1O5RA

Crystal structure of adenosine deaminase complexed with a potent inhibitor
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
349
structure length
349
Chain Sequence
b'TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title Structure-based design, synthesis, and structure-activity relationship studies of novel non-nucleoside adenosine deaminase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 140
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1o5rA00
2O4QA 1M65A 4ERAA 4CNUA 4GC3A 4GOAA 4GX8A 3IGHX 3F2CA 3LU2A 1K1DA 2PUZA 4PCPA 2WJFA 1FWBC 2G3FA 4LCSA 2ZC1A 1YIXA 3F2BA 3GUWA 2Y1HA 3QGAC 3IARA 4WHBA 4IFKA 4F0LA 4F0RA 4QROA 4ERIA 1O5RA 4RDZA 1PSCA 4GK8A 1FWAC 3GTHA 2FVMA 4DLFA 1YBQA 3UBPC 1FWIC 3C86A 3E3HA 1UIOA 1M7JA 4L9XA 1NDZA 3E74A 3MDWA 3QY7A 2Z26A 4H9YA 3S4TA 4B92A 4HK5A 1K6WA 2Z4GA 2GSEA 4QS6A 1A5KC 3B0YA 3K5XA 4C6OA 4H9MA 2Q09A 4RDWA 3TN6A 3LS9A 4HJWA 4NI8A 2GWGA 3FDKA 4YIWA 1EJTC 2OB3A 4IF2A 4IFRA 2Z2BA 2R1LA 4C6IA 4KQNA 2BB0A 1A5NC 3T1GA 4OFCA 4IGMA 1P6CA 1RAKA 4C6KA 1ONWA 4IFOA 3NEHA 3A3XA 2Q01A 4QSFA 3URNA 1FWEC 4C60A 3HPAA 3GU9A 1YMYA 4ICMA 3TN3A 4XD4A 1ADDA 1V7AA 2HPMA 2E25A 1POKA 4DIAA 3URAA 4KEUA 2A3LA 3PANA 2D2HA 1ITQA 4DI8A 3PBMA 3S2MA 2OODA 3F2DA 1NDWA 3CAKA 1KRCC 4GY1A 5FSDC 4G7EA 4H9TA 2VC7A 4KIRA 1YRRA 2DVTA 2Z27A 1W1IE 3N2CA 4DI9A 2Z24A 4CNTA 1R9YA 2CZVA 3EGJA 3B40A 1P1MA 2YB4A 3DCPA 4GYFA 4DO7A 1J6OA 2Z00A 3IV8A 3LY0A 1V4YA 4J5NA 4V1YA 1BF6A 4H00A 1XRFA 4H01A 4LEFA 3QGKC 2YXOA 1FWFC 4KEVA 4DZHA 3DUGA 1KRMA 4H9UA 2P53A 1FWGC 2VC5A 1PO9A 4QS5A 2HBXA 4C6MA 2UZ9A 1EYWA 1R9XA 4B91A 4BY3A 3K2GA 4AC7C 2ANUA 4R88A 4XAGA 2GOKA 2PGFA 4GXWA 2VM8A 1R9ZA 4E3TA 4PBFA 1WXYA 3URBA 3E0FA 4EPBC 3RN6A 4GY0A 2R1MA 1EJSC 3RCMA 4WGXA 3PAOA 4KF1A 2HNHA 5HMEA 3URQA 3S2JA 4C6JA 3UR2A 2E1WA 4RZBA 4IFKB 3D6NA 3E38A 1QW7A 3AUOA 2WJDA 2I5GA 1YBQB 4L6DA 1EJWC 4XD6A 5A6TC 1EJRC 3LSCA 2UBPC 2I9UA 3GTXA 4LAMA 3GU1A 1NFGA 1EJUC 4WVXA 1DPMA 1M68A 2DVUA 1XRTA 3HM7A 2XIOA 2D2GA 5HMFA 1E9ZB 1RA5A 4LAKA 4IH3A 2PAJA 2OGJA 4XAFA 4C6LA 2QT3A 2GWNA 1ONXA 3WMLA 4C6NA 4UB9A 2Z2AA 3LGGA 4H9VA 4PCNA 3KM8A 4RDYA 3UF9A 4Z42C 3IPWA 4NG3A 4BKNA 1PB0A 3OODA 4IGNA 4QRNA 4MUPA 4RDVA 4QTGA 3R0DA 1V51A 3OJGA 3T8LA 1NDYA 2WM1A 4C5ZA 3MVTA 2HBVA 4ERGA 5LXXA 3GTFA 3ICJA 1HZYA 1V77A 2WJEA 2AMXA 3NQBA 1RK5A 4DYKA 2EG6A 3QY6A 3MKVA 3UPMA 3IACA 1EZ2A 1KCXA 1RJPA 3GG7A 2AQOA 4C65A 3NURA 3B0XA 4KEZA 4DLMA 4C6EA 2OOFA 3A3WA 2R1PA 3ORWA 4GY7A 1RJQA 3MTWA 1EF2A 2KAUC 4BJHA 4CEUC 1FWJC 1FWCC 3TNBA 4GZ7A 1J6PA 3CJPA 3EWCA 3MVIA 2Z29A 4ZSUA 1PTAA 1WXZA 3UR5A 1KRAC 1S3TC 1FWDC 4RE0A 3MJMA 3LNPA 1GKRA 3IJ6A 4CQCA 2HPIA 1NDVA 4C6QA 2IMRA 3WYZA 4IG2A 3MPGA 5CH9A 1XWYA 3GTIA 4J2MA 1A5LC 2P50A 2Z28A 2FTYA 2DVXA 3LSBA 4LALA 4EPDC 4C6FA 4IQJA 3CS2A 3GIPA 4HK6A 1FKWA 1GKQA 3HTWA 2VR2A 1I0BA 4HA0A 3ID7A 1J79A 5HMDA 3OVGA 2EG7A 1RA0A 4LANA 4GBDA 4HK7A 2HQAA 5FSEC 1IE7C 1O12A 4CNSA 4GX9A 3MDUA 3BE7A 4NP7A 1XGEA 4LAOA 3ISIX 2FVKA 4INFA 2QS8A 4I6VA 4M51A 3A4JA 4G2DA 4XAZA 3PNZA 4DNMA 4XD3A 1YNYA 4KERA 2ADAA 5G4HC 2QVNA 1JGMA 3F4DA 4DZIA 2EG8A 3O0FA 4D8LA 4TQTA 3OU8A 4EP8C 2AQVA 1A4MA 2ICSA 4XD5A 3MSRA 4B3ZA 1UBPC 4CEXC 1V79A 4ZSTA 1VFLA 3GIQA 4V1XA 3O7UA 1I0DA 3QY8A 3WZ0E 4B90A 1POJA 1ZZMA 3LA4A 4C5YA 4EPKA 1EJVC 4R85A 2F6KA 2W9MA 2R1NA 2Z7GA 3OOQA 4JOMA 3PNUA 1E9YB 5AKQA 3TN4A 1RK6A 1UMLA 4I6KA 4LCRA 3RHGA 1FKXA 4C6PA 3AU6A 1KRBC 3EWDA 1QXLA 2VHLA 4KESA 3ITCA 4G7EB 4PBEA 3FDGA 3RYSA 3E0LA 1K70A 1A5OC 2RAGA 1A5MC 3T81A 3GRIA 1RJRA 2R1KA 2OQLA 4PE8A 3IRSA 1P6BA 4P5UA 5E5CA 4C6DA 2D2JA 1GKPA 2FFIA 3GU2A 4H9ZA 4C6CA 2FTWA 2Z25A 4LFYA 3AU2A 3G77A 2PLMA 4J35A 4F0SA 2VUNA 3F4CA 2O4MA 4H9XA 3SO7A 3JZEA 3K4WA 3S2NA 1EJXC 1FWHC 3TN5A 1ITUA 4KETA 2PGRA 3S2LA 4IG2B 4UBPC 2BGNE 3V7PA 2YZ5A 1UIPA 4R7WA 3DC8A 3LGDA 3OQEA 4AQLA 4LH8A 4CQBA 4EPEC 1A4LA 4XAYA 2YB1A 2GZXA 3SFWA 3FEQA 4C6BA 4CQDA 3E2VA 4LCQA 1J5SA 2QPXA
chains in the Genus database with same CATH superfamily
1KM4A 3N17A 2FHBA 1TPFA 2PS2A 5E0FA 2PWFA 4R9OA 4AUBA 4NX0A 3PUGA 3MMTA 3VNZA 1F3XA 3N73A 3UERA 4F0LA 1VEMA 3CH9A 5LIUX 4GO9A 1H4PA 5ABEA 2IKGA 3P6LA 3PUDA 5REQB 1JG9A 3REQA 1CGYA 3TONA 1UZ1A 1SPQA 3P0XA 1NDZA 3BVJA 3VABA 2E28A 1OZQA 1Q6RA 4MDPA 4PH6A 2GSEA 1C92A 4LW7A 3DC0A 4Y6GA 5A8GA 5H2ZA 2I16A 1AH4A 1ITCA 1SGJA 4J3XA 2GWGA 2E40A 4YHGA 3PZIA 1OGGA 4B3LA 4P8UA 5D05A 3T1GA 1A0DA 1OB0A 1BAGA 4A29A 4P7LA 3VNMA 1KTCA 3A3XA 2YBTA 1FWEC 3H24A 3CZLA 1VYSX 1WAWA 2E68A 1ADDA 3CMFA 3H22A 4N4QA 1V6VA 2FZDA 1EPVA 4E6MA 4LBSA 3SCVA 3URAA 4AWSA 3E12A 1UBSA 3PG8A 2RDWA 1IXPA 1J18A 1KWKA 3BAWA 4EK7A 3MU7A 4KIRA 4MUZA 3VO0A 2DSVA 1YRRA 2GVLA 3GB6A 2ZCGA 1B0IA 4JTSA 2TAAA 3PY2A 4Q33A 3WQVA 4TTGA 1UPPA 2HWGA 3DHUA 3KBJA 3OGRA 3S1WA 3QH2A 4LQ1A 3CM4A 1Z48A 1F76A 1QWGA 5FA5A 4J27A 3BG5A 2J8TA 4ZE4A 1YW1A 2YXOA 1JQXA 3I6TA 3M46A 3IEBA 4OBSA 5A69A 1UUQA 2G97A 2V5BA 5KINA 1REQB 4PB5A 3W7PA 1QCWA 3K2GA 3WH5A 4WSHA 3KOYA 3UPWA 3VKAA 3CPGA 4ACYA 2Z1WA 4PBFA 2VFFA 3C8NA 4MWAD 1AQFA 5CSYA 1M3UA 5K9DA 1PZ0A 1DIKA 2F6XA 3N4EA 3GE7A 3SIMA 3QQWA 3NDYA 3G5EA 3TH6A 1LQAA 4ZO7A 3BCFA 3OBEA 3W28A 3W7NA 3Q37A 5EKYA 3AYRA 2CWNA 4ROQA 4DZ5A 2DT1A 3KBVA 3ZT5A 3GUGA 1EJRC 4HU4A 3STCA 1BLIA 1ISVA 4MJ2A 3CIVA 4HZ6A 4V27A 3BAJA 4PTXA 1IWAA 5SWUA 4L9YA 3N2OA 2OGJA 3W4RA 1A49A 1VP5A 3AMKA 3GXNA 4DO4A 2IPWA 1V03A 2B31A 3NTYA 3GDBA 1JPIA 1PVNA 4BKNA 3ARVA 3GTNA 1Q66A 4LC8A 5J04A 2QV5A 1MWOA 1P0NA 3SGGA 5C54A 3NQ6A 3BGGA 1HP5A 3RRAA 3L68A 2AMGA 2O9TA 3GTFA 1Q2RA 3QC0A 3GM8A 2P3EA 2J6XA 1GJUA 4D2JA 1TB3A 4C6EA 5D37A 3FGCB 4QE4A 5FJOA 2OEJA 3G1YA 1NQ6A 4DWSA 2C0HA 1OYAA 1ZCCA 3LUTA 4ZB5A 4CVWA 3GDRA 5H8MA 2ZTKA 4Q7NA 1US0A 4ZSUA 2YX0A 3AXKA 1WXZA 2VQUA 1Q7QA 2C14A 3LTPA 2PDXA 3M44A 2O56A 1TRIA 4L1XA 2GVYA 3VMPA 4RPPA 4ICNA 3V1HA 4Q4SA 4JQ1A 3HZ3A 3THUA 3NQFA 3RPTA 1XDLA 4A3YA 4HK6A 1U33A 1FKWA 2PP0A 2X09A 4M7SA 2A6LA 3GFXA 4JTEA 4UZUA 5AYZA 3ZVHA 3ID7A 2OT0A 2DQXA 3INPA 3WDJA 5ECUA 3N12A 2GLKA 5T26A 3LDVA 5HXMA 5I79A 2IUZA 1C8YA 4FS9A 4B15A 3G1DA 3B9DA 4JTJA 5G2WA 1QOXA 2CKRA 4OUIA 4DUXA 4GWEA 3CMJA 3WLRA 1LDCA 3PPGA 3E0IA 4YMZA 1C7SA 5FCZA 2PDYA 2PWGA 2X1SA 1VJZA 2EG8A 2OGYA 4AVNA 2X1TA 4Y9PA 4HSNA 3PULA 1KM1A 5D30A 3TTOA 5IOBA 2F7FA 1A4MA 1ZAJA 2V3FA 2YPIA 2ZUWA 3WQ4A 2ZUTA 1ZSXA 1V79A 1RUSA 1I0DA 3R43A 5A2BA 3S47A 1Q45A 1CPUA 2QAFA 1K8XA 3LCLA 1K6AA 1KFLA 2QKFA 3PM6A 3OGVA 3RXZA 1LJYA 4H41A 1SFLA 1LQ2A 1QPRA 1TQJA 3N9KA 1XIFA 3W7MA 1CNVA 4ZOBA 3A6OA 1K70A 2G3NA 1A5MC 3WLLA 4HN4A 4AZ6A 4GISA 2OQLA 3LD5A 4F79A 1C9DA 4LT9A 2VVNA 1L8NA 3QC3A 4E2DA 2WBGA 4MGGA 3RILA 3AU2A 2AL2B 2CLKA 3GSMA 4X60A 5ABFB 3K4WA 1EJXC 4YVXA 5AVHA 3U4FA 1O5QA 1YLVA 1BRLA 1XLKA 1O66A 4CNNA 1CWYA 4UTUA 4PMXA 3UZXA 1B90A 5XIMA 7TIMA 3HPFA 4CU6A 1EGVA 4CCCA 5C71A 1EWEA 1TX0A 4AQLA 4PEEA 4ZFMA 2HXUA 1O94A 2CBIA 4Z1CA 2A2IA 4BCEA 1KXTA 3DBPA 3EDKA 1H7RA 3N9RA 3E2VA 4LCQA 2QPXA 3H2AA 3P93A 4CNUA 3PWGA 4GOAA 3LTSA 3W02A 1K1DA 1FWBC 2W66A 5JH1A 3W1RA 3UXLA 2PGWA 3F2BA 4DXKA 2PTXA 1J96A 2WVVA 3BSGA 4ERIA 3WLTA 4K7VA 5AC4A 3A12A 4DLFA 1C93A 2J74A 1QAPA 2G37A 3JVAA 1O60A 3RLHA 1JCYA 3CWHA 2D2OA 4ZOCA 2XPKA 3B3DA 4LVBA 3E0WA 2Y63A 3DFQA 3TN6A 4RDWA 4HJWA 4HN8A 1G69A 4NAEA 3PFRA 3NQDA 4OQVA 3W00A 1CXFA 2WKLA 3R10A 4GI8A 3AIWA 2XU2A 1W3KA 1ONRA 1DHKA 1ONWA 3U0HA 1EL3A 4K39A 1QI0A 1MEWA 3W7KA 1XYAA 1ZTVA 2E6YA 3EWYA 3ARYA 4JD4A 1NARA 2PP3A 4GIEA 5BOOA 3KVLA 1L6FA 1NOUA 4ZODA 2I56A 1UHVA 3MMDA 1V3IA 1E0WA 2PRMA 1HP4A 3OIHA 1VIWA 2ZA3A 2I5IA 1JNDA 3O63A 3GK0A 2OTDA 1R3YA 3CT2A 2XVPA 1S2CA 3UYIA 5C5YA 4E2OA 1E4IA 4V28A 5LZLA 3GNNA 1TFVA 1OQFA 3DGRA 1GOQA 1SZEA 1SO3A 4NSBA 4B5VA 4J5NA 1H5YA 3W2MA 1MDRA 2VCBA 1VHNA 4D6CA 4PUJA 2O92A 1B4EA 2GSHA 4RXFA 1HVXA 4UXDA 2Z7KA 4J3ZA 3UJSA 3KXQA 2VC5A 2YW3A 2PC4A 3ARQA 4QNWA 1EYWA 2XZ9A 1BD0A 1D3HA 4N02A 4DPQA 3DESA 5FESA 1FOBA 5HMEA 4KWOA 2PBOA 3GWQA 1LP6A 1Z8AA 2Q8XA 4B5WA 1IIGA 2I5GA 5J8LA 4GIYA 2WYSA 2ALRA 4GVGA 2I9UA 5M5DA 5IXEA 4TO8A 4GQRA 4MY9A 2WSRA 4HOZA 2WCAA 5RUBA 4XZWA 2WW5A 4L1GA 5TD4A 4WDXA 1Y65A 2QIIA 2Y89A 4NASA 1OC5A 1TX2A 4KFOA 1X6UA 5LHFA 1KCLA 3LGGA 4RDYA 2R24A 4QQUA 4S3JA 1HKJA 1H5VA 4B5SA 6ENLA 2XINA 3M7WA 4MMWA 1IZKA 4EXBA 4FNQA 3VNJA 4FI4A 3AMGA 3UWYA 4IP4A 4WDWA 3EPOA 1XLDA 2VURA 3NQVA 5JIPA 1EZ2A 1T7LA 3B9NA 4QXIA 1S46A 2ZUSA 1LL6A 1XKYA 1Z42A 2VDIA 1TWWA 2FPYA 4ZO8A 3UR8A 2PGEA 4UR8A 1XH0A 1JCLA 2GJPA 4P61A 4OOZA 3SCPA 2YCJA 2XSAA 4DBUA 5DLCA 4YXGA 3RAOA 3VE7A 3E49A 3WF2A 2WHJA 1W17A 4M6QA 5A6LA 4POCA 3GO2A 4PMQA 3A4AA 3O05A 3WLQA 4YYCA 3LHTA 3OP2A 3MY9A 3W37A 3B04A 4NVTA 1ZP3A 2H6RA 4QG9A 1VC4A 4N9CA 1W54A 1TCDA 3OG2A 4LALA 4IQJA 1KBLA 3HJZA 1PX4A 1I0BA 2ZTJA 4M81A 3GC2A 1XGEA 2XJ7A 3GYCA 2FVKA 2QJGA 4M51A 2NV2A 1PWMA 2V5DA 1XYBA 1HG3A 4DNMA 4QG6A 2Y5SA 3HIJA 1V93A 4MDOA 1OZMA 2GVGA 1SJBA 3M0HA 1XHGA 2OZ8A 2VELA 2WLYA 4ZZ9A 4URIA 3JR2A 5BRPA 3GIQA 3VKJA 2QUMA 3KL0A 3S9YA 2O55A 5CBIA 1TMQA 1BKSA 1WYIA 3C0LA 1TCMA 1ZLPA 1SFJA 3B9OA 3LBMA 4JOMA 3XIMA 2D3NA 1J93A 1KFKA 1Q8JA 1TPEA 2PTYA 1OC6A 2ZXAA 2UV8G 5J5RA 4UCGA 4KESA 3VPLA 2ZWYA 1X7FA 4W85A 4AD5A 3BH4A 1ZRQA 3NZPA 1XFCA 2YL8A 3VX0A 1FDYA 3U2CA 4I9AA 4PE8A 3C4UA 1PTGA 4P5UA 1A3HA 2XGBA 4ZEPA 4Z2JA 1W56A 4GIAA 2ZWZA 1W1TA 5CC3A 2GDUA 4WSJA 4A2RA 5GQBA 2B7QA 4V33A 3VDAA 1ITUA 2GVEA 3K13A 1C8VA 5B7YA 3W7JA 5CPQA 3H4XA 4WSKA 1AL7A 2I5QA 1UD3A 2EJ1A 3VM5A 2WSYA 4MLJA 4IISA 1KB3A 2BGSA 3VOIA 3FNDA 2WZHA 1NY1A 5I24A 3WD0A 2YL5A 3R5EA 1MW1A 4B5XA 1FH7A 3FJ6A 3TJLA 4QDWA 3W1NA 3EMQA 4ML4A 2YDRA 1H0IA 3ZSTA 4U10A 1JDCA 3M0VA 2NUYA 4L64A 2CFFA 3WUBA 5I02A 2WZIA 3IJQA 2Y5JA 4GYJA 4XUGA 4UOQA 2DUXA 1OWQA 2FMOA 1K6WA 1RHCA 1WA3A 3T4CA 2Q09A 4NI8A 3VK5A 5D04C 4YIWA 1TJ0A 4IF2A 5FL0A 4AAJA 1CGTA 3O6CA 3QVQA 1KCKA 2XISA 3WJZA 5E9AA 3PZQA 3OA5A 1OADA 4QHRA 1UZHA 4MKSA 3VNYA 1EA0A 1FTXA 1XCWA 1MUWA 2A0NA 4FO4A 4YCOA 1PZ2A 5IM51 4AHPA 4HYRA 3U4AA 1YDYA 4DIAA 2CPUA 1CGUA 3D3FA 4DF0A 4US5A 4IICA 2J79A 1I60A 3UP8A 2CLEA 3N18A 2ESCA 1EXBA 4H9TA 2ZX6A 3NQ2A 3T2QA 4PUNA 1UKOA 1W1IE 4UNKA 5BXPA 5TIMA 4IP7A 2HVOA 5BOEA 5HR6A 4CNTA 1R9YA 4HCLA 3B40A 1HL2A 1MUCA 4UMAA 4PUMA 1BF6A 1XRFA 2ISFA 4I5XA 3NFUA 4LEFA 3GAKA 5FAGA 2BHYA 2RGMA 3BOLA 4UC5A 4FP1A 2DPEA 4GZEA 4K8EA 2UZ9A 7ENLA 1QR7A 1SMDA 4R3UA 4CNPA 4HCHA 1E3XA 3NUKA 2QPUA 3CQIA 3LXBA 4A2SA 3G8RA 1TV2A 1KBBA 3PUOA 3RN6A 1TE6A 1UKQA 4JPGA 4Q7IA 4RUBA 4C6JA 4N0RA 2VRJA 3T0DA 1MNSA 1UH2A 2Y0FA 1N8WA 3GKFA 3WJWA 3AUOA 5CPLA 1AW5A 4IIGA 3WMSA 5IFPA 1MW2A 1W3TA 1T96A 1SU5A 1JPMA 3S42A 3WH6A 3GU1A 4BWLC 4AEFA 5A6MA 3HGOA 3WLIA 1BEUA 1EWDA 1UJQA 2YA1A 4C6LA 2B7NA 1W3LA 5BWFA 4H7ZA 3M07A 4YLWA 1UR4A 4H2HA 5LHEA 2X1IA 4ZBCA 3ZR5A 1TWZA 3NZRA 3OA3A 1KFBA 2FGZA 5HNNA 3LK6A 3WDPP 3CUZA 3BCDA 3R0DA 3CK5A 3BLFA 3T8LA 4CNOA 4XBSA 3HGJA 1ZBKA 4O0QA 5JBFA 1PKLA 2RKXA 4FA3A 3QSRA 2CETA 1NSJA 3UT0A 3MKVA 1PKYA 5LXEA 1WDDA 3UESA 4PMJA 1NU5A 3IAPA 1TTIA 3C0JA 1LT7A 3GKAA 4AEEA 1ZJHA 3BUVA 2PCQA 5DMLA 3CBWA 3AI0A 1TA3B 4WQ6A 1H2JA 1UB3A 3W6YA 3JUGA 2NQJA 5B7ZA 1S3TC 3HN3A 4NJIA 3QHNA 3FJ4A 2Z0IA 3V0UA 2EEXA 2ZZ6A 2HPIA 3TV8A 2EGZA 3ZWTA 5A6AA 4JL2A 2A3HA 3QV8A 1HVQA 2G4FA 4LVGA 1UD6A 3WLSA 3CS2A 2ZX7A 1KV8A 3ZO9A 2OG9A 4ROPA 4BHYA 3VGHA 1W0MA 1XKJA 1ZJAA 4JDBA 1IE7C 2VXNA 5CPSA 3DGBA 1CX9A 4P7OA 4FOJA 4GX9A 3W84A 1B9ZA 3UG5A 2ZX9A 1OT1A 3V36A 4GQQA 2G41A 3W71A 2QCCA 1A5UA 3WNNA 3EOEA 3PZGA 4S2CA 3QKZA 2V9DA 3ZLHA 1V3KA 4HTBA 5EA9A 4GA8A 1DP0A 1FP8A 4TQTA 2PDGA 3KVKA 1KR1A 2OKTA 5G4WA 1XUZA 4XD5A 2E9BA 3R8HA 1XR2A 3APGA 3TTEA 3ZWSA 8TIMA 2C79A 2XN1A 1SO4A 3VZZA 1HO1A 4R85A 5BW6A 1JYVA 2JF7A 3OOQA 3NQ8A 5C6MA 1ODZA 1ECEA 4F2UA 3VIFA 4KRUA 1E9YB 3H12A 3HPSA 3RU8X 4GH3A 3N19B 1VRXA 4XBJA 2WHMA 2UY5A 4OV4A 3TU9A 4C6PA 3AU6A 2ZE0A 3CQHA 2F61A 3EWDA 4ATLA 3U8GA 2DFAA 1Q6DA 1TO3A 1R5YA 1P5BA 1TPC1 2HROA 5LSMA 3QYQA 3P3BA 3FK4A 3L66A 3LHWA 4HU3A 2QCMA 2J7BA 1N55A 1GKPA 4LS2A 3CIXA 3A23A 1DHPA 3BOXA 3ARSA 5BZAA 3L5AA 2HJPA 1OD8A 5D2VA 4JIIX 3HQNA 1JPHA 3LHVA 3TFCA 1TVLA 3L67A 2EJAA 2DEPA 4C7GA 1TUXA 1UIPA 2QZRA 1WUEA 2D24A 1VJIA 4RPQA 3FEQA 1PKMA 3EWUA 2WMIA 1XLIA 2P88A 4HNTA 2NX9A 3E96A 3NSMA 3DG3A 1MQRA 1F6PA 5IDIA 1RD6A 1PAMA 2ZZ4A 1V5XA 2ZC1A 4LCSA 3MP4A 1TV3A 1GHSA 1DBTA 1J9YA 3UNTA 1R6WA 4F9DA 3PJWA 4YTQA 3VNDA 4AZBA 5C0QA 4MSSA 1R86A 1VFSA 2Y7GA 5JQ9A 2Z6IA 2VL4A 2NSXA 1HGYA 5LA0A 1P43A 4XKYB 2ISWA 4AY1A 2Q02A 4HZ8A 2PDQA 3S4TA 4B92A 4GNKB 5AB3A 3HG5A 3VYLA 3ONBA 4J2PA 3SUTA 3ZXWA 1R7OA 1V02A 4TV5A 4ZTXA 2OWCA 3OYZA 1QTWA 2Y5EA 2DT2A 1N8IA 4OFCA 4X63A 1P6CA 3BOFA 3C0SA 3DERA 1L2QA 4YJ5A 4XSLA 1OGSA 1O5KA 5D2XA 4Z17A 3TN3A 5FF2A 4QLLA 3BMVA 1TV7A 2DIJA 3N6JA 3QR3A 3N11A 4DY1A 1POKA 3NO5A 3GC4A 3O6AA 4O10A 1BKHA 5E1QA 1TVPA 2OX4A 3UA4A 3KL5A 5AHFA 4LYPA 1B3ZA 3MUIA 4FF7A 3OBAA 1XPYA 3KWXA 1TIWA 4O16A 2C7FA 3RITA 1YE6A 5G2IA 1OD0A 3G18A 7ODCA 5CC6A 4DO7A 1J6OA 3LY0A 2XGZA 3HPXA 4AY8A 1FP9A 2J7CA 3CGTA 3LOTA 2CHOA 1VIZA 1S5NA 3ZJ6A 1D2KA 5K7JA 1OFDA 2HBXA 3P14A 2FLIA 2VQTA 4FEZA 4Y2WA 5BU9A 4WIWA 1WXYA 2I9EA 2XH7A 4JCLA 2HISA 1GOKA 3ES7A 3TYBA 5DX7A 3TA9A 5CPNA 1SJDA 1HNYA 5F1UA 4XX6A 1S5VA 4CLMA 3WLHA 5A6TC 3GC5A 2VOTA 4AW7A 1LWJA 2E7FA 1DPMA 4IX2A 5HMSA 3BW4A 2PAJA 1R3VA 4HIBA 1XLMA 4LX4A 2QQ6A 3SCQA 5KZMA 4EAYA 5HUPA 3AS1A 5I3FA 4A3HA 3WENA 1AQHA 1BWVA 5A8QA 3MWAA 1PEZA 1KM5A 4IGNA 1HJXA 2WM0A 4J40A 4GI4A 1E43A 3F03K 3M64A 3KVMA 5CG7A 3N3MA 2HBVA 4L7ZA 4M8UA 1PX3A 1RPKA 3H2MA 1F4HA 4DJEA 4N7QA 4XSMA 1KNWA 3QY6A 2YCLA 1NH6A 4IJBA 4AWEA 3WK1A 1O6IA 4GY7A 1EX1A 3O2LA 4I90A 2JKPA 3SJNA 4HVXA 3GVRA 1LRTA 2YCEA 3H7UA 5DCBA 3TW6A 3MYPA 1JFHA 2VZUA 1QPOA 1LLOA 4IL0A 3ANVA 1QW8A 4M6UA 1KW1A 1VZWA 4S3DA 3V5FA 1FWDC 3K1DA 5AZ0A 1RY8A 3U9IA 1F61A 3VCRA 4WOQA 2GQ8A 2YFOA 3I7QA 4JTDA 4HD5A 3NPXA 2IMRA 1XINA 3T42A 4FOKA 3C8FA 1GEQA 1KR0A 4CD4A 3VDBA 3MSYA 4MADA 1Y5VA 3G1FA 3SRHA 1IXOA 2DIKA 3EEGA 2C16A 5XIAA 4QGCA 4GI6A 4LRSA 5DT5A 1M7PA 3UWWA 4MWAB 4OZOA 1PZ3A 1R46A 1ZJIA 2NZLA 1HXJA 5C7VA 4JIRA 1WDQA 1RALA 1EBGA 4KERA 5CBJA 1VBJA 2ADAA 3HPZA 4O1BA 3DX5A 1I1WA 3L0NA 1JGMA 4H04A 5A1AA 2J13A 2YIHA 2A4AA 4RE2A 4A8NA 3DFTA 1XH1A 1X39A 2PB1A 1OCNA 1E72M 3DHFA 1QMLA 3NZGA 4UFMA 1ODUA 3S6TA 4KCUA 2VENA 4ZQRA 4MWAC 3ATZA 1RD5A 1C8XA 1E1CA 1IEVA 5U7SA 1XLHA 2TPSA 2F9RA 3RK8A 1JDEA 2PURA 2AAMA 4X2PA 2HZGA 3C2RA 3ABSA 3TFXA 4DO6A 5HULA 1UMLA 3ZJ7A 4I6KA 1A5SA 3BDKA 1RBOB 3EKZA 1UPMB 4ACZA 2INZA 1A5AA 4GYPC 1DWGM 4L65A 1GVOA 3IVSA 1X1OA 1XIJA 3MCOA 1DWJM 3W1LA 3O1NA 1GORA 3F5LA 3BLIA 3KBWA 2ZE3A 2ZXBA 2IQDA 4BK9A 1AJZA 2X0YA 2QJIA 3F4CA 3WBEA 1DQXA 5G1TA 4M29A 3D5HA 2BOFX 3KL3A 3H55A 3B97A 2VP8A 5DXXA 2OJPA 1GOOA 2WHKA 4JHZA 3V7PA 4GCXA 3HURA 1XIDA 2X30A 3B8DA 1VFOA 4CN1A 3CV6A 1SR0A 4E5TA 4A05A 2XM2A 3CZJA 3QW3A 3GNDA 4FHAA 1XF0A 3QXBA 2VKZG 1PDZA 3QMSA 5TQLA 2ACQA 1DJHA 4GZIA 4EWND 1CB7B 3F5KA 5CSRA 2PDKA 3H7RA 3PZTA 4U5IA 4J3TA 4ZOEA 3L4YA 1XQLA 1UH4A 2C3ZA 3AHYA 4NAFA 4AZCA 1UIOA 4L9XA 1GJPA 3I4EA 3K46A 2J77A 2J7GA 2VVSA 1OVDA 2Z4GA 3FIGA 5I09A 4UR7A 3OQ8A 4QS6A 1BFNA 3G1RA 1HJSA 3BLDA 2BY1A 5CPTA 3TQVA 2D1ZA 3FDKA 1K9TA 3NL6A 3ARTA 4K37A 4C6IA 1EDGA 1X97A 1FH9A 4QLKA 3TXVA 3EXTA 4ZR8A 2ZUNA 4QCFA 4FNPA 2Q01A 2X1UA 3LZ5A 3HPAA 1GQNA 1K8YA 1QWKA 4ZGYA 4RCXA 3HQOA 1SW0A 2REQA 3DENA 2E25A 1WZKA 4IJCA 4L4MA 3RDKA 4KEUA 3EWWA 3SGUA 3PJUA 3TSMA 1ICPA 4PBGA 1H1NA 2E09A 3TDFA 2V0TA 1NDWA 3CAKA 3SN1A 1AUSL 1IGWA 3EOOA 4Q3MA 2V67A 4H6KA 2FH6A 1BVZA 1XRSA 3FHQA 4QDPA 2IQTA 3QPEA 1EHAA 3L5LA 2Z00A 4ZTYA 1LOQA 1UASA 4IMGA 4DF1A 2D22A 4H00A 3RX2A 1PBGA 4JTGA 1UD2A 1VHCA 2QUTA 3SQLA 5HR7A 1YPIA 4MB4A 1FWGC 1GQIA 1PO9A 2GK1A 2VEGA 3W2UA 4JTUA 3QPZA 1LROA 1IEQA 1PJ9A 3SY1A 3L0GA 1GOWA 3HGSA 3BLOA 3BQ6A 5LIWX 3L2IA 5KITA 2ZRWA 3AS3A 2PDMA 1RLDA 4FSAA 1UWTA 2CHRA 1NEYA 1CBGA 2QEZA 4MNMA 1QW7A 3NZ1A 4WDUA 3DHPA 3AHXA 1HJWA 1VH7A 1XLAA 2FDMA 4AIOA 3VZYA 1UH3A 3SZ8A 4RE3A 1W31A 3T05A 3UZYA 3TC3A 2ZFAA 4YL2A 3WD2A 3GVQA 1NELA 5K9XA 4W8LA 4DBWA 5AHEA 1OF6A 1F74A 2OZTA 4PRRA 1VPYA 3NVDA 3C56A 3IPWA 4CU8A 3GFZA 3MCNA 2JEPA 3DI1A 2PF0A 2ZX8A 2NSOA 3MBFA 5CAHA 4EX4A 1T8QA 4OTKA 3T9PA 1H7WA 3W81A 1V51A 2EO7A 3ERPA 3UJEA 3U2ZA 1JPDX 2WQPA 1LTDA 3O16A 1MYRA 4O0KA 3GXTA 3BL3A 3VDGA 4CQ9A 1YNQA 5A6BD 4LBUA 3A21A 3WDHA 2G4JA 2VEFA 3NURA 1FCUA 5DRIA 2NV1A 1BYAA 3WF0A 4LAZA 3MSDA 2WOQA 4EACA 3DI0A 2E77A 4LB3A 3WUGA 1G1YA 3GS6A 4TVCA 1HKKA 3VFCA 4YPJA 3UYCA 3NDOA 3WDQA 4AF0A 4TIMA 4Q4MA 3C2EA 4DB7A 1BTMA 3VXGA 3VUSA 3WYZA 5AOUA 3AOFA 1L0PA 4WDTA 3H53A 1A5LC 2X2GA 2BFGA 4EPDC 2HE8A 4HPNA 3NQGA 4YWSA 5GNZA 1UR3M 3P74A 2NVAA 5F4SA 3OBKA 2J4GA 3MP3A 3BE7A 1FRBA 1V6UA 1LWHA 3SCOA 3CHFA 4XIAA 1F73A 3ENLA 1WUFA 4G2DA 4IIBA 2E3ZA 1CGXA 3VGFA 2NX3A 2VX5A 4IMAA 3AFBA 4G7FA 5G4HC 1XLEA 3VD3A 2EBNA 3NXLA 2OYLA 3RR1A 1GOXA 3OB8A 1ICSA 3OU8A 4ZFCA 2AQVA 3VC6A 3W2KA 4QDMA 2PD5A 4YTSA 1UW9A 4LXFA 3PR2A 1RCOB 3TROA 3MB9A 3QZEA 3WZ0E 5D03A 4EAMA 1GOIA 2DSUA 4WRHA 1ZBCA 1GUVA 1VBHA 4I5RA 3OEXA 1E6PA 5AC7A 1GTHA 3BZGA 2ZRYA 5CJ5A 3S5ZA 4XUYA 4HT3A 1E0TA 2H9AA 2BXZA 4IL2A 4ZOAA 2VO5A 1WQ5A 3LPOA 2XGIA 3N6HA 4Q8UA 2RAGA 3EWXA 2XSXA 3ITXA 5LNVA 2PDWA 1OT2A 2OQHA 1VYRA 1JXKA 4Q8WA 3WMCA 3AALA 4J35A 2V6AA 2VUNA 2WV8A 3P82A 4PMYA 3KTCA 1WDWA 4GCAA 3ZLGA 5JUVA 7A3HA 3U57A 5DELA 3VNLA 4JTCA 1J12A 3I7SA 3P5YA 3RIKA 1BYBA 1WBHA 3T2PA 1P0BA 2O0TA 2YDQA 5I0DA 2BVDA 1SQ7A 3IK2A 4PB3A 2WNNA 2PLKA 2PEVA 5GJNA 5IDZA 2X0HA 5T9CE 3UW6A 2Q8LA 3MI3A 3VDHA 3M0LA 3VU2A 4HYWA 3IIXA 3AISA 2YGYA 5I23A 2WJZA 3STPA 1E55A 2CESA 4XO7A 1SZRA 3THCA 1HKWA 2VTFA 3MZ2A 1GHRA 4S2BA 4ZQCA 1AL8A 1K9FA 2OYKA 4YVPA 4MJZA 2VX6A 1GJWA 1FH8A 2Z26A 5CXPA 4WR3A 5LIKX 3W7GA 3EZ4A 4O57A 2NUXA 3FXYA 3W26A 1GQJA 2YXGA 3ITOA 5K9CA 2W27A 1XLGA 3SRDA 2HK0A 4B9YA 1A5NC 4R7JA 5A8PA 1TJPA 2ZXDA 1RAKA 2ZIDA 4JS3A 1DQUA 4AMAA 2ZRVA 3A5FA 3DHDA 4XBKA 3WDRA 5M03A 1QI3A 2EF9A 4S3KA 1CZ1A 1H7NA 4XD4A 6ALDA 1WOAA 4HOXA 4MOZA 1YDVA 3RNDA 4PODA 4PC8A 1XP3A 3KDOA 2DZTA 2PLJA 1UC4A 3AXIA 3GG0A 5AHIA 3N04A 1FWSA 2VR5A 3R94A 1VLIA 4HNCA 1OFRA 4OUEA 1AH0A 3VGBA 1SR9A 3Q58A 1OCBA 1OIFA 4UTTA 4GYFA 1TV8A 3CH0A 2PWDA 4AYSA 4WJXA 3QYSA 4S23A 1AG1O 3DYMA 4U31A 1YEYA 5I2UA 3W73A 4O1EA 4IQDA 3VOJA 1NOWA 3LG3A 2VFEA 3E0FA 1D3CA 1FX6A 4LPCA 1MQQA 3EDJA 3KLLA 5D8WA 2BWGA 3I4KA 1B54A 3UNDA 3EMCA 3QMRA 4QX4A 4DZAA 4AIEA 1YXYA 1AH3A 4BI5A 1R2SA 4AIBA 2DT3A 3VFLA 4LYRA 3ARXA 5HNUA 8XIMA 3F1QA 2ZUUA 4ZA0A 1NFGA 3UY8A 5DF0A 3DYOA 3NOEA 2CKSA 1V0MA 2GJNA 2YCKX 3VX1A 1BF2A 1WV2A 1GVIA 1DQWA 2EPNA 4RKAA 2BP1A 4H8VA 4C1KA 1R3QA 4DAIA 3FLUA 1VFHA 1VAHA 2QMKA 1B2YA 4QTGA 1FHLA 2WANA 1W1A1 1ZGDA 1VBGA 5DBUA 3N15A 1BYCA 3KZSA 5BRBA 4UNIA 1GVSA 4I3GA 2AMXA 5M1TA 1ZFJA 3RJYA 4TR9A 1BSLA 1MQPA 5DY3A 3AROA 2V3DA 4YU1A 2ZZ5A 4ATDA 3MI2A 1W9DM 3WQ8A 3CJPA 4S3GA 3ME3A 3W7QA 2Z29A 1TYGA 1HX0A 1W3IA 3VC5A 1QO5A 6PTDA 3CHCA 4MZYA 3LNPA 1GONA 2GVJA 1CLVA 5E0CA 4K68A 3VOGA 3MPGA 3UWVA 2X8RA 4O11A 2A3EA 2BDQA 5IBXA 5D38A 2X7WA 4DM2A 1XISA 5HWMA 1OFPA 1EBHA 2NT1A 1PS9A 1ZNNA 2EG7A 3BCJA 3QF0A 1FDJA 1PTDA 1GVQA 1Q6FA 2ACUA 5TBOA 2BXYA 4ICCX 2G5WA 3PZVA 3C2OA 4PR4A 4INFA 2FZ8A 4XAZA 1UUOA 4D1JA 4U33A 1QU4A 1J8VA 2VDHA 3IWPA 5DMNA 3D47A 4AMCA 1UUMA 3PSWA 2OELA 1US3A 4PGLA 2QJHA 1TTJA 2WSQA 4KS0A 2GGJA 2BOEX 1I1XA 2TYSA 1VKFA 4B3ZA 1HIZA 3SCUA 3KBSA 4PMNA 1HO4A 5I3HA 4L9ZA 5MKGA 1RXOB 4HZ7A 3TYUA 1X1NA 4Q8PA 4AD1A 4UTWC 3R13A 1V6TA 1N8FA 1MFVA 4QM1A 5FF7A 4F0KA 2W9MA 4EE9A 3GW3A 4FIRA 5FEZA 4PYSA 2J9YA 3M0JA 4PUUA 1W32A 3SW6A 4K38A 3S9ZA 3BW2A 3C3UA 4ZQOA 4XZHA 4FALA 4R33A 4XTIA 4HPJA 4R53A 2E8YA 5C2GA 4DJFD 1EKOA 1IIHA 1SYTA 4D6DA 3H2EA 1EX5A 1IT0A 1AZ2A 1QVBA 1HTIA 3RUBL 1OK4A 4DJDA 2ZOXA 2GJXA 2CEQA 3TZFA 3PBYA 4REQB 3GU2A 4C6CA 4LFYA 5GVJA 5CSSA 1KCZA 2O4MA 4CUCA 3S2NA 1WO2A 3SCWA 3FS2A 3EOUA 3CB8A 1P7TA 2FB3A 3ZR6A 3RM4A 3CWOX 4R7WA 3OW1A 3U7BA 1ZAIA 4GMEA 2MNRA 4GGHA 4PTMA 3IJIA 3L23A 2BHUA 4ATWA 2ODOA 2NVDA 4CQDA 1B9BA 4D8ZA 1NJJA 3BWWA 4Q22A 1DEDA 2D0FA 1GZJA 3GHTA 1YQ2A 1QNQA 1LQ0A 2EHHA 3UCCA 4NL1A 3R89A 3HG4A 1QPNA 5A2AA 1J0HA 4AISA 2OO0A 4YYFA 3BAYA 1XSKA 4WHBA 1JZ7A 4N9DA 1PSCA 4Z08A 3T44A 4HPHA 1FDZA 4X2RA 1J0ZA 1O95A 4GVIA 3NR0A 3EMZA 4E38A 4H9YA 1JJKA 4MZ1A 3M43A 3UFYA 2VC9A 3LHYA 1UWSA 1HJVA 6TIMA 3RRXA 2R1LA 4O28A 4F0MA 2ZZ2A 5T8GA 3WJXA 3GXPA 5DANA 3GH4A 1AVAA 1UKSA 1EUAA 4GBUA 1X8CA 4QLJA 3SSJA 4DX3A 3KP1A 4GVHA 2XVGA 1S2TA 3HFTA 2HPMA 4GG9A 2Y24A 1UQYA 4ZO9A 1ZS2A 4JQAA 3S5YA 1I6NA 2OZ0A 3M9YA 1I2OA 1Z32X 4LF2A 5LKYA 4MJ4A 2OXNA 1JYWA 3EX6A 4W7UA 4NILA 4DELA 4J9JA 1FFRA 1SVDA 3ABRA 3N2CA 1TREA 3VVGA 1EGZA 1OFAA 4CD7A 3W27A 2VOMA 1TRDA 2NLYA 1ZHAA 3AJXA 1H51A 5DCDA 1WKEA 1UQZA 3PK7A 3W76A 3E6EA 1N82A 1LBMA 4HA4A 3QJAA 5G4EA 2DY3A 3W7RA 4PMVA 1JL8A 2CYGA 5CJNA 1KC7A 1ELSA 2RDXA 3B4YA 3E02A 3W75A 4M80A 2WSKA 4DXVA 2WCSA 3OVQA 5I3IA 5IHRA 5MF5A 1L9WA 3UR2A 1IHIA 1Q6CA 2C1IA 3G0XA 2Z6JA 4FR6A 1PKNA 1YBQB 1VCVA 4MYAA 2WZTA 4LU0A 3HM7A 3W38A 3BGAA 4MFEA 2D2GA 3FCPA 3WLNA 3P7YA 5LIXX 4OT7A 4FNRA 1W37A 4XAFA 5I3DA 4JFTA 2Z1SA 3O6YX 1KV5A 1QPKA 1XBZA 4DYEA 3UU0A 1DXIA 1RLCL 2FYMA 4PUKA 3AIBA 3S5SA 1PE1A 2W62A 4K1WA 2PWVA 3CAQA 4MUPA 2POZA 3S1VA 1E15A 4GJ1A 3N14A 2X05A 2PRLA 1B3WA 5DT7A 3W1UA 3VOFA 4DN1A 1HN1A 2Y2WA 3ICJA 3VD7A 3W87A 2C13A 2OMAA 5M2FX 4UTIA 4ADUA 2RJGA 3FA4A 3APTA 3B8IA 1BXNA 4B2DA 2XWDA 2C15A 1JI1A 2FHCA 3N4FA 4AFYA 1RJQA 4KCVA 1KLZA 1SSGA 2OFJA 3NQEA 5KZDA 1XLBA 4B3KA 1TV4A 3G0UA 2NQ9A 3NCOA 4H3DA 3I3DA 3MVIA 5D2TA 3S8HA 4G9PA 1DE5A 1W1YA 2IXUA 2O9RA 3STGA 1V0KA 4GUGA 4ZVJA 2I57A 4UOJA 1CENA 5B80A 5AHNA 1ZL1A 4IG2A 1XGDA 1C9WA 3PN8A 4G56A 4AYGA 3IS4A 4KCTA 2P50A 3T0TA 3WNKA 2J75A 1AMKA 3LX9A 3B0VC 4OBTA 4TX9A 4AHOA 2GQAA 1LBFA 4LANA 4D6GA 3NIYA 4D9PA 2A79A 2VCAA 4LNYA 4LAOA 4UQDA 4NAFB 4XQ6A 2W92A 3EA1A 3LPPA 3V5CA 1IQ8A 3J7HA 4AXNA 5CKSA 4D8LA 3A5VA 5REQA 4O4WA 2NQZA 2YSWA 4JBRA 4KPLA 1I2PA 2ICSA 3N13A 4CEXC 4D8AA 3SIZA 3P5ZA 4DO5A 2QR6A 1EIXA 2BHZA 3PTQA 4JGDA 3TCSA 3G6MA 4B90A 1Q6LA 3AUJA 1BG9A 5EPDA 2BBFA 4O12A 4JEJA 4LCRA 2PDBA 1FKXA 5TNVA 2LLEA 5U4NA 4B16A 1THFD 1M1BA 1TZ7A 2D0GA 1KO0A 1FXPA 4HQVA 2E5BA 1TMHA 3E5BA 4MZ8A 3GNOA 4XK2A 4A3RA 3W23A 5ABHA 4JTFA 3THQA 3NPUA 3LCWA 4UTFA 2ZA2A 4RZ5A 5HA7A 3R6IA 4N9BA 1JZ8A 2O7SA 4FPSA 2Z25A 1TUFA 3G77A 1WKYA 3QTPA 4GKTA 3W07A 4GKLA 1BHGA 3PZOA 4HMEA 3GDMA 3VILA 4UTJA 1DJXA 1JF6A 3MA8A 3N3TA 3MHFA 2PDHA 1RR2A 3PUEA 3OHIA 3WO8A 5CPMA 1KFEA 5CEWA 1LZOA 2CITA 3EX3A 3UG8A 4EPEC 3BZJA 5C2CA 2B81A 1W5PA 3RPMA 5C70A 1ME9A 3MUXA 4LUTA 1OYCA 3A13A 5FEPA 3CT7A 3CHVA 3A9IA 1E6SM 4PCPA 2O9PA 3HV8A 5CZ0A 4C1NA 2P1FA 2ZADA 3IARA 4MNLA 1TPH1 3PP7A 3HG3A 3I10A 3TSDA 2VWTA 3GTHA 2XTKA 5HNTA 4LY4A 4GLEA 2PBGA 4GACA 1VEOA 4I8YA 4HK5A 2EPMX 3RM8A 3SUUA 4PTWA 3POHA 5CGMA 2QCHA 3KZPA 4RL3A 1MFUA 1MRAA 1WOBA 2C18A 4NIRA 3GZAA 4GFIA 4NQ1A 3AC0A 4JYDA 2WVSA 4IGMA 2GGGA 5K3VA 3WMBA 4C6KA 5EMYA 1B5TA 1PDYA 2V5CA 4OWGA 1QOQA 3G2GA 1H50A 1QK2A 1FY6A 4IUGA 2V2CA 3TAOA 3VZXA 1JDAA 1SZGA 2ISVA 3L4UA 3GAYA 1MUMA 3PBMA 4NY2A 4EOUA 3F2DA 3MI6A 3VCCA 2DU2A 1S2VA 3H21A 1S3HA 2VGBA 3PTMA 2QDDA 3B06A 3FGCA 4GXMA 2FQIA 2Z27A 2QYGA 2H90A 3TTQA 3SN0A 1HQTA 3KP0A 3AIVA 3DCPA 3B4UA 3OZOA 5AYXA 1XYCA 3NGJA 3TCEA 4D71A 3LI1A 2YA0A 2MANA 1XICA 1W9VA 5LYRA 4E8DA 4UUIA 4NUWA 1Y0EA 3L12A 3V0TA 1YTDA 3I6RA 4NJKA 3URBA 1KD0A 3LHUA 4AD4A 4IMDA 1XRVA 4QE1A 1TR1A 2HNHA 3MV01 3WQEA 3D3AA 3AWOA 1GPFA 4U3AA 3CZKA 4IFKB 3VAVA 1K3UA 1FWWA 5BXTA 2QV4A 2QJJA 2WJDA 1VPQA 1R47A 3MMUA 4CN4A 1WE5A 4L6DA 3KTSA 3HQPA 2XWEA 3XISA 1W3HA 3BJSA 5DMYA 3GQYA 1TIMA 3IGXA 5FI8A 5E0KA 1L6SA 1O1ZA 3R25A 3ITGA 1DJZA 4C6NA 3NM1A 1WZLA 1J2BA 3HMJG 4Q8OA 2XH4A 3AAMA 4UB9A 4BA0A 4U2YA 2A5HA 3NGFA 4HHLA 3KM8A 4NG3A 1JDDA 3SRFA 2KZHA 1T41A 2NUWA 1GQLA 2G3MA 3MUZ1 1HGWA 3LM3A 1OCQA 1IT7A 3OJGA 4JHOA 4JNYA 4O15A 2A7PA 4BF7A 4ERGA 2E67A 1E6QM 1LOSA 4YVVA 3ZM8A 5KETA 3USZA 1ZU8A 4JTTA 3UPMA 1E4NA 3GG7A 4LEQA 4C65A 4EANA 1MXDA 3B0XA 4EF9A 1CTNA 3LRMA 3ORWA 4LS0A 4JIHA 4H1ZA 2JGQA 3FX4A 1GVFA 3W7EA 4O8AA 4AWUA 3ZVIA 4XV0A 2W6RA 2IKIA 3FSUA 4JIEA 3WIJA 2AL2A 1QHOA 5ABFA 2PC8A 3S1UA 3VKCA 3W1QA 4O1FA 1GKRA 2VMFA 1NDVA 4OJYA 1RVGA 2GUYA 1J5TA 2WNQA 3UA3A 2VGIA 1R7AA 2Z28A 3CASA 2WXDM 3ARUA 3K30A 4FLOA 2BY3A 3TYEA 2PTWA 4GUJA 1VPXA 2FH8A 2C0AA 4K6AA 4R27A 3WF4A 3LM7A 5FJRA 4NP7A 4F9JA 4AC1X 3R12A 5DEZA 2QNEA 3LQLA 1OEPA 2VEIA 4L80A 1SO6A 4DVOA 3LV5A 4EVZA 4Z2IA 5HINA 1YXDA 3IJ7A 5HDRA 4LYKA 3FAXA 1LM1A 4QEEA 2Y70A 4CCZA 3MW7A 2VUYA 1KQZA 1R38A 1DJQA 1QBBA 4J3WA 3VIOA 3QN3A 1PHQA 3UXAA 1S38A 1M53A 3AZTA 5BXRA 1S1RA 3WEZA 4NRRA 4F40A 2UY2A 3UXKA 3WLJA 1OINA 3RO8A 4X0NA 1E1EA 4NYUA 4BQ3A 4AEOA 1UA3A 5CC7A 1CEOA 1WBJA 1NAL1 3VOHA 2X16A 2EPLX 4Q32A 1JCNA 3NEVA 3ITCA 9XIMA 1R0MA 3RF9A 3RFAA 3U2OA 2DIEA 2XFWA 4JNZA 4AVFA 3WBYA 1IZJA 1V02E 7PTDA 3ITTA 3I65A 3Q65A 1UZDA 3PAJA 3B0UX 3VIPA 2Y7DA 3W24A 7REQB 2CZ5A 3KOFA 2AGTA 2HSAA 4KETA 3CL7A 3B03A 1CXHA 3RGTA 2QJNA 1VEPA 4NHVA 2XM1A 2J9ZA 2YZ5A 3E2SA 3W86A 2GSJA 1ISXA 1GW9A 4NF7A 2E9LA 2YFNA 1A4LA 1OC7A 3CPUA 1SFTA 1EP1A 2YB1A 2GZXA 3T6CA 3RX4A 3TQKA 4LBRA 4ERAA 3M0KA 5HPCA 4OE7A 4HHMA 3GUWA 1EJ7L 1W5MA 3T08A 4F0RA 3PPFA 3NYZA 2CZEA 3VIGA 2V3EA 2CU0A 1FWAC 4O13A 3QZ6A 2A7RA 2CLPA 4M1RA 4WY0B 4AZGA 1V6XA 4CD6A 3STEA 3EB2A 2J24A 1W6TA 2C1HA 4GNJA 5BNKA 3B0YA 2QULA 4JTAA 4O1AA 1FVPA 3W1AA 5DBTA 1OF8A 3W9ZA 1TPDA 2GPTA 4LUSB 3WEOA 2IKHA 5AFDA 1DXEA 2PSNA 3KOZA 3RCNA 3DDMA 4JN8A 3P80A 4US5D 4QSFA 4OECA 1DWHM 1ZBVA 3RMJA 1Q13A 2XIBA 3M0ZA 4PSRA 1V7AA 3W7OA 1F3WA 2V5JA 1QNOA 4L4OA 4PUEA 5DRCA 3CWNA 3IVTA 4O4VA 2X42A 1NVMA 1ITQA 4E0CA 1V3LA 5IRPA 4H19A 1MW3A 1XD0A 1XBYA 3AHTA 2PFHA 3I7RA 3KTXA 4KW2A 2TSYA 3L2MA 3UXIA 1JZ2A 5D4YA 1XW8A 2YDAA 4DI9A 1EEXA 1EYEA 3L65A 3PBGA 5CZKA 3SADA 3EGJA 3GDTA 1P1MA 2YB4A 4LOCA 3I3BA 2WSPA 1X8FA 1OJXA 4LV9A 3FXGA 4I7UA 4V1YA 3WKZA 4HBKA 1BXBA 5EMUA 3QGKC 3GVVA 3OTRA 3DUGA 4LYQA 3U48A 4XO6A 2OU4A 4A35A 4UFIA 3DH7A 4XZ9A 3EKLA 4RX0A 1X6NA 2WHLA 4RZ6A 3C6CA 1UP2A 4E3TA 1CLXA 2DZAA 3DEQA 4FK9A 2W63A 3WN6A 3CTTA 2F6UA 5T91A 2PDJA 7CGTA 3OO2A 1CXIA 3W1PA 4W89A 3LCGA 3LLXA 2WBKA 3HA1A 1DIDA 4DNHA 3QSTA 2DZWA 1NFBA 3GTXA 1SO5A 1BTCA 1EJUC 5EU9A 5MKGB 1RP8A 3VI2A 2QCLA 4IH3A 3TMQA 1F8IA 1WPCA 1YADA 5C2XA 3S0CA 2V38A 5PTDA 2XYLA 4ZB0A 1F05A 1ISWA 4Y8EA 2GGHA 3RLUA 1E6XM 4WF7A 1E51A 3N1AA 2RH9A 5HJLA 2BY2A 3A9BA 1DWAM 3TWAA 1OX6A 1TJ2A 1PB0A 4H6RA 1XIIA 3CC1A 1CXEA 3L7RA 4JAWA 5KTLA 2NVCA 3ANUA 4LVFA 2WM1A 4LB4A 4YS1A 4PMZA 3M5VA 4XG1A 1TWDA 2GJXB 2DZXA 3GBEA 7TAAA 1CGVA 4KIEA 3ARZA 3SQMA 2CLHA 4DLMA 3KLKA 5FJIA 1WAUA 1CLKA 3USBA 1QHPA 3WSUA 1FWCC 1K7FA 3TNBA 2OYMA 1J6PA 1B31A 3EWCA 3VGEA 1WNOA 3V35A 1P7TB 2Y8KA 1M5WA 5BROA 4MB5A 1PTAA 1BPLB 2C1GA 3LBCA 2QUUA 2ISSA 1DOSA 4RZ4A 4JTQA 4EKJA 3GHRA 3NAVA 3CV7A 3N2TA 4CQCA 3EDDA 1JI2A 2P76A 5D09A 1FQ0A 3NL3A 3THDA 3H70A 3PS7A 3HB9A 2ASHA 3UVAA 1E9IA 3DFHA 4Q8TA 1IEWA 1XUUA 3CHDA 1NF7A 3FYOA 1QI4A 4U2ZA 1OBAA 3ISIX 2DV0A 2NX1A 5LA2A 5A3HA 3TOYA 3PB2A 2QW5A 3TAKA 2CXEA 3PHAA 3WLPA 3C2FA 2O7QA 3UXDA 1O7AA 4DZIA 3M4HA 1MZRA 2WMGA 4IT1A 2BGQA 1A47A 2H3BA 3NXFA 1UD5A 1P6WA 2OZ3A 2E5CA 1DTNA 1P0DA 1Z89A 3PJXA 4C5YA 1H41A 5FEWA 1B30A 6REQA 5GNXA 2Z7GA 3POCA 1ML1A 3B0PA 3NYDA 2TMDA 3UETA 1VFFA 1KKOA 3H23A 3RHGA 3SCTA 3N2XA 4BI6A 1LYXA 3PPCA 5HQMA 3QV9A 3KRBA 5HUOA 3TYCA 4E4PA 3TJIA 3RYSA 3BSHA 2A3BA 1PXGA 2VJXA 2V30A 4AHQA 3TYZA 4MM1A 3HQ1A 1VBRA 4C6DA 1F6YA 4Q4RA 2FFIA 2Y6ZA 3O9NA 4CVUA 3B9AA 4XZLX 3TTSA 2ZVRA 4NI3A 2PWEA 1QNPA 3NPWA 2QF7A 3XINA 1IZCA 2Y7FA 4IPJA 4KH2A 3TJ4A 1OX5A 4RW3A 1TTQA 4JEQA 1L2UA 4MF4A 3DFSA 3BAIA 3WQOA 1QI5A 2WNZA 3DC8A 2XFYA 3ITVA 4F2TA 3L4VA 1QDSA 2NWSA 5A8NA 1LCOA 4HP5A 1A53A 1AA1B 4BWLA 1LT8A 4AB4A 4Z2HA 3AICA 1EHNA 4FLRA 3W53A 3GR4A 5EGRA 3VIJA 3ZLFA 4AX6A 2PTZA 2VZTA 5F2MA 3QFEA 2WJFA 4O1DA 3NO1A 1Y5XA 2XUCA 1VQTA 2KX9A 4DPPA 2R14A 2E6FA 1LOLA 3GXMA 1WX0A 5EMJA 2FVMA 3NVTA 1UROA 4ES4A 3TQ0A 3NQMA 4JFSA 4FX6M 2NXIA 2QVHA 3MDWA 2FGLA 2XVNA 5C7HA 4IMEA 4GNVA 2GDQA 1A5KC 2NLIA 2J62A 3WJSA 4C6OA 3ARPA 3L0KA 1LBLA 3T4WA 1RY0A 4R7OA 1US2A 2QCNA 4IFRA 2Z2BA 3BGJA 2BOGX 1CI1A 2EXOA 2BB0A 3GFYA 2PLCA 2RFGA 3AIQA 4Q8NA 2XIJA 2VC6A 1I8JA 1OY0A 4E4FA 4UCFA 4F3HA 1F3EA 3RLGA 3URNA 3T8QA 3W29A 3KFTA 2AKZA 4Q6XA 3M6YA 4PULA 3TYDA 2XG9A 2QCGA 1M03A 3ZYZA 3DECA 1RSCA 4MB1A 2D2HA 3KCJA 1XYLA 4P8VA 3LXCA 5H8PA 1VCFA 3S46A 1NF0A 3PB0A 3OHMB 2YR1A 4HPGA 2ZUMA 1XDJA 2CERA 3BJFA 3FV9A 4RE4A 4Z2LA 1EXPA 3QKEA 3W7HA 4AZ7A 2CZVA 1EP2A 1KXQA 3CZ8A 1TA3A 4B4FA 1HKVA 1V4YA 4L61A 3B8WA 2Y62A 3M0IA 3BANA 1CCWB 5FL1A 3UR7A 3G1XA 2D23A 2R9RA 1RBAA 4F2BA 4DJFC 3LLFA 2QUVA 1V8EA 4A21A 4XAGA 1TTPA 4YTRA 1ECQA 1TWSA 2BASA 3ARWA 1GNXA 3OZMA 3EPMA 3R4IA 3RCMA 1K8ZA 6CGTA 3W82A 1XS2A 1Y5WA 2FVLA 3URQA 4Q7BA 2EPKX 1JYXA 2E1WA 3LENA 2VWSA 3E38A 1FHVA 3TTYA 4O14A 3L4ZA 2CBVA 3ZQ9A 3OVRA 1O1HA 3REQB 1WDRA 3WNMA 1NQKA 3NQAA 3NDZA 3ANYA 3MANA 4O54A 1UP3A 2PU1A 2DDXA 1DJNA 1XV8A 2YYTA 4LUIA 5HMFA 1PWLA 5HWNA 3LMZA 2P8BA 4Q8VA 2UWFA 1T99A 1H60A 3B05A 3EXSA 4H9VA 3WQWA 2QCFA 3IJ8A 2W79A 4DJED 1MZHA 5CJMA 4QRNA 4HU0A 1GWJA 1NDYA 4C5ZA 5KZ6A 5JIWA 1GTEA 3EOSA 1XLFA 1QPQA 1HZYA 3WQDA 1V77A 1RK5A 4DYKA 4E3VA 1L6WA 2C91A 3IACA 3G24A 2DH3A 1JEZA 1KM2A 2V2DA 3UGVA 2OOFA 5TF0A 1OFOA 1E71M 1FWNA 2ZBTA 2JFEX 4WZHA 1TZZA 1Q5MA 2HMCA 1QNRA 4AZIA 1GEHA 3S5NA 2VFGA 4IMFA 2J66A 4HGXA 2YKKA 3EX4A 2Z1BA 4NZ4A 1V6WA 4UTKA 5EB8A 1LRQA 3ITYA 1MMFA 1K9EA 5HATA 2PCEA 5HK4A 5CH9A 4LUTB 4PZVA 5FIPA 2AGKA 5BU6A 4S3FA 4D6FA 2WMHA 3EX2A 1OCJA 1GKQA 4UOZA 2A85A 4JTHA 4C1NB 3UJRA 4HA1A 4GBDA 2A7NA 1GYMA 3TLQA 1V3MA 4HK7A 2DZSA 4H2CA 4XAPA 3CLWA 2HDJA 2V5LA 1Q8AA 3LCHA 1FHDA 1PIIA 1EC8A 1UWQA 2H3DA 4PCFA 4TMBA 2UY4A 5AYBA 3F4DA 3ZJ8A 4LAUA 4Y7EA 1V6YA 1UG6A 5KSWA 1G94A 4XKYA 2F2KA 3CAWA 4UQEA 1R85A 1Y7VA 2EAWA 3WQ5A 2WC3A 2VT0A 1VFLA 3QRHA 1JCTA 3I68A 3O7UA 1EJVC 2Y8UA 5L6UA 2ZQ0A 3WNOA 1MRQA 3K8KA 1SUXA 2E6AA 2PDPA 4M56A 1B3YA 3QV6A 1AJ2A 3V16A 3A64A 5DMMA 1K9DA 3VD9A 4ORIA 3ZT7A 1OG0A 3T07A 2F84A 3WQPA 4TX8A 1IEXA 4UTMA 4EWJA 1W5OA 1UYQA 4OU1A 1JCXA 4TTUA 3HV9A 3FYPA 4UFHA 2PZNA 4F0HA 4S3AA 4ZXLA 3A24A 4MTVA 1E6RA 4NXSA 2ZA1A 4CU7A 4JL1A 3MO7A 4MVAA 1DJWA 3ALFA 3UQNA 4DWSB 1QJWA 1AODA 1IWBA 1CB2A 2BVYA 2GOUA 1IYXA 2CBUA 1SMAA 4X0VA 1I9CB 2QXWA 1AQMA 1WKDA 2NXHA 5AHMA 1HL8A 1W2PA 3V5OA 1X38A 3ZVHB 4CQ8A 2BVTA 4O53A 3KEHA 2DGAA 2E6DA 4DWSC 2DJLA 1PCKA 3KX6A 1ZUAX 1RVKA 4PTVA 4LY8A 1FWRA 1M65A 1PIFA 1JCMP 3M0XA 4I9TA 5D8ZA 5ECVA 3LU2A 4D1IA 3AYSA 4KT2A 1AZ1A 3FA3A 1R3WA 3GY1A 5AN7A 2PODA 1IF2A 4I9JA 5CLWA 3GD6A 4QROA 4GPNA 2Y8VA 2OVLA 3VNKA 1D8CA 3BG3A 4Y90A 3WDIA 5FF4A 4F66A 1YTKA 2J7DA 3GVGA 1M7JA 4N6FA 2V5KA 4OVXA 3BICA 4IPIA 3WFLA 4GQGA 1KTBA 2HCVA 3H2CA 2Z1KA 3M5XA 1GT8A 4PRTA 3NA8A 1J10A 4U4MA 4W8AA 4AD2A 2QPSA 4LVAA 2F8QA 4AXKA 1ZCOA 1MI3A 2XIQA 1R8LA 2P10A 4GH1A 1YMYA 5XINA 4L1WA 2E5DA 4FF5A 3W7DA 3R58A 2VEMA 2GGEA 2Y61A 3B8TA 4N4PA 3HFYA 1RH9A 2XVKA 2GQ9A 1GK8A 3F4WA 3PANA 4JX4A 3G1VA 2JQXA 5H6HA 3GNRA 4RXGA 2O9OA 4YHEA 2D69A 4G7EA 4US6A 3G1HA 4HMDA 2IQ0A 3O06A 2YLAA 3E1F1 2X1RA 3CQKA 3AHZA 4HMNA 3S6DA 5C9RA 1UOKA 1VD6A 4H6QA 8CGTA 1XCFA 1LG1A 1BRLB 3PJTA 4RW5A 4I7WA 3Q45A 4RR4A 1GYNA 2BNJA 4X9YA 2WMFA 1K02A 4U3CA 1KRMA 5CZSA 3N9SA 4Y96A 1J0YA 2W91A 1KFJA 2YW4A 1OG6A 4B91A 4R88A 2FPVA 2PGFA 1LL7A 2XZ7A 2G3IA 1K03A 4BQ4A 3VGGA 1EJSC 1GW1A 3W7IA 4C1LA 4JKLA 2QHAA 1OFEA 1L8PA 2WVVB 2BMBA 3VIMA 1CT5A 1O5XA 4X9SA 1ZENA 3QHMA 4MAZA 4MWAA 4QISA 5HANA 3OGSA 4YWIA 2E9MA 4UFJA 2WC4A 2XVLA 5D9MA 4NZJA 4WVXA 2YYUA 4MFDA 1MDLA 2XIOA 4B5NA 1N2VA 4GINA 5LNWA 3VNIA 1JPKA 4NJHA 2C19A 3FN9A 5FACA 1S1PA 3TSBA 1XBVA 4L6OA 3CV1A 1IT8A 2R82A 4NAEB 1ISYA 1JF5A 3DKJA 3SY8A 4UMCA 1DIEA 5D02A 4GYPA 5JBEA 3G3DA 2NXGA 3LHZA 4HZMA 3ZT6A 3ABXA 5H1WA 3EA2A 4DF2A 1XSIA 3QV7A 4LF1A 3TIMA 3LYEA 3MKCA 3GLCA 3EWBX 3P0WA 5A8MA 3HU7A 3U7VA 5EYWA 3UVIA 3FSTA 3SECA 4IJRA 3CHEA 1RJPA 3FEMA 4N9EA 2HV5A 4FZIA 4KEZA 4HNVA 4OOUA 4DYJA 2PF8A 4DBSA 1JD9A 1FWJC 4DBDA 3SR7A 2FJUB 1LORA 4Z0JA 1MXSA 1ZPTA 1CYGA 5FF3A 3P2VA 2ZRZA 4W86A 4A4AA 3EYPA 3IJLA 3W88A 4PUDA 3C2YA 1M6JA 1QNVA 1TJRA 3MWCA 1TR9A 2XN2A 3IV3A 3IJ6A 2CZDA 5C9ZA 2YBVA 4JDYA 3N2BA 1XWYA 4K3ZA 3LCIA 3AMLA 1R3SA 5E9XA 3KWSA 4NX5A 3TKFA 1XIEA 4WY0F 5F2LA 2BLEA 5HMDA 4M3PA 3ABQA 4NRSA 2UY3A 1J0IA 3TC6A 5C9UA 4CNSA 3P84A 5I06A 1JRBA 1OABA 3MDUA 1X96A 3WLMA 4FMVA 2GDVA 4AG0A 4MG4A 3AO0A 2ZICA 4XD3A 4QP0A 2RJHA 2ZC8A 4C91A 4A22A 1YDNA 2X41A 2Y88A 5I77A 5FKYA 3M5YA 3SUVA 3TLLA 1QRQA 4Z1AA 4EP8C 1QW9A 3DG6A 3SCNA 3BO9A 1E6NA 3BXWA 2EPHA 1UWAA 5KMYA 4M82A 4EPKA 5FJPA 1JNEA 1E40A 1BWLA 5JMUA 1EGMA 3TK7A 3W1TA 1EOMA 3TW7A 4JCMA 2DJXA 1DJIA 1RQHA 1Z41A 1MW0A 3DZ1A 3TN4A 1G4PA 4HSHA 4Z2GA 4N6EA 4ML9A 1KRBC 1VJSA 2ZRXA 5FJTA 4M1BA 4LSBA 1VR6A 5D2YA 2OSYA 3BLLA 2W67A 4JZ5A 1PPIA 1EC9A 4J4KA 1RJRA 1F4AA 2R1KA 2YBUA 3LRKA 3IRSA 1D7FA 4JQ4A 1P0KA 3ELFA 3MMWA 4GRSA 1XIHA 5E5CA 3QEZA 3NL2A 4BR1A 1F3TA 4GQBA 4E8GA 5CAKA 3BLEA 1EEPA 3PTKA 1Z69A 2WZEA 1LL4A 3F7JA 9XIAA 1S2UA 1UMYA 1UJPA 3LCFA 1R30A 4O19A 4Z0SA 3C2VA 3MT1A 3BAKA 3AZSA 1BXCA 3VMOA 2PMQA 1J5SA 4M5PA 1VFUA 2O4QA 5H8UA 3W25A 3LI0A 3F2CA 4OBRA 4MY1A 1RQBA 3H7VA 1I4NA 3RU6A 3TMLA 4ECLA 2B4GA 1ESWA 1ZP4A 4QAIA 3WUFA 2W3ZA 4OIFA 5AC5A 1UOZA 3TXZA 3O3RA 1F2JA 2VFDA 1G6CA 3VDCA 1HJQA 3APYA 1E6ZA 3LEPA 3C86A 2OEMA 1A80A 3PBWA 4MPQA 3QY7A 5I6SA 2J7EA 5AECA 4QQ3A 4NNCA 3L4WA 2IS7A 1XG4A 2W4XA 4ZL1A 2WWDA 1EOKA 3WQGA 3H4GA 3FKRA 3A4WA 4H8UA 1EJTC 5G5IA 5AYYA 3KRZA 3MHUA 1DJGA 2V3GA 4EIVA 4PCSA 3IGUA 1PYMA 5EMKA 4JX5A 4GE8A 2YXXA 2Q71A 4HNOA 4ICMA 1F7BA 3P8IA 4JIPA 3C5QA 1IEIA 3S3GA 4L4LA 2A3LA 4V2XA 1LLWA 7XIMA 3IIZA 2OODA 4PTDA 4KFPA 4QNEA 5DO8A 4NZCA 3PVFA 3DXIA 2XH0A 3K8MA 2DZUA 3JZUA 3NOYA 4IQLA 4RNJA 2VYOA 5HQEA 2VI0A 4B9ZA 1EB3A 1W8SA 2JIEA 3SEPA 3IUDA 1HW6A 3DYPA 3QTGA 1U5VA 1YYAA 3B8SA 1OGBA 3T7VA 4Y9OA 2FJKA 2OOGA 4KEVA 2Z1VA 5HNRA 1LG2A 1W3JA 4JN7A 1H7PA 4PA8A 4C6MA 3NWRA 3WQ6A 5HJYA 4LGXA 4BY3A 4AC7C 4F4RA 4K8GA 2PDCA 2GOKA 4GXWA 4W4QA 5JH2A 1R9ZA 4FAMA 1YE4A 1F8MA 4H6EA 1UWIA 4LJ3A 1WP6A 2D0HA 2QCDA 5HAOA 1UC5A 3WUEA 2JALA 2FZNA 4XD6A 2VGGA 2VZSA 3HF3A 2XIIA 4KRZA 4LAMA 4QE5A 2X7VA 3SGZA 3PBUA 1GPWA 2BX7A 4D6EA 5L9FA 3P62A 4B4HA 2GWNA 3QPYA 1BVWA 6REQB 3PZNA 3WMLA 3WH7A 3CV2A 3UY7A 1PL9A 5HPOA 2RHGA 2Z2AA 4PCNA 2GUBA 3GHSA 3CIWA 3SDOA 3FHAA 4O0ZA 4CCDA 1XPGA 1MEIA 5AC8A 4RDVA 5M17A 1J0JA 4HSOA 1WZAA 1Q6GA 1XJBA 5K4ZA 1EZWA 4ORMA 2WCGA 1OHLA 1L6GA 1KA9F 2X2YA 4PSPA 1JZ3A 3WEMA 2D3LA 3M0MA 1SJCA 3NSXA 5K2ZA 3S5OA 4JQ2A 1FXQA 1BGGA 1RV8A 3MCMA 3MYOA 3UJFA 5IHSA 2AQOA 4GUFA 2GGIA 3KOXA 4KGLA 3ZZ1A 1GVYA 5CC5A 5IFTA 4BI7A 4IPLA 4DAFA 3ZIZA 4PTNA 1DWIM 2FZBA 2R94A 4GZ7A 1UR9A 3BLKA 4HNNA 2HVNA 1D7KA 3O8AA 1R87A 3AMCA 4QAWA 1UD4A 1YNPA 2IPGA 3SM0A 4H8NA 1KRAC 2QDGA 1IWPA 4A6GA 4X61A 1NM9A 1WCGA 1DL3A 3OLEA 5CGQA 1KLYA 3VUPA 3KBNA 3PWAA 4GYKA 1TVNA 1OIMA 1TZ9A 4J2MA 1EUNA 4HJFA 4C6FA 3O07A 4IIEA 1ICQA 4IOTA 5E09A 4ZQMA 2OX1A 5E93A 4WOZA 1E70M 1X1ZA 3IIVA 1QFEA 1EIBA 2HQAA 1EF3A 1A3XA 2CHNA 1MVYA 3BJTA 3EAUA 4NJGA 1I2RA 4CQAA 1MEHA 1ONEA 4UQAA 3OZPA 2P3ZA 3HO8A 4D6HA 2QVNA 3RM9A 2X40A 3ZS4A 3YPIA 3O0FA 2INEA 3AZRA 4WLCA 2V68A 1YTEA 3BURA 1JR1A 2ZZ7A 3O0KA 4XISA 3CEPA 4ZSTA 1RCQA 4W8BA 3BW3A 3QY8A 5FAJA 3M7SA 4Y8FA 2R1NA 1Z9AA 3LN3A 2WK2A 5CPOA 3PNUA 4LV4A 1RK6A 4DJDD 3CQJA 5GJPA 3N34A 2ALDA 4HB7A 3WD4A 1QXLA 3KUMA 3NM3A 4A3QA 5CBBA 3PF3A 3FDGA 2OLAA 3NPVA 3MJYA 2D73A 1SJAA 2ATMA 3GRIA 1CIUA 4W88A 1G01A 4GJJA 4D72A 1K7EA 1KQYA 1VRDA 1QOPA 3FW6A 2PLMA 1Z44A 2PWHA 3JZEA 3TW9A 1UD8A 3FAWA 1DJYA 4TUFA 2BODX 1O4UA 3QR0A 1J4EA 2IKJA 1XI3A 1LUCA 3M1ZA 4IWWA 1PV8A 2DP3A 3WBAA 1Q6QA 1H61A 3LGDA 1W9BM 1XG3A 4NZ1A 1G5AA 2XIMA 2ZKMX 2Y7EA 2NV9A 4CQBA 5EY5A 1E3ZA 1U1JA 2PA6A 5FOOA 2OSXA 2WMJA 4MKNA 1OFQA 3VD4A 2JKEA 3GXDA 4ADSA 4Z1DA 4GC3A 3WD3A 3E2RA 3IGHX 4PFHA 1D9EA 1GVEA 1W2VA 2P0IA 3W74A 1YIXA 3PWIA 1BVNP 1A5BA 4G8TA 4ADTA 4RDZA 1EP3A 4IPPA 1BYDA 1KGUA 4R5EA 3CUGA 3EB3A 1NP2A 3IIOA 1FCVA 3ALGA 1FWIC 1XQKA 5I3GA 4FXJA 3KW3A 4RNHA 4UQ9A 1DTUA 3WLOA 3CAVA 3EX1A 2J7FA 2J78A 2J6VA 4JHMA 4ONVA 1ZJBA 1I45A 1EQPA 2WAGA 1TJ1A 1GGOA 1K7XA 2HXTA 2CIPA 3PZMA 2OB3A 4I7VA 1X7IA 2H8ZA 3VKBA 3ABOA 5DN1A 1NWSA 2QGYA 1C8QA 4F48A 1H49A 1NIUA 2TRSA 1Q2SA 5A6JA 5EBAA 3ECQA 4G6CA 3NEHA 2VGFA 3LPGA 2Y4SA 4C60A 3MKKA 4XTDA 1HF6A 4L6HA 1I2NA 3DAQA 4WGHA 3W22A 4NJJA 5E6ZA 2DW6A 4P7QA 3IIPA 1R3TA 1BGAA 3CTLA 8A3HA 3H8AA 1UR8A 3AYTA 2Y85A 3WX7A 1G4EA 1J2WA 2CC0A 4LVDA 3NZQA 1RBLA 4JN6A 3W1MA 2EPOA 3CU2A 4GY1A 2QAPA 2DVTA 3TEVA 3NJ3A 1JUBA 1VGAA 3DFNA 3IV8A 2CXGA 1U1UA 2DZBA 4IX0A 4NT0A 4QIUA 2JEQA 3PBVA 1D8WA 3WNLA 1S2AA 2E8ZA 1SZNA 1IR2A 3PZ9A 1EC7A 5HBFA 3BMXA 4M19A 3S9IA 1E4LA 1E4MM 2WMIB 2VD9A 5LNSA 4KCWA 1XLJA 4PEKA 2V69A 2R1MA 4RNIA 4ZB2A 1W1B1 4H7CA 4KF1A 5HJXA 1NWRA 4MY8A 3GYEA 4W5UA 3UWZA 4UTWA 1IXQA 2BVWA 2DSKA 1EJWC 3HOJA 3MHGA 3CB3A 4AX7A 3CPRA 5BOFA 1XD1A 2FHFA 2DVUA 1H1ZA 1XRTA 2PDLA 3ARRA 4UMBA 3FJLA 1E9ZB 1XGZA 2B7OA 3UWQA 3Q94A 1YHTA 1ONXA 1G4SA 2ZUVA 5A94A 3TR2A 1KGWA 3C61A 3N25A 3C3NA 1MSSA 4H4IA 3A4XA 1HUVA 3KS6A 4AY7A 4D6IA 4L4PA 1EO5A 1ALDA 4GXPA 3VKDA 1LWIA 1B57A 3LB0A 4B2DD 3LV6A 4G5DA 4NNBA 1XYZA 2W0UA 4FLQA 4GI9A 3QHOA 3TNOA 3FVDA 4ZQNA 1TWIA 2CNCA 3T78A 4S3EA 4CEUC 2Q8ZA 1QK0A 2GL5A 2CW6A 1E1FA 3IANA 4WJEA 4XZNX 5AVNA 1KM3A 4WJ8A 4NZ3A 1OK6A 4REQA 5A6SA 5FD0A 1UKPA 3AS2A 3DKLA 3T40A 2QGHA 3PTDA 1B3VA 4X22A 1U5HA 4JFUA 3FJNA 4XWUA 5LGXA 2DUZA 3L5MA 3K8LA 1FWTA 3BSMA 5I07A 1R2RA 3GG8A 2OEKA 3GTIA 4C90A 2R91A 1Q6OA 4PMDA 1XFBA 3MO4A 1Z6KA 4J28A 2PRHA 2QMJA 3WFZA 2VR2A 5I00A 4E8CA 1JUKA 1XH2A 4Q6JA 3SN4A 1DIOA 2ZRUA 3CMGA 3QM3A 3WD1A 3AIUA 4F8XA 2WVUA 1A50A 4DRSA 1FUYA 4JNMA 3WBXA 2IPFA 4W7VA 3COTA 2L5HA 3W85A 4AD0A 2NQHA 4Q8QA 1N7KA 2P5NA 4BFAA 1GG1A 2PU0A 2J25A 4N2YA 1A0EA 4IMCA 1YPFA 2HE5A 2JGYA 3VE9A 1OX4A 2R8WA 4J3UA 3ZJKA 4O1CA 4GUIA 4IGSA 3T09A 1HT6A 3KRUA 4Q4QA 2G3JA 1POJA 1CW2A 3AMDA 2OPJA 3CYJA 4GO8A 1B1YA 1XLLA 1AJ0A 2WMKA 3LPFA 2F6KA 4O17A 3IAQA 3VGDA 1ADOA 5G1MA 1E5JA 5AKQA 3EDEA 2OLSA 4W87A 1W5NA 1QO2A 4FOUA 4MPKA 1TSIA 2YCLB 4CCEA 4B5UA 4G7EB 1R3RA 4LUYA 4HCDA 3E0LA 2CLFA 4AD3A 2WLZA 1CGWA 4QJ1A 3R8RA 3VCNA 3N2MA 2NQ5A 4JTLA 4WXYA 1MXGA 3CO8A 4H9XA 4Q4KA 1UKTA 4D6JA 5M3WA 4BZYA 4DJEC 4I5UA 3TC7A 3STFA 2WPBA 5JXQA 4JXCA 1JDFA 5I5RA 3IUIA 1W9UA 2FFCA 3G1SA 3WH8A 2ZZ1A 1YXCA 3LBOA 3IK4A 1F5ZA 3G6LA 4OV9A 2BY0A 1WDPA 1A0CA 4JFWA 1BQCA 3NQ7A 3LLDA 2CBJA 3OLDA 3CNYA 4Y9MA 3KHJA 1S5TA 3C0QA 1PHWA 3IRDA 4KWWA 4DUWA 4GX8A 2PDIA 3B8VA 2A3CA 2G3FA 3LQGA 3SRKA 2VDGA 4PMOA 4BF9A 3LXAA 3BLPX 3IGSA 3SCSA 5DCEA 5TAOA 1O5RA 1XLCA 3GHUA 3U6WA 1O68A 5BRQA 2OLHA 1YBQA 1SZFA 1UWUA 3E74A 3LTYA 1NWTA 4HU8A 4QJ4B 4A8IA 3H2NA 1ZALA 3UZWA 2V82A 1TELA 1VLWA 2R6OA 4BQ2A 1TKKA 1E1CB 5I3KA 4YTTA 3OIXA 3UG3A 2VD8A 4LS1A 5FF0A 2PTDA 1U30A 1JAKA 4FXSA 4G1KA 3LERA 1JQVA 2RDTA 4V15A 4DWDA 4Q8MA 3GU9A 5A6KA 4UQBA 1PUDA 1YKWA 3S1GA 4ACZB 2RGLA 4AVOA 2DSZA 3OYXA 4S3CA 3RMEA 3HJEA 4RV3A 1Q65A 2ABAA 2I14A 2POTA 4IPNB 2V8ZA 2ZX5A 4HHPA 3S2MA 2I17A 5HWJA 4DWSD 4JQ3A 3ITLA 5FSDC 1UCWA 5LNUA 3VOCA 3W01A 1S2WA 5AYIA 3WBWA 1DORA 3WH9A 3WQFA 4HNLA 4UQCA 1OFBA 2QUNA 4RNFA 4JICA 3VKKA 5E70A 2HS6A 3BAXA 4W5ZA 2RDUA 4KBXA 3HMCA 3UZ5A 2FZ9A 1SFSA 4YNGA 3R0UA 1XCXA 3SAZA 3R2GA 3VMNA 2XHYA 4QBXA 3WG6A 1FWFC 4LRTA 2INFA 3RO6A 3TWBA 4H9UA 1H3GA 5LIYX 2J27A 4QS5A 2Q6ZA 1Q6EA 1TPVA 4KWUA 2HK1A 4JTIA 1AFSA 1H0GA 3Q4DA 6A3HA 3VTRA 4P8XA 3KE0A 3T0AA 4M0XA 4EPBC 1T6MA 1V08A 2GUUA 3IUHA 1KXHA 1M9HA 1JYNA 2GQ3A 5CZTA 1G7UA 3FA5A 5F1VA 4RZBA 3Q2DA 1EH9A 3BG9A 5T9BG 3DU0A 5A5WA 3TVAA 1WZMA 4G1NA 4S38A 3AHVA 4MYXA 2UBPC 3F4VA 4AZCB 1V3HA 3EKGA 3L4TA 5ABGA 2J8GA 3W6MA 4JYFA 2WPGA 3WK3A 1LLZA 4PL1A 4LTSA 1XL9A 4W84A 1KWGA 3GVWA 1JZ4A 1SW3A 1NP0A 1K4GA 3W70A 4IQEA 3T2OA 1Q85A 3BARA 4LC6A 2V81A 3BV7A 3WY1A 5I03A 4WEVX 3UCDA 4BF5A 4TOQA 5I3JA 3OODA 4P8WA 3AWNA 2CLOA 3LRLA 3U5YA 2REQB 1JCJA 1W8GA 5F4WA 2WJEA 4FR1A 2E0PA 4J7RA 3NQBA 4UTHA 3W0KA 1VB9A 4GJIA 3LZ3A 4AZ5A 4ILSA 1Q7MA 3N6QA 1WXJA 4Q4PA 1QBAA 3MTWA 2BXVA 3ZR4A 5AY7A 3G3MA 3R8GA 2FB2A 2BG5A 1F07A 2IXVA 3M41A 4KMQA 1CECA 2WNWA 9RUBA 4FNSA 4QITA 2I1OA 4IZGA 2XH2A 1NTHA 1ENUA 1G0CA 4RE0A 4IM4A 3RPDA 2BV9A 2GK1B 1PYFA 1E9LA 2ON3A 1H09A 3BC9A 1H1YA 1OM0A 8RUCA 3LSBA 2DVXA 1JD7A 3FOKA 4P7NA 4AIUA 4KKXA 1SM9A 4DXXA 3AXMA 1KBKA 1REQA 2B7PA 1K77A 1G67A 3WFAA 3VINA 3NQCA 1ZB5A 2NQLA 4JIQA 1WKFA 4YCPA 3A4JA 2XFFA 1QASA 2W61A 1H7OA 2HNEA 1YPXA 4AWTA 3CUIA 2HS8A 3E2QA 1OSEA 3CEUA 2QIWA 1W1ZA 3RR4A 4BEQA 2Z2UA 3AXHA 2Q3RA 4QCEA 5KZEA 3R11A 4KFNA 2QJMA 1S39A 1UWRA 3DIPA 3MSRA 1KBJA 4H83A 3QOKA 1UBPC 3RG6A 5DQPA 5F2GA 3DG7A 4UZSA 4O8RA 1K8CA 2QCEA 4V1XA 3WLKX 4E4UA 2ONEA 3M16A 5J5DA 1ZZMA 2ZDSA 3LA4A 4IIFA 3R1ZA 2AAAA 4MLRA 5CLTA 4MNKA 4GC4A 1U1HA 3AXXA 3VIHA 4HYVA 5K4XA 1Z3NA 3W83A 1U83A 1CXKA 5BMXA 3H6OA 4WK9A 2G0WA 2DQWA 2VHLA 3ES8A 1EPX