4K7YA

Oye1-w116t
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLTVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
total genus 151
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k7yA00
1AW1A 1WBHA 1K02A 4MKNA 1OYBA 3W85A 3CC1A 3CIWA 1RR2A 4UNKA 2ALDA 3FS2A 2HSAA 2FFCA 3TCEA 2VFEA 5DCBA 3DFPA 1O4UA 3TAOA 2E5DA 3L5LA 3KHJA 1EEPA 3VE7A 2WQPA 1W31A 3LLDA 4ORMA 5D2WA 4YCOA 2V2HA 3HGRA 5HR7A 5HINA 4UXDA 4NNCA 3GK0A 4AWSA 1TPVA 3N9RA 1SSGA 3BW4A 1W3TA 3QRHA 1KFCA 3LGEA 1KFJA 3NPVA 4PFMA 3JRKA 4BI7A 3W3OA 2A2IA 3TW7A 3W7CA 2FPYA 1VQTA 4DQWA 4JEQA 1KBJA 3W1QA 3TXVA 1T99A 1Q45A 4AVFA 4GC4A 1KLZA 4O28A 7TIMA 4Z08A 2OMAA 1RV8A 2G95A 2Z0IA 2DZSA 3CT7A 5G5IA 3NL2A 3O6YX 3KX6A 4TU1A 2VFFA 3LRKA 3P5ZA 3C2FA 4HPJA 4HT3A 2E68A 1OFEA 3PBUA 4OE7A 3LI0A 1OX4A 3RNDA 2Q3OA 3O6CA 1YDVA 1DJQA 4WY0F 1Z44A 2G97A 1U83A 3NXFA 1X1OA 1TPC1 4PODA 1O60A 1TPFA 1QOPA 5HWMA 3P5YA 3WK3A 3DZ1A 1CI1A 3M5YA 2A4AA 4IPIA 1TPEA 1DBTA 3W7PA 1TSIA 1XDMA 2DZWA 5C55A 3HO8A 3FFSA 1LOSA 3C8FA 3DAQA 3PC0A 1SW0A 2ZZ4A 3B8DA 4LV9A 1PCWA 5FEXA 3W7IA 5BRBA 1JQXA 1TV5A 3OHIA 3PULA 2GVJA 5TBOA 3OA3A 4RV8A 3LB0A 1BEUA 1TPUA 1ZY9A 4TR9A 4DPPA 3IIXA 5K9DA 1TTQA 3TXZA 2A21A 3FOKA 1KFEA 2VEKA 3BLFA 4GWEA 5FEPA 3V75A 2JKAA 4DPQA 2NX1A 3UWWA 5G2IA 1LOQA 3KOFA 1YLVA 3TNOA 2JGYA 4IOTA 1LLWA 2V2CA 3JR2A 1B57A 1OFAA 5DLCA 4CCCA 3HMJG 3CWOX 2VKZG 3TKFA 4ZZ9A 3JS3A 3MHGA 3M6YA 4H3DA 1ME7A 1QPOA 1C9DA 2QAPA 2HTMA 5E1QA 1VRDA 5D2XA 1DKWA 1SO6A 3Q2DA 1GWJA 3TA6A 1FY6A 1VJIA 4R53A 4PC8A 3T4CA 4LUJA 2C3ZA 1Z41A 3P62A 3LXAA 1I2PA 1KM4A 3E02A 2QDGA 3O16A 4JIPA 4ADSA 2WNQA 1LORA 5AHIA 1RD5A 1FDYA 4RZ5A 2AAMA 4YWIA 5G4WA 1VLWA 5F1UA 5I3KA 4CNOA 4FNSA 2ZZ6A 4JYDA 1QFEA 3U8GA 1TTPA 1A5BA 2V5LA 4K36A 1LBMA 1YYAA 3RFAA 4N02A 1Q6LA 4OGZA 3N14A 2LLEA 3C52A 3UWUA 1ONRA 3QC3A 3G0XA 1OYCA 3GNNA 3NPWA 4N9BA 4Z1CA 2V30A 3N19B 3S5NA 1HG3A 1ZAJA 2XN1A 3PBWA 3NQGA 1TPB1 3LV6A 1XL9A 4K7VA 1FBAA 1U5JA 3DKLA 4TMBA 5C2XA 4UFIA 1TQXA 4FX8A 3HGSA 3PB2A 3QSTA 4O53A 2TYSA 1H7WA 4QAIA 1LP6A 5CKSA 1YXCA 3E12A 3L0GA 4JR5A 4CQ9A 3G1XA 3IVUA 3NR0A 5F2MA 3TK7A 5K2ZA 1EPXA 3U6WA 1BWLA 3C0JA 3NQVA 4O11A 2P1FA 3IIZA 1GT8A 1KFBA 1I2NA 5DBUA 3LHTA 4JTTA 1XC4A 5J5RA 1SFJA 4CLMA 3SECA 2A5HA 1WAUA 2X2GA 4QIUA 1FQ0A 3MBFA 4K6AA 1N7KA 1WOAA 4X22A 3PG9A 4UMBA 4RX0A 3RLUA 4GNJA 3RMJA 5G4EA 3NQCA 3BPWA 2Y7GA 1SO4A 1UCWA 4LY8A 3NZRA 1EP1A 4Z1AA 2A1YA 4FB7A 1VS1A 3GVGA 5CPNA 5AFDA 3SI9A 1UJPA 4AB4A 3TU9A 4IXXA 4B5NA 4IJBA 1O5KA 3TUUA 1AG1O 1WXJA 3LBCA 3VKJA 2Y63A 1A53A 2DZPA 3ABSA 4DO5A 3PM6A 1HL2A 1XDLA 4WXZA 4E2DA 2BWGA 1XKYA 5KZMA 4UR8A 5FEZA 2AQWA 2JBMA 3PS7A 4LC6A 1F76A 4O4WA 4JTUA 5TQLA 4DF1A 3P8JA 4CCDA 1RQEA 3HG3A 4E2BA 2NV2A 2V82A 3GAKA 2PCQA 1TJRA 2X1UA 3IIPA 3MI6A 4LOCA 1TRDA 3LCLA 2W6RA 4LVDA 3HPZA 3MWAA 5AYXA 1KBIA 4GRSA 3UPWA 3G22A 3EX6A 5MHBA 3MW7A 2RDTA 4YCPA 3T7VA 4LWWA 1KTNA 2DJXA 3W2KA 1XUUA 3UXDA 3WJZA 3B0UX 1GVQA 3NEVA 1EUAA 1FDZA 3GZ3A 4OBTA 2WV8A 3VI2A 2X1SA 3GXPA 5LHFA 2WSQA 3FKRA 4BFAA 3E96A 4AH7A 1OX4B 4QM1A 3T40A 1MEHA 1H51A 4ADUA 2Y7FA 4RXGA 2B7PA 3GXTA 5F4XA 3A5VA 1H1YA 2GVLA 2QAFA 2QUUA 4HKPA 2ZRUA 4O15A 2Z2UA 5K4ZA 2ZZ1A 1S5TA 3W2MA 3NQMA 4BR1A 3KXQA 4OV9A 5FF2A 4S2CA 5TIMA 3IEBA 2BTMA 4O50A 4W9TA 4JX5A 3IGXA 4BK9A 4U4MA 4PA8A 1M6JA 2ZCGA 4WJEA 2V81A 2UV8G 5L9FA 1WV2A 3P8IA 2ZZ3A 3FIGA 4GUGA 2CWNA 1JCLA 3UWQA 5G1TA 2RDUA 3W72A 4NJGA 1SZNA 1MXSA 3S8HA 5IBXC 4NJKA 1LBFA 4BI5A 5HWJA 4YXGA 4RKAA 1KM5A 3OBKA 1SUXA 3M44A 1J4EA 5HNRA 3C2OA 5HMSA 5CGQA 5GVJA 2BZNA 5HULA 2GVGA 5G2WA 3CEUA 4CQAA 4JTEA 1RPXA 3W7MA 5A5WA 3MMTA 2R91A 4NX5A 1JQVA 4I7VA 4O1BA 1K03A 4FIQA 3STEA 4N6EA 4A29A 3UNDA 1TPH1 1IXNA 2E6DA 3YPIA 1B3OA 4K8HA 3BG5A 2WNZA 1G67A 4K39A 3C3NA 1S5VA 3HB9A 2FPTA 3O63A 4N6FA 4XTDA 5D30A 4UTKA 3SIZA 4A2RA 1NFBA 1TPDA 2Z6JA 5CPLA 3CPRA 4UFJA 5CZJA 5D2VA 1W5QA 6ALDA 3H54A 1LRTA 3W86A 1MZHA 2Q8ZA 3TFXA 5AYZA 2F84A 3DBPA 3W1RA 3W7RA 5AB3A 4CNPA 3NNTA 2Y61A 1SQ7A 2G5WA 1N55A 3S5ZA 2Y88A 2DZUA 1ZALA 3EWUA 1DOSA 4O16A 2V9DA 5D32A 2A6NA 3T55A 4L4MA 2QEZA 3EX4A 2GUUA 4HSNA 3DU0A 1JRCA 1H1ZA 3WFAA 3W1PA 1FXPA 2QR6A 4MY1A 3STFA 4N4QA 1FCQA 1VCVA 4FNUA 3PY2A 2GQ9A 3P82A 1XM3A 4O1AA 3NQ7A 5HUOA 2VFGA 1DL3A 1TB3A 3M5XA 3PWAA 1D9EA 2ZRWA 3TH6A 4C1KA 2Y7DA 3PUOA 3FA5A 4XZ9A 3O1NA 4S1FA 1G69A 2GJLA 1JULA 1PE1A 2TSYA 5G2HA 3IGUA 4JNMA 4MY8A 1PIIA 3O06A 1KV8A 4EF8A 3W76A 1MEIA 3S1XA 5KZEA 3K30A 3FLUA 3C2VA 3BV4A 4QISA 1ME9A 5E0KA 4FF7A 1IF2A 5IBXA 1TTIA 4NJJA 2CLMA 1MEWA 3LERA 4ADTA 3HQ1A 3DKJA 3MYPA 1I8JA 1LDCA 3CIXA 2QKFA 4WX2A 5D09A 1WQ5A 3TSBA 1G4SA 2B7QA 1KV5A 3W07A 3W23A 1I2RA 3LHVA 1OJXA 1J5TA 3N34A 4PL1A 1MSSA 3R13A 4JYFA 4UTWC 3I7SA 1O95A 2H6RA 4E38A 1KM3A 1VYSX 4YLWA 4RCXA 3OVPA 4N4PA 4OV4A 4IMCA 5LKYA 1GG0A 1R2RA 2CLLA 2Y62A 2ZA2A 2QCLA 3FKKA 2PRMA 4O8RA 2JKEA 1G4TA 4AHPA 5LNRA 4K38A 2E5CA 1S3HA 3H55A 1NF7A 5CPMA 2CU0A 4AWUA 4IMDA 1TYGA 1W54A 1H50A 4HSOA 3ZWTA 4BWLC 3M0ZA 3M5VA 1LYXA 2RFGA 3R5EA 1F7BA 4NZJA 1TMHA 1V7YA 2R8WA 4ORIA 3S9YA 1ZCOA 1OVDA 5BNKA 5AHFA 2ZTKA 5CZSA 1UASA 2H3DA 3LCXA 3BK0A 1K8ZA 3A9IA 2QCFA 4KFPA 4GJ1A 3UWZA 3L5MA 1F5ZA 4NX0A 4Y90A 1P0NA 1A5SA 1TIMA 1K7XA 3BGJA 2EAWA 4DEFA 4NNBA 1PL9A 4AAJA 3MHUA 1EA0A 1GTHA 3BLIA 3IIOA 1KTBA 2NUYA 3WK1A 2V2DA 2F7FA 2EKCA 3FJLA 4JIQA 1KLYA 1L9WA 1L2UA 1ALDA 3M7WA 4I7UA 1H7NA 4FX7A 1KM1A 4BI6A 4GUJA 3TQVA 4JDBA 3W84A 2PRHA 3SFKA 2VEMA 3KRSA 3OEXA 3LHWA 2CZFA 1THFD 2VXNA 3HGJA 2VEIA 1CX9A 3FEMA 4MZYA 3I65A 4Q33A 4UFMA 3HG2A 4R33A 4JYEA 1IGSA 5L6UA 4UTUA 2AGKA 1GEQA 3LCIA 4NUWA 3S5YA 3MP3A 3TAKA 1TRIA 3L2IA 5EA9A 1LZOA 1XFBA 2ZTJA 1SZFA 4LT9A 5D03A 1FWWA 2QCMA 5EBUA 2NWRA 5AHMA 3W2NA 2H3BA 1G4PA 2E1DA 3W7EA 3W75A 2NLIA 1ICPA 3BLEA 4WY0B 2WSYA 5DCDA 6TIMA 2C16A 4ZQRA 3NDOA 3PG8A 3UZ5A 3IVSA 3I68A 4QJ1A 3P67A 1T0OA 4QQ3A 1VR6A 5HR6A 4ZMGA 1KW1A 3ZWSA 4FXRA 1EP2A 3NM3A 4D2JA 4J9JA 4I7WA 2C19A 4UTWA 5EY5A 4EWND 1JCNA 3NPUA 3SY5A 1D3GA 3B06A 1JCJA 3C2EA 4ZQCA 1QDSA 3W1TA 3G1FA 1WOBA 3TSDA 3WJSA 1K7FA 5T26A 1LRNA 2PURA 4HHPA 3QYQA 5DY2A 1W3IA 3LHUA 3BO9A 4ML9A 3I7RA 3RU6A 4JTLA 1VGAA 2FB3A 1OF6A 2C14A 3P61A 2WOQA 3G0SA 4BWLA 2O7QA 3EWXA 2W0UA 4QSHA 2VFDA 3IV3A 1QPNA 4Y6GA 1ZAHA 1P4CA 3MUXA 3NQAA 3UPBA 4IMEA 1F74A 3RLVA 1R2TA 1Q6OA 4GUFA 2VEPA 4UFKA 3PVFA 1OF8A 4MLJA 4JX6A 1QAPA 4NJHA 1GVSA 5LNWA 3EWWA 3VE9A 4AEOA 5AC6A 1YDOA 3O6DA 3C6CA 2QCCA 2DP3A 3QJAA 3NL5A 4Q4KA 1H63A 2V8ZA 4MFDA 5LHEA 4FNQA 3W2UA 1ZHAA 2C0AA 1GVFA 1H7XA 3PBVA 2YSWA 3HPSA 3NQ6A 2A7PA 3A21A 4H6KA 2NZLA 1JUBA 3NQFA 3NGJA 3M43A 1I2OA 4TMCA 4KWVA 1QWGA 1GOXA 3G18A 4O0ZA 3PSVA 4LW7A 2NWSA 4PCFA 4LU0A 1FWSA 1JCYA 4ZL1A 3PB0A 3LXCA 4Z1BA 4QITA 3MBDA 3LRMA 3O8AA 4O54A 3W9ZA 3F03K 3QQ0A 3F4NA 1JCMP 5K4XA 1W5PA 4LUIA 1E51A 2GPTA 1QNVA 3C56A 2OZ0A 5AYYA 1OK4A 2DZVA 2TRSA 3KRUA 4OWGA 4JTFA 2CLFA 4C1LA 1JUKA 3G1YA 1EWEA 3BG9A 2BX7A 1G6CA 3LHZA 1A5AA 2ISVA 4AXKA 4Y8FA 4UTLA 3NG3A 5K9XA 3W7OA 4UFHA 1EIXA 2GOUA 3QSRA 5CSSA 2QJIA 3TMLA 3IGSA 3DFSA 4PTNA 5D2YA 1A5CA 3TC6A 2YFOA 3NQEA 4M5PA 1XXXA 1R46A 2FTPA 1NF0A 2FJKA 4RXFA 3DFTA 3L66A 1YPFA 1ZFJA 4ZVJA 3GLCA 1IXQA 4EOUA 2J24A 4O52A 1SPQA 3QPYA 3N73A 1ZNNA 1B4EA 2D73A 3STGA 4Z1DA 3CTLA 2ATSA 1LTDA 3UYCA 3L9CA 3LCFA 3TQKA 4IMGA 3DH7A 1TQJA 3QF0A 1EB3A 1I4NA 4XBKA 4XBSA 4O1DA 5FF7A 4DF0A 1DORA 4NJIA 3ATYA 2QCEA 3IVTA 4O0KA 3LCGA 4IGHA 1AL7A 2NXIA 4O17A 1QCWA 3PR2A 4GUHA 1X8FA 3OIXA 2ATMA 3RK8A 1VPXA 5LGZA 2C15A 2YYUA 5CPOA 3INPA 3G1VA 3TX9A 5H91A 5DELA 3W87A 5AN7A 4MUZA 2V5BA 3USBA 4KWWA 4A3UA 2YX0A 3TV8A 3F1QA 1HO4A 1NEYA 3G3DA 4RZ6A 5D38A 2EPHA 2XFWA 3W7JA 4XTIA 4HNUA 3TJLA 1X6UA 4N9CA 4PEKA 1Z48A 3MHFA 4P61A 4IQLA 3QQ1A 3I6RA 1GVOA 2B0MA 4HIBA 5D33A 2J88A 1SR9A 1AL8A 1LLZA 4GFSA 1QO2A 5D05A 2X1RA 2J6XA 1XCFA 1XBYA 1B9BA 2H8XA 3HF3A 5AHLA 2E5BA 4JTIA 1AMKA 3V1PA 4K7YA 4JY9A 3KAOA 1Z42A 1L6YA 1WA3A 4LRTA 1B4KA 1EP3A 4OQVA 3MO7A 3S1VA 3CWNA 4NU7A 4FNPA 2ZYFA 4N9EA 3VFLA 2QJHA 2CZEA 4LS1A 5BW6A 3W7HA 4O1CA 1YTDA 1GG1A 5AOUA 3S1UA 3LLFA 4POCA 1XUZA 3GKFA 4WY0A 4OHQA 2CLIA 2A0NA 2OT1A 5CZ0A 3W71A 5H2ZA 1X1ZA 2FB2A 4O14A 3LCWA 1SU5A 1P0KA 5CZTA 1G7VA 3TE9A 2X16A 5EL1A 3EWYA 3M5ZA 2FLIA 3LV5A 4MJMA 3NL3A 3CU2A 3KVLA 3ZS4A 5HUPA 4KFNA 3L67A 2CFFA 5I3GA 3MP5A 3RF9A 3L21A 1K8XA 3VCRA 1H7OA 1QOQA 3W7KA 3NVTA 4UMCA 3B04A 1GJPA 4M19A 3HJZA 4N9DA 1EX5A 3M9YA 4I9AA 1TO3A 1Q3NA 1M7PA 5F2LA 3R12A 3AJXA 4LV4A 2WPBA 1PS9A 2QUTA 2Z1BA 2YW4A 2ZFAA 3TSMA 4HNNA 5KZDA 1DVJA 4YMZA 1W56A 3TW6A 2NV1A 3IIVA 3TIMA 1H7PA 4JS3A 1OFPA 3N2MA 1FWTA 3GR8A 3S5OA 3NQ2A 4A21A 5LNVA 5SWUA 3G0UA 4JTKA 5EYWA 3WK0A 4NQ1A 5HQEA 1KFKA 1WX0A 3UXAA 4DBEA 3DXIA 2VELA 5D02A 1BKSA 5BMXA 2QF7A 1LRQA 4S2BA 2Q8LA 3BW2A 3N3MA 4ZQNA 1SFLA 3TQ0A 3GKAA 4IPJA 2V0TA 1LBLA 3IRDA 1JJKA 5I3HA 3LBMA 3TROA 3HOJA 3R89A 2DZTA 5C5YA 4AMAA 1FCBA 2YGYA 4A22A 5FF4A 5AC8A 3LX9A 3OVRA 4M7SA 4DBDA 8TIMA 4Z0SA 3EWBX 3W7DA 2Y7EA 3L68A 5EPDA 4O13A 1OFBA 2YFNA 4AHQA 4TO8A 1F2JA 5BMWA 5K9CA 2B7NA 3FYPA 3SJ3A 4XWUA 2R14A 4AHOA 4BF9A 3W1LA 1A50A 4O19A 5K3VA 4WOZA 3SSJA 3TJXA 1M7OA 1JRBA 4MPQA 4FNTA 1T8XA 1TJPA 3R2GA 3PF3A 1LOLA 1ZJIA 2B7OA 2CZDA 4DELA 1QO5A 3B0PA 2PC4A 3MI2A 4JDYA 1H62A 1R30A 1D3HA 3HGOA 2DZXA 1QR7A 2ISWA 4K37A 3PUDA 3LRLA 3NO5A 1ME8A 1SW3A 1K8YA 1JCXA 4XUGA 3Q58A 1SO3A 4NXKA 5F2IA 3W2JA 1JVNA 5FF0A 2FIQA 2X30A 1RVGA 3QW3A 3ABRA 1GYLA 1FX6A 5LNSA 3ABOA 5DN1A 4LC8A 1TTJA 2FQIA 3GAYA 2ZZ2A 4CNNA 4DXVA 3U2OA 1FWNA 3Q94A 1IIHA 2H90A 4FO4A 3WK2A 2GQ8A 5D2TA 3SGZA 4MYXA 1FXQA 3L5AA 2TMDA 3CEPA 4R34A 1N8FA 2FPVA 5F4SA 1FCVA 1RZMA 2TPSA 5KSWA 4ONVA 4TIMA 2Y85A 2VFIA 3NZ1A 2CZ5A 3DHFA 3NYZA 3L65A 4MJZA 5DXYA 3GDLA 1GPWA 4GE8A 1UB3A 1YXYA 3GDTA 4JY8A 1L6WA 5KITA 1DHPA 3GXNA 4UTTA 4G1KA 5LSMA 3VNDA 1EWDA 1G4EA 2QCHA 3HG4A 3R8RA 3EX1A 3LTYA 4NVTA 1GYNA 4UUIA 3B03A 4LS2A 3NM1A 2QJGA 3LCHA 4L4LA 1OYAA 1PVNA 1G7UA 2J9YA 3EXTA 2ZA3A 3NOEA 4ZQMA 1UUMA 4UR7A 3W1MA 3NL6A 4O18A 3G8EA 4FEZA 2NX3A 4LVGA 4PL2A 1NVMA 4RJEA 5FI8A 1YXDA 4ZQOA 1ML1A 1I45A 3FYOA 2CLKA 4UMAA 1GQNA 3HG5A 3S1WA 1KM6A 1ICSA 2ZBTA 4EF9A 3P7YA 1IXOA 3ELFA 4O10A 4IX2A 2W79A 4GXMA 2I1OA 3TDFA 2J27A 2YR1A 4RR4A 3C61A 2WKJA 3E9AA 4JICA 2EGZA 3UWYA 3M47A 3ABQA 5K7JA 2DU2A 3UWVA 3N2XA 3MP4A 5D37A 1PHQA 3A23A 5EMUA 5LNUA 2NUXA 4JTGA 1RQHA 4M6PA 3MJYA 3W22A 4TX9A 4NNAA 1NAL1 3LTSA 4XKYB 4FX6M 2Y6ZA 2PRLA 3EX3A 3H53A 2RH9A 2ISSA 3PUEA 1F6PA 4AF0B 3QM3A 3P60A 3WJYA 4UTIA 2RDWA 1HFBA 3QFEA 3EX2A 3W88A 4NXSA 2I9EA 2XN2A 3KVMA 4MYAA 2NX9A 4R7JA 5CG7A 2ZA1A 3F4WA 3A24A 3CM4A 3W1NA 3GR7A 3G3MA 3W6YA 1WYIA 2YCEA 2QCDB 3EKLA 2H8ZA 3QH2A 2OJPA 2CLHA 3TFCA 1O5XA 4X2RA 3CHVA 4HN4A 4UTJA 4DF2A 5U4NA 1W5NA 1FDJA 3TMQA 3I7QA 3UZJA 1R2SA 3CQ0A 3ZR4A 3EXRA 4RK8A 2VFHA 1P1XA 1CW2A 4UCGA 3LTPA 3PBYA 1FCUA 1VLIA 4MY9A 1XI3A 2ZRXA 2NXGA 3P80A 2HS6A 1H60A 4LRSA 1BTMA 3M16A 4IWWA 2YZRA 3B05A 4KFOA 2E77A 5F2GA 4K8EA 3BARA 4RZ4A 3DI0A 5AHEA 2VENA 3LOTA 1YPIA 3EKZA 1SW7A 1LCOA 5LGXA 1C29A 1VC4A 1W1ZA 3SGUA 1J2WA 4O4VA 1PCKA 5BOOA 3DFQA 5C6MA 4HPXA 1F73A 4QNWA 1JR1A 2GQAA 4UFLA 3BG3A 1LROA 3DFNA 3W7LA 1W0MA 3UY7A 5IM51 3ATZA 2EHHA 3E0IA 3QEZA 1K3UA 5DBTA 3KVJA 2BXVA 1W3NA 3E49A 4X3ZA 1GTEA 3UY8A 2YDAA 2A7NA 2R94A 2E6YA 1VYPX 4N2YA 4MFEA 1HUVA 2YW3A 3OVQA 4LNYA 1SZEA 5CSRA 5A8GA 4DO6A 4IX0A 1XBZA 2WNNA 1IXPA 1C8VA 1LM1A 4HNTA 3EEGA 5C54A 3HBLA 5I3IA 3THAA 1R47A 1MO0A 1XBXA 3KRZA 2QCGA 5F1VA 4M6QA 1KM0A 2RHGA 3W7GA 4ICNA 2BSLA 3UD6A 1OFDA 2JKPA 2VC6A 2HMCA 4LVAA 3W83A 3PSWA 1NSJA 2BLEA 1L6SA 4YL2A 3LXBA 2YYTA 5DCEA 1HTIA 2E09A 3ZFHA 3GX9A 3L0NA 2EF9A 3DENA 5I3JA 3LDVA 3GYEA 4XQ6A 4PH6A 4HNVA 2ABAA 2WJZA 1VZWA 3EXSA 2P10A 1WDWA 3L0KA 1WBJA 2CLOA 1QPRA 3AO0A 1QMLA 4UNLA 4KKXA 4JTSA 3A22A 1ICQA 3S6DA 4MZ1A 3G24A 5EKYA 4OT7A 5J5DA 3QMRA 4M7TA 3O07A 4FNRA 3GDRA 2ZRZA 4FIRA 3UQNA 3OG3A 2XN0A 4WUIA 3DFOA 1DJNA 4EVZA 1V5XA 3QW4B 1OFOA 3QPZA 3G1SA 5HJLA 3ANYA 2GJNA 1W5MA 4MLRA 1UUOA 1X7FA 4CCEA 2CLEA 5G1YA 4MOZA 1IIGA 1TV8A 5DY3A 1SO5A 1O94A 5KMYA 1H7RA 2A6LA 3DHDA 3G1HA 4WXYA 3TR2A 3W70A 3NA8A 5KTLA 4FHAA 1TPWA 1KM2A 5AC7A 1KTCA 4IXHA 2NXHA 4O57A 1KA9F 4WOQA 3FJ6A 4O12A 1T96A 2OX1A 3GIYA 3W7NA 3EB2A 3QMTA 4Y9AA 3SZ8A 1H61A 2Q3RA 1UBSA 1DV7A 3LM7A 1W5OA 3BVJA 1VHNA 3G1AA 1OK6A 1YDNA 3THQA 4P2VA 1SZGA 2Y70A 2WSRA 2Y89A 2ZRYA 4GUIA 5F4WA 2J9ZA 3N9SA 3WJWA 1TV7A 2E6FA 2A7RA 1S5WA 2C1HA 3QMSA 3NPXA 1Q6RA 3O15A 3MI3A 1K7EA 1OX6A 5DXXA 3DGRA 1TREA 2P0OA 1FUYA 2O7SA 4JN6A 3QZEA 4OU1A 2ZDRA 5FESA 1M5WA 5I3FA 1DQXA 3NAVA 1Q6QA 5LZLA 3W1UA 4Z0JA 1HO1A 1XBVA 4Q32A 5AHNA 3KVKA 4JTJA 2JK2A 5FEWA 4FXSA 3KFTA 4U28A 4XKYA 4JD4A 4UC5A 2ZZ7A 3W7QA 3S0CA 2VOMA 3B4UA 3CLMA 1BWKA 3SR7A 1EUNA 3DI1A 4UTHA 2PE4A 4AF0A 2IQTA 1I2QA 2Z6IA 1VHCA 3GNDA 4JXCA 3P84A 2ZZ5A 4X9SA 3G1DA 4NT0A 2I14A 1Y0EA 5ABTA 1OFRA 3MYOA 3LI1A 1VH7A 5KINA 4MIMA 3HPXA 2E6AA 4JGDA 1GVRA 3GDKA 3TC7A 4JTHA 3STCA 3EWZA 2C6QA 1VCFA 3W1XA 2C13A 4M6VA 1VCGA 2QCDA 2HS8A 4NZFA 2G96A 2J9XA 4WZHA 1AK5A 4EIVA 1RQBA 3HIJA 3W1AA 4WQ6A 1TCDA 4LTSA 3G8RA 1DQWA 3W73A 2ZRVA 4LVBA 4A2SA 1PHWA 4JX4A 1GZGA 1PV8A 2NUWA 1KFLA 3NQ8A 4UTTC 1AW2A 3C4UA 5HWNA 2YXGA 3CB8A 4ALDA 4AWTA 2QCNA 4QNEA 1OHLA 1AW5A 4CQ8A 1F05A 2C18A 4MVAA 3S42A 1ZENA 2QUVA 2B4GA 3W2LA 2RKXA 1JUEA 3BW3A 3BGGA 3NQDA 1W8SA 5D04C 5U7SA 3Q37A 2CW6A 1YADA 4LS0A 3WJXA 2FDSA 2YPIA 2A85A 1VYRA 4DO4A 4WD0A 3C2RA 1FWRA 4ZQPA 5E93A 4UTMA 2DORA 3GDMA 1YTEA 3LHYA 1OABA 4IUOA 3P74A 1H5YA 1P5BA 3P81A 1QPQA 2X1TA 1W37A 1OX5A 3M1ZA 4GBUA 1OG0A 3SW6A 4H4IA 1ADOA 3W74A 2QDHA 4UIOA 3B0VC 1SSDA 1ZAIA 3M41A 2DJLA 2OT0A 1OFQA 1F6KA 4Y96A 3A5FA 3O05A 5FF3A 3GB6A 2WO5A 4RLIA 2JGQA 1YTKA 4MZ8A 3D0CA 2KZHA 2ZQ0A 4IMFA 2OCZA 3T78A 4E0CA 4LVFA 2ABBA 3T44A 3PAJA
chains in the Genus database with same CATH superfamily
1K02A 1OYBA 5C9RA 1M01A 4ZB5A 3BQ5A 3QOMA 2VT0A 4FAMA 2HZGA 3VE7A 3GWQA 6A3HA 4PMUA 4PMZA 2WQPA 1KXHA 1BSIA 3HGRA 3PHAA 1Z9AA 1AODA 4QLKA 3BSHA 3GK0A 1TPVA 3N9RA 1SSGA 1W3TA 3L4XA 3NPVA 3W82A 1ADSA 1EXBA 3W3OA 1F3WA 3T09A 4DQWA 3GR4A 3LGGA 1FOBA 3W1QA 4A35A 1XRFA 2YB1A 3LGDA 3TXVA 1WKFA 2O56A 1BG4A 1Q45A 1W1VA 1V77A 1PZ3A 1FWJC 4C65A 1NTHA 1QVBA 2EJAA 3K1GA 1RV8A 3K2GA 2J25A 3CT7A 5G5IA 1U30A 2VMFA 4KW2A 2V3DA 3TN5A 1A47A 2OZTA 2AAAA 1A5OC 1GW1A 1OX4A 3PZ9A 3MCMA 1F8MA 3ALFA 4WY0F 2Q8XA 1FHLA 2Y1HA 3PTQA 2BVYA 2GSHA 1U83A 5A8OA 3NXFA 1X1OA 2YDQA 2BOGX 3WQPA 1QOPA 3DESA 2I16A 3P5YA 4DJDD 3DZ1A 1CXEA 2A4AA 1DBTA 2ZWYA 5CH9A 4F66A 3VGHA 5A8NA 1BXBA 1NQKA 3PC0A 2GDUA 2P50A 2ZZ4A 4QLJA 3WQFA 2H9AA 4GOAA 1NWRA 2X09A 4XZLX 3W7IA 1JQXA 1TV5A 2V63A 2ZX6A 3OA3A 1KQYA 1BEUA 4DPPA 3L4UA 4MKVA 3TXZA 3FOKA 4C6KA 2VEKA 3K8MA 4GWEA 1AZ2A 3PN8A 2JKAA 3UWWA 1HQTA 5G2IA 3TNOA 1KR0A 1BYCA 2ZC1A 1O7AA 2JGYA 3JR2A 2PDMA 1EZ2A 4RZBA 4CCCA 2HV5A 2ISDA 1JFXA 2UY4A 3JS3A 5CPTA 3IV8A 1VRDA 1NWUA 3OGSA 4JQAA 3LZ3A 1SO6A 4PMVA 4EANA 1VJIA 4R53A 1P48A 3SO7A 3PP7A 3UBPC 1TUXA 4PC8A 1V4YA 2EPNA 4PE8A 1F3TA 1KXQA 2PGWA 3GYCA 4JIPA 1VFTA 3TW9A 2GL5A 2AAMA 3GG1A 1VLWA 5I3KA 3UETA 3T0CA 2ZZ6A 3PTDA 5EFDA 2I5IA 4K36A 1YYAA 3OO2A 3N14A 1HXJA 1NWSA 2IW0A 3UWUA 1XLGA 1RH9A 3QC3A 1EJTC 2FTWA 2WJEA 3GNNA 4N9BA 3N19B 1HG3A 3PNUA 1TPB1 4H9YA 3KZPA 4GX9A 1S5NA 2NVAA 1U5JA 1TQXA 4M1BA 4FX8A 3EA2A 4H7CA 5CKSA 4H04A 1YXCA 1JF5A 2PLCA 3L0GA 4CQ9A 3IVUA 4AEEA 3CJPA 1EPXA 1V79A 3C0JA 3NQVA 3KCOA 4O11A 1SFSA 1C8QA 2P1FA 1GT8A 1W3KA 3CHFA 1I2NA 3LHTA 2CERA 4LAKA 3IANA 4A3HA 1J0HA 2A5HA 1WAUA 3F4VA 5K9CA 4K6AA 1WOAA 3PG9A 3WEZA 3CGTA 1PX4A 3GY1A 1ONWA 3RMJA 1UKPA 4A3RA 5A6SA 1UCWA 5CPSA 4Z1AA 2A1YA 4D9PA 1VS1A 3GVGA 4I9JA 3HA1A 4YHGA 1KNWA 3AMKA 4ZFMA 4GX8A 3V18A 5CZKA 3CZLA 1HF6A 2VO5A 3LBCA 2Y63A 2BHZA 1OWQA 4E2DA 5HMDA 4BQ5A 3PJTA 3PPGA 5BU9A 4M82A 3CASA 3WLRA 4I8DA 1W1B1 4DF1A 3P8JA 4CCDA 1PJ9A 3FV9A 2BODX 5CAHA 1E1CB 3UJSA 1W6TA 1ZP4A 3LCLA 4HZMA 4DJFA 2WVSA 2UBPC 3S2JA 1ECEA 4W88A 1D7FA 3G22A 2VVNA 1EPVA 2RDTA 4YCPA 3T7VA 2IPGA 1T40A 5ECUA 4KWOA 1WKDA 2PDQA 3LEPA 4NRSA 3VD7A 2NQ5A 5HDRA 3SUSA 3FKRA 2O9RA 4V27A 4AH7A 5REQB 3N11A 1Q66A 1OADA 3V3WA 3F4DA 3FAXA 5IDIA 2B7PA 2QW5A 1OGGA 3A5VA 2GVLA 2PP3A 2QAFA 5JBDA 1YNYA 3ZXWA 2Z2UA 1P6WA 4ENLA 1Q5MA 4BS0A 1NOWA 3WELA 3LENA 2W63A 3U7VA 4BK9A 3B8IA 1M6JA 4MADA 3EKGA 5JQ9A 2UV8G 3P8IA 4PULA 2ZZ3A 3UWQA 5G1TA 3W72A 5I09A 5JIPA 1TWZA 3S8HA 5IBXC 2IQ0A 1LBFA 3TJIA 4RKAA 1KM5A 4PN2A 3C2OA 5HMSA 5MKGA 2GVGA 2XU2A 1DIOA 2PTXA 5AYBA 2R91A 4NX5A 1JQVA 1LJYA 4I7VA 4P7NA 1V6UA 1UWUA 3H2NA 1ECQA 1EGVA 1V02E 2E6DA 2DVTA 1WDDA 3I3EA 4J3VA 2PDLA 1NY1A 1JL8A 3KRBA 1G67A 2FZ8A 3KTSA 3N9KA 4K39A 4MAVA 3O63A 4PMRA 1XLIA 3SRFA 1XH0A 1HVXA 3S46A 2OGYA 4J2MA 4A2RA 5EMKA 1TPDA 1S2AA 5CPLA 5D2VA 1W5QA 4D6DA 4RUBA 3TP4A 1LRTA 3CYVA 1UP2A 3TFXA 1FWCC 3W1RA 3W7RA 4CNPA 3TCSA 3NSXA 3S5ZA 1ZALA 3D6NA 3EWUA 3USZA 2A79A 2A6NA 4TVUA 5CBIA 3E0VA 2GUUA 4HSNA 1YDYA 1H1ZA 1ZBWA 4C60A 2CITA 2ZXBA 3SQMA 1HIZA 4O8AA 3EDDA 4N4QA 1PX8A 3PY2A 2GQ9A 2VFGA 4IHCA 1YE4A 3VM7A 4C1KA 3CZ8A 5LA0A 1JYVA 2Y7DA 3PUOA 4LEQA 4XZ9A 1QW9A 3T9PA 2DQWA 4P5UA 1JULA 1PE1A 2TSYA 3AI0A 1JYNA 4CU6A 2CCRA 1DWAM 2JFEX 3O06A 2Q02A 4IPLA 1BSLA 3S1XA 4C5ZA 5HBFA 1RBLA 3CO8A 2PLJA 4PRRA 3WG6A 1TTIA 1TZ7A 3AIBA 2OZ8A 4ADTA 1I8JA 3BLDA 1LDCA 4UOJA 2WNWA 2VR4A 3CIXA 4LXFA 2QKFA 2X42A 3MSRA 5D09A 1DHKA 3CK5A 4QAWA 3TSBA 3W23A 4H41A 3IJ7A 4Q6JA 4B16A 1OJXA 1J5TA 3SCPA 5A1AA 4PL1A 1W2VA 4CQBA 3LQLA 2H6RA 3R1ZA 1DE5A 1VYSX 4YLWA 3OVPA 5H6HA 4N4PA 4IMCA 2DUAA 1GG0A 3BL3A 2Y62A 3S9IA 3AJ7A 1FH8A 2QCLA 4ES4A 3R8HA 1G94A 2EXOA 3H12A 3CAVA 4AHPA 2CU0A 1B54A 1QATA 3ZWTA 4JKMA 2RFGA 3R5EA 4NZJA 1V7YA 4XKMA 2ZXAA 2VL4A 1QUMA 5AHFA 1E71M 1EYWA 2H3DA 1HNYA 3B40A 2XIIA 4KFPA 3L2LA 3KCJA 1P0NA 1A5SA 4DEFA 4AAJA 3T2OA 3MHUA 4CN1A 1EA0A 1GTHA 3BLIA 4QP0A 2J7BA 2V2DA 3ZSSA 3CHEA 5FCZA 4CGTA 3EMZA 3CHCA 1KM1A 4DB7A 3SFKA 1VFLA 2VEMA 3OEXA 3HGJA 4PSPA 3HURA 2E40A 4AD1A 3I65A 4Q33A 3PJWA 3HG2A 2A3CA 4R33A 4UTUA 2AGKA 3S5YA 4ZXOA 1TRIA 1LZOA 2ZTJA 1EC9A 3TN3A 1SZFA 4LT9A 5JIWA 1FWWA 4L56A 5EMYA 5XINA 2QCMA 2EG8A 5EBUA 3ARXA 2Y24A 3W2NA 1JNEA 2NLIA 4CEXC 5CC3A 3RR4A 2WSYA 2X8RA 2C16A 5AYIA 4HK5A 4IIHA 3W53A 5HR6A 4ZMGA 1KW1A 1S5MA 3IARA 3N2OA 3UG4A 4D2JA 4XK2A 3GH7A 4I7WA 2Y5EA 2C19A 5EY5A 3SY5A 1K9FA 6TAAA 1D3GA 3TN4A 1JCJA 3C2EA 3VZZA 1C8YA 4ZQCA 4MSSA 3TSDA 2FMOA 1VFSA 2D0HA 5T26A 4HNCA 3QTPA 3LU2A 1GCYA 1PZ1A 3GQYA 4IIDA 4U33A 3QYSA 4XO6A 3BO9A 4ML9A 3W24A 1EO5A 3I7RA 3RU6A 1S1RA 1NDVA 2I5GA 3VCNA 1KRMA 2OSYA 1OC6A 1BQCA 3IV3A 3RX2A 1OCBA 2ISFA 4TVDA 2ZUUA 2VD8A 1WZKA 1R2TA 1OC5A 4UFKA 4GO9A 1HJUA 1EQPA 4NJHA 2PDIA 4J3SA 5LNWA 3ENLA 5AC6A 3C6CA 2QCCA 1XIBA 2RUSA 4AISA 2DP3A 4PTWA 2WVVA 3OOQA 4F4RA 4ZR8A 1H63A 2V8ZA 3TEVA 3DFHA 5LHEA 2C0AA 3PBVA 3M0VA 2A7PA 1EJ7L 3NZQA 4H6KA 3WNLA 5C7HA 4KWVA 1GOXA 1W2PA 3UG8A 4CNUA 5E5CA 1P6BA 1SZRA 4LU0A 3RIKA 4WGXA 4W85A 3EPNA 2WCGA 3W9ZA 3H7VA 3CYJA 1JCMP 4W87A 2GPTA 2VGBA 2RGMA 1EJUC 1DJYA 3VKAA 1OK4A 1AJ2A 5HXMA 2GQ3A 4C1LA 1JUKA 1D3CA 1UPMB 2Z26A 3F7JA 4FLOA 1A80A 4WSHA 4NI3A 1TWWA 1YIXA 2BX7A 4LANA 2ISVA 1CTNA 4AXKA 1PKYA 2VWSA 3P6LA 3NG3A 3W7OA 4UFHA 3QSRA 2INZA 2INFA 2V3EA 2J8GA 3DFSA 3VGGA 5D2YA 1ZSXA 3TC6A 2YFOA 4E4UA 1Q6FA 4M5PA 2EG7A 3GFZA 4Y9OA 1R46A 2FTPA 2FJKA 1KBBA 1YPFA 3QPYA 1NIUA 1KGUA 2WZTA 2E7FA 4GKLA 1ZNNA 2PP1A 2D73A 1E9YB 4Z1DA 3CTLA 3VAVA 2ATSA 3UYCA 3L9CA 3TQKA 5CCZA 4AU0A 2PDBA 5CAKA 2J8TA 2WM1A 1S39A 3S83A 1UD3A 3MPGA 4CKQA 1EB3A 5C7VA 3BGAA 5D9NA 4ACYA 3ABXA 2QCEA 1J12A 1LLOA 1JPHA 4O17A 4YS1A 3OIXA 4UR9A 5CPOA 5AN7A 4MUZA 1GK8A 4R9OA 4H8UA 6XIAA 3MJMA 5BRPA 1I9CB 4BY3A 4F40A 1HO4A 3PFMA 3G3DA 3MCNA 2XFWA 4XTIA 4HNUA 2PD5A 1M65A 1Z48A 3QQ1A 3FY1A 3M0LA 1GGOA 3CBWA 3EGJA 3R11A 2J88A 2D1ZA 1SR9A 2ZOXA 4KIEA 1QO2A 4W84A 1RA5A 3ABZA 3VDCA 1X96A 3VZXA 5LIXX 2J6XA 5TF0A 1B9BA 2H8XA 3HF3A 1OCNA 3PJUA 2HCVA 3KBJA 4XZIA 3V1PA 7REQA 1ODUA 1L6YA 4JZ5A 2DSKA 3VNKA 4OQVA 1KQZA 1B3YA 1X6NA 4IL0A 3MO7A 1NQ6A 3N29A 2PGFA 2XM2A 3Q4DA 1R9XA 2IXVA 2CZEA 1YTDA 1GG1A 4H9TA 1C90A 2CHRA 3S1UA 3W29A 4PUKA 2R1LA 3MY9A 4Q8MA 5CZ0A 4D8LA 1DQUA 5H2ZA 4Q8OA 3U2CA 3CH0A 1AVAA 4QG6A 1G7VA 1WE5A 3TE9A 2X16A 3PNZA 2YDRA 3VNZA 3M5ZA 4MJMA 4YN5A 3NL3A 1C9WA 1DWFM 2X41A 3N13A 3E0FA 1JIBA 3L67A 1N8WA 2UWFA 3OJGA 5I3GA 4YYFA 1QOQA 2VC9A 4DVOA 2FVMA 3A47A 5B7ZA 3WX7A 3BLLA 1UQZA 2CBUA 3AJXA 4LV4A 2WPBA 2Z1BA 1QW8A 2ZFAA 3TSMA 3ARSA 3WQ5A 2YOCA 4XSLA 4PGLA 3IIVA 2FFIA 1H7PA 4JS3A 4XX6A 1V3JA 1FKXA 1E0XA 3LYEA 4CVWA 1HT6A 2ZVIA 3GR8A 3NQ2A 2Z27A 4A21A 2XFRA 1HZYA 3DC0A 4GLEA 2Y8VA 4M29A 5EYWA 6REQB 4NQ1A 3W6MA 4PCPA 2D2OA 4D6GA 3ARZA 1XD0A 2XFYA 4BHYA 1IR1A 4S2BA 4GVHA 2Q8LA 3FA4A 3SN0A 4GABA 2P8CA 4HPNA 3IS4A 3AHYA 3QXBA 4KWUA 1FHUA 3IRDA 3U48A 3APTA 3SSZA 5C5YA 2YGYA 5FF4A 3OVRA 4NY2A 2Y0FA 4P7OA 5I03A 4LUSB 4O13A 4EACA 4TO8A 2OKOA 5BMWA 3RXZA 1BD0A 4OTKA 4XWUA 2VC7A 1A3HA 1A50A 3SSJA 1JRBA 4FNTA 1PSCA 1TJPA 3R2GA 3O6AA 4KETA 4HA1A 3U5YA 1H62A 5D8WA 1D3HA 2HVNA 1QR7A 3MMDA 2ISWA 2OO0A 1JCXA 3M0YA 2GJXB 3RLHA 4B9ZA 3GVVA 3W2JA 2R1MA 1DIKA 1Q4WA 4AUBA 2VEGA 1O1ZA 3SB0A 1GYLA 2J6VA 3R0UA 4C7GA 5RUBA 3WF2A 3VIOA 4AD5A 3DHPA 2OFJA 1K9DA 2FQIA 4MMWA 3NSMA 1W9PA 4OUIA 1IIHA 3OZYA 3SGZA 1FXQA 1Z6KA 2TMDA 4X9YA 5DT7A 1TE6A 4ZODA 4R34A 1FH7A 1N8FA 3LNPA 1FCVA 4WGHA 3TLQA 2TPSA 8CGTA 1ZGDA 2G50A 3SCVA 1HGWA 2Y85A 1UW9A 2VFIA 2XH0A 1UKTA 1B2YA 3NYZA 4MJZA 1JZ4A 3TTSA 1IEXA 1GPWA 1YNPA 1GPFA 4UTTA 5I23A 3VNLA 3BWWA 3TC3A 5LSMA 5FKYA 3VNDA 1EWDA 2RGLA 2PI6A 2I5QA 3HG4A 5I00A 4NVTA 4LS2A 3EEZA 2QJGA 1DJGA 4L4LA 1PVNA 1XSIA 1G7UA 3CV2A 3NO1A 2NW0A 4WDXA 1UUMA 2POZA 2UY3A 5HATA 1RLCL 1LWJA 2J78A 2XVNA 6PTDA 4PL2A 1MRQA 5FI8A 4ZQOA 4GI6A 3FYOA 4UMAA 1GQNA 5EU9A 4QJ5B 3T0DA 1K77A 2O9PA 4CN4A 2IKIA 1XRSA 1I75A 2YR1A 3C61A 5C9XA 1UWAA 4V28A 2WKJA 4JICA 2EGZA 3UWYA 3M47A 3ABQA 4ZA0A 1JZ8A 3A23A 3RRAA 4M6PA 3D3FA 4L6DA 3MJYA 4QDMA 3BAYA 1NJJA 1NAL1 1GHSA 2OGJA 4XKYB 1WNOA 2Y6ZA 1YX1A 3EX3A 3H2OA 3H53A 3PWIA 4RDVA 1F6PA 2BXZA 1EJSC 4GC3A 5I5RA 4NZ1A 4NXSA 1V6XA 2I9EA 5GPRA 3KVMA 4WDTA 4Z17A 2NX9A 1J0ZA 4PCNA 3UZXA 3A24A 1HX0A 4M24A 2BGSA 1DWHM 3RUBL 3TFCA 3LPGA 4X2RA 4AWEA 3DCPA 1MYRA 1U5VA 3IJQA 3I7QA 1R2SA 4JNYA 3CQ0A 5CEWA 3EXRA 3M6DA 2J13A 4S39A 2VFHA 2D0FA 1CW2A 4UCGA 3PBYA 2NV9A 1FCUA 1VLIA 3PPHA 4KEUA 1R3YA 1V0MA 4ICMA 1H60A 3M16A 2KAUC 3EMQA 3S47A 5F2GA 4NG3A 1EDGA 5AHEA 2WC3A 4GZJA 2VENA 1YPIA 1SW7A 1LCOA 3DG3A 4U3AA 1VC4A 4XZWA 4O4VA 1PCKA 4V15A 5BOOA 1GKQA 3U7BA 4Y9NA 2YDSA 5CLWA 4L7ZA 2WC4A 3H22A 1LROA 4NP7A 5I77A 1EDQA 3EPOA 3R94A 1B3ZA 2EHHA 1YPXA 3KW3A 2ACRA 4QE1A 1A5MC 2EPMX 3ZLHA 2YDAA 3WUFA 1BG9A 2A7NA 2NT1A 1C7SA 2YW3A 1QBBA 1PKNA 3OVQA 1T8QA 1KGWA 5T9BG 4IX0A 4M51A 2WNNA 2D23A 4CNTA 2ZUWA 2PF8A 2P88A 3UR8A 2BOEX 5C54A 5I3IA 4WF7A 1MO0A 3R6IA 4XD3A 3KRZA 1RA0A 3QR0A 5F1VA 5BRQA 4M6QA 4MDOA 1Q6DA 2W27A 2RHGA 3IUIA 3S2NA 1N82A 3U4FA 3GTFA 4LVAA 4R5EA 3W83A 4DI9A 3N2TA 1VBGA 3ORWA 1QK2A 2YYTA 5DCEA 3KLKA 3GX9A 3DENA 1IWAA 2QV4A 4GQ0A 2J7GA 4U2ZA 4RNJA 3WH5A 3VIIA 1VZWA 1QNQA 1K70A 2WHMA 3CHDA 3BDKA 2P10A 5I78A 3WLSA 1WBJA 1QMLA 1LUCB 4DYJA 4KKXA 3A22A 1GVYA 1ITQA 1J18A 1V6TA 3AU6A 1IYXA 4JCLA 1ZPTA 2GYIA 1E5JA 2QJMA 4EWJA 1A3WA 1UYQA 1DJNA 1V5XA 1W5MA 5C2GA 1UUOA 2DW7A 1X7FA 1IIGA 1JXJA 3THCA 1SO5A 2GGEA 1H7RA 3LM3A 5DQPA 1NARA 1XYFA 3MQTA 3OBEA 1BYAA 3FJ6A 4NILA 3W7NA 5AY7A 3WMBA 1TZZA 3QMTA 3NQBA 2VRJA 3ANVA 2WPGA 4Y9AA 2PS2A 5FD0A 3AIVA 1WZAA 5CBJA 3D3AA 2R1PA 3G1AA 2AQOA 1YDNA 5F4WA 2ZRYA 2WSRA 5GJPA 4N42A 4IGSA 2J9ZA 3C0QA 3N9SA 4JKLA 3UW6A 1TV7A 4ZSUA 3QMSA 3BAIA 4Q7IA 2VTFA 3NPXA 3O15A 4W86A 3MI3A 1OX6A 4PRTA 1TE1A 1TREA 1EIBA 4DO7A 2P0OA 3ANUA 2ZUSA 3VYLA 2ZDRA 4JTRA 3WH9A 1DQXA 1Q6QA 2OOGA 4QFUA 1HO1A 3TYCA 4QHRA 4QLLA 2EEXA 3KFTA 3WQDA 4Y9PA 3CLMA 3SR7A 3THUA 2YL5A 3DI1A 4UTHA 5HPCA 1PBGA 2IQTA 1I2QA 3GDBA 2R1NA 3W01A 4IFOA 3ZR6A 4MDPA 3T05A 1X7IA 3B0YA 2HK1A 1EGMA 1HKMA 1Y0EA 1VENA 2JALA 1VH7A 4H7VA 4H2HA 2E25A 2QXWA 3TC7A 4X61A 1VIWA 4JTHA 4NAEA 3STCA 1G1YA 2C6QA 4URIA 2I17A 3VC6A 1JF6A 4WZHA 1R3VA 1AMYA 1AK5A 3LPFA 4UTFA 3HIJA 2WSPA 3G8RA 3W73A 1KO0A 1E1FA 1EJXC 4JX4A 5H1WA 1PV8A 1J10A 1F07A 2NUWA 4PSRA 4DUVA 1KFLA 1AW2A 2GDVA 5HWNA 3CB8A 1TG7A 1CIUA 3GU1A 1AW5A 4GIEA 4CD4A 1ISZA 4MVAA 1ZENA 4JQ2A 3W2LA 1B0IA 2G0WA 2I57A 2RKXA 3PAOA 1PIGA 2B31A 4BA0A 4LALA 4C1NB 4LS0A 4LUTB 2FDSA 5CQ1A 4DO4A 4WD0A 1V3IA 4IFKB 4UTMA 1ZJAA 5PTDA 5IFPA 3P74A 4QXIA 4FOKA 4FS9A 1W37A 4JKKA 1OX5A 5T91A 3G6MA 2ANUA 1G5AA 4GBUA 3SW6A 1HL8A 2YCKX 1ADOA 1FHDA 2W61A 2FTYA 1P0DA 2JF6A 3SJNA 1T41A 3OTRA 2BP1A 3M41A 4ZE4A 2PDPA 1W1PA 3I6TA 3VIPA 3AYSA 2WO5A 4RLIA 2YA0A 2JGQA 2DSZA 2KZHA 4PBFA 4HHLA 3T44A 1O66A 6XIMA 1XYAA 3WLIA 3ITLA 1C91A 2A3LA 3GTXA 2FFCA 3TCEA 2DVXA 1EH9A 1J2BA 2OYMA 3TAOA 1IEWA 1IT0A 1EEPA 2VD9A 2HWGA 3L7RA 1ZRQA 4ERGA 3LLDA 5D2WA 4YCOA 5B80A 1TA3B 4BQ2A 1D2KA 3TOYA 1XISA 3A64A 4NNCA 1KFCA 3LGEA 1KFJA 5EFFA 2PMQA 3JRKA 1DTNA 4PMOA 1EGZA 3W7CA 1VQTA 3GW3A 4K1GA 2VI0A 4C6QA 1XF0A 4JEQA 3AXMA 4GJJA 4PFHA 4H83A 2NQ9A 4D6JA 1DWJM 5A6LA 4AVFA 4CU7A 3JVAA 3LNMA 1DJZA 4OKDA 1KLZA 5DT5A 2Y8KA 1QJWA 1B31A 1TV2A 2OMAA 2XDFA 3ZT5A 1E6NA 2G95A 1UIOA 2Z0IA 4H19A 3NL2A 4HK6A 4DUXA 3KX6A 3N6QA 3LRKA 3P5ZA 1ITXA 4XZNX 2NQHA 2E68A 2F6KA 4OE7A 1S2VA 3LI0A 3PJXA 1X98A 2CHOA 2Q3OA 1I60A 5E0CA 1K4GA 3AICA 4W8LA 2DDXA 2PDKA 3P0WA 2PU0A 1Z44A 3B8SA 6ENLA 2A3BA 1S2UA 3K13A 1TPC1 2EKGA 4PODA 1TPFA 4WKFA 1H1NA 5HWMA 1DPMA 3GHRA 1CI1A 3M5YA 4L6OA 4IPIA 5A6KA 2XIBA 3UJ2A 1TSIA 2KX9A 4KWSA 1B9ZA 4EPDC 1UWIA 1BPLB 3CT2A 3VMNA 1PCWA 3R43A 4HHHA 1TVLA 1UR2A 4WIWA 2YBVA 1V8EA 2OTDA 4XAPA 2GVJA 4HA3A 3LB0A 5FAJA 1R8LA 1FH9A 3IIXA 2EJ1A 5K9DA 3KBMA 3PFRA 2O0TA 2A21A 4AZ7A 1KFEA 1JXKA 5FEPA 1PZ0A 4X63A 2FH6A 4AD3A 2ZX5A 4LYPA 1GZJA 1LLWA 1B57A 1WKYA 1M68A 1OFAA 3OODA 3HJEA 3DYPA 3HMJG 3TKFA 2VKZG 1CB2A 4ZEPA 3NXLA 3M6YA 1EZWA 4QCEA 1F4HA 3MCOA 1ME7A 2IPFA 4D8ZA 3NGFA 3Q2DA 1GWJA 1R0MA 4DXXA 5A69A 4LUJA 1OD0A 2ZE3A 3VUSA 3LXAA 1M03A 3ZO9A 3E02A 2QDGA 4HOZA 1VAHA 1QHPA 4ADSA 3OPSA 2WNQA 4J27A 1LORA 4H00A 1E1EA 1RD5A 1FDYA 2DIJA 4YWIA 1JCTA 1UMYA 4MJ4A 4FNSA 5CJ5A 2HVOA 4ACZA 1TTPA 4MWAB 3RPMA 1Q6LA 2GLKA 2LLEA 4LGXA 4KMQA 2PWGA 3S6OA 5CJNA 3NPWA 3KP0A 1H11A 3VTRA 5LXXA 4DXKA 1UBPC 1ZAJA 2BDQA 2F9RA 4K7VA 1FBAA 4TMBA 5C2XA 1VFUA 1UJQA 5BYWA 5EGRA 3HGSA 4O53A 2TYSA 1LP6A 1PWMA 3WD4A 3G1XA 1RBOB 5K2ZA 1I6NA 3SAZA 1UWSA 4OOZA 1UZ4A 3AROA 3IIZA 2WK2A 1KFBA 1YW1A 1XC4A 1SFJA 1VPQA 3SECA 1FQ0A 1N7KA 1CNVA 3E38A 5AZ1A 2O55A 3RLUA 4GNJA 4MB4A 1EL3A 3GIPA 2ACUA 3BQ6A 5G4EA 3NQCA 1OY0A 4US5A 1XD1A 1EP1A 5M1TA 4FB7A 5AFDA 4WSKA 3SI9A 2YXXA 1KGXA 1UJPA 4B5NA 2VP8A 4O1FA 1P0BA 4RW3A 4AIBA 3TUUA 3W00A 4E5TA 3CUGA 1A53A 2DZPA 2XIOA 4DO5A 2HPMA 3PM6A 4LCQA 4R27A 1HL2A 3EOOA 3V5CA 5DEZA 3MANA 4AY1A 1XKYA 4UR8A 4GIYA 3WQVA 2AQWA 2JBMA 3MSGA 1P7TA 4AX6A 2E67A 2GWGA 3HG3A 4GINA 3OBAA 1V3KA 2V82A 3KOXA 2PCQA 2X1UA 4QG9A 2J77A 3MI6A 4LOCA 1HJVA 3E0WA 5LA2A 4HU4A 4P8WA 5JBFA 1F6YA 3WQ8A 5AYXA 1KBIA 3H8AA 3GO2A 1XIEA 2QJNA 1KRBC 5MHBA 5GJNA 1I0DA 4LWWA 3SY8A 2C71A 1QBAA 1GVQA 3ITXA 3NEVA 3A6OA 2WV8A 4GCXA 3GXPA 2FHCA 5LHFA 4BFAA 3ZIZA 5A6JA 3SIMA 3DIPA 1OX4B 3T40A 1MEHA 1H51A 1ZBKA 4XVDA 1R86A 2CKRA 4RXGA 3GXTA 1H1YA 4F0LA 4HB7A 2AL1A 1CXFA 2HBVA 2ZZ1A 4KIRA 4ASTA 5FA5A 3U57A 4MWAC 3NQMA 1C8XA 4OV9A 5HNNA 3IJDA 5A3HA 2RJHA 1AH0A 3VX0A 2ZCGA 3WNMA 4QE4A 2V81A 1ZQ5A 2XZ9A 2RDUA 2QIWA 3DOPA 3RRXA 3GHTA 3L4ZA 4A3QA 4BI5A 4RE4A 3VX1A 3WEOA 3K8LA 4KERA 1SUXA 2VUYA 5A6TC 1FP9A 3HN3A 1J4EA 5HNRA 3WLPA 4GGBA 4HMCA 2YL8A 5HULA 4CQAA 4IIBA 4JTEA 1RPXA 4H9ZA 5A5WA 3RHGA 1E40A 4FIQA 4L64A 5J8LA 4N6EA 3R4IA 1AQ0A 1TPH1 2Z2AA 4TV6A 1JYWA 2J4GA 1Z3NA 2WNZA 1IZKA 1QI3A 4I6KA 2R82A 4PB5A 4RNFA 3C3NA 3HB9A 3TOPA 2E4TA 3FNDA 3UZZA 4XTDA 3IK2A 1NFBA 2W66A 5CZJA 4WJ8A 4RPPA 3UF9A 2PODA 4IIGA 1MZHA 1E9LA 1WDQA 2F84A 2DT1A 1UG6A 1SQ7A 1UWTA 3DEQA 3KBVA 2Y88A 4ECLA 4AFYA 2QEZA 4YJ5A 3EX4A 4PTXA 4EE9A 1ADDA 1A0DA 3JUGA 3B8VA 4KRUA 3W1PA 2PDXA 4NL1A 3SCTA 4QE5A 2OZ3A 3NQ7A 2W62A 3WO8A 2DV0A 3M5XA 3PWAA 1OC7A 2PDUA 2PA6A 1WO2A 4LY4A 3BTNA 3FA5A 1IV8A 3VGFA 1NWTA 1G69A 1KD0A 5G2HA 4RDWA 3UG5A 3IGUA 5DRIA 2C91A 2IS7A 4JNMA 4FLRA 3BCDA 3UCCA 4YNGA 1REQB 3AISA 1E6SM 3WKZA 1V3LA 3ARQA 4Q8TA 3FLUA 1VEPA 1KC7A 2ZXQA 5E0KA 3UYIA 4FF7A 1IF2A 5IBXA 3SCOA 5I24A 1TMLA 2CLMA 3CZKA 3LERA 4XIMA 4IMAA 1CBGA 3MYPA 1JDFA 3NSNA 3ZVHA 1WQ5A 3R58A 1G4SA 4G7FA 4JQ4A 4E2OA 1XS2A 1I2RA 4ROPA 1X97A 4JYFA 4UTWC 1O95A 4Q8UA 2DPEA 3GTHA 3VOCA 2R9RA 2PB1A 4WHBA 3DYOA 3WD2A 3CMGA 4RCXA 3P93A 3PK7A 4OV4A 1XR2A 3SRHA 5LKYA 2CLLA 1AUSL 3DECA 4RDYA 5I07A 1Q65A 5LA1A 1G4TA 3ARYA 5LNRA 4JIEA 4REQB 1NF7A 1TYGA 1H50A 3M5VA 1Q63A 1F7BA 3UJFA 1FTXA 5ABGA 2R8WA 3WFLA 1NDWA 2DQXA 2WHJA 3CL8A 2ZE0A 3EOEA 3M07A 3BK0A 5DRCA 4ATWA 3GBEA 1QHZA 1XX1A 3UWZA 4NX0A 1F5ZA 4DLMA 1R7AA 4WEVX 1TIMA 2CNCA 3TWBA 3D5HA 4ZOEA 2EAWA 1V0NA 3ARPA 2PD9A 1NOUA 4DJEA 4DBWA 3B8TA 3SEPA 3MUIA 4GQBA 4EXAA 3WK1A 2VX4A 2VRKA 1UD2A 2F7FA 3FJLA 4JIQA 1KLYA 2Q09A 4HQVA 5M3WA 4BI6A 5C70A 3TQVA 4JDBA 2PRHA 4ZE5A 2CZFA 5REQA 4V33A 4UBPC 2BBFA 1A4MA 3SN4A 4UFMA 3BSGA 1GEQA 3ITYA 3LCIA 4UQCA 4NUWA 2XGIA 3EOSA 3TAKA 5EA9A 1CDGA 2HISA 4NYYA 1K1DA 1MZRA 3MZNA 1ZUAX 4EP8C 2VX7A 1OCQA 2NWRA 5AHMA 1J6PA 2H3BA 3W75A 4WY0B 4JFUA 4FMVA 3NDOA 1UD4A 1CXKA 2C7FA 2HQAA 2VX5A 4ZSTA 5KETA 3CO4A 3P67A 1T0OA 1XIJA 4GD0A 4JIRA 4ZTYA 2FMNA 3ZWSA 1PO9A 4FALA 4EWND 1JCNA 1F8IA 1QDSA 1WOBA 4JTDA 3TA9A 3AZRA 3WF1A 1K7FA 4QX4A 3DGBA 3E3HA 3MTWA 1LRNA 5GQBA 3EAUA 1W3IA 3ARRA 4X60A 4ATLA 2F61A 3PUGA 2FB3A 2C14A 2FZ9A 2WOQA 3T07A 4A4AA 2Q71A 2WHKA 2P5NA 3WBEA 2O7QA 1KFWA 4GY1A 1QK0A 4TXEA 2X1IA 2VFDA 3W81A 4HJWA 1QPNA 4Y6GA 3IUHA 3MUXA 4DJFC 1DJIA 3PZIA 1GONA 1BGGA 1QAPA 1GVSA 1G0CA 4FI4A 4S3GA 2OEKA 3UJRA 2QJJA 1EXPA 1MUCA 4AVNA 3H2CA 3MSDA 3PBMA 3QJAA 4Q4KA 2CKSA 3ITGA 4IIEA 1IQ8A 1Q6GA 1B3VA 3HPSA 3B9EA 3NQ6A 1P1MA 1US3A 3CH9A 1IT7A 3LG3A 3TTQA 3E2SA 3EWCA 4TMCA 2HNHA 1QWGA 1EDTA 3FA3A 3PSVA 2OODA 1R38A 1FWSA 3QGKC 2Z1VA 3LXCA 5BOFA 4U5IA 1VFOA 3O8AA 1HKVA 3RX3A 3QQ0A 5K4XA 2ONEA 3XISA 3MSYA 1E51A 3C56A 3WDIA 1UKOA 2TRSA 3PPCA 3KRUA 4BQ4A 4OWGA 1MQRA 2CLFA 4F0MA 3MVIA 4HJFA 3BG9A 3MA8A 1G6CA 4ZENA 3A12A 5K9XA 2J66A 4B5SA 5CSSA 2PAJA 2QJIA 3TMLA 3ONBA 3IGSA 2BY2A 1YEYA 1MXGA 3RO6A 4DWSA 1PB0A 1XXXA 3VD4A 4RXFA 2PZ0A 4EOUA 2J24A 4ZGYA 1DXIA 3KCLA 1AH4A 2WJDA 4GH1A 3UT0A 1NFGA 2CZVA 1QU4A 2QYGA 3OLDA 1YKWA 1RY8A 4GZ7A 4K8GA 4IMGA 4LYQA 2G3NA 3GNPA 1TQJA 1I4NA 4XBKA 4KEZA 2REQB 1DORA 3VGDA 3ATYA 3IVTA 1CGXA 4O0KA 4N0RA 3LCGA 4Y7EA 1FWDC 8XIMA 3W28A 3QGAC 1QCWA 4GUHA 5LGZA 2C15A 3UZYA 4F3HA 1Q2RA 3INPA 3G1VA 4QG8A 2Z29A 2XYLA 1GKRA 4JFVA 3UVIA 2Z4GA 3USBA 3ZOAA 2D2GA 3F1QA 2PTDA 3K4AA 1FKWA 2EPHA 2PUZA 3APYA 1J0YA 1HP5A 3BMVA 4N9CA 2F6UA 4L9XA 4W7WA 4P61A 4IQLA 4XUYA 3P3BA 4G8TA 1H0GA 4AX7A 3RCMA 3SUVA 1NOFA 4W8AA 3RN6A 1SMDA 3WQEA 4XD5A 3UU0A 4Q4SA 2X1RA 1XCFA 1J9YA 3DG6A 2X7WA 1TVPA 3QV8A 2PDWA 3H2FA 1JZ3A 3HV8A 4FK9A 3MUAA 1FRBA 3WH8A 3KAOA 4D6IA 2JIEA 1EP3A 2D3NA 3S1VA 3PZOA 4NU7A 1LL6A 1Q6EA 4HA4A 4FNPA 4N9EA 4IQEA 5BW6A 4YVVA 4O1CA 3W7HA 1QI2A 4WRHA 3VD5A 1AQFA 1C93A 3LLFA 4POCA 4AY8A 3GKFA 4V2XA 4BZYA 3SM0A 4ML4A 4OHQA 1JD7A 3WNKA 5FL0A 4MNJA 3WLLA 5CZTA 3OG2A 4TV5A 5EL1A 5LIYX 3V0TA 3EWYA 1HL9A 3LV5A 4UZUA 3RMEA 3T81A 3QBUA 5EBAA 3KTCA 3NFUA 4R9XA 2VZVA 2C79A 2VDGA 4H8HA 3GC2A 3HJZA 4YTQA 3M9YA 2DVUA 4I9AA 4KEVA 3TZNA 3R12A 4M8UA 2CBVA 2OU4A 9RUBA 4HNNA 2WVVB 2GVYA 1OG6A 3VIGA 2YJQA 3URBA 1B90A 2D3LA 1W56A 3TW6A 2Z28A 3ZZ1A 3N2MA 4GYPA 1FWTA 1QI5A 4QDPA 1KB3A 5LNVA 3AMDA 3S4TA 2DT0A 1SJAA 2HEJA 2OR2A 3AXHA 2OSWA 2X0SA 4B2DD 1KFKA 3AUJA 3SRDA 4J4KA 1WX0A 5C9UA 5D02A 1BKSA 1ZS2A 4HYWA 4X0NA 5I02A 1TVNA 4ZQNA 2V0TA 4GKTA 3DERA 3BURA 3KUMA 5I3HA 1J96A 4DZAA 3LBMA 3R89A 4AMAA 3R10A 4A22A 3LX9A 4GVGA 4M7SA 4DBDA 8TIMA 4FXJA 4JTQA 1QT1A 2GGIA 4D71A 1RP9A 4BCEA 2YFNA 4AHQA 1HGYA 4PCSA 2XM1A 1Z89A 3A4XA 3VOJA 3SJ3A 2R14A 3W1LA 3DFYA 4O19A 3LPOA 3TJXA 4RDZA 2OQLA 1XIFA 3C5QA 2B7OA 3URQA 2BVDA 2PWFA 4JDYA 3MI2A 3RGTA 4XAYA 4K37A 3PUDA 1ME8A 3VKBA 5CPQA 2ODOA 4EX4A 1JPKA 3Q58A 1JVNA 2X30A 3ABRA 4KCVA 4CN6A 4AIEA 1FX6A 3ABOA 5DN1A 4LC8A 3WL0A 4NZ5A 1TTJA 1XSKA 4H1ZA 3GAYA 1GZ1A 2ZZ2A 3RG6A 3BOXA 1I1XA 2OQYA 1FWNA 1UH3A 3AS3A 3ME3A 2OPJA 4FO4A 3SRKA 3WK2A 1SFTA 5D2TA 4MYXA 3D46A 3I3BA 4UB9A 3CV1A 4ILSA 2AMXA 3WQCA 3EDKA 2PPGA 3EPMA 3VNMA 3CTTA 1L0PA 4ONVA 4HMEA 1OQFA 2G4FA 2CZ5A 4HN8A 2YCLA 3L65A 4AZGA 4UNIA 3GDLA 3SDOA 2DIEA 2OSXA 4AYSA 3GXNA 3L4TA 4G1KA 3UGVA 3VA8A 2VR2A 4KRZA 1WUEA 4YTTA 3SUWA 3C3UA 4AZIA 3LTYA 4UUIA 1TWIA 3E5BA 1KXVA 1OIMA 2E9MA 2J9YA 3CPGA 3EXTA 1ZLPA 2DSVA 2YL9A 4Q22A 3ITCA 1UKQA 4GVIA 4O18A 4LVGA 2JEQA 3O2LA 4RJEA 1YXDA 3OP2A 1JYXA 1ZZMA 3HG5A 2QUNA 2W92A 1XLAA 1ICSA 3IPWA 1LQAA 2ZBTA 3P7YA 3GRIA 1IXOA 3ELFA 4GXMA 4HP5A 1EFZA 2Q01A 1IEQA 2IXUA 3E9AA 3H2EA 4KH2A 3NDYA 4IP5A 2PP0A 3UWVA 3OHMB 3PZQA 1PHQA 2PDGA 5EMUA 5LNUA 3RU8X 2NUXA 1RQHA 4L4PA 2DGAA 3E74A 2PTWA 3FVMA 3EOUA 3W22A 4NNAA 4F0KA 1JDEA 4A6GA 5CC5A 2ISSA 3RO8A 3PUEA 1JGIA 1YHTA 3BAJA 1J0KA 3WJYA 4IG2A 2VZTA 1D8WA 1SM9A 4CEUC 2XN2A 2PBGA 3W0KA 1OZMA 4MYAA 4R7JA 1UZDA 4I5XA 3F4WA 3AIEA 3HU7A 3ZJ7A 1O12A 1OGBA 5EMLA 5E6YA 3WD1A 1WYIA 2YCEA 2QCDB 5G4HC 2OJPA 1TJ2A 4HN4A 5U4NA 3VFCA 2VC5A 4PUNA 1FDJA 3T0AA 3TMQA 3DUGA 2ZX7A 2BXYA 3ZR4A 2W9MA 4AD4A 3R25A 1XYBA 1P1XA 4XIAA 4NHVA 3LTPA 1T5AA 5D8ZA 3OA5A 4HMDA 2FZMA 5E9AA 2YZRA 2TODA 3NO3A 1XJBA 3B05A 4GGHA 5HAOA 5MF5A 5I7GA 2ICSA 2Z1SA 3P14A 6REQA 3URNA 4YHEA 5C6MA 3OQEA 4QNWA 2J7HA 5HJXA 3PBGA 1MDRA 3W7LA 1W0MA 3UY7A 2WKGA 3MU7A 3KVJA 2BXVA 2SFPA 3E49A 6CGTA 1LQ0A 2WSKA 3UY8A 4E3VA 1UZHA 4N2YA 2R94A 4MFEA 1XINA 1E9ZB 3H21A 1U5HA 4JIHA 2DT3A 3E0LA 4LUSA 5I2UA 1XBZA 2WWDA 1JAEA 1LM1A 3MVTA 3MKCA 3OW1A 2PGRA 3THAA 2CEQA 3BMXA 4ROQA 3FJNA 2QQ6A 4JHMA 3UD6A 1OFDA 2PWDA 3BMWA 4DBUA 3PSWA 1NSJA 4C6IA 3EDEA 4YL2A 3LXBA 4JPGA 2O92A 2O4MA 2PWEA 2ZVRA 3LY0A 1MNZA 3AALA 4XQ6A 2BY1A 4PBGA 2YCIX 2WJZA 2VJXA 3VINA 3FXYA 1Q6CA 3UFYA 1KKOA 5C2CA 4DZ5A 1WDWA 3L0KA 1R6WA 1IWBA 5JVLA 3MUY1 4HZ8A 1ICQA 7ENLA 4MZ1A 1RSCA 5BXPA 1QNOA 4PRWA 1E0WA 1UR8A 4OT7A 5J5DA 1ZTVA 3N18A 3O07A 4IJCA 3UQNA 4WUIA 2XN0A 3BAKA 1TX2A 1E73M 4EVZA 4CQDA 3QW4B 4YTSA 1XFCA 1OFOA 3G1SA 5HJLA 1ZP3A 2CLEA 4MOZA 1TV8A 5DY3A 3OVGA 5KMYA 3DHDA 2QT3A 4WXYA 5KTLA 1JZ7A 3O9NA 2OYKA 1H4PA 4WOQA 1V6WA 3C0LA 4GI8A 2OX1A 3GIYA 2HVMA 1OB0A 1QXLA 4MB1A 5JXQA 2B81A 3JZUA 3SZ8A 1H61A 2Q3RA 4B4FA 1M7JA 1W5OA 1SMAA 1NM9A 3VK5A 3SCRA 4TOQA 2BOFX 2INEA 1DP0A 5A6BA 3THQA 4GK8A 1SZGA 4AQLA 2GWNA 3WJWA 4ZOCA 3CWHA 2WXDM 5DXXA 3H4GA 5JBEA 3FHAA 2Y8UA 4QJ3B 1FUYA 2O7SA 4JN6A 4EK7A 3OU8A 3F2BA 1M5WA 4FXFA 2WZHA 5CJMA 1HN1A 4XZHA 3EB3A 5I3FA 3U9IA 3WDQA 1JDCA 4Q32A 2J47A 4PEEA 4JTJA 3CQHA 5AKQA 2JK2A 4AZCA 4XKYA 4JD4A 4NAFA 2DUXA 3S0CA 2VOMA 4MB3A 3B4UA 1EC8A 2QHAA 2PE4A 4MWAD 4ZO9A 1ENUA 3FDKA 1U33A 4JXCA 4B5VA 3ISIX 4X9SA 2BV9A 1MQQA 2QMKA 3G1DA 3V4BA 3M4HA 3HMCA 4NT0A 4C6BA 1OFRA 3MYOA 3LI1A 5KINA 2E3ZA 4MIMA 3TYAA 2XVLA 3GDKA 4M6UA 4W4QA 4YU1A 3BAWA 5AVHA 2C13A 3WFZA 2WANA 4Y2WA 4GYJA 4U31A 3WLJA 4EIVA 1VJSA 4J3WA 4WQ6A 4MF4A 2EPOA 1QNRA 3GC4A 1GZGA 3AWNA 3G2GA 3M0JA 1SVDA 4UTTC 5IOBA 1LG2A 2YXGA 4ALDA 2OEMA 1OHLA 1XV8A 1IZCA 2XPKA 2C18A 4IFRA 1WCGA 5DFAA 2E0PA 2QUVA 2B4GA 2QPXA 1JUEA 1VBJA 3BW3A 3BGGA 2IKJA 3T4WA 4ZBCA 4QROA 3WJXA 3POCA 3QY7A 1VYRA 2G3FA 3C2RA 4ZQPA 3QR1A 1LQ2A 3CQJA 3H6OA 3MZ2A 3P81A 2WMKA 4I6VA 3VOGA 2J62A 3VABA 4AEFA 4QQUA 1QNSA 3GW0A 1OG0A 4FP1A 4H9MA 3WLHA 3WF4A 1AD4A 1YBQA 1B3WA 1ZAIA 4KCTA 3NURA 1H49A 3HQPA 1ZB5A 3B3DA 3TR9A 3PZTA 3O05A 3NUKA 2FGZA 3WMLA 2V6AA 4IMFA 2OCZA 3T78A 1KKRA 2D20A 3PAJA 3O7UA 4S3JA 1AW1A 1WBHA 1RD6A 3IRSA 3L12A 2L5HA 3CIWA 1RR2A 4HYVA 4UNKA 1Z8AA 2HSAA 2VFEA 4HCLA 4FOJA 5DCBA 2IPJA 2E5DA 3PZUA 2PEVA 3L5LA 4ZOBA 3CUHA 3F5LA 3F5JA 2OLHA 4IGMA 1W31A 4ORMA 2CIPA 2V2HA 4Q3MA 5HR7A 1YNQA 4UXDA 2W67A 3CLWA 1W1YA 3DYMA 3MB9A 1H3GA 4AWSA 4BEQA 4Z2JA 3BW4A 5EMMA 4Z1YA 2WJFA 4ERAA 4PFMA 4BI7A 4W5UA 2A2IA 3SCWA 2FPYA 1LUCA 3WNPA 1B5TA 4JFSA 4JAWA 4U10A 4H7ZA 4HHMA 1XGDA 1XLLA 3NIYA 3KL0A 1T99A 1M04A 1UR0A 4PTDA 2HBXA 3VO0A 4Z08A 1CLKA 5CLTA 4GNVA 4GQGA 2OYLA 2WC7A 4ICCX 3FN9A 1ISXA 3O6YX 4TU1A 1UD6A 2VFFA 1F61A 3APGA 3C2FA 1V08A 1OFEA 3PBUA 1Q85A 1FWHC 1RLDA 3O6CA 1YDVA 1O1HA 3O0FA 1GW9A 3W37A 1N2VA 3QVQA 2OX4A 1Z7AA 2BGNE 1QTWA 4MM1A 3WK3A 3W7PA 1YQ2A 3QR3A 5C55A 3HO8A 3FFSA 3C8FA 3DAQA 3R8GA 3T6CA 3ITOA 1SW0A 3GH4A 2W3ZA 3B8DA 1UQYA 3LS9A 3MKKA 3KDNA 5FEXA 3ZLFA 3OHIA 1J8VA 3E1F1 4LAUA 5TBOA 1LT7A 3CV6A 3H4WA 3GVQA 4TR9A 3FK4A 2WZIA 3BLFA 4IZGA 3V75A 3VOFA 4DPQA 2NX1A 1MW3A 4L6HA 3U2EA 3KOFA 1QRQA 5BXSA 2ZADA 4LAOA 2V2CA 5JMUA 4JFTA 3ZLGA 5DLCA 1JI1A 3CWOX 3SQLA 3GZAA 2YA1A 4ZZ9A 1EX1A 1Y5WA 2GVEA 5M5DA 5E1QA 1C9DA 2QAPA 2HTMA 3CZJA 1RALA 4HA0A 3HFYA 1J0JA 3TA6A 1UR3M 2DEPA 3T4CA 4DJDA 1LT8A 1OCJA 2C3ZA 4EKJA 2OWXA 1I2PA 1KM4A 3BJFA 3C0SA 3REQB 1UOZA 4L9ZA 3WLNA 1Z32X 2XZ7A 4RZ5A 1EQCA 3AAMA 4CNOA 4HSHA 3S9ZA 5JH1A 2G3IA 1TCMA 7XIMA 4JYDA 3MT1A 4XD6A 1QFEA 3RX4A 4F0RA 2P53A 4JQ1A 3RFAA 3EBVA 4OGZA 3C52A 1ONRA 1OYCA 2VUNA 4D6HA 1R5YA 3BV7A 4PUJA 5FJUA 4Z1CA 2V30A 1MVYA 3PBWA 3NQGA 3LV6A 4QEEA 4UQAA 3DKLA 2ZWZA 4C1NA 4OIFA 4UFIA 4GVFA 5A8PA 4LUTA 3PB2A 3QSTA 1KWGA 1HJXA 4QAIA 3B8UA 4DJFD 1TV3A 2EPKX 4I8YA 3SN1A 3U6WA 1BWLA 3C86A 1EHAA 1E0UA 3B9AA 3GHSA 5DBUA 3ICJA 4JTTA 5J5RA 4CLMA 4KQNA 3AZTA 2X2GA 4P7LA 3ONCA 1JZ5A 4RX0A 5HOSA 1R7OA 2MANA 1SO4A 3NZRA 1XPGA 1C3FA 1IE7C 3SUTA 1LG1A 1AG1O 1WXJA 3VDGA 3VKJA 4DAFA 4I9MA 1XDLA 4WXZA 1E6ZA 1V6VA 5KZMA 1E4LA 5FEZA 1ZCCA 4YYCA 2YIHA 4CD5A 2QULA 1F76A 4XG1A 1RQEA 2NV2A 3V1HA 1DJXA 2TAAA 4I3GA 3GAKA 4XVEA 3URAA 1BVZA 3IIPA 4S23A 1NU5A 1XLCA 1TRDA 1TA3A 3ITVA 2W6RA 3ZMRA 4LVDA 3V16A 3HPZA 3MWAA 4IPPA 4G7EA 2D24A 3UPWA 3VNJA 3EX6A 2PBOA 3QHNA 3MW7A 3W2KA 1XUUA 2C1IA 3B0UX 2VQUA 4Q7BA 3AHVA 3A3HA 3SY1A 2HXUA 1EUAA 1FDZA 3VI2A 3ES8A 3B0XA 5HNUA 2WSQA 1PIFA 4MNMA 3VD3A 1GOOA 3E96A 1ISWA 2PFHA 3R7MA 4F9JA 3T8LA 2ZUTA 3T8QA 4ADUA 1JPIA 2Y7FA 1XLEA 3GS6A 5T9CE 1XC6A 1E3ZA 3GFXA 4B3KA 4LB3A 2OWWA 4C6JA 1US0A 3AUOA 2BNJA 2QUUA 3BLPX 2ZRUA 2V5JA 4PBEA 1S5TA 4GPNA 4BR1A 5JH2A 3KXQA 2DZBA 5FF2A 4C6LA 3N3TA 1NELA 1A5UA 5TIMA 1WDPA 2ESCA 4JX5A 1TX0A 3CAQA 4GH3A 4WJEA 1UWQA 2IMRA 4DIAA 4IT1A 3B9OA 4C6MA 3FIGA 3B4YA 2CWNA 1JCLA 2ZXDA 2DW6A 2CBJA 1W17A 4NJGA 5DO8A 5A8MA 4YVXA 4Q4MA 4YXGA 1HKWA 1YE6A 1UIPA 3M44A 3AWOA 2I56A 1MW2A 1XYMA 1M7XA 5GVJA 2BZNA 4NSBA 4BEUA 2FKPA 5G2WA 4AIOA 3KP1A 4O1BA 1K03A 4UOZA 2DT2A 1AH3A 2Z1WA 3STEA 2JEPA 3NEHA 4A29A 3UNDA 4H6QA 4GBDA 1DE6A 2R24A 1B3OA 4K8HA 3BG5A 3HPFA 1EJVC 3QY8A 4JIIX 5FACA 2P8BA 3AYTA 4N6FA 3CIVA 2J8FA 1K9TA 4O1EA 4AZBA 4D8AA 7A3HA 2GSJA 2Z6JA 3OZMA 3CPRA 1BLIA 3H54A 1A5LC 3W86A 1OINA 5FJIA 2Q8ZA 2V3GA 4MNKA 3NNTA 1FP8A 2F2HA 3OGRA 2G5WA 2PF0A 2BMBA 2WBKA 1N55A 2PTYA 1U22A 4O16A 2V9DA 3QN3A 5LXEA 4L4MA 4LBUA 1ISYA 1BWVA 3ERPA 2YZ5A 3EWDA 3UXIA 3DU0A 4S3FA 1JRCA 2G41A 4OOUA 3GXFA 3TNBA 2QR6A 2I7GA 3STFA 1FCQA 2XWDA 4FNUA 3SGGA 3P82A 1XM3A 4MWAA 4S3AA 4LF2A 5HUOA 1Q2SA 4Z2LA 1A0CA 1JD9A 2ZRWA 2Z25A 1A5NC 4GZEA 4S1FA 2E28A 3GG7A 2BGQA 1A49A 3VKDA 1Y65A 4MY8A 4HBKA 1MEIA 4F2UA 4QISA 3HPAA 1PZ2A 2XH7A 5DF0A 2DIKA 3DKJA 2FHBA 2J79A 3UG3A 2E9LA 4WX2A 2VDHA 3VIMA 2P0IA 3B8WA 2B7QA 1KV5A 3W07A 3WDJA 1E6PA 3A3XA 3UGRA 3LHVA 3PTMA 3N34A 4G56A 3R13A 4ATDA 1KXTA 2NSXA 4DN1A 1P7TB 3BH4A 2P3EA 3QLLA 4PUDA 1MFVA 1F4AA 2J75A 2IUZA 3LK6A 2A3AA 4DBSA 3W25A 1W1TA 5IXEA 4K38A 2E5CA 3H55A 1KRCC 3LUTA 4S3BA 4IMDA 4HPGA 3WLKX 5AZ0A 3RAOA 4BWLC 1BHGA 3M0ZA 5FAGA 3OLGA 2WAGA 3SCQA 4ORIA 1ZCOA 2JE8A 4CVUA 1UASA 5GJMA 1MW0A 2EPLX 2XUCA 5HA7A 3A9IA 3V0UA 2QCFA 2G37A 4GJ1A 4S38A 1KRAC 4B4HA 3BGJA 4Q8PA 3UA4A 3UR7A 4L65A 5LYRA 1RBAA 3O0KA 3W27A 3WYZA 3IIOA 3VPLA 1L2UA 4AD2A 1ALDA 3QLDA 2QDEA 3I4KA 4FX7A 1SJDA 1YRRA 4LCSA 2GJRA 4GUJA 2XH2A 3JZEA 3KRSA 3TYUA 1KCXA 1X8CA 2VEIA 1CX9A 4MZYA 4WJXA 1HJQA 1XPYA 1W3JA 4JYEA 1W9UA 1UR4A 3OYXA 1IGSA 5L6UA 3MP3A 3NYDA 3TVAA 3VIKA 1GUVA 3BJTA 3UWEA 3PZVA 1TJ1A 4C6FA 7TAAA 1WDSA 1EF3A 2E1DA 3KS6A 1XLJA 2G4JA 1TR1A 3ZJKA 2XVGA 6TIMA 1G9HA 3PG8A 3N15A 1L8NA 3IVSA 3UZ5A 5E9XA 4OFCA 3KHDA 1VR6A 4AXNA 4UQEA 4XISA 2I9UA 3AS1A 4FXRA 1EP2A 3NM3A 4A8RA 4J9JA 4UTWA 5DMNA 1OZQA 2DZAA 2XIJA 3KTXA 1AA1B 3W1TA 2OVLA 4C90A 3G1FA 3WF3A 3WJSA 2WLZA 3TQPA 1AJ0A 3KOWA 3QYQA 5DY2A 3WLQA 3LHUA 4AYGA 4JCMA 3P61A 5HMEA 1H2JA 3G0SA 1FA2A 4MJ2A 1OD8A 1EBGA 4ZCWA 2V5KA 4QSHA 1RJQA 4IIFA 1E3XA 2XIMA 1P4CA 1WXYA 3N1AA 1F74A 3RLVA 4LYKA 2ZX8A 3KOYA 3GSMA 1BVNP 1JZ6A 2PWHA 2WMHA 1M53A 1OF8A 3WH6A