4K7YA

Oye1-w116t
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLTVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase 1
publication title X‑ray Crystallography Reveals How Subtle Changes Control the Orientation of Substrate Binding in an Alkene Reductase
doi rcsb
source organism Saccharomyces pastorianus
molecule tags Oxidoreductase
total genus 151
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4k7yA00
1GYNA 1QO5A 3NM3A 2H8ZA 1THFD 2BXVA 4LS2A 1W3TA 2ZZ4A 1W3NA 1DJQA 5LHEA 1EP1A 4KWVA 5EMUA 4M5PA 1KM5A 4UTHA 3ABRA 4M19A 4XTIA 3W7LA 4CCDA 1EUAA 4HT3A 3W84A 4WY0B 1QPNA 5HQEA 5F1VA 1KFLA 3EWUA 1DBTA 3BG3A 4O1AA 2NUWA 2Q8ZA 3QQ1A 4GWEA 3GXNA 3R2GA 1JUEA 3NQDA 4AWUA 1W1ZA 3LXAA 2X1SA 4Z1DA 3NG3A 3DENA 3LCWA 3DI0A 4JTKA 4KFPA 1SSGA 3T40A 5IBXC 1RVGA 4QAIA 4Z0JA 2ZRZA 1BWKA 1TPUA 1UB3A 4YMZA 4MY8A 4K7VA 3LCGA 1O95A 1J4EA 1KBIA 2VFEA 3NNTA 1P5BA 1ME7A 2JBMA 4TU1A 1VC4A 4L4MA 5FESA 3F4WA 1ICQA 1TPB1 2ZBTA 2ZRYA 2C19A 1T8XA 2GJNA 3ZR4A 1O60A 3NA8A 4IMDA 3P5YA 3MBDA 1B9BA 3JR2A 1P0NA 1RZMA 2QCCA 3TAKA 3DHFA 3QC3A 2Z6JA 4OT7A 5D04C 1EUNA 1XI3A 5HJLA 3O1NA 3IGUA 2GQ9A 3NQMA 2B7QA 3LRKA 1OFAA 3G1XA 3SW6A 4DF2A 5ABTA 2CZDA 1S3HA 3UXDA 1S5WA 1QR7A 3S1XA 3LXBA 2J24A 1SFJA 3MI6A 3F03K 3RK8A 3NPUA 2CLOA 3EWZA 3GX9A 5I3IA 3L0GA 3A23A 3BG9A 4MZ8A 2QCDA 4LV9A 4LVFA 1F5ZA 2NLIA 2YFNA 4UTIA 4O18A 3M5ZA 3N2XA 2ZTKA 1ZHAA 4Q33A 1XC4A 2F84A 5KTLA 4JTGA 2PRMA 4Y90A 1BEUA 5C2XA 5D38A 4AHPA 3CT7A 3THAA 2DZTA 4Z0SA 2DJXA 5G5IA 2CLHA 3W86A 2XFWA 3SGZA 3IRDA 3PR2A 1VS1A 4JX5A 4AMAA 4BWLA 3IVUA 1L6YA 4Z1BA 2C18A 3L67A 4LOCA 5HUPA 4QM1A 4OBTA 3S5OA 2EHHA 3TCEA 4JTFA 1HL2A 2XN2A 1NFBA 3MW7A 4DBDA 2TYSA 3W1LA 3W7JA 3W2NA 1EA0A 2XN1A 4C1KA 5K9XA 2Y7EA 2ISSA 1MSSA 2WQPA 1OX4A 3GYEA 5A8GA 1OF8A 3TA6A 4NJJA 4IMFA 3OBKA 2ZFAA 3EX6A 1EPXA 3NDOA 2JKEA 3G24A 3PBWA 1LOLA 1OJXA 4N9DA 5CPMA 1DORA 2A7RA 3M0ZA 3MI2A 3NQVA 4OGZA 4CCEA 1LDCA 2A2IA 3DFSA 2BTMA 3CEUA 1B57A 4E38A 1ME9A 1UUOA 1I8JA 3GDKA 2ZZ2A 4UMBA 3MP3A 5DLCA 1SZEA 1GVRA 2Y7DA 4IWWA 4O12A 2WV8A 5G4WA 3TKFA 4I7WA 5DCBA 3WK3A 1F7BA 5H2ZA 2Z0IA 1TPVA 3V75A 1CX9A 3TK7A 2VEKA 5HNRA 1FWSA 1JQVA 1WX0A 2FPYA 4K39A 4ADSA 1MXSA 1KLZA 1KLYA 4WOZA 4JNMA 1SZNA 2B7NA 1VYSX 3M5VA 1N8FA 2I9EA 2QAPA 3F4NA 1YXCA 3PY2A 3GDLA 3LGEA 1NAL1 1VYPX 1HUVA 4EWND 3G8EA 1AW1A 4TIMA 2G5WA 1JUBA 3U2OA 3W74A 4LVBA 4NU7A 3IIPA 5G1TA 4R33A 3P5ZA 1K3UA 3DU0A 3C56A 3M43A 1O5KA 5EPDA 4O15A 4CQ8A 1EX5A 3NM1A 3STFA 3QPYA 1KA9F 1O5XA 3C2VA 2H8XA 4HSNA 3MP5A 3B04A 1T96A 3S6DA 2ZDRA 5E0KA 1P4CA 3UYCA 4UTTA 4ZQCA 5DXXA 5D2TA 1TJRA 1HO4A 1ZAJA 2ZQ0A 5AYZA 1MEWA 3JRKA 3TFXA 1KFBA 1GZGA 3VKJA 2FDSA 3CPRA 3P84A 4M7TA 3KVJA 4J9JA 1IIGA 3T55A 2A7PA 4O8RA 1GVQA 1QNVA 1DKWA 4NNBA 1B4KA 1KV8A 1G4PA 4RV8A 2E6YA 1Z48A 3PBUA 1KM4A 1FUYA 1TJPA 4JTHA 3HF3A 1W0MA 3R5EA 3H53A 3TAOA 2RKXA 2Y85A 1GTHA 4YL2A 3ELFA 2CLMA 4MLRA 4UTLA 4XTDA 2DZSA 5K7JA 4K38A 4KFNA 3TC6A 1FQ0A 3GLCA 3GNDA 3L21A 3TE9A 3DKLA 2PC4A 2VFHA 1ONRA 1FDZA 3BO9A 2P10A 4X22A 5D30A 4MIMA 4DPPA 1SO3A 1R30A 3SZ8A 5AB3A 2AAMA 2X1TA 4GFSA 4N2YA 1LCOA 4EOUA 4LT9A 3TQ0A 2TSYA 3M5XA 3NQ2A 1QAPA 3O63A 4XUGA 3W22A 3S8HA 4MJZA 5BNKA 4EIVA 1RV8A 3W1MA 1RPXA 5K4ZA 3VNDA 4DBEA 3DH7A 2NZLA 2W6RA 2Y89A 3LHWA 1GEQA 4WX2A 4BI7A 3S5YA 4ZQOA 1K8ZA 3UZJA 1R2RA 1D3GA 3W1PA 4WY0A 1XL9A 5CPNA 1X1OA 4P61A 3T78A 3EX4A 4FX7A 3NVTA 4RR4A 3QEZA 3OG3A 4JTIA 4EF9A 3NQEA 3W07A 1O94A 2C6QA 2D73A 1V7YA 1H7RA 3M5YA 2VKZG 1Q6LA 5LHFA 1AW2A 2C14A 1JCNA 3PULA 2YXGA 3OIXA 3ZFHA 2DZWA 1NVMA 4CNOA 1EEPA 2QDHA 1OYBA 3HB9A 4FO4A 2E6AA 4MYXA 1OFEA 1SO6A 1NEYA 3GKFA 2YW4A 4DO5A 2I1OA 4JY8A 5D03A 4GNJA 4QSHA 1D3HA 1F74A 5D2YA 5HR6A 3LXCA 4UCGA 3SR7A 3BK0A 1W56A 3NQGA 1B3OA 2A5HA 3O8AA 3M47A 4IXXA 2VFGA 1KFCA 2CZ5A 4PA8A 3HG2A 4O53A 4JTSA 4LC8A 4Q32A 3PS7A 1LORA 4K8EA 5AHEA 1YDNA 4LRTA 2QJGA 4RZ5A 1R47A 2DZUA 5DBUA 3G0SA 4JX6A 4Z1CA 3N9RA 4O14A 5FF4A 4AH7A 4AVFA 1OFRA 3LM7A 2CZEA 7TIMA 3T44A 2E1DA 2NXGA 2F7FA 3CHVA 4CQAA 4KFOA 4O1DA 4S2CA 3HIJA 1XKYA 3P81A 1C29A 1PVNA 1TREA 2FLIA 4HNTA 2B7PA 3PF3A 4OWGA 4M7SA 3E9AA 3C2RA 3LHYA 3HG4A 3EX2A 2ZA1A 3C6CA 1TRDA 4FX6M 3QSRA 2RFGA 2WO5A 2YYTA 3QH2A 4WOQA 1OF6A 2X1RA 5LNSA 1YDOA 1JCYA 1JR1A 4OV9A 3DFNA 4RJEA 1YTKA 4IQLA 4D2JA 1GJPA 1ZNNA 5AC6A 3UPBA 3QMSA 1AL7A 4P2VA 1H60A 5F2IA 4JD4A 5DCEA 3W7QA 2V5BA 1WA3A 4NX0A 3EXSA 5CG7A 3EWBX 1KTNA 1VGAA 4JN6A 4O50A 3UWUA 3V1PA 1OFBA 1KM2A 3QSTA 1VYRA 2CLFA 4PODA 4N9CA 4U4MA 1G6CA 3UWYA 3CWOX 2QJIA 5FF2A 3TNOA 4O1BA 3FS2A 1JRBA 4PL1A 1K03A 4UTTC 3TSBA 2E77A 3TSMA 3G0UA 3UWVA 4ADUA 5CPOA 3M41A 2YYUA 3MUXA 1VCGA 3WJWA 5I3GA 5F1UA 4C1LA 2WJZA 1TTPA 2R14A 4QJ1A 5L6UA 3M16A 3W2MA 3ZS4A 1M7PA 3EWYA 4M6QA 3W73A 4EF8A 3GDMA 5D2WA 2CWNA 2RHGA 3OVRA 5CZSA 2QCMA 1G4TA 1FDYA 3MHGA 4WZHA 3HGSA 4NJIA 3O15A 4HSOA 3FKRA 1W5MA 3OEXA 5HWMA 2ABAA 3A5FA 2FIQA 2W79A 4UTMA 4POCA 3CQ0A 1AW5A 4LY8A 2Y7GA 3MHFA 2NV1A 1FCQA 4IMGA 3EKLA 1YPIA 3WK2A 3MBFA 2C1HA 4S2BA 1OG0A 1XUUA 4JDBA 1W5QA 1DQWA 4YWIA 1OVDA 4QNEA 1K7XA 3C2FA 1HTIA 3SI9A 4O10A 5G4EA 2ZRWA 3S1VA 3HBLA 5LSMA 1YYAA 4LU0A 1X7FA 3ATYA 1N55A 4YXGA 3PG8A 4H6KA 3TW7A 2B7OA 3ABOA 3KOFA 4K36A 2R91A 1H61A 3G3MA 2VXNA 5DCDA 2WOQA 1H7OA 3W2UA 1YPFA 1FX6A 4JDYA 3SFKA 3U8GA 4E0CA 3BPWA 4RXFA 4IGHA 5AOUA 1PCWA 5AYXA 5HINA 3VE7A 5GVJA 3WK1A 3I7QA 1LLZA 3WJZA 3MYPA 3SGUA 5KMYA 1WQ5A 3Q94A 3LRMA 3P82A 4NXKA 3VCRA 4JICA 3USBA 1LBFA 4UFHA 2TPSA 4LNYA 2JKAA 3ZWTA 1SO4A 1JRCA 1P1XA 3N19B 2NX3A 3P80A 3QMRA 1UCWA 4HPJA 3LI0A 3CIXA 1UASA 2GOUA 5AHIA 3UWZA 5KITA 5KZMA 1H7NA 2VELA 3B05A 3PG9A 3GK0A 3HPSA 4RZ4A 5CZJA 3LTSA 3DFTA 3LERA 4ZL1A 1NF7A 2VEIA 1L6SA 4BK9A 1I2NA 1W31A 3NPWA 4QITA 5LGZA 3P8IA 4K37A 1L6WA 1OABA 1OX5A 2NXHA 2C13A 2NUYA 3VE9A 3LBMA 5HMSA 1MO0A 1WAUA 5FF0A 1ZAIA 5HULA 4UFKA 4JTLA 5DN1A 1R2SA 1LBMA 3DXIA 1U83A 1LYXA 2ZRUA 2QF7A 4O0ZA 3C61A 4LVAA 3CIWA 4MFEA 2VEPA 3B4UA 1ML1A 3I7SA 1I2PA 3ANYA 4YLWA 3O16A 4WD0A 3TQVA 3OA3A 2CW6A 1XDMA 1H1ZA 3DZ1A 1GWJA 4Q4KA 5CSRA 1TV5A 3NZ1A 4XQ6A 1RQHA 3D0CA 2V5LA 3NPVA 4MPQA 2B4GA 4BF9A 3W2JA 1TQJA 1Z42A 4LV4A 1H63A 1WOAA 1ZENA 1QFEA 1MEHA 4YCOA 1BKSA 1WBHA 3QJAA 1ZY9A 3G1SA 3BW4A 3P74A 4TR9A 2QJHA 1TQXA 2AQWA 3O6DA 4NXSA 2J9ZA 1T0OA 1XM3A 3QMTA 2C0AA 5CGQA 2ZTJA 3G3DA 2Y61A 2VFFA 4DXVA 2O7QA 2BLEA 3M44A 3R89A 4IMCA 4JEQA 3NQ6A 3WJSA 2X30A 1IIHA 1PCKA 1I2QA 1VCVA 3GVGA 1K7EA 1DOSA 2X16A 2HSAA 4OHQA 1QOQA 5EL1A 1Q6OA 1SPQA 3MMTA 3BVJA 3DFPA 3LI1A 3N14A 3L5AA 2V9DA 1JCMP 2HS8A 4BI6A 1QPRA 1KW1A 2V2DA 3B0UX 3A24A 3TMQA 3CM4A 4PL2A 3TV8A 3UWQA 3E49A 3TJLA 2VENA 3T4CA 1W54A 1F6KA 2CU0A 1AL8A 1VLIA 2ZA3A 1TV8A 1CW2A 3W2LA 5AC7A 3RFAA 1W5PA 1IGSA 4FX8A 1YXYA 3C4UA 3PSVA 4I7VA 3ABQA 3LTYA 3BLIA 2A6NA 3W9ZA 4MOZA 1XUZA 3W83A 2FQIA 4XBSA 5I3HA 4ZMGA 5HWJA 5G2WA 3BG5A 2J88A 3AJXA 3LTPA 2OZ0A 2V0TA 2VFIA 3W7HA 4QQ3A 2EKCA 4UTUA 4MZYA 3Q2DA 1I2OA 1SW3A 2ZRVA 4L4LA 2R94A 5E93A 3BLFA 1LP6A 2BX7A 5I3FA 4NZFA 5BRBA 1QDSA 1XFBA 3ATZA 3CB8A 2CZFA 2CLIA 3L5LA 4OE7A 2BWGA 4K8HA 5KINA 1ZAHA 1H7WA 4ADTA 4A3UA 3GDRA 5FEXA 2A0NA 4B5NA 4Z1AA 4O4VA 6ALDA 3L68A 2RDTA 4QNWA 1K8YA 5TBOA 4H4IA 1FXPA 2IQTA 1TCDA 2H90A 5I3JA 3IV3A 1EP3A 1QO2A 3UNDA 5K2ZA 2YSWA 1ZALA 1PE1A 3GR7A 4W9TA 5I3KA 2YX0A 1VJIA 2A4AA 5DY3A 3FLUA 4AWSA 2Q3OA 4LW7A 5D32A 1KFJA 4RKAA 1OK4A 5D2XA 3WJXA 2FB3A 4H3DA 1G4EA 1LOSA 3HGOA 2HTMA 4HNVA 3M7WA 4MVAA 4ZQNA 2NX1A 3S5ZA 3TJXA 4ORIA 3GKAA 1SO5A 3TU9A 3I7RA 1FY6A 1DQXA 5AHLA 4QISA 2Y7FA 4OV4A 2RH9A 4GJ1A 4UFIA 3P8JA 3QYQA 3LHVA 4LS0A 1ZCOA 3SJ3A 4WXZA 4IOTA 4AF0B 3HG5A 3KVKA 4WUIA 4RK8A 3C3NA 3UWWA 2ABBA 3RU6A 3NQAA 4PC8A 1P0KA 4LTSA 3QW4B 1Q3NA 1J5TA 2ISVA 3NL2A 4A22A 4JGDA 4X3ZA 1LRQA 1M7OA 3B03A 3TX9A 5K3VA 3W7EA 4R53A 1R2TA 3GAKA 5D02A 2B0MA 1Y0EA 4EVZA 5EBUA 5D05A 2KZHA 3O07A 1F2JA 3RLUA 3C2OA 1NSJA 1OK6A 3UPWA 1XCFA 4UTJA 4UTKA 4XZ9A 4NJKA 4O54A 1A5CA 3C0JA 4JIQA 1TMHA 3DFQA 4CNNA 2J6XA 2VEMA 2OX1A 4LRSA 1HO1A 4AEOA 1AMKA 5LZLA 5C55A 3R8RA 3S1UA 4O16A 3NYZA 2V2CA 3HGJA 3PB0A 1DJNA 2GVGA 1SW7A 4TMCA 5F2LA 3EXTA 2E6FA 3P61A 3B0VC 4K6AA 3ABSA 3QPZA 2ALDA 4R34A 2X1UA 2JK2A 5G2HA 1IXOA 3TH6A 3MJYA 3O6CA 4HN4A 1KM0A 1EWDA 3W88A 3DKJA 2YCEA 3L65A 3BW3A 3LLFA 3A9IA 3NQCA 4O1CA 4BR1A 1EB3A 3OHIA 3Q58A 4TMBA 3FFSA 2E68A 4FEZA 5EYWA 4N9EA 1JJKA 5CKSA 1XBYA 2FJKA 2YR1A 4NVTA 4UUIA 3W71A 2YW3A 4Y6GA 4GUHA 5G1YA 1MEIA 4DO4A 1TTJA 1LOQA 3MHUA 4HIBA 3LCHA 3P67A 3K30A 3TMLA 3S1WA 3O6YX 1HG3A 1MZHA 2Q3RA 2WNQA 3PBVA 3QZEA 4HKPA 4JTEA 4UFMA 3BARA 3PAJA 3LV5A 4IPIA 2ZA2A 1XXXA 3P7YA 3KXQA 3THQA 3RMJA 2DZVA 3EEGA 1ME8A 1WOBA 3W6YA 1VHNA 5D33A 2YPIA 1G69A 5J5RA 2DP3A 1FXQA 4UNLA 3LCLA 4FF7A 2NWRA 3CEPA 3FYPA 2QCFA 4Y96A 2Z1BA 3E0IA 2ZZ5A 3L5MA 2A7NA 3W7KA 3STCA 1PV8A 1FWWA 2QAFA 4FNPA 4LUIA 5U4NA 4RZ6A 1F6PA 3NO5A 1B4EA 1SUXA 5BOOA 3NEVA 3M1ZA 4HNNA 1W5OA 2A6LA 3TXZA 3S9YA 5AYYA 1W5NA 3GZ3A 5BMXA 3QFEA 1GVOA 1H50A 3W7CA 4JTTA 4KWWA 3TC7A 4Y9AA 1PS9A 1TPEA 3L0NA 3KVLA 5CZ0A 3IGXA 2HS6A 5FI8A 5DBTA 1S5TA 3FJLA 4UNKA 3W7GA 3STGA 3E96A 4WY0F 3IEBA 3RLVA 3HGRA 2UV8G 3QQ0A 4ORMA 4N4QA 2WSQA 1A5BA 2V2HA 1IXPA 5H91A 4N6FA 3Q37A 1CI1A 4JYEA 2G95A 1YTEA 4XKYA 1L2UA 3B8DA 2VOMA 4JYFA 3W1AA 4UR8A 3HJZA 5D2VA 2PURA 2YFOA 4PTNA 5LKYA 4O19A 1H7XA 2X2GA 3WJYA 3E02A 4NZJA 4A29A 1E51A 4JX4A 4GUIA 1FWTA 3PC0A 3EWWA 1VZWA 5CZTA 3W7OA 1H7PA 3HMJG 1X1ZA 4FNQA 1JCLA 3IVTA 1UBSA 5FF7A 1OHLA 3NZRA 4MY9A 4O11A 3LDVA 4DELA 2Z2UA 3GR8A 2H3DA 2VC6A 1GTEA 3S42A 3UQNA 4O17A 2CLKA 1S5VA 4GE8A 4A2RA 3AO0A 2YGYA 2GPTA 3FOKA 5E1QA 4AXKA 1KFKA 3GNNA 2A21A 4U28A 3QM3A 5AHNA 4FXRA 3SSJA 3WK0A 3QW3A 5LNWA 4I9AA 2Z6IA 1TYGA 1ZFJA 3LHUA 5K9DA 2NXIA 3W72A 4IX2A 3EWXA 5HR7A 1LLWA 2FFCA 1F05A 4ZQRA 4MJMA 4DPQA 4N6EA 2GQ8A 5A5WA 3H55A 3KRUA 5FF3A 4I7UA 4UTWA 2Q8LA 3PB2A 1VQTA 4QIUA 2CLEA 3LHTA 1FCBA 4NUWA 3W23A 1WV2A 1ICSA 1I2RA 5KSWA 1O4UA 4MUZA 3C8FA 5KZDA 3PVFA 1YLVA 2Y6ZA 2PRHA 2DU2A 3E12A 3GDTA 4BI5A 4FB7A 1IXQA 2ZZ6A 4MLJA 4N9BA 3NOEA 3W3OA 1DL3A 1QPOA 1JQXA 2EF9A 3SIZA 4IX0A 1GT8A 4ZZ9A 1SZFA 2NUXA 3CTLA 2QCHA 5C54A 1K02A 4S1FA 1V5XA 2OT0A 3UY7A 5AHMA 3W85A 4YCPA 1G67A 2I14A 1FWNA 5U7SA 4AF0A 1T99A 3G1AA 3YPIA 4MZ1A 1VR6A 3IVSA 4FNRA 1BWLA 3EX3A 2QUVA 5F2MA 3EXRA 3HPXA 2GUUA 5TQLA 1TIMA 5G2IA 3A5VA 1EWEA 4JXCA 3B0PA 4GXMA 3W2KA 2EGZA 3TIMA 2Y62A 3L0KA 4JTUA 3SECA 1SR9A 1X6UA 3HO8A 1WXJA 1LTDA 1H51A 3PUOA 2GJLA 1W37A 4GUGA 5EKYA 1LRNA 4KKXA 2E6DA 1FCVA 1SZGA 3N73A 3IIZA 5C6MA 2C15A 2HMCA 3PUEA 4O57A 3VFLA 4X2RA 3NAVA 2OJPA 4FIRA 3PM6A 4MKNA 4WQ6A 1GOXA 3W1UA 1M5WA 3FKKA 3U6WA 1TO3A 4AHOA 2GVLA 1Q45A 2R8WA 1EP2A 1K8XA 5EY5A 1LRTA 4Y8FA 4ONVA 3GXPA 1QWGA 3P62A 3G1VA 1UUMA 3HG3A 3PUDA 5F4SA 1H1YA 2O7SA 2NWSA 1FBAA 2QCGA 1R46A 5T26A 4HNUA 2A85A 3LRLA 5LGXA 1TV7A 4ZVJA 4MFDA 4OQVA 4MYAA 2YZRA 3IIXA 5J5DA 1TSIA 4N4PA 3F1QA 1XBXA 4ALDA 2RDWA 2WSYA 2Y63A 3CLMA 5FEPA 3GAYA 5K4XA 1LM1A 2G97A 2DJLA 2YDAA 5KZEA 5F4WA 4A2SA 1TTIA 1KV5A 3KRZA 2ISWA 2JGQA 4UFLA 4AWTA 1TRIA 4GC4A 4NNCA 4UR7A 4DQWA 1FCUA 4NT0A 3NL3A 5D37A 1A5AA 1Q6RA 2GVJA 3FA5A 3TQKA 1BTMA 2JKPA 1YDVA 1OFDA 2W0UA 2V30A 1AK5A 2FB2A 2E5DA 3TXVA 3W1TA 3EKZA 3G8RA 3UD6A 5L9FA 4XKYB 1KTBA 5DELA 2FPTA 3INPA 1SFLA 2ZZ3A 3VI2A 4UIOA 1VH7A 3UY8A 1TPWA 1C9DA 1TPFA 3G1HA 1ALDA 5FEZA 5SWUA 1YADA 2QCNA 3BLEA 1YXDA 1PL9A 2EAWA 4IPJA 3FIGA 5F2GA 4FXSA 1G4SA 4HHPA 3TSDA 2QUTA 3PBYA 5IM51 1K7FA 1DHPA 1A50A 3N9SA 1VLWA 3HPZA 4XWUA 2QKFA 2H6RA 1TTQA 3MYOA 4HPXA 4DF1A 1OFOA 4FNTA 3OVPA 3LCFA 1N7KA 1DVJA 3STEA 3FEMA 1A5SA 2FTPA 3L66A 1TPH1 2DZXA 1TPC1 3TFCA 3W1RA 5FEWA 1OYCA 1RR2A 3R12A 3JS3A 3TROA 4RLIA 1L9WA 1QCWA 1TB3A 3LV6A 4AHQA 3S5NA 5AHFA 4JR5A 3A21A 3W1QA 3LBCA 3MWAA 2NV2A 1GG0A 5MHBA 5DXYA 3HQ1A 4N02A 1XBZA 5LNVA 2ZYFA 4GUJA 2TMDA 4UC5A 3LB0A 4LVDA 3W87A 4FNSA 1ICPA 1U5JA 3KAOA 3RNDA 3LLDA 3W76A 1WBJA 1JCJA 3LOTA 4E2BA 1I4NA 4PEKA 2QR6A 1Q6QA 4NX5A 2QEZA 3LHZA 1QMLA 2C16A 3UZ5A 3W1XA 2WNNA 2A1YA 2E09A 4ZQMA 4UMAA 2Y70A 1ZJIA 1J2WA 3W7DA 4NJGA 4AB4A 2PE4A 1WYIA 3W1NA 2V81A 3R13A 3IIVA 2QUUA 1KM3A 3N3MA 1KFEA 4DF0A 5EA9A 4UTWC 4O4WA 2WPBA 4O52A 3GIYA 3G22A 3C2EA 4NQ1A 4M6VA 2QCDB 3W70A 3ZWSA 1RQBA 1A53A 3P60A 3TR2A 6TIMA 1GYLA 1GQNA 1SSDA 3WFAA 1JULA 1JUKA 2J9XA 2JGYA 1F73A 1QOPA 4BFAA 5TIMA 3KFTA 5LNRA 3W7RA 3B06A 3NL5A 5IBXA 1EIXA 1FDJA 3W7IA 1GVSA 1GG1A 3EB2A 2EPHA 1M6JA 1RD5A 4PCFA 3L9CA 4UFJA 5BMWA 4LC6A 3PWAA 1KTCA 5CPLA 4TO8A 4M6PA 3S0CA 3M9YA 1ADOA 4LUJA 4K7YA 3L2IA 3HOJA 3FJ6A 3MI3A 3NPXA 4ICNA 4XBKA 1GVFA 4R7JA 1NF0A 3C52A 3W7MA 3CU2A 1H62A 1OX4B 3GB6A 1TPDA 3T7VA 3MO7A 2RDUA 3G1DA 4JIPA 3W7NA 4BWLC 4LVGA 4A21A 3LCIA 2NX9A 2TRSA 4O13A 1OX6A 3BGJA 2ATMA 5K9CA 4TX9A 3TUUA 3TW6A 1C8VA 3BV4A 1W8SA 2P0OA 3NGJA 1UJPA 3MP4A 1KBJA 5F4XA 2DZPA 3DAQA 3N2MA 3KX6A 2J9YA 4RX0A 1JVNA 4PFMA 1SQ7A 3N34A 4WXYA 4E2DA 1KM1A 1I45A 2BSLA 4IMEA 3O05A 3G18A 1RQEA 5HWNA 2ZCGA 4CNPA 3IGSA 5CSSA 3FYOA 2J27A 4IXHA 3NXFA 3NQFA 4Z08A 2PCQA 4LWWA 3IIOA 5LNUA 4X9SA 3G1FA 2V8ZA 4FNUA 1HFBA 1SW0A 3NQ7A 1QPQA 3KVMA 2OMAA 1Z44A 4O28A 2WKJA 4OU1A 3DBPA 3I6RA 4JY9A 3TDFA 1VRDA 1KM6A 2CLLA 2H3BA 5DY2A 2QCLA 3W7PA 3H54A 2VFDA 2Y88A 1JCXA 1W3IA 4CCCA 2GQAA 2FPVA 2QDGA 5C5YA 1LBLA 3KRSA 4RXGA 2ZRXA 3DHDA 1IF2A 2V82A 4DO6A 3LCXA 3RF9A 5AN7A 4LS1A 2C3ZA 1OFQA 1XDLA 3OVQA 3DFOA 4MY1A 5BW6A 2ATSA 1SU5A 3G1YA 1X8FA 3EX1A 4ML9A 2OCZA 1DV7A 4JTJA 4NJHA 3NR0A 1G7UA 4GBUA 4PH6A 4NNAA 3DI1A 4CLMA 4FIQA 3O06A 4DEFA 3SY5A 3KHJA 1OYAA 1H5YA 1XBVA 4UXDA 2E5BA 2AGKA 5AFDA 2G96A 4JYDA 4GUFA 2ZZ7A 3I68A 2P1FA 4RCXA 1G7VA 1OFPA 2LLEA 2CFFA 4UMCA 4IJBA 5HUOA 3QRHA 4O0KA 4JS3A 1Z41A 1AG1O 3NQ8A 3A22A 3PSWA 1PIIA 4WJEA 1IXNA 3NL6A 5AC8A 2XN0A 1LZOA 2DORA 1VHCA 4AAJA 1VPXA 1WDWA 1PHWA 3CC1A 3UXAA 8TIMA 3DGRA 4FHAA 3BW2A 3QF0A 2E5CA 2PRLA 2OT1A 2ZZ1A 3GXTA 4GRSA 4CQ9A 4IUOA 1D9EA 3BGGA 3CWNA 2WNZA 2WSRA 1PHQA 3I65A 2BZNA 1YTDA 1GPWA 3G0XA 1VCFA 4ZQPA 5D09A 1F76A 1LROA 4G1KA 3W75A 2QCEA 1FWRA 3LX9A 3M6YA
chains in the Genus database with same CATH superfamily
3B8VA 3NM3A 4XD4A 5BZAA 1W3TA 3VIIA 3PN8A 2CCRA 2BY2A 4LB4A 4DYEA 4M5PA 4UTHA 4M19A 2ZX6A 4IH3A 5CEWA 1C90A 4GCXA 3T9PA 3W7LA 3T2PA 3F2DA 2UY5A 1G94A 1ONEA 3VIJA 5IDZA 4W88A 4E8GA 4PCSA 1KFLA 4IGSA 4C6PA 3IUHA 4O1AA 2NUWA 5I00A 4B4FA 3GXNA 4Z1DA 1TUFA 3DENA 3NG3A 4DYKA 2X0YA 2QJMA 3TA9A 3MSRA 4KFPA 1SSGA 5IBXC 4QAIA 4Z0JA 2XVKA 2FTWA 2DQWA 1OSEA 2VFEA 2GVYA 1P5BA 3EA2A 4TU1A 2Y0FA 1BSIA 2ZBTA 4H7VA 2C19A 3JU2A 1O60A 1JZ4A 4IMDA 1YHTA 4KERA 5IFPA 1XIIA 3NIYA 4IM4A 4TX6A 1TA3A 3JR2A 1VP5A 1OIFA 3TAKA 3QC3A 4AY7A 5D04C 1UIPA 3TYAA 1IEXA 3NQMA 4F9DA 3LRKA 2CIPA 1V51A 2CZDA 3U57A 3S1XA 1B3ZA 3F03K 3RK8A 3OZOA 1EZ2A 4MZ8A 2GUBA 4WF7A 4LV9A 2BODX 1FWGC 3VDHA 1RK5A 2YFNA 1SMDA 1GW1A 2ZTKA 4J2PA 4ZODA 2EKGA 1W1IE 2F84A 2FH8A 1TX0A 4Y90A 5D38A 3QTGA 1MQRA 4IIEA 1SFTA 3THAA 2DZTA 4IISA 5G5IA 2J7GA 2MNRA 4C6LA 4AMCA 3RG6A 1K8CA 1UOZA 1AA1B 3MZNA 4AVNA 4MAZA 1MXDA 2C18A 3GW3A 4GYPA 4QM1A 4OBTA 3S5OA 3VOCA 4JTFA 2XN2A 1NFBA 2QPSA 3W7JA 3U2CA 2BGQA 5FD0A 4C1KA 2ISSA 4QQUA 5A8GA 1TZ7A 4L61A 4UZSA 3OBKA 3LNMA 3EX6A 1TFVA 1EPXA 4M1BA 1XS2A 2VMFA 3MT1A 1LOLA 1HKKA 4A8LA 4N9DA 1E73M 3APTA 4WDUA 1LDCA 2BTMA 4L9XA 4L6OA 1UUOA 4JEJA 1KRAC 1I8JA 2YCKX 3CL6A 2HVOA 3NOYA 5ENLA 3MP3A 4MNLA 4Q6JA 2BOGX 1I0BA 4YTQA 5G4WA 4E2OA 3TKFA 2PUZA 3POCA 2F2HA 1F7BA 1Z8AA 1GW9A 3TK7A 2D1ZA 2VEKA 4GQGA 3S9ZA 2UY2A 4E3VA 3RAOA 1FWIC 2DIEA 4GPNA 1KLZA 1U1UA 1SZNA 2B7NA 1VYSX 4E3TA 1GONA 1UD2A 2Z4GA 4OOUA 3AZRA 3CUFA 3LGEA 4KRTA 1NAL1 1VYPX 1BD0A 5JBEA 2VDGA 3PFMA 1N2VA 3GS6A 1AW1A 2G5WA 3W74A 1JDFA 3P5ZA 4IIGA 3M43A 1ADDA 1OZMA 4O15A 1ZSXA 3RMEA 3STFA 1TMLA 2PGEA 1CXEA 1DJZA 5A94A 3UJFA 3Q4DA 5E0KA 3F5JA 4ZQCA 5DXXA 2B31A 3A47A 2I57A 2RGLA 3VKJA 3UVIA 2FDSA 4HMCA 2GGHA 4WDWA 3UR2A 3KVJA 1L6FA 3RJYA 3T55A 1ZJAA 2A7PA 4O8RA 3UFYA 3VIOA 1IEQA 3W26A 4GGBA 1R8LA 1DKWA 1ODZA 4NNBA 1B4KA 4J3UA 1G4PA 4RV8A 1UWQA 5CBIA 1LJYA 3A13A 1TJPA 3BQ6A 3XINA 3HF3A 3R5EA 1V0NA 2RKXA 3EDKA 2P8BA 1TA3B 5A6BD 2CLMA 1A80A 3FA3A 3RX2A 5K7JA 3QC0A 5JUVA 2CNCA 1UC4A 2VFHA 1ONRA 3RM9A 2PODA 3OLDA 1UR9A 4LSBA 5EMJA 4DPPA 1SO3A 1SJBA 2X1TA 4M29A 4EOUA 2TSYA 4J35A 1JZ2A 4MWAA 4XUGA 2NVCA 3W22A 4MJZA 1LWJA 2FHBA 1RPXA 3VNDA 3UJ2A 4DBEA 2VO5A 3R8HA 5JXQA 4ZQOA 1K8ZA 2ZVRA 5FJPA 3LZ5A 1R5YA 3NEHA 1D3GA 3ZR5A 1JDCA 1U30A 3AWOA 4P61A 4AD3A 1O5RA 3VGDA 1HNYA 3QEZA 1CYGA 2AL1A 1TR9A 3KCOA 1O94A 4S3EA 1Q6LA 1Q13A 5LHFA 2C14A 3PULA 1GKPA 2DZWA 1NVMA 1OYBA 2BG5A 1ZP4A 5GJNA 1R85A 3JW7A 3WH7A 1NEYA 4FZIA 4KPLA 4DO5A 5D03A 4HNOA 4DJDD 4GNJA 2Q09A 1D3HA 1F74A 1KGWA 1JDDA 4J3WA 1RLDA 2ZX7A 1DXIA 3NQGA 3OQ8A 3KBNA 4XBJA 3M47A 3VD7A 4AD1A 1KFCA 2CZ5A 4JPGA 1W9XA 1EJTC 2EPMX 4GQQA 4Q32A 3WQPA 4WKFA 3ES8A 5CCZA 4K8EA 1N8WA 2BFGA 2DT0A 2O9PA 2PCEA 4O14A 4AVFA 1OFRA 3LM7A 2CZEA 4M6UA 3KUMA 3CHVA 4PGLA 4QHRA 4CQAA 2ZXBA 4KFOA 1UPPA 4GVIA 2FMOA 2YLAA 4S2CA 3HIJA 1XKYA 3G6LA 3P81A 1RALA 3M64A 4HNTA 6REQB 3CBWA 4BA0A 2DSWA 2B7PA 3N13A 4AQLA 4GZIA 3LHYA 1ISZA 2W67A 1QATA 3FSUA 1BG9A 2PGFA 1TRDA 4WOQA 1OBAA 4AZGA 3W02A 4Q4MA 5LNSA 1JCYA 1JR1A 1YTKA 2YA0A 2C79A 4IQLA 3RLGA 1A5UA 4RNHA 1GJPA 5I77A 3QMSA 1H60A 1MZRA 5DCEA 2GGJA 4NZCA 1WZKA 4NX0A 3KZPA 4JNZA 1IT0A 5CG7A 2UWFA 3CIVA 3IPWA 1KTNA 1VGAA 4O50A 4B15A 3RCNA 4GACA 3NYDA 4N9CA 1HXJA 1G6CA 3CWOX 5FF2A 3TNOA 3TSBA 3CUXA 3K1GA 3TSMA 3CL7A 4D72A 3UWVA 2DT2A 3CZLA 4K3ZA 3M41A 1A4MA 2WSPA 3WJWA 4DZ5A 2OSWA 1SMAA 5F1UA 4C1LA 2WJZA 1UZ4A 1BWVA 4R85A 5L6UA 3N6JA 4AEFA 3W2MA 4UQ9A 2G3IA 4E5TA 4ICMA 2R1NA 2VNCA 4E2VA 2CWNA 3OVRA 4TVUA 5CZSA 1WDSA 1G4TA 1FDYA 4JZ5A 3UJSA 4WZHA 1WDQA 3APGA 4NJIA 4L5ZA 3O15A 5HMDA 1W5MA 2ABAA 4NZ5A 4MWAB 2DPEA 2W79A 3O3RA 4LY8A 2GUYA 1F3TA 1ZPTA 3MBFA 1FWHC 2P3EA 4S2BA 3MWCA 3HFTA 1R3TA 2W91A 4YWIA 1OVDA 2ACUA 1QU4A 3SI9A 1PX3A 4OBSA 2ZRWA 4LGXA 3SM0A 3HBLA 5IDIA 5LSMA 2EPNA 3ATYA 3PG8A 4H9XA 1H61A 2VXNA 3WL1A 5DCDA 4DUVA 2GK1B 3UG4A 3MPGA 4RXFA 3G77A 4PMYA 1PCWA 4PSRA 3QZ6A 3WK1A 4H41A 3WQEA 5C7HA 1DEDA 4DIAA 1TELA 5KMYA 3WYZA 3VCRA 3H22A 3OGVA 4JICA 1YNPA 3R0DA 3UBPC 2TPSA 4LNYA 3AHTA 5CXPA 5CGTA 3ZWTA 1DWAM 5A69A 1Y8BA 2IPGA 1HJWA 4NYUA 2WKLA 3QMRA 3BANA 3RUBL 2G0WA 3NO3A 3CIXA 4L7ZA 4XAPA 1UASA 1XINA 2WMGA 4FK9A 1JPMA 3ZSSA 5KZMA 1H7NA 2J7HA 3OB8A 3GK0A 3S1GA 3ZVIA 3GXDA 3CASA 3UF9A 1TE1A 1NF7A 2VEIA 4EWJA 1I2NA 3P8IA 4DWSD 1WKEA 4AD0A 1CPUA 4KT2A 2NXHA 2NUYA 4CEUC 5HMSA 2HCVA 4JTLA 4X60A 1B54A 3D6NA 1U83A 2BHUA 5H8UA 5E0FA 2XISA 3ANYA 2PDFA 1P7TB 1VENA 4WD0A 1IZJA 2EPOA 2DZAA 4K8GA 1BKHA 1KXHA 1GWJA 5A8PA 1C92A 3F5KA 5CC7A 1TV5A 1RAKA 3NPVA 3I6EA 4BF9A 3W2JA 4HBKA 2YB4A 1ZENA 3RCYA 1BKSA 3QJAA 2CWXA 3BW4A 4DJEA 2IMRA 3QHOA 3ITYA 1R3VA 1XM3A 5CGQA 1VBHA 4LANA 1C8QA 4IT1A 5I0DA 3V0SA 1AD4A 4NL1A 3AMKA 1BXCA 1F3EA 4JEQA 3NQ6A 3RPMA 3VC5A 3OGRA 2QIIA 3VNYA 1K7EA 1JD7A 3OODA 4OHQA 5EL1A 2Y5JA 4PCTA 4NF7A 2J7EA 2CXEA 1DXEA 5C9UA 2V9DA 2HS8A 4BI6A 1KW1A 3BLPX 2OSYA 3CM4A 4PL2A 4ATLA 5D9PA 3WMSA 3E49A 3TJLA 3T4CA 1JXJA 2DSVA 1TV8A 4EAMA 4KRZA 5HQLA 3S83A 1W5PA 1IGSA 1RY0A 1TR1A 1YXYA 3ABQA 1E0TA 4MOZA 1NWUA 5DMNA 4ZMGA 3UJEA 3BG5A 4C6NA 3H24A 3WELA 3B97A 3UGRA 4UTUA 3Q2DA 3MVIA 2R94A 3WFLA 1S3TC 2BX7A 5I3FA 5HMEA 4NZFA 1US0A 1HIZA 4RPPA 5C9XA 2GJXA 1K77A 2VX6A 3L5LA 2CLIA 4W87A 1XH2A 4K8HA 3W38A 4ADTA 1VFOA 3GDRA 3U48A 3KLKA 4JOMA 4B5NA 3DYPA 4Z1AA 1CXKA 1EC7A 3OZPA 1MNZA 1ZRQA 3HV9A 4QNWA 1MVYA 5TBOA 4H4IA 3VGGA 3IJ7A 4FXFA 5I3JA 2J8FA 4UZUA 3WIJA 1GNXA 3BAJA 1QK2A 5K2ZA 1ZALA 5C71A 3VOIA 3UCQA 3DERA 3A4WA 2EPKX 3WQWA 4I5XA 2X7WA 2A4AA 3WLIA 3ITTA 1HJXA 1A47A 1KFJA 2ZWZA 1J8VA 3BC9A 5HNUA 7A3HA 5FCZA 3HGOA 4HNVA 3O0KA 4MVAA 1XLHA 3F5LA 2X0HA 4WSHA 3ME3A 1Z69A 3WL0A 1FY6A 5AHLA 3UCDA 4OV4A 3VIFA 1JZ7A 4GJ1A 4UFIA 3M0IA 3LHVA 2ON3A 1EIBA 1FP8A 1HKMA 4HVXA 5BCAA 1HF6A 3T0DA 4AF0B 3SY1A 1G01A 3EMCA 1XHGA 3MDUA 3RU6A 4PRWA 4QXIA 4PC8A 1ONXA 2GDVA 2R1MA 4LTSA 3CH9A 3AXMA 4Z17A 2ISVA 3NL2A 3CYVA 2E9MA 4WIWA 3VD9A 3SB0A 5K3VA 3UA4A 2EG6A 5DMMA 4B2DA 1W2PA 2VDIA 2QHAA 5D02A 1RVKA 4B9ZA 1QVBA 5DMYA 1UA7A 3RLUA 3N15A 1TVNA 3RPTA 3NCOA 4UTJA 3OW1A 1JCTA 1ONWA 2PLJA 5CGMA 8XIAA 3QOMA 4JIQA 3DFQA 1S2WA 2VEMA 3SQMA 4JTCA 4LRSA 3SEPA 3GU9A 1AMKA 3RILA 3S1UA 4DLFA 4GQBA 1EQPA 3PB0A 1I9CB 5BU9A 1GOKA 2E6FA 3B0VC 2UBPC 3ABSA 4P5UA 4PBGA 3T2QA 3TH6A 3MJYA 3PZNA 2E28A 2DDXA 4ASTA 3W88A 4WGHA 3WBXA 4ATDA 3NQCA 3A9IA 4A6GA 4KBXA 4HJFA 9RUBA 5CC5A 4N9EA 3D3AA 1YKWA 5GJMA 5CKSA 1U33A 1ECQA 3BZGA 3P2VA 3QR0A 4GUHA 1MEIA 2WMKA 1TTJA 4DWDA 4HIBA 4I6KA 3P67A 2ZE3A 1MZHA 1XIGA 2HE5A 1M7JA 2J8GA 2PD5A 2WNQA 1A5LC 2F2KA 1M01A 4JTEA 4FAMA 5F7UA 3BARA 2MANA 3PAJA 1BGGA 1HJVA 4AIEA 3N2OA 1KBKA 2DZVA 4ZOEA 3KS5A 2NVDA 2IXUA 1MW2A 5H1WA 4U10A 3W6YA 3PJXA 4PBFA 4UNLA 1J01A 4UQBA 2Z1BA 1RA0A 2ZZ5A 3IRSA 2A7NA 3W7KA 1PV8A 3E5BA 3PZQA 1FWWA 3GNOA 1J10A 5U4NA 4L6DA 5M5DA 3CMFA 3AIVA 3T8LA 5BOOA 1QNSA 3ARPA 3NEVA 4F2UA 2X41A 4QJ4B 3ALGA 3TXZA 1XSIA 1XF0A 2GFTA 2YA2A 3D47A 3MU7A 2QXWA 4JTTA 4G9PA 7TAAA 1KXQA 3KVLA 4Q4QA 2HS6A 2OO0A 3WF3A 4ACZB 1VEPA 2JFEX 1S5TA 3E96A 3RLVA 2UV8G 3LPGA 4W8LA 4IGMA 3Q37A 4JYEA 2G95A 4QP0A 2IKJA 2VOMA 2ICSA 3W1AA 3HPFA 5D2VA 2PURA 2E7FA 4LUSA 1Y5WA 4NZJA 1E51A 4GUIA 3PC0A 4HZMA 1WNOA 4D1IA 1VZWA 3UG5A 1H7PA 1E70M 1JCLA 3IVTA 1UBSA 3ARVA 5FF7A 4O11A 4XZMX 4C7DA 3VYLA 3M0KA 2Z2UA 2H3DA 2ZOXA 1EJRC 1GTEA 3VNJA 4DHGA 2WJEA 4LYKA 3SCUA 2CLKA 1S5VA 4R7WA 1H41A 2RUSA 4A2RA 1AZ2A 3AO0A 2YGYA 3WDRA 1KFKA 4NAFA 1XC6A 2XTKA 3KL5A 5A6TC 3WH6A 2Y5EA 3R11A 2E8YA 1ZFJA 3LHUA 1S2AA 3VAVA 4IX2A 1A0EA 3WUFA 2FFCA 4MAVA 1I1XA 4S23A 5REQB 5A8NA 1UC5A 5CG0A 4ZXOA 4N6EA 4KIEA 2ZUMA 3KRUA 4GYFA 1UD3A 4IP7A 4I7UA 3L23A 2EXOA 4YTTA 4M1RA 1IGWA 2ZIDA 1FCBA 3IUIA 4CNUA 3W23A 1WV2A 4FXJA 5KSWA 1EBHA 4MUZA 1HJSA 4TV5A 3GU1A 1PTAA 1ECEA 3R1ZA 1K6AA 2ZZ6A 1UP3A 4ZZ9A 1SZFA 4DJFA 1J12A 4XSLA 3MVTA 4WKHA 2PDKA 3O0FA 1Q6DA 1BPLB 1G67A 2I14A 1FWNA 1XLBA 1XYBA 2HZGA 3E0LA 3PP7A 4MZ1A 2ZUTA 1VR6A 4JIRA 2A3HA 4EPBC 4JN7A 1XGZA 3SDOA 1CGVA 1QNRA 4QX4A 4FS9A 1DWIM 3W2KA 1TV4A 2BGSA 3VKCA 1HZYA 4V2XA 3B9DA 1LTDA 3PUOA 1J6PA 3OBEA 2XYLA 1SJCA 1XQKA 4KKXA 4ZFMA 2E6DA 2BY1A 1AQHA 3MA8A 2RDXA 1E15A 3U4AA 1XYMA 4QG9A 4F3HA 2HMCA 1CB7B 3LEPA 4M3PA 3NAVA 4FIRA 3PM6A 3KOZA 4WQ6A 4ML4A 5JBDA 1JYXA 3U6WA 4AHOA 2DT3A 3SCNA 3QHNA 4UQEA 2X8RA 2D3NA 2I7GA 4ONVA 3GXPA 1UZHA 2E4TA 2EQDA 4LAMA 2Y5SA 5F4SA 2I17A 1H1YA 5AZ1A 1FBAA 2QCGA 1W1A1 3FHAA 4R88A 4ZVJA 3VDGA 4TTUA 3IIXA 1KNWA 4MM1A 3EAUA 1MDRA 2ZUWA 4IJCA 4IFKB 1NU5A 3BOLA 3CV7A 1WO2A 3ES7A 1KV5A 3KRZA 3GY1A 4NNCA 4Z2IA 4UR7A 3WQVA 2QYGA 5D37A 5CSUA 2GVJA 3MJMA 5FJJA 3TQKA 1YDVA 2ZX9A 1E9LA 1R3SA 3PK7A 2E5DA 2PU1A 3SCRA 1EXBA 3W1TA 2C8NA 3G8RA 1Q2RA 1KTBA 2YL8A 3WO8A 3AOFA 3BDKA 4R9OA 1SFLA 1UWUA 1FHDA 3GG0A 1NP2A 4CN1A 5FEZA 1YADA 4Y9MA 4HCLA 2BDQA 2VC9A 4IPJA 1FH9A 5JIWA 3FIGA 5F2GA 1W3HA 4YVPA 4GABA 4J28A 3C86A 1DHPA 1VLWA 2OZ3A 1CGUA 4MB5A 1K9FA 4GLEA 5MKGA 1PKMA 1WDDA 4FNTA 3LCFA 2IQDA 3BAYA 3FK4A 3OVGA 3L66A 1VBJA 1TPC1 1DXFA 4NAFB 3W1RA 1B1YA 2O4MA 4H00A 3R12A 1UA3A 3JS3A 2YBVA 2YL9A 3DCPA 2QV4A 3QZAA 5A3HA 3GIPA 1GG0A 5DXYA 4S3GA 4H83A 1I60A 5LNVA 2OO6A 4P8UA 4GUJA 5EMLA 2EPLX 1PYFA 4B5TA 3POHA 2CBUA 3CJPA 1B3YA 4E8DA 3W76A 1TX2A 4GO9A 2GQ3A 1FOBA 1QMLA 2Y70A 1EJSC 3W24A 3W7DA 4AB4A 1YMYA 3R13A 1JYWA 3N3MA 1K4GA 4UTWC 2WPBA 4DBWA 2W5FA 3GIYA 3C2EA 4CU6A 1IZCA 3D3FA 3ZWSA 3TYBA 3TR9A 1A53A 3MMWA 4G6CA 6TIMA 2OWCA 4UOQA 1JUKA 4GZ7A 1F73A 1OC6A 3U4FA 1KGXA 4YN5A 3S6OA 5LNRA 2PWFA 3AU6A 4W7WA 1CGYA 2YXOA 2VQTA 3W7IA 2IW0A 1V3JA 3AXIA 1GVSA 2JIEA 2OLHA 3EB2A 3VDBA 4PCFA 5BMWA 4LC6A 5FL0A 3WFZA 1KTCA 1ZGDA 3EOOA 1JF5A 3UA3A 4I9JA 3AIBA 2HXTA 3NPXA 1UH2A 2CKRA 3W7MA 1TJ2A 1S39A 2OSXA 4EPDC 4KWUA 3TNBA 4N7QA 4S3DA 4BS0A 2X2YA 3GVQA 3E2SA 3KDOA 4EKJA 5K9CA 4TX9A 3TUUA 3TW6A 2FZDA 4YYFA 4RE4A 1W8SA 2WHJA 3GTIA 3SY8A 3KX6A 3S2CA 1C9WA 2J9YA 1DWJM 4XG1A 3SAZA 1UH4A 1I45A 4IMEA 5TNVA 3E2QA 3CQKA 1RQEA 5HWNA 2W27A 4DZHA 1E0VA 3IGSA 1XJBA 3FYOA 3NXFA 2PP3A 3REQA 4Z08A 2PCQA 4LWWA 5LNUA 4X9SA 3N6QA 2J8TA 3KVMA 4KH2A 3PPHA 3VIGA 3SGGA 2CLLA 1E0WA 4HOWA 2O92A 2XUCA 3EDFA 5DY2A 1JEZA 2QCLA 2C7FA 3V7PA 2G37A 2W63A 4RXGA 1EPVA 1MQQA 1J0ZA 4MG4A 1LT8A 3RF9A 2J13A 2C3ZA 1OFQA 4BZYA 4GI4A 1XDLA 2O0TA 4IPNB 2OZTA 3E1F1 5BW6A 4RV3A 4PTXA 2OCZA 2HK0A 4DLMA 1DV7A 3RN6A 4JFTA 2X05A 1OIMA 3WSUA 1G7UA 2VGFA 3WF0A 4RL3A 4D71A 4FIQA 3C0SA 4ZO7A 2POZA 3SUTA 2WMHA 5MKGB 4LBSA 4DEFA 3SY5A 1XCXA 4PTWA 3ANVA 1XBVA 1UIOA 2EJAA 3CUJA 5I24A 2G96A 3M0VA 1W9PA 3QRHA 3LPFA 1NDYA 1AG1O 3CAVA 4KGJA 4NKCA 3A22A 4DBUA 5FACA 1YE6A 2O9RA 4Z42C 3I3EA 3AWNA 3N11A 2DORA 2I16A 1PHWA 3GD6A 8TIMA 4QSFA 3LA4A 1OWQA 2RGMA 3SBFA 2DW7A 3QF0A 3Q45A 4PMJA 1NH6A 3GSMA 5H8MA 3GXTA 2YJQA 3BGGA 3PZVA 1GQLA 3I65A 1SM9A 3IS4A 1GPWA 3QGAC 4QCFA 1JGMA 1ZUAX 2FGZA 2R82A 1T8QA 2AQVA 5CAHA 1LL6A 1E56A 1LT7A 2VWTA 1GYNA 1O1ZA 1QO5A 1V8EA 1EYEA 1THFD 4LS2A 2NT1A 1JDAA 1DJQA 3GTXA 2QUMA 1EP1A 4QDMA 5D9OA 5EMUA 1MW0A 4XTIA 3T81A 2PLMA 3W84A 5HQEA 5F1VA 3CB3A 1OC5A 1WZLA 3NZGA 4GQ0A 2PGWA 3EWUA 3GM8A 3BG3A 1C91A 1W1ZA 2XVGA 4L1GA 3LXAA 3CO4A 4XVDA 3BCDA 2BS9A 1KCKA 3DI0A 4JTKA 3BAIA 3AYRA 4K7VA 1PYMA 3LCGA 1J4EA 1KBIA 1ME7A 1VC4A 5CPQA 3F4WA 3LU2A 3CV2A 2ZRYA 3V1HA 2I56A 4PB4A 2GJNA 3MSYA 3ZR4A 3NA8A 1DJXA 4CQCA 4L4PA 1P0NA 3BLLA 1RZMA 3GFXA 4MJ4A 2W3ZA 3H23A 3DESA 3VKKA 4EE9A 3U2ZA 2EG8A 5HJLA 2OG9A 1TUXA 3GE7A 2B7QA 4F0LA 1OFAA 1QI3A 1ZCCA 3SW6A 1QR7A 3CAQA 3REQB 2J24A 5TF0A 1K1DA 2E9BA 3AHYA 1P0EA 1RJRA 2CLOA 2PDBA 1R3QA 3EWZA 4QE5A 3L0GA 2AMGA 2XIMA 5EBAA 3AUJA 4O18A 4UTIA 4EXBA 4Q33A 4HTYA 2PRMA 1M03A 1OCJA 5C2XA 4Z0SA 2CLHA 5H6HA 3W86A 4A05A 3SGZA 4EANA 3BMWA 3BSGA 4XD6A 5DMLA 4JX5A 4Z1BA 3L67A 3OLGA 1FFQA 2RJGA 1FWBC 4CU7A 1XRFA 2EHHA 1HL2A 1E4NA 5G4HC 5FAGA 2VR4A 3W1LA 4ZE5A 1EA0A 4GI9A 5K9XA 3GYEA 2NQ5A 2P53A 1OF8A 2CESA 4IMFA 4I9MA 4RPQA 3NDOA 1F3XA 2JKEA 2XH7A 4KESA 3FDKA 3QGKC 4J5NA 3PTMA 4GXPA 4E4FA 1UP0A 5CPMA 2XVNA 2A7RA 3NQVA 1DJYA 2QPXA 2VX4A 2A2IA 1ME9A 4AXNA 2Z7GA 3RCMA 4REQA 3EBVA 4RUBA 5HXMA 5C9WA 5LYRA 4W7UA 1S46A 1TPVA 2C1GA 5DRIA 1LQ2A 3BOXA 4H9YA 1FWSA 2FPYA 4K39A 1M1BA 4ADSA 1MXSA 1KLYA 1M68A 4GZJA 4JFSA 3OIHA 2QAPA 3F4NA 1YXCA 2WZIA 4RW5A 1VRXA 3W81A 1U22A 3U3HA 3KOXA 3G8EA 3AALA 1UKPA 3U2OA 2AQOA 3IIPA 4CGTA 1PAMA 2PTWA 1K3UA 4ZA0A 4DJED 5EPDA 4XZWA 4CQ8A 4JQ2A 3NM1A 4ZCWA 1KA9F 3C2VA 4AW7A 2H8XA 3VOJA 1T96A 3GQYA 3S6DA 2ZDRA 2NQZA 1HO4A 1EDQA 5AYZA 1MEWA 3BMXA 4PUNA 5JU6A 2WVSA 2HDJA 3LPPA 3P84A 4M7TA 4K1GA 1VBUA 3HURA 1DP0A 1I75A 4AC1X 4RE2A 1S1RA 3MQTA 4KQNA 2YA1A 1A49A 1KCLA 1VF8A 1FUYA 3LQGA 1W0MA 3GH4A 2JEPA 2F8QA 4YL2A 3ELFA 4UTLA 3TC6A 1A0CA 3MV01 1FQ0A 1DIEA 3L21A 2PC4A 3ONBA 4H7ZA 3AHZA 2XFFA 4XX6A 5GQBA 3BO9A 3ARTA 4X22A 5D30A 1OGGA 1R30A 3SZ8A 3UERA 3SN1A 1EKOA 3ISIX 1QAPA 2PWEA 1N8IA 4KETA 3S8HA 2J77A 1RV8A 5DQPA 2OB3A 1QW9A 3DH7A 2NZLA 3C2YA 2DSKA 4BI7A 4BCEA 1M3UA 1LLOA 3ZIZA 3UZJA 4Z2KA 1R2RA 4EP8C 2OFJA 1IR1A 4WY0A 1XL9A 1X1OA 4JIHA 2Z2BA 3T78A 1JPIA 2HISA 2CHOA 3W0KA 3TC3A 3F4DA 3H2FA 2DIJA 2QW5A 5BRQA 2MUCA 3NQEA 3W07A 3S2MA 2D73A 1V7YA 2OYKA 4PUUA 2VKZG 4IIBA 4GHRA 1AW2A 3T1GA 2YXGA 1UR1A 3ZFHA 3KE0A 4GISA 1OFEA 3GKFA 2YW4A 3RU8X 4PRRA 1XLCA 1V3LA 3MUIA 3LXCA 3LGDA 4UCGA 2CKSA 1D7KA 1RPKA 3NSNA 3OYZA 1HW6A 3PJUA 2A5HA 3O8AA 3L4XA 2VEGA 3LQLA 2EG7A 4O53A 4LC8A 1E9ZB 1XIFA 4M0XA 4OTKA 4KRUA 2JIWA 1Q5MA 2ACSA 2DZUA 3BAWA 4A3YA 3G0SA 3GU2A 5FF4A 1V3IA 2VD8A 4V15A 7TIMA 2E1DA 2NXGA 2F7FA 3CUGA 4O1DA 4GY1A 3LMZA 3M0HA 1WP6A 2PF8A 4WVXA 2XINA 1PVNA 1TREA 2FLIA 2JF6A 4QBXA 4OWGA 1Z7AA 3TJ4A 4PR4A 4B2DD 2PBGA 3HG4A 3TONA 4IMAA 2WBGA 2ZA1A 8XIMA 4FX6M 1EGMA 3QH2A 2PF0A 3J7HA 1ZB5A 1YDOA 4RJEA 4J27A 3UT0A 1ZNNA 3UPBA 1AL7A 4P2VA 4OUEA 4JD4A 3W7QA 1WA3A 3EXSA 3LSBA 2ANUA 3EWBX 3UWUA 3V1PA 4RNJA 2WW5A 3QSTA 1VYRA 4AU0A 1B3WA 1RCQA 4PUJA 3IV8A 3FS2A 1JRBA 4UTTC 4H9VA 3VUPA 3G0UA 5A2AA 1Y65A 2HROA 2J7FA 1VCGA 5HJXA 3ZS4A 3EWYA 4M6QA 3CGTA 1QRQA 1SJDA 1GVYA 2RHGA 1GPFA 3VINA 2QCMA 2VUNA 4CCZA 1GOQA 4D6DA 3MHGA 2XJ7A 1SJAA 4HSOA 5HWMA 2Z29A 5C2CA 2WK2A 3O9NA 2V3FA 3MSDA 3QTPA 6XIAA 3CQ0A 3MHFA 2NV1A 1FCQA 1K9TA 4IMGA 3VGFA 4ERAA 1NDZA 3WDIA 2YDRA 1W5QA 1VD6A 1DQWA 3C2FA 3W29A 5LA2A 1B2YA 1Z9AA 1YYAA 4LU0A 4HK6A 3TW7A 5BXRA 3AMDA 2V5JA 2YOCA 3W6MA 4K36A 2R91A 4DUOA 3VIHA 3SCWA 1N82A 1WE5A 4L9YA 4E0CA 5I5RA 4L6HA 1XW8A 2R24A 2V68A 5AOUA 5AYXA 5HINA 3I7QA 1LLZA 3GBEA 3LM3A 3XISA 1XIJA 1NOUA 3LRMA 4NXKA 2OKOA 2DVXA 1LBFA 3HA1A 2JKAA 1SO4A 1JRCA 4U31A 1P1XA 3N19B 3P93A 2CZVA 1XRSA 3P80A 5DRCA 4DX3A 2XM1A 2Y1HA 3BV7A 2X7VA 1H11A 3UWZA 3WLMA 3B05A 1GZ1A 3PG9A 2D23A 4HYVA 5CZJA 1CT5A 2BXYA 1BVWA 1EOKA 3LERA 4ZL1A 2ZWYA 1W31A 3NPWA 1LG2A 5A8OA 1VEMA 5JH1A 3K4WA 1L6WA 1Q6CA 1DJIA 2G8ZA 2UZ9A 1TJ1A 1UMLA 4GZEA 3ARXA 1PZ2A 2C13A 4IP4A 3VNZA 7REQA 1UW9A 2HJPA 1ZAIA 2A3BA 5LIXX 4Q8OA 5DN1A 1R2SA 5CBJA 1LBMA 3DXIA 1XIDA 2PA6A 1V6XA 3CPGA 1WXZA 4LVAA 1JXKA 1ML1A 4A3HA 7XIMA 4DZAA 3I7SA 1E5JA 2CW6A 1ZU8A 1H1ZA 4HCHA 5CSRA 5B7YA 4J7RA 3QN3A 2V5LA 3LN3A 1OCQA 3KHDA 4MPQA 1A3HA 5AC4A 2B4GA 5E09A 4GI6A 2W66A 4LV4A 3TWAA 4LCSA 2YL5A 1MEHA 4S3BA 3M0MA 1ZY9A 2YLLA 3P74A 4TR9A 3O6DA 2AQWA 3C0QA 1WKYA 4NXSA 2J9ZA 9XIMA 1SFSA 4AX6A 1XH0A 2FDMA 1T0OA 3QMTA 2ZTJA 3WDPP 3N12A 4YS1A 4W8BA 1JNDA 2BLEA 1PWLA 4S3CA 2WCGA 3NURA 3WJSA 4DJFD 1O6IA 3ZT6A 2X30A 1IIHA 1PDYA 5I23A 1PCKA 5AECA 4CD8A 4NZ3A 4Z2GA 1NIUA 3VD3A 2G4JA 1QUMA 3WCZA 3N4FA 4GNKB 2X16A 1UHVA 1FWAC 1SPQA 4H8HA 3BVJA 3G6MA 2BVDA 3APYA 1DWGM 3L5AA 3QHMA 4IIHA 1V0LA 4F2TA 1BAGA 2V2DA 3OHMB 3PJWA 3TMQA 4JN8A 4GVGA 4QDWA 1TMQA 3VO0A 1W54A 2WXDM 4C90A 3ZVHB 1AL8A 3CQHA 3SN0A 3SUWA 3OP2A 3P6LA 2HNHA 9CGTA 3IJIA 5LIKX 4AYSA 4I7VA 2ONEA 1J2BA 4C5YA 3W83A 2GGGA 2V5KA 4XBSA 1OT2A 1E71M 3B0YA 2J88A 4ZTXA 2UY4A 4QG6A 2DW6A 2OZ0A 2OEKA 2VFIA 3W7HA 4QQ3A 4DWSB 1DWHM 3FXYA 3SN4A 4MZYA 1SW3A 2QF8A 3AS3A 2O56A 3BCFA 5E93A 1IQ8A 3B8IA 3BLFA 3QKEA 3M6DA 3VGBA 4PE8A 1ENUA 4WKAA 3ATZA 1DIOA 4BEUA 3SFWA 3EKGA 2CZFA 2CHRA 5BU6A 3SRKA 2BWGA 4J1OA 5KINA 1H7WA 4A3UA 1HKVA 3H70A 2A0NA 3E0WA 2WPGA 2QQ6A 4O4VA 2PTZA 3L68A 1K8YA 3S2JA 3R0KA 1UROA 1J5SA 4Q8TA 3IV3A 3GR7A 2YX0A 4FLSA 2W4XA 4C7FA 1HVXA 2Q3OA 1EBGA 5D32A 3K8KA 4J4KA 4RNFA 1VBGA 4RKAA 1QNPA 3WX7A 4RW3A 5D2XA 1W2VA 3WJXA 1C8XA 9XIAA 4FOKA 2DUAA 3WNLA 4ZQNA 1ITCA 3AIRA 1GYMA 3GKAA 1SO5A 3TU9A 2ZUVA 7REQB 3I7RA 5DEZA 1DQXA 3WQFA 3WQDA 2RH9A 4AZ6A 3QYQA 2KX9A 4UNIA 4LS0A 2YIHA 4AZCB 2OXNA 4NAEB 8CGTA 1FRBA 3AYVA 4WUIA 4RK8A 1V6VA 4A8RA 2YDQA 4MSSA 2OYMA 1EHAA 1TVPA 1FFRA 2QVHA 3UVAA 1JF6A 3B03A 3LMYA 2X40A 3QV8A 3WKZA 3QBUA 1Y0EA 5D05A 2A3AA 3VABA 2KZHA 1U1JA 3M46A 1TKKA 5BWFA 2PDMA 4MDOA 4FI4A 1NSJA 1OK6A 3S47A 3UPWA 1XCFA 3QLLA 4XZ9A 4NJKA 1V6TA 1A5CA 1EC9A 4ECLA 3KOYA 2OX1A 3DC0A 2OOFA 4HYWA 5LZLA 4ZOAA 3LBOA 3GVVA 3R8RA 3W27A 2OELA 3PPGA 5BXPA 2WYSA 3PZIA 3HGJA 1K9EA 2EJ1A 1DJNA 2GVGA 1SW7A 5F2LA 2VX7A 2RJHA 3O6AA 3P61A 4K6AA 2ALDA 4NRSA 4R34A 2V3GA 2WKGA 4I3GA 3DUGA 1E6SM 5HJYA 4HN4A 1V0MA 4I90A 1KO0A 1I6NA 3DKJA 1EX1A 4BR1A 3LGGA 4R9XA 3Q58A 4TMBA 3T8QA 2E68A 5EYWA 1X8CA 2XZ7A 4FOJA 3CMJA 1W3LA 1VFMA 1ZQ5A 5M1TA 5I06A 5G1YA 1KR1A 1YIXA 4Q4OA 4DO4A 4H2CA 5IFTA 1LOQA 1JDEA 4JKKA 3MHUA 4AD5A 1E0UA 5A95A 4M82A 3PBVA 1JPDX 4HKPA 3EPMA 4CD4A 4UFMA 1I0DA 3R7MA 2YCLA 3FHQA 3R94A 4DXXA 2GJPA 4J3VA 3THQA 3TN6A 2NLYA 4XIMA 4PTDA 3W53A 1WOBA 4GMEA 1IWPA 1B3XA 2O55A 2PDNA 3VZZA 5J5RA 1B30A 3LCLA 4AY8A 4V28A 3NJ3A 1UH3A 2WVVA 1P0DA 3CV1A 4Y96A 3L5MA 4JKLA 5KZ6A 3JZUA 2WHLA 2PTYA 3VGEA 4DI8A 4RZ6A 3NO5A 2ZXDA 5C8BB 2SFPA 1OGBA 3UYIA 2G3JA 4B5UA 1Q7ZA 3S9YA 5AYYA 1YDYA 4Y2WA 1KWKA 1XIBA 1W5NA 3WN6A 3GZ3A 3N1AA 3QFEA 4KWOA 1GVOA 3SUUA 3HV8A 2FGBA 3W7CA 3PTQA 3AYTA 4HHLA 3PZ9A 3L0NA 3S5SA 3EA1A 5CZ0A 4GH1A 5DBTA 1OZQA 4WY0F 5DX7A 3ARUA 2Z2AA 3QPEA 4N4QA 5FIPA 2V2HA 2XSAA 5FJTA 3IWPA 4DJDC 1L2UA 3ARYA 3S46A 1AJ0A 3WEZA 3WNKA 1VPQA 2QNEA 4TUFA 1ZP3A 3TYEA 3WLPA 4MF4A 7CGTA 4O19A 5LKYA 1QTWA 1H7XA 3WJYA 1QT1A 1R3RA 1GQJA 1R9ZA 3MTWA 4A29A 4GA8A 4PMDA 2CXGA 1NQ6A 5ECUA 3HMJG 4G8TA 3FEQA 1X1ZA 3VOFA 3LDVA 1BFNA 1E9IA 2ASHA 3S42A 3MANA 3LUTA 1RJPA 2DY3A 4PFHA 3CMGA 4AXKA 3GNNA 2IXVA 4U28A 5I09A 1B5TA 3IARA 3WMLA 4D8AA 3C8NA 3K13A 4HJWA 1WPCA 2W61A 3H2EA 1EFZA 1CXFA 4JIEA 1TYGA 1XD1A 5CAKA 5K9DA 1QK0A 3B8TA 3KP0A 4O1EA 3EWXA 1OD0A 2Z7KA 3EMQA 1OB0A 4GNVA 4Y8EA 4DPQA 1DPMA 2BP1A 5A6KA 4RE0A 1LG1A 5A5WA 2GQ8A 3GUGA 3DDMA 3ZMRA 4OZOA 5FF3A 3URNA 2DFAA 4EPEC 2CLEA 1ADSA 2XVPA 3LHTA 4NUWA 2TAAA 1M9HA 2J75A 3C8FA 2Y6ZA 4GI8A 1J93A 2DU2A 3VOGA 4FB7A 1IXQA 3NOEA 3R6IA 1ZJBA 4Q8MA 3EOLA 2PZ0A 1QNQA 3WQ8A 2OT0A 3TYUA 3PTKA 3W85A 5AHMA 3FAXA 3EOUA 1T99A 3G1AA 1UQZA 4YIWA 5BROA 5F2MA 3HPXA 2IKHA 5TQLA 5G2IA 3A5VA 1EWEA 3I3BA 3UEQA 1S2UA 2EGZA 4JTUA 1SR9A 1X6UA 5HMFA 1J96A 2EO7A 2YCLB 2PDWA 2HNEA 1VIZA 3OO2A 3AU2A 5EKYA 1LRNA 4YTRA 1SZGA 3MCMA 4P8XA 3JZEA 2ZADA 3IIZA 4LUYA 5I2UA 2XM2A 3W82A 1K9DA 4W93A 4N0RA 3AAMA 4HU4A 2HXUA 4MKNA 4GQRA 3FKKA 2BY0A 2VURA 3QV6A 2WVVB 1Q45A 1KD0A 1O5QA 5EY5A 4MB1A 3RM4A 4Z2JA 3G1VA 2XWEA 1JG9A 3ITCA 5AYIA 2NWSA 1XYLA 1R46A 5T26A 4ZGYA 1JAEA 1YBQB 1VB9A 3PAOA 4MFDA 3QY6A 5A6SA 3TN4A 2RDWA 2Y63A 3CLMA 5K4XA 1LM1A 2G97A 3UGVA 2YDAA 3GR4A 3WD0A 5F4WA 3P14A 2ISWA 4UFLA 3WNOA 4AWTA 4DQWA 3NL3A 3QXBA 2WLYA 4YHEA 1A5AA 1Q6RA 2HVMA 1XP3A 1FKWA 1Q4WA 5HPCA 2VCCA 2FB2A 3UG3A 3UD6A 5DELA 1KRMA 2FPTA 5I78A 4ATWA 1ZBVA 4UIOA 2YL6A 3UY8A 1TPWA 4LY4A 1HN1A 3G1HA 2QCNA 3NZPA 3QQWA 5E70A 3BLEA 3GHRA 3NO1A 5EGRA 2OLSA 4W5ZA 1TWDA 4LALA 3N25A 2GOKA 1G4SA 4JTAA 3E0VA 4HHPA 4ZTYA 2QUTA 1ISWA 1A50A 3BAKA 2CITA 3N9SA 4CKQA 3PJTA 1RA5A 4IQEA 3FCPA 2G3FA 4H6EA 1EQCA 1TTQA 4PCPA 3OVPA 3N9KA 4B3ZA 3STEA 1DVJA 3FEMA 4F2BA 3FSTA 3KBWA 1OYCA 1Y5VA 1TB3A 3OBAA 3LV6A 3S5NA 1ZBKA 1OY0A 4Q7NA 1UWSA 2NV2A 3A64A 1TIWA 2ZYFA 2BMBA 3LB0A 4LVDA 4AD2A 1WDRA 4FNSA 3ECQA 1U5JA 1XWYA 3KAOA 1WBJA 2P50A 4H04A 5C0QA 3QY7A 3GC2A 1Q6QA 1Q63A 2EEXA 2WNNA 2Q01A 3F7JA 4ZQMA 4HK7A 1ZJIA 4H2HA 2PWDA 4ZR8A 3MUAA 2E1WA 3W1NA 3GRIA 3FJ4A 1KM3A 3PWGA 2VM8A 2INFA 1F6YA 3SQLA 4HU3A 3G22A 8A3HA 1EDTA 5E9XA 3TR2A 3PNZA 1GYLA 1UKTA 2JGYA 2J9XA 4XSMA 2BV9A 3W7RA 4ZE4A 4F66A 4IG2A 3NL5A 5IBXA 3MCNA 1BF6A 1EYWA 2EPHA 4LF2A 1UP2A 4TO8A 4M6PA 1GKRA 4FPSA 1AQFA 4XZHA 5D9MA 3AHVA 4XBKA 5GJPA 1GVFA 3P0XA 3WF4A 1H62A 5FJOA 1PB0A 3HQOA 1H4PA 3IJ9A 5M2FX 1KXVA 1AQ0A 3UU0A 3NSXA 3T7VA 3CYJA 3G1DA 1GZJA 4LVGA 1UQYA 4A21A 2VP8A 2TRSA 4WSJA 1NOFA 3WF1A 2ATMA 1PX8A 4B91A 3NGJA 3MP4A 2YZ5A 3CO8A 3DAQA 3H4GA 2HK1A 1JVNA 1SQ7A 3QYSA 1OEPA 4TXEA 4DZIA 1TJ0A 1KM1A 2BSLA 2P3ZA 4XVEA 3OZYA 5CSSA 4G1NA 4IXHA 3I4EA 2BASA 3NQFA 3N4AA 3IIOA 3G1FA 1EJWC 3AJ7A 3BSMA 4MPKA 1AUSL 1QPQA 4O28A 3TLQA 3ZLFA 1ZL1A 2WKJA 3I6RA 4JY9A 3TDFA 3MMUA 2VFDA 1W3IA 3THDA 4HOXA 4M80A 3WBEA 3DHDA 2V82A 1JZ5A 4AZBA 1FWJC 3LCXA 3ID7A 3TTYA 3A3WA 3AXHA 3HPAA 5AN7A 4W8AA 1AH3A 1KCZA 3DFOA 5RUBA 5D9NA 1SU5A 1X8FA 3E3HA 4CVWA 4ML9A 4JTJA 4PUEA 3NR0A 4GO8A 3VDAA 4C5ZA 3S2NA 2J47A 4WCJA 1IWAA 3SCQA 4BQ2A 2W62A 3O06A 3EB3A 3DYMA 1H5YA 1YNYA 1MUWA 4UXDA 3H2MA 4C6EA 3TN3A 1WDPA 4J3ZA 3WQCA 4JYDA 2ZZ7A 3UXKA 3I68A 1QHOA 1VFFA 1PO9A 4U3AA 2HWGA 1C7TA 3K46A 4IJBA 2DUXA 1BRLA 3A4XA 3DC8A 1PIIA 4C6MA 4WJEA 1IXNA 5AC8A 2NQJA 3FW6A 3R58A 4G2DA 3V16A 2J4GA 5E0CA 3DGRA 1Q6FA 3KTXA 2BVWA 4RDZA 1IV8A 3O2LA 4HPHA 3OYXA 5LXEA 2INZA 3MMDA 2IPWA 1TV2A 3CWNA 2WNZA 2WSRA 1BYDA 3OLIA 2XIBA 3WDQA 4JAWA 2BZNA 1GOOA 1JZ8A 2JF7A 2O4QA 4JQ1A 5FOOA 2WLZA 3SCSA 1FWRA 3UZWA 3TTOA 3M6YA 3EDDA 2DV0A 3TP4A 3ENLA 1RY8A 2H8ZA 4J3TA 1XYZA 1GKQA 5LHEA 5TD4A 3ERPA 1KM5A 2X1IA 1IR2A 4TVDA 2VZVA 3T6CA 4O1FA 4C65A 4CCDA 3V5CA 1POJA 4HT3A 1QPNA 3B8SA 1BXNA 4QDPA 4OECA 1UYQA 1NDWA 1DBTA 3K8LA 3QQ1A 4W4QA 4GKTA 3R2GA 1JUEA 3NQDA 4AWUA 2X1SA 3CHEA 1CECA 3LCWA 2H9AA 4MNMA 1HJQA 3ITVA 1E6XM 4GYKA 3BJFA 1RVGA 1HKWA 4GG9A 4HYRA 1TPUA 3PZGA 4MY8A 4YMZA 1O95A 3WQ5A 2JBMA 5FJRA 4L4MA 2DT1A 5FESA 4AZ5A 3WEMA 4PTVA 4MGGA 1G1YA 4B9YA 1XKJA 3NDYA 4H1ZA 2DSUA 3P5YA 1D2KA 2WZEA 5CJMA 2R1KA 3ARZA 2G41A 3DHFA 4OT7A 1ELSA 2PFHA 1FHVA 1GVIA 1B3VA 3VM5A 3O1NA 3VIPA 3IGUA 3KBSA 3EWCA 3G1XA 3SCVA 4DF2A 5ABTA 3A4JA 1S3HA 3UXDA 1S5WA 4GC3A 5FJIA 3LXBA 2R1PA 1SFJA 3WLHA 3MI6A 3H12A 3EDEA 3GX9A 3RITA 3BG9A 2GGEA 1C7SA 2QCDA 4LVFA 2OKTA 2NLIA 1EXPA 3M5ZA 3N2XA 4XAGA 1F4AA 1GQKA 1ZHAA 5MF5A 1NWSA 1UKQA 3GNPA 4NP7A 4P7LA 2Z25A 2DJXA 4LBUA 2DEPA 1PX4A 4B92A 1H3GA 1W6TA 2XFWA 4ZO8A 3PR2A 2D3LA 3IVUA 2WM0A 3QV7A 5HUPA 2D0HA 4YVXA 3TCEA 4TTGA 4F8XA 2BOEX 4HHHA 1QXLA 4DBDA 2OWWA 4UQCA 1V6WA 4Q6XA 3GTHA 2Y7EA 1JYVA 4J40A 1MSSA 2Y8VA 1OX4A 4NJJA 4JTDA 5EFFA 2AKZA 1EGZA 2VCBA 3G24A 2J7BA 3MI2A 5DT5A 4CCEA 1P6BA 3N2BA 3T0BA 2QUNA 3DFSA 4ES4A 2ZVIA 4E38A 4BJHA 3BLDA 3GDKA 2ZZ2A 4UMBA 4XIAA 5DLCA 3CNYA 1H09A 1BRLB 1FWCC 1SZEA 3ZYZA 3LK6A 4ZB0A 3BJSA 4H19A 3U2EA 4IQDA 5H2ZA 2Z0IA 4U2YA 4JHMA 4ZB2A 5HNRA 2GLKA 3WG6A 1WX0A 5C2GA 3L4UA 3WNNA 3B4YA 2CBIA 4WOZA 1N8FA 2I9EA 1V3KA 1IT7A 1HUVA 3AZSA 3GXFA 4TVCA 5HK4A 1E1EA 3H4WA 2BB0A 2D2OA 4TIMA 1JUBA 2ZUUA 3T05A 4LVBA 4NU7A 4IPPA 3C56A 4JQ4A 2Z24A 1O5KA 4PSPA 3BQ5A 3M07A 4R27A 5LIWX 4W85A 1MQPA 4EXAA 4A3RA 3GHSA 3NWRA 3BTNA 3AS1A 1K70A 3R25A 2PGRA 3USZA 4EPKA 2WBKA 2NQ9A 4FLRA 1JI2A 5D2TA 3RO6A 1ZAJA 3JRKA 3TFXA 1CNVA 4QJ3B 4US6A 1KFBA 1UR3M 5FSDC 1X38A 1RLCL 3CPRA 4L1XA 2H9AB 4J9JA 1PSCA 4D8ZA 1GVQA 3F4VA 4UOJA 2Y4SA 3CUIA 1KV8A 3UCCA 1Y5XA 1V79A 4KS0A 1Z48A 4DN1A 1FH8A 2PBOA 1GGOA 3DIPA 4R7OA 3WUBA 3TAOA 3ITXA 3QV9A 4MLRA 2E40A 4PUKA 4K38A 4KFNA 3GLCA 3GNDA 3TE9A 3DKLA 5IHSA 5I07A 3B8UA 1QWKA 2P10A 3EEZA 3BAXA 4YU1A 2QDDA 2AAMA 4TOQA 1LCOA 4LT9A 1CXLA 3M5XA 3PHAA 3LS9A 2F9RA 4Q8UA 3VKDA 3VDCA 1ZLPA 1XG3A 4EIVA 4PMVA 1S2VA 4OIFA 3MCOA 2Y89A 3LHWA 1GEQA 2GWNA 2WMJA 2QT3A 2WVTA 3RLHA 4ZO9A 4FA3A 4GK8A 3W1PA 1B0IA 1LWHA 3NVTA 2YBTA 2PI6A 3OG3A 4DY1A 4JTIA 4EF9A 4XZLX 4UBPC 1BSLA 2IPJA 1IE7C 4M8UA 1H7RA 5T9BG 3L4VA 3M5YA 3CLWA 4L64A 3HB9A 4PRTA 4AY1A 2E6AA 4MYXA 1Q7MA 1SO6A 1HGYA 2I1OA 4JY8A 4YVVA 4CD7A 3SRFA 3SR7A 3BK0A 1B3OA 2VFGA 3WMBA 3GTFA 5M03A 1D7FA 3HG2A 3E38A 3DN5A 1EF2A 4JTSA 4XAYA 3GC5A 1MW1A 3KTSA 1LORA 3CZEA 5AHEA 4RZ5A 1E6ZA 3WENA 5DBUA 1E3XA 4JX6A 3V35A 2IS7A 1YW1A 3N9RA 4AH7A 1U5VA 2E9LA 3T44A 2WZHA 3NTYA 2QDEA 3SQSA 3SADA 1Z3NA 4MNKA 1CGXA 4AIUA 1C29A 2V5CA 3LENA 1PEZA 4ERIA 1TE6A 3PF3A 3N4EA 4M7SA 3ABXA 4ZFCA 2PLCA 4YTSA 1J0KA 4K68A 4X0VA 2FVLA 4XAFA 3C6CA 3GWQA 3QSRA 4YPJA 2VRQA 1OD8A 2X1RA 3BJTA 4XD5A 2Q8XA 2DVUA 4OV9A 4D2JA 2Z1KA 5AC6A 3N29A 5A8QA 4AC7C 2GL5A 4CD6A 2V5BA 1UD6A 3QLDA 1M7XA 3B0XA 2BOFX 4HOZA 1I1WA 4JN6A 4A35A 1L0PA 1OFBA 1KM2A 2CLFA 4OUIA 3MUZ1 4GGHA 4U4MA 3DX5A 2QJIA 2GSHA 2GJXB 3HQNA 4PL1A 1K03A 1W1YA 3AFBA 4JFVA 2WMIA 2E77A 3ANUA 1XICA 4ADUA 2BNJA 4H6RA 1ISVA 5CPOA 4Q7IA 3MUXA 4S3JA 5I3GA 4NZ1A 2GDQA 1TTPA 2R14A 4QJ1A 1TWIA 2FZNA 2FZ8A 3UG8A 3W73A 4EF8A 3VGHA 2QJNA 3GDMA 5D2WA 1W9UA 3KBVA 5E5CA 3KWXA 1X98A 3B3DA 4HNCA 4IFRA 3R79A 2HVNA 1CB2A 4O8AA 2O9TA 4H9ZA 4DB7A 3OEXA 1EOMA 1ITXA 3A5FA 1VBRA 2QMKA 2OPJA 4UTMA 3EKLA 4FF5A 3WLQA 5A1AA 5AZ0A 1OG0A 1XUUA 2ODOA 4JDBA 2XGBA 4ZSUA 4QNEA 1XX1A 1W1TA 1FVPA 1Q6EA 3ALFA 1V03A 3GC4A 2NSOA 4AWEA 2P5NA 3PANA 3UNTA 4MWAC 1IEIA 4ACYA 1X7FA 1N55A 4H6KA 2WJFA 2B7OA 3VA8A 4GCAA 1CXIA 4FR6A 3PZTA 4E8CA 2G3NA 1H7OA 3W2UA 2PWVA 1YPFA 1FX6A 4QCEA 1P48A 4L80A 3U8GA 5AY7A 4H9UA 4IGHA 2PPGA 1FKXA 3VE7A 4HU8A 5GVJA 3WJZA 3MYPA 3SGUA 4P8VA 1AJZA 1WQ5A 4J2MA 3II1A 4HNLA 4JKMA 3TWBA 2D0GA 3MC5A 2OYLA 3KP1A 1R6WA 4CQBA 3K5XA 1UCWA 2OGJA 3H7RA 4YWSA 3G5EA 3EDJA 3LI0A 5EFDA 4X63A 1XIMA 5AHIA 5KITA 2VELA 3H26A 2INEA 3I4KA 1S38A 4LYRA 3DFTA 3IJDA 1L6SA 5LGZA 2ZE0A 1GOMA 4K37A 2J7DA 4MKVA 4Y9OA 2OOGA 1OABA 3AYSA 1OX5A 3WLLA 3LBMA 1E1FA 1QI4A 4RDWA 3KL0A 1XIEA 4UWMA 5FF0A 5HULA 3OLEA 1XLDA 2ZRUA 2QF7A 3C61A 3CIWA 1XSJA 4MFEA 1CTNA 5EMYA 3DHUA 1T6MA 3BLKA 3VIKA 1DJWA 4YLWA 3O16A 3DHPA 3DZ1A 3CAKA 5GNZA 1XLFA 2HBVA 3DG3A 5IXEA 2FGLA 2FHFA 2GZXA 1H5VA 3UXIA 4HPGA 1UD4A 1TQJA 1X6LA 1Z42A 4RE3A 1H63A 3T07A 1BYBA 1QFEA 3B9NA 4BQ4A 2P76A 1WBHA 1ZS2A 3G1SA 2QJHA 4CN6A 1TQXA 3B8WA 3G3DA 3URBA 2Y61A 4DXVA 1XYFA 2WMIB 1A5KC 3M44A 4W7VA 3DG6A 3WEOA 4IMCA 2Z1XA 4XK2A 1HQTA 4P7QA 1I2QA 2D0FA 1A3XA 2CBJA 1VCVA 2X42A 3GVGA 3MUY1 1ZJHA 1DOSA 3NDZA 2AGTA 3ARWA 5A8MA 1UD8A 3CPUA 4DO7A 2E25A 1UMYA 1LUCA 1Q85A 3F4CA 4AUBA 2Y24A 1J6OA 2VVSA 1T40A 3KBJA 1PTGA 3LI1A 3VD5A 3CHDA 1QPRA 1UWTA 3B0UX 5J8LA 1VFUA 3A24A 3VM7A 2PZNA 6REQA 4KEUA 3UWQA 4YTUA 4AEEA 2J74A 3URQA 1E40A 2A79A 1UJQA 1F6KA 2CU0A 2ZA3A 1AH4A 3ZZ1A 4AZHA 2NVAA 2Y8KA 4GX8A 4U3CA 3C4UA 3PSVA 1U1HA 3LTYA 2A6NA 3W9ZA 2O9OA 1EDGA 5CQ1A 1QNOA 3ZOAA 4D9PA 1QPKA 2DQXA 3L7RA 5AVNA 4EK7A 1HP4A 3AJXA 3OTRA 2V0TA 4LUSB 1NM9A 2EKCA 5DF0A 3AICA 4HZ7A 3PTDA 1I2OA 4D1JA 4IICA 2PWHA 1HVQA 1DE6A 5BRBA 1QDSA 3NSMA 3TYCA 4C6BA 4HA1A 3CB8A 3NQBA 3UW6A 2BVYA 3LPOA 4OE7A