1O5RA

Crystal structure of adenosine deaminase complexed with a potent inhibitor
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine deaminase
publication title Structure-based design, synthesis, and structure-activity relationship studies of novel non-nucleoside adenosine deaminase inhibitors
pubmed doi rcsb
total genus 140
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1o5rA00
4J2MA 4MUPA 4JOMA 4KERA 1KRMA 3G77A 4IFRA 2EG6A 2Z2BA 3NQBA 4GX9A 3A3XA 4C5ZA 2HPMA 1BF6A 1RK5A 3AU6A 4BKNA 1RA0A 2Z7GA 3AUOA 1V7AA 4IQJA 4F0LA 3GTXA 3CAKA 1YBQB 3RHGA 3S2LA 3RYSA 4P5UA 1FWHC 3K5XA 4UB9A 3TNBA 3URBA 3IARA 3GU1A 1FWGC 3TN6A 4CEXC 4DI9A 4ERGA 1HZYA 3T1GA 3A3WA 4H9ZA 4H01A 1M65A 4R88A 4C6IA 1KCXA 4B3ZA 4C6BA 4DLMA 5A6TC 3N2CA 3K2GA 2DVTA 4I6KA 4I6VA 3FDGA 2E25A 3S2NA 3LSBA 2R1LA 1YMYA 4IFKA 2PUZA 1KRBC 1NDVA 1FWAC 4HK7A 1UIPA 3IV8A 1O5RA 1NDYA 4LCRA 3QY8A 1R9XA 2QPXA 4UBPC 3F2DA 1ADDA 2YXOA 4C6LA 4WHBA 4G2DA 3OQEA 1FWIC 4IFOA 4C6QA 1UIOA 1RK6A 3GTHA 2W9MA 3MDWA 1RAKA 4OFCA 1ITQA 4BY3A 1FKXA 2WM1A 2OGJA 3PNUA 4LCQA 1RA5A 3CJPA 2BGNE 3ICJA 3UR2A 4ERIA 4RDZA 4RDWA 4C6FA 4BJHA 2VUNA 3DC8A 3TN5A 4E3TA 4XD4A 3F4CA 2YB1A 1P6CA 4QRNA 1S3TC 5HMDA 2R1PA 3FEQA 3T81A 1FWEC 3C86A 4XD6A 4PCPA 3WMLA 4NP7A 4GBDA 1QXLA 1K1DA 4QS5A 3WZ0E 3EWDA 3OU8A 4PBFA 2VM8A 3E2VA 1V4YA 2Z2AA 3MJMA 5FSEC 1EZ2A 2UZ9A 1NDZA 1FWFC 3HTWA 1YIXA 2Z25A 1EF2A 3BE7A 3B40A 1PB0A 4HJWA 2Z00A 3OOQA 3OJGA 4R7WA 4B92A 4PE8A 4XAYA 4C6CA 4CEUC 2VHLA 4LAMA 2A3LA 3QY7A 4DNMA 2ADAA 1P1MA 3UPMA 2R1KA 3MKVA 4CQDA 5CH9A 1RJQA 1FWCC 3KM8A 4KEVA 4DYKA 1XRFA 3EWCA 4XD5A 4GY0A 3MPGA 4PBEA 1I0DA 3V7PA 5HMEA 4H9TA 1E9ZB 3MVIA 2Q01A 1WXYA 4LANA 4J35A 2QVNA 3GIQA 1FWDC 2ICSA 4C6EA 4B91A 4GY1A 4IF2A 3QY6A 3E0FA 1E9YB 4V1XA 2YZ5A 3UF9A 2XIOA 1ZZMA 4CNSA 1WXZA 3A4JA 1UMLA 4QTGA 2EG8A 3EGJA 3UR5A 4C6OA 4AQLA 4QROA 3AU2A 2HNHA 3T8LA 3GIPA 4DZHA 4NG3A 2GSEA 1YNYA 2I9UA 1A5NC 4KESA 4GY7A 4WVXA 1KRCC 4ZSUA 2Z24A 2ANUA 1ONXA 2IMRA 1J6PA 2D2HA 4R85A 1XGEA 2Y1HA 4IGMA 3GTFA 4WGXA 4H9YA 2PGRA 1ITUA 4C60A 2FTYA 3ITCA 4XAGA 1GKRA 2AMXA 3OVGA 3OODA 4IGNA 2Q09A 4HK5A 4KEUA 3ISIX 3LU2A 3WYZA 3UBPC 3LGGA 4XAZA 3HM7A 4CNUA 3QGKC 3URQA 1A5MC 4GK8A 4PCNA 4H9VA 4AC7C 4C65A 2DVUA 1FWBC 1K70A 3SFWA 4H9MA 4D8LA 3LNPA 1O12A 5HMFA 4F0RA 4EP8C 4LH8A 2F6KA 3MSRA 4H9UA 2Z29A 2OQLA 1PSCA 4INFA 2D2JA 2VC7A 1EJRC 1J79A 4IG2A 3GTIA 2GZXA 2YB4A 4C6PA 1A4MA 3PBMA 1A4LA 2OODA 3PNZA 4CQCA 4DIAA 1EJSC 4C6MA 4DO7A 2Z28A 1YRRA 4KETA 4TQTA 1A5OC 4GC3A 2OOFA 4LAOA 2HPIA 1EJXC 1XWYA 4C6NA 2GWGA 3CS2A 1A5LC 1R9YA 1PO9A 2WJDA 4LCSA 1EJUC 4RDVA 4J5NA 1NDWA 5FSDC 3IPWA 4IH3A 3B0XA 4XD3A 2OB3A 4ERAA 2HQAA 4KF1A 3DCPA 1EJVC 3URAA 4C6DA 3PAOA 3IRSA 4NI8A 1UBPC 3HPAA 3O7UA 4V1YA 1M7JA 3TN3A 2I5GA 4LALA 5E5CA 1DPMA 2HBVA 1POJA 4GXWA 3S2JA 2UBPC 1P6BA 2Z27A 3E38A 3QGAC 5LXXA 2E1WA 3IACA 2PGFA 4C5YA 1J5SA 3E3HA 3GU9A 4F0SA 2ZC1A 3LA4A 4YIWA 1J6OA 1IE7C 1ONWA 1R9ZA 4DI8A 3NEHA 4IG2B 4HK6A 4RDYA 2BB0A 4GZ7A 4XAFA 3FDKA 1I0BA 2GOKA 4G7EA 4EPEC 4CNTA 4KQNA 2D2GA 3ORWA 2QT3A 4LFYA 4QS6A 4ICMA 3MDUA 3GUWA 1EYWA 3IJ6A 4B90A 2FVMA 3F4DA 1GKQA 3RN6A 2KAUC 2RAGA 1M68A 2PLMA 4H9XA 3GRIA 3GU2A 4LAKA 4HA0A 4RZBA 1KRAC 5G4HC 4GYFA 3S2MA 1GKPA 2PAJA 1NFGA 1EJTC 3LSCA 2GWNA 4DZIA 3E0LA 3E74A 2O4MA 4L6DA 1FKWA 3URNA 3TN4A 3RCMA 1V51A 2EG7A 3LGDA 2FFIA 2QS8A 3NURA 3K4WA 3F2BA 2R1MA 1XRTA 4H00A 1YBQA 2O4QA 1V77A 1V79A 2AQOA 1VFLA 2Z26A 4EPDC 2VC5A 3IGHX 4LEFA 2WJFA 1PTAA 1K6WA 3LY0A 1POKA 2CZVA 4EPKA 2P50A 2R1NA 2FTWA 2DVXA 4DLFA 2AQVA 2P53A 4M51A 3O0FA 3F2CA 1EJWC 2G3FA 2WJEA 4QSFA 4G7EB 4L9XA 4GOAA 4ZSTA 3DUGA 3R0DA 3GG7A 1RJPA 1JGMA 2Z4GA 4KIRA 4RE0A 1QW7A 3S4TA 4C6KA 4EPBC 1FWJC 5AKQA 1W1IE 1A5KC 3D6NA 4IFKB 2VR2A 4C6JA 3LS9A 4CQBA 3SO7A 4KEZA 4Z42C 4GX8A 2HBXA 1RJRA 3PANA 3B0YA 3MVTA 2FVKA 3ID7A 3MTWA 3JZEA
chains in the Genus database with same CATH superfamily
4J7RA 3GH5A 1IZCA 3A9IA 5DO8A 2C1HA 1UD5A 4GX9A 3S3GA 3SN0A 1FBAA 2NX1A 3TTOA 3HPXA 3TQKA 1RK5A 1V3JA 3VD3A 3TQVA 4O13A 3RPMA 3O16A 1XRSA 2C7FA 2PGWA 1YBQB 3VGGA 3N18A 1QWKA 4S3DA 3B06A 1XV8A 4GVHA 3BJFA 1HZYA 4Q8OA 4MDPA 4DWSB 8XIAA 4P2VA 2WNWA 4O28A 4C6IA 2QIIA 1C8VA 1SO3A 3P0XA 5A6TC 5EBUA 1JDAA 3ZJ6A 3WDQA 1J4EA 3KS6A 4DYJA 3P7YA 1X6UA 3SCTA 2OU4A 2FFCA 1XLGA 2X2YA 2Q02A 2ZVRA 1KCKA 5DELA 3V35A 1AQHA 1O5RA 1L6YA 1O60A 3QY8A 3WD3A 3SIZA 3VO0A 4P8VA 5BOEA 4LNCA 4QLKA 2DORA 1LDCA 3CL8A 3GWQA 3VMOA 4YTSA 1G4SA 4IGSA 1FP8A 5ABFB 4F0HA 3PBYA 5GNZA 4WZHA 4O11A 4B2DA 2NT1A 3CUIA 3WLRA 1SJAA 2IKIA 3RPTA 3HO8A 2AAAA 5DMLA 3TN5A 1LJYA 3GQYA 1OC5A 3DFQA 3NXLA 4BA0A 3VI2A 1JCTA 1B0IA 1MUCA 3G1YA 5FJTA 2F6XA 3QV6A 1B3OA 1E40A 3RCNA 2Q3OA 2PWUA 1E1CB 4BQ2A 2UY2A 4ZQRA 1EH9A 1ZP3A 3VMNA 2PBOA 1E6ZA 4JTSA 4JN6A 4XBKA 4Q7BA 4CN6A 3OLIA 1W54A 4WY0B 2NVAA 4MPQA 3O6YX 2W6RA 4QNEA 2J13A 4MHBA 5MKGB 4H7CA 4ZOAA 3H55A 1YKWA 2BY2A 1XLCA 2GFTA 2CC0A 1E1EA 1V3LA 1WPCA 2G96A 3A5FA 2DZWA 4C6CA 5DEZA 1X7IA 1AH4A 3EMQA 4DNMA 2HVMA 3WQ8A 4DWSC 5J5RA 3U4FA 4YVVA 4O17A 1H7WA 4DF1A 1A5CA 3VNYA 4H3DA 1PUDA 4EXAA 1JUEA 1HP4A 1A80A 1ZBWA 3NQVA 4RXFA 4AB4A 4BI7A 4P7RA 1HX0A 5IBXC 1T41A 3SJ3A 4GHRA 1VBRA 5XIAA 3V5FA 4B91A 4IF2A 3SY1A 3BV4A 1G4TA 4RUBA 3KEHA 1E56A 3ANUA 3E2SA 3UWEA 4GI6A 1MI3A 3MV11 3S47A 1EBHA 4D2JA 3OHMB 1OK6A 4DXKA 2EXOA 4L1GA 1FHDA 3VINA 1XIBA 6REQB 8A3HA 3NGJA 1VBHA 3IVTA 4AD5A 1UKOA 1O1HA 2RJHA 5D09A 2J66A 1FDYA 4WSJA 2JKAA 1Q7ZA 3VDAA 2HXUA 3IANA 4CVWA 1UH4A 1RCOB 2P88A 4LNYA 4ZXLA 3VDGA 2YW4A 4IIBA 4ZTYA 1ZBCA 2VWSA 1A3HA 5LHFA 3ATZA 3IVSA 1KM0A 2IQ0A 3TWAA 3HV9A 4YN5A 3E9AA 2BHZA 4MLRA 2F6KA 3MSRA 3AWNA 4ROPA 3C0JA 2GLKA 3P60A 3I4EA 3W24A 4LV9A 3VKCA 1R3SA 4GG9A 1QNPA 3IJQA 1MXGA 4JHZA 2ACSA 2ESCA 3KL0A 4IP5A 4UMAA 1VR6A 1ONRA 3W2NA 4E4PA 1JCNA 1MEIA 1EJXC 2OT1A 4D8ZA 5LYRA 3VM7A 4Q8MA 1WP6A 4ATDA 4C1NB 3OTRA 3AWOA 2DP3A 4JTHA 3NDZA 3O6CA 3RDKA 2OELA 2OSWA 1WBHA 1E4IA 3DU0A 1OCBA 1JCJA 3O2LA 1OZMA 3AICA 1PX3A 3GXNA 4O0KA 1J10A 4ZODA 1YPXA 2HBVA 5JQ9A 2D0FA 3QGAC 1D7KA 4N6EA 2XSAA 4HKPA 3E12A 3I68A 3C5QA 2PGFA 1E3ZA 5L9FA 2HEJA 4XO7A 5AC5A 3LTSA 3W1RA 4ES4A 1KFJA 1ONWA 1R9ZA 3P5ZA 3WJYA 2JIEA 3DGRA 3WH6A 3WH5A 3TTEA 3LHVA 1W56A 3FJ6A 2VZVA 1C9WA 3ORWA 2FGLA 2OCZA 3T09A 1MMFA 4B90A 2VDHA 4KWUA 3EDFA 3EWWA 4H6KA 5K4XA 2ZC8A 3VABA 3BQ6A 4JIPA 1MEWA 4AD0A 1N8IA 3U2CA 1UKSA 4E5TA 3WFLA 2QV4A 3M1ZA 1XSJA 3GXDA 2DH2A 3PVFA 2BLEA 3G5EA 2WC7A 3HQ1A 2OZTA 1B3ZA 3WKZA 4KWVA 4H7ZA 3THQA 2PDCA 3NPWA 1Q6CA 3LK6A 1VS1A 1LRQA 1FVPA 3FLUA 2G4FA 4OOUA 1V79A 1CXLA 3GHUA 2BVDA 3DG3A 3MMDA 3LY0A 1XPGA 3TA9A 1GZ1A 1M04A 2A6LA 1WV2A 4G9PA 3GKAA 3LTPA 3O0FA 1TPVA 2QF8A 3SCWA 5I0DA 2TPSA 5CJMA 4ZSTA 1HGYA 5BXTA 1LL7A 1BFNA 1RY0A 2J77A 3I65A 1GORA 2Y2WA 2Z4GA 4O16A 5A8MA 4R9OA 4AZIA 2DW7A 4CQAA 1R87A 2NXHA 1OCNA 4X9SA 1ITXA 3B0YA 2D69A 3LHYA 1R6WA 1EPVA 3C0SA 1TWIA 4XZNX 5FEZA 4HPHA 1YTDA 4ML9A 1P5BA 1ISXA 3CIVA 3V1HA 3R94A 3GYCA 5H8UA 1RA0A 4IQJA 3CAKA 1BYAA 1UH2A 1QO2A 1OFBA 3IARA 1TTIA 4MZ8A 3F4WA 4H01A 3D47A 3C0QA 2VO5A 2V5LA 4FXFA 4UIOA 4UC5A 3CT2A 4LUSB 5LNSA 4NL1A 3TC7A 2ZE0A 1RPKA 1AW1A 3G1VA 3O3RA 3LQLA 4C6LA 3WJZA 4V15A 1GOOA 4IFOA 5CGTA 1RK6A 3ECQA 1UKQA 5IHRA 3AUJA 1OQFA 3QFWA 3DFSA 2Q8LA 1B1YA 1PXGA 3NFUA 2VP8A 3MANA 1JDDA 3K30A 5G2WA 3VUPA 4RDZA 2Z1BA 5HATA 3MZNA 2EO7A 2R24A 4E3TA 1KFKA 1JNEA 3TYBA 1O5KA 4A05A 1W5NA 4PFMA 5HWJA 3WQCA 1V3MA 3MI3A 4AEEA 5CC3A 1ISWA 1QOPA 2XIQA 4GBDA 1UWQA 5F4XA 1M9HA 2DW6A 4I9JA 1MQQA 5D30A 4FIQA 2VGGA 5LNVA 4J4KA 4YHGA 3VKJA 3W53A 1EEXA 4OECA 5AHIA 2POZA 1E3XA 4XKMA 3CHDA 2WMFA 1NFBA 3G6MA 2A3CA 3AS3A 4GC4A 3SN4A 2PCQA 1XW8A 2MNRA 1ONEA 5M17A 4E2BA 5EKYA 1W2PA 2R91A 2NQJA 4EIVA 5BW6A 4OBSA 1TJRA 3I4KA 2XVNA 2NX3A 3FN9A 4J35A 4IT1A 2QVNA 1FWDC 2ZQ0A 3VIHA 2AGKA 4PUEA 2J7EA 3QRHA 3OZOA 1TX0A 3NYZA 3LQGA 3OZMA 3W7LA 6TAAA 3KOZA 2P8CA 3LN3A 1JDFA 3UR5A 2XIMA 2YIHA 2E9MA 1TUFA 2PLJA 3AMLA 4O52A 1A3XA 4Q3MA 1PKNA 4C90A 1CPUA 3PBGA 3NDYA 2I9UA 2EBNA 3O0KA 2FTPA 3VIMA 2GGHA 3EWUA 1LCOA 2GDUA 3ZXWA 4NAFA 1VHCA 3C3NA 3O1NA 4PFHA 4JFUA 4R85A 5DN1A 1SPQA 1N55A 5FI8A 2DY3A 5C5YA 4IJBA 4A2RA 3PJXA 1QHZA 5T8GA 4BFAA 1ZHAA 2QCGA 5AOUA 1YDNA 3THCA 3TU9A 1F61A 3I6RA 3LU2A 1WNOA 3LGGA 2O7SA 1IIHA 2FYMA 3CV1A 4HJFA 2XVPA 4HTBA 3UWYA 3FOKA 3PTQA 1YNQA 2ZRYA 1FH9A 3RX3A 4JIRA 4FX8A 4Q8VA 1XIHA 4A8RA 1XIFA 3BMWA 3NOEA 2Y7FA 2Z29A 3R0UA 4N9DA 4INFA 3TFXA 2XN2A 3B8UA 3M5XA 4TIMA 1KA9F 3S9ZA 1UKPA 5E0CA 2EEXA 5AHNA 3W22A 4LT9A 5G1YA 2VX4A 4I8YA 3OGRA 3BARA 1K7XA 2OGYA 3HFYA 2VL4A 3S6OA 3EA1A 3TROA 5D4YA 3RLGA 4C6NA 4UFIA 4JBRA 4Z2JA 5DF0A 4DBWA 3MC5A 2ZXQA 1X6LA 1QR7A 4M82A 1K8ZA 4YVPA 3K4DA 5CC5A 1JZ5A 4C6DA 2VFIA 3HPAA 4V1YA 3VU2A 3VDCA 4AXKA 5AZ0A 3CEPA 1JI1A 5BMXA 3MV01 3UZ5A 4FNUA 1GOQA 3OIXA 1POJA 4ZOBA 1E4MM 2H3DA 1EQCA 1I2NA 1Z41A 1JPKA 4M5PA 2V67A 2UY5A 4GVGA 4U5IA 3EA2A 5G5IA 4F4RA 3CV7A 4RNFA 2ACUA 3V36A 3MZ2A 1GJWA 3WUBA 3K46A 4U2ZA 1ZPTA 3DEQA 5D8ZA 2Z6JA 4EACA 3FJLA 4B5TA 3ITOA 3NVDA 4W85A 4H41A 2DV0A 2WO5A 3HPFA 3VOHA 1KC7A 5REQA 1VYSX 3QVQA 1NAL1 4DHGA 4H9XA 1LL4A 2AMGA 4PMRA 5TF0A 1QUMA 1CLKA 1KM6A 4GCAA 1TPEA 6XIAA 2PAJA 3NQEA 1JQVA 5CBBA 2QCHA 1BTCA 1W1YA 3REQA 3CAQA 1KBJA 1KGXA 1OJXA 4HP5A 3PC0A 1RALA 2VC5A 4XK2A 2E5BA 4GIAA 2WJFA 3WO8A 5B7YA 3WUEA 3BK0A 5EPDA 5BOOA 1I9CB 1JRCA 3WK2A 1JNDA 1US2A 4PODA 3ZLGA 1H1YA 4JAWA 2PDYA 2ZRVA 1WKEA 1JGMA 3QZ6A 5AKQA 4GQBA 2HS8A 2DSUA 2ZA3A 1UR0A 1K7EA 3WD4A 3VIKA 3B0VC 2ZICA 4OZOA 4CU8A 4HZ8A 1A0EA 4WQ6A 1PX8A 2YYTA 3QXBA 1JZ2A 5KEZA 3W1AA 4L1WA 3ITVA 4AMCA 3GBDA 1IHIA 4WDWA 4MY8A 1ICPA 5AYYA 2VXNA 4AVFA 2ZRXA 3TJ4A 4YTQA 3NEVA 4EAYA 2CNCA 1V6WA 1XCFA 4IPIA 2NV9A 3TOYA 1SO6A 3TNBA 3W81A 4KFNA 3HGJA 1F4AA 3GH4A 4Q8WA 2IS7A 3XINA 1ODUA 5HUPA 3LBCA 1AL7A 2WM0A 3N2CA 4QJ3B 3R2GA 1RBOB 4D71A 4NYYA 3UWQA 2G3JA 4QIUA 1LBLA 3H2EA 4MUZA 3CQIA 3IV8A 4HU0A 3A22A 3KOYA 3F2DA 1FCQA 1IT8A 4JKMA 3DDMA 4LUYA 2ZE3A 5HDRA 1C90A 1IZJA 3MMWA 4FOUA 2W9MA 3CO8A 1QPRA 4JYFA 1ZFJA 3JZUA 3ZJKA 2VTFA 5K9DA 2VQUA 1XCWA 1FWWA 4UTWC 5EY5A 1H49A 3PPHA 2HCVA 4P7NA 4AF0A 4MYXA 5BXRA 3TR2A 3ES8A 3BCJA 2ZRZA 1E73M 2E7FA 3T7VA 1RSCA 3G24A 4DWSD 1S3TC 4LVDA 5HMDA 2IPFA 3RILA 1BWLA 2V38A 1SW0A 3M0XA 4PUDA 3U2ZA 3CQKA 2PFHA 4PBFA 2NQ5A 3W7CA 3CZJA 4PUKA 1EZ2A 4KRTA 3HGSA 4NQ1A 4JN8A 2O9TA 3T2QA 1FWFC 4PC8A 1MDLA 2QEZA 3BE7A 3K8MA 2VFHA 3OIHA 4NRRA 5DMNA 2ZUNA 3MUY1 3B8TA 1S1PA 3VNZA 1EO5A 3WDIA 3E5PA 1Q5MA 4GQRA 2B31A 3QY7A 1QNOA 4KGLA 3CZ8A 1BG9A 1J12A 1QPOA 1S2VA 3TX9A 1G94A 3L5MA 1EHNA 3EOSA 3TYDA 4XIMA 1ALDA 3MHGA 5RUBA 1H7XA 3ZWSA 2PTZA 1KFWA 1WXYA 1GOIA 5FJUA 1W3KA 1TFVA 3A4AA 2OG9A 1DXFA 1UKTA 3DKJA 5G1TA 3WD0A 1X1OA 4WOZA 1ISZA 4JQ4A 2WVUA 2WQPA 5AYXA 3UXKA 3AU2A 5BROA 4IQLA 3GR7A 5GJPA 3FSTA 1XS2A 4NG3A 1MUWA 3EB3A 5J8LA 1H4PA 3GR8A 3F5LA 4K39A 3B04A 4KESA 3IEBA 1V6UA 4S2CA 3MSYA 1FWTA 3NQ6A 4QQUA 4A8LA 1WO2A 4GYPA 2ZFAA 1E4NA 2ZX9A 4J3ZA 4AZCA 1ITCA 5BNKA 2Y1HA 4DJDC 4ZQMA 4XBSA 4YYFA 3OLGA 1CDGA 3FA3A 2I5IA 2WSKA 2AMXA 4H1ZA 4A2SA 3NL6A 3EMZA 3N4EA 3WYZA 4HZ6A 4NZJA 2CLKA 3UP8A 3RPDA 3QBUA 2H8XA 2V3GA 4AYSA 1YX1A 1DQWA 1V03A 3RO8A 2E6DA 3ABXA 4QAIA 3U3HA 1DBTA 1XG3A 3BC9A 2VGBA 5EMUA 4NJGA 1PSCA 2PZ0A 3TSDA 1W9VA 1MFVA 1FUYA 2GZXA 4S3CA 1ZGDA 4CNPA 4CQCA 4Z08A 5HR6A 4Q4SA 4JQ3A 2A3HA 2NV1A 3KW3A 2OYMA 4CQ8A 3H4XA 1J8VA 2NLIA 1D9EA 1ZAJA 1JZ7A 1RZMA 2R14A 1AD4A 4DBEA 2XSBA 3FHAA 1PO9A 1XLMA 4X0NA 1TRIA 3C2EA 4S3FA 3PWIA 4LCSA 1IIGA 3ABSA 3LRLA 3TA6A 6PTDA 2QUNA 4D8AA 5I07A 3FVDA 2J9XA 4O1FA 4Z2GA 1LWHA 5TIMA 4RK8A 3AAMA 4ZMGA 3GNDA 4F48A 3AMKA 2IKJA 2XPKA 3E38A 3INPA 4AWEA 2VJXA 1RD6A 3NJ3A 3HG3A 5EFFA 4QX4A 4DBSA 4YIWA 1AJZA 3HA1A 2ZZ2A 1JRBA 1WDSA 2FIQA 2V5KA 1MRAA 1QDSA 3FDKA 2CLEA 1XBYA 4G7EA 3AYTA 4LYQA 4B16A 1R85A 2XINA 3EDJA 4MKVA 1REQA 3B9AA 5BRQA 1EUNA 5EMLA 1XYLA 2VUYA 2HK1A 3I3EA 7ODCA 3IGSA 3F4DA 3KBVA 1XC4A 5GNYA 5CLTA 3UA3A 4DM1A 1KXQA 1B90A 4HB7A 4QAWA 3SZ8A 2W92A 4IMDA 3WBEA 4DF2A 1S2CA 1TPDA 4XKYA 4A4AA 4FIRA 3CUGA 1IQ8A 1NU5A 1XIJA 3KOFA 3OVRA 3FCPA 1W0MA 2DT2A 1Q66A 3SY5A 2FFIA 1VKFA 2ONEA 4EF9A 3WY1A 1UWUA 2QVHA 4BWLA 2IKHA 4KCWA 5FF3A 2FGBA 1K9EA 1YYAA 5EMYA 4XVEA 1T40A 3OG2A 3PBVA 2CERA 3W1MA 2OYLA 4L9XA 3LM7A 3C61A 4IMFA 1LROA 1V3HA 4JY9A 3CZEA 4HPNA 3BOXA 1PKYA 4Y8FA 3THDA 5HULA 1FXPA 1AZ1A 2VD9A 4FNPA 4NT0A 4LGXA 1KTBA 3RU8X 5FF0A 4GX8A 4MG4A 3SUTA 5M3WA 2DQXA 1QHOA 5E70A 5LNUA 2NW0A 3T78A 3EWYA 1ZRQA 4Q33A 4LSBA 2V69A 2OQHA 1YDYA 3CHVA 1I2QA 2GGEA 3AU6A 1VJIA 2UV8G 2DH3A 1TVLA 1HF6A 3RXZA 1XLIA 4HPJA 3VGDA 5FACA 2YLLA 4TV6A 3R8HA 1XKJA 4WUIA 4Q22A 3BLFA 4TMBA 1XLEA 3DHFA 3DI0A 2BOFX 3WUFA 4D6IA 1M7PA 2E25A 3PZ9A 3M6YA 1Q4NX 5D37A 1YMYA 1FH8A 4FNTA 5IM51 3THUA 3WNLA 2ZUSA 1PYFA 3ZO9A 5AN7A 1TTQA 2G41A 4LJ3A 4RZ4A 4G2DA 3UGVA 3PAJA 1OG6A 5C54A 4UTFA 4IL0A 1OX5A 1Y7VA 4MNJA 1LWJA 3TP4A 4LCQA 5FA5A 2CXEA 5CJ5A 2A3BA 3G6LA 3VOJA 3KCLA 4IP4A 3NL5A 1PAMA 2BXZA 4LEQA 1JI2A 5K3VA 4JX5A 1CGYA 1ZQ5A 3H53A 3WMLA 3HMCA 3PZIA 1QXLA 5CG7A 2ZXDA 1UYQA 1F3WA 4PBGA 4XTIA 2WC3A 2YL6A 4NZ5A 3LV6A 3GB6A 2P3ZA 3GKFA 1UROA 1KBBA 5C0QA 1NDZA 3QM3A 3SRKA 3MW7A 4HA1A 2QMKA 2ZX8A 2A6NA 4Q8UA 3PZOA 4QNWA 5D9PA 1NARA 3WQ5A 2PA6A 1WAUA 3ONCA 2WXDM 5D33A 1G4PA 2HE8A 3GE7A 1R2RA 2EPMX 2ODOA 4XD5A 2EPKX 4IMEA 1CGWA 1R30A 2CHOA 3PTDA 1EOMA 5HMEA 1E9ZB 3MVIA 4LV4A 3W9ZA 3HIJA 2ISDA 3N4FA 3H2AA 5K9XA 2C3ZA 3UG5A 4ZL1A 3TW6A 1M7XA 2WYSA 2REQA 1VPXA 5LIKX 3IIZA 3FKKA 5A6BD 3WQWA 4J9JA 1GG1A 2AAMA 2V3DA 4RV8A 1IXPA 3QF0A 3T42A 2YCJA 1KTCA 3ME3A 1CYGA 2BS9A 4H6EA 4XTDA 1KRCC 1NP2A 1KW1A 1XKYA 4ZO9A 3MCNA 1Z8AA 2WAGA 3T55A 4UTMA 1RBLA 2D2HA 9XIAA 4PB5A 3DN5A 1FCBA 1WUFA 5A8OA 5AB3A 4GBUA 1TVPA 3W2UA 1KTNA 2KZHA 1R3TA 4XAGA 4BK9A 3UZZA 1D7FA 2V5DA 1E0XA 4KEUA 4JPGA 3S42A 2OX1A 4EK7A 2MUCA 3L4YA 4QDWA 4H83A 2GUBA 3HM7A 3KRUA 3TWBA 3IS4A 3LZ3A 4FHAA 4RPQA 3T4CA 3DFYA 1XM3A 1S39A 1GEHA 4LF1A 1W37A 3BMXA 4OBRA 1H7PA 7REQB 2A2IA 1A49A 4EP8C 2CLHA 5U7SA 3STGA 2AOSA 3AZRA 4HT3A 4OTKA 3WL0A 4A8IA 3SR7A 3BSGA 1MW1A 2YB4A 3B9EA 3CPUA 4KFPA 1XYBA 5CQ1A 4GQGA 3LTYA 3UR7A 3WEOA 1JUKA 3VMPA 2DIKA 1P6WA 1DWGM 2O9OA 1XDMA 5GJMA 1XLLA 5LNRA 1R9YA 3VFCA 1JL8A 2RFGA 2XGBA 4H8UA 1R8LA 5H6HA 4CKQA 4LC6A 1C92A 1CZ1A 3CXOA 4J5NA 5A8GA 5LXEA 4NXKA 2FH6A 1W3JA 3DFTA 3LCLA 2DUXA 4UQAA 4HHHA 3RK8A 4LALA 4HOZA 1OX4A 2PP0A 3HB9A 2A79A 5IDIA 1J5SA 1LTDA 3WQ4A 1UMYA 4UNLA 2Q6ZA 4RV3A 1LT7A 4GUJA 3QW3A 4PULA 2WC4A 3COTA 4DWDA 4HIBA 3NEHA 5DX7A 2POTA 2CFFA 4AU0A 2ZA1A 2BB0A 4M1RA 3AZSA 4C1LA 1XLDA 4GACA 1J93A 4M6QA 5K2ZA 4ICMA 1J2WA 3KFTA 1MUMA 3TKFA 3CZGA 2JEQA 2YPIA 1LP6A 1YE4A 3C0LA 3VC5A 1L6FA 3BL3A 2CKSA 1EFZA 2QDDA 4OVXA 1EJTC 1IT7A 1FKWA 4QDPA 4CNNA 1VGAA 3WDJA 3U6WA 4PRWA 3UZWA 2R82A 2EJ1A 4LBSA 2IXUA 3MP3A 3NURA 1AQFA 2JGYA 2WPBA 4AMAA 3EX4A 2DSWA 4MJZA 1U83A 3EAUA 3BAIA 3IGHX 3LGEA 3KZPA 5BOFA 3TONA 4LOCA 2V68A 4LUTA 1B54A 1XX1A 4MWAA 4M51A 4K7VA 2WQDA 1N7KA 3N6QA 1OT1A 3R12A 1E5JA 4UCGA 1JCYA 7ENLA 4A22A 4QISA 3PR2A 4NZ1A 3MCOA 5JIWA 1FWJC 1JXKA 3AS2A 4PUNA 1K3UA 2VR2A 2WVSA 1KFBA 4FEZA 2TYSA 2YBUA 1DWHM 3PUEA 1KWGA 3SO7A 2D2OA 3GG1A 4Y9MA 1LT8A 4AH7A 3IV3A 4YTUA 1QI3A 2Y6ZA 4ZO8A 3UCDA 3EMCA 2PWVA 4B3LA 2Z2BA 3ITGA 3BTNA 3O6DA 2WZEA 2VMFA 2G95A 2BY3A 4RNIA 4QE5A 2Z7GA 3GTXA 3A4WA 4DRSA 1LOQA 3AIWA 2DIJA 2XHYA 3BMVA 3DHDA 3KVMA 3T1GA 2RDTA 3A3WA 1PYMA 1XGZA 3QEZA 1S3HA 1GT8A 4HVXA 1M65A 4R34A 1H5YA 1X1ZA 4PMQA 4HNLA 4JFVA 2YBVA 1WKFA 3EX2A 4NIRA 1W31A 3VX1A 4H19A 2J7BA 1UIPA 2QAFA 4S38A 3CWNA 4ACYA 3W76A 4GA8A 1DHKA 1LLZA 2OSYA 3AXIA 3P14A 5DXYA 3EKZA 3ITYA 2Q8ZA 2V2HA 4L80A 2ZUMA 3MBFA 3M07A 3NPVA 1W1PA 3WLOA 1SMAA 3QMSA 4XISA 3P93A 4ERIA 3F1QA 3H4GA 1VHNA 5M1TA 4C6FA 2TSYA 4XD4A 4BQ5A 1HL9A 5HNUA 2YB1A 4QRNA 4UR8A 3TTYA 1KBKA 3ALGA 3PZUA 3ZJ8A 4PTMA 1KR1A 2PTXA 3NVTA 4XD6A 4CN4A 1NVMA 2OFJA 1JG9A 3NQ8A 3VA8A 3V0TA 4FALA 2PDBA 3IWPA 3MJMA 5F4WA 2PCEA 2D20A 4ZOEA 4DUVA 4YXGA 5IBXA 1YIXA 2Z25A 4GQQA 5CCZA 4OWGA 1JUBA 2JF6A 2V6AA 4HMNA 4R7WA 4IISA 1ISVA 2C91A 4XAYA 4CEUC 3B0UX 4FNSA 3JRKA 2ADAA 5FESA 2HDJA 5CH9A 2WMKA 1VAHA 2A3AA 3U9IA 1KM1A 4HTYA 3JU2A 3VCNA 4GUFA 5T26A 3EWCA 2XJ7A 1XQLA 4ALDA 2QV5A 3MUCA 4PBEA 1ICSA 1P0EA 4YMZA 4H9TA 1BGGA 1B2YA 2ZIDA 3CB8A 1O4UA 3TVAA 4DJDD 3H4WA 3QY6A 3E0FA 4KCUA 3HQOA 3TK7A 2PDNA 2I14A 4LBRA 4UOQA 1UWTA 1SU5A 2XH0A 2V3FA 3WDHA 2P5NA 5I6SA 4AZ7A 4I90A 2GL5A 4AQLA 3D46A 4O19A 4AIEA 2GQAA 3UU0A 1B9BA 4UTTC 1O68A 3GIYA 3HN3A 2GSEA 2NVCA 3SIMA 3VTRA 2PPGA 1TIWA 3CLMA 5CPOA 3WQEA 1W1ZA 1Q6OA 5C7HA 2GK1B 2ANUA 2WMIA 1ZLPA 3IK4A 2QLYA 1OX6A 4UQBA 3RGTA 4RZ6A 2I16A 3AXMA 5CC7A 2H3BA 2WNNA 3B9NA 3W07A 4UFMA 3S5OA 5TBOA 3ITCA 5HNRA 1CXEA 1LG1A 4GD0A 4Y9PA 1TPH1 2OWCA 3ISIX 4C7GA 3TIMA 1WX0A 4XAZA 3KCOA 3L2MA 3VKBA 4PCNA 4AC7C 3UZYA 4DO5A 3WCZA 4ZQNA 3QQ1A 5KZ6A 1XHGA 2VCBA 2ZCGA 4AAJA 3BSHA 2E5DA 2P0OA 3WH7A 1OG0A 4WX2A 5AZ1A 1TPWA 5GVJA 2V8ZA 3UESA 4M8UA 3H2OA 4E2DA 1YPFA 4LAZA 4C6PA 4YL2A 1UR8A 3PBMA 1PZ0A 3NXFA 2OT0A 1Q7QA 1D3CA 1W1A1 1G67A 1X96A 1GQJA 4DO7A 1EP2A 4Z0JA 4F0KA 4L6OA 1P0KA 1ZBKA 1XWYA 5LIWX 1OBAA 1Q2SA 1A5LC 2IPGA 1TR9A 3BLIA 1RXOB 4GISA 1SSGA 3IJ8A 4IJCA 3IK2A 1OK4A 4DXVA 5KITA 1KD0A 2RDXA 3RMJA 2YJQA 4ADUA 4CCEA 1XC6A 3H23A 3T0AA 3PFRA 4X22A 5BMWA 2CZEA 5E5CA 4US5A 2Z1WA 4MNKA 5LXXA 3OPSA 1E55A 4Z1BA 1DV7A 1OFAA 1UQZA 4YHEA 3PB0A 4H4IA 2ZC1A 3W00A 1PCWA 4JHMA 4BCEA 3PUOA 5LZLA 3QZAA 2XM1A 5F1UA 4J3UA 2C1IA 1GOKA 4DN1A 4DAFA 2J8TA 2WBGA 4AUBA 8CGTA 4P8WA 2NQ9A 1HO4A 4J3XA 1BF2A 4C1NA 1KBIA 3VFLA 5A6SA 3S2MA 1TCDA 3L4TA 3W7DA 1XFBA 3MI2A 1HIZA 2VZOA 4DZIA 3NQAA 1TA3B 3T0DA 2TAAA 4L4MA 3LGDA 5F2MA 4UTKA 2QJHA 4IPJA 1JVNA 1HKVA 2O4QA 3W1NA 4JZ5A 3AHYA 2O7QA 1RY8A 5FJOA 3NA8A 1QK2A 4XB3A 1LQ2A 1WKDA 4RE2A 4DLFA 1S2AA 5EA9A 2CWNA 4QG6A 3RLHA 2X0SA 4I7UA 4HOWA 3JUGA 1V02E 4DO4A 2HNEA 1R3WA 3SQMA 2J6XA 3N14A 3MMUA 4PTDA 4XX6A 3CYJA 3RRXA 1JPMA 4JTRA 2GOUA 3M0JA 4W87A 1B3XA 3EDKA 1MFUA 3CTLA 2YXGA 3MTWA 1XLJA 1MZHA 3QYSA 4O4VA 1OT2A 4REQB 3M5VA 4G6CA 4IXXA 4M6UA 1GVOA 1TE1A 4KFOA 1XPYA 3VDBA 4D6EA 3N3TA 2AL2A 4OHQA 4MB4A 2OX4A 3SCPA 4E3VA 4R53A 1HJWA 3D5HA 3GVVA 3DXIA 4Q4QA 3ABRA 4A3RA 4O12A 3KBNA 3R0KA 3RITA 3MP4A 1IT0A 1GQKA 5CSYA 2DVTA 4DUWA 3FDGA 3UXIA 1L6SA 4YYCA 3VOCA 4RLIA 5HWMA 4LB4A 4I9MA 1EIBA 4FSAA 1LG2A 1W1TA 1DJGA 4HNCA 1O95A 3K8LA 1EX5A 4L4LA 3RIKA 3WMSA 1TX2A 4DBUA 3ATYA 2PTDA 4OFCA 3DI1A 2VEKA 3PNUA 1WDWA 3CEUA 2G37A 5ABEA 4JQ1A 4PEEA 4BJHA 3V5OA 1PZ3A 3A47A 2IPJA 1JDEA 3AIEA 3GAKA 5HQLA 4U3CA 3WD2A 3BG9A 3G1DA 3OB8A 1Q2RA 3TJXA 4WGHA 1DE5A 1C3FA 3KBJA 3O6AA 3C6CA 2QW5A 1ZL1A 3L0KA 1XUUA 2QZRA 1OCQA 1T6MA 2Z00A 4J2PA 3OOQA 4FB7A 3WLQA 2D3NA 2VEPA 1DORA 3B8VA 1CTNA 3TYUA 3GTNA 3GVGA 1SFTA 2V5CA 3MS8A 4CUCA 4W9TA 5FAJA 2W27A 2VURA 2X42A 2IQTA 1FDZA 2PF0A 1S5VA 4I5XA 1EGMA 1I0DA 1UOKA 2OYKA 2BOGX 5I3JA 4JN7A 3LI1A 2Q01A 4PSPA 4NJKA 1OGGA 4MB3A 1AODA 5LIYX 2GUYA 1UR3M 4OT7A 2XH2A 4YTTA 1RUSA 3RRAA 3EBVA 1TWZA 1P4CA 1PPIA 4GMEA 3FYYA 4C7DA 5GNXA 8TIMA 3BV7A 2DEPA 1QMLA 4XUYA 1W5OA 1BTMA 3FJ4A 1N8FA 3WBAA 4Q8PA 4MVAA 1ZUAX 1VFFA 2VFDA 4R33A 2OEKA 1W9DM 2Z2UA 4GI9A 1X8FA 2Y63A 3ARQA 5B80A 1CWYA 2QCLA 3BZJA 3LPGA 4HHMA 1YLVA 4NY2A 1DKWA 3OVPA 4OUIA 2PWDA 1BGAA 1UH3A 1ECEA 2CBUA 3OODA 1PCKA 1XL9A 3S5YA 2NLYA 1L2UA 2Q09A 2AKMA 4MTVA 2OTDA 4PCSA 5M2FX 1XD0A 2E6AA 2J24A 3QGKC 4US6A 3R43A 1FWBC 3WNKA 5C7VA 1J0ZA 1GVYA 4G7FA 1UP3A 3D3FA 5KMYA 1OD8A 4LTSA 1QFEA 1PJ9A 2PRLA 2Y62A 2PZNA 4ZE4A 1OGBA 4HCDA 2MANA 2VENA 3GDKA 3A5VA 2YDSA 5HOSA 2Z28A 4MJMA 5HQMA 3JW7A 2WBKA 4TQTA 3EWZA 2FPYA 3KTSA 3IGXA 1VBGA 1KXTA 1EDQA 3N2XA 3PN8A 4J28A 4UUIA 1JYNA 3LBMA 3PTMA 1R47A 4UZSA 3L4UA 3GHRA 3B0XA 4EKJA 1JFHA 4FZIA 1BVZA 1W8SA 2QGHA 3W7NA 4MB5A 1DIDA 4KF1A 1V3KA 3URAA 3PAOA 1TPC1 3W3OA 3IUDA 1M7JA 2YL8A 4GH1A 1SYTA 4L9YA 3WQFA 1XLAA 2I5GA 3QPYA 3MCMA 3MT1A 2Z27A 2PDKA 3BAJA 1QPNA 1I2PA 4NZ4A 4XZ9A 3GS6A 1I1WA 1T8XA 1TZ7A 3BANA 4B3KA 4XZLX 1KB3A 4PTWA 4JGDA 4HQVA 4LW7A 4FNQA 1BVWA 3ARPA 2JKPA 1FWNA 4H6QA 2GDVA 1DQXA 3KLLA 4O50A 4O18A 2D2GA 3M16A 3A24A 4JIQA 3VGHA 3P5YA 1AW5A 2WMGA 2D73A 2BDQA 7TIMA 1PHWA 3H2MA 2R9RA 3ABQA 1KCLA 5BU6A 5A5WA 4RZBA 5F2IA 3AI0A 2Y89A 2ZDRA 4L6DA 5IFTA 4KCVA 4NUWA 3LXCA 3KWSA 1OYCA 2JGQA 3K8KA 2ZA2A 2EG7A 3E0IA 2BVWA 3F2BA 5D04C 5KZDA 3BLKA 1UZDA 5DMYA 4RZ5A 2E5CA 5BXPA 1Q8JA 4P7QA 3TCSA 1ME8A 2G3IA 3KDOA 1NOFA 2QIWA 2VYOA 3W75A 4LVAA 1J2BA 3VNKA 3DOPA 3SY8A 1CXIA 1W1B1 4F2BA 4OUEA 5F1VA 3DUGA 2WCSA 3LOTA 5K9CA 4C6KA 4PTVA 3EPNA 1W1IE 2Y7GA 3G0SA 4JFWA 2GGJA 2WNZA 2A5HA 1NWSA 4BR1A 2ZOXA 5AC4A 1UD3A 3TMQA 1IXOA 3LCFA 2OLAA 4JNMA 2D3LA 4ZO7A 1HG3A 1KRMA 1J0KA 3EX3A 4BEQA 2G0WA 2NQHA 3CZKA 5AECA 2E6FA 1KR0A 1EXBA 1E70M 3Q67A 1I45A 3CH9A 1V7AA 2XIBA 4F0LA 4JY8A 3N25A 3R1ZA 5G2IA 2AKZA 4GIRA 3LEPA 3BURA 4QDMA 3URBA 4ERGA 3KVLA 3CQ0A 5FAGA 4XZWA 2VOMA 1H2JA 1R2TA 1AFSA 4QCEA 2VVSA 1SW3A 1JZ4A 3CUFA 3LSBA 3DBPA 2VZSA 1NDYA 1NEYA 9RUBA 4M6PA 1ADDA 1AH3A 2GGGA 1BQGA 3V18A 4AXNA 3DHPA 1WOAA 1DYSA 1H7RA 3LLDA 3W23A 4CQ9A 4V2XA 1L2QA 2WSRA 4IICA 3KRSA 2VKZG 4B5SA 2WM1A 3QV7A 3VOGA 1EL3A 2CETA 1KO0A 1E15A 3T07A 5CZKA 1P6CA 1UPPA 3CNYA 4ATLA 1Q6LA 2YA2A 3AJ7A 3GC2A 3P6LA 3H8AA 5A6LA 2UWFA 1UJQA 2QUUA 5BWFA 1G69A 2XUCA 4ZA0A 2CW6A 3E2VA 2TMDA 3G3MA 1DJYA 2DFAA 3SSJA 1CGXA 2B0MA 3CIWA 2A7PA 3PG8A 1O5XA 2ZX5A 4JTFA 1CW2A 1MXSA 1EF2A 3R8RA 2CBVA 3G8RA 1Y65A 4K8HA 5AVHA 3G0XA 1JCMP 3ZR4A 1XH0A 3NM3A 4CQDA 4V33A 2OVLA 4RL3A 5G1MA 3QOKA 3UJ2A 3I10A 3USZA 1VRXA 4GKLA 1CXFA 4ZQPA 1QOQA 3GXFA 4F66A 4MZ1A 3SRFA 4AX6A 5CPQA 3LCGA 4F2UA 1BVNP 3IJ7A 4V27A 3TYCA 5JBEA 1IXNA 4O14A 4DJED 1QOXA 1ZZMA 3A4JA 2RKXA 2OSXA 1Q8AA 4DZAA 2CZDA 1F6PA 3LM3A 2NQLA 3PULA 5LKYA 1W17A 4NX5A 1DJWA 2FZ9A 3MSDA 1L8PA 1JPDX 3AXXA 4B9YA 1A5NC 3RJYA 1P1XA 4GY7A 3H21A 1SJDA 1LQ0A 3GK0A 1VFHA 4W4QA 2Z24A 1CXHA 5I78A 1UR1A 1XGEA 3VNJA 3GTFA 2C0HA 4H9YA 1R5YA 4B4FA 2B7PA 1KFCA 1KM2A 1O7AA 4QITA 3N2BA 5XIMA 1UD2A 2PODA 3KE0A 4X0VA 3W85A 3N2MA 4AZBA 3G2GA 4R7JA 3MY9A 4GNKB 4CNUA 1XIMA 3VCRA 4Q7NA 4K36A 2OWXA 3TXZA 4O57A 4IIFA 2YA1A 3N6JA 1HJXA 1HFBA 2G50A 2YX0A 2E28A 3N17A 3HV8A 2EJAA 5F2LA 2JKEA 5CBJA 4PTXA 2CHNA 1GG0A 1K6AA 3GW0A 1YDOA 3S1UA 3NO3A 2FPVA 3STPA 3WQVA 2QUTA 2W62A 1R0MA 3IIPA 4RE4A 5FSDC 3ARWA 5TQLA 2NUXA 3DBNA 4QP0A 3RCYA 3FJNA 3M7SA 2H9AA 1F6KA 3L2IA 1LRTA 1G7VA 1PWLA 4A8NA 2ZXBA 1TZ9A 2UBPC 1AW2A 2E1WA 1FOBA 4AEFA 3EDEA 1TWDA 5AFDA 2EPNA 4ZB5A 1CEOA 5CZTA 2PDWA 3M6DA 1VEMA 3TH6A 2XYLA 1VFTA 5FIPA 1SJCA 1EQPA 1TV8A 4ZXOA 3LMYA 4TVDA 3PZMA 2FJUB 2FZNA 5DRCA 2G3NA 3GD6A 4KWSA 1BKSA 3A23A 3ZSSA 1G9HA 5BRBA 3VE7A 3GVWA 1J5TA 4JQ2A 1S5NA 2A85A 1BD0A 2PDFA 3SI9A 3UCQA 2X1UA 4LAKA 1I8JA 4GPNA 1FDJA 3BCFA 1VJSA 1BAGA 5CEWA 3PZVA 1H1ZA 2DZAA 4S3EA 3B8IA 3TN4A 1EJ7L 3P8IA 1FCUA 4UFKA 3WDPP 1ENUA 3K4WA 5C71A 3VCCA 2BSLA 2XG9A 5CGQA 1VFLA 3DG7A 1YXCA 4K68A 4QGCA 3T9PA 4B5VA 1PKLA 1GW1A 1H0GA 2R1NA 3WF3A 3V0SA 4Y7EA 4H2CA 2AQVA 4W8BA 1F3TA 3AHZA 5I7GA 1XUZA 4M24A 4QSFA 2CYGA 1TCMA 3L2LA 1HVQA 5H91A 5C9XA 1QASA 3BAXA 5E1QA 3RG6A 1XCXA 4GWEA 4H2HA 3GX9A 1U1UA 1V7YA 5REQB 2GJNA 1H60A 3R6IA 1E51A 3V3WA 2FVKA 2YCEA 3QPZA 1N2VA 1ZALA 4OOZA 1TG7A 3B8SA 1SO4A 3H6OA 3M5ZA 1FQ0A 1I2RA 5HANA 4GXPA 1OF8A 4C5ZA 5A6MA 1LLOA 2D24A 3ITLA 1T99A 2BODX 4NNBA 4KMQA 4AD3A 1ZSXA 3TSMA 2CBJA 4PMJA 4GUIA 5CSRA 3GYEA 1UZ1A 3VIIA 1DXEA 1UWSA 4L56A 4LX4A 2GJXB 5A2CA 4BI5A 2YCIX 2H6RA 4J3SA 5AY7A 4AWTA 5F7UA 3W26A 1P43A 1EP3A 5H8MA 2Y85A 4C1KA 3WLIA 1PEZA 4ZGYA 1W6TA 1B4EA 2CU0A 5JBDA 1R9XA 2HJPA 2ZWYA 2QPXA 3NPXA 4Z2IA 5HQEA 3WX7A 2FHFA 4K6AA 4C6QA 1UIOA 1QBBA 3GY1A 3U2OA 3P81A 4O1AA 1LUCB 3QSRA 3MDWA 1CB2A 2PDGA 1FKXA 5CJNA 4FS9A 4W5ZA 3V5CA 3T2OA 2EKCA 3C2VA 3R79A 1KLZA 2BGSA 1HJVA 3PSVA 3DAQA 1V6VA 1FP9A 3UXLA 2Y88A 3FEQA 4FX7A 4HN8A 3UPWA 3MJYA 3R89A 1M7OA 3GZAA 4B5NA 2WSPA 1ZJIA 4IQDA 2BV9A 3OU8A 4PN2A 5IOBA 1G01A 2OO6A 5A95A 2E3ZA 3A21A 1NF0A 2ZTJA 1F73A 2W63A 3GDMA 3B03A 1TPFA 3HG5A 3GXMA 1P48A 2V82A 4PB3A 4PGLA 2DZTA 2OXNA 2XVGA 3AOFA 3CZLA 3A12A 3UY7A 1QPQA 1TJ0A 2VHLA 2OKTA 2DUAA 2Z1VA 1ZU8A 2WANA 4GO8A 3O05A 4I3GA 1ADSA 4UWMA 1FWCC 4IMCA 1M03A 1QRQA 2JF7A 3DH7A 4H7VA 1S38A 5JU6A 5FOOA 3AS1A 3KOXA 3TAOA 2QJMA 1SZRA 1T8QA 3L21A 2HZGA 4AF0B 5AC7A 4NNAA 1WQ5A 2WMHA 3OBAA 2ICSA 2NT0A 3LRKA 1VIWA 1MXDA 2J7DA 1UMLA 1XXXA 3WLTA 3CT7A 3AIVA 2F2KA 1K8CA 4MB1A 3GIPA 3W1QA 2D0HA 2NXGA 3NWRA 4JTGA 2DSVA 3LPPA 2W4XA 1WCGA 2CCRA 1Q6EA 4PRTA 5C9UA 3UA4A 1IGWA 5EMMA 2QNEA 3N1AA 1TREA 3G3DA 3H7VA 1GKRA 3BQ5A 4H04A 3AYSA 3PTKA 4FNRA 3AMGA 4IGNA 3SB0A 3U4AA 4CCCA 5JH1A 4AIUA 5DY3A 3TTQA 3VPLA 1A5UA 1GZGA 2ASHA 1CENA 3JS3A 4KWOA 3T6CA 5A8NA 4PR4A 3W84A 3CWHA 3SFWA 4AIBA 1H1NA 7XIMA 4PA8A 4RKAA 2OLHA 4K8GA 4H9UA 3APYA 3JVAA 3P80A 3W29A 2QDGA 5A2AA 1VB9A 3TZNA 4HZ7A 5BYWA 3PZTA 5DBUA 4IG2A 2Z1SA 3THAA 1W9XA 3IIXA 4QG9A 2XFRA 3WL1A 5DBTA 3WBWA 1LL6A 9XIMA 4BQ4A 4XZHA 5CZ0A 4PCTA 2BHYA 3S5ZA 1NF7A 2UY4A 3AXKA 2X16A 3HPZA 4UCFA 1XBZA 3GFYA 1PDYA 1XLKA 1FWSA 1GGOA 3DCPA 5A6AA 1JZ3A 4LVBA 1UCWA 1KFLA 4DVOA 3TN3A 1D2KA 3LHWA 1XYFA 3FHQA 1S5TA 3H12A 5L6UA 4ML4A 3RR1A 3LPFA 4ACZB 1HL8A 1V0LA 3V16A 3TJIA 4AX7A 4K3ZA 1LORA 4IPLA 1GVRA 5I3KA 3GNNA 4YU1A 2QQ6A 3HQNA 4XAFA 3TCEA 1I0BA 1MO0A 3PB2A 1VYRA 2GOKA 5FJIA 3H7UA 3V75A 4TXEA 1TKKA 1OB0A 4LFYA 3T44A 2INFA 4O4WA 2O9RA 1I75A 4RX0A 4I7WA 4BF7A 3WFAA 1LBFA 1Y5XA 3WF4A 1EX1A 3IJ9A 4GIEA 4TU1A 4HMEA 2HTMA 2PLMA 2NX9A 4K38A 4O1EA 1KRAC 1DTUA 3OYZA 1PVNA 4HD5A 1F4HA 1TO3A 3USBA 3CMGA 1E0VA 2FLIA 4MDOA 3KDNA 4GYPC 3ERPA 4GCXA 5A1AA 3PS7A 2F9RA 2ISSA 1XRTA 4KIEA 2F6UA 1PWMA 3NQ7A 1V93A 4Z17A 4LEFA 4LVFA 4EPKA 3AIRA 3TZFA 1PV8A 1EJWC 2G3FA 2GSHA 2XN1A 1WOBA 4DUXA 3GG0A 4G7EB 3VZYA 3CHEA 4JIHA 1EIXA 3DFPA 2BVTA 4FMVA 1EC7A 1EF3A 3VIJA 1A5KC 2VDIA 3H26A 1MQRA 4YVXA 4ADTA 5FL1A 4RW3A 5C55A 3WNPA 3EOOA 2VVNA 3JZEA 2PE4A 1QI4A 2QPUA 3RAOA 3CTTA 5EB8A 4IQEA 3J7HA 2J8FA 1VYPX 3WLKX 3A3XA 4AC1X 1XBXA 1IF2A 2ZTKA 4JQAA 3W1XA 3BLDA 1LBMA 3IRDA 3OQ8A 1QK0A 4P5UA 3W38A 2PS2A 2OLSA 3LB0A 3TN6A 4CEXC 4DI9A 2V3EA 4IHCA 3Q45A 1S2UA 4W8AA 2F84A 4HSOA 1XR2A 4C6BA 4DLMA 1OVDA 4I6KA 1JIBA 2J25A 5LA1A 4UFLA 3IJIA 1TRDA 5EYWA 4NSBA 4ZFMA 2PC8A 1VFOA 4E2VA 1UPMB 2PC4A 1Q6DA 3CL6A 1W1VA 3DESA 3UW6A 1OYBA 1X98A 3BSMA 2BASA 1ZB5A 1W2VA 1YTEA 3PZGA 1WB0A 1J0YA 3BW3A 3LG3A 3GNOA 3FA5A 3NQ2A 2J6VA 3EWBX 5IDZA 3LNMA 4WDTA 3GXIA 3WNNA 2RJGA 2OR2A 1FWEC 3C86A 5I5RA 3SEPA 4QS5A 1K1DA 4PMUA 4DPQA 4ORIA 3GNRA 1PKMA 4O1CA 1H3GA 2C15A 3QR0A 3AMDA 2Y8VA 5A8PA 2ZXAA 3ZS4A 1HTIA 3OG3A 2DZUA 3K1DA 2QUVA 5LNWA 5E9AA 4BWLC 1Q4WA 3FXYA 3KZSA 2FZDA 3WNOA 3YPIA 1MZRA 2BHUA 3GVRA 4W93A 1Z9AA 2JFEX 3OGVA 3S6TA 4S3JA 1ESWA 2JALA 1Z42A 3CK5A 3MPGA 4A3QA 4PB4A 4L64A 4JYDA 1GONA 4TMCA 2W79A 2CHRA 3LPOA 2Q8XA 3KL5A 3XISA 1F76A 2WHKA 1AVAA 4OBTA 4QLLA 2NSXA 2BVYA 5ABHA 1LYXA 4LUIA 4DJEA 4RW5A 1NQ6A 5MHBA 3QGVA 4GABA 3E49A 4M0XA 2AL1A 2BNJA 3IAQA 3S1GA 1SSDA 4ZE5A 1SUXA 5KZMA 1Q6GA 3E6EA 4BI6A 1RQHA 3L12A 3DERA 1ITUA 3B9DA 2PU0A 5HA7A 3O15A 4JL2A 3N12A 4AD2A 2CLLA 3FNDA 1QNSA 1LOSA 2Y0FA 1E4LA 3ARXA 3UBPC 4U10A 1Z32X 4WDXA 4GK8A 4MF4A 1X38A 2I56A 4GZEA 5FEXA 4GZIA 4YLWA 3CGTA 3CBWA 4N42A 2OQLA 3PHAA 1L6WA 2XFYA 1BYBA 3UG3A 3GTIA 1HUVA 2QCFA 2QPSA 4Q4RA 2NV2A 2Q71A 3MP5A 1L9WA 1AUSL 3LZ5A 5D9OA 1JZ6A 1E6SM 3MHUA 3HGOA 1ZY9A 3QW4B 2GWGA 5F2GA 1GPFA 1EUAA 2VDGA 1EJUC 1SR0A 4QM1A 4RDVA 3W6MA 4S39A 3SRDA 3RM4A 3EEGA 3TFCA 2VR5A 1EJVC 3IRSA 3L67A 4IX2A 2ZWZA 2CLOA 3ZM8A 1QVBA 3R5EA 3ZLHA 4ZB0A 1P6BA 3EA3A 4M6VA 3WQDA 3KRZA 3KP1A 3LCWA 3N19B 4XO6A 2J7GA 1HT6A 4A6GA 1H7OA 2E68A 2CLFA 4HK6A 4IIGA 2PLKA 1IYXA 3C2OA 4TX9A 3TLQA 3PWAA 2WJZA 4IIEA 3U8GA 2FGZA 3CASA 1KM5A 1QNRA 2GQ8A 3S46A 4DY1A 2Y61A 3M41A 4QS6A 2J7HA 1DIEA 3VD4A 5BCAA 4J3VA 1XFCA 2CKRA 4IPPA 1HKWA 4D6HA 1CNVA 3GU2A 2FZMA 3QHOA 2VC9A 1OABA 4GYFA 3W88A 2YDRA 1NFPA 3LSCA 4B5XA 3C3UA 3E0LA 1FTXA 1RVKA 5IXEA 1JEZA 2W66A 3E02A 1BSLA 4GJ1A 3ZWTA 2R1MA 1QW8A 1WZLA 3L0NA 4Q8QA 3VKAA 2J74A 2X0HA 1LWIA 3ZVIA 1JF5A 3W7JA 1K6WA 2BP1A 3SCOA 4NAEA 2WWCA 1NWRA 2FTWA 5CZSA 2E40A 3WQPA 1E9IA 4OU1A 4O15A 1TV3A 3TJLA 4GOAA 1XINA 1PTDA 1UW9A 4L65A 4RE0A 4XIAA 5EL1A 4JKLA 2NVDA 1TELA 4IFKB 2PBGA 3NAVA 1WZMA 1P0BA 1SZFA 4I5RA 4KEZA 4IZGA 3KHJA 1E1FA 1O6IA 4Z2LA 1DJQA 4WJ8A 4KERA 5KSWA 1LZOA 2EG6A 1D3GA 1UG6A 3VK5A 3W01A 1UD6A 2EPHA 4W7WA 3NDOA 1AJ2A 4WIWA 4S3BA 3AISA 3OLEA 4OJYA 4WR3A 4HPGA 1UC5A 3STFA 3F4VA 3ZR6A 3EB2A 5DANA 2ALRA 3MQTA 5AHMA 3KHDA 4NYUA 1ISYA 1FX6A 4MPKA 4MWAB 4L7ZA 3QHMA 4P7OA 1KCXA 1M53A 1KCZA 3I7RA 1Q6FA 3K2GA 1DWIM 2FZBA 4AHQA 3BPWA 1FRBA 3TUUA 1ODZA 2X1TA 4JCLA 2BXYA 1QNQA 2F61A 2J9ZA 2F8QA 4RNHA 1ML1A 3O63A 4KT2A 1SQ7A 3E2QA 2VT0A 1EA0A 2DT3A 2DJLA 3GSMA 1JD9A 3SCRA 3VVGA 5FEWA 2FVLA 4JTDA 4WD0A 4WF7A 1EB3A 5C2CA 3GUGA 3VXGA 2OGJA 1UP0A 1GVQA 8RUCA 1BXBA 4U31A 1U5HA 4UMBA 2TRSA 3F4CA 4B4HA 1A0CA 2H8ZA 3BCDA 5JH2A 3NZQA 4MGGA 4Y8EA 3CQJA 1GW9A 1Z89A 1OZQA 1IR1A 3GC5A 2I7GA 4N9CA 3SUVA 3U5YA 4YS1A 1CGTA 1TV4A 1ME9A 2YZRA 4HJWA 3EOLA 1YHTA 4AHPA 4PE8A 2VNCA 1O66A 4BQ3A 1DE6A 2ZVIA 1UWAA 2R1KA 2Z1KA 4MWAC 5DRIA 2Y5JA 1Y5WA 4DYKA 4UOJA 1QCWA 2L5HA 3BUVA 4N9BA 4QXIA 1ME7A 4DYEA 5I77A 3RX4A 4G1KA 1TV5A 4LANA 1QNVA 2G4JA 4UR9A 3MI6A 1K8YA 1E9YB 4O1BA 4V1XA 5K4ZA 2YZ5A 3E0VA 3EXRA 4DF0A 2W91A 1WXZA 2JBMA 1XLFA 3VIOA 3ZT6A 3WMCA 4D72A 2XU2A 3UG8A 1S5WA 3NCOA 3ZR5A 3EKGA 2VFGA 1UUQA 3W71A 2OMAA 2XFWA 2J79A 3MWAA 3NSNA 4G1NA 2ZZ1A 3BAWA 3W87A 3WBYA 2XFFA 3M44A 2QULA 3SBFA 2X1RA 1E5NA 1H7NA 3FX4A 1A50A 2ABAA 3KBMA 1ONXA 3ZOAA 4HU3A 3W7HA 3VKKA 1C7SA 2WKLA 3VX0A 3PM6A 1BSIA 1T0OA 3WSUA 1UUOA 4WKHA 3VD9A 1C91A 4PEKA 3LHZA 4QCFA 1GYNA 2DUZA 4HNNA 3DHUA 4AISA 1HJUA 2PEVA 3SGZA 2J78A 2FH8A 2Z0IA 4FPSA 1B4KA 1Z3NA 1B30A 2DVUA 4CN1A 6XIMA 3LNPA 1O12A 4F0RA 3NM1A 3GXTA 2YGYA 3MUAA 2E0PA 4ZEPA 5ENLA 3TNOA 1J79A 4NHVA 3WH9A 3W7RA 1TSIA 1W8GA 3H70A 3N11A 1UASA 4DIAA 3AQUA 1PX4A 2DZVA 4ZVJA 5D9NA 1TTJA 2CWXA 2WMIB 1XIGA 2XWDA 2OOFA 2QCNA 4IL2A 4AD1A 3CQHA 5I02A 1XDJA 2C79A 1IEXA 2SFPA 1CLVA 4M56A 1KXVA 1NDWA 3A6OA 3QTGA 4JDYA 2RDWA 3LBOA 4UXDA 4W84A 1Q85A 1GZJA 2XVKA 1OINA 4FA3A 4C91A 1PL9A 3EKLA 4AZGA 5G4EA 3S2JA 3CL7A 3Q37A 1IR2A 2NQZA 2R8WA 4LWWA 5FCZA 4GH3A 4FLSA 4HU4A 1ZBVA 4W89A 2PURA 4RDYA 5I03A 3G1SA 4R3UA 2E67A 2OOGA 3VNLA 4EXQA 2NWRA 4KQNA 2QT3A 3S1XA 4QG8A 3HMJG 1TMQA 5A6JA 4QJ4B 3SDOA 2XIIA 4PUJA 1C8YA 1UOZA 2RAGA 1FA2A 3CM4A 4LYKA 3DIPA 2VX7A 1DL3A 4DELA 4JNZA 3L4WA 1W5QA 2GUUA 4FXRA 4S3GA 5CZJA 4ZCWA 4AVNA 4MAZA 4PMNA 1V51A 5T9CE 1G1YA 4H00A 2GVYA 3IIOA 2VEFA 1NWUA 4EPDC 2DSKA 4LPCA 1WA3A 3WH8A 4FLRA 1DJHA 3WF1A 2XDFA 3SGUA 5IHSA 4PYSA 1HQTA 3BGAA 1Z48A 1T96A 4RPPA 1KV5A 4LS1A 3E0WA 1SZGA 1UJPA 5ECUA 3R8GA 1JXJA 3R0DA 2XVLA 2QXWA 1H61A 3VM5A 4DZ5A 1UA7A 1EA9C 2PLCA 2CBIA 4CQBA 1BKHA 2WPGA 4R27A 1EP1A 1XF0A 1TWSA 1VJZA 4U33A 1CGVA 3NQGA 1BRLB 3WJSA 5D2TA 4AY1A 4WK9A 1Q45A 1KQZA 1SMDA 2WWDA 4GNJA 4Z2KA 2FJKA 2HPMA 3I6TA 1TV2A 3N4AA 3LLXA 2ZRWA 3UJEA 2YOCA 2ZZ3A 3K5XA 3KRBA 4UB9A 1K03A 5DT7A 4Q4OA 1GEQA 5FJRA 4DUOA 2PWGA 4H9ZA 2CESA 1XDLA 2J47A 1NY1A 2XGIA 3UWUA 2D22A 3EEZA 2ABBA 3TW9A 5LGXA 4JR5A 3M7WA 4HBKA 4IUOA 2RUSA 4EAMA 5CAKA 1KRBC 3T0BA 4PMYA 1EPXA 1IZKA 3OQEA 1C8QA 3PPGA 1QAPA 1FWIC 1BYCA 3BG5A 3PP7A 3QKZA 2PDHA 2VX5A 4Q7IA 4HOXA 5CKSA 4DBDA 3DFNA 1CI1A 5LSMA 1C8XA 3S5SA 1W9PA 1H5VA 4N4PA 4YCPA 2VGFA 3RJXA 4PRRA 1IEQA 3W02A 5BRPA 2VUNA 2XSXA 3MYPA 2GQ9A 3C2RA 4RJEA 3FGCA 3L4XA 2AL2B 4N0RA 1A53A 3PZNA 2B4GA 3GDLA 4GQ0A 4PCPA 5CPNA 3KCJA 4NP7A 3IUIA 3P8JA 3ZVHA 4BEUA 2X2GA 8XIMA 2GDQA 5FF7A 1VH7A 5D32A 1K9TA 3MSGA 1I4NA 2HISA 4M19A 1M3UA 2ZUUA 4LXFA 4Z1YA 3N13A 3NZ1A 5C6MA 2PDPA 4I7VA 3UG4A 1TJPA 3QLLA 2PDLA 4O8AA 1XSIA 7CGTA 1IWPA 1P1MA 2F2HA 3ES7A 5JVLA 2J7CA 4KS0A 3L4ZA 4IIDA 3NPUA 3FA4A 2VI0A 1OEPA 4E4FA 1EDGA 1J01A 1MW0A 4IGHA 4YJ5A 2A7RA 3UJRA 1D3HA 3W82A 3S5NA 4UQ9A 1JPIA 4W5UA 4ZFCA 1QO5A 1CCWB 2WVVA 3FVMA 2HRWA 3MKKA 4B5WA 3U7VA 3VGBA 4GY1A 3GM8A 1K9DA 2OO0A 4HU8A 3GO2A 5D8WA 3UF9A 3UVIA 1KWKA 3GLCA 4A3HA 1Q6QA 2HNHA 1N82A 4U28A 3SAZA 4LQ1A 3QYQA 1VCGA 1YNYA 3GNPA 4FI4A 2OPJA 3RUBL 4HHPA 5GPRA 1KKOA 2DU2A 3PFMA 4NZFA 3TYEA 3QH2A 1WE5A 3BG3A 3CWOX 4MYAA 2X41A 3C2YA 3GH7A 4B5UA 3DX5A 2E4TA 3PPCA 4KWWA 3GBEA 2W5FA 1GQLA 1PE1A 4KBXA 1ZAHA 1Z6KA 1GOWA 4ORMA 3V4BA 1YE6A 2PDJA 2ON3A 3P74A 1EDTA 1ZAIA 3CPRA 1SFSA 3QR3A 3C52A 4JDBA 1P7TB 1O5QA 2V0TA 3DG6A 5U4NA 1IWBA 2B7OA 2ISVA 3PBWA 1JF6A 1VPYA 3IIVA 3URQA 1U1JA 3SADA 1RD5A 4WOQA 4UQEA 1LQAA 5KTLA 4HYWA 3W7OA 4TUFA 3FSUA 2PD9A 4LYRA 3U7BA 3UXDA 4X60A 5HPOA 5DCDA 4H8HA 3UWWA 4XWUA 3N73A 3ANYA 1A0DA 1GCYA 3PNZA 2BFGA 1F9CA 3BGGA 4MMWA 1W91A 3NQMA 4MOZA 1A5OC 1V5XA 3KXQA 1OFDA 3M0MA 1AH0A 4PUMA 2BTMA 3QMRA 1F3EA 2PP3A 2BWGA 1RLDA 2PRHA 2E77A 3BO9A 4K1WA 2OB3A 4JTTA 4JNYA 1VFSA 3UYCA 4GYJA 4TVCA 4E2OA 1K8XA 2QJJA 1DPMA 1PBGA 1VD6A 2YYUA 3LHTA 2ZRUA 4HYVA 5CAHA 4XG1A 1V08A 5J5DA 3HF3A 2QCDA 4C5YA 2GVLA 3GU9A 4PL2A 4UQCA 3LA4A 2QGYA 4UNKA 1PTGA 4ROQA 4IIHA 3QPEA 4W7UA 2PB1A 4CNTA 1G0CA 2JE8A 4D6GA 3CAVA 5EU9A 2PDQA 3D3AA 4D1JA 3W6YA 1ZNNA 5HNTA 4J3TA 2KAUC 3R7MA 1VIZA 1W3HA 3VYLA 3GXPA 3W7PA 1XIDA 4HA0A 1WBJA 1NFGA 4QEHA 5I3HA 2O4MA 4HNUA 4IM4A 3TSBA 5AYZA 5FL0A 3CMFA 2NZLA 3WK3A 4NRSA 2G5WA 2ZKMX 1YBQA 3UNTA 3L65A 1U22A 4Q8TA 2YR1A 4UQDA 1BHGA 1PIFA 1SGJA 1PTAA 4GVIA 4FXJA 1POKA 1V3IA 4DWSA 1GQIA 3AXHA 4CD6A 3GG7A 1UB3A 1RJPA 5C2XA 1K7FA 3L23A 4KIRA 1YPIA 5EGRA 3N2OA 1H0IA 3W0KA 4JCMA 3TC3A 3ALFA 4AZ5A 4PCFA 2OEMA 3D6NA 1ECQA 3QC0A 5EMJA 3W25A 3VOFA 1RJRA 3TAKA 3CV6A 1LLWA 2YFOA 2DIEA 4D9PA 4PMVA 1XICA 3SFKA 4MY1A 3R4IA 5ABFA 4J2MA 1QI0A 2FB2A 1QT1A 1M6JA 2YCLB 1WDPA 3B8WA 4TVUA 4GGHA 4JS3A 5MF5A 4GNVA 2V2CA 4N4QA 4XSLA 1H50A 3T40A 5G4WA 4JEQA 5LIXX 4XVDA 1US3A 5AVNA 3S2LA 2ZUTA 3R10A 1BEUA 4LAUA 3GU1A 1JPHA 1E1CA 5FJJA 3B9OA 3MUIA 5FJPA 2INZA 3BAKA 1OYAA 2WV8A 1D8CA 4K2SA 1G4EA 4B3ZA 6CGTA 1EGVA 4WY0A 5DFAA 4I6VA 3W7GA 3S2NA 4UTLA 5MKGA 4U5KA 1T7LA 2PUZA 1PS9A 1Y5VA 1FWAC 5I06A 1WZKA 1MWOA 4ECLA 4KPLA 2HWGA 1VFMA 5A94A 2FPTA 1PIGA 3SUSA 4HPXA 1QJWA 3CH0A 4UR7A 3S1VA 2VEGA 4WLCA 5CLWA 3C8NA 3TYAA 4GFIA 2R6OA 5FF4A 1ITQA 3WQGA 3LCIA 1BLIA 3M0VA 5I00A 4IOTA 3STCA 4JHOA 4PMOA 1KXHA 3S0CA 3PUDA 4G8TA 3AYRA 1SFJA 4HSHA 4O8RA 1WXJA 2E9BA 2X8RA 4MWAD 2GJXA 3IJLA 4E8DA 1AQ0A 3VILA 4PZVA 5T91A 3WQ6A 3HQPA 3TTSA 4J3WA 4O0QA 1M41A 3W70A 3N34A 3NGFA 1EC9A 4NJHA 3NQDA 6REQA 2BY0A 2HS6A 4DJFC 3I7QA 3RU6A 5HUOA 3WK1A 1RCQA 4F40A 2P3EA 2XZ7A 2ZZ5A 1LM1A 4ZO6A 4LS0A 3B40A 2QHAA 1R3YA 3UZXA 3DKLA 1Z44A 4GJJA 4HCLA 1LUCA 1Q6RA 1OGSA 4YWIA 4LF2A 5C9WA 1WDDA 3CO4A 3PY2A 5TAOA 1TVNA 3WLNA 3M46A 4LRSA 1JCXA 1PZ2A 3TMLA 4Q6JA 4WJEA 1J11A 3GIQA 3PWGA 4GO9A 2E9LA 2YBTA 3M0IA 2C0AA 4M3PA 1I1XA 4PUUA 3I7SA 1HN1A 3FS2A 4L4OA 4RE3A 4UNIA 1UA3A 2ZUVA 2EG8A 3K13A 4LU0A 1AZ2A 1TPUA 2DT1A 3W86A 5A6KA 3KAOA 4NKCA 3OBKA 5C9RA 3MUXA 3T8LA 5DXXA 5KETA 2YA0A 1WDRA 5IRPA 1W3LA 3N2TA 3G22A 4OQVA 3DYMA 2GGIA 3V1PA 4ZSUA 2HMCA 5I23A 1VF8A 3CC1A 1J6PA 2QCEA 3UETA 1CBGA 3QOMA 4R5EA 2PGRA 3G1RA 1SFLA 1X39A 4GYKA 4MFEA 3U48A 2PDMA 2Z1XA 4EE9A 4FK9A 3TXVA 4MWAE 3RM8A 3QV9A 2XH4A 3W2KA 1W32A 1OM0A 3P3BA 3CMJA 4JTLA 1QPKA 4NZCA 1OF6A 3AJXA 4H9VA 4JTJA 3SCVA 3N9KA 1WAWA 3ZLFA 2WZMA 1K70A 5KZEA 3MO7A 5HMFA 5BXSA 4FOJA 4LH8A 4QFUA 4X2PA 3CB3A 1TQJA 4U2YA 2ZZ4A 3MA8A 1EYEA 5HPCA 5TD4A 2F38A 1JULA 1A4LA 1H09A 1EJSC 1EBGA 1MQPA 4D1IA 1UD4A 5I3IA 4L6HA 4YTRA 2RDUA 1XD1A 2FZ8A 1KQYA 1XIIA 1UZ4A 4CCDA 2A7NA 4GZJA 3MKCA 3IPWA 2V81A 2C6QA 1GHSA 4ERAA 3CAWA 1A5BA 1GHRA 1GNXA 4WSKA 2X05A 2EHHA 2FMOA 3UCCA 3ABZA 3EOEA 2JQXA 4QEEA 5I24A 2ZZ6A 1JR1A 1W3NA 4CD4A 2CLPA 3BH4A 2WVTA 3C8FA 3E2RA 3ELFA 3UYIA 3MYOA 1MDRA 4XZMX 4JEJA 1HJSA 4DI8A 4DQWA 1YDVA 4UZUA 3W73A 1W5PA 4EXBA 4L4PA 3IGUA 4DEFA 1E6PA 4K1GA 1DWFM 5A3HA 2C71A 1TV7A 2C14A 4HNVA 4O0ZA 5EMKA 3IJ6A 3PG9A 1E6QM 3QTPA 2G97A 4L5ZA 2QAPA 4F9JA 3G1AA 3FFSA 3WIJA 5EBAA 3R25A 3M0KA 1E72M 5E09A 3AHXA 1EWDA 1R7AA 3PF3A 1BXNA 5G4HC 3VC6A 1GKPA 4A35A 3ITTA 2GWNA 3ARTA 4GJIA 4Y96A 3URNA 2H9AB 2B7NA 4IWWA 2PDUA 3RX2A 3H54A 2PDXA 4A3YA 1OSEA 4J27A 3FXGA 1IEIA 3AFBA 3N6HA 4ACZA 3BVJA 4D6FA 3Q4DA 4TX8A 4A29A 1AQMA 3W7KA 3UERA 3H2NA 4MLJA 2P50A 2J8GA 1DVJA 3EX6A 4CU6A 3TW7A 1C9DA 2OEJA 2VWTA 3F2CA 1EC8A 1J0JA 5DQPA 3QFEA 1K9FA 2OZ3A 4LUSA 4FR6A 3CHFA 3AHTA 3PJWA 3WJXA 1XRVA 3DECA 4O53A 3TLLA 4C6JA 3U57A 3NL3A 4E4UA 5D05A 2C19A 1QI5A 2GJLA 2JEPA 3QQWA 5GQBA 1UWIA 3GFXA 4JOMA 4X2RA 4NF7A 4M29A 2WLYA 4KGJA 3A9BA 1A47A 4US5D 3RR4A 3NQBA 1A5SA 3S6DA 2A4AA 1CGUA 4MJ4A 1BF6A 1SM9A 3UT0A 4BKNA 3F4NA 3WF0A 3ENLA 3VZZA 1KGUA 1XH1A 1L0PA 1AD1A 2GYIA 5FD0A 3RYSA 2FHBA 1F74A 3G18A 4MIMA 3NYDA 1OADA 3DYPA 2Y5SA 4LY4A 3SURA 3Q58A 4G56A 5DLCA 2VOTA 4FF5A 3W1LA 4JIIX 2WW5A 4UTJA 5F4SA 5DY2A 1UR4A 4WJXA 1JCLA 3QLDA 2Y7DA 3HG4A 2IQDA 3BLEA 1IEWA 5A6BA 1P0NA 2W67A 1Q7MA 3EXTA 3BOLA 4HK7A 3E5BA 3WLSA 4LCRA 2VC6A 3H2FA 4OIFA 1R2SA 4PTNA 3N3MA 4WHBA 4HA3A 1RBAA 3CIXA 4DXXA 5D2YA 1S2TA 3T08A 4Z2HA 3M5YA 1VLIA 1XYMA 1PIIA 4AG0A 2E6YA 1RV8A 3NL2A 1PZ1A 4GGBA 1HP5A 2DZSA 4QSHA 5M03A 4ZOCA 1WKYA 1V6XA 4P8UA 4JD4A 4AW7A 4DPPA 1RP8A 4UOZA 4JYEA 2R1PA 1W3TA 2EPOA 2XGZA 1C7TA 3HGRA 1VC4A 1L6GA 3KUMA 1V0KA 4H6RA 1WDQA 4L1XA 3HURA 3KS5A 3AMCA 2VEMA 1XQKA 2CZ5A 3KL3A 3TDFA 1R46A 4GUHA 3UXAA 3T0CA 1OD0A 4B92A 2VR4A 4Q8NA 1Q63A 1RHCA 1XH2A 3EZ4A 4QJ5B 1DXIA 2A3LA 4X63A 3NSMA 1F6YA 3B4YA 1TJ2A 3WN6A 3I3DA 4CD8A 3ZMRA 1AA1B 2H90A 3W1TA 1FH7A 3A13A 5HK4A 5JUVA 1IV8A 2QDEA 3W72A 3KBWA 2HXTA 4N02A 2QJIA 3C56A 2Y4SA 2YW3A 4ONVA 3BXWA 2O55A 7TAAA 3TEVA 2E8YA 3M43A 1J0IA 2E8ZA 4CD7A 4BF9A 3HU7A 2GVEA 4AY7A 3FY1A 1IWAA 2V9DA 5CPLA 4IX0A 4FLOA 2CITA 1C93A 3P82A 2C18A 5CPMA 3R13A 5M5DA 1S46A 5CGMA 4WVXA 4HCHA 2XZ9A 1NP0A 2E1DA 4I8DA 4AYGA 5FEPA 3E96A 3GAYA 1XYAA 3SUUA 2ZX6A 3PJUA 3QMTA 4QHRA 2EGZA 1XYCA 2LLEA 3ARRA 1ADOA 2DT0A 2YKKA 2ZUWA 3FEMA 1SW7A 2RGLA 3KWXA 3NO5A 2PI6A 2BG5A 1E71M 1NOWA 3WMBA 4Y6GA 2JK2A 1TUXA 4WY0F 4GE8A 3LXAA 1JDCA 1MEHA 2WSYA 1K4HA 3DENA 1F2JA 3U2EA 2PTWA 4WDUA 2QMJA 2R94A 4RNJA 3WBXA 3CU2A 4YNGA 1A4MA 2OODA 3I3BA 4ZR8A 5E6ZA 4AHOA 3S8HA 3WLJA 5GJNA 2WCAA 1YRRA 5E0FA 1GOMA 3MHFA 4LAOA 2VFEA 5LA2A 4BZYA 1JD7A 5JMUA 3CS2A 2F7FA 2WJDA 1EXPA 4NX0A 4ZENA 1LRNA 1HO1A 2J88A 1RR2A 4PMZA 1XLHA 2YFNA 3SN1A 1GUVA 1XBVA 3GG8A 3HZ3A 1LF1A 3M9YA 3P61A 1JGIA 4NXSA 1TB3A 4QQ3A 1FHVA 3EB4A 4LB3A 3LXBA 4HMCA 3GDRA 3UFYA 3VNIA 3G0UA 1FFRA 1XYZA 2RH9A 3WJWA 5PTDA 3ZT5A 3P2VA 1IE7C 1NJJA 4Z1CA 1NH6A 4IG2B 5C8BB 3NO1A 2INEA 4EANA 4EPEC 4V28A 1U5VA 3W27A 2XH7A 3D0CA 2Y70A 2O9PA 4UTWA 4ZQOA 5D2XA 1ZJAA 3S2CA 1M68A 3DC0A 3L68A 1YEYA 5CSUA 4BF5A 4JTIA 3WG6A 1OIFA 3OA5A 3H2CA 4FX6M 3WLLA 3SQSA 1WUEA 3ONBA 3RCMA 1V6TA 1SZNA 5I3GA 4N7QA 3TV8A 3KTCA 5E9XA 1V77A 2RGMA 3SM0A 2Z26A 3VKDA 3UPBA 4W88A 3ZSTA 1TMLA 3WD1A 3WNMA 2CZVA 2YL9A 1K4GA 2ATMA 3WUGA 1QW9A 1HNYA 2WCGA 2W0UA 3QSTA 4F0MA 1VBJA 3S4TA 4CD5A 1HKMA 3P84A 2GSJA 1HGWA 3HFTA 3LS9A 3GDTA 3OW1A 3CYVA 1VFUA 4I9TA 1OWQA 2BMBA 3W2LA 4Z42C 3L7RA 3M0LA 1BPLB 2VRKA 1KFEA 2V30A 3OO2A 4TO8A 1VQTA 1F8IA 3R58A 3B97A 2KX9A 4Q4KA 3WLHA 2OZ0A 2WHJA 5ABTA 3UVAA 2EPLX 1DJZA 4JTKA 4HMDA 3AUOA 2VD8A 7A3HA 2Y5EA 4EOUA 4IXHA 4MADA 1FWHC 4CVUA 2YSWA 3CLWA 3OA3A 2GJPA 2VZTA 2DZPA 1XISA 2ZBTA 4FAMA 1M01A 4DJDA 1MYRA 4TTGA 1SR9A 1VBUA 3BOFA 4UTIA 3F7JA 4Z0SA 3VZXA 3G8EA 3BLOA 1QTWA 1VEPA 1PHQA 3II1A 4IFKA 4A21A 3PSWA 4LBUA 4PSRA 1B57A 2QF7A 2BX7A 2WOQA 3UGRA 3P0WA 2YXOA 3VIFA 4Y9OA 4W86A 3PBUA 3OGSA 1GYMA 3QKEA 3WLPA 1AMYA 1GVIA 4DJFD 4QE4A 4CNOA 1PDZA 3BLPX 4HZMA 3MU7A 1R3VA 1YNPA 3TYZA 1JFXA 1HJQA 1FFQA 1T5AA 1HKKA 4UMCA 1BWVA 1ZP4A 4BHYA 4AY8A 3U5UA 3NR0A 3ARYA 3BW4A 5I79A 3WELA 3MBDA 4YWSA 3VNDA 2NWSA 1KBLA 2BZNA 5H2ZA 5H1WA 4ZQCA 1EKOA 4RCXA 5D2VA 1XG4A 1JAKA 2ATSA 2JIWA 4WRHA 5FSEC 4NZ3A 2A1YA 4W8LA 1ICQA 2IPWA 3AZTA 1ZTVA 1F7BA 3HTWA 3FAXA 1VCVA 1RQBA 2O92A 1PB0A 2DQWA 1QWGA 3OJGA 5K7JA 4D6JA 1TQXA 1AJ0A 3R11A 4XZIA 4NAFB 2B81A 3M0HA 5SWUA 1DEDA 1RJQA 2HROA 1EO7A 2FKPA 3KM8A 3O07A 2W3ZA 3BW2A 2G8ZA 1CECA 1V02A 1UD8A 3V7PA 1YXDA 4OV4A 1GJPA 2DJXA 1Q13A 3EYPA 1F8MA 3C4UA 3LHUA 4CNSA 5D38A 2QJGA 1R7OA 3JR2A 4O54A 3EGJA 1AK5A 2QCMA 4QROA 2P0IA 3EXSA 2O56A 4F8XA 3S83A 2ZYFA 1VENA 3QN3A 1FHUA 5DMMA 2C16A 3W4RA 2J75A 5DCEA 3LERA 1ZCCA 4PL1A 2IMRA 4TR9A 3PUGA 4IGMA 2NSOA 3N04A 1W3IA 3QV8A 2P8BA 4K8EA 2X7WA 2X09A 7PTDA 1BWKA 4ENLA 2VQTA 3OVGA 2PMQA 3SRHA 1THFD 4HK5A 4ZBCA 2I17A 3ITXA 2X40A 4DM2A 1S1RA 4HSNA 2V5BA 1J18A 1DWJM 3LYEA 2IUZA 3SQLA 4C65A 1KM4A 2XISA 4MY9A 4IPNB 4MKSA 3ZZ1A 4PUWA 3B4UA 3T2PA 4AIOA 4QE1A 2VC7A 4R9XA 5C70A 4UFJA 3QJAA 2ISWA 3P67A 1JJKA 4WEVX 4CGTA 1XGDA 4MNLA 4J1OA 4XZBA 5JXQA 1U5JA 4U3AA 2EQDA 5CPSA 2ACQA 3QZEA 1I60A 1NQKA 4N9EA 4IMAA 3LI0A 4RXGA 4K37A 5HNNA 1ZCOA 3CUHA 4E8CA 3DGBA 2Q3RA 3BICA 4B9ZA 3T4WA 2PP1A 5A2BA 1G6CA 4KRZA 4WKAA 3