1O5RA

Crystal structure of adenosine deaminase complexed with a potent inhibitor
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title Structure-based design, synthesis, and structure-activity relationship studies of novel non-nucleoside adenosine deaminase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 140
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1o5rA00
1R9YA 4TQTA 2Z2BA 1WXYA 3B0YA 3N2CA 4GYFA 2GWNA 4H9MA 1YRRA 3NEHA 1WXZA 4EPKA 3IPWA 1YIXA 2VC5A 4H9VA 4C6JA 4ZSUA 4DZHA 3OVGA 1EJVC 2R1NA 1ITUA 3F2BA 1XGEA 1FWAC 4OFCA 1R9XA 4BY3A 3PNUA 1PTAA 3K2GA 2Z27A 2Z00A 3CJPA 1UIPA 4CNSA 4D8LA 1KRAC 4UBPC 2UBPC 4LAKA 1EJSC 2PGRA 3OODA 3DC8A 4C6NA 3AU2A 3A4JA 4KETA 3O7UA 3ICJA 3ORWA 1P1MA 3QY7A 4NG3A 2UZ9A 4HA0A 4IG2A 3TN3A 4C6MA 2Y1HA 2R1MA 4XAFA 4J2MA 1M65A 3S2MA 4XD3A 1J6PA 4CEXC 3RYSA 4PE8A 3GU1A 4V1XA 4G7EB 2I9UA 4I6VA 4C6EA 4XAZA 2EG7A 2GOKA 4H9UA 1R9ZA 2A3LA 2O4QA 2E25A 3HTWA 5HMFA 1W1IE 4H9TA 1RJPA 4LAMA 2FFIA 1FKWA 3UBPC 4C6KA 1FWDC 1ADDA 4LANA 3A3XA 1RA5A 4GBDA 1XWYA 4R7WA 2FVMA 4H9XA 2G3FA 3MVTA 3OQEA 5FSDC 4G7EA 3AU6A 4RDZA 4C6OA 2FTWA 3T81A 4DIAA 3SO7A 3MVIA 4H01A 2CZVA 4ERAA 3LY0A 3K5XA 2VR2A 4H00A 4J35A 1K1DA 1ONXA 4INFA 1A5MC 1A5NC 2GWGA 2Z25A 2ICSA 3S2JA 1I0BA 1K70A 1K6WA 2Z29A 4QRNA 4XD6A 3MSRA 3CS2A 3PAOA 4KF1A 3C86A 4F0SA 1E9ZB 4GXWA 2VM8A 4GK8A 3F2DA 4IGNA 3MJMA 3LA4A 1FWHC 3GU9A 3UR2A 2WM1A 1M7JA 2O4MA 2WJDA 4GOAA 4CQCA 2IMRA 1UIOA 3RN6A 1GKPA 1J5SA 1RK5A 3URAA 3OJGA 5A6TC 2QS8A 4HJWA 3URBA 3GTFA 3B0XA 3GTHA 1HZYA 1M68A 1EJXC 4F0RA 3GIPA 2P53A 2VUNA 3EGJA 3ID7A 3IV8A 4M51A 4B90A 2BB0A 4UB9A 3KM8A 2OB3A 4IG2B 4ZSTA 3F4CA 3IARA 3QY6A 5E5CA 3WZ0E 2FTYA 3O0FA 4H9YA 4GX9A 4KEZA 4DLFA 4GY7A 1A5LC 2QVNA 2Z24A 4WGXA 1O12A 4C6DA 3K4WA 4CNTA 1NDYA 4WHBA 1V77A 3FDGA 4EPDC 2PLMA 1KRCC 2HPIA 4YIWA 1VFLA 2HBXA 4DI8A 2DVXA 4KESA 4C6IA 1V7AA 2YXOA 4MUPA 1QW7A 4I6KA 4CQDA 3GU2A 3S2LA 2WJFA 4RE0A 2VHLA 2FVKA 1J6OA 3S2NA 4E3TA 2XIOA 4RDVA 2PGFA 4AC7C 2I5GA 3MPGA 5FSEC 2GSEA 2HNHA 3IACA 4R88A 1RA0A 3MDWA 1UMLA 3QY8A 3TNBA 1EJWC 1FWEC 2R1PA 1NDZA 1FWFC 4V1YA 1DPMA 4GY0A 4C5YA 2DVTA 4EPEC 1A5KC 4GY1A 3ITCA 4DYKA 1I0DA 3S4TA 3PBMA 3UR5A 4KQNA 3CAKA 4RZBA 4HK6A 1KRBC 2AQOA 3G77A 5CH9A 1RJRA 2Z4GA 4GC3A 4ERGA 4WVXA 3IRSA 2Q01A 3SFWA 4NI8A 1S3TC 4P5UA 1NDVA 3URQA 4DO7A 2D2JA 4PBFA 4C6FA 3LGGA 4C5ZA 2QT3A 4QSFA 3LSBA 4ERIA 4B92A 3D6NA 2ADAA 3EWDA 3GUWA 5HMEA 4F0LA 3OOQA 4JOMA 3RCMA 2Q09A 4BKNA 3GIQA 3R0DA 3T1GA 4EPBC 2HPMA 3DUGA 1NFGA 4Z42C 3E3HA 3TN5A 1FWBC 2Z26A 4KERA 3B40A 4CEUC 4XD4A 3UF9A 1ITQA 3LNPA 1V51A 3QGAC 3GTXA 1J79A 4PCPA 2ANUA 3HM7A 3LSCA 3UPMA 3LGDA 3FEQA 4QROA 4IH3A 2PUZA 4GZ7A 4XD5A 1RK6A 1NDWA 1GKQA 3F4DA 3V7PA 4LCSA 4G2DA 2Z28A 2EG8A 2AMXA 4IGMA 4RDYA 3QGKC 3RHGA 1A4LA 4KIRA 3E0FA 4C6BA 1YBQA 3F2CA 2KAUC 4C6CA 3HPAA 4DNMA 2BGNE 3DCPA 1PB0A 4BJHA 5LXXA 1FWGC 2F6KA 3T8LA 3TN6A 4IQJA 5AKQA 2R1KA 1YMYA 4KEUA 4PBEA 2ZC1A 3NQBA 4C6LA 1EJRC 1IE7C 2YB4A 1V79A 1FKXA 1POJA 1EJTC 1UBPC 1PO9A 2YB1A 3E2VA 2R1LA 4PCNA 2HBVA 4DI9A 3URNA 1BF6A 3AUOA 4L6DA 1ZZMA 4J5NA 3PNZA 1POKA 1FWCC 2YZ5A 3GRIA 2Z2AA 3IGHX 1FWJC 4HK5A 2QPXA 3E74A 3NURA 4IFKB 3LS9A 4QS6A 2VC7A 4XAYA 4C6PA 1QXLA 4LAOA 1GKRA 2OOFA 2PAJA 2OODA 1P6BA 4QTGA 2AQVA 1EF2A 3A3WA 2W9MA 1XRTA 1E9YB 3BE7A 2OQLA 3PANA 4DLMA 5HMDA 4B3ZA 4L9XA 2OGJA 4ICMA 4LH8A 1A4MA 2D2HA 1V4YA 4IFKA 2WJEA 1FWIC 4H9ZA 4XAGA 1JGMA 3MTWA 4R85A 2Z7GA 3IJ6A 2HQAA 3E38A 3OU8A 4AQLA 2DVUA 3ISIX 1P6CA 1PSCA 4GX8A 3FDKA 2RAGA 3WMLA 1RJQA 4CQBA 1EYWA 5G4HC 3GTIA 4QS5A 1KRMA 3MDUA 4CNUA 4IFOA 1EZ2A 4HK7A 4KEVA 4B91A 2GZXA 4IF2A 1RAKA 3GG7A 4EP8C 3EWCA 3LU2A 1XRFA 3TN4A 3JZEA 1YNYA 4LALA 2D2GA 4LCRA 1O5RA 3MKVA 4LEFA 3WYZA 1ONWA 1YBQB 4LFYA 2P50A 4DZIA 1A5OC 4C60A 4C65A 1KCXA 4RDWA 3E0LA 4LCQA 2E1WA 1EJUC 2EG6A 4NP7A 4IFRA 4C6QA
chains in the Genus database with same CATH superfamily
3E0VA 4DRSA 3R12A 3W38A 2E9LA 3R4IA 1KM4A 4WUIA 4S3FA 1YRRA 2TYSA 4HYRA 4C7DA 1P43A 2PDLA 1NOWA 3OVGA 4G5DA 1BLIA 3M41A 4UTTC 1U2YA 1JPDX 3GW0A 3VIOA 2PDBA 1M5WA 2DSZA 4Y2WA 3GH4A 5AFDA 3UJRA 3UXLA 1DJGA 4GUIA 1QT1A 2WM0A 3T7VA 1Q4NX 3TN3A 2XM2A 1NWSA 2EPHA 4J2MA 5E1QA 3I10A 1R3YA 5HANA 1GK8A 3VGGA 4Q32A 4DAFA 1T0OA 2KX9A 3FNDA 4FHAA 3WF0A 5I77A 4O16A 4XBJA 1ZPTA 3MU7A 1YQ2A 1C8YA 4QEHA 4JNMA 2EG7A 4MM1A 4N0RA 1QBBA 3TNOA 3L4XA 1WDDA 2PWDA 4DYJA 1EP1A 4I3GA 4MDPA 4F9DA 1XWYA 3LXBA 3B04A 1UC4A 3SGUA 5FJJA 3SO7A 3DFHA 1OG0A 2XSAA 3EB2A 3LPOA 4H00A 4XIAA 1DJHA 4INFA 1XYCA 4YVPA 3C86A 1R3TA 1J9YA 3WEOA 3QKEA 4WJXA 4JBRA 5EB8A 2O9TA 2PD5A 2YXXA 1QPRA 4BA0A 2UY3A 4FLQA 4M7SA 4V27A 4B5XA 2WMHA 4GOAA 4J3XA 5I00A 1XLDA 3BMWA 3WIJA 2P0OA 2WSRA 1LWHA 2EJ1A 1JZ3A 4W8LA 5LZLA 3CNYA 1M03A 3WQ8A 3S83A 1FA2A 3CZLA 1B1YA 3CXOA 4DWSA 3ITOA 4FX7A 3BSHA 2BHZA 1XD0A 3N9SA 1S5VA 4O4WA 3NQDA 1OT2A 5FEPA 1Q7QA 3VZXA 4GX9A 5D32A 2NQJA 2WHMA 1TIMA 2YFOA 1VJIA 4R9XA 4UQAA 4GQGA 4S2BA 2AQWA 4US5D 4C1NA 4EPDC 1I1WA 4NAFA 1AMKA 3T0TA 4LBSA 4S39A 4KESA 4DF1A 3BOFA 1JR1A 1V3JA 1QW7A 5A6JA 3PBUA 5M3WA 4CQDA 3S2NA 3MA8A 4Y9MA 4RDVA 3BH4A 3W2LA 2WC3A 3WQGA 1UCWA 4YTRA 4CVWA 5K9XA 5DY2A 3I3BA 2DPEA 3CHFA 3QV7A 2DU2A 1HGYA 1LL7A 1S2UA 1DIOA 1KFKA 2EPLX 2UY2A 5F1VA 4E2OA 1GQIA 1IWPA 1RP8A 2I5IA 1O1ZA 5D2XA 2A85A 2TAAA 3CT2A 3NZ1A 3CAWA 1A5KC 3VNMA 1FWSA 1VBHA 3TV8A 1ME9A 3N2TA 4GRSA 1ADSA 3ALGA 4UCFA 3EKZA 2Y62A 3V3WA 1X38A 5FOOA 3IRSA 5CSYA 1ZSXA 1MXGA 1W31A 2GVLA 1O60A 2RGMA 3LGGA 7TIMA 3W70A 4FP1A 4S3CA 3H55A 1FUYA 2YA1A 2QR6A 3ANVA 1QDSA 1U30A 4WX2A 3AMKA 3TJ4A 6XIMA 5C8BB 3TR9A 1L6WA 1PX4A 1XUUA 3OHIA 4PUJA 1GPWA 3VDHA 4Z2KA 1A0CA 3VIHA 3UXDA 1JUEA 1XINA 1J79A 3H4GA 4AWUA 3LSCA 1NF7A 3NG3A 3M0KA 5D05A 3NUKA 4X2PA 1EB3A 1GKQA 1IXNA 1C8QA 2VZVA 2Z28A 3ZJ8A 3WLKX 4RDYA 4TX9A 4A35A 3O3RA 1PZ2A 5IHSA 3B4YA 1XKJA 1AW1A 3ABXA 3SDOA 4C6CA 4K6AA 4MOZA 3KFTA 4HPHA 2B7PA 2CESA 3QOKA 3IIOA 4KPLA 1CGTA 5AVHA 1QW8A 2VXNA 3E2VA 1E6QM 4DM2A 3IJLA 3UWWA 1OC6A 2XH4A 1V0MA 2QPXA 4L4PA 5LKYA 3CT7A 2X1RA 4LAOA 3V0UA 1GKRA 3O16A 3ZVIA 2AQVA 4IGSA 3CHVA 1O1HA 3SUSA 3IEBA 1TCDA 3AJXA 3LZ5A 4O4VA 4U31A 1OFDA 4R34A 4E3VA 3QRHA 2D2HA 1Q13A 4G56A 2MNRA 3A22A 2GQ3A 3GFZA 1ADOA 1LM1A 4N42A 3SUTA 3SIZA 4D8AA 3BVJA 2E5CA 4ORMA 4MUZA 4IXXA 1BGGA 4ZTYA 2Y8VA 1AFSA 4AZCB 3GBEA 1MDLA 5GJMA 2DUXA 4A6GA 4I8YA 4CU7A 3UCCA 3W7KA 3LCHA 3LX9A 4KH2A 4XB3A 1XC4A 5DT7A 3MB9A 1B3XA 4CQAA 3GAYA 2BVTA 3MZ2A 3QMSA 5G1TA 1UR0A 1C7SA 4RKAA 5F2IA 3LNMA 1YBQB 1X6NA 4LC6A 3U4FA 4HA4A 6ENLA 4GGBA 2ZX9A 2W27A 4PTNA 1DTUA 5TQLA 1JF5A 3WELA 2WMIB 4AF0A 2H8ZA 4JCMA 4NJKA 3CWOX 1E72M 2PBOA 4IFRA 3RLUA 3W7OA 4Q8TA 2X1IA 3IJIA 4TQTA 1TQXA 3SN4A 4Z2LA 3BG9A 3SUVA 5I3JA 2VC5A 2VQUA 3R58A 2PE4A 4W93A 3E2SA 4B16A 1GW1A 4OFCA 3OZYA 1PS9A 3N4AA 1XJBA 3ANYA 1CW2A 1ECQA 5KTLA 1V02A 3NSXA 1MQPA 2FMOA 9XIAA 2IKGA 3QHNA 4LUSB 4LAKA 1NP2A 1ZAIA 2A3EA 3UCDA 4RZ5A 4WKFA 2HEJA 2OVLA 3O7UA 3PY2A 1P0DA 3WQ6A 5J8LA 4Y90A 2Y1HA 3VMNA 3EDFA 3S2MA 5ABEA 5A6BD 5M2FX 1J10A 3CMJA 3LM3A 4O10A 4NZJA 2QCFA 1A0DA 1J01A 2I9UA 4BI6A 2ZUUA 4NJHA 1XYAA 3N11A 2FMNA 4IMCA 4AZBA 3G1RA 1WX0A 1GHSA 3N6JA 1ADDA 2AL1A 4RZ6A 3BCFA 3O06A 4JKMA 2HROA 1K03A 4UZSA 3TTEA 5KETA 1UD3A 2VCBA 4G7EA 4DIAA 5D8WA 3WBAA 2XN0A 5FF0A 3HJZA 3T07A 3GNDA 3CUGA 5AHIA 3MI3A 3O2LA 4DBUA 5I3HA 4OTKA 4HCLA 4AIEA 5HPCA 2OZ8A 3L2IA 1H49A 2QVHA 5CGTA 4JFVA 3AUJA 1R7OA 1GVOA 4LT9A 1KM3A 2PDNA 2WK2A 2IMRA 3R6IA 2EPMX 3N04A 3PSVA 4PUUA 5A6TC 5DLCA 1HZYA 2NX9A 4IMEA 2QCNA 4L6HA 3N6HA 1UQZA 4ZL1A 4MADA 1XBVA 1T6MA 4ZSTA 3CHEA 3AALA 4NL1A 3O0FA 3P6LA 2CITA 2XH7A 3O6YX 1E4LA 1KR0A 2Z24A 1ZP4A 1SW7A 1QUMA 4CD6A 2HS6A 2EPOA 8A3HA 1PTGA 3BLPX 4EOUA 4QCFA 2FYMA 2PP3A 1WPCA 2V3GA 3MUAA 2BODX 2OR2A 1RSCA 3R8RA 2I5GA 1WE5A 2GSEA 7PTDA 2WANA 3CV2A 5HUPA 3FHAA 1UP2A 3P60A 3VI2A 2IXVA 5HPOA 5LNWA 3TVAA 1CENA 4B3LA 3N2XA 4L4MA 3CH0A 3TSBA 4K2SA 4UTJA 5L9FA 1YTEA 4GZEA 3JZUA 4GVGA 3WH5A 2A3BA 4GC4A 1MRQA 4ZQRA 1LORA 4KCUA 1VH7A 3W7QA 4DF2A 3ITTA 1YPIA 4QJ4B 3UZWA 3I6TA 3OBEA 2JGQA 4QCEA 1UHVA 4E5TA 3UPWA 4Z0JA 4DJEA 3PP7A 5T26A 5BNKA 3G3DA 1EZWA 2JQXA 4RZBA 1TWDA 3FK4A 2V5JA 4AEFA 2RUSA 3L2LA 3SRFA 1Q45A 2Z4GA 3KWSA 5C0QA 2PZ0A 4JPGA 3S0CA 3PG9A 4L61A 4LB3A 4PBFA 3GNNA 4C5ZA 4J3SA 4Q7IA 3TTYA 5A5WA 1EL3A 4QGCA 1O5KA 1W3JA 2IPJA 2ASHA 1PBGA 1RBLA 3ELFA 4NHVA 3LGEA 1IYXA 3BZJA 4P7LA 1BSLA 1QI4A 4GYKA 1S5WA 3RLGA 3SR7A 3SN1A 1YEYA 3G3MA 3SECA 5CXPA 2V30A 1B4KA 2BVYA 3ARZA 4PULA 5CG0A 1ZENA 3L4WA 4DBDA 2FFCA 2WCGA 1E6ZA 4QNEA 2JF7A 5DMYA 4AY1A 1ICPA 3V7PA 1VBRA 7ODCA 3S42A 4CCDA 1W8SA 4HOWA 3QGKC 2FZNA 4O14A 1A4LA 3BCDA 1J93A 3CGTA 4BJHA 2F6KA 3JRKA 1XYZA 2PLJA 1QHPA 2FGBA 2XFFA 4UFLA 3CQKA 4M81A 2PBGA 4OGZA 1KC7A 2HVMA 2ZVRA 2X2GA 2ISDA 5KEZA 1B9BA 3WENA 4L6DA 1JI1A 3H7RA 1WZMA 1KLYA 1YPFA 2XUCA 2CLIA 1JCJA 3KE0A 3KAOA 3EOUA 3RCYA 3T6CA 2XZ9A 1L6FA 3WMCA 3B9DA 3LM7A 1K4GA 1HG3A 1QPNA 3A3WA 1XRTA 4AVOA 3SCPA 3GR8A 7ENLA 1K9FA 3YPIA 4H1ZA 4DUVA 2QULA 3GC4A 3LYEA 3UNTA 3DG7A 3NSNA 4IPPA 4IIDA 2FJUB 2INZA 4BS0A 2Z7GA 2V6AA 3AWOA 1R2SA 5G4EA 5H8MA 5FEXA 1AMYA 3FDKA 1WUFA 3T40A 4NXSA 4XZWA 3CZEA 1ZJAA 3NDYA 1DQWA 3VM5A 2Y8UA 1QNPA 4PUWA 4XVDA 2VR5A 5FI8A 4TMCA 1BYAA 2DT3A 3MWCA 1GONA 1SR9A 4QAIA 3S1XA 3GVRA 3QW4B 3NO5A 4IJBA 2C0AA 3F5KA 2J7GA 4A3RA 4NIRA 3QPYA 2HTMA 4XISA 4C60A 4D8ZA 3BLIA 2EG6A 2VRQA 4TOQA 3TYAA 2OO6A 1R6WA 2YW4A 1P48A 3B0YA 1IIHA 4Q6XA 4TIMA 4X0NA 1OHLA 5DMLA 3T78A 2QGYA 2YA2A 4UUIA 4CQ9A 2R82A 1XDMA 2VCCA 3EWZA 1EGVA 3GVWA 3OODA 3DC8A 3ATYA 1TKKA 1P0NA 1EX5A 4QAWA 4HA0A 2W66A 2DZVA 1CGUA 3B9EA 2G97A 3TC3A 2ZOXA 3P93A 3VX0A 3S1VA 3RX2A 4YS1A 5BOOA 3MYPA 3L2MA 1UUQA 2H9AA 3RYSA 2EHHA 3M64A 4V1XA 1UROA 5ABFB 2A79A 5B7YA 1HP5A 4TX8A 1Q3NA 3DHFA 1JL8A 2GVYA 1Z48A 5EFFA 2NLYA 3UBPC 4QJ3B 2XPKA 3TC7A 1Y5WA 3ERPA 1C9WA 2V2DA 4ASTA 3UFYA 1S5TA 1FWNA 1O7AA 5E9AA 4LXFA 4JY9A 2QDGA 3WY1A 1FFQA 3K5XA 3KX6A 1W3KA 1NVMA 2CW6A 3PZUA 4J3VA 1I0BA 1XG4A 3VVGA 2G8ZA 3B8VA 1UZHA 2Z2UA 4KW2A 4K8GA 1XW8A 4RX0A 1R85A 3GNXA 2C8NA 4I7WA 2Z1BA 1EPXA 4DYEA 6XIAA 4TMBA 2BMBA 1OX4B 4ACZB 2GYIA 2WJZA 1WDSA 4TX6A 4F0HA 2ABBA 4JIHA 4JYDA 3V1PA 3WL1A 4BF5A 3SJNA 2YCKX 1TZZA 1QOXA 3COTA 5KINA 4NX5A 4UQ9A 3CPRA 4M51A 4LY8A 4B90A 4ZQOA 3S5ZA 1PKYA 3LPPA 2EBNA 4E8CA 2XVGA 5GNXA 4X63A 3LDVA 3FXGA 1X39A 4JHOA 3S46A 3TYUA 4GI4A 1CI1A 3K4WA 4XTIA 1XYFA 2WSPA 3IVSA 5HQLA 3QGVA 1JGIA 1Q7MA 3TQKA 1TJRA 1TX2A 1F3EA 1XBXA 4IMFA 1EYEA 4LUTB 1OCNA 5DCEA 4X2RA 1XYLA 4BQ2A 3U2EA 3MDWA 1KGWA 4CNNA 4EE9A 2WZIA 3M16A 1QO5A 4JNZA 3CUFA 3G1VA 3QYQA 1HIZA 2Y89A 3NJ3A 4CN1A 1OABA 4BEUA 1S2TA 4MPQA 2VDHA 4WK9A 3LI1A 3W28A 5G2IA 3ZLGA 4Y96A 1W37A 1EXPA 3SW6A 3HURA 3GFYA 1KTCA 3GHRA 3VAVA 1LWIA 4U2ZA 4MNMA 2RGLA 2WPGA 5T8GA 2PDPA 3WJSA 5HBFA 1VPQA 2X30A 3VINA 3N2OA 1XRSA 3B8SA 4KIEA 2E09A 4R5EA 3C3UA 4NI8A 2F8QA 2O92A 3G1FA 5DCBA 1IXOA 2VOMA 2VZOA 4NJJA 3QSRA 4QQUA 4ADSA 3A4WA 3E6EA 2G41A 3D6NA 4F0LA 2ZXAA 3SQMA 3WD2A 2ZA2A 2J78A 2Q09A 3W7MA 1V6VA 1UOKA 5TF0A 3CPGA 1EFZA 1ODUA 2RKXA 1BF2A 4HSNA 4NZFA 1JRCA 2XFWA 1W3NA 2GJNA 2WVSA 2VFFA 4A29A 3WLTA 4FX8A 4GI6A 1KBLA 4QLLA 3FFSA 1KM6A 4WDWA 3W6MA 2FH6A 1K9EA 4XD5A 1G94A 3FKRA 4JTTA 4ROQA 1P7TB 3WD1A 3E0FA 1H0GA 3M0JA 3DBPA 5U4NA 4DO5A 2EO7A 3SSJA 1DWJM 1E1CA 4Q4RA 4F40A 2V5CA 3WMSA 2Y24A 3O6CA 1E40A 4F0MA 5RUBA 2PTXA 3TCEA 3R2GA 2HV5A 3CPUA 2YL9A 3THDA 3TJLA 3UY8A 2R9RA 4ZOCA 1LLOA 4HMDA 4RXFA 2GVEA 3NIYA 4IP4A 1H3GA 4O19A 4PCNA 3BAWA 1FWCC 2PRMA 2OZTA 4I9JA 3GZAA 5TD4A 2OEMA 3HQNA 3W7EA 4NZCA 3C3NA 3W83A 3TW9A 3H54A 3QMTA 5XIMA 5DXYA 4TR9A 1E9YB 1XIMA 3PZ9A 1QI0A 3AZSA 3B9AA 1W17A 4XKMA 4Z1CA 5ABTA 1B0IA 5LNRA 3QFEA 4ICMA 4DXKA 4LF1A 2IXUA 1LOQA 3FEMA 1EGZA 4BHYA 3S9IA 3W1NA 1JD7A 2WYSA 2PC8A 2HVNA 3ISIX 5E6ZA 4UQCA 4JFUA 2RAGA 1OGBA 3WD3A 3H2MA 2J9XA 4GH3A 2HWGA 1GG0A 4HNTA 2CC0A 1E0VA 4IQEA 4EXBA 1GQKA 4RE3A 3UG4A 1YXCA 2W4XA 1XPGA 2CZ5A 1SZNA 4WOQA 3LPFA 1B31A 1SFJA 4HHLA 2QV4A 2WHLA 1BVWA 3DGBA 1ONWA 4ICCX 3NR0A 4WOZA 1HKVA 3NO3A 4GQ0A 4RDWA 4JTUA 3E0LA 3BOLA 4O8AA 4F2BA 4NP7A 2AAMA 1U1UA 4GYPA 1HJWA 2Z2BA 3L0NA 1EPVA 3PG8A 1F76A 1ZAHA 2R6OA 3SCTA 2FPTA 4AZGA 2W0UA 1CXHA 1YXYA 3B8UA 5CZTA 2GUBA 3SUUA 1KWKA 3DYOA 4OU1A 5AC6A 2ZUNA 2E8YA 4CNSA 2W6RA 4CGTA 1WBHA 3VD9A 1F4HA 1F2JA 4UTWA 3VDBA 1BKHA 3AU2A 1Q8JA 3A4JA 4NNCA 4K39A 3FW6A 3QY7A 2YX0A 3MSGA 1QU4A 4DNHA 3KOXA 5BXPA 1U5HA 3QQ0A 2VEIA 3AS2A 2W92A 3M5ZA 3MP4A 4GINA 2Y2WA 4N02A 4J3TA 1E71M 3W2KA 2GOKA 1SR0A 3DI0A 1H1ZA 2C14A 5F2GA 1K9TA 4IMGA 4HHHA 2CU0A 3XINA 4D9PA 4L6OA 1GZ1A 3TXVA 2Y0FA 3I7RA 5A95A 2SFPA 3MUIA 2BP1A 5D33A 3U6WA 5BMXA 4HNUA 3MVTA 4N4PA 4WSKA 4JL1A 3AIBA 2X09A 2FTWA 2NW0A 1KFWA 1ZS2A 1QATA 3UG8A 2VUYA 3OGRA 3U7BA 1TMHA 4OUIA 1XG3A 4D6CA 4HOZA 2E5DA 1A5MC 1A5NC 2ICSA 3S2JA 4QRNA 1MUWA 5C7HA 3VFLA 3CS2A 3PAOA 4XZMX 4F0SA 2DDXA 3EPMA 4FALA 2ZADA 3GB6A 3KTCA 3W4RA 3TONA 3C0QA 3RRXA 3M5VA 1FWHC 3HPSA 1JDAA 1I6NA 4M7TA 1M7JA 3WF1A 4GNKB 5EMJA 3UG5A 2B81A 4NU7A 2OX4A 2DZSA 1CLXA 3UVIA 5J5DA 4ILSA 3S5YA 3LCGA 2CBUA 4EWJA 3HQOA 4X60A 1BHGA 3STGA 2IQDA 1AZ2A 1HVQA 3HG3A 1Q8AA 1LRQA 1XLHA 4JTDA 2VCAA 4M24A 1U1JA 1B2YA 3A9IA 3BJFA 3EWYA 3MO7A 3KOWA 3IARA 1AJ2A 4O18A 2FGLA 1VFOA 3W85A 1Z32X 2WZHA 3WJZA 1H60A 5GPRA 5A6SA 2PLMA 1MNSA 5JIWA 3GDBA 3ITGA 1BQGA 5HATA 3ANUA 2Y70A 1IT7A 4AD0A 2OPJA 2BY3A 3AJ7A 4MJ2A 2JKAA 1A5BA 1VIZA 2QUUA 2XU2A 4WXZA 5D9PA 2MUCA 3W7PA 1FFRA 1GYLA 4YWSA 5LIWX 1BYCA 2WVUA 1LTDA 3ZXWA 3GM8A 1RALA 3VGEA 4YTSA 2ZA1A 2A6LA 7REQB 1OFRA 4D72A 1TX0A 4LJ3A 1A47A 3AYSA 2CPUA 1FWFC 3SGZA 1EHNA 3AXKA 2B0MA 3OVRA 3TQPA 4REQB 4LB4A 4FOKA 1DJWA 2WV8A 1YNPA 2J66A 5EMUA 1MYRA 2B7OA 3ABOA 2Y85A 2VWTA 1B3WA 1RJRA 3EX6A 4KCTA 2J7FA 3B8IA 4OECA 3W1TA 3MCMA 1TV2A 2E6AA 2ZX8A 3IS4A 4E0CA 3GKFA 1X6UA 5T9BG 5HR7A 2A1YA 2ZA3A 3PJXA 3UJEA 3H6OA 1ZBWA 3V4BA 1R86A 1ZUAX 3ZSTA 3VIPA 1S1RA 3WLJA 3GXFA 5LYRA 4ZQPA 4Z42C 3EX1A 1LQ0A 3HGRA 1IGSA 3LQGA 6ALDA 3UPMA 3N15A 2QF7A 3B9NA 1TPEA 3MC5A 3APTA 3U5UA 3BGAA 2FZBA 2J9ZA 2PTYA 4MDOA 4PUDA 4QG8A 1OF6A 3C52A 1E0TA 4GVIA 5CC6A 2Q8LA 5JVLA 1V8EA 1MVYA 3OP2A 2KAUC 4QM1A 3OIHA 1S5MA 2X0YA 1ZP3A 3BWWA 3DCPA 1K77A 1G5AA 3KHJA 3STCA 1SSDA 4IQJA 2ZTKA 5K9DA 1GVEA 1GGOA 1V3LA 1TRIA 3FJLA 3M5YA 4XWUA 2OYLA 2R1LA 3AUOA 3GXMA 2NVAA 2E9BA 4XTDA 1SZGA 4US6A 4JKKA 4ATDA 3PK7A 4IFKB 2Y5SA 1CIUA 2JBMA 2FPVA 1TJ2A 3LLDA 4KWUA 1CCWB 3V1HA 3QR3A 1ZL1A 4RV8A 1W3IA 1OB0A 4XSLA 1R3RA 3MMWA 4LH8A 1NQ6A 1I2PA 1H5YA 1LG2A 3N3MA 3FGCB 3TE9A 4H7CA 3WX7A 2CZEA 4A3YA 4OV9A 4IL2A 1AODA 5AN7A 4AQLA 3W1MA 1OFQA 1QNVA 4CQBA 4ONVA 4HKPA 4QS5A 2A7NA 4PN2A 3U5YA 2PDMA 1VJSA 3N12A 1ISYA 1Q6LA 3SY8A 2E6FA 2NWSA 1YX1A 3MT1A 3BO9A 3CWHA 2ZRXA 4AH7A 4G9PA 4F3HA 4AZCA 2E40A 3FS2A 5C55A 4UTTA 4GI8A 3RK8A 3M7SA 4D6EA 1W5QA 1IZJA 3MANA 4LCQA 1TV7A 2E1WA 1EJUC 1PWMA 1E4NA 4HJFA 1W8GA 4O1AA 1RP9A 3W75A 4GKLA 4LVFA 3RILA 4DAIA 1QVBA 1WXZA 4EPKA 3EWXA 5DELA 1T8QA 1TO3A 2A3CA 3WNPA 3MJYA 3WQPA 5I5RA 1H62A 4US5A 4QBXA 2XIBA 3NDOA 1CGYA 4OV4A 3MUXA 1IF2A 2FB3A 3VUSA 4PMDA 1KRAC 4BR1A 1DIEA 3QM3A 4JN8A 2X1TA 4ICNA 4PMRA 4JTGA 4W8AA 4IG2A 4TO8A 3FSUA 3RR1A 3G0UA 5C5YA 4LRTA 3DFTA 1AZ1A 1SO5A 2O55A 4I9MA 2QUVA 1W3HA 4LUSA 1TMLA 3WUBA 1EC8A 1ENUA 1JDCA 3IGUA 3SCVA 3R0KA 1GNXA 1E4MM 1OBAA 4IT1A 2FGZA 1PEZA 3W24A 2PCQA 3TTQA 4P7QA 1UD2A 2G3FA 3TJXA 1ZFJA 3TDFA 1KWGA 1X8CA 2BNJA 1DIKA 4YJ5A 4CN6A 1TPVA 5HQEA 5AHLA 4C6OA 2VTFA 3NQFA 1D2KA 4X9YA 1UWRA 2CHNA 4XK2A 5H91A 4FS9A 1DV7A 9RUBA 2Z25A 1K70A 2GPTA 2OQHA 5C54A 3WDIA 5LHEA 3BAXA 2NVDA 1LLZA 3S6TA 1TR1A 5FCZA 1IV8A 1GYMA 2J74A 3KCJA 4PUNA 1JUBA 4EANA 2YKKA 1CGXA 3FAWA 1Q6OA 3POHA 1E5JA 3UEQA 3WH9A 2PD9A 3RN6A 3PSWA 4QDMA 1XLEA 4NY2A 4C90A 1JVNA 3GS6A 1F61A 4JQ2A 5EU9A 4F0RA 2FZMA 2P53A 3LTSA 5AHFA 2E67A 5G5IA 4WDTA 4JIRA 2PB1A 4K1WA 2J7EA 3FY1A 1NU5A 4JDYA 3ONCA 3WZ0E 3T4CA 1M04A 2PP1A 1ZTVA 4C6DA 1XYMA 4FNTA 2QYGA 2E68A 3GLCA 1UW9A 2P10A 1V77A 1KXVA 4L4OA 1UA7A 3PFRA 3QTPA 1Q2SA 1PUDA 3EYPA 1FDJA 3DG6A 4K68A 1L2QA 2XIOA 4C91A 3MPGA 1XBZA 3BAIA 1EBGA 4I5RA 4IIFA 2CBVA 1PTDA 4RCXA 2OEKA 4PMUA 2JALA 1FWEC 1L6YA 4LUIA 4AD5A 1Y65A 3KVJA 4V1YA 1UC5A 3BW3A 2VGIA 5F4XA 5HXMA 1WNOA 2G3IA 3OVPA 1M6JA 2OWXA 3S1UA 1VD6A 1EGMA 3SM0A 4CKQA 1JCLA 4UTIA 1XSIA 3A21A 2AQOA 3G77A 1HT6A 4O1EA 2YDQA 3UVAA 2PRLA 2X05A 4O0QA 4LEQA 3B8TA 4PGLA 1RBAA 3SFWA 4UC5A 2NUXA 3N34A 3FJ6A 4MJMA 4U3CA 2A21A 1UKTA 4UZUA 3MQTA 4KWWA 3PR2A 1W9PA 5IXEA 2ADAA 4N4QA 2DFAA 3AIQA 1F05A 3S5OA 1RVKA 2VC9A 3W29A 4W88A 3NCOA 3W1UA 4NZ1A 3R10A 7A3HA 1QOQA 4AZIA 1XLBA 3RG6A 1A5AA 3ARWA 1FH8A 1J0YA 2XINA 4XO7A 1FP8A 1CGWA 4MY1A 5H8UA 1D8CA 2X1UA 1TVPA 3VIFA 1WDRA 1R3SA 3G2GA 1MZRA 5DX7A 4IICA 3POCA 4Y7EA 1YYAA 1VP5A 2CHRA 4DNMA 1B90A 2VFGA 2BGNE 3QR0A 3SURA 4MTVA 1QNSA 3N2BA 3NQAA 2F2HA 1G1YA 3ZFHA 3GC5A 4R33A 5LIXX 1VLIA 4TTGA 1AL7A 1XF0A 4Q4SA 5J04A 1KKOA 3IIVA 3EOOA 2VI0A 4RW3A 2D2OA 4CVUA 3L0KA 2QQ6A 2PC4A 3URNA 1ZZMA 2Z2AA 3IGHX 5E0FA 4D2JA 4GYJA 1W0MA 2JGYA 3LRMA 1V02E 4ML9A 4IXHA 3T0AA 1UG6A 1VGAA 1V3IA 4C6PA 1Z69A 3WG6A 3RF9A 2BXZA 2VFDA 3B0PA 3MYOA 1SU5A 3PWIA 4KFNA 1KGUA 1QASA 4B5SA 2UV8G 5F7UA 4NF7A 3M9YA 4EK7A 1M1BA 3MKKA 1H7RA 2FLIA 3KS6A 4LOCA 1F73A 5LGZA 3CB3A 1VZWA 1PKLA 2VX5A 1MEWA 3WMLA 5D04C 1WKEA 2E7FA 1UD4A 4TV6A 4XKYB 4HK7A 3ABSA 2C3ZA 5C7VA 1H0IA 2XIJA 4DX3A 1T99A 3TQVA 2YCEA 5M17A 3KVMA 2QPUA 4GUGA 4MB4A 1YXDA 2BHUA 3UWUA 4EKJA 2BBFA 2TODA 2P50A 2Y6ZA 3PWGA 3LHZA 3CQ0A 1H63A 3DESA 4JTKA 3EX4A 4J4KA 5KZDA 4A05A 3QXBA 3G24A 4DPPA 2RFGA 2PS2A 4Y9OA 2BHYA 3RMEA 1NARA 1R9YA 3PF3A 3KLLA 4BQ5A 1PJ9A 1E1FA 5FA5A 3MBDA 2JIWA 4PTVA 4GG9A 3W7HA 5KZ6A 2W79A 4YYCA 3PS7A 4BY3A 1R3QA 1NQKA 2BVWA 4NAEB 3ZR6A 3RGTA 2QJJA 4F0KA 9CGTA 3WF2A 1DJIA 3V18A 4TVUA 2BG5A 3TW6A 1OC5A 2DZWA 1EJSC 1T96A 1XKYA 2ZUWA 4GZJA 2UZ9A 3SCUA 2QCHA 4LAUA 5GNYA 3WQ5A 3M47A 2VZSA 1OGSA 5CBBA 4V2XA 1UPMB 3W27A 1AQ0A 4O53A 1B3OA 2D3LA 1TTJA 3PTKA 4JIIX 3FYOA 1XLLA 1PHWA 2O4QA 3M4HA 1IT0A 5LXEA 2DZBA 5TIMA 2FFIA 1VBJA 1J96A 1W9BM 2XN1A 1BAGA 4XZLX 3VM7A 2QHAA 5DCDA 1XIJA 2DSVA 4YTTA 2BVDA 5FSDC 4X9SA 1GJPA 5ABFA 4GO9A 5ECVA 3NDZA 2C79A 4ZOBA 4QFUA 3E2QA 4L7ZA 2ZX5A 1ONXA 4JY8A 3D3AA 2G4FA 5G1MA 5CPOA 4TUFA 1DJNA 1UKSA 1OD0A 2VM8A 3HB9A 1TIWA 3AISA 2WO5A 4L1GA 3AIRA 4MB1A 2NQZA 1MNZA 1M9HA 2DY3A 1Q7ZA 2WJDA 4UFHA 3GNOA 1J5SA 4H2HA 4TV5A 3VZZA 3V75A 3EX2A 4PTXA 2XJ7A 3IUHA 4D6FA 3O8AA 3VIKA 2Y63A 2GVGA 4B5NA 3MKCA 3DDMA 2GJXB 2TPSA 4U5IA 8RUCA 1G69A 3L7RA 1KD0A 2D73A 1K3UA 3M0IA 5CJMA 2Y8KA 4JQAA 1OX4A 4ACZA 1CX9A 1TSIA 1UZ4A 3OQ8A 4KEZA 4Z2JA 2PDHA 3S9ZA 4WGXA 1Q6GA 1ISZA 4M1BA 5F2MA 2F84A 4M3PA 1K8ZA 5DBTA 1KRCC 3O6AA 4CCZA 4ZZ9A 1Z6KA 4RE0A 3CUIA 2VHLA 4QDWA 4WZHA 2PGFA 2MANA 1KBJA 3EA1A 3SN0A 1RA0A 1RV8A 4YLWA 3SRDA 4DXXA 5JQ9A 1DVJA 1FOBA 4J3WA 1HW6A 3SJ3A 1H7PA 3DXIA 4OT7A 4LUTA 2GK1B 3R1ZA 2J8FA 2G50A 2PA6A 3W1RA 1ESWA 2DVTA 2EF9A 1PDYA 4GY1A 3W1LA 2BY2A 5G2WA 2J75A 2VP8A 4IIHA 1JXJA 3N3TA 4ERGA 3U7VA 4GCXA 1HJUA 2Q01A 4P5UA 3QH2A 2POTA 2QW5A 2PDYA 3MP5A 2D2JA 2F6XA 2V0TA 4J7RA 4KRZA 1YLVA 3AXIA 3ITLA 5K7JA 2PURA 3P61A 4GI9A 4J27A 4UQDA 1TPDA 4UFIA 3R0DA 3T1GA 3ZT5A 3FJ4A 4LYPA 4ZQCA 2EQDA 5FJUA 1JCTA 1WQ5A 3LNPA 4LWWA 3BLDA 2YL8A 3CV6A 3OO2A 5A2CA 1DJYA 3M1ZA 1XX1A 3LCXA 4PODA 3W2JA 3HV8A 1X7IA 4U33A 3F2CA 4PYSA 1JDEA 3H8AA 4XSMA 3MI6A 5FEWA 1RCQA 4QQ3A 1F4AA 5BYWA 3PTQA 5LIKX 3UYCA 4AZ7A 5BZAA 3W87A 1P7TA 1FWRA 1POJA 2OQYA 2FH8A 3LV5A 3FV9A 1GYNA 4O17A 3L5LA 4GYPC 4PFHA 1EBHA 3UT0A 4XX6A 5HUOA 4HK5A 3CMFA 3E74A 3GG0A 1E51A 2JEQA 3OGVA 2O7QA 1WZLA 2P3EA 1XCXA 2XTKA 4UR7A 5HR6A 3HN3A 3H53A 2OGJA 4LNYA 5CPTA 3LG3A 1LBFA 3G1AA 2UY5A 1ZJHA 2I7GA 2QPSA 5JH1A 2VELA 3E0WA 4FXFA 5GVJA 5CC7A 5HWNA 3PJTA 5HAOA 5C71A 5I02A 2VVNA 1YKWA 2I5QA 2VGGA 3PZNA 2A0NA 3R8GA 4M8UA 4ZODA 5BWAA 3B06A 3W72A 3H2AA 1TFVA 3WDRA 4L4LA 3LU2A 4AD3A 1C8VA 1H7WA 3NZPA 3EMQA 4IJRA 1PIGA 1QNQA 4GJJA 4W8BA 1DJXA 4AB4A 3N19B 1L8NA 4J28A 3WCZA 1A5OC 2DIEA 4MKNA 1F3WA 3PJUA 5GQBA 4OE7A 1GQJA 3ZR5A 1JRBA 2DT2A 3TZNA 3PUEA 3B9OA 1VB9A 4N6FA 3BW4A 2WZMA 3PC0A 1CBGA 2PDCA 3A3HA 5CPMA 3ZJKA 1PL9A 3OA3A 4Y9AA 1VENA 2YGYA 4FIQA 5AC7A 1S2AA 2QJMA 4FPSA 1G4TA 2VRJA 3OPSA 1KB3A 4W4QA 5IHRA 4UR8A 1JNDA 1D3CA 4JX4A 1MFVA 2R24A 1E5NA 3WD0A 1V3HA 3CTLA 2ISVA 2Q02A 4HZ7A 3S6OA 4C6MA 2Q8ZA 3TOPA 2NUYA 1DIDA 1W54A 2BDQA 1M65A 1Z7AA 2QAPA 1QI2A 2PLCA 4AHOA 3EB3A 1GVYA 4B4FA 3L21A 3MI2A 3SFKA 1UMYA 4I6VA 4H8VA 5PTDA 3GFXA 4H9UA 2A3LA 3HMJG 3HTWA 1MQQA 4HU4A 4IOTA 4UQBA 1RPKA 5EMLA 4GNVA 1KFBA 1UH2A 1RA5A 2CLHA 4YCPA 4MNJA 4R7WA 4H9XA 3IAPA 4N9CA 5DF0A 1TJPA 3MO4A 1NWRA 2PWVA 5LSMA 3KDNA 1BYBA 1W5PA 3KBJA 1QO2A 4C1LA 1NTHA 4QLKA 4J35A 4GZIA 2QGHA 4GWEA 1UWUA 2GWGA 2C18A 1CECA 2RDXA 2XWDA 3ZJ6A 3VCRA 3WLOA 4GQRA 1LYXA 4JQ4A 1V0KA 3A4AA 2ISFA 3ARXA 1KXQA 4JYEA 4O28A 1UA3A 4HTBA 1OIMA 3BGJA 1XL9A 3CEPA 4PSPA 2O4MA 4ALDA 1GKPA 1V5XA 1OEPA 3PZIA 4AEEA 3PHAA 4IP5A 4U4MA 1K9DA 3KVKA 1VRXA 4QE5A 3WLHA 2CZFA 1C93A 3VO0A 1AQFA 2DJXA 3CO4A 3W1XA 5DFAA 5I09A 1Q65A 3APYA 1GVSA 2IW0A 4QP0A 2PI6A 3UZ5A 5F2LA 1V6WA 1FQ0A 2DW6A 2ISSA 2IQ0A 1E6XM 1H7NA 2QCGA 3AFBA 3MV01 5FD0A 3BQ5A 4XV0A 4EAYA 4ZR8A 1I60A 4QG6A 5AVNA 2ALDA 1REQB 2WAGA 3DC0A 1TMQA 1FBAA 3BW2A 4I6KA 3K4AA 4I5UA 4JTJA 3P2VA 3VIMA 1AW5A 3DH7A 3SQSA 3O63A 1EF3A 9XIMA 3SBFA 2B7NA 1KLZA 3EXTA 1TE6A 4GKTA 2YR1A 3S1GA 4J1OA 3TNBA 4MGGA 2GJLA 4PMVA 4YYFA 3LRLA 3VC5A 2Q6ZA 2G96A 3E49A 4FMVA 4G8TA 4FF5A 1BQCA 3W7DA 5KSWA 3W1PA 1OG6A 1VAHA 1I0DA 4R27A 3PJWA 4UQEA 1XHGA 4DM1A 3B03A 2D1ZA 4XZNX 7REQA 3CYVA 5CH9A 1YHTA 3TOYA 3OIXA 1E55A 3KBWA 4DZAA 6TIMA 2NX3A 1NDVA 4ZO9A 4AD1A 2XN2A 4REQA 3BLFA 2P0IA 4B92A 4PZVA 5BMWA 3RCMA 3FVMA 4DWSB 1VJZA 4D6IA 1BTMA 4FEZA 5AECA 2ZTJA 3MSYA 2POZA 1JJKA 3LQLA 3DUGA 2DSWA 3RAOA 3W22A 3VKCA 4LAZA 3HIJA 3E3HA 2PWHA 3LBMA 1FWBC 3BV7A 2REQA 4XD4A 2VR4A 3C56A 4WJ8A 2WWCA 3DBNA 3AS0A 1E6RA 1HO1A 4JTLA 3H2OA 1X1OA 4NAFB 3DHUA 3P8IA 4HZMA 1SJDA 2X7WA 3T0CA 3DN5A 4E4PA 3SB0A 1Y5VA 5FF3A 3W74A 1J11A 3W23A 2X8RA 3BPWA 4QE4A 3PAJA 3W6LA 1T7LA 1YDYA 1YMYA 1IE7C 4AU0A 5BROA 3WFLA 1VRDA 3VNDA 2BZNA 1OINA 1XLIA 2HBVA 1BF6A 1TPUA 2HJPA 4O1CA 4IM4A 4M5PA 1VHNA 1UASA 4NSBA 3E2RA 4QS6A 2EPKX 4HOXA 3GR4A 2PAJA 1P6BA 3LV6A 1FXQA 5KITA 4LW7A 3EPNA 2XGIA 4FLSA 4XZ9A 4RNJA 3I7SA 4IIGA 1I2RA 3UW6A 2QCMA 3AWNA 1YPXA 3W7JA 3WK3A 4KGJA 4IFKA 4YU1A 1XDJA 2G4JA 4H9ZA 4UR9A 3VOHA 3R94A 3SADA 1EJ7L 3N25A 4UTHA 1UUMA 1BPLB 3H2CA 3QW3A 3BG5A 1YW1A 3MHFA 3OYZA 1X97A 2J9YA 2FJKA 1OZQA 4AMCA 1S2WA 1HP4A 4GMEA 3TN4A 4WQ6A 4D71A 3JZEA 2V3EA 3GDKA 3NZQA 1AVAA 2D2GA 1OD8A 3B0UX 3CB8A 3A6OA 3MY9A 5BRQA 4JEQA 2VOTA 4GABA 4S38A 5A8GA 3W86A 4XIMA 1UKQA 4S3EA 4X0VA 1V3KA 2PRHA 3N4FA 1KV8A 3N13A 4W5UA 2NSXA 3BMXA 4FX6M 2QJNA 1ISWA 2VT0A 3VGFA 1OM0A 4Z2HA 3RJXA 1RQEA 3PUOA 1EJVC 1TA3A 4DBWA 4JX5A 4PL1A 3UJSA 2C0HA 4DBEA 1UIPA 4AG0A 4AY7A 3N9RA 4D8LA 4WY0B 4PTWA 3EDKA 2V5BA 3CAVA 3BLOA 4O54A 2QJGA 4YTQA 4C6NA 2C19A 5CG7A 5F4SA 1ALDA 3MMTA 2ABAA 3IIXA 4AFYA 1QPKA 1N8FA 1UWIA 4GJ1A 1VF8A 1JYNA 1F3XA 3GXPA 3DFNA 4UTFA 3EOLA 1BVZA 4CEXC 4KWVA 3KP1A 1F9CA 2R8WA 4FSAA 1NFPA 1JPHA 1GG1A 2VWSA 4S3AA 4N6EA 3N14A 2ZZ1A 4KRUA 4H9TA 1VYSX 2HZGA 1W9DM 1XYBA 3WKZA 3GR7A 4LANA 3A3XA 1OSEA 4GD0A 3PZTA 2OLAA 3WQEA 2INFA 4I7UA 1GWJA 1C29A 2B31A 2IKHA 3QJAA 1OCBA 4B2DA 3IK4A 1O66A 3VE7A 2FB2A 1XRVA 3B05A 4W9TA 1K1DA 4QG9A 3MS8A 1L2UA 4KBXA 2VENA 1HL9A 4TU1A 4LGXA 1Q6CA 5MKGB 4Q22A 3EOEA 4QEEA 3NVDA 4RNIA 3II1A 4OZOA 2P5NA 4E2BA 4BWLC 3R43A 1W2PA 4S2CA 4DZ5A 4CU6A 3BICA 2J7BA 1AW2A 1HL2A 1DP0A 1JEZA 4AYSA 3LXCA 3BG3A 2B4GA 4NJIA 3Q58A 4S3BA 4W7UA 5E5CA 1S5NA 3TQ0A 2IKJA 1XLJA 1XDLA 3QV9A 5G1YA 1Z42A 2CYGA 1DOSA 2HSAA 3QZAA 4QR6A 3HA1A 2DVXA 3MV11 3WLNA 1GQLA 5BOEA 4MUPA 3NL2A 1XCFA 2WXDM 3GU2A 3AHYA 4K8EA 4G6CA 3SY1A 5HDRA 5FSEC 4MAVA 3S47A 1JYWA 3IIZA 5FF2A 4NQ1A 2QAFA 1B54A 1MSSA 1JD9A 4R53A 3W7GA 1XH2A 1HKIA 4B5UA 1N82A 1W1A1 1XLCA 1O5QA 3E1F1 4HA3A 4ML4A 1NDZA 3SZ8A 3LHYA 2R14A 3ZT6A 4IQDA 3NQVA 3D3FA 3CAQA 3C8FA 2EGZA 4KQNA 5D2VA 1ITCA 4HK6A 1GVIA 3G22A 4O13A 1W3TA 3R13A 3C0JA 1KFCA 1VBGA 3ZJ7A 3T9PA 4Y8EA 1W9UA 2PWUA 3TYBA 4G1NA 3GIQA 1FDZA 1WB0A 1TWWA 3RPTA 1GOXA 4GIAA 1R2TA 3WH6A 4KERA 3U3HA 5E6YA 3UYIA 1CWYA 1DWFM 3PULA 3PBVA 5CGQA 4FNPA 1V51A 4KS0A 4Q4KA 3L67A 4PCPA 5I3IA 3W02A 1NH6A 5EMKA 2ZIDA 4HP5A 5A8OA 1UR3M 4QE1A 4LQ1A 3I6RA 3EKGA 1QHZA 3P8JA 5DBUA 1J0ZA 1FHUA 4L64A 4V28A 1RK6A 2QCLA 4JR5A 4H04A 1IEVA 2YCLB 4LF2A 1T8XA 4LC8A 2V3DA 1TJ0A 2I1OA 4HYWA 2FQIA 1H11A 2VFHA 4KEMA 3ABRA 1PB0A 1FH7A 2QLYA 3THAA 2ACSA 1WUEA 3OBKA 2FVLA 1QNRA 2QCEA 3EWWA 4PBEA 4C6LA 2KZHA 3ZO9A 2CIPA 2ISWA 4UTMA 2Z1SA 2Q71A 4RW5A 4L80A 3UPBA 3GE7A 4HGXA 3MMUA 4P2VA 1Q6EA 2EEXA 3A12A 1VFMA 4HTYA 1GOQA 4OUEA 2YB1A 1LT7A 4BF9A 4Q7BA 1IR1A 2TRSA 1IIGA 3AICA 1PYFA 2QMKA 1OFAA 4YVXA 2GQAA 1Q6FA 2I57A 4PUEA 1K8YA 4LRSA 3RM9A 3WLPA 5TBOA 4YHEA 3C2VA 1SMAA 3CWNA 3PTMA 1KGXA 2QUTA 4ZFMA 2YZRA 2OQLA 2FHCA 3GVQA 1XLAA 4LS0A 5ABHA 2CLMA 1I2OA 4A2SA 1P4CA 4XZBA 3HPZA 3VNKA 1E3ZA 3W82A 4XAGA 1EA0A 4PR4A 1JAKA 1JYVA 3IJ6A 2X2YA 3CHDA 4F9JA 3AYTA 5CBIA 5ECUA 1J0HA 1EYWA 3GTIA 4DEFA 2YFNA 1M3UA 3LTPA 1KRMA 5A6LA 3MDUA 4CNUA 1JPIA 1EZ2A 5LA1A 3UA4A 5HNTA 5BRPA 3QV6A 4ACYA 1OYBA 6REQA 2WSKA 4F2UA 2ZCGA 3MCNA 4JYFA 2IQTA 2J25A 2VC6A 5C2GA 4LFYA 1IHIA 1THFD 2BGSA 4F48A 1UPPA 4XKYA 1U5VA 3N4EA 1HJXA 3PZGA 2V81A 2J13A 3KRUA 3EZ4A 3UJFA 1FH9A 2HDJA 2E28A 4C6QA 2W3ZA 4JFTA 2RDWA 4PCFA 3GKAA 5LGXA 1WXYA 3USBA 4Q3MA 2HXTA 1MW1A 4GISA 4WSJA 4HU8A 3UCQA 2DUZA 3NEHA 1TB3A 4H9VA 2R1NA 1XGEA 1FWAC 1IQ8A 2VKZG 1KQYA 1BRLB 4RNHA 3VPLA 5XIAA 2UBPC 2V69A 2XVNA 4M6UA 2F7FA 4O8RA 1AD4A 2WNZA 2CLPA 4PMJA 5I23A 3QEZA 4NAEA 1S46A 1XIGA 1B9ZA 2OKTA 1J6PA 2FZ9A 3FAXA 4TTUA 4Z1YA 1UR1A 4MSSA 4PE8A 2X7VA 3IUIA 2YDSA 3E0IA 3BAKA 1DXFA 1H7XA 4ZFCA 4PL2A 3VIGA 1JZ7A 4C6KA 1O94A 1VFSA 1TUXA 2E77A 3M0VA 4W5ZA 3SCWA 2WW5A 3ZOAA 1KCLA 2ACUA 3KW3A 3NEVA 3I68A 2E0PA 1CLKA 4V33A 4ERAA 5CC5A 4BI7A 4JTFA 1PZ3A 2DIKA 4HMNA 1E3XA 3QYSA 3H4WA 4WKHA 3ITVA 4PB4A 2GUUA 1DHPA 4ADUA 3GC2A 4M19A 3BMVA 1EUAA 2XGBA 1AH4A 4HHPA 2J8GA 3L4TA 5E09A 2DQXA 3U2OA 2OJPA 2ZC8A 1OK6A 5HWMA 2W5FA 1B4EA 3RR4A 3URAA 1NIUA 2Y7FA 1K7XA 4JTSA 4HD5A 1UD6A 1Y8BA 4IQLA 1EJXC 3VOJA 4S23A 1J2BA 3O15A 2VUNA 4CD8A 3ID7A 1HUVA 1X1ZA 1XUZA 2ZUMA 4MZYA 3VNJA 2HE5A 3A13A 5EGRA 2RDTA 2DT0A 3LCIA 1FCBA 1UKPA 5HINA 3DKLA 3C5QA 4OOUA 2DZXA 4ATWA 1FRBA 1P5BA 2GJXA 3MWAA 1YTKA 3OB8A 3RNDA 4IIEA 3B0VC 3BV4A 2C1IA 4HA1A 4L1XA 4PTDA 1EWEA 2FVKA 2PF0A 5G4WA 2XG9A 1I9CB 1PYMA 3HFTA 4U5KA 1LT8A 1K02A 5SWUA 5I03A 3AYVA 5BU9A 1K7FA 4LVGA 1CEOA 3L65A 3T44A 1EIXA 4PSRA 3HQPA 2YDAA 3P7YA 3KZSA 5C70A 4KRTA 4C5YA 2YL5A 1MDRA 3ALFA 4UOZA 5G2HA 4X3ZA 3W2NA 3UZJA 5MHBA 1H5VA 1CYGA 4ZO8A 1F8IA 1PZ0A 2BLEA 2AL2A 4OIFA 4CD5A 1JG9A 4AUBA 1A5SA 3DG3A 3JR2A 4ZB5A 3URQA 1SW0A 1ZB5A 4B5TA 1EO5A 3W7CA 3WSUA 3LSBA 4UTUA 2H3BA 4ERIA 1N55A 5HMEA 1FHDA 3OOQA 1W5MA 2V38A 1I2NA 1AG1O 4B3KA 4EPBC 3L4VA 3O07A 3D46A 5K4ZA 3VKKA 4MIMA 1VKFA 3RIKA 1DTNA 3MUY1 4UIOA 1QR7A 4CNPA 3HM7A 2HRWA 5DXXA 3UJ2A 1KV5A 1F3TA 5E0KA 3U2ZA 1ZCOA 4LV9A 2Y88A 4WJEA 4MYAA 2C1GA 2J62A 5DMMA 4IIBA 2YL6A 3WQVA 3GVVA 3LERA 2EG8A 4JIPA 1B57A 3O9NA 3DEQA 4KIRA 5CAHA 4C6BA 1XLFA 4DN1A 1AQMA 3UXKA 4D1IA 4PEEA 1XLMA 1UUOA 3QOMA 4AIBA 3QPZA 3W84A 2WKJA 5LXXA 3LTYA 1LROA 3ATZA 3NQ8A 3TN6A 1RD5A 4R3UA 1Q85A 2ATMA 3VYLA 3WNOA 4HU3A 4JTIA 2EPNA 1ITXA 2PDJA 4WF7A 3VKBA 3W7RA 1X98A 1PPIA 3UERA 2HCVA 1J5TA 1POKA 1FWJC 3VUPA 1HXJA 2JK2A 1V6UA 2GLKA 2LLEA 3MHUA 1SFSA 4FXJA 1XIFA 2PDXA 2PGWA 1XGZA 3PANA 4YNGA 1JCYA 3CUXA 3TSMA 2WZTA 3G0XA 3TKFA 3LI0A 1AJ0A 3CASA 3I4KA 1NSJA 1GQNA 3ABZA 3Q2DA 1XISA 1WKFA 1BKSA 5HNNA 1OWQA 5I07A 3VIIA 5AHMA 3KS5A 4WGHA 3C61A 1A5UA 1UJQA 2XIMA 4IFOA 2BS9A 1JCMP 1RHCA 1KM2A 4B91A 1W2VA 1GOOA 4IF2A 1FP9A 3HU7A 3RJYA 1JZ4A 1CZ1A 3TYEA 4O15A 3H21A 3EWUA 4L65A 4DJFC 1UP3A 3BSMA 3AXHA 4LALA 1UR8A 3STPA 4AC1X 1XI3A 5JMUA 1Q4WA 4S3KA 3TA9A 2Q8XA 2ALRA 4JXCA 1PDZA 1VCVA 3S1WA 4NX0A 1FHLA 4PB3A 1UP0A 1H51A 2BSLA 4UNKA 5JBFA 4CCEA 3INPA 2R91A 5I3KA 3RX4A 1X7FA 1WBJA 2GGHA 1DWGM 1ZALA 3QSTA 1KTBA 5H1WA 3W2MA 3G8RA 1U1HA 1NWTA 1OFEA 3ZM8A 3F2BA 1P0KA 2WQDA 3QLDA 3OA5A 2Z1VA 2NQ5A 1HX0A 3CQJA 2JEPA 4EXQA 4UBPC 4UOQA 4NKCA 2OU4A 1SYTA 4H8NA 1GEQA 1AD1A 3KWXA 3NZRA 4KETA 3WQ4A 5LNVA 3ORWA 1TUFA 2ZDRA 3UESA 3ABQA 1CTNA 3EEGA 2H6RA 1I8JA 1OF8A 3V5OA 5B7ZA 1MW2A 3QVQA 4H2CA 4LSBA 3LCWA 4MFEA 4HNLA 2IKIA 4GGHA 1EXBA 4PBGA 3WQWA 4MWAB 4OJYA 3VE9A 4DXVA 1MI3A 1TPFA 4H8UA 2P8BA 3GQYA 2OWWA 4ZTXA 2Y61A 3K46A 3TTOA 2CETA 2ZRUA 4OHQA 2OZ3A 1H41A 1FKWA 1Q6DA 2AKMA 3QV8A 3VGBA 3EDEA 2NLIA 4K7YA 3FX4A 3WNNA 3S9YA 4KFPA 3LHVA 4RDZA 3TAOA 2PP0A 1JFXA 3KXQA 3UWVA 1TV8A 3HZ3A 1TPB1 4AHPA 4MKVA 1IXQA 3K4DA 4QISA 1PE1A 1E9ZB 2YW3A 1RXOB 4IGNA 3NO1A 4IPLA 3E5PA 1TV3A 4IMAA 1RLDA 1TV4A 3VDGA 4H6RA 2XVKA 1DQXA 5CPLA 1UIOA 3HFYA 1VYRA 1RK5A 2WBGA 2GL5A 2QS8A 2OSYA 4E8GA 2VFEA 3P74A 3SI9A 1XSJA 4UXDA 2J27A 4LU0A 2VYOA 6A3HA 3WJYA 4C7FA 3LK6A 1VHCA 4GVFA 1JI2A 3BJTA 3K13A 2OYMA 2PODA 2WSQA 4I7VA 1ZHAA 1M7PA 1MMFA 1BSIA 1QPQA 1C9DA 4BCEA 1TQJA 2R94A 1I4NA 3LHWA 3NA8A 3OVQA 5H6HA 1SUXA 2CBJA 4KWSA 4TXEA 5A8QA 5DQPA 1R3VA 1LOLA 2OLSA 3SAZA 1K6AA 2ZE0A 3OHMB 2WLYA 5C6MA 4WRHA 4IUOA 3LRKA 3NWRA 3VNYA 3NQEA 4HMEA 1BG9A 4NRRA 1P0BA 4NJGA 2YPIA 3FA5A 1F6KA 4BEQA 1FXPA 1X1NA 2YLAA 1DWIM 1SZRA 5JU6A 1EO7A 5AYBA 2Z1KA 1REQA 3ZSSA 5B80A 5DANA 4RLIA 1A50A 3RLVA 4J3ZA 2V8ZA 4M80A 5C9XA 3KVLA 3BANA 2A4AA 3KRSA 5IOBA 1OFOA 1JCXA 3EDJA 1L6SA 1US3A 3C8NA 1W3LA 1UBSA 2GGIA 4E4UA 1OIFA 4WVXA 2OGYA 3VD5A 5C9WA 1S3TC 1DHKA 3I65A 1KFLA 1U22A 4DO7A 2I9EA 2J47A 3P67A 3OEXA 3R79A 3S8HA 3L5MA 1OVDA 3LXAA 2E1DA 1C3FA 4HCHA 2OO0A 4ZB2A 3HGSA 1LL4A 2ATSA 3EEZA 3KLKA 2G0WA 1W1YA 4E4FA 1TTQA 3P84A 1SMDA 4GNJA 1D7KA 1NFGA 1NWUA 1WDPA 4PRRA 5FJPA 3GH7A 1GVFA 4IZGA 4C7GA 3UF9A 1LBLA 1ITQA 2QNEA 4FB7A 3TMLA 1F07A 2VEPA 4FIRA 5CKSA 1QK0A 3MHGA 1R5YA 3QFWA 4AX6A 2J24A 3WDQA 3Q37A 5I06A 1NP0A 4JAWA 3RU6A 3ARYA 1P6WA 4HSHA 5AYYA 2AMXA 2NV2A 3OG2A 1R2RA 4JTEA 3P5ZA 1OK4A 1XIDA 3WDJA 4JL2A 2IS7A 2XIIA 1B3VA 2NZLA 3HV9A 3F4NA 4WXYA 1LQAA 2A3HA 1TCMA 4Z08A 1Q5MA 1FKXA 3GX9A 3I3EA 2VX4A 4A8IA 3WH7A 1SZEA 1CPUA 3VX1A 5I6SA 3K1DA 4JTQA 5A69A 2E4TA 4L56A 1HN1A 4X22A 3VCNA 3SIMA 1GTHA 4GJIA 5FJRA 3TLQA 1L0PA 3PVFA 3EXSA 4J40A 2PZNA 2V2CA 3NPVA 2OODA 1ECEA 2ZZ4A 3KBNA 3IJ8A 2ZZ6A 3M44A 2PCEA 3CL6A 1EDGA 4FAMA 3ARPA 3WLQA 3QKZA 2VX7A 5K4XA 3IUDA 2IPWA 3MTWA 3E38A 3OU8A 3NPXA 4GX8A 3PZOA 1K7EA 4RNFA 3VOGA 4A8LA 2DV0A 1E6PA 2WPBA 3U9IA 4WKAA 4XVEA 1G67A 4JN6A 1KCZA 4U10A 3RXZA 3F4WA 2A2IA 5CZ0A 3AIEA 4K3ZA 3WUEA 4HHMA 2GZXA 4WSHA 3W7LA 1E4IA 3JUGA 3EWCA 1XRFA 3ECQA 4PA8A 5C9UA 2HK1A 5EMMA 2QCDB 2PDFA 4PMQA 1ZQ5A 5FJTA 1Y0EA 1S39A 2DZAA 1DEDA 1PCWA 3V0SA 2X42A 2Y7EA 1MUMA 3DHPA 4OKDA 1LL6A 2HISA 2YXGA 3DX5A 4MHBA 2YDRA 4HNOA 4W7WA 4RUBA 4UFMA 3WD4A 1A53A 3TA6A 2GWNA 2ZWZA 4D6HA 2V3FA 3W88A 3M07A 3W3OA 3CYJA 1ITUA 1X96A 1Z44A 1GUVA 1UZ1A 2DSKA 3PNUA 1EQCA 4HNNA 1OGGA 4KWOA 3K30A 2W62A 3EB4A 4P7OA 3L23A 4LVAA 2BFGA 1Q6QA 2WC7A 3NVTA 2DT1A 4ZOEA 3SGGA 3W0KA 4GHRA 4PFMA 1US0A 4E2DA 4H7VA 1H1NA 3SCNA 4WY0A 2OXNA 2PTZA 3N2MA 4J3UA 2V63A 4AISA 2OEJA 4GIYA 2QXWA 2OFJA 2PFHA 4FNSA 2E25A 1F6YA 4LAMA 4JS3A 1BXBA 1EIBA 1EWDA 1OQFA 4D6DA 5GJNA 3VOCA 4GBDA 3P3BA 1MEHA 4AWSA 1J8VA 1L9WA 4ZA0A 4Z1AA 4L9YA 4W84A 3C4UA 1UWQA 3LY0A 2XWEA 3FKKA 1HTIA 1US2A 1Q66A 2CZDA 3QPEA 3ES8A 2VMFA 2JFEX 4MYXA 4B2DD 4PRWA 5CJNA 5D9NA 3NXFA 2CEQA 1JQVA 1ZBCA 4A3UA 1TZ7A 2E6DA 3V5CA 1NEYA 2CLOA 2NT1A 4FNRA 2C91A 4POCA 1B3YA 1FCQA 3GD6A 1SO6A 4LX4A 2Q3OA 3KHDA 2ACRA 1UOZA 1W1B1 3ARSA 5MKGA 2V67A 3CUJA 2WQPA 2F38A 4DHGA 3KM8A 4JICA 4IG2B 3I7QA 3SEPA 4MB5A 1TG7A 3F4CA 4B15A 5D03A 4GUJA 3I3DA 4DF0A 3GXDA 3KZPA 3BLKA 1SO4A 5JBEA 4NILA 3WL0A 4N9DA 1WAUA 1ZJIA 1WV2A 2VEGA 3FDGA 4YIWA 4YMZA 1M7OA 4A3QA 4C6IA 4K8HA 1CXKA 3NPWA 2WMFA 2DZUA 3D47A 1GVRA 4HPNA 2WJFA 3KTSA 2OZ0A 4GQBA 1ZU8A 4TVCA 4N9BA 2Z6JA 2ZFAA 3OZOA 4NZ5A 3PZMA 1QJWA 2GUYA 1N8WA 1E70M 3F1QA 3H22A 2OT1A 3QY8A 4PMXA 3VD7A 1S38A 3F5LA 2AOSA 4Q4OA 3UETA 1L8PA 4GY0A 3CQHA 2W91A 4ADTA 5D30A 3H2EA 2AKZA 4S1FA 4MFDA 2V68A 5JUVA 1XR2A 3T0BA 1S2VA 3WO8A 1PWLA 2WCSA 3VDCA 1I2QA 1F74A 3C0LA 3GIYA 3T08A 1E15A 2J7CA 2PPGA 3RO6A 3UD6A 4C6FA 2J4GA 2QT3A 3AOFA 3R0UA 1R3WA 5AC5A 2XM1A 4JOMA 5D2WA 3TLLA 2CLLA 4RJEA 1IWAA 3DU0A 4M6PA 3KBVA 2WHKA 3TAKA 1RQHA 1S3HA 3IRDA 3A23A 3ARQA 5M5DA 2Z26A 2H8XA 1DL3A 2BX7A 2JF6A 4K36A 1ICSA 2OTDA 3OLGA 4AXKA 5C9RA 3GTXA 3AYRA 3IGSA 2QMJA 5A2AA 2ZICA 2PUZA 4GZ7A 2VO5A 4ZEPA 3F4DA 3UNDA 1XPYA 4G2DA 3M0LA 5E70A 4MJZA 3VNLA 2AMGA 3FYPA 3PB0A 4JQ3A 4AD4A 2OSXA 5F4WA 3GDMA 3VD4A 2VEFA 3W00A 1YBQA 2J7HA 7CGTA 2V5LA 3HPAA 1VIWA 5CPSA 2WMIA 1OX6A 3TMQA 3B8DA 4URIA 4IWWA 2WVTA 2ZC1A 2YB4A 5BXSA 2XVPA 3XIMA 4NNBA 3CL8A 3TWBA 3VC6A 4P8UA 2GGGA 2JE8A 2YCLA 4S3GA 3TROA 4ZENA 3WJWA 3PNZA 3GRIA 3W25A 4YCOA 2BGQA 4FI4A 4GBUA 3GY1A 1QXLA 4AZHA 1UWTA 4A4AA 5JBDA 1RD6A 1Y7VA 3SRHA 1XFCA 2ZBTA 3G1XA 2BY0A 4ZGYA 3MMDA 5I3GA 3EA3A 3UR7A 3S5NA 3VXGA 5FKYA 4JKLA 3BQ6A 1BWKA 5AB3A 4Y9PA 2J79A 3QZEA 4M1RA 5FL0A 5E93A 3CL7A 1JGMA 4A8RA 2HQAA 3WLMA 4A22A 2FHFA 3W26A 3IIPA 4RE4A 1RJQA 3RITA 5G4HC 2NUWA 4OBTA 4Q7NA 1CB7B 4Q8NA 2O9OA 3GZ3A 3TXZA 4JTAA 3B97A 5I7GA 5CSUA 3B4UA 3BDKA 1A3XA 1RBOB 2P3ZA 3NNTA 2QEZA 3CV1A 2E6YA 1GTEA 4HCDA 4JX6A 2PDWA 3A9BA 1V08A 3MKVA 1FTXA 2BOGX 3R5EA 1YADA 3QTGA 1OC7A 4OOZA 1O5XA 4IMDA 2CKSA 1UQYA 2QDEA 1KCXA 3ITXA 3W1QA 2D0HA 2DEPA 4R7JA 1GOMA 2Q3RA 5CZSA 3VKDA 3G0SA 4UCGA 3E02A 5ENLA 4GYFA 2EXOA 4ZSUA 1CGVA 1WDWA 3IGXA 3C2EA 2W67A 1NJJA 2Z00A 1BG4A 4FNQA 1AA1B 3KDOA 3H2NA 4QIUA 4H7ZA 1EX1A 2FKPA 3H70A 2G3JA 3H4XA 4JEJA 4NG3A 1T5AA 5C2XA 3NQ7A 3FXYA 3KL3A 3ZR4A 2R1MA 2OWCA 3V0TA 3P81A 1E0XA 2GDQA 1BRLA 3BUVA 3G18A 5LNUA 4U28A 3RUBL 4P61A 1F8MA 1XIEA 3D5HA 3RDKA 3KOZA 2TSYA 1SPQA 4A2RA 2PDGA 3WQDA 4B9YA 1TWIA 4Q8WA 1R9ZA 5BXTA 4EX4A 1RH9A 1W1IE 3ENLA 1CXLA 4DJDC 3PZQA 4JIEA 3TX9A 1S2CA 4YN5A 1N8IA 4P8VA 3EPOA 1QOPA 4HU0A 4H41A 2WLZA 1KFJA 3FIGA 4RK8A 2WC4A 1O68A 4OVXA 4H01A 4BF7A 2VD8A 2DSUA 4LYKA 3C2OA 3UWEA 3W7NA 4CQ8A 1QWKA 2ONEA 2O9RA 3LB0A 5I24A 1K6WA 1KM0A 4BWLA 4AMAA 4D1JA 2NV1A 3QLLA 3F2DA 4CUCA 2X0SA 5K9CA 2DZPA 1JIBA 3ME3A 5REQB 2NT0A 3LA4A 3AS1A 3WNMA 1O6IA 4MJ4A 1GHRA 4Q8VA 4XBSA 2FDSA 3Q4DA 2BXVA 2OT0A 1AH3A 2X1SA 1JFHA 4HJWA 3GTFA 1ZBVA 1QNOA 3LLXA 3P5YA 1EUNA 2PWGA 3LMYA 3CQIA 3T4WA 5AC8A 4E8DA 3EGJA 4HPXA 2BB0A 2NQLA 4UB9A 4YXGA 2INEA 1G7VA 3DYMA 4H4IA 3L68A 2VEKA 5I0DA 1CB2A 3K1GA 3QY6A 2FTYA 4I90A 4HN4A 3L66A 4AIOA 3TYZA 2QCCA 2VRKA 1KA9F 1PV8A 1A5LC 4QDPA 2DIJA 2QVNA 4GE8A 3RMJA 1MWOA 3GXTA 4PMYA 3NL5A 1IWBA 2PWEA 3KUMA 2HK0A 3CV7A 2ODOA 1HKKA 2HPIA 4OBRA 1VFLA 1NAL1 4DUOA 8XIMA 1ME7A 2NQHA 5D2TA 3ZQ9A 3P14A 5HJYA 1XP3A 1J6OA 3T8QA 1RQBA 4DJDD 2VZUA 5EKYA 4AC7C 2A7RA 3BXWA 3CM4A 4JZ5A 4MLRA 1UMLA 3ARUA 1XIHA 1EC7A 1WZKA 3H2FA 3QHOA 3AXMA 2BOFX 3EDDA 4ZO7A 1QPOA 4BQ3A 2ZUTA 1DORA 2J77A 3O05A 2EJAA 4MY8A 3OG3A 3NQ2A 4JNYA 3CMGA 1HNYA 4JTRA 5FEZA 3VIJA 3ZLHA 4DYKA 3QC3A 4Q8PA 3WMBA 3PBMA 1XS2A 3UR5A 4ZQNA 3THUA 1JZ8A 2PU0A 3V35A 1GZGA 4O52A 3NGJA 4AVFA 4GACA 2VURA 4K1GA 2CLFA 4DUXA 4UWMA 3BLEA 1DJQA 1HF6A 3AIVA 1R87A 1E1EA 3PPFA 3EWDA 3GXNA 5EBUA 3TJIA 1KTNA 2D0GA 3WBXA 2ZRWA 5IDZA 1YE4A 3U8GA 3QMRA 4PEKA 4B4HA 3LBCA 4XUYA 4UNIA 3B40A 1OZMA 5BOFA 3GDTA 3BAYA 3EX3A 3QGAC 1RY0A 4KGLA 4NASA 2RHGA 2ZDSA 2ZYFA 4F8XA 3R11A 1W9VA 4IX0A 3LGDA 1SQ7A 4QROA 2P8CA 3BURA 1DQUA 2A7PA 3T0DA 3CEUA 3VMPA 1BYDA 3KCLA 4NZ3A 3W81A 3RLHA 4B5WA 4P7RA 3CHCA 2I17A 1FY6A 1KBIA 2PDIA 1YNQA 2FPYA 2Y4SA 4HYVA 4MZ1A 3P0WA 4D6JA 1FWGC 1XICA 4DVOA 2NXGA 2EAWA 3NQBA 1Z9AA 2X0HA 4QITA 4UFKA 2XHYA 1PO9A 2PU1A 7XIMA 3HJEA 3W9ZA 1Q2RA 4DI9A 4FO4A 2I14A 1QWGA 2YZ5A 2X16A 3AHXA 3CUZA 3WDHA 4R7OA 4WIWA 5BU6A 2NWRA 1E0WA 2OOFA 1ELSA 1SFLA 4QTGA 5EL1A 3FLUA 4Z17A 3BE7A 1V0NA 1WCGA 3H23A 3RM8A 1GPFA 1BTCA 5IBXC 3REQB 5CQ1A 1V4YA 3E96A 4UMAA 1QAPA 2WJEA 1FWIC 4AX7A 4R85A 3ZVHB 3FHQA 1IEIA 1PSCA 2WNWA 3GW3A 3PBYA 3DHDA 4K37A 1EP3A 2OMAA 3H7VA 2PTWA 3VFCA 1UKOA 5CSRA 4RE2A 1I75A 3MCOA 3IJ9A 3NOYA 4W89A 3SUWA 1M41A 4J2PA 4I9TA 1P1XA 3GG8A 3A5FA 4NT0A 5D38A 1BWLA 4EP8C 2XSXA 1SM9A 3QHMA 3VILA 4CD4A 1X8FA 1O95A 2P76A 1XXXA 1T40A 4HZ6A 3A4XA 2YCJA 2UY4A 3HBLA 5JIPA 2NXIA 3NOEA 3AXXA 3PPCA 2D20A 4C65A 3OLEA 3GK0A 3E9AA 1JYXA 4H6QA 2P88A 3A47A 1BGAA 5D8ZA 5H8PA 4LNCA 2P1FA 2DH3A 4GH1A 1UH3A 1G4EA 3GXIA 4H9MA 1OJXA 5DY3A 1WO2A 3T42A 4H8HA 5I78A 1WKYA 3UY7A 3FSTA 4C1KA 1OY0A 2W61A 3CJPA 3HG5A 2BV9A 1SW3A 1NM9A 3W7IA 1RR2A 1XC6A 1PX8A 2L5HA 2RJHA 3ICJA 2NQ9A 1P1MA 1VPYA 2QZRA 1GJWA 1W5OA 4XAFA 3PBGA 2YCIX 5MF5A 1XBYA 3NQCA 3QC0A 2WVVB 5HMSA 4C6EA 1TPC1 4WCJA 3STFA 4JN7A 4LBUA 4Q8MA 3AO0A 3NPUA 4DELA 1Q63A 3E5BA 1FWDC 1R0MA 2C71A 2ZKMX 1V93A 5HQMA 4MWAA 1HGWA 1W1TA 4GXMA 5AZ1A 3MBFA 3AU6A 5HOSA 2YYTA 4V15A 8CGTA 3G8EA 2WNQA 3WN6A 2VR2A 5LA2A 1X6LA 2Z6IA 1TE1A 1IEXA 3ONBA 2Z29A 3UR8A 3NZGA 2PF8A 3N29A 3C2FA 1TTIA 3L5AA 1LF1A 3QBUA 1WAWA 1AK5A 5XINA 1V6YA 1A49A 1E9IA 3SY5A 5IFPA 2D23A 2J6XA 1W1ZA 1WOBA 1LWJA 5EY5A 1GOWA 1VR6A 3OZMA 5CLWA 4Q8QA 3B0XA 3K8MA 3GTHA 4AYGA 3LN3A 4Z0SA 2XSBA 1TREA 4CN4A 4S3DA 4LUJA 3RCNA 3NFUA 1HJSA 3FVDA 1K8CA 1U5JA 4LV4A 4Q4QA 4RPQA 1LUCB 3AZTA 1HKJA 2GSJA 3M5XA 4AHQA 1HO4A 3HMCA 1R46A 4JGDA 2FZDA 4YWIA 4WHBA 1GCYA 4LYRA 3AMCA 3DFPA 1QW9A 4YL2A 4DI8A 4UMBA 3BOXA 3W07A 2H90A 4DWSC 1D3GA 3S2LA 3WQOA 4EVZA 4ENLA 1KKRA 1LBMA 3WH8A 1BWVA 2A5HA 4M56A 6TAAA 4R88A 5ABGA 2XGZA 1WYIA 3N18A 5LNSA 3M0HA 1G4PA 3ARRA 3HGJA 5A6MA 3AHZA 5EFDA 1Z8AA 3OGSA 3VNIA 2R1PA 2ZX6A 3WFZA 2GGEA 1P0EA 3IJQA 1AQHA 1B30A 1DPMA 3UGVA 1D7FA 4IJCA 3LMZA 4RL3A 4MNKA 2YBTA 3WK1A 3EBVA 1K4HA 3S4TA 2O7SA 1FHVA 3BJSA 1G4SA 2WMGA 3PB2A 5CLTA 4G1KA 4RPPA 4MG4A 3QN3A 4NYUA 3NGFA 3GAKA 3ZMRA 1KQZA 3GTNA 3Q45A 2PWFA 3CO8A 4L9ZA 3G1YA 1TZ9A 4NRSA 3UXIA 1MXDA 4HN8A 1WA3A 3GNRA 1UR4A 5M1TA 3TZFA 2E8ZA 1ZBKA 2CFFA 1PVNA 3DYPA 3E12A 3TU9A 1YDVA 5L6UA 4O12A 1QTWA 4Q8UA 2AGKA 2C7FA 4OQVA 1TTPA 3VGHA 2BXYA 5J5RA 4IH3A 4LUYA 4HBKA 1J4EA 5D02A 5AC4A 4NI3A 1OT1A 2VQTA 1MW0A 3WUFA 4DWSD 2G95A 3WBEA 4ZVJA 1QI5A 4Q4MA 1NFBA 3W1AA 4M82A 4HSOA 5H2ZA 1XH0A 4IP7A 1UH4A 3KRZA 3DKJA 4Q6JA 3TH6A 5CCZA 5T91A 3LCFA 3NSMA 2GGJA 3FJNA 4F4RA 2WKLA 5HK4A 1TVLA 1DJZA 1EJTC 1JCNA 1E56A 1A80A 3VD3A 5D09A 3DFOA 3LHUA 1H1YA 3KCOA 3M46A 3PUGA 2A6NA 1KW1A 3NURA 3LS9A 3CIWA 3BAJA 3NQMA 1IGWA 4O1DA 1CNVA 2NX1A 1SJBA 2XYLA 2YIHA 2IUZA 4H19A 4E2VA 6CGTA 1JUKA 1OX5A 3RPDA 2H3DA 4B3ZA 2ZRZA 3FOKA 1ZGDA 3GUGA 1A4MA 2Z1WA 4N2YA 3T2OA 5FIPA 2HXUA 3HG4A 4MPKA 1DWAM 4DUWA 2ZUSA 1QCWA 4DJFA 3GSMA 5IRPA 1IEWA 3SCRA 1KO0A 5T9CE 1EP2A 2REQB 5DEZA 3GDRA 1OFPA 1WZAA 3W76A 4AZ5A 2XVLA 3UP8A 3NYDA 5HULA 3AMDA 1QBAA 1KR1A 1RAKA 4GUFA 2FHBA 1LG1A 3VZYA 4H6KA 1VFUA 3CIVA 3CH9A 1O5RA 1YDOA 5HJLA 3CK5A 1F5ZA 3R89A 2PTDA 2VVSA 3QF0A 1XGDA 2OLHA 4ZE5A 4QJ1A 4NYYA 3J7HA 3NAVA 3NM1A 1W5NA 2XISA 3CLMA 4WDUA 3G1HA 4WLCA 1FWTA 2ZXQA 4HQVA 5IFTA 4HMCA 1ML1A 1J18A 1LDCA 2QCDA 3N2CA 4GVHA 1GZJA 1M01A 3OW1A 3IPWA 1PXGA 1CXFA 1YIXA 3WLRA 4C6JA 4F79A 2PDQA 4WR3A 4WY0F 3GHTA 1XQKA 1OCQA 3WEMA 2CBIA 4AD2A 1PTAA 3CIXA 3UWQA 5IM51 3ARVA 5CPQA 4FA3A 2YBVA 4YVVA 1JDDA 2VL4A 2AGTA 2NSOA 5CAKA 2ZWYA 4JTHA 4U2YA 1TPH1 2WCAA 4EF8A 4EWND 6PTDA 5JXQA 3PTDA 3SCSA 3AMGA 4XQ6A 3PPGA 3EAUA 3GBDA 3LD5A 5AYXA 2GVJA 2XH2A 4M6VA 1C90A 3N73A 4XAZA 1E0UA 4JHMA 3IWPA 1ZY9A 3VA8A 1F6PA 4PMNA 4OBSA 1JZ5A 1D9EA 3T2PA 4FLOA 1JXKA 3HGOA 3QZ6A 3BGGA 4QSHA 2FVMA 1DE6A 2FZ8A 1CXIA 1EC9A 4WDXA 4O11A 3ARTA 2J6VA 3T81A 4AXNA 3MVIA 4BZYA 2CZVA 2WZEA 4O0KA 1A5CA 3AMLA 1EOMA 2CKRA 3U57A 1J0IA 3IAQA 4JIQA 2X40A 1XQLA 1WOAA 3M7WA 3O6DA 1VC4A 4GQQA 1IZKA 4RZ4A 1E43A 3RFAA 2GDUA 3W01A 3WK2A 3WEZA 3MJMA 3UR2A 5CBJA 5HWJA 3CZ8A 2AAAA 3L4ZA 3VU2A 3AIWA 5F1UA 1XCWA 1TA3B 3BK0A 1ONRA 2O9PA 2C1HA 4I5XA 5HNRA 1CDGA 3GG1A 4LTSA 2RDUA 3URBA 5EYWA 1D3HA 5LIUX 4O50A 3RRAA 1PKMA 4K7VA 1PKNA 1PHQA 2QF8A 3IV8A 2GOUA 4G7FA 4C1NB 2Z7KA 3M0XA 1KXHA 2BTMA 1LP6A 1TVNA 4AZ6A 4LPCA 2ZE3A 3NQGA 5TNVA 3THCA 3WLSA 2XFRA 1YE6A 3F7JA 5JH2A 3VCCA 1MO0A 3M0YA 1PZ1A 4CNTA 3IANA 1NDYA 3ITYA 1DE5A 1NY1A 4DPQA 1VEOA 2WMKA 4LBRA 5I3DA 4DQWA 4HPJA 3OTRA 5D37A 3BSGA 5D9MA 2ZRVA 3IACA 4IL0A 1U33A 1MRAA 3KL5A 1G0CA 3H26A 2E3ZA 1C91A 2PSNA 5FF7A 4XAPA 3PFMA 1R47A 1DKWA 2YBUA 2Z1XA 4MLJA 3WQFA 2G5WA 3M6YA 4NNAA 4QX4A 3B3DA 4RXGA 5FL1A 3TK7A 2OYKA 4IHCA 3EA2A 1W9XA 1UR2A 2OKOA 1IEQA 3CAKA 3TFCA 5C2CA 3MUCA 3K8KA 3SRKA 1KRBC 3L12A 3L9CA 3G6MA 1LRNA 1K8XA 1LCOA 4GC3A 1J2WA 3JU2A 5AHNA 3WJXA 5LHFA 2CLEA 3M0ZA 1G7UA 3HQ1A 4DB7A 3M43A 5HJXA 2HNEA 4LVBA 3T2QA 1O4UA 2CXGA 2ZXBA 1L6GA 1KCKA 3FGCA 4DJEC 3H7UA 3DGRA 2ZUVA 1GJUA 2D3NA 4LS1A 5E9XA 4QLJA 4B5VA