1XH0A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with acarbose
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh0A01
1BVZA 1JF5A 2OWXA 4DO6A 1R85A 1GCYA 2VOTA 1G9HA 3VSVA 1CGXA 2X2HA 3W6LA 3GXFA 3AIWA 3AXIA 2WHKA 3BAXA 3A5VA 5E0FA 4URIA 1TQUA 2J7BA 4JFVA 2CERA 2GFTA 3E1F1 4DM1A 4WKHA 2FGZA 2VRQA 4M81A 2BHUA 3PZUA 2NW0A 4J3SA 3MMUA 3D52A 4CU6A 2J7DA 4ZENA 2OLHA 1TCMA 1X6LA 2WC7A 3B9DA 3CUJA 2FHCA 1X6NA 6A3HA 1PX4A 1TA3B 4ATDA 4JFTA 4XUYA 1DP0A 3LXBA 1BHGA 4J3XA 1GOQA 4OUEA 3VIJA 1GHSA 2G3MA 4CD7A 2CBJA 2Q8XA 4CVUA 2XSAA 3IANA 3W82A 2XN2A 3S2CA 2XN1A 2XG9A 1C8XA 5A2AA 1BYAA 1GPFA 2CBIA 3U5YA 3PBGA 3KL3A 1QI0A 3VGDA 3T2OA 4IPNB 5A3HA 1OD8A 4MDPA 3DX1A 3WEZA 3FXYA 2V3FA 4HU8A 1PX3A 3OIHA 5JBDA 3AZRA 4OGZA 3DECA 1MFUA 4AW7A 1JG9A 4JFWA 2YL6A 3WL1A 2BHZA 3FAWA 2J62A 3VM7A 2DSZA 3AS3A 2F8QA 4GINA 1UD5A 2E9LA 3ARTA 3W0KA 2DEPA 4H8HA 5IXEA 3VSUA 3GNRA 2PF0A 2FH8A 1FFRA 1OWQA 2DIEA 2UY3A 3BUPA 5EFDA 5CPTA 1XSKA 3WELA 4B15A 1CWYA 1B31A 1BTCA 4CCDA 1LL7A 2DSKA 4XZWA 1LF1A 2YL8A 3VIKA 2VCBA 2WMGA 4AZ5A 3WNOA 4AZIA 4AEEA 3GNOA 3D3AA 1NWSA 3CUFA 1H11A 4N42A 3OLIA 3ZIZA 2X2JA 4NF7A 3WNNA 3DDGA 3ZM8A 1J0KA 3LXAA 1AVAA 8A3HA 3AYRA 1WAWA 1BYBA 1CTNA 4QP0A 3T2PA 4AZ6A 1EOMA 2WKGA 1KR1A 2GDVA 3VDHA 1JGIA 3VPLA 4AD2A 2EABA 1KBBA 3A6OA 3HG2A 1H49A 1OD0A 5C8BB 4GZIA 5A6KA 2FHBA 2EPMX 3VM5A 1BGGA 3BC9A 3QGVA 3MI6A 2XUCA 3OGSA 1NARA 1UD2A 6CGTA 1E1EA 3T09A 3K8LA 2OYMA 3L4WA 4TXEA 3RILA 1PBGA 4HA3A 2BV9A 3NJ3A 3U5UA 1JZ2A 2JIEA 3WUEA 1GQKA 4E8DA 3OLGA 3AROA 3WD4A 4P8WA 1AQMA 1PJ9A 5E6YA 2PWGA 4DWSC 5D9OA 1UA7A 4TVDA 3HJEA 2DGAA 1JL8A 1XCWA 4PSRA 5A2BA 2VRKA 1K9DA 4W8LA 3WD3A 1MQRA 1XSIA 3AS1A 2VR5A 1PAMA 4AZHA 3AHTA 2TAAA 2Y4SA 4NSBA 5BXPA 1IZKA 2W5FA 1JXKA 1SZNA 5AYIA 1CGUA 1UR8A 1GOMA 3UETA 4A4AA 2ZE0A 2B31A 3SUWA 4P7NA 3WDJA 1VRXA 2XFRA 3WQ5A 1MXDA 1O7DC 3POCA 1B3WA 3THDA 1E43A 3UG4A 1A3HA 4NZCA 3W81A 4FLRA 4DUXA 3EJPA 1VEOA 4TVCA 3ZJKA 5AC4A 4AD5A 4D6HA 3GTNA 4JCLA 1EH9A 4D6DA 1R33A 1VBRA 5I77A 3CTTA 1C93A 2EQDA 4B16A 1W32A 3AMKA 1JNDA 3RJXA 2J8FA 4BA0A 4GPNA 3SIMA 1FP9A 5A6MA 2CEQA 3AS2A 4CD5A 2O9PA 1OT1A 2G8ZA 1XD0A 2MANA 1MW1A 4WJXA 1GOIA 1V6UA 3BMVA 1E72M 1UWIA 4HMCA 2PWEA 1UH4A 2WMKA 1J11A 3L2MA 4AZCA 4LXFA 4W5UA 1YHTA 4F66A 3KL0A 2X0YA 1V6YA 3MS8A 2W67A 4OOZA 3AHZA 4ZXOA 1KTBA 3EDKA 3ZQ9A 1QHOA 4C7DA 3IAQA 5BRQA 4OOUA 4Y7EA 4FNUA 1MW0A 1Q6DA 3DYPA 3ZSTA 2Y8VA 3WDPP 2WAGA 1OIFA 1G0CA 4PMDA 5ABEA 3VILA 1HTYA 4WKAA 3PZ9A 1AMYA 5ABFB 9CGTA 4EKJA 2A3EA 1QW8A 1OT2A 4J3WA 2VX7A 1W1PA 3GXIA 1FH8A 3RCNA 2ZXQA 1TQVA 2XHYA 4U2ZA 3WF4A 3UEQA 3WUFA 4CD6A 2JFEX 2G41A 2YL9A 2WMIB 3AIQA 3MSGA 4M29A 1B3YA 2EPLX 3SEPA 3TONA 1J12A 2G3NA 4FNTA 2A3HA 3RDKA 3VTRA 1W1VA 1NP2A 1ZJAA 3OLDA 4W86A 1BG4A 2PI6A 4U31A 4YPJA 2DH3A 5FD0A 3WDQA 1JYVA 1V3IA 4J3VA 2EACA 2IUZA 5D8WA 1XSJA 2VI0A 2WHLA 1JZ4A 3U7BA 4P7OA 4D6IA 1PZ2A 1C91A 4F9JA 1W9PA 2YIHA 4JL1A 3PTQA 5I3DA 1VFOA 1W2VA 3BLKA 1HKMA 1HJXA 1UZ4A 3VD9A 3SCRA 2WMHA 3WNMA 1UD3A 2YBUA 1JXJA 4E2OA 4BCEA 3EJSA 4C7FA 2O9RA 3MKKA 3NDZA 4FNRA 1HX0A 1UQYA 4PYSA 2DSVA 1V02E 3NSXA 3BAIA 1CGYA 3ZJ8A 1BVNP 3WH9A 4HMDA 1DWGM 1C3FA 1W9XA 4AZBA 2YA2A 4TX8A 1ISXA 1WDPA 1E4IA 4Z2LA 5I6SA 5AC5A 3WEOA 1GJWA 4YHGA 4BZYA 1CYGA 3W27A 1O6IA 3IK2A 3VDCA 1H0IA 4PCTA 2GJXB 5KZ6A 1E5JA 2Y2WA 2BXYA 3UG3A 2UWFA 3DX3A 3PZVA 1MW3A 4GQQA 1I1XA 1ESWA 3LRLA 1OGBA 1W3LA 4NRRA 4AY1A 1W9UA 1C8YA 4ATLA 4CD8A 2D3NA 1NH6A 1UKPA 5DT5A 2PC8A 2WMFA 4JZ5A 4PN2A 1JZ7A 6TAAA 4KRUA 3DYOA 5EFFA 5GNXA 1M7XA 1T0OA 1JD7A 5ECUA 3PZGA 4B9YA 2Z1KA 3F5KA 1JNEA 4D6GA 1C92A 2GJPA 4UQ9A 1G94A 3PZMA 4ZEPA 1FH7A 5I0DA 4AD4A 3WBAA 3ZR6A 3WIJA 3W26A 2XWDA 3SCNA 1KQYA 1U2YA 1E4LA 3LPGA 4V27A 4KGLA 3WDRA 1QHPA 2PB1A 2RGMA 2ZX6A 2PWFA 3K8KA 3AMGA 3N18A 1UYQA 1HJWA 1HKJA 4YN5A 1XH2A 1V03A 2J7HA 3J7HA 1DHKA 4F79A 1Q6CA 3EJQA 4U33A 1W3HA 1EOKA 5CJ5A 1UR9A 4DUWA 2J47A 4MNJA 4MDOA 1OCQA 2JIWA 1MWOA 2DSWA 1EXPA 1LL6A 2CXGA 4QLLA 2ZICA 1E70M 1EA9C 4BQ3A 4EAMA 3NSNA 1HP5A 3N15A 2J7GA 3OA5A 4M8UA 3A47A 3GM8A 1CIUA 4UQDA 1CGVA 4EE9A 1CXFA 3POHA 1US2A 1EHNA 2W92A 2X0HA 3CBWA 1SR0A 5CG0A 1QWNA 3KEHA 4OKDA 5LA0A 1E15A 2ZUTA 3H55A 1CBGA 1WCGA 1GQJA 1GORA 2W91A 2J4GA 3OGVA 2ZUUA 3CPUA 4UNIA 1GJUA 2GK1B 4BF7A 2BHYA 2QPSA 5E70A 2J25A 2ZX8A 3TTOA 2E4TA 4HA1A 2E8YA 2V3DA 1CPUA 1HJUA 4MADA 3ARWA 3ARUA 3N11A 4H2CA 4PMZA 1KXHA 2D0GA 4UTFA 4GZJA 1ISZA 2XVLA 2VTFA 1B1YA 4A3YA 3WMBA 5JIWA 3WF0A 5BRPA 1GONA 1KGXA 1V6WA 3BAYA 2QV4A 1OM0A 5A6LA 1E4NA 2WSPA 1HIZA 2BVDA 2XFYA 1MFVA 3AYSA 3CC1A 2PWHA 5CLWA 5A69A 3BUIA 1L0PA 3KL5A 2YDSA 1RH9A 2XYLA 3BGAA 3CUIA 4TVUA 1E0WA 1S46A 3WFZA 4X0VA 3VGBA 2CESA 5IFPA 3A4AA 1G1YA 3W25A 3KLLA 4D6FA 4X0NA 1UG6A 1QI4A 4FNPA 1US3A 4LQ1A 4OIFA 5E09A 3D50A 1KXVA 1XRVA 3II1A 3CIVA 3T0DA 3WNPA 1HNYA 1FFQA 1GNXA 1TUXA 2X8RA 3MUAA 3N13A 5A6BD 1CEOA 3VGEA 2DQXA 2E8ZA 3ZSSA 1OBAA 1KXTA 4DWSB 2FHFA 3W38A 4M82A 1HVQA 3A22A 3WENA 3N12A 1HWWA 4HU0A 1B3VA 2DPEA 4HZ7A 2WWDA 3WF1A 1K9TA 1GQIA 2X1IA 2XIBA 1WE5A 4HOXA 3EJRA 1OSEA 1HVXA 1QX1A 5D8ZA 2D0HA 3VDAA 3PZOA 5BCAA 1BPLB 1XGZA 3WY2A 4LYQA 3VIOA 4BQ4A 4B9ZA 4PMXA 2YA0A 3DHUA 1CXEA 4H04A 1AQHA 4UOQA 1JZ5A 1BQCA 5HDRA 1LG1A 1LWJA 4GO9A 1UR1A 3WUBA 4QLJA 3LMYA 4CD4A 4AD0A 1NWTA 1H41A 3D4ZA 4QAWA 2G3IA 3AHXA 5ABHA 1UD6A 3LPFA 4U5KA 4AIUA 1UWTA 2F2HA 3MU7A 4C7GA 4IUGA 3VD5A 4U3CA 2WK2A 2E40A 3FHQA 5CSUA 3OGRA 2JEPA 1WP6A 1V3MA 3T08A 3OZOA 5KEZA 4MNKA 4D6JA 3EYPA 2NT1A 5IHRA 2CNCA 2XTKA 3BSGA 3L2LA 3IGUA 2VL4A 3K8MA 1A47A 4H41A 1MXGA 1HXKA 2OSXA 1JDCA 2ZXBA 5FCZA 4WIWA 3PZIA 4DWSD 3GXPA 1KQZA 1XV8A 2YL5A 5A2CA 3DYMA 3WQ6A 3AZSA 1VF8A 3QHNA 1LJYA 3ARXA 4UQAA 3WNKA 1J0JA 3FAXA 2PBGA 3F4VA 4W87A 3MO4A 3M46A 4Z2JA 2C8NA 3ARYA 4FLOA 3N04A 5A6AA 3VMOA 1FP8A 3VSTA 2W4XA 3UCQA 3VGFA 4KRTA 1B3XA 5EB8A 1JYXA 4L4PA 1JI2A 1KGWA 4N0RA 3A3HA 1JIBA 2FH6A 2D0FA 1U30A 2YA1A 1IT0A 5DMYA 4HPGA 2V38A 3WEMA 2WBGA 4Q7NA 1R87A 4KWUA 1H2JA 2YDQA 4CN4A 1O7AA 1CGWA 1UQZA 1E0VA 4P7QA 3WNLA 4JFUA 1OGGA 4QLKA 1GZJA 4ACZA 8CGTA 1CLXA 4FK9A 3UESA 3AIBA 4UFIA 1DWIM 2VRJA 4WLCA 4MAVA 4ZE4A 5M3WA 2VURA 1J10A 3UR8A 1WB0A 2V3EA 1ITXA 1ISVA 1E1FA 1QNQA 3LRKA 4AMWA 1KFWA 1X1NA 2WVUA 4CCCA 4AD1A 3BAJA 3FY1A 3O6AA 2QHAA 4P8XA 3AISA 3SCTA 5FL0A 1VEPA 2W62A 3NIYA 4UZUA 3BH4A 1QI2A 4D1JA 1Z32X 2EAEA 2EPKX 1FHLA 1E6PA 3L4UA 1BG9A 3SCPA 2NT0A 1VFMA 3FHAA 2J75A 2DH2A 4UFLA 2VUYA 4HMEA 1EDGA 1E5NA 4J28A 4WKFA 1LL4A 2VT0A 1W9DM 1UR0A 2WMJA 3HMCA 2EADA 3M7SA 2WCSA 1EIBA 1UKOA 4DO4A 3FN9A 4D72A 1R47A 3N1AA 4MB5A 2IGTA 2VVNA 2WCAA 3F5LA 3KE0A 1FA2A 1HL9A 4GKLA 2XSBA 5BYWA 1W9BM 4AIEA 2WZEA 1VENA 4P8UA 3WQVA 1DWJM 4AZ7A 2JEQA 3ARQA 1HL8A 1E4MM 3GXTA 1CXKA 1HXJA 2F7OA 3CH9A 4RE4A 1IZJA 1GHRA 1M04A 3QHOA 3VIIA 1ZBCA 3WDHA 4PUDA 2E3ZA 2WYSA 5JIPA 3ZOAA 1EDQA 4Z2HA 1B2YA 1TVNA 3CHDA 3WD2A 5JBEA 2WVVB 4HPHA 1NQ6A 4PRWA 5FOOA 4W93A 4TTGA 3BUBA 3CZ8A 2DDXA 2OW6A 3FW6A 3NDYA 4XZBA 1JF6A 1L8NA 3WY1A 2EBNA 1UR4A 4GZEA 3BLPX 1UZ1A 1E56A 2DT3A 2J7EA 1ZS2A 1E6QM 3EDDA 3PHAA 5EMYA 2ZUMA 1C7SA 1PS3A 4IM4A 4JHOA 3LXCA 1TA3A 2V5CA 2FGLA 3W29A 3T0BA 3AZTA 4W7WA 1WZLA 4CU8A 1VIWA 3VMNA 3VIGA 4PMYA 2V5DA 3B9EA 4K68A 2GSJA 1OB0A 4LPCA 3EDJA 2WKLA 2XVNA 1TQTA 3BAKA 4PMOA 3UR7A 2VZTA 3GDBA 4OJYA 3HZ3A 2PWDA 3MMDA 1H5VA 1QW9A 4MB3A 5FKYA 3DX2A 2X05A 4W85A 4MJ2A 3VNYA 1TVPA 1E73M 1D2KA 2X2YA 3LRMA 1N82A 3NCOA 2J77A 1D3CA 1JD9A 1B3ZA 3T2QA 3HN3A 4AYSA 3WKZA 3DDFA 1AQ0A 3D51A 4F8XA 2EXOA 5A8NA 3VD7A 3THCA 1UUQA 2ZX9A 1E6RA 2ZOXA 1QI3A 1TQSA 3D4YA 2ZUSA 4NI3A 2JALA 3NUKA 3EJUA 1TFVA 2WVTA 3VIPA 4J3TA 3BMWA 1ZB5A 4W89A 3KLKA 3AIRA 1NWUA 4OBSA 2QLYA 5D4YA 3TTQA 1GQLA 1E40A 2ZXAA 1VJZA 3AS0A 3AMLA 3EDFA 4W84A 4Z2GA 2WHJA 1TE1A 5I5RA 3PZNA 3AJ7A 2J79A 3LPPA 3VIMA 3HG3A 3G6MA 5I79A 1ZBVA 1E6XM 1ZBKA 3L4XA 1GVIA 4FLQA 3L4VA 4MJ4A 2ZUNA 1W91A 1BYDA 4UFJA 3WF2A 1RP8A 5ABGA 3ALGA 1HN1A 3OBAA 1GOKA 4AIOA 5CPSA 1GVYA 1CNVA 4LX4A 4GXPA 2YOCA 3JUGA 4UFMA 1QWUA 2V3GA 3HU7A 3EJTA 3ZO9A 3CHCA 3PN8A 2VJXA 1P6WA 1CZ1A 3LX9A 3QOKA 2DT1A 1XH0A 3CZGA 3GZAA 1LLOA 4EANA 3AXHA 1W9VA 3GH5A 5HPCA 1J0HA 4XB3A 3BAWA 2WXDM 1JAKA 4HZ8A 1HJVA 4Z2KA 2FE0A 2BNJA 5I78A 2WPGA 2XN0A 2BVTA 1QHZA 4R5EA 5HBFA 1QNRA 3U57A 2YLAA 4ATWA 1XC6A 2F1AA 2W61A 3KZSA 4TOQA 4FMVA 1LG2A 3I3BA 4HOWA 4P7LA 1NM9A 5M5DA 2WVSA 1KTCA 1GOOA 3WDIA 5M17A 1PIFA 1DTUA 2D1ZA 1ITCA 3SCQA 5CSYA 1J9YA 4J27A 4IPLA 4XX6A 3CZEA 5A95A 1E0XA 4E4PA 1R7AA 2FDMA 4W7VA 3BCFA 1V6VA 4PCSA 3VVGA 2O9TA 3AICA 1HKIA 3CUGA 3RMEA 4MTVA 2WWCA 4UQEA 2WBKA 1JFHA 4PTVA 4U3AA 2Z1SA 4BQ5A 1BSIA 3DHPA 7TAAA 2J7CA 1RPKA 1E55A 2OYLA 5CZKA 1CGTA 2XGBA 4PMUA 3VO0A 4GI9A 4GIAA 1E6NA 1JAEA 3B9AA 3MUY1 1CENA 2CHNA 4NZJA 1H4PA 4QFUA 3W24A 1HF6A 3PZTA 1R46A 1C7TA 2IXUA 2D73A 3VU2A 1KR0A 2BY2A 3AMDA 1UOKA 4LYPA 5CQ1A 2O9OA 3AQUA 2DT0A 3TP4A 3IJ7A 5FL1A 4U2YA 3AI0A 1KBKA 4TX6A 5HOSA 3APGA 3HG5A 4NX0A 3GBDA 5A6SA 3DC0A 2J7FA 2BY1A 2XWEA 2CBVA 2XVGA 3KWXA 4M24A 1SMDA 2VQUA 4ACYA 4D6EA 1EO7A 1EO5A 2X2IA 2QMKA 3ARZA 1R34A 1XHGA 3W37A 1CXHA 1HT6A 1CDGA 2AMGA 5CPQA 4CU7A 3CMJA 4KMQA 5CGTA 1ODUA 2CCRA 2EPOA 1H09A 1V0KA 5HXMA 4J7RA 2WMIA 2D3LA 5A1AA 1NOUA 4AZCB 2CIPA 1ZJBA 2YBTA 3WFLA 1ZL1A 3WQ8A 4B3LA 3IAPA 2ZWYA 4AWEA 2YKKA 4UCFA 3RM9A 1GW1A 2HVMA 4HZ6A 3ALFA 3WD1A 1W3KA 3IJ8A 2W63A 3OZPA 4EK7A 1JFXA 1UH3A 1M53A 3L4ZA 3PTMA 4DUVA 5M03A 2ZWZA 1F4AA 1QPKA 4FF5A 2CKSA 3CO4A 1PZ3A 4FNSA 1R86A 4JKKA 3WL0A 2Y24A 4W88A 1SFSA 1R7OA 3SUSA 1NOFA 1ZU8A 3WN6A 1CXIA 4CCEA 2DSUA 2GDUA 1JDDA 1VB9A 3ZR5A 4YHEA 5DT7A 4GQRA 2E9MA 4PMRA 3GH4A 1JI1A 4Q22A 4AMCA 2AAAA 5AYBA 3TTSA 1RP9A 4CUCA 2X09A 1UD8A 2EJ1A 5IFTA 3ZT5A 5TD4A 4QCEA 3A21A 1QOXA 1D7FA 3OG2A 3SCOA 2J74A 1V3LA 3VGGA 1UD4A 2GJXA 2AOSA 2CPUA 2YFNA 4HA4A 3O2LA 2UY4A 2E0PA 4HTYA 5JUVA 2XPKA 3VD4A 1K9EA 3SUVA 4RE2A 3CHFA 5F7UA 2F7PA 2XVPA 4PTXA 1U33A 4NXKA 3W53A 4LYRA 2D2OA 2GVYA 4S3KA 2VX4A 4H7VA 3UG5A 2JF6A 4UFKA 3A23A 1SYTA 4PTWA 2G3JA 1KWKA 4E8CA 4PMNA 2VCAA 7A3HA 4LGXA 5GQBA 5I23A 3L4YA 3TTYA 1WZAA 3RIKA 5DO8A 2OYKA 3WQWA 4W7UA 2JF7A 1EGZA 5A8PA 3WH8A 3CZSA 2XM2A 3ARSA 5BXTA 3MV11 1WO2A 5C71A 4MB4A 1B9ZA 5E1QA 5A94A 3S6TA 3EMZA 1LQ0A 1Q6EA 5LA1A 3BUDA 3CZLA 4UR9A 4DO5A 1BLIA 4NZFA 1G5AA 5CXPA 3CZNA 2VVSA 2BFGA 4WSKA 4KH2A 3W6MA 5IHSA 3K1DA 1E3ZA 1EDTA 4R27A 1XD1A 1WDRA 4UOJA 3N17A 1EQPA 1MVYA 3ARRA 4FLSA 5A8QA 2BXZA 4GO8A 1I75A 3L4TA 4P8VA 1FHDA 3NSMA 1WNOA 4PTMA 1V0LA 1J01A 4GI6A 5A6BA 1H1NA 1V3HA 1MW2A 5DF0A 1QNOA 2ZXDA 3QHMA 2VR4A 4QCFA 5BXRA 2CETA 2ESCA 1V02A 1LWHA 3TV8A 1UWRA 2GK1A 2WZHA 3SUTA 4PMVA 1UASA 2WHMA 3AFBA 3AMCA 4JIEA 1KXQA 4CKQA 5BWFA 3H53A 3MUZ1 1W1YA 2BVYA 1FOBA 4CGTA 1XH1A 2O92A 1HJSA 1IV8A 4OBRA 1TMQA 3OB8A 1HP4A 1G01A 3SCVA 3W4RA 3B8SA 2Y5EA 2C7FA 3TA9A 2XFFA 2G4FA 4AMXA 3EBVA 4AD3A 5JBFA 2W66A 1B0IA 2QMJA 1W1TA 2VZOA 1V0NA 3CLWA 1QBBA 4KGJA 2WLYA 1TQWA 1MQQA 4CN1A 4CN6A 3U7VA 2DIJA 5I24A 3AHYA 1YQ2A 4PMQA 4MB1A 4JHZA 1VFUA 3CUHA 2VCCA 4QDMA 1MQPA 4M56A 4D1IA 1WDSA 1E3XA 3SURA 3G6LA 3F5JA 1QNPA 4AC1X 3BUQA 3H54A 3GXDA 5E6ZA 1QVBA 3VNZA 2WCGA 4AXNA 1KCKA 2YDRA 2OWCA 1GUVA 3WQ4A 1WPCA 4JAWA 1RD6A 3VINA 1XYZA 3HG4A 4L4OA 3AIVA 4XV0A 2CHOA 4FNQA 3BVUA 1DWFM 1SMAA 3M07A 1NP0A 2C0HA 3BVXA 4DWSA 5A8OA 1R8LA 1JDAA 1V0MA 2F7RA 2F18A 4X9YA 1ZBWA 3WUGA 1KB3A 3ARPA 3CHEA 3RM8A 3A24A 1H3GA 2VX5A 2EEXA 1JYWA 4MNLA 7CGTA 1QI5A 5EBAA 4WF7A 3AOFA 2WSKA 1VEMA 4M1RA 4ZFMA 3CZKA 3K4AA 1UWSA 2PBOA 3BLBA 3VX1A 1PIGA 3OLEA 4PBGA 5BXSA 4PUEA 1H0GA 5CLTA 2YFOA 2J78A 1CXLA 3GXMA 3I3DA 4UQCA 3GH7A 5AY7A 3AHVA 3WF3A 3CMGA 4AYGA 2CBUA 2VQTA 3CGTA 3RO8A 1DEDA 1JZ6A 4AISA 4AZGA 2RGLA 2OSWA 3CZJA 2F61A 4HOZA 1WKYA 1TG7A 4TTUA 5FIPA 3K46A 3RPMA 3PTKA 1UH2A 4NXSA 4JL2A 2F7QA 4CVWA 2CYGA 3M6DA 2DT2A 4JFSA 5IDIA 4PSPA 5D9NA 3VX0A 3PZQA 3VD3A 1DWHM 2YJQA 2NSXA 1B30A 3RJYA 1BAGA 2A3AA 4UQBA 4P7RA 2VNCA 1J0IA 4WSJA 1CECA 3O9NA 2FYVA 4OZOA 1CLVA 2CKRA 1OGSA 4UOZA 3I3EA 5E0CA 1HJQA 3ZJ7A 3SCWA 3BVWA 3DX0A 2D24A 2XM1A 1QNSA 2OWWA 1TR1A 1E9LA 3NYDA 3W28A 1M01A 3VUPA 1PX8A 3TOPA 5A6JA 2XGIA 4M80A 5BROA 2WW5A 4V28A 2WB5A 2J8GA 3VKKA 4RE3A 1KWGA 1VBUA 3MMWA 1WZMA 3GNPA 1Y7VA 1J0YA 1VAHA 1ODZA 2GUYA 5LYRA 4W8AA 4JKMA 4MPKA 1ECEA 1Q4NX 2ZUWA 3GBEA 5DEZA 4IISA 2BS9A 5HNNA 3WH5A 1V6XA 2YLLA 1V08A 1K9FA 2WANA 1OIMA 2EO7A 2ZX5A 4JCMA 1C8QA 3BVVA 3CV5A 1JYNA 1BFNA 3WD0A 4UZSA 2QPUA 2Y8KA 1UKTA 4U5IA 4BS0A 3VMPA 1J18A 3UERA 1UWUA 3BCDA 4RL3A 1QBAA 3SCSA 5DFAA 3ARVA 4A3HA 2D23A 1VJSA 2A3BA 3EMCA 4ZE5A 3ZJ6A 2WNWA 3S5YA 2ZIDA 3VGHA 4GI8A 3AIUA 4ZXLA 1E71M 1BF2A 5D9MA 3SCUA 3DX4A 1JZ8A 3SUUA 1XYFA 1WDQA 3BSHA 3WY4A 2VMFA 2ALWA 2E9BA 1EHAA 5CGMA 2VO5A 3MV01 3D5HA 2EPNA 5GPRA 3MANA 2VZSA 3A4WA 3RM4A 4WK9A 5C70A 2WC3A 4MNMA 1C90A 1JZ3A 1Q6GA 2BY0A 4JKLA 3VOCA 3A4XA 1NWRA 4J3UA 4W5ZA 2WZIA 1UKQA 3WMCA 3GYCA 2OW7A 4ACZB 2HISA 1EQCA 1UHVA 4UFHA 3S5ZA 4H8VA 3WH7A 4ML4A 1Q6FA 3AIEA 2GJRA 1R75A 4PEEA 1HKKA 1BGAA 3VIFA 3GXNA 4NRSA 1KGUA 4V2XA 1XCXA 4MAZA 5A8MA 2CITA 2JE8A 1V3JA 2VC9A 2XVKA 1V3KA 3WBEA 2WC4A 3IJ9A 4D6CA 3ECQA 3ZT6A 2VX6A 4AEFA 3ZMRA 2A3CA 2UY5A 1BYCA 2VZVA 1J0ZA 4Z2IA 4F9DA 3WY3A 5E9AA 2XJ7A 3VDBA 4S3JA 4TUFA 3BVTA 2OSYA 1UWQA 3N9KA 1ISWA 3AXXA 2WVVA 1FH9A 1E6ZA 2BY3A 3QOMA 4H8UA 3WMSA 2XIIA 1E6SM 5GNZA 1I1WA 2QF8A 3ZT7A 3MUIA 5ABFA 3EDEA 4DM2A 2ZUVA 3FNDA 2UY2A 1UKSA 4B3KA 1K6AA 3WSUA 3BXWA 1VFFA 3WH6A 2VZUA 5HPOA 5LA2A 3VIHA 4D71A 3T0AA 1F4HA 1NOWA 1OINA 4HP5A 1W3JA 4W8BA 1MYRA 3EMQA 3QR3A 1PEZA 1WZKA 3MSDA 4BQ2A 1UA3A 1GOWA 1TZ7A 1KCLA 5D9PA 2D22A 1DWAM 1ISYA 1B90A 2IXVA 2D20A 2WLZA 3K4DA 3LPOA 2WM0A 1W2PA 5GNYA 2ZX7A 1UR2A 5I2UA 1M03A 1PPIA 2F1BA
chains in the Genus database with same CATH superfamily
1BYPA 4KQNA 4M7ZB 5SWZB 4OZFH 4LNRB 3QZNA 4M81A 1E5UI 4NI8A 4JAMA 3EHBD 1BD2E 3QI9D 4AM0A 1XDLA 3DPBB 4X5XA 4JY8A 1YQVL 4X2PA 3JWDC 4KF1A 4QRPB 2FHCA 2JKIS 4UCGA 2INZA 5KYWA 3F4NA 4HDIB 4ZMZA 1FDJA 3VIJA 5A2JH 5C9UA 1ZNNA 2YD9A 3F85A 1BEUA 2OZ8A 1SJVA 2GUOA 4P2QA 2LR4A 1HH6B 3KUMA 1S2VA 1UJPA 1TQBC 3C8FA 1GPFA 3GSXB 4JR5A 1M41A 1MHPH 1SN5A 4WOZA 2VP8A 1T21B 1AACA 5I07A 2ANUA 4A8IA 2J8UB 2BSTB 1RALA 1KFKA 2X0VA 4NUGH 2OULB 3ARTA 4KXBA 3OYZA 3VSUA 5C0NC 1X5JA 4P5KB 5DXWA 4MDIB 3DG3A 4P23B 1RCOB 2BS8A 5CC7A 1TOXA 3H9SD 3G5WA 3MV7A 4PRRA 3DVNA 1RL1A 3MQIA 4LVOB 1FL5A 4NIKB 4HPOH 3L9RB 2I5IA 3WEXA 3MUGB 1OHLA 3WJLA 1RU9H 3FMGL 4L29A 4X7SL 1KUMA 5E51A 1CTNA 4AZ6A 2FYMA 1M3IA 1RULL 1AQDB 4GQ0A 1KBBA 3LKQA 5C8BB 2J27A 5KZDA 2WXGA 4RNJA 5INDA 3RGVC 5AL0A 1OAZH 3FN0H 3LB6D 4N0CC 3VU1A 1PBGA 3BW4A 4FZ8L 2R0WH 4C57C 3A13A 4NN6C 3W71A 3WD4A 5AOZA 5CEXB 4FQIL 2DQGH 4WHYH 4NQEB 5PTDA 4UT6L 5TE4L 2BMKA 1C5BL 4XXDA 3RIFF 3QIWD 1H5BB 1N7KA 1FO0A 3VFUA 1P4CA 5LGKA 1O5XA 3POCA 4PJBF 3TZVA 3BT2L 5BS0E 4PGEB 3G6JF 3GTNA 2DTSA 1MI5E 3US9A 4A2HA 1EQWA 2IV9A 4JHMA 1WD8A 3ZBMA 4I18B 4FCHA 3GJFK 4N2EA 4YDIH 1OAUL 2ENPA 1H3PH 4WJXA 4Q4MA 2CU9A 4YSUA 5I76A 3BE1H 1YHTA 3KL0A 2VDQB 2Z91B 3D0LA 5B7ZA 2CLRA 2YJLA 4OLVL 3VFNA 2XG4A 1MW0A 3WKYA 4ZAKD 5H8PA 1ZGDA 4DQWA 3I2CH 4Y19E 2D03L 2XWBB 4V1DB 5D71H 4EIGB 2ZXQA 2N56A 2IPGA 4HU2A 4GGHA 2YL9A 1OARL 3MFFA 3TONA 1QFWH 3TNMA 2VFHA 5J1AA 5LHFA 3K71B 3WDQA 4U1NB 5D8WA 4HKXA 3H4XA 4S1SL 4P7OA 1VCBC 4NYLB 1R2SA 3BKCL 5A16B 2WMHA 1BJ1J 3PS6A 4HNOA 1XGRB 2QCGA 4OTKA 1TX0A 3EJSA 1NC4D 4AEOA 4G7YL 4N68A 1P84K 4LLMB 3D3VD 4PJXA 1KLYA 1W54A 5DJCB 3L3KB 1BVNP 3QN3A 2VN7A 3OGCB 5T1KB 3UZEC 6XIAA 3LHYA 1GJWA 5F96H 5ESVA 1AY1H 5DMGD 4PCTA 4PH6A 2WQUA 4O1DA 1YADA 1BXVA 4DZIA 2DV0A 2DIKA 3GBML 4NRRA 2L7UA 3AY2A 3MHGA 5EZLB 5EO9A 2PC8A 2WMFA 4PN2A 1I8AA 4NQCE 1A53A 1J86A 1T0OA 1H9VA 4W4OA 2C9XA 4XWOD 1JNEA 3KFTA 3PZMA 4K3ZA 3JTTA 5BJTA 4R2GD 3UDWC 4LOEA 4X99B 3LCLA 3LHPH 5FK9A 1HJWA 4U6VH 2VISA 2V5MA 3ARFA 5LWYH 3SSZA 5D2NC 5TDNB 3TLQA 5EBLA 3T3PB 4APQB 3PPCA 4WHYG 3RVUD 4NZTL 4LHUD 1S7WB 4OZFA 1XQKA 5DHYB 3NSNA 2MKLC 1XAUA 2O5YH 1ZVYA 1CIUA 2WLHA 1XLJA 3QCTL 1NTHA 1MG2C 2BSSA 4L5FH 5LA0A 2XINA 5AHNA 3IJDA 1M1XA 3EBAA 2P1YA 2BHYA 2QPSA 1EUNA 2BNRA 1F90L 4UAOB 3DVGA 2DL9A 2D0GA 1ISZA 3FQWA 1B4JL 5E6UB 4KJYA 1Y6KR 1OG6A 3DFNA 5C0AD 4LQFH 5I6MA 1JCVA 3HE7A 5EU3B 2PWHA 4GW4B 5A69A 5DS8B 2YDSA 1VFLA 4HIXL 1JNHB 2MJWA 4M43L 4ADJA 2L8AA 2KUTA 1HINH 4YVNA 3WO8A 4WGVB 2NY3C 4FEZA 3WTTA 4IU3A 3SSGA 4XVJL 5IOBA 5A6TC 3OGOE 3FQYA 4C56B 4Y5XC 4KKPA 4Y5VC 2E8ZA 5CAHA 4G6KL 4X4KA 1R3SA 3APNA 5AQ0A 4JHWL 5FO7A 2EVHA 5T9BG 1P1XA 2CR0A 4I89A 3B9KB 5HJ3B 4IGMA 1MRFL 4C1LA 4UNKA 2LU3A 3PZOA 4NWTH 1Y07A 4LSSH 4PRDA 4J9JA 8FABB 4HBCL 4BFAA 3MRNB 6REQB 5EOCL 4XBPB 2VZ1A 2CNYA 1A6ZB 4XPAL 3LZRA 2Y5SA 4PMFA 4NUPA 2IAAC 1ID2A 4I9WE 4P5MA 3NJGA 4N4QA 1LORA 4AKPA 3BJTA 2E7CA 1YNPA 3LHUA 4J1UB 5DS2A 1Y6MR 4AG4L 1HHIA 3OKDA 2VL4A 4O02L 1HXKA 4LLQB 1JDCA 3AWOA 1JS4A 1JGUL 1P1ZA 2PXYA 3GRGA 2DAVA 1XCTB 4YHZH 1VF8A 1ZHNB 1ES0A 2XQYA 3CX5J 3LBMA 2C1GA 3D3VE 3C5ZC 3UTSD 1UJQA 3VFCA 3T0EA 5EB8A 5K9JL 2JKPA 4N0RA 4MJJA 1AS7A 2WXPA 2W88A 1KCXA 2FJKA 5DJDA 3RU8X 3ULUD 3GHRA 3HUJE 4PJHF 4B4FA 2NXYB 1LP9F 1CGWA 5BNKA 4XZIA 3MRJA 4JFUA 3AC0A 1LEIB 4A7VA 1OGGA 1GZJA 1PCWA 5HBBA 2OA9A 1BZ8A 2NX3A 2AJZB 1HQ4B 1YPZB 4X6EB 3DCPA 1R3JA 5IFHL 2VRAA 4NQTA 2QUNA 1N7ML 2DY3A 4KXZH 5E6IC 5E2WL 3KOYA 2WQPA 3EB2A 4DKTA 1PG7H 4O8AA 1JHTB 3TJPA 5CSBA 4TNEA 4HAFA 4LVNC 1UZ8A 2J75A 1ZTXL 4TQPA 2VT0A 5HVWA 1XAKA 2L04A 4E0RB 4XKMA 5I00A 3FN9A 3PWUB 1RQ5A 4Y2OB 3MHFA 4JK0D 1RJQA 2FTWA 3E2HC 5FGCB 3SDCD 1TVDA 3UZYA 1YE4A 1MNNA 3BPNC 4KJWC 2APFA 1R6VA 1E4MM 1EIXA 3P0VL 2YPIA 5LGYA 4ZNEA 1RERA 1YY8A 2F5AL 2O4EA 2WOYA 2HE5A 4HT3A 4IRZL 2DM2A 1FC1A 1NQ6A 4L4LA 2GPTA 1KC5L 4DIAA 1F3EA 1JF6A 1NPJA 1UWEL 5FAAA 1PKQA 3D06A 5BUGA 1E7VA 3ZKMD 3M17B 1HZLA 1C7SA 1PS3A 3AZTA 4YDLC 1VIWA 1NELA 1KCVH 4ODTL 3VMNA 1A4KA 2Z1WA 3U30C 4Q6JA 1VCVA 2DM3A 5EU5B 2XVNA 2Z1XA 1AP2B 3QHZH 3V16A 3LTSA 1I1AB 3JBG7 3P7YA 1BVKB 1QW9A 4IIEA 3CFIC 4KZ0A 3IFOA 3VNYA 1TVPA 1E73M 1D2KA 4HSCX 2J77A 1D3CA 3PGFH 4P2OC 3T2QA 2ZCLH 5IRPA 4GUQA 1N0LA 3D51A 5KANG 4TVPE 1HFBA 3N06B 2FQEA 1AG1O 5IMOA 2C7UB 4WJEA 4UTUA 2WVTA 1ZMYA 4Z7IA 4J3TA 1YSOA 2IDSA 3BMWA 1ZB5A 3OHXB 4G9FA 2WZ6A 3OTRA 3TTQA 4B3ZA 2ED7A 1XGYL 5EBWB 4ZQTA 5BU9A 5SWQA 1TE1A 4D8PA 2FBRA 4QRQB 3VIMA 3AU1A 4QOKB 3EYUH 1A3LH 5BRBA 4CMHB 3ALGA 5J6HB 2D2GA 3QM3A 4GSUA 3KJ6L 4D2JA 3CLFL 3LKSB 3OV6A 4MJMA 3PN8A 1OF2A 4HZAA 3IFLH 4QEHA 1ZVNA 1EEZB 4W9DC 2WXDM 2NXGA 2WPGA 5ENWA 4R5EA 4D8ZA 5I75C 1OPGH 3MODL 1FV1B 3OF6D 4P46A 2VXUH 3F2BA 1QBMH 2D1ZA 3UTSE 3AT9A 3SDAA 1SF3A 1V77A 4IH3A 4NGHH 2DKUA 1TZGH 3NFPB 4O1CA 3EO1B 3CCHA 4UQEA 2X4QA 3EFOB 3R8HA 2VAAA 3BPOC 5D6DA 2MCAA 2HDJA 4Z1AA 4QSFA 4Y4HA 1OF0A 1WV7T 1FWAC 4PS8A 1R46A 3L8QA 1C7TA 1DQDH 1GVOA 5KS9A 5KVEL 1IT9H 2DN7A 4RMVA 3DFPA 4QXUH 5HOSA 4NX0A 2WV3A 2NUYA 4HG4K 1M7PA 4R4FH 2DWEB 4KHXH 2CZFA 4MGGA 5EWIL 2JCCE 2FECL 2VQUA 3C61A 2CUMA 1KTKE 2VDKB 3U25A 2YPLB 4Q3MA 2UZYB 5DJAA 2XSXA 5HXMA 3IJSA 5HHNB 4OGAD 2O5NA 4B9IA 1NOUA 4U0QB 4AX7A 3U36A 1YEDA 4LOUD 2A38A 3IAPA 2VSDA 3E38A 3MRGB 3VE9A 3QEUB 1ZV2A 2ZA1A 3HKFA 1DL7L 1YMME 3IJ8A 1IQDA 4N2GA 1QUNA 1W1B1 1F6LL 3L4ZA 4DP2X 4GYKA 1T5KA 1Y0LB 4FF5A 2VLJD 1FWGC 5C0IB 1R7OA 3F65A 2KQMA 4YSCA 3ZR5A 3QQ3B 3S2AA 4IIQA 5C8JA 4REQA 3TTSA 1ME9A 4ADGA 5IB4A 5TD4A 3GSNA 1CT8B 1ZPTA 5ITBL 4HXAH 4MA1C 1U8PB 2YFNA 1S7UB 1FWSA 4PP1D 3QGKC 4MNGE 2FGBA 4DJFD 4OZ4B 3CUPA 3W53A 3ZTCC 4GLRI 5MHBA 4HK5A 5DZAA 1VFBA 4C6FA 3ARGC 4K3JH 2DI9A 1U6AH 2VE6A 7FABH 1J8VA 2C1OB 3GHEL 4PMNA 1Z44A 4PW4A 2ZWSA 1JSYA 3MRLB 2OV0A 4N2BA 4NLAA 1JK8B 3ARSA 4HD5A 5I2IB 1CDBA 1LE9B 1XLGA 4FXSA 3GMQA 1LQ0A 2NY4C 4OD1L 4I5UA 4IKIA 2J2ZA 1U92A 2JQAA 5CU5A 1E3ZA 2CUHA 3N17A 3TZFA 2PUZA 3NSMA 2ZONA 3KYKH 1BXUA 3MJ8A 3ZZ1A 3TV8A 4WCYL 3QEZA 3LU2A 4RSVA 2A7NA 4TYUA 4QRBA 4JBSA 4I4WA 4J2MA 1KXQA 1YEFH 1JGMA 4NC1E 3MLRH 4PUBH 2DW6A 2DD8L 3EIFA 1Z9SA 1T2QL 3IS1X 3MRDB 2HXUA 4AMXA 5KSBB 3LY6A 3NA4A 4A29A 4P0DA 4CN1A 3BP4B 2ZFAA 1ORQB 1YQ2A 4YX2L 4JHZA 5MEPB 2MQ3A 1IM9D 5E6ZA 1PO9A 4FQ1L 2YCKX 3NEXA 3SKOA 2KZWA 1R0AL 3LZQA 2Z8WC 1DV7A 1K4DA 3BJ91 4XO5A 2BVQB 5C0QA 2I25N 3OOQA 1F11A 1HQTA 3IDJB 4LARH 4IIZA 1GYUA 5A2KH 1ZBWA 3OTTA 1YN6A 3ZRFC 3NK4A 3PAVA 4MMYB 3RG6A 3EO0A 4Y8AA 3MCYA 3HC4L 1JWUA 1HHGB 4CNTA 3OJDA 4OFYA 1IFRA 1MFAH 3QAZC 4IFOA 2NV1A 3TSMA 1D8WA 2J78A 1TMCB 2JQZA 2YXFA 5ECGA 4RGNE 4XODA 3RWJA 5FYJH 4MZRA 4CDHA 3S35X 5CIPB 2HKHH 4HGWA 4OCYH 1HIMH 1BZQK 1OP3K 4LCIL 4HOZA 1U8JB 2MHAA 4IRSA 2NY7L 4HEPG 2NNCA 3XISA 1A7OL 5AC6A 1FL3A 1A50A 5BMXA 4ORIA 3LS5H 3HOJA 4FEIA 1IEAA 4YOKA 1EDHA 2QQNL 5HJXA 2VLJE 2IWGA 4U05A 5DD6A 4IJRA 5A6JA 2GJNA 3TW7A 3I02B 5HGAA 3FOMB 1OFBA 3PM6A 2YYUA 3N1PC 1FTXA 3EFFB 3P3UA 1FNEB 1S2WA 4DGUA 1V08A 2VLKE 2UY7A 2OI9B 3WD0A 4Y1AD 1J18A 3JV6A 2H9GA 4L6OA 4O9HL 2Q8BH 5JDSB 3CV2A 3KLQA 4A3HA 2D23A 2A3BA 3EMCA 3TXAA 1IGMH 3QQXA 5HHQA 3X12A 1ITQA 3Q94A 1EWDA 4GOAA 5C0JB 4TPRH 4NCDA 1JZ8A 1XX1A 2ALWA 4X2RA 1RZFL 3MLWH 4XNBA 1BKHA 2EPNA 1M6OA 1ML1A 3NJJA 3L5MA 2NY6C 2WMPA 3PBYA 4NKDB 3ULVL 1F2XK 4IKJA 3EUDA 4IKNA 4LNVA 3KPLA 2E59A 3V7PA 1I7UA 1FWRA 2IANE 2WNXA 4IQEA 4WAFA 3L2NA 2NYKA 1FHVA 2F38A 3S6CA 1EB3A 1BEXA 3P82A 1NUGA 4R7DB 3C87A 4PRTA 1ND0B 1D5BB 4BA8A 4IQHA 4BHUI 1MY5A 1G84A 2EIZA 4AQAB 3WY3A 3GRBA 2K6ZA 2JJVA 1E6ZA 3QOMA 3R18A 1T4KA 4HZLA 4EF9A 1CD9B 3FGCB 3FF8A 4GW5B 1OGPA 1X7SA 4LLVA 4K7PX 4W8BA 1OFAA 5D9SB 3REWA 3GSOB 1S3HA 5DMMA 2HG5A 3A4FA 4CEUC 1YJDL 3LPOA 4ELMF 3LNFA 1RXOB 4ZUTB 5EO1A 4RESB 3MX0B 4W9GC 5DK2A 4JVUA 1OY0A 1O5RA 4XD5A 1NEPA 4HJJH 5C0DA 1L3NA 5E94B 4P4KB 4AJVA 4M1BA 2NR6A 4YSTA 4ZYKB 3C8KB 1KYOK 1FE8H 4F2UA 1NBZA 5JOPD 1XF3A 1H19A 1S7QA 1USQA 5CBIA 1EJSC 2OMVA 4TNVK 4WU7A 4BD4A 3ZL2A 3HMXL 4XVSH 3PL6C 3IANA 4RFNC 3RFAA 3NP3A 2A4EA 4DELA 4YC2C 4NJIA 4WFFE 2XG9A 2WXRA 4AB4A 1FVEA 2X6CA 2CBIA 3QKZA 4XVTH 1MFDH 3BPNB 3BLIA 3RUGA 5C9JA 4PJHB 4OGZA 3JVAA 5KTEL 3ABKB 3T71A 2I9TA 1LP9B 4F0LA 2E9LA 1ORSB 5FKAA 2DEPA 4H8HA 4GRWE 4YPGA 5IROC 3G5ZB 1HH9A 2ADYA 4H4NA 2YD4A 5GGSB 1GYVA 4C4KO 4AZ5A 2BDNL 1IKNA 4NHVA 3BUVA 4N8VB 4FALA 2VHLA 3FZUC 4AWSA 4I7WA 4HULB 1MXSA 2COQA 3TR9A 3NSFA 5T91A 8A3HA 4Q8VA 1BYBA 3VDHA 4J6RH 2EVJA 3VPLA 1W0VA 4Q8WA 4JQVC 4OZIA 2PRLA 3GC5A 1OD0A 35C8L 5I17B 3QGVA 1YCSA 3OGSA 2VR8A 3MTWA 3W7LA 4TXEA 3L4WA 5AVYB 4Z7VA 4RMWA 2CQVA 1DKWA 1MRCH 5E6YA 1REQB 4X6CE 3V4VL 2IVFC 1NFAA 3HVDA 5IK3B 2C13A 4JR9H 1K9DA 4XNQB 3HFFA 4Q8OA 4U0RB 3LRSB 2OX4A 1N5AB 3SE9L 1E4WH 1MRDL 2FZ3A 1NDWA 2R69L 1F45A 3QYCA 2C1PA 1INDH 3UETA 2KYIA 3DTDA 4KW2A 5IBXA 2F53A 4UV7H 4ZFGH 4P57B 4Z6AT 3KXQA 4HUUA 4BQ8A 1BVLB 4PFMA 2TPSA 4NQCA 4ZL1A 5I77A 5KUKA 4DH2A 5H37H 1JGVL 4HS6B 3WGVB 1HCVA 1ZGLP 3H0TA 1P7BA 1DLHB 4KCTA 2VJ0A 2F5BL 2NZ1A 5D96B 1V6YA 3W01A 3HHRB 2VSCA 1RK7A 3R0MA 3KWUA 5BRQA 3RTQA 1TJ1A 1DQMH 1XLCA 3ZSTA 4R88A 3QULB 3HC0B 4MD0B 2IW0A 4QG9A 5C0FA 1DVXA 4ONGL 9CGTA 1FN4B 4OJEH 3OZMA 3DMMC 1TQVA 3NFSH 3SY0B 3CMOL 1AS8A 5FF6B 3NIFE 1HHJB 3G1HA 3VZZA 1TVBB 1UOLA 1XLMA 4AFYA 1MNZA 1TCDA 4MZ2A 4G11A 5C0BE 5G1TA 4XCFH 2EACA 1HFUA 4GUHA 1XS2A 3TBYB 1VSCA 1C91A 1VFOA 2VL5A 2J6XA 4GY4A 2DQDL 4TSBL 2RIKA 3HTLX 4XCCH 1EFXA 4BCEA 2OFJA 2E75C 3MKKA 2J55A 1EV2E 3F3HA 3LMJH 3KLHC 3T4WA 4DAIA 4DJDC 1QLFA 1UM4H 1CGYA 4PJIF 1BFOB 1UYWL 1VLWA 1ISXA 2CDEB 1EGMA 1WSST 5I6SA 3MV9D 4FXKB 4MVBD 4J2XA 1G7MB 3VCLA 1BZ7A 4N5ED 3ASWA 5DUBB 2WZAA 3WNJA 4F9LC 1FBIH 4WTZG 1GYAA 1SQMA 1HE8A 4F3FA 1EJ7L 4ZX3A 1UWAA 5HHOD 5GNXA 2YMOA 5ECUA 1RK0A 4B9YA 4XP5H 5AZUA 5EYWA 3IIVA 1G67A 4QTGA 1ZDQA 4YR6A 4W4QA 2WIMA 4R9XA 3UWUA 4O00A 3N18A 3HMWL 3O0FA 2H45A 3EJQA 3RL2A 4NASA 4Z7UE 5CJXA 3UEZA 5F1NA 1URIA 3LQAH 3NQEA 5DT1H 4GG9A 1DO5A 2F1EA 2OMNA 4R6UA 4F0HA 2J7GA 4N9DA 1GEQA 2VGBA 4Q6KA 2V37A 2WD0A 2W92A 1M2OA 1S9XB 4PG9B 3U9WA 3F04A 4I88A 4NM4L 2J1XA 4BUQA 1IIIA 2B1AH 3RGHA 3EA2A 3C2RA 3EWXA 4EXAA 2AK1L 3RFRA 1KKOA 1QYGL 3FL7A 4A3YA 3FDWA 5BRPA 2Z8VC 4S10A 5TF1H 3V6OA 3L1EA 3T3PF 3ZE2F 3QJXA 3GIZL 4QXGH 4ZX6A 3BV7A 4PEKA 9RUBA 4X0VA 3VKCA 2CESA 3BIKB 5I66B 1IXPA 4LSVL 3IBOA 4CQ8A 4YS4A 3ZYOA 5E00B 1UMYA 3QCVH 1KXVA 1XRVA 2VWTA 3K7UA 1C16B 3D0VB 1A4JB 5LIKX 4HWBL 3LV5A 5A6BD 3B2XA 4ERSH 4C6PA 4FO4A 3OMZA 5G1YA 1KJ2B 5DR5H 1FC2D 3AB0B 4GJTB 4M5SA 3T1FB 2DPEA 1R2RA 2GBTA 2WWDA 1YNTF 3NPZB 5F7FA 5G1MA 2NY1C 3Q2LA 4QS6A 3VWKD 2ZADA 2IBZY 3FYEB 1AQHA 2QL1A 3CV7A 2VDNL 4GKNA 1IQWL 4NOFA 1LWJA 2PURA 2PYEA 1TTUA 4POZC 2B59B 2OSLA 1KGJA 1MLBB 2EUZA 3F2LA 3TEXA 6XIMA 3D4ZA 3RQ3A 5J11B 1F73A 4RXFA 3RO6A 3RVXD 2R2BA 4I9TA 4JFXA 3AM8A 4MHHG 3QYNA 3GRWH 3AITA 4WUUA 4P5UA 3TWCL 4OAWA 1X5IA 2VMJA 2GK2A 3IGUA 3DBPA 3WKMH 5FKPA 3AUWB 2DWDA 3IEAA 4PQXA 2VDPL 4URKA 4IMGA 4PFEA 3PU7A 2DKSA 5DUMH 3IMRA 2PYFA 1EJTC 1MIML 3PWGA 3OAUH 2G5WA 4FLOA 3QAZB 3TVMA 2FBJL 3VGFA 3F5WB 1JI2A 1U1UA 1GH7A 4RDQG 3GT6A 3GC2A 3ZMNA 3MV9E 5DDHB 3ZYIA 1RUML 1TZOA 4LDOB 1O7AA 3PG2A 2DQJL 3IS4A 4OCMC 5C3TA 5TE6H 3MCG1 4BR1A 4MNHA 3P4LA 2PDBA 5IHZA 5CUSH 4ODXA 5EZIH 3RX3A 4CSTA 1AL7A 5C08D 1YPIA 1I7TB 3OJVC 1ECQA 5J5DA 3QG6B 3KM2A 3D4CA 1AR1C 1XFCA 2D7TL 5GZND 3PWPB 3KDMA 2V81A 2OT0A 4O02A 4MHBA 4M19A 1NSNH 2J7LA 5DEFB 1JNNH 2X3AA 3P3BA 1AMXA 4UFLA 1RJPA 4J28A 1UGNA 1UURA 1L9MA 1IGFH 4CW1B 2WMJA 2EADA 3HMCA 3ORWA 2Y5QA 3MRIB 2IGTA 2AL2A 5HYEA 2PD5A 2XWCA 2MNRA 1HL9A 1UVQB 4FXGA 1OADA 3ZIMA 3ZTJG 1CQKA 1R9ZA 3WQVA 1KULA 4WU5B 3Q2WA 4AQ1A 1Q7MA 1IZJA 4JVPA 1NIEA 2DM4A 1XVSA 1RFDL 3H6JA 4HS8L 1P7KA 4E5XG 3ESMA 1Q45A 3MYJA 2FSDA 4YLBA 4JPWH 3OU8A 3NYKA 3BLPX 3IJYB 3IJ6A 1F61A 4RMTA 5EMYA 2ZUMA 3O4LD 3SDDC 1KF9B 3KPRB 5AYTA 2UZIH 1IM3B 4OGQC 5G5DB 1EXBA 5KSAB 4M7SA 3TX4A 2ZP0T 5DHVA 4PMYA 4WW2C 3NIGF 1G9EA 4WO4A 1OB0A 3QUMB 4RFOH 3TAKA 1CR9L 2GFBA 2E25A 1FO0H 2BGQA 1K6QL 4YNYB 4YHKL 2VC2L 1W72L 5GS0H 2R0KL 3LEVL 2QVNA 1OVZA 1T6WA 4UDUB 1MCOL 1U3HD 1LEGB 3QIUC 5E99L 2J6EL 4G7SB 4OFCA 1G9MH 2JALA 1TJHL 3VIPA 1OTSD 1WITA 4IRZA 3IGAB 1GQLA 5F3BA 2GTQA 2ZXAA 4XZLX 5CHNA 3VW3H 2F54E 5ANMA 1OGTA 4NC2B 2LFGA 2Q7AA 1A5UA 1X7QB 1XCQB 1E6XM 1GHFL 4EBQH 3UBXG 4OGYL 3S46A 2BZNA 4URTB 4FR6A 1CFQB 3PIQA 3W1MA 4L3AA 3D39A 2YC1A 4OIIH 1N8FA 4BZ2L 1X9RA 4KCVA 1BA9A 5HR6A 2BHFA 3GWQA 2KDGA 1VFTA 3CH8A 4F15C 1L7TL 4QWWD 1C08A 5AVSB 2NQLA 4GMTL 4YO0A 2HZHA 1F56A 4YDMA 4E41A 4XNUL 3CASA 3ROOB 2P8PA 1GOOA 3NZ8A 3PL6B 3UYOD 3LV3B 3A4DA 1BM3L 1WHPA 2GBAA 3WJSA 3LVTA 1EBGA 5HPMB 1RBLA 4NNPL 3WIHA 2NW3A 4P9HH 4JRXE 4A2DA 4QRUA 3RMEA 3PUDA 3EADA 4M6ML 4A7GF 4ELMB 4AVOA 4NZUL 2J7CA 2KDYA 4PTNA 4WNQB 4J3OG 1A22B 1CGTA 4FTVA 4KC3B 4GI9A 3IUIA 1OX6A 4ZW3A 5AZEH 1A1OA 4L61A 2JB6A 4YWGH 1DLFL 1FPTL 3BPWA 3GRWA 2Q8ZA 2BNQE 4DYJA 2RR3A 1XFPA 1IE7C 5HY9B 2XWEA 1GK8A 4QRSB 3VRJB 1TEFA 2QQKL 3QQ9D 2HJLB 3ETTA 3N9GH 4HNUA 4YSRA 2OR9H 1ODUA 4YFDB 2G3XA 2IF7A 4A8RA 4PREB 1D5IH 2VLRB 3VG9B 3VFLA 2BNUB 4L05A 4AZCB 1ZL1A 3SDYL 3SSJA 4NPYB 2XSKA 4AEHH 5CNHA 5LAXA 5T3ZH 3UTTB 3HPXA 3IETB 3BG9A 4OUUB 3A67H 3M1ZA 5EOQL 2DI8A 4HUXA 5D70L 3TURA 3RG1C 1HS6A 1DCEA 5I5IA 5KMYA 2CKSA 4W88A 1SFSA 4DBUA 5T8GA 3EH1A 1XM3A 3RPTA 3SCMA 3FT0A 4UIMB 5SV4A 4Q22A 1E1CB 1HWGB 5IFTA 3VXNA 1G7IA 5CSGA 3GD6A 4HFWB 3TGXA 3BW9B 1XFBA 5FUCC 5I74B 2PETA 3TYUA 1I2RA 5JUVA 3WLNA 4KI5C 4FQ2H 5F7UA 4PS7A 2XRAL 3QUZD 4AMKH 4EE2A 1MZRA 3TASA 4LEQA 2V5RA 3Q48A 5CP7A 5B22A 1ALDA 3V5HB 4MLJA 2V5KA 3RY6C 4G7RB 4DGVH 3CNKA 1A8JH 5H94B 3HS0C 1IL1B 1TETL 3NJVA 4CADB 2I5GA 1YXCA 2VABA 1NIFA 1NANI 5I6OA 1I9CB 2V8MA 3SE6A 4H5SA 4ZS7H 2EKSA 2CWRA 3B8TA 3K1DA 4XPTH 1LEKB 4CMMB 3Q4DA 4UOJA 2X4UA 3D08A 3T78A 1EQPA 3QDJB 1AGBA 4W9ZA 1WCBA 1F74A 1SEQL 4WWNA 4GI6A 4PJ7A 2G50A 5DF0A 1QG3A 1S4IA 1KCBA 2W65B 1EJUC 4F0SA 2CDGA 3EOSA 4HWNA 5B1CA 4JUSA 2V63A 3IDNB 5DMJB 1GR7A 5EOCJ 4GE8A 3TT1L 2XWTB 5I1CH 1I0DA 4PJ8D 3MUZ1 1MREH 4QXWA 3W4RA 1HJBC 2C7FA 3HS8A 5M1TA 3L7EA 5DZNA 4KIRA 5F89B 1I31A 1ADQL 3FCUB 2GWNA 5CZSA 4WXZA 3T9PA 4DERA 4ZOCA 5JMOC 4MJID 2WJZA 3FQXB 1T03L 3D33A 1RJRA 4QJ3B 3CXDL 4GBXC 4OVXA 3H54A 5KVDE 5EKYA 3TYGL 1QVBA 2VZ3A 4IK7A 2YDRA 4U6YB 3QHFH 1BECA 1HO4A 3M0MA 4XXCA 2P5ED 2YXMA 5DJ2A 1O6SB 1V0MA 3NPVA 3IXTB 4X4YB 2GL5A 1KB3A 1RXLA 4MWAB 2HVJA 5ETUB 5SX4I 4IIDA 2O72A 2OG9A 1DORA 2D3VA 1QO2A 1K8DA 5KSBF 3MN8A 2D69A 1BQHA 1S7SB 2HPTA 2EZ0C 1VPOL 1DBKL 2GGGA 4PJIB 1XF1A 4M0XA 1PIGA 3MBEA 4IPJA 4YBHA 4OZFG 3QFJD 2IIJA 3AWEA 5B39A 3UCDA 3GH7A 2D8KA 1MSSA 5J1SC 2FB4H 1KTNA 3VI3E 1BZ9A 1RZGA 4MKSA 2F19H 3K46A 2HBXA 4FFVC 5ICXA 3HKZA 4UTJA 1CVRA 1U21A 1CECA 2IPUG 3SDXE 5DI8B 3N4AA 1OGSA 3IFPB 1HJQA 1JZHA 5IQ9A 2QR0B 3P54A 3WKNA 4A7SA 3GEFA 4YH6A 4Z95L 3C0LA 4O2FA 3D6GA 3EA3A 1EX1A 3B2PA 1JPDX 4JN2A 1FZKA 3PQYD 4ETQB 5D72H 4Q9RH 2WW5A 2BSBA 5CWSB 3AAMA 1U91A 3QXDA 3WK2A 1WZMA 1J0YA 3G5EA 2QUTA 3ICJA 3VFPB 3EOEA 3E5PA 1IGIL 5FWQA 3WH5A 1WAAF 3W1RA 2E27L 3D25B 3UTZA 5LZLA 1QNIA 4XXWC 2WNZA 2IC2A 3QJAA 4ALAL 3SCUA 4QDWA 4ZUVB 4UNTA 2HMID 4DVRH 3CYJA 4KH9A 4LYKA 5FYKD 4HQQL 5J4MA 2ESVD 2J1ZA 3S97C 3CVBA 3MGTB 3H9SE 3ZE2B 2NNRA 1C9WA 2BY0A 2NLJA 1ILUA 1GC1L 5HHXH 4HZMA 3GYCA 1UXSB 1ZPUA 8XIAA 3HB3D 2QVHA 3PDOB 5F0JB 3GXNA 1KGUA 4JN6A 2XVKA 5JHBA 2OJEB 5IVZB 3VOHA 5KSUA 1DFBH 1KBJA 4D6CA 5CH9A 4X7TB 4C5YA 2GQAA 5AZ1A 3U2CA 4HAKA 1O6TA 5I0WA 4ZZKA 4Z2IA 1EAJA 5GHWL 2XJ7A 4S3JA 3RDTA 5IMLB 2XQYG 3ETSA 1YNTB 2VXTL 3M8OH 1CLCA 3MMEB 1T89A 3L66A 2WPBA 1FIEA 3WBDA 3TMQA 4Z8FL 3GLEA 1XO8A 3OQ8A 4BQ2A 4Q6IC 4IIBA 3EX6A 4M7JH 2AXGB 3K4DA 4NRXB 2Q9OA 1JJUA 4MJIE 3U4EA 5I2UA 3W0WD 3GSMA 4JDZB 4JY4A 4ZMOA 3BL3A 5U7SA 3ARDA 5DU7A 4O11A 5FW6A 4X4XA 4MSSA 2FEEL 2R4SL 2NUTB 3O41A 4QJ4B 2H26A 4YSPA 2Z00A 4RMSA 4CU6A 4E9LA 1XWVA 6FABL 1TCMA 3QR1A 2CO7A 2CLMA 2IDUA 1H63A 1O7SA 3CAFA 2V68A 1BZDA 2VWEC 4IBYA 1OC6A 4OUEA 2R8SH 1NBVH 2G0WA 2X40A 3W82A 3KCWA 2QSTA 4XNMB 4LAJH 3S2CA 4TVPL 1XR9A 5FA4A 1EHKB 3DIVA 3GVVA 1CICB 1KCRL 4DK6A 5BOPA 1RV8A 4KDVA 3MCLH 4P5TA 4M4RB 1MFUA 4M62H 1YTKA 1AJ7L 2EUVA 3TJEH 2P1FA 3W0KA 2P53A 2XKSA 2FH8A 3N25A 3WX7A 2HFEB 3TYFB 4PRIA 2B1OA 1KFAH 4AZIA 2AMUA 1F6KA 4Z7QB 4MJ5B 4JEJA 1O5PA 4PV1C 3ZIZA 1GOGA 4IRJA 4PTUB 3HW7A 2ENQA 1ZHKA 2KERA 3TDFA 2ZQKA 4WW2B 1KR1A 3P0GB 4E6MA 1Q9LB 3UPRA 2IPTL 4YSAA 3EB3A 2X4OB 5F7BA 3K8LA 2GKIA 2Y1AA 3HMXA 3U5UA 3AROA 5B1JC 5I0ZA 1YMHA 3JXAA 1KW1A 5I1HL 2IKJA 1OAKH 2L0DA 3WD3A 1PAMA 4AZHA 3MUUA 2WKJA 5FB8B 3GSNH 2OGJA 1OCWH 2NY0D 3O6KL 5DEGA 3S36X 4IDJH 5HQLA 1GOMA 2HWZL 3O3AB 4FG2A 4BDVA 2N7BA 4PJDB 4I1PA 2EEAA 2HT2C 1SJXA 4OCXL 2ZPKH 3ANYA 4U6TA 4ZTYA 2F58H 2V5JA 1D9EA 4O15A 1OE2A 3ZDWA 1REIA 2J8FA 3K30A 1LK3H 5B7FA 3G9VA 2FJHB 1B88A 1WC7A 3AS2A 5DC9B 5AAWC 3FX4A 5JQ9A 5HJBA 5T1LA 3NIGB 1V6UA 1UWIA 1BJ8A 5D30A 1OM9A 3BP5B 4G5ZL 2YAMA 2Q20A 2PDYA 2R9HD 3SGKA 1KTBA 1HSAA 1QHOA 4BH7B 3U7WH 2DQIH 3BGMB 1Q6DA 2Y8VA 4FN0A 4FPSA 3ZXWA 3O16A 3KRZA 4PMDA 2DW5A 3LG3A 3V4VA 2APTA 5ABFB 1SXNA 1WK0A 2V2WB 1PZ5A 2VMCA 5HYJA 1XZ0B 1A6UH 2FVLA 4GAYB 4FERA 5FYKU 1A21A 2DMBA 1YAIA 5IB5B 5C0AE 2QQLH 2R69A 5EF2A 3TN0B 1B3YA 1KGCD 3TJ4A 2PTZA 4JHAL 3SYCA 3VXOB 3I9GH 2AGKA 1FORL 1Q9KB 3S98A 4TULH 3W7HA 2AP2A 2ISWA 3TF7C 5GRVL 4R84A 4KWOA 1AK5A 4QO1A 5T5NG 4TQHA 3TROA 4B5ZA 2DKMA 4Q32A 3PWJA 2JKEA 1RMFH 1DFXA 1XP3A 3QUYB 2E74C 4LDCA 3BSZL 4JJ5A 2BFVL 2AJ3B 4HX1A 4MNQA 3UWYA 4Y0GA 3VWJD 1AKJD 4F57H 3GI8L 3W27A 1O6IA 3NTCH 6PTDA 3TCLA 1NGPH 2GJXB 4EIBA 4XC1H 3LH2L 3TO4D 2G75B 1ZLSH 4K3DH 1J4EA 3O6FA 3IARA 4J12A 3P9MB 1EL3A 3RX8A 2ITCB 3RAJH 1NFDF 5TGBA 4G82A 4RZBA 3VH8B 3SBQA 3AQZA 3F5KA 2HT3D 2R1KA 4NFBA 4E4UA 1A3RL 1LDPH 4KMTL 4O58L 4AD4A 3ZR6A 3QJHB 2YPKB 4V27A 2RGMA 4QTIL 5ISZB 1TV3A 1VS1A 4ENEC 4LF2A 5H6HA 5CKSA 4UTWA 1TV5A 3I6GB 4ERAA 3L21A 4L9YA 3PGCB 2UXVA 1TQBB 1MCJA 4S39A 3HGRA 4C83B 1B2WL 3HNSL 3KEHA 3KG5A 5JMRA 3ULUE 4NZ4A 4YHLH 4JFED 4DP0X 2ZX8A 1EJ8A 3T2NL 2XACC 5BVPL 1GCFA 3P77A 3D46A 2XPGA 3OQEA 1YDPB 43CAA 1MZZA 2Y8UA 3HS0B 3N19B 4HKJA 2SODB 5T1JA 2NOYA 4Y7OC 2F0CA 4FA8A 4JPVL 3CC1A 1Q13A 3NQAA 3V0AC 5CLWA 3WJJA 3K0WA 4GI4A 1RQEA 3WFZA 3VGBA 2A9NH 2ZVRA 3FU0A 3RLVA 2VSMB 5JIQA 1XYLA 4UI2A 3RGVB 4J3OC 1IAKA 4M6PA 1QR7A 3NR0A 1OVDA 3KR3L 2HJFB 4OB5L 4NN6B 3UJTL 1DE4B 1T04B 4F1SA 4HU0A 1M42A 3WIIL 3QEHB 1WE5A 1BMWA 5FOBA 3PJSB 3MROB 4KFOA 4UTAL 3ABRA 3UF9A 4FQLL 1BPLB 1ET8A 3FTZA 4B95C 3GAYA 3NQCA 4XO3A 3SPHA 4H04A 4JX6A 4TQTA 2WO3B 2Z0UA 4GO9A 5CILH 3CDZA 3R7RA 5TK2A 1A9EA 2XXFA 4Z7WA 1DJSA 2ABBA 4QXVA 3QUGA 3L0GA 3ET9F 2R0ZH 3VXRB 4G7VH 4NI6A 1A6PA 1OK4A 1KGCE 3T8QA 2ATKA 2ZBTA 4YVVA 3GMOB 3QHTC 3E02A 2E46A 4I9AA 4JANB 3SHSA 5A2CA 1KNWA 4R96A 4HWBA 5KYXB 1J9QA 3LA4A 3B7YA 4RRPM 3CQIA 5GS0C 3L95A 1Q7QA 4P3DB 3VMOA 4XN8A 3HG1B 4L4PA 1JIBA 2YA1A 3TN4A 1G9MC 3FQUB 3EYVB 1KCUH 2ODIA 2AQWA 1JN6B 5BOJA 1FCQA 4R7LA 4I48A 4YZWA 4YZFF 5I03A 1L2QA 4NBXB 5CN2A 3QNXA 4DKFH 1QQDB 4LKXB 3M0IA 4JMXA 4ACZA 3AIBA 1DWIM 2VRJA 4O2EB 1J10A 4RWYL 1UZDA 1U8NA 3OW1A 2C9VA 3Q1SH 2CLZB 1E1FA 1X1NA 4AXKA 5DA0B 1TZ9A 2YK1H 4Q14A 1ZPLA 3SCTA 3II2A 1ANUA 3SOBH 4TRPH 2EAEA 3QIBA 3HFTA 3KVKA 3BN3B 5E9DA 1QA9B 1T41A 3FT2A 3T6QC 3UT0A 4S3BA 3H2OA 1I8MB 4P3CH 3U2ZA 3HBZA 3HE6A 1QVOB 3B40A 4Z23A 5BYWA 4A2SA 3O2DL 2IQAB 1M1BA 2Z7YA 5LG6A 1KPUA 1HL2A 1HL8A 5BRZD 3GK8L 3WOVA 1N3NA 2ITDB 3CAWA 4FXRA 3G04A 3SJVA 2WYSA 3BOXA 4JFEE 5SWSB 3BD3A 4UDTA 1EDQA 4FOMA 4HWZB 1YQVH 1P9MA 4YQXL 3V55A 1PB0A 3JUYA 1R3IL 3WQGA 2A74A 2DDXA 3S4SA 2OW6A 1QD0A 3FT4B 4LVEA 3WY1A 3F7PC 4GRMB 1UZ1A 5D2NB 4TTDC 2Q6ZA 3URQA 2YXXA 2X41A 4W7WA 1N6QL 4I6VA 3R06B 3ANUA 4O50A 4KKCD 4IMEA 3Q5YA 1TPH1 1ULVA 1TB3A 2V2TA 1IR2A 5C0GB 3ESNA 2OMZA 4W4OC 1SM3L 1LWRA 1IILE 3EOYG 2OLDA 5D7LB 1LUCA 3NCOA 4LVDA 4KUZL 3BSMA 3WTUA 5FM5M 2ZOXA 3GSQA 4DO7A 5JVLA 1KNOA 1UWYA 3P3TA 2Z6FA 3U4BL 3R8QA 1TWIA 4D0BB 3FMGH 2E9IA 1HILB 1XIFA 4X7SH 5L2KD 5TFSH 3CQQA 1I1RA 1RULH 4BEQA 2GBVA 3AMLA 4H1LA 4Z2GA 4WHBA 4KWWA 2NY3B 5I8CA 3MFGB 4FX5A 1ZBVA 1ZBKA 2PRMA 4BI6A 5FWRA 4FZ8H 3I6KB 1FA4A 4AIOA 2RB8A 4Y5XB 4Y5VB 4FQIH 2HN7B 4EUPA 3KPQB 1LE5B 5IBTL 4BK5A 1QXLA 4RRPA 4UT6H 5TE4H 1ZAIA 1BD2A 2DT1A 1N4XL 1T3FA 1C5BH 3F58L 1EBAA 4HC1L 4QRNA 4HZ8A 2EICA 2AQ1A 5DLLA 2NW2A 4DAFA 4J2PA 5JOFA 2XN0A 4DKAA 1XYCA 1KRCC 4XR8C 2YLAA 1W72A 3UY7A 2V2HA 3AT0A 2FL5B 4JZOA 2R1PA 4O2CB 5EU7C 1ZP3A 4KETA 4B92A 4UM9B 2M26A 2J6EA 1X1ZA 4KX9A 4XSMA 1W1IE 5IJVB 2OOGA 1WT5A 3HG0A 2BP0B 3H6OA 2YN3A 3D1MC 5CSZA 3O9WD 1ZJHA 2MSPA 5HWNA 3GGWB 1O94A 4OLVH 3MRMA 4EPEC 2TYSA 2H90A 4I85A 2OCJA 2Z25A 5J9PA 1HF6A 5IW1B 2HFFB 3QQ4A 4HK0A 3UO1L 3N9RA 2CRYA 2D03H 5I3FA 4W6XB 1S5MA 1KBKA 3X17A 4BZ2A 3NDZE 3F01A 3GBDA 3SIZA 3UR2A 3C5ZB 1MEWA 2Z0BA 3IKCA 2DYPB 4IT1A 4K8RL 3U8GA 5GJSL 2XVGA 3EFDL 1OARH 1WFTA 1MHCB 4D6EA 4ZFFA 1EO5A 2RD0A 4OV5A 2IMMA 3KRSA 1HT6A 5CPQA 2HLAB 2EPOA 1H09A 4U6XB 5IBUB 3PJUA 4S1SH 2OXHA 4MAYC 2NWRA 5CN3A 3BKCH 1LD9B 2ZWYA 3EKGA 3QG7L 3GZ3A 3V4LA 1TYRA 1GJIA 1A5BA 2PXYC 4R9OA 1S8DB 3ALFA 4G7YH 3WD1A 2R14A 4AI7A 3HFYA 3R1ZA 3S37L 3UX9B 3DO7A 4JREC 1KC7A 5E6IB 4LP4A 4KNTA 3T0EC 5BS0A 3LEXA 3QZWB 1SVDA 1ZU8A 2RDUA 4PRAA 1MI5A 4LVNB 3BH9A 4PMRA 5AB1A 4AMCA 3D0AA 2R27A 4OR1A 2X09A 1CD1A 1NKOA 3GBMH 1H60A 4AT6B 3QISA 4J4KA 5GIRB 4HA4A 3WUZA 4U1JA 4Y4FC 3KZ8A 3E2HB 3Q65A 3M43A 1IE4A 3HBQA 4A35A 1U33A 3GS0A 3N2JA 4Q9BA 1UP0A 1QR4A 4DVBB 3W9DB 4HKPA 4NU7A 4MTMA 4X8JA 4Y19A 3C9NA 2Q86A 2GVLA 4JFDD 3TYZA 5B3SB 1I9JL 1WLHA 4M9PA 4HB7A 2JF7A 5A8PA 3NAVA 2LT9A 4NZTH 4CNSA 1D5ZA 1RPUA 2R29L 4MB4A 4RBPK 4JTHA 3QCTH 5L2KE 4GAJL 4YDLB 3H2QA 3V52L 1S5NA 1EJ6A 1Q63A 4LNYA 4WSKA 5DN1A 3U30B 1TT6A 4MS8D 1EDTA 4YDJB 3F4WA 1VCAA 4I2XE 1F90H 4OD3L 4GQ9L 5AUMA 1I3GL 2AQ3A 5D7EA 1KFEA 2XPZA 3OWRA 3CFNA 3SDXA 2CETA 1B4JH 4P2OB 1MUMA 3SUTA 3AFBA 5K5YA 3QI9A 1NZRA 4U4BA 4NBYB 3DI0A 4Y1AE 2WHVA 1FOBA 3ZHDA 3C60A 4Q9CA 3TA9A 4HIXH 3FS9A 3FTXA 1VADA 4M43H 3UG8A 3CMFA 3C6LD 1DUZA 2VZOA 1V0NA 1W3IA 4WI7A 2PLJA 5AYUL 1S9KC 3JYBA 3WQCA 4XVJH 2V9UA 2YOAA 3F5JA 3ZRSA 4ZQNA 4G6KH 1AZ1A 4JHWH 4LASH 2BSDA 4U7SA 4OQVA 1WBJA 5LBSL 1XMWA 3PWLB 1MRFH 4M03A 1DWFM 2H8PA 3ASOB 4MS6A 4JPIA 4V2BA 4HBCH 3P9LA 5FEPA 5I75B 4XPAH 2FWOA 4LJ3A 2WJ5A 4ZFMA 4UT6A 3WEAA 4JQXA 1F6FB 2GK0B 4DN1A 1ZLPA 4AH7A 2ZP8A 2HSIA 2PP7A 4DNHA 1F18A 1F6PA 1ADQA 5CGYD 3CGTA 3B9NA 4AG4H 4OECA 3U2OA 2J57A 4PJGE 4QR7A 4O02H 1ONWA 4PTTB 3BPOB 1JGUH 1A3XA 2PTDA 1NFDB 3HPSA 1YC7A 2NTFA 1SOSA 2WIIB 3STZA 1TVLA 1EVUA 5HYQA 4X0KB 1FL6B 2XN9D 2CKRA 4MDJB 5AW6B 5K9JH 4XRCB 3DBXA 2OWWA 1E9LA 5I1IL 1TZHB 1M01A 3A12A 5JOPE 4C4KT 1ZT4B 2NTSP 5E9XA 4FLHA 5BROA 1SZEA 3PAZA 2R91A 1Q72H 5FXCH 3MMWA 4QHRA 1QR1A 3H4WA 2YCIX 2P8BA 2EXTA 2IGFL 3ZLQC 1JJKA 4X61A 5D6DC 2BS9A 3KAAA 2DZPA 2A6KA 2PTWA 2PWUA 3PP7A 5FC9A 3GMMA 1ZAHA 2WAHA 3QCUL 3G1XA 2WANA 4Y4HC 3HI1B 5IFHH 3C5SB 4YSSA 5F1IB 4PB3A 3OKMB 3S0CA 1N7MH 3L08A 5CCHE 3RWFB 5E2WH 1BJ1H 1FLTX 4ZAKA 2GJ6B 3S5YA 3GBNL 5DHVH 4HUWA 5MEOB 5D7SL 3KP0A 3ZHKA 1KM6A 4R7WA 4A2RA 2QCCA 3S9DB 5D2XA 5K93A 4HT1L 4C6EA 1ZTXH 4R7XA 4HS3A 2P5WB 4O16A 3ATYA 4KERA 2DQCL 3A4XA 5I16B 1ROWA 1NEYA 4MA1B 2R23B 2IQ0A 3BXNA 1TKWB 4LY8A 3FUHA 1YTEA 4L3CA 4A8NA 4BKLA 4YHNA 2FUTA 3P0VH 3MRQA 4MAZA 2F5AH 4M6AA 2Y6TE 3CPRA 1TG8A 4IRZH 3ARGB 4DP4X 3D3VA 3O0KA 1JTPA 2I5YL 5E8NB 5L4FA 1OAQL 3VDBA 1H3TA 5H37G 1UWEH 4E9RA 2WGNB 1G1KA 2N7SA 1TV7A 1VZIA 2XWXA 1QFWI 3KOFA 3WQFA 4ZUSB 3HUJA 4B3KA 2FPYA 4DZBA 3T5WA 1F4HA 3B2UC 4ODTH 2NY4B 1EJOL 4LVAA 3MSDA 5AL8A 3FV9A 4QS5A 1X98A 2PP1A 3CXFA 2WQSA 2ONEA 1SPQA 3ZU8A 2DM7A 4C55A 1X5LA 3ERXA 4LUYA 1XLFA 4Y9MA 3GG1A 3UJIL 1P84J 4L65A 1YYML 2J7BA 2W0PA 4MSWB 4YDVB 3VKBA 3T8XB 2I57A 4I3RL 3B06A 3DXAB 3WIHH 4GY1A 4UM8A 5DLCA 1QATA 1XGYH 1S78C 1GOQA 4A2MA 4LHUA 1OB1A 2Q8XA 3CZUB 1PG7X 3QJOA 4F7PA 2RACA 1AGDA 1JV2A 3QAQA 4LS0A 3CFEB 4L1LA 3ZFHA 1OD8A 3IT8D 3FXYA 5DS1A 3KJ6H 4XOEA 4Q0XH 4ZS6C 2Y25A 3CLFH 5ERWA 3VM7A 2NUXA 3T3ME 4M7LL 2ZXGA 4JFYA 4X5RA 1MO0A 5F7NC 1W8OA 1H7RA 3NWRA 1HSBB 5HUOA 3RNDA 1ZGLM 3DH7A 1A5FL 3Q05A 3BH8A 4HOMA 5DRZB 2IV8A 1VACA 1CX9A 3MODH 4RR4A 3OKYA 4HLJA 4WDIA 4X7FC 3WNNA 4F0KA 3BEWB 3F7JA 2KLSA 4G43B 1P4LA 4NJGA 4DGIL 2ICES 3FCTA 1ZLUH 1HJCA 1DQTA 5DJXA 2W6RA 1A25A 2HK0A 2JWYA 2OEJA 5JPNA 3NCWA 1UA7A 4E36A 4GIOA 2IPWA 5IB2B 1TPXC 3L7FB 5HHOE 3RVWC 5KVEH 4S23A 1WICA 4ONVA 4Z7QF 5FW8A 2ZOTA 4P7NA 4TLUA 3WDJA 1JPEA 5EWIH 3TNBA 4PU2A 2EKJA 4NQVB 2PPAA 4LAKA 1NDGA 4WW2F 2GEQA 4FNLL 1LLWA 3DJ9A 4BGLA 2EC8A 1XIMA 1B3OA 4JFOA 3W1TA 5BV7L 3MR9B 1NFBA 4J35A 1JNDA 2HG0A 5A6MA 1QEXA 3EGXB 1SXZA 2G8ZA 1XD0A 4F20A 2V7NA 4IRSC 4LDLB 4C6KA 4KY1L 1DL7H 3LZLA 2CLVB 5JHDD 2W67A 2D2JA 4IMKC 4ZXOA 3MTXA 4E5TA 4C7DA 1X44A 4OU3A 5CR1A 4UNLA 4LO9A 2FJGA 2PCPA 2WAGA 2X3CA 3W7QA 1HTYA 1HOCA 4ETYA 4PJDF 4AWTA 4R26L 3UTSA 1MQKL 5D4IA 5KANI 1W1PA 2A4ZA 1DZBA 3GXIA 3DFQA 3N4FA 3O3RA 2XV6B 4BFEA 5ITBH 2GGJA 1PMYA 4IHBA 4IBVA 2NY6B 2XV2A 4QGYA 3DV6B 5F6HJ 2QPEB 4NAFA 3JW7A 1CFTA 3KCPB 1BG4A 4U31A 4Y8EA 3V1HA 4ZOBA 3FYIB 4L8DA 3PTQA 2E1WA 4GVFA 5DHEA 4NO0B 2YBGA 2NX1A 5HYSA 2CRIA 3GHEH 2YBUA 3BIBX 1E8ZA 4JQ2A 2OQJB 3MI3A 4K2UL 2OTUB 2V2XB 2QGYA 1SO5A 3DJZA 4XMUA 2PRHA 3NSXA 3PJTA 1AO7B 2WNGA 2JCCA 2PP9A 4R4BB 1RJYA 4MD4B 3TZNA 4D7BA 1GT8A 2ZNXA 5TNVA 1LK2B 1SYSB 5AC5A 4QHKI 3GUTA 1E0TA 2C4XA 1QSED 2PCYA 4KQ3L 4XVEA 2YN5A 2UWFA 1PWMA 3UYPB 3QJUB 3GKAA 3UWVA 4MAYB 1I3UA 1W3LA 3SDCA 1DVTA 2X53A 4O51B 3ZUNC 2P76A 1KN2L 1NH6A 5DT5A 2DFAA 5C54A 1ZGLA 1YMMA 4EQ3A 2UUDH 1IGJA 3PZGA 4KXZI 4WCYH 3X1GA 2N01B 4BFFA 4HHAA 1C92A 4UQ9A 2DMCA 3RE0A 1KIQB 4KK5D 2ZA2A 4PHXA 4HN8A 4AC4A 3ZWTA 1SGKA 4YHML 4ICCX 2VUNA 1T2QH 1XH2A 4MFHA 2CD0A 3EH5B 4HALA 1Q6CA 3REVB 1U8LA 1I4FB 5CJ5A 1A7PH 1JPTL 3EKCA 2YB4A 4B41A 4QLLA 3EXJA 5AG8A 4RFNB 4YC2B 5BW6A 4MNGA 1UJ3C 4XPGL 3POHA 4Y4FB 4PJEB 5G4WA 1KYAA 3UP6A 4IFKB 4FQ1H 1M7UA 1R30A 1R0AH 2XOTA 4ONFL 2NR6C 5E70A 2YGNA 1V27A 2E4TA 1I2NA 4L2YA 2EIMB 2CLEA 4LC8A 3T7VA 4AW4A 5CD5C 5AALA 1TVHB 2DQWA 2X89D 4ANVA 4U4MA 1TJIL 1FDYA 3MLTB 1E4NA 2PW1A 5CAYB 1L9TA 3EXLA 3HC4H 5C08E 3MO7A 5KVDL 5F7HA 2VGGA 4CGUB 5IFJA 1GYWA 3KL5A 3IB4A 4KIEA 4GEJA 2NY2D 3A4AA 3MGOA 4KI5F 4U7KA 1RURL 3UWWA 1JRCA 4LCIH 1GNXA 4PW9A 3RDJA 3MUAA 5DZOA 3CHOA 4X5WA 2NY7H 3U46B 2KT6A 3OKNB 3LYRA 4KKAD 2QNEA 1A7OH 4MJ6B 2F74A 3W38A 4OUIA 4KJPD 1G7VA 1IKNC 1GGOA 1B3VA 3OG6B 1GZPA 1KTDB 3SYAA 1QX1A 2D0HA 3D2UD 3NSCA 3OC8A 2OR2A 3S7GA 1CDJA 2QQNH 2YA0A 3FHEA 1AUSL 3OF6A 5HDRA 1VKFA 4QLJA 1AH0A 2WJDA 4FEMA 3FFCD 4H25B 4U5KA 4GW1A 2Y1VA 1U1JA 2AXHA 3N6HA 3O4LE 5IQOA 3ME3A 3AXLB 4KRLB 1OFOA 3ABSA 2WLJA 1V3MA 5JLZB 1G4TA 4D6JA 2Y3AA 4O9HH 3EGSB 3IXAB 4CC4A 5IBXC 2MQCA 3ALPA 4J2QA 3RY5A 3S1UA 4K3HA 5F9DC 2JKNA 1RZFH 2QPFA 4PRPD 3WFAA 5I3KA 5IFAH 5A6AA 2FYYA 2BCKA 4QXIA 3DMMB 3CD4A 1BQHG 5HGHB 4G9DA 3ULVH 1QUPA 1JGDA 1NCOA 2GWGA 1DBJL 3EOBA 4PIRF 5TH2A 3I6RA 1L6WA 1XH3B 3VRLF 1QSEE 5DA4A