA 3TWBA 5AZ0A 3WQ6A 2WV8A 1KXTA 4F2TA 1LL6A 3BLDA 4XTDA 1D3GA 1FWGC 1LJYA 1WAUA 4JYFA 1YE4A 3GQYA 3Q37A 1TV2A 3E0VA 3M46A 1PE1A 4OBTA 4I9MA 2DJLA 1WZMA 4RE3A 1F2JA 4FLSA 3SJNA 1ZENA 2OO6A 2ALDA 4DZ5A 3W7LA 2VEGA 4NZ1A 3TLQA 1SR0A 2H8ZA 1HF6A 1E0WA 4Q8UA 2FKPA 5G2WA 2YBVA 2FYMA 3GHRA 4PSPA 4GI6A 4A21A 1TPC1 4FXRA 4YHEA 2F6UA 2JGQA 1MRAA 4J3UA 3RGTA 5H8MA 2QZRA 2OGYA 3T4CA 3OEXA 4AC1X 1GPWA 1AD4A 3LQLA 5FEZA 3QQ1A 3QEZA 2Z2BA 3C2EA 3WD2A 1PWMA 3AU2A 4NJIA 3U57A 4XZMX 4IIHA 5DQPA 1K4HA 1CGXA 3VOGA 2ZDRA 1FKXA 4PMZA 2Y88A 2Z1VA 4RK8A 4UZUA 1Q8JA 1T8QA 1TX0A 1IWAA 2OGJA 5C2GA 3LX9A 3STEA 4XV0A 2TSYA 4HYWA 2WHKA 2D1ZA 4DAIA 3GO2A 2O7QA 3ZJKA 4QR6A 3A9IA 4IWWA 5IXEA 3W2JA 3KOWA 4LPCA 2F2HA 3LENA 1KBJA 1J0JA 3I3EA 3B4UA 1ZZMA 5A6SA 2R1LA 4WD0A 4YWIA 1BVZA 2ZA3A 2XISA 4DF2A 4F0RA 3TJ4A 5AKQA 2VHLA 1HQTA 3UA4A 4O54A 4UXDA 3FA3A 3DKJA 4CLMA 4A35A 5MKGB 3W2NA 1JAEA 4JN7A 2JIWA 1POJA 5I06A 1W8GA 3OLEA 3MWAA 4UTKA 1X39A 3LI1A 4EWJA 1S2VA 4KCWA 3MCNA 4I6VA 1YDVA 4LYKA 1JL8A 2J9YA 4OECA 1PPIA 1XLEA 1ZBVA 4Q8OA 5BMXA 1ECQA 4QDMA 3ZT5A 4C6BA 4TV5A 3ZM8A 1ME8A 4H9VA 3FKRA 1JPMA 1ZAJA 3MY9A 4Q7IA 3OVRA 3VX1A 4JOMA 3ZZ1A 5LNSA 3WLNA 4H9YA 1DXFA 4Y9PA 2FB2A 1RK6A 4CCCA 4UR9A 2PWUA 4XAZA 4UTUA 1VFHA 5U7SA 4JCMA 4C6FA 4OGZA 3DBPA 4UFJA 4Z2LA 4R85A 1J01A 1OM0A 3WDPP 1CB2A 1MUMA 2Q3RA 5CSSA 3BK0A 3WUFA 2A3AA 1OC5A 5A8GA 1LDCA 1PYMA 4EE9A 3W72A 3RLGA 4W8BA 4DYEA 1BYBA 4GJIA 3A6OA 3TCEA 2D2OA 5A6MA 4NHVA 4FR6A 1UP0A 3DCPA 4D6HA 1P43A 3UBPC 4WVXA 5IBXC 1KLZA 3TJIA 3VIGA 4AYSA 5EKYA 4JDBA 3VKJA 2OWWA 3LMZA 1KBLA 5CC3A 4WXZA 2H9AA 4F2BA 2OO0A 2QCGA 4A22A 2PCEA 2A85A 2F84A 5K4ZA 1WE5A 2QHAA 3U48A 4GUHA 4DQWA 1JYNA 4A3QA 1MXGA 3AHZA 4QDWA 5CJMA 3CT7A 3L5MA 5H2ZA 3PHAA 2VM8A 4MM1A 1XLKA 5TD4A 1S46A 4HSHA 1CXHA 2PWGA 1GTHA 4CQDA 1Q66A 4I7UA 1PIIA 5FOOA 4R53A 4XAPA 2Z27A 1TPVA 4K1GA 2CPUA 1X6NA 4BZYA 7XIMA 4IPLA 3BLFA 3WJWA 3LCIA 5KZDA 3TROA 3E0FA 2C13A 3GU2A 4PCNA 1NTHA 3O63A 2UWFA 5E0CA 4PUKA 1LORA 3G8EA 1IEIA 1XDLA 1KQZA 4HPGA 1FWDC 3G1RA 4UTHA 5FL0A 3GNNA 4DIAA 3CPGA 1GW1A 1RK5A 3VIMA 4BF7A 1TKKA 1EBHA 4L80A 3NOYA 1DJWA 3UA3A 2Q02A 1K77A 4GGBA 2H3DA 1UWUA 3RM9A 1TPFA 1UMLA 5MKGA 2ISWA 3KXQA 3AMCA 3VGGA 4MB5A 3V1PA 3MYPA 4ADTA 1WYIA 4LUYA 1EJXC 3IJQA 4CU8A 1A5BA 4O0ZA 1VFLA 3GH5A 1ITUA 4ZFCA 5EFFA 2VEFA 1H7XA 5HATA 3TDFA 2GQ8A 4HPJA 3A24A 1IXNA 2ZQ0A 3AYTA 3VX0A 2WKLA 1DL3A 3GHUA 5C2CA 3T0CA 3ZWSA 1JZ2A 4W7WA 2QDHA 2F6KA 4RE2A 1BQCA 1K9EA 1SW7A 5FAJA 3KDNA 4LUTB 2PF8A 3G1DA 2CZFA 3PZQA 4CQ9A 3DFPA 3CL7A 4QJ4B 1TZ7A 4E0CA 4GE8A 2WC4A 3HFYA 5LXXA 4DELA 3BW2A 1S5MA 4AFYA 4DBDA 1QW7A 1LQ2A 2X41A 5CLTA 2ALRA 1ZSXA 1FCVA 2XGZA 3T1GA 4AWTA 3GWQA 5TIMA 2F2KA 4MNKA 4V1YA 3F03K 3S8HA 3REQB 1Q45A 1GPFA 4ZFMA 1CB7B 2J7HA 2DP3A 5C8BB 1ZJBA 4M5PA 3CUXA 1R6WA 4S3EA 2C15A 3PZGA 4PUWA 2QPSA 1KTNA 4N42A 3WK0A 2BXYA 4HZMA 1XQKA 3AI0A 2ZVIA 3OVQA 1EH9A 3VD9A 4M24A 4R7WA 3FJLA 4HYVA 2GFTA 1RUSA 4NASA 3HURA 2NZLA 2Z1XA 2OODA 1J2BA 3LPOA 4AWUA 3THDA 2YBTA 4GLEA 3LV5A 4PGLA 3I6RA 4GINA 5LA1A 4PMVA 2YB4A 1CBGA 1RJPA 4H04A 2QUNA 3OJGA 4JTCA 5D05A 5I09A 2VR4A 4YNGA 2J7EA 4YJ5A 2XIMA 4DAFA 4FA3A 2YX0A 5C70A 3WFAA 3GZ3A 3EMZA 1H4PA 1FWAC 4UTTC 1A5LC 2QUTA 4XZ9A 2WZMA 5ECVA 3EKGA 4MFDA 4POCA 4PZVA 1W3TA 2ZUSA 3LM7A 3GG8A 1QO2A 5FJPA 5GNZA 4JS3A 1VEOA 2XH4A 1U1JA 1KCLA 2V81A 3WBAA 1W56A 2GDVA 3GW0A 1EJ7L 1JCTA 2XYLA 3MV11 5L6UA 5DMMA 5KZMA 3W29A 3OVGA 1SJAA 1OCNA 3DH7A 4PBEA 3NZGA 4QNEA 3VGEA 5AVHA 4H6EA 4IP5A 1JDAA 2ESCA 4HHLA 3KTSA 5ABHA 1S2WA 3B8UA 2D2GA 3FK4A 4QLJA 3CGTA 2EPMX 1TMHA 4XD3A 5CBBA 4KWOA 1K9DA 3RPMA 3VFCA 5DCDA 1ITQA 2DZBA 1EO7A 4J2MA 3VE9A 2DY3A 2QKFA 1DIDA 5H8PA 4LUTA 5AHNA 2VENA 6TAAA 1ZPTA 1OIFA 4K8GA 4DUXA 3GKFA 1LOSA 4AX6A 3WLTA 1I2RA 3KBJA 3KVLA 3IGSA 2WB5A 1E9IA 4XKMA 1PVNA 3R5EA 5AYZA 1JDFA 2PDBA 5ABFA 3VABA 2B7OA 3GC5A 3NAVA 2BHUA 5CAHA 4G7FA 3RLUA 3VIOA 2DSKA 4UR8A 4Z0SA 5EFDA 3VZXA 1SMAA 3EDJA 4UTIA 4AZ7A 5AC8A 1C8QA 3THUA 1UWAA 3GR8A 3MDUA 3Q2DA 2D3LA 1P7TA 3TH6A 3H2OA 2JKEA 4KPLA 3C5QA 3M44A 2I16A 1F4HA 1E55A 3U2EA 3HPFA 1FWSA 5HNNA 3A64A 1H60A 1XGZA 4W9TA 4Q4SA 3NM1A 4C6LA 4KWUA 1HP4A 4BI6A 3QPEA 4JN6A 4C1LA 3FYOA 3P14A 2D24A 4FZIA 3URAA 2YIHA 3SQSA 1XYMA 2BHYA 3NQBA 3UG5A 1JAKA 4Q22A 3DG6A 4F9JA 4H2HA 1TG7A 1JVNA 3WD4A 3OA5A 4LWWA 3WENA 2Z24A 1EHNA 2W61A 3KHDA 4J28A 1R38A 3POCA 1J9YA 1W9BM 1UKTA 3TSBA 2V3DA 4DWSD 4X2PA 1BYDA 1J6PA 3W83A 3NL6A 2BHZA 1L2QA 3LI0A 5CAKA 2E9MA 3T0AA 1FXPA 1E6PA 1GKQA 4UFIA 3VYLA 4OZOA 3LXAA 2ZE3A 3P84A 3WNNA 3LBOA 4AVOA 1OFRA 3A22A 2ACUA 2CFFA 1FUYA 2O7SA 3SGGA 3HMCA 1KCZA 1OF8A 3CHEA 3KS6A 3UZWA 4CQ8A 1HJXA 5AECA 3H7VA 1ML1A 5C9WA 4U10A 5DRIA 1RBAA 3VGDA 1TRDA 2CZ5A 1VFUA 4LXFA 3PJUA 4H9UA 4LCSA 3SCVA 2FZDA 1DWJM 4AQLA 2ZTKA 4H41A 1ELSA 4JTEA 1KV8A 2Q71A 3W3OA 5H1WA 2FB3A 1KBIA 4D1IA 3ERPA 4IL0A 3QFWA 1F3XA 3EOOA 4ZE4A 1RPXA 4DXVA 4GRSA 3STFA 3G1FA 4YCPA 4B5VA 3TTOA 3LB0A 3N6JA 3AHXA 5HPOA 4S3CA 4NXSA 1WZKA 3CASA 1NAL1 4NU7A 2YJQA 3DN5A 4C1NB 3BC9A 3UG3A 3MKCA 5E70A 1FHLA 2PP0A 1FRBA 4PL1A 2X40A 4WJXA 2XVPA 5LA2A 3MI3A 2FPTA 4EXAA 3RU6A 4IMGA 3CQ0A 1BSIA 5CGTA 5G1TA 1CW2A 4N6EA 3GU9A 4LYRA 3BZGA 4A6GA 3UR8A 2V5CA 3VOCA 4XX6A 3IVSA 3WBWA 4TVCA 1O12A 4D6DA 1JF5A 3W9ZA 2CEQA 3WFLA 1RQHA 4OOZA 4IMFA 2VCCA 3EB3A 5HR6A 2C14A 3ONBA 4XAYA 4IT1A 1SO5A 5CBIA 2V63A 3BURA 4AMAA 1UUQA 2D2HA 5AHFA 1EDGA 1X6UA 1DJXA 2J8FA 4MFEA 2ODOA 4PRRA 4HA0A 5HQEA 1U33A 1QOQA 1B4KA 3IIOA 1NELA 4CQBA 4K7YA 5F4XA 1MZRA 4C90A 3MVIA 4JHOA 4E2OA 2YA2A 4YN5A 2AQVA 1S39A 1QASA 3CEUA 2ZWZA 1YDYA 2EJ1A 5AHEA 4LNYA 2QUMA 2G37A 2INZA 2XU2A 5F4WA 3VO0A 2PDXA 1CDGA 3NQFA 1R9YA 3AIUA 4F66A 4MNLA 3W6MA 3QPZA 4MHBA 5C7VA 1T0OA 2GJNA 1XIEA 4GABA 1MQRA 3V5FA 1RHCA 3CIWA 1TR9A 5BRPA 4CEXC 1H5VA 1I2PA 1TTPA 1R30A 4QHRA 5CSUA 4PMNA 2IQ0A 3P8IA 3VPLA 2DW7A 5BRBA 3UJFA 1LP6A 3WQWA 4XD4A 1R2SA 4B5NA 3OZPA 4KEVA 1SO4A 3EXRA 3PZUA 1SFSA 3VTRA 3TU9A 2WLYA 3HG2A 1XIJA 1LG2A 4AY7A 5LA0A 5HUPA 3D5HA 1OD0A 1VF8A 3A9BA 3MKKA 5D2TA 3B9OA 1ZJHA 2ZIDA 2WNNA 1CENA 5CG0A 4IQJA 4L6HA 1PX4A 3QSRA 2OPJA 2AGKA 1AG1O 1H41A 3CQKA 3MO4A 2AGTA 4PTDA 3GXFA 1UH2A 1XG3A 3PBGA 1K03A 4C6IA 5A6BD 4MB1A 3QMSA 3FA4A 3SQMA 5IRPA 3QQ0A 4RZBA 4QE1A 1GKRA 1PYFA 5FI8A 1QCWA 4B3ZA 4Q8MA 2FZNA 2V0TA 4MLJA 1UH3A 2XFYA 4FK9A 4ERAA 3PTMA 2WJZA 1FH7A 4YU1A 3EBVA 3SAZA 3WY1A 1IGWA 3G1AA 1OCBA 4C1NA 4WIWA 4J27A 4PTVA 5HMDA 2PWHA 4IFOA 2RGLA 3OW1A 2HS8A 3RX2A 3VA8A 4GVIA 1Q63A 3E3HA 6ALDA 2QDDA 4UCFA 3RNDA 3W1NA 3F2DA 4Y9OA 4LY8A 1TSIA 3G3MA 1XINA 2VZOA 3BVJA 4AEEA 3C8NA 1KFWA 3WFZA 2C1HA 3BO9A 1JZ7A 5A6KA 3W1TA 3TEVA 1PL9A 3OA3A 3A5FA 4O14A 1YIXA 2WCGA 5FF2A 3AXIA 3MTWA 1H1NA 3M47A 1XIMA 4UBPC 2FPYA 2POZA 3O7UA 1FY6A 2VD8A 4QG9A 1NFGA 5AHLA 3EWUA 5HJLA 3ITVA 2BWGA 4JIEA 2GSJA 4GZJA 1QOXA 3SUTA 4D8LA 5SWUA 3EWXA 3K30A 2VWSA 5CC5A 5JH1A 1UD2A 1JUEA 1H7PA 3B0VC 5DXYA 4JX4A 3QZAA 3QZEA 3VDAA 3WQPA 3BGJA 2BVWA 4HJFA 5HK4A 3TC3A 3IGHX 3V0SA 2NLIA 1O6IA 3QRHA 3ABSA 3WYZA 3WLOA 3PBWA 2CLHA 1P1XA 2GGHA 3KVMA 3WEOA 1AQMA 2C0AA 1DHPA 3PJXA 3VCCA 4KQNA 3PSVA 5LIKX 1HVXA 1S5VA 5FJUA 1XLCA 2AL1A 8RUCA 2VFIA 4TV6A 2G4FA 3STGA 3T6CA 1BD0A 3PBYA 4X0NA 1RY8A 4ZMGA 1OINA 4BCEA 1VCFA 1MQQA 1US2A 3L2IA 3CWNA 3FV9A 3PSWA 1GVQA 4U5KA 4W5ZA 2QUUA 4ZOAA 5AYBA 3OYXA 1XC4A 3F2BA 1PUDA 2ZUWA 3RMJA 3TMQA 2W0UA 3Q58A 2D0FA 1NF0A 2ZXAA 3CV2A 3B0YA 5KTLA 3QC0A 2GVLA 1DWIM 1A5MC 2GLKA 4YMZA 3PY2A 1SGJA 2BZNA 1E5JA 2FTWA 2VX4A 2XJ7A 2HE8A 4J3TA 2PDYA 2PTDA 3M0YA 1VPYA 1TWSA 3LHVA 3NNTA 5KSWA 3OYZA 3VGHA 4LB3A