1XH0A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with acarbose
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh0A01
2CBVA 4H7VA 4PSRA 3GM8A 4LYPA 3VIPA 1CGWA 1E6QM 2DSKA 2HISA 4FNQA 7CGTA 5A6LA 2YJQA 1RH9A 2CERA 2X2HA 2WWCA 1UH3A 1WNOA 3L4ZA 1FFRA 4NXKA 1V02A 1X1NA 4NZCA 3CHFA 3WUFA 1J10A 1OIFA 2JFEX 1W9XA 1NQ6A 2WMIB 3ZR6A 1FA2A 1TQWA 1H49A 2WWDA 3GH5A 1QNPA 1ZB5A 3CHEA 3W28A 4J3SA 4MNKA 4Q7NA 5A6MA 1PZ3A 4W8BA 1UASA 3W81A 4W7UA 4AEFA 3KE0A 2QHAA 1AQMA 1H0GA 4GZEA 1EXPA 3IGUA 4UFJA 3PZQA 2XIIA 4IPLA 1VFUA 2VZTA 1MFUA 3SCRA 4NZJA 1CEOA 3WMSA 5JUVA 3VGHA 2WSPA 4D71A 3L4YA 4FLOA 3CBWA 3VO0A 4PRWA 2WSKA 3MANA 5I0DA 3WY2A 2YIHA 1KXQA 2Y8KA 1Q6CA 3TOPA 3AMCA 3SCTA 1JYWA 1NWRA 1EDGA 1PX3A 3ARSA 3CPUA 1GJUA 1KQYA 3VDAA 3WENA 5C71A 3BUIA 5D9MA 4AD1A 2X05A 1MW2A 3MKKA 1B1YA 1B3ZA 3FY1A 3HZ3A 5M3WA 1KGWA 2V5DA 5FD0A 3WH7A 3AZSA 2D0GA 2YBTA 1LL6A 4LXFA 2BFGA 3ZJ7A 2YDQA 1VBUA 1W9UA 2OW7A 1C93A 5LYRA 1ZBKA 1EOKA 3T09A 3DX1A 3A3HA 1FFQA 1NWSA 4V28A 5ABGA 2ZUUA 4FNPA 3ZR5A 3N17A 4MNJA 3VU2A 4UQBA 3UETA 2J79A 4RE2A 1J18A 2G3NA 3FAXA 1IV8A 3VIOA 2W67A 3BGAA 4PBGA 1CGVA 1VBRA 1E40A 3CHCA 3CUHA 1J0KA 4U2ZA 4KWUA 3TTQA 4MAVA 4LYRA 4GI8A 2XM2A 2WLZA 1BF2A 4MDOA 2X2JA 5A2AA 3NDZA 4N42A 3BLBA 2D24A 1CNVA 2WK2A 3PZOA 1LQ0A 3I3DA 1E4IA 4P7OA 4D6IA 3IAPA 5A94A 2NT1A 2YDSA 4Z2IA 3WELA 1UKQA 2YOCA 4TX6A 1ZBCA 3DYOA 2DSWA 2F1BA 4UQ9A 3BSHA 4BS0A 2GK1B 2PBOA 5JIPA 1FP9A 3A23A 1OBAA 4R27A 4S3JA 3O2LA 1EGZA 2WHKA 4UFKA 1U33A 3W6MA 4TOQA 2A3CA 3W27A 5CGTA 1UKPA 1K9TA 3SIMA 4Q22A 3U57A 1E4MM 3EDDA 2EQDA 2O9TA 4PMXA 4UR9A 4E8CA 2XG9A 2VX4A 1CDGA 1HJVA 5EFFA 2W63A 5IHSA 3W24A 3BUBA 4Y7EA 2G8ZA 1J12A 1HVXA 5A6JA 3AI0A 1XH1A 3T2OA 4J27A 3GXDA 4DUXA 3CUIA 3A6OA 1NOFA 1O6IA 3GBDA 1GCYA 3U7VA 2CBJA 4M56A 1JZ7A 3DYPA 3CZLA 1ECEA 2EPKX 4AIOA 1H5VA 3PZIA 3WKZA 4AZCA 1JF5A 3MUY1 4DWSB 1OB0A 2ZXBA 3BXWA 3ZT5A 1LL4A 4W93A 1L0PA 3LXAA 5I3DA 2C8NA 4ACZB 2A3EA 4YHGA 5ABFB 3T2QA 4CD7A 5DF0A 3PBGA 3WF4A 3WL1A 3WDIA 4EKJA 4J3TA 1UD3A 4YHEA 2OSWA 1ITXA 5KEZA 5BWFA 3WY1A 1E15A 1BYDA 1QI3A 3N18A 1LL7A 2WC7A 1UQYA 1W91A 3AS2A 1HX0A 1P6WA 1E55A 2F18A 2CBIA 2V3EA 1BYCA 3I3BA 2WC4A 1OGBA 3VMNA 2WPGA 1KGUA 4W88A 1HP5A 4AD5A 4HMEA 4ZEPA 2W5FA 3L2MA 1TR1A 1TUXA 3F5LA 2VZVA 2YDRA 5HBFA 3VX0A 1BSIA 3DDFA 3ALGA 3N13A 5AY7A 2WKLA 2FYVA 4BQ5A 3QR3A 3WD4A 2AAAA 3RILA 4W84A 4HU0A 4KGLA 3T0BA 3AYRA 1V3MA 3UG3A 4AYSA 4D6GA 2XVKA 4UQEA 3BAWA 3BAKA 4LPCA 4NF7A 1WDRA 2ESCA 5ECUA 4H2CA 3LRKA 1NP2A 3WMCA 3AHYA 4QFUA 4W5ZA 3APGA 2XM1A 3W82A 4MNLA 2ZUVA 3EDEA 3WD3A 3A22A 4OBSA 3HG3A 1TVPA 1MW0A 2Y24A 3IJ9A 3ARZA 4D6DA 1NARA 4X9YA 1UH4A 1PIFA 2BHUA 5BRQA 4U31A 1W1TA 1G0CA 1IZKA 2QMJA 4MB4A 3WH9A 1PS3A 1DWFM 1L8NA 5DO8A 2WHLA 4J3VA 2WM0A 1M01A 1TE1A 2YLLA 2VZUA 5CLWA 4DO4A 2VCAA 1OT1A 2BVYA 1V08A 2XYLA 2VJXA 1Q6GA 2WLYA 3QHNA 1JI2A 4WSJA 1OIMA 3GH7A 4PMQA 4JAWA 2OWCA 1EOMA 3U5UA 2OYMA 2UY5A 4QLLA 2GJXA 1VFOA 3H53A 4XB3A 1WDPA 1XRVA 4CVUA 4FNSA 4CD8A 4W85A 9CGTA 1QW8A 1UH2A 4KGJA 1Y7VA 2PB1A 4JKKA 2VL4A 2G3JA 1XD0A 1JZ8A 4E4PA 2VTFA 1HXKA 1R47A 2E8YA 3AYSA 1QI4A 3VSTA 5CPTA 5I77A 3PZGA 1JZ4A 3DX3A 4NRRA 1KQZA 1CPUA 4ATWA 3NYDA 2YL5A 3LRLA 1V6YA 2WZHA 4P8UA 2J7BA 4B15A 4MPKA 2QMKA 1HXJA 2WC3A 1EQCA 1Q6EA 1KBBA 1XC6A 5JBEA 5A95A 3QGVA 3NDYA 2YLAA 3TTOA 4HMDA 5AC5A 2CIPA 3PZUA 3DYMA 4AIEA 2ZWYA 1KTBA 4HA1A 1LG1A 3W53A 4FK9A 3BH4A 4JL1A 2IGTA 4XZWA 2CNCA 2BY1A 1E6ZA 3SUUA 1JFHA 3BC9A 2ZX7A 1HKKA 4AMXA 5CGMA 4FF5A 1DP0A 4W5UA 5BROA 1UD6A 2GK1A 2VZSA 1R8LA 1UWTA 2D3LA 4Z2HA 1E73M 4GZIA 4UQDA 4F9JA 4UOJA 2F7PA 3OB8A 4HZ6A 4MADA 4V27A 4KRUA 2XIBA 5F7UA 4WSKA 3OIHA 4AISA 4HPGA 1OD0A 2FGZA 3O9NA 3WQ5A 1BYBA 1BYAA 3RIKA 3ZT6A 3PZNA 2X2IA 2WVSA 1E56A 8CGTA 3PTMA 4LQ1A 3VGDA 1WZAA 4BA0A 1OCQA 4HP5A 2FGLA 2Y4SA 1E6XM 3L2LA 1CLXA 3KZSA 4OZOA 1WE5A 2FDMA 3WEMA 1LWJA 4UOZA 1FOBA 2CITA 2HVMA 1UWQA 2QLYA 1B9ZA 2QPUA 3WDHA 4E2OA 3RM4A 3MSDA 2GUYA 4GXPA 5DT5A 1PX4A 2J74A 5BXTA 1V03A 1KCLA 4F8XA 1HNYA 3DX0A 1NOUA 2XSAA 4PMVA 3SCQA 2RGLA 2F2HA 4UFLA 1HIZA 1JXKA 1AQ0A 3VDBA 2X8RA 4D1IA 3BAYA 1E0WA 3VPLA 3K8KA 4X0NA 1BAGA 2YA1A 3NCOA 2WNWA 4EAMA 2ZOXA 2RGMA 2BY0A 2J8GA 1B30A 4V2XA 3VSVA 5D9NA 5A3HA 4HOXA 3WDRA 1MVYA 5JBFA 4B9YA 1C8XA 2ALWA 3K8MA 3ARTA 4NSBA 2O9PA 1GUVA 3OGRA 1O7DC 2J4GA 2VQTA 3MV01 1J0YA 3AMLA 3PZMA 1CXLA 3K1DA 4NZFA 2W4XA 1VRXA 2OYKA 3S5ZA 4GQRA 1E5JA 2EXOA 4BF7A 1TA3B 5CJ5A 4JFUA 5I78A 5FOOA 5FL0A 3VDCA 5BXPA 1YQ2A 4MB5A 4CU7A 5HOSA 1WPCA 1RD6A 2J7CA 1DEDA 2GJXB 1ODZA 5I79A 2A3AA 3EMCA 2VCCA 2F8QA 3MSGA 1HP4A 3A21A 4EANA 3LMYA 1TMQA 1GPFA 2JE8A 1ESWA 1W2VA 1V3JA 1TZ7A 1ISWA 2PBGA 2VRKA 1LJYA 3FN9A 3N12A 3AJ7A 5EFDA 3E1F1 1UD2A 4MAZA 1H3GA 1JD7A 1HJUA 2JF7A 4XV0A 3UR7A 3VNZA 2VVSA 4PMZA 3WD1A 2DIEA 4HOWA 2VMFA 2D73A 4J28A 4B3KA 1R85A 3AZRA 2WMJA 1VF8A 3MO4A 1XYFA 3RM9A 1GJWA 2YFNA 5JIWA 3BCFA 3BAIA 3PZVA 4CN1A 1QVBA 1PJ9A 4M24A 1CXHA 3THCA 1BVNP 3TA9A 3PZ9A 2J7FA 4OJYA 3WN6A 3WQ4A 3UR8A 2WVVA 1SZNA 1O7AA 5GPRA 1A47A 3BAXA 1B90A 3F4VA 1VEMA 3N11A 1IT0A 2VR4A 1GW1A 5C8BB 2VX5A 3AS0A 5EB8A 2F1AA 1XGZA 1MW1A 3WD0A 1XSKA 5IHRA 5A6SA 2CESA 3W0KA 4JCLA 4HTYA 3ARPA 1I1XA 4U5IA 1QI2A 1EH9A 5D4YA 4PCSA 2ZUNA 4AMCA 3K46A 1GQKA 5A8PA 3CTTA 3BVVA 5E0CA 3LXCA 1GZJA 1B2YA 5D8WA 3CZNA 3FAWA 1BLIA 2BY2A 3EYPA 2D22A 1UKTA 3I3EA 3CZSA 2OYLA 5ABHA 5ABEA 2OWWA 2V3GA 3TONA 1UR2A 1GOWA 3BLKA 3QOMA 4S3KA 2DSUA 3ZJ6A 4P7RA 2OLHA 2WZEA 5TD4A 2YKKA 1GHSA 5ABFA 2WB5A 1QNQA 4K68A 1DWHM 1E5NA 2Y8VA 2UY4A 5CPSA 3DX4A 2WXDM 4DWSC 3AIQA 1FHLA 2DGAA 3S5YA 1SR0A 2V38A 1GOMA 4ATDA 4PUEA 5A8NA 4YN5A 5GQBA 3UEQA 1JNDA 3VM7A 2CYGA 3GZAA 1WP6A 4ATLA 1N82A 3ZT7A 2X1IA 4CN6A 2WVVB 1FH9A 4ZFMA 2F7QA 2J77A 3N1AA 3CZ8A 3SURA 1C7TA 3D3AA 1EO7A 2EAEA 1OM0A 8A3HA 3EMQA 5GNYA 1QHPA 1BQCA 1CXKA 3T0AA 1QI5A 3RM8A 1PX8A 3HG2A 4ZXLA 1MQRA 2CETA 4BQ3A 4JKMA 5I2UA 1HT6A 1UYQA 3N04A 1W1YA 2VO5A 2BXZA 2EACA 2Y2WA 4CGTA 1XSIA 1ISVA 4UQCA 4HA4A 1M04A 2ZXDA 4AD4A 4PUDA 1OD8A 1CECA 1GQIA 1UHVA 1OWQA 1H1NA 3ECQA 3VDHA 2XVGA 2EPLX 4P7LA 3VTRA 4HZ7A 1HKMA 4MNMA 2EJ1A 4CD5A 3TTYA 1WAWA 2EPOA 2E9MA 2E8ZA 3G6MA 2AOSA 3H54A 2NSXA 3DX2A 4MTVA 4J3WA 1KCKA 7A3HA 2UY2A 1GQLA 2CHNA 3AMDA 3JUGA 4W7VA 1VB9A 4HU8A 1HJQA 3VX1A 4WK9A 5I6SA 2OSXA 3CC1A 1EIBA 4TTGA 2VX7A 4QDMA 3AMKA 4AZHA 2C0HA 4L4OA 2D1ZA 3T2PA 3GXPA 4OGZA 1U2YA 3WL0A 4F9DA 1RP9A 5E1QA 3OLIA 3G6LA 4MJ2A 3NSXA 3VGGA 1ITCA 1UD5A 2ZXAA 3POCA 3VM5A 3IJ7A 3GXIA 3GXNA 5E0FA 3EDJA 4FNUA 4GQQA 4CKQA 4TVDA 4PTVA 3TV8A 2F7OA 5HNNA 2J25A 4IPNB 1SFSA 4P8WA 1HTYA 2W62A 3PTKA 3AMGA 3RCNA 3CZEA 4NRSA 3A4WA 4M80A 3WUGA 1W1PA 3VIKA 5M03A 3D50A 1KFWA 3KL5A 3ZQ9A 4GI9A 1TQTA 1B3XA 2DSZA 2OW6A 2IUZA 1TG7A 3IJ8A 1MWOA 5FKYA 4D6JA 4AZ6A 5A6AA 3ARUA 3SCVA 4UFHA 2XVLA 3RMEA 4HOZA 1PBGA 4HMCA 5DEZA 3MS8A 1I75A 3ARXA 3W6LA 3MV11 3T0DA 4UQAA 3BVUA 3WDQA 2WZIA 1TQVA 3VD3A 2X0HA 3M46A 2GVYA 2WVTA 2Z1KA 4GZJA 2WBKA 3BVTA 1B3WA 1TQSA 3B9AA 3CMJA 3OZPA 4D6CA 4CU8A 2XWDA 2J62A 2EPNA 4JCMA 1V6XA 1GVYA 3RO8A 1Q4NX 4GIAA 2JEQA 3WF1A 4WKHA 4JFTA 1XSJA 3K4AA 1QI0A 4PEEA 1ODUA 3WFZA 3EJRA 2XVNA 1CIUA 1G1YA 1DWJM 4DUVA 2CEQA 2DQXA 5A69A 2D0HA 3ZIZA 3KLLA 3CZGA 3D4ZA 5JBDA 2XWEA 3F5JA 2W92A 4YPJA 1KBKA 1E70M 5CPQA 1LG2A 5IFTA 3KL0A 1KXTA 3VGBA 5CSUA 3W38A 1VENA 3SCPA 5LA0A 2WMHA 3WY3A 4FLSA 1NP0A 4BQ2A 3AHXA 4U2YA 3MMDA 2GDUA 3ALFA 1R7OA 1QWUA 5A6KA 2JALA 3CZKA 1QBBA 4DM1A 2J7EA 5E09A 2W91A 2NT0A 1VEPA 1FH7A 1UR1A 2WHMA 4AZ7A 4U5KA 6A3HA 5LA1A 4RE3A 4FMVA 1F4HA 1UWSA 3WDJA 2ZX8A 4GINA 3AXHA 4PN2A 2O92A 1LWHA 4AC1X 1BVZA 1DHKA 4RL3A 4KRTA 3VNYA 5HPCA 2ZX6A 3BUQA 3VSUA 3AFBA 4QLJA 3TP4A 2JIEA 1G5AA 3GNRA 1AMYA 1ZS2A 2PWHA 1VIWA 1DTUA 3NSMA 1JFXA 5I24A 2ZX9A 2E3ZA 3WQ6A 3D51A 3WEZA 1W3JA 3J7HA 1E72M 3AXXA 3KEHA 4JHZA 4GO8A 6CGTA 3SUVA 2CXGA 3OA5A 2ZUMA 2XVPA 1W3HA 2WYSA 1H4PA 1JI1A 2UY3A 4N0RA 1CTNA 3VGEA 1C8QA 1Q6DA 1GQJA 2BNJA 1JYXA 1JZ5A 1CGTA 5CXPA 5HPOA 3GYCA 2PWDA 2ZE0A 4WIWA 2CPUA 1JIBA 2VCBA 5A1AA 4UTFA 2FHBA 2UWFA 2DEPA 1HL8A 4AMWA 5HDRA 4P7QA 3ZSSA 1SMAA 7TAAA 2XJ7A 2BS9A 4LYQA 1JNEA 1KWKA 1JF6A 3O6AA 4QAWA 1CBGA 1JG9A 3BLPX 2BVTA 3AOFA 4H04A 1UR0A 4EK7A 3ZO9A 1PAMA 3BUDA 3PZTA 2WMIA 5A2BA 5D9OA 2C7FA 3CUFA 2WVUA 2PF0A 1DWGM 3DHUA 4W87A 4H8VA 4ACZA 2FH8A 4AY1A 4EE9A 1US3A 3ARWA 2E40A 1QNRA 1BG4A 3POHA 3PHAA 4HA3A 1V6VA 1KB3A 4JZ5A 1VAHA 3VIFA 1M7XA 1R46A 2TAAA 5A8QA 1LF1A 3AS3A 3DDGA 3MU7A 4MDPA 1EHNA 4TUFA 2YFOA 3EJTA 2J78A 1R87A 2G3IA 1UD4A 3EDKA 3K8LA 4CD6A 2G41A 2GFTA 5E70A 1QNSA 3H55A 4GO9A 3OZOA 1WCGA 3VD5A 4QLKA 3VIHA 3EJUA 1QNOA 3B9EA 2E0PA 3F5KA 1TQUA 1B31A 1W9BM 3FHQA 1XCWA 1BFNA 1E6NA 5D8ZA 3VOCA 4WKAA 1H11A 4JFSA 1UKOA 2BXYA 1WZLA 5D9PA 3WH8A 3WQ8A 1V3IA 5I5RA 3AHZA 4AZIA 3L4TA 3HG4A 4CUCA 3A4AA 2NW0A 1UUQA 1HJWA 1UWUA 4D72A 4FLQA 5A8OA 4ML4A 3VD7A 3SCSA 3WNKA 2D2OA 3WD2A 3UG5A 3GH4A 2ZXQA 2VX6A 2YA0A 4U33A 1HJSA 1JZ6A 3L4WA 2MANA 4PYSA 1ISXA 3A4XA 1UA7A 3MUZ1 1UKSA 1GONA 3CV5A 4C7DA 3BMWA 4TXEA 1HJXA 3HG5A 3GXMA 1WDSA 4BQ4A 1XD1A 3GTNA 2WHJA 4WLCA 2WCSA 4PMYA 4OOZA 3AICA 1R7AA 1K9DA 4DM2A 1CENA 3PN8A 1E9LA 3UERA 3WNMA 5IDIA 3LX9A 3NSNA 4PSPA 2DT1A 1B3YA 2B31A 3UESA 1W3LA 1R75A 1AQHA 2BV9A 1FP8A 3WH5A 4AD2A 2WBGA 2EPMX 2J75A 2DDXA 4HPHA 3CLWA 1SYTA 1D2KA 3K4DA 1GORA 1MW3A 1B3VA 1E1EA 2CHOA 3AS1A 2W61A 3NJ3A 3OBAA 1J01A 4H8UA 2G3MA 4JL2A 1E3XA 2J7HA 3KWXA 1W1VA 4MJ4A 3QHMA 1D7FA 4A4AA 3LRMA 3AROA 4W8AA 6TAAA 4D1JA 5AC4A 2FE0A 1JXJA 3WF2A 3VD4A 3WUEA 2ZIDA 1W32A 5BRPA 4PMDA 1MYRA 3AHTA 5BYWA 3W26A 1RPKA 1W2PA 1GOOA 3AIEA 2XUCA 1KR0A 2WCAA 4NXSA 3VILA 1R33A 2VUYA 1HVQA 4ZXOA 2BHZA 1HWWA 1TA3A 4JKLA 1GOQA 2PI6A 4F79A 4AW7A 1WZKA 3U7BA 5M17A 5E6ZA 1VFMA 2DPEA 1X6NA 2OWXA 2X0YA 3AISA 3RJXA 4PTXA 1V02E 1RP8A 2VVNA 3S6TA 1K6AA 2VC9A 1CWYA 3W4RA 3WQVA 3WSUA 4W86A 2O9OA 2YA2A 2J7GA 3M07A 3EJPA 3WUBA 4D6HA 3LPPA 1UZ1A 5FCZA 5GNZA 1ISZA 3VD9A 1KR1A 1EDQA 1IZJA 3CZJA 4QCEA 2VRJA 4AZGA 2FHFA 1J11A 4PMUA 3WNOA 4UFIA 4MB1A 3II1A 2PWGA 1JD9A 1NM9A 3VIIA 4AIUA 1ZBVA 4WF7A 2CKRA 4P7NA 3IAQA 4HZ8A 2DT2A 2QPSA 1V0KA 3ZJKA 1FH8A 1R34A 1SMDA 5IFPA 1PIGA 4KMQA 4F66A 4Z2JA 4FLRA 3OGSA 5CLTA 2EEXA 3DC0A 3RDKA 3DHPA 1V3HA 3BCDA 3GXTA 2VI0A 3EDFA 1J0ZA 1EO5A 3MMWA 1H09A 1KTCA 3WF3A 1BHGA 1JL8A 3BAJA 1QOXA 5BXRA 3L4UA 1QWNA 3OLGA 2D23A 1H41A 3SUSA 4URIA 1WZMA 1C91A 2Q8XA 3GNOA 3IK2A 3CH9A 1E0VA 2YL8A 3CGTA 1WB0A 4GKLA 3HN3A 1QW9A 4RE4A 1HF6A 4WJXA 4ZE4A 1OT2A 3LPFA 2ZUWA 1G94A 2BHYA 2QV4A 1VJZA 4B16A 5CSYA 2D3NA 1V3KA 1JZ3A 3AZTA 2WW5A 2GSJA 3UCQA 2DH3A 4PTMA 3ARQA 1F4AA 2WCGA 4W7WA 1C92A 2XSBA 1T0OA 2VRQA 2EO7A 2GJRA 1VFFA 4QP0A 2XN2A 4UNIA 1PEZA 1UG6A 2XTKA 4DO5A 3EMZA 1JAKA 1WDQA 3N15A 1GVIA 2IXVA 3D5HA 3QOKA 3SCNA 1J0IA 4OOUA 4W8LA 1CXFA 3S2CA 1K9EA 4A3HA 3N9KA 2DSVA 3VMOA 2XGIA 1QX1A 2VNCA 2V5CA 3VUPA 5M5DA 2XFFA 1AVAA 1Z32X 1ZBWA 1B0IA 1KXVA 2FHCA 3SCUA 2VT0A 4TVCA 2D0FA 4NX0A 3CMGA 1GOKA 4DWSD 4LX4A 5EMYA 3A24A 4M1RA 5A6BA 3WMBA 2O9RA 3EJQA 3CUGA 4QCFA 3LXBA 3B8SA 4JFWA 4LGXA 1MXGA 1M03A 3HU7A 1E4LA 4TTUA 2IXUA 2DH2A 3L4XA 2WAGA 2VOTA 4ACYA 1E43A 1TFVA 3SCOA 1ISYA 4TX8A 2WANA 3WIJA 1X6LA 4WKFA 2F61A 1EA9C 3BVWA 5DT7A 4CU6A 4JIEA 1ZJBA 3VVGA 2CKSA 1XCXA 1DWIM 3RPMA 2CCRA 2PC8A 1BGAA 1OINA 1WO2A 4E8DA 5CG0A 2E4TA 2XFRA 3WBAA 3VINA 2XN0A 2A3BA 1V0LA 2X2YA 4M8UA 4C7GA 1QHZA 2F7RA 2V3FA 1KGXA 2FH6A 1HN1A 1KWGA 1UWRA 4B3LA 3BUPA 3W25A 1NH6A 1CXIA 4UOQA 1YHTA 1MXDA 4D6EA 3SEPA 2ZICA 3WDPP 2JEPA 1I1WA 3D4YA 3WQWA 4TVUA 4BZYA 1JZ2A 3MMUA 1VEOA 3ZJ8A 2YL6A 3QHOA 1C3FA 1NWUA 4AD0A 4J7RA 1E0XA 4AD3A 1UWIA 3VIGA 2XPKA 4FNTA 3GDBA 2VQUA 5A6BD 4Z2KA 2A3HA 2EABA 1TCMA 2BY3A 2XHYA 2ZWZA 3MUAA 2GJPA 2EBNA 3EJSA 4ZE5A 3OGVA 4C7FA 5AYBA 4Z2GA 2XFYA 3DECA 3VMPA 1W3KA 3CUJA 4P8VA 5BXSA 2DIJA 3GBEA 3ARYA 1OGSA 4AZBA 1OSEA 3AQUA 5FL1A 1BGGA 2XN1A 3NUKA 4H8HA 1J0HA 4BCEA 2WKGA 4ZENA 1QPKA 1ZU8A 3HJEA 1W9VA 2OSYA 1MFVA 2ZX5A 2JF6A 5A8MA 2JIWA 3IANA 1CGXA 2EADA 4U3AA 3HMCA 4W89A 5BCAA 1JAEA 4X0VA 4OIFA 1E6PA 3NIYA 3WEOA 3ZSTA 1E71M 4AYGA 4XX6A 3A47A 4AXNA 1XH2A 4KH2A 4M82A 3TTSA 3W29A 1UA3A 1H0IA 2YL9A 1G01A 4GPNA 1HL9A 3FNDA 1JYNA 4J3XA 4DO6A 1CXEA 4AZCB 2J47A 4CCEA 2G4FA 3WH6A 1MQPA 5FIPA 4PMOA 4AWEA 4CD4A 1HKIA 3WNPA 4D6FA 1UD8A 3L4VA 4JFVA 3THDA 3AIWA 4IUGA 4XUYA 4UZUA 1EHAA 5DFAA 4B9ZA 1BTCA 3ARVA 3T08A 1TVNA 1BPLB 3UG4A 5CZKA 3OG2A 4CVWA 3ZMRA 4CN4A 2Y5EA 4UCFA 1JDDA 1JDCA 1NOWA 1VJSA 2WMGA 4L4PA 3GNPA 3AIUA 1G9HA 4OUEA 3PTQA 2E9BA 1E6RA 2V3DA 1E4NA 2VURA 1NWTA 3AXIA 1OGGA 1E6SM 2WMFA 5LA2A 2J8FA 4M29A 5HXMA 2W66A 3ZM8A 4UZSA 1LLOA 1JDAA 3AIRA 3WY4A 3CHDA 3FXYA 1UQZA 2PWEA 1W9PA 1UZ4A 4Z2LA 1QBAA 1XYZA 1FHDA 4U3CA 3GXFA 1S46A 4IM4A 1UR9A 4MB3A 1UR8A 4P8XA 2YBUA 1DWAM 3SUTA 5KZ6A 1U30A 1A3HA 5E6YA 2X09A 2ZUTA 1C7SA 1E3ZA 2E9LA 3VKKA 1M53A 1JGIA 4H41A 5DMYA 3M6DA 1H2JA 3WF0A 5AYIA 1EDTA 3BSGA 3U5YA 2PWFA 1EQPA 1C8YA 1WKYA 5CQ1A 1CYGA 3BMVA 5C70A 4AEEA 1GOIA 3WFLA 1PPIA 1ZJAA 1V6UA 2D20A 2VR5A 1UOKA 1BG9A 1CZ1A 4R5EA 1V0MA 1J9YA 5GNXA 1XH0A 3CO4A 5A2CA 3M7SA 3RJYA 1V0NA 2XGBA 4GI6A 4AZ5A 4PTWA 1PZ2A 5E9AA 2ZUSA 2GDVA 4XZBA 2Z1SA 4OBRA 3WBEA 1V6WA 1XV8A 5IXEA 4DUWA 3LPOA 1CLVA 3FHAA 1QHOA 3AIVA 3SUWA 4PCTA 1E1FA 1JYVA 2BVDA 1W9DM 3KLKA 3WNLA 2CBUA 4PMNA 3VIJA 3BVXA 4J3UA 4CCDA 3OLDA 3LPGA 3B9DA 1R86A 3EBVA 4OKDA 1V3LA 1GHRA 2DT0A 1C90A 2WMKA 1K9FA 4M81A 1CGYA 3SCWA 1D3CA 4FNRA 3AHVA 3AIBA 4IISA 4CCCA 3OLEA 1GNXA 2J7DA 3W37A 2QF8A 4DWSA 2DT3A 3VGFA 1Q6FA 4UFMA 3VIMA 4A3YA 3FW6A 1MQQA 3MI6A 2AMGA 1ZL1A 1HKJA 1XHGA 1KXHA 3ZOAA 3D52A 5I23A 5EBAA 3CIVA 4JHOA 3WNNA 3A5VA 4PMRA 1UR4A 1CGUA 4NI3A 3KL3A 3ARRA 2VZOA 1J0JA 1US2A 3MUIA
chains in the Genus database with same CATH superfamily
4R6UA 2CBVA 4U3HA 1IGIL 1BVOA 1O5XA 3D69A 4NSKA 1RY7B 3U30B 5C0EA 4WI2A 2VL5B 3EO0B 3GHPA 4MMZA 1D9KC 4UNVA 1M6JA 3ABQA 4C55A 2HISA 4LYPA 3UYPB 4R9HA 3REVA 3UBXB 2O6CA 2LGNA 3VXQB 2DZSA 7CGTA 3QORD 1P6AB 3I68A 3VOFA 4EQ3A 4EX4A 4PY8I 4Y16D 5DD6B 1GZPA 3MBEC 4XX1E 2HYMA 3D3VD 4H9ZA 4E5XA 4AYID 3AM8C 1XR8B 2QQKH 2WWCA 5EV7A 5BQDA 1WNOA 1YNLL 2EKSB 3U4EB 2B0MA 2I60H 4AZUA 3APFA 2X7VA 3H21A 3MRKA 4MNGB 1MI3A 1V02A 4K71B 4X60A 4DO7A 1CGSL 1COBA 1ACXA 4JB9L 3EGJA 2D3VA 1REQB 2JFEX 1NQ6A 3WFLA 1RVFH 4JE4B 3DHDA 1WAAE 4BSVA 1OQXA 4IOFD 5EWIL 1ETB1 1HHKA 1L7IL 3ZR6A 2PC4A 2VLRE 1RPUA 5GIRB 3B8VA 3P80A 3R11A 1KG0A 3EBHA 3GH5A 1K8IB 1BLNA 4UV4L 3P3BA 5BZWA 4BRVA 4D9RD 2HJFA 2LU7A 4FTVB 4X6CA 3LHPL 1AP2A 3KOZA 1PZ3A 1PUDA 4YSSA 4JO2L 1YDYA 4N9CA 3PJSA 4JKWA 1DJNA 4JTTA 1WBXB 2B2XH 2PPDA 4BXSV 5I8EB 3K71B 1G7JB 1UASA 2QHAA 4NNPH 4P2QD 1AQMA 1H0GA 3F6LA 2CU9A 2X0VA 3PNRB 3GZKA 2OK0H 4UFJA 5CGYD 5AVQB 4WUUA 4R7OA 2BS8A 2AQRA 4RMUA 5TPWL 4JO1H 4D0CA 5KBPA 2XIIA 3MVSA 3DO7A 3FK4A 3CSPA 3TK7A 2XWBB 1ED3A 4NJ9H 4MD4B 4IPLA 2VZTA 3QJZA 2VW6A 4Y2WA 4NZJA 1MSPA 1S2AA 3WMSA 4UNLA 3CX2A 4ANVA 4M62L 3QN3A 4Q2ZB 4OGXL 4GBXC 4RZCA 1NFBA 4D71A 1F4WL 2Z9TA 1GGOA 2OMTB 5HHVL 3CBWA 1R6VA 2WP3T 4KBPA 3KCJA 5LSMA 3FJLA 4D3CH 4ES8A 1V7ML 1J5TA 2C14A 1F2JA 1I7ZB 3EKGA 3IDYC 3GUWA 4IXHA 3WY2A 1XR9B 1N6QH 3HQPA 3TPKA 1A80A 3QJTB 4X5QA 4OJFL 5EBGA 2Q6WA 1JNLH 2F8XC 1QD0A 4NRXB 1GXEA 4U1IB 3TOPA 2P8PB 3ZHFA 2KHAA 2CLIA 1W80A 3GDRA 5MKGA 3QPQD 1CLOL 4HUVA 2PCPB 5KUMA 3PJLA 3NVQA 1AGDB 4XH2A 4EF9A 2IADB 4WWKB 2GB2A 4Z7WE 4F0LA 2ENPA 3NJLA 4PCKA 1GJUA 4WI6A 4CDHA 3C8FA 5CPLA 3II2A 3WGVB 1RA0A 5KVEE 3WENA 5K1JA 3NMEA 2WNQA 1RCQA 4HD5A 4NNYB 5DUBB 2FRGP 2ZZ4A 3SZ8A 4AD1A 1TV4A 2FEDC 3CS2A 4JNZA 2OM5A 4FXJA 1CURA 4AUBA 3MKKA 4IUOA 1KLUA 3FY1A 2TYSA 5D7LD 4JK0D 1YQVH 3P0GB 3KPRA 4RDYA 1JUFA 2RJGA 2DQIH 5EMLA 3L45A 1GPOL 1R3SA 2YBTA 2YXMA 5AW0B 1XIFA 5DCCA 4RR4A 3BWZA 2RD0A 3QUXC 5IB5A 3T2NL 1FFNB 1CD9B 2PR9A 4PRDA 1GQNA 5I71B 1Z1WA 1LBLA 4AHOA 1IQDA 4F7CB 4YGVA 3GZOA 4BZ2L 1C93A 1XGUA 3G08B 1EPVA 2E09A 1ZBKA 5AHIA 3DX1A 4X5RA 4WV1B 5I74C 1NWSA 1XO8A 1XAUA 1AMXA 4AVIA 3IMTA 5ABGA 2NY1B 4MJ6B 4NQVB 4ZVJA 4NZ1A 1Z9OA 4NUPA 1ILSA 4LLYB 3RK8A 1BZ7B 3F58H 1SYSA 4TUOA 5ILTL 4IJTA 3N17A 3SQBA 3VU2A 3NZSA 3TNNA 2J79A 4LUTA 1D3GA 1J18A 1B4EA 2G3NA 1KXQE 1R3LB 1S9KC 2H0JA 2VDIA 3LDVA 2Z3FA 4UMAA 5BZAA 5F2LA 3XINA 5H37A 3BZEA 2E46A 3VIOA 3D08A 3PCYA 1BWKA 5FGBA 1PO9A 2QUUA 3BGAA 1ZLPA 5I1HL 3VAVA 3MLWH 4R7DA 3QUMA 4YSPA 1EO8H 1O66A 1PZUB 3RG1C 4R2GD 1IT7A 1C1EL 2AVGA 2XPZA 3GB7B 4PPTA 3CUHA 5D2WA 5HANA 5HNUA 3HPLB 3GIZH 5F7EL 1RXLA 1J5DA 1KN2L 2V2XB 5HJDA 2UXVA 2WMPB 3DOIA 4I0PD 1TE6A 3GHTA 3OKLA 4E3VA 2P45B 2XM2A 2YHGA 2WLZA 2RCSH 5A2AA 4HFUL 3SZ6A 2HSAA 3BLEA 4HB7A 4O12A 3VG9C 4PJ5A 5AENA 2CZFA 3OPUA 3I3DA 1E4HA 1OD9A 3Q6GH 1U8NB 5D7LE 4ZUUA 1OE3A 5BS0D 2Y61A 3VUSA 4Y16B 1E4IA 3QLLA 2Z7ZA 5H94B 4YXHL 4Z5RB 4ZZ9A 1WCBA 3NACL 2YDSA 3V0SA 4G6AD 4G8EB 3UO1H 3S1UA 3L48A 1NAML 1VFAA 4FIRA 1U2CA 1KBWA 3W7CA 2JIXB 4LPWA 4PWJA 5F6IC 1UPMB 2F1BA 3QHZH 4ASTA 4U1MA 1KPRB 4JY6A 4CQ9A 2XBDA 3MMEA 5AD0A 3GB6A 5JU6A 1IGYA 2RCSL 3A23A 1TU2A 1OBAA 3VXMD 2OVLA 4Y5VB 4EPKA 3MBEB 5LNDA 1Y5XA 5DDHA 2IANA 4UFKA 4G6FB 4UINL 5D1ZD 3HVNA 2W88A 1VH7A 5D1XD 4OJDH 3IJLA 3TOYA 4MCZA 4UNTA 5HJYA 5CSZA 3GLDA 1A4LA 3W27A 4NO0D 5E2TH 1V6TA 3OBKA 5LGJB 3SIMA 3UXLA 3U57A 4PV1C 1CFSA 5IB4A 1PZ0A 5D2LA 1A14L 2AI0H 3M8OL 4BUQA 1NAMH 3EDDA 1NGZB 4UTBL 3IMBA 1F6YA 3GQFA 4U1MB 3GMQA 5TF1L 4DFHA 1FVEA 4WKZB 4CVXA 3DBPA 1L6SA 7FABL 4IBQA 4YXHH 2P5EB 3C6LA 2Q8BL 1H7XA 4UR9A 4E8CA 3PS6A 1JCXA 1CDGA 4PJXB 2EF9A 3L66A 1VRDA 4PJFF 3S6CA 3WXWH 4JBSA 5IHSA 1E2ZA 4LPYA 2KZKA 3BUBA 1U95B 1U8IB 5F88B 1HVXA 5C7ZA 4PD4K 4OCYH 3QDMB 4A21A 2F08A 2IPKB 3LRGA 1JVLA 3L3GA 1G9NC 3KP0A 1KYOK 1JZHA 3MX0A 4NN5B 1TJGL 3T2OA 2Z35B 1NSNH 4DUXA 4ZMVA 5KANI 3T0EA 3GIPA 1W15A 1F56A 3ME0A 1SJAA 3C8NA 4K2SA 1OE2A 1DHPA 1O6IA 4W68A 2EG8A 1MG2C 4K0OA 2PPEA 1GCYA 3CXHJ 4H8WL 4MMYB 3A4DA 3KPQA 2CBJA 4M56A 3V8OA 1UZHA 2VAAB 5HVGB 2OI9B 4KIEA 4PJHF 2C15A 1T4KA 4X5XA 4JTQA 4K5NA 1VHNA 4K1GA 1RZIA 1C5BL 4NCC2 4EI5D 3PZIA 2YK1H 4JTLA 1NCOA 3S4SG 5K9JH 4AZCA 1WZ1H 4DQAA 1JF5A 4KROB 4MKVA 1OB0A 1WTLA 2ZWLT 4IRSB 5C9JB 2ZXBA 1A1NB 3ZT5A 4FO4A 1PU0A 3O2DA 4U1LB 4JHAH 3QZPA 4TXVB 1WBZA 3RVXD 3WFCL 5EEYA 1JCMP 5AHFA 3L5WB 4G42A 4C6OA 1H9VA 3KCPA 4IQEA 1BKSA 1AQDA 1DVTA 3MRCA 4ZFGH 2A3EA 1FVEB 4WKZA 5JORB 5LGXA 5DF0A 3WL1A 1TV2A 4I89A 4OFDA 3WDIA 2CO7B 2J21A 3CFEA 2GIMA 4J3TA 5FHAL 3TVMD 3L9RB 4O2FB 3DOPA 4XZ9A 1ZT4B 4L8DB 3RGVA 5DRZB 2AEWA 2AS5M 4PG2C 2QCDA 2CLKA 3UWQA 5BW6A 3DH7A 4AYMC 2XFXA 4G7SB 5BWFA 3WY1A 4K7PX 3MREA 3EWXA 3NGBB 2NNRA 1LOQA 1NCBL 5HA7A 2WZPA 3TE9A 3N18A 3B4UA 4KETA 3DBXA 2DD8H 2E6AA 1LL7A 4RNHA 2BO0A 3LY6A 1IEQA 4WQ6A 3BSMA 5HBFA 1ZCOA 4JREB 2V9TA 5LAXB 4R3UA 4ZXBC 5IV2A 2VN7A 3N41F 3MFFB 3AS2A 3KNBB 1BYCA 4XVDA 3B8DA 1E8YA 3TU9A 3ANUA 2BNQA 5IHRA 1HP5A 1IU1A 5D55A 4IBZA 4ABWA 1A9EB 1T40A 2AXFA 3FA3A 5KBDA 3L95A 1G87A 2XJKA 2A6IB 3BDYH 4P06A 4ZW5A 2W5FA 3HO8A 1Q6QA 3JQOB 3Q6GL 1TUXA 3JWDC 4ZPVA 3KBEA 2PP3A 5E6ID 1MFEL 2OMZA 3VXSE 4APQD 5KN5A 2D69A 2YDRA 4GW1A 4F3FB 3ULVD 5JHDD 1UP0A 4PV8A 5D70H 3HAEB 2Q71A 1BOYA 4I7VA 4M7SA 3O6ML 2DQHH 4P46A 1Q0YL 4I1PA 5AY7A 1SXAA 1IBGL 1I7ZA 1E67A 1RZFH 2FYVA 2VLRD 3IPFA 4L9LC 4K8RH 1A1OB 2P8MA 4MA3A 3WD4A 3FN0H 3DTXA 2AEPL 1TSRA 2VXUL 4XWGL 1P2CB 1ET8A 1MNUL 1V3MA 3TN0B 4YEEA 5I66B 4R26L 3CVHH 1PFCA 3H2OA 3JTTA 3NIFE 1BWMA 3T0EB 1D8WA 4DZ8B 4BCEA 4GXMA 3BAWA 1TQCC 3CBJB 4D0CB 3HTLX 2VO8A 3LEVH 4YWIA 2GVLA 1LO0H 4RSYA 3CFNA 4S1SL 4NF7A 1WDRA 2JV6A 5AAMC 2ESCA 4YHMH 5LBGA 3EPNA 4TRPL 1DEEB 4AGLA 2D2CC 4R33A 4H2CA 5IMLB 4RETB 1K6WA 4RQQA 4DF2A 4Y96A 5BOFA 4JRYD 2FIQA 1SXNA 1NP2A 2C91A 3MJ8A 5F96H 3SY1A 5JUEL 3MRMA 3AHYA 1YEGH 5EYWA 5IVZA 3R06B 5CJQH 2XM1A 3KMDA 3P0YL 3MRQB 4KH9A 1QTYT 5DD0L 5BZWB 1SVCP 1QEXA 2BWQA 4MNQA 4AQ1C 4OBSA 3HG3A 5F1KC 1H3XA 3UZEA 4C91A 4TQ8A 3GUTB 5FM8A 5IHUH 4GBXA 4KKZA 2X30A 2XKSA 2EZ0C 1S2UA 4TSBH 5FA3B 3UZVA 3PGFL 4LIQL 3GTFA 3DX5A 1PIFA 2QGDA 5BRQA 1FC2D 4U31A 4TL4A 4YHOL 4XMPH 5L2KE 4A04A 1QRQA 4GY4A 4WI8A 2J8TA 4GIYA 1XFBA 4B9KC 1IZKA 2GY7B 3FN3A 3LEVL 4OZHF 4PJXE 3BN9C 5D96B 3UAJA 4IGBD 1IM3B 5TGBB 1DWFM 5HYQA 2QCDB 4AJWA 2R2EB 3FO9B 1L8NA 5DO8A 3CTLA 2IAMD 4MX7B 3WOVA 1QWHA 4BH8B 2OR9L 4U49A 4RAVB 3W88A 4AMAA 4AVFA 2WGXA 1P5UB 3UBXA 5CLWA 2FMNA 4GFSA 3UJRA 4LEXL 2R0KL 4H25B 2BVYA 2VL5A 4I77H 2DU2A 5CP7A 2W81C 2VJXA 1SLVA 2NQLA 2BSDA 4GYKA 4WENB 1U8QB 4PB3A 3QIBA 2GGEA 1EBHA 1K2DB 4K3JL 5AVXB 1KTLB 1OIMA 5IM7A 4PMQA 2DQMA 3CHRA 4OLVH 1EOMA 1OFEA 3BFQG 3IKCB 4X9BA 5EZLB 4R7LA 4DJMA 4L4VE 3U5UA 1NPNA 4N5EC 3GTTA 4LSQH 4WO0A 5K59F 2UY5A 2VWEC 4WO4D 4A35A 3CBKB 2WBJC 1ZVSB 1BECA 2WZ0A 3B5GA 2ZXWB 5F0LB 4CVUA 4FNSA 2HJLA 3M1BA 4UTUA 4FEZA 1YEJH 4Y4KD 1AKJA 1A3ZA 1QOKA 2XLLA 1PTGA 3LCHA 4W85A 1UH2A 5JW4N 3CFCL 1Y7VA 5BO0D 2DZBA 1KFAH 4JKKA 5INCA 1G7LA 4YXGA 2VL4A 2IWEA 3FQ4A 3ECBB 4RNIA 2EIEA 3U2JA 1B6UA 4FNLH 5AVHA 3DMMD 1DLHB 2PD5A 4MNQE 2OMAA 1UOWA 4CQDA 4OF5A 1NGQL 5J1AA 5CD5D 1A6VH 5CPTA 3S42A 4P9ML 3LDBC 2VLMD 1DE5A 1J87A 2GK0B 4TM9A 2WYTA 4F37F 4QOKA 1JZ4A 1KF9B 4O58H 1MQKH 1TELA 3PZGA 2Y2YA 3LU2A 3K4ZA 2FL5B 5IT2L 4GG6A 4JQAA 1E8XA 3DZ1A 4OZIA 1JGUH 3BP5A 4CMHB 2YKLH 1XCTA 1U41A 3MBXL 1A6WH 3LRLA 5GS1C 4XHJC 2R4RH 4WO4B 1I0DA 2YL5A 3RITA 2VDPL 1S7RA 5CAKA 4HJGB 1A4BA 3L81A 2XCMC 5ERWA 5EULV 2VGIA 3GBML 2Z4GA 1KBBA 1PZBA 1UWXH 2KZWA 5I73C 3M41A 2CBPA 5E8OA 4RH4A 3HNSL 4L3EB 3ROLA 4NERA 2WKOA 1POJA 3TQVA 2PXYD 3P2DA 5DMJB 5TDNB 5JHDB 4S1RL 4IIHA 4ERAA 1P4IL 2NRDA 2XSKA 3GYRA 5A2KH 3APTA 1QLEL 3PYCA 4LYKA 2HT2D 4JHWL 5DZNA 1TKWB 3DVFA 1CK0L 5A2FA 4N20A 4L9LB 3SCMD 2IGTA 3FB7B 5C0AA 2QBWA 1KCSH 3TYZA 3OKKB 2CNCA 4YXLH 2V69A 2QJMA 5HI3D 1FHNA 3G0SA 3KDOA 4Q6IA 1OIOA 3CB8A 3MROA 4OCSL 1FYTD 2H9GA 3MLUH 1EJRC 1DL7H 4Y4HB 3RNKA 1A6WL 2UWEB 3SB0A 5F9AC 5BROA 3RNDA 3ROOA 3UU0A 4HIEA 1FCGA 4QXWA 1FH5L 2OQLA 1KFEA 3W7OA 4BDVB 1GYWA 2NQHA 1J5IA 3EO0A 4MMZB 4H1LG 1M1BA 3RIFK 5I6NA 2JCCA 5HBBA 4Q4RA 2F0CA 2NY5C 3I84A 4HJTA 2A0LC 4LNRB 5FL0A 4A22A 4POUB 4UQDA 4F9JA 3P9WB 4PAZA 3NFSH 2ATKB 2EKGA 1F05A 1MJJB 4JDEA 4YZFF 1A7BA 3OB8A 5AZ2L 3FEMA 1KBVA 4V27A 1HEZA 1Y5VA 4NO0B 2XIBA 3EO9L 4H44C 3CT2A 3W1ZA 1XF3A 3PJTA 2XX0A 3LN4B 4NRXA 4P23D 5H91A 4P3DA 4ZAKA 1M2VA 5EHFA 1OD0A 4HPGA 4XHQA 5CR8A 3U9UB 2PPGA 1F6AB 3O9NA 4ZDHA 4HKBB 1BYAA 3KXFB 3WD5L 1K4HA 2Q9OA 3KXFA 4HK5A 3VFOB 4YHKL 1FE8H 2GJLA 5E4EC 1E56A 4P61A 4A2EA 3ZMNA 8CGTA 1P1MA 1MIMH 1CE6B 4YGAB 1SZFA 4BA0A 1LT7A 2R8SL 3IIVA 4HP5A 3HE6D 4WK4B 1OX4A 1N26A 4YHYB 3H9ZA 1VACB 3LYRA 5HTSA 1HL4A 3ZLGA 2FAUA 1E6XM 5CZ0A 5I5MA 1WQ5A 2Q8ZA 4U1KB 1CLXA 1GGBL 2A7NA 1WE5A 3CXDH 3WEMA 4UOZA 3EFDL 3MUCA 3EGSB 5J6GB 4KRNA 1KM3A 3ZKXB 4MAUL 4ZZKA 2DIBA 3QDGE 4PJ9B 1AK5A 2HVMA 1UWQA 1RJZB 4DZAA 2QLYA 5ENLA 2NY1D 4P9HC 4QT5A 1MI5E 2W0FB 5EO0B 1LRTA 4LRNL 1WBXA 4P5SA 5TBOA 2JF1A 4FG2A 1RK0B 1KCUH 5E7FA 2VZ1A 3O6KH 1DQWA 2OI9C 3EBGA 3QG6A 2GUYA 3U8GA 3FBQA 3MCKA 5C9XA 3UZYA 5D2LF 4QR6A 4PVLA 1KCLA 4F8XA 3MRBB 2YAEA 2OKMA 2W9EH 1DBJH 4K8RC 3RU8H 1KIPB 3N44B 2ARJB 3K0WA 3SCQA 4JGDA 1NCWL 5I18L 1H6FA 1IZCA 1SOSA 1JXKA 2BBFA 4PA8A 4UFLA 3VDBA 4H2AA 3RX2A 1AQ0A 4PJ8A 3FU7B 1G7IA 1T6MA 3S83A 3VPLA 2GPTA 4DKFH 2FK9A 2R0LH 4X0NA 2ENJA 2ILLA 1AL8A 3BLLA 4NZ5A 3O4LA 5GJTL 4X2RA 3MUGB 1VFHA 3MJ6A 4M6PA 4Q8UA 3HMWH 4IMDA 4EAMA 3FJNA 2BY0A 1ZA3A 2AQ1A 3ULUC 5JPNC 2QTVA 4MYWB 1PZDA 1KCUL 2PFHA 3P8IA 4HOXA 4FR6A 1MVYA 1I8AA 1JF1A 2FL5A 3S36L 4GG6B 2ALWA 1C8XA 1XYLA 3K5SA 1V55B 3FUFA 3LKNB 3ZQWA 4IPIA 4NSBA 4NNYA 4MGGA 3RLGA 5KZEA 3TEZA 3NCEB 1O7DC 3AB0B 2WTPA 3MNVB 1SF5A 4LAJH 2VQTA 2HRGA 4ZUVB 4ABUA 1J0YA 1GKOA 1SJCA 2N7AA 3M0MA 1Q9LA 2H6OA 1AGDA 3G1XA 4NZFA 4GEIA 5F44A 3CDGA 4OAWA 4P2VA 4FQ1L 2CH8A 1RJLA 1PF3A 2DQ6A 4HU2A 4KK8D 4M7ZB 4ZSTA 4KY1H 2NWRA 4FG0A 4ZMPA 1ULVA 3C6LD 4BF7A 3M1CA 1IGIH 5LNEA 2X6VA 1XMEB 4WAFA 3WTWA 1AS7A 3CXHK 3VDCA 4M9OA 1YQ2A 4CU7A 5K9DA 1J86A 2VN3A 3VXNA 1WPCA 1RD6A 4PV9B 1PV8A 3ZKMD 1JZIA 2GJXB 2H2SC 1BF6A 3EMCA 1EKOA 3QPXL 3VW3L 2QL1A 5DEFA 2J6EH 1YEHH 4PUMA 5CD3A 4UTJA 1CLZH 4ONHB 1OGAE 4U1GC 3WMQA 5K9QI 3RTLA 2ZKHL 1FVPA 2NQ5A 1NCDL 3L3OC 4BWUA 4IMEA 1HINL 3LMYA 2H3NA 2AJUH 4LSTH 2FIRT 4PD4J 2JE8A 3R10A 3ZDYE 4GZ7A 3VQLA 1YQVL 2DTMH 4NC0B 3WJLA 3TC3A 2HK0A 3QXVA 3T0XA 2OKTA 3E02A 4O11A 4C90A 2OZ4H 2A1WL 5I8EA 3AQDA 3E1F1 1UD2A 1F76A 5G1YA 2K78A 1H3GA 4MAZA 4EQ2A 1UM6H 1GPWA 3LHPH 4DF0A 4OT1L 4Q6IB 5J5RA 4DKDC 1FNGB 4TQPA 3I02A 2WLJA 4BQBA 1FWCC 1G7QB 5FHBH 3GDLA 1BWWA 3PK7A 4LCIH 1FFPA 3VNZA 2VVSA 2WNGA 4PMZA 3QPXH 3VW3H 2ZCKH 4KRMB 4YX2L 4HOWA 1HHKB 3ZTJG 4U6VH 1XLIA 3T6XA 3SDAB 3KPLA 5F2FA 1J1XH 3D3FA 5C0ND 1LQSR 4OCNC 1UBPC 1VS1A 5G4WA 4K36A 3GZPA 2YFNA 2D7TL 1TTBA 2FT7A 3BCFA 3EAKA 4KHTH 3PZVA 4KEZA 3RLUA 3UGVA 1KT2A 4ZOCA 3BKYH 3V4LA 1XZWA 3PPCA 1PJ9A 2OTPA 3QZWG 1UURA 4HDIB 2X6CA 3R06A 3BJFA 1SGJA 3ABGA 3F7KA 5HHVH 2EE9A 5F7MC 2YRBA 3B8IA 3BV4A 5FYJU 5C54A 2XIDA 5K4ZA 5B7ZA 2A38A 4A39A 2OMNA 2YJLA 1WUEA 5BVJA 5DVOA 2HKAA 5FF7A 3QNXB 1N0LA 1T7WA 1WQVT 3OX8B 4YTQA 3WQ4A 3SY5A 1HNGA 4PLJC 3SGGA 1YMMB 1MFAH 1SZNA 1KCVH 3LBOA 1HS6A 3BAXA 3F7QA 2VEPA 4UF7C 1F6PA 4P4KB 1OK4A 1HKVA 5I0WA 3AFLA 5MEOA 3WGUB 1IQ8A 1AD4A 5EU5A 1IT0A 3GVQA 1L9PA 2BIIA 3VFRB 5FUOH 1H1ZA 1BIHA 5JIHA 3GO1L 4DGIH 2VX5A 4PRPE 2AXJA 2HTKD 1JWMA 2C3HA 4XVTL 3X1NA 2QDDA 3TO4A 1XGZA 2VGFA 1E5YA 2DQFB 5DRNB 2FBJL 4PRAB 4ZUWA 1KPVB 4LS0A 3TBTB 3SYPA 4S23A 3W0KA 1FL5B 2AXGB 3GSRB 4IOSD 4KXZH 3ZN6A 1W5NA 4HCGA 2VEKA 3KVJA 3IKCA 1AIZA 3K2UH 3LKRB 1XAKA 4M93C 1LBMA 1QK0A 2GJJA 1K4GA 3U6RA 5BVPL 3O63A 2P3YA 4JTJA 1HIMH 2HTMA 4N9OB 2XSXA 5DHVH 5DLCA 3ISRA 5ANHA 3TCEA 2FQEA 1X7SA 1YHPA 4OR1A 4I5BB 2XU2A 4O1AA 3T0CA 5CC5A 1D5RA 3QFDB 4MNGE 3PL6A 3CTTA 4N28A 2C3WA 4IP5A 2BDNL 3TBVB 4BFKA 5E0CA 4I2XB 3URBA 1HZHH 5JDSB 1GZJA 2UYLB 5IW1B 5C09A 3WG7B 3OF6A 1DVZA 2M83A 3QIUA 3V4PL 3P0XA 4OZ4B 2G60L 3EYPA 3IDYB 1IGCL 1UKTA 2FD6L 4IKLA 4MJ5A 1YAZA 3I3EA 4JUTA 4V2CB 1P4LA 3QEHB 4BZ2A 3Q6FA 5IQOA 4PJ7A 3GR4A 3GSWA 4Y88A 5ABEA 3LNPA 2V3GA 1E8WA 3TONA 1TMHA 3BLKA 4NJHA 1D6VH 2H6UA 3ESMA 3L9RA 2DSUA 3ZJ6A 1DYSA 2WZEA 3SFWA 2QZRA 5H2BA 4A7GF 3HG1E 5D1ZC 1P1VA 3RR1A 4YC2B 4LS1A 1GHSA 1YUKB 4HXAL 1HOCB 3RX5A 4DIAA 1KJ2H 1MPAL 3D1MC 3QUZB 3TH2T 4ES9A 1KBJA 2W9DH 3RGTA 2Y7GA 4Z7QE 3TROA 2O5ZH 3S37X 4HNTA 5JYMA 2DICA 2JKWA 3WIIH 3OIXA 4HIIA 1DR9A 3EUDA 1AG1O 3R19A 1E9QA 4JHBA 2RFXB 1G9MC 2JJSA 3CQPA 3SODB 3X11B 2UY4A 3FIGA 3SSZA 1CB2A 4PVMA 2WXDM 3BD4A 4IEFA 3GHEH 1N8WA 5FUZL 3TT3L 4OUOA 1FHLA 4DWSC 3ZS4A 1RZIB 5AKSA 5DLMH 4PI0A 1UPPA 3DJRA 3VRLF 3TA3C 4FQIH 3TIDB 3TYUA 1LM8V 3JTTB 4NHVA 2INFA 3UEQA 4JO4L 1U8JA 4P23A 2VUNA 3THUA 1W17A 1TJHH 4Q8VA 1QAPA 4LKXA 2LLLA 4JQ3A 5JR1L 4LRSA 4Q8PA 5ADPL 5B1JA 4ATLA 1PVHA 1XX9C 3DFSA 2HSIA 5KVFE 1K8CA 4I3SL 4JJOA 3X3FL 4OTXL 5K5YA 3ANYA 3EB2A 1JPST 2I24N 3AYTA 3LUTA 2F19H 4KKBC 3MQIA 3W1QA 4WUKL 4CJ0A 1FH9A 4RFEB 3B9KB 3BFOA 1R9YA 1W1ZA 2J77A 3QUMH 1NCAL 2YXXA 2Z91A 1NBQA 3UAAA 3N1AA 2PN5A 1YVLA 4UB0H 4G6JL 2J6VA 1Y6MR 1NGWB 2UZYB 4L80A 2IC2A 3MJGX 1UACL 4Y0GA 3W7NA 5I26A 4O4YL 1EC7A 5EEWA 8A3HA 3VCNA 4KHTL 2EH8L 3D3VA 1J6PA 5EIIG 2TODA 4FF7A 3L68A 3RX9A 4L05A 2GHWB 2A6DA 1BZ9B 3DX7A 4AK1A 3NTCL 3PBVA 3X17A 1VZHA 3U7AA 3U36B 4QITA 3GMQB 2ZNXA 1BQCA 4F4RA 2F5AL 1X96A 4I9TA 4RAVA 1QI5A 4N1HB 5IQ7H 5DFWH 5ECUA 4YDLB 5HPMA 1R1CA 1RLCL 3W2LA 3UCDA 3VXTB 4MX7A 3ZE1E 2GIXA 3FXGA 3N4EA 4ZXLA 3QCVL 3HPSA 2CETA 1NMCB 3LKSB 5IBLD 4BQ3A 3CHOA 1HT6A 3EYVB 4F58H 3CAFA 1P7TB 4H20L 2VO5A 5EU4B 3B8UA 1H7WA 1B54A 3I6LD 2BXZA 3NR0A 3V6BR 5XINA 5FSDC 1P53A 3VQ2C 1JQVA 4IL2A 4B5VA 2PTTB 2HVKB 4G9DA 4P46C 1B4JH 2DBLH 3W1MA 5C0CA 1SO3A 2CLZA 3E3QE 1ISVA 1CVSC 5DSCA 5IKCB 4UQCA 1RZQA 2A79A 1I0BA 1M04A 5I02A 1G7UA 1P5VB 3WLWC 2I5QA 4O4YH 4AD4A 3U48A 2YGOA 1Q0YH 1SJMA 1YUHA 1ZANL 3OAYK 4XP9H 2I7SA 3STZA 4CBPA 3WU1A 3FO0L 4N3UA 2AGTA 1AD0A 2AL1A 3SQSA 2XVGA 2CJSA 2R91A 4IFKB 2APSA 4QRRE 4L8CB 1G4EA 2YK1L 4YIWA 1FWXA 1WWCA 2YKLL 2EPOA 5LXGH 2E8ZA 4MRCA 1WIPA 1LTXA 3H54A 4GP8B 2AOSA 3FJTA 4QD2E 3BHBB 3LERA 3TN0A 4CQBA 3H4WA 1DYZA 1RA5A 4MTVA 2A9AA 1SJVA 2OMVB 4J3WA 1P2CA 4NGHH 1MZZA 4ERSL 3F7LA 3Q3GA 3M0HA 2QKIC 4H8NA 3IDGB 5HMEA 3QUMB 1MCBA 1TFPA 3ORWA 1BFSA 3H0TB 3ULUE 3AMDA 3TIDA 1S2TA 4RUBA 4DAIA 5B80A 3AUOA 4BEQA 3QFJE 3BK0A 1EWHA 3W2UA 3OSKA 4QHKJ 2F5BL 3L7EB 1XEUA 5FGSA 3SGKA 4GW1B 4KU1A 5CEXB 3ZHKA 1LNUB 1V7NH 4LH8A 5GRUH 2OMXB 1O5RA 5F88A 3WTUA 2IFGA 1DE6A 2ODOA 4DZHA 4YK4C 4MJMA 3ULVE 3FFDA 4YK4B 1ZLWH 5ICZA 3E2QA 3MVIA 2IOOA 3N2BA 3UMTA 1M71B 1VZGA 1ONQA 3GSNA 4QYAA 2VX7A 4OQTL 3BSZA 4ALDA 4QDMA 1UFGA 4XO9A 1K5NB 4DSYA 5D8JH 2TMDA 4NN7C 2GK2A 1XIWC 4U6YB 4L4OA 3FTXA 3GXPA 3NJGA 4FZ8L 1U2YA 9PCYA 3NURA 2XNAB 1CBVH 3UNTA 2A9NL 4OVVA 3WCZA 3IE9A 2YXOA 4BFJA 4D8OA 3OLIA 3LTVA 4Z08A 2CK0H 3MR9A 3OPZL 5IROA 2ZXAA 5AALA 3POCA 5GRJH 3DIPA 3L12A 4R53A 3GC5A 3SN0A 1DO5A 3MV7B 3LGDA 4EACA 5C2XA 2HXUA 4RX4D 5JO5A 1KV8A 3IJYA 4FNUA 2XICA 3DESA 4ONOA 3GVGA 5ECGA 2AJSL 1S3KH 1TU2B 2JI3A 3BPOB 3MPCA 3TV8A 5HNNA 3PAUA 4N6FA 4TVCA 3TEVA 2P8CA 2PDBA 5FYKE 1MN4A 1TFHA 4LCCB 4XO6A 1TWWA 3VZXA 1EO8L 3L5WA 3WUGA 4LSRL 4FQ2H 4HWBH 1W1PA 4ELMF 1H8OA 1MI5B 5M03A 4S3DA 2QDWA 3U6RB 4XH2B 4K37A 5EMJA 3VI4F 3L9YA 3KL5A 2A9NH 4M1GH 1OSZA 2HKHH 1BVWA 1NEZB 3H4FA 3ZZ1A 4IX2A 3WFCH 3X12B 4KC3B 2DSZA 2IUZA 1HNFA 3NH7H 4EUPA 2Q7NA 5HDBB 1TG7A 2GUUA 2DB8A 3OTRA 5EFIA 1OGAA 5C0AE 1DN0B 4WI3A 4XXCC 2OODA 2EEBA 5BQ7A 4YHML 8FABA 3SECA 4KNTA 1IRAY 1HKWA 5DX7A 3VWJC 4WOQA 5E9DD 3PWPE 3IS0X 4XODA 1MQKL 5LZLA 4OIBA 1ZLUK 3GJEA 2QADD 2XVLA 1KV7A 4QIRA 1H8NA 2WTRA 3RDTC 4Y1AD 4UFHA 3RMEA 1PBGA 4NB7A 4HMCA 2ZA1A 5J3HD 1AKPA 1IC1A 2CUIA 3ARXA 3MV11 1LRNA 2C9SA 4FL4B 1A3LH 2ZKWA 3WDQA 5TDPA 1SGKA 1MJUH 3P9MB 3ITXA 2J88A 5EPDA 3MNZB 1A0QH 5BVJB 3M1OA 4MS8C 1PD0A 4Q9QL 1XCQA 1N6UA 2GVYA 2V2CA 2NV9A 3WDRA 2Z92B 3L8QA 1SYVA 4MA7L 4JHAL 5SWQA 3IDUA 2VIRB 1RZGB 2K3HA 1RURH 3LY0A 2R1YB 3QJXA 1EEZB 3K72A 4HHAB 1KJ3L 4J8QA 4O02A 3QDJE 3O6FD 4XPTH 4L8SA 1D5IL 4L2YA 4CU8A 1B0GB 3B7RL 1DANT 4G7VH 1X5KA 3SDDA 3BDYL 1V6XA 4YDKL 3RWEB 1W72H 1XS2A 1XXXA 2A0NA 3RO8A 2JEQA 5E2VH 3QJSB 5D7JD 1OCCB 5I76B 1BJMA 2X4PB 1RU9H 4MYXA 3CUZA 2LHAA 3LQAC 2W9LA 2ZOKB 3V0WL 4I77L 4HYWA 5GJMA 3F4DA 4GT7A 1IIIA 3ZTEA 1JCVA 5D2XA 4LKCA 3CN4A 4C6IA 1UWGL 2HZHA 2MCPH 4YHPB 4KIRA 1QG3A 3APMA 2PXYC 4DUVA 4Y5VA 4MD5A 1OCWL 1M1SA 3Q43A 1YPZA 3AO0A 2F2KA 3UJEA 2Z0BA 3CZGA 4GAFB 2GOUA 1GOGA 3F7PC 3P3YA 4O2CB 2Z7UA 2ZONA 4QRPB 4NT6B 1GMIA 1F42A 2YXWA 5KSBA 2HMIC 4L0ZA 4RZBA 3C2SA 2R27A 3ELFA 4LALA 2AW2A 2YUVA 2BVOB 2CQVA 2VR7A 2A5UA 1GL4B 2ICEA 1E51A 4C4KO 3TNOA 4WFFE 5C0QA 1A4KA 4ONFH 5HYEA 2W92A 5M7QA 4H9VA 2MNRA 3ITCA 3C9NB 5IFTA 1ZMYA 3OKEA 5ABTA 4NAFB 5I1EL 2C1IA 3FCPA 3R12A 2BOGX 2PR4L 2I5YH 2BP1A 4FZEH 3B06A 2VDNB 1AZUA 1KCXA 3KPNB 4NBXB 2WMHA 3KYNB 2ICCA 3ZO0A 3IETB 1OCWH 2V5LA 3IPWA 4BQ2A 1BBJA 2BOCB 3EOOA 3AHXA 3N5AA 4C47A 1EP3A 4GVHA 3MBXH 3G9AB 4NC1C 4I8DA 2V2XA 3OKDA 2E9JA 1RJYA 3QY6A 4H00A 4DNLA 2JIXD 3RUGE 1UUMA 3UZXA 4IHOB 4A8IA 1OHZA 2DDQH 2H6PB 1NMBL 3T4AB 4EBQL 1PYFA 3SKNA 2JALA 3K13A 3CFUA 2CRIA 2JJTA 4Y2DC 3GMOA 4GGBA 5E09A 2OB3A 5B8CA 1T8XA 3SGUA 1M7OA 1CICB 4PRPA 4HU4A 4AOFA 2EE3A 4KWVA 3MXWH 2IF7A 4AZ7A 4FXTA 1RSYA 1FYTA 6A3HA 4JN1H 2ORBL 2VC2H 4O1EA 2OR9H 3GE7A 2XZAL 3QMRA 5D1XB 1M65A 1YEKH 3CFTA 4HIXH 4LC8A 3AXHA 1YCSA 1HWGB 4PRTA 3UZ5A 5HHXL 2HJKB 2XWTB 3BWUC 2G37A 2CM5A 1BVZA 3MBWA 5I7GA 5IFJB 4JHUA 4RL3A 4BFAA 4FJZA 2Y07L 3EXLA 3V4BA 4OUUB 2AEOA 3RU6A 1Q94A 5GGUB 1NMBH 1ORSA 3MXVH 4AG4H 4DN3H 2OSLB 4E9TA 2IAND 4DKFL 3U2SB 1HG3A 1OFBA 2G75B 4LIQH 3RFZA 1YXCA 5C6TL 1XRTA 3UABA 5ETUB 4OF3A 4MGXA 5KVMC 4AISA 2VM9A 2I57A 2ARJA 4P5KB 2VQ4A 3GO2A 3WLTA 1G5AA 3HI5H 4X98B 2CRZA 5HR6A 1ZS2A 3T6CA 1T0MA 3NSMA 1O6TA 1CR9H 1E4KA 5I24A 3WTTA 2YD0A 1D7DA 2E3ZA 1XR8A 2WUCL 3NP4A 3ZW3A 1OD7A 2NXGA 1OTTD 4RZ4A 2BZCA 2OL3A 5HYJA 3SJVD 2OAAA 5ITFB 4JHZA 2H2SD 5FFGA 1N12A 7TIMA 2V0TA 1CDJA 3OA5A 4M1BA 3HC4H 3V6ZA 2DWEA 5DHXB 4F7TA 3IE4A 4F7PA 3EWUA 4UV7L 1NOAA 5LBSH 4Z8FH 3JVGA 1J7VR 3QORC 1W3HA 3HVDA 1K4CB 3GM0A 3LEPA 3UTSA 4F40A 1OAZH 2IALB 4N0RA 3Q0HA 2UY3A 35C8H 1GGBH 3B0VC 3C08H 3JV4B 4ZNCD 3RKDD 3VGEA 5J5EA 3C2EA 5AHMA 5MERB 2Q3RA 4XTRC 4LHJB 3L9CA 5IBUG 1TCDA 2FWUA 2HMCA 1JYXA 3PQYB 4P5MA 4P2YA 1HCVA 2AK4E 4KUZL 4S0HA 1CGTA 5DJDB 5HPOA 2K6ZA 3MV7E 3WUWG 1FWEC 3GYCA 2PGFA 3AW5A 3IU4H 5H35B 3T8XB 3H9HB 2A74C 2Y5JA 5F96L 4PBFA 1M3IA 4N1CA 4MQ7A 3FFCA 4PJFB 4H26A 1KD0A 2UX7A 4M6QA 1BMZA 1PCXA 3J07A 5ESQA 2ISFA 2GSIB 3PIQB 1QBML 3W02A 1EJWC 1I1AB 1UWYA 5TJWK 43CAB 1BQSA 5I0ZA 8XIMA 4WI5A 2VMDA 2J13A 5HDRA 3VFVB 4P7QA 2C3VA 3CFDA 3OAZH 4R7VA 2AJVL 2GCYB 5I2IB 1U5VA 4XC1H 3RTQC 2PP0A 3PB0A 3WLSA 1NFIB 2V8ZA 3UWZA 4LJ3A 5C2GA 4U4MA 4M9PA 2VJ0A 5E24E 3QIWB 3CVDA 4EZMA 3BLPX 5D05A 2ZG2A 2OP4H 3C5ZA 1N0XH 4S39A 1KCWA 2R59A 3MB9A 3UY7A 1Q9KB 3B83A 3NCJL 2WQ8A 1I2PA 4EEEA 4P3CL 4HT1H 2R56L 4AM0B 5AHEA 5HGHA 3IKKA 1PAMA 3BUDA 1K77A 1PYWA 3WN5A 2YCJA 3U25A 2QVHA 4JPWH 5D9OA 4YVXA 4LCWA 2IG2H 1AO7E 2C7FA 3LB6C 3QZWA 4KFZC 4Y89A 1L3WA 2WVUA 1REQA 1Z9PA 1JGVH 2PCFA 5AVSB 5I19H 4A68A 3KLHD 3TCLB 4LSUL 4PG9A 4DJFC 1P5BA 3TZVD 3OYXA 5DJ2A 4B9JA 1DUZB 4NNAA 3LRSB 4H8VA 3QPKA 5EWIH 3F7VA 2ALRA 4ACZA 4WW2B 5HINA 1IGML 1MJ7L 5F3HA 4AY1A 4EE9A 3ARWA 2E40A 5DWPA 1KYDA 4IU2B 1QNRA 3WFDL 3EKCA 4DN4L 4WHYH 4LAZA 4WDUA 5B1KA 2E6YA 1BG4A 2PO6C 1JWSB 3ECWA 2DQIL 1AQ8A 5C0NC 2ISSA 5T8GA 2J6EL 2FCBA 2VSDA 1HH9B 4JZ5A 4DNMA 3DIFA 4H26B 4I3RL 1L9OA 4UC5A 3BGFC 3DDGA 2XA8L 2OXHB 3AM8A 3NQGA 1SO5A 3DC8A 4TUFA 3EJTA 7ODCA 4BA8A 3IU3A 3N2CA 3TN5A 3G0XA 3IGXA 3QIWC 4GRMA 4YE0A 3WBDA 3NEVA 4PYHA 4PRIE 1NC2B 3ITOA 4CD6A 1GKRA 1EBGA 2GFTA 1D9KA 4DCQB 1BV8A 4DCQA 2A1WH 5DZVA 5INCB 4NG3A 5EA0H 1WA2X 3CSTA 3MC0A 1NTHA 4AGQA 4P2RB 2Q86A 5DWUL 3VNIA 2YD7A 2IEPA 1MWAA 3KYOB 3QF0A 4QLKA 5D2NA 3F5KA 2E0PA 1TLMA 3LHAA 1TDQA 4YDVA 2R1KA 4LGRB 1RUAH 3FYPA 4XAGA 1B31A 3LH2H 1PGRB 3U0PA 1U8OA 5FM5O 1B6DA 4P2QA 3FPYA 4LOUD 4ZFZB 3MLXL 5DQJA 4XVOA 4LO9A 1KIUA 4EXBA 1NFGA 1O6SB 4RIRB 4V1DD 5CWSA 1H11A 1I9JL 3OG4B 4BKTC 4BY3A 4YPGB 1YO4A 2O4EA 4JFSA 5C08A 3D0AA 3KLHC 4BKLB 3U2OA 4NPYA 4WFGD 4LGPB 5D9PA 3U6WA 1CJYA 2CBQA 1K6QL 3ZX1A 3IIZA 4K1WA 2AK4A 4KQ4H 1ZSDB 4UTAL 5L2JA 3A3WA 1RHFA 4ZD3L 4R34A 1E4XI 3TQKA 3V5CA 3DVGB 3AITA 1MG3C 1N3NA 3Q8CA 4X98A 2NZ1A 1CB7B 2K6YA 5ID0B 4DWDA 3QXDB 5I9QC 3OZLA 3SYOA 4CUCA 3A4AA 5E9DE 4KRPB 4IIQA 1NBCA 1UUQA 1HJWA 7PTDA 4MPQA 4HPJA 4QSFA 5HGHB 1MCJA 1T4WA 4HWZB 4WHDA 4J39A 1B5TA 2R8WA 4HC1H 3SCSA 2FLIA 2CJUH 1J1PH 2AV1B 5DJAA 3P2VA 1TZIA 3R1GL 2V2TB 2CHXA 5DXWA 1S39A 3UZVB 3UG5A 3GH4A 4IQHA 1AYOA 1EGJH 2YA0A 4FLHA 5F71A 1HJSA 3RP1A 1VKFA 4XP1L 1RPQA 4FN0A 2WKJA 1J2BA 5IQ9B 4LLUA 4PGBB 4XOEA 4K5OA 4ORGB 1I8KA 5DD1L 5GJTH 3WAJA 2MANA 4KK6C 4ENLA 3WIIL 1QKZL 4KI5F 3AVEA 4NILA 4IJ3B 2I14A 3ML8A 2X4TB 3D18B 1PY0A 4PRPB 5GXBB 32C2A 4D8PA 1I2NA 4TXEA 3APDA 3UNDA 3V7AG 3F85A 4YE4L 1I1AA 3HG5A 2ZYHA 1UJ3B 5FYKD 3GXMA 5SWSA 2XZQL 3WE6B 3IMRA 2NW2A 4PHXA 3MLTA 5D2NE 1JNHA 1KB9J 5FKPB 4C83B 5KSBE 1B3OA 4OFCA 3SBQA 4GUPA 3U0TB 2WHJA 4GMSL 3RY4A 1BRLB 3I2CL 3RHWF 2E6QA 3TFBA 1U8CA 3KGRA 1T0PB 2Y9RT 4GSUA 5EZOL 3LZNA 2WCSA 4JFQA 1EHXA 3GMPB 4FG6C 2WIIA 5F3FA 1XCFA 3EEGA 4OOZA 4Z7VA 5FJOA 2QCEA 1ITQA 1NEUA 2F19L 2K45A 3FRPG 1AQFA 3HPAA 4P2OD 3HE6B 4Y19E 3W9DB 1AXSB 1RZKH 4GSXA 5D1XC 1CENA 5LNVA 4IBSA 1QFWI 4NP4L 3UERA 4I3SH 4H1ZA 4HC1L 1AD9A 5TF0A 3P69A 4MCNA 3RB5A 3NSNA 4XO3A 4AVHA 4GGHA 3WO8A 3M5ZA 1UWAA 3ARDD 2DT1A 4MAUH 1B3YA 3HS0B 2K4WA 1C16A 2B31A 3D39B 2OR2A 1E7UA 5K9CA 1F58H 2FEDD 1SW3A 4KJQD 2A6KA 2YSTA 3QDJD 4WEEA 2BV9A 5C1MB 1FP8A 1H63A 5I73B 4GJ1A 5D2VA 2Y7EA 4E41A 4MIMA 4HPHA 1IGCH 1A5UA 4MFDA 3CE1A 1IXNA 2W38A 3V4PH 4PJGE 1EWEA 3L95B 5E1HB 1D2KA 1X8FA 2G2NA 4DKEH 1CUOA 3H3KA 1GC1H 3L6FA 2LW3A 1DVFD 1O5DT 3FCBA 2O93L 1IEVA 2VENA 3TT1L 1NFDA 3USZA 2HWZL 2J6WA 2BVQA 4H0IA 5KJ7E 2CHOA 2W61A 2IQAA 3LQAH 3LNMA 5AVYB 5B4MD 1FZOB 1KJ2L 2R1NA 5F7HA 3QG7H 5FK9B 1X5GA 1E3XA 3B2VL 1V77A 3KWXA 1Z7JA 3QYQA 5E2UL 4AQLA 1KSRA 3C3UA 1ASQA 1D7FA 1KJMB 1QFUL 4QRQB 5AKTA 4HAKA 5J1SC 1QO5A 2IKGA 2IDQA 3Q65A 5BZXA 1BWVA 3UMNA 1QBLL 2XH2A 4F92B 1KACB 1M7IB 3FTGA 3DLQR 2QIIA 3VOIA 4G6MH 2DM4A 4YDNA 5L8JB 1IE5A 4U1HA 1F8MA 4ODUB 5ALCL 3RL1B 3KRSA 2DY2A 5C0GA 3VFWB 3MRFB 1MCKA 3P40A 1RI8A 4P2OC 5JMOC 3D25B 4MOZA 2CALA 5DR5H 3QLDA 1TEFA 1XH3B 1XCQB 1Z9NA 5DLML 4X5WB 3C2OA 5BYWA 3RX3A 1AQDB 1W2PA 1HK6A 3COTA 3RZWA 4G1EB 3MSRA 5H8UA 1JPEA 1P84K 5LGZA 2X4NA 4LNYA 4Z7UF 2RKXA 1X5XA 1GOOA 3DROB 3F6JA 4INFA 2C1PA 1F9CA 4O5LL 3R1ZA 2VLRB 3SKNB 5T1MA 4UT9L 2CLRA 4P2RE 3V4PB 4FFYL 2AJYL 3QW9A 5AKVA 3WJJA 2XUCA 1GS8A 4FQJH 2Y1HA 4QHMB 1GZ1A 2WCAA 3NZGA 4Z0SA 1FXPA 2VUYA 4ZYKB 3WIFB 1HVQA 1ZIAA 4ZXOA 5FO2A 3FCSB 5BOPA 2B5IB 1DVFC 3EOSA 5DCDA 3KX6A 4JKLA 5DD3H 2XISA 5IHZA 2CLMA 2K7QA 4CC0A 3ILQD 3EXSA 4OBTA 2ZCHH 2PI6A 3QUKB 2OG9A 1FSKB 2EDYA 2GSGB 3U7BA 5E6ZA 1VFMA 1FI8C 4P59L 2X4UB 1BJ1J 2C9AA 4GQPH 2R1XA 2X0YA 2X42A 4L61A 3MLVH 4WFHD 1GOHA 1SLWA 4JY5L 2OQJA 1EAJA 1H0DB 4XKYB 1G6VK 1KC7A 1M68A 2VVNA 3PY2A 2DBJA 3S6TA 3CPGA 1ADOA 3QQ3A 4XZUB 2R6OA 1JNLL 3WQVA 1Z9AA 1UM5H 3SSGA 5LDSA 2EHHA 3PUOA 1FZJB 5EOCJ 3VI4A 1I8UA 2YA2A 1E5AA 1PZAA 4FTVD 3NSYA 4U6TA 2G5WA 4QHNA 2J7GA 1NAMA 4O50A 2AXWA 4KMLB 1A7QH 1IAII 2NCEA 1UZ1A 2N4IA 3I50H 4AUYA 3AT0A 4B95C 3LHYA 4KFMA 4GRWE 4KFNA 1T7ZA 4HS6A 5ABDE 1KR1A 6PCYA 2D7TH 3O3DA 5HUOA 3VXSD 2I26N 2Y0SA 3O8XA 5A5WA 3I74A 1UEYA 2Z8SA 2VRJA 4AZGA 5CBIA 2HFTA 1J11A 5CBAA 4O51A 4PMUA 3G5WA 1QR1A 2XQYA 2WWKT 4UFIA 3ZLFA 2CDGA 1CF8H 3FYIB 3IS1X 3K7UA 1MCFA 3CAKA 3UC0L 3TTEA 3P0YH 4H0LC 1YDPA 2XXFA 3EGXA 4QHNB 3BPOC 4UM9A 5K9KB 2C26A 4PH8A 2JJTC 4GG8A 3SE3C 3VIIA 3W84A 3EO1B 4UTHA 3V0IA 1EVUA 4RMTA 4X4YB 1EERB 1XIIA 2DI9A 3AOFA 3K6SA 2DT2A 4HZ8A 1OC5A 1H3TA 1NQKA 4B6ZA 1WUFA 3BOLA 2SODB 4KITB 1MUWA 1M41A 3ZJKA 1ZEAL 4HZAA 3DRTB 1CD0A 1FORL 3PHOB 3B8YA 3S7GA 1PIGA 3VRLE 1VPQA 2LLEA 1A4JA 3N43F 4KDVA 4H7CA 4CVZA 3R58A 3MVTA 5J0BA 3CVBA 1CQKA 1KENL 1JTPA 3EJJX 5ISZB 2CGZA 2GSGA 4RRPM 1XIWB 5ESVB 5C0CE 3SRFA 4IDJH 3GMRB 2FPVA 2E75C 2DWYA 1KEML 2XI9A 2ADIB 2GQHA 3GXTA 2MSPA 4K8RL 2MQCA 1J0ZA 3FKKA 1GHFH 1XBRA 3FCSA 3FSVA 1OY0A 2VISA 3WF3A 3AUWB 1E50A 3O6MH 4KZEL 3O0FA 5E93A 1QOXA 2FR4B 2EDNA 2YD5A 3SUSA 1SHXA 1ZGLA 4WU5A 3NZ8A 3QA3B 3FQ2A 3TWYA 3GNOA 1OFQA 1BQKA 1G6RL 4G9FB 4HUUA 1NIDA 2YL8A 1Z5LB 2ESVA 3F83A 3MRPA 4TYUA 3SJNA 1KENH 3CGTA 3DDMA 5FESA 4AYEC 3VUAA 1JZDC 4G1EA 4NHUA 5KYWA 2CLZB 4WJXA 1S7SA 5K39B 4HSHA 4XVEA 3K4WA 1TZOA 1N7ML 4GRWF 1SPDA 3TVMB 3L5HA 2BDQA 3MSYA 3UWYA 1M42A 3C5ZC 3EOTL 2FZ3A 2QTEA 2QV4A 5CMAA 3W0WD 4IRSC 4XR8C 4WUUE 3L3DB 2GJZB 4GH3A 4DF9A 4MASA 1XLLA 1V3KA 2NY3D 4FFWC 1W3TA 3K6IA 1WBYA 2VR3A 2WXPA 3OKOB 1KEGL 3W39A 2GSJA 1X97A 3ZKSD 1EJ7L 1YN7A 3L5IA 4KFOA 3IRCA 4QKTA 1DZ0A 4CADB 5IOPB 4I7WA 5EC1B 5LN4A 3RVWD 1PKYA 1C92A 1AOHA 3DERA 2HT3C 1FG9C 1MFBL 1T0OA 2VGLM 2YQ2A 2YSSB 1VFFA 4MLSA 2I32A 4QRPE 2WN2A 4QP0A 3NIGF 4FFYH 4K55A 5IHUL 5FLUA 1OOWA 2E86A 2IQAB 3GEWB 5C0AD 2B59A 4DO5A 4JM2F 1MLCA 4F1ZA 2AQNA 2UZXA 2JXMA 4QXTB 2VXSH 2XY1A 3FZUC 4HU3A 2GSMB 4ZFFB 5KJRH 2A74A 3K2KA 1O1HA 3B2DC 3MV9A 2OBGA 2EUVA 3QOKA 2FZ3B 3SCNA 3V0HA 4TV6A 5KMYA 1X5LA 5I3IA 4OZIF 2WJFA 1NMCC 5K2ZA 2X9ZA 2PYFB 1S8DA 4LUSB 1AANA 1SEBA 3WLHA 5TFSL 3QJFA 1F4YL 1QX1A 4W9TA 4ZMOA 5KYXB 2DWDB 3WF2A 2WLKA 3MZ2A 4JY5H 3FQXA 4U7SA 2XFFA 4JTCA 3NPXA 3OZ9L 2WD0A 1L7TL 2AJ3B 3Q3GB 1ETA1 3KHDA 1B0IA 1NLBL 3PP4H 2COQA 5FGCE 1KXVA 2AEPH 2GI7A 3S98A 1QPQA 2EC9U 4XBSA 4ALAH 2X44D 4Z7OF 3CMGA 1GOKA 2HRPL 4MD0A 5EMYA 2E7CA 4FAAB 3CFCH 3ZZLA 2Z6JA 1QMUA 5GVJA 2ADGB 2BGNE 2PLCA 1E90A 4L8CA 4OZFA 1A6ZA 4QF1A 4WDXA 3CH8A 1C8VA 4QCFA 4IFKA 4Q0XH 2N0KA 3DURA 4Q2ZA 4X6CF 2LAGB 3FQRA 3HS0C 1AKJD 2NW2B 3B8SA 1W72L 4JFWA 4YR6A 2PDFA 1M03A 2R1PA 1AGFA 3EJYC 2DH2A 2NUYA 2W8CA 2JKTM 1OP3H 4DXXA 4EDWH 3RFZC 1C08B 4DIXA 3C2FA 1E43A 3T04D 3ML9A 4PJDA 3SCOA 2H8ZA 3BX7C 1EEXA 2DYRB 3AWGA 1NSJA 4IWWA 4ZPTB 4XZMX 1RAKA 2EDQA 4JVPA 2FO1A 4XMLL 1I2RA 3WIJA 1M05B 2Q7YA 1EA9C 1EPFA 3PWJB 4D2JA 1IVLA 4P2OB 1ZJBA 2B3RA 4KTDH 4LVNB 1XCXA 2YCEA 1IWBA 3TKFA 3VVGA 5HP5A 3MMTA 1BGAA 4EAYA 4URKA 5GIRA 4QMEA 1H7OA 5CG0A 1CFVH 2ZOUA 3BJSA 2JQMA 3VFGL 3ANVA 3VINA 3V9CA 2QADB 3L17A 1V0LA 2IVFC 4PBXA 4M8UA 4IGBA 2F7RA 2V3FA 4ZW7A 4GW5B 3UEZA 4N26A 5JQ6H 3IF1B 2A0LD 1TF4A 3KPPB 4RFOH 1IO4C 3BWUF 5AUMA 1B88A 1AGEA 1DXFA 3D3VB 1K8ZA 1R2SA 5F9OL 4WKXA 4JFZH 3KHJA 1YNTB 4Z7VE 4DI9A 5DVLA 2XWXA 2IV9A 5DD0H 4IHCA 2NX5B 4IF2A 4Q4OA 5LNWA 1IM9A 1F02I 1CXIA 1XTMA 1RK1B 4TNVK 4KRPC 5DUPL 4EN3A 4HG4K 1T8QA 2OTWA 3M9YA 3QPEA 2ZICA 2X1OA 4FQ2L