5I2UA

Crystal structure of a novel halo-tolerant cellulase from soil metagenome
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
296
structure length
296
Chain Sequence
SIVAQNGRLQVIGTQLSNEKGEPVVLRGASLGWHNLWPRFYNKNAVQWLADDWKCTVVRAAMGLEIEDNYRENPEFALQCITPVIESAIENGIYVIIDFHAHNKYTEEAKTFFAGMAEKYGEYPNVIYEIWNEPDYFEWEEVKTYSEEVIAVIRAIDPDNIILVGSPHWDQDLHLVAEDPIRDVSNIMYTMHFYAATHEAWLRDRTDEAIAKGIPVFVSECGGSEANGDGRLGIEEWKTYVDWMESRKISWVAWSVSDKNETCSMLLPRASADGNWTEDLLKPWGKLTRNSIRNAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title Biochemical and structural characterization of a novel halotolerant cellulase from soil metagenome
pubmed doi rcsb
source organism Soil metagenome
molecule tags Hydrolase
total genus 119
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5i2uA00
4IUGA 5LYRA 4DWSB 4A3HA 4TVCA 1XSKA 3UG4A 2F8QA 3EDFA 4J28A 1HJXA 2QF8A 3AHXA 4TX6A 3KL3A 5GNYA 1U30A 3GNPA 2WBGA 4JAWA 1WDPA 1HNYA 2VI0A 2WM0A 1V3MA 3SCPA 4GZEA 1IT0A 1TA3B 1I75A 2WVVA 2W63A 1UWSA 5A94A 1ZBVA 1QNOA 5HOSA 2BVDA 2J7EA 3CH9A 4AD0A 4BCEA 1G0CA 3CHCA 4UFHA 4W8AA 3F5LA 2GVYA 3L4TA 3OGVA 3AS0A 1E6SM 3WNPA 3BXWA 5BXSA 5IFTA 1C92A 3EBVA 2OWXA 4V2XA 3WF2A 2J7GA 5BROA 1RP8A 3VOCA 4P8VA 1FH8A 3WH7A 1F4AA 4J3WA 1DP0A 1JYWA 1B9ZA 5A8MA 3WEZA 1RPKA 2VTFA 4MJ2A 6A3HA 3AJ7A 2D3LA 5IHRA 1JZ6A 4DWSC 2GDVA 1JZ7A 3WEMA 2VMFA 2ZIDA 2V3EA 5I23A 1JI2A 3AZSA 2O9TA 1JDDA 3WNKA 2XVLA 2D3NA 4N42A 3FHQA 1W1PA 1SFSA 4UZUA 2E0PA 2FGLA 4P7QA 2DGAA 3T2QA 3AOFA 1RH9A 4E2OA 1QNSA 1V0KA 3LPOA 3AYRA 2ZWZA 3VD9A 3WMBA 2WMIA 3WQVA 1HX0A 4AD2A 2XGIA 3WELA 1VJSA 4MNLA 3WD4A 2FHBA 5E6YA 5JBDA 1OIMA 2YL5A 1FOBA 3IAQA 4P7OA 2A3AA 4UFJA 1OB0A 2BY0A 1KWKA 3KEHA 4AD4A 3NCOA 2EPNA 3APGA 3WNOA 1US2A 3VIIA 3FAXA 2IUZA 1B0IA 1J0IA 4E4PA 1GOKA 5CPQA 2C8NA 3IAPA 2FGZA 1CNVA 1WO2A 3CUIA 3VKKA 1ECEA 1IV8A 1E70M 4CN6A 1XC6A 1PIGA 2FDMA 4UQAA 3AMDA 3DHUA 4CVWA 4ZXLA 1CXEA 4Z2GA 5EBAA 1FP9A 3QHMA 1UQYA 1ZJBA 1JDAA 3K8LA 3N18A 4LYPA 4RE4A 1DWHM 1GNXA 1UR1A 4D6FA 3WH9A 3KL0A 4NZCA 2HISA 2J8GA 4H8VA 1KXTA 3UCQA 4FLRA 1LJYA 2WHMA 1GQKA 1DWGM 2GJRA 5C70A 5IHSA 1LWJA 3B9DA 2BHUA 1WE5A 1TVNA 3CGTA 3VIHA 4CD4A 2VNCA 1UKQA 3NUKA 3ZR5A 4D72A 3W81A 2XM2A 1WP6A 2WVVB 3WL0A 4AD3A 3WIJA 2DT2A 1XYFA 3W26A 1G01A 3HJEA 2JE8A 2ZOXA 3VGBA 1GQLA 7TAAA 3ZT7A 4J3UA 1QHOA 2ZUWA 1UR8A 3U7VA 5E0CA 2VT0A 4DWSD 4BQ2A 1J11A 3SCRA 4QCEA 4JFTA 1QPKA 1WDRA 5KEZA 4FLSA 1W2PA 1HVXA 2A3BA 4JL2A 3OZPA 4DUVA 3ZM8A 3NIYA 3AHTA 4MB3A 5A8NA 4CN4A 4ZE4A 2ZX9A 4AZ5A 4PTVA 3SCVA 4AIOA 4AZIA 1CXFA 1TUXA 4IPLA 2XFYA 2XYLA 4LXFA 4PMZA 2VL4A 4EE9A 2JEPA 4HP5A 4CD8A 1UA7A 4U3AA 1JIBA 4ZXOA 4GI8A 2V3FA 1K6AA 4JCMA 3THDA 4RL3A 5IFPA 1H0IA 3VX0A 1PBGA 4D6IA 1VRXA 2J78A 3M07A 3K1DA 2OYMA 1JYNA 4D1IA 2VVNA 1J0HA 1JG9A 3GDBA 1HIZA 1TMQA 3ARYA 3F5KA 5EB8A 3RJXA 2YDQA 2F61A 1BGGA 1MW3A 2FHFA 2XFFA 3EMCA 1LF1A 3ARSA 5A8QA 1JNEA 1B3WA 2WMIB 1XGZA 3IJ7A 3F5JA 2WK2A 1W3JA 4PRWA 5CLTA 4W7WA 5CSYA 2OSWA 3RPMA 1CBGA 2QLYA 2E4TA 3EDEA 1W9BM 2VUYA 4DUWA 4IISA 5E70A 4HPHA 2BVYA 5JIWA 3RDKA 1HL9A 1XRVA 1JXJA 3L4YA 4KH2A 1B90A 2VX7A 3SCNA 4WJXA 3WY1A 2WHKA 3T2PA 1E0VA 3UERA 3ARZA 1W1YA 1GOIA 1R7OA 4BA0A 2EQDA 1UH2A 3SUTA 3AISA 3N12A 3N17A 3WUBA 4UFKA 4OKDA 1XSJA 5CSUA 2XVPA 3TTQA 2CIPA 5EMYA 5FL0A 3GNRA 2XGBA 1QVBA 4GI6A 3WDIA 5BXPA 5FIPA 3PZGA 2V5CA 1H49A 4W5UA 2D24A 2ZUVA 1JXKA 3W4RA 2DEPA 2VZVA 1CGXA 3WKZA 1MFUA 1L8NA 1J0JA 3VO0A 3CZKA 4UTFA 4CVUA 2GFTA 1OD8A 4E8CA 3GYCA 4W7UA 3N1AA 3BCFA 1E73M 2VO5A 9CGTA 1OCQA 4H2CA 7CGTA 4Z2LA 1BFNA 1EDQA 5ABFA 3WL1A 2VR5A 2ZICA 3W28A 1V6XA 4J7RA 3NDYA 1LL4A 1GZJA 3EDDA 2E9BA 2DT3A 1GHRA 1NOFA 3SUVA 2J62A 2ZX8A 3VDHA 4W8BA 1JD9A 3VUPA 2GUYA 4AW7A 1HKIA 4W93A 2D0GA 2JFEX 1UD4A 2AMGA 3II1A 1GQJA 1NM9A 4PMNA 1TE1A 1R85A 1E72M 3AROA 1ISWA 2X2YA 2QV4A 3VVGA 4E8DA 5A6JA 4M8UA 2O9RA 3PZOA 4AISA 1MQRA 1H1NA 3WDJA 3CBWA 2DSVA 3RCNA 1C3FA 1E6ZA 4OUEA 3WDQA 3L4UA 1V6VA 1E56A 3ZOAA 1JGIA 4ATWA 1UD2A 3NDZA 1XD1A 3QOKA 1B1YA 1E3ZA 4CCCA 1W9VA 1E6PA 4AZCA 1UR9A 1VF8A 2DSZA 3W37A 3VM5A 1BLIA 3ZR6A 2GK1A 4QDMA 3ZMRA 4YHGA 3KWXA 5JBFA 1OM0A 4J3VA 5IXEA 3CLWA 2EPOA 3DYOA 1QW9A 1CLXA 2WHLA 2VR4A 3ZSSA 1U33A 4BS0A 1CEOA 2ZUUA 1ISXA 1TVPA 2FH6A 4NF7A 1LG2A 3ARTA 2E8ZA 2YKKA 3MV01 1HJSA 2OLHA 3A4WA 2XPKA 2WVSA 3UR7A 3KL5A 4QFUA 1PZ2A 2DSKA 4FLQA 3BAKA 2E40A 4ZENA 3L4ZA 2YBTA 3CZGA 3K8MA 4S3JA 2X8RA 1W3KA 2JIWA 4PCTA 4D6GA 2YA2A 2Y2WA 2PWDA 4AIUA 4MPKA 3EMQA 4FK9A 3VIOA 2UY3A 1DWIM 3THCA 5HXMA 3U57A 2YL8A 2J7DA 2BY1A 1KXQA 2JF6A 2VCBA 3TTYA 2UY2A 3W53A 4AIEA 3NYDA 1QHZA 1QNPA 4MAVA 4CUCA 1E55A 2W66A 1UYQA 1PEZA 4MB4A 3U5UA 4AZ7A 4HA1A 3WNLA 1GHSA 1E5JA 4Q22A 2YJQA 2XSAA 3LPFA 3RMEA 5CLWA 4PTMA 3AQUA 1QBAA 1DEDA 4M24A 3WF1A 4HPGA 2V3DA 1ODUA 4MADA 3A47A 2XVGA 1UD8A 4CD6A 5DF0A 3CUGA 2W67A 4PUEA 2WLZA 4FF5A 3VIPA 4HU0A 5CG0A 3N13A 5E0FA 1HKKA 4HZ8A 3WDRA 4RE2A 2G3MA 2CCRA 1JNDA 4OBRA 4PMVA 3PZUA 3VX1A 1VEOA 4Z2IA 5GNZA 1W91A 3A6OA 3CZEA 5JBEA 1CECA 1NWRA 1V02E 5ABFB 4JKLA 2PBGA 1EHAA 2DDXA 1JAEA 1UWUA 3CUHA 1KBBA 4P7RA 1E5NA 4AXNA 3BMVA 4XZWA 2V3GA 3SCWA 4PTWA 1WZMA 3AXIA 5A2BA 2F2HA 4C7FA 1C90A 2DH3A 3OA5A 4W84A 4F8XA 3MS8A 1XSIA 1MXDA 3OG2A 1NWTA 1W9PA 4JFWA 4DUXA 1FH9A 3NSNA 1BG4A 2CITA 1GOWA 3CZLA 3L2MA 4AEEA 5M5DA 1EIBA 2OSXA 4S3KA 1VAHA 3DYMA 2WVUA 2BY2A 1H0GA 3MKKA 1HL8A 3T0DA 1E6QM 3ARQA 3TA9A 3ZQ9A 4B15A 2WWDA 3VDBA 4AZCB 1QHPA 5JUVA 4Q7NA 2W4XA 1F4HA 2D1ZA 4JZ5A 6TAAA 5M03A 2GK1B 5FD0A 3CIVA 1AQHA 3WQ8A 2PBOA 1UQZA 4PSPA 5HBFA 5DFAA 3AIVA 2D0HA 5A3HA 3WD0A 4CN1A 2VQTA 2QPSA 2G3NA 2WXDM 3WH8A 3GBEA 1E0XA 5AY7A 3T09A 4C7DA 1KWGA 4OJYA 2W62A 4UOQA 3FY1A 2J7HA 3AZTA 2XFRA 2VZUA 3SUUA 4EANA 2EEXA 4ZE5A 1CTNA 1EXPA 4ZEPA 1GUVA 2J74A 4JFSA 1E6RA 1LL6A 4WF7A 1W9DM 1CDGA 3OLIA 2ZUMA 3WDHA 1C8YA 3FAWA 1GONA 1LL7A 3VMPA 3VGEA 1R87A 1GORA 1PIFA 1J18A 2QHAA 3FNDA 4WKHA 3BAJA 3SCQA 2DPEA 2EXOA 5C71A 5D9PA 3W82A 1UKOA 2WZIA 1E0WA 2CBIA 1W1VA 5FCZA 4TTGA 1H09A 8CGTA 4H04A 2OYKA 1TG7A 2PWEA 4ML4A 3BAWA 2VX5A 3MANA 1GCYA 1C7SA 2WMHA 3SCTA 4UCFA 5F7UA 1VIWA 4UFLA 5A6KA 1CXHA 4GKLA 2ZX6A 5HNNA 1CXLA 3VMNA 5I5RA 1VEMA 5DEZA 2WZHA 1KCKA 2YA1A 4L4PA 1K9TA 4F79A 4M81A 4V27A 4BF7A 3OB8A 2XTKA 3VM7A 4NRSA 3SCSA 1QI3A 2CPUA 1CGWA 1P6WA 3S2CA 1Z32X 2Y5EA 1E1EA 3AHVA 1G9HA 4J27A 6CGTA 5LA1A 1ISYA 1H3GA 4WKAA 1KGWA 2ZUTA 4UQEA 3AS3A 2JIEA 1NP0A 2J7CA 1ESWA 1IZJA 3T0BA 4XZBA 2DT0A 2ZXAA 3MMWA 4UR9A 2CBJA 3CHDA 3HN3A 4P8XA 3LMYA 5A6AA 3QR3A 3AI0A 1HP4A 4JFVA 4MTVA 2WAGA 5E09A 4W88A 5BWFA 3AIUA 1C93A 3WUFA 1TR1A 2YOCA 4M80A 1JZ5A 1Q6EA 2Y8KA 2VC9A 2DQXA 4GZJA 3AZRA 2VCAA 3T2OA 1CGVA 3N15A 4UOJA 4TVDA 4CKQA 1GOQA 3ALFA 1J01A 1MVYA 4OOUA 3VGHA 3VINA 3RM4A 1FH7A 2AOSA 3BH4A 5HDRA 1E6XM 3UESA 1HJVA 1TZ7A 1UR4A 1UOKA 3A4AA 3CZJA 1CGYA 2WMFA 1V0MA 1OT1A 4TUFA 3O6AA 5CGTA 3MV11 2YDRA 3WF3A 4LQ1A 1LWHA 1WNOA 1BAGA 1ODZA 1I1WA 1JZ2A 1E40A 1TCMA 3CHEA 3SUWA 5I78A 3K46A 3CUFA 1B30A 3I3BA 1L0PA 4J3TA 3WD1A 3AMLA 1Q6GA 5D8ZA 2V5DA 5DO8A 1QNQA 2WZEA 4D6HA 4FMVA 1BVNP 4GO8A 2NW0A 4HA3A 3I3EA 2ZWYA 4HMEA 3DECA 3OZOA 2VZOA 5E6ZA 4HZ6A 2PC8A 3AICA 3VGDA 2J4GA 1SYTA 4KRUA 3W24A 1R7AA 2X09A 4WIWA 1UUQA 3VTRA 3O9NA 3QGVA 2G8ZA 4GINA 3GXMA 1H2JA 1PZ3A 2XSBA 5BXTA 1C91A 4URIA 2DSUA 2UWFA 1YHTA 1QI0A 4OBSA 2YDSA 4BQ4A 2VRKA 1QBBA 3OIHA 2WB5A 2CESA 1R86A 2FH8A 5D9MA 4HMDA 1B2YA 1J9YA 2YBUA 1BSIA 1LQ0A 1EH9A 4CGTA 3WQ5A 2W5FA 4B9ZA 4JL1A 5GQBA 3OLGA 2WANA 1OGSA 4A4AA 4M82A 3AIBA 3PZ9A 4PUDA 3ARVA 4B9YA 1KQYA 4EK7A 1J0ZA 3AXXA 4J3XA 1V08A 1B31A 1ZBCA 2BXYA 3EDJA 4JHZA 5A1AA 3E1F1 2WW5A 3BLPX 4D6JA 1VB9A 2DIEA 4PBGA 3GZAA 5I2UA 4HA4A 1PAMA 3VD3A 1R8LA 4TOQA 5I79A 1JYXA 3VIJA 2XJ7A 5ABEA 3PZNA 3POCA 1GVYA 1SMAA 2D2OA 2WMGA 1UD3A 3WF4A 5GNXA 4TX8A 2BY3A 3NSXA 1M04A 2XWEA 3PZMA 1UKPA 3BAIA 2OWCA 5I0DA 1G5AA 4F66A 2VOTA 2QMJA 3AFBA 5EFDA 4GQQA 2CBUA 1BHGA 1XCXA 5CXPA 1FP8A 4PMYA 1CGUA 3BAXA 2CKRA 4WKFA 1XH0A 5HPOA 2XVKA 2B31A 2XM1A 3PN8A 2JEQA 3VIFA 3ZT6A 2WCGA 4W5ZA 1CWYA 4MAZA 3ARWA 5A6BD 4U2ZA 1EQPA 1E1FA 2G41A 3HMCA 1EQCA 2PB1A 3AHYA 3UEQA 1JDCA 3U5YA 3MMDA 1Q6CA 1KB3A 1V6UA 3BLKA 2ZUNA 1GJWA 5ECUA 3A4XA 1DWAM 1TFVA 1UH4A 1W3LA 3PZIA 1WDSA 1I1XA 2YA0A 1UD5A 1PX4A 3VNYA 2XIIA 3AIEA 4LX4A 2Z1KA 1JZ3A 3N9KA 1VBRA 1K9EA 1JAKA 1V3JA 5BRPA 2EPKX 3T0AA 1A47A 1CXIA 3EDKA 1V02A 4PSRA 3WDPP 1V3KA 1V6WA 3FN9A 4JIEA 3W27A 1JF5A 4YHEA 2BHZA 5AYIA 4ZFMA 3MMUA 4OIFA 3W6LA 1B3ZA 1PX8A 3K4DA 4X0NA 3M7SA 5I24A 3MU7A 2WLYA 4R27A 4LPCA 1XCWA 3VIMA 2WMJA 5A6MA 1GJUA 1J0KA 4WSKA 3J7HA 1E4MM 4N0RA 2WC3A 5D8WA 1ZJAA 2ZXBA 3IANA 3SUSA 3BAYA 5CQ1A 4MB1A 4HZ7A 2G3JA 2WKGA 3PZVA 2Y24A 2VX6A 4W8LA 4YPJA 2VRQA 1W2VA 3S6TA 1B3XA 1D7FA 2EPMX 2EJ1A 4PMRA 4TXEA 1BGAA 4AD5A 1KQZA 1NWUA 2CERA 2J25A 1K9FA 3AYSA 4H41A 2BHYA 4PCSA 2CETA 5A8PA 3IJ8A 5BRQA 3AS1A 4D6DA 1BPLB 3OBAA 1M53A 2J79A 1VFUA 5BYWA 3CMJA 4UQDA 3OGSA 2V38A 2DT1A 1Q6DA 2O9PA 4AMCA 4GI9A 1CZ1A 1W9XA 5M17A 3GH4A 5E9AA 2DSWA 3D3AA 3WFZA 3GXIA 2MANA 1QOXA 3RILA 1W9UA 1UWRA 1KXVA 2GDUA 2CHOA 2JALA 1FHLA 2FHCA 2CNCA 2PWFA 4HMCA 1VEPA 3BMWA 2W91A 3VD7A 4CU8A 3RO8A 4QLKA 3QHNA 1WZKA 1E4NA 1NWSA 4BZYA 1E43A 1WAWA 1BTCA 2E3ZA 1EDTA 5A6LA 5D9NA 1U2YA 1E4IA 1QNRA 1NQ6A 3B8SA 4NRRA 1M7XA 1PPIA 1AVAA 3WMCA 5LA0A 1GVIA 4U2YA 2WPGA 3PZTA 4JKMA 3NSMA 1NARA 1UA3A 4D6CA 4RE3A 1FFRA 3WH5A 2WYSA 4B3LA 7A3HA 2WSPA 2QPUA 2RGLA 4OZOA 4U33A 2VJXA 4A3YA 4CD7A 2DH2A 4TTUA 1ZL1A 3OLDA 1OINA 3K8KA 3UR8A 1X6NA 1BYCA 1OBAA 5AC5A 3MUIA 5A6SA 2ZX7A 3F4VA 4KMQA 1HJWA 2A3HA 1OT2A 4QLLA 1HVQA 4B3KA 5IDIA 4JFUA 1MYRA 3TONA 1SR0A 3WD2A 1AMYA 2BVTA 2QMKA 1M01A 1E15A 4W7VA 4M1RA 1HKJA 1OGBA 2AAAA 1KFWA 3CO4A 1ZU8A 3WEOA 3DC0A 1A3HA 1BF2A 4XV0A 1KGUA 3QOMA 3WSUA 1EHNA 3JUGA 2G3IA 3HU7A 4MNKA 2YL9A 2J7BA 2CBVA 1OGGA 1UD6A 2D0FA 3SURA 1KXHA 1PX3A 1EOMA 1UR2A 4WLCA 3FW6A 4MB5A 4W87A 4AY1A 3AIQA 1XV8A 4OOZA 5LA2A 4QLJA 3UG3A 2J77A 3FXYA 5DMYA 1EDGA 4JKKA 2BS9A 3DHPA 1UZ4A 1V03A 4U5KA 4LGXA 1WKYA 4BQ5A 2GJPA 4AZGA 2O92A 4GZIA 4ATDA 1RD6A 2UY5A 5A2AA 3WUEA 1V0LA 1S46A 1OWQA 4AYSA 2XVNA 5CGMA 3VD4A 4AC1X 2WKLA 2XG9A 1M03A 4L4OA 3CHFA 2IXUA 4M56A 3AMKA 2Y4SA 1GPFA 1DTUA 1WB0A 2OSYA 2W61A 1OSEA 1H11A 1OIFA 1IZKA 1C7TA 2VURA 3IJ9A 4PMQA 3VDAA 1VFOA 3PZQA 1SMDA 2WBKA 1QI2A 5ABGA 1KCLA 3SEPA 1JZ4A 1CPUA 1ISVA 1KBKA 3W0KA 4HOWA 1WZAA 4U5IA 2TAAA 3U7BA 2VQUA 3TTSA 1G1YA 2WNWA 2E9LA 3ARPA 2ZXDA 3L4WA 3LPGA 2EO7A 1XYZA 1MQQA 1UG6A 1LG1A 3CUJA 4P8WA 2GJXA 3CPUA 3TP4A 1ISZA 2WC4A 4UNIA 1W32A 5I3DA 4QP0A 1V3HA 2X0YA 2JF7A 3B9AA 1KR1A 1V3LA 3FHAA 1NOUA 1GOOA 5BXRA 2XWDA 3L2LA 3PHAA 1CGTA 4PMXA 5A8OA 2YLLA 3BCDA 3MSGA 1BQCA 2WC7A 3M46A 4HTYA 4UFMA 3WNMA 3K4AA 3VMOA 4UQ9A 3VGFA 5FKYA 4MDOA 4NSBA 3PTMA 1E6NA 4W85A 4AZ6A 4J3SA 4Z2JA 3W25A 4HU8A 4K68A 3TOPA 4GO9A 4Z2HA 4JHOA 4W89A 4P7NA 3BSGA 1C8XA 4WK9A 3G6MA 3VD5A 1AQMA 3N11A 3RM9A 1HN1A 2PWHA 3VU2A 3WF0A 1PJ9A 1N82A 2WSKA 3GH5A 1KGXA 2NSXA 1UR0A 3SCOA 1CLVA 3WBAA 4ACZA 4F9JA 2Z1SA 4W86A 2WMKA 3ZJ7A 1VENA 2YLAA 1NP2A 3ALGA 1D2KA 5D9OA 1UKSA 5C8BB 4P8UA 4AZHA 1MWOA 3QHOA 3PTQA 4GQRA 2G4FA 1J0YA 4CD5A 3ZIZA 1WZLA 1VFMA 3D5HA 3OGRA 4UOZA 1CENA 2E9MA 1QI4A 3VIGA 4AZBA 5GPRA 2C0HA 5DT5A 5A95A 2DIJA 1JF6A 5CJ5A 1MFVA 2CHNA 1JZ8A 3ZJ6A 1X1NA 5I6SA 4EKJA 2OYLA 3ZJ8A 2Y8VA 4PYSA 2OWWA 1H41A 2VRJA 5HPCA 4KGJA 3B9EA 3VDCA 3GBDA 5JIPA 2BXZA 1JD7A 4QAWA 3MUZ1 1D3CA 1EGZA 3BGAA 4PEEA 4V28A 2YL6A 2ZUSA 2W92A 2D23A 4UQBA 1E9LA 4D71A 4GXPA 1EO7A 1W3HA 2RGMA 2WWCA 5A2CA 2Q8XA 1V0NA 2D20A 1BYDA 1NH6A 3PTKA 1GW1A 4XX6A 3ECQA 3SCUA 1B3VA 4XUYA 4H7VA 3ZSTA 4MJ4A 2IXVA 3MUY1 4MNJA 4P7LA 1CXKA 4ACYA 5BCAA 2A3CA 4D6EA 1CYGA 4H8UA 2PI6A 1QW8A 1UHVA 4AWEA 2X0HA 5AYBA 1HKMA 2HVMA 3GH7A 1WCGA 3WFLA 2NT1A 4U31A 5CPTA 1NOWA 3WQ6A 3M6DA 2XUCA 1AQ0A 4UZSA 3LPPA 1UWQA 4PMDA 2GJXB 1B3YA 3AIRA 1US3A 2CXGA 1LLOA 3NJ3A 3ZJKA 4BQ3A 3BC9A 8A3HA 1Y7VA 4H8HA 2X05A 3KE0A 4B16A 1VFFA 1CIUA 4DWSA 1YQ2A 4PMUA 1Q6FA 4IM4A 3W38A 5TD4A 1WDQA 2UY4A 1VBUA 5DT7A 1MW1A 2PWGA 4FLOA 4WSJA 3A3HA 3CMGA 4PTXA 3UETA 2YIHA 3WQWA 4ATLA 1EA9C 5CPSA 4LYRA 3AHZA 5D4YA 1HJQA 3WMSA 4YN5A 3SIMA 3L4XA 1C8QA 1HF6A 1X6LA 4JCLA 4PN2A 4U3CA 4C7GA 1GQIA 3UG5A 4Z2KA 1E71M 1TA3A 1H4PA 3GXFA 4F9DA 4X9YA 2X1IA 1ITXA 4X0VA 1MW0A 3AMCA 4EAMA 2ZE0A 4Y7EA 3GNOA 1V3IA 1BYAA 3ARXA 1VJZA 3GM8A 3W6MA 2C7FA 2GSJA 2J75A 3VGGA 4R5EA 2ZXQA 3T08A 3VNZA 3AXHA 3L4VA 4UFIA 2EPLX 4ACZB 1XD0A 2PF0A 1MXGA 1JI1A 4AD1A 1EO5A 3MUAA 4NI3A 1Q4NX 1JL8A 1QI5A 3W29A 2ZX5A 2BFGA 4LYQA 4KGLA 4HOXA 5CZKA 3IK2A 2CKSA 4KWUA 3AS2A 2XHYA 1J12A 1WPCA 3CZ8A 4GIAA 4CU6A 5AC4A 2CEQA 1JYVA 1UWIA 2VCCA 2BNJA 1H5VA 3RM8A 1BVZA 2WVTA 1W1TA 4DM2A 1JFXA 1DWJM 1E3XA 1XH1A 5FL1A 3GTNA 3VILA 3I3DA 2NT0A 3N04A 2CYGA 3RIKA 3VPLA 1UH3A 1OD0A 3PBGA 5FOOA 3WN6A 2XIBA 4DM1A 1O7AA 4MNMA 1BG9A 1EOKA 3EMZA 3EYPA 3WBEA 3WENA 1FFQA 1MQPA 1BYBA 5M3WA 1HXJA 1UZ1A 2J7FA 4CU7A 4HOZA 3MSDA 1O6IA 3G6LA 5A69A 4AEFA 2J47A 1KR0A 2J8FA 3VIKA 4TVUA 1HT6A 5I77A 5KZ6A 1ZB5A 1UKTA 1XHGA 2A3EA 3WD3A 3TTOA 1ZBWA 2WHJA 1RP9A 3AIWA 1V6YA 1JFHA 3O2LA 1ITCA 2VVSA 3ZT5A 3ZO9A 1E4LA 3WUGA 2VX4A 4IPNB 5A6BA 4KRTA 2ESCA 1DHKA 2D22A 3CTTA 4PMOA 5EFFA 4XB3A 1MW2A 1GOMA 2VZSA 3MO4A 1ZBKA 2E8YA 1UWTA 1FHDA 3KZSA 1J10A 1FA2A 3GXDA 2BV9A 4UQCA 4D1JA 1K9DA 3DYPA 4QCFA 3RJYA 3POHA 4MDPA 4M29A 2WCSA 1HP5A 3OLEA 1ZS2A 3WNNA 4GPNA 4CCDA 3ARUA 1DWFM 2EBNA 4CCEA 1XH2A 2O9OA 2WCAA 3WH6A 2VZTA 3WQ4A 3ARRA 1HJUA 5ABHA 3AMGA 3BSHA 1G94A
chains in the Genus database with same CATH superfamily
3LSBA 2AL1A 4DWSB 2AL2A 1Q2RA 3P0XA 4DEFA 1DBTA 4H6RA 3CQ0A 4JGDA 3BUVA 2VEFA 4Z0JA 3O8AA 3VFCA 3GNPA 1WDPA 2PTYA 2WM0A 4J1OA 2YZ5A 2VELA 4GZEA 2JKPA 1I75A 3URQA 2I1OA 2W63A 1VKFA 4LVAA 1UWSA 1EPXA 1W1A1 5CAKA 3CH9A 4BCEA 3CHCA 3SGUA 4W8AA 3F5LA 2GVYA 4HU3A 3AS0A 3WNPA 3BXWA 5BXSA 1FKXA 2OKTA 2OWXA 4NQ1A 3WF2A 3WO8A 1RP8A 4FXFA 3M0JA 4JN7A 1SJAA 5C54A 2GOUA 1W5MA 5A8MA 1R6WA 2VTFA 4MJ2A 6A3HA 3TQVA 3VC6A 3GDMA 5K4XA 3IIVA 2PWVA 4R9XA 2O9TA 3I10A 1JDDA 2XH2A 4IG2B 1ITQA 4LS2A 4IGNA 4NNCA 2QGHA 2XVLA 1SGJA 4BF9A 2DGAA 4MM1A 4E2OA 1QNSA 4HYVA 2BSLA 4XZNX 1TPVA 3VD9A 4XO7A 2WMIA 4ZGYA 1XF0A 1W3IA 3WELA 4DO5A 2W3ZA 4IIGA 1E0TA 5E6YA 2VFDA 3T55A 1OIMA 1EZWA 3KOXA 4EXAA 1OB0A 2BY0A 2BGNE 1TPC1 1WBHA 1KWKA 1UMYA 3BZGA 3UJ2A 1TREA 2A0NA 2Y7FA 1O5XA 4I9MA 1PCWA 4E4PA 3OJGA 1XX1A 2C8NA 1CNVA 2KZHA 3UNDA 3UZJA 4PUUA 2FB2A 3B8VA 1S2CA 4FSAA 2XSXA 2BX7A 1IV8A 2PDHA 4FNSA 4Q4MA 4HSNA 1E70M 1JUBA 4CN6A 2FPYA 3CL7A 1XC6A 5EGRA 3NR0A 4L4MA 4C90A 4H7ZA 3LBMA 3DHUA 4Q8NA 1CXEA 4FA3A 2QULA 4AXKA 3QHMA 1M5WA 1JDAA 3N18A 4LYPA 1DWHM 1GNXA 1UR1A 3CAKA 3QH2A 3A64A 3TUUA 3ICJA 2AGKA 3N3TA 5FEXA 1P7TB 1EEXA 4XQ6A 4HPNA 3UCQA 3V1HA 1UZHA 1DWGM 2GJRA 2NQ5A 5DMMA 1ZJIA 2BHUA 4R85A 1TX0A 4UXDA 3NUKA 4D72A 3W81A 4H6QA 2PDYA 3H4GA 2WVVB 3W26A 5B7YA 1G01A 2J8TA 1RVGA 3GHSA 3HJEA 1TPH1 3RCMA 4Q4KA 2JE8A 5I00A 3MWCA 7TAAA 1Z48A 1FTXA 4FEZA 2ZUWA 4O0ZA 1UR8A 1PUDA 3B8TA 4XTDA 4BQ2A 1XGEA 3R0DA 4JYFA 1OFOA 3R8GA 4XD4A 4FLSA 4OQVA 2Z0IA 1HVXA 4JL2A 1YTKA 3IIXA 1VLIA 3RX3A 3GXNA 4DUVA 4ZB5A 2Y70A 3UZZA 1XYAA 4CN4A 4ZE4A 1QK0A 2ZX9A 4K1GA 2IKHA 4AZ5A 4AIOA 4AZIA 2XYLA 4GZ7A 1PL9A 1KLYA 1IWBA 3LBCA 2V3FA 1K6AA 4GXWA 4JCMA 3HGOA 1DJNA 3MZNA 4LVBA 4YWSA 3WLTA 2XN0A 1I4NA 1JEZA 4Y8FA 5EB8A 2YDQA 2FHFA 1TPB1 3ID7A 1XR2A 1X38A 3ARSA 1JNEA 1CW2A 1SO4A 2VKZG 1S39A 1KFBA 3V5OA 5C55A 2WK2A 2JKAA 1UIOA 4PRWA 5CLTA 2PF8A 4GXMA 5CSYA 5IBXA 3STGA 1KM2A 4UTUA 1FQ0A 1W9BM 4O18A 3W01A 2F6KA 3TX9A 1XRVA 3H8AA 4DF2A 2VX7A 3P82A 3WY1A 1RBAA 1ADDA 1LTDA 3TC6A 1VGAA 3ARZA 1W1YA 1T0OA 1KW1A 4U4MA 4BA0A 4AFYA 1NIUA 1VYSX 3SUTA 2UV8G 3RU8X 2CC0A 3HZ3A 4GACA 5CSUA 3NQBA 3KVJA 4GKTA 4DX3A 3G1RA 4XBJA 3WZ0E 3WDIA 1H49A 4OE7A 3VE9A 1C9DA 1C8VA 1US0A 3VO0A 4CNSA 4CVUA 1FCUA 2P10A 1XRFA 3BCFA 2QJHA 3KLLA 5CC6A 3W7JA 3WLLA 1EDQA 2PDCA 1XGDA 3TJXA 4LRSA 4IOTA 3CAWA 4FP1A 1GZJA 3EDDA 4L9XA 1VPYA 1FWDC 1FDZA 4L9ZA 3SUVA 4MKSA 4XBKA 3VDHA 4Z1BA 7XIMA 2Y7DA 4I8DA 3QY7A 5U4NA 4AW7A 4HB7A 3UCCA 3QW4B 1PKLA 1R85A 2HEJA 3V5FA 4Q4QA 2QV4A 3CAVA 3MDUA 1L6YA 1BWVA 1MZRA 4JN6A 4M8UA 1Z7AA 3PZOA 4GC4A 1UZDA 1H1NA 3MHUA 3CBWA 3RCNA 3L4UA 1L6GA 2PGEA 3ZOAA 4CNNA 4QITA 2PFHA 1B1YA 1E3ZA 7REQA 3BLOA 4M6PA 1TQJA 4O8AA 2QZRA 2V5LA 3G1FA 1VF8A 1XPYA 1ZQ5A 3MJYA 2A7PA 2VFHA 4J3VA 3CLWA 3PK7A 4WEVX 2WHLA 1U33A 4KCTA 3A12A 4WQ6A 3EXTA 4CCZA 4XAGA 1ISXA 2FH6A 3LY0A 3WCZA 4UUIA 1OG0A 2DW7A 3O63A 2XPKA 3SN1A 4YVVA 5GJNA 3FGCA 2VGIA 3B0VC 3M5VA 1QJWA 4ZENA 1W3TA 3K8MA 2DIKA 4ONVA 4E3TA 4DBDA 3RGTA 6XIMA 4F0MA 3TQPA 4AIUA 3NVDA 4JEJA 3EMQA 4FK9A 3FSUA 2OZTA 3U57A 4NI8A 4LUSB 3M0HA 2O56A 1OQFA 4K36A 2BY1A 4NX0A 5CG7A 3VC5A 1KXQA 4GIEA 4R34A 3TTYA 3ANYA 1CX9A 1A5AA 2RDTA 4AIEA 4WUIA 3R8RA 3NURA 4IF2A 5L9FA 2FZ8A 3TTEA 3VOHA 3RLHA 4AZ7A 4HA1A 2ISWA 3WNLA 3KX6A 1E5JA 2YJQA 3RMEA 2Q8LA 2I5IA 2OX4A 4US5D 3LDVA 1JPMA 1PXGA 4QQUA 1DEDA 3A3XA 3WF1A 1XIDA 3M0ZA 4NJHA 5CJMA 3SRKA 3AXMA 2VD8A 4EWJA 5CZJA 4PUEA 4XSMA 3CT2A 4FOKA 1Z3NA 6ENLA 3W1PA 3MCOA 1SZNA 3OBKA 1X6UA 2Z1BA 3D46A 1W1B1 3BZJA 1BXBA 4QE1A 3VX1A 5CC5A 1W91A 5AZ1A 1EYWA 3F2DA 1KC7A 5JBEA 2NWSA 4HNNA 4JKLA 1LWIA 4X9SA 3C4UA 2DDXA 5JQ9A 1XLIA 1WZMA 3FSTA 3AXIA 3PTDA 3UPBA 4HNUA 1YX1A 4MUZA 3MS8A 3CQIA 1V6TA 4OV9A 4IXXA 3DFTA 1PTGA 1XRSA 1AK5A 4NAEB 3T40A 4PCFA 1KM3A 5U7SA 3USZA 1BF6A 1RY0A 1BG4A 3LU2A 1GOWA 4ZB0A 5HMEA 1EIBA 2OSXA 4IGHA 9XIMA 2WZTA 1H0GA 1HL8A 3LZ3A 3UWWA 3Q67A 5AHFA 3T0DA 3NM1A 3O1NA 4X3ZA 4YTUA 2E68A 4ILSA 3LERA 3BTNA 2H8ZA 1KFCA 5FEPA 1F4HA 3LYEA 4LFYA 4WY0F 5FD0A 1GVEA 3WQ8A 1TTJA 5DFAA 3L7RA 3BW3A 5A3HA 4CN1A 4C6JA 4LANA 4KCWA 3ZYZA 3GBEA 3DFPA 4XAFA 1E0XA 3S5OA 5AY7A 3T09A 3AZTA 3W7KA 2VZUA 2EEXA 1V7AA 4ZE5A 1POJA 1CTNA 1EXPA 1YXYA 4L6HA 1GUVA 4JFSA 1E6RA 4WF7A 1H1YA 5TBOA 3GVWA 3OLIA 3LHUA 3WDHA 3PG9A 2INEA 1LL7A 2A7NA 2V5JA 3VMPA 3W00A 3VGEA 1PIFA 3BAJA 5D03A 2DPEA 1SJBA 1U5HA 2R6OA 4GUIA 2R1NA 2PTZA 3SECA 1H09A 4LCQA 1YE4A 1KFEA 4MUPA 3PS7A 5DN1A 2VX5A 1EP2A 1GCYA 1NELA 3QMTA 4BWLC 4GKLA 1MSSA 4I5UA 4EPKA 2ZX6A 3S2LA 4GNKB 3GX9A 4YYCA 1DXIA 1RUSA 3WK0A 2YA1A 2XN2A 3DH7A 1QOQA 3G3MA 3KAOA 3KZPA 1K9TA 4XTIA 1W31A 1IWAA 1GKQA 4UTWA 3S2CA 1G4EA 3C2RA 4RZ4A 3W76A 1B54A 1BWKA 1E1EA 3LGDA 3MSYA 1FWRA 3AWOA 6CGTA 5LA1A 4C6OA 1KGWA 2VFIA 3G5EA 1NP0A 2J7CA 5AECA 3CL6A 4ZTXA 4TO8A 4HVXA 2DT0A 3MMWA 3QYSA 4WJ8A 1HO4A 3HN3A 4FNPA 4EPDC 4JFVA 4O8RA 1XLJA 2Z00A 1CB7B 3M41A 3AIUA 2GYIA 2GWGA 2HSAA 2REQA 1P0NA 3DU0A 4F0HA 2HROA 3NXFA 3RF9A 4JTGA 2VCAA 2HV5A 1YDYA 1CGVA 1J01A 4OOUA 3VINA 4YJ5A 3UWEA 1ZP3A 2NUYA 3RM4A 2AOSA 3BH4A 2ZVRA 5CJNA 1UR4A 1XCFA 4LUTB 3A4AA 8XIAA 1V0MA 1DJGA 4LQ1A 1SUXA 4JTAA 1E40A 3CHEA 1SJDA 5I78A 5D32A 3K46A 3CUFA 1B30A 3WD1A 1L0PA 1YPXA 4HHMA 1YW1A 1QNQA 1BVNP 3QKZA 3ABSA 2NW0A 2JBMA 2VZOA 3T7VA 4ORMA 1VFLA 3R89A 3VGDA 2J4GA 1SYTA 3E3HA 5BMXA 4IIFA 3W24A 1R46A 4UMBA 5DELA 1R7AA 2H90A 1UUQA 2EF9A 3VTRA 4HHPA 3BO9A 4QEHA 1VHNA 3ABOA 1PZ3A 4WY0B 1C91A 4URIA 1SR9A 3CM4A 1XLHA 3S42A 4OBSA 1RCOB 2HDJA 3FOKA 5FF0A 1QBBA 3U48A 2WB5A 2XIQA 4V1XA 2FH8A 4HMDA 2MUCA 5CAHA 2YBUA 4HYWA 4M3PA 4LB4A 1EH9A 3H53A 3WQ5A 4A8IA 2G95A 2W0UA 2W5FA 2RJGA 5GQBA 2WANA 3I6RA 3KHDA 4M82A 3PZ9A 4QNWA 3AXXA 4J3XA 4QJ3B 2DZPA 4OT7A 1TWSA 3EDJA 1X98A 5A1AA 3V7PA 1OF8A 3E1F1 5LXEA 1K8YA 4D6JA 1RCXB 1XLLA 2I5GA 4HA4A 1R8LA 2V2HA 5I79A 1GG0A 5ABEA 1JCYA 3AJXA 3N73A 2WMGA 3CH0A 2BY3A 3PPCA 1HL2A 4UB9A 3V18A 3NQ2A 2PCQA 2PUZA 3L23A 4Y9NA 4YLWA 2OWCA 3O07A 3IVUA 1G5AA 1EGVA 1YPFA 2CBUA 4E0CA 2TODA 4PMYA 3EWZA 2CKRA 2CHRA 4IQDA 4AY8A 3H24A 5I3HA 3GG0A 4S2CA 4JDBA 3PN8A 4XD3A 2JEQA 4JQ4A 5G4HC 3VIFA 4W5ZA 1CWYA 3WLHA 3ARWA 3EOLA 2Z7KA 1KKRA 1UB3A 1A49A 3AHYA 3UEQA 3UBPC 2HTMA 5LIKX 3BLKA 5ECUA 5BOFA 1TFVA 1W3LA 2BG5A 3PZIA 5DQPA 1UD5A 1PX4A 3L12A 3PG8A 3GG7A 2EJAA 4BEQA 1OCBA 1JZ3A 5LHFA 3BARA 3W02A 2ATSA 5BRPA 2EPKX 2I57A 5F2MA 1A47A 1CXIA 4PSRA 1R3TA 4ZQNA 1W6TA 1V6WA 4JIEA 2IPGA 4LH8A 4PODA 1RALA 3P5ZA 1AFSA 4ZFMA 1P1MA 5E0KA 3MU7A 2WV8A 3VIMA 4WSKA 1E4MM 4LSBA 4HK7A 2ZXBA 3BMXA 4MB1A 1PO9A 3LCWA 3FK4A 3DBNA 2YCLA 2Y24A 2QCDA 2R91A 4BI6A 4YPJA 3S6TA 2GGGA 3VKCA 2EJ1A 4PMRA 2ANUA 3W86A 4WDTA 1WXYA 1X8CA 4ZO9A 4PCSA 4IP4A 5A8PA 3FA3A 4F0KA 1KV8A 1ZRQA 4H2HA 3GIYA 1JPKA 3OBAA 2J79A 1KM5A 1UUOA 4W9TA 2V38A 2DT1A 4INFA 4GI9A 1W9XA 2E77A 3AO0A 3D3AA 5H6HA 4RDVA 1QOXA 4PMJA 3B0UX 3EGJA 4ADSA 2F6UA 3P61A 2DV0A 3NZRA 4QS5A 3S5ZA 3BMWA 3WJWA 4O4VA 3E2RA 3LQLA 4R33A 1FX6A 2IMRA 4BZYA 2DQWA 4H9XA 1BTCA 2LLEA 3GDLA 3LENA 2H8XA 1S5MA 4NRRA 1M7XA 3PJTA 5EU9A 2NX3A 1Q7QA 4JKMA 4AF0B 1UMLA 4JTUA 3TMLA 4DPQA 2WSPA 3L0KA 4IMAA 3W85A 4A3YA 1VS1A 2HZGA 4TTUA 1VBGA 1ZL1A 1OINA 5CBBA 1Q8AA 3SFKA 3EXSA 5GVJA 3JVAA 3N2XA 4M0XA 4DY1A 3E02A 1BYCA 4PUJA 5AC5A 1Z41A 3SADA 3MUIA 3BDKA 2ZX7A 3F4VA 4KMQA 3UPWA 2B7QA 3CPRA 1HVQA 4ZQRA 3P6LA 4NZ4A 4OBTA 3OVRA 5XIAA 2BVTA 4K8HA 1M01A 4I7WA 4W7VA 2ZQ0A 2HE8A 3STFA 1HKJA 1R3QA 2AAAA 4GE8A 4ZQMA 3SRDA 2GGHA 4XV0A 2DZUA 3FFSA 1OY0A 3ZFHA 3I68A 4UR8A 3WSUA 5FJOA 3KTXA 1PV8A 4KEUA 2YL9A 3STCA 2J7BA 4ZO8A 4JBRA 4G7EB 3U2OA 3AYTA 3SURA 1UR2A 1L2UA 3BQ6A 5J8LA 3AIQA 4MY8A 3GXPA 1JJKA 5LA2A 2Z26A 1D7KA 1SSDA 2J77A 4M6VA 3ZR4A 1NF7A 5DMYA 1TELA 4JKKA 3DHPA 4F4RA 4LGXA 2P88A 2PODA 3QGAC 4GZIA 1L2QA 3IVSA 2VEIA 3MO7A 8XIMA 1V0LA 1S46A 1O1HA 4GNVA 4O12A 5SWUA 1EX5A 5FACA 4AYSA 3GU9A 4DQWA 4NASA 3VCRA 4GJIA 1QASA 1XIBA 3TXVA 1GPFA 1OIFA 5HUOA 4LBUA 4FX7A 2F7FA 2A2IA 1J93A 3VDAA 1VFOA 5LNRA 1ZCCA 4PRRA 4XUGA 1Q7MA 4UIOA 4WDXA 3BE7A 2CZVA 3EA1A 1KCLA 1ISVA 4HOWA 1WZAA 2TAAA 2VR2A 3GG8A 3U7BA 2VQUA 1G1YA 4HZMA 2PZ0A 3DHFA 3L4WA 3TZFA 2NXHA 1O5KA 2EO7A 2OMAA 3CUJA 4P8WA 3CPUA 4HMNA 1ISZA 4QDPA 3LHVA 3IK4A 5I3DA 4QP0A 4ZTYA 3B9AA 3OZYA 5DXXA 1V3LA 1S2VA 3BOXA 1F05A 1NOUA 4MZ1A 5BXRA 2XWDA 3MUXA 3MVTA 5C9WA 4LV9A 2QAPA 3KWSA 3A9IA 3E0VA 3BCDA 5CC7A 3R2GA 1W8GA 3URAA 1BQCA 4IMCA 2PDMA 3MTWA 3W83A 3M43A 4PB4A 3APTA 4AZ6A 4Z2JA 3TOPA 1UROA 3T6CA 1XIMA 3LCXA 4F2BA 4Q8MA 1V93A 1H1ZA 3TIMA 3TR2A 4UTTC 3COTA 3WK1A 4HU4A 1XPGA 2DZAA 3ITTA 4JEQA 3MMTA 3N11A 3O16A 5D04C 1GZ1A 1PJ9A 3LBOA 1R30A 2WSKA 3SY1A 4IMDA 3UZXA 1UR0A 1IYXA 2FMNA 3SCOA 4ACZA 3VCNA 2F38A 3EWDA 4RXGA 4CNOA 5F4SA 3RR4A 3NOEA 2YLAA 1S2WA 3HGJA 3VAVA 2C0AA 3NL3A 3QHOA 2WKJA 3PTQA 1A0EA 3M1ZA 2QR6A 1J0YA 3ZIZA 1WZLA 2C19A 2E5BA 4LAMA 3D5HA 3IGUA 1U22A 3CMFA 4RDYA 4UOZA 3TU9A 1CENA 3N2TA 5EMJA 3E5BA 3WLPA 1QMLA 3VIGA 2CLFA 1TKKA 3WJZA 3UVIA 4E6MA 1X1NA 5LGZA 4EKJA 2QCGA 4GI4A 3S6DA 1A5BA 3VOJA 4MSSA 3DZ1A 1QK2A 3LLFA 4KGJA 4FALA 3VDCA 1Q13A 2BXZA 5LNWA 3MUZ1 3V0UA 3LCHA 4PEEA 4V28A 3W72A 4GXPA 2RGMA 4IQLA 1Y65A 4C6QA 4PGLA 4HK5A 4QJ5B 4HPJA 4ZVJA 2E7FA 4JQ3A 1SVDA 1B3VA 4XUYA 4AH7A 5I3JA 4R3UA 1QCWA 1DJQA 1GYMA 3DN5A 2PDGA 3ZSTA 4MJ4A 2HWGA 2IXVA 2PEVA 4E4UA 1R3VA 4KERA 2A3CA 4O11A 3QMRA 3R5EA 4WHBA 1REQB 1OG6A 3UGRA 4FXJA 4HBKA 2NT1A 2F9RA 4U31A 3ME3A 2YFNA 3WQ6A 4XZ9A 2XUCA 4JIPA 1AQ0A 3R25A 2NVAA 2IKIA 2BOGX 2GJXB 4C6FA 1FHVA 1KCXA 4JQ1A 3WQCA 1UPPA 1FWHC 3LCGA 3NJ3A 3HV9A 5BOOA 3KE0A 4B16A 3BVJA 1Q6FA 4O50A 1WDQA 5DT7A 1EKOA 4FLOA 3RRXA 1BEUA 4JX6A 2OT1A 4ATLA 4LYRA 1OC6A 5D4YA 2PZNA 1C8QA 4PN2A 4C7GA 4Z2KA 5LNUA 2PGFA 2F6XA 3TYAA 2Y85A 1ITXA 5C6MA 4YNGA 1I45A 3AMCA 4EAMA 2ZE0A 3CV2A 4AAJA 4KKXA 1BYAA 3HPZA 2PTWA 1A5LC 3OPSA 4L1WA 4R7WA 2PRLA 4V33A 1FCBA 2G5WA 3GW0A 3NZGA 1GTEA 3FDGA 2E67A 2PF0A 4C65A 1Q4NX 3W29A 1JGMA 5F2IA 1SPQA 3NQDA 3AS2A 1VPXA 2XHYA 3K4WA 1J12A 5DCDA 1ONXA 3VNLA 1YRRA 4GIAA 1JYVA 3I65A 1UWIA 2BNJA 4E8GA 1BVZA 2WVTA 1BTMA 2WM1A 1DWJM 2V82A 1E3XA 1U5JA 2QJJA 3JZEA 1FY6A 2G4JA 2VD9A 1R3YA 2CYGA 3VPLA 1UOZA 4HQVA 3W1AA 3G1HA 4GFIA 3HPFA 2XIBA 2YDAA 3FA5A 4DM1A 4MNMA 1EOKA 2G50A 1XLAA 4GK8A 4QE5A 2NQHA 1VJIA 3SM0A 3WBEA 1TPWA 2GUUA 1GG1A 3WENA 1Q45A 1ZFJA 3MSDA 3REQB 4IMFA 4AEFA 4ADTA 1KR0A 1M68A 2ZTKA 1HT6A 5KZ6A 1ZB5A 1UKTA 3XINA 3HBLA 5HNUA 2R1MA 3WD3A 2OU4A 1RQEA 1U1UA 3O2LA 2VVSA 2TPSA 5DCEA 5F2GA 4C1NA 4KRTA 2ESCA 2GGIA 4PMOA 5BU9A 2V2DA 4O1DA 3DXIA 2OJPA 5DY2A 4GVFA 4XAYA 5HULA 3KZSA 5REQB 2BV9A 3GXDA 4UQCA 1K9DA 3SQLA 3GFYA 3S8HA 3TN3A 1PZ0A 3VNJA 3E6EA 3LLDA 1LLZA 3V3WA 3HJZA 3QLLA 2EBNA 2KAUC 1F07A 2OEJA 2RDXA 2WZMA 2E6YA 4I90A 4E2VA 4DBWA 4IUGA 4QG6A 4A2RA 2F8QA 3EDFA 4JTSA 2P8BA 2X1SA 3AHXA 3MWAA 1LBLA 3M5YA 3W87A 3KL3A 1LRTA 1U30A 4JAWA 1NVMA 1HNYA 3I4EA 1OEPA 3ES7A 2C16A 1AUSL 1TA3B 4AUBA 4UTLA 1OZMA 1JR1A 2J7EA 2QCLA 3QF0A 4BJHA 1G0CA 4DZIA 2CZEA 3M0IA 1E6SM 1EFZA 3SRHA 1AMKA 2YXOA 4Q3MA 4ENLA 4L5ZA 2ZRWA 2O55A 4AWTA 1NF0A 1OFQA 4B5WA 3ZVHA 1FH8A 1DXFA 1ZJHA 1QT1A 4B5XA 3KRUA 1JYWA 1J5SA 1F3XA 5T8GA 4S1FA 3WEZA 4A05A 1GOXA 2D3LA 5IHRA 4DWSC 3CEPA 3M5ZA 4ZO6A 1JZ7A 2EGZA 2DZSA 2ZC8A 3CTLA 5I23A 1IEQA 3AZSA 1AQFA 3IIZA 3M47A 4WRHA 2PDBA 3M0YA 3UXKA 2D3NA 3NA8A 4N42A 3UZWA 4CQAA 1W1PA 1TJ2A 2A85A 3T2QA 4M7SA 4Q8VA 5G2IA 1XICA 4PCPA 2YCKX 4CEXC 5HR7A 3IARA 3WMBA 3LD5A 1FDYA 3WQVA 2YYTA 4AD2A 5MF5A 3KDNA 2ACUA 5HWJA 1VJSA 4N9CA 4X2PA 5K7JA 4OTKA 3EOEA 1PSCA 2TMDA 3ITYA 5HMFA 3IAQA 4P7OA 3UG8A 4TIMA 1AL8A 4PFMA 4AD4A 3UWYA 4AB4A 4ERIA 2EPNA 1MO0A 1O66A 3RR1A 2ZRZA 3L5MA 1XLEA 5FJPA 2IUZA 4HN4A 1GOKA 2FGZA 2I9EA 5AVNA 3CUIA 1RSCA 2QUNA 3VKKA 1ECEA 3NO5A 3TN6A 4Z17A 1S5NA 5JVLA 1H5YA 2FVLA 2YZRA 1PIGA 1VR6A 5H1WA 1DIDA 2FDMA 2BBFA 4NYYA 4Z1CA 3WLQA 3AMDA 1EBGA 3EEZA 4N02A 3F03K 3ORWA 1FP9A 3K8LA 1BXNA 4RE4A 3V0SA 4D6FA 4F0RA 3EKZA 2ZCGA 3WH9A 1KFLA 3U2ZA 1GWJA 2JGYA 1CI1A 2FKPA 1LJYA 5IHSA 3IJIA 3PPHA 3B9DA 3THQA 1TVNA 3CGTA 4I7UA 2C14A 4CD4A 2YW4A 2XM2A 1DVJA 1O4UA 3WL0A 4AD3A 5MKGA 3WIJA 3MBFA 3FS2A 2QIWA 3STPA 1R9ZA 1VH7A 2ZOXA 1RJQA 4XG1A 4ZCWA 4J3UA 1QHOA 3W88A 4DB7A 3YPIA 4CQ9A 4F0LA 2VT0A 3N6QA 4DWSD 3GR4A 4O1EA 1B57A 3O0KA 4JFTA 1WDRA 2A3BA 4MY1A 1T8XA 2VC6A 3OZPA 4FNTA 3AHTA 5A8NA 1N8FA 2FYMA 4PTVA 1B3OA 1OFBA 4DLFA 3QYQA 1TUXA 4LXFA 2VL4A 3KCOA 4UTJA 4CD8A 3H7UA 3M0MA 3A22A 1G67A 4C6BA 1ADOA 4D6IA 3K1DA 2OYMA 4K7YA 2OR2A 1J0HA 2ASHA 1TJRA 1YLVA 1JG9A 3F5KA 3FEMA 1MW3A 4ZSUA 2HS6A 1B3WA 3UWQA 3ONCA 4IFKB 1TE6A 1XIHA 3GYEA 2V2CA 3P8IA 1K7FA 3QFWA 1W3JA 1F61A 2OSWA 3RPMA 1MNZA 3TYBA 1CBGA 3WX7A 4WD0A 1JPHA 4QJ1A 5T26A 3ERPA 3LXAA 2VUYA 1IE7C 4IISA 2NLIA 2IW0A 3N4FA 2QVHA 1DXEA 1HL9A 4B4FA 3IWPA 1A5MC 1DIKA 3SCNA 3BCJA 4FZIA 7PTDA 3UERA 1A4MA 3B0PA 4GMEA 4IIBA 3LS9A 1AH3A 2EQDA 4FOJA 1UH2A 4UBPC 3N17A 3QKEA 4OKDA 1XYLA 3G0XA 2XVPA 3TTQA 2CIPA 5EMYA 5FL0A 1TV4A 1HKWA 3GNRA 4YIWA 3ENLA 1YTEA 4X2RA 2UBPC 2PCEA 2Y89A 5FIPA 4W5UA 2V5CA 4M5PA 2ZUVA 2ZRYA 2G97A 1TMHA 1E1CA 2Z29A 2GFTA 1XG4A 1KA9F 1ICQA 9CGTA 5D30A 7CGTA 3UCDA 2RFGA 5CZTA 1OFEA 2VR5A 1N8IA 2J88A 1V6XA 2VDGA 3G24A 3LTPA 2DT3A 3CWOX 3URNA 2PP0A 2VHLA 2A6LA 1JD9A 1HW6A 2PWUA 2VEMA 4H9ZA 2DVTA 1UD4A 3USBA 3MP5A 4MJMA 1NM9A 4KCUA 1E72M 3AROA 2X2YA 1EJXC 1PE1A 3CK5A 2O9RA 3NQ7A 1MQRA 3LX9A 4Q33A 1C3FA 1E6ZA 3LI1A 1V6VA 2QUTA 1JGIA 1I2QA 1EGMA 1VCFA 2OT0A 4GG9A 4CCCA 1E6PA 4AZCA 1UR9A 4BWLA 5HR6A 1A5OC 1BLIA 1JDEA 2XISA 3KWXA 4NAFB 2EPOA 3DYOA 4AX7A 4LTSA 3CWNA 2QDHA 2VR4A 3ZSSA 2BOFX 1XLFA 2X16A 2ZUUA 2OPJA 3EWYA 2VGFA 2E8ZA 2YKKA 2EKGA 3SO7A 3KL5A 2V0TA 3L0NA 1PZ2A 4LALA 1QR7A 3IEBA 2E40A 4OHQA 1PVNA 3S83A 1DJHA 2GVLA 2NX9A 2X8RA 4KW2A 2RDUA 3F2BA 3GFXA 3TJLA 3U8GA 1ME8A 2Y2WA 2PWDA 1R0MA 3W7DA 3NQ6A 4DHGA 4JNMA 1DWIM 3JRKA 3GIPA 4Y8EA 5G4WA 1OYAA 2HJPA 2OB3A 2JF6A 3E74A 4XKMA 4Q8TA 2UY2A 3OZMA 3EOUA 4NILA 1D9EA 3NYDA 3OYZA 1QNPA 3OO2A 2G0WA 4IL2A 4CUCA 1E55A 2W66A 3RITA 3DIPA 4MB4A 1RAKA 2J24A 3UR5A 4DBEA 5D02A 4IWWA 1DJYA 1FWJC 3T44A 2XSAA 3LPFA 5AHNA 1A0DA 2HXUA 4PTMA 6REQA 3L67A 3PWGA 1QBAA 3LXBA 5T9BG 2V3DA 2QCCA 1ODUA 2DU2A 2XVGA 2V6AA 1UD8A 4ES4A 2PS2A 5DF0A 3VYLA 4Q6JA 5CG0A 5CBJA 1AW1A 3N13A 5E0FA 2WJZA 4HZ8A 1QFEA 3GVVA 3PUEA 1MRAA 2G3MA 2X1UA 1JNDA 4Q7IA 4MOZA 3P81A 5FF2A 3PZUA 4Z2IA 5GNZA 3A5FA 1JVNA 4HSHA 3CZEA 3TN4A 5ABFB 2NQLA 1PTAA 3VFLA 2QAFA 1OK6A 1UWUA 3N3MA 1KBBA 2PDLA 3C56A 4AXNA 1BSLA 3AC0A 4B4HA 1KD0A 2V3GA 4PTWA 3L9CA 4C7FA 3HG4A 2DH3A 4W84A 4B5UA 4REQB 1W9PA 2OFJA 3WLNA 1FH9A 3VDGA 4PTDA 4RNFA 1MEIA 1QXLA 4AEEA 5ABTA 1TPDA 3MBDA 5D09A 3ZLHA 4JY8A 3CEUA 3FDKA 2BY2A 1FXPA 3QTPA 1IIGA 2E5DA 3S3GA 1AODA 1Z42A 1E6QM 3SJNA 3ARQA 2DP3A 4B15A 3MI3A 3VDBA 1SO3A 4O0QA 1O5QA 1ZY9A 1EUNA 5JUVA 4Q7NA 2W4XA 2D1ZA 2VC5A 5AB3A 5K4ZA 2GK1B 3CIVA 2PBOA 1UQZA 3EKGA 3NO3A 2ZRVA 3WD0A 4DYJA 3EX4A 1V7YA 2FQIA 3NZ1A 2VGBA 1Q6OA 1TVLA 3FY1A 2XFRA 3SUUA 1PKYA 5G4EA 3LGEA 1LL6A 2QJNA 5C9RA 1CDGA 2ZUMA 1Q6LA 3FAWA 4NHVA 3DG7A 1T96A 1TMLA 1R87A 3JS3A 1J18A 2QHAA 1M3UA 4WKHA 3A5VA 3MP4A 2BODX 3IGSA 4A8RA 3JZUA 4O19A 1E0WA 1W1VA 2Z6IA 2QYGA 5FCZA 1RVKA 2PDXA 4N4QA 3G1DA 4FX8A 3ANUA 3LV5A 2Q01A 3G1AA 2PWEA 2XIJA 4ML4A 1SM9A 4G5DA 3D3FA 1C7SA 2MNRA 3SCTA 3K13A 2V81A 5HNNA 1CXLA 3O6CA 2CU0A 1KRAC 1VEMA 3T42A 5BZAA 6XIAA 4S3AA 4F79A 4M81A 4Q32A 4ZFCA 4GIYA 2PDIA 4DN1A 5LHEA 3VNMA 4NRSA 4GWEA 3SCSA 2J27A 1MXSA 1QW7A 1FVPA 1G9HA 3FX4A 4JTEA 1ISYA 2HQAA 3RXZA 1X97A 2JIEA 4YTQA 3T05A 1IZJA 5F4XA 5HQEA 4XZBA 5DMLA 1VFTA 4WVXA 1ZGDA 3CHDA 3H2CA 3P93A 1P5BA 5A6AA 3AI0A 3VXGA 4L6DA 4W88A 4M19A 2ON3A 1C93A 4ZR8A 1TR1A 4O14A 2YOCA 1Q6EA 1BKSA 2R24A 2VC9A 4GYPC 3QEZA 3T2OA 3N15A 4ERAA 4UOJA 4TVDA 1ME7A 1MVYA 1FH7A 4KWSA 1OFPA 3UESA 1TZ7A 2VUNA 4KS0A 1OFAA 3CZJA 1CGYA 1JCLA 1IGSA 2WMFA 3N6JA 3BJSA 1TR9A 3PFRA 1X96A 5AKQA 4TUFA 5CGTA 3MV11 1BAGA 5LIYX 1WKDA 1TCMA 1XINA 4CEUC 3LSCA 2FZDA 3B8IA 1Q6GA 5DO8A 2YSWA 3QQWA 1LUCB 4IX0A 4FMVA 3GKFA 4GVGA 4HA3A 2NV2A 3OZOA 4O1CA 1LORA 5E6ZA 1WYIA 2Z1XA 4CQ8A 3L68A 4RV8A 4KRUA 5H8MA 1A5CA 3N25A 2E6FA 1R3RA 5BXTA 1W56A 2POZA 4S2BA 2UWFA 4XZHA 4ZSTA 1YHTA 1QI0A 2YDSA 2VRKA 4IIEA 1OX5A 2CESA 4XD6A 1P0KA 5D9MA 3ITCA 4GJJA 3HG2A 4IMGA 5C9UA 4LS1A 3RHGA 3TXZA 2V30A 1NU5A 3TFXA 4GHRA 4FI4A 3OLGA 4PUDA 1KQYA 4EK7A 2FZMA 5F2LA 5FSDC 2BXYA 2Q6ZA 3C2FA 2NLYA 3PFMA 1IXNA 2ACSA 2DIEA 4PBGA 5I2UA 5D2XA 1PAMA 3VD3A 1LOQA 4XAZA 9XIAA 3HGRA 3MQTA 1JYXA 3V16A 1XLKA 3H12A 3TR9A 3OYXA 2D2OA 3M7WA 4JR5A 1X1OA 3HQ1A 2XWEA 5CKSA 3HFTA 1TRDA 1TUFA 4F66A 2VOTA 1IWPA 2Y0FA 2C3ZA 4FR1A 2ISSA 2NZLA 3BAXA 1RCQA 3LM7A 2OX1A 4FR6A 2G3FA 1XH0A 3UR2A 2XVKA 2B31A 4QBXA 3SQSA 4DZ5A 3ZT6A 2WCGA 3QZAA 4IGSA 5A6BD 4DRSA 4U2ZA 1EQPA 1O1ZA 1E1FA 2YXXA 3T8QA 3HMCA 4TX9A 4B2DD 1F3TA 1AA1B 1KB3A 4HD5A 5CSSA 3RLGA 1GJWA 1NEYA 4A2SA 1P6CA 4C6EA 1UH4A 5L6UA 1VRDA 4NXKA 1KO0A 4I9TA 3P8JA 1BWLA 3ITGA 2XZ9A 2PTDA 5H2ZA 2OQHA 3DFNA 4L1GA 2Z1KA 1SQ7A 3QV9A 1JAKA 1V3JA 3V75A 3BJFA 3EDKA 1EL3A 4FIRA 3WDPP 3MKCA 3FN9A 4QRNA 4NYUA 3VNKA 2Q02A 2BHZA 4YHEA 1F9CA 1OC7A 1UASA 1AJZA 2TRSA 5DBTA 1JRCA 3VE7A 3MMUA 1F8MA 2VDHA 1BRLB 1B3ZA 1PX8A 5EMUA 3M7SA 2WLYA 1WBJA 4OGZA 1XCWA 2QQ6A 1GJUA 1J0KA 3VNDA 3J7HA 2QNEA 4N0RA 2WC3A 1W3NA 5CQ1A 1P48A 2DUXA 1EJSC 1SU5A 5G1TA 3TOYA 3UWUA 4NX5A 1K4HA 4MF4A 1TTQA 2VX6A 3TEVA 4W8LA 4LAZA 4LF1A 4C5ZA 2EPMX 2EPHA 1W0MA 3EPOA 5HJXA 5I07A 1KQZA 1NWUA 4DVOA 3NYZA 4GQBA 2Y61A 2CERA 3BW2A 2J25A 1HGWA 1R2RA 4K2SA 1TV8A 4UTTA 1S5VA 3IJ8A 1E0UA 2R82A 3OIXA 4MHBA 1OX4A 3QZ6A 5BYWA 4UQDA 1P6BA 4C6PA 1QUMA 3PPGA 2H9AB 4GCXA 5J04A 1LP6A 4XKYA 4LNYA 4M6UA 2WNQA 1SO6A 3W7RA 1FCVA 1YNPA 3WFAA 3KM8A 2MANA 3RILA 1T8QA 3H7VA 5FI8A 2ZA3A 3MYPA 2GDUA 1R3SA 4GJ1A 1PDZA 4CNPA 2JALA 1FHLA 3W7CA 3LEPA 4ICCX 2CNCA 1YDOA 2PWFA 1VEPA 1VC4A 2W91A 3VD7A 4QLKA 3QHNA 2CLOA 1E43A 4A3QA 4QM1A 1GZGA 1EDTA 1QNRA 2FIQA 3BV7A 3WMCA 5J5RA 5LA0A 4HIBA 2AKZA 1AJ2A 4U2YA 2WPGA 3PZTA 1NDYA 4FB7A 4KIEA 2BVWA 1UA3A 3N9RA 2Y63A 1FFRA 2WYSA 3V4BA 2RGLA 3NQEA 4OZOA 1CCWB 4U33A 4XD5A 3EOSA 4CD7A 3OLDA 3AXKA 1V4YA 3UR8A 2Z7GA 1X6NA 4PEKA 3AALA 3NL2A 1OBAA 5KSWA 3EA2A 3K5XA 1YBQA 4XZLX 3A23A 3L66A 2V67A 5FF3A 1EWDA 3N19B 3P2VA 5E1QA 1DTNA 2NWRA 1TWIA 1FXQA 1OGBA 1EF2A 4AMAA 1YXDA 3CAQA 3DC0A 1A3HA 3WEOA 1KGUA 4MMWA 5H8PA 4HSOA 3JUGA 3HU7A 4MNKA 5GJMA 2FVKA 3CQKA 1YADA 3S2NA 1IQ8A 1RJPA 1KXHA 3R43A 4WLCA 4ASTA 4W87A 4AY1A 3QSTA 4ERGA 3UG3A 1UR3M 3BW4A 1EDGA 2OLAA 4BQ5A 3H2MA 2PDWA 4ATDA 1J2BA 4O52A 2UY5A 3WUEA 2FZ9A 1OWQA 1SFJA 2XVNA 4AC1X 4A22A 4JX4A 3V36A 2XG9A 1M03A 1QPQA 3CHFA 3KVKA 3S1UA 2W9MA 2Y4SA 1WB0A 4L7ZA 1S1RA 1N2VA 5K9DA 1S38A 3CXOA 3HQOA 4MWAB 1IZKA 1XBXA 3W73A 3V0TA 3KRSA 4FX6M 1I60A 4JNZA 3PZQA 3T8LA 8RUCA 4H9UA 1K4GA 1Y5VA 5ABGA 3L65A 1JZ4A 1CPUA 4K39A 3W0KA 3KS6A 1KBLA 1RA0A 4AVOA 4NZ5A 1HQTA 2E6AA 3SIZA 3T0CA 2WNWA 1ONWA 2ZXDA 3LPGA 4DXKA 3NZQA 1ONEA 2E1DA 4DPPA 1UG6A 1LG1A 3TP4A 2OODA 3F7JA 3M44A 2J13A 2X0YA 3C2EA 1XG3A 3QTGA 3H21A 1GOOA 2GOKA 4WZHA 3W7OA 3PHAA 4DO6A 1H61A 5A8OA 2WJFA 4HTYA 5HMSA 3WNMA 5C0QA 1SZGA 4UQ9A 3VGFA 4IQEA 3DGBA 4MDOA 1E6NA 1FDJA 4K68A 3AYVA 1ZTVA 2EG8A 3QV6A 1B9BA 1KM6A 3LCIA 3WJYA 5D37A 4X63A 1Q65A 3JU2A 2P1FA 3G6MA 3VD5A 4DXVA 1RV8A 1HN1A 1GJPA 5AN7A 3VU2A 4J2PA 2BXVA 3UA4A 1QWGA 4RKAA 2O7QA 5FJTA 3GH5A 1KGXA 1CLVA 1F2JA 4F9JA 2Z1SA 2VWSA 3ONBA 4W86A 1VENA 4G2DA 1ZALA 4JX5A 1N7KA 4GBDA 1C9WA 3ALGA 2Q09A 1W5OA 5C8BB 2FTPA 4P8UA 2XGZA 2ZDRA 4GQRA 3S6OA 2G4FA 5HMDA 3BLFA 5I09A 2QCEA 4WXYA 2FJUB 3N6HA 4C6DA 1VFMA 4J3ZA 2ZBTA 1J4EA 4O0KA 3OGRA 3TNBA 1KFKA 4LBRA 3TSDA 3NZPA 3W7HA 4PUMA 3NNTA 2VM8A 5GPRA 3SSZA 4ZB2A 5CJ5A 1JF6A 3LNMA 1MFVA 1JZ8A 1DHPA 4QQ3A 5I6SA 4GBUA 2OWWA 1H41A 3KDOA 2VRJA 3PM6A 2W27A 2DZBA 3IS4A 1UW9A 4DELA 2A1YA 4ZOEA 3ABQA 2ZUSA 4L56A 4UQBA 1E9LA 1HKVA 3S47A 4BK9A 3K2GA 5FJRA 3P0WA 1W8SA 4OVXA 2JGQA 2Q8XA 1WOBA 2D20A 1BYDA 1NH6A 1VQTA 2A5HA 3CNYA 3DERA 3PTKA 1GW1A 1SW3A 3VOFA 4XX6A 5DCBA 3ECQA 2OELA 4GFSA 5LZLA 3QJAA 5EA9A 4F2UA 1F6KA 3W84A 4H7VA 3FYYA 1F8IA 4LCSA 3MUY1 4ACYA 5BCAA 2A7RA 3S1VA 1I6NA 1F73A 3VUSA 1LCOA 1QW8A 5PTDA 3SQMA 4AWEA 2CZ5A 1HKMA 3GH7A 3WFLA 1VBHA 2QUVA 2JQXA 4ICMA 1WDWA 2CLPA 2Y1HA 3V35A 4UZSA 3LPPA 1UWQA 3UFYA 3PULA 1B3YA 1ECQA 2OCZA 1RK5A 2CLMA 4WXZA 2DORA 6PTDA 4H8HA 1EA0A 1VFFA 4DWSA 3WG6A 4PMUA 4IM4A 3E38A 3PBWA 2DZXA 1VBUA 3I7QA 3A3HA 1WXZA 4JTCA 5D05A 2XDFA 3W9ZA 5DBUA 3WQWA 5CZSA 3ABXA 3AHZA 1HJQA 2RAGA 3OODA 1DIOA 2RHGA 4JCLA 3OA3A 4U3CA 4LJ3A 3D6NA 1AZ1A 1GQIA 4RDZA 3UG5A 1PWLA 4KBXA 3QQ0A 4ALDA 1H4PA 2E09A 4F9DA 2X1IA 3CB3A 3U4AA 1G6CA 1MW0A 4OV4A 3CO8A 4BR1A 3C0SA 1V3IA 1G7VA 1KV5A 2EHHA 3W6MA 2ZA1A 1QNVA 2GSJA 3T08A 2XU2A 2DW6A 4AQLA 5TF0A 4WOZA 4MLJA 1JI1A 4DZAA 2C13A 4NI3A 1VZWA 1XIIA 2P0IA 1ZAHA 3F4DA 4IGMA 4JTIA 4LBSA 4HOXA 4KWUA 3NOYA 1WPCA 4YCPA 5AC4A 1JRBA 4C6IA 3LCLA 3LUTA 1TV7A 4IG2A 3RM8A 1PB0A 1HFBA 1W1TA 2X1TA 2NXIA 1XRTA 1P0EA 5IM51 2Y88A 1AW2A 3N34A 4NZFA 1F6PA 3I3DA 2NT0A 3N29A 3OW1A 1OABA 3VA8A 3WN6A 4H1ZA 1BG9A 3VI2A 3GLCA 4KESA 3VKJA 4TQTA 2W6RA 1TJ1A 3TW9A 1FFQA 3DI0A 1BYBA 1UZ1A 4GOAA 4IPIA 1WOAA 3NQCA 2QIIA 1XXXA 3VIKA 3BURA 4QROA 3PJXA 4P61A 3W7MA 5I77A 4B3ZA 2GQ3A 1UBSA 4XZIA 3BG9A 2V63A 1RP9A 2PU0A 3WBXA 1V6YA 3TYZA 1ITCA 1G69A 3WUGA 2VX4A 1XYMA 4IIDA 3NL5A 3CTTA 1U1HA 5EFFA 1DJIA 4MPQA 3S5SA 3IVTA 3LMZA 3FVMA 4FOUA 4J35A 1FHDA 3GHUA 2W79A 1J10A 3S46A 1T7LA 2R14A 3POHA 2WCSA 1HP5A 3OLEA 4OECA 4GPNA 4CCDA 3OBEA 3ARUA 3LM3A 4UR7A 1DWFM 4CCEA 1XH2A 2QJMA 1F5ZA 3CV1A 1DE6A 1I0BA 3WQ4A 1HJUA 4Q4SA 1FWSA 2C71A 2A21A 4MKNA 4BF5A 1A3XA 1XSKA 1P7TA 4J28A 4B5NA 2XH4A 1DJXA 1A53A 1IGWA 2WBGA 2VI0A 2QW5A 1ZNNA 3SCPA 5FJIA 4L65A 1IT0A 4S39A 1AW5A 3T0TA 4EOUA 2P50A 2WVVA 4GUFA 5A94A 1QNOA 3C0LA 4S23A 3GVQA 5HOSA 5F1UA 4GYKA 4NP7A 2BVDA 4AD0A 3H2EA 5FAGA 2I14A 5RUBA 3LLXA 3OGVA 2DZTA 3PNUA 5IFTA 1C92A 1XL9A 4H9VA 1L6SA 2OQLA 3LQGA 1H50A 4V2XA 2J7GA 5BROA 3NAVA 4P8VA 3E2QA 2OXNA 3RK8A 2A4AA 3WH7A 5F4WA 3NQFA 1JPIA 3DDMA 2X2GA 1OYBA 3EX2A 4ZOAA 3ZLGA 3C52A 1XDLA 4IJCA 1RQBA 3WEMA 3EZ4A 2VMFA 3TQ0A 1EP1A 2V3EA 1JI2A 4F48A 2OGJA 1TTIA 1EJ7L 4TU1A 3WNKA 1EUAA 3BOFA 4C6MA 3IRSA 3R4IA 3FHQA 4XBSA 1SFSA 5AYXA 2FGLA 2WQDA 4JTDA 3DFSA 4R7JA 3FEQA 3AYRA 2ZWZA 1C29A 4H00A 2XGIA 3TDFA 1P0DA 1I2PA 3MHFA 2YBVA 1DL3A 5CCZA 1F74A 3SJ3A 2J9XA 3QV8A 2FZNA 4IMEA 1R38A 1S5WA 4UFJA 3TYDA 1QPRA 3KEHA 1M7PA 1RD5A 5HAOA 3IJQA 1I8JA 3WNOA 1IT8A 2WJDA 3K30A 3CV7A 3HURA 3B40A 2CLHA 4YCOA 1HUVA 3FAXA 1SJCA 1P1XA 3TSMA 1YE6A 1B0IA 1TYGA 1J0IA 3UYCA 5CPQA 5AHEA 1I2OA 4EX4A 4DJEC 4NJJA 4MFEA 1E51A 3CIXA 2DVUA 4KEMA 2WNZA 2PP3A 3V5CA 4RR4A 1XWYA 3QZEA 1GVRA 3RMJA 4UQAA 4ZMGA 3NFUA 4ZXLA 4Z2GA 2ZADA 4LVGA 2OVLA 2WSYA 1ZJBA 2OEMA 4MZYA 1ENUA 3QC0A 3P7YA 4XIAA 3GDKA 1ZAIA 2AL2B 3EWUA 2BP1A 3NPUA 4H8VA 1KXTA 2WHMA 1GQKA 3TCSA 4EPEC 3M0KA 2R9RA 3GD6A 4PE8A 2VNCA 1UKQA 1ZENA 5DY3A 2DT2A 3CASA 1WDDA 1XYFA 4RW3A 1AH4A 4W4QA 3ZT7A 3KS5A 1Q4WA 1MDLA 3V1PA 5HQMA 4Z42C 4RNJA 3L21A 1MEWA 1J11A 3S9YA 3SCRA 2E1WA 3IRDA 4QCEA 4A35A 1XISA 2NVDA 1PZ1A 5T9CE 1AJ0A 4I6VA 3CWHA 1Q6RA 3ZM8A 3NIYA 3FLUA 3W2UA 4QG9A 4MB3A 5CBIA 1GQNA 3PY2A 2P3EA 1FWFC 1HGYA 3H2NA 1WKEA 2VDIA 1CXFA 5HNTA 1J6OA 1HO1A 2BMBA 2JEPA 1UA7A 5M1TA 3L5AA 1JIBA 5HJYA 4RL3A 5IFPA 4M6QA 1H0IA 4L9YA 1PBGA 1GVSA 1VRXA 4GQGA 3M07A 1JYNA 4D1IA 2VVNA 2EKCA 3C2VA 9RUBA 3GDBA 1HIZA 1TMQA 3ARYA 4JDYA 3R1ZA 1Q6QA 3RJXA 1DJWA 2F61A 1BGGA 3FKKA 1KLZA 2IPWA 5A8QA 3GFZA 3LGGA 2EG6A 2WMIB 3IJ7A 3UZ5A 3NPVA 3F5JA 4LUSA 3CU2A 4OUIA 1ZPTA 4O16A 4W7WA 4I8YA 2C18A 1DKWA 3EDEA 4DUWA 1N8WA 2NVCA 4XO6A 3RDKA 3DHDA 3R11A 5LGXA 1JXJA 4KH2A 5BMWA 1B90A 1N55A 4DJED 3UF9A 3UJEA 5TNVA 1S1PA 4H9MA 3OQ8A 4AVFA 1ZHAA 2DFAA 4HTBA 1R7OA 3LZ5A 2VOMA 3FA4A 3HPXA 4G9PA 1GYNA 3M0XA 2DZWA 3DG6A 1SFLA 3HGSA 5BXPA 3A24A 3PZGA 1O5RA 2D24A 1JXKA 2DEPA 3NM3A 4MJZA 3WKZA 1VLWA 1L8NA 4Q7BA 3P62A 3T1GA 4UTFA 1W5QA 3GU2A 3N1AA 3Q4DA 3KBWA 1E73M 3EX3A 2VO5A 3BLDA 1OCQA 1W5NA 4N9DA 4Z2LA 5F1VA 1BFNA 3WL1A 2XH7A 2ZICA 3W28A 1LL4A 1XIEA 3E9AA 1GHRA 3RCYA 3TYUA 5I06A 2HNEA 3Q65A 1H7XA 2FVMA 5J5DA 4W8BA 3WK3A 4AYGA 3VUPA 2QDEA 1GVQA 2GUYA 1HKIA 4W93A 2D0GA 2JFEX 2HPMA 3G8EA 2AMGA 3II1A 3PVFA 4NAEA 4OWGA 1TE1A 4Q4PA 1ISWA 4GD0A 3TKFA 3TK7A 3P74A 4JQAA 5C2XA 4R88A 3KVLA 3VVGA 4E8DA 5A6JA 1K3UA 2PGRA 1LBFA 4AISA 3WDJA 2OGYA 1IIHA 1E56A 4B92A 1MDRA 1XBZA 4ATWA 3QOKA 2CWNA 3DI1A 1W9VA 5HWNA 2DSZA 3W37A 4QDMA 3ZMRA 4YHGA 2YX0A 5JBFA 4LC6A 1OM0A 5IXEA 1GGOA 2AKMA 1PWMA 5K2ZA 1CLXA 1RQHA 3OVGA 5BRBA 5I7GA 3PNZA 4BS0A 1IEWA 1CEOA 1J79A 2IS7A 3VK5A 1TVPA 4JN8A 1LLWA 1LG2A 5CZ0A 4A6GA 3MV01 1HJSA 2OLHA 3A4WA 2IQ0A 2WVSA 2NQ9A 4O1FA 2ODOA 2DSKA 2FTWA 3SAZA 3KBNA 1IZCA 4N9EA 3CZGA 1RLDA 1W3KA 3ES8A 4C5YA 1DORA 2YA2A 1UCWA 1HTIA 1PKMA 2ZDSA 4PUKA 2ADAA 3KRZA 3P84A 4MPKA 1DV7A 3VIOA 3R6IA 4GYJA 3THCA 4K8GA 5AFDA 2YL8A 2J7DA 5CSRA 4GYPA 3W1LA 5JU6A 1W17A 3W53A 2PURA 1VCGA 1QHZA 4MAVA 4NJKA 3RG6A 1UYQA 1PEZA 3U5UA 4AWSA 3UT0A 4O4WA 1LRNA 1GHSA 3IGXA 4F40A 1L6WA 5CLWA 3M9YA 2FPVA 2RUSA 1ELSA 3AQUA 3TCEA 3KTCA 4NJGA 4M24A 4XAPA 2ABAA 4MADA 4RZBA 4V15A 4AY7A 1EB3A 4CD6A 2I56A 3CUGA 1P43A 2W67A 3GUGA 4FF5A 5E5CA 4HU0A 4HPXA 2OQYA 5D2TA 1K8XA 1JQXA 3GY1A 2ICSA 2QDGA 3G1YA 4K38A 4RV3A 1Y5XA 4RK8A 4YMZA 1RXOB 3GZ3A 4PMVA 4H6KA 2VC7A 1O60A 3NTYA 3TH6A 4KT2A 1YXCA 4QTGA 1M1BA 1QWKA 5AC7A 3A6OA 1CECA 1V02E 3QPEA 2PBGA 1UC5A 1LBMA 3BGGA 4LUTA 4P7RA 1RK6A 1KKOA 4RCXA 4H7CA 2HMCA 3BMVA 3R8HA 5KZMA 3UY7A 3SCWA 5D33A 2E25A 1V51A 4JIRA 2J66A 3OA5A 1R2SA 4KIRA 4F8XA 3OG2A 1YKWA 4JFWA 4DUXA 2EG7A 3NSNA 2CITA 4LYKA 5A6TC 3L2MA 5B7ZA 3M0VA 3GC5A 3LCFA 2WVUA 4Q8WA 2FLIA 3MYOA 3QPZA 4BI5A 1DQWA 2INFA 1VFSA 1YNQA 3TA9A 3ZQ9A 4IFOA 7REQB 1CT5A 4ORIA 4KEVA 5FESA 2B0MA 4JZ5A 5HATA 1IXQA 1AQHA 3DENA 5HBFA 2YCJA 4A29A 1ICPA 2VQTA 5ECVA 1Q63A 4WY0A 4PFHA 2NUWA 1YMYA 2WXDM 3WH8A 1EXBA 2HS8A 3RNDA 4OJYA 4LV4A 2J7HA 2HNHA 4EANA 3DG3A 2J74A 2GL5A 3PB2A 1W9DM 3FGCB 1EC7A 3CUZA 4X60A 3KTSA 4LU0A 5EBUA 1FWTA 1GORA 3FNDA 4WDUA 2EXOA 5C71A 4GVHA 5D9PA 3W82A 2WZIA 2ISFA 3N9SA 4TTGA 3MT1A 3I7RA 3OHIA 4HNOA 5FSEC 8CGTA 4Z1DA 4DJFC 1B5TA 3W7QA 3MPGA 1AL7A 3BAWA 2DUAA 4UCFA 1KM1A 1VIWA 4QIUA 4JPGA 2ONEA 1XP3A 4PH6A 5I5RA 1D8CA 1CLKA 2WZHA 3C2OA 4PUWA 4DAFA 4L4PA 1TWZA 2I9UA 1LOSA 4LF2A 1XKYA 3OB8A 1ICSA 4JY9A 2CPUA 1CGWA 1P6WA 2OOGA 2Y5EA 4XSLA 3AHVA 3NEHA 3HM7A 2D2HA 4J27A 1QPNA 4U10A 1H3GA 4WKAA 3IGHX 4I6KA 4UQEA 3AS3A 1ESWA 1M6JA 3TSBA 3T0BA 2VGGA 2DUZA 2ZXAA 3I6TA 4XISA 3ZZ1A 2CBJA 4P8XA 3LMYA 5AYYA 3T07A 3W7PA 4YYFA 3QR3A 1HP4A 3TW7A 4Q6XA 4MTVA 4CQBA 5CEWA 3LRMA 4XZMX 3CIWA 4JIHA 4Y9PA 3EWCA 2Y8KA 1XYBA 4GZJA 4OU1A 4DAIA 3AZRA 2X42A 3TYCA 1J2WA 2PDJA 4PC8A 4CKQA 1GOQA 4QAIA 4HT3A 3LHYA 3H22A 2Z28A 1MI3A 1VYRA 2DJLA 4I5XA 1GW9A 3B4UA 1HJVA 5KZEA 3IJ6A 1UOKA 1W54A 5AVHA 3UVAA 3VZYA 5H8UA 1PCKA 1OT1A 3O6AA 1A5SA 1LWHA 2ZE3A 1I1WA 7ENLA 2PRHA 1XLMA 4L64A 3NQMA 4J3TA 3I3BA 1ZSXA 3VZZA 4CQCA 4PBFA 1P4CA 2WZEA 4AHQA 4D6HA 3W2LA 1UPMB 4A3RA 1TV5A 4IP5A 1OC5A 4HMEA 4QEEA 2QCMA 3PWIA 4YWIA 2PC8A 1T5AA 5C7HA 1TPEA 1LZOA 1JCXA 3DFYA 4M7TA 5HANA 4I9JA 4WIWA 4L1XA 3QGVA 4GX8A 3DFOA 3GXMA 2HBVA 2XSBA 2GGEA 2DSUA 1XLCA 4BHYA 2GWNA 4JIIX 4KWOA 4H6EA 3URBA 1R86A 1FWNA 4B91A 2YR1A 3HPAA 3W1XA 4DJFD 2FFIA 3LNPA 4B9ZA 1MEHA 4H3DA 1OGSA 3AIBA 3XIMA 1J0ZA 4EXBA 1B31A 1ZBCA 2A3LA 2PLCA 4D8AA 4JHZA 3HIJA 2WW5A 3BLPX 1VB9A 3FJ4A 3GZAA 5C2CA 1KTNA 4TOQA 2QF7A 2XJ7A 3PZNA 2Q8ZA 4K7VA 3EPNA 1JULA 1UD3A 5GNXA 4TX8A 3W2NA 3WF4A 4NT0A 3NSXA 3UY8A 1M04A 2RKXA 2QMJA 3AFBA 5EFDA 5B80A 4GQQA 4K1WA 1XCXA 4UNKA 3GQYA 1FP8A 1I2NA 1CGUA 3KBMA 3LG3A 1XC4A 4AF0A 4UMAA 4MZ8A 3GE7A 1F7BA 1IEIA 3GAKA 2FFCA 4MAZA 2P76A 3H4XA 2G41A 1XLGA 2ZRXA 3ITXA 1JDCA 1TTPA 3U5YA 2YW3A 4Q8QA 3A4XA 5A8GA 3A13A