1XH0A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with acarbose
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh0A01
3VSVA 2VI0A 4P7QA 3L4WA 3CHDA 1UWQA 4FNSA 2OWXA 4A3YA 3ZR6A 3LRKA 1C7TA 3WQ4A 1O7AA 2E40A 1B1YA 5A6BD 1VJZA 2FHFA 1JYXA 2J62A 1QI3A 2QMKA 5BCAA 3AMLA 2CBUA 4FLSA 3VDHA 2IGTA 3WQ5A 1Q6EA 3ARXA 1UR1A 3NDYA 5BRPA 2EABA 4QDMA 4DWSC 4Z2GA 4MB1A 1UHVA 5LA2A 4QLKA 3UETA 4AEFA 1VBUA 1B2YA 4LYQA 3SCVA 3O9NA 3VIOA 1BVZA 4E8DA 3WUGA 1V08A 1HP4A 1UR4A 4MADA 3AIVA 4PN2A 4PUEA 3OLGA 3WDIA 1R8LA 1EO7A 2V3DA 4V2XA 3CZLA 1OT2A 3T2PA 2PBGA 3D5HA 4C7GA 2XTKA 3U7BA 1WAWA 1U2YA 1G01A 3IGUA 4IUGA 3MSDA 1KXQA 1TE1A 1AQMA 2Y24A 1WPCA 4J3VA 2FGLA 3WQWA 3WD1A 3CZEA 1G5AA 3WELA 1UUQA 3UCQA 5D9PA 4M29A 2V5DA 2ZUNA 4S3JA 1B31A 2YBTA 5A8NA 1M04A 1JFHA 1GW1A 3EMQA 2D23A 4CU7A 3UERA 3FHQA 3CUFA 2YL9A 3QHOA 2VQTA 4AISA 2YBUA 7TAAA 1WCGA 2QF8A 4YHEA 1CBGA 1KCLA 2ZX6A 4XUYA 4DWSA 2DSKA 4HZ7A 3TV8A 3W24A 1CXLA 3N12A 7A3HA 3PZTA 2CEQA 2OSXA 2YFOA 3VX0A 2Y2WA 2CBVA 1E73M 1UQZA 1WB0A 2DSWA 4TTGA 4CN6A 3LPOA 3VD7A 3MV11 3WD4A 2GK1A 1UOKA 2JE8A 4PBGA 2V3EA 1E0VA 4JKKA 3MU7A 1C91A 4UFJA 4PMRA 4MDOA 1E0WA 5I77A 1HXJA 2MANA 1IT0A 2A3HA 3G6MA 1QNOA 5D8ZA 1YQ2A 3S5ZA 1QHOA 4RE3A 4F66A 1JZ6A 1ODUA 4MB5A 1JDDA 3K1DA 3L4XA 1A3HA 4V27A 3AIQA 2D20A 2VQUA 4TX8A 3WH8A 1VAHA 4FNTA 5AC4A 3WL1A 3WUFA 1RD6A 3W0KA 1MVYA 4OUEA 2Y8KA 3O2LA 3VGGA 1LL4A 1NOFA 4FLOA 3B8SA 2CERA 2YDQA 2E9BA 3W38A 4UCFA 2YDRA 2FDMA 3BAIA 3PBGA 1V3MA 3K8LA 1PEZA 3ARRA 1QI5A 4DWSB 1J11A 9CGTA 4UQEA 3IANA 3W25A 3WDHA 3KL3A 3ALGA 1V0NA 3AS3A 3AYRA 3QOKA 1HJQA 1EDGA 1C92A 3MUIA 4PTMA 4CD8A 3AS2A 2GK1B 1M7XA 3M07A 3M7SA 2J7EA 3VD9A 2WC7A 1C93A 4CVUA 1W1PA 1AMYA 1X6LA 2DEPA 2PB1A 3SUSA 1D2KA 4RE4A 1E3ZA 2J75A 1R34A 3WDRA 2VX4A 3RCNA 3IJ7A 2J7GA 3AHZA 3APGA 3POCA 3PZMA 2Y8VA 4W84A 2ZUMA 1JL8A 4PSRA 1E6XM 1H0GA 1EXPA 1W1YA 4W8AA 1JF6A 3MMDA 1UWUA 3PN8A 2WVSA 1ISZA 3A5VA 1DWIM 2OYKA 1WZAA 5AC5A 2Y5EA 1CXKA 1US2A 1UWRA 3IAQA 4W7UA 3EMCA 1K9DA 2BVYA 3EJSA 3K4DA 2ZWZA 2ZXDA 2ZUTA 2WVVA 5DF0A 5FKYA 3DDFA 3WMBA 4TX6A 4EANA 3ZOAA 2F1AA 2UY2A 1LL6A 4PMYA 4J3TA 5A3HA 1CXEA 1OD0A 3B9AA 1ITCA 1JNEA 2W91A 4XB3A 1PIFA 3AIBA 3OA5A 1PAMA 4IISA 4JL2A 3VOCA 3MSGA 3WUBA 1S46A 1EHAA 1Y7VA 5FD0A 1E15A 2WWCA 1W3KA 1UQYA 1XH0A 2WLYA 1TR1A 3MO4A 2GJXA 3OIHA 1OSEA 1PX4A 3HG2A 8A3HA 3MUZ1 4RL3A 2AMGA 3AQUA 5A1AA 4BQ4A 4UOJA 2CHNA 3S5YA 2VCBA 4TUFA 1JD9A 1HTYA 2AAAA 1WO2A 3I3EA 4BCEA 3GBEA 3PZIA 3N13A 1VFFA 2W5FA 3AMKA 1NWSA 3AXHA 3UR8A 1EOKA 3WH9A 3ARPA 1GNXA 2W67A 3VGBA 3CIVA 3SEPA 1JXKA 3CZGA 4Q7NA 3RJYA 2WVVB 3TTOA 1UKQA 3MANA 3A24A 1TQUA 4DO6A 4X0VA 5AYBA 2E9MA 4CCCA 4H7VA 1BYAA 4BS0A 3FNDA 4MPKA 2WSKA 1XYZA 1HKIA 2FE0A 3EBVA 1BYDA 2A3BA 4KH2A 2WWDA 2WC3A 5D9OA 2WMJA 1W3LA 3LRMA 3CHCA 1QNQA 3RPMA 3U5UA 3IK2A 2XVNA 5BXPA 1B3YA 3ARQA 4X9YA 1W2PA 2X09A 1OCQA 3B9DA 4KMQA 2G3JA 1R7OA 2YIHA 3CTTA 5FOOA 2VVSA 1K9EA 3H54A 4WLCA 2GJXB 3WIJA 1V3JA 1KWGA 1D7FA 2IXVA 3MUAA 2WVUA 3RDKA 5BXRA 2QLYA 4N0RA 1CGWA 1ZU8A 2D3LA 1LG2A 4J3SA 2OSWA 2J7BA 1UKSA 1UR9A 1XSKA 3QHMA 2XFRA 1MWOA 2DIEA 2FHBA 4AD0A 4AIUA 5I5RA 2BV9A 5A8OA 1RPKA 1JAEA 2F7QA 5EFDA 4ACZA 3SUTA 2RGLA 3EJTA 3VMOA 3SCNA 3DX2A 1H49A 1PJ9A 1DWAM 3AJ7A 2QV4A 4IPLA 1TCMA 1MFVA 4J3UA 4AD3A 3QR3A 2NT1A 4PMXA 4IPNB 6CGTA 4AW7A 3TP4A 2PWHA 1BAGA 3KL0A 4FNQA 1MQPA 3CHFA 1BQCA 3VIGA 1QI0A 4D6JA 1V3IA 2EAEA 1B3VA 1O6IA 2WVTA 3VNYA 1JI2A 4GZIA 2DT1A 1GUVA 1GHSA 2DSUA 5CLWA 4D6IA 3ECQA 3WMSA 1E1FA 2FGZA 1CNVA 1VIWA 1SZNA 4UZUA 3NSXA 1KB3A 1HVXA 1A47A 3OG2A 1CYGA 2VR4A 4UOZA 5HOSA 3BCFA 5IXEA 2E8YA 1CECA 4R27A 1U30A 3VIMA 5IHRA 4FNRA 1MW2A 1E4MM 1UYQA 3HN3A 3GXMA 3ZJ8A 4FK9A 1NARA 3AHTA 4UFKA 3FAXA 2F1BA 5A2AA 2XN0A 4WSJA 1CLXA 2EPOA 2DIJA 2JF6A 1GVYA 4CUCA 3HMCA 3VD3A 4ACZB 2XM1A 3VD4A 2XM2A 3W6MA 3BSGA 1JYNA 2XWDA 3CMJA 5HPCA 1KTBA 4U33A 1FFQA 3SCPA 1Q4NX 2X0YA 1UR0A 1HL9A 3EJQA 3F5JA 2E8ZA 4ATWA 3L4TA 3LX9A 3KL5A 4TTUA 3VUPA 1XH2A 4QAWA 1BYBA 4UQCA 1E6SM 5JBEA 3ZT6A 1CGYA 1E9LA 3UG3A 2ZX9A 1W9DM 2G3MA 1CWYA 1FH8A 1RP8A 3WY2A 1JYWA 1GOQA 2J7HA 3AS1A 1WDSA 4P8VA 2G8ZA 5JBFA 1J0HA 1J0IA 2EEXA 1FH7A 1V02A 5LA0A 3AXIA 4LX4A 3CV5A 3WNPA 1B3WA 4AD1A 3BAWA 7CGTA 3D52A 1MW0A 1E55A 2BY3A 1LWJA 3L4YA 4Z2JA 4P7LA 3GXFA 1JGIA 3T2OA 3WL0A 1MXGA 1K6AA 3NYDA 3WF1A 1HN1A 4DO5A 2DT0A 1TQTA 3OLIA 1MQRA 2VX6A 5DT5A 4FLRA 5C8BB 3AIWA 1JD7A 2BXYA 1ODZA 3U5YA 1J01A 5A6MA 1CXIA 3MS8A 3D51A 2DQXA 3PZ9A 1ISWA 1QBAA 1N82A 5DEZA 5HBFA 3ZIZA 3WH5A 1XH1A 4PTXA 5I0DA 1G1YA 4AWEA 3VINA 1CDGA 2YDSA 1TQWA 1EQPA 2G3IA 2XFFA 3DDGA 1ISYA 4Y7EA 1JAKA 1VFOA 1CENA 3CUJA 5FIPA 1OM0A 2OW7A 4TVDA 4U3AA 1G0CA 3WDPP 3VNZA 1ITXA 1V6VA 4LXFA 4LYRA 4UFHA 2ZUWA 4FMVA 4CKQA 1OD8A 4HZ6A 2VURA 4WF7A 2VZOA 1UR2A 5I78A 1GQIA 4CN4A 2EQDA 1H4PA 2VX7A 3MV01 5E70A 3K8MA 1JZ2A 1JZ7A 4V28A 2VO5A 4M80A 1P6WA 4YPJA 3GXPA 1BGAA 1E71M 4UQAA 5A8QA 1PBGA 2VUYA 4JL1A 5HDRA 1VEOA 3VSTA 4J3WA 2XIBA 3ARVA 2YL8A 1ZL1A 3G6LA 1G9HA 3WF3A 3SCQA 4HU0A 4JZ5A 3PTMA 3WBEA 1W3JA 2VOTA 1MFUA 2BXZA 3OGRA 4P7RA 1UKTA 1AQ0A 3N18A 4D6FA 1EQCA 4D6HA 2VZTA 3AZTA 5BYWA 1AVAA 3GXDA 2WMIA 1Q6DA 5BRQA 1PZ2A 3AICA 3BUPA 2D1ZA 5M03A 1ESWA 3OGSA 1DP0A 1C8YA 3GDBA 3CZ8A 4LGXA 3GBDA 1XD0A 4GQQA 2BHYA 2EO7A 2CXGA 3N15A 3N04A 1LL7A 4OBSA 2YLLA 3FAWA 4W5ZA 2A3AA 1KQZA 6A3HA 1QNRA 3NIYA 6TAAA 1VFUA 4CU6A 3SCUA 2WZEA 5KEZA 5HNNA 1I75A 2ZXQA 4U2ZA 2JEPA 4D1JA 2JIWA 2XGBA 4A4AA 5E0CA 2UWFA 1HP5A 2QMJA 4AIOA 4H04A 1PZ3A 2XPKA 1VEPA 1J0YA 4W89A 5ABEA 2WCAA 3PZNA 4JCLA 4TVUA 4LPCA 2B31A 3AOFA 3CUIA 1KBBA 1UKPA 1W9XA 1HT6A 3CMGA 3PZGA 4UR9A 3ALFA 1K9TA 1RH9A 5GNYA 2CBJA 1KFWA 1J10A 3BLBA 1GOMA 2IXUA 3VIFA 3WDQA 4B3KA 4D71A 3BVWA 4GI6A 4DM1A 3I3DA 1X6NA 1V6XA 4D6EA 1J12A 1V3LA 1ZBWA 2WHKA 2PWFA 2WMIB 2Y4SA 1ECEA 2E0PA 3NDZA 4HOWA 2GDUA 1LF1A 5D8WA 1FA2A 2JFEX 1V02E 1TFVA 2WZHA 5ABFA 1H09A 3ARUA 3UG4A 2ZUVA 2VNCA 1NQ6A 5JBDA 1NWTA 1NM9A 4NRRA 3BLKA 3L2LA 4H2CA 2WAGA 4YN5A 4WKFA 3WY3A 4PTWA 3BMVA 2TAAA 4HMDA 3BUIA 3W26A 5DFAA 2PWDA 2CYGA 2J25A 3WH7A 3VIJA 2CPUA 2EBNA 1QPKA 1CXFA 2WHLA 3RM8A 2FYVA 4U5KA 3KLKA 3ZT7A 3JUGA 3OLDA 2J47A 4AZHA 1UWSA 4GKLA 3AZRA 4W8LA 1WNOA 2WKGA 4H8VA 1QI2A 3TTSA 1QW8A 2WMGA 3L4VA 1KBKA 1BGGA 1CZ1A 3AXXA 2BVDA 4UTFA 2YA1A 3LRLA 1B9ZA 2XJ7A 3AIEA 3RO8A 3HZ3A 3S6TA 3ZJ6A 2XGIA 5M5DA 3SIMA 4MAVA 4UFLA 1WZMA 3LPPA 1E4NA 1DWFM 4UOQA 1NP2A 1SYTA 1DTUA 5ABFB 3AYSA 4J3XA 5AYIA 3KEHA 3WY4A 2X05A 4RE2A 3A4WA 3GH4A 4MNLA 2WANA 1BSIA 4UQ9A 4CN1A 3NUKA 1UH4A 3BSHA 4HTYA 5F7UA 3PTKA 1SMAA 4GO8A 1B0IA 5CZKA 4KWUA 3GXIA 4QFUA 1SR0A 2J7CA 3TTYA 1SMDA 5CPSA 4JKLA 4DWSD 3U7VA 1PX3A 1OBAA 3SUUA 5I6SA 4CD6A 5EFFA 2VZUA 1WE5A 3GYCA 1TMQA 3WF0A 1Q6GA 2WYSA 2G41A 3AIRA 3BXWA 1R33A 5CXPA 3M6DA 4M8UA 5HPOA 3FY1A 4W7VA 4ZE4A 4PMQA 2C0HA 1BFNA 3OZPA 3ZO9A 1CPUA 3TTQA 4AZ5A 2C8NA 4JKMA 1PPIA 3VVGA 5A6KA 5CGTA 4PRWA 5BXTA 2V3GA 5I2UA 4KRTA 3D4ZA 3LXAA 4B9ZA 1Z32X 3GXTA 2Z1KA 3DX0A 5CG0A 2J8FA 3ZM8A 1GQJA 1H3GA 2ZICA 1US3A 2BFGA 2PWEA 3MMWA 3BAKA 4IM4A 4KGLA 2XVLA 3D50A 1OGBA 1DEDA 3CZKA 3TONA 3EDJA 3NJ3A 4AZGA 3ARZA 4OJYA 1CLVA 4OOUA 3PZUA 1NWUA 2X1IA 3UR7A 3AS0A 5A69A 2W63A 1R7AA 3SUVA 4ZXOA 4UFMA 3ARTA 2CCRA 3GNRA 2WLZA 2XVPA 1RP9A 1XCXA 1ISVA 2CKRA 2CESA 1KGUA 3A22A 3W6LA 3THCA 2RGMA 1BTCA 2F61A 3LMYA 3M46A 3VTRA 5CQ1A 4ATDA 1XC6A 1ZBVA 2VVNA 4HOXA 1UH3A 1TG7A 1FOBA 2WZIA 4JCMA 4GPNA 3VIKA 3II1A 2ZOXA 5I79A 5A95A 2WNWA 4ZFMA 3MKKA 1GCYA 1QX1A 1GORA 1F4HA 3ZJKA 3BUBA 3W82A 2V5CA 2GDVA 2EPLX 3WH6A 1FP8A 4NRSA 3WMCA 3AHVA 4CD5A 2YJQA 2YA0A 1O7DC 3B9EA 1V6UA 1JXJA 1GJWA 2YA2A 1XHGA 1CXHA 2EACA 2ZX7A 2NSXA 1M53A 4AYGA 1UG6A 4PEEA 2DT3A 2O9TA 3EMZA 3A4AA 3VX1A 1V0MA 1VENA 1K9FA 2YL6A 3LXCA 3VM7A 2FHCA 3PZQA 1R86A 3POHA 4CCDA 1BG9A 3T0DA 5E0FA 2Z1SA 2F7OA 5ABGA 4CD4A 4BF7A 3QGVA 3A6OA 2WBGA 1ZJAA 1OWQA 3BVVA 1WDPA 2O9OA 3N11A 1MXDA 1ZBCA 3LPGA 1HKKA 5CSUA 1CGTA 1BF2A 4HZ8A 4E8CA 1VEMA 3BMWA 4L4PA 5GNZA 3SCTA 2OYLA 3SURA 4BQ5A 2EADA 4EK7A 1QBBA 1BG4A 1MYRA 5D9NA 2J79A 3KLLA 3VGDA 3GNOA 3VDAA 4Z2KA 3H53A 1W91A 3BGAA 4D6DA 2EJ1A 2D0GA 3A47A 1GOKA 4J7RA 1EHNA 1J0KA 1SFSA 4CU8A 4KRUA 2G4FA 1VFMA 3WFLA 2UY5A 4UZSA 2XYLA 2WB5A 4PMVA 3CZSA 3CBWA 2ESCA 4F79A 3RM9A 1TVPA 1XCWA 2ZUUA 3DHPA 3UG5A 1H41A 1TVNA 4B16A 1W1TA 1WZLA 1HVQA 2O9PA 1T0OA 1XV8A 2D73A 2FH6A 3VILA 2YL5A 3O6AA 4AYSA 5A6BA 4NSBA 3VM5A 2FH8A 4AXNA 1YHTA 2DH2A 3K8KA 3WFZA 4ZEPA 4UFIA 3DX4A 3IJ9A 1ZS2A 2QPSA 4JFUA 1FP9A 4AZBA 2F7RA 3WBAA 3UESA 4QP0A 1F4AA 1UD5A 2W66A 2CNCA 3WNKA 4HA1A 4KGJA 1QHZA 3ZMRA 1KCKA 4HA3A 3D3AA 2EPKX 2VC9A 4AMWA 1E72M 1R46A 2XIIA 5I3DA 1QHPA 2GJPA 1J18A 4DUWA 2D2OA 1PX8A 1WDRA 1WP6A 5IFPA 4S3KA 1WKYA 4AMXA 4GZJA 2ZX5A 5BXSA 3T2QA 1NP0A 4Q22A 1HJUA 5EBAA 4U31A 1UD8A 1TQVA 3F5KA 4P7NA 1H1NA 1W3HA 4GQRA 2ZX8A 2D22A 4XZBA 1BLIA 2OYMA 5CPTA 2EXOA 1C3FA 2F2HA 1R47A 4JHOA 1CEOA 2PC8A 1KQYA 4AC1X 1MW1A 3GH7A 1QVBA 2F8QA 2XFYA 4WIWA 4PMUA 1E5JA 1GQKA 4UNIA 1HNYA 4GIAA 3U57A 4AIEA 1E6QM 2EPNA 1H0IA 3CGTA 5D9MA 4EAMA 1KXHA 3CH9A 1HKMA 1EO5A 3WY1A 5GPRA 3VO0A 1UZ1A 4MB4A 2CHOA 3EJRA 1NOUA 2VL4A 4GZEA 4MJ2A 2CBIA 5ECUA 2DH3A 3HG5A 3AHYA 4AD4A 4J28A 2YLAA 3PTQA 1I1XA 1XD1A 1IZJA 4D6CA 4BQ2A 4MNMA 1UD6A 4M24A 1J0ZA 4CCEA 5DT7A 1H2JA 3WEZA 5LYRA 2W92A 4MJ4A 4H41A 4QLJA 3N17A 2DT2A 3EJUA 4PTVA 1XYFA 4PMNA 3DYMA 4QLLA 2WW5A 2J78A 1QWNA 4NXKA 3AI0A 1UA3A 5ABHA 1E6PA 1UD2A 3A4XA 3GH5A 5BROA 1KWKA 3VIHA 3W81A 3A23A 5A94A 3BUQA 4NI3A 3ZT5A 1HJSA 3VKKA 3MMUA 5TD4A 4OBRA 2BNJA 5D4YA 5A8MA 2QPUA 4OKDA 4MB3A 1E40A 3CPUA 1GJUA 4HMCA 2WCGA 2D24A 3T08A 2ZUSA 1E56A 3SCOA 1GVIA 1NWRA 1L0PA 2XG9A 1UZ4A 1V3HA 2ALWA 1HF6A 1TUXA 3TOPA 1NOWA 3FN9A 1KGWA 3GXNA 1W9PA 4PYSA 3BUDA 3WSUA 4HOZA 4MNKA 1CTNA 5A6SA 4CVWA 1DWGM 3L4UA 4PUDA 1KR1A 1IV8A 4AZCA 1OB0A 1B30A 1UA7A 1ZJBA 2XN2A 1JZ3A 1EGZA 4AZ6A 4U5IA 3ZJ7A 3AISA 1WDQA 4GXPA 3WEMA 1KR0A 3VD5A 2PI6A 3F5LA 3DHUA 2X2YA 4HU8A 4W88A 1KTCA 2ZXAA 4TVCA 1FHLA 1W1VA 3AMDA 1IZKA 2VTFA 5EMYA 3WNMA 2XWEA 2V38A 3AMGA 4PMOA 3EDEA 1V6YA 5C71A 3RM4A 5FL0A 2J7FA 1HXKA 4BA0A 3DYPA 3WENA 4JIEA 5C70A 2WSPA 4ZENA 3FHAA 3WF2A 1GPFA 1C7SA 3WQ6A 2YFNA 1V03A 4AY1A 1UD4A 4B3LA 1C90A 4NF7A 3W37A 3WQ8A 4NZFA 1BVNP 4W93A 4M56A 1E43A 3AROA 1QNSA 5A6LA 1AQHA 3BLPX 4YHGA 3W28A 3RILA 4AZCB 4AD5A 2O92A 4PCTA 1JI1A 2WHJA 3KWXA 3GM8A 2GVYA 1QNPA 4URIA 4ML4A 5CLTA 1FHDA 1JYVA 1VJSA 3BVTA 4CD7A 1EOMA 3VU2A 2HISA 3AFBA 2GSJA 5CSYA 5IHSA 2WMFA 4DUVA 1W32A 4BQ3A 4GI9A 4FNPA 2BHUA 2X8RA 4H8UA 1JFXA 5CJ5A 3N9KA 4DO4A 1D3CA 3IJ8A 4AMCA 3WEOA 2O9RA 1J9YA 3DX1A 3LPFA 2F18A 1GOIA 4D1IA 4FNUA 2XVGA 3I3BA 4NZCA 3BAYA 2DDXA 3AIUA 4C7DA 2QHAA 3QHNA 5GQBA 1PS3A 2CITA 4OOZA 4U3CA 3D4YA 5E6YA 1NH6A 2UY3A 2VRKA 2D3NA 4FLQA 5DO8A 1E0XA 2A3EA 5I23A 1E4IA 4M1RA 2BY1A 2J77A 2E3ZA 3PZVA 1DWHM 1LQ0A 1UH2A 3KZSA 1L8NA 4ATLA 2ZWYA 3WD2A 1X1NA 1ZBKA 3OGVA 4MDPA 5AY7A 1UR8A 2OSYA 1GOWA 1DWJM 1GONA 4K68A 3H55A 3WNNA 4W85A 1ZB5A 4P8XA 3LXBA 1EDQA 1UD3A 3WF4A 1PIGA 3CC1A 2ZXBA 4HP5A 2GFTA 3SCRA 4A3HA 4GI8A 3QOMA 1W9VA 3RIKA 4U2YA 5E1QA 5GNXA 3PHAA 3ZSSA 1V3KA 2WHMA 1BPLB 1MW3A 3VDCA 2W4XA 3TA9A 1C8QA 1LG1A 1JG9A 4W7WA 2OWCA 3WD3A 1LWHA 5FCZA 3T0BA 4BZYA 4QCFA 4B15A 3N1AA 1G94A 5E09A 3A21A 4J27A 2VZSA 1E3XA 3WNOA 1VRXA 3AMCA 2VX5A 4XV0A 5BWFA 1EH9A 1HJVA 1FFRA 1E6RA 1TA3A 2VRJA 1V6WA 5IDIA 2BY2A 3VMPA 1XSIA 1M03A 2X2JA 4WKAA 1Q6FA 3E1F1 5CGMA 4M81A 3CZJA 4UQDA 1CIUA 1QWUA 3J7HA 2VJXA 1V0KA 4NX0A 1OIMA 1EIBA 3VGFA 4HMEA 3K46A 1J0JA 3L2MA 4W8BA 4WK9A 2VRQA 4AZ7A 3WDJA 3MUY1 5E9AA 3RJXA 3EDFA 3FXYA 3HG3A 1I1WA 1VBRA 1E70M 3BAXA 2PF0A 2WBKA 1FH9A 2WCSA 1HWWA 3NSMA 3CUHA 4F9JA 2VMFA 2WMHA 4AD2A 5A2CA 4P8UA 3EDKA 4AEEA 1QI4A 2E4TA 1JZ5A 1DHKA 1U33A 1CGVA 5JIPA 1OIFA 4Z2LA 2VR5A 4Z2IA 4D72A 1XRVA 4E2OA 2E9LA 5KZ6A 5FL1A 3ZR5A 1TQSA 2HVMA 5JUVA 1HIZA 2WMKA 3T09A 2Q8XA 2NT0A 1OT1A 1XSJA 2OLHA 3KE0A 3HU7A 3AZSA 1VF8A 4LQ1A 8CGTA 4LYPA 4P8WA 3CO4A 1H5VA 4WKHA 4N42A 1TA3B 3FW6A 2XHYA 2XSBA 2X2IA 1JF5A 3RMEA 3HG4A 4MNJA 2BVTA 2CKSA 3W27A 1E1EA 3DECA 4GINA 3W29A 2GUYA 3SCWA 4OGZA 3CHEA 4EE9A 3UEQA 1BHGA 3WN6A 1HX0A 1E6NA 3DYOA 2OWWA 2BS9A 3EYPA 3WQVA 3ARWA 4F9DA 4JHZA 1HJWA 4PMZA 2PWGA 5IFTA 1JDCA 4JFWA 2XN1A 3EDDA 2IUZA 2DSZA 1KXVA 4F8XA 3BVXA 1OGGA 2D0FA 2VCAA 4CGTA 1TZ7A 3BH4A 1MQQA 2GJRA 3S2CA 3IAPA 4C7FA 3DX3A 2J7DA 4ZE5A 2DGAA 4JFSA 1C8XA 1XGZA 4GO9A 4PSPA 5M17A 3VGEA 4W86A 2C7FA 3DC0A 4HPHA 1GOOA 5E6ZA 2J4GA 3THDA 5A6JA 1GQLA 4E4PA 4X0NA 3WD0A 1WZKA 5A6AA 4FF5A 4DUXA 3W53A 2JALA 1OGSA 1JNDA 1W9BM 3ZQ9A 4JFTA 3F4VA 2WKLA 1R87A 2UY4A 3EJPA 3ARYA 1OINA 1Q6CA 2YOCA 1E6ZA 1CGUA 3OB8A 2W61A 2JF7A 3CLWA 4B9YA 2XUCA 4Z2HA 1QW9A 2ZIDA 4WJXA 2XVKA 4M82A 4PCSA 3VDBA 3VGHA 3CZNA 4JAWA 3PZOA 3OLEA 4D6GA 2JIEA 1JZ8A 3BC9A 1KGXA 1VB9A 4H8HA 2CIPA 4PMDA 1R85A 4NZJA 1UWTA 1HJXA 4ACYA 2YKKA 1EA9C 2VZVA 2WK2A 2BHZA 5I24A 1GZJA 3T0AA 2D0HA 2VT0A 3VPLA 2ZE0A 2WXDM 2OW6A 2WM0A 1BYCA 4OIFA 1B3XA 1QOXA 2W62A 3SCSA 4WSKA 3VSUA 3OZOA 2CETA 2WC4A 1EDTA 3VIIA 5DMYA 5A2BA 3BVUA 1CGXA 3ZSTA 5HXMA 2DSVA 4ZXLA 3GZAA 1KXTA 2G3NA 2J74A 5LA1A 3CUGA 3BAJA 2WPGA 3VIPA 4MTVA 2F7PA 3NCOA 3WUEA 2DPEA 4XX6A 2A3CA 2XSAA 1GHRA 3GTNA 5JIWA 2X0HA 4NXSA 3W4RA 4TXEA 2NW0A 1W2VA 4QCEA 3L4ZA 4MAZA 4UQBA 2V3FA 2EPMX 3WKZA 1HL8A 1B3ZA 1HKJA 4HPGA 1R75A 3ARSA 3VMNA 2X2HA 1M01A 1E4LA 1UKOA 2J8GA 4DM2A 1LJYA 3HJEA 5EB8A 4P7OA 2BY0A 1JDAA 3MI6A 2JEQA 1JIBA 1UASA 4TOQA 2VCCA 5M3WA 4XZWA 3K4AA 3GNPA 1JZ4A 3A3HA 3OBAA 4R5EA 2AOSA 3AHXA 1ISXA 1B90A 3NSNA 4OZOA 1V0LA 3WNLA 2PBOA 5A8PA 1W9UA 1UWIA 4L4OA 3BCDA 1LLOA 3SUWA 4EKJA 1E5NA 4JFVA 4HA4A 4AZIA 1H11A 5CPQA 4W5UA 4W87A
chains in the Genus database with same CATH superfamily
2C7UB 2IQ9H 2YAOA 1TEYA 4JQ1A 1TSIA 4DJDD 3BARA 2V5LA 2ZC1A 2E40A 1KULA 3ALXA 2FHFA 1BCIA 2XT1B 2A73B 2G37A 6REQB 3SPJA 3AMLA 4FLSA 4I9JA 3B83A 1RHFA 2E7DA 5BRPA 2AL2B 2E28A 4PGDA 2PDQA 2HRHA 1HI6B 4GRLC 1CFVL 1V08A 4XSMA 1MQKH 1DLHA 5M94B 2WMPB 2PBGA 4ZR8A 3GDCA 2A79A 3W22A 2DIKA 1KXQA 1TE1A 2QSTA 2VENA 4PJ6A 4YCPA 2BP8A 2V2TB 1JRCA 2CRYA 2JTYA 1MEIA 4NZDA 2WJEA 2Z8WC 3VE0A 3UGEA 3RU8L 1A7NH 2VDRL 4GQ0A 2CH8A 1HGYA 3N2MA 5F88A 2DTML 5L2KE 2X28A 1CBGA 4Y2OA 3L16A 2HKHH 2VQ1B 1TX2A 3FNKA 3KCOA 3CEUA 1T2QL 2CBVA 3THQA 1UQZA 4TTGA 1MUJB 4H25A 3B2UC 5JO5B 1G9ML 3ARFA 4PTNA 4ZMNA 3MRMB 3O3BA 5I77A 4BWTA 1NGXA 3ULVE 4FR6A 3NZUA 3O2VH 1A21A 2RFXA 2ZXEB 5CR1A 4ZBJA 3O2LA 1LL4A 4P4KB 1IFHL 3QI9D 4ZPVA 3BAIA 4JTEA 3S0CA 1QPPA 1XLJA 3PDOB 4LL4A 2GUOA 3EWWA 1KJMB 5F7AA 4LVBA 2HTLC 1UACL 1M7IB 5KN5B 5DT1H 5AYTA 4KW2A 3MUIA 2AQRA 3V0VB 2UVFA 2LLNA 1UJ3B 3SDDD 4ZX4A 2MHAB 5LGKA 4S1DD 4B3ZA 2H1XA 2J75A 5DHEA 4CNTA 3AHZA 1OD9A 1L7IH 4FQ1L 2BSRA 4GOAA 5MEQA 1NAL1 1EXPA 2V5KA 3PWNB 1XKJA 1UWRA 4AKOA 3W07A 2EDJA 3WMBA 3FFCE 1GGBH 4Z7WA 5FYJE 4GGBA 2Q2EB 3TSBA 1ITCA 1D5MB 3AT0A 4K5MA 2ZKXA 2JB5L 4I48A 2OK0H 1FFTB 1S46A 2X6CA 1EDYA 1NCWH 4XNMA 3TO4A 2WLYA 4AJYV 3OIHA 4B3EA 1NC4A 1KLGB 4X6BA 4I1NB 3FH8A 3GSNL 3IDYB 4O2CA 1J4EA 4P5KA 3WH9A 4PIBA 5DJXA 3HVDA 4M3HA 4IOSA 4UOW1 3ZYZA 4X0VA 3QAZC 3DFTA 3ZHFA 2J8HA 4QRQA 1P4CA 2VGBA 2AAMA 4KZ0A 2KDGA 1QNQA 3DDMA 3GFYA 4JEGB 1FYTB 4EBQH 1FF5A 1I1AB 5F1NA 3VH8G 5KS9B 2XZAH 4DK6A 1H3XA 1ZD6A 2HZHA 2Y22A 2DLGA 1H1YA 1WAAE 3AQDA 2QSVA 3D5OF 1UB6A 5IK3B 4O58L 3BKYH 3CUXA 4QEHA 3DURA 3W0WD 3PJUA 2ZAIA 4MQXC 5T5FA 4QHRA 4S0HA 4QO1B 3IVUA 3N40F 1HSBB 1DWAM 4KQ4L 4Y9FA 1XF2B 4A2EA 4D6JA 1GC1C 1QA9B 2IDFA 3V5OA 1GUVA 4OTKA 1UJPA 1OTTC 1E1FA 2OAAA 4Y88A 5J7CC 2HBVA 3HKZA 4MFHA 5IFHL 3NP3A 4LNYA 2DI7A 4Y19D 1E4MM 2V2DA 5MEPB 3KJ4C 3GGWB 3ML8A 4NP9A 2VN7A 4RZ6A 2DIJA 4LSSL 1E9QA 3NOEA 3E8VA 3BQ5A 4KRPD 4LUYA 1Q4NX 3PWLB 4N20A 1YKWA 4OLVL 3MO1B 1W31A 4K2UL 4I87A 4GKNA 4Q32A 1U4EA 4BINA 1LUCA 3B4YA 1KB5L 1JN6A 2NXGA 4IIHA 2QJIA 4KPHH 3GSUB 5AOMA 3WJXA 1XGYL 4DXXA 3ET9F 4PYHA 4DBSA 3NQKA 2DL9A 3F2BA 1ZJIA 2X4QB 2VDPB 1CWVA 2XH0A 3MA9H 3K2GA 5IWLA 4Z7QF 4WGWB 1IGFL 3M0XA 2ZZ7A 4B9CA 1SSDA 1ISWA 3NJLA 2PDPA 5E5MA 1RIVL 1DEEB 4J1OA 1ISYA 3FONA 4UTMA 4Y1SA 2ZRZA 4LU0A 4DJEA 4JRYA 4NZUL 3VQ1C 4X4XB 4CKQA 5IQLA 4XBPB 3G08A 2JCCF 4RX4D 1JZ2A 3VCLB 3MLZL 3S3DB 4G7SB 3V4BA 3EA3A 5LAPA 2H3KA 2Z4GA 2CJSA 3MRHB 3G6LA 4KWVA 1CFMA 1Z8AA 2BVWA 1XF3B 1ULVA 4XRCA 4OUUA 4BCYA 1Q6DA 1E4KA 2LU3A 2Q3RA 1YEIL 3OGSA 4ANUA 3MV9A 5K1NA 5F8QC 5D2NC 4LGXA 3RWHA 3QNYA 5E2UH 3IJDA 4E41D 4C56B 4HJGB 2BOCB 3BT0A 4KBPA 5B1JA 4IL0A 5HNNA 3TVMD 4XO3A 1UM4L 4TF4A 5D5MA 2PF6A 1DDHB 4QXGL 3R18A 1PZ3A 4M6OL 5HHOA 3BGFC 3E0WA 4JCLA 2GLKA 2NUTB 4PU2A 2YW4A 4UT6H 3GDLA 3I9IA 2OTDA 3O8AA 4H0GA 3N85H 3CIWA 3KPPA 4KJPC 3BVWA 1KRBC 2WN3A 4OTXL 1J12A 3GMMB 5JQ6L 1RAMA 3V6OE 2PWFA 4WCYH 4UBPC 2HBXA 1URIA 3E8UH 4NRRA 1NAMA 3L2LA 2WAGA 4G71B 4FGMA 4YSTA 3KM8A 3CU1A 5HNRA 3IBEA 4YTUA 1XEUA 2CYGA 1P0KA 2R6OA 2V37A 3MGOA 2HPIA 1BQLH 1XYLA 1WIPA 3IU3B 2XIOA 1T99A 1CCWB 2NZLA 1WTGT 3JUGA 3CFBB 4LPWA 4XX5A 3VOFA 1GMEA 3ENEA 3ONCA 2DJ4A 1MCOH 3O6KL 3Q6FA 4OGXH 3HZ3A 3ULUE 1WZMA 4QM1A 3RMJA 2GTZB 2B9AA 3B2VH 3GZKA 4RE2A 1YNYA 3PSWA 3PTKA 5F21B 1B0IA 4QYOB 2J7CA 1OCCB 5DZVA 3W7OA 2EXWC 2JCWA 3H56A 3BH8B 2Q10A 1F6FB 4S2SB 3HLAB 3QS2A 4GY1A 1AY1L 2J9ZA 3OXSA 4CBZA 2C0HA 4X5WA 3ARFD 4J4PA 5G2NA 5IV2B 3ZO9A 3NFPB 3KYMA 3IJSA 4W4NA 3LEXB 3X3FH 1PPIA 4KRTA 3LXAA 2FEJA 1JHLH 3DX0A 5CG0A 4GRMB 1GQJA 3GC2A 3O6DA 1W0VA 1XGUA 3C0LA 2Q8ZA 2XN9B 1F02I 4AWJC 4AG4H 1EYEA 3QDMD 1OYCA 3M44A 4JFFE 1AD0A 4KRLB 2NY6C 4JCMA 4A05A 2Y3AA 4FQXA 5FPIA 2GDVA 2EPLX 1A0CA 1RURL 3P1VA 1A5NC 3I50L 4JG0H 3WMPA 5F3FA 2YA2A 2ZUYA 2ZX7A 1E1CA 3O81A 1M53A 3SGDI 4IMAA 1UCWA 2P8LA 1NCDH 4NWTH 1V0MA 5DWUL 4RKAA 1FUNA 3VUSA 2WJ5A 1M05A 2FJKA 5J5RA 2I57A 4IICA 1O60A 3AT8A 2FZ3B 3QGVA 4NT6B 4F2BA 4X0KB 1F00I 4TVPH 1TUFA 4PREA 4BH7B 1AGCB 2DQHH 5E8PA 3TO2B 2W9LA 4L4PA 4NJKA 5BQDA 4GMSL 3DVNB 3WN5A 3TO4D 2ITCA 3VGDA 4HLEA 1ZPLA 1NC4D 2GDQA 3XISA 3ZTCC 1YTDA 3WEBA 5T3XE 2EGZA 1Q13A 4ZYKB 4PY7B 3QB7C 4V1YA 1XCWA 3DFQA 3W11D 4IOSD 1JPSH 15C8H 3RZCB 2HJKB 1T0OA 1XV8A 4YWSA 1UWFA 3D9AL 3FQXA 3KPSE 4RA3A 3H7RA 1G4SA 1AQKL 3P8JA 2O1AA 3FTZA 4DP6X 4K3HA 4LOUC 1G5GA 4RESB 2W66A 1AAJA 3MHZA 2CNCA 2XI9A 2NNRA 3G5EA 3FX4A 2ZUQC 5H91A 3D3AA 4IOFD 3EYSH 2DUXA 1F1AA 4O5LL 1ADQL 1FFNB 4DUWA 3DUUA 3BSZH 4OD3L 1WP6A 2ZX5A 5BXSA 2WZTA 5EBAA 2WB7A 4YS4A 2HTMA 2WWMC 3U2CA 2PTVA 4EI5C 5DD0L 2HG5A 5D1XA 5GZOC 4TULL 3T4AB 2B7NA 3C2EA 4GIAA 5GVJA 5HDBF 3B2MA 4OZIE 4JE4B 1UPPA 4P06A 4ZFCA 5E99H 5DCBA 3RVTD 3I9GH 4JO8A 2PPAA 2RFGA 4RSVA 1I1XA 4D6CA 3W23A 4GB9A 4OZFG 3R6IA 3BMXA 4YSAA 5LYRA 3O41A 3VXSA 4QLJA 3NEXA 3EYFB 1XYFA 3MRNB 1U8JA 1QWNA 4FA8A 4AU0A 4K9EL 3QQ3A 2PO6A 4FXTA 3BUQA 1XRSA 1NLDL 3GWQA 1EAPB 4W9IC 2SFPA 2BNJA 3S2LA 2VITA 3QIUA 1EP3A 3C08H 1XXXA 2E5EA 4WWNA 1R3RA 3W5MA 3OW1A 3GLCA 1GJUA 4FQJH 2W94A 4AGOA 2F2KA 1DFBL 4CQAA 4F7TA 4NJAL 4YQXH 4R5VA 3FO1B 2CIIA 3DGCR 3M1CA 3ONBA 2K4AA 4U1JB 3EWCA 4WEMB 4ZI8A 3BUTA 2VL5B 4NKMB 1T8XA 2RUSA 5C2XA 3WSUA 4BKTC 4ZXBB 4CVWA 1TQCC 3CLEH 3KVDD 1LEKB 4G43A 4KEZA 3AB0B 5KBNC 1EGZA 5HJGA 3ZJ7A 4OGAC 3VXPB 5E8EB 1FHGA 4N5UA 1QFWH 2YXWA 4HPOH 4M1DL 4P59L 3WNMA 1K8XA 3EDEA 7XIMA 1FE8H 3UADA 5E8NA 3RWFA 3TJXA 4IGBC 1AKJA 3PJLA 2X1RA 3FTSA 4LWWA 3RA7L 3MUUA 4P05A 1JPTL 4K94L 1BVNP 3GI8L 3PWPB 4JRYD 4V15A 1I7TB 4PCTA 3G6JE 3AADB 2NOYA 4LRIC 4WZ9A 4HK0A 2VDLL 5IHSA 3IRZA 1NTHA 4ZNEA 1M56B 3TZFA 1UROA 1JFXA 2VXVL 3OVRA 5CJ5A 1LNUB 4XMXA 4IIFA 5B8CC 1S5WA 1MPAH 4PV9B 4ELKB 2WQXA 4S1SL 3BAYA 4XXDB 3EYOB 3IIVA 2J13A 4U3CA 3UZVB 3MV9D 2Z29A 3RRQA 5K39A 4FFVC 4TQIA 4JN6A 3HB3C 5BRBA 3I02B 3GZOA 4PR5A 1V55B 3B9NA 4ERGA 5LIWX 5AZ0A 2ANUA 1PAZA 4C6KA 3V0EA 3P2TA 1VSCA 5HHOD 2RTTA 3K81A 4PYGA 4MWAB 2QQNL 4P8XA 1S9WB 1QDSA 2H6PA 4I0KA 4U2YA 1IEIA 4NHCH 2BCMA 1SZRA 1TZOA 5D7HA 4AHPA 3U1PA 4RGOL 2ZOUA 4PRHA 1SUJA 4YLCA 4FX8A 1JWUA 2AEQL 1EZWA 3S3SA 1IQ8A 3W84A 4H1LB 1GYNA 4CKVX 3AG1B 5E1GA 1AYRA 5B38G 3TT3L 2ZCGA 5LCVH 3AMCA 5ANME 3RF9A 1CYXA 1MLCB 3IDXH 3ZTJG 2IJ0C 1XQKA 1OQOA 2VZ1A 2GPZA 1RVGA 2NYYC 2EKJA 4NNYA 2ON3A 4DX3A 3K1GA 1H3TA 4YHLH 2EYSB 3UJEA 2PF8A 3SKOA 3VGFA 3A6CL 2BSTA 2PETA 2Y7FA 2OMWB 3ABLB 4XPBH 3VG9B 2OL3H 1E70M 2UWEF 4WVRA 2WBKA 5MHSE 4F9LA 3UTPD 3V5HB 4ZTOL 1A1OA 1OAUL 3AG4B 3C5ZB 4OSUL 4HJSA 2G75B 1DHKA 4ICNA 1ZTXE 2OU4A 3RWEB 1BTMA 2VR5A 1S2AA 3ZR5A 2ZZ5A 2WNGA 3BE1H 5I0XA 2J1XA 4RDBA 3M47A 4LYPA 3CO4A 4GLEA 1FWDC 3KTXA 1ORSB 4F91B 4F7MB 3REQA 4JQVA 4MNJA 2EIJB 3CVDA 4LVDA 3V3WA 4HJ0C 1OOWA 5D9SB 3DECA 1E9OB 1UMLA 1BHGA 4OF5A 3NIFB 1HX0A 4WO4C 4J4PD 4NO0A 3EYPA 2WQRA 3VI4F 2CD0A 4K8GA 3HA0A 2FT6A 3BVXA 4EPEC 4WW1A 1GRWA 3P9WB 4JFDE 4CGTA 2DYSB 3IAPA 4C7FA 4XNXH 2CALA 4HGWB 1TXKA 5EU6E 4W86A 3QYNA 3MV7E 4MJIB 1EBGA 4MZ1A 1XBRA 3NVQA 1N7ML 1LBFA 4XMKL 1G6VK 4WSHA 1ROCA 4G70B 1NGYB 4B9YA 5BVPH 3Q65A 4LCIL 4QRPA 4WJXA 3WNJA 5MEOB 3VDBA 5TPWL 1H63A 5IMKB 1TLMA 4HZLA 4FOMA 1JQXA 2JIEA 4FQXD 1JF1B 4ZAKA 1A0QH 4KKAC 7PCYA 4NZJA 1TPXC 1BKSA 3LCGA 3W00A 2IH8A 2VDNL 2CO2A 4O1CA 5AHLA 3DX6B 3L0NA 4M6UA 6TIMA 1FVDA 1HK6A 32C2A 4AHQA 4WSKA 2WC4A 4YK4B 4OV9A 3BVUA 1CGXA 5HXMA 4IEFB 4ZQMA 5F4XA 3NFUA 2J74A 2OX4A 2AJXH 1BQKA 1I60A 2IG2L 4FXKA 3RPTA 1AODA 4GKTA 2A3CA 1MDAA 1JGMA 3FCGA 3GDKA 4RNFA 4X99B 1XMWA 1XCQA 2V3FA 4X98A 3GB7A 1YCSA 4EIVA 2CNYA 1T80A 2X2HA 1NF7A 2QR0A 3ARBB 3VB8A 2Y5TB 4DIXA 2JEQA 2EINB 1BYNA 1FRGL 2AJVL 5HHQB 3GNPA 3VG0H 4PBWD 5F9WB 3VYOA 5I74B 1YMMA 3KCLA 3A3HA 4E4FA 5HJDA 1I9JL 2K7QA 2I07A 3WX7A 5CPQA 1W6LA 4HC1L 2YAFA 1T7YA 3MRIA 3ZDZE 2OZ0A 1N3NB 2GSIB 2OWXA 5C09E 1AHWC 2AXGB 2DJLA 1J7VR 3RZWA 4AWSA 4HFUL 1JYXA 5B21A 3EYUH 4PJ7F 3QXTA 4DCQB 2Z4TA 4DZBB 3HRZC 2WV8A 2YZRA 3N43F 3SSGA 4QNPE 4JDYA 5DGRA 2NY7H 3ZYOA 5KYYB 1OF6A 3DROB 3OZLA 2QVFB 2Z65C 5E1AA 1TF4A 1HIMH 2DM2A 2G3FA 1S5MA 1AQMA 3EWBX 2HJLA 3CZEA 2PGRA 3H12A 3FTXA 3L9RB 2D2CC 4PJEB 3TX4A 1GW1A 1DUZA 3C9NB 5D1XD 1RCXB 3N2CA 4IMFA 4AISA 3DHDA 1KCLA 1XIGA 2Q3AA 5GS0C 3ASWA 2ABBA 1E73M 2ZXWB 1K4HA 3WQPA 2AJ3A 2NY4C 1QSEA 4KKCD 5KTEL 2F9BT 5C7XL 3MU7A 3KDNA 1SPQA 2XKNB 1E0WA 1HXJA 2MANA 2PP9A 3LG3A 2GWNA 1ZHLB 5C2BH 3VXSD 2AGKA 1JDDA 2DLEA 4UTBH 4MZRA 2VQUA 1OE3A 3IFPA 5IJVB 2YEZB 1ZAGA 3KS5A 5A6IA 4O57A 1UCTA 5GHWL 2PO6D 2CERA 2Z1XA 2YDRA 2FDMA 3QHFH 3QIUD 4HCRH 2R51A 3L3KA 3WLRA 4H26A 2IFFH 2PSNA 3NP4A 3P4MA 3SRHA 3IANA 2VW4A 3MBWB 3F3HA 3FQWA 1ZVYA 2V8MA 3HI6H 2BMBA 1RULL 4F33A 2G2NA 1YQVH 2O0TA 2Y36H 4MZIA 4NM8L 5CIPA 2TRSA 3EBHA 1F6PA 3QIBC 4WTZG 3W3OA 3AFLA 1F97A 2RALA 1DJQA 2ZUMA 1ET7A 4AV4A 1IAOB 3TWCL 1F11A 2FD6H 3QO1A 4DY1A 2GYSA 1UEYA 1BOYA 3M1ZA 3FH7A 1MFNA 2ZUTA 3V5DA 2FFCA 1KRMA 3T0TA 3DDFA 2IDUA 1AKJD 1BJ8A 1P1MA 2VERN 4HS8L 3B8IA 4Y16B 4Y4HC 3UTTA 5JVLA 2QGHA 1PW3A 2HXTA 4PJAA 1Q1JH 1SM3L 1VFSA 2DQUH 4FX7A 3UJTL 4YIWA 2R2HB 3HMXH 3VXOB 3YPIA 2AXFB 1FV1B 2CDGB 3FFDB 3WD5L 2WW8A 1JZJA 4JFQB 2Z93A 4L1SA 5ID0A 2QUNA 3ICJA 2WZMA 3S5YA 1NBCA 3IGLA 3HPZA 1YPXA 4BCEA 5AHMA 1T1YA 1YPFA 1A3QA 1RVFH 1X5IA 3S5OA 2XUWA 1J1XL 1F18A 5F7EH 1OQXA 3CYVA 4AOFA 3BI9X 1F4WH 3CIVA 4QE1A 2WVVB 4K36A 3DBPA 3A24A 2M26A 4CCCA 1I7RB 3GD1C 4TM9A 3CDYA 2WSKA 4OZHF 4JGDA 3SGGA 1C9DA 1JVOA 3N06B 3TJ4A 3DO4A 3VXMA 3HBPA 3VOHA 3TCLB 1W2PA 4KMQA 1JPFB 1XGPB 2EH7H 4M7ZC 4PCKA 4W6WB 2J5LB 1BQ5A 1O75A 1PJWA 2J27A 1SF3A 3FQ2A 3P2DA 1HHGB 4MMWA 1U8OB 5A8OA 1Q6LA 1OOAA 1MO0A 1WA0X 4EWJA 2CJUH 4RFEA 3L1FA 4PRHD 2V6AA 3RAJL 3GMPA 4FNQA 1IRAY 4PRIA 4PJGE 3H0TB 3PUGA 1B3VA 3NPSC 4D6IA 2XWXA 4HXBL 2HFTA 2ZOTA 3FU3A 4L8BA 2WSYA 2OMTA 1IR1A 3OODA 3ZWSA 5C8JA 4UYPA 3HAEG 5D2LE 2GVLA 2YAMA 3NQGA 4UBDD 3DO7B 5A2AA 1XRFA 5I03A 2XFXB 2BP0B 3HMCA 1PD6A 4MDIA 1ZVNA 2ADIB 4GXWA 4OIIL 4UZGA 5LSMA 3V6ZB 1BRLB 4DYEA 4LCCC 3KHDA 3ZHNA 4E2DA 3HEIB 3FSUA 5B7ZA 2X3BA 1PF3A 1FORH 4M1GL 3EBAA 4XBEL 3VUPA 4O8AA 2WLNA 2XWTB 3GD6A 3JWNH 3ZT6A 3LSOB 5GGRB 5CLXA 2Z9TA 5GISL 2XTSA 3QUZC 4Z7UF 1X5ZA 4BFGA 4JN1H 2BSEA 1JPEA 4A35A 1DSFL 1BZ7A 1E4XI 1MWAA 1A7OH 4N2IA 4HJEA 3EXLA 5HHMD 4DZ5A 3TZVB 1NDGA 3SYCA 3AXIA 4YHYC 3AWFA 1B3WA 3BAWA 2WGXA 5J1AB 1LOQA 2FZDA 2OLSA 4ODWB 1DDTA 4PBEA 3LBCA 4NO0D 3WL0A 1X5MA 4YVXA 2VERA 2XXCB 4P5RA 2NNCA 1NANH 2NX9A 4PLJC 4OLWH 2VX6A 3V0FA 2BXYA 3JWOH 1BZ9A 2I85A 1TCRA 5D55A 1CW2A 3DBSA 2OMNA 3QEUA 1K4CA 1VFOA 1FG2B 1ECZA 1SEQL 1TKKA 3S5LG 4TVDA 2AJSH 1P48A 4LXFA 2ZUWA 1XWYA 1YEGL 3HC3L 3BJ91 4HHWA 3MGTA 1UFUA 4TYUA 4QRPD 1LDPL 4C4KT 1B88A 5LNDA 4LHUB 2FGWL 1DQVA 4KZEL 2DKSA 3IDGB 4Y7OC 3LKSA 4TNVF 4KIEA 3IFOA 4I7VA 3WF3A 3QEGH 5EN3A 3WBWA 3SDCC 5T3ZL 3G5XA 5C0EB 2OS7A 5BYWA 4R5XA 4Z8FL 3VFNB 3BUPA 1PZ0A 5TGBA 4WVXA 3Q94A 1J05B 1XD0A 4OBSA 4YDVA 2F58H 3X11B 2B4CH 1ETJA 1CICB 5E5CA 4YMPA 4HQQL 3FSOA 3CXHK 3FZUD 5HYEA 2A2QT 1Q85A 2YCIX 4MY8A 4JFEA 5FOBA 3OJ2C 5C86A 4HK7A 1UKPA 4U49A 1SJDA 5LNRA 1V7NH 5KS9F 2ZNWA 5HGHA 4MJMA 2OX5B 4YHOL 1IFRA 4A7TA 1WDAA 1YMMD 1V6XA 3P54A 4LL9A 3IKCA 3LS5L 3PXHA 3PGFH 3NDZA 3OMZA 5EF3A 3Q0HA 4JNYA 3AWNA 1CLZH 2VLKA 2ZWNA 2R0ZH 1E28A 3QJSB 1TTIA 3DK2A 4LARL 1NM9A 3E74A 3D18B 3TROA 3LPWA 2OOFA 3KZPA 2E7BA 3WXWL 3BMVA 4JB9H 4GNJA 3WJWA 2ZVRA 5EWIL 3KLKA 1YTEA 1YEEL 5B7FA 2X6BA 1B57A 4H8VA 1QW8A 4FQCL 3GLAA 2DUZA 3SJNA 3ZK0A 4MMZA 1TRDA 3CZFB 5ISZB 1MG3C 3KW3A 1DKWA 1N6VA 3DTXB 1E4NA 4ZQPA 5IHZB 4RW5A 1HL5A 5ABFB 3QEQA 4JMXA 3PWUA 2WB1A 4K8RL 4PGCB 3GBML 1BSIA 5F7UA 2P4AB 3EJYC 3UDWA 2NNXA 4O16A 5HVFB 3TTYA 3FTGA 5DFVC 4CVZB 3HHMA 4AUBA 4ERIA 1EX5A 2POZA 2Z8VC 2O6FA 1I2PA 5IQOA 3FY1A 3SN6N 5DEFB 4R2GB 1ADOA 3NO3A 2CO4A 3PYCA 5L88H 3DERA 2Y6TE 2OMUB 3QDHA 4LNCA 5A6KA 2NR6A 2O72A 1HO4A 3S9YA 4WFEE 1G9NH 5CC7A 3ZM8A 2NX1A 1IFGA 2YW3A 5I75B 2X4PA 3EX2A 4OJYA 1KYOK 2O6DA 4XCYB 5ESVA 4JUSA 4NO3B 4FL4B 2CCRA 3DVGB 5D71H 2GCYB 2N7AA 3WFDL 3NSCA 4HFWB 5C55A 4RVBA 2HFFA 1JTOA 1AE6L 1FO0A 2F7IA 3LEYH 2C9VA 3GBNL 4GPNA 2BHFA 3QISA 1HQ4B 3NACH 1QX1A 2ZG2A 1IT7A 4XMPL 1ADSA 4KO6A 3UBFA 1QEWA 4CSZA 1ZV5A 2CG9X 4GJ1A 1J5DA 2R1YB 4EVNA 1C12B 3TYFA 1Q2SA 3LKOA 5DCCA 3WIIH 4FEMA 4AT6B 5HGBA 2IV8A 3PZQA 1KIQA 1XVSA 3MRDB 5AOJA 3T0DA 5E0FA 3FQTB 2VDRB 1F76A 3FB6A 2PDCA 1MCEA 4Q8NA 5D1ZB 4RNRB 4YBLB 2ZXGA 4YHZH 1WDPA 4KMTH 3T42A 5CSUA 5KJ7E 2AKRB 5FR3A 3RWGB 1L9TA 1NGPH 5BMFL 3BWAB 1QBBA 5FYJL 3C8DA 5EF0A 1LE9B 3VDAA 3RO6A 4IIQB 3KBMA 1ZXQA 1JXDA 1KIRB 1GOKA 1XBVA 4B9PA 4MZ3A 4WY7L 3MJWA 5ACZB 2MOVA 1OCOB 2IWFA 5KJRL 1LO4L 3PREA 3S98A 2E7HA 1WBZA 3TL5A 4WNQB 2AEPH 1VFLA 1HHKB 1FNGB 4I18B 4XHJC 1TVNA 3TBTA 1WBXA 1MQKL 1NFBA 1Q8JA 3VILA 3CXOA 3O6AA 1WOAA 4HKZA 4WWKC 1QLRB 4KHTL 3IUHA 4ZQNA 3VXMD 3SO3C 4GMTH 3TN0B 5T3ZE 5IVZA 1BQRA 4P2RB 3EKCA 3KDMB 1SVCP 3UH8A 4J8RB 4DQOL 3U2SB 4ROPA 3S5NA 4AMXA 4Q22A 2HVJA 3MZTA 4PCPA 2XG5B 4P7NA 1X8FA 1CFQB 1ZDQA 2IVFC 5FA3A 2GHWB 5B3SB 2G95A 3BXNB 3IKKA 4LBUA 3BZEA 3GC5A 2VLMD 5BVJA 4JE0A 1CT8A 5AHIA 4PRID 2QHRL 2IWEA 3U57A 4XK2A 1IBFA 2V5MA 5KYXB 3S42A 1QBMH 5D9MA 3CH9A 3P9LB 3EJRA 2IMMA 4MJ2A 1TZIA 1F7BA 1L0XA 3DIPA 2FNBA 1H61A 3ATZA 2V69A 1Z3GL 1CTOA 1VF5C 1HCVA 2JJSC 3CVIH 2HT2D 5JA8B 3BDXA 4PMNA 4QLLA 3FUIA 3GSNB 5EUOE 4LBEB 3W7GA 1M41A 4X4KA 3T8QA 4HXAH 3UYRL 1Q0XL 2NQ5A 4HH8A 3EG9A 4BZ2L 3VWJA 3DG6A 3E5BA 4MB3A 5MERB 4X5XB 1RZFL 4HMCA 3KZ8A 4HWZA 1RK0A 2QNEA 3GIYA 4KMLB 3MFFA 2IPFA 2WXJA 2BSED 4F2MA 4BUGA 2Z6JA 4O1FA 2APVA 3OR6B 2RDXA 3BG9A 3ESNA 5FA5A 3WGVB 7ENLA 2DJUA 4D8AA 4B9GA 1I1RA 1GGBL 4JR9H 3O2DH 2GT9B 3AMDA 1YY9C 5D7LE 5B39A 5C0AA 3QEHA 3D46A 1GGCL 5AEAA 4PB9H 3S8GB 5IQ7H 5HVGB 3QM3A 3BHBB 4NC0B 3IDIA 4Y9CA 2QF7A 2MUCA 3UBXA 4WU5B 4JO4H 3WQDA 4XO6A 4GXMA 4NZFA 2P3EA 2E27L 1GQNA 4TSCH 3K5SA 3FUHA 3T77B 3W28A 3M0HA 2WQ8A 4P2QE 4AZCB 1QPXA 1SF5A 3SE3C 4D3CL 1SJMA 1DIKA 4G8GB 1QNPA 2FWOB 1FHDA 3ELFA 1U93B 4QLWA 1Q38A 2APSA 3P77A 1UGNA 3EFOB 2ATKA 4Y2DC 3RK8A 5BS0E 2KT6A 3IJ8A 1KEGL 2KDYA 3WEOA 4ELME 2O9RA 4D1IA 1TETH 3KXFE 3TNBA 4L4JA 1JCJA 3SDXE 3ZX1A 2GAZA 1V05A 4OOZA 1RIHH 2CIKB 3W2NA 5LHDA 5GJTH 3E6HB 5C92A 1KB5B 3BKYL 1GKQA 1HKLH 3LI1A 3UQNA 4G42A 3DRTA 3F62A 5EZOH 3OIXA 4H83A 4B2DA 3OGVA 3MROA 3OXRB 3E2SA 1AGEA 4JFED 2HCVA 3KPNA 3WKQA 4A2LA 3C5QA 5HHPA 2GFTA 3BFWA 2KX9A 1ML1A 3NCFB 4B41A 4JPIA 2IGLA 4POUB 4X9IA 5GGSY 3AY4A 3KVQA 3N2TA 4X6CA 4AJWA 2P3YA 5GRZA 2VLKD 1OY3B 5J12B 3FTVA 1XIWA 1ICQA 3OKKA 1VRXA 1BQHB 3G5VA 1M2VA 4EN3B 1YMHB 4G7YL 4YEEA 3BFQG 2VRJA 2Y5JA 2PCXA 4W9KC 3VMPA 4O12A 5AZEH 2AK4A 3O7UA 3NEHA 4LEOA 1AO7E 5CEYB 2Q76A 3PFRA 4MAUL 5E9AA 3RUGE 1XLKA 2OT1A 2ZD0A 2R0LL 3P0WA 3O0RH 2P9RA 4NKIH 1DE4A 1R3IL 3NSMA 4F9JA 3VNMA 2ZFAA 2VMFA 1HWGB 5D7JC 2KLTA 2JKTM 4FB7A 3CC5A 3P0VH 1LM1A 2IADA 1CGSH 4UR7A 3QEQD 3U46B 4KV5F 4M8QB 4GP8B 3ULUL 4FZEH 5I1DB 3C75A 2ODHA 5FO7B 2A3TA 5JOEA 1TA3B 3FW6A 2V7HB 4HSAC 3DOSA 1FVPA 3KMDA 4BEQA 3SCWA 1A3XA 1BREA 3QZ6A 4NS0A 4NJ9H 2BS9A 5TAOA 4ZMQA 4QCIB 1G1KA 1OAYL 4QHMA 4XBSA 2DV0A 3F64A 3F12A 4IRSA 2H32H 4GAYA 5DQ9A 2NR6D 2WLIA 3MLXH 1WUNT 3ORJA 3V75A 2FMNA 3QZPA 1AD9A 1L9QA 4CA4A 3VGEA 4RZCB 3TPKA 5JZ7C 5EO9B 4GKZB 4KI5C 2W6RA 4HJUA 2XC8A 2OKOA 3B03A 4PB3A 1XIEA 3VRJA 2UY4A 4PC8A 2YMXL 2EXTA 3ZDXB 3L7RA 2JJTC 1XLEA 4WUUA 2I9LB 4R0LB 1X3DA 2AQTA 8RUCA 1B4JL 4WGVB 2WXNA 2OQLA 5E2UL 2GGJA 1X7SA 3OEXA 3A4FA 3KNBA 1YN7A 2Q7YA 2VZVA 2CKBL 2INZA 1VCAA 2G9HA 2D0HA 2A77H 3DBXB 4UIMB 2V8ZA 5I76A 4KDVA 5KZCD 4OQTH 4XUGA 1HQRB 3SAZA 4XZHA 4Y96A 4B0MB 2WPGA 2ZKHH 5IP4A 3NCOA 4L3CA 1RALA 2BH0A 4IX0A 3EOBA 4OZFH 3RVVD 5C0FA 4RAUB 4WCYL 3FPYA 4PEKA 3TFBA 1E4LA 1LJYA 5HDQL 1HCFX 2ZE3A 3IFLL 2AC0A 2FO8A 3UR2A 5M3WA 1TZHB 4GVIA 3WAKA 4JD4A 2VR7A 5MI0B 2VXTH 4WJ8A 3GKAA 5EORH 1ITQA 3BCDA 5IEKB 4BWLC 3UU0A 4LAJH 4JY4B 4M7JL 3TU6A 4ASTA 5E8DL 3FBQA 1DQDH 1NU5A 5T3XL 5HR7A 2SEBB 5HNUA 3L5WB 5LKNA 3ZR6A 3LRKA 1LO2H 1QWKA 1O7AA 4W9DC 4P4KC 2OLAA 4GUIA 3TYAA 1NFGA 2QVKA 1Q6EA 5FCSH 3SGKA 2B7DT 5IT2H 1NMCB 4JG5A 4QOKE 4JPVH 3CBRA 3C3UA 3V5KA 2FLIA 2OI9B 4KVNH 4C6JA 2ZUXA 3NIDE 1R8LA 4N0CC 1I7UA 3IGFA 4C7GA 4OIAA 4HS6B 5DUML 1UJ3C 5GGVY 4LF2A 1H9DA 4ZMTA 3RLHA 4YFDB 4JFXA 3VRIB 3QJHB 5D9PA 3ZLHA 1FPTH 4WCJA 3GEWB 3R12A 2D23A 3GY1A 4XBMA 4MS8C 4LDLB 3VNIA 3B3IB 1GTNA 5JHDE 4HF5H 4QHNB 4JRXE 2E6AA 7A3HA 2YFOA 4PP1D 1S5IH 5DRZB 1Y18B 3QVQA 2WLLA 2B39A 5FV1L 2ZSWB 4H2AA 3HPFA 2UXTA 1IT0A 3G6MA 1Q9LB 3S5ZA 4QEGA 4NJGA 3JVFC 1PQZA 1TJIH 5KSBE 2ZKWA 3NIFF 4E9TA 5AC4A 4LLQA 1LT7A 1KGIA 2ZPKL 5LIYX 3DX8B 3O4LA 1K4DB 4Y9MA 3WCZA 1BP3B 3WS6A 3VWJD 3IDYC 5DDHA 1SQ2N 5CHNB 1OTSD 5DS1A 4JX5A 4UQEA 1GEQA 2Y7DA 1HZKA 5AW9B 1N55A 4OLZL 2G97A 1C92A 4IIGA 2ZCKH 5IB3B 1ONQB 1GY2A 3M07A 4LDEB 3M7SA 4NWTL 2J7EA 1OF2A 1ZS8B 3PPCA 5LNEA 4FXGA 3ZDWA 2EC9U 1XTLA 1VFAB 5IMMA 5F71A 4KPLA 2FTYA 4PSRA 3HC0B 4G8EB 3FCTA 4TVPL 1E6XM 2G0KA 2DQHL 2AXWA 4AF0A 2LTQB 3HPXA 3UTSB 5C0AD 4HH9A 4KRNA 5EZIH 1U8CA 3FLUA 2O61B 5C9RA 2PR4H 3WOVA 1WV2A 5GSVB 5IB1B 3CSPA 1MFAL 5IGXL 4UAHA 1QOKA 5MKGA 4PD4J 4J5VA 4H2HA 1CG9B 4J3TA 5IVXE 3ZTJH 1KIUB 4O2EA 2W91A 2D2HA 2B3RA 4A29A 4LSVH 1PAMA 4JFDB 1E15A 3NCBB 5HWMA 1E5YA 5TDPA 1R5IA 4OBTA 8A3HA 3O2WH 3AQUA 3MV7B 2NQLA 1A50A 4XC1L 3H9HA 1KJ2H 3ZMNA 5DJZB 5BOZG 2C3VA 1DQMH 5TTRA 1I2RA 1JMZA 3A9IA 1WKEA 3UR8A 1OP9A 5F3BA 1MAML 2VSMB 2OODA 1BYAA 3DI0A 5D6CA 5ALCH 1I8LC 3FUFA 4KK8C 3G8RA 1MH5A 4QRRA 3D12B 3MWCA 2DMBA 3NSJA 4RK8A 2C13A 4K37A 3G8EA 1YJDC 1D7FA 1BKHA 5EOQH 2ICCA 4B2DD 2REQA 5ELIA 2YMTA 5JIKA 3OHXB 4XAWH 3ZJAA 3W39A 2ICWJ 2Z34A 2BV9A 4AC7C 2F7QA 3T7VA 1A6PA 4M43H 4MHHI 2C3XA 5F96H 5E99L 3GLZA 3AJ7A 2ZYHA 2PPGA 1O0VA 5DQJB 1YMYA 4FTVB 1BVLA 2Z3FA 1UXSB 5DRNA 1XINA 1M1SA 2YMOA 4UZUA 1ONEA 1XIWD 3GINA 1Q0YH 4PJEF 1CYGA 1AHMA 3VIMA 4HW6A 4JXCA 1OO2A 5T5NG 3N55A 1W8NA 3TMQA 3ZDZB 2AK4D 2VDLB 3E7JA 1TTJA 2CLVB 4X8GA 5C09B 4L9DA 3MUCA 4ACZB 1AR2A 1EEZA 3BP5A 2UBPC 3W6MA 2EXYD 1K02A 4QF1B 1OY0A 4Y5YA 3TLRA 4MCNA 5FAAA 3P0YH 1FH5L 3N1QC 2Y88A 2C1PB 2BC4A 3W2DH 1RP8A 3U2EA 1QFWL 3CK0H 2XBTA 1ZTXL 2VE6B 3S97C 1J0IA 3ZBMA 1PDZA 1FE8L 2YXXA 4GUCA 3KH3A 4A2RA 4XIMA 3UBXI 1JGDA 1E55A 1IUZA 3REVA 3FQNB 2HYMA 2NZ9D 1AG6A 5B7EA 3E2QA 2APBA 3CFTA 2W27A 1TQTA 1LORA 5EMMA 4IRSD 3LQZA 4ZUWB 1NEZA 4TSBH 3EO9L 2GITA 3MNDA 4DK5A 3FOLB 6PAZA 3C2FA 1QUMA 1G1YA 5FJOA 5I0WA 4LEFA 3KOYA 4JHBA 2C9AA 1JAKA 1WG3A 3L5HA 1ZT7B 3OU8A 5GRUH 3R2GA 4O15A 1UIPA 1UYWH 2BXVA 1IBZA 1EK3A 4WUUD 4V28A 4YPJA 3MOBH 2KQMA 3QR2A 1DOSA 2YD9A 2PODA 1R4XA 1LBLA 4UTAA 5SWSE 1LQSR 3MRRA 3PTMA 5G4HC 4JKPH 4RWYL 1AQ0A 3N18A 4FFYL 4NEHB 3EGSB 5EEXA 1TSRA 3HZKB 1AH3A 1N59B 3ID7A 4WKZB 4NQVA 4UIOA 5T1MB 3EO0B 3QXWA 2L04A 4TVPE 4U2ZA 4OZ4A 1RBAA 3QRBA 4JPWL 4OAWA 1KC7A 3AAMA 2EDOA 1YUHB 5J13B 4DWDA 1QQDB 1G4PA 1LQAA 4Q6XA 4URKA 1MFCH 1G7LB 1W9XA 5JMOC 2UUDH 1OARL 3T0EB 5LCVL 4L3AA 2A99A 5GSRB 1D9KB 5AAPA 3ZTEA 4B90A 4HAKA 3N19B 1NC2A 3NFSL 1R19A 3AXLA 1GJIA 1AGDB 3IVSA 4DJED 1NQ6A 5JBDA 3BLKA 2H3DA 1I8KA 2H8PA 3D47A 1I31A 2TAAA 4Q9RL 2PWDA 2OL3L 4FQIH 4PUBH 2KHAA 5EBWB 3P11L 1KBWA 4U5KA 4NHUA 1GYCA 5J9PB 2H6OA 1DQTA 4JAMA 4AZHA 2V2XB 4XAZA 1DIEA 3OSVA 4O02A 3KWUA 2WKGA 5DD3L 1QI2A 3TTSA 1RHHA 1KKRA 1CZ1A 1JMXA 3BE1L 4N8CH 5DHVA 4JRLA 1TV5A 4ZDHA 3AIEA 3RO8A 5F7YC 5SX5H 3GU9A 3QQWA 3C3NA 2E7LC 3LN4A 2BTMA 3FYYA 5F89B 3PDDA 3DFHA 4YBQD 4PJXE 2DW7A 1UWEH 4WKXA 4DKAA 4C54A 3BSHA 4L29A 4HTYA 4XN9A 2F74B 3WIAA 5EU5A 3JTTB 4AYMC 3DCPA 2X0SA 3T0WA 5JDJA 1AACA 4L1XA 5AVYB 1YNKL 3I75A 4HUWB 2R8WA 4MXQD 1X5JA 2IXQA 3P02A 4AZ5A 3TTQA 3WMLA 4PJGB 3URQA 3WG6A 3EFDH 1WLHA 1XZ0A 2Z4QB 2C34A 4ZUSA 2R9HD 1LE5A 1P7KB 4FQ2H 1OAXL 2N1TE 2A0LC 4PJBE 5TE4L 5U4NA 4P3CL 4GD0A 5KSUB 4IGHA 3E6FA 5DJ2B 3O4LD 4S23A 3TH3T 4YL9A 1ZTMA 5JXEA 5E93A 2P1FA 4MASA 3RG1C 4QRSB 3RGVB 4IHBA 1M6UA 1ISVA 3E0FA 3RFZA 1IU1A 1A3RL 1E51A 3SCMB 4XMZA 2X4SB 1TG7A 4NRZB 4N1HB 1H7WA 1DJXA 1OL0A 3FGCA 4ZFFA 4PBVC 4JO1L 4K5OA 1KENH 3UIZA 3ZE0B 2Y69B 4X8JA 4AYGA 1OABA 2O9TA 3EW3B 1Y1UA 3QKZA 5JH1A 4WRLA 3K6SA 2YLHA 1VH7A 2KKQA 3GJFA 2FHCA 3G5YA 3LZ5A 5I8CA 4JS3A 5TNVA 5E9DE 1PZ5A 1UTDA 4BV1A 3IMUA 2I60L 4KKLD 2GSEA 3FK4A 5GRWA 2WPBA 3CHVA 3VU1A 5JHAA 4ALDA 3BKJH 2O6PA 3PE9A 3L1OL 1HKKA 3JVGC 4TNGA 3MW7A 3CWNA 3HAEH 4IQHA 4D7BA 3S2MA 1T41A 3IJLA 4E68A 3PNWB 4ODTH 1A4BA 4J6IA 4DW2L 1FWEC 3SB3A 4KXBA 5C08B 2IBZY 3NZ8B 4CU8A 2J8UE 3EYUL 1U58B 1X5FA 1UVQB 3KVKA 1EGJA 3TK7A 1RSCA 4TUJA 5ECGA 4F7EA 3QJXA 3FDGA 4AQEB 2YUZA 1XR8A 1FGVL 5EV7A 3IS0X 1OX4B 1TE6A 1BOGA 2WSDA 4L3EA 2POTA 2FH6A 4EDWH 2IW0A 4QRRD 4WZHA 4C1NB 3WBDA 4JS7A 3MREA 2DJXA 1NLBL 3DARA 4KFMA 4LUSB 5I6PA 2QS8A 4YDZA 3OGCA 1M68A 1YDOA 1FFOA 1S7WA 1S3HA 1V6TA 4JEJA 2D2OA 3G3MA 1G4TA 2JI1A 2DAVA 1WTLA 4X7TA 1R1CA 2PYFB 4Z76A 1F1GA 2ICWB 3AB0C 4K3EH 4L2LA 3EGDB 1J93A 2IQTA 5ICZA 4KHXL 1QTWA 3MY9A 3TYGL 2X6UA 2DKUA 4JHOA 2BSLA 5FHAH 4F2EA 1CDIA 1E5UI 5DCEA 1NBZB 3RGBA 4YUEH 1H15B 4PMUA 1IT8A 1I8MA 2DZAA 3HIZA 4NJJA 3BYTA 4HHHA 1YEKH 1GZHC 1OEPA 2HK1A 2PKDA 5EDXA 1EO5A 3W7NA 2GVGA 2H26B 3V8CA 4BKLA 4GIEA 1VCGA 4MIMA 4TNEA 4BFEA 4UOW0 1SZEA 3BICA 3MQIA 3VGAC 3QC0A 3VXGA 5FF6B 5IKCB 3LHZA 4QRUB 4HCRL 3P69A 3NSFA 5CJNA 3QO0A 1OWRM 4X4YB 3DYMA 2J7LA 4OCWH 4S3CA 4AMAA 5HULA 2D3VA 3GH5A 3HI6L 3GIZL 3G5ZA 5CBAB 3F4WA 1KCWA 3VFPA 3IIXA 1L0PA 1LJMA 2AS5M 3NIGE 5DHXB 3BP7A 3EKGA 3QV8A 1VZHA 2PPDA 1DLFL 4NC1C 5LLIC 1K8DA 2HPTA 1NOWA 3FN9A 5JW4Q 2FD6L 1B9BA 2R23A 2R2BA 5A6SA 4LCWA 3IU4H 3L5MA 5FEBA 3BLOA 4U5IA 2WZPA 1F8IA 5ES4B 4YDNA 3EO1A 3B05A 3WEMA 1AW5A 2QCDB 1MI5E 2XWEA 2W59A 1F42A 1ZV9A 4MWAC 3AGWA 1V6YA 2W8CA 3DKLA 2PEVA 4HBQA 4FG6C 3VTTA 2DMHA 1GG1A 2M1KA 4B27A 3HS0B 4NERA 5INCA 5J1SC 3LB0A 3W37A 2MTPA 3MLPA 3QVAA 4W93A 2GC4C 5F7EL 2LVCA 5KITA 2NX5A 2J20A 1DVQA 1OSZB 2LABA 3EJZD 4FHBD 5FB8B 4YXLL 5D1QE 1JK8B 1TWIA 4LCRA 2DYPB 1OTUD 1FI8C 4WI9A 2ZZ4A 5DVOA 1PCXA 3KBNA 4Q9QL 4O2FB 4TOYL 5B3NA 4ZUTA 3E0LA 4JYFA 2H2SD 5CEZH 3U7WL 1BWVA 2BNQB 5KYUA 4AJ0A 4YSQA 3P30L 2DDXA 2QHAA 2CLRA 1PS3A 1XLBA 1CTMA 3U4EA 5I66A 2P3ZA 2MTAA 2VRKA 2JJUA 1XB6A 4NQXB 2EDHA 3BRDA 3C5ZC 4OI8A 2EF9A 4PULA 3KHOA 4C55A 4Q8BA 3RYSA 3WNNA 3EA1A 2FQIA 4Q6JA 4GXUM 4ONFH 2Z2UA 3CH0A 5F4WA 3NA4A 3MJ9A 3D25A 4B96A 4G9FE 3V7AE 4FR1A 1TO3A 3C6LC 4C6DA 3OKOB 4EOWH 1SEBA 4OJFL 1LG1A 1G6RL 1NTDA 1NC2D 3TBVA 3GSQA 1QNZH 4ZT1A 2PXYC 1CN4A 1T20A 3HI1A 3WNOA 3D3VA 1RJZA 3VXUE 1MCBA 1FIGL 3HGOA 2WJZA 1HXMB 1CCZA 4APQC 2FX7L 2ODOA 5HYJE 3UR5A 2ESVE 2FPTA 4TUOA 1EIBA 1ZLWH 5LHEA 3KPRA 4AI7A 4PGEB 3LKNB 2EIZA 4JN1L 1Q45A 4PW3A 3H7BB 1QPRA 1FH9A 1U3HC 2WCSA 1T1ZA 1U8NA 1NEUA 4JFHE 3D2UA 2JVUA 4JFYB 3IDNB 1TELA 4XBGA 1X9QA 3KVPA 3T09A 3VCRA 1XSJA 4IU3A 2D4FA 2OLHA 3HU7A 5F2MA 4GG9A 1G7HB 4PL2A 4YK4C 3UXDA 2BVTA 3C0JA 5I1AA 3JWOL 4RISH 3NZRA 5JW3H 2WLKA 3R0NA 4TL4A 3Q1SH 2ITFA 4JDTL 5GGUB 3F01A 5AUMB 4M5ZL 5KINA 2AJSL 2D0FA 3QUXA 1XPGA 3BH4A 2EYRA 1FZOA 3ARBC 1OSPL 3CNKA 3GHBL 1U83A 4TVSa 2NZ1A 3LQAH 3O9WB 3DFPA 4FFTA 4P9HC 3O8XA 2RR3A 4OD2B 4HPHA 1GOOA 5F9WC 1X96A 1GQLA 4X0NA 3U6RA 5JXED 2A4AA 1KT2A 4X83A 2JALA 3TEYA 4CJ0A 1IGCL 3IT8D 1K8IB 3UOAB 3USBA 5FO9A 1MF2H 4NPJA 1BJMA 2I26N 4F15C 5ERWA 1VB9A 2P88A 3KYOA 1AW2A 4QUOA 5E7BA 1HHJB 4Y5XA 1QPQA 5F6HI 4RIRB 3L3GB 4ZS7H 1IXOA 1QOXA 4AWTA 1FL5B 5IHUL 3GSXA 3S3PA 2Z1VA 5HR6A 5C7ZA 4HHLA 3QNZA 1BYOA 2DVUA 1OW0A 2W65A 2VDKH 1V7NL 3I84A 4HD9A 1TJGH 3IXAA 5DRIA 3GZPA 1QO3B 4X4MA 2ENPA 4J8QA 5C2UB 2BOBB 4XI5D 5DQDH 4QS5A 2OSLB 4URTB 5L2KB 1CLZL 1N67A 2R0ZL 1EF3A 3PF3A 4ANKA 1N5AB 1FTXA 4E5TA 1ZT4B 4ABWA 3TNNB 4JB9L 4UUIA 2WXIA 2QKFA 2PN5A 3N40P 2Z27A 3QPEA 4YSEA 5A8PA 1UWIA 5FYLH 4HA4A 1WFUA 1U8KA 3MJ8A 3U83A 1H11A 5I1KH 1XLMA 1Z89A 5AD0A 4Q89A 5LXGL 1MHPH 1OCJA 4L3ED 2Y1YA 5I8OH 2PDLA 5FESA 4JX6A 2AMXA 2C1OB 5H35A 4U1NA 3WQ5A 4HCHA 2C9QA 2PW2B 1R3VA 1JGUH 3MPCA 2YPLA 4ZAKD 4ELMB 1CLOH 5IBXA 2NTFB 4ZK8A 3EIFA 5LBSH 3CFIC 4DVBA 4CRPA 3P4OA 3PFQA 1P0NA 2OV0A 4JM2B 1YY8A 1JGLH 1E7UA 3FRPA 2JF1A 2B1AH 1JFQH 1WS7A 3A67H 3DFNA 5HJXA 3KVLA 2R4SH 4I5RA 4IJTA 4JHMA 2XNAA 1FFPA 2VLJA 2IO5A 4A7SA 4WUIA 3ATEA 1GK8A 2ZX6A 3DGGA 2P24A 1C5BL 4JG1L 2PDWA 4XVTH 1Z6KA 3U4KA 1VLXA 3X12A 4Y16C 3FFCB 5F70A 2JE8A 4PMRA 5I1GH 4MDOA 3L5XH 4OFVA 2EG6A 4Q4KA 1JWMB 1M5WA 4F0SA 1D5ZB 1A1MA 2VDQH 3WXVH 3ZQXA 5C0CE 5DR5H 4B4FA 4PS3A 5EB9A 5JPNB 3PC0A 3FJNA 1NFDA 3NACL 4I1PA 1I1YA 3JWNE 2A4ZA 5G2IA 4Y9NA 1P7TA 1D7CA 1Z2KA 2JIXB 5EZJB 1J11A 2YPVH 3P0XA 2J8TA 3KL3A 3QUYA 3SKNA 2CLHA 3WFCH 3QOKA 5LGZA 2ZYRA 5DUBA 1RZKC 4IHOA 4LS1A 3KWVA 4NSKB 4D8OA 5FCUL 3ROOA 3VD9A 3HMWH 4CJ1A 2DEPA 3WIIL 4LCWD 3ASOB 4QWWD 3WJJC 4KOCA 4UIKH 4CADB 4QXIA 3GNML 3SOBH 3MJ7A 3SGJC 3ZDXF 3K6DA 4GBUA 4YHZL 3DRQB 2B59A 2WN2A 4KMTL 2J5LC 2XQYA 4JQAA 1QLFB 3D0VA 3A5VA 1DWIM 2WLHA 3T05A 3KLHD 4XMTA 3S96B 2DTSA 3RIFK 4Z7VA 3O3UN 4PLOB 4RLDA 4RE0A 4JN2B 4AQ1A 2W5PA 2A9AA 4S3EA 5DLMH 2QR6A 4IM8A 1QSED 3U4BH 4US5A 2NX5D 4HIHA 2Y5QA 4PTUB 1SJHB 3U7YH 2YAQA 2WWCA 3VFTB 4PJIA 1UQYA 2AEPL 3BZ4B 3ABXA 5BW6A 2QZRA 3M6YA 4TLKA 3UG8A 5A1AA 4WSGA 3SECA 1HTYA 5TK4A 2ZC8A 1DVZA 1DQJA 3LHUA 5IQNA 4CLMA 1AXSA 1F8MA 4MMXB 1TQUA 3CCHA 5I6XB 4BS0A 3EBVA 2DQTH 2WC3A 2ZOKA 4GS7B 5J8OA 4X9YA 5EBMB 1RZJC 4WJ5A 4N2NA 5LWYH 5JPMB 4WLCA 1UWAA 2RAMA 3MLSL 5EU7C 1R3KA 3VNLA 3U1SH 4AIUA 5AOLA 5I5RA 3TZVC 4P46A 4QBXA 3T6QC 3A64A 4EUPA 1IEAA 4WEEA 5D03A 3SHSA 1YN6B 1O12A 3UTTD 3ETTA 5FEPA 1BXCA 4AENA 1PL9A 3NQBA 4P3DB 3CVIL 5I3HA 4DF2A 3BO8A 4DGYL 3KAOA 1ES0B 1EWEA 3QBUA 4JTJA 3D3VD 3MP4A 2IQ9L 2QQ6A 1NDMB 1J96A 5CJOH 4R27A 2Q8BH 1W2KT 3N29A 3X14B 1EZVX 2X4UA 4HXAL 4WHTB 2BGQA 3S4SB 5HQMA 3M1OA 3GXMA 4FK9A 1NARA 3FUDA 1T7LA 4N9GA 4LSQH 5B4MD 1WAPA 1GVYA 2KPWA 4QTHA 3KPRD 3P62A 3HPAA 3HFFA 2XM2A 4A6GA 2HMIC 3OR7A 5AENA 2GSGB 1TZGH 5D7KD 4YJZL 4YDMA 3SDYH 2DWSA 1HL9A 1DBBH 3HQPA 3D2UD 4UQCA 4PJ9A 4P5TA 2FWLB 3BH9A 3G22A 1P4LA 1Z9SB 1U92B 3U9UB 4JNMA 1O9ZA 4ZPTA 2IGFH 2EEBA 1P6FA 1R3HA 1ME7A 1IBGH 2DY2A 2BSCA 1A7NL 2XJKA 5SX4I 3HPLB 4PB9L 1RUSA 4NHVA 3WNPA 3GSWB 1CICC 2HKHL 3KLDA 3JBG7 3T2OA 4LF3B 1ZOXA 5EUKB 3QUXD 3C61A 3TCTA 5IROC 3UJJH 1JD7A 4PJ8B 1IE7C 5BRZE 2A0NA 4XGZA 3N9SA 4HU3A 3O8XD 3GS6A 1G7JB 3O2VL 2YUWA 4FF9A 3QHTC 3OPUA 5F1IB 1AR1D 4L8SB 1ROWA 4CMHC 3MXVH 5KSBB 3X17A 5T1DH 4DKTA 3VOIA 2E25A 3L9YA 1A7QH 1VZGA 5I0ZA 1VGKA 3CV2A 5DT1L 4NN6C 5J6SA 4JL1A 3LNHA 5GJTL 3DFYA 1A6VH 1OZTG 3W01A 1SHWA 2H3NB 4P2VA 5IW1A 4TTDC 4IQEA 5EMKA 1EQCA 1I53A 5EZPA 4GRSA 1RFDH 3KG5A 3AICA 1L7IL 3MRQB 2F5AH 2BHYA 3UZWA 3VFCA 2XCMC 4CU6A 3GRBA 3MNWA 4OU1A 1ZHNA 4NUGH 3TN3A 4D1JA 2FJHA 2DZWA 4NI8A 3EGXB 4KEVA 2Z6IA 2HLEB 1B6UA 4FOKA 4YTSA 3RFAA 2W3ZA 1DCLA 4GK8A 5T9CE 4NYYA 2P10A 1ICPA 1QLEH 4IJRA 2OK0L 1NCWL 3PQYE 2WBXA 3TYUA 2YWYA 4DOHE 3WDQA 4D71A 4R2GC 4R4FH 4PS7A 4B91A 2WHKA 3CPLB 2WMIB 1CUOA 4Z1YA 2JK5A 3PGDB 5DJDA 5AZEL 2XG4A 2DLHA 4H8QA 1M1BA 1TVDA 3CASA 1U8LB 3FN0H 3SDAA 3FT2A 3WY3A 5I75C 2AQNA 3QPQD 3BUIA 1MLBB 3W26A