1XH0A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with acarbose
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh0A01
2PBGA 2EADA 1CXKA 4PMVA 3NYDA 3ZMRA 5BXSA 1KBKA 3KWXA 3QOMA 1HJSA 3AMGA 5A1AA 3OZOA 2A3AA 1FHLA 5M03A 3A22A 2W5FA 3MUAA 1PJ9A 4KH2A 4BQ4A 4DM1A 4UQ9A 4U5KA 3W37A 5C70A 3WNLA 2PWGA 3II1A 1M04A 1F4HA 2E4TA 1LG1A 1A47A 1DWFM 3LPPA 3GM8A 3VIGA 2VQTA 4GPNA 4B3LA 1L8NA 3SCVA 4AMWA 2X8RA 1KXTA 4WKFA 5C71A 2YBTA 1NWRA 3N13A 2ZUWA 3FN9A 4TX6A 5CSYA 2WVVA 2B31A 2W4XA 5A8PA 4Z2LA 5ABEA 4QAWA 1QVBA 3VD4A 1VB9A 2Y24A 1I1WA 4GQQA 3LPGA 3T0BA 5JIWA 1XCXA 3L2LA 3W53A 2V3DA 3CZLA 4U3CA 3HJEA 5ABFA 5DMYA 5FOOA 4JCMA 4PMDA 5AY7A 2J7HA 3WDPP 1HJQA 3DECA 2VL4A 5M5DA 2G41A 2G8ZA 2WPGA 2UY3A 3MSDA 2WBGA 1CXIA 1PS3A 3AROA 3POHA 1GJWA 4N42A 2XYLA 3SCOA 2XM1A 1W9PA 5CGMA 5DO8A 5BXPA 1R85A 4MDOA 1GVYA 2ZXBA 5BWFA 1KGUA 1BGGA 4OKDA 4AXNA 1H11A 1BSIA 3L4YA 2QF8A 1XH1A 2CESA 2J79A 3BLBA 4GI8A 3VGDA 1PEZA 2CYGA 4NF7A 3QGVA 1ZBCA 3OLEA 2J4GA 1JZ6A 2D3NA 3IJ9A 3ZJKA 2YOCA 3W24A 1PX3A 1P6WA 4MPKA 1KGXA 1E0VA 3SUUA 4JFWA 1GOKA 4AD0A 2ZX9A 1QHZA 3WDJA 4AD4A 1H1NA 4ZEPA 1FP9A 2Z1SA 4MDPA 1ISYA 2PBOA 4GIAA 4V27A 4ACYA 1E6QM 3U7BA 1IV8A 1GPFA 1VFFA 4FLQA 3W0KA 2NSXA 1BVNP 3T09A 4JCLA 1LWJA 2YFOA 1OBAA 4J3TA 2DEPA 3DHUA 5HNNA 2EPKX 2EXOA 2VCCA 3RJYA 4X0VA 4W88A 2EPOA 5A6LA 1RPKA 2J47A 3WY2A 3U57A 3DX2A 2C8NA 4AYGA 1H3GA 1CXHA 4DUWA 1J0JA 1EDQA 1DWHM 3WNKA 2V3FA 2J7DA 1ODUA 3AMKA 2VI0A 3UCQA 1QI5A 4EANA 4UFJA 1Z32X 2J25A 1ECEA 3NSMA 4LYQA 4W7UA 2YLAA 4B9YA 1GOOA 3N11A 3KZSA 3W27A 3WDHA 1JDAA 3EJUA 2DDXA 3QHMA 4PN2A 3CHDA 2VX4A 3MUY1 2F7PA 1JL8A 4PMZA 2WKGA 2FH6A 3WD0A 4W5ZA 2QLYA 4LX4A 4CCCA 3CZNA 4PMXA 1J0KA 2JALA 3KE0A 4S3JA 3O2LA 3MKKA 3A4XA 2EACA 4IPLA 3VOCA 3SCWA 3RMEA 4AIUA 5A2CA 5AYBA 3VMOA 2J62A 2WZEA 3VNYA 3VDHA 3AYSA 3T2OA 1NWTA 5EB8A 4P7LA 2F61A 3TA9A 1H09A 1OSEA 2JIWA 1FFQA 3GXIA 4JHOA 3UR8A 4WJXA 1JD7A 4YHEA 2W61A 1TQWA 3SEPA 1TCMA 5E1QA 2WMIB 4LQ1A 5A6BD 2RGMA 1E3XA 3TTYA 1VRXA 2PWEA 1RD6A 1Q6DA 3VNZA 1JD9A 4W8AA 4HOWA 1XCWA 4KGLA 1E9LA 3CLWA 4DUXA 1OM0A 2DSWA 2CETA 1XYFA 1HN1A 3WQ4A 1V6VA 3BUDA 5CPTA 1M03A 1QWUA 1K9EA 4J3UA 1ESWA 2WMJA 3PTMA 4DO4A 4YN5A 4QLLA 1MW2A 2PWDA 2PI6A 3AS3A 2WAGA 2UY5A 4J7RA 3WY4A 5I3DA 5D9MA 2FGZA 2XFFA 3PTKA 3L4XA 2WW5A 2JEPA 4AZ6A 3BAJA 1KR0A 3MUIA 1LLOA 1NWUA 2D22A 1ZJBA 1HJWA 2BHYA 1V3HA 3VM5A 3BUIA 3WDQA 1CXEA 1C90A 4W8LA 3QR3A 1HL8A 1QBBA 4YHGA 2A3HA 4PTVA 5E09A 4M24A 2WXDM 1KTCA 1FOBA 1K6AA 4IISA 4F79A 5EMYA 1GOQA 7TAAA 4KGJA 1W3JA 3LRLA 2CHOA 3BLKA 1V6XA 2YL8A 2ZUTA 4NRSA 3ZOAA 3M6DA 2ZICA 2JEQA 2W63A 1CYGA 1EH9A 1R47A 1GQJA 3SUTA 1AQMA 3EBVA 4L4PA 3GH4A 5I79A 3HU7A 1E15A 3WDRA 1IT0A 1MQRA 3CUJA 3WUEA 4R27A 1CGTA 4PUDA 3IJ8A 2Y8KA 4D72A 3I3DA 2Q8XA 1MW1A 4YPJA 4D6CA 1QHOA 1OGSA 1ITCA 4NI3A 1N82A 3MMDA 3FAXA 1UKPA 2D20A 4XX6A 2WVVB 5A6AA 3HN3A 3M07A 4F66A 3SUVA 3POCA 2VRQA 4TUFA 3WL0A 1HIZA 4MNLA 1WDQA 1R46A 4HOZA 2BNJA 3GTNA 4UQAA 1JIBA 3WKZA 3HG2A 4C7DA 4AD3A 2EQDA 5IDIA 4AZ5A 5IFTA 2Y2WA 2O9PA 3LRKA 1NP2A 3GNPA 3OA5A 2OYKA 3A3HA 2GVYA 4AD2A 2WHLA 3KEHA 5CXPA 4DWSA 5A94A 1TUXA 4OUEA 2XVPA 3WSUA 1E43A 4OBSA 1JXKA 1TG7A 2QPSA 3RCNA 2J78A 1FHDA 3B8SA 5BXRA 1L0PA 4M81A 3WQ8A 4J3VA 3AIEA 3E1F1 4HZ7A 2WC7A 2YL6A 4UOZA 3BUPA 5E6YA 2VX5A 3AIUA 4HP5A 3AZRA 3AISA 4J27A 1UD3A 3FNDA 1HL9A 2W91A 2WSPA 5M3WA 3CH9A 3TTQA 3THDA 4N0RA 1CTNA 2VZSA 4PMRA 3VGBA 4AEEA 3MS8A 1UR4A 2DH2A 2PF0A 1BAGA 1NARA 3N15A 2BXYA 3WMSA 3IK2A 1AVAA 4X9YA 5DT5A 5CG0A 4A4AA 1UWSA 3UG3A 1W9XA 1HVQA 2JFEX 1E4LA 3S5ZA 3ZT5A 2XN2A 4Z2GA 3I3EA 3LPFA 1US3A 3WH6A 1X1NA 4PRWA 4H8VA 2ZX6A 1E6ZA 5CJ5A 3AHVA 2FHFA 1EOMA 4XV0A 2WYSA 5AYIA 2E0PA 3OGVA 3BSHA 4NXSA 1R33A 4P8VA 3OB8A 1JZ3A 4TVCA 4XZBA 3WNOA 1MYRA 2CKSA 1RP9A 4EKJA 1HXKA 4WK9A 2GJRA 4HU0A 1B3WA 2ZUSA 2E40A 1B2YA 2Y4SA 2D23A 2WMKA 2XSAA 4CD6A 3W29A 4MAVA 2D1ZA 1GHSA 2WCAA 3WQVA 2YA2A 3D3AA 4W89A 3ARVA 1PBGA 2XG9A 5CPQA 1IZKA 1LG2A 1E6PA 3DYOA 1FH9A 2VMFA 1PIGA 4HOXA 2PC8A 5CLTA 1KWGA 4M1RA 2OW7A 1UR8A 1TA3B 4NZJA 1MQQA 4U5IA 1J12A 4JKMA 3SUWA 5I78A 1I75A 2BVDA 4UQCA 1QPKA 4UTFA 1JZ5A 1NOUA 3AXIA 3GH7A 3KL0A 1AMYA 4ATWA 3PZQA 1UYQA 3WF0A 1W3KA 3WUBA 4BQ3A 1AQ0A 3ZJ8A 2VX6A 2E3ZA 3CUGA 1QX1A 4PEEA 2G3MA 2IUZA 1VIWA 4DUVA 1BYCA 1UR1A 3WEZA 2VC9A 3NDYA 1V0LA 1GVIA 1OD0A 4NRRA 2J8FA 3BVUA 3CPUA 1G9HA 1M01A 2ZX5A 4F9DA 3WD2A 2ZXDA 1KXQA 3VDBA 2MANA 4FNRA 1WDPA 3RPMA 1GUVA 2NW0A 3CZGA 1KGWA 2FE0A 1WNOA 1CWYA 4P7OA 3ARUA 3VIKA 4WKHA 1B3XA 3DHPA 1V0MA 1UASA 3VIIA 2CKRA 4HZ8A 3SCUA 2O9TA 3AS1A 1TQVA 1VFMA 2Z1KA 3MUZ1 4Q22A 3VD9A 2FDMA 3MMUA 3BGAA 1B1YA 2W62A 1JYNA 3DX1A 2WKLA 4TVDA 2VRKA 2OSYA 3EJRA 2X2IA 3K4DA 4HMEA 2VCAA 3WY1A 3SCSA 1QNSA 4FLOA 1JI2A 1JAKA 1Q6EA 3ARQA 1TZ7A 2E9BA 2OSWA 1W1VA 2GJXA 3AIWA 3BVWA 3ZIZA 5AC5A 1V02A 4PSRA 1ISZA 1GNXA 3ZT7A 2ZX8A 1EOKA 1HP4A 3CBWA 4CUCA 4FNPA 5DFAA 2WMHA 3FAWA 2QV4A 4D71A 1WDRA 4U31A 3CZKA 5ABHA 1UZ1A 2YDQA 3EDKA 5A95A 5A6BA 2YIHA 2ZWYA 3NDZA 5A3HA 1B3YA 3LRMA 5GQBA 1WPCA 4H8UA 3D5HA 5HPCA 1IZJA 4TOQA 1CXFA 4IM4A 1UKSA 4P8XA 1E72M 1H4PA 3F5JA 3B9EA 4H8HA 1HKKA 4MNKA 4WLCA 4PYSA 1J01A 3MV11 4D6JA 3WF2A 4ACZA 2G3NA 3DX0A 1WKYA 4GI9A 3G6LA 3AIBA 1CXLA 1HP5A 2C7FA 5CQ1A 2XIBA 3VM7A 3DYPA 1GQLA 1WCGA 2EABA 1TQSA 4WSKA 1BGAA 3AQUA 2F7RA 2A3EA 4RL3A 5DEZA 2WZHA 3F5LA 3VKKA 2WVUA 3SUSA 1W91A 2WC3A 2YLLA 3WF1A 4UFLA 1W1PA 5E6ZA 4AMXA 3KL3A 1UWIA 2WMFA 4V28A 1R34A 1S46A 2X1IA 4D6FA 4D6IA 3CV5A 4QCEA 1E6XM 4BQ5A 1MW0A 4M29A 4DWSD 4J3XA 4PMUA 2TAAA 2GDUA 4JZ5A 1NM9A 4RE2A 4BS0A 1UD2A 4DM2A 3BCFA 2RGLA 4ZXOA 3RILA 5I77A 4GO9A 4RE3A 4FLSA 3EJQA 4D6GA 4R5EA 4U2ZA 1OINA 2FH8A 1K9FA 2FHCA 1BQCA 2OWCA 1TE1A 3WY3A 2BV9A 2CCRA 1MXGA 3CIVA 3PZOA 1KFWA 3S2CA 1B30A 3CZSA 2ZE0A 1HNYA 1SFSA 2PB1A 1WO2A 4PBGA 3W25A 5I24A 3W82A 5E0FA 3CO4A 6A3HA 2CNCA 3T2PA 2W66A 1C8YA 2D3LA 3U7VA 2ZOXA 1TFVA 2DPEA 1TQUA 3NUKA 2WZIA 2J7CA 3AMDA 3IAPA 3N1AA 5JBDA 3H54A 1J18A 4AISA 3PTQA 1E70M 3PZIA 5CSUA 1CPUA 4GINA 1GW1A 4CD8A 2XWDA 3L4WA 4NX0A 1UWRA 4NZCA 4IPNB 4P7NA 4X0NA 5GPRA 4ZFMA 1W3HA 3A47A 5CZKA 3VIPA 3ARSA 1GZJA 1NQ6A 2WNWA 1ZJAA 1TVPA 1V6WA 1BG9A 2WC4A 3VDCA 2V3GA 3LX9A 3EJSA 3AIRA 4CN4A 1BYAA 4FK9A 5EBAA 1CNVA 2WHJA 8A3HA 1DWJM 3PHAA 1XSKA 1HVXA 4QCFA 5JBFA 3PZGA 1QNOA 5AC4A 3TTSA 2WBKA 4JKKA 3DC0A 5KEZA 3TONA 5I5RA 3MO4A 3QHOA 1UA3A 3GZAA 1E1FA 4CN6A 4P8WA 2PWHA 3GBDA 1W9DM 2FGLA 4W85A 3AJ7A 2X0YA 1EO5A 2HVMA 5A69A 4TX8A 2EBNA 4BA0A 4AD1A 1G1YA 3LXBA 2D73A 2VZUA 3K8MA 2DIEA 2GK1B 3T0DA 4AYSA 2EJ1A 4Q7NA 2ZXQA 2BY1A 3S5YA 1HJVA 1VBRA 1ISXA 3D50A 3WQ5A 3W4RA 1UQZA 1SMAA 2ALWA 3VU2A 1CENA 2BS9A 1JAEA 3KL5A 3CHEA 4JFVA 1QI0A 3T2QA 3VIOA 1UUQA 3AXHA 3FXYA 1UOKA 3FW6A 3WBAA 5GNYA 3MV01 2VTFA 3GXNA 2WVSA 3BAYA 3VINA 3VX0A 3IANA 3CUIA 1KQZA 4PTMA 1WAWA 2E8ZA 3VD7A 3BMVA 1HT6A 1VJZA 3EJPA 1TQTA 1QI2A 1GQIA 1VFUA 1QW9A 3CZEA 3GNRA 5GNZA 3BCDA 3CUFA 3GH5A 3A21A 3A6OA 1X6LA 3IAQA 2W92A 5HXMA 4GZEA 1H0IA 2QMKA 3BLPX 4PMQA 4URIA 4BZYA 3BMWA 5D9PA 3CTTA 3AFBA 4H41A 2O9OA 1O7AA 1GHRA 3BXWA 1UD4A 1GJUA 3PZNA 3UG5A 2J74A 3L4ZA 5I0DA 1JDCA 4J3WA 3U5YA 1E40A 2CXGA 4JFUA 3PZTA 2O9RA 3OBAA 4CCEA 3CMGA 3PZMA 1YQ2A 3AZSA 2OLHA 1VAHA 1UH4A 1V02E 1MWOA 5FCZA 4KMQA 4E8CA 5HPOA 2YL9A 2XUCA 2JE8A 3ZT6A 2YDSA 1KTBA 3BSGA 4AZGA 2ZUVA 1NH6A 1RH9A 2G3IA 1O7DC 5A8OA 3A5VA 1JYWA 1PPIA 4CKQA 2BY0A 3O9NA 2EO7A 1VEOA 3EMQA 1UD5A 4CD5A 4C7FA 1C7TA 3CMJA 5F7UA 1JF5A 2D0GA 3NJ3A 2JF6A 1MVYA 3OGRA 4P8UA 2E9MA 3VSTA 2DQXA 1XD1A 2ZUMA 4AZ7A 1MQPA 2VJXA 3OG2A 3W38A 4PTXA 4MAZA 4ZENA 4KRUA 3LXAA 4CU6A 3AS2A 3GXTA 1W9BM 3NIYA 4UZSA 1BYBA 1GORA 2J77A 4UNIA 4CU7A 1DWAM 4D1IA 5A8MA 3VUPA 5JBEA 1KQYA 1KWKA 2FHBA 1AQHA 4OJYA 1ISVA 1LJYA 3MANA 1BG4A 2F1AA 1PZ2A 3RJXA 4A3YA 1FP8A 2J7BA 3VO0A 1QOXA 3D4YA 1F4AA 1TMQA 3RO8A 3GXPA 2DT0A 1J0ZA 1KXVA 3L2MA 3G6MA 1QI3A 1E3ZA 4GZJA 3W6LA 3ZJ7A 1E6RA 1ITXA 1NOWA 4AIOA 2J8GA 4M8UA 3VSUA 5FL1A 2HISA 3ECQA 2G3JA 3PZUA 4ACZB 3U5UA 4B3KA 1B90A 3NSNA 4AZCA 3CC1A 1BFNA 3CHCA 2F7QA 3WMBA 3B9DA 2WMIA 3WF3A 1E73M 4Z2JA 5IXEA 3A4WA 1UD6A 2VUYA 4UZUA 1EA9C 4KRTA 1HWWA 5D8WA 1HJUA 4H04A 4QLKA 5A6MA 3OLIA 1JNDA 4D1JA 2EPMX 1XH2A 3UEQA 4QDMA 2XVNA 3L4VA 4DWSC 2E8YA 1RP8A 2YDRA 3OLDA 2C0HA 3WNPA 3VDAA 3KLLA 1BTCA 4W5UA 1GOIA 2A3BA 2GSJA 1SR0A 2VO5A 4EK7A 2CIPA 1ZB5A 4PMYA 3W26A 4JFTA 2D0HA 1A3HA 2VOTA 2VZVA 4HMCA 2ZWZA 1E6NA 2XFYA 2ZIDA 3AIQA 5A8QA 3HG3A 4HA4A 2D24A 4OGZA 1UH3A 4D6EA 4XUYA 2BHZA 3ZO9A 1BVZA 1V3KA 6TAAA 2PWFA 1E5JA 3D4ZA 2EEXA 3RM4A 2A3CA 1UKQA 1JZ8A 1E4NA 4PCTA 1C3FA 2UY2A 4JIEA 1KCKA 1Q6FA 4UOJA 1CLVA 4HA1A 2Y8VA 1LF1A 1W32A 1YHTA 1PIFA 1QHPA 2WWCA 1KBBA 1R8LA 1W1YA 4CVUA 3K8KA 4U33A 2F7OA 2XM2A 1E71M 3WH8A 5C8BB 4LYRA 5GNXA 2X09A 2W67A 1W1TA 3H53A 1JDDA 4QP0A 3TTOA 2VZTA 4AZIA 1ZL1A 3AZTA 1G5AA 3CHFA 1H0GA 4B15A 4CD4A 2XGBA 5LA2A 4S3KA 4PCSA 2WCSA 2XHYA 4W84A 1G94A 3K46A 1CLXA 1BPLB 3BUBA 3SCPA 4W8BA 1VJSA 5BRQA 1XD0A 2CBVA 3BVTA 2WK2A 3TOPA 5HDRA 1C8XA 2GK1A 4HA3A 3WUFA 1LWHA 3DX4A 1PAMA 3ZSTA 1KB3A 1UKOA 3WH5A 1OIFA 1HTYA 2YBUA 4IUGA 1EIBA 4PSPA 3ZQ9A 1EDGA 1R87A 1H2JA 4H2CA 5ABFB 1MW3A 1TA3A 2XIIA 1CBGA 2YA1A 4D6HA 2OW6A 2WWDA 3GYCA 1ZS2A 5D9NA 9CGTA 1U2YA 4MNMA 4AC1X 4J3SA 1HKMA 1XSJA 1ZBWA 3VGEA 3UERA 1DWGM 1QBAA 3PZ9A 2IGTA 3CZ8A 5CPSA 4OOZA 3ZM8A 2XN0A 3EJTA 1EQPA 2FYVA 3UESA 3WD4A 1B3VA 3WH9A 3ZR6A 3VVGA 2ZUUA 2BXZA 3RIKA 3F5KA 5JUVA 3BAIA 1QI4A 1J10A 1UR2A 4W7VA 2DH3A 1V3JA 3RM9A 1WB0A 3HMCA 2ZXAA 3B9AA 4AMCA 4QLJA 1GOWA 2DIJA 1J11A 4L4OA 4KWUA 2WHKA 1C92A 1MFVA 2VQUA 1V3IA 3ARTA 3D51A 2WB5A 2X05A 1W3LA 4Z2KA 3BAKA 5D4YA 4MJ2A 4MB5A 3EDJA 3SIMA 1E5NA 5FL0A 3VGFA 5ECUA 4B9ZA 1JG9A 1BYDA 3VIMA 4UCFA 3AIVA 2OWXA 3UR7A 1OCQA 2QMJA 1JXJA 2XTKA 1DHKA 1VFOA 4GZIA 4P7QA 4CN1A 3SCNA 4MADA 2WM0A 2IXUA 1HF6A 4ATLA 4TTGA 3WEMA 1C7SA 5I6SA 1DTUA 2QHAA 4MB3A 4LXFA 3IGUA 1Q6CA 3AHXA 3ZR5A 1UA7A 3EDEA 1GOMA 1ZU8A 4WSJA 3VIJA 1R86A 3ARRA 3OZPA 4DO6A 4Y7EA 2YKKA 2YFNA 4CCDA 4GO8A 1GCYA 1KCLA 1FFRA 3AYRA 5E0CA 3LPOA 2WVTA 2D0FA 1WZAA 1OWQA 3WD1A 1EO7A 5IHRA 1UQYA 5KZ6A 3AHZA 1JNEA 3ALGA 4WF7A 1V03A 1W2VA 3ALFA 3WF4A 1CGWA 3AXXA 4MTVA 1XSIA 2DT3A 3QHNA 1WDSA 5E70A 4PMOA 1Y7VA 1E4IA 1UG6A 2VCBA 3WBEA 2G4FA 4ATDA 5A6JA 4AZCB 1V6UA 3WD3A 1DP0A 3WFLA 1J0IA 1CGVA 5EFFA 1PZ3A 3HG4A 3FHQA 3RDKA 3KLKA 3VPLA 1C93A 2WLZA 5BYWA 1MXDA 4LPCA 3ZSSA 2DSZA 3ARZA 1KR1A 2WANA 4V2XA 5BCAA 1D3CA 4F8XA 4MNJA 5EFDA 5BRPA 2WCGA 1CGUA 4P7RA 4LGXA 2JIEA 1B3ZA 5A8NA 1B0IA 3ZJ6A 1JYVA 2OSXA 2XFRA 3AHTA 3I3BA 1T0OA 1NWSA 1K9TA 3UETA 1U33A 1QW8A 1UWTA 4UR9A 1LL7A 1FA2A 1XHGA 1VBUA 1O6IA 2YL5A 4RE4A 3WELA 2CBJA 4FNSA 4FF5A 4E8DA 3N04A 3VMPA 4HZ6A 1BLIA 4OIFA 3VD3A 2V3EA 2VVNA 4JAWA 1W2PA 1HXJA 1UHVA 3ARWA 2AMGA 5LA1A 1CGXA 2CBUA 1SMDA 4JHZA 3QOKA 4HPGA 1VEPA 1TVNA 2V38A 3LXCA 1V0NA 1OGBA 1R7OA 5JIPA 4FNUA 2OWWA 1UWUA 4WKAA 3AHYA 4GKLA 3BVXA 1E0WA 2VT0A 5HBFA 5TD4A 5I2UA 4ZE4A 2VX7A 1UKTA 3A24A 1R7AA 1JFXA 3GBEA 4EE9A 1E6SM 3PBGA 5FD0A 5I23A 1V3MA 1FH7A 1DEDA 3EMCA 2VVSA 2X0HA 1HKJA 1CIUA 4C7GA 3VX1A 5BROA 3K1DA 3EMZA 2X2JA 3SCRA 1R75A 4GQRA 2EPLX 1EQCA 3J7HA 3OGSA 4W86A 2VNCA 1OB0A 5A2BA 4ZXLA 3LMYA 4DWSB 1KXHA 2OYLA 4ML4A 2XN1A 5DF0A 1JI1A 1M53A 2NT1A 2XPKA 1GQKA 1GONA 2WHMA 3S6TA 3L4TA 1TR1A 4FNTA 1OT2A 1DWIM 1OD8A 1JFHA 1E0XA 3EYPA 3APGA 3W28A 1V6YA 3N12A 3T08A 3WN6A 4E2OA 2DSVA 1XH0A 3MU7A 2CPUA 2ZX7A 1W9UA 4TTUA 4PUEA 1G0CA 1V08A 1OIMA 3TV8A 2QPUA 3WEOA 1HX0A 1QWNA 3WDIA 2DT2A 3A23A 1JZ7A 1XYZA 2XVLA 1JYXA 2J7EA 2JF7A 1JF6A 4JL2A 2CERA 1G01A 1CGYA 4AIEA 3EDFA 3IJ7A 5D8ZA 4BCEA 2CITA 3BAXA 1J0HA 2X2YA 1JZ4A 4FLRA 2IXVA 2VR4A 2F2HA 1X6NA 2YJQA 4OOUA 1B31A 3WNMA 1J9YA 4U2YA 1UZ4A 2D2OA 5FIPA 4J28A 1CEOA 3DYMA 5BXTA 4MJ4A 2CHNA 2XWEA 4EAMA 1C91A 4E4PA 1MFUA 1WZLA 4MB4A 3GXDA 1EDTA 2F18A 3WH7A 7CGTA 3WQWA 2ESCA 1LL4A 1M7XA 4D6DA 1UR0A 3VTRA 3WIJA 3VMNA 4UFMA 2X2HA 3FHAA 3WFZA 1PX8A 2BHUA 4MB1A 2GDVA 1NOFA 3AI0A 2BVTA 4HU8A 1WP6A 5A2AA 4AW7A 3M7SA 4B16A 2AOSA 4OZOA 1V3LA 4UFIA 3GXFA 3NSXA 1QNPA 1QNQA 3H55A 1W9VA 2OYMA 3WQ6A 4M82A 2WSKA 1I1XA 2DSUA 2DGAA 3N18A 2E9LA 1EHAA 8CGTA 1OGGA 3MI6A 1V0KA 1ZBVA 1CZ1A 4HPHA 3ARYA 3MMWA 3WMCA 1CECA 4W87A 3VGGA 5LYRA 2AAAA 3AS0A 4H7VA 3VSVA 5CLWA 4AZBA 5A6SA 2GJXB 3ARXA 5E9AA 1EGZA 3VIFA 1EHNA 1LL6A 5M17A 4W7WA 3GNOA 1ISWA 2DSKA 4BQ2A 3CZJA 3BC9A 3PN8A 3HZ3A 1K9DA 1VENA 3SCQA 4XB3A 1CDGA 2GFTA 1VEMA 4GXPA 1D7FA 2J7GA 3L4UA 3PZVA 4GI6A 4AWEA 2EAEA 4UQEA 1B9ZA 1Q4NX 1C8QA 1SYTA 3AMLA 2GJPA 3EDDA 2GUYA 3BUQA 2NT0A 3HG5A 4CGTA 1WE5A 3F4VA 3WUGA 4DO5A 5D9OA 4U3AA 1UH2A 4PMNA 4AD5A 5HOSA 3W81A 3WNNA 4JL1A 4HMDA 4UQDA 3WL1A 1WZMA 3AICA 4M56A 3MSGA 3BH4A 4Z2HA 3SCTA 2UWFA 2ZUNA 5DT7A 3CUHA 1ODZA 1H41A 3T0AA 1J0YA 2BVYA 3VD5A 3BAWA 1US2A 1UD8A 1XV8A 3JUGA 4M80A 2DT1A 4UOQA 3K8LA 4UFKA 2V5CA 3AMCA 1LQ0A 5A6KA 4K68A 4JKLA 5FKYA 1SZNA 2J7FA 6CGTA 3FY1A 2CEQA 4AZHA 2VURA 2F8QA 3THCA 3NCOA 2XVKA 3DX3A 1E56A 1FH8A 3SURA 4WIWA 4NXKA 2O92A 3W6MA 3WENA 1PX4A 4AY1A 4TXEA 1VF8A 3OLGA 5ABGA 2F1BA 5IHSA 4HTYA 4CU8A 5IFPA 4TVUA 1E1EA 2BY2A 1JGIA 4FNQA 3BVVA 2Y5EA 1E55A 2XVGA 2VZOA 1UR9A 1BF2A 2XGIA 2VRJA 2XSBA 3DDGA 1UWQA 4UFHA 4XZWA 3AOFA 3GDBA 1E4MM 3GXMA 1QNRA 3N17A 1WZKA 7A3HA 2BY3A 2UY4A 2CBIA 1OT1A 1H49A 3N9KA 1ZBKA 3A4AA 4NSBA 4LYPA 3CGTA 1H5VA 3VILA 3M46A 3K4AA 1D2KA 1NP0A 1HJXA 4NZFA 4JFSA 4QFUA 2VR5A 4OBRA 3RM8A 3UG4A 4ZE5A 4AEFA 2WMGA 1U30A 2V5DA 1HKIA 4A3HA 5CGTA 2XJ7A 3DDFA 4UQBA 4FMVA 1Q6GA 1XGZA 4PTWA 4W93A 3VGHA 5LA0A 3OIHA 4CD7A 4CVWA 3TP4A 4BF7A 2WLYA 1BHGA 4Z2IA 3D52A 3VIHA 1JZ2A 1XC6A 2BFGA 3ARPA 2EPNA 1EXPA 2YA0A 3O6AA 2J75A 4F9JA 1XRVA
chains in the Genus database with same CATH superfamily
4EN3A 5IQ7H 2PBGA 3GFXA 4WI2A 2JLLA 4NUJA 4O5LH 1CXKA 1EWHA 3LV5A 3TQKA 5FAAA 5GS0L 4FG2A 4ZMWA 5KJRL 1Z7AA 1GQNA 4YIQB 1BJMA 1CDHA 4TNVK 1HJSA 1MEIA 2C3VA 2OMAA 1BVLB 3RWGB 3PULA 1JZHA 1CVRA 3IRDA 4HIXH 5A1AA 2EXTA 2B08A 1Q9WB 5D7IE 4J4PA 1JCMP 1AL7A 3RPIA 2PGFA 3KPRB 3NGBB 4R34A 1PHWA 2RALA 2FZ8A 5MI0B 1Q1JH 3UTPD 2GVGA 4BQ4A 3KDMB 4ZYKB 4GW4A 3TC7A 2PZ0A 1KMGA 3GC4A 4JDYA 3TWCH 4H1ZA 1RURL 3TN4A 5EDXA 3FTYA 2VXQL 4N9GB 1WC7B 4EUPH 4HBCL 2P8MA 4P57B 4QI3A 2B1AH 3GHBL 1QSVA 4JYEA 5LWYH 1A47A 2NCEA 3L0KA 2PDIA 3FB6B 3KCJA 4O28A 4K9EL 1EZLA 3ASNB 4JM4H 4WIQA 4Y9BA 3QEQA 4GXMA 2VQTA 4O14A 2X12A 3S6CA 3DG6A 4R3UA 4ALDA 4GKOA 3V35A 3HZKA 5FUZH 4KDWA 3LHUA 2PDFA 1MVUA 3DBXA 2X8RA 2ADJB 5DYFA 4WO0A 4XPAH 2JIXD 1UZ8A 1XX1A 1I7RB 3K91A 4MMZB 2KI6A 4RAVA 4NWTL 2YEQA 4XBGA 1BA9A 3NAVA 1A7QL 4GSRA 4X4XA 4Z95H 1C16B 2WVVA 4P05A 4XAYA 5DMMA 3R19A 4WY0A 5ABEA 2FYYA 4DAGL 3UTTA 4DP1X 1QO2A 1FYTA 3AG1B 3OKKA 1OV8A 5DVMA 3SQBA 3LGEA 2HVJA 3HBPA 2PZNA 4HNVA 2A3TA 2ENSA 3MCNA 4WK0B 5DRNA 2Y07H 4UMGA 5LGYA 2AJ3A 2JKXA 3K2UH 3PM6A 1Q5MA 2F53B 2W9LA 3HZYB 2BSCA 4GQQA 4O02B 5B1JC 2VM8A 2YCJA 3DI1A 4YCPA 4DETA 3NVDA 4PUBH 3MGOB 1A6ZB 1MJ8L 5F7YC 3N4EA 3W53A 1ED3B 4U3CA 2MPAL 2YHGA 6TIMA 1U83A 4LS2A 5E2WL 3QG7H 1MRFH 3RY5A 1L9RA 4J3OF 3T4AB 2J7HA 4XWGL 4O52A 1ORSB 1HJQA 4AHOA 4PJ5D 2C9QA 2G41A 2NY3D 1J9QA 5HYSB 5IGXL 2VQ4A 4U0QB 5FJUA 4ZVJA 3OAYH 3U0WL 1JHLL 3MSDA 4WQOA 4JHWH 1CXIA 1WV2A 4MSWA 1U8IA 4NQXB 3VFWB 3BPLC 1GJWA 4MKTA 4R9HA 4N42A 2XYLA 2NLYA 1U8JB 3SCOA 4PGCA 5BV7H 5DO8A 3S2JA 3PWVB 3QUHA 4FHJA 3WN5A 2NX9A 3CT7A 1FYTE 1R85A 1M05A 2UWEB 1AXTL 2ICES 3P3RA 2RFGA 3SQSA 2GSHA 4ZW5A 1JCTA 1KBVA 2YQBA 5D96B 5AKVA 4LVEA 4ZDHA 4FADA 1H11A 4IMGA 4P5UA 2OKMA 4RCAA 1JCKA 1HESA 2G9HA 1DQDL 4LVHC 4P4RA 2CESA 2QF8A 1XIWB 4OQTH 3FDWA 9PCYA 1BQLL 1DVFD 1ORSA 3D6GA 5IUCA 1EC7A 3RVVC 3VGDA 4K3HA 2ZG1A 1PEZA 4CNIB 5T1LD 4PS4L 2YBRA 3QGVA 4XMZA 5JR1H 4ROQA 4YVXA 1UENA 1J5IA 3H7BB 1VYSX 3DOSB 5BZWB 3DUHA 1JZ6A 3F4DA 4JO2H 1F11A 1HKFA 2D3NA 4PS3A 4S1QH 1A5SA 2PAJA 3GAYA 2YOCA 1XIEA 1MY7A 4NC0B 4Y19B 5DHMC 1PX3A 3LKQA 1E0UA 1P6WA 4E2BA 1LILA 1Q9KB 4X80L 2HTKC 3BLDA 3E49A 3V6OC 2I7GA 4MPKA 3WK3A 1NOAA 3SZ6A 1E0VA 4KK8D 4AD0A 1B4KA 4ZMTA 5E08H 1QHZA 3C8DA 3E2VA 5J6GB 3ABZA 4AD4A 5FHAL 5I5JA 4HMNA 3S98A 1WAAF 4OECA 1WLHA 5FYKD 4R85A 1Q2RA 4HCRL 1S3RA 4MDPA 1ISYA 4ONOA 3NFPB 4GKSA 4JLRA 2HMCA 3C6SB 3GR8A 5L8KB 1INEH 3SY0B 1ZEAL 1E6QM 4PP2B 4X6DA 4NN6C 1FP5A 5JPNA 1GPFA 3IGXA 4US5D 1NELA 4MLIA 1VFFA 4FLQA 1GOFA 3S1GA 5EOCH 4DKDC 2YBVA 2NSXA 3W0KA 1UM6H 1W1ZA 1DVFA 3ZKQD 4DVBA 4RNIA 4PGJA 1I8KB 4IP5A 1QRNA 3LH8A 5SX4H 4J3TA 3DX9A 3NA4A 5J13C 3MV9E 2XWJB 5HNNA 3PDOA 1NCAH 1P1VA 2E9IA 3C12A 3RDTA 1QR1B 2VCCA 3VXRA 3RJYA 3C60B 3JVGC 5TK4A 1F11B 5JHDD 4POYA 1TVLA 4NNCA 4W88A 4EQ3A 1RPKA 1QK0A 4LBAA 2BNRA 3SY0A 3WY2A 3P61A 4PJ7B 3WL9A 2O6DA 4XN2A 2C8NA 4NO3B 5I8CA 1CXHA 5CWSA 5E6IA 5GGRB 5D05A 1LBLA 2PURA 5CR1A 1V5JA 3CAKA 2V7HB 3UVIA 3C6LD 5J6GA 3QUML 5HHOD 1CGSH 4P4KC 1RSYA 2XTJD 4HD5A 1DWHM 1CF1A 3WNKA 4JFFB 3E9AA 3T05A 1B4JH 5E8PB 1ZANL 4LPXA 1ODUA 3HRZC 1OFPA 4MXWH 3DXIA 1IILE 4UIKL 1FXPA 5K69A 2VI0A 2ICWJ 1K7EA 1QI5A 3N43F 4P59L 3LBMA 4EANA 1DJWA 1VLXA 2WLMA 4MD0B 4ZFZB 1H51A 2P45B 1Z32X 4AMAA 3R8GA 5KBNC 1OM9A 1Y0LB 2V9QA 2L3BA 2R56L 3HRZA 1KCXA 1KEML 1SXBA 4Z7VF 1GOOA 5I15H 3EO9H 5J4MA 1HNGA 5C0AA 2EDOA 2ZSVB 5C9XA 5DD0H 4GK8A 3LK6A 3GTTA 5H2ZA 2BNRE 2CLVA 2VDQB 3PFRA 2FECI 4P4RB 5TTRA 2A7NA 1ENUA 4YL4A 5FB8A 2DDXA 3FCTB 1RUQH 4Z7NF 1U8LA 3GMLA 4IJ3B 1N3NA 4RK8A 2XXFA 1SJEA 2X38A 3CHDA 2P24A 4JUTA 2VX4A 1NEYA 1ZAGA 4PTDA 4PMZA 3W7KA 3AU2A 3EB3A 2X89A 3ZTJG 4WR3A 5E6ID 1E9PA 2QVKA 3LRSB 3AC0A 2I32A 4NHUB 4POZC 2QGEA 2QLYA 2YGVA 3RDJA 3KYMB 4OI7A 1I3RA 2OJZL 1S7VA 1IVLA 4LX4A 1BTMA 3LD5A 4RMUA 3ISWA 2IADA 4B5SA 1PKQB 1TJHL 2WBWB 3EFFA 2Z93A 2EUZA 1HKVA 5HJLA 1IGML 5DD1L 3O2LA 1RSFA 4PJDB 4AG4H 4IPLA 1VCVA 3VOCA 4JKPH 4RMQA 3ZE2E 3SCWA 1DYZA 5DI8A 4NFCA 4JIHA 4DP4X 1DQJA 4O58L 2QCLA 2J62A 1TJMA 4QSHA 3G6JA 2WZEA 3SYPA 5DHEA 5HD8D 3QIWB 4AVIA 5TDNB 5H94A 4F2EA 3KOZA 3DO7A 4N2DA 4TMCA 3L5JA 4NQVA 1I82A 1MFMA 3GMNA 4HU4A 2WWKO 5BRZD 1JPTH 2FX8L 2YMTA 3KPQA 1UM5H 5HHME 3RN6A 1IR1A 4YDVB 1KB5A 4PRPE 5CG7A 2A99A 1WSST 3RDTC 1JDEA 3FTUA 5MENA 5DBTA 5IFJB 1QFHA 2AXFB 2O7SA 3WFDH 3P4NA 2H9GA 4Z7VA 5GGTA 3QDJB 2FJGA 4LCUA 4W81A 1JD7A 1Q72L 3BRDA 1HS6A 4W68A 3FBQA 1R3WA 1CE6A 4WJXA 4GLEA 3FQNA 1UXWB 1QBLL 4OUOA 1PY9A 1U92B 1TQWA 3K2IA 4OZGE 3MVTA 2FO8A 4YZFE 3P3BA 1NAML 3FT0A 2QQKL 5FO7A 5IESL 2DM3A 3L3JA 4ICXA 2B1AL 3GHBH 4GXUN 4YH6A 4Y5YA 2IADB 3WXWH 1DQLH 3DO7B 2RGMA 3A12A 5CC7A 5FM5M 3OXSB 3BRFA 1YE4A 2IXQB 5B7ZA 1Z41A 3ARBA 4HPYL 1TOXA 3GF8A 1MEWA 3EJYD 5KTEL 2C5DC 1F8TH 5DI8B 3CLWA 2GQ3A 2G3XA 3NESA 5AHMA 5HUOA 2Z6FA 3S5OA 3D05A 2JTYA 4PCKA 4WW2A 2DM7A 4YWGL 1FDJA 2DSWA 4C90A 4AT6B 2CETA 1XYMA 4F15B 5EBWA 4PJDF 5BRZA 5DUMH 4UTBA 5IW1B 4H9YA 2QV5A 1A4BA 2I24N 3VTMA 1F3WA 3Q8CA 3AXLB 4J3UA 1MEXH 1ESWA 2WMJA 3MLUH 3O4LD 4OZFA 9XIAA 1MLCB 4YN5A 3FTWA 1C9WA 2R4RH 3G1XA 1SLXA 2PWDA 3AS3A 1HGYA 4WWKD 4Y9CA 4LUSB 4J7RA 4P5MA 1XMEB 3NTCH 2H3DA 1A3WA 4M62H 5EU3A 4LLDA 5LNDA 1N5YL 2HNEA 4H8PA 5AHNA 1ETJA 4HWBH 2XFFA 3PTKA 3L4XA 4QJ1A 1G7PB 3RTQC 2R9HC 3PNRB 3VH8A 1WIPA 3DTUB 3O8XB 1LLOA 1NWUA 1BBDL 4F8NA 1NJJA 2IFGA 4GFXA 3H0TA 1ZJBA 3C2YA 1HJWA 3P14A 1LDCA 1H8OA 5SX5K 4KTGA 3BUIA 3WJJA 3WDQA 4D2NA 5CUSL 1B9KA 5FO2A 4F8PA 1LO3H 3HR5B 1C90A 3P8IA 3CIWA 1RK1A 1HL8A 3SDAA 3TS8A 4YHGA 5KZEA 1F3JB 3RNKA 3W0WB 2WQAA 3MLRH 1FOBA 2ZRXA 1IC1A 5EOQL 1IC7H 1I7TB 2VN3A 1KM3A 3QUXA 1GOQA 1JNLH 1IAIM 5RUBA 3GC5A 5SWZB 1KFAL 5AECA 1W3JA 4Q4RA 4YXHH 1QWKA 3EPNA 3TBBA 2V2XB 1FV1B 1AXTH 3EH1A 4CAGA 1P4IH 2QQNH 5JA9A 4L4MA 2YL8A 4X5XA 3PAUA 3DHDA 1OZQA 1TT6A 2WYZA 3KBEA 4YSEA 1H7WA 4NRSA 1FL6B 3VXMD 2BERA 3M6DA 1FL3B 2OCCB 1M7JA 3ARGC 4DFHA 2FZ9A 3ZR4A 4DUOA 5IJVA 5D72L 5GVJA 2GJ6D 1R47A 1RK7A 4JOMA 3ZS4A 2XX0A 3QO0B 2AGTA 3ZZLA 4JIRA 1NFAA 3DSFL 5JR1L 3OZ9H 1OGPA 2J44A 5ECVA 4YWSA 3G04A 3IXTB 1KB9K 3T6VA 5D1XD 3H7VA 3VFSB 1E5UI 1TLMA 3HU7A 4H26B 5I79A 1E15A 1POJA 1VADA 4L2LA 4AJVA 3GHTA 3H2CA 3I6EA 3L5MA 4MZ3A 4WTXA 3O6LH 4R27A 1JGEA 4ZPVB 3QULB 3IJ8A 1HZHL 4K7PY 2Y8KA 4XG1A 4D72A 3JWDH 1ZQ5A 5F6IC 2PU1A 3I75A 1MW1A 2ZOOA 1QHOA 4I2XA 3H2WA 5DUJA 4CJ0A 1V27A 1YEJL 3OG6B 2EE2A 3QUXD 4MZYA 4WX2A 1ITCA 2X2UA 1U3HA 1IGIL 1AZZC 2WIIA 4JEGB 3TA4D 2R8SH 5HDBF 3MMDA 1JPGA 5BRZE 3MP4A 3BPOB 4LGRB 3CC5A 3O3UN 1E1CA 4KTEL 3PF3A 4PRPD 3M07A 3C9NB 4PWJA 5BO1L 1KIQB 3U25A 3U6XS 3M8OH 3MX0B 1TKWB 3QFDB 2VRQA 3PWJA 4TUFA 5A2KH 3WL0A 3WFHA 4TOYH 4K07A 4RMWA 1AH4A 1JEZA 1S9VB 5DMKB 1MPAH 1RLWA 5FUOL 4WTWA 3UTPE 1EGJH 1W8OA 5IBUB 3GIVA 1G7MA 3PXHA 5DK3A 1R46A 2V2HA 2Z4QA 4HOZA 1QNZH 2BOLA 3RP1A 5T8IA 2UV3A 3B04A 3PNZA 4JFYB 3MRQA 2AP2A 4G71B 1TV4A 2ADIB 2V9RA 4XNDA 1M68A 3WX7A 3SJVA 3U2SA 4IOIA 5K9KA 2UUDK 2XTLA 1WUFA 2EQDA 2NQCA 3B7UX 1KPVA 2EDNA 2FATL 4ZQKA 5J13B 1A1OB 3EGSA 1RVFL 3LH2L 3PC0A 1JF1A 1R5IA 2J73A 1NP2A 3GNPA 2Z9TA 5CBEA 3IBEA 2OYKA 5JOPD 1TUPA 1ZT4B 3A3HA 2DQJL 3KEHA 5CXPA 5I71B 1I1FA 1YY8B 1B4TA 4M7KL 4W9JC 2Z28A 5IJBC 15C8H 4LLQB 3QCVH 2QTEA 1A6TA 4G6JL 1BG1A 3F1QA 2EXYD 4KQ3L 5DUBA 2XZCH 4YSUA 3EJZD 4OUEA 3QJTB 4FQJL 4QLWA 1E43A 4JHMA 3SDXF 1RIUH 4XNAA 4E5XB 3RLVA 5DTFA 4PG2C 4QXGL 2ENPA 4NIRA 2OG9A 3ARBC 3D0LB 4JFEB 3KZPA 4RDYA 4S1DC 3B8SA 4DJMA 3BG3A 5BXRA 1LRNA 1L0PA 1P4LA 3UX9B 1TB3A 3WQ8A 1AYRA 5T5FH 2DYSB 1IC5H 2DLGA 2PDUA 5DVNA 4O51B 2IPKA 3ITGA 4HYWA 4ZQCA 1P84K 4HF5L 4FG0A 4UOZA 3UU0A 2ICEB 1OIOA 5DJ6A 1OW0A 4GKZB 5DD0L 3ZVVA 2E67A 2ZFAA 4WY0B 3D48R 4HP5A 5IK3A 3NFSH 1JXDA 1T1WA 1UD3A 3P69A 2QDGA 1RUQL 3KCLA 3IRPX 2W91A 1AFVL 4G9FE 3CVCA 3HG1A 4CQCA 3BKJL 3HPSA 1VZIA 3R0DA 4NUPA 2R69H 3HMWL 3THDA 5E6RB 3JWOH 4FKHA 4OAWB 1XF3B 2VZSA 5DJYB 5B3JF 3L81A 3BJFA 3C2OA 3TYUA 2V5JA 2XQBL 2MWCA 4RGND 2DH2A 4MQXD 1FZJB 3WS6A 2UWEF 4MZRA 1DUZA 4KRMB 5HJGA 4DGIL 4WJEA 4DX3A 4F0MA 3ESOA 3QRLA 1FGNH 3IMRA 3OG4B 5CJOL 3JWNC 1OM3L 2NQ3A 3WTVA 2WTRA 3O6FA 1SO4A 2BXYA 4FI6A 1JNHB 3YPIA 3BWZA 5DT5A 5EIVA 2IBZY 3SB0A 1A3RH 5CPLA 2D8KA 4PJHF 2Z0UA 1W9XA 1QSFA 4PJEB 4C58B 2DQEH 2BVQB 4J4PC 2Z1WA 3NO3A 2JFCA 2IPTL 3RPTA 3GVVA 3S5ZA 2FEJA 1YMYA 2FBRA 3QQDA 2WUCL 5FDWA 1A3LH 4E42B 4Z2GA 3TBYB 4PH6A 2JQMA 2F15A 2FJUB 4UUJA 2GTZB 5AOJA 2FX8H 3N4AA 4HFWB 4PRWA 3QG6A 1RQ5A 1FX6A 4XKYA 1E50A 1HHKB 3SD2A 5EO9B 2FHFA 4JHAL 1JPMA 4YXGA 1LORA 3W75A 3E6FB 4TL5A 4C6PA 3O05A 2R1WB 1ZV9A 1KGYE 1W31A 3CPGA 3KLAB 5IMMB 4L6DA 3KBWA 2BSSB 1JZ3A 3TYAA 3BIBX 2QQKH 3CVDA 5AWNH 3D47A 3W86A 5L6UA 1DDTA 4JO1L 4XZBA 4JDEA 2HFTA 2VDLB 1R3KB 1H7XA 1V79A 1CK0H 4EKJA 1GW6A 2Z31B 2R1KA 3PWIA 1J87A 4EIGB 1BXAA 4I9XA 4F79A 4EUPG 3E2HC 2VDMB 2XKNA 1PO9A 3SBQA 4ZJ9A 5G5IA 2XSAA 2JJVA 1VGEL 3FNKA 2NXZC 2FECL 1AQFA 3BZEB 4AVKA 5FI8A 1YUKB 3GSNL 4NM4H 2D1ZA 3HC2A 1T6VN 4G8AC 2YA2A 2PF8A 1GKPA 3D3AA 3HS0B 3FONB 3SY1A 5DUML 3ARVA 4AXWA 3J2PA 1M41A 1YCSA 2FJFB 4TF4A 3L5XL 1O7VA 2JELH 1UR3M 5LBGA 3Q06A 4C6QA 2WJZA 2YWZA 3RJQB 2R4RL 3KCWA 4FTVD 4L9LB 1P7KA 2IAND 2Q3AA 3DYOA 5C0CD 1AGFB 5IQMA 1X8CA 4O9HL 3R43A 3U7WH 3L5IA 2F19H 2DOCA 2JKJA 1FDLH 1HZKA 4B2DA 1MRAA 4H7ZA 4LCCA 3AACA 4IBVA 4AIZB 4A2FA 3CUXA 4YL2A 3I84A 2BWQA 3I6GA 4LRSA 1UR8A 3AY2A 3I6SA 4KITB 1XXFC 5KJ7E 1UP0A 1MQQA 3DBPA 3S9YA 2LLNA 1MCEA 2FTWA 4XAZA 1RJZB 1J12A 4PJXA 1RIVH 5INDA 4HS3B 5T91A 5AG9A 4JKMA 2XISA 4ZR8A 3SUWA 1AGBA 1A7RH 1SY6A 4KCVA 4WW1A 2BVDA 3JSSA 4B6ZA 5EA0L 1IEBB 2YPKA 5J8OA 2J6EH 4GABA 3KOXA 4UTFA 3JUYA 2HQAA 3OZKA 3DPBA 3FRPG 4W9IC 4R7LA 2QJGA 5KYYA 3BMXA 4P2OB 3CDGA 1K4HA 5D37A 2PLTA 1U95B 3AXIA 1UPMB 3FSZA 4JTGA 3KL0A 4EPEC 1EFXB 4AEIH 4ATWA 2OODA 3PZQA 3HBGA 4YXHL 3UXLA 4X4XB 5K9DA 4ODTH 1W3KA 4FP1A 4MFEA 2N0KA 3WUBA 3ZJ8A 2JJSC 3B2XA 1H60A 1FIGH 3CUGA 1X5ZA 3PWPA 4H9UA 4PEEA 2G3MA 43CAA 5HBBA 5LJYH 1W3IA 1GYLA 1VIWA 3V6OA 3IPEA 4X8JB 3WEZA 4DPBX 2CMRL 1V0LA 1S7RB 4UT9L 3N5AA 2J8FA 2VERN 2NY3C 3CHQA 3CPUA 1G9HA 1BJ8A 3MKGA 4LUYA 4GQGA 2DZPA 3IDGA 3ANUA 2Z7UA 3RY4A 2Y85A 5JNYB 3GUTA 1B9BA 1VRDA 3VFCA 2MANA 1X5MA 1WDPA 3FT4A 5F1IA 3RUGB 5A2FA 3EYOA 1FWNA 2GKIA 1AZRA 3H21A 4I5BB 1UIOA 1MY5A 5GGUA 3IGSA 3I74A 3QEUA 1A7PH 1RJYB 1CWYA 1N12A 3ARUA 1E6OL 3L1GA 4TQEL 3KTXA 2P42B 4WKHA 4ZK8A 1JGVL 1XGYL 4ZBJA 4GXFA 3DHPA 1B3XA 2XWTA 1V0MA 1KLUB 4HUCA 4PBWD 4C5YA 3ZO0A 5I6XC 1XCQA 2CKRA 3SCUA 5EF0A 1XTMA 2ZCHL 1TQVA 3B4NA 4G2DA 1VFMA 4BCXA 4LNRB 1C8VA 4Q22A 2J8OA 1CLKA 3C8FA 5KVEL 1HAUA 5IB2B 2B3RA 2I60H 1Q9OA 3T2LA 2W62A 4L4VE 4GNJA 3IJYB 2DKMA 1COBA 2OMBA 1S9YA 2LU7A 4L9ZA 1VFBB 1JPST 1F3DH 3FFDA 3EJRA 3SECA 3S34H 1EGJL 4L8CB 3I6KA 3O06A 4HMEA 4XNZC 3H7BA 1DUYB 4ZO7A 4B9CA 4IUOA 1RK0A 4NC1C 2WJ5A 1JAKA 1Q6EA 3QI9A 1POKA 2VDOL 5D1ZA 4MZ1A 3BQUB 5DCCA 4KOCA 2R2HA 5B39A 2CO7A 1M1XA 3EX2A 3F7KA 4OCWH 4N1EA 5DR5H 2OSWA 3VXSD 5IEHB 4OQVA 1TXKA 4FEIA 1W1VA 3AIWA 1P5VA 4FEZA 2FATH 4QS6A 4MJ5B 5IG7A 1GMEA 3GNNA 2IAMC 1V02A 2PO6C 3TCSA 4AY7A 5AC7A 3C08H 3ZT7A 1GNXA 4ZTXA 5B1BB 5AZUA 1FORL 1MRCL 5LN8A 1TV7A 1N3NB 4JY8A 4U3SB 5HNUA 2ZWKA 5DD6A 4LV9A 2CM6A 1T2XA 5DFAA 3D0CA 1OARL 1IKFL 5E1GA 3FSUA 3I7SA 2H2PC 1RQEA 4GUPA 1EUUA 3QH3A 2YUWA 1T7WA 1T3FB 3BI9X 4U31A 2PGEA 4UM9B 1KYFA 4M7JL 4OCSH 3TJEH 3BDYH 2CHRA 2FJSA 2W65A 3CZKA 3RBGA 2DVUA 2RH0A 5LSMA 4MRBA 4TSCL 2YDQA 4JPWL 4PYHA 5J9PA 3W1NA 5AN7A 3ZHNA 3TJLA 3FVDA 2QV2A 4NZ8A 1D6EA 3MBXL 5HHXH 3RX3A 3OJDB 1JPDX 1PDKA 2X41A 3QO1A 3K2GA 2O5XL 1XKYA 1MF2H 5A3HA 2FX9H 1N0LA 2KZBA 4P49A 4NLAA 2Q3ZA 4O1CA 3CHFA 1RMFH 4LUIA 4C60A 5HPCA 1IZJA 1WWBX 3NP3A 4NERA 3KTCA 4GZ7A 5FV1L 2VDPB 1CXFA 5HDQL 4IM4A 1UKSA 5C0JA 1BQKA 5EC1B 3EYSL 5HMSA 3SOTA 4P8XA 4N0UB 2YD8A 1W5PA 4Z1YA 4JPSA 3GMQB 1AIFA 4P2RD 3B9EA 4LLDB 3F5JA 2KLSA 1LQAA 5CC5A 1O9ZA 1HKKA 5CWSB 1XUUA 4DIAA 4G8GD 3MV11 3S1UA 4D6JA 4AL8H 1W56A 1N67A 3T78A 2E6PA 4KFPA 3E38A 3DX0A 3LZNA 3F7RA 4KK5D 2WXGA 1RZFH 1H5YA 1ZGDA 2O4QA 4NFBA 4F37F 1IAKA 2C7FA 4K8GA 2B7DT 2WLJA 4Q6IC 3VI3E 4C4UA 1W5QA 3S2LA 2BW4A 4HKXB 3ZDZE 5CSRA 2ACRA 4PD4K 2HAZA 1FNEA 5EWIL 3NJIA 2EABA 4DP7X 4KCUA 1RCYA 2HT3C 4MLSA 3RZCB 5I19L 3ISIX 3MC0A 4IQEA 1GYAA 4OJCA 5AOIA 2EVJA 4HISA 2HCVA 1Q8AA 1VF5C 4HYTB 1DE4A 1I85A 4GSQA 4PLOB 2VLKE 1T0NB 1DBMH 3MLVL 4FFWC 4XNXL 3F5LA 1EK3A 5BS0A 3JVGA 4Q8PA 4PHZA 3RIAK 5F72S 1CURA 1DIDA 4A3QA 2WVUA 4R88A 4D9QE 3UNDA 3NJGA 2Y7MA 3RGVB 2ZXGA 2WC3A 1S7SA 4ICNA 3SUSA 4NYUA 3FJLA 4HW6A 1ZVYA 2KX9A 4AMXA 1AANA 4XWUA 3QJUB 4YDZA 2D31B 3U46A 4QHUA 1WK0A 2GUBA 1R34A 2EKSA 4H88L 3RVTC 1QPNA 3LHZA 4LVHB 3HS9A 4QNPE 3BIAX 4D6FA 3VFSA 4D6IA 4FALA 2BOFX 3FO0H 1Q90A 5DYOA 2GJJA 4GAFB 2CZNA 4Y4FD 1KCZA 3CJPA 3WEXA 4I0PC 4MY8A 1F1AA 3IJEB 3ZY7A 1CD1A 5CEXB 3B0PA 4RNHA 1S7RA 3KPQB 3ZZSA 3WBWA 4DWSD 1NUFA 4J3XA 2YW3A 1WD9A 1CK0L 2GDUA 1B5TA 4O8AA 2PTZA 1ECQA 4RE2A 4BS0A 3KOWA 1UD2A 4DM2A 3L7FA 3RTQD 4PJGB 4ZXOA 3RILA 2R91A 2HT3D 4FLSA 4ZUTA 5G4HC 5L9FA 4AV5A 3P74A 4LALA 3BKMH 1MHEB 4XMLL 1OINA 3D25B 2QFPA 4D9PA 2REQA 5JMOC 3T3PE 3OG3A 4NQEB 3W5NA 4XODA 5LBSA 1C5DB 3VXTB 4G9FB 5IKCB 2EVHA 3P9WB 3F7JA 1W72B 5DJZA 4OD2B 1IQWH 4EMZA 4GG6A 3VA6A 1AW2A 1BQCA 1YY9D 2GSIB 3HS8A 1MXGA 4OJFL 5D7HA 2KHAA 3RVUC 4HZ1A 2VLKB 5IB1A 4DKFH 2BC4A 1KRBC 1E65A 3U7WL 3LZ3A 4LY4A 3T71A 2Q8BH 5C6WH 1L2QA 2GBTA 5EC2A 1KBWA 2PB1A 5IHLB 2NYZA 1TYJA 4Y4FA 4QTGA 2ISWA 5EU4B 2C1GA 3H2QA 3NABL 3ZDZB 3QA3A 4FKKA 4G6CA 2VRAA 3TM6A 3CO4A 4ODXA 3QPZA 2IOOA 4I0PA 3ULUC 3T6CA 3FO2B 3WLHA 4NILA 2W60B 4HHAA 4DQOH 5IMOB 2CNCA 3T2PA 3ARFB 2V63A 4DXVA 1E8ZA 2PPCA 1P7QA 5FK9B 3U30C 2CU9A 3CDZB 5CBEB 1C8YA 4XZUA 4PGEA 1H1ZA 5FM5O 1W72A 4HIXL 1YYLL 5DJZB 1YE6A 2WINB 1YXYA 2J13A 3QIUA 2VEKA 2ZOXA 4GQBA 4LUTA 5D03A 1BVKB 2GTWA 3C0JA 1PS9A 3DROB 5EBWB 1W8SA 3S88H 3ANYA 3QQWA 2WWMC 3ZE2B 3V55A 1FNEB 3PZIA 2ICSA 4AVJA 4QOKD 1PVNA 3LEVL 4PJDE 1A5NC 3NXLA 4AY8A 3O2VL 3L4WA 1UWRA 4IPNB 5GPRA 4X0NA 1FG9C 3N19B 1H0DB 3A47A 3MAWA 2XSKA 3GSXB 3D06A 3QJVB 4KJYA 4P2RE 5E0QA 4AC4A 3OZMA 4JTJA 1HH9A 2PPDA 2O5NA 4PRTA 3T0CA 4LP8A 2XBDA 2P1YA 1P4BH 2IANB 5C0CB 5AYUL 3NR0A 5H8PA 2ZUQB 1TVPA 3EYQD 4BWLC 4Z1BA 3BJ91 1U3HC 5EV7A 2V2TA 1RUKH 3VGAB 5HGAB 1EDHA 3AIRA 2Y70A 4OM0H 3IPBA 3NEEA 5ES4B 4FK9A 1A7QH 5EBAA 1MWAA 1CNVA 3P73B 3JWNH 5IQ9A 1NBYB 5EEVA 3AXMA 4YHML 3UC0H 2P76A 2C34A 5IB5A 4OLZL 4F1ZA 5DVOA 4C1KA 3PZGA 2ZE3A 5IVNA 3DG3A 4TQEH 2ZBTA 3HPZA 4HK6A 5FF0A 3TTSA 1U8QA 2VM9A 3NJNA 4X4ZA 4F58H 3DETC 4QRRD 3AGVA 4N85A 1JK9A 3ZUCA 1A4CA 3FQRB 3G04B 5GGQL 5I5RA 5H4YA 4UNTA 5IQNA 2WXHA 2DZUA 4X6DF 1M7OA 3BV7A 3GMMA 4JFFE 4XMKL 4CN6A 5IFHL 1FVPA 2XIDA 4D94A 2BJMH 3GBDA 1G9MC 1SHWA 2WTRB 3O6FB 4K7PX 4WNQA 1D5RA 3VCLB 5I6XB 2NUTA 5HSFA 1JHLH 3ULUH 3S34L 1EO5A 4G56A 2VITA 2AS5M 3MNWB 5JOPE 3L5AA 4X6CB 2NX3A 1WUZA 1YNYA 1FO0A 2EC8A 5LG6A 1KTNA 1NCDL 3K8MA 4XBMA 3LYRA 4HYRA 1NMAL 4WD0A 3M17B 4JDVA 4NP9A 1XIBA 2GK1B 2EUXA 3QZLA 2IQ9H 4JAMA 4X83A 4AYSA 4Q7NA 1HJVA 2DQMA 1SUJA 5IF0B 4FEMA 3QBUA 3MDJA 1PU0A 3FZUD 3ITOA 1UQZA 4HK3N 1MRCH 2PPEA 2OLAA 3ROLB 2N7BA 3Q2VA 4D0CB 1DTNA 2QVTA 4MUZA 2PTWA 2F8OA 1R3KA 3OKOB 3M0LA 1OT4A 3GSRB 4RX0A 3R4RA 2VDML 3RUGE 1VKXA 5ALCL 1TTIA 3T2QA 3CLMA 3VIOA 1UUQA 2IKGA 3OZLA 1DVQA 4KK9C 1SFHA 1UACL 4E5XG 4KESA 1WKFA 4TSCH 4XP4H 4IFRA 3FW6A 5HHNA 4R8WL 4RNRB 4IJ3C 3MV01 2VTFA 2Q7AA 4K3EL 1RHHB 4ANXA 3BAYA 3MUXA 5C9UA 2O5XH 2XIQA 1FNLA 4YZWA 3CPLA 3VNLA 2FX9L 2R7EB 4L8CA 3BD3A 2X4TB 2W0FA 1YY8A 1EJXC 2CWXA 2WJDA 3VDGA 3KJ6L 4FQ1L 1WAWA 5ITFA 3G8EA 1EAPA 1X7IA 1F6AA 4HCRH 1SEBA 4IMFA 2CRIA 1V8HA 4H1LB 1VJZA 4MWAB 4XZMX 3W01A 5CEZL 1X5KA 3PY9A 1IT8A 3LNDA 3M45A 3V6ZB 3QLLA 4PCFA 1TZGH 3TBYA 4LASH 1I8UA 1UWXK 5FM8A 5JIDA 3MZGB 2FUTA 4JQXA 3ULUE 1GZQB 2XDHA 2MQCA 3GNRA 5GNZA 4DKTA 1BEXA 3A6OA 3IAQA 3VCNA 4UANA 2BSDA 4O4YL 5CKAA 3LQGA 5DMIH 1JCLA 4GZEA 5DMNA 4J6IA 3BPNC 1TPXB 1NMBL 1DFXA 2BCKA 4OTXL 3TH4T 3BFQG 4Z7AA 3BANA 4URIA 2NX5D 3G1AA 1OTSC 2V7NB 2WXLA 3LNGA 4DP2X 4K15A 1DVSA 3CTTA 2KERA 3CVHH 3US0A 4BK8A 5ECJE 4R7JA 5K9JH 2JF7A 3IE4A 4BFIA 1IVTA 3ONCA 4JJHA 1LEIA 2A2IA 2RMNA 1A9EB 1LO0H 3WHE0 2BDQA 1YUHB 1T1XB 2V8ZA 2YCLB 3BXWA 1N0XL 4N1CA 3PZNA 3EEGA 1EUTA 4C57C 3K4WA 3KJ4C 2FDBP 3N2MA 3W7JA 3QZ6A 4B5XA 1KB5B 7ENLA 2WMPB 3TN0D 4MJ6B 5I0DA 1TPDA 4FXGC 4GVFA 5C2UB 1H5BB 1OGAE 1A5CA 3U5YA 3L66A 3VB9A 5FW8A 3EOAA 3Q01A 1E40A 2FVKA 2CXGA 2YWYA 3S37H 4LDLB 1AJZA 4CCEA 1BJ1J 3NCBB 3FSOA 1XLCA 4R2GC 1SY6L 2IBZX 4RESB 3FB8A 3M7WA 2EKGA 3TX9A 5FGCE 3N3EA 1V02E 2ADJA 1IU1A 1RY7B 3RKPA 1MWOA 4AC2A 4NP4L 3AWEA 1VH7A 2OTDA 5DCEA 4JCWA 4E9RA 4KMQA 1KV8A 2R56H 3CS2A 2CO6B 1KKRA 1NKOA 4XB8A 5FDWB 1WX0A 2ICEC 2ADFL 1FFOA 2H1PL 4E38A 4MMXC 3W1TA 1LRQA 1T8QA 5ITBL 1XRFA 3UJ2A 5I1LA 1QRNE 3MFGB 1HILA 1EJ6A 1O7DC 2QQLL 5D55A 3SDXE 2QR6A 3RL1B 3C6EA 3SBFA 4LAJH 3ALXA 3RYMA 4A7QA 4ZNCD 4L4VD 1K6QL 4L5ZA 2JSFA 1PPIA 1FZMB 1P9MC 4XBKA 1LM8V 1OW0C 4RDQF 4CKQA 4PY7A 2GDQA 2B4CC 3WLRA 3RFZA 3ZKMD 3W84A 3RWGA 1LWRA 3VRLE 4NT6B 4K3JH 2CO6A 2BLEA 2OJPA 4WGWB 4PR4A 4PW9A 2BTMA 1OQOA 1S8DA 1C7TA 4FXKB 1FO0L 1JF5A 1HUVA 2CC0A 1G7QA 3FVMA 4DY1A 3CN1A 4NDMB 4JO4H 3V9CA 2JKAA 2GJZB 1XB8A 3WS6C 3OGRA 2WXQA 5JTWA 4A7GA 2ZOUA 3TO2B 4E5TA 5ICZA 1ED3A 3WLMA 1XXXA 5C09E 1HQ4B 1TJIH 2MSPA 3NZHL 1WFMA 2VJXA 3QSRA 3Q5YA 4PTXA 1BV8A 3BOLA 1U0QA 3AWGA 2RBLA 3O41B 5AALA 3WJMA 4KRUA 3HR6A 1R3VA 1MN4A 2TSYA 1UM5L 4PYGA 3AS2A 4DQOL 4XHJC 1W9BM 5SWUA 1YNLL 4UZSA 2B5IC 4NT6A 4PGDB 1HILB 2ETWA 3CHOA 1BYBA 2P0OA 4G5DA 1T66D 4GRWE 1X7TA 1BREA 5FECB 2J77A 1NDWA 1YYLH 4Q8BA 5IB4B 1Q0YH 4UNIA 5E0KA 1MUWA 1INDL 4WW2C 1JP5A 1T8XA 1M42A 2YPIA 2IMNA 3C2FA 1PL3A 1FGVH 3JT0A 1QU4A 3ZPDA 4OFQA 1E4HA 1MAJA 3UY8A 4OJYA 3HUJA 1NAMH 1ISVA 4JBRA 5IESH 1OL0A 3NAAH 5CIPB 5JUEL 1LJYA 4JM2D 3MANA 4KKQA 2X1QA 3GJEB 4YBQD 4MJID 1YLVA 2QSCH 3FMGH 4XNMA 1FI8C 1XTLA 1XCQB 4A3YA 4XBEH 2BNUB 3IVKA 2H6OA 1VCFA 4XPGH 1CTMA 3H9YA 1QOXA 3N6QA 1AD1A 2I7OA 3Q5OA 4OFKA 4XVSL 3N9RA 4MNQA 5EU5A 4ECNA 4HIEB 3OQEA 3WLIA 1TMQA 5LB1A 1YADA 2OJ1A 3GXPA 3CBRA 1AQKL 3ERXA 4ICWA 3NYKA 3TBTB 1J0ZA 3QFJE 1GOXA 2KPNA 4WUKH 4KMTL 1KZYA 2KAUC 4BY3A 4X99A 4ZFQA 4WI7A 3N6HA 1OYCA 3S35L 3G6MA 1DVYA 3W7LA 4N2CA 3TH2T 4JQXC 3RUBL 3W6LA 3ZJ7A 4R5VA 4XXWA 3S96B 5DZOA 2XPGB 1ITXA 3RJDA 1CBJA 4M8UA 2GVLA 3VFUA 1AS6A 2BH0A 3UABA 2C1IA 2B20A 3HV8A 3PWUB 2Y7NA 4RVBA 4HUNB 3E12A 3S36H 5IM7A 1QPQA 4XBJA 3ANVA 2PR4H 3ECQA 5BO0D 1TEYA 4V1DA 5DO2D 4N2MA 3RHGA 2F5BH 4JZOA 4FJYA 3COOA 2X0VA 1NIUA 1TELA 1B90A 4ADIA 1SBBA 3CC1A 2VW4A 3WMBA 2WMIA 3DIPA 4XZNX 3HHMA 5DHDA 2OKOA 4EP8C 4ROPA 2Q6WB 3DKLA 2ENJA 3IKKA 2LV4A 4H40A 3UIYA 3A4JA 1LO3L 4NUMA 4ELMA 4GBXC 3Q4DA 3VFOA 3TA3C 1NICA 3QXTA 4G6ML 4XO5A 2DQHH 1EA9C 2FLRT 1N6QH 3GAKA 4FXJA 3O16A 1HWWA 1BMWA 1X5XA 5E8DL 5EOQH 2QHRH 5FOBB 1TPB1 2H9AA 4QLKA 4RKAA 2QZRA 5A6MA 1RAKA 5B3SB 1RPXA 2BMBA 2PDWA 5AZ0A 2FQGA 4HGKC 4KDTC 1JNDA 3ABXA 4KEZA 2EPMX 2XKSA 1TEFA 1KB9J 4MNGA 4H8WC 4WZ9A 5CO1A 5BRZB 4GQ0A 4ISVB 4TS6A 3L3KB 2C1HA 4LB4A 2A6KA 3L4VA 3VFRA 1CU4H 5FA4B 4N2IA 5KSVA 3U9UA 2EDRA 4NHCL 4FABL 3HC4L 2AK1L 4J8QA 3OLDA 4HIJB 3C52A 4MJZA 5LGHH 3E5PA 5DUBB 1BXXA 5MEPB 4YJ5A 5ID0A 3ZTDC 1KDIA 4LLQA 1I8LC 4PREA 4BHYA 4X2UA 4ZNEA 4FJ6A 1WA3A 1CDIA 1Z3GL 4MLRA 1TTBA 1BYPA 4QT5A 4MNHB 4I9MA 2XG5B 2HRPL 3BJLA 5ICYA 1GOIA 3P80A 2DTMH 4V1DB 3CV6A 2QUUA 1X4YA 3C5JA 4NIKB 4Z7QF 3VFTA 2VO5A 2IPFA 1LP6A 5HI5D 1DBTA 3ITCA 3U0TA 4EK7A 4LSVL 3EOSA 3S4SA 3MRPB 4PB5A 3CZUB 3WOVA 1MAKA 1GC1L 3OKMB 4L1HA 5EU6B 1XBYA 1HZHH 1KOAA 2FZ3A 2WD0A 3UZVB 4L6OA 1RR2A 3KHQA 1OSYA 4ZA0A 4BR1A 2NR6A 2BX5A 4O50A 2VW7A 3S1WA 1DUYA 5DD5H 1YN7B 2VZVA 3MNWA 2Z2UA 1U8HB 4RAUA 3LLDA 1T7VA 2ZIDA 5A8QA 3HG3A 3WU1A 2B81A 4QXTA 4C4KT 2PCYA 3N9GH 1UH3A 4OGZA 4WFFE 5EPDA 4AH7A 5ESVB 4NCC2 2BHZA 1TZGL 4KKPA 5C9ZA 3QAZB 2Z4TA 4DJEA 4N5UA 3D4ZA 2EEXA 1JZ8A 1Z42A 1UKQA 3KWWB 2A3CA 2PDJA 3RM4A 3FT1A 1E4NA 3AT0A 3W83A 1VHNA 4PCTA 5I30H 1IQDB 1I9IH 4HFUH 1C3FA 1X1ZA 3QQNA 4DHLA 2QVIA 3PL6D 4HAKA 3VFNA 2UY2A 3ATZA 4LCWD 4JIEA 1X4ZA 1E9OA 4ZI8A 4L48A 1CLVA 2E6AA 4JTTA 2Z7GA 5IHUH 1TYGA 2CUMA 4N90E 2Y8VA 1WOBA 5JYLA 3FT3A 1YDPB 4YYFA 3E6HA 3GRGA 4F8OA 4DF9A 3TURA 4O2EA 1IEAA 1NDVA 4K4KA 1AZCA 4NNYA 4PTUA 4U4BA 2FQIA 4O57A 3WMLA 1RVFH 4OH2A 3V0SA 3P0WA 1H3UA 1KCWA 3MNMA 3O3RA 5IEKB 1TIUA 2M8XA 4PJBE 1ALDA 3OB0K 4LU5H 4M7KH 4MA8H 2ROXA 1HEHC 2W67A 2WLIB 3C09C 3MLTA 1RXOB 4H6KA 4QP0A 4Z7VB 2JCWA 3VGAC 2R59A 5LBVA 1S7WB 2VZTA 4Z1PA 3TTOA 1XDJA 4MCZA 5T3ZD 1Q3NA 1SY6H 5FW7A 4CD4A 5DHVA 2E6YA 2NPLX 2HX8A 4DP8X 1QWGA 2Z31C 5LGKA 3NIDE 4YPGA 5HATA 2WCSA 1Y6KR 5IKCA 1PKQA 3EFFB 4W84A 2HLFD 1OE3A 4MUPA 2JCCE 1CLXA 3SN4A 1MFDL 2Z27A 2NVDA 5AENA 2V0AA 2OM5A 2PMZA 4G1MA 3X1EA 1N8WA 4NKOA 1EJSC 3SQOL 3ZGIA 5CCKH 3B0XA 5I1EH 2FB2A 4UV4L 3BVTA 2WK2A 1EJRC 2HJPA 3EOLA 4KKAC 3HHSB 5HDRA 5I8CB 2NUYA 1I9EA 5I1GL 2AGKA 3QF0A 5A2LH 3V0EA 1G6RB 3A9BA 3P30H 3F65A 5DJ8A 5DQDH 3LM3A 3IMBA 5FYKH 5BOPA 2DIBA 4PGEB 4P9MH 3LQAL 2RJMA 3WEXB 5C0RH 1JQXA 3MHZA 4H0HB 3VFPA 1XG3A 3LU2A 1F9CA 5HYSG 5A2JH 5CSSA 3UA4A 3QHFL 1HEZB 4KNTA 5GS1A 2FT6A 2OEMA 4WNQB 3BWAA 2YBUA 5AYXA 5HULA 3VKCA 1NPJA 4AHQA 4C83B 5HYIA 2UV8G 4HHGA 4UTKA 5CR8A 4JEQA 4EPKA 4HEPA 1XL4A 5HVGB 1H2JA 3C61A 3ZYIA 3TN3A 2XFXA 3KWVA 1VPYA 3SSGA 3QR0A 2XTJE 1A4JA 1LE5A 2I5YH 4P3WA 4GFTB 1L9OA 2ZSWA 4PGBB 4BELD 3DX8B 1FYTD 5DT1L 4XAKE 3PR2A 5D2TA 3FB7B 1D8WA 1PDZA 5D32A 3SGGA 1L4IA 2C7UB 1ONQB 3ARBB 1P4UA 1U2YA 4QJ5B 1IGSA 2FO1A 2D4DA 4HJTA 4NQEA 4M1GL 4O2CA 3LY0A 1CLOL 5LQBL 3US1A 3G5XB 2ATPB 1ZBWA 1DWGM 2BS8A 4LO9A 1WCBA 2IGTA 5JW4N 5CPSA 3VNMA 4NPJA 2PXYD 5CHNB 1MCKA 3EJTA 4XZLX 4GAGL 3GD1C 4PJ5A 4D3CH 4LF2A 3V5CA 1B3VA 4FAAB 2J8UF 2QUNA 4NRXA 5D2WA 3MUGB 5B38B 1CFTB 3X2QB 2EYTB 3RJOA 4ENZA 1T6BX 5KINA 3LD8C 5AVZB 2Z93B 2Z29A 5TAOA 2W6RA 2EDTA 3BT2H 2YBGA 1KFKA 3VVGA 3QV8A 3QCTL 2D2CC 2FWLB 1W3NA 2QSCL 3FMGL 4ANWA 3K71A 1ONRA 3GQFA 1TV2A 3F5KA 3A6CL 1QI4A 2YN5A 1J10A 3ULUD 3L9CA 4KZEH 1KJVA 3VG9B 1ANUA 5IT2H 2X4RA 4XPTL 2V2CA 5FYKE 2WWNA 3KMDA 1KKOA 3QIWA 3NPXA 3CU7A 5CPMA 1A6UH 4JYFA 1DJZA 1QFWI 3RY6A 3V5DA 2DJXA 3OTRA 4JIIX 4YC2C 4YSAA 3CHVA 4NAQA 4WRLA 2JCCB 1KO0A 4KI5E 3NK3A 4KMTH 1WB0A 4IPIA 4LFHD 3JVFC 5J89A 4JDBA 3UWVA 5TQ2H 3SKMB 3T3MB 4QLJA 5PTDA 4K8RD 4F7PB 4FZEH 1GOWA 3E02A 4Y9OA 4TV3A 4XCEA 2P8PB 2PPGA 2H3NB 4N5EC 4HNCA 4PM1A 5MENE 3WS3B 3E0WA 4L29A 5CZJA 3MCKB 5C97A 1BOGB 5CBAA 4NVTA 3ITTA 4PJ8C 5KS9A 5AAMA 4G1NA 4FFWD 3SE9L 4RXFA 2QTVA 1XO8A 2PPAA 2R1NA 3LRHA 3FU5A 2G75A 1XGUB 3M4HA 1TVDA 4OZGA 4P61A 4MB5A 3B9KB 3EDJA 4QAIA 4G72B 3JUZA 2XACC 3THML 3CVBA 2IGFH 4XVJH 4K3DL 2J6EL 3LBOA 3VIMA 4KX7A 3H1ZA 5KOVC 3G5YA 4LSQH 1BF5A 4ZZ9A 2W0PA 2E9WA 4GAJH 3UWZA 1H19A 1DYSA 4H8QA 3QC3A 3LRSA 4AEIL 4K2UH 2XTKA 3VZXA 2MUCA 5KVMC 4JFDB 1VFOA 2VD9A 4GZIA 3VE7A 4MADA 4PJ9D 1GZHC 4K94C 3N85L 4LOVA 3Q7JA 1USZA 2EE3A 2OL3A 1WD8A 3G6JE 5HDOA 4DSYA 3RDTD 5LGHL 4KJQD 5K9OA 1TWDA 2QHAA 2NDFA 2VC5A 5FCSH 3QXWA 4MB3A 3H9ZA 4M3HA 1NCOA 4P8QA 3CAQA 1EBHA 1Q6CA 3CFCH 3MCKA 4UT9H 2ATAA 2C3WA 2BNRD 1X5IA 2OX5A 3D34A 3FU9A 5LAXA 2J56A 3W9EB 3PU7A 3ZR5A 3D2UD 1PTDA 1YPZF 2XGZA 3UL4A 3N4FA 2OZTA 3UWWA 3OQRA 1EEXA 3ZWTA 3G18A 3GSMA 1ZDSA 3ARRA 1Z44A 2RB8A 4DO6A 4Y7EA 5HHOA 4A67A 4G6FD 3RG1C 2YFNA 1OG6A 3T6XA 2OZ0A 1FCQA 1PSCA 4M6VA 4CCDA 1OB1A 2XCMC 4HJJL 4IU2A 4M7SA 2WJ7A 3GIZH 3HFML 2A9NL 3AYRA 1FFRA 3HE7D 1EB3A 2PUZA 4A6YH 2WVTA 4IS6B 2ON3A 1Q2SA 3HI1B 3LTPA 1DQML 4RCXA 4RV8A 3ZLFA 2OMTA 3E3QC 3TNBA 1EO7A 2LU5A 1NLBL 5KZ6A 1J8SA 3MFFB 3NCJH 4HN4A 1QA9B 3OGCA 3MRLB 4M48H 3F6JA 4ODVH 4TYUA 3ALGA 1V03A 1W2VA 4HNNA 5J11B 4W1TA 1OHLA 2OTWA 1KIPB 1SF3A 4XMPL 4GYKA 5J04A 1MCPH 2YXVA 2AW2A 3WLPA 4G6AC 4EIUA 3O8XD 2E09A 1EZVY 1YC8A 1FHVA 1TV5A 4D8AA 5CU5A 43CAB 3MHGA 3FB6A 5A6BD 4BZ2L 1GVRA 1KLFA 1Y7VA 3WHE1 3TYBA 3NOEA 4CRPA 2CK0L 2H32B 1FWFC 5D2LF 1XYAA 3MREA 4A8IA 1J9RA 4Q9BA 2RQEA 2X89D 4KJWC 3IMWA 5KVFE 2G4FA 1A4JB 2VDOH 1LE5B 2QCGA 3H9HA 4PJHA 1V6UA 2AKMA 3WV0A 2PYFA 1JGEB 1J0IA 2DJSA 4IRSD 1DBKL 3BHBB 4JG1L 4M7ZB 5BRBA 3BP6B 3GU2A 1G9NC 2Q86B 4ZG1A 1EWEA 3AAZB 1U41A 4K3ZA 3SDDC 1TO3A 3NQAA 4RJEA 2Y69B 4UWMA 1AD9A 1MAMH 3L2IA 1YECL 4ZPTB 5GJTH 4L7ZA 2DSZA 4ZB5A 1NCTA 3VJ6A 3JV6A 4X9IA 3MRRA 3ENEA 1WXJA 3X13A 3C4UA 1A6ZA 3ES7A 1PLGL 4BWLA 5KOMC 4E41D 5AVRB 3GNXA 1DBBH 3KWWA 1KFJA 5D7SH 2JIEA 3HQPA 1AJ7L 2NY1B 1B3ZA 1B0IA 4FXKA 2CFFA 1LO4H 3OW1A 4UB0L 4S0SD 1O7DE 1S9XB 4AXWB 4EX4A 1MFDH 1CZ8L 1K9TA 2QVHA 2CPCA 5D7JA 2VKXA 1HYSD 1XWYA 3W87A 1TETH 1FRGH 1M9SA 2DEXX 3UYRL 3DXAA 1U8LB 3QGAC 1N2VA 2H7WA 1FA2A 4IKIA 1VBUA 2PCXA 5BNXD 5AW4B 1MJ8H 4JAMB 5T33H 3WELA 1VCAA 4JVUA 1OTTC 4E2DA 2YQ2A 4JZNB 4U1MB 4LBSA 2TSAA 5K7JA 1WITA 1I4FA 2A2QT 4XXDB 2VN7A 1CICC 1KYUA 2PNDA 2YEZB 3QC5X 4K9JA 4XISA 3R8HA 4G9FA 3WFEL 5JHLH 1IEXA 2AQRA 2OU4A 4JHWL 1RVKA 3WS3A 2VDOB 2UVFA 4LUSA 2VVNA 4E5XA 3V6FB 1IT9L 1GGBH 2RKXA 4A8LA 1XLIA 5FW6A 1QFWM 2XV6B 3G5ZA 2WZTA 4DZHA 1CGXA 2NNRA 2MPVA 2AJSH 2NZ9C 1R5VB 3BAEH 3B34A 3WSQH 3O3BA 5DDHB 3GFZA 4DQAA 4YDIH 2BB0A 1L9NA 3DX6B 4IIZA 1TVNA 4AV4A 2CWNA 4GUIA 4QYOA 1PE1A 1BECA 3TH3T 3WTWA 5AZEH 3PJSA 4Z18A 3SBRA 4ISVA 2P5ED 1JSYA 5C0DA 3TBWB 3VWJB 1OGBA 1DBML 3GM0A 3MLVH 5BMWA 3URQA 5HYQB 5CEZD 4RGOL 2J6EA 3W7PA 4FNUA 2XKNB 5EL1A 2CKBH 1UWUA 5KVDE 1LO2H 4RWYL 3O45B 1OZMA 4C6IA 3HNVL 4L5FH 1DE6A 1RZIB 5B1AB 2V5KA 5EBLA 5ICXA 5B39G 1GL4B 2CDFA 3DUUA 3EH5B 4P46B 5FGBC 1Z9OA 4BZ1H 5GGRY 1DQQA 4F92B 3DOIA 3UXFA 5I74C 2VDGA 6XIMA 4EE9A 3WO4C 3HA1A 3EJZC 2GVEA 5AZ2L 3SDAD 4G9FD 5EOTB 4NRZA 4HAFA 5J0BA 1ME7A 4NQCA 2HKFL 4ZUWA 4GXVL 4XHJD 3D6NA 4Q8WA 3OL2A 5BPPA 3G8RA 4KJYB 2G60L 1JZDC 3GHRA 4D8PA 1HKJA 1UGKA 4ONHB 5ISZE 1OF2B 3VX1A 1YBQB 2TRSA 3K1DA 3W3OA 3FQ4A 1HHIB 4FFYH 1A49A 1EEUA 1AC0A 5ACZA 1R75A 4M1CC 4GQRA 4N2NA 3HJ0A 4X8GA 2EPLX 1Q9LB 2AQ3A 2QJNA 4NQSB 4CSZA 4W86A 4AL8C 2VNCA 4ORZC 4GIEA 1OB0A 4N0FB 5A2BA 1MIMH 2A5HA 4I9AA 5KSUA 4WGXA 3MY9A 3BKML 3BP5B 4XMLH 2FZ3B 4FA7B 3L1OL 4OJEH 4E0RA 1K70A 2J7LA 3NJFA 4TLTA 4DWSB 1XEDA 4JQIH 3OWEA 3WJSA 1KXHA 3FUIA 3IKCB 3HFYA 1QLRA 4EDWL 4DNLA 4FZ8H 1A5FL 1ZLUH 1JFQH 4G80A 4LEBA 3ARGD 3W85A 3CSBA 1IGTA 3QXAA 3S6TA 1GZPA 4NHVA 3L4TA 4KF1A 2FBJH 1OD8A 1JFHA 1N7KA 3L17A 5BUGA 3I02B 5KYXA 3EYPA 3LSBA 2AQQA 5C6TH 4E41B 1JUEA 2WTOA 3D3VE 2H47C 3HUJB 3KPSB 4DXKA 5D2NE 1UVQB 1UA6L 1HYSC 3FKUS 3WN6A 4LOCA 5CJ8A 3QNZA 1YSOA 4XP9L 1S3HA 3UJTH 2DSVA 3MU7A 4MZ2A 3OA3A 4QEEA 5FF3A 5DZVA 4MBOA 2EIBA 3CN2A 2ZX7A 2CPUA 1E30A 4MDRA 2DI7A 3A64A 5KZMA 5CSGA 1T1WB 2XLLA 1P5UA 1YRKA 1ZANH 4M1DL 3JXAA 3U4BL 4XXDA 2E7MA 4Z5RA 2I16A 4QISA 1U8JA 1MZHA 4QAMB 4HCFA 1TTAA 4AQ1A 3K5XA 1II4E 3MCYA 3ZJAA 1ZS8A 3LHPH 3T6WA 3PWAA 2R2HB 5B39B 1XF3A 5DJYA 1IJ9A 1TJGH 3MRPA 4A37A 4A04A 1HX0A 2W0UA 2VLRA 3SO5A 3WDIA 2DT2A 4K2UL 1A0QL 1GGCH 1BD2D 2K0RA 4KRNA 4LP4A 4AK1A 3BW9B 3QXUA 3QFEA 1WA2X 2A9DA 5FKPA 3RFZC 3SGZA 1RA0A 1RJCA 3KS0H 3FO1A