4K7YA

Oye1-w116t
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLTVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 151
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k7yA00
3S5ZA 4UTTA 3R12A 1KV8A 1LOQA 3P61A 4N9CA 5EBUA 4O17A 3QF0A 4EOUA 1YPFA 2A7RA 2J9YA 3NPVA 3UWYA 4CNOA 1GVSA 2G95A 1IXQA 1R2TA 1ICPA 1TTQA 3NA8A 4QISA 1OX4A 3N9SA 1ZY9A 3INPA 4FF7A 1YADA 1QMLA 2R91A 4KFOA 2YFOA 1WOAA 4DXVA 1H1YA 1G4EA 4Q4KA 2X1UA 4O1CA 2A21A 1VYRA 2I14A 3EWYA 2QCMA 3W2UA 3HJZA 3PM6A 5FEPA 4PFMA 1ZCOA 3USBA 1JRCA 1FBAA 3PF3A 4FHAA 3W84A 4O11A 2H3BA 3B0UX 3W1LA 1GYNA 2V82A 1KBIA 1C9DA 2W6RA 5L9FA 3LV6A 1W31A 3R89A 1SFJA 1W5MA 4O10A 4NJKA 4ORIA 3W1MA 1VJIA 4EVZA 2Z1BA 3O8AA 3C6CA 4GUIA 1GVOA 3IIZA 1ZALA 3WFAA 5H91A 3SZ8A 3SSJA 3P7YA 2ZZ5A 5AHIA 2A1YA 3NZRA 3RF9A 1MO0A 2EGZA 3FJLA 2Y70A 2QDGA 3UZ5A 1V5XA 3GXNA 3HGRA 1Z42A 2NLIA 3PUOA 3FIGA 3O63A 3KHJA 4AWSA 1K7FA 2J88A 1GG0A 2Y62A 1TB3A 4M7TA 2NZLA 1R47A 3O6CA 5D30A 3N34A 2ZZ7A 2TYSA 3N2XA 1FDZA 2GQ9A 3EWWA 3B06A 4A21A 3PVFA 4JYFA 2J6XA 2CLIA 5D32A 1YTDA 4LNYA 1OFOA 2F7FA 4O1DA 4RKAA 4A2SA 4C1LA 2YFNA 1DORA 3HO8A 1KLYA 5DCDA 3PSWA 2JGYA 1LTDA 3DFTA 5HWMA 3L5LA 2EHHA 2KZHA 3GXPA 1VCFA 5F1VA 4O13A 1AW2A 3GB6A 2V2DA 2BXVA 5I3HA 5HUOA 1TMHA 1ZHAA 1YTEA 5I3KA 4C1KA 1V7YA 2FIQA 2QAPA 5EA9A 1LORA 1KBJA 3C56A 4KFPA 3LGEA 3VFLA 3NNTA 3L67A 1ZAHA 4FNUA 1XI3A 5F2MA 3S9YA 3B04A 3BGJA 4HSOA 2CLEA 3C3NA 2WNNA 1XCFA 3NQ6A 1KFEA 4GJ1A 5LHEA 5FEXA 2DORA 3OBKA 3LDVA 5FF0A 5E1QA 4WY0F 2ZZ2A 1M7PA 2X1TA 1M7OA 2HMCA 4XKYB 3W87A 2V8ZA 1TCDA 5I3JA 2TPSA 2ZTKA 3M5YA 2A5HA 4UTWA 3TSDA 2VFDA 2TRSA 3I6RA 3BW4A 3LV5A 3W1QA 1L6SA 4K6AA 3EX1A 4NJIA 3T4CA 5F2LA 2QJGA 5AYXA 3TAOA 1OYCA 1H1ZA 3RLUA 3MYPA 5EL1A 3ABSA 4E2BA 4O0KA 3M47A 2JKAA 1YDVA 3LCIA 4YL2A 1IIHA 3S1VA 2FB3A 2TMDA 3KFTA 3PBUA 1I2PA 3W9ZA 1W3IA 4O53A 5H2ZA 3P62A 1B57A 4DO6A 2VEKA 3NL3A 4MKNA 1XFBA 3QJAA 4FEZA 3KVKA 2J9ZA 3QMSA 1VYSX 4JTHA 4RR4A 2QJHA 3TJLA 2CW6A 3O05A 2J27A 4WXZA 4DPQA 3UWUA 4O57A 3LHUA 4JICA 2RKXA 1OFDA 3R5EA 3FOKA 2B7NA 2GOUA 3SY5A 4RJEA 4HPXA 1OJXA 2JBMA 4NJHA 3LTYA 1Q6LA 1D3GA 3OVPA 2DU2A 4MZYA 2QCDB 4IOTA 1A5SA 2BX7A 2ZZ3A 2WKJA 4D2JA 1TIMA 5KZMA 4N9EA 2C6QA 4JTUA 3ATZA 2Z0IA 4X2RA 3JRKA 3NGJA 3N2MA 4Z1DA 1RV8A 3NEVA 4PCFA 5C54A 2ZRXA 3NL6A 4DF2A 3TSMA 4DO4A 1JUKA 3MO7A 5F4WA 5CKSA 1W37A 3M43A 1VLIA 4AHPA 1TPB1 1AK5A 3G3DA 3W88A 3B4UA 1UASA 3BGGA 3CU2A 2AGKA 2PCQA 5KSWA 1DVJA 5EPDA 1F05A 2E09A 4AWTA 3OA3A 2FPVA 3GAKA 1FWWA 2GJLA 2OT1A 3SECA 4Q33A 2NX3A 4DF1A 2Q8LA 4AF0A 3TMLA 2ZDRA 3NPUA 1SO4A 4MY8A 5KZDA 4YLWA 1E51A 2O7QA 5CGQA 4WD0A 1H7PA 1OFAA 1XKYA 2PRLA 3TNOA 2ZCGA 3GAYA 3U8GA 1GOXA 3H53A 4GNJA 4LC6A 2NUWA 3GDKA 4CNNA 5LZLA 3W71A 1IXNA 5BW6A 4JIPA 1RQEA 4P2VA 1UUMA 3DFPA 4LS1A 3TCEA 3LLFA 2I1OA 4LY8A 2Y63A 3GIYA 1IGSA 4UMCA 3TE9A 1VS1A 5D33A 4L4LA 4IMCA 5LNSA 6TIMA 4TMBA 3LLDA 5K9DA 4M19A 3LX9A 4CNPA 4UNLA 3SI9A 1PHWA 5BOOA 2ZZ6A 4O4WA 1AMKA 3NQ2A 3UWQA 5G4WA 1KFJA 2DZSA 4GUGA 3ANYA 2G97A 2X1SA 3A21A 4R33A 3DENA 5D38A 1LM1A 3LXBA 4O52A 1C8VA 1TPDA 4MLRA 1SPQA 3CIWA 3QMTA 1G7UA 1VHNA 3UY8A 4BWLC 5HWNA 2QDHA 4ORMA 4RCXA 4CQ8A 3EWZA 5LGXA 2GUUA 3PG8A 3TUUA 5HULA 1EPXA 2E1DA 3G18A 2VKZG 4LVAA 3CT7A 2A0NA 3G1YA 2Y89A 4UTTC 3S1XA 3HG2A 1R46A 4BI6A 5SWUA 1F73A 4ONVA 4XQ6A 3TQ0A 3MP3A 1VRDA 3C2RA 3P80A 4GRSA 2QEZA 1TJRA 3ABQA 3DFNA 4PA8A 3LCFA 1ALDA 1MEHA 1KM6A 1YDNA 4RZ6A 3E0IA 4FIRA 3W7JA 3EKZA 4H3DA 5AHFA 1JCYA 1XUZA 1G4TA 3THQA 4LS2A 3IRDA 1LBLA 3W74A 3LOTA 2Y61A 4Z1BA 1KTBA 4OU1A 4OHQA 3T55A 2V2HA 2PRMA 3LTSA 3MUXA 6ALDA 3TQVA 1FDYA 5LNVA 1UBSA 1CI1A 2QCGA 3BG9A 1PHQA 3EB2A 3ZWSA 5DCEA 4DELA 4UTUA 3GKAA 1B3OA 1TPEA 5FEZA 3L68A 4GUHA 5IM51 5LNUA 2CFFA 3O16A 5D09A 2VENA 5A8GA 4BFAA 4GUFA 4ADSA 3A5FA 2VXNA 3HG5A 2CZ5A 1OHLA 3KRZA 3AJXA 4TR9A 5D2TA 3ABOA 3W1NA 3OVRA 4LV4A 5DXXA 3I7QA 4ZZ9A 4IMEA 2VFFA 2DZVA 4CCCA 4UTLA 3FYPA 4MYAA 4POCA 4Y6GA 2P10A 4Z0JA 1SQ7A 4LRTA 1FUYA 4IX0A 5HUPA 1LROA 3TKFA 3W23A 4R34A 1SR9A 5G2IA 4IJBA 1TRIA 4LWWA 5LGZA 2A85A 3DI0A 5DBUA 3G1SA 2AAMA 4CCEA 1XL9A 1J2WA 2RDUA 3LCWA 5FF2A 5C5YA 3L0GA 5AOUA 1F6PA 4O0ZA 4UR8A 5CPOA 4JYDA 1WX0A 1GWJA 2CU0A 3BV4A 3HF3A 4GWEA 4L4MA 5CZSA 2EF9A 1W5PA 3B0VC 5CPNA 1SW0A 2B7QA 2QCHA 5D2WA 1GVQA 1XBVA 1SZEA 3C2EA 1OFEA 3GR7A 3TA6A 1R2SA 1Q3NA 3IGUA 4WY0B 1TPWA 2Z2UA 2JGQA 4NZJA 1GZGA 4UFIA 3EWBX 3PBWA 5HMSA 3MBFA 1OVDA 5KITA 3MI2A 3DI1A 3LI1A 3CC1A 3GK0A 1G67A 3Q37A 4ML9A 1MXSA 3LCLA 3TC7A 4PEKA 1TO3A 4CQAA 3UPWA 1K8XA 3BG3A 3KOFA 4FX6M 4I9AA 4N4QA 3W7PA 1H63A 1DQWA 2ZRWA 3TU9A 3E9AA 4UFLA 3PBVA 1RD5A 3HPZA 4O54A 4NZFA 1J4EA 2ZRUA 4TU1A 2IQTA 5F2IA 1KM0A 3DGRA 1JUBA 4FXSA 3S8HA 3DHDA 2CLKA 2YW3A 3CHVA 5KTLA 3VKJA 3W2LA 3EX6A 5K9CA 3UZJA 1OYBA 1Q6RA 3P84A 3Q94A 1TSIA 5AYZA 3QMRA 1D9EA 1O94A 1P4CA 1PVNA 2ZRYA 3ZS4A 2NV2A 4AWUA 4LUIA 3G1XA 4JXCA 4Y9AA 3KAOA 2ZZ4A 2E68A 5A5WA 5L6UA 4QIUA 1YPIA 1WOBA 3QM3A 1XBXA 1EIXA 4UMBA 1BEUA 1TTJA 2OMAA 4FNPA 1FQ0A 2QCCA 1JRBA 1LDCA 4ICNA 4JX5A 3W7HA 4IPJA 2E5DA 3QPYA 2WV8A 1P5BA 4UTKA 1WV2A 4UR7A 3EX2A 1GT8A 3HGJA 1B9BA 3QQ1A 2C1HA 3NQGA 3CB8A 5EY5A 1FWSA 1L6WA 1SUXA 4DF0A 1G69A 1XC4A 2TSYA 5G5IA 4HNUA 5K4XA 4JS3A 1VCVA 4HPJA 1K3UA 3K30A 3W7NA 4K7VA 3WJYA 2PURA 2C14A 3FLUA 2VEPA 3Q2DA 4EF9A 2HS8A 2C16A 4FNSA 2ZFAA 3GXTA 3HMJG 2GQ8A 3W07A 5AHMA 2DZUA 2CWNA 1TQXA 2H8XA 3BLFA 1WYIA 3TDFA 2FQIA 1SO6A 3F4WA 3TXZA 3FFSA 4FXRA 3CIXA 1G6CA 4O4VA 3GYEA 1OFBA 4HKPA 2OCZA 5TBOA 1YXDA 1HO1A 2NUYA 1FXQA 3M7WA 4HN4A 1OK4A 4FIQA 2EAWA 2ZTJA 2H8ZA 5E0KA 2C13A 3G1HA 5J5RA 1ZAJA 4KKXA 2V5BA 1Z48A 4UC5A 2FB2A 4IPIA 1EUAA 3PY2A 5G1TA 4DPPA 4KWVA 4YCOA 3A23A 2GVLA 1CX9A 3O6DA 1FWTA 2P1FA 3QPZA 2E6AA 2AQWA 1W3NA 3W7MA 3T44A 1XUUA 2XN0A 5DLCA 1ME7A 2CZDA 3TROA 1KTCA 2NWSA 1Y0EA 3P74A 5AC8A 1I4NA 1QO2A 3I7SA 2ISSA 3DBPA 3MWAA 4AXKA 1FDJA 1TV5A 1TPVA 4JTKA 4O8RA 2F84A 2GPTA 1FWRA 4N6EA 1W54A 1ME8A 2WSYA 1JUEA 3W7EA 2W79A 2FLIA 3OIXA 3O07A 5KMYA 5HWJA 4EWND 3FA5A 2WOQA 2YW4A 4GUJA 4MZ8A 3A24A 4LS0A 1F2JA 1W0MA 3QFEA 1FCQA 4RLIA 3FS2A 4JIQA 3W1TA 3L9CA 3GDMA 2R14A 4Q32A 3DFOA 3W83A 4NX5A 4JGDA 4FB7A 4S2CA 3W76A 5CG7A 2Y7FA 4LVFA 3TK7A 4XKYA 4ZQOA 3C61A 3BO9A 4LVBA 3GR8A 1VGAA 2NX1A 4IGHA 3HG4A 2RH9A 4J9JA 3PSVA 3WJZA 4ZQRA 1LOLA 2B7PA 4PTNA 4CLMA 1FWNA 3D0CA 1PIIA 3MHGA 3VCRA 1A5CA 2FJKA 3TQKA 3QRHA 2PE4A 1GG1A 2VEIA 1KM4A 3W1XA 1YYAA 3NYZA 5F4SA 3UY7A 2GVGA 2NWRA 3S6DA 1I45A 3LBCA 1YLVA 1SZGA 1O5KA 3G1FA 1H62A 1L9WA 4QNEA 2DJLA 1TPFA 1BWKA 1QFEA 5G2WA 5HJLA 5K2ZA 3LHWA 4DBDA 5CZJA 4CQ9A 1CW2A 3EXTA 5G1YA 5J5DA 4M6VA 1QNVA 1JCMP 1LP6A 4YCPA 3O15A 1VHCA 3S5NA 1GPWA 1S5WA 2QCDA 2QUVA 1H7OA 2NXIA 1NF7A 3RU6A 1LLWA 4HNTA 2DZPA 3DKJA 3CEPA 4NU7A 3EWUA 5E93A 3DHFA 4M7SA 4Y90A 4AEOA 4JX6A 4JEQA 4A29A 1HG3A 4NNCA 1NSJA 3NQDA 2RDTA 4DQWA 1DJNA 5MHBA 3GLCA 3RK8A 4RV8A 1H50A 3M44A 1TTIA 4A22A 4BK9A 3NQEA 3GDRA 1OG0A 3G3MA 1DQXA 4NNBA 2NV1A 3C8FA 3LERA 3MI6A 4MJZA 3DAQA 3IGSA 4YWIA 3LRKA 1S3HA 2QCLA 3MJYA 4ADUA 3N3MA 3E96A 5LNRA 2C19A 1O95A 4OWGA 3H54A 3W7QA 3W1UA 3AO0A 2E6DA 3UPBA 3L5MA 4XUGA 1VCGA 3BW3A 4MVAA 5IBXA 3A9IA 2BLEA 3EKLA 4Z08A 1UUOA 4QJ1A 3EX3A 2CLMA 1M6JA 3BLEA 3LXAA 2E77A 1I2QA 4MYXA 3TSBA 3TMQA 4JTJA 3BVJA 4NXSA 3IV3A 1KTNA 4NNAA 1F74A 1EA0A 3LB0A 1SZFA 2Y7DA 1DOSA 2QAFA 1X6UA 2YSWA 1KW1A 4IMFA 2ZRVA 1D3HA 3VE9A 2WQPA 1K7EA 2B4GA 1H7XA 3C52A 4JDYA 4FO4A 1SW7A 1QPQA 4CCDA 5FEWA 4JY8A 4S1FA 3SJ3A 4B5NA 2VELA 1NFBA 3T78A 3CWNA 5CPLA 5KZEA 2XFWA 4IX2A 2VFEA 2EKCA 4KFNA 4HT3A 5F1UA 1X1OA 1ZENA 2Y85A 1OFRA 2OZ0A 3GX9A 3W1RA 1JQVA 3DH7A 4ALDA 4WJEA 3P60A 3IIXA 3W3OA 1KA9F 2DZTA 1H7WA 3FKKA 3FKRA 1J5TA 3KRUA 3P5YA 4YMZA 5I3FA 3EWXA 1KLZA 4N4PA 4NQ1A 5BRBA 2ABBA 4LTSA 3NL5A 1WXJA 1OK6A 3LHVA 4PC8A 4PODA 4H6KA 4MLJA 3UWWA 1VLWA 4O12A 1EUNA 2NX9A 2XN1A 1S5TA 1RPXA 1GVFA 3RFAA 1XBYA 1O5XA 2ZRZA 4OT7A 2A6NA 1AL7A 5F4XA 2O7SA 4MPQA 3G0UA 3I65A 1LBFA 3UD6A 2Y6ZA 1N7KA 3TW7A 2W0UA 4UCGA 1JULA 3LCGA 1GJPA 2JK2A 3PUDA 4E38A 2YCEA 2G96A 1QR7A 3KVLA 1IXPA 3G8EA 1DL3A 3ELFA 3G24A 3B03A 1LCOA 4MOZA 1L2UA 5BMXA 1JQXA 2ZA2A 4EF8A 3NR0A 4GC4A 1FCBA 3G0XA 4UTIA 2A7PA 2QCFA 4JX4A 2ATMA 3DZ1A 3PWAA 4N6FA 3CTLA 5F2GA 3OVQA 3HB9A 4QQ3A 3PAJA 3TIMA 2QR6A 4JR5A 4QNWA 2YZRA 5FF3A 4MZ1A 4OV9A 1W5NA 5K9XA 4K36A 3IVSA 3WK1A 3NG3A 1X7FA 1A5AA 5EYWA 4K38A 1BTMA 1DV7A 2ATSA 1MSSA 3LTPA 5D37A 3N19B 4MIMA 4TO8A 3QW4B 1GQNA 2ZA1A 2DZWA 1KFBA 1GTHA 4JN6A 3S5OA 3M9YA 4E0CA 2RFGA 3HIJA 4O28A 5EKYA 1K7XA 4IXXA 3UQNA 3G1AA 1X8FA 3PB0A 4UFKA 3I68A 5FF7A 1F76A 1TPH1 4Y8FA 2JKPA 3F4NA 3G8RA 4NJJA 2C18A 3S0CA 3F1QA 2ZZ1A 1Q6QA 3P8IA 3W7OA 3W70A 3A22A 3L5AA 2GVJA 5LSMA 4NT0A 4U28A 3NQMA 4UXDA 3FEMA 1QWGA 1VR6A 2GJNA 2WNZA 3NL2A 3O6YX 3M0ZA 2NUXA 4LU0A 3LRLA 1WA3A 4DEFA 2Q3OA 2HS6A 1QOQA 4GBUA 4JTEA 1VH7A 3OEXA 3CPRA 1YDOA 3DU0A 5AYYA 4IWWA 5GVJA 4WY0A 2CLHA 3L21A 3FYOA 4IUOA 1ICQA 3W2KA 4JYEA 5HQEA 2Y7GA 3LCXA 4MFDA 3NPWA 3P81A 2J24A 1QPRA 1ZJIA 4XZ9A 3W1PA 2ISWA 3EXRA 3VI2A 3W7KA 3W2NA 2Q3RA 3SIZA 1TREA 1PCKA 4AMAA 1SFLA 3PBYA 1K8YA 4N9BA 1TPC1 4N02A 1ADOA 5CSRA 4GFSA 3A5VA 5K3VA 4O1BA 1LYXA 4AHQA 1RQHA 3HPXA 3ZR4A 2V5LA 1AW1A 3N9RA 3HG3A 1OX4B 2E6YA 2UV8G 3IIPA 2OT0A 3NOEA 3W2JA 4HHPA 1O60A 4NJGA 1LRTA 4AAJA 2VC6A 1N55A 1W5OA 5FI8A 4BI5A 3QSTA 2J9XA 2P0OA 2Z6IA 1OX5A 2GQAA 3QEZA 3GNDA 1OABA 2YYUA 1OF8A 2YDAA 3MHFA 1KFCA 3LRMA 4OQVA 1SSDA 4O50A 1EP3A 3O06A 4MUZA 5CSSA 1GVRA 3C2OA 1LRNA 4RXGA 5D2YA 3IVTA 1ML1A 3U6WA 5G4EA 1NAL1 2H6RA 3CM4A 3EXSA 3NZ1A 4OV4A 1THFD 3NQVA 4BI7A 1HFBA 4Z1CA 4XBKA 5DCBA 1PS9A 3PUEA 1WQ5A 4R53A 3C2FA 3G1VA 1UCWA 1WAUA 2QF7A 4RX0A 1H60A 3R8RA 3U2OA 3ZFHA 5C2XA 3CQ0A 4NX0A 4OE7A 4K7YA 2WPBA 4H4IA 1YXCA 3PG9A 3TW6A 4ZQCA 4ZQNA 3DFQA 3NQ8A 5CZTA 2E5CA 1SO3A 5BNKA 5DN1A 2H3DA 3UYCA 3HQ1A 3DKLA 3WK2A 4LOCA 4O19A 3NQ7A 3BLIA 4JDBA 1ZAIA 4I7WA 3THAA 2R8WA 4LV9A 1KM1A 2BTMA 4FX7A 3IGXA 4BF9A 1HO4A 4LVDA 1T0OA 4PL1A 3W86A 1YXYA 2FTPA 3N73A 2CLLA 3B05A 3KRSA 4QSHA 2YPIA 5ABTA 1QPOA 3NQCA 3TFCA 4M6PA 1MZHA 2JKEA 4XWUA 2OX1A 3B8DA 3KVJA 3NVTA 5AHNA 1UJPA 4JTLA 3V75A 3JS3A 3KXQA 3QW3A 4WZHA 1F6KA 2ZQ0A 2RDWA 1FXPA 2DZXA 3MW7A 4UFJA 3L0KA 5IBXC 2RHGA 2X1RA 3PB2A 5DY3A 4U4MA 3NPXA 1U83A 1MEWA 3TAKA 4N9DA 1JJKA 2A2IA 1EWEA 1PE1A 1FX6A 1W56A 5HNRA 2FPYA 3KX6A 3BW2A 1LZOA 1GYLA 1VC4A 1XXXA 1L6YA 3LM7A 4XBSA 2VEMA 2QUTA 5I3IA 3QZEA 5FESA 3T7VA 3VE7A 1JCLA 4HSNA 1A53A 1GTEA 4AVFA 2WJZA 4IXHA 4LRSA 3SGUA 1K8ZA 1TPUA 3UNDA 3OHIA 1QCWA 3NQFA 1DKWA 3RNDA 2QUUA 3W7RA 2FDSA 3G0SA 4RZ5A 1AG1O 1RQBA 3B0PA 1ICSA 1DBTA 1JCNA 1I2OA 1R2RA 3QYQA 1JCXA 3MMTA 1JCJA 1EP2A 2B0MA 1VYPX 3UWVA 4JTGA 4M6QA 1X1ZA 2BZNA 3NDOA 2CLOA 1JR1A 1EEPA 3SW6A 3MHUA 3W85A 1FCUA 2QKFA 1W8SA 3LHYA 4WUIA 5DBTA 3CWOX 2PC4A 4ZVJA 2A6LA 3W7IA 1U5JA 4LVGA 1T96A 1VQTA 3W7LA 2NXGA 4K37A 4AH7A 4RXFA 1TYGA 1UB3A 2CLFA 3HOJA 1B4EA 4UNKA 5D2VA 1S5VA 4RZ4A 1SSGA 2ZBTA 2H90A 3TR2A 3M5ZA 5TQLA 4ZQPA 1Z44A 3T40A 2Q8ZA 1IF2A 1H7RA 3MI3A 3CEUA 1K02A 5AN7A 2VOMA 4LC8A 1R30A 2WNQA 1G7VA 1W1ZA 4NXKA 3STFA 5D04C 2V0TA 4AHOA 3W22A 4MY9A 1TV8A 3HPSA 4NVTA 1NEYA 1BWLA 1TJPA 2B7OA 5BMWA 3WK0A 3LCHA 1PL9A 3PR2A 1BKSA 1KFLA 4I7VA 3HGSA 1HUVA 4M5PA 1XDLA 3W7GA 3WJSA 1F7BA 2ZA3A 4FX8A 1GEQA 5HR6A 3MP5A 5AB3A 4UFMA 5K4ZA 5LKYA 2YXGA 1HL2A 5C6MA 4WOZA 4JTSA 3LBMA 1A50A 4I7UA 3E49A 4MJMA 2G5WA 3LI0A 3STCA 2ISVA 1VZWA 2X30A 2A4AA 2A7NA 4IMGA 1KM5A 4HNNA 1A5BA 1H7NA 4X22A 4G1KA 1I8JA 1FY6A 4QAIA 3LHZA 3YPIA 5LNWA 1WDWA 3G22A 1HTIA 1W5QA 3NAVA 3L0NA 3TXVA 2NXHA 3PS7A 5T26A 4TIMA 3CLMA 4JNMA 4UFHA 4AF0B 2Y7EA 2DP3A 2C0AA 3V1PA 4O15A 4XTDA 3LHTA 3S1UA 1SW3A 1EB3A 1YTKA 2C3ZA 4E2DA 2QCEA 3TX9A 1WBJA 3HGOA 4HIBA 3GDTA 3R2GA 4GE8A 3W73A 3W6YA 4FNQA 3P82A 3QSRA 4TX9A 1SO5A 7TIMA 3L65A 4LUJA 3L66A 5CZ0A 2VFIA 2XN2A 3BPWA 3GKFA 3NO5A 3HBLA 1QAPA 3GVGA 4TMCA 1LRQA 4Z1AA 1ZFJA 4P61A 4JTFA 3H55A 5TIMA 1OFPA 1T99A 3GZ3A 3TJXA 4X3ZA 1M5WA 3BARA 3L2IA 2QJIA 4Z0SA 1DJQA 3MYOA 3M16A 3W1AA 3UXAA 4A2RA 1TRDA 1ONRA 1N8FA 5FF4A 4K8EA 4LT9A 2YGYA 3EEGA 3STEA 3LXCA 3ZWTA 1P0NA 3WJWA 5AC7A 3WJXA 1JVNA 3W7DA 2CZEA 3NXFA 4IMDA 1T8XA 4O14A 4K8HA 4WQ6A 1KM3A 4UTJA 4UTHA 4WX2A 4ZL1A 1QDSA 1SZNA 3E02A 2X16A 2FFCA 1IIGA 1NF0A 2R94A 3UWZA 1EWDA 3NM3A 5D05A 1I2RA 1P0KA 4UMAA 3W72A 3G1DA 1EX5A 5AHLA 4XTIA 3TH6A 1B4KA 3N14A 3P8JA 1OX6A 3R13A 3BG5A 5DELA 3SR7A 1SU5A 5LHFA 1K03A 3VNDA 4YXGA 1AW5A 5I3GA 2Y88A 2WSRA 1H61A 2D73A 4IQLA 4K39A 1ME9A 4X9SA 3TV8A 5CPMA 1MEIA 3MBDA 1RVGA 3I7RA 1TQJA 3SGZA 1G4SA 4UUIA 1LOSA 4KWWA 3IIVA 1QOPA 3RMJA 2HTMA 3BK0A 4UIOA 1QPNA 3JR2A 1KV5A 3STGA 4EIVA 2VFHA 2CZFA 2ZYFA 3IVUA 3DFSA 4W9TA 1O4UA 3M1ZA 4N2YA 5HR7A 4ZMGA 1XBZA 5D03A 5U7SA 5D2XA 3UXDA 3W2MA 2BSLA 1TV7A 4QM1A 2I9EA 1XM3A 4ADTA 2VFGA 4S2BA 3IIOA 2YR1A 3IEBA 1PCWA 4WOQA 2V30A 4A3UA 2WSQA 5DXYA 3TFXA 3WK3A 3O1NA 3QQ0A 3RLVA 1TTPA 1RR2A 2PRHA 2X2GA 2WO5A 3DXIA 1OF6A 3OG3A 1AL8A 1FCVA 1XDMA 4FNRA 4BR1A 1WBHA 2HSAA 4O1AA 2V9DA 4JD4A 1I2NA 2ALDA 1ZNNA 2V2CA 2OJPA 3MP4A 1H5YA 3F03K 3FJ6A 3KVMA 3PC0A 1LLZA 3E12A 4LW7A 1QO5A 3M5VA 4JY9A 4O16A 1VPXA 3P67A 1KFKA 4Y96A 4HNVA 4MFEA 4GXMA 4PH6A 5AC6A 2DJXA 1Q45A 3S5YA 4DBEA 1PV8A 2E5BA 4NUWA 4RK8A 4WXYA 1RZMA 3S42A 4JTIA 2EPHA 4OGZA 2E6FA 4R7JA 4DO5A 3PULA 2YYTA 4QITA 1Q6OA 3TC6A 4O18A 2YX0A 1H51A 3M6YA 3M41A 3QH2A 4AB4A 5DY2A 1DHPA 2Z6JA 4PL2A 4FNTA 5AFDA 3S1WA 2LLEA 2BWGA 1OFQA 3P5ZA 1F5ZA 1EP1A 1LBMA 3W7CA 1C29A 5AHEA 3ABRA 5G2HA 4MY1A 5C55A 3C2VA 2FPTA 5D02A 5K7JA 4JTTA 2V81A 2ABAA 5EMUA 1G4PA 3Q58A 3NQAA 3GDLA 3EX4A 1IXOA 4UTMA 3NM1A 4BWLA 1Z41A 2QCNA 3SFKA 3W75A 1W3TA 5U4NA 4UTWC 1P1XA 5KINA 8TIMA 3C0JA 4OBTA 4ZQMA 3C4UA 3ATYA 3M5XA 3GNNA 1OYAA 3QC3A 5HINA 1NVMA 1KM2A 2C15A
chains in the Genus database with same CATH superfamily
4UTTA 3T08A 3LK6A 5HMFA 1HKJA 1EA9C 2A7RA 1PWLA 4HOXA 1GVSA 2G95A 3W37A 4QISA 4AQLA 3PWGA 2YCJA 4KFOA 1CB2A 2WWCA 1WOAA 4AY1A 2RJGA 3VIPA 4V28A 2PDYA 3KZPA 2O56A 1QOXA 2I14A 3HJZA 1I0DA 3PM6A 5FEPA 1UWIA 1ZCOA 4AD0A 4O11A 2H3BA 3VFCA 1E0VA 2Z24A 3WL1A 1CXFA 4NL1A 5HXMA 1S46A 2CBIA 3VZYA 1TWZA 3A13A 4L1GA 2OWWA 3R89A 3LSBA 3KTXA 3O8AA 3C6CA 4DI8A 1ZALA 3WFAA 4QJ5B 6XIAA 3A3HA 1R3YA 4J27A 3SSJA 3P7YA 4GY0A 2CCRA 1DEDA 3UEQA 1VFFA 3UZ5A 1V5XA 3GXNA 3GY1A 4CQDA 1KRAC 6XIMA 4HVXA 3AOFA 2NT1A 4AWSA 2Y62A 2NZLA 1JDAA 2BFGA 1BF2A 1Q85A 3M0IA 3N29A 5MKGB 3SIMA 1V3KA 3NZPA 1H3GA 2UY5A 4IL0A 3ITGA 4A3YA 4WDUA 1HKWA 1YTDA 2F7FA 4GXWA 4CEXC 4HQVA 4A2SA 4C1LA 1TIWA 2HDJA 1DORA 3GHRA 1A5MC 1UOKA 3MB9A 3DFTA 4P7RA 4WJ8A 3L5LA 2BY0A 1ZP3A 2PDHA 4C6MA 3MJMA 5H6HA 1MNSA 1AW2A 3BLPX 3GB6A 4W88A 2BXVA 5I3HA 4C1KA 1ZHAA 1LORA 4CNTA 2VDIA 3PBGA 5FKYA 3MUZ1 2TAAA 1TVPA 3KZSA 2GJXA 4FNUA 1A5KC 3LPGA 3B04A 2XVKA 4HSOA 3CASA 4GA8A 4K2SA 1WXYA 3NQ6A 1XPGA 5LHEA 5FEXA 1H41A 3NCOA 2QJJA 2XUCA 2Z2BA 2ZZ2A 1XIJA 1M7OA 4Q8OA 1BYCA 2MNRA 1XRVA 3W87A 3ITLA 3MY9A 3WBXA 1RCOB 3CL8A 3BW4A 5G1MA 5JH1A 1NH6A 3ARSA 3T4CA 2QJGA 3TAOA 1XLDA 6PTDA 3QR0A 1HL8A 2J7CA 3F5KA 3MYPA 7XIMA 2FZDA 5EL1A 1HKVA 3UETA 3M47A 4ZCWA 3S1VA 2D20A 3W9ZA 2TMDA 3KFTA 2DT0A 4G8TA 5AKQA 5H2ZA 1B57A 4DO6A 4AZHA 1XFBA 3KVKA 1GOOA 1ZPTA 1MRAA 2J9ZA 2QYGA 4JTHA 1P0EA 3N12A 2QJNA 4HTYA 3KTSA 4ES4A 1HKKA 1FWGC 1NWTA 2J27A 2X42A 1R86A 1NARA 4YU1A 1EO5A 3AU6A 4JICA 2RKXA 3FOKA 2B7NA 2GOUA 3SY5A 4JNZA 2JBMA 2O9OA 3OVPA 3IJIA 2HWGA 2YZ5A 3BCDA 4MZYA 4MHBA 3HA1A 2BX7A 2ZZ3A 1FWCC 3H7RA 2AAAA 3ATZA 2Z0IA 3F2CA 3E3HA 3G77A 4Z1DA 3NEVA 3TSMA 5F4WA 2VL4A 1J18A 1RY8A 3UGVA 3BMWA 3L23A 5HA7A 3G3DA 3D47A 4DZ5A 1E4LA 1OWQA 4KGLA 2AGKA 3FDKA 5A6MA 4JFUA 4JHZA 5AECA 2E09A 4U31A 3UR7A 4OOUA 2FPVA 5TNVA 3NFUA 2GJLA 2OT1A 4Q33A 2FVMA 3UYIA 1W9PA 2DGAA 4G56A 2QV5A 4GCAA 2AQVA 4S3FA 1OFAA 1Y5VA 1QNPA 3TNOA 4FOJA 3CMJA 4GNJA 4LC6A 1PIGA 3MPGA 4GGHA 2NUWA 3GDKA 3DFPA 3TCEA 2I1OA 3M64A 1AVAA 1UWUA 5AVHA 1V02A 3GIYA 4PMZA 3S4TA 4LCSA 1DJHA 4L4LA 4DJEA 5EMYA 4OUEA 5C7VA 6TIMA 1P7TB 1UWRA 4CNPA 4QDMA 4UNLA 1TV3A 3OZOA 1S1PA 5BOOA 2ZZ6A 5I24A 3NQ2A 4R7OA 1TZ7A 3RX3A 5G4WA 5LA1A 2DZSA 1XLJA 2G97A 3ZT5A 2PTXA 3SM0A 4J3VA 3ZOAA 3LXBA 1YNYA 3LG3A 1SPQA 4X63A 3ALFA 1G7UA 5CJNA 3EAUA 2QDHA 4ORMA 3ARXA 4YYCA 3EWZA 1B3XA 2QJMA 5HULA 2W92A 1EPXA 1RK5A 3G18A 2VKZG 3XINA 3WBEA 3C86A 5IFTA 3AIVA 3S1XA 5CH9A 1F73A 4XQ6A 1VRDA 3U5YA 1TJRA 1DTUA 3ABQA 1XCXA 3DFNA 1SJDA 1VKFA 1KM6A 1YDNA 4RZ6A 3E0IA 2INZA 4H3DA 1JCYA 1XUZA 1G4TA 3PTQA 4U10A 1PX4A 1LBLA 2Y61A 4Z1BA 4OU1A 1B1YA 3T55A 4IF2A 3AIRA 2ANUA 4ACYA 3HN3A 2DW7A 3BH4A 5LNVA 4KIRA 1E3ZA 1HXJA 1S2AA 1PHQA 3ZWSA 1XIIA 4PRTA 3LU2A 4RDVA 4PMNA 3AI0A 2G3NA 3O16A 2X41A 1CECA 2XG9A 4BFAA 2R1NA 4NZ4A 3DFYA 3AJXA 3G5EA 1ZBKA 7REQA 1G01A 3DCPA 4LV4A 5DXXA 3ZVHB 3GZAA 2VFFA 4IMEA 2DZVA 4CCCA 3VD5A 3FYPA 2ZWYA 4C6PA 4QTGA 1VJSA 4POCA 4AZ7A 4S3AA 2GGJA 3UR5A 3R79A 1FUYA 2Z7GA 5HUPA 3UF9A 1LROA 3TKFA 1SR9A 1PDYA 1TCMA 5A95A 4HU3A 5LGZA 3M0MA 1SYTA 3F4VA 2PDIA 3DI0A 3WNPA 2ZX6A 3UBPC 3BJTA 5KEZA 2AAMA 1XL9A 5C5YA 3LCWA 2CXEA 3L0GA 3FNDA 1TWIA 1WX0A 2GL5A 1GWJA 3BV4A 4GWEA 2JE8A 4LJ3A 3B0VC 1SW0A 3T2QA 1E6SM 3BLKA 2TODA 3ARZA 3CGTA 5D2WA 1XG4A 3F2BA 1H11A 1UZHA 2Z1WA 3VCCA 2CHOA 2AMGA 1R2SA 4QG6A 4AC7C 3TYBA 4PTWA 3GG7A 3R94A 1KCXA 1AQHA 1D7FA 2CC0A 3W28A 1TMQA 5HMSA 6A3HA 1OVDA 3R43A 3WD1A 3VKDA 3S47A 3CC1A 1DIKA 4WRHA 4OOZA 3RIKA 2GZXA 1MXSA 3TC7A 2XWDA 4CQAA 1K8XA 4I9AA 1H63A 1DQWA 3BAXA 2J7HA 1UD3A 5IOBA 3WFLA 2ZRUA 1R5YA 1TE6A 4EWJA 3P0XA 3CHCA 4IICA 4DM2A 5LXEA 2P53A 4LB4A 1OCJA 3LUTA 3DHUA 5KTLA 3QFWA 2Z27A 1RLDA 5K9CA 4URIA 2PI6A 1W3HA 1Q6RA 2Z1KA 3VYLA 4EACA 1O66A 4PB5A 2XIBA 1P4CA 2Y8VA 3LN3A 2DPEA 2OSXA 5A2CA 2QPUA 2E68A 5A5WA 4W8BA 4QIUA 1WZKA 1YPIA 5E70A 4FK9A 1EIXA 4DX3A 4FXJA 5A3HA 3IARA 4CUCA 4C6FA 2QCCA 3FSTA 3UA4A 3QPYA 1H09A 4XZIA 1WV2A 4GNKB 4GC3A 3EX2A 1Q65A 3WQ4A 3HGJA 1RK6A 2A3BA 4J1OA 1J5SA 1I60A 3IJ7A 5EY5A 4E4PA 3E2RA 1G69A 2NQLA 4TVDA 2TSYA 5CSUA 3TCSA 4HNUA 1Q6DA 1DTNA 5REQB 3WLKX 1OY0A 2X0YA 3W7NA 2C14A 3ITOA 1R6WA 4FNSA 4QX4A 4JAWA 3SCOA 3GXTA 3HMJG 3W07A 1B30A 1JAKA 1R0MA 2BGSA 3NGFA 2H8XA 1TQXA 3BLFA 3OZPA 3TDFA 1WP6A 2CKRA 1SFSA 4QEHA 3L4ZA 1GONA 4O4VA 1UR8A 1YXDA 1HO1A 4DLFA 1FXQA 1V0KA 5CC7A 4FIQA 1GKRA 5MKGA 3KL3A 3VNYA 3AHTA 4QROA 3CK5A 2WVTA 3AIBA 3VIKA 5G1TA 1AD1A 4KWVA 1V6WA 3QN3A 3GG0A 4DY1A 4K8GA 1DJZA 4FLRA 1C90A 5M1TA 4H19A 2VT0A 2NWSA 2DT1A 1QO2A 3I7SA 3ANUA 3WQWA 1O5QA 1HP5A 1EO7A 1JYWA 3DBPA 5DFAA 3RR4A 3VIGA 4M80A 4R85A 1V8EA 3GXDA 2ISFA 5JU6A 1TWWA 1JUEA 2WSYA 5C0QA 1ISZA 2W79A 2PDXA 5KMYA 4P7QA 5HWJA 4EWND 3U0HA 1P6BA 2OODA 1GZJA 1OGSA 1W0MA 5M2FX 1AJ0A 3FS2A 3L9CA 2R14A 4W93A 1VJZA 4JGDA 4J3XA 3WNOA 1FH9A 4LVFA 3N4AA 5A8OA 4ZQOA 4P8XA 1KNWA 3CQIA 5ABHA 3K46A 1HKMA 4IJCA 1X8CA 2WHMA 4Q8VA 5IDZA 1K4HA 5I3DA 1YW1A 1VGAA 3GR8A 4IGHA 3HG4A 2V67A 4CLMA 2ZE3A 5J04A 4JKLA 4R9XA 3N3TA 3HFYA 3VTRA 1UKQA 1A5CA 1AQ0A 3TQKA 1EJSC 1GG1A 1YYAA 3NYZA 3L4YA 5F4SA 1E15A 3UY7A 5XINA 2FHFA 1Q4NX 4PMJA 3I4EA 2P76A 3LBCA 4PMVA 1YLVA 1O5KA 3H12A 2CEQA 4PZVA 4D6IA 3BAJA 4IFRA 1BWKA 3PNZA 2VWTA 3UR2A 1BXNA 5A2BA 3EXTA 3ZR5A 1IR2A 1MQQA 3BOXA 4PUEA 1QNVA 4U3AA 4GNVA 1WPCA 3BQ5A 1C8QA 1GPWA 1CZ1A 4EXQA 2F6UA 2QUVA 8XIAA 1H7OA 2J79A 3TONA 1LLWA 1E6NA 2DZPA 3DKJA 4FZIA 1XYAA 3CL6A 3OBAA 3EWUA 4U3CA 2VQTA 3DHFA 2YBUA 4A29A 3BAWA 4JEQA 4C6KA 2YLAA 4LUYA 4WSKA 4QCFA 4KF1A 1M01A 4ERAA 5ECUA 1HJQA 2W27A 4A22A 4HOWA 1GQJA 1GJUA 4AYGA 1VBHA 3G3MA 1IWPA 2CBVA 5XIAA 3ARYA 3MI6A 2DEPA 2JIEA 1AODA 1KXVA 3KM8A 3N6QA 3MJYA 5A6BD 2OZ3A 2W67A 3N3MA 2OVLA 3MKVA 4QG8A 3W1UA 4UZUA 1UMLA 4J40A 2GDVA 5IBXA 3A9IA 5HNNA 3V5OA 3AICA 3CQKA 3CV1A 4EXAA 1XYCA 2HCVA 2CYGA 4DWSD 1ELSA 3LXAA 3CIVA 5M5DA 4MYXA 3TSBA 2RJHA 4NXSA 5B80A 4QAWA 1KTNA 3RPMA 3CBWA 1VFMA 1QWKA 3LB0A 3N04A 1UYQA 5I78A 1P7TA 3MCNA 1UW9A 1X6UA 4GABA 1KW1A 4IMFA 1E9YB 4P8WA 3MT1A 1PDZA 5H1WA 1BYDA 3R58A 1K7EA 1H7XA 1ODZA 4JDYA 1EYEA 2B81A 4S1FA 3CLWA 4B5NA 1EKOA 3EPMA 1KCZA 5CPLA 3BLOA 4RW5A 5KZEA 2V69A 1X6LA 5I77A 2EKCA 4KFNA 3OVGA 1OFRA 3LEPA 5LIWX 3KWSA 3VC6A 3W1RA 4WJEA 1KA9F 3CT2A 4XX6A 1JYVA 1J5TA 3KRUA 1AFSA 1IZKA 3QGKC 3EWXA 1H5VA 1KLZA 3B8SA 2ABBA 5I2UA 1QI0A 3NL5A 1WXJA 1OK6A 2ZUMA 4PC8A 3WUBA 3UWWA 4YTTA 1E4NA 3AXHA 3U2EA 2V5JA 2NX9A 5CLWA 2XN1A 1S5TA 4Y9MA 1TMLA 3BAIA 3QV9A 2ZRZA 5A8NA 5F4XA 2O7SA 3G0UA 3VOHA 3I65A 3UD6A 1N7KA 3P2VA 1GVYA 3LCGA 5HK4A 4DYKA 2WHKA 5AVNA 2YCEA 1W1IE 4US5D 2PDBA 1S2WA 3KVLA 4HTBA 3G8EA 3DFHA 1QU4A 3B03A 1GOQA 1UJQA 4GVFA 2ZA2A 5I5RA 1FCBA 1KRBC 3G0XA 4UTIA 4YYFA 4HN8A 2A7PA 3O0KA 3A3WA 3DZ1A 3PWAA 4N6FA 3OVQA 5CPTA 2HXTA 4RNIA 4UQDA 1XIHA 1UQZA 3STPA 3PAJA 3CZLA 3WKZA 1ZTVA 4QNWA 1XIDA 4LNCA 1CGWA 4K1GA 3M0VA 4OV9A 5JBDA 3IRSA 3IVSA 3CV2A 3WK1A 4E8GA 1JGMA 5EYWA 2ZXAA 1FHUA 2YXOA 4RE2A 1OEPA 4BZYA 1R3WA 3ZVHA 2ZA1A 4B3KA 3M9YA 2FH8A 3TZFA 4NILA 3VMOA 3FHQA 3H7VA 5EKYA 2XSXA 4IXXA 3G1AA 3ZIZA 2XIOA 1BSIA 1TPH1 2D0HA 3F4NA 3NO1A 2C18A 3S0CA 3GQYA 5A8MA 1G0CA 1SJCA 3W70A 2YKKA 4U28A 3NQMA 1O1ZA 3FEMA 4R9OA 3WN6A 2GJNA 4LU0A 4HPNA 4PCTA 4JTEA 1WZMA 1Q6FA 3WBAA 3VK5A 4EXBA 2DT3A 1IT8A 2JEPA 4IWWA 4MNJA 2FYMA 4R88A 3IUIA 2OOFA 2W62A 3NOYA 3NPWA 1QPRA 3EDDA 3SIZA 4AMAA 1K8YA 4N9BA 3OG2A 5CSRA 6TAAA 4HK6A 3WMLA 5BOEA 2OLAA 4KEUA 2WMGA 1OX4B 2E6YA 1DIEA 3NOEA 3RM4A 4ZB2A 2VC6A 4HJFA 4YVPA 4HYWA 3QSTA 2J9XA 2Z6IA 1FWIC 1OX5A 2GQAA 1JG9A 1OABA 2YYUA 4CU8A 3WF4A 3VDGA 2ZUWA 3GVRA 2ON3A 2YDAA 4LYKA 2E40A 4OQVA 3AU2A 1EP3A 3MANA 3O06A 4MUZA 3A12A 1ZGDA 1GVRA 3B8VA 5D2YA 4RXGA 2E9MA 3AIWA 3IVTA 4M24A 4HMEA 5G4EA 2XVLA 4H8HA 4OV4A 4OECA 4IPPA 3S9IA 3VILA 3QV8A 3H21A 4BI7A 1FFQA 1CXKA 1H0IA 2WCGA 4R53A 1E0TA 1UCWA 1WAUA 5E5CA 3W01A 3M07A 3ZFHA 3U2OA 4KERA 3SSZA 3SUTA 3VOGA 4H9XA 4K7YA 1DWJM 3OODA 4RL3A 3UYCA 2PDCA 3HQ1A 3CUZA 2I9UA 3DKLA 3DIPA 2PTWA 3WK2A 4S3CA 4LOCA 2AQOA 1EGZA 5REQA 4I7WA 1AZ2A 3THAA 2R8WA 4LV9A 3T07A 1MDRA 1HGYA 3FVDA 1LG1A 3IGXA 1XKJA 3LGDA 2XINA 4U33A 3IGHX 5ABTA 3U5UA 4M6PA 1OC5A 4FOUA 4LAMA 3B8DA 2PUZA 3JS3A 3GRIA 3A4AA 3QW3A 4WDTA 3MW7A 3PB2A 2VRJA 3K1GA 3KBSA 4AEFA 4AUBA 4N9DA 2A2IA 4U5IA 1W56A 3ZO9A 3KX6A 3V4BA 4Q6XA 1RP9A 1GYLA 1XXXA 1L6YA 3LM7A 4W5ZA 3DBNA 1MMFA 2VEMA 5I3IA 1X38A 3FY1A 1GTEA 3HQNA 1UC4A 4LRSA 4W8LA 1AQFA 3NQFA 1DKWA 2MANA 5C8BB 4D71A 3B0PA 1NQ6A 1VFLA 3FX4A 1DBTA 1JCNA 3URBA 3NO3A 2VCBA 3MMTA 4B5SA 3WCZA 1EP2A 3QLDA 1VYPX 3FAWA 4Q8TA 3E0FA 3K8MA 3C0LA 1EEPA 3MHUA 4JFVA 4V1YA 4WUIA 3CWOX 4PSRA 2A6LA 3W7LA 2NXGA 2G3MA 4A6GA 3CHFA 4GJJA 3GYCA 4INFA 1YE6A 4E2VA 3BTNA 4CVWA 3WH5A 5CAHA 4ZQPA 2Q8ZA 3CEUA 3KOXA 5AN7A 3TYDA 2VOMA 1V03A 4LC8A 4NXKA 3K1DA 5I07A 1JI1A 5HQMA 3BJSA 2PLCA 4MY9A 1TV8A 1NEYA 2B7OA 3SADA 4AY8A 1PL9A 3PR2A 4GQQA 1XDLA 1QATA 3SCWA 2FZ8A 4JN8A 4Q4SA 1UR1A 2WJDA 2Z7KA 4LQ1A 3NSXA 4C6NA 1HL2A 4O0QA 4IQDA 1A50A 1IHIA 3B9NA 1OINA 4MJMA 3WQFA 1RCQA 1VZWA 2WPGA 3LZ3A 1EZ2A 4HNNA 1A5BA 4FR1A 3N4FA 4G1KA 2J6VA 4LYQA 5AZ0A 3P6LA 1Z3NA 3G22A 4IQEA 2VEGA 4HK7A 2XH4A 3KW3A 4JNMA 4AF0B 4S23A 1AH4A 4YN5A 2DP3A 3LYEA 2VO5A 4XTDA 3A9BA 3OP2A 1SW3A 1YTKA 1NFPA 5D4YA 3SRFA 4HIBA 1ECEA 1GOWA 3R2GA 3W73A 2D0GA 4GKTA 3ECQA 3KP0A 3QSRA 4ZSUA 1FRBA 1I1WA 3BPWA 1V6XA 2XIMA 1JPHA 1KRCC 2DSUA 1QAPA 3LNPA 2IPJA 1ZFJA 2X0HA 4GI4A 1ZQ5A 2PU1A 3H55A 1T99A 4TVUA 2PDLA 5A6TC 3EMZA 3FW6A 4DZHA 4B3LA 4DWSB 5HJYA 3DYMA 3TJXA 3AXMA 5M03A 4PGLA 4B9YA 2F9RA 3BARA 5A6KA 4QE5A 1DJQA 3MYOA 2FJUB 3W1AA 3UXAA 1N8FA 3PZNA 3IS4A 3ZWTA 4NAFB 1P0NA 4IHCA 3DGBA 5BU9A 1A4LA 3WJXA 4PUUA 4TUFA 3WQGA 4K8HA 3LQLA 4UTJA 3K5XA 4ZL1A 3UJRA 1XP3A 3WDPP 1NF0A 3IV8A 3UWZA 3ZT6A 1NOWA 4EE9A 5DO8A 3EOEA 5D05A 1TG7A 1I2RA 1P0KA 1Z9AA 1E0XA 4JTQA 2DZAA 5CC3A 2WC4A 2EJ1A 1DJIA 1LQ2A 3ZLFA 3TH6A 3R13A 3BG5A 4YXGA 2GSJA 3PBMA 3VXGA 2ZE0A 1P43A 2WSRA 3AXXA 4IQLA 3BSMA 2ZWZA 4K39A 1ME9A 1MZRA 5F7UA 1DYSA 4I5RA 2R9RA 3KUMA 5HAOA 4ATWA 1TQJA 1JFHA 3T0DA 1CNVA 1LT8A 1RSCA 1W9DM 1EJXC 3S2CA 3BK0A 3E0LA 4H7CA 5HATA 1KV5A 4LANA 2ZYFA 1FA2A 3ZXWA 2CHRA 4N2YA 1JZ2A 3W2MA 3HFTA 4H9TA 4LF1A 1NTHA 2I9EA 3S2NA 4ZO8A 3KEHA 4OFCA 1JXKA 4DBUA 4NAEB 1TTPA 2BV9A 2PRHA 2WO5A 1T41A 1BXBA 2YA0A 5CEWA 2V38A 5FCZA 3SQSA 3VD4A 3URNA 4JD4A 1E72M 2Y24A 3PTKA 4D6DA 3FJ6A 4FS9A 3KVMA 4LW7A 2XYLA 3M5VA 4JY9A 3P67A 3JU2A 1KFKA 4I6VA 3BICA 2XGBA 2BGQA 4PH6A 3OQEA 2E5BA 4NUWA 2D3LA 4RK8A 3P93A 3REQB 4GI8A 2C0HA 3VUSA 2ZUSA 4V15A 4DO5A 1W2VA 3WDIA 2EXOA 4M51A 2YX0A 1UD5A 1CEOA 2GUYA 4JQAA 1H51A 3M6YA 2L5HA 5FOOA 1RBAA 2XTKA 5DY2A 3PJUA 3B9OA 1Q7ZA 1VAHA 1JXJA 4HZ8A 4QJ4B 1DHPA 3DOPA 5AFDA 3AS1A 2HE5A 2ONEA 2BWGA 1OFQA 4NZ5A 4BQ5A 4B5XA 1C29A 1W1PA 2EPNA 3VM7A 3TYUA 1JF5A 3OHMB 4MY1A 1BTCA 3Q65A 2FPTA 5D02A 1MDLA 5K7JA 1D2KA 2ABAA 4AIOA 4X9YA 4NYYA 1IXOA 4LALA 5A2AA 1D3CA 2IPGA 4JKKA 4GO8A 1DPMA 2VUYA 4BWLA 1Z41A 3CUGA 3MKKA 4UTWC 2P88A 2PDJA 1B3ZA 3C0JA 3CO4A 2ADAA 3B9DA 4MKSA 2P8CA 3XIMA 1AJ2A 1HJVA 3N9KA 4W89A 4O17A 3NPVA 1V0MA 4CNOA 4ATLA 1IXQA 1G9HA 1ICPA 3LQGA 3N18A 1M1BA 1B0IA 1OX4A 3CH9A 1GQIA 1QI4A 3UFYA 1QBAA 3JUGA 5BRQA 1H1YA 1G4EA 1US0A 5A6SA 4W7WA 2ODOA 5TAOA 2A21A 2WVUA 3WLRA 3BJFA 3AS0A 3RITA 4E4UA 1JRCA 3B0UX 3VKKA 3W84A 5IHSA 3N4EA 1GYNA 4Q8PA 1C9DA 3LV6A 1SFJA 2XJ7A 4NJKA 2I56A 3URQA 4ORIA 3VM5A 4RE0A 4V2XA 4GUIA 5T9BG 3CJPA 1GVOA 2EBNA 2D2HA 1J8VA 3FA4A 4MAVA 4Q8WA 5H91A 1R8LA 5AHIA 3CWHA 3RF9A 1MO0A 1Z69A 3E1F1 2Y70A 3R8HA 4JHOA 4JTCA 4HB7A 1PIFA 1MQPA 3PUOA 3KWXA 3FIGA 3BWWA 4HMDA 4QEEA 1K7FA 3BZGA 1UD6A 3U7BA 1UBPC 3VGGA 2YCKX 5E9AA 1MUWA 2GQ9A 1Z7AA 4HZ7A 3V36A 2CLIA 1N8WA 3EB4A 3C0QA 4O1DA 2PLMA 4RKAA 1SGJA 4PB3A 2Z28A 3HO8A 3SN0A 5DCDA 3PSWA 3BUVA 5I03A 3GC4A 1EF3A 1E9LA 1JD7A 2EHHA 2KZHA 3GHUA 5F1VA 3WQEA 3ZVIA 1YTEA 4OIFA 3LZ5A 1KBJA 4KFPA 1X1NA 3R25A 3VFLA 2WZEA 4A3RA 1XI3A 4BEUA 3S9YA 5AYIA 2CLEA 4C90A 2WNNA 4GMEA 4QJ3B 3TA9A 1XCFA 4UQEA 2ZX7A 3EA3A 1XHGA 3OBKA 5FF0A 4Q4MA 4WY0F 3ISIX 4GYJA 4A8IA 1E9ZB 4XKYB 3H2AA 1TCDA 5I3JA 4HA0A 3CPGA 2A5HA 3NQBA 3LV5A 4K6AA 4MJ4A 3EX1A 4L1XA 5F2LA 1RJPA 5AYXA 3QXBA 1H1ZA 4X2PA 1IEXA 2PF0A 3ABSA 4E2BA 2JKAA 1YDVA 4I8DA 4M8UA 4YL2A 3PBUA 3CXOA 3POCA 3EB3A 4GY1A 4JIHA 1CLKA 3NL3A 4FEZA 2VGIA 1QNSA 3CV6A 1IT0A 2WK2A 2OZ8A 1CGVA 1CGTA 2QJHA 3TJLA 1KB3A 2CW6A 4WXZA 3QYSA 4DJDC 1PB0A 2WZIA 3UWUA 1WDDA 4O57A 2ZUUA 3LHUA 1NFGA 1OFDA 2A79A 4CKQA 1BQCA 2Q6ZA 1OM0A 1IYXA 2QCDB 4IPNB 4IOTA 4L6HA 1BPLB 4D2JA 1E6PA 1B90A 4QCEA 4N9EA 2C6QA 4JTUA 1CXHA 3NGJA 1XH1A 4LUSB 4AIBA 1JUKA 3E38A 2QDDA 2CLPA 4C6QA 3GBEA 4BQ3A 1W37A 1VLIA 4AHPA 2W9MA 1L6GA 5CZKA 1TPB1 3HV8A 3GTXA 3W88A 3B4UA 4E8CA 3WF1A 3VNKA 3CU2A 3GIQA 1ONWA 1V3JA 2PCQA 3D6NA 3AS3A 5EPDA 1F05A 2O9RA 3WUFA 3R0DA 2P0IA 5B7YA 3GAKA 2J8GA 3ITVA 2DT2A 3T8QA 2J25A 2G3JA 2NX3A 4IG2B 4AF0A 3TMLA 3W02A 4YLWA 2PRLA 2XZ9A 5LZLA 4CGTA 1B9ZA 1YNQA 1IXNA 5BW6A 4D6HA 2W3ZA 2FVLA 3LLFA 3H2FA 2Y63A 3K13A 5A6BA 4IGMA 1IGSA 1UWAA 3GNPA 3T0TA 4IMCA 5GNZA 2Z29A 5K9DA 3QHOA 3WELA 1A80A 1BVNP 3SI9A 5C9UA 1Q8JA 3COTA 2VURA 4O4WA 1AMKA 3BOFA 1UIPA 1REQB 1AJZA 3UWQA 3E2QA 3PHAA 5BXPA 5HDRA 4K3ZA 3A21A 4R33A 1DJWA 3DENA 3WLTA 1FHDA 1MXGA 3OZMA 4MLRA 3TP4A 1BGAA 3PJXA 1VHNA 3UY8A 1GOIA 3O7UA 2IKHA 3IACA 4NAFA 1E6ZA 1UZ4A 2GUUA 2SFPA 3TZNA 3EOUA 4LVAA 1VPQA 4O1FA 2Y89A 4UTTC 3ONCA 3HG2A 2R24A 4BI6A 5SWUA 2JF6A 3C2RA 3CH0A 4C7GA 4QS5A 4GY7A 4PB4A 4LAOA 1ALDA 1A0EA 1MEHA 5GJNA 3AAMA 4FIRA 3FK4A 3W7JA 2VD8A 1J12A 1SM9A 2NLYA 3EKZA 4LS2A 3IRDA 3LOTA 3V0TA 4OHQA 3FXYA 3QPEA 1RALA 6ENLA 2EG8A 4C6IA 3W6MA 2ZC8A 3EB2A 2IKGA 3WNMA 4KEZA 5FEZA 3L68A 1J01A 5LNUA 4NP7A 1QJWA 5D09A 2VP8A 3ZMRA 2VI0A 4US5A 3LLXA 1UKTA 3A5FA 4CEUC 3KRZA 4TR9A 5CBBA 4Q4QA 3OU8A 2J7FA 1QI2A 2DUAA 3OVRA 4G9PA 3I7QA 3CZGA 4H8NA 3GFYA 2GSHA 1Q63A 1GGOA 4Y6GA 4HBKA 4NAEA 2P10A 1SQ7A 4LRTA 3WQVA 3RLHA 4DI9A 1EQCA 3W23A 3UJEA 5JMUA 3RJXA 3RN6A 2V6AA 1JDDA 5DBUA 3MQTA 3CTTA 3FA3A 1J2WA 2ISDA 1EDGA 1F6PA 4M1BA 5CPOA 4JYDA 4RW3A 2I17A 4EX4A 3PZQA 3MCMA 4GVHA 2EF9A 1E73M 5CPNA 1V7AA 3TN4A 2B7QA 3WMSA 1UZ1A 1TUFA 1GVQA 1XBVA 1SZEA 2PWFA 3B40A 3IGUA 4WY0B 1IEVA 2Z2UA 3Q67A 2JGQA 3OQ8A 3QHNA 1A5OC 4JKMA 4NZJA 4DJFC 3MBFA 4WIWA 3ZR6A 3LI1A 2UY4A 1G67A 3Q37A 4XZBA 1JDEA 3KBVA 3UPWA 3BG3A 3KOFA 2R82A 3N15A 4Q8NA 3TU9A 2BODX 4PBGA 1M7XA 3HPZA 1J4EA 4TU1A 3L2MA 3U9IA 3HQOA 2IQTA 1KM0A 1Q2RA 2WZTA 4I9MA 3GTIA 1GW1A 3DHDA 4JHMA 3CHVA 3GH5A 3EX6A 1V77A 1XC6A 2YA1A 1OYBA 3P84A 5C9WA 1PTAA 4ZSTA 4E3TA 3HPFA 1HJSA 1O94A 3G1XA 1BQGA 1FWJC 3TJ4A 3AZSA 5L6UA 4GZJA 2NQ5A 3BCFA 4HNCA 1WOBA 5GNXA 1W1B1 1K9TA 3AFBA 2WJEA 1X39A 2VRKA 2OMAA 3B8TA 3IWPA 4ICNA 1DWAM 5H8PA 3TN5A 3AIEA 3GWQA 1VBUA 4PUJA 4PRRA 4UTKA 1TWSA 1UR9A 5I79A 1GT8A 4JEJA 4KGJA 5EB8A 3WNNA 3CB8A 3AHVA 1FWSA 4D6GA 1L6WA 4F2UA 5G5IA 4W5UA 1Q4WA 2GLKA 1VCVA 3O9NA 4MGGA 5LIXX 3RGTA 4K7VA 4IP4A 1E1EA 2VEPA 4HMNA 2HS8A 4AMCA 4PBFA 4C1NB 2CWNA 5AC4A 4ZOAA 4HSHA 2FQIA 1SO6A 3F4WA 3TXZA 2WMIB 3CIXA 1TELA 2XSBA 1JI2A 1OT1A 2OCZA 1WO2A 4HN4A 4RPQA 5E0KA 4IUGA 4LY4A 2C13A 4R5EA 4UZSA 1ZAJA 2XVPA 4RZBA 1Z48A 1OZMA 4UC5A 4J2MA 4GFIA 1EUAA 1RP8A 4RDYA 3PY2A 2FGLA 2ICSA 4FLQA 3WLHA 3GNOA 3U4AA 3CUFA 1CX9A 4MM1A 1HZYA 1LWHA 1W3NA 3MC5A 4XK2A 1XUUA 2J66A 3TROA 3VC5A 1P0DA 4F66A 1I4NA 3BV7A 1XIFA 3SCSA 3BMVA 2I7GA 1XGDA 2F2HA 1TV5A 1W8GA 2F84A 1W32A 1FWRA 1ZRQA 5C70A 5A8PA 1VEMA 2G4JA 3W7EA 3OIXA 4ZB0A 3O07A 3FA5A 2WOQA 2YW4A 4GUJA 3SCNA 2W66A 4L4OA 3W1TA 1EOMA 1A4MA 3BCJA 3W83A 4GXPA 5CG7A 2XVNA 3TWBA 2Y7FA 4XKYA 3TLQA 3C61A 4WCJA 3BO9A 1E56A 3WQ5A 2XIJA 1H2JA 1EJWC 2D2JA 4LVBA 3AMLA 1EBHA 2NX1A 2BASA 1GVEA 1ZS2A 4R3UA 4S3JA 1FWNA 1XIMA 1PIIA 5C2GA 4GLEA 2VDHA 2ZC1A 1TX0A 4IPLA 4N7QA 2FJKA 3QRHA 5CBIA 2PE4A 1KM4A 1T7LA 4OJYA 3W1XA 3UERA 1V0NA 2GVGA 3AISA 2NWRA 4Y7EA 1SZGA 2BOFX 1L9WA 4QNEA 2DJLA 1TPFA 4XAYA 1QFEA 4WLCA 2ESCA 3VX1A 4IISA 1EC7A 1D8WA 1QI3A 3QY8A 4BCEA 4M6VA 1LP6A 3KCLA 5HOSA 4AISA 2WHLA 4HCDA 3S5NA 1KWGA 2QCDA 2WMFA 2NXIA 1NF7A 2A3HA 3MWCA 1UQYA 3M0KA 4C5ZA 4NU7A 4Y90A 2PGWA 4LUSA 4JX6A 2X40A 5CJMA 1NSJA 1RJQA 1WXZA 4DQWA 4JOMA 1DJNA 5MHBA 2V5DA 2PLKA 4QR6A 1H50A 3M44A 2Q09A 4BK9A 1ITCA 3NQEA 5LA2A 3CQJA 4I5XA 3LERA 1V0LA 5DMLA 2CERA 1DIOA 1S3HA 2QCLA 4ADUA 3E96A 3EA2A 4OWGA 3H54A 4IG2A 1O12A 3AO0A 3GG1A 1JPIA 3L5MA 3MVTA 1RBLA 5BXTA 1AH3A 1BYBA 4MVAA 4YTQA 5DRCA 4HU4A 5IFPA 2ZX5A 3SAZA 1GK8A 1JDFA 2VM8A 4Z08A 5IDIA 3M0XA 5CCZA 3EWDA 1M6JA 3BLEA 1PWMA 1I2QA 1VB9A 4JTJA 4WSHA 2PDWA 2D23A 2GJPA 3IV3A 3RG6A 4C6BA 1EA0A 1DOSA 2MUCA 1U1UA 4HCLA 3ZLHA 2F6KA 2ZRVA 3K4WA 1REQA 1VIZA 3QR1A 3OZYA 2X2YA 1NDVA 1J93A 3KL5A 5A6JA 5JUVA 3QV6A 1YDYA 2ZKMX 5DT5A 5F1UA 3WD3A 4EANA 3GX9A 1US3A 2DVTA 3DH7A 4ALDA 4HP5A 1RBOB 3FKRA 2P50A 3P5YA 5I3FA 4NQ1A 4Y8EA 3LPPA 1T40A 2CKSA 4AZIA 2E1WA 4PODA 4MLJA 3VDHA 4DJDD 7ODCA 2ACRA 3OTRA 2R1PA 1EUNA 3BGAA 5CBJA 2CHNA 1RPXA 3URAA 1GVFA 4ILSA 1O5XA 2EQDA 4HMCA 4Y9NA 1NDYA 2VR5A 5D8WA 2A3CA 5LIUX 2PGEA 1XSJA 3RM8A 3NZQA 3ZJKA 4GPNA 4AD3A 2QIWA 2OFJA 4J28A 3U3HA 3V16A 1VBJA 1CT5A 3E6EA 1ZSXA 3T05A 4XAPA 4ZODA 1KFWA 5A1AA 2VVSA 4IIHA 2J75A 2HZGA 3APTA 3IAQA 4KMQA 4GX9A 3RJYA 2YZRA 4QLJA 2VDGA 1HN1A 1W5NA 4IFKB 4XVEA 5K9XA 3DX5A 2ZVIA 5I7GA 3H7UA 4H1ZA 4Y9PA 2YA2A 3O3RA 1RCXB 1BTMA 1DV7A 1SMDA 1JIBA 2ATSA 2Z1XA 5D37A 3N19B 4ATDA 1C3FA 5D9OA 2IQ0A 1US2A 2G3IA 1M03A 1KFBA 3S5OA 3N6HA 5M3WA 1FHVA 4O28A 1VENA 1VEOA 3ZT7A 1CB7B 1ZBCA 4H9UA 3I68A 3LNMA 1R3SA 1O5RA 1F76A 3GC2A 2JKPA 3GXFA 1KQYA 2ALRA 4H83A 3PJWA 4CNUA 2ZXBA 3UG5A 3A22A 5LSMA 1QHZA 4UXDA 2VR4A 2BDQA 1VR6A 2NUXA 3KS6A 3JVAA 1T8QA 2HS6A 1QOQA 3RRXA 2PWEA 4F0SA 1Y8BA 5AYYA 3PPCA 3PPFA 1FKXA 4WY0A 4QP0A 1CGUA 2BHUA 3L21A 4Q4PA 1M41A 3C8NA 3T1GA 3FYOA 4IUOA 4D8ZA 2Y7GA 3LCXA 2DVUA 3THUA 3P81A 1AH0A 3GTNA 1ZJIA 3WUGA 1AQMA 2V3EA 3VI2A 3W2NA 1L8NA 3W7KA 3CAQA 2ACSA 1W9XA 1FHLA 4NHVA 4GFSA 1CLXA 4JQ2A 4OKDA 3HG3A 1KKOA 3SUVA 2BY3A 2HXUA 3CMFA 3H2NA 1CCWB 1DJYA 2OT0A 3MZNA 3W2JA 1O60A 1QNQA 5EMKA 1W5OA 6REQB 4C91A 3EOSA 3GNDA 2GGEA 1G1YA 1RXOB 2WKGA 2OKTA 1CXIA 1I9CB 4A3QA 1KFCA 1ONXA 1QT1A 3LRMA 1SSDA 4DYEA 4IJRA 2OXNA 1ISYA 3B8WA 3H22A 3QTPA 4RNHA 3ZJ7A 4OBSA 1V3LA 3NZ1A 5RUBA 4AX7A 4MWAC 1HFBA 1NQKA 3RCMA 1PS9A 3SEPA 3C2FA 3M6DA 3WLOA 4KWUA 2DFAA 4GI9A 3R10A 2QF7A 4RX0A 5BCAA 4NX0A 2QPXA 2EPMX 4QBXA 3ICJA 3H2EA 4ZOEA 5GJPA 5BNKA 5LA0A 4AXNA 4UQBA 2HISA 1T6MA 4F40A 3QY6A 4JDBA 3WL0A 1PJ9A 3S9ZA 5I00A 1B2YA 2PDMA 3ITTA 4MDPA 2BTMA 5DANA 4BF9A 4WDXA 1HO4A 1BHGA 3VCNA 3KBWA 4LVDA 4ZA0A 4IP5A 4C1NA 2CLLA 3KRSA 4QSHA 1F4AA 2YPIA 1QPOA 3KVJA 2E4TA 3KOYA 3UG8A 2WMIA 1MNZA 2ZQ0A 5IBXC 1S5MA 5DY3A 1MEWA 3TAKA 4LAZA 4DJFD 1S1RA 3ZJ8A 1PE1A 1C8XA 1FX6A 4EAMA 5HNRA 3KCOA 2FPYA 4NI3A 3BW2A 1VC4A 1W2PA 4C6EA 4L7ZA 3T7VA 1RD6A 3VE7A 4YTRA 4J3SA 1TE1A 2WJZA 1DE5A 3WMCA 1K8ZA 4PRWA 3UNDA 4TX6A 3HZ3A 2FDSA 4DZAA 4RZ5A 3EWCA 1KXQA 2X8RA 3LENA 3QYQA 3HTWA 4JZ5A 2B0MA 4D9PA 4S38A 2BZNA 1XR2A 3NDOA 4XISA 4IL2A 3AQUA 3W29A 1FCUA 3LHYA 3CB3A 8RUCA 4ZVJA 3K4DA 4LVGA 1T96A 4K37A 1BG9A 2C71A 4HNOA 4RPPA 3EA1A 3VMPA 3D3AA 1JYXA 1S5VA 1SSGA 4ML4A 1Z44A 1IF2A 2FZBA 2XFRA 1K02A 2XIQA 3II1A 1UA7A 4AZCB 5BWFA 4YVVA 2H9AB 1W1ZA 3AYRA 3FEQA 2JIWA 4XSLA 1K77A 4AHOA 3AUOA 3AIUA 3ARPA 3W22A 1W9BM 4ICMA 4IT1A 3HPSA 3QHMA 4LUTB 3S2MA 2BMBA 1EL3A 1K4GA 4I7VA 1HUVA 1VF8A 1PZ0A 3J7HA 4F0LA 2FHCA 2CIPA 3MP5A 5K4ZA 5LKYA 4WGXA 1F6YA 4WOZA 1SFTA 4IIEA 3JZEA 1DWGM 2UWFA 2QZRA 5CGMA 2JF7A 4XAZA 1UC5A 4B5VA 2G5WA 1GOMA 2P8BA 2ISVA 3UVIA 2A7NA 2RUSA 3NVDA 3SQMA 4JIIX 1H7NA 4IIBA 2NV9A 1I8JA 1FY6A 1JPDX 1AMYA 3DECA 3TW9A 3LHZA 3S2LA 5HMEA 3SY1A 2E7FA 4KQNA 2QV4A 1HTIA 2DW6A 4X60A 4AX6A 3L0NA 3TXVA 2NXHA 3PS7A 2BS9A 4TIMA 4MPKA 3MMDA 2Y7EA 1R9ZA 4KIEA 3IUHA 2G0WA 3W38A 4O15A 1UD2A 4AD2A 2Y5EA 2C3ZA 5FJJA 1W1YA 2QVNA 4XD4A 2AL1A 4FNQA 3P82A 3W6YA 2VGFA 3CS2A 4JIEA 1GW9A 2GYIA 4A3HA 7TIMA 4LUJA 4NG3A 2VFIA 3NEHA 3VD9A 2XH7A 3OPSA 3WUEA 4ZEPA 1W1TA 2VCCA 3GKFA 3HBLA 3O6AA 3M46A 4OBRA 3TTSA 4TMCA 4Z1AA 5HBFA 4P61A 3SCVA 3EBVA 3PFRA 4JTFA 1W3KA 5A6LA 1OFPA 4H7ZA 3VNIA 4J3TA 1WDSA 4BHYA 2QJIA 3L4TA 4E6MA 4G7FA 5CPQA 3M16A 3AHZA 4A2RA 1JCTA 3ENLA 2NVDA 4RE4A 3OIHA 2ASHA 3BLLA 2DIEA 5CJ5A 4DN1A 2CZEA 3XISA 3NXFA 2OGJA 1XFCA 4UTHA 1WB0A 5CC5A 1SZNA 3E02A 4RDWA 2ZDSA 1UP0A 1ZJBA 4L9ZA 3EYPA 4JNYA 1EX5A 4ZBCA 1ZU8A 4OTKA 3U2CA 3N14A 4Z17A 1B3YA 1OX6A 1QHOA 4GO9A 2BVDA 4W4QA 5LHFA 2OU4A 1FWBC 3AYVA 3GH4A 4MB1A 5HNUA 3VDAA 2VGGA 5CPMA 1MEIA 3N2BA 2VUNA 3I7RA 3I3BA 3SGZA 1VIWA 3R1ZA 4UUIA 1RVKA 4YVXA 2VX7A 2HRWA 3A3XA 2CITA 3ZJ6A 3RMJA 2HTMA 1I6NA 3VOIA 2CZFA 3DFSA 1O4UA 1UUQA 3S1GA 2UY3A 5HR7A 3KDNA 1Q6EA 1X98A 4H9ZA 5FACA 2PP3A 3RU8X 2OQYA 2PP0A 3IEBA 4WOQA 1UR0A 2V30A 4A3UA 2WSQA 5DXYA 3TFXA 3THCA 4DYJA 1LWJA 2EPKX 1QK2A 3O1NA 6CGTA 1SJBA 3RLVA 4F79A 1AA1B 2X2GA 3OLEA 3OG3A 4ZR8A 4FNRA 4BR1A 4CN6A 4BJHA 1Z8AA 1R38A 1I2NA 1UZDA 2OJPA 4D1JA 4IFKA 1H5YA 3F03K 3PC0A 1LLZA 3E12A 1QO5A 3U4FA 3PWIA 2Y1HA 1DHKA 1M9HA 4FF5A 7A3HA 2Y2WA 2Y4SA 3S6OA 4MFEA 3LPOA 1CYGA 2HQAA 3S5YA 4WJXA 4DBEA 4WXYA 1F3XA 4W86A 2GUBA 3S42A 4JTIA 2E6FA 5KZ6A 2YYTA 4QITA 1Q6OA 2FTWA 2GGHA 1ZB5A 4WKAA 1U22A 3TTQA 1TWDA 2FDMA 4PL2A 2IMRA 2LLEA 4EAYA 5JBFA 1KRMA 1F5ZA 3WH8A 4TX8A 1LBMA 3W7CA 4BQ4A 3ZZ1A 5AHEA 2WMHA 1BFNA 3E0WA 5C55A 2V81A 4TXEA 1G4PA 1E1FA 4UTMA 1EEXA 3LA4A 3NM1A 3WZ0E 2PCEA 3UZWA 1OG6A 3SFKA 4M6UA 2XSAA 2W5FA 4OBTA 3T42A 3C4UA 2WZMA 1JL8A 1OQFA 1OYAA 3KCJA 3W26A 1NVMA 2IS7A 9RUBA 3R12A 2PS2A 1TJ2A 3F7JA 3SUUA 4N9CA 5EBUA 3PP7A 4CN4A 1CTNA 1YPFA 2J9YA 1R2TA 1Q6GA 3NA8A 3N9SA 3ONBA 4FF7A 3DESA 3ORWA 4G2DA 2YBVA 4DXVA 6REQA 4ZFMA 4Q4KA 3CZJA 4J3UA 1VYRA 3W2UA 4ZOCA 4PTXA 1GHSA 4PFMA 3USBA 4FHAA 1FBAA 3W1LA 2V82A 3WO8A 4KRZA 5L9FA 3AROA 3P14A 2X05A 1W31A 1W5MA 2D2OA 4XKMA 4XIAA 1VJIA 2Z1BA 2V63A 1JZ5A 4D6CA 3IIZA 1UG6A 2Y0FA 3VNZA 3NXLA 3SZ8A 3ABZA 2A1YA 3OBEA 4Q7IA 3FJLA 4MADA 3HGRA 1Z42A 2NLIA 1WDRA 1VFSA 3KE0A 2HV5A 5FJPA 4M7TA 1PX3A 3O6CA 5D30A 3N34A 1U30A 2OEMA 2EG6A 1FDZA 3EWWA 3B06A 4Q8MA 3ID7A 4P7OA 2F8QA 3PVFA 4JYFA 2J6XA 2QIIA 3M0YA 1I75A 2ACQA 4LNYA 4LCQA 1WUFA 1JDCA 4GIAA 5DMYA 2JGYA 1T5AA 2WSKA 3R6IA 4Q4RA 4V33A 5HWMA 1UH2A 1KBLA 3TVAA 3BLDA 3QKZA 3QGAC 4YJ5A 4O13A 1TMHA 4AZ6A 3G6LA 5I3KA 4X61A 2CZVA 2QAPA 3B9EA 2VMFA 2YCLA 5EA9A 4Q4OA 1O1HA 4LSBA 3WX7A 2PGFA 3LGEA 1SZRA 2F2KA 1JFXA 5EFFA 3L67A 1EDTA 2A3EA 1GCYA 1S2TA 3SFWA 3C3NA 1KFEA 3VIIA 2DV0A 3QVQA 4WDWA 3LDVA 3T09A 1O68A 1V51A 5E1QA 1UH3A 1NP0A 2X1TA 4F4RA 2HMCA 3CAWA 3VKAA 1LL4A 2TPSA 2ZTKA 3TSDA 4UTWA 1CPUA 2VFDA 3I6RA 3W1QA 1L6SA 4GVGA 4NJIA 9XIAA 2YBTA 1MXDA 4M0XA 1EHAA 4F48A 1LT7A 3KRBA 4GK8A 2Z26A 5FSEC 2HNHA 3EPOA 3VD7A 3C0SA 2FB3A 8A3HA 2XH0A 2IXVA 1OC7A 3P62A 3VNJA 3N1AA 1DWHM 4MKNA 2OYKA 2YL6A 3EKGA 3QMSA 3UCQA 1O7AA 3UW6A 4RR4A 4XB3A 4HK5A 4MWAD 4GZEA 2EEXA 2XGZA 2OQHA 4DPQA 3B9AA 2OX4A 1IGWA 5D9PA 4AZCA 1DWIM 2H9AA 3R5EA 4D72A 4RJEA 4HPXA 4KS0A 1TVNA 3L2LA 5CGTA 4H9YA 4NJHA 1WZLA 3LTYA 1D3GA 2DU2A 1UD8A 1I1XA 4LUTA 3WH9A 4CN1A 1JAEA 2W91A 1TIMA 1KKRA 5KZMA 4GQBA 4X2RA 2F38A 3JRKA 1SJAA 3E74A 4HHHA 1RV8A 4XD3A 1RA5A 2YDQA 2ZRXA 3NL6A 4DF2A 4DO4A 1F8IA 2GK1B 2F6XA 1VBRA 4CD5A 4AU0A 1V02E 1AK5A 1EGMA 2VC5A 1UASA 3BGGA 4S3KA 4XZWA 2DSWA 2ZOXA 3SRKA 1DVJA 5G4HC 3VOCA 4AWTA 1FOBA 1FWWA 3F2DA 3D3FA 3SECA 1WAWA 2Y5SA 4DF1A 3OLGA 4BQ2A 3WQCA 2ZDRA 3NPUA 1SO4A 4MY8A 3DG6A 4NSBA 1YNPA 1E5JA 1NJJA 5KZDA 3SBFA 4Z2GA 1E51A 5CGQA 1H7PA 2VOTA 2BXZA 2ZCGA 3GAYA 4CNNA 1RPKA 3W71A 4D6FA 2J4GA 4JIPA 1A5UA 4P2VA 1UUMA 4LS1A 4V1XA 4N0RA 3WNKA 4UMCA 3NUKA 2NW0A 4XIMA 2I5IA 5LNSA 2QGHA 1KXTA 4M19A 1WZAA 2OO0A 3BMXA 3MA8A 8XIMA 1PHWA 1R9XA 4MTVA 1KFJA 3L7RA 4NF7A 4QDPA 4GUGA 3ANYA 3UWEA 3FCPA 5D38A 4AFYA 4O52A 1C8VA 3VDCA 4MSSA 3VVGA 3TYZA 3WQ8A 4BWLC 3I3DA 2G3FA 3MSYA 5HWNA 3QOMA 1V93A 4KCUA 4PTMA 3M0LA 4L9XA 3SURA 4CQ8A 3WLIA 3CV7A 3A4XA 4WK9A 5LGXA 1GEHA 4PMUA 1EJ7L 3CZEA 3VX0A 2BOGX 5BXRA 4H6EA 1PZ3A 5HPCA 3TC3A 3CT7A 2EPOA 4GYPC 4IZGA 2I5QA 4ONVA 4B5TA 3WENA 3P80A 4GRSA 3OYXA 2QEZA 3Q4DA 1X6NA 1XYLA 4PA8A 3WLMA 4ZB5A 2P5NA 2WSPA 1HX0A 4F9DA 3TN6A 3PAOA 3GTHA 2OOGA 1V79A 4YS1A 1QW8A 3A4WA 2V3GA 3W74A 1OGBA 3ZM8A 1KTBA 2VCAA 4DJDA 1ZJAA 2V2HA 2PRMA 2Z00A 3LTSA 3MUXA 4B5WA 6ALDA 3UCCA 1FDYA 1UBSA 2QCGA 3BG9A 1EXPA 1IE7C 2FMOA 1ISWA 5DCEA 2WQDA 4UTUA 4AD4A 4GUHA 5IM51 4YPJA 2CFFA 1XISA 4C7FA 1RUSA 2P3EA 3GW0A 3RHGA 4GUFA 2BG5A 4ADSA 2CZ5A 1EC8A 3BZJA 5E09A 4ZENA 4UOJA 3ALGA 5D2TA 3GFXA 3ABOA 1QK0A 4JCMA 1NM9A 4LAUA 3GE7A 1NOUA 3TTYA 4ZZ9A 1UR3M 5EBAA 4UTLA 3PZ9A 1JYNA 3PJTA 4B90A 4IX0A 2BB0A 5DMMA 3FJNA 2VZOA 2YIHA 1A47A 4N42A 3WEMA 3MDWA 1QASA 4LWWA 5DMNA 1WE5A 3RR1A 1KGUA 2G37A 1KO0A 1GNXA 3MV01 2I5GA 1MUCA 3GU9A 3BANA 4HYVA 1VBGA 3HF3A 4L4MA 1W5PA 3OLDA 2R1KA 3C2EA 1OFEA 3TA6A 3VIOA 2D2GA 2EO7A 3EOOA 1VPYA 4NZ1A 1Q8AA 2DQWA 4KT2A 5I02A 4UFIA 3PBWA 3EOLA 5KITA 3KTCA 2OB3A 4RE3A 2DY3A 1XSKA 3UJ2A 1Y5WA 1ONEA 3GK0A 4LCRA 1E70M 4ML9A 3CO8A 4N4QA 3W7PA 2ZRWA 4FMVA 3PZVA 4PMDA 1A49A 4JTAA 3E9AA 4UFLA 3VMNA 1CGXA 1RD5A 2WYSA 5C2CA 4NZFA 4C6CA 4PEEA 5F2IA 3DGRA 3WLLA 1O6IA 4PMOA 3S8HA 1GQLA 4UQCA 3WF3A 2YW3A 1J79A 2PZ0A 2X1IA 3UZJA 4DHGA 1C93A 3Q94A 1KCLA 1TSIA 2ZICA 1ISVA 3F5LA 3IJDA 1UKPA 2C79A 3WEZA 3GNXA 5GPRA 4G7EB 1V6UA 1PVNA 3ZS4A 2WM1A 4LUIA 1A0CA 2JALA 3VOJA 5PTDA 1OSEA 4Y9AA 5HNTA 3KAOA 3SJNA 1DWFM 1R85A 5HJXA 4MDOA 1TUXA 1XBXA 3I10A 1IQ8A 4XAFA 4UMBA 3MMUA 1ZL1A 1TTJA 1XLKA 1FTXA 4S3GA 4FNPA 1LDCA 1BVWA 5DT7A 3W82A 3WDQA 4JX5A 2E8YA 2E5DA 1IEIA 4M56A 1YRRA 2WV8A 3R4IA 1P5BA 3FSUA 1BXCA 3QQ1A 2C1HA 3NQGA 3TEVA 1TR1A 1TJ1A 3V0SA 1WKEA 1L2QA 1Q7MA 2DIKA 1TA3B 5E6YA 4DF0A 1PZ2A 1XC4A 5IXEA 3WF2A 1A5LC 2XWEA 1EC9A 3VIFA 4JS3A 4B5UA 1GOKA 1OD8A 1R87A 1KWKA 3K30A 2OPJA 2PURA 4BKNA 5EU9A 3Q2DA 4EF9A 3WLSA 2EKGA 1Q7QA 3GXIA 3VNLA 4PCSA 1I0BA 5AHMA 1V6VA 5E0CA 1JD9A 1VD6A 1JPMA 1XIBA 4FXRA 4NZ3A 4DBSA 2DIJA 2O4MA 3GYEA 5J8LA 1OFBA 1WDQA 3LMYA 2NUYA 2EAWA 4XO6A 2ZTJA 1J0IA 2QQ6A 4HZ6A 3UESA 4KKXA 3L4XA 2V5BA 1MRQA 3IAPA 1LJYA 3KL0A 1GHRA 4WGHA 2FB2A 1LQAA 4IPIA 4TV5A 2PD9A 1JZ6A 4RUBA 4W7UA 4F0HA 1PYFA 2ZADA 1TKKA 2WM0A 1SVDA 4KRTA 3A23A 1XS2A 2GVLA 3W4RA 3UPMA 2P1FA 1OD0A 1JGIA 4DJFA 1EHNA 1A3WA 2AQWA 3CHDA 3W7MA 4ZXLA 3T44A 1TVLA 5DLCA 1ME7A 1QHPA 2CZDA 1KTCA 4DWSC 1Y0EA 5AC8A 1Z6KA 1XINA 4O8AA 3MWAA 4AXKA 4JTKA 1TPVA 2CNCA 1LQ0A 4O8RA 4N6EA 4W8AA 2Y5JA 4PTVA 4IMAA 4XO7A 2PMQA 2GOKA 1WDPA 4MZ8A 4LS0A 4Q7NA 4RLIA 1MW0A 3GDMA 4X0VA 4Q32A 3ARQA 2Z1VA 4NX5A 3SCPA 4S2CA 3UU0A 4HU8A 2YJQA 3T8LA 3TK7A 1HQTA 3CAVA 4MWAE 3T0CA 4Z1YA 4C6LA 2E25A 2OWXA 2RH9A 3WJZA 1LOLA 4ROQA 5D9MA 1NOFA 1W1VA 4U2YA 3D0CA 3FN9A 3L4WA 4QRNA 4MWAB 3E0VA 1A3XA 2OYMA 3DG7A 3S6DA 2C91A 4Q22A 4AEEA 2A3LA 1M3UA 3WH7A 1I45A 1QBBA 3G1FA 3U7VA 1H62A 4NIRA 3WLJA 5JVLA 3UZYA 1H4PA 3LHWA 1VEPA 1LL7A 2J7BA 5CZJA 4CQ9A