5I2UA

Crystal structure of a novel halo-tolerant cellulase from soil metagenome
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
296
structure length
296
Chain Sequence
SIVAQNGRLQVIGTQLSNEKGEPVVLRGASLGWHNLWPRFYNKNAVQWLADDWKCTVVRAAMGLEIEDNYRENPEFALQCITPVIESAIENGIYVIIDFHAHNKYTEEAKTFFAGMAEKYGEYPNVIYEIWNEPDYFEWEEVKTYSEEVIAVIRAIDPDNIILVGSPHWDQDLHLVAEDPIRDVSNIMYTMHFYAATHEAWLRDRTDEAIAKGIPVFVSECGGSEANGDGRLGIEEWKTYVDWMESRKISWVAWSVSDKNETCSMLLPRASADGNWTEDLLKPWGKLTRNSIRNAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of a novel halotolerant cellulase from soil metagenome
pubmed doi rcsb
source organism Soil metagenome
molecule tags Hydrolase
molecule keywords Cellulase
total genus 119
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i2uA00
1JYNA 2BY2A 1WDSA 1UA7A 3DHPA 5DEZA 3UG3A 5ABHA 2VRKA 5GQBA 3LMYA 2G3MA 3T2PA 3F5KA 3NJ3A 1C90A 1WNOA 3ALFA 2XJ7A 1OINA 5CGMA 4AD3A 2ZWYA 4Q22A 3L4ZA 3PTKA 5A6JA 4HU0A 3SCUA 4E8CA 3AIBA 2CXGA 3ZIZA 3VGHA 3A4AA 4UR9A 1UD2A 4UFLA 2Y5EA 4PMVA 3K8MA 1DEDA 2VMFA 3WQ5A 4LQ1A 3BC9A 2ZUNA 2O9PA 4OZOA 2ZUTA 3DECA 3CPUA 1VEPA 2PBGA 4WLCA 1E6QM 4UQEA 3VD9A 2AAAA 2PB1A 5A6SA 4OOUA 2YL5A 4EK7A 1EOMA 3K4AA 1EQCA 2XFRA 3F5LA 3PZNA 2J7BA 2BVDA 1DTUA 2DT0A 4MJ4A 1JYXA 3WD0A 4XUYA 2V5DA 1UWQA 3AOFA 4AYSA 1DWHM 2ZX9A 3AHVA 1HIZA 4D6IA 3PZIA 4ZXOA 3U5YA 1VB9A 1XH2A 1JDDA 3WIJA 2QLYA 1CXHA 5I78A 3TOPA 1J01A 5DFAA 2A3AA 4TTUA 4CN1A 1W9PA 4AWEA 3W37A 2F61A 4AIUA 1H5VA 3CZGA 3NSMA 2G3IA 5A69A 4KGJA 2D20A 1ISZA 3NIYA 1JFHA 3DYMA 1OWQA 3KZSA 4P8UA 4CD7A 1J0IA 2XWEA 3POHA 2E4TA 1CGXA 3OG2A 5A2CA 3ARRA 3M7SA 4PMXA 4ATWA 5E0FA 3UR8A 3FXYA 4AD2A 3F4VA 1KXQA 2A3CA 1B1YA 3HN3A 3GH7A 4TX6A 3QR3A 4QAWA 3U5UA 4MNMA 2DSUA 4J3XA 4UCFA 4DUWA 5I23A 1AMYA 3BLPX 1UR8A 1TVNA 2BV9A 2DIJA 1QNRA 3AS1A 1XSKA 5DT5A 1QNOA 4TXEA 3ZT7A 4BQ3A 4DM2A 4GIAA 4GQQA 1HP4A 1GW1A 2NSXA 2ZOXA 1E6NA 4B3LA 1KXHA 1E6PA 1XH0A 1W32A 1W1TA 2JIWA 5CSYA 3VM7A 4Y7EA 5IXEA 2JF7A 1IZKA 1NARA 1PZ2A 1R85A 4MB3A 4Z2LA 4M24A 3IAQA 1HJQA 3RPMA 2VUYA 3ZSSA 4NF7A 3VIIA 2XFFA 2HISA 5I77A 1JI1A 1EQPA 2XVNA 1FH7A 2WHMA 2WWDA 1GVYA 3AIVA 4C7GA 3PZOA 2G8ZA 4JFUA 1KWKA 1H11A 4P8WA 4CKQA 3VD3A 3CIVA 3A4WA 3UERA 2TAAA 1W91A 2VRQA 3WEZA 2W92A 1B30A 1JZ5A 1J0JA 3WQWA 5KEZA 4YHGA 2XSAA 2YA2A 5BYWA 2VCBA 4CU6A 1R87A 4U3CA 1DWJM 3CHCA 3WL1A 1BG4A 3GNPA 2WZIA 2W63A 2ZX6A 1MQQA 1NWTA 4FLRA 4TVDA 5F7UA 2CHNA 5D9OA 2ZXAA 1C8QA 4FF5A 2WWCA 3AHYA 3BSHA 4GZIA 3EMQA 5EFFA 5GNXA 1C92A 4GO9A 1I1XA 3KE0A 1VBUA 3WEOA 1KWGA 4ACZB 1UQYA 3VX0A 3WD3A 1GOKA 1GVIA 1GUVA 1ITXA 6TAAA 1S46A 1H3GA 4HZ7A 1V3LA 1NP0A 3LPGA 2BHUA 3OLGA 1JNDA 3T09A 1PX8A 2F2HA 2E3ZA 2DQXA 2RGMA 1VFUA 3UR7A 1OT2A 3WL0A 1UWSA 4AY1A 1U33A 2IUZA 2D0HA 1FFQA 1H4PA 1V6XA 3VIGA 2E8ZA 4LYPA 4DWSA 2RGLA 4BQ2A 1XC6A 2PWGA 2W62A 3GNOA 4Q7NA 5BROA 4PCTA 1UWTA 4HP5A 2FH8A 3ARPA 2CPUA 1EHNA 1KR0A 3EDJA 2VQTA 5I79A 5E0CA 1V3MA 5BXTA 3CZLA 1JZ7A 1E73M 4W85A 4L4PA 3AHTA 2J7GA 1R7AA 4P7OA 6A3HA 1UR4A 4TX8A 4AD1A 3WH6A 1CTNA 1MW2A 1F4HA 1QHPA 5D4YA 4JAWA 4WKAA 3MMUA 1FH9A 1N82A 2WLZA 4UFMA 5LA1A 1V3HA 4U5KA 2WHLA 2QV4A 1MQPA 3WQ4A 2J74A 1ZBWA 1ISVA 4R27A 4IM4A 3GTNA 1HKMA 2E40A 3NDZA 3SCWA 5M03A 5HXMA 3VDBA 2VX6A 3CUJA 4CD5A 4TOQA 1EO7A 3GYCA 1E4NA 3VGGA 2V3FA 2DH2A 3AHXA 3OGRA 4JFWA 3WF0A 4CVWA 2ZXQA 3G6LA 1CXFA 1E6ZA 1C3FA 1B31A 4AXNA 2BNJA 5M5DA 3AHZA 5BXRA 1LQ0A 2FH6A 3VD7A 3D5HA 3M07A 3CH9A 2PWFA 4HZ6A 2WHJA 4HZ8A 3RMEA 2WLYA 2UY3A 3I3EA 1WZMA 1EGZA 3GXFA 4JKMA 2J7CA 3AYSA 3AIUA 4M1RA 4H8HA 3N04A 3ARZA 3VDHA 4HOXA 5LA2A 4IPLA 2WPGA 2VC9A 1KFWA 2D0FA 2E9LA 1XGZA 4WKHA 2Y2WA 2XYLA 5IHSA 2G4FA 1QNSA 3CMJA 4W87A 1MW0A 3WF1A 1HNYA 1ISXA 3B9EA 1A47A 2WMKA 1V0MA 2YBTA 4CD8A 2IXUA 1EXPA 1QBBA 3RJYA 2WK2A 4MB1A 4P7QA 1M04A 2VOTA 4ACYA 1H41A 1JF5A 3AI0A 3L4VA 1TMQA 4NRRA 4OBRA 1HJXA 4HOWA 4HA1A 4J3VA 2YA0A 1OGGA 1HF6A 2V3DA 1VJSA 1OT1A 1I1WA 4W8LA 3TP4A 3ZJ7A 1XSJA 3VIJA 1NM9A 4BS0A 1D2KA 4EKJA 4ACZA 2D1ZA 4W88A 5A6BD 1J11A 4JFTA 2GK1B 1JYWA 1KQYA 4L4OA 4U31A 4JIEA 3JUGA 4KH2A 2D3LA 3EYPA 5E09A 4E4PA 3WNOA 2XIIA 5A3HA 2J8FA 2YIHA 1EH9A 2WC3A 3IAPA 4JHZA 4PSPA 1BG9A 1E1EA 3OLDA 3RM4A 3CZEA 3KL0A 3L2LA 4P8XA 3ARYA 4FLSA 2C0HA 4LPCA 3ZJ6A 3CHDA 4UQ9A 3KEHA 1HL9A 1DHKA 5CPTA 1GHRA 4V27A 1DWGM 1FP9A 1Z32X 3WNLA 1XRVA 2A3EA 4AZ7A 2J77A 3AZTA 3AIEA 1OGBA 1E72M 1UYQA 2C7FA 3VD5A 5FL1A 2BY0A 1ZJBA 3MKKA 2YDSA 3AXHA 5KZ6A 1F4AA 4MNJA 5CXPA 4P7NA 4C7FA 3AS0A 4PMYA 1JD7A 1RP8A 3B8SA 3WH8A 3VUPA 3PBGA 5A2BA 2Z1SA 4W5ZA 1K9EA 1U2YA 2WSKA 2YDQA 1JD9A 2WCGA 8A3HA 5HOSA 2VL4A 2GK1A 2ZUVA 3MV11 2G3NA 1KXVA 2WVTA 2VZUA 2IXVA 5A6MA 4AZCB 1BSIA 3WNMA 3EDEA 1EHAA 1NWRA 3VMOA 4MDOA 1EA9C 2PF0A 5A6KA 2UY4A 2O9RA 1M53A 3GBDA 4CN4A 4PTVA 1QPKA 2O92A 1QI5A 1V02E 1B3YA 1BLIA 2NT0A 1ZL1A 1JG9A 1BGGA 1UUQA 1PZ3A 3SUSA 4WKFA 3SUWA 5AC5A 1MVYA 3L4YA 5BXPA 4UOQA 3ARVA 4A3HA 1Q6GA 2BVYA 2G41A 1UA3A 1EDQA 1XCXA 3N17A 4ZENA 1NOFA 4W93A 4NZCA 3WMBA 3HU7A 1CENA 4D1JA 3WQ8A 1UD4A 5FIPA 4AZHA 5I2UA 4A4AA 1D3CA 4YPJA 4D6JA 1L8NA 2EBNA 3FAXA 3UEQA 1QBAA 1CDGA 4PTMA 3NDYA 3VU2A 2O9OA 4KWUA 4AD5A 2YJQA 2EEXA 4GI8A 3T08A 3WQ6A 3J7HA 4JCLA 4AD4A 3WELA 3OLIA 5I3DA 4JFVA 2X0HA 3BSGA 2CNCA 2WC4A 5IFTA 1QNPA 1W9UA 1MW1A 3OB8A 4AZCA 2V3EA 5LA0A 5DT7A 3O6AA 1MFUA 4MB5A 1UOKA 3O2LA 2XVPA 5HBFA 1MW3A 4HPHA 1SFSA 3GH5A 3AMKA 4GI6A 1C91A 3IK2A 3G6MA 4J27A 1C7TA 2WVVB 3AIWA 4D6DA 2J4GA 2VCCA 2D3NA 1SYTA 4PMDA 1JZ4A 4F8XA 2J7FA 1Q6FA 3FHQA 2X0YA 3SCQA 4BZYA 1KGUA 1CLVA 4WF7A 2XVLA 1TR1A 1VAHA 4HMCA 1B0IA 1K9FA 3EBVA 4DWSD 4AD0A 4KGLA 4DM1A 1X1NA 2JEPA 2AOSA 2X2YA 1MXDA 1JZ2A 1PJ9A 1BYCA 2Y4SA 1TA3B 4MNLA 1W1PA 2VI0A 1J0KA 1AQ0A 2VZTA 3T0AA 1HVXA 1WDPA 3WFLA 1J9YA 2BY3A 3GDBA 2XGIA 1E6XM 4PSRA 2V5CA 3A47A 2ZX7A 3ZR6A 1G01A 4GO8A 1W9DM 4JL1A 4J3TA 4HMEA 1XD1A 4QCFA 1JI2A 4DWSB 5IHRA 2XM2A 4PBGA 3ZQ9A 5A2AA 1V08A 3N1AA 5A8MA 1NWSA 1WZLA 1E15A 3PZVA 4MJ2A 3WNPA 4MPKA 1LF1A 2JALA 5A6AA 3GXMA 2DT2A 3HJEA 1E4IA 1UKQA 4ZE4A 2CEQA 4UFKA 4WSKA 4X9YA 1V6WA 4GXPA 2ZX5A 2PBOA 2J8GA 5BRPA 4PMZA 1C7SA 1NWUA 1QNQA 4U3AA 1CBGA 1HKIA 3PZMA 3AZRA 3L4TA 1YQ2A 2XVKA 3WMSA 4N42A 4BQ4A 4Z2HA 1SMDA 3VTRA 4BF7A 4B16A 3ARWA 2WVVA 2E8YA 4JL2A 5DF0A 2WVUA 2XG9A 4U2ZA 2OYLA 5GNYA 1UZ4A 1FP8A 1GJUA 3K1DA 1V3JA 4UFIA 3TTOA 3CO4A 4FLQA 3SIMA 4B15A 1UR1A 1UKTA 5C70A 3SCOA 5AYIA 1KBKA 1PX4A 4PRWA 3POCA 4U2YA 1B90A 2XWDA 1JZ6A 1OIMA 2FGZA 3VO0A 2YLAA 3W53A 4F9JA 2XHYA 1JYVA 3L4UA 1BTCA 4UZSA 1TUXA 1G94A 1E0WA 4W89A 1K6AA 3T0DA 2DIEA 1W1VA 5HNNA 1HN1A 3BAIA 3W25A 3GZAA 4C7DA 1VFOA 2Q8XA 1W9BM 4CN6A 2BHZA 1GONA 2OYMA 3W6LA 4HPGA 1J18A 1UKSA 4BCEA 1UH3A 4E2OA 2WKGA 4WK9A 4AISA 2VZSA 1LG1A 2GSJA 4CCCA 2WMHA 1CXEA 4AEFA 1V0NA 5FL0A 3WD2A 4H41A 4IISA 4HTYA 4M80A 1O7AA 3WH9A 2WZHA 3W6MA 1GQIA 2JE8A 2XFYA 1B3XA 3SCRA 2VX4A 1G9HA 1Y7VA 3OZOA 4D72A 3AMGA 4JKLA 2WKLA 3OGVA 1CXIA 1BPLB 1IV8A 5D9PA 4LYRA 3IJ7A 1ODUA 3WD4A 4RE4A 4EANA 3VINA 4DUVA 2BS9A 4AMCA 1JGIA 1NQ6A 3BCDA 1QW9A 5E6ZA 4DUXA 1G5AA 1MWOA 1OM0A 4B9ZA 3N15A 4UNIA 1CXKA 4PN2A 1VJZA 2FHBA 4TVCA 1UKOA 2B31A 2EQDA 1V03A 3ARXA 4OBSA 1LLOA 5JUVA 4JCMA 3K8KA 2VT0A 3WF3A 1E5NA 3BGAA 1R8LA 1UZ1A 2NW0A 3I3DA 3MMWA 1BYBA 3EDFA 4CCEA 4TUFA 3QGVA 2VZVA 1W3KA 1WDQA 7TAAA 4ZXLA 2OLHA 2ZX8A 2FHCA 1J12A 4FLOA 5I24A 3SUVA 4A3YA 4WJXA 1MYRA 1GOQA 3VILA 1CGUA 4KRUA 2GFTA 4GI9A 1BF2A 3BAXA 4BA0A 4HU8A 4ZEPA 3THCA 2EPMX 3AFBA 3F5JA 3U7BA 2EPOA 4LGXA 2BFGA 1J0YA 4FMVA 2XUCA 1FFRA 1VENA 2CBVA 3GH4A 4EAMA 2W5FA 4NSBA 2J7HA 5JBEA 2VR4A 4DWSC 4MNKA 3UESA 2GJRA 4PMUA 1UKPA 3TONA 1L0PA 3M6DA 1HVQA 3ZOAA 3VIOA 1VEOA 5A94A 3VGBA 2OWCA 1A3HA 1FHDA 3VGDA 4D6CA 1WE5A 1Q6DA 2E9MA 2EXOA 4J28A 5BXSA 1BFNA 1JZ8A 3CZJA 1CIUA 2XIBA 3LPFA 4QLJA 1K9DA 4M82A 1JXJA 1V0KA 1XCWA 2OWWA 3TA9A 3KL3A 4W7VA 1GQJA 4LYQA 3VIFA 4P7RA 2VO5A 1TE1A 1B3WA 1CZ1A 2DEPA 1P6WA 3N12A 1C93A 1SMAA 2FDMA 5EBAA 3II1A 1R7OA 2J78A 4PMQA 3WDPP 3PHAA 4GINA 3VIPA 1BYDA 1ISYA 4J3UA 8CGTA 4AZ5A 2YL9A 5A1AA 2PWEA 1SR0A 3ZT5A 4GQRA 4Z2KA 3PZUA 4AIEA 1WCGA 1H0IA 2JF6A 4LX4A 4J3SA 4V2XA 3WBAA 2CETA 5CPQA 2X8RA 3W82A 2WMIA 1H2JA 1IT0A 3PTMA 2WMIB 4ATLA 1HKJA 4U5IA 1CPUA 4S3KA 1UWRA 3UCQA 3FHAA 3VIMA 5JIWA 2VVSA 1NOUA 1K9TA 4J7RA 4ATDA 1MQRA 3VNZA 4IUGA 1DP0A 1NH6A 2WNWA 2PWHA 4HA4A 3NUKA 1XYZA 1V3KA 1XHGA 4URIA 1AVAA 3CLWA 1W3HA 3GBEA 3U7VA 1J0HA 1EDTA 4D6GA 4FK9A 1HJVA 3WDHA 2J62A 3WQVA 2W4XA 2J7EA 1AQHA 3WNNA 1UH2A 3NSXA 4PYSA 5D9MA 2D24A 4X0NA 2Y8VA 3MS8A 1XD0A 1X6LA 1H0GA 5M3WA 3WH7A 2F8QA 2PI6A 5EMYA 1UQZA 5GNZA 1X6NA 1XH1A 2DSVA 4K68A 2ZWZA 3QHNA 3VVGA 3CZ8A 3APGA 3AZSA 1WPCA 2O9TA 4CU8A 3AROA 1V3IA 1ZB5A 4PUEA 2CIPA 2VTFA 3T2QA 2DT3A 2WYSA 5C8BB 1RD6A 3NYDA 5I0DA 1GOWA 3WENA 2J47A 1C8XA 3WH5A 2AMGA 1E0XA 3UETA 4H7VA 1PIFA 1LG2A 4JHOA 1W3JA 4QLKA 2JEQA 3BAKA 4OJYA 4W86A 1BGAA 2WBGA 1V6UA 3IJ8A 5A6BA 5ABEA 1UWIA 1E70M 2QHAA 4IPNB 1QI2A 2CCRA 2VURA 2D22A 2DH3A 3WUBA 3BMVA 2BY1A 1UR2A 1BHGA 2QPSA 3RDKA 1WZKA 1ECEA 1LWHA 5HDRA 2GJPA 1QI0A 1M03A 4X0VA 3SCSA 2VZOA 2WM0A 1PAMA 3EMCA 3QHMA 3VGFA 1UG6A 5GPRA 3KL5A 3RCNA 3A6OA 2OWXA 3RILA 2DSWA 1EIBA 6CGTA 1UR9A 3QOKA 4XZBA 2WMGA 2CITA 3EDDA 4MADA 3SCPA 1JNEA 2W61A 3NCOA 1OIFA 4D6HA 3GNRA 1US3A 1WKYA 2A3HA 2XSBA 3VX1A 4Z2JA 4V28A 1XV8A 2D0GA 1TA3A 2Z1KA 4UOJA 2CERA 4GPNA 1W9XA 3FN9A 1UH4A 1GORA 3MSDA 5C71A 2PWDA 3CBWA 2WMFA 4UZUA 4D6FA 5CJ5A 4NRSA 1HP5A 1UHVA 1KXTA 1W2PA 2YKKA 1GQLA 2X09A 2JFEX 3BMWA 4AEEA 3W0KA 3VOCA 3EDKA 3ZR5A 1HXJA 5I6SA 2VCAA 4D1IA 2VX5A 4GZEA 3BAWA 3T0BA 3AMLA 4YHEA 5ABGA 5DMYA 3WDIA 4HMDA 1BQCA 1DWAM 4HA3A 1CGVA 1QOXA 1LL6A 1WP6A 3AMDA 3OIHA 5BWFA 1KR1A 1BYAA 3NSNA 1PPIA 2WANA 3VD4A 4AZBA 4RE3A 2WCAA 3THDA 3PZTA 1VIWA 3VDAA 3AYRA 2VX7A 1E55A 1EO5A 2FHFA 1GHSA 2A3BA 4AZGA 3ALGA 2VJXA 2WW5A 1GPFA 5D9NA 4S3JA 1UWUA 1ODZA 3ARSA 3PZ9A 1OSEA 5HPOA 3WF2A 2YA1A 5A8NA 1ZBVA 3WY1A 2YDRA 2ZUWA 4Z2GA 1E1FA 4PMOA 5CGTA 1D7FA 3RO8A 3N13A 2CBUA 1W1YA 1MXGA 3OBAA 1VF8A 4E8DA 5AC4A 3E1F1 1KCLA 3BH4A 3MUAA 3S2CA 1U30A 3LPPA 4GZJA 1QW8A 3CUGA 2ZUMA 5EFDA 4H8UA 4QP0A 1HJWA 1CEOA 3AICA 4H04A 1CNVA 1V6VA 2ZIDA 2W67A 2DGAA 3TTQA 2BXYA 4XB3A 3KWXA 2YL6A 2YOCA 4OOZA 5ABFB 3B9AA 1O6IA 5IDIA 5A95A 3RM8A 5HPCA 1ISWA 3SUUA 3U57A 4RL3A 1E40A 1EDGA 4M56A 3VKKA 2J79A 3BAJA 5A8PA 4JKKA 2CHOA 3CZKA 3MUZ1 1ESWA 2BXZA 4CGTA 5FOOA 3PN8A 2CBIA 1HT6A 4PCSA 2GDUA 4OUEA 1J10A 3DHUA 4UFJA 2J25A 4YN5A 4H8VA 1CYGA 4QFUA 1WAWA 3K4DA 3VM5A 3WSUA 3CUHA 2OSXA 4PTXA 2VNCA 1M01A 1I75A 3OZPA 4TTGA 4D6EA 4UTFA 1ZS2A 3VMPA 5CPSA 1E43A 1GOMA 2WXDM 2HVMA 3CMGA 3A3HA 3MUY1 4HOZA 1ITCA 1VBRA 4TVUA 1E9LA 1ZU8A 2V3GA 3ZJ8A 1VEMA 5E9AA 2GVYA 2XTKA 1KGWA 3WMCA 2J75A 2BVTA 2OSWA 3L4XA 5CLTA 2WMJA 3T2OA 1CWYA 4PTWA 4Z2IA 5JBDA 3L2MA 1V02A 2QPUA 2JIEA 5EB8A 3SURA 4PEEA 3AIRA 2ZXDA 3SCTA 2ZE0A 3A4XA 1ZBKA 3UG4A 1JFXA 3RIKA 9CGTA 3MSGA 1JAKA 2DT1A 3D3AA 2XM1A 2WSPA 3WUFA 5CLWA 1NOWA 4N0RA 4F9DA 3AS3A 1GCYA 3ZM8A 3AMCA 2YL8A 4U33A 4AW7A 1CGYA 2WBKA 2WCSA 3FAWA 1XSIA 3PZQA 3W4RA 2VQUA 2X1IA 4CD6A 4NI3A 3PTQA 5JIPA 1R86A 2CYGA 1W3LA 5CQ1A 1QHOA 3TTSA 1V0LA 5ECUA 3VIHA 4CVUA 1KCKA 4UOZA 5JBFA 2QMJA 2WHKA 3AXIA 3CHEA 5E70A 1GJWA 3RM9A 2W91A 5A8QA 5CG0A 3GM8A 2UY5A 1JZ3A 1WO2A 3VNYA 3DYOA 2BHYA 2E0PA 3AXXA 4AIOA 2WC7A 2WZEA 4GKLA 1NP2A 5A8OA 2DSKA 3WKZA 1BAGA 4W7UA 4F66A 4MTVA 3PZGA 2GJXB 2XPKA 3ARTA 1KB3A 4BQ5A 1M7XA 5FCZA 1JL8A 1VFFA 5A6LA 3AJ7A 4LXFA 3MANA 2GDVA 3QHOA 1FH8A 2MANA 1E3ZA 3MV01 1RH9A 3ZJKA 3CUIA 1GOIA 2J7DA 4M8UA 2DSZA 1E6SM 3WN6A 3BAYA 3TTYA 3UG5A 1PX3A 4R5EA 5FD0A 4WIWA 1HJUA 3ZSTA 1Q6CA 4CUCA 1H1NA 3AS2A 1AQMA 1CLXA 4W8AA 2YLLA 3N11A 3WDRA 2FGLA 1FA2A 1JF6A 4KRTA 5D8ZA 1CGWA 1G1YA 3DYPA 5FKYA 2W66A 1UD3A 2G3JA 1CECA 4PMNA 4JFSA 3M46A 1ZJAA 3ZT6A 4QDMA 1E5JA 1JIBA 1W2VA 3AIQA 1PEZA 1G0CA 3SEPA 1JAEA 1Q6EA 1KBBA 3W29A 2CESA 1MFVA 5AYBA 4OKDA 4CCDA 1GQKA 3K8LA 1TVPA 1ZBCA 2YBUA 3O9NA 1B3ZA 3N18A 3WFZA 2GJXA 2XGBA 2WB5A 3B9DA 4ZFMA 1KGXA 5BRQA 4OIFA 3RJXA 3WDQA 1H09A 1QI3A 2EPKX 1LL7A 4RE2A 4UQDA 4PMRA 1GOOA 3DC0A 5E6YA 4QLLA 4CD4A 4CU7A 2ZUSA 4XZWA 1HX0A 3SCNA 1DWIM 1E71M 3FY1A 3OLEA 2C8NA 1Q4NX 1OD0A 1PIGA 1J0ZA 1HKKA 5I5RA 2WAGA 2X05A 4F79A 5TD4A 4AZIA 2V38A 2CKRA 2Y24A 1OD8A 1IZJA 3ARQA 4AC1X 3HMCA 1BVZA 4XX6A 1FHLA 4EE9A 2CKSA 3BLKA 1JXKA 3ARUA 3WBEA 1XYFA 2QMKA 1B9ZA 2DPEA 5D8WA 1OBAA 1LWJA 3VMNA 3VGEA 3CGTA 1GZJA 1WB0A 3CHFA 5CZKA 3SUTA 1WZAA 4ML4A 5BCAA 7CGTA 1E4LA 1TG7A 1PBGA 1UD6A 3VIKA 3LPOA 2ZXBA 3VDCA 2CBJA 3WEMA 1W9VA 3MO4A 1OCQA 2UY2A 4PUDA 1JDCA 1CGTA 2QF8A 3AISA 2NT1A 1RP9A 4W7WA 3CTTA 3WDJA 3ECQA 4UFHA 4MAZA 3S6TA 3GXIA 1OGSA 1WDRA 1C8YA 1RPKA 2ESCA 4B3KA 3CUFA 1E56A 1QHZA 5DO8A 3SCVA 1LL4A 4UQBA 1E4MM 1KQZA 3WF4A 3ZMRA 5ABFA 2E9BA 2GUYA 4D71A 1DWFM 2VVNA 3I3BA 2XVGA 5IFPA 4J3WA 4W5UA 3W81A 2EO7A 4XV0A 3W28A 4JZ5A 4MAVA 1EOKA 3WD1A 1JDAA 4W8BA 2Y8KA 3GXDA 3FW6A 1V6YA 2D23A 3L4WA 4MDPA 1UD5A 2ZICA 4ZE5A 1YHTA 4W84A 4UQCA 4M29A 1US2A 3FNDA 3WNKA 4AZ6A 1QVBA 3BCFA 1TCMA 2EPNA 2ZUUA 5CSUA 4MB4A 3W38A 2VRJA 5AY7A 3AQUA 3W27A 3W24A 3N9KA 3QOMA 2WVSA 3OA5A 1UD8A 2UWFA 3K46A 1TFVA 3MUIA 4B9YA 2OYKA 1B2YA 4P8VA 5M17A 4UQAA 5LYRA 1B3VA 2VR5A 1HL8A 1CXLA 1E6RA 1VFMA 4M81A 4WSJA 2EJ1A 2EPLX 3IJ9A 1HJSA 4KMQA 1TZ7A 3IANA 3BXWA 3W26A 1E3XA 1QI4A 4P7LA 4H2CA 1GNXA 1UR0A 1FOBA 2OSYA 3MU7A 2DDXA 3ZO9A 3WUGA 1E0VA 3EMZA 1BVNP 4QCEA 3MMDA 1LJYA 1H49A 1VRXA 2PC8A 2D2OA 3VPLA 3WUEA 1OB0A 3OGSA 7A3HA
chains in the Genus database with same CATH superfamily
1ZQ5A 1JYNA 4O8AA 2BY2A 4IIEA 1UA7A 1Y8BA 3ITCA 5GQBA 4PFMA 2G3MA 3NOYA 4EF9A 3BARA 3QPEA 3WLOA 3LD5A 2I5QA 1OINA 5TQLA 1A5KC 3MDUA 3H12A 1ZGDA 3SCUA 4E8CA 3NZ1A 1PCKA 1EJSC 4GWEA 4WXYA 2DW7A 1FWWA 4PMVA 1DEDA 4JTGA 1DIDA 4MWAC 2BSLA 3SB0A 4AXKA 1A50A 2ON3A 4XBKA 2Q8ZA 4NNBA 1ZENA 1I0DA 4OZOA 2C71A 3DECA 2QVNA 2QIIA 2PBGA 2AAAA 2GGIA 3CYVA 1EOMA 3DENA 4QITA 3B06A 4DWDA 3QTPA 2ZX9A 4Y9AA 2NV2A 3PZIA 3NL3A 2A1YA 1XH2A 4J4KA 2B4GA 1JDDA 1M41A 1W5OA 2R1NA 2OLSA 1X7FA 2Y70A 5LIUX 5I78A 1J01A 1EYWA 5DFAA 3T8LA 4CN1A 1GT8A 4KKXA 4DJDC 4AWEA 2F61A 2HCVA 4KGJA 1JFHA 3DYMA 1OWQA 2NUYA 3KZSA 4CD7A 1P1XA 1Z6KA 3LMZA 4QISA 2HS6A 4JQ2A 3TJ4A 3FXYA 3P61A 1R3QA 3LCIA 4QM1A 1OYCA 2E1WA 4MNMA 1ICSA 2DSUA 4FX7A 2Y7EA 4LVAA 4GCAA 4M6UA 1DTNA 3BG5A 4UCFA 4MOZA 3C2EA 2IKHA 1G4TA 1ICQA 1LTDA 1XIFA 2PSNA 1PL9A 4L1WA 1YEYA 4ONVA 2OEKA 1HP4A 3WBWA 1GW1A 1MEIA 1P1MA 3SI9A 1V7AA 1P4CA 4N4PA 4O54A 2OTDA 1Y5VA 3OJGA 2JF7A 4XKYA 3TIMA 1SQ7A 4IZGA 1SZGA 1AH0A 1PZ2A 4LB3A 4US6A 1G4EA 3GK0A 3VKBA 4NASA 3STFA 3VOGA 2R1MA 2VUYA 3ZSSA 4NF7A 3VIIA 3LLXA 4KCWA 2XFFA 1K4GA 3CV1A 4KFOA 1N7KA 2HBVA 4IPPA 2REQB 3AIVA 2I16A 4JTUA 4P8WA 1L6SA 5DRIA 1Q6OA 1LROA 2W92A 1K7XA 3M64A 1JZ5A 1J0JA 2Q3RA 2EPHA 1OEPA 4XD4A 1LZOA 1LBLA 1E9IA 4LBUA 3W7NA 1DWJM 4DXVA 3WL1A 1BG4A 4QS6A 4MLJA 3V0TA 2W63A 2DJLA 3FK4A 1NWTA 3W87A 3PS7A 3KM8A 4AY8A 5EFFA 1C92A 5CPNA 3UY7A 2H9AB 3KE0A 4NJJA 1UQYA 1GUVA 1EXBA 1S46A 3BV4A 3BG3A 3OLGA 4JR5A 1PX8A 2E3ZA 1KM2A 1Q7MA 2VFIA 1NEYA 4AY1A 2BASA 4LAUA 4DJDA 3KOZA 1H4PA 3L65A 1XS2A 4LYPA 4O28A 2RGLA 4YJ5A 4AAJA 5TF0A 1IF2A 5CC6A 4PRRA 1DXIA 4XZNX 4PCTA 2CHRA 3WBYA 3ARPA 2CPUA 3TLLA 1V6TA 3NL2A 4ZMGA 3OVGA 3K2GA 2VYOA 2I9EA 3C56A 6ENLA 2VQTA 3CZLA 4O11A 3N2CA 4AH7A 5HR7A 4W85A 4L4PA 4V33A 4LV9A 4JNMA 6A3HA 3PFMA 5LGZA 2IPJA 1RCQA 1QHPA 4WKAA 1TWDA 4UFMA 1GVOA 4O1EA 3S46A 1ME9A 7TIMA 1M68A 1V3HA 1EA0A 2WHLA 1MQPA 4DF0A 4XIAA 2HBXA 5HXMA 1KW1A 4ZQRA 2RDUA 4CD5A 4DO4A 1EO7A 1W37A 4M6PA 2QCMA 1F74A 1OYAA 2DH2A 1PDZA 3MSYA 4WVXA 4JFWA 3WF0A 4CVWA 4NL1A 4XVDA 1CXFA 1I2RA 1Q2SA 1E6ZA 3M0JA 1VJIA 1O5KA 2HSAA 5BXRA 3C0JA 1QOQA 3D5HA 3M07A 1SW3A 3CH9A 4HZ6A 4QDWA 4QHRA 3SQSA 2IPWA 4HJFA 4O1DA 5DLCA 1DORA 2QCGA 4H8HA 3N04A 5BU6A 4S39A 2VC9A 1KFWA 1NVMA 1XGZA 4NZ1A 3IPWA 1TMLA 2Y2WA 1M7JA 3B40A 1JCTA 3DKJA 1CLKA 5IHSA 3MSRA 1FY6A 1AQFA 3WLRA 4KWWA 4YWSA 4KCVA 1KCXA 3W3OA 2EKGA 4F2UA 2YBTA 4CD8A 5KSWA 3RJYA 3N9RA 2WK2A 4MB1A 4FALA 2E67A 3L4VA 3EB3A 4RNFA 4HOWA 4QROA 4YL2A 4S3FA 1N55A 3G8EA 4GBUA 2V3DA 4PCPA 4W8LA 3QQ0A 2TSYA 5D2TA 4I8YA 1DJHA 1NM9A 4BS0A 1D2KA 2D1ZA 3I7QA 5A6BD 4MF4A 3Q67A 1JYWA 3IEBA 4NZ5A 4U31A 5AVNA 4MWAB 4BEUA 3GVGA 3SRFA 3JUGA 2QDGA 2EAWA 1XYAA 4ZB2A 3UWQA 5A3HA 4CLMA 1ZJIA 4ZGYA 1BG9A 1K8CA 3NPWA 1QAPA 3ISIX 3LTYA 1OFPA 4GHRA 1PTDA 1E1CB 4P8XA 3USZA 3C2RA 3ARYA 3ZJ6A 3EA3A 4UQ9A 1HL9A 4QE5A 1M6JA 3RXZA 3M0LA 1GHRA 2KX9A 3G1SA 4LVBA 3M47A 1DE6A 4XBJA 5F2MA 3AZTA 3VD5A 5EPDA 5LNSA 1S3HA 4TMBA 5FJUA 2BY0A 3DG6A 1L6WA 4KWOA 1LBFA 5LNWA 4YTSA 3AXHA 4OGZA 2HE5A 2HXTA 3NZRA 2YCLB 3E02A 1H7PA 5CXPA 4ASTA 4PMYA 3MUXA 2RHGA 2ZA2A 3C2VA 3NQEA 4GGHA 2FPYA 2I56A 2WKJA 3T81A 3TSBA 3UJFA 4XKMA 4ZO8A 2WCGA 1CX9A 3RCYA 2GK1A 3MV11 1U5HA 1AW1A 1JQVA 1YPIA 1GGOA 2G3NA 5AHEA 4PH6A 4WHBA 2PTXA 5AFDA 3CWNA 3TVAA 3T8QA 3BW3A 1T8QA 3KRSA 4CN4A 5FF3A 3FFSA 3L5LA 1F6YA 4L9YA 2VHLA 3B8DA 4GC4A 1WX0A 1ZL1A 1EPXA 1JG9A 1BGGA 3SUSA 1OFDA 5BRBA 5AYYA 4A3HA 1Q6GA 2G41A 4AWSA 3N17A 2NX9A 3RK8A 4J3ZA 3WMBA 1CENA 5E5CA 4IXHA 3WQ8A 5DMLA 1UD4A 4W9TA 5C9RA 4AZHA 5D30A 2NWSA 1D3CA 4C6BA 4QSFA 1XUUA 2CLKA 2YBVA 1GOXA 2A7RA 1UC4A 4GX8A 2HRWA 3J7HA 4JCLA 6XIMA 4IT1A 2FMNA 2X0HA 3KOWA 2CNCA 2WC4A 3L7RA 4FSAA 1QNPA 4JX5A 3OB8A 2W79A 2PDNA 2XH2A 3O6AA 1BKHA 4IIGA 2ISFA 3IUDA 1ME7A 5HBFA 1MW3A 1SFSA 6TIMA 3VNLA 1RV8A 1C91A 1S5MA 3E3HA 4RX0A 1XLIA 2VC5A 3AIWA 4PMDA 4NAEA 4YMZA 4G56A 1JZ4A 2PLKA 1Q6FA 1XIIA 3GXNA 2INFA 1OCNA 2V68A 3BLOA 1MO0A 1KGUA 2XVLA 3ES7A 1VAHA 4C6KA 3TV8A 4HMCA 4UTUA 1GQNA 3UR2A 4AD0A 1X1NA 3W1UA 4EAYA 5BNKA 4MNLA 3EWDA 4HVXA 4E4FA 5TAOA 4ZFCA 1R3VA 4DYJA 4Q8TA 4WQ6A 1U1HA 1L9WA 4ILSA 2QAFA 2V5CA 2WO5A 2RJGA 3AXKA 4JL1A 4J3TA 1DHPA 1JI2A 4O19A 4DWSB 4WGHA 4I9AA 4A05A 1TPFA 3BOFA 1GVRA 3TJXA 2DORA 1W3IA 3EX2A 1LF1A 1XLCA 2DT2A 2OCZA 2CEQA 4UFKA 4WSKA 4X9YA 1V6WA 3FYOA 4GXPA 3UR5A 2ZX5A 1IXNA 1XLEA 2PBOA 1RD5A 1NWUA 2OGYA 1TIWA 1CBGA 3AZRA 4O12A 1YQ2A 3N2MA 1GEQA 5HUOA 4N42A 1EKOA 4O17A 3ARWA 1XG3A 2PAJA 4JD4A 3W73A 4J5NA 2I17A 1QATA 4M19A 1K4HA 3K1GA 1L8PA 2J9XA 2WVUA 2PD9A 2IMRA 1AL7A 2XG9A 4U2ZA 2OYLA 5LNUA 3QV8A 3TN4A 5GNYA 2V69A 1O12A 2QUMA 2VM8A 4HNOA 1UROA 4GUFA 1V3JA 3XISA 3LENA 4B15A 1I2QA 3PWAA 4QG6A 1KNWA 4L5ZA 4IIDA 4IFKA 1F05A 1P5BA 4O1CA 1B90A 2XWDA 5A5WA 1JZ6A 2FGZA 1YBQA 1Q8JA 2HVNA 3W53A 3UBPC 4LJ3A 4W89A 3R4IA 1B9BA 1K6AA 1KKOA 1Z89A 5HNNA 1KM6A 4C7DA 3M7WA 1ZHAA 4O1AA 4ICCX 3QLDA 3NVDA 3CTLA 4F0RA 2OYMA 3FDGA 4BCEA 1UH3A 2WKGA 2RFGA 1FHVA 1CXEA 4AEFA 4QJ5B 1DJIA 1V0NA 5FL0A 4S2CA 3W7LA 3EOLA 5CJMA 2DW6A 5LHEA 2W6RA 1G9HA 3WO8A 2H8ZA 4MZ8A 4HB7A 3AMGA 3RN6A 4KEMA 1Y5WA 2O0TA 3MT1A 1ODUA 4MY1A 1PCWA 1LM1A 1Q7QA 4E0CA 1H7XA 4MUPA 3T07A 2FTYA 4NG3A 4PCNA 4PR4A 4DUVA 2HS8A 4KESA 4TIMA 1DQUA 4Z1AA 3B0UX 4Q8MA 1ZY9A 1MWOA 4E3VA 1R5YA 2H8XA 4GYPC 4B9ZA 3PUGA 3O3RA 3L5AA 5I3GA 1W54A 2C18A 4IJRA 3MHFA 5JUVA 4JCMA 2PU1A 3IWPA 2SFPA 3F2DA 3TJIA 5FESA 1KM5A 4CCEA 2PC4A 3B9OA 1F61A 2VZVA 2FPTA 1WDQA 7TAAA 2POZA 1PVNA 3VNKA 2OZ0A 2ZX8A 1FWFC 4A3YA 2OX4A 4WJXA 4Y9OA 1GOQA 5AZ1A 1KRBC 5CCZA 4OECA 2PURA 3QLLA 1FQ0A 1K8YA 4BA0A 3N6JA 3HGRA 2WM1A 4NAFA 3AFBA 3U7BA 3NVTA 3O1NA 3R11A 3JZUA 1A49A 2IQTA 4LGXA 3S4TA 3UZZA 1J0YA 3L0GA 2EG7A 2XUCA 3GH4A 1H1ZA 3IGXA 4Q6XA 1I2OA 5JBEA 4DWSC 4MNKA 4PMUA 5LIYX 3SGZA 1S2TA 3TONA 3M6DA 3ITTA 1A80A 1VEOA 3VGBA 3MO7A 4HHPA 3H2NA 1BFNA 3CZJA 3G1HA 3PNUA 3ABQA 3LPFA 1V0KA 3SQLA 1DL3A 1WKDA 1GQJA 4HQVA 1ONRA 1UOZA 1SMAA 2H3BA 4MLRA 3SQMA 2J78A 4PMQA 2FZBA 3PHAA 3FKRA 1BYDA 3EX6A 4LC6A 1MEWA 1IR2A 1LDCA 1WUFA 2HTMA 2Y8UA 4A8RA 4AZ5A 8CGTA 3S9ZA 1OVDA 4LNYA 3GNXA 1QXLA 2QVHA 3NQDA 1WCGA 4IMCA 2NQLA 4J3SA 4A2SA 3WQEA 2CETA 3W82A 1H2JA 2V5LA 2G96A 2Q01A 3E0IA 2OXNA 3PG8A 3MA8A 1X96A 3UCDA 1O68A 1UC5A 4UTMA 4GG9A 2VVSA 4ZODA 1NOUA 1M7OA 2NXGA 3VNZA 4ERIA 4IUGA 1U1UA 2QF7A 3SY1A 3NZPA 1F3TA 2PWHA 4HA4A 2ADAA 5CAKA 1XYZA 1XHGA 4URIA 3U7VA 1EDTA 4GIRA 4D6GA 2J7EA 4B92A 3SR7A 3SSJA 1IWAA 1C9DA 3R58A 3P8JA 4IP7A 2QJJA 5I3FA 2Y8VA 1X6LA 3BW2A 3G2GA 1H0GA 4WRHA 2J66A 4ZO7A 3URAA 5EMYA 5BOFA 5GNZA 1X6NA 3HG3A 3SN0A 1SR9A 2PDJA 3TR9A 2GGHA 3CZ8A 3E0LA 2QT3A 4LF2A 3H7VA 5BOEA 3AZSA 1WPCA 3FGCA 1TX2A 3AROA 1ZB5A 5SWUA 2GVJA 2F84A 2DT3A 1VBHA 2ZRWA 5I0DA 2CXEA 1GOWA 4TO8A 3WENA 2H9AA 2WV8A 4ML9A 1EJRC 4H7VA 1PIFA 3Q94A 3NPXA 4O10A 1BGAA 2WBGA 5CZTA 3IJ8A 1XF0A 5A6BA 1UWIA 2OOGA 2QNEA 3P80A 3I6RA 2DH3A 3WUBA 2Y88A 2OB3A 1UR2A 3UT0A 3AU2A 1Q8AA 3GO2A 3T40A 3P0WA 1WZKA 3LSBA 4XTIA 3P0XA 3EOUA 3TQKA 1QI0A 1M03A 1YDOA 1PAMA 3EMCA 4HN8A 4HHMA 1JCLA 3GW3A 1UG6A 5CJNA 3A24A 5GPRA 3A6OA 3QFWA 3LYEA 1GWJA 1DVJA 1TX0A 1TV3A 4JX6A 2VGGA 4LAKA 2CITA 1R6WA 3TJLA 3SCPA 3PY2A 3IVTA 4JTRA 1LOSA 1VYSX 3NCOA 1OIFA 3GNRA 1OF8A 4RV8A 3OBKA 4Z2JA 2XINA 1XV8A 1W8GA 3WQOA 4NKCA 1IWPA 3U2OA 3EXSA 3URNA 5G1TA 4R7WA 3CT7A 1LP6A 3FN9A 1W31A 2ABAA 2WMFA 3CB3A 1JPIA 1UHVA 3EWXA 4MWAA 1GQLA 3DI1A 2JFEX 3BMWA 3R6IA 2ZRVA 1THFD 3TN6A 3EDKA 3CO8A 4OFCA 3GHTA 4YTTA 4GZEA 3F2CA 2W0UA 2R24A 3IVSA 4NVTA 4Q4QA 2HWGA 3AMLA 2V2CA 4L7ZA 4QJ3B 2VWTA 5K9DA 3LLDA 1DWAM 1JQXA 4HA3A 1XYBA 1HGWA 1QOXA 4J1OA 1ALDA 1S38A 3G5EA 3NSNA 3FJLA 2WQDA 3SY8A 3WQDA 4AZBA 3PZTA 2ABBA 5HWJA 3WZ0E 7REQB 3C2YA 2Y62A 3VDAA 3AYRA 1GZGA 4DZ5A 1E55A 4AMAA 3ARSA 1OSEA 5IBXA 3WF2A 2YA1A 2ZE3A 3VYLA 3WY1A 1DJZA 1RPXA 1EP1A 1LOQA 2ZUWA 4UUIA 1EJ7L 1D7FA 3RO8A 3MY9A 2CBUA 2V2HA 4S3AA 5AC4A 3GHUA 3E1F1 3H2AA 3OTRA 5A6TC 4ROQA 2HXUA 1QO5A 4FR6A 2R1PA 2Y6ZA 3PSWA 2ZIDA 1TJ2A 3TTQA 1KFEA 2OJPA 1RQEA 2YL6A 2YOCA 5JU6A 4GFIA 5H8PA 4AG0A 3I7RA 1R3RA 3M0ZA 5MKGA 4RL3A 3W71A 3SN4A 2W3ZA 3ATYA 4KEUA 4GVFA 2PGFA 1ESWA 2BXZA 3RMJA 3FJ6A 4Q4KA 1M5WA 2J25A 4YN5A 4H8VA 4N7QA 3K4DA 3WSUA 1Z48A 3CUHA 2OSXA 3B4YA 4L6DA 1FRBA 1EP3A 2TRSA 3PAOA 2GSHA 3OZPA 3WLKX 5JH1A 4IUOA 2WXDM 2HVMA 2B7NA 2PDWA 2X7VA 2H3DA 4HOZA 3I68A 1VBRA 4TVUA 3W1MA 2V3GA 3ZJ8A 1VEMA 2GVYA 1KGWA 3WMCA 3H26A 2CZEA 3O15A 3CWOX 5CLTA 4O0ZA 1JEZA 4LUSA 1CWYA 4PTWA 1DJWA 4UNKA 5I3JA 3L2MA 1WKFA 3FYPA 3UXIA 2JIEA 3VK5A 3E12A 5EB8A 4ZQOA 3CIWA 3MI6A 2Y5SA 3T0CA 3QMTA 4QEEA 9RUBA 3M0KA 4DQWA 1BF6A 5I09A 3RIKA 9CGTA 3MSGA 3D3AA 2XM1A 3LK6A 4O4VA 2XH4A 3PB2A 1A5OC 5CLWA 1GVQA 1NOWA 3UCCA 2ZC8A 3AMCA 3LXCA 4U33A 4AW7A 2WBKA 1U83A 4I5XA 3W4RA 1PYFA 2VQUA 4CD6A 4JX4A 4NI3A 5JIPA 3I4KA 2YSWA 1W3LA 2HVOA 1BVWA 6XIAA 1QHOA 3RR4A 1V0LA 3VIHA 3CL7A 4CVUA 2NQZA 1GVFA 2FFIA 4ROPA 1IXQA 3RM9A 1TPDA 2W91A 2ZZ3A 3BJFA 3PUOA 3R10A 2NQHA 1X38A 3B8UA 2PU0A 3LM7A 3AXXA 4LAMA 3UF9A 2WC7A 4JTCA 3A4JA 4C6NA 4Q8PA 3WKZA 1DJYA 1Q3NA 4W7UA 4F66A 3P2VA 3NG3A 3R0KA 3LN3A 1KB3A 1XIHA 4BQ5A 4LAOA 5FCZA 1G6CA 4XQ6A 3AJ7A 2ZZ1A 5KTLA 1RK5A 4AF0B 3HV8A 1WOBA 1QU4A 1GOIA 4B5VA 1BWLA 4M8UA 3MHGA 3WN6A 3QYQA 3TQPA 5MF5A 2D2HA 4LBSA 2IPGA 3BAYA 3CWHA 1J5SA 3UG5A 4EACA 5FD0A 3ZSTA 3V3WA 3G3DA 4OU1A 1AQMA 3EOOA 2YLLA 1OK6A 3S1VA 1JF6A 4H6EA 4NZFA 3SECA 9XIAA 1XBYA 3DYPA 1GYMA 5C0QA 5G2IA 3CB8A 4JFSA 3N19B 1HO1A 1E5JA 1A0EA 5AC7A 3AIQA 3BWWA 1Q6EA 3W29A 2CESA 3W2JA 1FCQA 4FI4A 1MFVA 4CCDA 4A3QA 1GQKA 3K8LA 2V2DA 3A21A 1SO4A 3QMRA 3GR8A 4LYKA 1QPRA 2ICSA 2WB5A 4DF2A 5FSDC 4BWLC 4YYCA 1OCJA 1H09A 5D2VA 3WDQA 1LL7A 4PRTA 4UQDA 4PMRA 3DC0A 3G24A 5I3HA 3R2GA 4IFOA 4XZWA 3SCNA 1ZZMA 1LWIA 3OLEA 2DZPA 5GJPA 5HAOA 1YYAA 2HNHA 3LCLA 1IZJA 1M9HA 3ARQA 4HN4A 2BWGA 2PDHA 2HPMA 4EE9A 4XSMA 2IW0A 4EIVA 3WBEA 1NJJA 7PTDA 3C2FA 5B80A 2DPEA 3S0CA 3OVRA 3DIPA 1OBAA 4LUJA 3CGTA 1GZJA 3SUTA 5XIAA 6ALDA 4ML4A 2NSOA 5BCAA 1SZNA 1E4LA 3R0UA 1UD6A 4RPQA 3TSDA 5K4XA 1XL9A 4GJIA 1F6KA 3WQPA 3ANUA 4XD5A 4GUHA 1EEXA 3FOKA 2QGHA 2GJNA 3UNDA 1PDYA 2QF8A 2NT1A 3IACA 1L6GA 3PSVA 3THQA 3WDJA 4TR9A 2QCHA 3R94A 1RPKA 3T42A 4HNTA 5KINA 3KX6A 1R2SA 3GIPA 2V82A 4KF1A 4KS0A 4S3GA 5ABFA 2E9BA 1KBLA 3M1ZA 3W88A 2ATMA 3NTYA 1PIIA 5REQB 3I3BA 4HTBA 2PDYA 4IMGA 4J3WA 1ELSA 1XWYA 1EJWC 3W28A 1AFSA 4MAVA 1EOKA 4Z1DA 2J27A 4DJFC 1J4EA 4MDPA 4DPQA 4R9OA 4RE0A 5BMWA 4HNNA 4A6GA 2RUSA 4AZ6A 3AAMA 1KV5A 3C8NA 3HIJA 3P3BA 4LFYA 4FXFA 2EG8A 1UD8A 2UWFA 1TFVA 4R53A 4B9YA 3ZLHA 1OC5A 3VNJA 5DANA 1HL8A 1VFMA 4WSJA 2Y89A 2EPLX 4MWAE 3IANA 1SJBA 4AHPA 3SADA 2V67A 1PE1A 4P7LA 1JVNA 3RHGA 3TEVA 1XQLA 1GNXA 1F3XA 1FOBA 2OSYA 2ALDA 4S2BA 3WUGA 1KFLA 1IEIA 3TYBA 4EPBC 1A0DA 5LIWX 3B0XA 1YADA 1DPMA 1J8VA 4BF5A 3QKEA 1BEUA 1FWBC 1W5PA 4C6QA 8TIMA 1WDSA 3DHPA 3UG3A 5ABHA 2NVAA 4H7CA 2Q3OA 4DLFA 2Z1VA 3LMYA 2PDCA 1C90A 1YDNA 2X1RA 3N14A 1V8EA 3ALFA 2ZWYA 2YB4A 4Q22A 3QV9A 1FBAA 3PTKA 4IGNA 3S5ZA 2FPVA 2CXGA 3NFUA 4GD0A 5L9FA 3VGHA 3W07A 2UBPC 2WZMA 4UR9A 3VOIA 5JXQA 2OQLA 5AC6A 3HG4A 4B5WA 4O0KA 2F38A 3CL8A 2INEA 4LQ1A 2ZUNA 2O9PA 3AUJA 3CPUA 3OOQA 2QJGA 3W1TA 4C1NB 3LGDA 3S5YA 4UQEA 2C1IA 1EFZA 4FNUA 2OZTA 1PS9A 4EK7A 3JW7A 2FZMA 3F5LA 1XYMA 1DTUA 2DT0A 3WD0A 2V5DA 3KBWA 1BD0A 2HK1A 5F2IA 4AYSA 1DWHM 1EGVA 3S83A 3NOEA 3H7UA 2BGNE 1UP0A 3P62A 5GJMA 4QTGA 3FVMA 3B8VA 2QLYA 1CXHA 4PUNA 4H01A 4K6AA 2VC6A 4N9BA 4TTUA 1GKRA 4ZB5A 4HCDA 4WEVX 4Q32A 1UP2A 4B91A 1YDVA 1TVLA 1GJPA 3CZGA 3NSMA 2G3IA 3OA3A 4JTLA 4DNHA 2D20A 5M2FX 2E4TA 3HM7A 1W0MA 1NFPA 1XKYA 1GTHA 3ARRA 2PCQA 1L2UA 3UR8A 1YE6A 3F4VA 1TWWA 4LUIA 1XBXA 4EP8C 4XD3A 2Z2BA 1WQ5A 3QR3A 1ZCCA 3EEZA 3KDOA 4ES4A 1P7TB 2PCEA 4KWVA 4UTHA 2PDFA 6REQA 3H21A 1TQXA 1TVNA 3AS1A 4TXEA 4PC8A 2GDQA 3ZVHA 4BQ3A 4I7VA 3BSMA 4GY1A 4PB3A 4DM2A 4GQQA 4Z1CA 4LCRA 4EPDC 2NSXA 2WJDA 4B3LA 4J40A 1J96A 1XH0A 3RYSA 2JIWA 3P7YA 5IXEA 4JICA 4L1XA 4WOZA 4GACA 3AO0A 5FEWA 4M24A 1VBGA 3GB6A 1FHUA 3RPMA 5I77A 1JI1A 3QY7A 2XVNA 2WHMA 1QK2A 2VDGA 4MFDA 3GXPA 1GVYA 3PZOA 3RLHA 3GHRA 3C8FA 4E8GA 3A4WA 2I5GA 4RJEA 3WEZA 3EX4A 4RNIA 3BW4A 3WQWA 5KEZA 3VI2A 2C1HA 2XSAA 2VCBA 1RBLA 4M51A 1R87A 1LLZA 4DF1A 1RAKA 3LV5A 2WZIA 2Q02A 2ZX6A 6REQB 4TVDA 3NQVA 2OGJA 4ZTYA 5D9OA 4FF5A 4DNMA 3AHYA 1GVEA 3BSHA 1MNSA 3EMQA 1I1XA 4ACZB 3VX0A 1GOKA 4XZMX 6TAAA 1H3GA 3F4DA 4HZ7A 4Y9NA 2YXOA 1NP0A 2VR2A 3T55A 2BHUA 1IR1A 2RGMA 4IH3A 4LAZA 1UASA 5IM51 1GG0A 2PWGA 3WLJA 1XICA 3G1VA 4GVHA 5BROA 1VHNA 3G1YA 2YB1A 1UWTA 3P6LA 1YMYA 4O1BA 4CQCA 3NQMA 3NL5A 5I79A 1A5MC 5D33A 1LLWA 1V3MA 4AVOA 2ACUA 5K9CA 1F3EA 1Q65A 1R7AA 3WH6A 1CTNA 1F4HA 2Z27A 1H7NA 5D4YA 1ZNNA 1FH9A 3L5MA 2QUTA 4U5KA 1FWDC 2J74A 1ZBWA 3GTNA 4JDBA 1VYRA 1W1B1 2FYMA 3C0QA 3HGSA 3K4WA 4TOQA 1E51A 5DCEA 2V3FA 3LHYA 4HJWA 2VP8A 3P67A 4HYVA 4LCQA 4XZLX 3WLPA 3PULA 1W1IE 3P60A 4XVEA 1B31A 2NVDA 1YNYA 2FQIA 2VFGA 3ERPA 3H2MA 3XIMA 3VD7A 1SW7A 1ONEA 3EWZA 5AHIA 4UR7A 3CAWA 5EYWA 3MMTA 4DJEA 2NXIA 8XIAA 1HFBA 5C2GA 4JKMA 2XU2A 2Z28A 4F0SA 4IQLA 4Q7BA 4M1RA 4ZO9A 3VDHA 5LA2A 4IPLA 3VKDA 2Y5JA 1KO0A 1H1YA 2D0FA 1PV8A 3W84A 1TR9A 3MKCA 4RNHA 5DRCA 2G4FA 1QNSA 4E2DA 3EWWA 3EOSA 3JRKA 4LT9A 4W87A 4JIIX 1EC7A 1G4PA 3CQJA 4F48A 3NDOA 1V0MA 1QBBA 4C1LA 2OT0A 4P7QA 1M04A 1JF5A 4MPQA 4KFNA 1TMQA 3GR7A 3UWYA 1VC4A 1OGGA 2KAUC 3O05A 1HF6A 5G2HA 3WLTA 1BQGA 4KBXA 5D05A 1VJSA 4V1YA 1OT1A 2A2IA 1I1WA 3TP4A 2IKJA 4V15A 1U5JA 4ACZA 4IOTA 3DH7A 4W88A 4I5RA 1J11A 2CLEA 3DXIA 4REQB 4X2RA 3VFCA 2ZDRA 2NXHA 3EYPA 3DHFA 3GHSA 3WNOA 1ONXA 1OYBA 3QV7A 2PDKA 2J8FA 4PSPA 2WC3A 4JHZA 3USBA 1IQ8A 3OLDA 2R82A 3VE7A 2Y0FA 3H24A 1FXPA 4FLSA 2C0HA 2C14A 4LPCA 4NNAA 3TLQA 4GKTA 1OHLA 3U2CA 1FP9A 4FXSA 3WNLA 4AZ7A 5LIKX 3P14A 2J77A 3NQAA 3TW6A 3L67A 4US5A 4L6HA 4LY4A 5FL1A 1ZJBA 1AW2A 4ZSUA 1EWEA 2YFOA 1O1HA 4HT3A 5KMYA 1F4AA 1XJBA 2YGYA 4MNJA 1PB0A 4G1KA 3UPMA 3UD6A 3WH8A 3PBGA 3QV6A 5HUPA 1EC9A 2DZXA 2PDXA 4GBDA 1HKWA 3TTEA 1I2PA 1UW9A 2QUUA 1KRCC 1OCBA 3NO3A 1KXVA 1U5VA 1N8WA 2GQAA 4LH8A 3C6CA 1BSIA 3WNMA 4X3ZA 4P61A 5FJOA 2OVLA 1EA9C 2CZFA 2PF0A 2UY4A 2O9RA 4XAYA 1M53A 3GBDA 3DFTA 1DIEA 2O92A 1V02E 4GYKA 2DUXA 3OQ8A 2IPFA 3BZGA 3W1NA 2NT0A 4XTDA 1UUQA 1GVSA 3SUWA 3INPA 3M0YA 1MVYA 1FDJA 4JQ4A 3ITOA 2G97A 1JGMA 2BVYA 1F9CA 1UA3A 4QBXA 1NOFA 4W93A 4OUIA 1WXZA 3HU7A 3BL3A 1DYSA 2MNRA 1LUCA 1Y5XA 4CEXC 4MJZA 4NJHA 1EL3A 2JGQA 5K2ZA 4PTMA 1TTJA 3ZVHB 2YJQA 3EA2A 5D2XA 4RV3A 3WQ6A 3MTWA 4AD4A 3WELA 3WLQA 2Z26A 5CC3A 4PUWA 2V30A 1QASA 5KITA 1I60A 1B4KA 1WBHA 3HQ1A 5EA9A 3M43A 5FAGA 1MW1A 4AZCA 2V3EA 3KLKA 3VOFA 5DT7A 2OPJA 3SJNA 1MFUA 4MB5A 4PUUA 3O2LA 2XVPA 3H2CA 1XIMA 4HPHA 3G6MA 4Q33A 4J27A 4PUMA 5C7VA 2J4GA 3L0NA 3NGJA 3W75A 4HHHA 4F8XA 3FHQA 4PB4A 1CLVA 3FEMA 4JIHA 4WF7A 3AALA 3EKGA 3WLLA 1K9FA 2J13A 1DQXA 3V36A 2Y1HA 2AOSA 2AQOA 2X2YA 1MXDA 1KM4A 2GYIA 2I1OA 1BYCA 4B90A 1TA3B 1W1PA 2GGGA 4WY0A 2VI0A 3KBSA 4BWLA 2VEMA 2YFNA 3S9IA 1PYMA 3QF0A 3E2VA 1BRLB 1TMHA 2QAPA 3QJAA 5CKSA 2OQHA 3WFLA 1J9YA 3LQGA 4GH3A 3OW1A 3UZXA 1GKQA 1E6XM 4NJKA 5ENLA 3TSMA 4DZIA 2PWUA 4BR1A 3URBA 1ZSXA 2ZX7A 4UB9A 3ZR6A 4HCLA 2C0AA 4ZTXA 2QYGA 4LUTB 4HMEA 5FF0A 5IHRA 1V08A 4L4LA 5A8MA 1GK8A 3FKKA 3PZVA 4MPKA 2ZZ5A 1XDMA 1UKQA 3GAKA 4PGLA 4LNCA 1JUBA 4PCFA 3MVTA 5CBJA 3BCJA 4PMZA 1AJZA 3PJWA 3HBLA 1OG6A 3L4TA 3B4UA 2X40A 5HK4A 3WMSA 1XRFA 1F8IA 3DFNA 4HGXA 4E4UA 1CI1A 3S1UA 2DZBA 1DE5A 1RBAA 2UZ9A 1JCJA 4JN6A 1D7KA 4XISA 1QTWA 1UZ4A 3CL6A 4WSHA 3CO4A 3KTCA 1UR1A 1VFTA 3LGEA 3SCOA 4FHAA 3H23A 4PRWA 4BI6A 3POCA 3REQA 4U2YA 1OIMA 3VO0A 5K9XA 2EGZA 4F9JA 1JYVA 3MC5A 2INZA 3BURA 3TZNA 2DIEA 1W1VA 3BAIA 4JTAA 3GZAA 2ZRYA 3UU0A 8XIMA 4JNZA 3UXLA 4CN6A 3GTXA 2GLKA 3W6LA 3G1AA 4HPGA 3H8AA 4Y8FA 1F5ZA 2QULA 3MP4A 1TO3A 4M0XA 2VZSA 1V4YA 3BZJA 4H41A 4M80A 1O7AA 3STEA 4F0HA 3QTGA 2WZHA 4WCJA 2JE8A 2XFYA 4IFRA 1B3XA 3SCRA 1Y7VA 2YZ5A 3IUHA 2NVCA 1FWCC 2WKLA 2ACSA 1DIKA 1XLBA 5FAJA 1IV8A 4S23A 3M44A 4PL1A 1L6FA 3HURA 3N4FA 1Z41A 4EF8A 5JQ9A 1ZP3A 1G5AA 2O4MA 4J2PA 4UNIA 2FHBA 2B31A 3MJMA 3ARXA 2YCJA 3N9SA 5I03A 1TPWA 1UUMA 3KXQA 3E96A 3WF3A 2JGYA 1E5NA 1UZ1A 3LUTA 1BYBA 3EDFA 4TUFA 2CZDA 5G2WA 1O1ZA 1OFEA 2P0IA 3UJ2A 4GX9A 2DV0A 2RDTA 3LHWA 2YXXA 4FLOA 2FHCA 1F8MA 2NUWA 1Q85A 1OX5A 2QZRA 1CGUA 3BQ6A 5KETA 2GFTA 2I7GA 1FWTA 4GI9A 4X61A 3W2MA 3BAXA 2DZSA 4GYJA 4ZEPA 4UMCA 3BJSA 1TYGA 3CUZA 3FCPA 1A4MA 3RF9A 3ZZ1A 1RQHA 4MSSA 3EWYA 2CBVA 3N3TA 4EAMA 3PAJA 2QCDA 1MI3A 3TFXA 4DJED 2VR4A 4LANA 2ASHA 1HW6A 2GJRA 3WK1A 1L0PA 4ZOEA 3B05A 1JULA 5K4ZA 1FHDA 3P81A 1HUVA 2IKIA 3VGDA 4GYFA 1Q6DA 2E9MA 2EXOA 1SUXA 3GDLA 1VCFA 1CIUA 3TYCA 2VKZG 3V75A 2XIBA 1S3TC 3MP5A 1K9DA 5H1WA 3EXRA 4H9MA 1PKNA 2BZNA 2QV5A 3TA9A 5DY2A 4A22A 3C52A 2VO5A 3CNYA 4AU0A 2YW3A 3GVWA 3N12A 2Z2UA 1R7OA 2YW4A 1TREA 4GINA 2WPBA 3NO1A 3WJZA 3U3HA 1AJ0A 1SR0A 3ZT5A 4GQRA 4Z2KA 1OABA 4E2BA 4NZ3A 3UVIA 3EXTA 3FSUA 4JTQA 1J6PA 4V2XA 3G1FA 3WBAA 3RGTA 1VYPX 4G1NA 4OHQA 1XM3A 1IT0A 3B0PA 3TW7A 2IQ0A 2E68A 4DBWA 4OT7A 3UCQA 4O18A 3VIMA 1V93A 1K9TA 1DP0A 3ITYA 4OTKA 2WNWA 3QY6A 1ZPTA 1TPVA 2YCKX 1V3KA 4LC8A 1AVAA 3V5CA 3GBEA 4LCSA 2P8BA 1J0HA 1KTNA 5BMXA 3KHJA 3KTXA 2J62A 3PP7A 1AQHA 3WNNA 4IGSA 3GU9A 3RRXA 3FXGA 1UH2A 4PYSA 4Q6JA 4IG2B 1P48A 1XD0A 4B5UA 3KBJA 4HNVA 2F8QA 2VENA 2AKMA 2PI6A 4F0KA 3TKFA 3W85A 2J24A 5D09A 4FAMA 2ZWZA 3LQLA 3VNDA 1XLFA 1XLAA 1VFSA 3CAQA 4X2PA 3APGA 1X6UA 2O9TA 3OZMA 2V8ZA 3D47A 2VTFA 2NX3A 1W8SA 2WYSA 5C8BB 3DFQA 3ANVA 3RO6A 1RD6A 3KVKA 3V18A 1XLJA 4N4QA 3QPZA 3VC5A 1P0KA 4AVNA 4M7TA 4QGCA 4LS2A 4B3ZA 4JHOA 2JEQA 2XIQA 3R8RA 1KLZA 5ABEA 4S1FA 1E70M 2QHAA 4IPNB 4DRSA 2VURA 3LZ5A 4JTEA 2D22A 3VOHA 3BMVA 4K1GA 3B3DA 1YBQB 2QPSA 4B5TA 4QSHA 1KRAC 1T8XA 2RH9A 1ECEA 5C5YA 3PPFA 3BE7A 1RCOB 4Q4MA 3SCSA 2VZOA 4Q8UA 1TJ1A 3TC3A 3KL5A 3MQTA 1Y0EA 2DSWA 2X1SA 1EIBA 6CGTA 2BOEX 1A5SA 4B2DD 4I90A 1D3HA 1IGWA 2WMGA 1N8FA 4BK9A 2ISVA 1HO4A 3EDDA 2PDPA 2PMQA 1POJA 3LHUA 1JNEA 4B2DA 3WG6A 5KZDA 2P3ZA 1VHCA 3CV7A 4CQAA 4LVFA 4DZHA 4DBEA 3G0UA 5C71A 2PWDA 1YPFA 3LCGA 2GJLA 2WNNA 3NM3A 4NUWA 4D6FA 1HP5A 3HMJG 2BGSA 1YIXA 2X09A 1ZRQA 3H7RA 2A0NA 3ZR5A 1HXJA 2VX5A 3HZ3A 4JYFA 5ABGA 3QVQA 4DBSA 4HMDA 2XH0A 1Z44A 4HYRA 2ATSA 1WP6A 2ZFAA 3OYZA 2W9MA 1KR1A 4I6KA 1PPIA 2GOKA 2WANA 1N2VA 1RUSA 1XDLA 1A5LC 1S2AA 2JKEA 5DXYA 3TOYA 1TV4A 1S1RA 2FHFA 2WW5A 3M0MA 3KOXA 1XIDA 4NYUA 2NQJA 3STCA 3C4UA 3PZ9A 5I00A 1K8XA 1VH7A 3UA4A 2P3EA 3CIXA 1ZBVA 4UTTC 1NDYA 4H00A 3W7MA 4Z2GA 5CGTA 4PODA 3N13A 3H55A 1MXGA 5E1QA 1VF8A 4DHGA 3N6QA 1JDEA 4ZO6A 5AOUA 1U30A 4QJ1A 4N02A 1FX6A 1QW8A 3MWAA 4QP0A 1HJWA 4MKVA 1CEOA 1ZALA 3AICA 5D2YA 1CNVA 3SW6A 4JTIA 1IIGA 3BG9A 2E77A 3GDMA 3GU1A 1VRDA 3IJ6A 4HK7A 2W67A 2D69A 2DGAA 3UNTA 2BXYA 3S42A 3KWXA 4OOZA 2DVUA 5ABFB 4IQDA 3B9AA 2Y7GA 4HPNA 1LQ2A 5HPCA 1MMFA 4X60A 3U57A 1TTPA 1MZHA 1R3YA 1EDGA 1G4SA 5A8PA 3SFKA 2HEJA 3CZKA 1XI3A 4LF1A 5M1TA 2E09A 2WJEA 1V5XA 1EYEA 1Q6RA 2HJPA 3KRZA 1WAWA 4KIRA 3GDTA 2VNCA 1BTMA 3TROA 1I75A 1XRSA 4D6EA 3TC7A 1ZS2A 1TCDA 2ZRXA 4IP5A 2QJIA 4O1FA 3CMGA 1A53A 3W2LA 1E9LA 1ZU8A 4Y8EA 3W72A 4XZIA 4TMCA 1TPC1 1O5XA 3R8GA 1MSSA 3L4XA 3LA4A 3RPTA 5H8MA 3HPZA 5JBDA 4YLWA 4H6QA 5C2XA 3SURA 4PEEA 3AIRA 1T6MA 4AYGA 1BWVA 3SCTA 3A4XA 1ZBKA 2P1FA 5GVJA 4GH1A 1JAKA 3GTFA 2WSPA 1UIOA 1O5RA 2F9RA 2Z1BA 4ZBCA 3M0HA 4N0RA 1DQWA 2PZNA 1GCYA 2XIJA 3DGRA 3VZZA 3PZQA 3RPDA 2X1IA 3PTQA 1E1CA 2OZ8A 3U4FA 2WNQA 5ECUA 2WHKA 3AXIA 3UJSA 5HMSA 3CHEA 2GVEA 5E70A 4NX5A 3S6DA 5A8QA 5CG0A 4LVDA 2Y63A 3MUCA 3TR2A 3VNYA 3W83A 3PF3A 3DYOA 2BHYA 2E0PA 3VKAA 4AIOA 3KOYA 1UPMB 4UTLA 3E0FA 1EWDA 4QQ3A 1NP2A 3KOFA 3DI0A 5D02A 3GUGA 1XKJA 1NIUA 3PZGA 2XPKA 3ARTA 4P2VA 1WYIA 3PR2A 4IWWA 1JL8A 1P0EA 1VFFA 1R38A 3QHOA 2TPSA 2CLLA 1E3ZA 3GKAA 1DIOA 3ZJKA 3UP8A 4L9XA 2QCLA 1XISA 1AD4A 2VEFA 2CWNA 2A6LA 1PX3A 3U2EA 4CUCA 4NHVA 4H6RA 1ECQA 4XK2A 1P6BA 4KFPA 4XAPA 2AAMA 2A6NA 3STPA 3NO5A 4JTJA 3ELFA 3G0XA 1XQKA 2YZRA 2X1UA 4RDVA 2VFDA 1CECA 1MRAA 2PEVA 1ZJHA 1NELA 3LM3A 2C16A 5F4WA 5T8GA 4GY0A 1JAEA 2RDXA 3PB0A 3CJPA 3PJTA 4UTJA 3BOLA 5AYBA 3SSZA 4OKDA 3TUUA 1FWSA 2HV5A 2BLEA 2YBUA 3O9NA 3RCMA 1B3ZA 2NZLA 3N18A 2GJXA 3S9YA 4AHQA 3FJ4A 4DAFA 3FSTA 3IGHX 2PRMA 1JJKA 4YXGA 2VGIA 3IIXA 3KZPA 1QI3A 3A64A 1XGEA 3PUDA 4B4HA 1J5TA 4AF0A 4IL0A 4CU7A 5AN7A 3UGRA 1HG3A 4LALA 4H6KA 3T4CA 1K02A 2ODOA 4UCGA 1OD0A 1PIGA 1LYXA 5I5RA 5T26A 5HMDA 5FSEC 3HA1A 5TD4A 4FF7A 2V38A 2CKRA 1YNQA 3TFCA 1IHIA 4K1WA 4GZ7A 4PA8A 7ODCA 3HMCA 1LBMA 1BVZA 1PKYA 2CKSA 1EZ2A 3HO8A 3L2IA 1B9ZA 5D8WA 3ZLFA 1R3SA 1WB0A 2PPGA 5AHLA 3W7PA 1T99A 3I4EA 7CGTA 1PSCA 1XLDA 1TG7A 2O4QA 2GVGA 2QCEA 3TMQA 4C6FA 4KT2A 2Z6JA 1OCQA 4GY7A 5LNVA 1CGTA 3AISA 4W4QA 3GG1A 3C2OA 1EPVA 5CPMA 4UFHA 3DN5A 3ZS4A 1C8YA 3V0SA 4B3KA 3CUFA 4S3EA 3QZEA 3SCVA 4IIBA 1LL4A 5FJRA 3WF4A 3ZMRA 3A13A 2X2GA 1YLVA 5AHMA 2DIKA 4AQLA 1MZRA 4D71A 1ADOA 4MG4A 4W5UA 3UZ5A 3W81A 4IP4A 3MZNA 4FNTA 4JZ5A 1YNPA 2X42A 4RR4A 3FW6A 3LERA 2V5KA 4XAFA 3L4WA 2ZICA 2A7NA 4W84A 4DYKA 3FNDA 3W2NA 1VS1A 1QVBA 1TCMA 2EPNA 2YR1A 4AC7C 3LGGA 2Q71A 4ALDA 2OLAA 5HJYA 4H2HA 3QXBA 2EJAA 1ZFJA 1FWRA 5M17A 5LYRA 1B3VA 2VR5A 1E6RA 2DZTA 2XIOA 3B9NA 1HJSA 2VEKA 3WJSA 3E2QA 2OT1A 4GUIA 4H2CA 4JBRA 1S2CA 4PULA 3CQKA 1QT1A 4ERAA 3E0VA 1T7LA 2WQPA 4BF9A 3GDKA 1AW5A 4H9YA 1KFJA 1BVNP 4FNQA 2C1GA 3G3MA 4B5XA 3GYEA 2PC8A 4J2MA 2D2OA 3VPLA 1KFKA 1H63A 3IRDA 4C5YA 2EG6A 4B5SA 1I9CB 4FEZA 3F5KA 2E1DA 3NQ2A 4B5NA 2AMXA 1IT8A 5C2CA 2EKCA 3LU2A 5CGMA 1JPMA 3W1RA 3L4ZA 3SRDA 4HU0A 1XFCA 3ZIZA 1P6CA 1UD2A 4IJCA 1LRNA 4DJFA 2VMFA 3QM3A 4JXCA 1FCUA 3ABXA 4Z0JA 3AU6A 3W7RA 3G1DA 4QJ4B 2ISWA 1MDLA 4LOCA 1CW2A 2ZUTA 5G4EA 1BXBA 4FNRA 1E6QM 2PB1A 3EGJA 2XN1A 4OOUA 1TQJA 4GQBA 3W74A 1EQCA 3UW6A 3PZNA 2J7BA 3BQ5A 2BVDA 4MJ4A 3ABZA 4G6CA 3E2SA 2C6QA 2E7FA 1HIZA 4IX0A 1JCNA 3L0KA 4D6IA 3U4AA 3XINA 1VB9A 3FVDA 3WLMA 4FXJA 3WIJA 3BLFA 3OPSA 3T9PA 3K30A 4ZA0A 3T7VA 3VC6A 3B97A 3OVQA 1XP3A 4CQBA 1I8JA 1RCXB 4IQEA 1R46A 2CLHA 3W37A 2J6VA 2Z0IA 4I7UA 4AIUA 6PTDA 1H5VA 1KLYA 2WSYA 4DYEA 5A69A 4ZCWA 1RY0A 3HB9A 3W7OA 1J0IA 2XWEA 3LV6A 4MZYA 1CGXA 3EAUA 3BJTA 3KCOA 5E0FA 4AD2A 5RUBA 1KXQA 7REQA 5U7SA 5FA5A 4QAWA 5DQPA 3U5UA 4O13A 4J3XA 4DUWA 1UMYA 5I23A 1AMYA 1EIXA 1F7BA 2C91A 3BLPX 2BV9A 4MMWA 4WGXA 1LUCB 1XSKA 5DT5A 1QNOA 2FJUB 4Q8OA 4DBUA 3P82A 3WLHA 5LSMA 3TA6A 4OQVA 3TYZA 4HNUA 1I6NA 1V79A 4GIAA 4MKSA 4HNLA 2PZ0A 1UZDA 2ZOXA 3NQGA 1E6NA 4PUJA 1E6PA 4C6JA 1W32A 1W1TA 5CSYA 3VM7A 4Y7EA 5D2WA 4DJEC 1TPUA 5XIMA 3U9IA 3DESA 4GOAA 4MWAD 3IAQA 4BFAA 4HMNA 4CNNA 2HISA 3UZJA 4JPGA 2C15A 3N6HA 1H7WA 2WWDA 4M7SA 1Q45A 1ICPA 5AHNA 1CCWB 3DFOA 4N6FA 5I02A 4JFUA 1KWKA 1H11A 2GUUA 2ZVIA 1SVDA 3CIVA 3AXMA 1W91A 2VRQA 4JIPA 4QS5A 1B30A 2V9DA 1QO2A 3GD6A 2YA2A 3MB9A 3FGCB 2G0WA 4ADTA 4CU6A 4U3CA 3CHCA 1L2QA 3P74A 3GNPA 4ZZ9A 2NV9A 2ZRUA 1M3UA 2E25A 2QJHA 3APTA 1MQQA 4FLRA 5F7UA 3QBUA 4CQ9A 1C8QA 2WWCA 1QW7A 5GNXA 3DDMA 2ONEA 3VZYA 4GO9A 4JN8A 4E5TA 3WD3A 3PTDA 1V3LA 4GMEA 1TRDA 1JNDA 1FTXA 1IT7A 2B81A 3NA8A 3OZYA 1W17A 3UR7A 3EWCA 1OT2A 2XDFA 5HINA 2IUZA 3O07A 2D0HA 3C0SA 1XUZA 4DWSA 3R12A 1UBPC 4CCZA 1XC6A 2W62A 1IEVA 4Q7NA 1AMKA 1ADSA 4HP5A 5IBXC 1EHNA 3EDJA 3I7SA 4XKYB 5EKYA 5E0CA 3TN3A 4CNUA 5BXTA 1XW8A 4RZ5A 1E73M 4XAZA 1OQFA 3AHTA 3S1WA 4P7OA 3IK4A 1UR4A 2CLMA 3VA8A 4YCOA 1MW2A 3TYEA 1D9EA 4CQ8A 1EBGA 4BKNA 2ZTKA 1RVKA 3MMUA 2WLZA 3IRSA 1SJAA 4ZOBA 1TPEA 3LSCA 3CXOA 2VDIA 1ISVA 1FWAC 2D73A 2W27A 4QR6A 4R27A 3TN5A 2E40A 3M41A 3NDZA 3SCWA 3NEHA 2BXVA 5M03A 3ANYA 3VDBA 2VX6A 3CUJA 1AUSL 2DZWA 4JYEA 3GYCA 1E4NA 4LB4A 4A29A 3R8HA 3AHXA 1JPDX 2PWVA 4RZ6A 1R47A 2VD9A 2OQYA 2ZXQA 3JU2A 3UXDA 1C3FA 4YVXA 5M5DA 4H9TA 4HZMA 3AHZA 5C55A 2XN2A 2Q09A 3I6TA 4E3TA 2PWFA 3PPHA 5I07A 1XRTA 3WJWA 2UY3A 3I3EA 4D8AA 2L5HA 1OX4A 3W1AA 1EGZA 1NSJA 3GXFA 3AYSA 3AIUA 3R13A 3ARZA 3QH2A 4FB7A 2FVKA 4RKAA 2WPGA 4E6MA 4IXXA 4NY2A 4IG2A 3S1GA 4I5UA 3W02A 3DERA 3H4XA 5AZ0A 2R94A 3CMJA 4A3UA 1MW0A 4X9SA 1HNYA 3W86A 3B9EA 1A47A 1HKVA 4GQ0A 4Z42C 1BKSA 4K7YA 2IXUA 2BTMA 3ORWA 1IEWA 3U2ZA 2VOTA 4ACYA 1H41A 4LRTA 2F7FA 1Q63A 4NRRA 4HA1A 4IGMA 4J3VA 1G69A 3MKVA 4FA3A 4UNLA 3IIVA 4ZOAA 3NZQA 3ZJ7A 4QE1A 4FNPA 4JHMA 4I3GA 4JFTA 2GK1B 1XLHA 1SZEA 1XX1A 4L4OA 3LNPA 4F4RA 1QOPA 3GFXA 4JIEA 3E9AA 5FJJA 2D3LA 1VLWA 1AJ2A 2XIIA 1DKWA 4WX2A 5T9CE 1EH9A 3M5VA 2PGEA 2PDUA 1MRQA 1E1EA 3V5FA 3BGGA 2DU2A 3CZEA 3E2RA 3H53A 2Y61A 3L2LA 1RBOB 3ZFHA 2BMBA 3CHDA 2DVXA 4DO5A 2X41A 1DWGM 3KHDA 4UTKA 3P84A 1Z32X 2QDHA 5LXXA 1RR2A 1Q13A 1T5AA 2A3EA 1OGBA 2C7FA 2X7WA 3GS6A 2OKOA 3BPWA 5KZ6A 1M7PA 3DGBA 4BHYA 5F4SA 3JR2A 3HQPA 1R3TA 3AS0A 1JD7A 2D2JA 4RZ4A 3B8SA 3VNMA 3KAOA 2PGWA 5A2BA 2Z1SA 4JTTA 4PUKA 3VNIA 3EEGA 4W5ZA 4QEHA 4V1XA 1K9EA 3UG8A 1U2YA 2WSKA 2YDQA 3GG7A 1JD9A 1S1PA 1SU5A 5JH2A 3LXAA 2ZUVA 5MHBA 2V0TA 2VZUA 3HFTA 3RX2A 5J04A 4KCTA 3GXTA 2G5WA 1J2WA 3KBNA 4A35A 4MDOA 3T78A 2XGZA 2ZADA 1O95A 4PTVA 3BOXA 1Z8AA 1VCGA 4DO7A 3LNMA 4TV5A 2CC0A 2F6UA 4UR8A 4ZQNA 5AC5A 3L4YA 5BXPA 3HV9A 2NUXA 3F03K 3HFYA 1XCXA 4MJMA 4POCA 4ZENA 2Z24A 4NZCA 3GFYA 3GWQA 5FIPA 4GUJA 1TELA 3KBVA 4ADSA 3REQB 4A4AA 1FXQA 5BWAA 2QGYA 1L8NA 4HCHA 2XH7A 2EBNA 2B7PA 3UEQA 1QBAA 1CDGA 3VU2A 3NDYA 2O9OA 3GVQA 4XO6A 4GI8A 3QQ1A 1Z69A 3T08A 2PDGA 1LRTA 4KWSA 3EZ4A 3S47A 3OLIA 3TNOA 2R8WA 3BSGA 4C91A 3QMSA 5IFTA 3TYDA 1W9UA 1XYLA 3MDWA 5LA0A 2ZTJA 3QW4B 1IGSA 3GH5A 3AMKA 2FZDA 3IK2A 1S39A 2CU0A 2J88A 1C7TA 1JPKA 4D6DA 2YYTA 4R34A 2J7FA 1ZCOA 3OBEA 3EB2A 3SCQA 4WD0A 5EMUA 3U48A 2JKPA 1B0IA 4MY8A 3OG3A 3O0KA 3TQVA 4DM1A 5C7HA 2PP0A 3DZ1A 4AX6A 2A21A 2YXGA 3A3XA 1PJ9A 2GVLA 2Y4SA 4XBSA 3W2UA 4HD5A 4Q4SA 1J0KA 2F6XA 1QUMA 4G9PA 4K2SA 3ZXWA 1AQ0A 4QNWA 3BMXA 3T0AA 1GPWA 1HVXA 3QN3A 1WDPA 3GIYA 1CB2A 3GDBA 1MUMA 1NF0A 3K5XA 1PTAA 4AY7A 4EPEC 1QWKA 4ICNA 4PSRA 2ZVRA 2PLMA 4UTTA 3PBMA 5EL1A 4G2DA 3WX7A 5FF4A 2BBFA 2FZNA 1XD1A 3G1RA 4QCFA 4ERGA 3D3FA 3V16A 4PBGA 5AKQA 1Q66A 1F6PA 3N1AA 4Q8NA 3SRHA 4MJ2A 3WNPA 3CPGA 4NQ1A 4ZE4A 3HJEA 1E4IA 5FJIA 3MI3A 1KTBA 1A3WA 1SZFA 2PA6A 4S3BA 2J8GA 3CV6A 3IJLA 5BRPA 4U3AA 3PJXA 2VFEA 3GIQA 3IV8A 3CV2A 3F2BA 1JCXA 3R1ZA 3NQ8A 2F6KA 2XVKA 4Z2HA 3LCWA 1SMDA 3VTRA 4BF7A 1OADA 4B16A 2E8YA 1YE4A 1B3OA 3O6DA 1WAUA 1SFTA 3N3MA 1VCVA 1RJPA 3TK7A 3G8RA 1RVGA 4RLIA 1TTIA 3B8WA 3DX5A 1IIHA 1RALA 2PF8A 1F76A 1FP8A 1GJUA 4UFIA 3TTOA 2QUNA 4FLQA 3SIMA 2FKPA 5C70A 3I6EA 1KBKA 1PX4A 5FI8A 4Z17A 3HOJA 3E38A 3ABRA 2VELA 2OO0A 2YLAA 5AYZA 2ALRA 3L4UA 1B57A 2H90A 1KBJA 2PP1A 3T0DA 4ZL1A 3IJIA 3W25A 1S2WA 3GC5A 1OC6A 4DLMA 2A5HA 3GX9A 1W9BM 2JK2A 3CQIA 1J18A 1RJRA 1T96A 5HMFA 4GLEA 4YTUA 4WK9A 4AISA 1LG1A 5C54A 4A8NA 2WMHA 5FEPA 2GSEA 4Y6GA 4HTYA 4HIBA 3WH9A 5E9XA 2G3FA 3GNDA 1TJRA 4LY8A 4EWND 3E5BA 4JKLA 3I65A 1J93A 5C9ZA 5IDZA 1BPLB 1EJUC 4J35A 3CM4A 4X22A 3IJ7A 3TNBA 3KRUA 3C61A 4EANA 3W1QA 1V51A 1XLKA 1VPXA 3VINA 3WK0A 1E0UA 1QPQA 4DI8A 1XDJA 1EC8A 3IVUA 1E9ZB 3B0VC 1QW9A 3WYZA 1OM0A 1UP3A 1QPNA 1CXKA 1VJZA 4TVCA 2EQDA 1TV8A 3PPCA 1V03A 2CZVA 3K8KA 2VT0A 3PBYA 2Y7FA 3MBDA 1W3TA 3BGAA 1NDVA 4N9EA 2BP1A 2G95A 1R8LA 2NW0A 1RA5A 3UA3A 1NFGA 3IGUA 3QGVA 3CEUA 4K36A 4UWMA 1PHQA 4ZXLA 3KS6A 3PBUA 1Q7ZA 5EMLA 3WJXA 2OLHA 3SIZA 4WY0B 4FIRA 5I24A 3SUVA 1MYRA 5AVHA 3CMFA 4YTRA 1HZYA 4KRUA 1WUEA 2PTYA 3ES8A 3F5JA 3APYA 2EPOA 2R1LA 3NEVA 3GE7A 4F2BA 1EJTC 2BFGA 4FMVA 3EWBX 1FFRA 1VENA 3IGSA 2VD8A 2ZA3A 4K8GA 3UESA 4MYAA 1S5WA 3H6OA 1HVQA 4PBFA 3UXKA 3VIOA 5AB3A 5A94A 3P5ZA 2OWCA 1A3HA 4RXGA 4D6CA 1WE5A 2VC7A 1U1JA 2BX7A 4J28A 5BXSA 1RHCA 1YKWA 4M82A 1TZZA 1XCWA 3KL3A 3PFRA 2QDEA 4LYQA 1GYLA 4P7RA 1ZAIA 4WJEA 1CZ1A 2DEPA 1P6WA 5BOOA 1UJQA 2FDMA 3ZVIA 4J9JA 2AQVA 1TE6A 3II1A 2VFFA 2WJFA 3PBVA 1RQBA 3WDPP 3VIPA 3VKCA 3BLDA 1ISYA 3QR1A 1VQTA 4J3UA 4QAIA