1O5RA

Crystal structure of adenosine deaminase complexed with a potent inhibitor
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design, synthesis, and structure-activity relationship studies of novel non-nucleoside adenosine deaminase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 140
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1o5rA00
4DLMA 4H9VA 2EG8A 3MJMA 4NI8A 1RAKA 1FKWA 3EGJA 4KEUA 4GXWA 2Z2BA 1V79A 1YMYA 1RK6A 4ERGA 2A3LA 3F4CA 3DUGA 4XD6A 4C5YA 2XIOA 3GIQA 2Z24A 1A5LC 2ANUA 4R88A 1V51A 4H00A 3S2MA 4IG2B 1I0DA 4UBPC 1FWBC 5A6TC 4H9ZA 4ICMA 1PSCA 3GTFA 2Y1HA 1IE7C 5HMEA 4CNUA 4B91A 4RDZA 2I9UA 1KRBC 2QS8A 4AC7C 4XD4A 3MDUA 5HMDA 4EPEC 1FWHC 4RDVA 2FVKA 3LS9A 2OOFA 5FSEC 2UZ9A 2OGJA 2WJDA 4XAYA 3OOQA 4B92A 3SO7A 3AU6A 1RA0A 2GWGA 1R9YA 3GTXA 1KRAC 3GRIA 4ERAA 4UB9A 4OFCA 4CQBA 4C6KA 2CZVA 4IG2A 4CQDA 4HK5A 3TNBA 1UBPC 3URQA 4DZIA 3LNPA 4HK7A 1A4LA 4NG3A 4KEVA 3EWCA 2I5GA 2HNHA 4ERIA 1M68A 3GUWA 3IRSA 1UIOA 3PNUA 2BB0A 2Z28A 1QW7A 3E0FA 1K70A 2VC5A 3S2LA 3GU9A 3PANA 4B3ZA 2IMRA 1ITQA 4G7EA 3TN6A 2E1WA 4H9XA 3QY8A 4WHBA 4XD3A 3KM8A 4KIRA 3RCMA 4DO7A 1ONWA 1GKRA 4LCSA 4C6MA 4H01A 2D2HA 4C6LA 3LY0A 4GY7A 3ORWA 2Z29A 4QS6A 3RN6A 3S4TA 3RYSA 3FDKA 1XGEA 3A3XA 3T81A 5HMFA 2E25A 3RHGA 1J5SA 1PB0A 4HJWA 3T8LA 4LEFA 1UIPA 2Z25A 4XD5A 3UR5A 1FWAC 3URBA 2WJEA 3O0FA 5G4HC 4C6IA 4KESA 1FWIC 1O5RA 2R1NA 2Z26A 4PE8A 4KF1A 3B40A 5AKQA 4F0SA 3MTWA 2OODA 1HZYA 1YRRA 3C86A 1K6WA 5LXXA 2Z00A 4IFKA 4R85A 4DYKA 3V7PA 4MUPA 1FWDC 4IH3A 3F2DA 2R1LA 3NEHA 4LCRA 4RE0A 4IF2A 4G2DA 3HPAA 1RJQA 2EG7A 4CNSA 2VC7A 2Z2AA 4J2MA 2PLMA 1YNYA 2YXOA 3GTHA 1PO9A 3MPGA 3OU8A 2F6KA 4KEZA 1V77A 4EP8C 4RDYA 1E9ZB 3MSRA 4C6OA 1O12A 1ADDA 4GX9A 3GU1A 3EWDA 4IGMA 4H9MA 3N2CA 4C6FA 2HPMA 4LH8A 1FWEC 4GX8A 3CJPA 2G3FA 2RAGA 2GWNA 3IPWA 4WVXA 4J35A 4B90A 4D8LA 4L6DA 1P6CA 4LAOA 1NDYA 1XRFA 3MVIA 1KRMA 3OQEA 4C60A 1A5MC 4C6EA 3ITCA 1WXZA 2FVMA 1A4MA 2AQOA 1V4YA 2GOKA 1M7JA 2FTYA 1I0BA 3E0LA 3WYZA 4Z42C 2R1MA 2YB1A 1EJTC 1K1DA 2VM8A 3HTWA 4QSFA 3UBPC 3TN5A 3BE7A 3LSCA 1QXLA 4E3TA 3PBMA 3OODA 3UR2A 2HBVA 4C6JA 3ISIX 1JGMA 1RK5A 1S3TC 3SFWA 4BKNA 1UMLA 1NDZA 4CEUC 3F2CA 1EJUC 4GY1A 2AQVA 2P50A 2Z27A 4G7EB 4I6KA 3IJ6A 4EPKA 3S2NA 4GY0A 4BJHA 4AQLA 4JOMA 3UF9A 4V1XA 1J6PA 1EYWA 2OB3A 1YIXA 4P5UA 4LAKA 2D2GA 2OQLA 4YIWA 4RZBA 1DPMA 3F4DA 2QVNA 4C6QA 4EPBC 2YZ5A 3IACA 3WMLA 3E38A 3D6NA 3DC8A 4PCNA 3K4WA 1ITUA 1WXYA 3NURA 4DZHA 3QGAC 2Z4GA 2HPIA 1P6BA 3ICJA 4DNMA 3IV8A 2ZC1A 4V1YA 4DLFA 4INFA 1RJRA 4IGNA 3TN4A 3PNZA 1EJRC 1EJSC 4ZSTA 4I6VA 4BY3A 1A5NC 1YBQA 3JZEA 4IFKB 1BF6A 4QS5A 2W9MA 2DVXA 2UBPC 4HA0A 2Z7GA 1EF2A 1NFGA 4TQTA 4QROA 2D2JA 3PAOA 2O4QA 1FWJC 1POKA 3A4JA 4LANA 4CEXC 2R1KA 3TN3A 1VFLA 1V7AA 4ZSUA 2R1PA 1J79A 4KETA 4PBFA 4EPDC 3GIPA 2VR2A 4C5ZA 2HQAA 1PTAA 1XWYA 2P53A 4GYFA 4L9XA 4H9TA 1EJVC 2PGFA 3LGDA 1M65A 4M51A 4C6NA 4XAZA 3E74A 4HK6A 3OJGA 3QGKC 4DI8A 4PCPA 2GZXA 4GOAA 3DCPA 2DVTA 3MVTA 4F0LA 3FEQA 2WM1A 3LU2A 4GC3A 4J5NA 2GSEA 3QY6A 3E2VA 1EJWC 2O4MA 2YB4A 4DIAA 4GK8A 2PUZA 3FDGA 4F0RA 3IGHX 3LGGA 2KAUC 4XAGA 3B0XA 3LSBA 4C6DA 2PGRA 2EG6A 2WJFA 4IFOA 5CH9A 3K2GA 3CAKA 4H9YA 1J6OA 4KQNA 1FWCC 2QPXA 3R0DA 2Q01A 2PAJA 3OVGA 3GG7A 3MKVA 1A5KC 3T1GA 2AMXA 4DI9A 1KCXA 1XRTA 1KRCC 2ICSA 2HBXA 3B0YA 3WZ0E 1EZ2A 1FWGC 1NDWA 1ZZMA 4C6PA 3A3WA 4LFYA 4C6CA 3LA4A 3CS2A 1R9ZA 1FKXA 1P1MA 3HM7A 4GZ7A 4NP7A 1GKQA 4R7WA 3QY7A 3ID7A 3URAA 2FTWA 4LAMA 2FFIA 2Q09A 1GKPA 1EJXC 3GU2A 4QTGA 1A5OC 1E9YB 4RDWA 4CQCA 2ADAA 4C6BA 4C65A 1POJA 4IQJA 4LCQA 2DVUA 2QT3A 4WGXA 4H9UA 4PBEA 4KERA 4CNTA 3AU2A 3E3HA 3NQBA 5FSDC 1W1IE 1FWFC 1RA5A 4IFRA 4LALA 3G77A 5E5CA 4QRNA 1YBQB 2VHLA 3GTIA 3MDWA 3UPMA 1RJPA 3IARA 4XAFA 4GBDA 3S2JA 2VUNA 2BGNE 3K5XA 1ONXA 1R9XA 3F2BA 3AUOA 3URNA 1NDVA 3O7UA
chains in the Genus database with same CATH superfamily
4E5TA 4MVAA 2TMDA 4DN1A 5KZDA 3EOOA 3N9RA 4GXWA 2JF7A 3SRKA 2QEZA 1XV8A 3SUVA 2A3LA 4C5YA 3OGSA 1LP6A 1K8XA 4AD2A 1K4GA 4B4FA 3TA6A 3U7VA 4PTWA 2QUNA 1UR9A 4ICMA 1KR0A 3WJXA 1ZY9A 3H54A 2E09A 3LEPA 4YMZA 1XIIA 2WZHA 3CASA 1T41A 3UYCA 2ISWA 4Y9NA 3KVJA 1GHSA 4GKTA 1DIEA 1O6IA 3PF3A 3OOQA 1PIFA 5KZEA 3MV11 1LT8A 1ZJAA 1V3IA 4OFCA 2PDGA 2VZVA 1EBGA 1VR6A 3W76A 3VOHA 1WOAA 1WKDA 4HMNA 2WBGA 4LV9A 4HK7A 1A5BA 3R4IA 4M82A 3XISA 1ALDA 5GJMA 4YWIA 3EA3A 3KBSA 3N25A 4O0QA 3O6YX 1VYRA 2G3NA 5HA7A 2ZRUA 5A94A 4QBXA 1BYAA 3TJXA 3E0FA 4KFOA 2D3LA 1SW0A 4DJEC 5EGRA 2O9RA 3N2BA 1VBUA 4ZQRA 3LXAA 1XSKA 3BURA 4NZ1A 2ODOA 2D73A 2BY2A 4E3VA 1CGXA 1JR1A 3EKGA 4P7NA 4ZXLA 5HWNA 5CBBA 3C5QA 3CV2A 4HNLA 2XZ9A 2BY3A 2D23A 2NT0A 3EWWA 2R9RA 3BLFA 2O0TA 4ZB0A 1W8GA 4GUJA 4QLKA 1V02A 3SQSA 3O0FA 4IQDA 2GPTA 3FVMA 2VGBA 5D02A 5CSYA 5EU9A 5H2ZA 2J7GA 4CD6A 4UQ9A 1YPXA 5I5RA 4ZOEA 2DORA 2J7DA 1R86A 3G8RA 3TXVA 3FSTA 3GW0A 3S42A 3F1QA 3MWAA 1A0DA 3WF3A 4PA8A 1YNYA 2FH8A 4GO8A 3AS3A 3REQA 1IEVA 1VP5A 4QFUA 2JQXA 2A85A 4JTQA 1PL9A 3DC0A 4ATDA 1RHCA 3HPXA 3FVDA 4AAJA 3GB6A 4H9MA 2HPMA 1T7LA 3ZFHA 2YL8A 3R13A 3M5VA 2G3FA 1OFAA 2ATSA 2GWNA 5HUPA 2F6XA 4POCA 3ZR4A 4HIBA 3KCOA 5T91A 1FUYA 3V35A 1VAHA 1WXZA 3T07A 2ZBTA 1L0PA 3M0YA 1OF8A 3ATYA 5CQ1A 3S9YA 1ODZA 1ZRQA 1UOZA 3PBVA 5CZSA 3HTWA 4S3GA 3RO6A 1CECA 5KSWA 4GD0A 4Y8FA 2WMJA 3WQOA 3CZKA 1TPFA 4FZIA 4J3WA 3T9PA 3S9IA 1S3TC 1RK5A 1WYIA 3W29A 5BRPA 4G6CA 1S39A 3WQ8A 2GSJA 1HT6A 1IXNA 3IV3A 1G7VA 4GY0A 1IQ8A 5EMUA 1EYWA 1KKRA 1CXIA 3TC3A 2FHBA 2YZ5A 4U2YA 1QOQA 1GYMA 1BPLB 1DVJA 1X6LA 3BLEA 3BW4A 3QGAC 1ISZA 1P6BA 3KVLA 4M7SA 1HGYA 4INFA 4ZMGA 1C92A 3TN4A 2F38A 1YBQA 3PHAA 4DPPA 4OQVA 3GDTA 1R5YA 1VS1A 4GNJA 3M7WA 5FOOA 5AB3A 2E9BA 3LMYA 4N02A 4ZE5A 3W7RA 2DW6A 2GVGA 2PZNA 1HNYA 2HV5A 3PG8A 3PZIA 1LM1A 5LNWA 1OF6A 4Q8UA 1E0TA 1R8LA 2VQTA 4H9TA 1DHPA 1Q13A 5D2XA 1F9CA 2FQIA 3V0UA 1TUXA 1KCKA 3T8QA 2PI6A 3PUEA 3RX2A 4J9JA 5H6HA 3IIXA 2IXUA 2JFEX 3WL1A 2HS6A 2WVVB 2E6DA 2C0HA 4W8BA 1JCMP 2DT2A 2DFAA 1NOUA 2J8GA 2PUZA 2NX1A 2Y5EA 3AIRA 1Z7AA 3E5PA 3L12A 1XLIA 4F4RA 4GI9A 4N6FA 3HO8A 4DM2A 3NA8A 4X3ZA 4DQWA 5M1TA 2HJPA 1U2YA 3WLSA 1B30A 2QZRA 4PUDA 2VGIA 1E72M 1OD0A 4W85A 4L1XA 2Y62A 2J77A 2FMOA 3P5YA 4BI7A 2Y0FA 4Q7BA 1QOPA 4R34A 3W02A 3LBOA 2J74A 1MQPA 4C1NA 2OZ8A 4N4QA 2PLJA 3QYSA 5EMJA 4GGHA 1TZ9A 2RGMA 2P5NA 4AD4A 6TAAA 3TTSA 1XIBA 2FZ9A 2DH2A 3LYEA 3NCOA 3ZT6A 2HDJA 1G67A 2XIBA 3OZOA 2H9AB 1IXPA 2X1RA 3S2JA 4FLSA 3MO4A 2ZIDA 1UP0A 4N2YA 1TPDA 3LCXA 3KX6A 1DOSA 5A6JA 3DZ1A 5CAKA 2P0IA 2BOEX 4XVDA 4D8ZA 1XLLA 3PBYA 1EA0A 3COTA 4N42A 3SCTA 3WO8A 2HSAA 2QF7A 3CBWA 2ZFAA 3O1NA 4FAMA 4QG6A 3UVAA 1G4EA 1DV7A 4WY0B 4CLMA 1LZOA 5FL0A 1VEMA 3W23A 3SGZA 1G5AA 2J9XA 1EDQA 4CNUA 2PDXA 3WFZA 1D3CA 4QE1A 4CN1A 3QTPA 3W7EA 3FAXA 1JNEA 3ZYZA 1KC7A 3WQEA 4WDXA 4NAEA 4B92A 3R0KA 3KWSA 4URIA 4XIMA 3VZZA 1OFBA 3ARUA 3GBEA 2X05A 4AHPA 4UTFA 3FS2A 3VTRA 3URQA 3KOWA 2QJHA 1A4LA 2WMIA 1M68A 5C7HA 1XDMA 4KT2A 2NW0A 1SFTA 2RHGA 4FF5A 3IJ8A 3AJXA 2PDQA 2IKHA 4NKCA 3GU9A 2AL2B 1E6ZA 3G0XA 4DZAA 4OBRA 5FF7A 4D72A 4G7EA 2VEKA 3QQ1A 5MF5A 1E55A 3AS2A 1GOQA 2ISVA 4WX2A 4JDBA 3U2CA 3E02A 1C9WA 3EWZA 3HG3A 5D09A 4MPQA 4O50A 1UP2A 1VC4A 3MU7A 3UZYA 1QBAA 4QS6A 5M17A 3RYSA 3T81A 3DHPA 3WUBA 1T0OA 1FHUA 4C1LA 3FN9A 1IIGA 3UW6A 3PY2A 2PP1A 3STFA 2X0HA 4DJEA 4D6EA 2QV5A 1XHGA 3O06A 4OOZA 2W27A 1SSDA 1W2VA 4B3KA 1F4AA 1PCWA 2HVNA 1YRRA 3C86A 3IUDA 4W8AA 3BG3A 3IJIA 1B3VA 3H22A 1MUWA 1QI0A 5F2GA 5LGZA 5C9XA 1AW1A 3W70A 4HU0A 4P2VA 1H2JA 4TV6A 1C7SA 5FJPA 4TU1A 4EAYA 4NZFA 3BLKA 3AIWA 1VCFA 1PX8A 4TTGA 2BHYA 4HA3A 4XVEA 1X6UA 1F3TA 3M5XA 1WOBA 1I75A 1UBSA 1CXLA 1LLZA 2FMNA 3QPEA 3TYZA 3K4AA 4J35A 4N9BA 1TX0A 2OJPA 4KFNA 3ARTA 3W85A 5HNTA 3KCLA 2PLCA 3K8KA 5FKYA 1V3LA 4UTHA 4WOQA 1MI3A 1TPVA 1DXIA 4H2HA 4NJIA 3BDKA 1OD8A 2XIJA 5F4SA 2F6UA 3NQ7A 3APYA 4ZZ9A 1QVBA 3OODA 3RLGA 3EDEA 7A3HA 1UG6A 2GLKA 3ISIX 2ALDA 3NZRA 1WAWA 1R6WA 7XIMA 3BQ6A 1B2YA 3GKAA 4AIUA 4JIPA 4YWSA 2INFA 3JR2A 3T0AA 1TV3A 4EPKA 3S2NA 3GR7A 4HNVA 4HSNA 4HZMA 2OB3A 3QBUA 3S5OA 1GONA 4RZBA 3NZ1A 3LLFA 5HNUA 3L4YA 1DWHM 1JFXA 3CPUA 1SO3A 5CPTA 4DZHA 5G1YA 4AY7A 2CWXA 5D2WA 2E4TA 4DX3A 4DNMA 3N14A 1JZ3A 1VPXA 1Q65A 2WSRA 3IV8A 3RX4A 1R0MA 5FIPA 1KXVA 2FJUB 5REQA 1EJSC 4ZSTA 2E28A 5I78A 3CTLA 2YCIX 4OV9A 1YHTA 3G0UA 1V02E 4G56A 4DO4A 4CNPA 3PAOA 3KL5A 3LV5A 2UY2A 1DQWA 3PN8A 4EWND 1S5WA 1PTAA 2V3EA 4H83A 2PGFA 3MHFA 1JXJA 3D46A 1XIHA 1B3XA 3OG3A 1NQKA 1JI1A 3F4VA 4UTMA 4J5NA 1D2KA 1GW1A 2OEMA 1A5CA 5IHRA 1F74A 2WHKA 1H60A 3AICA 2VFEA 3PZQA 3NL2A 3HJEA 1NM9A 3LMZA 4TX9A 1H7PA 2HXTA 4FSAA 2YLLA 1V0LA 3VXGA 1O1ZA 3MANA 1VB9A 3P67A 2PODA 3L21A 1DHKA 3M0IA 1F05A 3MSYA 1TMLA 3TR9A 3UJRA 1XRTA 3IK4A 2HBXA 1ECQA 3AS0A 3IJ7A 4LUTB 2XVLA 3AZTA 2QDGA 1SZGA 4O18A 4HJFA 3K13A 3P61A 1A0CA 1H62A 2VX5A 1BXBA 1SZRA 2A2IA 1SR9A 5ABEA 3IGUA 1E9YB 5AC5A 1D7FA 1GOMA 1GOIA 4D71A 2WKGA 7TAAA 2ADAA 2NLYA 2VZSA 1QJWA 1Q3NA 2PD9A 5C5YA 3QXBA 3NO1A 5IBXC 3W2JA 2FZMA 3FV9A 1AQMA 1AMKA 3AU2A 1FWFC 2QDDA 1MXGA 1VBGA 2CU0A 3OLGA 3SCPA 5JVLA 4AUBA 4MGGA 5DCBA 2E6AA 1THFD 4XAFA 3KS6A 3N4EA 1PJ9A 4FXJA 3T09A 3K5XA 3TLLA 1OB0A 1RQHA 5AC7A 2GJNA 1U1UA 3ZZ1A 2ZWZA 3O7UA 3AIVA 2HVOA 4NYUA 5I02A 3M41A 3QR0A 4PSPA 1H5YA 3BAIA 4HCHA 3FGCA 2Z1BA 3Q65A 3WIJA 4B5SA 3F4CA 2NQLA 4XD6A 2QJNA 3UESA 3DFTA 1QNRA 3IJ9A 2O9TA 2Q3RA 4UCGA 3CMFA 3IVTA 3SRFA 2ZZ2A 3NUKA 3LX9A 3ARZA 3QH2A 1IE7C 5HMEA 3TR2A 4MIMA 3G0SA 2BVWA 4H19A 3CAQA 4LS2A 4CKQA 5FF4A 2L5HA 1PTGA 1W1YA 2HISA 5C9UA 4QAIA 4RDVA 3ZR6A 1NF7A 4US5D 1EQPA 1S2TA 3TTEA 4S3FA 3HQNA 5D2YA 3KS5A 1MVYA 2OKOA 1P0NA 1KD0A 3CYJA 7REQA 3GRIA 4EOUA 1XLEA 4LB4A 3ITVA 2RH9A 3BK0A 1LQ0A 3R43A 3WH9A 1V3KA 2PS2A 4H7CA 2TPSA 1XFCA 4GYJA 1X39A 1MEHA 3S0CA 5EBUA 4ZENA 1TR1A 1R30A 4DBDA 4H04A 2FZBA 3QMSA 1J96A 5C2CA 3RGTA 1IYXA 2ZTJA 3UERA 4O17A 3BSMA 1BKHA 5BXSA 3S1UA 2ZXAA 3VM5A 3ANVA 4LXFA 2QCDA 5DXXA 4B15A 3OTRA 5K4XA 4KIRA 2OO0A 3VFLA 1T96A 4RV3A 1MXSA 4C6MA 4JNZA 1DQUA 4H01A 4L9YA 1OX4A 4MJ2A 4FF7A 2GVEA 4GY7A 1WDQA 3NM3A 4JQAA 1RY8A 4XTDA 2BDQA 4ZO8A 4WKFA 4QEHA 5CC6A 5K2ZA 2OSXA 2DZWA 4F9DA 2YYUA 1ZBVA 3E12A 3PJXA 4FOUA 3WNKA 1OX5A 3NFUA 3CEUA 3ANUA 1HJXA 3VKCA 3SUUA 3LCWA 4I5RA 3WL0A 4KGLA 3TXZA 3A3HA 5LNRA 1M7XA 4QJ4B 9XIAA 4J2MA 1SZFA 4R5EA 4X2PA 1GVEA 2DSWA 5EMYA 1TELA 2HVMA 2DZUA 4CU8A 4PMQA 3L23A 3W72A 1XINA 2BY0A 3S1VA 3WNNA 1XLDA 3B8UA 1LYXA 4ALDA 1O12A 4F3HA 1GG1A 4C6FA 1OFEA 4LH8A 2ZZ5A 3KVKA 1HVXA 4LUSB 1OIMA 1B3WA 5AZ1A 5C9WA 2PC4A 3QR3A 2FH6A 4GH1A 1GVOA 2RAGA 1TPEA 3QQ0A 2C18A 4BWLC 3NOYA 1EUNA 3W7MA 4CN4A 4PMYA 3SJNA 3TTYA 2ZRVA 4M29A 3QN3A 3KDOA 3NO3A 2BOGX 4JAWA 2E8YA 2R1MA 3TTQA 4MB1A 1K1DA 4FR1A 4A22A 1TA3A 1GVQA 5BNKA 1FHLA 5JUVA 1QWGA 4O52A 4AXKA 2HBVA 4C6JA 1HJSA 5BRBA 1TTPA 4WUIA 1VJZA 4GZEA 2QNEA 2G96A 4JTLA 1QU4A 1ZU8A 4IJRA 4G7EB 1TJPA 1UW9A 1A5UA 1PZ0A 3IGSA 2D2GA 2EJ1A 5AOUA 1B3OA 1W17A 2IXVA 3WMLA 5BXTA 3C52A 5AHEA 4NJGA 4O4VA 1OYBA 4UZUA 2NQHA 3L4TA 3OBAA 5A6LA 2X7VA 3Q94A 1P7TA 2Z7KA 3W6MA 1UC5A 2WWCA 2TODA 2YL9A 3ARSA 3LPOA 5FF0A 3SBFA 2E6FA 3OB8A 4QLLA 4DYEA 3S47A 4LANA 4CEXC 4H8UA 1V7AA 5DY3A 2GSHA 2YXXA 3N2MA 3GVQA 1RBAA 2R82A 2RJGA 2W0UA 3XINA 1XWYA 5J8LA 1XW8A 1V6TA 3W22A 3TVAA 4CGTA 5CG0A 1UR2A 1NOWA 4RZ6A 3H7UA 3DECA 2YLAA 2XINA 3P0XA 2J79A 3G1XA 4UMBA 5AC8A 2JGYA 4RXFA 5I3HA 4AZCA 1RCQA 3CU2A 4A21A 4CNNA 3UXKA 2XH2A 3UETA 1H1YA 1K4HA 5I09A 4F0RA 3IGHX 3V1PA 4E4FA 1B54A 4H2CA 4C6DA 5A2AA 3QZEA 8XIMA 4DJDC 1QPKA 3W53A 4JTKA 1XIGA 1W9VA 1XC6A 4LUYA 3UWWA 2HNEA 3B0VC 5DBTA 4ATLA 3A5FA 3I7RA 2PB1A 1JZ2A 3HOJA 4XV0A 2EPNA 2QPUA 2ZRZA 1H0GA 3GVWA 3AI0A 4DM1A 2PDCA 4A3RA 3MUY1 4C6PA 3T0BA 2X1UA 2XPKA 4Q3MA 4PEKA 3LA4A 2O56A 1IV8A 3AYVA 3UZXA 4Z1BA 5GNXA 4GQ0A 3UZZA 4Z0SA 4E8CA 3O6AA 4KWSA 4DWSA 1I1XA 2OKTA 4RUBA 1EHAA 3MCNA 4TTUA 3V5CA 4PH6A 2V5CA 4M6PA 2A7RA 1GQLA 3ABZA 5BMWA 4OUEA 4DNHA 2RDWA 3UG3A 2CCRA 1W56A 5FSDC 3U57A 2DZSA 1D9EA 2JK2A 5EMMA 3P6LA 5HOSA 3EB3A 1V5XA 4FPSA 2A3BA 4I7UA 3EZ4A 4AZ5A 3PZMA 4B3LA 1GOKA 1R9XA 2P0OA 3GQYA 3RK8A 3POHA 1NDVA 1N82A 4PUMA 4DWSD 3P60A 1KM1A 3UWYA 2PDPA 1B0IA 3G2GA 3P82A 1V3HA 2Y5JA 3UGRA 4W87A 4F66A 2A1YA 3WLRA 1XLBA 3GAYA 3PBGA 1ZLPA 1V51A 1E71M 4GINA 1S5TA 4Q22A 1ZALA 1AW5A 3PVFA 4ZEPA 4OV4A 3R12A 2EPHA 4PMVA 3W83A 1CGTA 3T2OA 4UOJA 1KGWA 3VOFA 4L4LA 4O53A 2XYLA 2WOQA 2HXUA 3Q4DA 4NJKA 4AW7A 4UTWA 2B7QA 4EPEC 4MNKA 2E7FA 2Q8ZA 3E0VA 3F5KA 2EKGA 3SGUA 3KRZA 3QFWA 4DAIA 1QT1A 1XIEA 4AWTA 3GTXA 4O14A 4UIOA 3S6DA 1KBIA 3VIJA 3KOZA 4D6DA 4WK9A 1CTNA 4N9CA 1Q6QA 5D30A 5BXPA 2JGQA 4AWEA 3GR4A 3VFCA 3KBWA 4PEEA 2Z6JA 2DZVA 4PRRA 1R2RA 3EB2A 4EF8A 3UWUA 1OEPA 3L67A 3A4XA 3I6EA 3VE7A 1HUVA 4YCOA 2UY4A 1GPWA 3H4GA 1QHOA 1ITQA 2I9EA 4WHBA 1OVDA 1OC6A 1WX0A 3GG8A 4LQ1A 4ACZB 4KEMA 1AZ2A 2HWGA 1AZ1A 4GI8A 5I23A 4CU7A 3G3MA 2BODX 3M9YA 2NZLA 4CVUA 2YXGA 3UZWA 5LA0A 3LY0A 1LWHA 2BMBA 3KWXA 3WJZA 3USBA 2YA1A 2WVTA 5E9XA 3WLOA 1MDRA 4MMWA 3L65A 1TREA 5AYXA 2ZQ0A 3W24A 4LVGA 2J9YA 1WB0A 4AD0A 2W4XA 1IR1A 4I8DA 4BFAA 1TV8A 4EWJA 1CBGA 5D2TA 2DT0A 5EKYA 5KETA 3MJYA 3FKRA 1FOBA 1EPXA 1QFEA 4RE0A 5FAJA 3L4UA 2J8TA 1OWQA 1W1B1 3DN5A 2J7BA 3HG2A 3T4CA 3SUTA 3SECA 4JX5A 1L8NA 1C8QA 4ZB5A 3CT7A 4GYPA 4GC4A 3EWDA 3N2CA 1VFMA 1AA1B 1UP3A 3EEGA 2A3CA 4J27A 4WVXA 3DYMA 4KGJA 4UQAA 3C3NA 1I2NA 3CZEA 1PHWA 1V08A 2VQUA 4L7ZA 1H63A 1PCKA 4HMDA 4PTXA 5HR7A 1VYSX 3BLLA 3SJ3A 1JPIA 2VURA 2WK2A 3TAOA 3E0WA 3PBMA 3LRKA 1OINA 4EXAA 4LNCA 3LBMA 3G1AA 2OGYA 1GNXA 5DT5A 1MRAA 3BZGA 1KV8A 3L0NA 1C91A 1GZ1A 3M6YA 2RGLA 1XGDA 2Y7FA 1SW7A 2R14A 1GOXA 4PR4A 4GY1A 2AQVA 1TWWA 1M41A 1F3XA 2I57A 2Z1WA 3HGJA 1UPPA 3N2TA 1EX1A 2OX4A 5U4NA 1QNOA 1UYQA 2XWDA 1IT7A 1FCBA 2A79A 3E38A 1LORA 4REQA 1W1A1 3B8WA 3GXMA 3II1A 2VWSA 2Z4GA 2CWNA 2P1FA 2YDAA 1ECEA 4FK9A 1CW2A 1A49A 3U2EA 3PNZA 1NOFA 3N34A 2I16A 3QSTA 4NNAA 3OVQA 4EVZA 3NQ6A 5M5DA 2F8QA 3BXWA 2VFHA 1BQCA 4AU0A 4N9EA 2OEKA 1U30A 4CD7A 4GNKB 3STCA 4OUIA 3DBPA 5L6UA 4M81A 4PBFA 4W84A 4EPDC 1U33A 2VTFA 3E1F1 3FA3A 2XIIA 3GDBA 1JUBA 4KS0A 3CEPA 2BHUA 3GYCA 1UKSA 1FH9A 1XJBA 2B0MA 1XYZA 3UG5A 4DI8A 4US6A 1FWTA 1J4EA 3TE9A 2J24A 3LV6A 3GHTA 2YA2A 4IP5A 2O4MA 4L56A 3OVPA 3TUUA 5CZTA 2NQJA 2YB4A 1G1YA 2XVPA 1GVSA 1OCNA 1E51A 5CPOA 4LS0A 3AYSA 1XYAA 1CIUA 4TX8A 1ML1A 4I8YA 1W1VA 1J6OA 3VGEA 4MJMA 3BTNA 2AGTA 3R0DA 3PK7A 4X60A 1ME9A 3T1GA 3NJ3A 4OHQA 1H7XA 4MB4A 3G1RA 5FJIA 3VD7A 1JL8A 4LFYA 4YTQA 4XO6A 3W1TA 2ZICA 3AYTA 5DMYA 3TYUA 3RR4A 2V30A 3IGXA 5MKGB 3WLQA 3VIOA 3V4BA 4FLOA 1EJXC 1T8XA 2OLSA 1ZAHA 1A5OC 5DMMA 4CQCA 3N2OA 1VBHA 3WQCA 4LCQA 2YZRA 3DG7A 1KA9F 3MMWA 3MP4A 1E0VA 3V3WA 1YQ2A 4NYYA 5AFDA 1I8JA 4PCFA 5FI8A 3W1PA 1YBQB 2J6VA 4LYPA 3CHEA 3U48A 4HCDA 4U4MA 4JIIX 3GNXA 2UY3A 1W3LA 1W5PA 3FJ6A 1SQ7A 3P62A 3AIQA 4NI8A 2ZUNA 3CUHA 2CFFA 2VR5A 3TJLA 2VX4A 1FWNA 1F73A 4DXKA 3SCOA 3QV6A 3AHZA 5F1VA 2GDQA 3BVJA 1QI2A 3K30A 3WNMA 4E0CA 1W3KA 2ANUA 1S1PA 4G7FA 4LUIA 2ABBA 4RE3A 1Q6FA 4WDTA 3L66A 1GQNA 2YIHA 2BP1A 3UJSA 3LHUA 1A47A 3B8VA 3VD4A 4ZODA 2I9UA 3EXRA 1E0XA 2QS8A 1EEXA 2XFWA 2V67A 2JF6A 3QV8A 1PBGA 1B9BA 3PTKA 4MAVA 1VFHA 5GJNA 4GUGA 3OIXA 5I77A 3TYCA 1CXKA 3AMKA 1E73M 3W25A 1TYGA 4B5NA 1MUCA 5AN7A 2ZUSA 1OT1A 4NZ5A 1L6FA 3ZMRA 4DUXA 4IG2A 1RV8A 4M24A 3ARYA 4JN6A 3VMPA 1RCXB 4IQEA 4QSHA 3MSGA 2HNHA 1QK2A 2Y70A 2EF9A 5G1MA 3K46A 4GVFA 1UUQA 3DFHA 1FCVA 3MY9A 1VCVA 3DXIA 4UTTA 1IXOA 1ZSXA 4BR1A 2WZEA 1WQ5A 4LY4A 3W00A 3VU2A 4DAFA 4UTWC 1UD4A 4YXGA 1E0WA 1AH3A 4XD3A 3ENLA 1WE5A 1RPKA 5XIMA 1Z32X 4MKSA 1GKRA 1JCXA 5AHIA 5A5WA 2QCCA 4S1FA 4GUIA 2JKPA 3CO4A 1P48A 3GVGA 3B4YA 3A3XA 4AYGA 5J04A 2FHCA 3L5LA 2CZDA 5ABFB 3TFXA 1TR9A 3KDNA 5LIYX 3W1NA 4B16A 1BGAA 3L0KA 4E6MA 1K7FA 4YYFA 3VX0A 1J0KA 1VBJA 2XIMA 4B5WA 1DJWA 7TIMA 1LUCA 1K6WA 3LDVA 3RU6A 2CETA 2VC6A 3HV9A 1BTCA 4I5UA 4NJHA 1W9PA 4AD5A 3BV4A 4GHRA 4DF1A 1G4TA 3F2DA 1PPIA 2R1LA 3NEHA 2FB2A 3CV1A 5REQB 4IP4A 3CC1A 4HBKA 4CNSA 1RCOB 2WHLA 3GTHA 3MPGA 3C0SA 1C8XA 4PL1A 2POTA 1GK8A 2FJKA 4QQUA 2PLKA 1W9DM 5CG7A 2OLHA 5RUBA 4ICCX 4MKVA 4A4AA 2J62A 4S2CA 3BWWA 1JZ6A 5CEWA 2NXIA 1MZRA 1XDLA 2EEXA 4I3GA 1K6AA 3TTOA 2OG9A 2FZ8A 4RE4A 3E2QA 1VQTA 1QRQA 2J8FA 6XIMA 5HULA 3S5SA 4UUIA 1NAL1 1H1ZA 3H2EA 5F2LA 2GOKA 1XLKA 1M01A 3OBEA 5DCEA 3G6MA 1IT8A 4FHAA 1H5VA 4RNJA 3L68A 2ZE0A 5F4WA 1W32A 3C2OA 3QW4B 2QJGA 4HOZA 4A8IA 3PBUA 1C29A 1JVNA 1TWZA 4BKNA 2I5QA 2OTDA 3VNIA 1Q4WA 2GK1A 7ENLA 3HIJA 4LVAA 3DDMA 4AQLA 4V1XA 3BOFA 2D22A 5G2IA 1NU5A 1TX2A 2YBUA 1E6XM 2VFGA 3OA5A 4BQ3A 3F4DA 2DT1A 3SQLA 3I7QA 3UGVA 4C91A 3K4WA 3JU2A 4ASTA 1K8YA 3A9IA 4TX6A 2O7SA 3WH6A 1OABA 4B2DD 1LL6A 3A9BA 3OP2A 3CPGA 2UBPC 4MWAB 3ALFA 1NFGA 3H24A 3RRXA 4GG9A 1XLCA 3WFLA 2ZRYA 2DSKA 5D05A 1TRDA 3M0KA 2WMHA 1MMFA 2G37A 1VFLA 3HMCA 1AJZA 1RP9A 3ES8A 4W93A 1J0HA 3GIPA 3C61A 3SW6A 4O1EA 4NX5A 3WJSA 3HF3A 4RNHA 3WMCA 4Z2LA 3NOEA 3CMJA 4D2JA 1B9ZA 3B04A 3W7IA 3E74A 3QKEA 2HMCA 4Z2HA 2EPOA 8RUCA 3VMNA 1US0A 3SCRA 4ES4A 3NIYA 3BOLA 1ZJIA 5CPQA 4W5ZA 1R85A 1GVYA 4WXYA 3R5EA 1VFTA 2DIJA 1N8WA 4GZIA 2MANA 4LPCA 3IANA 3SCWA 2WWDA 4GZJA 2GGIA 4J3ZA 2DSUA 3ZXWA 1E6PA 2YCEA 5A95A 1A3WA 4HPHA 3CHFA 4R7OA 2PGWA 5I3KA 5BCAA 2H9AA 4JHZA 1FWGC 4PC8A 4HOXA 2WPBA 1FKXA 3UWZA 3SURA 3RLUA 3URAA 1DL3A 2VZUA 5DXYA 3ALGA 3CQ0A 3UEQA 3CZJA 2KX9A 3I6TA 4QTGA 3AALA 4UTIA 5D9OA 4JY9A 3LRLA 4WQ6A 4U5KA 5FEZA 4QG8A 3N3TA 3WDIA 2AKMA 3GXPA 2REQB 3G77A 3VI2A 1JUEA 2VDIA 5E5CA 3VA8A 1Z42A 1CNVA 3WG6A 4HHLA 4UFHA 1GJWA 2FGZA 2WANA 1C7TA 4AXNA 3CZ8A 4KH2A 3LOTA 1EO7A 2NQ9A 4QCFA 1FKWA 4XIAA 1JD9A 3H53A 4ZQNA 1XG3A 2WKJA 4UQEA 4V27A 2YKKA 3I68A 3WLKX 4YHGA 3VZYA 4PBGA 2Z24A 3KRSA 2JIWA 3T08A 4YTRA 1WDRA 3CYVA 2VEGA 1J2BA 3P0WA 1R87A 3AOFA 2C3ZA 1PAMA 1XLAA 1QHZA 3GTFA 4LOCA 2XHYA 1JZ8A 3PTDA 1QAPA 1ZP3A 4XZHA 4CQAA 1K7EA 3QF0A 1OCBA 4LRSA 5DN1A 3BCJA 4DELA 2P8CA 2DQXA 1FWHC 1EEPA 1LG2A 2BASA 1JCLA 2OGJA 2CLEA 3NDYA 4KWWA 3AU6A 3G18A 1HTIA 2O9PA 4GVHA 4IT1A 1JDFA 3ZWTA 4LU0A 1KQYA 3TNBA 1UBPC 3UWEA 4Y8EA 3I7SA 1DWIM 4A3HA 4IIBA 4AX7A 3MC5A 4KEVA 1XYFA 4NVTA 4UTJA 2I5GA 5D8ZA 4AVFA 1VENA 1DEDA 4DWSC 5HQLA 3UJFA 1QDSA 2VC5A 3BSHA 4EXBA 4QM1A 1VFUA 5ECUA 2D0FA 3DENA 5TAOA 3M47A 4BQ4A 3TN6A 1I2RA 1O95A 4PMRA 3KM8A 2QV4A 1LF1A 1LROA 1NQ6A 4M19A 3ELFA 3NZPA 1EDGA 2BS9A 2WSKA 3C8FA 1GT8A 4PULA 3T2PA 1LBFA 3UR5A 2V8ZA 1TCMA 1FXQA 3TW6A 5LIXX 4CQ8A 5FACA 1K02A 3TQ0A 1FWIC 1J93A 1W54A 2A21A 1IR2A 2ASHA 1GYLA 1MNZA 5AKQA 1JRCA 3KP1A 3CAWA 3VKBA 3A23A 4JTUA 3IEBA 1M9HA 4R85A 3ARVA 1R3SA 4Q8PA 2CESA 3V7PA 3SAZA 1BXCA 3TJIA 1V0MA 1DYSA 3GVRA 1MQQA 1IF2A 1PO9A 1H61A 4IX0A 1EKOA 1IWAA 3PZ9A 4HD5A 4KEZA 5E70A 1UJPA 4Q8QA 3O6CA 5EYWA 2FKPA 1K8ZA 2R94A 2BVYA 2VEPA 4CCDA 1VH7A 4S2BA 3NYZA 4Q8WA 1Y65A 3AS1A 5H1WA 5E0CA 3IAQA 1XGZA 1DXFA 3SRHA 3C2YA 1FP8A 3IPWA 1FH8A 4A8NA 3I10A 3BQ5A 3O8AA 3SIMA 1P6CA 4RE2A 2DU2A 3GK0A 2VC9A 3SADA 1O1HA 1A4MA 4IICA 1R3QA 2YBVA 2QULA 3M0ZA 4O0ZA 4AIBA 1I0BA 3ZIZA 4Z42C 2CZFA 1I45A 3N3MA 1WP6A 3MHUA 3VYLA 1HKWA 3KL3A 2WC4A 4MWAA 5IDZA 4JHOA 4OJYA 3GAKA 4KIEA 4ORMA 4LSBA 4S39A 4WIWA 2WM0A 5DT7A 4E8GA 2GVJA 3RXZA 3EX1A 1OX6A 1V6UA 1M7PA 4H6EA 4N9DA 3NDZA 3R94A 4OBTA 1G01A 4LX4A 4JEJA 4KBXA 3M6DA 5KITA 1AH0A 2Y61A 3OGRA 3ZQ9A 4YIWA 1YDVA 4TO8A 1EWDA 1ADOA 3IRDA 5CPLA 2E0PA 2X30A 1KTCA 2Z1XA 1J01A 4FX7A 4R53A 3V75A 5AECA 4HU8A 1EF2A 1OG0A 2PRLA 1FWJC 1POKA 3AUJA 3MBFA 1K9DA 1GYNA 3NQEA 4PGLA 4MLRA 1J0IA 3D47A 1TCDA 4Y9OA 5E09A 4HZ6A 5I03A 3VABA 4M51A 5EFDA 1XLFA 2W61A 1XIFA 3TMLA 3UZJA 2CW6A 4WKAA 3FA4A 1E5NA 3WX7A 3W38A 3DCPA 3M0LA 3DERA 3FKKA 1S5VA 2XGIA 3PPFA 1H7NA 1Q85A 1GQIA 3EWXA 3PP7A 4KCUA 5K7JA 1VIZA 3SQMA 2E77A 2ZUMA 2KAUC 4ORIA 1TTQA 2PGRA 5FEWA 3GXNA 1U1HA 1VJSA 5ABTA 4S3CA 3AMDA 3W7DA 2QPXA 4HSOA 1VKFA 3S5ZA 5LKYA 5HJYA 1YNQA 3ITGA 1I4NA 2WMKA 3U6WA 4F48A 3ITLA 1H51A 3AXIA 4DO6A 4DO5A 1SJAA 3PR2A 8TIMA 2Y89A 4M3PA 4YN5A 1W91A 4HYRA 4PMDA 2A6LA 1BLIA 1W5OA 2X09A 4YTUA 3NZQA 5HPOA 5E93A 3WQ4A 2W92A 4JTAA 4L5ZA 1XPYA 2HE5A 4JTSA 3RRAA 4AMAA 5C8BB 3GH7A 3AIBA 3PWIA 1PZ1A 2WMIB 1OFDA 3KHDA 2DUAA 4M80A 3EA1A 3WLIA 5HQMA 1TJ1A 6TIMA 3MYOA 1E1CA 1W8SA 4QAWA 5ABHA 4NXSA 3GTIA 2PPGA 3L4XA 2Z0IA 1EJ7L 3PFMA 4Q4RA 3PZVA 1FCQA 5DANA 2VT0A 5CGMA 3NAVA 1PKYA 2BTMA 3NL3A 4DLMA 4LEQA 4UFJA 4QDPA 1RAKA 2H3BA 5BYWA 5AVNA 4HTBA 2QCEA 4CD4A 2XIQA 2Z6IA 1TFVA 5J5RA 3ES7A 2Q71A 4JEQA 2OT1A 3C0QA 2POZA 4M7TA 2WYSA 4R88A 4O8RA 4V2XA 2D1ZA 4H00A 3M0MA 3U2ZA 4J1OA 1I0DA 4L61A 5A6TC 2PDMA 1PSCA 4M6QA 2ONEA 2J6XA 1N8IA 2PCQA 3HPFA 3AXKA 2J78A 2VKZG 3LLXA 4AC7C 3BPWA 1XF0A 2YL6A 1WDSA 2DZPA 3MHGA 1QWKA 4DUVA 4R7JA 3R8RA 1W1TA 3N15A 1E0UA 4AH7A 4LRTA 1S2VA 3OLDA 2BVTA 1UD3A 4P7OA 3SO7A 1QI3A 4U10A 3NPXA 3KVMA 1ISWA 1F6PA 1BVNP 1MDLA 1W1PA 1JEZA 4JIEA 4NASA 5JU6A 2VZTA 5FJOA 3G24A 1M1BA 4WY0F 2NUWA 4DZIA 4P7QA 3W07A 3ABSA 4YTTA 4GRSA 3MUZ1 2KZHA 9XIMA 3GUWA 3W1UA 3O15A 2WC3A 2Z28A 4GXMA 1OQFA 3S2LA 4DWSB 5J5DA 1XX1A 3EB4A 3WQPA 1HJWA 1KR1A 1EWEA 1QPNA 2NVCA 5LIUX 4H9XA 1VIWA 4RLIA 4EAMA 3G6LA 5A6SA 3RG6A 3S5NA 2NV1A 2VR4A 3UZ5A 2QW5A 2PWVA 3VM7A 2INZA 1X1ZA 3G5EA 1O4UA 3LI0A 1XP3A 4JR5A 3RN6A 3MI6A 3QZAA 1J5SA 1PB0A 1TSIA 1V6XA 4HJWA 5CGTA 1AQHA 2VI0A 3THDA 2BVDA 4ADSA 5C9RA 4N0RA 4KESA 2V6AA 4A6GA 3DHDA 3FAWA 1Q7QA 3S46A 3VIKA 3ABRA 4GQGA 3WSUA 3OHMB 3CTTA 3HQPA 1EBHA 1R2TA 3UR8A 2XUCA 5FJRA 5B7ZA 1UZDA 4ML9A 1GTHA 1YDYA 3GXDA 3A24A 4F0HA 4MYAA 3ATZA 2ZZ6A 2CPUA 3OW1A 3N1AA 3NPVA 2ISSA 3CO8A 1UR0A 4WDUA 2OEJA 2VRKA 3AAMA 1LJYA 4N4PA 2EPMX 4IGMA 1V3MA 2Q02A 3M0HA 3C56A 3S1WA 3PC0A 2WBKA 4NAFB 4LVFA 4D8LA 5AHLA 4QIUA 3VCNA 3ITCA 2QR6A 4JNMA 3PJTA 3R8HA 5BU6A 1TIMA 4IOTA 4AG0A 3S9ZA 3UXDA 1I9CB 4ZTYA 1X7IA 3KXQA 4XTIA 3LSCA 1ZQ5A 3DGRA 1J0ZA 4HPGA 1PZ3A 3ABOA 1WPCA 4US5A 1E43A 3PBWA 3CK5A 2INEA 2DW7A 5H91A 1H7OA 4KCWA 3WBYA 2P50A 5DQPA 1O7AA 1AQ0A 4TMBA 2RUSA 4XISA 3KLKA 4IPIA 2WHJA 1UC4A 4HCLA 4EPBC 3HGOA 3B03A 3IACA 2C6QA 1OBAA 3TONA 1DJXA 4ZQCA 1SJBA 1ITUA 1MNSA 3NR0A 5AHNA 1TB3A 1E4MM 5LNSA 2DSVA 3FYPA 3HV8A 1UWUA 4GLEA 4MWAC 2IKJA 3VNZA 1XSJA 1TMHA 1S2WA 3K1DA 2I7GA 5HQEA 4W7VA 3ZSTA 3N9SA 5AYBA 3BUVA 4KRUA 5DMNA 4ZSUA 3MI3A 1BTMA 2EBNA 5C6MA 4YCPA 2WSQA 3WF1A 1YTEA 4M5PA 4IIDA 3LGDA 4JS3A 4E8DA 4HK6A 3SUSA 2VRQA 1K9TA 1PKNA 1ZCCA 4V28A 4F0LA 4H7VA 3LU2A 3A6OA 1UWTA 4B5VA 1GPFA 3OBKA 3INPA 1GG0A 1EC9A 2OZ3A 4LBRA 5I79A 4H6KA 4LYKA 4GUFA 4FALA 2E40A 2PDWA 3I6RA 3QYQA 4IMDA 3KUMA 1R3VA 3HJZA 4ECLA 1JCJA 3N29A 1I60A 4WSJA 1E6NA 4IPNB 1FBAA 4D6JA 1KRCC 2PURA 1CENA 3FSUA 1ISXA 2HE8A 2QGYA 2HCVA 1KNWA 4L6HA 3VILA 1YYAA 4UTKA 1E15A 5CC5A 2ZUUA 1DWFM 4PCTA 1HKIA 1OSEA 4CQ9A 3AXMA 1E40A 1ZBKA 1REQA 1S5MA 1H1NA 1POJA 3A64A 3B8TA 4PTNA 3SY5A 2HTMA 3RCYA 4QHRA 2OLAA 3GWQA 3TWBA 1KV5A 4PMZA 5XIAA 3ZT7A 5KMYA 1H09A 2G41A 4RPQA 3N4FA 1SW3A 4PUEA 3E9AA 3B8SA 2BGNE 4EACA 2QIWA 2QCDB 5DRCA 4NSBA 2PTZA 4BA0A 5GVJA 2PWFA 5F7UA 3HFYA 4XBKA 4N7QA 3W7HA 3EGJA 3N2XA 3AMCA 3O07A 2JE8A 2B81A 1QASA 2CBUA 2A0NA 2WLYA 4HA1A 1X98A 3DKJA 3UFYA 1V6VA 2IKGA 3APTA 4YLWA 3QFEA 3GNRA 4K7YA 3T7VA 1VJIA 2W91A 2XVGA 2CZ5A 3EXTA 4O12A 1TMQA 1PX4A 2PDLA 2PTXA 3B4UA 3GVVA 3OIHA 1S2AA 5FAGA 4GI4A 3R7MA 4IUOA 3VCRA 2IPGA 4JYFA 2XFFA 1W5MA 2YDQA 5IXEA 1R9YA 2BGQA 2VL4A 1OHLA 3Q2DA 4C6KA 4IL0A 2D69A 1MZHA 3K8MA 3APGA 4H8NA 4O1CA 4CCEA 4IHCA 3O2LA 4B9ZA 4Z1CA 1WDWA 4L1WA 4K6AA 5CZJA 3IRSA 4WD0A 3FIGA 4B9YA 1XISA 1QW7A 3NQAA 3G3DA 1LT7A 1S1RA 1BVZA 1SO4A 2PA6A 1TRIA 2RDUA 3T0CA 3HGRA 3S3GA 3SUWA 1OADA 4J4KA 3H21A 4NHVA 2C15A 4O13A 4F2UA 5IHSA 1WA3A 2XDFA 2YCJA 3LQGA 3P93A 4PN2A 3LHWA 4O4WA 1TA3B 5LIKX 4OVXA 2ABAA 4LAUA 3T8LA 3CLWA 1D8CA 5KTLA 1OJXA 2BWGA 1XPGA 5HNNA 3SI9A 5JH2A 2PDBA 2CLKA 2IQDA 3KRBA 1UZHA 1B57A 2Y7GA 3FJ4A 5DBUA 5MKGA 2I17A 4A8LA 4W88A 1WZKA 4FX8A 1KTNA 3B0PA 2VEFA 1HN1A 3GG0A 4HA4A 3W4RA 2GVYA 3EDJA 4IF2A 3XIMA 5LYRA 2VC7A 5HPCA 3KW3A 4LV4A 1JZ5A 3NXFA 4XUYA 3GXFA 1RVKA 2OELA 1GORA 5C71A 4JICA 1O94A 2A4AA 4RDYA 1JPHA 3BGJA 3MSRA 3BLOA 2E6YA 3UNTA 5LGXA 3IUIA 2D0GA 4TV5A 2XM2A 1GOOA 4WDWA 2EPLX 3CV6A 4UC5A 4W5UA 1EIXA 3GYEA 2YDRA 4ZOCA 4E2VA 1K8CA 1F5ZA 2V2DA 4DF2A 2Y4SA 1XSIA 5CZKA 4A05A 1OT2A 1FA2A 2CBVA 3EOEA 1TTJA 1QO2A 1OYCA 4TUFA 3TC7A 3WD3A 3FX4A 4PZVA 5A8QA 3AROA 3MO7A 3AHTA 4QEEA 4H3DA 4CD8A 3C2VA 1WUFA 3EX4A 1SO6A 1JQVA 1Q6RA 1QW9A 1EC7A 5BRQA 1E4LA 1MQRA 1HJVA 3DU0A 1UMLA 4BWLA 3G1YA 1MEWA 4M6UA 5DFAA 2HRWA 5DLCA 2PFHA 3AHXA 1OFPA 2IS7A 3VKDA 1J6PA 1ICSA 3IIZA 1PS9A 5CJMA 3PUOA 3QRHA 4AISA 2XGBA 2YGYA 3C6CA 2QVNA 1JNDA 6ALDA 1JFHA 2JKEA 4R3UA 3RPMA 2DIKA 1IZJA 2WZIA 5HWJA 1UD5A 1FFQA 3GBDA 5IOBA 4OTKA 3CUFA 2AMGA 1ZJHA 4GYKA 4L4MA 3PG9A 3B8DA 1C8YA 3TDFA 1JYVA 5D8WA 2Q6ZA 2ZUTA 1VLWA 3ZLGA 4RXGA 1OCJA 2VCAA 4XO7A 2BV9A 1JG9A 3AO0A 4M6VA 1B31A 4MB3A 2V0TA 1Y5WA 3GHSA 3DOPA 1C9DA 1RD5A 1U22A 4UQDA 3MZ2A 3NPUA 3S2CA 2VR2A 3NVDA 3PFRA 3RITA 4GYFA 4IUGA 2QUUA 4UTTC 2V81A 1RZMA 3H2MA 3U5YA 1XRSA 5IM51 4IIFA 1G9HA 1JDEA 3QGKC 4AF0B 5EA9A 5GPRA 2WM1A 5D37A 3AHVA 1UZ1A 3BO9A 4I9MA 2DZTA 1IEWA 4XZNX 3WUFA 3E2VA 1VF8A 2ZUVA 4JN7A 4WEVX 3VE9A 1PHQA 2GJLA 4GK8A 1JZ4A 2D3NA 4JYDA 5FEPA 2FPVA 3LGGA 4HN4A 3R0UA 3VGBA 3LHTA 5CH9A 4Q8VA 3C2EA 3RILA 4DJFC 4KQNA 4S3JA 3WLNA 4M0XA 4I90A 4QITA 1R7AA 3HA1A 1ADSA 5CLTA 1E4IA 2E9LA 3HU7A 3OVGA 2RFGA 3GW3A 4D6GA 1N7KA 2J7CA 4XSLA 1DKWA 2ICSA 3B0YA 1CLVA 2BXVA 1F4HA 3FHAA 3FXGA 5A8OA 4R27A 3CS2A 2JEQA 1AJ2A 4KKXA 4R7WA 1MFVA 3C3UA 5BW6A 1L9WA 3TOPA 3POCA 1UKPA 2WVUA 4F40A 2FFIA 4JY8A 1EOMA 3R1ZA 5CSSA 2D2OA 2OMAA 3EKZA 1J18A 2EKCA 4TVUA 4FP1A 3UCCA 2GGJA 3RDKA 4IQJA 4ZOBA 3PPCA 4Z08A 2ZXQA 5DRIA 4PUUA 5CC3A 1KM3A 3AYRA 4IFRA 2OX1A 3K8LA 3YPIA 1WKEA 3HG5A 2IUZA 4V15A 4JIQA 4WSKA 3AISA 3QPYA 1P0BA 1X6NA 1ONXA 4GQBA 5I3DA 1ZPTA 4CVWA 5FESA 1TPWA 2NWRA 4LC6A 1CX9A 3MJMA 4XBJA 1LBMA 3DFPA 1WAUA 4E4PA 3DESA 1V79A 5A8GA 4UFKA 3MCMA 4S38A 1ME7A 4Z2IA 1FXPA 1CLXA 5TF0A 2YCLA 1QNVA 1A5LC 3NXLA 2BOFX 5K9CA 4NRRA 1UMYA 1QCWA 4ZFMA 3WQ6A 4UBPC 3AWNA 1GVFA 1HQTA 4QCEA 3M44A 1XIJA 1R2SA 4AMCA 1O66A 3KBVA 3AZSA 3W7NA 3WDHA 1XUUA 5HMSA 1TWSA 4I7WA 5A69A 1JI2A 2XWEA 3KAOA 4L4OA 4MOZA 4ATWA 3AMLA 3ECQA 3OQ8A 1B3YA 3TCSA 3WBEA 3NQFA 3NQVA 5BWFA 4GISA 1U1JA 2OSYA 3FHQA 5LZLA 4NU7A 2GDUA 3U4AA 1B1YA 5C7VA 1EUAA 1AJ0A 2ISFA 3LNPA 5A8NA 1WDPA 2PDYA 1PWLA 1GGOA 1FHVA 2BXYA 4HMCA 2WCAA 3REQB 4Z1DA 3W75A 4GACA 2PSNA 4TMCA 1XLJA 4XKMA 3TSDA 3PANA 1TQJA 3WQVA 2EO7A 4JL2A 2BLEA 4PUNA 2E1WA 3N9KA 3SGGA 2X1IA 5FJJA 4BF5A 1XC4A 1JD7A 1A53A 3RCMA 2X40A 2DUXA 3MUIA 5TBOA 4ZQMA 3G22A 4EXQA 2XH4A 4LCSA 2WB5A 2FTPA 3VNLA 2RJHA 1X1OA 3STEA 3IVSA 4M1BA 2ZX6A 1F6KA 3L4ZA 2WHMA 2Z29A 5A6BA 1ZAJA 3GD6A 3Q37A 3VC6A 5HAOA 4LEFA 5G5IA 2ZXBA 2FLIA 1SMAA 1UKQA 2YR1A 3CQHA 2VX6A 4C6IA 1XH0A 3LHZA 3WF4A 3EDKA 4HN8A 3SDOA 4NNCA 1HO4A 4NZJA 3W26A 3ONCA 4FNQA 3BCDA 1HJQA 5K4ZA 1GJUA 1HX0A 3F4NA 4M1RA 2NQZA 4IMGA 3VIGA 3WK0A 2HROA 2PEVA 3MCOA 1FH7A 1NP2A 6CGTA 4K8GA 2PU0A 2WVSA 3W1MA 4UTUA 4G1KA 3SY8A 2Z2AA 1HL8A 3VNKA 5AHFA 1KLZA 3W87A 3UPWA 4A2SA 1DORA 3T55A 1SZNA 2PWUA 2WLZA 5G4EA 3V5FA 1VBRA 3TMQA 4A29A 4OGZA 4DBUA 3LZ3A 3PS7A 5A3HA 4AY1A 2WZTA 2A5HA 4FNUA 2X1TA 4C6OA 4LUJA 3EOUA 1U83A 1KW1A 3JUGA 3R2GA 3A4AA 5A6AA 4MWAE 3L2LA 1Q7ZA 2AQWA 1BHGA 8XIAA 4HNOA 2C0AA 2ZUWA 2NV9A 3VINA 1KBJA 2Q8LA 1X38A 4LAOA 3OQEA 4MJZA 1V3JA 3W84A 5T26A 4O1DA 4JTFA 3H4WA 1WO2A 3KEHA 1E1EA 5DMLA 1ZFJA 3W88A 2ZA2A 2FYMA 1KFBA 1OGSA 4Y9MA 4YJ5A 3WDJA 3SFWA 7ODCA 4K2SA 5A6KA 4CEUC 2C1HA 1Q66A 3LERA 1OFOA 1UR3M 4IZGA 2Z27A 3PPGA 1GVRA 1E5JA 3OLIA 4ACZA 5BOEA 4DJFD 1ONRA 1RQEA 4NILA 3TEVA 1Q6DA 4C6QA 3OZMA 4L4PA 1SFJA 3GR8A 2PF0A 4PCNA 5T9CE 2QHAA 1L6GA 4FLRA 4V1YA 1PDYA 4HGXA 5D4YA 1A5NC 1MUMA 1V6YA 4IFKB 2CLIA 5G2WA 4ML4A 3A4JA 2VELA 1KFKA 5BOFA 2UY5A 2WZMA 4BZYA 1JRBA 4HNCA 1EJVC 2ACQA 3GC5A 5E9AA 4LWWA 3PZNA 3GIYA 1J8VA 4XAZA 4PYSA 1GWJA 1UWSA 2ZA1A 1TKKA 4J7RA 3MV01 4JZ5A 4XKYB 2OVLA 2WV8A 3QV9A 1J5TA 3M5ZA 7PTDA 4GUHA 2NUXA 3KRUA 2YA0A 1SYTA 3WQWA 2PF8A 3BAXA 3ZVHA 3E96A 5D38A 1PZ2A 3W9ZA 2PU1A 2G50A 3B0XA 3LSBA 4MYXA 3D3AA 5M03A 4IFOA 1LL7A 1REQB 5JH1A 3HFTA 2WO5A 3EMCA 1YPFA 2DGAA 3RU8X 2VGGA 1ZL1A 2AMXA 4AD1A 2QUVA 1DQXA 3LTPA 4BI5A 1ENUA 3W71A 3WZ0E 3P80A 3GH4A 1OZMA 1IIHA 2G4JA 1PVNA 2QIIA 3LHYA 3U9IA 1P1MA 2Y8VA 3HM7A 1CLKA 4GZ7A 1T8QA 1EB3A 2DZAA 3U0HA 1N2VA 3CUGA 1PE1A 3QKZA 3TKFA 4RCXA 3IWPA 3BARA 3EXSA 2FTWA 4HHMA 5JQ9A 4RDWA 4JGDA 3G8EA 4FA3A 1TUFA 4GQRA 4Q4MA 3NGJA 4N6EA 1V0KA 2XSAA 3A5VA 3S6OA 5HANA 3UCQA 3O16A 4B5TA 1KGXA 1EZWA 1IWBA 1W1IE 3VGFA 1OC5A 4K7VA 2DP3A 4DXVA 1VRXA 1VCGA 3ITYA 2YW3A 4JKKA 3TSMA 3ITXA 3NNTA 3PZOA 2VDHA 2EG8A 1J2WA 4DUOA 3GXTA 1M53A 3WLLA 4GCXA 3TZFA 3IK2A 1TVLA 2Z2BA 5KZMA 3EX2A 4ERGA 4AZIA 2ZXDA 3P74A 2GK1B 3B97A 1BFNA 1FHDA 2JIEA 4WJEA 2DZBA 4L64A 3KP0A 3QOMA 2PTWA 1MSSA 4E2DA 1J11A 4GIEA 2DDXA 5IFPA 2PRHA 1RBLA 3LNMA 5D32A 3N6JA 2GQ9A 4A8RA 2JALA 1I1WA 5HMDA 1QK0A 2AOSA 3DFQA 4MAZA 2FVKA 2NLIA 1E4NA 4IMAA 3KZSA 2H90A 3H6OA 5A2CA 4UB9A 4DUWA 4FB7A 2CZVA 3AQUA 3ZT5A 1XCWA 1NARA 1ITCA 4HK5A 1E70M 2AAMA 3KOXA 2V38A 1E6QM 1TG7A 3W37A 4PMJA 1SU5A 2DIEA 3F5JA 5LIWX 1CGWA 2P10A 3ARQA 2NXHA 1H50A 2NV2A 1H0IA 4DJDD 1XLMA 5PTDA 3PJWA 4AX6A 3DH7A 2XSXA 3GG1A 3W2UA 2ZA3A 3BW3A 3WY1A 4WY0A 4UR7A 3U5UA 1PIGA 4CUCA 2WNQA 3B05A 2OOGA 2YDSA 2WQDA 1NWRA 3CWOX 4Y6GA 1FDYA 4XD5A 3UA4A 2QCLA 4HT3A 3UG8A 3GY1A 2EAWA 4ROQA 3W7LA 2H3DA 3QLLA 1EXPA 3THCA 3VOGA 2BZNA 3MTWA 3NVTA 1BF2A 5BROA 1SO5A 4TR9A 3QLDA 1TPB1 3RLHA 1JF5A 3W81A 3LHVA 4XZ9A 1GOWA 2QPSA 3WDPP 4IPJA 1KBBA 3CWNA 2EG7A 1AD4A 1LCOA 3GNNA 2X0YA 1US2A 4QGCA 2BSLA 3BANA 1XH2A 4DWDA 1GQJA 5LA2A 4JTIA 3NGFA 5MHBA 3QPZA 1U5VA 1ADDA 1ME8A 1AQFA 3DHFA 4B2DA 4AEEA 5FD0A 1M03A 4DB7A 4K1WA 3WNLA 3V1HA 2YCLB 1JUKA 1P4CA 3QC0A 2OQYA 2BFGA 2B7OA 1KRMA 1A5MC 2CLLA 3TZNA 4AVNA 3MMUA 4OWGA 1VFSA 1NWUA 2AQOA 3V0SA 4B4HA 1DE6A 3OYXA 2CLFA 4PB4A 4BF9A 2VM8A 3PUDA 3UBPC 5IBXA 3A47A 1RLDA 4P61A 3UR2A 3TFCA 2WSPA 2DT3A 3BC9A 1VPQA 2CNCA 4J3VA 1TWDA 1EF3A 1JCNA 1BVWA 4NRSA 3N13A 3UF9A 3UP8A 5CCZA 1NH6A 3LG3A 1P0KA 1FCUA 3ITOA 1W3JA 2E5CA 1RXOB 3I4EA 3WLMA 4XAPA 5LNUA 3D6NA 3BAJA 1QNPA 4GFSA 3HQ1A 4Y9AA 2HPIA 5D9PA 3WK3A 3DYOA 4QG9A 4FXSA 4K1GA 1NFBA 4ZO9A 2ZVIA 2E68A 2J25A 2OT0A 4IMFA 1TPH1 2GJPA 1EDTA 2DVXA 4UWMA 1EA9C 5ENLA 5CC7A 7REQB 1KKOA 3CHCA 3AIEA 2WW5A 2O55A 1J79A 3NZGA 4ZO7A 2SFPA 3VIPA 4HTYA 4JQ4A 1M65A 1SGJA 4MNLA 1E3ZA 1XFBA 4C6NA 4KWOA 1O5KA 4AIEA 4DBWA 4S3EA 3HQOA 3JZUA 5CLWA 3B9NA 2GZXA 2DVTA 1RQBA 2PTDA 3FA5A 1A50A 1NJJA 4FXRA 5H8UA 3GNOA 3GC4A 1LUCB 4KFPA 1LRTA 5F1UA 3CB8A 4MSSA 3GZ3A 4CNOA 2BHZA 2OYMA 4HPNA 3THQA 3NQ8A 4MPKA 1J10A 3S5YA 2I14A 1WUEA 2EG6A 4KMQA 3ZO9A 1DJQA 1PYMA 4G8TA 3GG7A 1WCGA 4DI9A 1Z48A 1JF6A 3TC6A 1VYPX 3SEPA 1VZWA 1DE5A 2GVLA 4GMEA 3B9AA 1SFSA 1YTKA 3VDGA 3G1DA 2Y8KA 3SRDA 4C65A 4LYQA 1NP0A 1Q63A 3H2OA 1TVNA 2DPEA 3BG9A 1J12A 1UD6A 9RUBA 1ISVA 2TYSA 5CAHA 2QCNA 5JIPA 1RJPA 1KM2A 2Y7DA 3IJQA 4RX0A 4IWWA 1JCTA 3N6HA 3T05A 4H9VA 4YL2A 4ZCWA 4AB4A 2PDJA 3ANYA 3WQ5A 2VFFA 4BHYA 1L2QA 4MDOA 5LHFA 1YMYA 3OA3A 4Q8NA 1JDAA 3WEMA 3GIQA 4XZIA 4JTJA 3O05A 4U28A 3CHVA 4F2BA 3S2MA 1BYCA 4IG2B 3L0GA 4LUTA 4E2OA 3NL5A 3BH4A 3UXLA 4AEOA 3DIPA 1ICQA 3VNDA 3N19B 4XB3A 1Y8BA 1MWOA 5I07A 2BY1A 4HVXA 3MDUA 4GABA 4PMOA 4AZGA 4MZ8A 3WCZA 4W4QA 1VLIA 2OOFA 1PXGA 5FSEC 4HPJA 4K39A 2WJDA 1LLOA 2GWGA 1AMYA 2V69A 4WKHA 4W7UA 2YFNA 3NPWA 4BF7A 3E49A 3AMGA 1HP4A 3EX3A 4QE5A 2XZ7A 5CPSA 3MQTA 1RD6A 2E5BA 1JPKA 4PB5A 3TQKA 3EWCA 3FCPA 1AW2A 1EGZA 1GHRA 1RUSA 3PNUA 1OYAA 4H4IA 3VMOA 2VMFA 2JEPA 4DY1A 1V03A 5D04C 1LOSA 3STGA 3CZGA 4ENLA 4HB7A 3EAUA 1BSLA 3VKAA 3NEVA 2VEMA 1TQXA 5K9DA 1W3TA 3TYBA 4O11A 2ALRA 3VO0A 3CIWA 1X97A 3WQDA 2HK1A 5C55A 5LA1A 3T6CA 3LPGA 4DBSA 5HDRA 1J0YA 1VFFA 4R9XA 2WAGA 5D9NA 4Z1YA 4JIRA 4MADA 3M46A 2V5BA 9CGTA 4P8XA 2Y8UA 1MXDA 2V2HA 3FLUA 4PTMA 4MWAD 1W37A 4GFIA 4PE8A 4KF1A 4ILSA 1XYLA 2AL1A 2OODA 1XUZA 2DH3A 4IFKA 2PDNA 4X0VA 2QCHA 3T4WA 4AWSA 4IJCA 1QNSA 2YYTA 3ZJ7A 4JTRA 4AZBA 2J7EA 5HUOA 4FOJA 4U3AA 2YXOA 4O54A 1AH4A 3OU8A 3WBWA 3NQCA 4O19A 2PP3A 3ME3A 4NAEB 2F6KA 4FNPA 4NI3A 2J13A 1ONEA 4MFDA 5DX7A 2R91A 3L5AA 3FY1A 3HZ3A 4OE7A 3LCGA 4UNKA 2YL5A 4NX0A 4B5XA 1UA7A 4MF4A 3PPHA 1TV4A 1FWEC 2C1GA 2ZRWA 1WNOA 3WENA 3CJPA 3TW7A 1K77A 1F7BA 2J7FA 3RFAA 4DEFA 4G1NA 1JYNA 2Q8XA 5F2IA 3CT2A 1EL3A 4C60A 3CQKA 2GQ3A 4AZHA 3DYPA 1KFWA 1QPRA 1EQCA 3LTSA 2OPJA 2YB1A 3WUEA 4K8HA 5FL1A 3RJXA 1QXLA 1TZ7A 3UT0A 4DHGA 3P5ZA 3UWQA 1ZNNA 3GDKA 3EWUA 3OG2A 5TIMA 4ZO6A 1A5SA 1JGMA 2CHNA 3VK5A 4Q4SA 3ARXA 4IXXA 1SMDA 4GPNA 2FHFA 3W1RA 2GYIA 5DELA 1KM4A 3CV7A 3DAQA 1WXJA 3ERPA 1H4PA 3NQ2A 3QHMA 4BJHA 3TH6A 3KOYA 2VOTA 3KFTA 2OQLA 4NZ3A 5HR6A 4K37A 5LHEA 4YNGA 1N55A 4KRZA 4AYSA 1GCYA 1YXYA 3CUXA 3W7KA 1LBLA 2Z2UA 3GS6A 1JGIA 1EYEA 4AZ6A 3OYZA 1Q4NX 3Q58A 4MLJA 2B4GA 3EMZA 5C2XA 3V36A 3RLVA 4QROA 4YHEA 2IQTA 3CM4A 1UD8A 3WELA 2BNJA 1TTIA 3KBJA 2IPJA 4JTTA 3ABXA 4K3ZA 1XBYA 2NWSA 2WCSA 4KETA 4PMNA 5CSRA 1KFEA 2P53A 3LM7A 3WNOA 3ARPA 3K4DA 2XN2A 2V5JA 2CERA 2C79A 3K1GA 4ZOAA 4JHMA 3TP4A 3H7RA 3PM6A 2VCCA 2YSWA 4W7WA 1JIBA 4PCPA 3MUXA 1SJDA 4OU1A 1XLGA 5FJTA 3OGVA 4FX6M 4D1JA 4GXPA 4UR8A 2MUCA 1Z8AA 4H6QA 1Z44A 2OYLA 4MHBA 1UQZA 4D6CA 1EX5A 3M0JA 1UROA 2PAJA 3G1VA 3RM9A 1XBVA 3CL6A 3TOYA 4UNLA 2QUTA 1W2PA 3W2KA 1UPMB 1YE4A 4JTCA 1P6WA 4J28A 2GJRA 1V6WA 3CXOA 2ZDSA 1PKLA 3UD6A 1EHNA 1PWMA 1BXNA 1GKQA 1VPYA 5I0DA 1QW8A 3MWCA 2Q09A 4MZYA 1W9BM 4UFLA 6XIAA 3HURA 4UFIA 1R3YA 3QGVA 4C6BA 2V9DA 1CB7B 1Q6OA 4H9UA 1XIDA 4RW3A 3D3FA 3CIXA 3PWAA 1TE6A 1AK5A 1NFPA 2D24A 5I24A 3NQBA 4P8UA 3WKZA 4ADUA 2GL5A 2YOCA 1YLVA 3UWVA 3MZNA 4A2RA 4PUJA 4AZCB 1RP8A 2VHLA 2YCKX 3MDWA 3VOIA 1UQYA 1UCWA 4QJ5B 4GQQA 3HPSA 5I3JA 2DQWA 1SVDA 3EDFA 5BZAA 1ZGDA 4GH3A 4KEUA 1RK6A 2J9ZA 2XVKA 1UR8A 4GVIA 3DUGA 3WK2A 3T42A 2V82A 3DFNA 1BG4A 3AIUA 3H2AA 1UB3A 3W82A 2ACUA 3CL8A 3ARWA 2NXGA 5DO8A 3O63A 5GNYA 3MS8A 1UWRA 3WEZA 3ARRA 1CZ1A 3GHUA 2J66A 4UMCA 1J0JA 2CC0A 2W3ZA 2EHHA 5E6ZA 1RVGA 1YTDA 3LENA 3LCIA 1X96A 1E6RA 3N4AA 5CGQA 1R47A 1UWIA 2WCGA 2UZ9A 3MSDA 4XAYA 5CZ0A 1Q7MA 2W63A 1HGWA 4Q4OA 1MW2A 4QISA 4UCFA 1DBTA 1RA0A 2E3ZA 3LM3A 4I9AA 1NVMA 2PDUA 3RPTA 4Z0JA 4U31A 6A3HA 1K3UA 4NG3A 4PSRA 1SUXA 2NVAA 4XZBA 1ZTVA 1UIOA 4RNFA 3T0DA 2AAAA 2OR2A 1QOXA 4KWUA 1TJ2A 3VGHA 4MNJA 4B3ZA 4PL2A 4P8WA 1JZ7A 4HZ8A 4X9YA 3GH5A 1DP0A 2CXEA 1OFQA 3Q67A 5H8PA 2W79A 5KZ6A 4AZ7A 5A1AA 4C90A 3GDLA 1JXKA 3I3BA 4RL3A 1R3TA 4IMCA 3S4TA 3S83A 4PMUA 1FWAC 1G69A 1PIIA 4JFUA 1XRVA 1HF6A 1FDZA 3OZPA 2VD9A 1XYMA 4FO4A 4LVDA 4F0SA 2B7PA 3NL6A 2QF8A 3DI1A 2Z00A 1LRQA 5FEXA 4J40A 4MUPA 2RDXA 4BCEA 3V5OA 2V3DA 3CQJA 3KBNA 2PZ0A 5I00A 1IEIA 3LTYA 3SSJA 1S3HA 3H55A 3FNDA 4P8VA 1FDJA 2VNCA 1V77A 3NWRA 1UR4A 3P84A 3WBAA 3MP3A 2HS8A 3R58A 1IXQA 1E9ZB 4HKPA 2OU4A 3N11A 4GX9A 1NEYA 3IS4A 1LRNA 3AXHA 4DZ5A 4C7FA 4YVPA 3OVRA 4GJJA 1Q45A 3TJ4A 3RNDA 4QXIA 4L9ZA 1GZJA 1F8IA 1QHPA 3SN0A 1ZENA 1KXHA 4QNWA 2XJ7A 4L1GA 3SCVA 2OWWA 1KFLA 4Q6XA 1RR2A 3TN5A 1Q2SA 4IIGA 4V33A 3S1GA 1CWYA 3NSMA 1L8PA 2E1DA 3D0CA 1U5JA 4JTEA 3IIOA 1MW1A 3W7OA 3KOFA 4GJIA 2DJXA 3AJ7A 4YTSA 3D5HA 4ICNA 4X9SA 1M5WA 3FXYA 4P5UA 3WD4A 3P8JA 3F5LA 1IGWA 4OECA 2Y88A 4QQ3A 4LTSA 3DKLA 3SSZA 1Z6KA 5JBEA 2I1OA 3LN3A 5CJNA 3B0UX 4XZMX 1WXYA 4EF9A 3W2NA 4I5XA 2ZTKA 4WOZA 3N6QA 4EX4A 1JAEA 4IGNA 3NQGA 1EJRC 3UA3A 4ONVA 3UU0A 5I3FA 4JFVA 4HA0A 3DBNA 2Z7GA 2C7FA 1XBXA 5G4WA 3CZLA 2Y5SA 4WF7A 4OIFA 3VD9A 2Z1VA 1JAKA 3RJYA 2QDEA 3BJTA 2XFRA 2A6NA 3LK6A 4JL1A 3OHIA 3HB9A 3H8AA 3S1XA 3T2QA 2GJXB 2CYGA 3IAPA 1P1XA 1ZCOA 3TROA 3W86A 4K38A 3GFZA 3JRKA 2HZGA 3N73A 4LW7A 1I2OA 5U7SA 4GC3A 1FRBA 3VGGA 1DIKA 3W3OA 4HU3A 5EL1A 5A6MA 5I2UA 3THUA 5EMKA 2CLPA 4TIMA 4M56A 1OG6A 3BAWA 2VGFA 2W6RA 4CD5A 3K2GA 4HYVA 4REQB 1LWJA 4Q8TA 1P43A 4NL1A 4MB5A 3MA8A 2A3EA 2R8WA 2WVVA 1B4EA 2YJQA 1KCXA 4O1BA 4Q32A 2ZX9A 2GUYA 3I3EA 2D20A 3CLMA 3FYOA 4LS1A 4MG4A 4HNTA 4NP7A 4W86A 3R6IA 1EP1A 3A21A 1RALA 3QW3A 3QQWA 4LAMA 5CBJA 1XCFA 4QLJA 3DEQA 3NQDA 1R3RA 4UOQA 4HZ7A 1TVPA 3L4WA 1IZKA 3MMTA 2ZZ4A 4LB3A 5HXMA 2WNZA 4PBEA 4KERA 4GA8A 2PBGA 3QR1A 1V0NA 1KWKA 4FIRA 4LALA 1E56A 4GWEA 3MYPA 4I9TA 2QQ6A 2PWDA 4BI6A 1QNQA 4IIHA 3UPMA 3PSVA 5EMLA 3L4VA 1VHCA 4GBDA 3SN1A 2VUNA 4Q33A 3AUOA 3RF9A 4DYKA 5EY5A 1KM0A 1UASA 3JS3A 2FPYA 1WDDA 4ZA0A 1UH4A 1XQKA 5LSMA 3OO2A 4LT9A 1XBZA 4D6HA 3AZRA 4Z2KA 4YYCA 1S38A 1IZCA 3P7YA 2F61A 2ACRA 5C70A 2VCBA 4AIOA 2ZADA 2EPKX 2J88A 3RUBL 4H41A 3VDBA 5AY7A 4RDZA 4PFMA 3TYEA 3VKJA 3WEOA 2BX7A 4J2PA 3TYAA 1H41A 3CMGA 3FGCB 4Y9PA 5FA5A 4PRTA 4EIVA 3VIHA 3MKKA 4ZQPA 1F2JA 1JDDA 4C1NB 2W66A 1MRQA 2CHOA 4Z2JA 1IHIA 2GGGA 2ESCA 4MKNA 3U8GA 6REQB 1RPXA 4PFHA 3VOCA 5IRPA 3E2RA 3TLQA 2CLMA 3DFSA 4WRHA 1FWRA 1HKMA 4H8VA 1KB3A 1JULA 1AL7A 4EK7A 1TWIA 1K70A 2OCZA 1US3A 3UY8A 3FJNA 3EWYA 2E8ZA 2VP8A 4O28A 4X61A 4HQVA 5HINA 3KLLA 1BAGA 2YW4A 3QZ6A 4JTHA 1SFLA 3EPMA 3VIFA 4LJ3A 2C19A 3OZYA 1HW6A 4RJEA 2B31A 1HKJA 5M3WA 1E9IA 3CNYA 2REQA 3L9CA 3DHUA 4IX2A 3M16A 1BWKA 3BJFA 3ORWA 4WJ8A 5HMFA 2E25A 4WLCA 3TSBA 2Z25A 2ZCGA 3URBA 2PWHA 1BRLA 1QPQA 1BQGA 1YEYA 1O5RA 2G5WA 2PRMA 1W31A 1MFUA 1XCXA 8A3HA 3PJUA 2QJIA 1X7FA 1TZZA 4IH3A 1T5AA 2GGEA 3QV7A 5C9ZA 1NWSA 4NAFA 1SJCA 4ROPA 1W9XA 3HPAA 3V18A 4RW5A 2CLHA 2OZ0A 1TV7A 3TU9A 3M1ZA 1VFOA 1GUVA 1C8VA 3TCEA 1AL8A 3PTMA 3DGBA 2ZC8A 4H1ZA 3GXIA 4Q4PA 2EGZA 2WJZA 4Z1AA 2P3EA 3A4WA 4FIQA 4ZBCA 3EX6A 2F2HA 1EO5A 4GX8A 2GOUA 5CKSA 4Y2WA 2DSZA 1IT0A 5GJPA 3B9EA 3LCHA 3NTYA 1A3HA 4GI6A 2X2GA 1OGBA 2OXNA 3MI2A 4OBSA 3CQIA 3WD0A 3PZTA 4HHHA 1M7JA 4XX6A 1QPOA 1R38A 1T6MA 1HIZA 4OKDA 3C2RA 4Q4QA 4O57A 3GO2A 3OLEA 4E3TA 3FEMA 3BSGA 4WGHA 4B5UA 5JBFA 4CCZA 4RNIA 3H12A 3VZXA 2XG9A 4Q7NA 1EJUC 1HJUA 4JD4A 3Q45A 3IJ6A 5E1QA 3A12A 3IVUA 1P0DA 1KWGA 4JQ2A 1DIDA 2PTYA 4AY8A 1KLYA 2TSYA 3ZS4A 4IXHA 4Z17A 3NURA 1PUDA 2WXDM 1ODUA 3BW2A 3N17A 1F61A 1FP9A 3QHOA 4IM4A 4DLFA 1K7XA 1DWJM 3JZEA 4HP5A 1D8WA 1WZAA 3VDCA 1LOQA 2W9MA 5GNZA 3CL7A 2NSXA 3EYPA 2E5DA 4TQTA 3GNPA 2O4QA 3TV8A 3ZSSA 4XZLX 1JPMA 3F7JA 1PX3A 4X22A 1UH3A 4GNVA 2R1PA 4ZVJA 4IJBA 5TD4A 1UWQA 3BLIA 1R3WA 4NIRA 1K9EA 3KTSA 4L9XA 1A3XA 3I3DA 2NX9A 3VVGA 4WCJA 3IJDA 4PTDA 1VD6A 1YDNA 3OJGA 4GOAA 4J3UA 4JTDA 2ZX7A 3FEQA 1H7RA 2TRSA 3GFYA 3SCQA 2GSEA 1FWWA 4U33A 3GFXA 2Y63A 3QY6A 3WMBA 1JQXA 2ZE3A 1EJWC 4ZFCA 2WKLA 1BG9A 5BOOA 2NSOA 3RPDA 3VIMA 3CH0A 3KL0A 5AZ0A 1W3IA 3SCNA 5BXRA 4DJDA 2WJFA 4S3BA 1DJIA 5AC6A 4U3CA 2VOMA 1G0CA 3VDAA 3M43A 2O7QA 5IFTA 1OFRA 3C0LA 3WF2A 3HMJG 3G1FA 2H6RA 4CU6A 3MKVA 1GJPA 3ZJ8A 3G1HA 4RPPA 1Q8AA 4F8XA 2CIPA 3SB0A 3EDDA 1KFJA 1EGVA 3STPA 3TW9A 1PTDA 2QYGA 5E0KA 1SZEA 3CAVA 3ID7A 1JJKA 5XINA 4NUWA 4O8AA 2XH0A 3KTCA 1KBKA 1JYXA 1OM0A 4JYEA 2YFOA 1Z9AA 3DX5A 4C1KA 1BWLA 4KWVA 4LC8A 4DPQA 1ISYA 5DF0A 3W7PA 5I7GA 5K3VA 1WZLA 4NQ1A 3ZR5A 4JX4A 3HN3A 1Q6CA 3WD2A 1FFRA 1H7WA 5T8GA 3VPLA 1GEQA 2A7NA 2WNNA 4W8LA 3IARA 1IWPA 3HGSA 5FF3A 1M04A 3M07A 3URNA 2ZOXA 3BV7A 2MNRA 3L5MA 3QJAA 2FZNA 2VENA 1CGVA 1EFZA 3MUCA 2J27A 5EPDA 2WSYA 1Q5MA 1GEHA 3S6TA 5CJ5A 2XIOA 3GUGA 4FMVA 3P2VA 4MTVA 3ZVHB 1UOKA 1EPVA 1MW0A 2FIQA 5E6YA 1WV2A 2CKRA 3DFYA 4PTVA 3ABQA 4Q6JA 2PMQA 3SIZA 3EPNA 1Q2RA 4JFWA 1DTUA 2WPGA 4Q7IA 4B91A 3PB0A 4F0KA 3VUSA 1I2QA 4KRTA 1ZUAX 2G97A 4UQCA 4E4UA 1HVQA 4GYPC 3M64A 2GJXA 2FB3A 2VXNA 4CQBA 1XIMA 3TWAA 3MUAA 4A3QA 1FX6A 5DEZA 6PTDA 1YNPA 2CBIA 4AEFA 1XD1A 1U5HA 1W6TA 1LL4A 2E9MA 3LZ5A 3TIMA 1CXFA 4ERIA 4FXFA 1A80A 1XLHA 1O5XA 2BB0A 3WQGA 4YPJA 3TK7A 4XK2A 4LBSA 3WH7A 2QJJA 3W7GA 3RCNA 4MY9A 2PDKA 5C2GA 4RKAA 1HFBA 2BGSA 4ZL1A 1CXHA 3W7JA 2PWEA 2VYOA 3PULA 2NT1A 1FTXA 1QUMA 2ZDRA 5JMUA 4ZB2A 4DO7A 1AFSA 1NWTA 1JDCA 2D2HA 1F6YA 4S3KA 5ECVA 4JNYA 1ITXA 4C6LA 1XD0A 1I6NA 2GUBA 4S3AA 8CGTA 3S8HA 1XGEA 4XQ6A 1X1NA 4R9OA 3H23A 2J75A 2WJEA 5K9XA 2GQAA 3A22A 1VEPA 2R1NA 3R89A 4F9JA 3B40A 3LUTA 1GTEA 4X2RA 3BG5A 1LG1A 1N8FA 2UV8G 2CZEA 5LXXA 1XL9A 5I06A 1D3HA 3UR7A 1TV5A 5HNRA 1UHVA 4UQBA 4G5DA 4LYRA 1DTNA 3WLJA 4LCRA 4FNRA 4G2DA 1RJQA 3UCDA 2PLMA 1SSGA 4XWUA 5FCZA 3BAKA 2G95A 1Q6GA 4GGBA 1Z69A 1CCWB 2XGZA 2XTKA 2NQ5A 3GU1A 2ZRXA 2V5DA 1LTDA 4W89A 2PBOA 1K9FA 3WJYA 3THAA 2ZX8A 3GNDA 1LLWA 2QAPA 5C0QA 4MFEA 3MKCA 1YDOA 2VFIA 1HG3A 3CH9A 4JKMA 1CB2A 3N12A 1D3GA 1CGUA 7CGTA 1DWGM 3DI0A 4GO9A 3NM1A 3E5BA 3VDHA 2FTYA 2ZVRA 3E0LA 4DRSA 3AWOA 4QSFA 1EJTC 1KGUA 3H2FA 1DJNA 3BE7A 4KCTA 2V5KA 1P0EA 1XYBA 4GE8A 4DBEA 3L2IA 3W6LA 3WLPA 3PB2A 1YXDA 1FWSA 4NXKA 2XISA 4ZR8A 3VUPA 5GQBA 2QMKA 3EA2A 5CSUA 3UJ2A 4A35A 2VJXA 4L80A 1HKKA 2ZX5A 4JOMA 4MUZA 4ZE4A 1DPMA 3QOKA 3TAKA 4IISA 3IUHA 2LLEA 1LWIA 3EBVA 5AYZA 1G4PA 3HPZA 3QVQA 3RMJA 1SR0A 3EOLA 3WUGA 2F2KA 2EQDA 2C16A 1B5TA 4TXEA 5HJLA 4QS5A 3W6YA 4UZSA 2R24A 4GIYA 4MJ4A 3WF0A 2P88A 1S2UA 1ESWA 3QMTA 4UNIA 1EP2A 3RAOA 3TN3A 3A13A 1ZHAA 2X1SA 2YBTA 1VRDA 4WSHA 4O1AA 3KTXA