1XH0A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with acarbose
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh0A01
5EBAA 4A3YA 5C8BB 3WF1A 4PTXA 3BUPA 3AICA 3CZ8A 3CZKA 3QHOA 1NWRA 4WKHA 3W6MA 4H8UA 5CLTA 4L4OA 3WDJA 3WUFA 4D6CA 3QOKA 3SCUA 4D6DA 4TVCA 4ZEPA 5BXTA 3WMBA 4KH2A 2WBGA 1E6NA 3MMDA 1TE1A 4W8LA 4HOZA 4QLLA 4CD4A 2VCBA 2WYSA 3T0DA 1CGTA 1UH4A 1H3GA 1UWIA 1OD0A 5E6YA 4M1RA 2J25A 3A22A 3D4ZA 4PMRA 5FIPA 3G6LA 3RM9A 7TAAA 3AIUA 1LWHA 2YFNA 3VSTA 2YLAA 4W5ZA 2E40A 1G5AA 1VFFA 3A21A 2BS9A 3BAXA 4JL1A 2G3MA 3WY4A 5D9NA 4UQ9A 3ZJ6A 4C7GA 2DT1A 2D0HA 1GHRA 4W7UA 1KGUA 1UYQA 1JI2A 1HJVA 1VF8A 2WHJA 3B9DA 1HXKA 2E4TA 5DFAA 4LQ1A 4MJ4A 2X2IA 2QMJA 3ARTA 3CUIA 3DYPA 4AD2A 4V2XA 1R86A 4BCEA 1E40A 2WSKA 2J77A 2XHYA 3PZGA 1QX1A 4NZFA 4A4AA 4X0NA 4PMUA 1UKSA 3WH5A 2ZE0A 4FNUA 1QHOA 1EDTA 1WDSA 4JKMA 1KB3A 5FOOA 1CXLA 4UFHA 3DECA 4E8DA 4CGTA 4X9YA 1UZ4A 1ZBWA 4U3AA 5C70A 2YOCA 4Y7EA 2GSJA 2OYLA 5I5RA 2NSXA 1E0XA 4OBSA 3VOCA 4LPCA 3IJ7A 1U30A 3OLIA 3VD3A 4H41A 2OSWA 2WK2A 1B3VA 2VRKA 1OWQA 1QBAA 5GPRA 2YDRA 3MUY1 3WN6A 1GZJA 2Y4SA 4U5IA 1LF1A 4UQCA 2YL6A 1V03A 4X0VA 1MWOA 3SUTA 3T2PA 3E1F1 5IHSA 3WBEA 1DTUA 1JZ3A 1HF6A 2CERA 2DT0A 2WMFA 4DO4A 3SCPA 3OZPA 1BHGA 3WD3A 4TTUA 1EQCA 1UR8A 5FD0A 1WAWA 2WZIA 3A5VA 1U2YA 1QHZA 1VJSA 1PBGA 1R33A 4HOWA 4LXFA 4J3UA 4MAZA 5D9OA 1P6WA 2E9LA 1W9BM 5HOSA 5CJ5A 1LLOA 3AHTA 3AS1A 4GQQA 3DDFA 3NYDA 1HJXA 3OLGA 2J47A 4PTMA 4DO6A 4PMOA 1CENA 1EHAA 3MO4A 4FK9A 4HZ6A 3UESA 2ZICA 1V3JA 3TV8A 3EYPA 5DT7A 2ZX6A 1NM9A 3N04A 1NOWA 1J10A 3LRKA 2PWDA 5A6KA 2GDUA 4AD1A 1B2YA 3AS3A 1VBUA 3GXNA 4DM1A 2W67A 4J3XA 2OWWA 3VILA 4UQAA 2D23A 3ZR6A 4FMVA 3BSHA 5LYRA 1QI3A 3EDJA 2E9MA 5CPSA 3VGDA 1CNVA 3B9AA 4MPKA 1JIBA 4Z2JA 1QPKA 1GORA 1V3HA 2X05A 1MXDA 4ACYA 1EO5A 1HN1A 3WNLA 1RD6A 4JIEA 2UY4A 2BVDA 5I0DA 1WZAA 1XCXA 1K9FA 2VVSA 2O92A 2J7HA 3DC0A 3ECQA 2VRQA 3DYMA 2WAGA 1BF2A 1R34A 1GNXA 2WWDA 1V6UA 4DM2A 3F5JA 2VX4A 3WY2A 1C8XA 2MANA 2EPMX 4B16A 2JF7A 1JFHA 1E1EA 5ABFB 1GONA 2AAAA 2DSVA 1NOUA 3LRMA 1XGZA 1ZB5A 4OZOA 3VDHA 3AIVA 2OWCA 4RE2A 1CEOA 1FP9A 2YBUA 5BYWA 1W9UA 2ZX7A 4RE3A 3KL5A 1ODUA 1E4NA 1W1YA 4F9DA 3BVWA 1H1NA 1W9VA 1W91A 1M53A 4D6HA 2XTKA 2J7FA 1OM0A 3NCOA 1ISVA 2Y8KA 4JKLA 3FAXA 5A8QA 2J7DA 3T0AA 3AIBA 3LXAA 3WQ8A 1OSEA 5BXRA 4OOZA 1KWGA 3L2MA 2QLYA 4XB3A 4AZCB 1TQTA 3NSMA 2BV9A 1V02A 1NQ6A 3WIJA 1OBAA 1VEOA 2OSYA 3MMUA 4JCLA 3TONA 3BAIA 3POHA 4YHGA 3PZQA 3VDBA 3N9KA 1V0LA 2YKKA 2F61A 3DDGA 4GKLA 2PI6A 3BAJA 3ZT7A 1CLVA 1J12A 1SYTA 3VIMA 1D7FA 5A2CA 1JNEA 3VD9A 2OW7A 4FLSA 4GZJA 1O7DC 1B3XA 4QLKA 2WC7A 1WDPA 2YL9A 1E6PA 5CGMA 2Q8XA 5ECUA 3MS8A 1V0KA 4MNJA 2XPKA 1JZ4A 2VO5A 4AD3A 4TUFA 2WHMA 3AIQA 4IISA 1W3JA 1OGSA 2ZUSA 1NH6A 3VIKA 1GUVA 4UFLA 2QMKA 3SCQA 1UD6A 3BUIA 3AS0A 5BROA 1SMDA 2BHUA 1JF5A 1LL6A 1C93A 1F4AA 1B3WA 2XSAA 1UZ1A 3L4WA 4ACZB 4PYSA 3SUSA 2J79A 2EXOA 3GH5A 3TP4A 2QV4A 2WHLA 3W29A 1J0ZA 2DIEA 3GBDA 3OGSA 3OLDA 2FHFA 1NP0A 4ZE4A 1W9XA 3DX3A 2DH2A 5E0CA 3W6LA 2XN2A 2CBIA 1GW1A 1MQQA 3SURA 1TQUA 3BC9A 3QHNA 4EKJA 5A1AA 2D20A 1DWIM 2W92A 2D3NA 3VMPA 4HTYA 1KXHA 1SR0A 1E6SM 1CECA 1K9EA 3ARRA 3CZEA 1C8YA 3WD1A 4B9ZA 2D24A 4AD5A 1CBGA 1TCMA 4HOXA 2CNCA 2VRJA 3DX4A 3OB8A 4W88A 1UWQA 3N18A 4UFKA 3F5LA 1CPUA 3PZOA 4JFTA 3EDFA 1E71M 4HZ7A 1XHGA 2ZUMA 3PZVA 2ESCA 1QNQA 1SMAA 2GJRA 2J8GA 2Y8VA 2ZUWA 4H04A 2G8ZA 1VENA 2VCAA 4R5EA 3GXTA 1VFOA 2O9RA 4DUVA 3BVVA 4Z2KA 5D9MA 4ZXLA 3PZNA 1BSIA 5LA0A 1WE5A 3VO0A 1CGYA 3VNZA 2OLHA 3GDBA 1XYZA 4YN5A 1BYAA 1FFQA 1TVNA 4HP5A 2XIBA 1JDCA 5A2BA 1DWJM 3NDYA 1W2PA 1QHPA 2WPGA 5AY7A 3K1DA 1EOMA 3WDIA 4CCEA 4ZE5A 1QNPA 3SUWA 3SCNA 3KEHA 1KGWA 2WC3A 3UETA 5A8PA 2FHCA 3UR8A 1UR2A 2CPUA 1ITCA 1M04A 4PMDA 3ARQA 3SIMA 1MVYA 2E8YA 1JDAA 4KGLA 3WH7A 3DHUA 2VVNA 4FNQA 1N82A 2Y24A 4QCFA 1M01A 1UD5A 3BAYA 3WUEA 3LPPA 1U33A 2O9PA 2W63A 3AZRA 2X2YA 5CXPA 4UNIA 4FLRA 3II1A 2JF6A 5A2AA 4EK7A 4BA0A 2D0GA 1UD3A 3BLBA 1E6XM 4WSJA 2JIEA 2VX6A 3NSXA 3HU7A 2X09A 1PX8A 3W0KA 1HJUA 1V3LA 3VUPA 4AISA 1TVPA 3GXMA 2BY2A 4E8CA 4Z2LA 3HJEA 3L4XA 4W8BA 2EPOA 1IZKA 1H41A 4FNSA 3DX0A 1ZBVA 4ATDA 4ZFMA 2PWFA 4XUYA 3EMCA 5TD4A 1O6IA 2FYVA 1BFNA 4UOQA 1WP6A 2CIPA 1R75A 5BCAA 4W7VA 2YBTA 1EIBA 1MFUA 1GOIA 1GQKA 1PZ3A 4PCTA 2G41A 3W37A 3OLEA 4U2YA 1J9YA 3WF2A 3IAPA 5E9AA 2X2HA 1W3KA 5CG0A 1FH9A 2WVTA 1LG1A 3IAQA 3D51A 2XM2A 1GQIA 2DSUA 2D1ZA 4P7QA 3W82A 3LXBA 3QOMA 3ZR5A 2RGMA 4D6IA 1RH9A 4OUEA 5C71A 1VRXA 4FF5A 4ATWA 1UKOA 5ABGA 4NF7A 3OG2A 3WD4A 4W89A 2V38A 1WZLA 1JZ6A 2WMIB 1UR1A 1PAMA 3I3EA 1YQ2A 3WSUA 1XCWA 2PBGA 3BGAA 3PHAA 5HXMA 3M46A 1CZ1A 4WIWA 4PCSA 4AYGA 4M81A 1B0IA 1ECEA 4JHOA 4KRTA 3WNKA 1HIZA 1E72M 4TOQA 3WNNA 1BLIA 1DWFM 2X0HA 2XN1A 3BVTA 1CTNA 4YHEA 1PIGA 3WELA 1OGBA 5A69A 2B31A 5DMYA 2DH3A 3QR3A 1HXJA 3EJQA 4XZWA 1CGXA 2CBJA 3VMNA 2YDQA 3NSNA 3MKKA 4PMZA 3FHQA 3IANA 2VTFA 5CSYA 4AXNA 4MTVA 4HA3A 2A3BA 1VIWA 4V28A 4URIA 3AJ7A 3SEPA 3DHPA 5E0FA 3G6MA 2J8FA 3VM7A 2WZEA 4HU0A 2CBVA 3ALFA 3WEZA 4GIAA 3WQ5A 3AMKA 2BVTA 4M56A 5CSUA 4LGXA 3M6DA 3ARUA 2WCSA 5HNNA 4M24A 2FGLA 3LXCA 3TOPA 3RM8A 3THCA 2JEQA 1G01A 4TVUA 3WY1A 3N13A 3HG2A 2F2HA 1BG4A 4ML4A 1KQZA 3T2QA 2XJ7A 4U3CA 1ZS2A 4GINA 4J3TA 1R46A 3PTQA 4Z2IA 3RDKA 3MSDA 1QNSA 2G3IA 3WUBA 3TA9A 4NZCA 2XGBA 1TG7A 3N11A 5A3HA 2F18A 1VFUA 1HX0A 3VDAA 3SCRA 1GOMA 1WZMA 1L0PA 3CLWA 4GI9A 3CV5A 1KBKA 4AZBA 5CZKA 3TTQA 2D22A 1C90A 2ZWYA 3BCFA 1FP8A 4JFUA 5FCZA 1CXEA 8A3HA 5DO8A 3BUQA 2E8ZA 5I78A 1HJQA 3ZT6A 3TTSA 1Q6FA 3VGGA 1O7AA 1WDQA 1GHSA 2WSPA 3CGTA 4UQBA 4OOUA 3BXWA 5JBDA 3ZJKA 3K8MA 3BVXA 3W24A 4J7RA 4ZXOA 4E4PA 3GZAA 2XFFA 2O9TA 3CUJA 4P8XA 1Q4NX 1BGAA 1DP0A 2ZX9A 2IUZA 4MB3A 3WDHA 2UWFA 4PN2A 1DWHM 2PB1A 3T2OA 2DSWA 2F8QA 5IFPA 4PSRA 5D8WA 3BAWA 3VD5A 1Y7VA 4Q22A 3MV11 4AZ6A 3MU7A 2YA1A 1FFRA 3SCWA 2W61A 5AC4A 2QPSA 4OGZA 2WBKA 1E1FA 1HKJA 2GK1A 1I1XA 1VEPA 3OGRA 5DF0A 4N42A 3EJRA 5GNXA 3BLPX 4PEEA 1QOXA 1AQ0A 5DT5A 4R27A 1E5NA 1CXHA 3A4AA 2XYLA 1IZJA 2BNJA 4U33A 2WNWA 3AYRA 1QI2A 1XD1A 3VIOA 4CD8A 1W3HA 3UG3A 1H09A 4BQ4A 3VMOA 4MNKA 3VX0A 3U5YA 3MMWA 4DUWA 1HJSA 5A6MA 3ZSSA 4UQEA 3ZIZA 2WVUA 1LQ0A 3W27A 3KLKA 1ZBCA 1KWKA 2O9OA 4HZ8A 3AHVA 4BZYA 1B31A 1AMYA 3WUGA 1NP2A 2CKSA 3VVGA 3AHZA 1MW0A 3B9EA 4CU7A 4M29A 4CCDA 1JD7A 3KLLA 1G9HA 4GO8A 1V6WA 3VGBA 4B9YA 2EACA 2E9BA 1E4LA 5GNYA 3WQWA 3LRLA 3I3DA 1JGIA 3N12A 3ARXA 3APGA 3RIKA 1HNYA 1W1VA 2WKLA 2OWXA 2J7BA 3BMVA 2V3DA 1H5VA 3HG3A 1CGVA 1TFVA 3WENA 1QW9A 1ODZA 2VX5A 2WCGA 1XD0A 2VZOA 4QP0A 4JAWA 4HU8A 1UG6A 2WM0A 1UHVA 3WQ6A 1TZ7A 2EQDA 3A6OA 3WD0A 1TUXA 1DWAM 4AZ5A 3VGHA 3H55A 3ALGA 3W25A 1JXJA 4QCEA 1KXQA 2WB5A 1GVYA 2Z1SA 1GQJA 1UR4A 2VI0A 3AXHA 2VURA 3VTRA 4HMCA 1AVAA 3RO8A 1TQWA 1JYXA 5EB8A 1JYVA 2F7PA 1QI5A 4U5KA 2ZWZA 3ZO9A 3AIRA 4QDMA 1GJWA 2D2OA 4MJ2A 1BYBA 2WMJA 1NWTA 3HN3A 2YA2A 1UKPA 3CZJA 4BF7A 2CHNA 4P8VA 4UZUA 3WFZA 1EHNA 1EO7A 1J0HA 5M3WA 4CN1A 5E09A 1FHDA 1W1TA 1C92A 3AOFA 1WCGA 3WFLA 1V08A 2EO7A 3DYOA 4QLJA 3LPOA 1LJYA 1MW3A 2UY5A 4FLQA 4WK9A 1NOFA 4H7VA 2GUYA 1CDGA 4NXKA 4GXPA 4JFWA 4P8UA 3PTMA 3AROA 1JD9A 2NT1A 3L4UA 1X6LA 3SUVA 2GJXA 1DWGM 4MNLA 3U7BA 2X8RA 4MDOA 4F79A 2F7QA 3GH7A 3S6TA 5I2UA 4ZENA 1SFSA 2EAEA 4UFIA 2UY3A 2EPNA 1CXIA 3KWXA 1YHTA 1V02E 3D3AA 4NRSA 2OW6A 1E56A 1J0YA 2X0YA 5AYIA 3SCSA 2TAAA 1W2VA 1PX3A 1HWWA 1MQPA 4D6EA 5F7UA 1GOOA 2CKRA 1E6ZA 3VD4A 2F1AA 1PX4A 1LG2A 1ITXA 4EANA 5EFFA 1W32A 4M82A 1TQSA 1FH7A 1G0CA 3WBAA 1B9ZA 3T09A 4AIOA 1BAGA 5FKYA 2ZUUA 3FAWA 2FE0A 2VZUA 2CBUA 2UY2A 3O2LA 3UCQA 3AQUA 2GVYA 4P7LA 2VCCA 3ZJ8A 1OT1A 4DWSC 4AD4A 3MI6A 3GBEA 2WVVB 1ISWA 1R8LA 4QFUA 3IJ9A 1B3ZA 4JL2A 3CMGA 1WDRA 3WEMA 2VQUA 1E15A 1K9DA 2YDSA 3LPGA 4P7NA 4KGJA 1FOBA 1B3YA 3U5UA 5CPQA 2ZXDA 1KQYA 3AZSA 2PWGA 3L2LA 2EEXA 2J7EA 1UD4A 4MAVA 4W86A 5GNZA 4NX0A 1KTCA 5CLWA 1E55A 4JKKA 3VX1A 3IK2A 3WKZA 4DWSB 3ZJ7A 2VX7A 1XH0A 2ZXQA 5A6SA 1GOWA 1R7OA 5M5DA 3WH8A 1H49A 4WLCA 2BXYA 1ZL1A 2VQTA 4NI3A 1GOQA 1J18A 1WB0A 5HPCA 1R47A 4BQ5A 3VM5A 1Q6CA 3OIHA 1OGGA 2G3NA 5LA2A 4PMXA 4K68A 3VKKA 4W8AA 3PZ9A 2W4XA 4KMQA 3WEOA 5FL1A 3CH9A 3UERA 4CN4A 3F5KA 1JZ2A 3K8KA 1BQCA 2XVKA 1US3A 3OA5A 3BLKA 4J3SA 3EMZA 2XIIA 4XV0A 2VC9A 3PZTA 1UH3A 3GXDA 5A6JA 3D4YA 3FY1A 4WKAA 1BPLB 1JNDA 2J4GA 3WF3A 4TTGA 2GDVA 2XSBA 1V6YA 3T0BA 3BAKA 2DQXA 6CGTA 4HA4A 3ARVA 2CCRA 2WWCA 2CHOA 4CD7A 1BTCA 2BY3A 1WO2A 3EJTA 1IV8A 1JZ7A 3WY3A 2EBNA 4L4PA 4P7OA 2Y5EA 3W53A 1QVBA 5BXPA 5A6AA 3KZSA 1HL8A 1UWRA 2HVMA 3PZIA 2C8NA 3RJYA 1UOKA 3VINA 1ZBKA 1TQVA 1F4HA 1QWNA 4AWEA 1VAHA 3GXIA 1C91A 4RL3A 1BVZA 4CCCA 1V0NA 4B15A 2ZX8A 2RGLA 2ZIDA 1LL7A 2ALWA 3VU2A 4GZIA 1M7XA 4MB4A 1W3LA 1TA3A 1V6VA 2WVSA 3CZNA 3RILA 1S46A 1KCKA 3ZM8A 3A4XA 1MXGA 4AW7A 4JFVA 1PEZA 1JL8A 3GH4A 2CESA 3A3HA 2BXZA 1I75A 4WKFA 2W66A 4CU8A 2VL4A 2JALA 3K46A 2CITA 5I79A 1E9LA 1JYNA 3WMCA 4CD6A 1UKTA 1ZJAA 2VOTA 5ABEA 2VT0A 4IM4A 3A4WA 3H53A 3VIJA 4OJYA 1NWSA 1E73M 3WF4A 1B30A 2V3GA 2D3LA 4UTFA 5HPOA 2X1IA 1ESWA 4PTVA 3EDDA 1QNOA 1OD8A 4IUGA 4PTWA 3AHXA 2VMFA 3GM8A 4GPNA 1C3FA 3A47A 4PUDA 3CZSA 4S3JA 3EDKA 3KE0A 1EDQA 5AC5A 3D50A 1EDGA 2BHYA 4M8UA 3CHDA 3BUDA 4BS0A 1D3CA 2NT0A 3WL1A 3ZT5A 2BY0A 3IGUA 3AS2A 3RJXA 5BRQA 1E43A 1XYFA 3MV01 3WNOA 3VIFA 3K8LA 4PMNA 3GXPA 3SCTA 4W87A 4MB1A 4A3HA 2C7FA 2V5DA 4HMDA 1AQMA 2XGIA 4D1JA 3OBAA 1E70M 1GJUA 4CUCA 4V27A 1CLXA 1JDDA 3W28A 2J74A 1JFXA 7A3HA 3VNYA 3MANA 3HMCA 3GXFA 5GQBA 5I23A 1KFWA 3L4ZA 2GFTA 1CWYA 2VJXA 1OT2A 1WPCA 2FH6A 3KL3A 3WDQA 5I77A 1Q6GA 4TX6A 3ARSA 2Y2WA 1XC6A 3GYCA 2WCAA 2QPUA 3W81A 1KR0A 4GO9A 4PMVA 3CZLA 1HTYA 1E6RA 2YIHA 1DHKA 4LYPA 1CXFA 3CHCA 1HT6A 2J7CA 5D4YA 3CUHA 1KXVA 1OINA 4KWUA 1UD8A 1XSKA 3WQVA 4JZ5A 1K9TA 2F1BA 4D1IA 1XV8A 1UWTA 2A3CA 1UH2A 3GTNA 2A3AA 3UEQA 4IPLA 1GVIA 4D72A 1OIMA 1CGUA 3NDZA 4MB5A 2QHAA 3N17A 1GCYA 3W38A 3WH6A 1JF6A 1MW1A 3A23A 2WXDM 1XH2A 3CIVA 4RE4A 3H54A 5IFTA 3CC1A 4H2CA 2BY1A 1PZ2A 3AIEA 3AIWA 4CD5A 3M07A 3CMJA 2WMKA 1J01A 2ZUVA 2AMGA 3NJ3A 4OIFA 1E4MM 3O9NA 3FNDA 1GOKA 3MUZ1 3DX1A 3N1AA 1UA7A 3VIGA 4ATLA 2WHKA 1JZ8A 4WJXA 3AMGA 3PZUA 1H2JA 4F9JA 4WSKA 6TAAA 4J3WA 2D73A 3EMQA 2OYMA 1ISZA 4W84A 4GQRA 2FHBA 3PZMA 2PWHA 3BSGA 2XVPA 2GK1B 3NUKA 1X1NA 1UASA 5BXSA 2XFYA 2VZSA 1WKYA 4J27A 1E4IA 3U7VA 4PBGA 3HG4A 3K4DA 1HKIA 1MYRA 1VJZA 1M03A 1NWUA 4D6JA 4HA1A 2IXVA 3WNMA 3ARYA 4HMEA 1UR0A 4CKQA 1EGZA 1EQPA 2EPKX 2VZVA 4AEFA 2W62A 1KR1A 3DX2A 1Q6DA 1EA9C 2XG9A 3AFBA 3RPMA 3N15A 1R7AA 4IPNB 3ZMRA 2YLLA 2W5FA 4W85A 1QI4A 3M7SA 4TXEA 4H8HA 2V5CA 1JI1A 4GZEA 2IXUA 1B1YA 2E0PA 2XUCA 4MNMA 2DGAA 4AMWA 4NXSA 1XSIA 5JIWA 3GNPA 5CGTA 2EABA 5A8OA 3B8SA 3J7HA 1A3HA 1KGXA 5CQ1A 4JCMA 1WZKA 2YFOA 2C0HA 1JAKA 1SZNA 1CGWA 1LL4A 2OYKA 4AZHA 4BQ3A 5IXEA 2WKGA 2D0FA 3WQ4A 2VR5A 4J28A 4YPJA 1E3XA 2QF8A 1KCLA 3UR7A 2WLYA 1BYDA 1QNRA 4QAWA 3QHMA 2VUYA 4UFJA 3MSGA 1KBBA 4DO5A 3BMWA 1UQYA 2XVLA 2BVYA 1LWJA 4Z2HA 2CXGA 1UA3A 2ZXAA 4AZ7A 3VIIA 4FLOA 4MDPA 4UZSA 1H0IA 4DWSD 1RP9A 4UOZA 1R87A 2JFEX 4AIEA 2EPLX 1JYWA 1UQZA 1UR9A 5IHRA 1PJ9A 2DT2A 5JIPA 2VZTA 4CN6A 1J0IA 1W1PA 3RCNA 3HG5A 2JE8A 3AXXA 1HVQA 1TR1A 1BGGA 1G94A 4U31A 1UUQA 1C7SA 1RPKA 3KL0A 3CZGA 2J75A 1T0OA 4NZJA 5A8NA 2JIWA 2DPEA 4PSPA 4AC1X 4UCFA 1UKQA 4C7DA 3IJ8A 1RP8A 4JFSA 3LMYA 3OZOA 3RM4A 1V6XA 1G1YA 3S2CA 4PMYA 2FDMA 4AZGA 1HL9A 2XWEA 1GQLA 4OKDA 3MUIA 1VBRA 2NW0A 5ABFA 1HKKA 2GJPA 1HVXA 3EJSA 4M80A 4LX4A 3ARPA 4S3KA 4AY1A 1MFVA 1QBBA 5KEZA 3UG5A 2JEPA 1EOKA 4HPHA 4UR9A 1X6NA 3CUFA 3TTOA 2GJXB 5IDIA 3POCA 1V3IA 3FXYA 1JZ5A 5A6BD 5LA1A 4PMQA 1R85A 3CHEA 1QI0A 3MUAA 3BVUA 4J3VA 1EH9A 2G3JA 3PN8A 2ZOXA 4OBRA 2FH8A 3OGVA 2YL5A 6A3HA 2ZUTA 4AZCA 3AHYA 2CYGA 3AMCA 4W93A 3VGEA 2ZX5A 3QGVA 1QWUA 3D52A 5CPTA 4AD0A 1J0KA 4TX8A 2DDXA 5EFDA 1MW2A 2DSKA 1KTBA 1VEMA 3GNOA 3WH9A 3S5ZA 2ZUNA 2A3EA 2WMGA 4AEEA 4XZBA 1PPIA 3EJPA 3LX9A 1HJWA 2WANA 2WMHA 1UWUA 3VIPA 1HP5A 1VFMA 3VGFA 4FNRA 1ISXA 2E3ZA 5HBFA 2DIJA 1EXPA 3CUGA 3L4VA 3CPUA 2WZHA 3VDCA 1E5JA 2V3EA 2PWEA 3VIHA 1W9PA 3K4AA 2WW5A 3FHAA 3NIYA 3S5YA 1L8NA 3F4VA 5JBFA 2HISA 1C8QA 3WNPA 1AQHA 3CBWA 3AXIA 1J11A 2PBOA 1E6QM 4B3LA 4ACZA 3JUGA 1K6AA 2WC4A 2XFRA 3A24A 2XVGA 2BHZA 3D5HA 5A6LA 3VD7A 1C7TA 3EBVA 4Q7NA 5M17A 4C7FA 4UOJA 3BCDA 1W9DM 3AISA 2J78A 4KRUA 4AMCA 4D71A 4UQDA 1NARA 1QW8A 2F7OA 4E2OA 1V0MA 2IGTA 3HZ3A 1A47A 2ZXBA 4NRRA 2YJQA 3WDRA 4P7RA 1BVNP 3THDA 2WVVA 3VSUA 3AMDA 3AI0A 2WLZA 4TVDA 5AYBA 2J7GA 1ZU8A 5I6SA 1FH8A 2BFGA 5E6ZA 3ZQ9A 1B90A 2J62A 2PC8A 2EADA 4UFMA 2Z1KA 2XVNA 1US2A 1OIFA 4H8VA 3U57A 2VNCA 1CXKA 1UWSA 3AMLA 3SCOA 2XWDA 4DWSA 3I3BA 4D6FA 3BH4A 1H11A 1CIUA 4AZIA 1BYCA 1PS3A 2EJ1A 3WF0A 4F8XA 4BQ2A 3LPFA 5A95A 4EAMA 1XSJA 1JXKA 1V3MA 1ZJBA 3L4TA 1GPFA 1OCQA 1H0GA 3WD2A 1TMQA 5HDRA 1XRVA 3UG4A 1TA3B 4AMXA 2XN0A 1Q6EA 5FL0A 4CVUA 4EE9A 1JG9A 4MADA 3ARWA 4F66A 3FN9A 1FA2A 3AYSA 3VPLA 2DSZA 3FW6A 2AOSA 1FHLA 4P8WA 3VSVA 3EDEA 3CTTA 4AYSA 1D2KA 2DT3A 1PIFA 4PUEA 4GI6A 7CGTA 2DEPA 1UD2A 3WL0A 2PF0A 1E0VA 3W4RA 5E1QA 1JAEA 4D6GA 3L4YA 8CGTA 1OB0A 1WNOA 3ARZA 4W5UA 5DEZA 2YL8A 2VR4A 3CHFA 4FNPA 4HPGA 5A6BA 2CEQA 4LYRA 1HKMA 4N0RA 1BG9A 2A3HA 3O6AA 1MQRA 1XH1A 1HP4A 3WMSA 3W26A 5I24A 1VB9A 3SCVA 4U2ZA 3ZOAA 5A94A 4DUXA 3BUBA 3PTKA 5KZ6A 5ABHA 1H4PA 4PRWA 5BWFA 2FGZA 9CGTA 5A8MA 3SUUA 1E0WA 3PBGA 4CU6A 2YA0A 5EMYA 1IT0A 2XM1A 4NSBA 5JUVA 5BRPA 2X2JA 3T08A 5E70A 5D8ZA 3ZSTA 3CO4A 3GNRA 4AIUA 4B3KA 4CVWA 1V3KA 3EJUA 1I1WA 4FNTA 3WDPP 1Z32X 4GI8A 1CYGA 3AZTA 2W91A 2OSXA 5M03A 4WF7A 1ISYA 1E3ZA 4Z2GA 5JBEA 4W7WA 2F7RA 2CETA 5I3DA 4JHZA 1KXTA 5D9PA 4LYQA 3RMEA 3TTYA 4XX6A 1J0JA 2V3FA 2G4FA 1DEDA 2WMIA
chains in the Genus database with same CATH superfamily
3QUYB 4AM0Q 1W0WB 5FECA 3MBWA 1SQ7A 4XWUA 4PTXA 2XXGA 1EEYA 3AICA 4QJ1A 2VDLB 5C0AE 1XYMA 1NWRA 4KFNA 3TQVA 3WFCL 1WDDA 5GS0D 4ADJA 3QZPA 1XGQA 2Z6FA 2WBGA 4WK4B 3ZRSA 4HOZA 4AW4A 3T0DA 4IH3A 1HHKA 3RR1A 3LB6C 1MCCA 1J96A 1PNCA 1N64H 4ZW6A 3FB8A 1S78D 4UTAH 1MEHA 1F4WH 5D6CB 1H3WM 4GRWH 1T7LA 5HYJA 4JFED 1YE6A 2PU1A 3ZDXB 1HJVA 1LO4L 3B9DA 5MEOA 5AB1A 1LP9B 3GE7A 1CFQA 1TYJA 3DYPA 4BCEA 4KRLB 1GEHA 2XHYA 1GW6A 5EL1A 3KVJA 4UTIA 4P46B 4RMWA 4I77L 1DQQA 1I7UA 4XMKL 3KFTA 1ORSB 2BSED 4MDJB 1F90H 3WIFA 2DMGA 2W95A 1NC4B 3OLIA 4R7NB 4Y5XC 2OSWA 5IIEA 3MYJB 2XZCH 2XDHA 3MUY1 1CFSA 1GZJA 4X4ME 1FWJC 1JCNA 1NIUA 3HE6B 4MKNA 1KEMH 4K2SA 1UWGL 2O5XL 4IW4C 5K9OB 4ZO8A 1PDKA 1WAWA 4XI5C 4Y2DB 1ES0B 4N2LA 3OZ9L 1XL4A 1JPST 3U2CA 3PJUA 2H90A 1QNIA 3AS1A 3VXRB 4RFOL 4BKSC 1T89A 4DO6A 4Y1TA 4GUHA 2QVHA 4XZ4A 3UC0H 2CK2A 3N04A 2W27A 1RMFH 5J9PA 3DXAE 3GB7A 2OT1A 1YLBB 2FVMA 1E0UA 1NSNH 4LAJH 3VA8A 5IEKB 2E6QA 4FMVA 3BSHA 1GY1A 1ZLSH 4JX5A 1QI3A 1KELH 4NIYE 3HAEA 4IKLA 1G4SA 4GUQA 1DBKH 1HN1A 2G0KA 3LEPA 5A8GA 1XCXA 5EG6C 1TV3A 4PGDA 4AXKA 1OFEA 5DURD 1GNXA 3EWUA 4OAWB 4HSHA 4XVOA 1JFHA 2VLRB 4RZCA 3DA0A 3RPIB 1NOUA 2DSVA 5BVPL 4YDJB 1PZSA 3AIVA 3JWDC 4DELA 5GS1A 5LCVL 4UINH 4YPGA 3MUCA 3KL5A 5GRXG 4FB7A 2DVXA 3US0A 2X6VA 4Y16C 4OVVA 1FO0B 4R7XA 2JKJA 4MXVE 2AQRA 3LXAA 4NJ9H 4YNYA 4KVCL 3MUXA 2AV7B 1M05A 4NSKA 2P5WA 3KYMB 4GMTH 4K8RL 3IFOB 2QL1A 1XLIA 3N9GH 4IGSA 2GJ6E 2NW2B 4FD0A 4BFAA 1GS6X 5CEXB 5A2CA 4R7DB 2VR3A 1EXUA 5KW9H 4GSRA 2CLRA 2CR6A 3EBIA 2XQ0A 2YL9A 1E6PA 3LUTA 2RACA 4LSTH 5CJMA 2ZOLB 3SCQA 4BUGA 1VFAA 3BZFA 2F6UA 2P8BA 5IREA 3L6FB 4W6YB 2OI9B 3BP4A 4G1EB 3WUZA 2VITA 4H1LH 4KX9A 2HLFC 4HUUA 2PDMA 1RCYA 5D7KE 1SR0A 4CNPA 4GW5A 1Q6RA 3GRIA 2WQPA 2GBUA 3KVDD 1JR1A 3ZMEA 1EVTC 2RCSH 1J93A 4RDZA 3OC8A 2HFFA 4YO0B 4JMNA 4EOWH 5CPMA 3CXDH 4HIJB 5IUSA 3L95B 3WJLA 3SJVA 4YXGA 3KR3H 3DTDA 1P4UA 3RX4A 3ONBA 3NIGE 4HWZA 5LA0A 1CGYA 3UJIL 1LEKB 1QK0A 1EPVA 1TRDA 3AFLA 1OWWA 1DWJM 1QHPA 2WPGA 1PZAA 3K1DA 1V5JA 1EV2E 4DGUA 4UB0L 1CFTA 5IHBA 5E2VH 2ADIB 3OGCA 4JXCA 2E9WA 2OGYA 5A8PA 3TT3L 3N43B 2PDLA 1IM3D 3US1A 3LLFA 3ARQA 5DRXA 4A1RA 3TBCA 4XXWA 2AEQH 4PTDA 3HI5L 5I09A 2OAAA 4P5KA 1D3GA 3RLSA 4MX7A 4P57B 2W63A 3AZRA 5JHDD 5LDUA 4J3ZA 4EK7A 3QCTH 4BA0A 4TU1A 3UPMA 2UWEA 3TYBA 1QLRB 3A3XA 1P6FA 3UTTB 4MPQA 5AOMA 3VI4F 1FA4A 5E9DE 3W0KA 4PMJA 3G9AB 3TO4D 1RLDA 4UIMA 1BQGA 4KXZI 2K1MA 5ECJE 3PXLA 2JCCF 4UWQB 5T1KA 2WQ8A 4OJEH 1HYSD 2FWSA 1PL3A 4Q4SA 1NL0L 1S7VA 4ATDA 3KPSD 1FFNA 4JHAH 4JRYA 1NMCC 5TD4A 4IHOA 1O6IA 3JT2A 3G08B 3BT0A 1CLOL 1LRQA 1R75A 4W7VA 3CYVA 4MAYA 3I9AA 4JTAA 4OZIA 1GQKA 4PCTA 2CMRH 1TWIA 1SFJA 5E9AA 2B1HL 3VQ2C 2WVTA 4UQ2A 4S39A 1KBGH 2PXYD 4NNXA 3R89A 4M5ZH 4ODTH 4WI0B 5FGBA 4FOMA 2G0WA 2OODA 2PBGA 5B7ZA 2BSTB 3VZYA 2GC4C 3LRHA 4DBDA 4MCYB 2PGWA 1AR2A 7FABH 3ZE1F 4JHOA 5I3JA 2QADD 1LDSA 1WZ1H 3TEVA 1SBSL 3LGDA 2EDKA 2R56H 5I74B 2ZSVA 4PMZA 3VFUA 4YSQA 1TPVA 1RAMA 1QPNA 2HG5B 4N87A 2DDQH 4UV4L 4H8WL 5E0FA 5GZNA 4HSCX 3CLEH 3QYQA 2CBVA 1ZA3A 1QQDA 1JPTH 4RDQG 1WCBA 3EO9H 4PRPB 3T0WA 4LGXA 4ZMQA 5IT2L 5DJ8B 3JV4B 1A6VH 1C9WA 2DU2A 4INFA 2GIYA 3VH8A 3DSNB 1KRMA 4K7VA 4I13B 4XE0A 1YEEH 1YO4A 2PTDA 3UJFA 2ATSA 4BDVB 1RUAL 4NZCA 5KZEA 4FZEL 1J79A 1VFUA 5MP6H 5JPNB 4B9JA 3UR2A 2PNDA 4C1NA 5IQ9A 1DBBH 4KRMB 4ABUA 1FWRA 1NDTA 5DO8A 1HJQA 2XWXA 3N2CA 1T21B 1OHQA 4UM9A 3NSDA 1G4EA 3P4LA 3GRBA 3NP4A 4X8GA 3N6JA 4NQVA 5HMDA 1S9XB 2OEKA 2NQ3A 1S9KC 4P4RB 3LKQA 1E9QA 5AENA 2VFDA 3EA3A 1PBYA 1SXSA 3MUGB 4W9TA 1FFRA 4IU2A 4M62L 4PFEA 3QC3A 6XIAA 2QVNA 1LUCB 4JBRA 4PCYA 1A4BA 1U92A 2WJDA 4LCUA 3ULVL 2WNWA 4K9EL 2YD0A 4IBUA 4U3XA 3NCMA 3OO2A 2J4WH 2R1LA 1I2RA 3VFRA 1HCZA 4BQ4A 3U5YA 2OZNA 2PP1A 4DFIA 3HLAB 2R0WL 4HZ8A 3WUGA 3PGFL 4JG0H 2Z0UA 5I8OL 2VZ3A 2XKNB 5CBAA 4JQAA 4KK5C 4PJIA 4BQ9A 3CFNA 1TFVA 3WG7B 3OZKA 3W0WD 2QZ5A 3GMOA 1NFPA 1A02N 2HTLD 1WXYA 5LJYH 4J2MA 4BH7A 3SPGA 4P5TA 1TPC1 5C07B 3VGHA 2APSA 2JSFA 4U6YB 3S96B 5ID1B 1VGAA 2Z34A 4DZIA 3QGAC 3TCTA 1QSED 4IKJA 5J7CC 1V77A 3RO8A 2H3DA 4UV7L 2V68A 1LE9B 3W3BA 3AIRA 1ZALA 3GNMH 2YA2A 2DIAA 2CHNA 4UZUA 2OTWA 1O6SB 3DI2B 3WQFA 2VC2L 3TOYA 2ZA3A 2O6DA 1LJYA 1A65A 1NGWA 2X41A 2EDJA 4OFVA 4LKXB 2AQOA 1OSZB 3CM4A 2IO5A 2PDCA 4MNLA 5GGSA 3IVTA 3P93A 2F7QA 1YQVH 5EZLA 1RIHH 3O2WH 3KWXA 4L80A 1WAPA 3BCJA 1IXOA 4ODHL 2J8UF 2IBBA 3ZTNH 4NO5B 1PVNA 1HWWA 3G6DH 2YC1B 1F0LA 1GOOA 3EHBC 4JRLA 3L21A 2XWZA 2DI9A 4I5UA 3S88H 1HKLH 1Q90A 2YPLA 2X4NA 2W88A 5C7HA 3MNZA 1XQKA 4KESA 2AJUL 1P1XA 5I6KA 5AZ1A 3TMLA 4DGWC 5H4YA 2DQGH 2EXYC 2BMKB 3LYRA 3WHXB 1KLZA 5GRUH 1A5FL 3NQDA 2ICWA 1LNUB 3L2LA 4LAQL 3L2NA 3IDMB 5FGSA 4ZW8A 1BBJB 4MMZB 4IXHA 5LGHH 3N2BA 2VN7A 1FN4B 3PS7A 2Q7AA 2ZXQA 4ZOCA 1MLBB 4ZXBD 1R7OA 4S3EA 3RGTA 2GEEA 4OZGE 3BT2H 3RU8H 3G1AA 3Q2DA 4OJFH 4Y5YB 3O81A 3VKKA 4AY0A 3WEOA 1ZGLM 3UZEA 1BQCA 4RGMC 3QPXL 5I0XA 2E5CA 3B7RL 1IEXA 4JY6B 3UD6A 5A6JA 3L12A 3D4YA 1P4LB 2IFGA 4GKSB 4QMEA 2OQHA 4O02L 3UXAA 5LDSA 2QR0B 3JWOC 5KSAA 3L7EA 4I9TA 5FAGA 3KZSA 2QTVA 4XT1C 1JOIA 1AFSA 1XICA 5FKPA 4AWEA 3N44F 4C6KA 3UPRA 5AB0A 4NDMB 5TDPA 1NAKH 3S37X 2ICWJ 4BFNA 3TN6A 4YDIH 3VW3L 1ADQH 1QO5A 2CO6A 1JL8A 5G5DB 1X5ZA 5BS0A 3GH4A 3A3HA 4QNWA 5HHVH 2W66A 5C0BB 1I7TB 1I9CB 4N25A 3S3SA 1ZJAA 3CDFA 3RDTC 4IM4A 3BN3B 3ANUA 4X6CE 5T3XE 1TJHL 2EKSB 3MLYL 3QORD 1P9MC 4BSVA 2GDQA 4KI5F 2Q0ZX 4QXWA 1A7PL 3KPLA 4AUUA 4QRUA 5J6HB 2FB4L 1C3FA 4DERA 4JYEA 1BFOA 4BHUI 1EDQA 4NO0A 1UFGA 2F8VA 3CHDA 1H3TA 2X4QA 3ISYA 1EK3A 1IILE 1KCUL 1A0DA 2XZAH 4YUEH 3EYFA 1U3NA 4PJCA 3CLFL 4Q9RH 5G4HC 4X22A 4HMDA 4A7GA 4WI3A 4UDTB 1E70M 3PGDB 3OVRA 3NRFA 3SBRA 3WUWG 1ITUA 4WZHA 2C1OB 3QUYA 4NPJA 3FUMA 4M1GH 5B3JE 2I5YL 1S9VB 3I2CH 4R9OA 5A3IC 3IM1A 1K6QH 3KHDA 3PK7A 3PDDA 5TE7L 3D3VD 4A7VA 4NAFA 4WY0B 4PS8A 1BEXA 2VUKA 3BW9A 3U6XS 3IGXA 5I1GH 2D3JA 1IGCH 1FIGH 4D0BB 3WH6A 3C2AH 2PLKA 1L8PA 1G1KA 3CIVA 2WNZA 1R5WB 5D6CA 4AGPA 1A7QH 4GFXA 1VPOL 5AW0B 1IVLA 1L4IA 5C7ZA 4ATLA 2WQSA 4XH2B 3AMGA 1K4CA 4F9JA 4CMHC 1Q8AA 3PY2A 4ERGA 1M6OA 4YHMH 1WQVT 3RLGA 1FRBA 4P46A 4CQ9A 3BSGA 1SOXA 5HMEA 1ORSA 3MXWL 4REQA 2UV8G 1M03A 2FX7H 4PJHF 3MACL 2JNZA 2EIKB 2VZVA 4AEFA 2HX7A 3MYJA 1BBDH 1FDZA 3GJFA 4MRBA 2A38A 5TK2A 5ISZE 3HE6A 2KI6A 1WFIA 4XHJD 4GXVH 5CGTA 4GI4A 4X9BA 4OFYD 3W2DL 1SZNA 4F2EA 3QC5X 3UTPE 1FDLL 5HINA 2WLYA 3VXRA 1BYDA 1DJHA 3AYVA 2WYTA 4UFJA 1MPAH 4WHBA 4XWOC 3IVUA 1W3TA 1RVFH 2UZIL 4RLIA 3KWVA 2Z7ZA 2YYUA 4AQLA 1OE2A 5JZ7D 4X83A 3BJSA 4W9KC 4CN6A 1U8JA 5IEKA 4N24A 4HCFA 4POYA 2JE8A 3CQFA 5IVXB 2QV2A 3W7GA 3F85A 4BK9A 3MNWB 4GBXB 3QN3A 3BKCH 1G84A 5TH2B 3OZOA 1YPFA 3Q0HA 4OAWA 1HFBA 4P2QA 5GSVB 1MMFA 1Z7AA 4JTTA 1E5CA 4OKDA 2J1ZA 4GSDL 4OCNC 1DFBL 5DK3A 3W07A 1KLFB 4YDJA 4LX4A 4AY1A 4TLKA 5KEZA 4B90A 3F00A 2J5LC 5C54A 2WO3B 3UWZA 3DURB 3CUFA 3FXYA 4AM0A 3D87B 1UVQA 2EDMA 1QI0A 4ELDA 1MHPL 4A2HA 3T3PE 1FO0A 1U3YA 2R83A 1Q0EA 2AV7A 3WLPA 3U0PA 4C57C 3JR2A 3AMCA 1ILSA 2W3ZA 1OTSC 2YGNA 3IFOA 2F6XA 5DJ0A 3D52A 2NW2A 4F2UA 3ARFC 3IFLL 4N0UE 1LZOA 1ZEAL 3DU0A 1L9PA 3ZVIA 2DKMA 4ENEC 2EVIA 1WBZB 2ZOLA 4JDEB 3FYEB 4F7CB 3P40A 1PV8A 2QKSA 3U1QA 5IB2B 3BP5B 2NXZB 2P80D 2HISA 5FOBA 1JXGA 4K5NA 1UCBH 1FBIH 4G1EA 4OFDA 4Z1PA 4M6NL 4FHAA 2DWXA 2AABL 4LZKA 3D9AH 2OZ0A 4HUWA 2RQEA 3S7GA 5E4OA 4ODWB 5C0CA 4ZAKB 3RB7A 3SB0A 4XOEA 3AB0C 3NIDB 1GS7A 2AK4E 4S0HA 1G5GA 4YO0A 3HS0B 2AV1B 4LDEB 1KCWA 2XIJA 4QRPD 4HIJA 2EADA 4ODBD 1O7DE 1X5IA 4LASH 2EF9A 4M3KB 3E0VA 1G4PA 4XZMX 1JCMP 5IOPB 5D5MF 1ZPTA 4DWSA 4D6FA 1H11A 1BYCA 3ZDYE 1I8LA 3UADA 3A5FA 3SW6A 3MROB 4LPWA 4HKBA 1KC5L 3GTVA 2P28B 2AJXL 1W6LA 2ADIA 4NT6B 2HKFH 3STLB 3PGCB 1MIML 3WO3B 1PLGH 2VP8A 4LVDA 2DEPA 3H7UA 3HIZA 1ZA6A 5BOEA 2PF0A 3G8EA 2VDOL 4RW3A 4OGQC 2K45A 4FMKA 4I3SL 4KK6C 4Q6JA 1YNTF 5A6BA 4N0RA 2PTTA 4W9LC 3ZDZE 2ARJB 1PCSA 2V67A 2B4GA 1XB6A 3UH8A 3PBGA 1LQAA 1XGDA 3G08A 1XH3A 3QZ6A 2WWKT 4YH6A 3W39B 1RUQH 1V3KA 5EU7E 5LQBL 2G3XA 3RHWK 1UXWB 3K80A 5TGBA 2OSXA 3OF6A 3R4RA 1WS8A 4RXGA 4DN3H 1ZSHA 3HC4L 2Q20A 3TTYA 2V3FA 3GNNA 2NYYC 2O6FA 5FEPA 2BSTA 4PV1C 1EHXA 1TWDA 4QTIH 3CZKA 1K8IB 4MCYA 3DK2A 5CLTA 3QEQE 1VFHA 3JYCA 1EHKB 3UY8A 4D6CA 2UY6B 4CMMB 1QTSA 2YWYA 4R0LC 1X6UA 2EUXA 3U9PL 2VCBA 4HJSA 3DMMC 1TTJA 3NJXA 1H3GA 1OD0A 4DN4H 3KYKL 4WV1A 4LUJA 2HG5A 2YLAA 3RBSA 3I6TA 1V7NH 1QUPA 2VAAB 1PG7L 3FCUB 3FJNA 4I5RA 5BMFL 4PRPA 1YNLH 2XY2A 2LT9A 4OCWH 3KVPA 4EUPH 3ZL1A 3CVIH 2E4TA 3ARTA 1LLAA 3R19A 3DSNA 2X1WL 5D1ZI 1H7NA 1OOAA 3I4EA 2WQRA 4B91A 3DX9B 4JKMA 4BDVA 2Z31D 4N2EA 2EKJA 2JMRA 4NPKA 5DN1A 1GAFL 4X63A 1JERA 4RWHA 5C70A 2GSJA 1IEAB 1RCOB 4YSPA 5T5FH 5DHYB 2PLCA 4MCZB 2TRHA 2AANA 3S1UA 3VKCA 4WU5A 4Z7QB 1YADA 3GXUB 1QBMH 4YGVA 3I74A 1T21A 4CADB 4GNVA 4IOIB 3L17A 4Q2ZB 1HCFX 1YIXA 5U4NA 1T40A 2C26A 3IT8D 1MCKA 3WD3A 3W1NA 3SDXE 4Y5XB 5SWZE 1HG3A 4K3EL 1IC7L 2PGRA 3Q45A 5DJAA 4XNQB 3QARA 2AL1A 4P4RA 4KPLA 4K0OA 5FFOA 4TOYH 1FYHB 4MQXC 4FK9A 5BOPA 1VZGA 3MUGA 5AUMB 5CINH 4FXGA 3V5DB 5DSCB 1E9PA 4XZLX 4LT7A 4OWGA 4KKCD 1LUCA 1JWUA 1PJWA 5EF3A 2L4OA 4G42A 4PTTB 1J8HB 1JPDX 2VFIA 3NXFA 1WKEA 1K9FA 2LU4A 2HH0H 4LO9A 3BLEA 3O4LD 1M1XB 3K2GA 5FWRA 4NZRH 4O11A 3FT4B 1AL7A 4L8SC 4GAYA 3PWPB 4FG4A 4KVNL 3OKLB 5AW4B 2Q02A 4HSOA 3G2GA 4FTVE 4HHWA 4F9DA 3BVWA 5KSVA 2IADB 1JPHA 1I7RB 2HZHA 4NUMA 1GJPA 3OAZH 4LEFA 5C07A 4MLRA 5ID1A 4GRWE 3WIJA 2G30A 2CLMA 4I0PC 1JV5A 4Z7VF 3R06A 5AAWA 1D7FA 4LAOA 3VAVA 4TUOA 3U1SL 3RWDB 2DD8L 4MNJA 4MNGA 3VFNA 1FYTB 1Q2SA 3MLZH 1OGSA 1O6SA 3MW7A 4MM1A 4PYGA 1LGVA 5BROA 1S7QA 4PJDE 2N1KA 4WJ5B 4LKXA 2J79A 2XBDA 4XAZA 1GKPA 4AF0B 2Q86B 2WINB 2C9UA 5DK0A 3DUUB 2VXVL 4MJID 3KH3A 3CB8A 5A1AA 4LUIA 1A14L 4NO5A 4YE0A 3WNIA 1ZCCA 2E7LC 2YC1A 2XWJB 4XXDB 5AC6A 3RWHA 1ZK5A 3BZ5A 2HTKD 2Y8VA 1CICB 4H04A 3D7PA 2VCAA 2FRGP 5ID0A 2BMKA 3WHXA 2CFFA 1BXCA 1Q7QA 1YYLH 2IOOA 1ZTXH 3RX3A 5GGQL 4G7SB 4KK9D 1VBHA 4YHYC 3IDMA 4JBSA 5FESA 4GH3A 4MMZA 4HQQH 4YBQC 4A2GA 3H12A 1FN4A 3FQYA 5F88A 1C16B 1A6TA 3SCNA 3KEHA 2AJZB 5IW1B 4G1NA 4IGNA 3WMLA 3QYMA 3S8FB 3UR8A 2CPUA 3NR0A 1GHFH 4Y5YA 3RVVC 4AEHL 2HTMA 5TF1H 1DQDL 2DW6A 3HQNA 7REQA 3V52H 3G6AB 1JFQH 1EBAA 1DPMA 4MZ8A 3BAYA 3P60A 3MQIA 2IV9A 3N2TA 1RQHA 4CQCA 4OCXL 1PEWA 3KXFB 4M7KH 3L3OC 1P4LA 2WOBA 2ODIA 1REQB 5J89A 2FB3A 3PNWA 2V37A 4ZI8A 1S9WB 3AW5A 4HHHA 1G0XA 3L8QA 2Z1VA 1XVSA 4D9PA 3MJ9H 4PJAF 2ZAIA 3LHUA 2G41A 3V7AG 1F56A 1W3KA 1BIIB 3SY6A 1AR1C 3D51A 5J5DA 5A40E 1CMOA 2DSUA 4K5OA 1NGXB 4MJHA 1OOWA 5C0BA 1JHLL 5FEWA 4G8FB 4NM4H 4AQEB 4M81A 5DMJB 2O1AA 2EKSA 1JTOA 1ECEA 2V81A 1EPFA 4QKTA 3WS3B 3K6SB 4L3FA 4Q3MA 5JR1L 1JGLH 2XSKA 5AZ2H 4S2SB 5GRVL 2CBJA 5BZXA 5IBXA 1OEPA 4V15A 2ESVB 4HF5L 3G1FA 5IMLA 2H9GB 1SSDA 4YR6B 4BFIA 5ABDE 5BQDA 1V55B 3LPWA 1A2YA 3P0VH 1BZOA 2F54D 3N5AA 4GGHA 4GY0A 1AD9B 1UT2A 2ON3A 5HJ3B 5BRZA 2XJ7A 5L88L 5AOZA 3I65A 4L1WA 1T6WA 4PJEB 1SR9A 3D3FA 2JJTC 2MPVA 3GR7A 2EZ0C 1RALA 3EYUL 2CGRL 3FA4A 2WZPD 3VFLA 2X12A 3S5LB 4L37B 4YZWA 1VH7A 3PV6B 1KBKA 3TTQA 3QBUA 3D0LB 3QGKC 4HCGA 4WY0A 5I8EB 3PLYA 5BW6A 2ZYRA 5HGGS 4XSLA 3D6NA 2R23B 3VFOB 3ASNB 2PYFB 3ECVA 3WUWA 5BV7H 1A6UL 5GISH 3T04D 4YXHH 1IAMA 5C09D 2A9NL 3EX2A 2O9TA 3CUJA 1LOLA 2QDVA 1RZMA 2PB1A 3BP6B 3H9SB 4A05A 3WGVB 2X38A 4QOKD 5EU5A 4FXFA 1KBVA 3IK4A 3SIKA 3PQYE 3DAQA 1QPOA 2FB2A 3CIXA 1VEPA 3STGA 5KVMC 2V7HA 2JTYA 2WYZA 5D05A 3I02B 1EYWA 3TU9A 3BRFA 3PAUA 1LBLA 4Y19B 3FF7A 5D2LB 4F57H 2WBWB 1XLKA 2FATH 4TULH 2OR8A 2I5QA 1YN7B 3O6ML 3CN0A 4HKZA 4NZ1A 2X10A 1BEYL 3UW6A 2CLZB 5DS8A 1S5TA 1O12A 5CGBA 5I71C 1SJBA 3I3DA 3RIKA 4AU0A 4XN9A 3HNVL 4XAGA 1QW9A 4O02A 2Z0BA 3OZLA 3TVMB 2WCGA 3QDMD 3C0SA 1MRFH 3CVHL 3WQ6A 3A6CH 4O1FA 3BN9C 1L9OA 1ID5I 1KXQA 4N5ED 3MOBH 4PFMA 4Z7WF 2FT6A 5D6DA 5IVXA 4A2EA 4JN6A 2H2SC 2VXTH 3X1NA 3CZUB 4A8NA 3QUMH 3T05A 3HN3A 4KXCA 2VDLL 3FFCB 4UU9B 2PPDA 1O5KA 4OJAA 5D7IF 5HDLA 4AMKL 1INEH 1HIMH 1FHDA 3NOYA 5MHSD 5JMOC 1UYWH 2EDXA 3MOQA 3ZIYA 1SXZA 4TQ8A 3SECA 2QDHA 4DJDA 1H60A 6XIMA 1DWGM 4GY7A 35C8L 4JFYB 4BUQA 5I2UA 3NJGA 4FQ1H 1E56A 2VM3A 2G60L 2YPVH 1A1OB 1PX3A 3MRBB 1ME8A 5B80A 4FYSA 4IOFD 5B21A 4PRIE 3LHPH 4Q6IB 3C61A 5C0RH 1G7UA 2NZ9C 1QRKA 1Q94A 4NUJB 2GTZB 5FUCE 1XMWA 2WSRA 4GGBA 1WBZA 2HWGA 4PD4K 4JDEA 3MV7B 3VWJC 2B8OT 4F7CA 4AX7A 4KY1L 4M9PA 5C0DB 3P11L 2H0FA 5CPQA 2KQMA 3OHIA 1SHXA 2IIJA 4HWBL 1M41A 1PAZA 5GNZA 2CGZA 1XH0A 4JAMA 2P26A 1QBLL 3B7SA 3LZRA 4NQEB 3V0TA 4IMCA 2F9BT 4NI3A 4RA0C 1OGGA 2G3NA 4B53A 4ZAKA 4W8AA 2M2DA 5F72S 1RJCA 3F5KA 3WJZA 1US3A 4FAMA 3OA5A 1WKDA 1MJ8H 1HZLA 4OLZL 1ZHBB 2VERN 5FO2A 1TJGL 3HS0A 2EDLA 5F89A 5D7LA 3GBLA 2Z4TA 2PLMA 1XIWD 2GK2A 3HNTH 2G3FA 1D9KC 3RIAF 1M2OA 1RZIB 2VC6A 5FXCH 3M64A 4RGMB 5IOPA 4UMBA 4OFKA 3P5ZA 1JPMA 5ELIA 5FHBL 4QS5A 1I0DA 1QWNA 3CZFA 2PYED 4LARL 3TNOA 2P46B 3SYCA 1SY6H 3MROA 4N26A 2RGLA 4JN2A 2HG0A 1MELA 3OKYA 1OV8A 1Q13A 3B0UX 1PVHA 2B3IA 4X6BB 3PGCA 3PBWA 3O2VH 3CB3A 2CESA 5DANA 3TN0C 1KTDA 1AQKL 4EIZC 3O6LL 2VQ1A 3UJJL 2DUXA 3GBNH 3EYOA 1E9LA 5ABEA 4MJZA 1KSRA 1TIMA 4I2XE 1NWSA 3PFMA 4OCSH 3PABB 1FO0L 3L9RA 1D6EA 1SVCP 4JKPL 3ZYOA 3WI9A 1AI1H 5EEYA 2HVOA 3KE0A 2ARJA 1IKOP 1ECYA 5EF1A 2LOEA 3H3PL 5D8JH 2DZSA 5C08E 2DM7A 1DV7A 4AB4A 3W39A 1OP3K 1NEPA 1TPEA 2QDWA 3OXSA 3ABQA 3QDGD 1G9ML 2C7FA 4BKTC 2QULA 3TEZA 1RUKH 2GITB 1WAAA 3CCHB 4NUWA 3AY4C 2HT4C 3N19B 4R3UA 7A3HA 2VDKB 1K8IA 5IMKA 4PW4A 4XMVA 3GYCA 2CE6A 3W81A 1KR0A 4CMMA 2SFPA 2OMZB 2EHHA 4PMVA 1HT6A 5D4YA 1JE6A 4XMLL 1S7RB 3GTNA 1OIMA 4MB5A 3D2UA 5TAOA 3NK4A 1EYEA 4TR9A 4NQDA 4RE4A 3H54A 4ALDA 4H2CA 1S8DA 2VAAA 1D5MB 3F03K 4RLDA 2E59A 2I5IA 1KW1A 1DEEB 2DRUA 4LRSA 3UTSA 1KOAA 2QVTA 5IQ7H 1LK2B 1NIAA 4XXCC 1NCIA 1KTLB 4QJ4B 1SHMA 1GIGL 3R10A 3DX9A 3BG9A 3GDCA 1ETZA 3QPEA 4Q9QL 1WKYA 4J27A 4PWFA 2BSCA 2IAND 1IEAA 5HA7A 4GAGH 3RGVC 3CWGA 1K8XA 4XG1A 4MCZA 1QFUL 4CMHB 1CLCA 3S1GA 5CD3A 1R7AA 2J24A 1JRHI 2JKIS 1TTCA 3WFDH 4CADA 3NGFA 5LNEA 4NGHH 2NQZA 3WQCA 4LIQL 4Q2ZA 1I9IH 2JJUA 2OMBA 4OGAC 4JCMA 5REQB 2ZKHH 2BSRB 5FJPA 4AIXA 4P23C 1IWAA 2G4JA 2VABA 4XNQA 1FBAA 2A0LD 2VLMD 1UQYA 3M0XA 4XHQA 5DSCA 4ZQNA 2FQFA 3M43A 1L6SA 1TQXA 3QW3A 3A4DA 5CSZA 4XB8A 1MEXL 1IXPA 4JIPA 2AI0H 3UZWA 4JTLA 1BGGA 1R0AL 1J8HA 3HC0B 2KS0A 1Q9LB 2BODX 4AQAA 4I85A 4NBZB 3OVUB 4JFSA 4BFRA 4TVPD 1RQ5A 5B1JA 1E7VA 1NDWA 4A35A 3QV9A 1L7TL 4ZQKB 2G3ZA 3PWPA 1B9KA 3OKLA 2CHZA 1EOKA 4HPHA 3PPFA 5HYIA 5HHME 1I7RA 4N1HB 1OW0A 3BVUA 4DHGA 1SUXA 2BSBA 2DTML 3ZVHB 1MCFA 4P5SA 1RUPH 1NWPA 2MTPA 3AHYA 1EQWA 2J5LB 5C86A 5TE6H 4O28A 4TX8A 4B0MM 5EBMA 1DBAL 5I7GA 1K8DB 2HWZH 3OPZL 5E00B 3F4CA 3IVKA 3W5MA 1U5HA 1DBMH 2J88H 2DIJA 3VKDA 4XKYB 3L4VA 3AREA 1FYTA 2V3EA 4EPDC 1JK8A 4PRDA 2H0PA 3S5YA 4L29B 4R4FL 1CI5A 1CDHA 1ILUA 4YDKL 2WXIA 3JUGA 5D7JD 3PFQA 4WJ5A 1ZDQA 1P6AB 5AWNH 3FB5B 1CFNB 3HFMH 2Q86A 2WINA 3M16A 3KAOA 4Q7NA 5IVZB 3KBVA 2X4SA 3BD4A 1X9UA 3CU2A 1E4XH 1XUZA 1D5XB 2Y06L 1T20B 3UF9A 3HS9A 4E2OA 4XNZB 2IGTA 4XAFA 4HCDA 2INEA 2XWJA 1MHHB 4XXDA 3THDA 1DKWA 1AE6H 3VDGA 2FJSA 1F8TH 4Z17A 3AABA 2EICA 3WQDA 3JXAA 4HK7A 4Q8BA 1HQRA 1CICA 2L04A 2Z35B 4QHKJ 1SYVB 3LZFH 3U4EB 5CHNB 3AB0B 3OTRA 4MA7H 3VWKC 2E9IA 6ENLA 2CUAA 3BVNB 1FHGA 2EJ1A 1T7VA 4OF7A 3C5SB 3HUJF 1CGSL 5HDRA 3UG4A 4BF5A 1TA3B 1Q6EA 1C16A 4OZ4A 4L4TB 2AJZA 5IW1A 1U36A 4F66A 1TZOA 4DN1A 3B4YA 4X50A 1BMZA 1BQ5A 3K74B 3LQMA 1ZPUA 4I9AA 4DEPC 3QIUA 4DVBB 2R94A 1AXTH 4P2OB 4XIAA 2Z7GA 2KUTA 3G6AA 3WLHA 3PP4L 1N8IA 1JAEA 1GG0A 3QHFH 1Z9MA 1FPTL 3KXFA 5IB5B 5B38G 5IJKA 1AH1A 3LNHA 4G2DA 4QQUA 2PF6A 3GSUA 4FQ2L 2HT2C 1ZHAA 3EO1B 4GMEA 4ZUTA 5ABHA 3EB2A 2HJPA 2Z27A 2E68A 4YK4C 3T08A 4LC6A 1QW7A 3RWEB 3ZSTA 3ONCA 4HV8B 3WQPA 4PRHA 3V0EA 5JBEA 5B38B 1INQB 1OPGL 2NV9A 2A77H 3RMEA 4LYQA 3GMMB 4GSUA 3L5XL 4LSVL 1J0JA 3DI1A 4M0XA 4Y1AB 2IAMD 1XIHA 4G8FA 3BUPA 5LXEA 3WDJA 4G7EB 5DMMA 3WS3A 3K6SA 1U58A 1Z44A 4JM2F 1KJVB 4LCYB 1WIPA 4QLLA 1N18A 5JH1A 3AAZB 4BWTA 4S2SA 1J5OH 3PVFA 4YHIB 4PJFA 5FIPA 4DIXA 1QK2A 3N2MA 3QEGL 5BMXA 3APYA 3A21A 2VDIA 1XF4B 4NN7B 2J43A 4DWDA 1NUGA 1NGPH 5AVUB 5LHEA 3B4UA 1RVKA 4BRJA 3L5JA 3KLAB 2QMJA 4YMZA 4J9JA 1IKFH 1E40A 4Y4FB 3VI4E 4KIRA 5LB1A 4PMUA 4IU3B 1OYAA 4FNUA 3F83A 3GHTA 1Z2KA 2JCCE 4PJEA 4N9CA 4EZLA 2NY5H 2C4XA 2DMBA 4IRJA 4JEJA 3FUEA 1F2QA 5I5RA 4W9FC 2Q6ZA 3DHDA 3NO1A 4WWID 5E2UL 4YC2B 1JK9A 3UU0A 3FJLA 5CAYB 3D0LA 5I8EA 1WV7T 1YJDH 3ZU8A 1FHNA 3DN5A 3VFOA 2PYFA 4KNUA 2HP4A 2FQEA 2E4FA 2DT0A 4G8GB 3PUEA 4MD0B 4PGJA 1UOWA 5GS2D 4J1OA 5F97E 2PR4L 1R33A 3SDYL 1P6WA 2J8HA 3CHXA 4GY4A 3SIZA 3I7SA 3B5HA 4J3OG 3KOFA 1LLOA 2FNWA 3B9VA 4GQQA 2X2UA 2BW4A 5GGVH 4Q8MA 4X5QA 1IJNA 3MO4A 1AD1A 4M6PA 1UM4L 4AE1A 2R8SH 1TUPA 1KGCE 3SGEH 2W67A 4LVOB 4LE8A 2IG2L 5TF0A 43CAA 3VGDA 1JVNA 1HINH 4NUGL 4Y19A 1TZ9A 1UM5L 5D2LA 1ECZA 2O92A 3ECQA 2XT1B 2NX5E 3FO2B 3M1CA 2WWDA 4YHKL 3QFEA 4DM2A 2DEXX 1WBYB 4PJGB 2MANA 2XUWA 4GC3A 2IWKA 2E27H 2VKZG 3SI9A 1ZB5A 5F1NA 4L9LA 4OZOA 3VDHA 3BEWB 4IP7A 3IDYC 4NC1C 2A6JB 1MJ7H 2BIIA 4JFZL 1OB1B 1UWEH 1M53A 3TVMA 6PCYA 4JKLA 4JN1H 1QMLA 4CNNA 4D9LL 4PP1D 4V1YA 1MEWA 3QRFM 3V7PA 5I1DA 4ADIA 4QF1B 2HFTA 2F61A 2KDYA 1TVHB 4UT9H 1J12A 1FV1A 2EEDA 3MT1A 4H01A 4UIKH 2PEVA 4EBQL 3F12B 1X5YA 3NQEA 2AXFB 2H1LM 1XDTT 3FTYA 5H91A 3MS8A 5IHLB 1HC1A 3L81A 3QIWC 4UU9A 2GGGA 4PG9B 4AWUA 4FQIL 4XPFH 3QY7A 1Y5XA 4UBDD 3U0WL 3L4WA 2DQDH 1NBVL 2QV4A 2WNNA 1VA9A 4LY8A 5C9UA 3STZB 5T1DL 1T3FB 4GH7B 4Y2WA 4ORGB 4JFYA 3B2VH 3VRLE 1UCTA 3ZIMA 5F70A 3S36H 3PG9A 2BVPB 2D20A 4Q89A 2O5ZH 1E6SM 3ECWA 4B9ZA 4HIXL 3K5RA 5BZDB 4M48L 3V18A 4W88A 3PZOA 2X7LB 1RIVH 2YLKA 2ZCHL 1GGCH 1OAYL 3GS7A 5DHMC 3KOYA 3WTWA 4NUJA 1SUJA 1LDPH 4U7MA 5IFAL 2O0TA 3MV7A 1U91B 5C0DA 1XLAA 1SJEB 3VCLB 3W9DB 5KOVC 1EOMA 2RDTA 2YARA 2NNXA 2BSDA 4CCEA 2HXAA 5I2IB 4GYPA 4MWAC 1U4EA 1TNMA 2B77A 5C0IB 3R1ZA 2YEVB 1FNEB 2R4RH 5FJOA 2JH2A 3GTTA 4PBXA 4H5SB 1U2CA 4XBEL 5H8PA 1G69A 1QSVA 3ATEA 4CQBA 4NVTA 3WUEA 4JYFA 1ZHBA 3RXZA 2O9PA 3RJQB 2VLJE 4OW6A 5A7EA 3TZVC 1C08A 2C71A 1LEGB 1DE4A 5B1AB 1RZIA 4OZHF 4AISA 5I82A 1C5DA 4XNYL 2HRPH 3ULUC 3V0GA 3QWQB 2DFAA 2ZRYA 2XFWA 4DP5X 2J8UE 2GVGA 2ZKXA 3LRSB 4N2IA 1BVOA 2P3YA 1WT5C 2ZWSA 1GOIA 1I31A 3RFAA 5FAAA 2YAHA 3WEXB 5BUAA 3UXKA 2C1PB 2BNRE 2D1ZA 1BF8A 3MI2A 4X6BA 4ATWA 1M42A 3CN1A 4HUVA 3GR8A 1BZ7B 3T6XA 5F4XA 3UPWA 3WSUA 3ITOA 1RBLA 1FRGH 3TBWB 3VC6A 3WXVL 2P5EA 4W4OA 4ACPA 3QNYB 1XWVA 2GBAA 1AR1B 1B0IA 3PABA 1RURL 1EKOA 1CG9B 2X0HA 3RNKB 1TR9A 2YCJA 5CC7A 4Z0SA 3IDJB 1OGBA 5D7SH 4XOBA 3QQXA 1TITA 2DH3A 3W11C 2YDQA 4PP2B 4NJHA 3MKKA 3CVHA 3S3DB 2KMWA 3GBMH 3ALPA 3B6SB 2DZAA 1ZAHA 3NZQA 2EJAA 2OJZH 4RISH 3G0SA 4GISA 3UJSA 5E6UB 4MNQD 3SCMC 1TKKA 2WBJC 4AEIL 1WWBX 1RBOB 1W0WA 4JTUA 3VFTB 1V05A 3UFYA 3FSTA 2GITA 3ME0B 1ZTXE 3CCHA 2E77A 4WI2A 3OJVC 5CJQL 2DYSB 5D1QB 3STEA 1EJ6A 2VOMA 3MN8A 3D5OF 1PYFA 4F58L 3JWNG 5D2TA 4M7JH 5DVNA 4Q8UA 4N0CD 3HIJA 1CU4L 2OMZA 4BR1A 4U3HA 1M6UA 4MKSA 4JS7A 2YXFA 3DBXB 3WHE0 2O4QA 4P49A 1XGEA 3BUQA 1BRLB 4KTYA 4KO7A 1XC4A 2XDFA 4K94H 3N1GC 3OMZA 1LP9A 4YQXL 2CC0A 2BVUA 4QXIA 3TWBA 3T07A 3U83A 3CIAA 5CC5A 1D5MA 3QLLA 1MVUB 1B6UA 1DEEA 4GWEA 2F15A 1ULVA 2NXGA 2DSWA 1IEHA 4KI5E 3ANVA 4GRLD 4MDJA 3NTYA 4KWVA 4YWGH 4HHLA 3HLKA 1LK2A 4Z9KB 1NC4A 5E2WL 1KTLA 2MWCA 2F53E 4R7NA 2EH8L 4ZYKB 4G83A 3OSKA 4HWBA 1IJ9A 3KNBB 3BDYH 4BZ2H 2BNJA 5FF6B 3TAOA 3ITVA 2ADFL 5K9OA 1B4LA 2ZG1A 4Y2DA 1ES0A 4K3DL 3H24A 4LFYA 5HHOB 1I9EA 4UTBL 2BRRH 4GCXA 2G5BB 1LRNA 4ZS7L 1A5AA 1K4GA 4OLYH 2B2XL 4I8YA 4JJOA 1JJKA 1KEGH 3GMPB 2QQLH 3TWYA 1E4LA 3FQNB 5F2GA 2MHAB 2Y23A 1EO8H 3W7PA 1QRQA 1I82A 1MWAH 3SKOB 5CF3A 1Y1UA 1ODZA 1MAML 2AK1L 5EBLB 5GJMA 5DZ9A 3JVGC 4HJFA 2GBVA 3TJHC 5I71B 3GU2A 3QSTA 1JXJA 1XFBA 2P7TB 2Z93B 4RFNC 2Z7KA 1Q6OA 4I3RL 2VLRA 1QI5A 1WIOA 3FYIB 3V1HA 3RPIA 3F6JA 3NJFA 3C6LD 1WFUA 5G55A 1BECA 3M5ZA 2IDSA 3CYJA 4LBAA 2C13A 2ARJQ 3QDJB 1SBBA 3GEWB 1C92A 3WFLA 5AZEH 3R5EA 3QXUA 2V4LA 4G43B 3L4UA 2EXTA 3KYMA 5C0AD 2QTEA 4J8RB 4PJHE 2H5UA 3U7BA 3MODL 4ZENA 2E76C 1GPWA 2EAEA 4NT0A 4UFIA 3BPOC 5CEXA 2O6PA 4O19A 4R90L 4OLWH 4FYQA 4R7DA 2P76A 5HGDB 2CKRA 1PX4A 5I6MA 3GHBL 1OAKH 2PN5A 4QRFA 1UOVA 1FH7A 3WBAA 3M88A 4L2YA 1Y6MR 3EGJA 5E00A 2Y2YA 3L6FA 4NIRA 2RJHA 1OAXH 4XKYA 4AG4L 1TEFA 5CD5C 3IGAB 1SXCA 2YDSA 1RAKA 4L29A 2RGSA 3TYGL 3ME3A 3FO0H 4QG8A 5DO2C 5CKAA 5KUMA 5IESH 1ME9A 1XF5B 3FB5A 1OX6A 4XMWA 2VQTA 3NCWA 1PTZA 2WW8A 5ADPL 3LQGA 1ORQB 3FPYA 3QY8A 4DK3A 2F8IA 4OVXA 1T20A 4IICA 2DBLL 2WXFA 3H9ZA 5CCHE 3L95A 3BLKA 3QHZL 9XIAA 2HPOA 4KMLB 4FN0A 4EZJA 4Q4EA 1BPLB 1XGRB 4KKAC 1LEKA 1V6YA 1X5KA 5CHNA 4C91A 2Y5EA 3GSVB 5BXPA 4Z5RB 4ADSA 4JO8A 4YBLC 5BOFA 3RJYA 3EWXA 4BBWA 4JUSA 1IFRA 4B15A 3ZHDA 2MPAL 3DXAD 4KQ4H 1TA3A 1D9KB 4TKWA 3AGWA 1H3VA 2MKWA 3NSYA 4L4TA 5CP7B 3CZNA 2LHAA 1W8OA 4P57A 3SSZA 2XWTB 3RBGA 2EVHA 3ZHKA 4GQBA 1DVFC 1QLRA 4P2OA 5I19H 3UTTA 1FGVH 1O66A 1V7AA 1W80A 1FL6B 1NEUA 4KUCF 2FUTA 2YGOA 3SGDI 5SWSD 5IB5A 4N20A 2X1UA 3O11B 1OD8A 4O12A 3JWDL 2NYKA 4BGLA 2Q8AH 2EYSB 3UIZA 3EBGA 4FFZL 4OQTH 2NT0A 3KGTA 3RWEA 4JTFA 4WI0A 4P2RB 4ZTEA 2FECL 4PGEB 3VABA 1I9JL 1D7BA 2GJ6D 5B38A 3E0GA 3AWFA 4NP4L 4JO4L 3E8VA 2FBJH 3NFSL 1CLXA 2VEKA 3L5HA 3C6EA 3K71B 1FQ9C 1H3XA 2CUIA 4ZUWB 1WPCA 3MO7A 4PRRA 2OXGB 2H45A 1KDIA 4G7EA 5J1TC 2FWUA 4GO9A 1EJUC 1KJVA 2B0SH 5KSBB 3IRDA 4O53A 1KV5A 2HT3D 5AVTB 4TSAH 1VRDA 4YHIA 1HEZB 3BZJA 3H2NA 1Z6JT 4OM0H 5B22A 5DJ8A 3JV4A 5D7KD 3B43A 1ZAGA 2BY1A 3LEVH 4GP5B 2B4CH 1I2QA 1L7IL 2YQGA 4NYUA 4K38A 2WHKA 5E7BA 3KLAA 4CNOA 5KJRH 4Y4FA 4G7YL 4DZHA 5JPNA 4IU3A 2KBGA 1KY7A 4QGYA 3PZMA 3B83A 3NUKA 4AC2A 1RK6A 3V6OC 4PLKD 2WZ5A 3VXGA 1M7DB 2CDEB 3NAAL 1VJZA 4P3WA 5GRJL 4CKQA 1XYLA 1A3LL 1UR3M 3U2ZA 4EP8C 1XSOA 3M7SA 1TJIH 2BS8A 5AHEA 5JXEA 1QSFE 2BFVH 4Y5VC 1RBAA 4GZEA 1IT9H 4PR5B 4NRYB 1S9XA 1KFEA 3M17B 4IWWA 4F3HA 3GAYA 2JKWA 4G8GA 3GNPA 1FWHC 2KZHA 2O93L 4ZBJA 1UATA 3ES7A 4J40A 1ZVHA 2Z4QB 2EE6A 2NVCA 2XYCA 5F0LB 3CHVA 5CGQA 1QNRA 4HNOA 1X9QA 5IB3B 1KBBA 4LOCA 5AL0A 2BLFA 3BE1H 3BSMA 4D94A 4QUOA 1E5ZA 1JYWA 1UQZA 4P23B 3HG5A 1NOLA 3HLAA 2CLEA 2FSDA 1YC7A 2CRMA 3BJLA 2SEBB 1HVQA 4PODA 4PGZA 1UUQA 5F44A 3CZGA 3NZ1A 3D6GA 3DOHA 2JIWA 2EEAA 2XKNA 1LT7A 1RA0A 2H6OA 3T0EC 5DD3H 3FO2A 3LQZB 3G18A 4F2BA 1CJYA 1WBYA 3DOPA 2XWEA 2QVKA 3MUIA 3QV6A 3APCA 1S3RA 3BEWA 1L3WA 3OVPA 3HQOA 2IQAB 2R2CA 3VRIB 4U6YA 3S96A 1R85A 4Z7NE 3QAQA 4JVWA 4EVZA 5IF0B 1GQNA 2JKLA 4R7OA 1WFOA 3B0XA 1SOQA 1Z7JA 4Q4IA 4Y16B 3IV3A 1XZ0B 1LE9A 4R2GD 3D18B 5DHVB 4PCFA 4QO1B 1KYOK 1MW2A 4QF1A 3FSZA 1LO2L 4S0SD 3LTPA 3LA4A 3T6CA 3RVTD 1IZCA 3TN5A 3B2DC 2OYPA 1KN2H 3J2PA 3VCRA 2PO6D 2FO1A 1OSZA 3D12B 4UUIA 4F27A 3WQOA 3A4EA 4HHAB 1E6QM 4ZNEA 4QE4A 3BV7A 3QRGH 2WC4A 1FNSL 2KLRA 1AGEB 3DJTA 4JICA 2XVGA 1T3FA 1MG3C 3VQLA 4XAYA 4ORGA 4C7FA 5KSUB 4ICXA 1RY8A 2NCEA 1P7BA 5BZDA 1XR8B 4YE4L 2Q2EB 1IF2A 1URLA 4NZ4A 2DOCA 1BVNP 1Y6KR 2X7LA 3QCUH 2XX0A 5CCJA 3EJYC 3B37A 3FXIC 3ZQ9A 3LIZH 2CJTA 2EE3A 1LNUA 4CW1B 2BZDA 4ZL1A 2XVNA 3UAEA 1BBJA 4PB4A 3U57A 3VKJA 1U91A 4G5ZL 4LLYB 2O72A 3MLRL 1MLBA 1SJEA 1BDYA 1NCHA 3VCLA 1XSJA 3W9DA 1IAIH 5DMIH 1P7QB 3F6LA 4QI3A 1GGYA 5I2IA 1XR9B 3PG2A 4MADA 4Z7VE 1ZFJA 4AVHA 3SN6N 4HJ0D 4N2BA 4OGYH 2EYTB 1BM3L 1RJQA 4JY6A 4P99A 3T8LA 4H5SA 3KYNB 3SM0A 2BDNH 3NL5A 3MLSH 4GKSA 3QW9A 1PF3A 3NL2A 2FNBA 3DG3A 4DXKA 3UYRL 5E1QA 4D6GA 2QR0A 3IGSA 1C12B 2VR4A 3T4YB 2RDUA 1YTDA 1M71B 3QC0A 4W6XB 5JXAH 4DEPB 4NDMA 3MRMB 4DUXA 5DMNA 1NCDL 4FFVC 3EWCA 4FJYA 4NSBA 5FYLL 1AY1H 5AB2A 1IEVA 5E7FA 5G5DA 2OFJA 3QI9C 1NMCB 4BWLC 1I7TA 4A21A 2R1XB 4G9PA 2Z2UA 3E7JA 5I3DA 1DVZA 3S3CB 3IJIA 4A8LA 3WLTA 1BZ7A 3JYBA 4L1TA 2NQ5A 4YK4B 4O0ZA 4Y0GA 3QXDB 5A43C 3TBWA 4U1LB 4CQ8A 3SJNA 5J6HA 1Q0YH 3QQ1A 2AXGB 2CG9X 1PLCA 2NWSA 3WLLA 2Y36L 4AJYV 3H7BB 1CG9A 3RNKA 4CD4A 4KITB 1NZRA 3S5LG 3TL5A 5HHPB 2LVCA 4PP2A 3CQKA 3I50H 1JGVL 1JZEA 1YYCA 1AKJD 1GWJA 1G5AA 1RH8A 2ED7A 1PKQB 4I9MA 4UDTA 3PGDA 4FXKC 2BM3A 1BWLA 4C7GA 3MRCB 2C1OA 1GC1H 2XFXB 4EXAA 5I16B 5LZLA 3DJSA 1PHQA 5IW6B 3T1GA 2XIDA 3L7RA 2B08A 4X0NA 1S9VA 1NBZB 5D1QA 3NIFF 3T4AC 5L9DH 2G97A 4K7PH 4KX8A 1PL9A 5DLML 3VXQB 2C4FU 4P2CG 2VMJA 2OYLA 3UWQA 3OM3B 4HS6B 4PJAE 3H42H 4D0BA 3WN6A 4DOHE 2PD9A 1R5WA 1BRLA 5AFAA 3PY9A 1MSSA 3WBEA 1E8XA 1F9CA 1DQLL 4DO4A 4XH2A 3W2KA 3TC9A 5K4ZA 3DC8A 3MDUA 1BW8A 1MVUA 4KU1A 2XH0A 1D2OA 4QGTA 3B05A 3RKDD 3ETBJ 3DDFA 4A55A 4JG1L 3FMGH 1R3YA 1U5JA 1OQFA 1JUBA 5E8PB 5XIMA 3II2A 2ALAA 1FCCA 4EE2A 5I15L 5E6RB 2GDUA 4ZYKA 2VD9A 3AS3A 3A9IA 3ELFA 3JWOL 2DYPB 2WKOA 3MXVL 2BOFX 2A0NA 3ZR6A 3KNBA 5FF6A 4L9YA 4F5CE 3WNLA 4KPHL 3H0TB 5HI4D 4WEBL 5FJUA 3GG8A 3MZGB 1BF2A 1V6UA 3MBED 4OCYH 2EPMX 1DQTA 4UQIM 3E0FA 4IDJH 5CZJA 3MV8B 2AAAA 4WHCA 3W7NA 5EU6B 3GMPA 3FQNA 3LBOA 3UTZB 2MHAA 3CL6A 1A7RL 3WD5L 1MZZA 1W9VA 5T3XD 4TF4A 1CD0A 5AW7B 3KCWA 1TVLA 5D2XA 1EJTC 2A3TA 1W3NA 1EEPA 1R2TA 4R4BB 2JKSA 3IDYB 1NFGA 1NQ6A 3MNWA 3KZ8A 4GBXA 2P7TA 3BJ91 3QMRA 3POHA 3VKBA 3CSFA 5TH2A 5GSVA 4XZUB 3WTYA 4GZJA 4NU7A 2VDKL 4FP8L 2KHAA 4F7EB 1KLFA 3VNMA 3HFTA 3OBKA 1J5TA 3P0WA 2VO5A 3B9KC 2WHMA 1C5CL 3AIQA 3QDJA 3A6BH 3N4AA 1FWIC 4F15C 3DURA 2P48B 1ZP3A 1YRKA 1SMDA 4PUUA 1UADC 3CFTA 1O75A 1HL2A 2EDHA 2Y22A 4D3CL 4LRNL 1WGOA 5D1XC 3X2QB 3U2EA 3TU6A 4G43A 1XGUB 4FQQB 4ZS6C 3APMA 3OLDA 1EUUA 2UWEF 3C8DA 3T6WA 4Y9PA 2DH2A 3NCXA 4DP8X 4WW2C 1MQQA 3CMFA 4LPVA 3D25B 4WFHE 1CECA 3K72B 1C8YA 5HI5D 4KO5A 1JXFA 4DP2X 4K37A 3UP8A 1NKGA 2OTPA 3EWDA 3EHBB 2ZUMA 5DT1H 1MQKH 5IB2A 2TRYA 3BP5A 4HQVA 3RPDA 5HVFB 1YEGH 4L4VB 1VENA 4RSVA 3HF3A 2O9RA 3IGAA 3S1WA 3VNZA 2OLHA 3DBNA 2CZNA 1FFQA 4NB7A 3SDCC 2AKRB 2NY7H 1INDL 3GB6A 4ODWA 3GVRA 3W56A 1CLZL 1L9NA 2X40A 4Z7WE 1AO7E 4M5YL 5KVEL 1PLBA 1QRNE 3T2LA 1ORQA 2IC2A 2RDWA 4PMDA 2AV1A 2OBGA 1ZGLB 2YQBA 5GRWA 3WH7A 1VLXA 2VVNA 3G6JF 5D7IE 5FYJH 4F48A 1VDGA 4K7FB 3HA1A 4JQIL 5ISZD 3HFFA 4XNAA 4Z7OF 1JVLA 5CP3A 2QEJA 1TZ8A 3TA3D 1E9ZB 2NNAB 2JIEA 2WWNA 3KPRB 4EIBA 5F3BB 1HJUA 4WI9A 4XC3L 1A21A 2ICWI 2IDTA 3HVDA 3GSVA 2H0EA 4Z5RA 3LS5L 2Y88A 4CLMA 1OARH 1KMGA 4NT6A 2ADGB 4IEFB 2DIKA 3N3MA 1I1CA 3STLA 1WA1X 3LD5A 4F93B 2ZXCA 2PDNA 1ZD6A 3HJ0A 5CP7A 3NCJH 1GQIA 3W82A 4YN3A 4LRIA 3WAJA 2PP0A 1ZZMA 1J5HA 4XD4A 4UTBA 1PAMA 2O5NA 4QXUH 2BDQA 1VBGA 5KZMA 4DKEL 3QLDA 1EBGA 1ETB1 5GVJA 3EGDB 4HJIA 4HCRH 4IIGA 4WIWA 4KZ0A 2ZDSA 3RDTB 1XKYA 4HNCA 3TF4A 3EH3B 1EJ7L 2DWEB 1DVJA 1S2AA 2GJLA 3O11A 3WELA 3NZHL 4X80H 1AC0A 4LHQB 5DMYA 5MF5A 5AYZA 2EYSA 4K2UH 2I7OA 1UXWA 3MP5A 1YE4A 2EPHA 4URIA 5CU5A 1A66A 1EGJL 1MFDH 2MH4A 3VAEA 3VM7A 4HU0A 2RFGA 3T42A 2UXGA 3NH7H 4DK5A 4M02A 1GPOL 5DJYB 4P2RA 2FMNA 4G80B 1LP6A 3M6DA 3LTSA 3OYZA 1P1ZB 2JEQA 4MDIB 4H0LC 1BG4A 4PS7A 4IRSC 3QJUB 2UY6A 3S46A 3QXWA 3TFKD 4OZFH 1TTUA 4S1DD 4GJTB 4HAGA 2OXGA 2WD0A 4YSRA 1GOMA 4JO2H 4HJUA 3LKSB 3HMWL 5CZKA 5KSBA 1CWVA 3TJPA 3KCPB 5BJTB 1HEZA 5ANHA 1FH5H 4PJ5B 4N2YA 1MJUH 4QWWD 5CCZA 3FUHA 4C5YA 4OQVA 3BXWA 4XP9H 1OLLA 2I25N 2AJVL