4K7YA

Oye1-w116t
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLTVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 151
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k7yA00
4UTTA 4MJMA 2QUVA 2ZRZA 4KWWA 3LRMA 1EX5A 1BKSA 3EB2A 4FXRA 5DN1A 3TUUA 3S5NA 3W71A 3PUEA 3I6RA 1PE1A 1T96A 4IWWA 3NM1A 3BGJA 3RLUA 3CHVA 3V1PA 4KKXA 5K4ZA 4HHPA 4U4MA 3UWWA 5D2TA 3W1LA 3NQCA 1OVDA 5CSRA 3T55A 4FHAA 3SGUA 5K9CA 1DBTA 2CW6A 2CLKA 3OBKA 4AAJA 4QNWA 1EA0A 1WXJA 4IX0A 5HJLA 5AOUA 3B0UX 1FWTA 1K7XA 3A5FA 5AC6A 2YSWA 3KX6A 2Y61A 3UNDA 3W7DA 4FNTA 4BF9A 1V7YA 1OX5A 3HGOA 3NDOA 4RZ6A 1TIMA 1WDWA 3W1MA 2B4GA 3S42A 3TMLA 2VELA 4RJEA 2CU0A 4QQ3A 4MYXA 3DBPA 4AH7A 1TTPA 2H90A 5BMXA 1WBJA 2G5WA 3IVUA 2X16A 2NV2A 3GB6A 3QFEA 2YXGA 4M19A 3NO5A 1H51A 1PHWA 5I3GA 4O53A 1KV5A 3QF0A 1WOAA 1CI1A 3MJYA 3BGGA 1DKWA 4FB7A 1AW2A 1VH7A 3BV4A 1UASA 3QH2A 1ME7A 1G7VA 4NUWA 3MP5A 1ZY9A 3YPIA 3OVRA 5A5WA 2CLOA 2YW3A 1THFD 3QM3A 3RFAA 1RPXA 2B7OA 3EX6A 4X22A 4O4WA 4M6QA 1GTEA 5K9XA 5LGZA 4IMCA 4MZYA 2JKPA 3G1AA 1DQXA 4CQ8A 1XL9A 1LBMA 1WA3A 2ISWA 3TC6A 4R7JA 3G3DA 3EWBX 5HR6A 4WOZA 2WNQA 4UNLA 3TH6A 3E02A 1N55A 2EGZA 2H3BA 2A7RA 2DZPA 2QR6A 1ONRA 3HGJA 3M5VA 3VE9A 1WBHA 4IXXA 1SU5A 1W5QA 3IGXA 4Y8FA 1P1XA 4LVDA 5DLCA 5U7SA 2J24A 4CQAA 3MI6A 4POCA 4KFNA 4LOCA 2PRMA 3W1QA 4O50A 2O7QA 2NUWA 4UFKA 3WK3A 1DOSA 2VEKA 5D33A 1VQTA 2FLIA 1ZFJA 1EB3A 3NPWA 2J9ZA 1NSJA 3EWUA 1OFEA 1I8JA 4GUGA 2ZA3A 1ZENA 3PBYA 1T0OA 3QPYA 4UTWA 4OV4A 2V9DA 5AFDA 2FJKA 1SO3A 2ATSA 2QJGA 1GYNA 3GVGA 2X1SA 3O15A 5AYXA 1JQVA 1N8FA 3EX2A 4H6KA 1FWNA 1O5KA 3NQ2A 1GZGA 1DV7A 4NXKA 4O57A 3LHVA 3MWAA 1KM3A 1YPIA 5DCDA 3DI0A 3QEZA 1EP1A 3L5AA 4O14A 1VCGA 2TPSA 3KXQA 2CZEA 2R14A 1YXDA 3W2LA 1PS9A 1P0NA 4Z1DA 2R8WA 1GPWA 3W75A 2V5BA 1KFEA 2RKXA 3B03A 3LCFA 2OMAA 4BI7A 1LROA 5F2MA 2ZA1A 1A50A 2Y6ZA 3QSTA 3NNTA 2FFCA 2WQPA 2FB3A 3BG3A 1LOLA 3C61A 3N9RA 3FYPA 4FXSA 2ISVA 1IXOA 3STFA 5IBXC 1OFAA 1UUMA 2FPTA 2EPHA 5HWMA 2ATMA 4IMFA 5ABTA 3KRZA 4FO4A 4GUFA 4IOTA 3G0SA 4JTIA 3KVJA 3L68A 4QAIA 3NQMA 3HO8A 3Q37A 3BG5A 4FNSA 2TSYA 4K36A 2ALDA 3CIWA 3O16A 3KFTA 2NX1A 2ZZ4A 3TX9A 3GK0A 4JTLA 3W70A 1TPVA 1BWKA 1VGAA 3NL3A 1W37A 4WY0F 2V8ZA 3UXAA 4FEZA 4Z1CA 4FX8A 3W7HA 3G3MA 1VS1A 2OT1A 4EVZA 4ZQPA 2Z6IA 4FNRA 1NAL1 1TCDA 3GDRA 4M5PA 4PA8A 3WK0A 2X1RA 3LXCA 1YLVA 3R2GA 3SSJA 4O1CA 1I4NA 1TV7A 5LZLA 4JD4A 4Y9AA 1S3HA 4BWLC 3DKJA 3P67A 4K6AA 3DKLA 4UCGA 7TIMA 4UR7A 3B05A 2CWNA 5EY5A 2YYTA 1H7NA 4A21A 1A5SA 5LGXA 4M7SA 1S5VA 1K7FA 3GYEA 4FX7A 1GVOA 2VC6A 3S5OA 3LCXA 1GVSA 1B4KA 1OK4A 4NJKA 4NZJA 1W0MA 3U2OA 2CZFA 4AHPA 3C52A 4JTTA 3MYPA 4HNNA 5DY3A 1W5MA 4XQ6A 1FQ0A 5J5DA 1OFQA 5HNRA 3TFCA 4IUOA 3CTLA 4NNAA 4KWVA 3DH7A 1MZHA 4KFPA 3QQ0A 4CNPA 3FA5A 2VFIA 5DXYA 3LHTA 1LM1A 1G67A 5AYYA 3G8EA 3QC3A 3C8FA 5DBTA 4UIOA 2OCZA 3FLUA 2E6FA 4MZ8A 3DAQA 3L0GA 3EKLA 3O05A 2QAPA 3VCRA 1EWDA 1SW7A 3OVPA 3E9AA 1X7FA 1QO5A 3CWOX 1YDOA 2QUUA 1LCOA 1DJQA 1VCFA 3SIZA 3GXPA 2NWSA 3EWXA 2QEZA 4K8EA 1ADOA 3W76A 2Y85A 1SZEA 4UR8A 1JCXA 5KMYA 1TJPA 1TMHA 4A2RA 1LRNA 2A6LA 1FWWA 1IIHA 1SR9A 3M44A 3ABOA 4LS2A 4RKAA 4IJBA 1RQEA 2QCFA 1EWEA 1GTHA 1O60A 3SJ3A 1KBJA 3W83A 1YTDA 2BTMA 1Z41A 5FEZA 2H6RA 1QO2A 4NNBA 5FEWA 2GPTA 2DZVA 1OYBA 3MP4A 2ABAA 3O1NA 3LV6A 2A1YA 3T7VA 3IV3A 4WJEA 4TX9A 1LLWA 3W2NA 1JRBA 3W7QA 1UB3A 5MHBA 1HG3A 1F05A 4HKPA 3HMJG 3UWZA 1TYGA 2Y7GA 3LX9A 4MY8A 1B4EA 1B3OA 1F76A 3W23A 5FF3A 4NZFA 1G4PA 3IEBA 2EF9A 4ADSA 4XWUA 3SY5A 3FOKA 3TSMA 1VYSX 4GRSA 3RF9A 1ICSA 3H53A 3NZRA 1VCVA 1AMKA 1RQBA 5E93A 4UTMA 2BX7A 3SZ8A 1TTQA 2DORA 2C14A 2EAWA 2AGKA 3Q58A 5AN7A 4R53A 3EKZA 3LGEA 4C1KA 4JYDA 3LHZA 6TIMA 3C56A 5GVJA 1W54A 5FF7A 4PCFA 2I9EA 3LM7A 3G1DA 1XDMA 3GXNA 5AHEA 5D32A 5G1TA 3W7LA 1IXQA 5HUOA 1I2QA 2RH9A 4GE8A 4CLMA 1UBSA 3S1UA 3UWVA 1GVRA 3G24A 1H7WA 2YPIA 4PL1A 3LXAA 3P84A 3TQ0A 3GDKA 3ATZA 3RMJA 1P5BA 4TO8A 1LTDA 3B0VC 2C1HA 5D2XA 4UTKA 3FFSA 3I65A 4O54A 2DZTA 1P0KA 4O16A 4AF0B 3NQ6A 5D38A 1LZOA 5F4SA 1PCKA 3PBWA 1EPXA 3S5YA 3F1QA 2DP3A 2WNZA 2G97A 3CLMA 2Z6JA 1G6CA 3MW7A 4YWIA 4GUHA 4W9TA 4H3DA 4BK9A 4E2BA 4LV4A 2E1DA 5CKSA 3P81A 4DO6A 1G4SA 4LV9A 4DF2A 2Q3RA 1TTJA 1JR1A 4I9AA 1U5JA 4HPJA 4ZQRA 3SW6A 1TRDA 1YDNA 4ZQCA 1HUVA 3HOJA 3M5ZA 1GOXA 3P74A 4JTGA 4S2BA 5BOOA 2ZZ7A 4X9SA 2WOQA 2JK2A 3ATYA 1TREA 3W2JA 1HO4A 3NEVA 1H63A 3TNOA 2GJNA 2XN1A 3GNDA 3PSVA 1W3IA 2ZZ6A 3W7EA 1F7BA 3P8JA 3R5EA 1M7PA 4AB4A 5D2VA 3M5XA 5BRBA 1QDSA 1RZMA 4AMAA 5F4XA 4Y6GA 3ZFHA 4JR5A 3DENA 3MHUA 4OHQA 3DHFA 2V30A 4FNQA 4O1DA 3I7QA 1WYIA 1QR7A 3M0ZA 5DCBA 2B7PA 1JRCA 1K8YA 4AXKA 5AHIA 3CM4A 3PB2A 3TE9A 1OG0A 4NXSA 4NX0A 2VOMA 4O0ZA 4AHOA 1GG0A 1PV8A 3B06A 3QJAA 3N2MA 5AYZA 1OHLA 1FY6A 5LNSA 3O06A 4HNTA 4WUIA 1OFBA 1YPFA 4EOUA 3W7PA 4AWUA 2PURA 5I3JA 3PBUA 3TW6A 4UFIA 1I2RA 3EX1A 2ZZ2A 4NJGA 1YYAA 5G2IA 4XTDA 1XBVA 3L0KA 4GXMA 4UFHA 2J88A 3IRDA 1I2NA 3TFXA 4DPQA 1OFOA 1C8VA 5FEXA 4M7TA 2GJLA 1OYAA 4WZHA 1JCMP 2E5BA 1ME9A 5KZMA 1YDVA 4FNPA 3DZ1A 1DJNA 1GVFA 1UUOA 2YX0A 1YADA 3S1XA 4UTHA 1GEQA 2NXHA 4OBTA 2Q8LA 1FXQA 1FCVA 3ABQA 4MJZA 1KTNA 3WJXA 2QKFA 2YR1A 2NUYA 4WD0A 4S2CA 4A2SA 4JTKA 2QDGA 4ZL1A 3STEA 1L9WA 3M7WA 4ALDA 2ZTKA 2V2HA 5DBUA 1LYXA 1KM2A 1BEUA 2X2GA 2UV8G 4FNUA 4N9BA 5T26A 2YDAA 3W85A 4WY0B 3UPBA 4ZQMA 1J5TA 3PG9A 2X30A 3GLCA 3G1XA 2NZLA 3NZ1A 3S9YA 4AF0A 4LS0A 2QCLA 3F4WA 5D03A 1SZGA 2A5HA 4IGHA 5LNVA 3M16A 1UCWA 1VLIA 2VFHA 4RZ4A 4YLWA 3THAA 4AWSA 5AHLA 3M47A 2OX1A 5FF4A 2ZBTA 3LLDA 3LDVA 4X2RA 3BO9A 1W8SA 3PY2A 1DL3A 3EWZA 1QNVA 2X1UA 4PL2A 1L6YA 1Q6LA 2WO5A 4RXFA 3HPXA 1FX6A 4A22A 3W7IA 3P8IA 3BARA 3DGRA 4PC8A 5LNWA 3IIXA 4HNVA 1S5WA 1KFJA 2YCEA 2CLLA 3SFKA 1TPH1 4PODA 4ZQOA 1A5CA 2ZRXA 3LCHA 3GDLA 2Z1BA 2VFFA 1FDZA 5I3IA 2DZUA 1MEIA 3E49A 5F2LA 1XCFA 1GJPA 1OK6A 3P60A 8TIMA 2HMCA 3NL5A 3A22A 3NQDA 3GDTA 2HS6A 1SW0A 4MIMA 3QW3A 4Q33A 2GVGA 1Q6RA 1MXSA 3BLIA 2JKAA 1KM4A 4IPIA 3IVTA 2W6RA 5KSWA 1J2WA 1LP6A 2Y89A 4Z0SA 3NL6A 1DQWA 3M41A 4JTEA 4OV9A 1FDYA 4IMDA 4XBSA 1R2RA 4XUGA 4MVAA 3MI3A 4ZVJA 4LY8A 4MZ1A 3UWQA 1W5OA 4JIQA 1S5TA 5CZTA 1J4EA 1RQHA 3ZS4A 4L4MA 2ZRVA 3SI9A 3NR0A 3T40A 3QMTA 3PUOA 4NQ1A 1VYRA 4O8RA 3MHGA 3O8AA 4LT9A 4J9JA 3W6YA 2DJLA 5FF2A 2P0OA 3BW4A 3NPXA 3OA3A 5C6MA 1HL2A 1SO4A 3HGSA 3WJSA 4MLRA 4N4QA 2Y70A 1H62A 2QCEA 5D2YA 1H5YA 3HG4A 5KINA 4N9DA 3JRKA 4JY8A 1DHPA 2BSLA 3FKRA 3LBCA 3KHJA 1KV8A 1X8FA 5CZ0A 1EUAA 3N34A 2ABBA 1BWLA 1W3NA 3UZJA 5D09A 3IIZA 3UWUA 1XDLA 1ZHAA 3FEMA 3FKKA 4ORIA 4WY0A 2A4AA 1WOBA 3IIOA 5I3HA 1F74A 3H54A 3TQKA 5HR7A 4UNKA 4ICNA 2RDWA 2ZZ1A 2C0AA 3BPWA 3NQGA 1LOSA 4PTNA 1QPRA 2JGQA 3HPSA 2GVLA 3LTSA 3E96A 2FB2A 5CSSA 3S1VA 1EEPA 1LDCA 1SZFA 5AB3A 4UTIA 3W2KA 2V81A 1JUKA 4QJ1A 3W72A 4U28A 2J27A 4NT0A 4DF0A 3CWNA 3NM3A 4DPPA 1R30A 3UD6A 1JCJA 3LRLA 3C2EA 5HUPA 2OZ0A 3SGZA 3NGJA 3TROA 4QM1A 3C2RA 1YTKA 3NQ7A 1RV8A 4GUIA 1DORA 2QCMA 2NX9A 3L21A 1H7PA 2CLMA 4HNUA 1TPB1 3CPRA 1H50A 3LCLA 3PAJA 2BWGA 1SZNA 2B7QA 1B9BA 3L0NA 2Q8ZA 4O15A 5D37A 1H7RA 3CB8A 5G1YA 4N6FA 5G2WA 3TSDA 1F6PA 3IIPA 1BTMA 2H3DA 3KOFA 4M6VA 1O5XA 2WV8A 1IXPA 1I2PA 2PRHA 3NXFA 4HSOA 1KFCA 4NNCA 5H91A 1IXNA 3T4CA 4O18A 5G4EA 4WXZA 3T78A 5CPLA 3U8GA 4JS3A 2LLEA 3W9ZA 4DBEA 2HTMA 5HWJA 1SO5A 1FWRA 1QPQA 2R94A 3OEXA 4NVTA 3MUXA 3ZWSA 3W22A 3WJYA 3N3MA 1GYLA 4JN6A 5EA9A 1XUZA 1TPC1 3PB0A 1R2TA 1TRIA 3W7KA 1F2JA 4LUIA 2Y7FA 5CZJA 3C3NA 5LNUA 2G95A 4OGZA 2FPYA 1QMLA 3WK1A 3FS2A 4RR4A 4Q32A 3K30A 2W0UA 1D3GA 2WKJA 3UZ5A 4ML9A 3S1WA 4BI6A 5K2ZA 4CNNA 2C16A 5HULA 3U6WA 5EYWA 3LCWA 4UXDA 3EXRA 2E6DA 1HTIA 5K4XA 4N9CA 4G1KA 1MSSA 3S5ZA 5D30A 4N4PA 3P80A 2B0MA 3O6DA 3NQVA 1NF0A 3IVSA 3P7YA 5G5IA 1VR6A 4O10A 3PWAA 3KVLA 3DFTA 2PE4A 2VEPA 4ZQNA 3G18A 1Q6OA 4NJJA 4GC4A 2ISSA 3VNDA 3CIXA 4JXCA 3W7OA 1LBLA 4JDBA 1XKYA 5CPMA 2ZA2A 2VEIA 3GIYA 5D04C 3UXDA 3QQ1A 3P5YA 2A21A 4FX6M 3S6DA 4UTTC 4ZMGA 4ADUA 3LHUA 1M7OA 2TYSA 4CCDA 1R46A 1V5XA 2Y88A 1PIIA 1SPQA 1Z42A 5D05A 5IBXA 1VC4A 2XFWA 1XBXA 4HIBA 4OT7A 1PHQA 3L67A 1SFLA 1C29A 4JTFA 1H60A 2QCCA 3NG3A 1Y0EA 3W73A 1A5AA 4RCXA 1RR2A 4JGDA 2JGYA 2QCDA 5EKYA 3F03K 4MPQA 4AEOA 3GZ3A 3MHFA 5TIMA 4I7VA 4CCEA 4PEKA 1VPXA 1TPFA 4AHQA 2TMDA 2A0NA 3N14A 1KTCA 3HPZA 1PL9A 4K39A 3N9SA 3HG3A 3NQAA 4QIUA 1D3HA 3G22A 5LHEA 4A29A 3DXIA 4JTSA 5J5RA 4UTUA 2RHGA 4DF1A 3RLVA 4DBDA 3TKFA 2QUTA 3A21A 2OT0A 4BI5A 3G8RA 3MMTA 4LRTA 4BWLA 1FDJA 5CGQA 3BVJA 4Z08A 4N2YA 3HG5A 1VLWA 3LHWA 3O63A 4N9EA 3INPA 3TSBA 4CNOA 4LVAA 3TAOA 1H1ZA 1XBYA 2DZSA 4O52A 4MFDA 5TQLA 1OYCA 5TBOA 1Z48A 3EX4A 2VFEA 2E77A 3A23A 2E5CA 4QSHA 3DFQA 3PUDA 4WXYA 3LRKA 5LNRA 1H7XA 1QAPA 3LCGA 4WQ6A 3VE7A 3S8HA 3DHDA 5K3VA 3NAVA 4MY1A 1P4CA 1TSIA 4O4VA 4XKYA 1QCWA 4LWWA 4ZZ9A 1Q6QA 1OFDA 4AVFA 1W56A 3DU0A 3QW4B 2JBMA 1EIXA 3W7RA 4RXGA 1I45A 3EX3A 4RX0A 3TMQA 4XZ9A 3EWYA 3UWYA 2RDTA 3MI2A 1QOQA 4K7VA 3I7RA 4JTHA 4P61A 3TCEA 4YCPA 1RD5A 3LBMA 2DJXA 3G1HA 2G96A 5FI8A 3W7JA 1TJRA 3ABSA 1ZAHA 2NUXA 4E2DA 2ZRWA 1VZWA 4PFMA 2KZHA 3B04A 1L6SA 3C2FA 1JJKA 2QCNA 4GUJA 4Z1AA 3S0CA 3F4NA 4DELA 3H55A 2PC4A 1EP3A 3HG2A 1JCLA 5LKYA 3AO0A 3P61A 3NPUA 3HJZA 1YTEA 2C3ZA 4UTWC 3PVFA 4R33A 3TV8A 3LTPA 1X1OA 3EXSA 3QZEA 1ZJIA 5SWUA 4M6PA 1XBZA 4Q4KA 4MUZA 5KITA 4YMZA 1A5BA 4E38A 2B7NA 3LV5A 1ZCOA 3FJLA 4TMCA 4GWEA 3TK7A 3SR7A 1KFKA 1H61A 2D73A 1PVNA 4OQVA 2CFFA 4IQLA 4MLJA 2ZDRA 5DXXA 5F1VA 1NEYA 4RV8A 2BLEA 3LI0A 1C9DA 2E6YA 2C15A 3W1UA 3BLEA 1TO3A 2BXVA 4C1LA 3OIXA 3R8RA 2YW4A 1ALDA 1FCUA 3L65A 3PSWA 1KBIA 2GQAA 1JCYA 1EUNA 2CZDA 3W7CA 1G4EA 5CG7A 3CQ0A 3VFLA 1NFBA 2RFGA 4RK8A 4DQWA 3DI1A 3MO7A 2CLFA 2CZ5A 2E5DA 3GAKA 3A24A 1TQJA 3LTYA 5BMWA 5HMSA 4JICA 4WX2A 4MOZA 5F2GA 2AAMA 4MFEA 4O17A 1O95A 1Z44A 3W7NA 3C2VA 5I3FA 2Z0IA 4UMAA 1AK5A 3M6YA 2BZNA 3MBDA 1GQNA 2C6QA 2VXNA 1OFRA 1TV5A 4O1BA 4IX2A 3VI2A 5KZDA 1LOQA 1ML1A 1B57A 1TQXA 4K8HA 4TIMA 3JS3A 2E68A 5D02A 1AG1O 3UPWA 1DVJA 3RU6A 2J6XA 2I1OA 3USBA 3W86A 2WNNA 3UY7A 2V5LA 2CLEA 2YZRA 5AHFA 3D0CA 1F5ZA 1KM0A 1G69A 4YL2A 4GNJA 5FF0A 1G7UA 2ZFAA 3NOEA 3TR2A 3W3OA 1JUBA 1ZAJA 4IXHA 1MO0A 4JDYA 5E0KA 3RK8A 4YCOA 2HSAA 3TQVA 4BFAA 4O12A 3GR8A 2ZRYA 5L9FA 3CEUA 3STGA 1A53A 2WPBA 3R13A 3L5LA 4Y96A 3KRSA 4O0KA 3G1FA 3NVTA 4I7WA 1TV8A 4JX4A 1AW1A 1K03A 2ZTJA 1WAUA 3R12A 4NJHA 2YFOA 2ZRUA 3SECA 3BW3A 3L5MA 3Q94A 4ONVA 5U4NA 5IM51 3W7MA 3N19B 4TMBA 2NLIA 2C13A 3KVMA 2GQ8A 2QDHA 3FIGA 3KVKA 4LVGA 1KFBA 1KA9F 4K7YA 3O07A 3HB9A 5K7JA 1LRQA 4LW7A 5F4WA 1KLYA 1VHCA 1TTIA 1SUXA 3LOTA 5HINA 4AWTA 3STCA 4QITA 5BW6A 1ZALA 2Y62A 3GR7A 3DFPA 2CLIA 4L4LA 3UYCA 3I68A 4FIRA 3M9YA 3QYQA 1D9EA 4LVBA 3NL2A 3BG9A 4K37A 3WK2A 3QPZA 1XFBA 5DY2A 3C0JA 4NU7A 2F7FA 1E51A 4LS1A 1H7OA 3GDMA 2QCGA 4WOQA 5F2IA 1KM5A 4EIVA 1H1YA 3E0IA 1SQ7A 3W7GA 1KFLA 1K02A 4UMCA 3HQ1A 1W3TA 2J9YA 3TC7A 1LLZA 3MYOA 1FXPA 4I7UA 1ZNNA 2VENA 1W5PA 3M1ZA 1HO1A 5EMUA 4D2JA 1T99A 5C55A 3B8DA 1KM1A 3CT7A 5CPOA 3TJXA 3TU9A 2W79A 4OU1A 5KTLA 3PR2A 4TR9A 2H8XA 4LUJA 2YFNA 1G4TA 5AHMA 5DCEA 1W31A 1CX9A 3W1NA 1KW1A 3T44A 2Q3OA 3TAKA 1FBAA 1OF8A 2XN2A 2NXIA 1QWGA 4UUIA 1ICPA 3LCIA 2EHHA 1OJXA 3PULA 3VKJA 5G4WA 4OWGA 1K7EA 1VJIA 1W5NA 1XUUA 3ZWTA 3UY8A 4QNEA 1QPOA 1HFBA 3WJWA 1IF2A 3TJLA 4LRSA 1OABA 2C19A 2V2DA 1F73A 2A6NA 5DELA 1K8ZA 1AL8A 3BK0A 3EWWA 3NYZA 2V2CA 3W1PA 3C6CA 4N6EA 1K3UA 4UTLA 2FDSA 4BR1A 3MBFA 1OX4B 2DZXA 5KZEA 1U83A 2VKZG 4ORMA 1KTBA 1Q45A 3A9IA 2VEMA 1TPEA 3TA6A 2A85A 3G0UA 5C5YA 4B5NA 4XBKA 3KAOA 1WQ5A 3LXBA 2A2IA 1T8XA 3W1RA 4NJIA 1NF7A 2Y63A 2QCDB 2RDUA 1K8XA 4JX5A 4UFLA 2V82A 5H2ZA 1JVNA 3HF3A 1O4UA 3DFSA 4JNMA 5F1UA 2WJZA 2HS8A 2DU2A 4UC5A 3GXTA 3GKAA 2QCHA 1O94A 5BNKA 4LTSA 4Y90A 1XI3A 1SO6A 5HWNA 1ME8A 4O28A 4UMBA 4TU1A 2QJHA 4RLIA 2H8ZA 1FCQA 2A7PA 3ZR4A 3KRUA 1LRTA 5AHNA 5L6UA 3P5ZA 3NQEA 3C4UA 4DO5A 3PG8A 5EL1A 1VYPX 5CZSA 3NQFA 4X3ZA 3WFAA 3W2MA 1YXYA 5C54A 4RZ5A 2EKCA 3DFNA 4EF8A 3G1VA 2CLHA 1SSGA 1TPWA 1WX0A 3PS7A 5HQEA 3GAYA 1YXCA 1X1ZA 3M5YA 1AW5A 2QF7A 4JX6A 3W88A 1F6KA 4ADTA 1KM6A 3GKFA 1LORA 4JYEA 1N7KA 2ZZ5A 4JEQA 4LNYA 4XKYB 5E1QA 5K9DA 3HGRA 4CCCA 4FIQA 5D2WA 3ABRA 2ZCGA 3RNDA 1GVQA 1SFJA 3G1SA 4DEFA 3LLFA 4DXVA 2TRSA 4JY9A 1L2UA 1WV2A 4UTJA 4H4IA 1R47A 4JIPA 4P2VA 4MYAA 1QPNA 1SW3A 2PRLA 3I7SA 1XM3A 1IGSA 3DFOA 4EWND 4IPJA 3CC1A 3LI1A 3LHYA 1OF6A 3NA8A 4XTIA 2F84A 4HN4A 3W1TA 2JKEA 2FTPA 4FF7A 3E12A 3O6CA 4JYFA 3PBVA 3N2XA 3NPVA 4R34A 3L66A 1XXXA 1FCBA 3QMSA 1FWSA 3ANYA 4N02A 2J9XA 4YXGA 1QFEA 1OX4A 3QSRA 3WJZA 2WSYA 1NVMA 1MEWA 2P10A 1FUYA 4IMGA 4HPXA 3G0XA 3GNNA 1AL7A 2C18A 1TPUA 2XN0A 4UFMA 2WSQA 4EF9A 2YYUA 1UJPA 5I3KA 2V0TA 2GQ9A 4O13A 5FESA 3W84A 4NX5A 4E0CA 3PF3A 1PCWA 1SSDA 2QAFA 3QMRA 1LBFA 5LSMA 1MEHA 2X1TA 1X6UA 2PCQA 3THQA 2FQIA 3A5VA 2GVJA 1ZAIA 1CW2A 4LVFA 3N73A 4GBUA 1W1ZA 3R89A 2OJPA 2YGYA 2I14A 1R2SA 1IIGA 3W1AA 6ALDA 4K38A 3IIVA 4Z0JA 3OHIA 4KFOA 4QISA 3W07A 2NV1A 3MP3A 4A3UA 2Z2UA 4UFJA 1M5WA 3FYOA 3B0PA 1Q3NA 2NWRA 3QRHA 4HSNA 3TXZA 4JTJA 3LB0A 5AC7A 5FEPA 1JUEA 3O6YX 3CEPA 5A8GA 3CU2A 5EPDA 3AJXA 1GWJA 1M6JA 2WSRA 2FPVA 2IQTA 4LC6A 3C2OA 2P1FA 4PH6A 2A7NA 1VHNA 1JQXA 2ZQ0A 1GT8A 4Z1BA 4CQ9A 3P82A 3PC0A 4LC8A 3P62A 3TW7A 3NQ8A 4IMEA 3M43A 5G2HA 3W1XA 3HBLA 1GG1A 4JTUA 5EBUA 2VFGA 3V75A 3GX9A 4O19A 1OX6A 3FJ6A 3TDFA 2Y7EA 5LHFA 3EXTA 1L6WA 1ICQA 1XC4A 1VRDA 3UQNA 3OG3A 2ZYFA 3L9CA 2NX3A 3EEGA 1EP2A 1OFPA 4O1AA 3JR2A 5AC8A 3G1YA 4GJ1A 3B4UA 2AQWA 3ELFA 3TXVA 2FIQA 4S1FA 3OVQA 3L2IA 4O11A 2R91A 4HT3A 1RVGA 3W2UA 2NXGA 2QJIA 1JULA 3BLFA 4MKNA 3LERA 3TIMA 4DO4A 4MY9A 2Y7DA 2ZZ3A 2GUUA 2DZWA 3PM6A 3W87A 3Q2DA 2GOUA 4GFSA 2O7SA 3IGUA 1I2OA 5CPNA 2E6AA 2VFDA 1QOPA 2E09A 4OE7A 1TPDA 3IGSA 5C2XA 1JCNA 3BW2A 3HIJA 4LU0A 3W74A 1KLZA 1TB3A
chains in the Genus database with same CATH superfamily
4UTTA 2QUVA 4Q22A 4V1XA 1EX5A 3TUUA 3S5NA 3W71A 4GQQA 4HMCA 4C6PA 1UZHA 1GYMA 4WKFA 2X7VA 3BV7A 1Q65A 3MQTA 3W1LA 3NQCA 2XM2A 2V67A 4JQ2A 4QNWA 3NGFA 1EOKA 5HJLA 5FSDC 3B0UX 3CV2A 4DLMA 2Y61A 3UNDA 1JZ6A 3QV8A 2YL6A 1R3QA 2Z4GA 4NZCA 3HGOA 5CGTA 5T8GA 5D9PA 2B4GA 3S42A 2WZMA 4QQ3A 4AH7A 4YYFA 2VR4A 2G3IA 3URBA 2H90A 5CPTA 1WBJA 2G5WA 3G77A 3IJLA 3J7HA 4HMEA 4HU8A 1B3XA 3AXIA 2X16A 2NV2A 1HKMA 4FMVA 2ZXDA 1R3RA 4LBRA 3KL0A 3QFEA 3H2EA 1H51A 1E3XA 1DJWA 1UH3A 3HTWA 2PGRA 3MJYA 4W86A 3OA5A 2NLYA 2PDPA 1A4LA 1OB0A 1QNSA 1UASA 3QH2A 3NIYA 1ZY9A 2CLOA 1KRMA 3M46A 2MUCA 1THFD 3QM3A 4F0LA 5C9XA 2UWFA 2B7OA 3EX6A 4O4WA 4YIWA 4M6QA 1IV8A 1BYAA 5LGZA 1YEYA 3G3DA 3EWBX 2Z27A 4XVEA 6REQA 3B9DA 1GNXA 4OVXA 2EGZA 4NZ3A 3PFMA 2DZPA 1SFSA 2FJUB 3GG8A 1BYCA 1BVZA 3OGSA 3M5VA 3HN3A 2HJPA 1W1YA 2W91A 2VRKA 1K9EA 5A8PA 2IKHA 4G56A 5U7SA 2IKIA 4CQAA 2HPMA 5T9BG 3WH5A 4KFNA 3E74A 2AMGA 2NUWA 4C6DA 1XKJA 4L65A 4GXPA 3TZNA 1VQTA 2FLIA 1TZ7A 3NPWA 2J9ZA 4PUKA 4GUGA 1P0DA 3QZAA 3G2GA 2E9BA 4UTWA 1JDCA 2V9DA 5AFDA 4KERA 3C8NA 2FJKA 1XGZA 3PP7A 3O15A 3WQEA 5AYXA 5BWFA 1JQVA 2PP1A 3DG7A 3EX2A 4H6KA 1FWNA 1O5KA 3MPGA 3W00A 1ZQ5A 3CMGA 3N9KA 1XH0A 4B15A 1KM3A 3TYEA 5DCDA 1G5AA 3DI0A 4DYEA 3QEZA 1UA3A 2OGYA 4Q3MA 3BOXA 2E40A 1VEMA 4Y2WA 4MUPA 4Z1DA 1NP0A 3KCJA 4BI7A 1LROA 2GLKA 2ZC1A 1ONXA 2FFCA 3RX3A 1LOLA 3FYPA 2ISVA 1OFAA 4DWSD 1JI2A 4FXFA 1P0EA 4AY7A 3RM4A 1FH9A 1XLBA 4R9XA 3V0TA 3KRZA 4IOTA 3G0SA 3BCJA 1PTGA 3RO6A 2VRJA 4S3AA 3HO8A 3H2AA 4HHHA 4CD7A 2ANUA 2FZDA 2ALDA 1PIFA 3KFTA 4HGXA 1ZUAX 4GX8A 1CGVA 2Z1VA 4MKVA 4C6QA 4FA3A 1VGAA 1W37A 2BOFX 2J47A 4FEZA 1J10A 1XYBA 3IUIA 5MKGB 3TJIA 1VS1A 1R3TA 4EVZA 2ZUWA 4A35A 4ZQPA 4QDWA 4DWSB 8A3HA 3DC8A 3WENA 4BWLC 3DKJA 3OOQA 2WHJA 3BAWA 2YYTA 1H7NA 3FN9A 4A21A 1A5SA 3FGCA 5LGXA 1V77A 4O1FA 2G4JA 3GYEA 4FX7A 1Q7ZA 2VC6A 5BRQA 2Z28A 3LCXA 1XP3A 4LX4A 4C6LA 2JIWA 1GVSA 3MSGA 4XZMX 4NJKA 4NZJA 1W0MA 3IJIA 1LF1A 2CZFA 2AKMA 2J77A 7ODCA 3TLLA 1CIUA 5J5DA 4XIMA 2BODX 3RHGA 4E4UA 2J8TA 4S39A 3S6OA 3CTLA 1MZHA 4KFPA 4PSRA 3UJSA 3QQ0A 2QPXA 4CNPA 4XAFA 3WL1A 3JZEA 3G8EA 2OCZA 1RP8A 5E0CA 3EMCA 1KNWA 4MZ8A 1T8QA 4DAFA 4LB4A 4Q8MA 4E6MA 3KBJA 4KCWA 2TAAA 1O5RA 1LUCB 3CWOX 1YDOA 2NWSA 3MUIA 2QEZA 4K8EA 4LAOA 1ADOA 2HRWA 1PWLA 1TA3A 3LS9A 4HCLA 5HA7A 3HFTA 1LRNA 2OZTA 2A6LA 1ZBVA 5EFDA 1IIHA 3GIQA 2HZGA 4B5SA 2Q71A 3VDAA 4XD5A 4OUIA 4RKAA 1RQEA 5H6HA 1GTHA 1BHGA 1MUCA 4Q7NA 1KBJA 3WF1A 2YDSA 3W83A 3K5XA 3JUGA 3VIKA 1TWSA 2QW5A 1QO2A 4NNBA 3LV6A 1QXLA 2A1YA 3T7VA 1NDWA 1JRBA 1UB3A 4HKPA 1OZMA 2Y7GA 2HV5A 5CSYA 5FJIA 4YJ5A 1YE4A 2J78A 4EPKA 1TJ2A 1G4PA 4M80A 4W8LA 3TSMA 1A47A 2OWCA 1ICSA 2P8BA 1P7TB 4RDZA 3H53A 1VCVA 1AMKA 1RQBA 3BMWA 4UTMA 1JXJA 2YL8A 1TTQA 3L4YA 2C14A 4EKJA 3Q58A 3LQLA 4M0XA 5AN7A 4TVDA 3B8TA 6TIMA 5GVJA 3U2ZA 3G1DA 3GXNA 3W7LA 1IXQA 5HUOA 4M8UA 4C7FA 4R85A 4CLMA 4GYJA 1GVRA 1EGVA 5FA5A 1Q6EA 2ZUVA 3ATZA 3HA1A 3M0KA 2CKRA 2A3BA 1DWAM 4O16A 3BQ6A 5D38A 2WHLA 1NQKA 2H9AA 4J3ZA 3R0DA 4HZ8A 3IUDA 3S2JA 4H6EA 4NSBA 5JQ9A 3DERA 1EL3A 2E1DA 3SN1A 3P81A 1S2VA 1W9UA 1TTJA 2O4QA 5FJRA 4I9AA 4FR1A 4ZQCA 1YDNA 2VHLA 4C7DA 2ZX9A 4JTGA 4X9SA 3BLPX 2QPUA 3OYZA 3PTKA 1TREA 3W2JA 3QFWA 2RUSA 3TNOA 2XN1A 3NZPA 1W3IA 1PXGA 1HJXA 4REQA 3D3AA 3PZTA 4GZ7A 3SCWA 1V3MA 1Z9AA 5BRBA 1QDSA 1RZMA 4AMAA 4NI3A 1IEVA 1DIOA 3MHUA 4W87A 2OB3A 3I7QA 1V0NA 2C1GA 2B7PA 1JRCA 4CEXC 4JFUA 4S38A 1OG0A 3WDQA 1CXKA 1WDPA 3DBNA 4RNJA 4AHOA 1UKTA 1K6AA 2GGIA 3N2MA 2PDYA 3OLEA 4ACYA 1R9ZA 1YPFA 4J3SA 4AWUA 2PURA 1DWJM 3N17A 2WM1A 2VOTA 5LIWX 4AFYA 1I2RA 1YKWA 1UZ4A 3EX1A 1YYAA 4GHRA 3QTGA 2R24A 1Y5WA 1XBVA 4P7LA 2J88A 3F5LA 1KCLA 3IRDA 1I2NA 4H6RA 4DPQA 4H6QA 1AJ0A 2GVYA 4DJDA 4GFIA 4MNMA 1ME9A 5KZMA 4FNPA 1YADA 4F66A 4JTQA 1A5NC 3CXOA 3S1XA 4G6CA 3PN8A 2OQLA 2F2KA 4AVOA 1GOOA 3C0SA 1CCWB 4MJZA 3ZJ6A 4U5KA 4YTQA 4J28A 2OYLA 5DMLA 4MDOA 2WZEA 1E5JA 4GOAA 1REQB 3WFZA 3OYXA 4JN8A 5T26A 2YDAA 5LYRA 3UPBA 1J5TA 4IUGA 2NZLA 2VL4A 4IGHA 3M16A 3GR4A 1GQLA 4AWSA 5AHLA 3M47A 3GO2A 2OX1A 1KRBC 4RZBA 4HU3A 3VKBA 4QCFA 2QGYA 2VQUA 2X0YA 1BAGA 1DL3A 1KRCC 3L2MA 1L6YA 2WO5A 4HYRA 1J8VA 1FX6A 4F0MA 1RXOB 3P8IA 4J1OA 3VA8A 3FXYA 4MHBA 2YCEA 3WMLA 2PODA 1FDZA 1MEIA 4RDVA 4GH1A 4PB3A 3LMYA 5AYBA 1DTUA 3P60A 8TIMA 1NP2A 3NQDA 2PDCA 4HZ6A 2HS6A 4DX3A 1SW0A 4MIMA 4IQJA 1W1IE 1MW1A 3PZIA 1Q6RA 3PHAA 3BLIA 3NO1A 4IPIA 1M65A 1Y65A 1J2WA 1LP6A 1DQWA 3WSUA 3M41A 4PMVA 6XIAA 5C0QA 3EOLA 1V8EA 3WNLA 1M1BA 3W81A 4ZVJA 4LY8A 2XFFA 4JIQA 2NVAA 1J4EA 3SI9A 3T40A 1YMYA 3PUOA 2OQHA 5CCZA 3ICJA 3EAUA 3LK6A 4DXKA 1AH0A 1A5OC 1GVEA 3SUSA 5FF2A 4U2YA 3KBWA 3RRAA 1SO4A 2WCGA 3HGSA 1XF0A 2PDKA 1XFCA 4XVDA 5FOOA 4MLRA 1MXGA 4US5D 4A8NA 4IPNB 5D2YA 3WUFA 3HG4A 3BCDA 1Y7VA 4JBRA 3ENLA 2XIMA 4IT1A 1ZBWA 2YJQA 3KHJA 4IQEA 2PC8A 1KV8A 1X8FA 5CZ0A 4AUBA 1EUAA 4E4FA 3GFXA 4JTAA 2ABBA 4HQVA 1W3NA 3UZJA 4C6FA 4C60A 1ZHAA 4X9YA 4ACZB 3VGBA 4WY0A 2IMRA 1JYNA 5I78A 1WOBA 3VX0A 4ICNA 2RDWA 4W84A 2WAGA 1OM0A 5AC5A 3BPWA 3NQGA 1LOSA 5E9AA 2JGQA 3E96A 4UOJA 3S1VA 3NURA 3KOZA 4ZSTA 2XGBA 3BCFA 4FOUA 4UTIA 1QBAA 2R1NA 2PD5A 3W2KA 1J18A 4HA0A 3W72A 3FDKA 4DF0A 3CWNA 4CN1A 3N4FA 4QROA 4DPPA 1R30A 2JEPA 1ISXA 1EJWC 4ZTYA 1GKQA 1CLKA 1F6YA 3ZQ9A 5LA0A 2EPOA 3NGJA 3OZMA 1RVKA 1YTKA 2X0HA 2ZUMA 1PZ2A 1YPXA 4XK2A 1MQQA 1E9LA 1SZNA 2FGZA 1H7RA 5G1YA 4LNCA 3E2SA 2PDNA 1XC6A 3EYPA 1BTMA 4IJRA 2DW7A 4M6VA 2X09A 1I2PA 3APYA 1FVPA 4HSOA 1KFCA 3BMVA 1V3IA 5G4EA 4WXZA 3AIVA 2LLEA 4DBEA 3DYPA 1NWRA 4INFA 3ZWSA 3OEXA 1EC8A 3W22A 3N3MA 4PULA 1XUZA 2XVGA 4J5NA 2Y7FA 1CGYA 1WPCA 4C65A 1LT7A 1P0BA 3WK1A 2PGWA 1R3SA 4RR4A 3LUTA 4IGMA 4Q32A 4TTUA 1OY0A 1RJRA 5FJOA 1AH3A 4YTRA 2WKJA 3NZGA 3ZLGA 4IH3A 1CGWA 4BI6A 5K2ZA 2VWSA 2C16A 3CUZA 2ZUNA 4CEUC 1XLJA 2ZWZA 2D2GA 3SUVA 5K4XA 3AU6A 3MMWA 3LSCA 2GJXB 5LXEA 2YBTA 4QP0A 3T2OA 3NQVA 3VC5A 1V3HA 5G5IA 1RCOB 5JBEA 2R1PA 3WNOA 3PWAA 3KVLA 2VEPA 4XAGA 3ECQA 2VDGA 3EWDA 3VNDA 2J74A 3VDHA 3H12A 2OXNA 3IUHA 3G6MA 3NCOA 3BZJA 1NELA 3VABA 1Q6GA 2A21A 2WC4A 2DUAA 3UW6A 3G1RA 3H4GA 4UR9A 3LHUA 2OSWA 2TYSA 4CCDA 4G2DA 1V5XA 4FALA 2YCKX 3GNRA 2XFWA 1XV8A 4OT7A 4UOQA 4JTFA 4V2XA 1C7TA 2WSKA 5M17A 1VPQA 3VDBA 4RCXA 3CGTA 4IFRA 3M0IA 3GVQA 3UG8A 5EKYA 2VGIA 1UH4A 1VJSA 4AEOA 5TIMA 1H5VA 5I79A 2VX7A 3AIBA 4JQAA 4PEKA 2TMDA 1KTCA 3HPZA 3QKEA 3CYJA 1AUSL 5G4HC 1Q63A 3NQAA 3G22A 3AIUA 4H04A 2V5KA 4I3GA 1I0BA 5J5RA 3K1GA 4DBDA 4PUJA 4BQ3A 1HXJA 1GW1A 3V0SA 5B7ZA 3FAWA 5HMFA 3MMTA 3CAWA 1EBHA 1VLWA 1JFXA 1UKQA 1J6PA 1H1ZA 1XBYA 3K4DA 1MFUA 2DZSA 4O52A 3VTRA 2VFEA 2DVUA 4GQBA 4J2PA 1L2QA 4QSHA 2VP8A 4UTFA 4ZA0A 4HZ7A 1QAPA 3IK2A 3U4AA 4M29A 2I9UA 3S8HA 3SY8A 4MNKA 1NU5A 3NAVA 4XKYA 1VFOA 4G7EA 4L6OA 1PBGA 3V3WA 2I16A 4HP5A 6ENLA 1UD2A 4FLRA 2FZ8A 1I45A 3EX3A 5GQBA 3TMQA 3WMSA 2CBIA 3PNZA 3SEPA 1HVQA 4QJ3B 2W62A 1E6RA 3UXKA 3QBUA 3W6MA 3TCEA 2OLSA 1EJRC 4JIIX 4OECA 3W7JA 1MNSA 1TJRA 4JCLA 3GBEA 5LIXX 4AD0A 1VZWA 1MDLA 3IS4A 2KZHA 1AJZA 3C2FA 3OBEA 1JJKA 2CEQA 4Z1AA 4Q8UA 1ODUA 4WIWA 2XZ9A 2DT3A 4PBFA 4S3GA 4DELA 3AO0A 3NPUA 1H09A 2VZVA 3HJZA 1YTEA 1XLGA 2GGEA 2YA1A 1X1OA 2OG9A 3EXSA 2O0TA 4QE5A 4V28A 1WNOA 4Q4KA 4MUZA 1YIXA 1FWHC 1NIUA 3T2PA 3S6TA 3FJLA 4TMCA 4GWEA 3SR7A 2SFPA 4A8LA 1H61A 2ZDRA 4KGLA 1C9DA 4JIEA 2VUYA 3TOPA 3R8RA 4AZGA 1WO2A 3I3BA 1PZ1A 4OKDA 3BLOA 1AD1A 2CZDA 3R8HA 1X96A 4IFKB 2X41A 2QQ6A 4A3YA 3MO7A 1W1TA 1QNQA 3POHA 1XHGA 5BMWA 4F9JA 5F2GA 2OLAA 5H1WA 1W91A 4GY7A 3VINA 3WDJA 1O95A 3SY1A 2Z0IA 4UMAA 3F4VA 4Y9PA 3UZWA 3LM3A 4L4PA 1GQNA 1HIZA 2C6QA 3CV6A 1TV5A 4O1BA 3AALA 5HBFA 3R7MA 7ENLA 5CJMA 2DFAA 4W88A 4AY8A 4Z2JA 4D71A 1XCWA 3JS3A 2E68A 1AG1O 3UPWA 1DVJA 2J6XA 3W86A 1EYWA 5AHFA 3D0CA 1F5ZA 1KM0A 4GNJA 2V63A 2QJMA 1ZAJA 1UD3A 5ABEA 3R6IA 1NTHA 1SGJA 1XLDA 4MG4A 1DJGA 3TTQA 1RAKA 1VEOA 3CK5A 4RE3A 3TVAA 2ZRYA 5L9FA 1GJUA 2UBPC 4Z1YA 3AJ7A 3L5LA 2QF8A 3KRSA 5GNZA 1W6TA 4O0KA 3NVTA 1XJBA 2ZTJA 2ZRUA 4TTGA 1W9DM 4KT2A 3CAKA 3BW3A 5GJMA 4QG8A 2QYGA 4QX4A 5IM51 4NHVA 4F3HA 3EGJA 3KVKA 1KFBA 4K7YA 3O07A 3HB9A 3O6AA 5DF0A 3BE7A 3CUIA 5FKYA 1KLYA 4K3ZA 4MB4A 3LOTA 5HINA 3STCA 5BW6A 3GW3A 1ZALA 2Y62A 3GR7A 3BWWA 3VILA 5ABFB 1P43A 3UYCA 4XB3A 3QHMA 4FIRA 3OVGA 1D9EA 1GZ1A 2WSPA 4UQ9A 2CBJA 3AYRA 4MWAE 4WCJA 3QHOA 2ZX5A 5DY2A 2E3ZA 4FOJA 3WN6A 3B8UA 1E51A 1Q7MA 4LS1A 5I77A 2QCGA 4EIVA 2WJDA 3E0IA 2D2OA 4DNMA 3MZNA 1RLDA 3BLLA 2VZTA 3HQ1A 3R79A 2J9YA 1BRLA 2NVCA 2VYOA 1IEWA 2PU0A 1R7AA 1FXPA 1ZNNA 1XIGA 2P50A 1W5PA 2IQDA 3PWGA 3CTTA 4AZCA 4BEUA 3EOSA 3TU9A 3E0VA 4DYJA 2W79A 4OU1A 3EMQA 2H8XA 4LUJA 1RSCA 5AHMA 5ABHA 3RG6A 3VNYA 1ICPA 5JIWA 3VKJA 4S3FA 3RM8A 2VGGA 1XUUA 3HURA 1IYXA 4I6VA 3DG6A 1B9ZA 4PB5A 5ENLA 3UVAA 3MUAA 1V6VA 4LRSA 4W7VA 1F73A 5DELA 1EOMA 1FTXA 4R9OA 3NYZA 1WDQA 2WWCA 4PMOA 2I5QA 2QV5A 2FDSA 5BU9A 1KQYA 3TN3A 3WQVA 1U83A 3A6OA 1WZLA 1V0LA 1TPEA 2Z7GA 4B5NA 4EPDC 4WKHA 1T8XA 3SCOA 4CD5A 1C90A 1ZP4A 1JNDA 3H4WA 3BURA 2G4FA 4BCEA 3NVDA 3U3HA 2O9TA 4JX5A 4UFLA 1HL9A 3CIVA 1JVNA 3BICA 3H24A 3HF3A 1WCGA 2J7HA 1CENA 1PYMA 3EB4A 4IFOA 2P5NA 3DFSA 4I9JA 2WJZA 2HS8A 1V79A 2DU2A 3GKAA 1TVPA 1XI3A 1NOWA 5EMYA 4RLIA 4GIYA 2A7PA 4PR4A 4LUTA 1FWGC 2WJEA 5CZSA 4JEJA 1UYQA 4H00A 2GSJA 4GVFA 3HV9A 3WFLA 4R7WA 5HXMA 5I24A 1YXYA 3DFNA 4KGJA 4H9VA 1GONA 1HP5A 1UC4A 1U33A 1TWIA 4NRSA 1AW5A 2BB0A 3VOIA 1FHDA 3MU7A 2XUCA 1LG1A 2E7FA 1XRFA 2ZZ5A 4JEQA 9RUBA 4PBGA 4CCCA 3RCNA 3GC4A 3GWQA 3RNDA 3SRHA 3LLFA 3CZGA 4B5WA 4DXVA 2TRSA 1EJSC 4JY9A 1L2UA 4Q6XA 3JZUA 4US6A 1XPGA 3RJXA 2QGHA 2R82A 3K13A 4D6CA 4MSSA 3O0KA 2PRLA 1XM3A 1IGSA 3KZSA 2CPUA 3CC1A 2IPFA 3B8SA 4CN4A 1ADSA 3IJ6A 3W1TA 8XIAA 4C6JA 3AIQA 3GVRA 3N2XA 4JQ3A 2CHNA 2VCAA 4XUYA 3ARPA 2EKGA 2XSAA 4UNIA 4N02A 1CXHA 3R43A 3LY0A 3ANUA 3WLQA 2AAAA 2OZ8A 2JIEA 4F4RA 4IMGA 2Y4SA 4HPXA 3SUUA 4TVCA 2XJ7A 4LYPA 1GK8A 2BASA 2XN0A 3GTXA 4UFMA 2WSQA 1A4MA 5FAJA 2YYUA 4EF9A 5CAHA 4MAVA 2V0TA 4O13A 2WANA 3PK7A 3W84A 2VVNA 1TIWA 3EWCA 1J0IA 1PKYA 4I5XA 4GISA 2R9RA 2VCCA 3QQWA 1UD5A 1BWVA 1F3WA 1LBFA 2FQIA 4X2PA 2Y8KA 4ZB5A 1M7XA 3A5VA 2GVJA 5I0DA 1CW2A 4LVFA 3C0QA 2OJPA 4HN8A 4C90A 3R10A 1XISA 6ALDA 1EC9A 1XRVA 2PLMA 3H23A 1TCMA 2VO5A 1JFHA 4LUSB 3ZOAA 2Z2UA 2CIPA 4P5UA 4F79A 3QRHA 4HSNA 3TXZA 1KCKA 1JZ4A 5AC7A 3AWNA 5FEPA 2I56A 1QT1A 2IQTA 4Q8NA 4MDPA 2Z25A 4D72A 1FP9A 1JQXA 1GT8A 3MUCA 3WUGA 3PC0A 1XR2A 1WAWA 1A3XA 5LIYX 2YBUA 2F8QA 4JTUA 4PUUA 3UNTA 3GX9A 3V75A 4Z17A 2QIWA 1PJ9A 4C6KA 1ICQA 1XC4A 4AD4A 1VKFA 2DW6A 3CH0A 3EEGA 4GBDA 1XLFA 5I7GA 5AC8A 4GJ1A 3BJTA 2C1IA 3ELFA 5D9OA 3ZVHA 4J3XA 2J7GA 1PB0A 3OVQA 1VFFA 5BXTA 2XFYA 2Z1KA 3L2IA 4O11A 1RVGA 1T6MA 3W2UA 1LLOA 2FKPA 1O5QA 2UY3A 1JULA 4C6BA 1FWIC 2YIHA 4F48A 4Y9MA 1F4AA 3S3GA 4W7WA 3SCSA 2I57A 1IEQA 1VFHA 2PCEA 3IGUA 5E5CA 2E6AA 4DJFC 4XZIA 3LPPA 3U2CA 1AD4A 1OQFA 4OE7A 2XG9A 3CHFA 4KESA 1PKLA 4DJEA 5C9RA 2V5DA 3H2FA 3HIJA 2XIQA 3ZSTA 3R0KA 3CT2A 2ZRZA 3LRMA 3EB2A 4MMWA 5DN1A 4WSKA 3I6RA 1PE1A 4AEFA 4MWAB 4IWWA 3NM1A 3S2LA 4N7QA 3PPFA 4HHPA 1VBUA 2GOKA 1G01A 1OVDA 5CSRA 5K9CA 1Q6DA 1Q4NX 3LA4A 2DV0A 4IX0A 4JCMA 1GOIA 2D1ZA 5AOUA 1K7XA 2WKLA 3W7DA 3GUGA 4NF7A 3THDA 1EPVA 5I02A 3GH5A 2IW0A 1WDWA 2PLCA 1SZRA 2DSWA 3W1MA 1E3ZA 4H83A 4NAFA 1SJCA 1TTPA 3WYZA 2ZVRA 1J79A 3OZOA 3MUZ1 1J6OA 3GB6A 2D0HA 2YXGA 3NO5A 3OQ8A 5I3GA 1KV5A 1WOAA 3AS1A 3EPOA 3BGGA 3K4AA 1DKWA 3POCA 4LCSA 1LWHA 1G7VA 1ME7A 1QU4A 3SN4A 1TMQA 3LNPA 4Z2IA 4LAKA 2YW3A 4UQCA 3S2MA 2XINA 2ALRA 1RPXA 3CWHA 4IPPA 1RUSA 4URIA 1S5NA 1GTEA 3FV9A 2JKPA 3UR7A 1WA3A 1V7AA 2F38A 3FSUA 5HR6A 3AMLA 4QQUA 4WOZA 1LL4A 3ES8A 1ODZA 2WVVB 2PWVA 4UNLA 1A80A 3E02A 3GNXA 2DH3A 2HROA 3JW7A 5BXSA 2ONEA 1HJWA 3OG2A 1I60A 1ONRA 3QR0A 3N4AA 2ZICA 3K46A 1F3XA 3QR3A 2BHYA 4CD8A 1W5QA 2PSNA 1SJDA 4J3VA 1P1XA 2Z2AA 4UQEA 5TD4A 1E0XA 4LOCA 2WZTA 4IP4A 2CETA 2G0WA 4UFKA 3WK3A 2V38A 3VGGA 3ERPA 5EFFA 5PTDA 1Y8BA 2EPMX 2PZNA 3BOFA 1JF6A 4GKTA 3QTPA 4E4PA 1KBKA 3VD3A 1I8JA 1J0HA 1ZENA 3PBYA 4OV4A 3VZXA 4FF5A 6A3HA 4D6FA 1ITUA 2QJGA 1GYNA 3GHRA 3GVGA 4J35A 3NQBA 5T9CE 1YBQB 2DSUA 2OQYA 3KHDA 4WJ8A 2AOSA 3NQ2A 2ZXAA 2WMHA 1E0VA 4HNOA 4NXKA 1LQ0A 3H6OA 4WSJA 3RR1A 3KXQA 3LPOA 5E6YA 2R14A 3W2LA 1V0MA 3WD2A 5A2CA 3OIHA 1FHVA 2XGIA 2V5BA 1NJJA 3KCLA 4F0SA 1GQKA 1A50A 2PDWA 2Y6ZA 2WYSA 3QSTA 3BG3A 3C61A 2Y1HA 3PZOA 1JDFA 2FPTA 2PDXA 1U22A 4GYFA 2EPHA 5ABTA 4FO4A 4GUFA 3R1ZA 3VIPA 4JTIA 4J27A 3BAKA 2OPJA 3BG5A 1ZJBA 4DB7A 3F4DA 1N8IA 3UERA 3W70A 4JTLA 1WB0A 1BWKA 2WKGA 3TYCA 3RO8A 4JFSA 4Z1CA 3REQA 5FJPA 3RLGA 4PMQA 4WDUA 1NAL1 4H8NA 2W63A 4PUMA 1S38A 4V15A 1XIIA 3OB8A 1E1CB 2QT3A 4M5PA 4PA8A 4TX6A 3LXCA 4HVXA 3R2GA 3KM8A 4GYPA 1TV7A 4JD4A 3P67A 1XH1A 4K6AA 2OFJA 3LD5A 2WMGA 3DKLA 4UCGA 4A3QA 2Q01A 3B05A 2CWNA 1M01A 4L7ZA 3ID7A 2BVDA 2Q02A 1XX1A 4M7SA 1GVOA 3S5OA 1VFLA 1JYWA 1S2AA 1WKFA 1OK4A 1XIJA 1QJWA 1Q2RA 2PP0A 3WD4A 1LWJA 3C52A 2RAGA 1W5MA 2WXDM 4XQ6A 3CH9A 1FQ0A 1XYMA 4UZUA 3LPFA 4QG6A 1CZ1A 2VX5A 4FOKA 5HNRA 4NNAA 3DH7A 2PTZA 1EQCA 3WF0A 5CGMA 2F61A 1EFZA 3U7BA 4IICA 2WMFA 5DBTA 2E6FA 2CNCA 3EKLA 1TE6A 4GZEA 3VCRA 1EWDA 3UA3A 1SW7A 2ACQA 2QLYA 1QO5A 1Z89A 2HXTA 5JXQA 2QUUA 1LCOA 1VCFA 3GXPA 2WHMA 3EWXA 1PX4A 5DFAA 3SCRA 1E9ZB 1SZEA 2TODA 1H1NA 3M0HA 1YE6A 2XVLA 4A2RA 3A4XA 4EAYA 1SR9A 1NH6A 2BNJA 3E0FA 2DT0A 4LS2A 4IJBA 2QCFA 1O1HA 3NJ3A 3SJ3A 2WBKA 1YTDA 2OWXA 3AXHA 2BTMA 3PZGA 5FEZA 2GPTA 3MP4A 3ARSA 3G5EA 3IV3A 4WJEA 4TX9A 3W2NA 5I03A 1J0KA 1OC7A 1HG3A 1IEXA 4YVPA 4MY8A 3U7VA 1B4EA 4GY0A 1F76A 3W23A 3LU2A 1JZ3A 2EF9A 4ADSA 3VNZA 4XWUA 4LJ3A 2CESA 1VYSX 3SADA 2IUZA 3BAXA 5BOFA 3NZRA 2A3LA 2VGFA 5E93A 5A6BA 4DWSA 1F07A 2EAWA 4GXWA 3EKZA 3B8IA 3LGEA 4CCZA 4JYDA 1O1ZA 3C56A 4B5VA 5FF7A 4PCFA 2I17A 4LF1A 3MMDA 5JUVA 4KS0A 2FZ9A 5D32A 1NY1A 1I2QA 5A6MA 5BXRA 1UBSA 3WQ8A 3S1UA 4AX7A 2D2HA 1BF6A 4F2TA 3DFYA 3C5QA 5FSEC 3ZIZA 5EMMA 1UQYA 3GDKA 1FHUA 1NM9A 4TO8A 2YZ5A 2C1HA 5D2XA 4UTKA 4O54A 1P0KA 4AF0B 3USZA 3PBWA 3K8KA 3OJGA 1G9HA 3SRFA 2Y8VA 3T0TA 4AEEA 2CITA 4GUHA 3AQUA 2FGLA 4W9TA 3WEZA 4H3DA 4KRTA 3WQGA 3BOLA 3EPMA 4LV4A 5CKSA 2IXUA 2BS9A 5C7HA 3FA3A 4H9ZA 1TRDA 2Z29A 3L4VA 2FH6A 3HOJA 3M5ZA 1LUCA 1GOXA 1HF6A 2PDBA 4LEQA 4AX6A 3NZQA 4WHBA 2NT0A 2XVNA 2WOQA 3ATYA 3ZR5A 3WQPA 2ZZ6A 4L9XA 1F7BA 3P8JA 3SAZA 3I6TA 5D2VA 1J0JA 1FFRA 3M5XA 3F2CA 1X6LA 7TAAA 1ITCA 4TVUA 6CGTA 3EB3A 3ZFHA 4R27A 1VJZA 3DENA 4OHQA 2V30A 2L5HA 4O1DA 1WYIA 3M0ZA 3M64A 5DCBA 5JU6A 2E25A 4S3EA 5EB8A 3WF4A 3A3HA 4O0ZA 2NQLA 2BOGX 2VCBA 1PV8A 3B06A 1DEDA 3QJAA 3U2EA 5AYZA 1OHLA 5A6JA 2WM0A 1Z32X 1W1A1 3O06A 2WC3A 4ATDA 4PRTA 2WVTA 3WBYA 3W7PA 5I3JA 4WVXA 3VNLA 1E0WA 3QV7A 4YWSA 3KRBA 1XLLA 5G2IA 4NIRA 4XTDA 2O9PA 4GXMA 2BXZA 3LLXA 1RY0A 4D6IA 1Q13A 1OFOA 3WEOA 1C8VA 3M6DA 5FEXA 4OTKA 3NSNA 3A13A 2Y5JA 2E5BA 1MZRA 2VURA 5H8PA 3SCQA 1UUOA 4DYKA 3WBXA 4UTHA 3LENA 3CZJA 4LB3A 1TELA 1J5SA 3OO2A 3ABQA 2YDQA 1KTNA 1KGUA 4WD0A 2QDGA 2GGGA 1L9WA 2OEKA 1W3JA 5DBUA 1BEUA 2X2GA 4FNUA 4N9BA 1K70A 3W85A 4ZQMA 3NZ1A 2WQDA 4V1YA 2A5HA 1W3KA 5LNVA 1AODA 1UCWA 4WJXA 2X42A 2ZBTA 1KR0A 1LJYA 3LLDA 3KP1A 3BO9A 3VKCA 3EDJA 4RXFA 4B3ZA 1YNQA 1TWZA 4GA8A 3W7IA 2ODOA 3BARA 3DGRA 1FKXA 5LNWA 3W01A 2XM1A 2HBXA 3I4KA 3WNNA 2VQTA 1YHTA 4H7ZA 1A5CA 3LCHA 2BHUA 4V27A 2VFFA 5B80A 2X40A 5I3IA 5F2LA 3M0LA 2VD9A 1OK6A 3NL5A 2YA2A 3GDTA 4LAUA 3AS2A 3P93A 5T91A 4Q33A 3CB3A 3H26A 4QLJA 2NQ5A 2Y89A 4J40A 3FGCB 4XBSA 4IMDA 4O1EA 3N3TA 4IJCA 4MVAA 3HU7A 3MI3A 4DM1A 1EZWA 1RQHA 3ZS4A 1WZMA 2CBVA 3GS6A 2WVUA 1B2YA 2VEFA 2PZ0A 4LT9A 1V08A 1JAKA 2DJLA 5AC4A 3NPXA 5AKQA 1VIZA 5C6MA 3UU0A 3WJSA 5BOEA 1XCXA 3AMCA 4IQDA 4RL3A 3CQKA 2OODA 4JY8A 4QAWA 3DGBA 5A8OA 3FKRA 3WLHA 4Q8QA 3MSDA 1UOZA 3NDZA 4GQGA 1NDVA 3K4WA 1REQA 1PZ3A 1TA3B 3IANA 4NKCA 4W89A 1UBPC 4AZIA 4N0RA 3PBGA 4FK9A 1F74A 4XD4A 4UNKA 3L23A 4PTNA 2G3FA 3E3HA 1EEPA 4ZXLA 3AC0A 5AB3A 3D3FA 3W28A 2IQ0A 2PU1A 1QW7A 4BZYA 3NM3A 1QK2A 4PUEA 1DWIM 3BC9A 3KZPA 3LRLA 3L4TA 4L5ZA 4ZE4A 4UQBA 3C2RA 3NQ7A 1A0CA 1RV8A 3VIFA 1DORA 3L21A 3RR4A 2O56A 3WD0A 3URQA 3PAJA 2BWGA 1B9BA 2KAUC 4GC3A 7XIMA 4I8DA 5J8LA 3ZVIA 3BAJA 1TVLA 5CH9A 2H3DA 2ADAA 3KOFA 4M51A 3RPDA 5IDZA 4YU1A 4IGNA 1EDQA 5KETA 3NWRA 4C6OA 4CUCA 1ESWA 1IXNA 5EMLA 1QBBA 2R1LA 4O18A 4Q8PA 3T4CA 5CPLA 3U8GA 3MT1A 3JU2A 4DBUA 1SO5A 2HE5A 3KTXA 1PKMA 2INFA 3OBAA 1JI1A 1EH9A 4EANA 3W7KA 1TRIA 4NG3A 1QHOA 2OSYA 4OBRA 4GPNA 1F2JA 2H9AB 5M1TA 2G95A 1PSCA 4XSLA 1E6XM 5LIKX 4H41A 3K30A 1XRTA 2I7GA 1V6WA 1DIKA 2HK1A 1C3FA 4AWEA 4CNNA 3NEHA 1EHAA 1E4NA 2E6DA 1LT8A 2D22A 1V6YA 1HKKA 4N9CA 4WF7A 2Y2WA 3ITGA 4N4PA 3P80A 2B0MA 1DXFA 1NF0A 3IVSA 3P7YA 3AOFA 1KKRA 1VFTA 1CPUA 4R7OA 3SSZA 4GCAA 3DFTA 1LQ2A 2PE4A 3ZT7A 3VOGA 2BY2A 4M81A 4US5A 5LA1A 2XGZA 4GC4A 2ISSA 4DJED 2PWUA 3CIXA 2REQA 4E8CA 4JDBA 4AZ5A 4YVVA 1OZQA 3GIYA 2PBOA 1XGEA 3P5YA 2WCAA 2OKOA 4ZMGA 1B3ZA 3QXBA 4GH3A 1R46A 4WDWA 2V3DA 1PIIA 1GZJA 1SPQA 3MCNA 1XBXA 3IJ9A 3L67A 1QTWA 1H60A 1PTDA 4Z42C 3H2CA 5C9ZA 2Q8XA 2G8ZA 4HCDA 1RR2A 3GNOA 3QOMA 1RA5A 2ISFA 3F03K 1VAHA 1XIEA 4UZSA 4FZIA 1OG6A 3MHFA 4I7VA 4CCEA 1JGMA 1VPXA 1HL8A 4P7QA 1ECQA 3FCPA 3F2DA 3W4RA 4XD6A 3ARRA 4D6HA 1UZ1A 3QZ6A 3N9SA 1AVAA 4MB5A 1ZJAA 5LHEA 4B2DD 4JTSA 3BAIA 3PANA 2RHGA 3WLMA 3N4EA 3QV6A 3V5CA 2QUTA 4JQ4A 2OT0A 4BI5A 1UQZA 2VJXA 4LRTA 3MDWA 4BWLA 1MUMA 4AZ6A 5C2GA 3BVJA 2FVMA 4Z08A 4PMNA 4XO6A 2DIEA 3LHWA 4XIAA 3DN5A 4JKMA 4LVAA 3VD7A 1PIGA 4H9MA 2V3EA 3HJEA 3TN4A 1ITQA 1EX1A 2E5CA 3DFQA 3PUDA 3W27A 5CJ5A 4JKLA 4Q4RA 2OYKA 1V02A 5F7UA 4NY2A 3ONBA 4QE4A 5FL1A 3DHDA 1O68A 3T09A 1Q6QA 2GJXA 3DU0A 1LG2A 4LXFA 2ZE3A 3BAYA 2QMKA 1EIXA 3W7RA 4RXGA 1N8WA 3ARTA 3V7PA 5HDRA 4NAEA 3AXMA 3HQOA 4RX0A 5FL0A 3EWYA 3UWYA 3CO4A 4RUBA 4LH8A 2V5JA 3MI2A 1QOQA 4K7VA 4MNJA 4JTHA 2RJHA 1LWIA 4NASA 4YCPA 1RD5A 3G1HA 4GZIA 4IL0A 1RCXB 1QW9A 1OCNA 3ABSA 3VM7A 4AZBA 4E2DA 3CPUA 4PFMA 2P88A 3WUBA 3B04A 2J4GA 3RX2A 3PTQA 4HTYA 5I23A 3F4NA 3T4WA 3H55A 1JCLA 3C2YA 2QZRA 2ZX6A 3QGKC 3WMBA 4QR6A 4R33A 1QI5A 3KDNA 1RALA 3QZEA 1ZJIA 4M6PA 1X7IA 3VAVA 3A4AA 2OKTA 4R3UA 1W1B1 1ADDA 4QE1A 1A5BA 3S2CA 2HDJA 3BH4A 4ZBCA 3AHXA 3F2BA 1KFKA 2D73A 5A6TC 1XYCA 3LI0A 2E6YA 5A3HA 2C15A 2X05A 2G37A 4AYSA 4F2UA 3WL0A 3SURA 3GU9A 3ZLFA 1ALDA 3GBDA 5XIAA 1KBIA 1JCYA 1G4EA 5CG7A 4DQWA 3E1F1 3S46A 4ZO9A 2CZ5A 3GAKA 3A24A 2HNHA 1TQJA 5HMSA 4JICA 4TV6A 4MOZA 3A4WA 2AAMA 5I6SA 4H7CA 4MFEA 5FJJA 4O17A 3W7NA 3WLOA 3UF9A 2BZNA 4KBXA 2VXNA 3TN6A 2DGAA 2YLAA 1NOUA 3CZLA 1IWPA 4ERIA 3IJQA 2VI0A 2I1OA 3TN5A 2V5LA 2CLEA 2YZRA 3CUHA 5D9MA 1TE1A 5IOBA 3W3OA 1JUBA 4IXHA 5KEZA 4DHGA 4NILA 5CLWA 1TUFA 4KCUA 2HSAA 4Y9OA 1E70M 3ITYA 4ATLA 3STGA 3WLKX 5DRCA 4I7WA 1TV8A 1WAUA 3TYUA 2NQ9A 3UZZA 2EO7A 1SFTA 4ONVA 1E5NA 5U4NA 3W7MA 2OU4A 2C13A 3KVMA 3WG6A 5CZKA 2GQ8A 2ZC8A 2HBVA 3FIGA 4JHOA 1KA9F 1B31A 1SUXA 1ENUA 4PE8A 1UPMB 1J0ZA 3DFPA 1X38A 2E28A 3LZ5A 3GC2A 3KTCA 2XZ7A 3RGTA 3M9YA 2VX6A 1IT8A 2WPGA 3VM5A 3BG9A 1VD6A 4HSHA 3MB9A 3B8WA 4Q7BA 4JKKA 4QS5A 4WOQA 5F2IA 1BVNP 4M3PA 4YTTA 1SQ7A 1BVWA 3W7GA 3SM0A 3PZVA 4UMCA 3VCNA 3ARWA 1AZ1A 3UG5A 3MYOA 1QK0A 2YB1A 4I7UA 1BXCA 3M1ZA 1HO1A 4HNLA 3NFUA 1AQ0A 3TJXA 2NSOA 5KTLA 3PR2A 4TR9A 4DXXA 1QNRA 2YFNA 3T8LA 4HHMA 1OWQA 4B3KA 1UKSA 1CX9A 1IZJA 5HOSA 3T44A 1OF8A 2NXIA 3BLDA 1QWGA 2GUYA 3PULA 3WLLA 4IM4A 1EQPA 4GD0A 2PB1A 3HQPA 3AUJA 4QEHA 4QNEA 1E6QM 3CBWA 4FS9A 3TJLA 2V2DA 1MUWA 1OT1A 2A6NA 1JZ5A 2NSXA 2Y8UA 3EWWA 5A6BD 3DCPA 3C6CA 3MV01 3TOYA 2XH4A 1OX4B 2DZXA 3FVDA 3B9AA 2VEMA 4B9YA 3TA6A 2A85A 4P7OA 3N6JA 3KAOA 3LXBA 3DX5A 2A2IA 4UB9A 2Y63A 3EOEA 3H21A 3KBNA 4RDYA 1KWGA 1MFVA 2WZHA 3HFYA 2V82A 1E0UA 4AMCA 3KWXA 6TAAA 4AZHA 1EYEA 1HP4A 4JNMA 4H9XA 3GXTA 3L4UA 1I1WA 1ME8A 1H0GA 2BY0A 4UMBA 2QJHA 4RE4A 3ITXA 2H8ZA 3D47A 3ZR4A 1LRTA 4XG1A 1Z8AA 5DX7A 3UYIA 2GQ3A 3C4UA 4DO5A 1UR9A 3PG8A 4NZ5A 4CQDA 2FVLA 3QOKA 2QXWA 3N13A 4NRRA 4X3ZA 3W2MA 3QYSA 4RZ5A 1IQ8A 2QMJA 1SSGA 3Q4DA 2GJPA 4Z2KA 2AL1A 2XIOA 3GAYA 5HQEA 1Q7QA 5C8BB 4RNFA 1UWQA 3OGVA 1HKIA 4ZO8A 1KBBA 4Q4QA 4JYEA 1F3TA 1QNOA 1N7KA 5E1QA 4XKYB 1IT7A 3K1DA 1UZDA 4G7EB 1GVQA 2JE8A 3GHTA 1UG6A 4DEFA 2WNWA 1XH2A 4Y7EA 1WV2A 1R47A 1VBJA 3HMCA 2PWHA 3KP0A 4G8TA 3EDFA 4D6DA 1QPNA 2GDVA 9XIAA 3DFOA 4KF1A 3WQFA 4DY1A 3SBFA 4EWND 4IPJA 3AXXA 3LI1A 1M41A 1RD6A 1PYFA 1HKWA 1OF6A 4XTIA 4HN4A 3AROA 2JKEA 2FTPA 1ZBCA 4XZHA 4JYFA 3PBVA 1RBAA 2VR2A 4B91A 1FWSA 2FMOA 4PBEA 3AHVA 1ZGDA 2J25A 2J9XA 4YXGA 1BKHA 3MCMA 1XG4A 2C79A 3EEZA 1FWJC 1ZB5A 1FUYA 4JQ1A 4LAMA 3T2QA 2YBVA 3B4YA 3GNNA 4UQDA 1AL7A 2D3NA 2C18A 1TPUA 4IISA 2A3HA 1UJPA 1QHZA 2QNEA 3EDKA 3IK4A 4NX5A 3MKKA 3DG3A 3EA2A 3MWCA 1C92A 4CN6A 1SSDA 3M0XA 2J8FA 5M5DA 2QUNA 2VRQA 1MEHA 1AJ2A 1OC6A 3BDKA 3II1A 3THQA 3CJPA 4L56A 3ZJ8A 1ZAIA 1BGAA 3N73A 4GBUA 1W1ZA 2V6AA 4J2MA 3R89A 3VNJA 2I14A 3VIJA 4YPJA 3W1AA 3GTNA 3M0JA 4L64A 4AU0A 3OHIA 1M68A 4JTDA 1UP0A 3OU8A 1XIMA 3WLIA 3MP3A 3OZYA 4A3UA 4UFJA 1M5WA 3B0PA 1Q3NA 2VDHA 5JVLA 3T0CA 3LB0A 1JUEA 3CU2A 3AJXA 4ROPA 1GWJA 1WDRA 4CVWA 4CU7A 1Z6KA 3WF2A 3TR9A 4LBSA 4ICMA 1MQPA 4LC8A 4DZHA 2BP1A 3NQ8A 4IMEA 3M43A 7REQB 3HBLA 1XLCA 3SN0A 1GG1A 4WR3A 3TDFA 2Y7EA 1L6WA 5DO8A 4L6HA 3T07A 3OG3A 2ZYFA 2NX3A 3V4BA 3WZ0E 2XH2A 2YCLB 1OFPA 4MTVA 4H9UA 3W6LA 4NYUA 2DUZA 4HOXA 3B4UA 2AQWA 1TX2A 3TYZA 4HA4A 3WQ6A 4GK8A 4P8XA 1EGMA 1FFQA 2QJIA 4DO4A 3LERA 4MY9A 2Y7DA 2PA6A 3NUKA 4NYYA 1JEZA 2DZWA 3W87A 2OLHA 3Q2DA 4D8ZA 4RW5A 4GFSA 2O7SA 5CPNA 4GG9A 2VFDA 3GNPA 3NYDA 3U5UA 1GW9A 2ASHA 2XVPA 2E09A 3PJTA 3IGSA 2J75A 4YTSA 1ZRQA 1QNPA 3VUPA 1R86A 1DPMA 1U30A 1BKSA 1DXEA 5DT5A 4J4KA 3WLSA 3KBVA 3BGJA 3RLUA 3CHVA 1BRLB 4KKXA 1QVBA 4U4MA 5D2TA 4C6MA 3T55A 4FHAA 3SGUA 2BGNE 2CW6A 2CLKA 1SMAA 4M24A 4AAJA 1EA0A 4RV3A 3MTWA 1WXJA 1JPKA 1FWTA 3A5FA 5AC6A 5E6ZA 2YSWA 3KX6A 1NDYA 1DQUA 4BF9A 1V7YA 1OX5A 3LGDA 2W67A 4LUSA 4RZ6A 3VOCA 1TIMA 1ECEA 2VELA 4RJEA 4B16A 4MYXA 3DBPA 3CLWA 4XAYA 2INZA 4PCTA 1KCZA 3IVUA 4ZEPA 3UG3A 3R4IA 3QV9A 3RCYA 4DZ5A 2DUXA 4BKNA 1CI1A 2MANA 3VGEA 1TWDA 1E4IA 4FB7A 2JQXA 1VH7A 1ZPTA 3MP5A 4Q8VA 3SGGA 4GVGA 3YPIA 3OVRA 1F4HA 1P1MA 1JYXA 4G9PA 4P8UA 2DVXA 3RFAA 3BJFA 4FI4A 1KXTA 3B8VA 4FPSA 5K9XA 4MZYA 4HHLA 2DSZA 3G1AA 1LBMA 5CSUA 4EPBC 3JVAA 3TH6A 4A3RA 4Z2GA 2H3BA 4PUDA 1XLIA 1UWSA 1L6GA 2E9MA 3VC6A 1S1PA 3AXKA 3WQCA 3VE9A 2QV4A 1WBHA 3BANA 2VX4A 5TNVA 3V5FA 5CAKA 4Y8FA 4DUVA 1C8XA 3MI6A 4POCA 5A6KA 5E09A 3W1QA 2PI6A 2XWDA 2O7QA 3AIWA 5FJUA 1VEPA 2PF0A 3EDEA 1EB3A 4KEVA 3LMZA 2YL9A 2WVSA 3PFRA 2ZA3A 3P0XA 3QPYA 4C6NA 3VIHA 3CV1A 1SO3A 2X1SA 1HKJA 3FSTA 5CC5A 4MJ4A 2WW5A 4HK6A 5A1AA 3WBEA 3H7VA 4OBSA 3H2NA 1RK5A 2PMQA 3LHVA 1FH8A 1W3LA 3O3RA 1R3VA 3FY1A 1VCGA 2TPSA 1YXDA 2R8WA 2HNEA 1IWBA 1MNZA 4UCFA 1EXPA 4GJIA 3OZPA 3F7JA 3B03A 1PO9A 2OMAA 4UOZA 3WX7A 2ZA1A 4W5ZA 3OLDA 2FYMA 4M82A 3NNTA 2WQPA 2FB3A 2Z2BA 1DE5A 2KX9A 2OEJA 5AVHA 5IBXC 1UUMA 5HWMA 2ATMA 3RN6A 4EK7A 3OTRA 1R9XA 4YHGA 1VB9A 4IIDA 5D8WA 1K9DA 3L68A 1PKNA 3N6HA 3Q37A 4FNSA 3I4EA 2TSYA 1J11A 2Y0FA 2Z00A 3SCNA 2OX4A 1VFSA 4K36A 3QY8A 4PGLA 2PWEA 4CD4A 3OP2A 4RNHA 4M1BA 3GK0A 2QJJA 1MRAA 1TPVA 2OSXA 1GKRA 4WY0F 2V8ZA 1UD4A 3UXAA 1JPHA 1NOFA 4BQ5A 3G3MA 3QPEA 2PTDA 3N2TA 2Z6IA 3MUY1 3N2OA 3RIKA 3GDRA 3Q67A 3WK0A 1YLVA 3C3UA 3SSJA 4OFCA 4O1CA 1I4NA 4PCNA 1GQJA 3CAQA 4Y9AA 1S3HA 3H4XA 3VKAA 2OELA 5EY5A 1Y5VA 2RJGA 3M7SA 4KCTA 2WJFA 3TTYA 5IHRA 1OSEA 6PTDA 3TTSA 1UHVA 1B4KA 2PDHA 3U2OA 4AHPA 1EF2A 3MYPA 1PX8A 2ZXQA 3UJEA 5DY3A 1M03A 4MF4A 3ONCA 1TZ9A 1OFQA 3L12A 3TFCA 4IUOA 3Q65A 2AGTA 4MNLA 4JFVA 4YNGA 1NWTA 2VFIA 3LHTA 5C70A 1LL7A 1G67A 3UBPC 3GHUA 1OD0A 4UIOA 3B9EA 3DAQA 3L0GA 2QAPA 4WKAA 3OVPA 4OOZA 1X7FA 3WEMA 1W9VA 1DJQA 3ALGA 3SIZA 4ZO6A 1EF3A 5D8ZA 3R0UA 2Y85A 3ZVHB 2Y24A 4UR8A 4IIFA 1BPLB 3N2CA 2D69A 3ZLHA 1HN1A 1T5AA 2J66A 3M44A 5GPRA 3OGRA 2C8NA 3WDRA 1O60A 5H8UA 1EO5A 1ZP3A 1PEZA 2ZE0A 2VC9A 4RW3A 1Z41A 2WB5A 4J7RA 1CXIA 3HQNA 2DZVA 2ABAA 3VIMA 2WMIA 1F05A 3HMJG 1BQCA 2QPSA 3UP8A 1LL6A 2Z1SA 4NZFA 3IEBA 4BQ2A 3EOUA 3SY5A 1G0CA 2PS2A 4GRSA 3RF9A 2BX7A 1IZKA 3SZ8A 1E72M 2DORA 2W61A 2AGKA 4LF2A 4XBJA 4R53A 3WELA 4XKMA 4C1KA 3AHZA 1W54A 3B3DA 1XDMA 2PTXA 1M9HA 1MQRA 2GGHA 3WF3A 3S9ZA 4GE8A 4H2CA 5FIPA 3OLIA 3WY1A 4DAIA 1H7WA 3CHCA 1MI3A 2YPIA 2B81A 1WXYA 3TYAA 1B54A 3P84A 1Q2SA 3UVIA 3E0WA 1OBAA 4NAFB 3VZZA 1LTDA 2FDMA 4L80A 3B0VC 1W9XA 3FFSA 2DZTA 1R9YA 1L8NA 3NQ6A 4QLLA 4ZXOA 1FRBA 1LZOA 5F4SA 5DRIA 4ZOCA 3IV8A 1EPXA 4ZO7A 5EBAA 3WH8A 2WNZA 2G97A 3CLMA 1G6CA 1ISYA 1XQKA 3PPCA 1OD8A 3M4HA 4BK9A 2BG5A 3URNA 3BMXA 3F4CA 1G4SA 4LV9A 2PDGA 4CNUA 1V3JA 4DF2A 2Q3RA 1JR1A 1U5JA 4ZQRA 3S1GA 3SW6A 3LSBA 3WUEA 1C93A 5GNXA 3DHUA 1BTCA 2X1IA 4Z2LA 4S2BA 5BOOA 1QW8A 3BL3A 2ZZ7A 3VFCA 3R94A 3NEVA 1H63A 3W26A 2GJNA 3GNDA 1N82A 3W7EA 3R5EA 1M7PA 4AB4A 5F4XA 2EG6A 5J04A 3DHFA 1CB2A 4PB4A 4HBKA 2WLZA 1K8YA 4AXKA 5AHIA 3S5SA 1TV3A 3WLPA 3PB2A 4IIGA 3CL8A 4NX0A 3VOHA 5E70A 4S3KA 3RU8X 1GG0A 4CQCA 2VVSA 4M1RA 1VRXA 4BY3A 1EEXA 4WUIA 1ZS2A 4EOUA 1MMFA 4IP7A 1XLAA 3PBUA 3TW6A 4MWAC 3ABXA 5EGRA 4UFIA 1S2CA 1P48A 5HAOA 4FXJA 4NJGA 2ZZ2A 1I0DA 3L0KA 4UFHA 4JZ5A 4JPGA 3GXDA 5BWAA 2ZX8A 3ITTA 3OPSA 3KEHA 4M7TA 2GJLA 3KBSA 1VBHA 1OYAA 1PDZA 4WZHA 4E3VA 4C6IA 5E9XA 1GVFA 4W85A 1GEQA 2NXHA 4OBTA 3KTSA 1H41A 4W8BA 2Q8LA 1U5VA 1FXQA 1FCVA 3WJXA 1GOQA 2QKFA 1RLCL 3GIPA 1QI2A 4JTKA 4U5IA 1EDGA 3STEA 4ZR8A 4ERGA 1X1NA 4F0HA 4ALDA 4K68A 1TUXA 2ZVIA 2V2HA 2CYGA 3CASA 2UV8G 3VD9A 4ATWA 3AMDA 3GD6A 1IR1A 3VO0A 3PG9A 4TQTA 1QUMA 4DVOA 2X30A 3GLCA 4BHYA 3G1XA 1KQZA 4AF0A 4LS0A 1SZGA 1CXFA 4PUWA 4D6GA 3THAA 1VLIA 2VFHA 4YLWA 1XG3A 4AW7A 4R88A 1KBLA 1BSLA 2X7WA 1BYDA 3A3WA 3ORWA 3L4XA 3PY2A 3EWZA 4ZTXA 2X1UA 2BXYA 1PWMA 4W93A 1J12A 3A12A 1HQTA 3IIXA 3F5JA 1S5WA 4FLSA 2CLLA 3SFKA 1S2UA 4PTWA 1JDDA 4PODA 4AIOA 2ZRXA 2WC7A 3REQB 3GDLA 2Z1BA 4I5RA 1EHNA 1A5KC 2JFEX 5ABGA 1RCQA 2WWDA 3KOWA 2HMCA 1RJPA 3L2LA 3GM8A 1D8CA 5I06A 2YCJA 2FZBA 1GEHA 3QW3A 4QS6A 2ZX7A 1GQIA 1MXSA 3FHQA 3P0WA 4B4HA 5KSWA 2E9LA 3APTA 4LFYA 4OV9A 3LG3A 1FDYA 3UJ2A 4YVXA 3H7RA 2OGJA 1W1VA 1S5TA 3EPNA 3NDYA 5CZTA 2ZRVA 4JFTA 3NR0A 1KGWA 2PLKA 3QMTA 1BXNA 4GINA 4NQ1A 4O8RA 4Q8OA 2YXXA 1U1UA 2IS7A 3LBOA 3W6YA 3STPA 2P0OA 3OA3A 4DJFA 3VD4A 1HL2A 3VOJA 2G41A 3WDPP 4QG9A 2XHYA 4N4QA 2FZMA 1E6SM 4IIBA 1BF2A 3E5PA 2R6OA 1TZZA 1H5YA 1R0MA 5KINA 1CDGA 3QHNA 4N9DA 3JRKA 4HJFA 1DHPA 1GKPA 3FHAA 2YKKA 4LALA 3LBCA 3XISA 3QY6A 1ZJHA 4QHRA 5DMNA 4KETA 4I9TA 4J3TA 5D09A 2BVTA 3IIZA 3L4ZA 3MC5A 3AS0A 2ZKMX 3FKKA 3AYVA 3IIOA 5I3HA 3H54A 1D2KA 1VFUA 4ZENA 2ZZ1A 2C0AA 4TOQA 5CJNA 2V5CA 3HPSA 2GVLA 3BJSA 2FB2A 1AMYA 5CSSA 4W4QA 3WLNA 1ISWA 4QJ1A 3WH7A 4U28A 1GCYA 4MAZA 2VNCA 4Q8WA 1JCJA 3C2EA 5LXXA 2OO6A 3SGZA 4QM1A 5CC3A 3VKKA 4LY4A 5FD0A 4C5YA 3NXLA 2QCMA 5KZ6A 1POKA 2NX9A 4PTMA 4EPEC 2YA0A 2CLMA 3GTHA 1TPB1 3CPRA 1H50A 1X97A 4GIEA 4D9PA 1EO7A 3N29A 3K8MA 1TJ1A 3L0NA 2Q8ZA 4O15A 5D37A 1XLHA 1WUEA 1MWOA 3CB8A