1LF1A

Crystal structure of cel5 from alkalophilic bacillus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
298
structure length
296
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGITVFRAAMYTSSGGYIDDPSVKEKVKETVEAAIDLGIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWDNQIKPYAEEVIPVIRDNDPNNIVIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cel5
publication title A novel combination of two classic catalytic schemes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 109
structure length 296
sequence length 298
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lf1A00
1H09A 2CITA 1BGGA 1EHNA 3AFBA 2FGZA 2VI0A 4MB1A 1LF1A 2AOSA 2IXVA 1W1PA 2BHYA 1ZB5A 4LYPA 2J78A 1RH9A 2EEXA 3NJ3A 4J3WA 1HF6A 1V02A 1K9DA 2UWFA 5DT7A 4TVCA 1IV8A 1V0KA 3PZ9A 1WE5A 2D2OA 4DM2A 4A3HA 5CXPA 1PZ2A 3T2PA 4J27A 4CN4A 4OJYA 4P7RA 3HJEA 4QLKA 2WCSA 4M24A 2VVSA 4PCSA 2WMIB 4GZJA 4FMVA 2VO5A 4ACYA 4CCEA 1WZLA 2ZWYA 4DUVA 1HX0A 1BYAA 2CKRA 1VJSA 3WEZA 4W7VA 4PMYA 3N17A 5JIWA 1XHGA 3GM8A 2WBKA 3WQ5A 2W5FA 2CBIA 3OBAA 2E0PA 5CGTA 4AZGA 3OGSA 3WH7A 1JDDA 2XYLA 2OWXA 1V3MA 1W2PA 4HZ6A 4HPHA 2FDMA 5HPOA 1J10A 3QHOA 1UQYA 4HMCA 2D20A 3WDJA 2DGAA 2XWEA 2WHKA 1UZ1A 3VO0A 1E6PA 4AEEA 2IUZA 1JD9A 3ARYA 4HMDA 3OB8A 4CN6A 1OBAA 3BSHA 2WMIA 3AROA 4LPCA 2CIPA 3MKKA 4GO9A 1UD3A 3OIHA 3SCVA 1E6QM 3BC9A 5KZ6A 2CERA 2DSUA 2EXOA 4AD2A 4DUXA 5IHSA 3QHMA 1CGUA 3T09A 1EGZA 1WDRA 3ALFA 4AD3A 5CSUA 4AY1A 5F7UA 2F61A 1W9VA 3WNMA 5E6ZA 4HU8A 1B2YA 1J0HA 5EMYA 5BCAA 2Y8KA 4XX6A 2VURA 4QLJA 1UR9A 4CD8A 1VFMA 3D3AA 1UH3A 2XPKA 4MNKA 3LPOA 1UR8A 2ZXAA 3ARWA 4JFUA 2GVYA 4PMVA 3VVGA 3L2MA 4AD1A 1OCQA 3CUFA 4QCEA 5HPCA 1JXKA 1UKOA 4NF7A 4RE4A 1OGGA 1QHZA 1OSEA 1W3LA 4X0NA 4D6FA 1MW1A 3GXMA 4GZIA 1PIFA 5GQBA 1E70M 1W9PA 3AHXA 4ZENA 4MDPA 4TTGA 1MWOA 2A3CA 1M53A 3AS2A 3L4WA 3MSGA 3AS1A 1HJQA 1K9FA 1N82A 1TMQA 4W5ZA 5I77A 5I5RA 1PBGA 1OINA 1KXQA 4JKKA 5CLTA 3AZRA 1UH4A 3EMZA 1GPFA 4OZOA 1E4NA 1R86A 4CKQA 2W61A 2CESA 2BHZA 3QGVA 4Z2IA 2Y24A 3DHUA 1BYCA 2YBUA 4PMDA 3BAXA 2V5CA 3ARTA 4AMCA 2V3FA 2UY2A 1B3XA 2W91A 2XVKA 2X8RA 4HOZA 3GXDA 1HNYA 2VR5A 4PEEA 1GQJA 1W9BM 1GQKA 1ZBKA 1FA2A 1ZL1A 1PX4A 1VEMA 2X05A 2WMFA 5HDRA 3BMWA 2VRJA 4GIAA 5LA1A 1M01A 5C8BB 2TAAA 2X09A 1J12A 4QDMA 2FHFA 3WD3A 1VEPA 1CXLA 3F4VA 4HZ8A 3AIQA 4W8LA 3VGFA 1UKTA 3VD5A 3QOMA 1DWJM 4JIEA 1EOMA 2QPUA 3QHNA 4GINA 1UWUA 4UQAA 1JFHA 1WDSA 5GNXA 4KRUA 3MUIA 4ML4A 1JI2A 1KCLA 1VEOA 1E4LA 3ZOAA 1JFXA 3OLGA 1UH2A 3VD9A 1BSIA 1CWYA 3W25A 2YKKA 4LX4A 5BWFA 2WVTA 1OB0A 4J28A 4QP0A 1KQZA 2EPMX 2FHCA 3NDYA 2WVVB 1ISYA 2WZHA 2J79A 2O9RA 2VQUA 4H8VA 1AQ0A 3K1DA 3KZSA 1GNXA 4PMXA 3RIKA 3AHYA 5D9MA 1D2KA 5A1AA 3WSUA 4AD4A 1R7AA 2WSKA 1MW2A 4JKMA 1NM9A 3BMVA 4CU6A 5A8NA 5A6BA 3KE0A 2ZX7A 4CCDA 2VZOA 4QFUA 1HKIA 5ABEA 1FFQA 3VNZA 2X0YA 3KEHA 1E6SM 4OBSA 2WPGA 2EPLX 3AIUA 3WEOA 2VUYA 4QCFA 1F4AA 1H5VA 3VUPA 2D0HA 1A3HA 1E3ZA 2WZEA 4L4PA 3U5YA 1XRVA 2J75A 1BTCA 3ARSA 1CGTA 1XD1A 3IAQA 5CZKA 1JZ7A 1UG6A 4WKHA 6TAAA 1E71M 1WAWA 3ZIZA 3M07A 1HT6A 2ESCA 2WSPA 3ZSTA 5FOOA 1UA7A 5EB8A 2O92A 2WK2A 4GI8A 1H1NA 1NOFA 1J9YA 1UWTA 3CZLA 3WFZA 3ZO9A 1ECEA 1WNOA 4HA4A 3WBAA 2Y5EA 1V3KA 2XUCA 2WHJA 1X6LA 2WANA 3IK2A 5M17A 2WMHA 4FLRA 5A95A 2RGLA 3A4XA 4U33A 1V3LA 1XYZA 4B9YA 3WH9A 5A6LA 4PN2A 2DIEA 2XVGA 3TTQA 1XH0A 5HOSA 4N42A 1ZU8A 2GK1B 1E73M 1ITCA 1JDCA 5BROA 5IFPA 1J0JA 3VMPA 4AZ6A 5AY7A 3W28A 3BCFA 1E5JA 3WNKA 4W89A 4W5UA 5IFTA 2XIIA 1QPKA 2WLYA 3MV11 4ACZB 3N15A 3GXIA 1LQ0A 5FL0A 1HKJA 2PWHA 4D71A 3TA9A 3UG4A 4UCFA 1CGYA 3AS3A 4CGTA 2VCAA 1KFWA 1R87A 2FHBA 4CVWA 2DEPA 1GONA 3IAPA 5BXPA 2VX5A 1R85A 3HMCA 4B9ZA 4PSRA 2YL6A 1NOUA 1W9DM 5A8OA 3GZAA 2J7EA 1H11A 1WPCA 4H8HA 1E6XM 4M8UA 2O9TA 3PZTA 5CQ1A 1TVNA 1H0IA 2GK1A 1HJVA 3U57A 3CTTA 2J7GA 1C8XA 1GVIA 5CGMA 4EANA 3NYDA 1PAMA 2V5DA 4KGLA 3A4WA 1KWGA 3T0BA 2BXYA 3NUKA 5ABFB 1TFVA 2DT1A 1KWKA 4UQEA 4R5EA 1E4IA 3OLDA 5I3DA 1PJ9A 4UFIA 2VNCA 4XZWA 1D3CA 4DWSC 1UA3A 3CZKA 4UQCA 2GJPA 1LWHA 2J7BA 1UWQA 3EMQA 1ESWA 3WF0A 1JNEA 3AXHA 6A3HA 3ZJ8A 1UD4A 3N04A 2G3NA 1H3GA 2WBGA 4MB4A 3BXWA 4YHEA 4IISA 3ZMRA 5EBAA 3KL0A 4FLOA 5CSYA 1HJSA 1GVYA 1P6WA 3M46A 1KR1A 3TTYA 3UERA 3VX1A 2CKSA 2ZX6A 4PUDA 4D6EA 5ABFA 1UWSA 3WNOA 4W84A 3N12A 1J0YA 2ZX8A 3I3DA 3CZ8A 3MUZ1 1PIGA 1KR0A 3VDHA 2YA2A 3O6AA 3B9DA 5HBFA 2ZXQA 5D9NA 3LPFA 4PTMA 1KGUA 4RE2A 1QI5A 1MW3A 1E6RA 3B9EA 1E56A 3PZOA 3VIOA 2DT0A 7CGTA 1CXHA 4N0RA 3RM9A 3WIJA 2ZUSA 5JIPA 3AJ7A 3WNNA 4PMRA 4U3AA 4RE3A 3WMCA 4WSJA 5DF0A 3DC0A 3FN9A 1E72M 1OT2A 4E8DA 5IXEA 2OSXA 3WELA 1QNSA 3VD3A 5ABGA 1UZ4A 5D8WA 4ATDA 1OD0A 3CZGA 3AXIA 1B30A 1ZBVA 4GQQA 3VD7A 1OGSA 2VZUA 1BGAA 2OWWA 1J01A 3MUY1 4BS0A 3TTOA 1H49A 1K6AA 3OZOA 4KMQA 5E09A 2D24A 3K4AA 1GW1A 3WQVA 4C7GA 1BG9A 3PZIA 3L4UA 3II1A 3WF4A 1KGWA 3SUSA 2VVNA 1J0ZA 4J3UA 2JFEX 1OIFA 1BFNA 4V27A 1JF5A 5FD0A 1GCYA 1Q6CA 4UFMA 4ZE5A 4GKLA 1IZJA 1XCWA 4HPGA 1C8QA 3UETA 5A8QA 3W6LA 2FH6A 3OZPA 4M80A 3CZEA 1FHDA 1QI2A 2CNCA 1MVYA 3WQ4A 3MU7A 4F8XA 2XM2A 5A8MA 2PI6A 5EFDA 1EIBA 1E43A 1UD6A 3WD2A 1JYNA 2C8NA 4WF7A 4M81A 4AW7A 1PX3A 2PF0A 1U33A 2VRKA 1LJYA 3AI0A 4S3KA 1V3JA 4P8VA 2GJXA 1XSKA 3U7BA 1Q6EA 1J0KA 3WMSA 1V6YA 1OT1A 3CMGA 1X6NA 3TOPA 2XFYA 1BF2A 2ZX5A 4U5IA 1UD5A 4KH2A 2DH3A 1M04A 1JYWA 3WUGA 4PUEA 5BRPA 3VGEA 3AIEA 3ZT6A 5HXMA 2YLAA 6CGTA 1H4PA 3RO8A 4S3JA 5A6MA 1TVPA 2VTFA 3QOKA 3WD4A 3U5UA 2ZUNA 3AMLA 3FXYA 3CPUA 4Y7EA 3W29A 4DM1A 1DP0A 2WMKA 2WVUA 3WNPA 3WFLA 1VRXA 1RP8A 5I6SA 1VAHA 3SURA 3DYPA 1MYRA 4UOJA 1HN1A 2XTKA 1EXPA 3CUJA 4ZXOA 2J47A 2VOTA 2G8ZA 1UUQA 4MDOA 1CECA 2BNJA 3T2QA 4ZE4A 3SCPA 1OGBA 1QI0A 4WKAA 3DYOA 1V6XA 3VNYA 1GOWA 2ZX9A 5FIPA 1E55A 4HOXA 3UR7A 1JZ5A 1PPIA 1DWIM 3ZSSA 1FP8A 4JL2A 3RMEA 2QMKA 1JYVA 5A6AA 1NQ6A 4JAWA 2UY5A 1JYXA 2W62A 2BV9A 5GNYA 1UHVA 4D72A 3CUHA 2WKLA 4JCLA 3PZVA 3WMBA 1EO5A 2CBVA 2QLYA 4FLSA 2W67A 2VR4A 3MMDA 1FFRA 1PX8A 4D6CA 1EQPA 1RP9A 1WDPA 4AZ5A 4BQ3A 1CENA 1V0LA 5D4YA 2WWDA 1DEDA 4GXPA 3PZGA 2VX6A 3VIPA 3O9NA 3VD4A 3VIKA 2DT3A 1W1YA 2CYGA 3M7SA 2ZIDA 1CPUA 4AWEA 4MNMA 1YQ2A 5E9AA 4WK9A 2WZIA 1NH6A 1OIMA 5DFAA 2WHMA 4M29A 5CPTA 3WH6A 3ARRA 2GFTA 4UNIA 2DDXA 3POHA 2OLHA 4P7LA 4MJ4A 2J74A 3EDJA 4UOZA 3VTRA 5M5DA 2J7CA 4A3YA 1BQCA 4NRRA 2YL9A 1KBKA 2WXDM 2YL5A 4OOZA 1CTNA 1CGXA 1CXFA 4WIWA 5I24A 2XSAA 5IHRA 3MMUA 3QR3A 4F9DA 3UCQA 3WUFA 1MQQA 3CIVA 4RL3A 1C90A 1JZ2A 1C7SA 3W0KA 3BGAA 4BF7A 1FP9A 1XSJA 2DIJA 3GNPA 1EQCA 4CD5A 2OYLA 4TUFA 3WL0A 1JZ8A 3A6OA 1A47A 3RILA 4MNLA 2VX4A 5A6JA 2BFGA 1CGVA 1JAEA 1SFSA 2YBTA 5HNNA 1JNDA 3VM7A 1UKSA 4YPJA 1ZJAA 1NP2A 4HA3A 1TG7A 2YDQA 2VRQA 1HP5A 2ZUUA 2OSWA 3W82A 1B3ZA 3CHDA 4BZYA 1QNOA 3VGDA 3A3HA 1U2YA 2FH8A 3VPLA 3NCOA 2EJ1A 5M03A 3WBEA 1HVXA 2A3EA 2OYMA 1CBGA 5CPQA 3AMDA 3WUBA 4H8UA 4AIOA 1LLOA 2V3GA 1L0PA 1I1XA 4PYSA 3K46A 3DECA 4LGXA 4DWSB 2PWFA 2ZOXA 4AIUA 1JD7A 2WCAA 2Z1SA 3PZUA 1LG2A 3ECQA 1V6VA 3U7VA 5A8PA 4ATLA 5I79A 3RDKA 4AD5A 2XM1A 2NT1A 3ZT7A 1C7TA 3WUEA 2OWCA 3KWXA 1ZBWA 1HKMA 1E6NA 1XYFA 1B0IA 2CHNA 3VX0A 2BVDA 3G6MA 3L4XA 1VFOA 3AOFA 1BG4A 5DMYA 1VJZA 1D7FA 3AYSA 1FH9A 5CG0A 1JI1A 1NWUA 2JIEA 1E0XA 5E70A 2NSXA 4AYSA 2DSWA 1MQPA 2WVSA 4Z2HA 1B3YA 2ZUTA 3IJ9A 1WZKA 2XVNA 1JIBA 4XB3A 4DWSA 3BH4A 2JF6A 2JEQA 3BAIA 4PRWA 3CHEA 2F2HA 2EPOA 3AMGA 2VT0A 3AHTA 1ITXA 1GOIA 1QBAA 4J7RA 2WCGA 2BHUA 2HVMA 4JFWA 1QHOA 1Q6DA 2PC8A 1Y7VA 4E8CA 4YHGA 1G01A 3GBDA 3N1AA 3SCRA 4P7QA 1EDQA 3ARQA 2WWCA 1DHKA 3RCNA 1GOMA 1Q6FA 2DSKA 2W92A 4HP5A 1DWHM 3ARXA 1E40A 4W7WA 3SCNA 3PZMA 4BQ5A 4EK7A 2WYSA 1W91A 1WKYA 1WB0A 3CUIA 1O7AA 4UFJA 3FNDA 3CZJA 1QVBA 1AQMA 3AIBA 1NWTA 3MMWA 1SMDA 1KB3A 4LYRA 2XG9A 4U31A 3W24A 3ZR6A 1JXJA 3VILA 1R8LA 2PWEA 3BSGA 3TP4A 4J3SA 3UG5A 2O9OA 4AIEA 3EMCA 2E8YA 5CPSA 5BRQA 5D8ZA 1DTUA 2D0FA 2IXUA 1TE1A 3VIJA 3G6LA 4TX6A 2D1ZA 4HMEA 2PWDA 5M3WA 1G94A 1BVZA 3OG2A 3VIHA 3PTQA 4QLLA 2G4FA 4MAZA 2D0GA 3FW6A 3WH5A 1WZMA 2BY0A 2DQXA 1VFUA 3F5JA 4D1JA 4URIA 1CNVA 1VB9A 4U3CA 4UQBA 2G41A 1W3KA 3WKZA 1XV8A 2G3IA 2BY2A 2J7HA 3WNLA 2NT0A 4W87A 4AISA 4E4PA 1BYDA 1G0CA 4FLQA 2BS9A 3N9KA 2C7FA 3DYMA 3B9AA 3SUUA 1B3WA 1ISVA 2MANA 3SCTA 5TD4A 3WQ6A 1QI4A 4GI9A 5AC5A 2AMGA 4WJXA 3BCDA 4P8UA 1LL4A 5BXSA 1GHRA 1BPLB 2PB1A 4MAVA 3AIRA 3VDAA 4UFHA 4B3KA 1JDAA 2CHOA 2BVTA 1G9HA 4GZEA 1TZ7A 2X1IA 5FKYA 1OM0A 1W3JA 5AYBA 4GQRA 4UOQA 5A6BD 3IJ8A 3W38A 2WLZA 1KXTA 5DEZA 1E4MM 1LWJA 3EDEA 4OIFA 3VIMA 3OLIA 2XWDA 1J0IA 1VF8A 3AYRA 4D6JA 1J11A 5EFFA 1E0VA 2QV4A 1CEOA 1LL7A 2ZWZA 1BVNP 4NSBA 4P8XA 2E9LA 5A2AA 2OYKA 1ISWA 4UTFA 3N11A 4H2CA 3LPGA 2VQTA 4MB5A 1FH8A 3L4ZA 2JEPA 1BLIA 1AVAA 2EPKX 2WMJA 1QOXA 1GQIA 3CO4A 4Q7NA 4HOWA 3SUVA 1XH1A 3AISA 2DSZA 5A69A 1YHTA 3W6MA 4PTVA 1K9TA 3CHCA 3CHFA 1JZ6A 4EKJA 1FH7A 3SCOA 1JZ4A 1XC6A 3BAKA 3WH8A 4AEFA 2V3DA 4JHOA 2GJXB 3THCA 5DT5A 5E0FA 4J3VA 5E0CA 5C71A 4QAWA 2YJQA 3GH7A 2BVYA 4A4AA 1WDQA 4TTUA 4P8WA 4DWSD 2G3MA 1IT0A 3A47A 3I3BA 1V03A 5D9PA 4F9JA 2BXZA 3SCQA 1XH2A 3MO4A 3EDFA 2YA1A 4TXEA 2EO7A 2E3ZA 3FY1A 1KGXA 3M6DA 2FGLA 7A3HA 2YDSA 1BAGA 4V2XA 1KXVA 1ODUA 3CMJA 4IUGA 4D6GA 3ZJ6A 1E0WA 4FF5A 5A2BA 3W37A 3ARPA 3EDKA 3VIFA 1E3XA 4E2OA 4TX8A 3IJ7A 4F79A 1CDGA 1VIWA 2BY1A 1U30A 2WKGA 1VBRA 3W81A 5ABHA 5C70A 2CEQA 4H7VA 4AZIA 1ISZA 2W66A 3PBGA 2CETA 3J7HA 2J7DA 4HA1A 2F8QA 3THDA 3RJYA 5I78A 4XZBA 4ZFMA 1C92A 1VFFA 1DWGM 1OWQA 3ZJ7A 3CH9A 2V38A 3AQUA 4PMQA 2YDRA 4CD6A 2E8ZA 1UQZA 3PTMA 4TVUA 4M82A 2CPUA 2GJRA 3PZNA 1W32A 2CBUA 4U5KA 4JFSA 1UD8A 4CU8A 4V28A 1EH9A 4JZ5A 1GORA 1G5AA 4MPKA 4DUWA 4IPNB 3ZT5A 4X0VA 3VOCA 1NWRA 5FCZA 1EDTA 1UYQA 1QNPA 3MS8A 1W9XA 5A3HA 3PZQA 4CCCA 1UR2A 1W2VA 3NSXA 1C3FA 2GDUA 4TOQA 2WW5A 3BAJA 1UR0A 3SCUA 3AMCA 3F5KA 3PTKA 1TCMA 2YL8A 4YN5A 3VM5A 2W4XA 4PMZA 4Q22A 2X2YA 3AZTA 3VIIA 2A3AA 4P7NA 1MFVA 2D22A 5I23A 2Q8XA 1EA9C 2QMJA 4P7OA 3VGBA 2VCBA 4X9YA 4W85A 1E9LA 4GI6A 2JF7A 1C91A 1CXKA 4U2ZA 1XD0A 1RD6A 4HTYA 3POCA 2GSJA 4D6DA 2ZICA 4JKLA 4ZXLA 1E6ZA 1GJUA 1H2JA 2QPSA 4B15A 3UEQA 5KEZA 1B31A 2ZE0A 1LG1A 3UR8A 1B3VA 2XVPA 1AMYA 1EO7A 3VGHA 1ODZA 2GUYA 3IANA 2XGBA 3A4AA 2WC4A 1HL9A 4B16A 1GQLA 2GDVA 3WDIA 1GUVA 3TTSA 4EE9A 2ZXDA 4MJ2A 4CVUA 3K4DA 3VIGA 3VKKA 1DWFM 3SUTA 4AZ7A 4PTWA 1EDGA 4Z2GA 1B90A 2QHAA 1O6IA 1EOKA 3BAWA 1UKQA 2WNWA 3GYCA 3N13A 2WC3A 2BY3A 1J18A 3APGA 4PBGA 1CGWA 1SMAA 2VZTA 3K8MA 2ZUVA 3WDHA 3WN6A 1GOQA 1MFUA 2PBOA 2UY4A 2V3EA 1EHAA 5FL1A 1W1TA 4KWUA 1WCGA 4OBRA 4OKDA 3WQWA 2JE8A 2WM0A 4UQ9A 1JAKA 1US2A 3ZM8A 1JZ3A 1V0NA 2UY3A 3GNRA 4XUYA 3RM4A 3BAYA 1CLVA 3WENA 1QI3A 5E6YA 3AHZA 2J7FA 3L4VA 1JL8A 4CUCA 2DSVA 3WDRA 3RPMA 3SCWA 4MTVA 4W86A 1GZJA 3PN8A 4JHZA 4M56A 2D3NA 3TONA 1HJWA 1E5NA 5GNZA 1TA3B 2Y2WA 3T2OA 3EYPA 3PHAA 2WB5A 2DPEA 3SEPA 1WO2A 4W8AA 5JBDA 2PWGA 5BXTA 1CZ1A 1R7OA 5I2UA 2YOCA 1QW8A 1Z32X 4PMOA 1XGZA 3BLPX 4HU0A 3FAWA 4WKFA 1QHPA 2XJ7A 4ATWA 3L4YA 1LL6A 2YIHA 3LMYA 3KL5A 1HXJA 3GXFA 1C8YA 2ZXBA 9CGTA 4M1RA 3FAXA 3NSMA 1CLXA 4J3XA 4AD0A 1TA3A 3FHQA 2YA0A 1I1WA 1V02E 4WSKA 5A6SA 4PCTA 2CCRA 1V6WA 1GOOA 3T0DA 1MW0A 2CBJA 2X0HA 4UZSA 5LA0A 3AS0A 2XFFA 3UG3A 4LQ1A 2J8GA 1DWAM 4AXNA 2NW0A 1ZBCA 3WD0A 2VJXA 2CXGA 1KQYA 5GPRA 2Z1KA 1KXHA 1PEZA 4W88A 4TVDA 1QNRA 1ISXA 3WD1A 1G1YA 2E9BA 1H41A 3AHVA 3WDQA 3WEMA 1E15A 4Z2LA 1FHLA 3VDCA 2ZUMA 4EAMA 3ZQ9A 1ZS2A 1V3HA 2A3HA 2XHYA 2VZVA 2WVVA 1SR0A 3AXXA 3MSDA 3B8SA 1CXEA 1W9UA 1W3HA 4MB3A 1HL8A 3CUGA 3SIMA 1K9EA 1HVQA 2VCCA 4D1IA 1KCKA 4UR9A 4LYQA 1IZKA 5JUVA 3NDZA 1CYGA 4BCEA 2EBNA 2AAAA 3W53A 1H0GA 2D3LA 5JBEA 1NOWA 4W8BA 4W93A 4C7DA 4KRTA 3WF1A 2J8FA 3BLKA 8A3HA 1HIZA 3GDBA 4C7FA 3MV01 1NP0A 1W1VA 4IM4A 4PTXA 3S6TA 5AC4A 3AZSA 4H04A 1GHSA 3K8KA 3VDBA 5ECUA 3ZJKA 4UQDA 4OOUA 3VMOA 4FK9A 4GPNA 3W27A 3GBEA 1UWRA 5A2CA 2G3JA 3FHAA 2QF8A 3K8LA 4BQ4A 3GH5A 1US3A 1RPKA 5BYWA 1V6UA 2VL4A 4CD7A 1XCXA 3OA5A 4WLCA 2OSYA 2EQDA 3OGVA 3KL3A 4JFVA 3GH4A 3S2CA 3AIVA 1X1NA 2VC9A 2A3BA 3ARZA 1WZAA 4MADA 3WDPP 4MNJA 4AZCB 1KBBA 3RM8A 2HISA 3CBWA 4W7UA 1L8NA 3OLEA 4U2YA 3D5HA 3CGTA 4L4OA 3I3EA 4AZHA 1VENA 1M7XA 1UOKA 5LA2A 2VMFA 3SUWA 1Q6GA 2WMGA 4HZ7A 5A94A 2W63A 3T0AA 3OGRA 4D6IA 4ZEPA 1F4HA 1M03A 5D9OA 1PZ3A 3O2LA 4XV0A 2C0HA 4NI3A 3WF3A 2XFRA 4NZCA 3VINA 2XVLA 1AQHA 8CGTA 4ACZA 4JFTA 1E1FA 1GOKA 1HJUA 3ARUA 4PMNA 1C93A 1MQRA 2XSBA 5A6KA 3UESA 1CXIA 3NIYA 3L2LA 3F5LA 1CIUA 2WHLA 3N18A 4D6HA 5LYRA 1TUXA 2VZSA 4AZCA 2WC7A 2Y4SA 2B31A 1B9ZA 5AYIA 2RGMA 3RJXA 4OUEA 2ZUWA 4PMUA 2D23A 4CN1A 3EBVA 3GTNA 3AICA 3VMNA 2Y8VA 2J4GA 1HKKA 1HJXA 3CLWA 1BHGA 2EPNA 4CU7A 2XIBA 3T08A 1QBBA 2JIWA 1NWSA 1GJWA 1V0MA 3JUGA 1UD2A 3AMKA 4UFLA 1E1EA 1FOBA 2DH2A 4R27A 2O9PA 1WP6A 3MANA 3WY1A 3MUAA 2DT2A 2E40A 4B3LA 2JALA 4BA0A 1JF6A 3WQ8A 1NARA 3WF2A 1I75A 2J62A 4JCMA 1OD8A 4JL1A 1SYTA 3E1F1 4AZBA 4J3TA 1MXDA 1JGIA 3WL1A 1MXGA 1UR4A 5JBFA 4LXFA 4KGJA 3SCSA 4Z2JA 1S46A 3AIWA 1XSIA 5DO8A 2PBGA 4BQ2A 4H41A 4UFKA 1QNQA 1UWIA 2E9MA 4IPLA 1QW9A 3VGGA 4GO8A 3DHPA 1VBUA 5BXRA 1UKPA 1Q4NX 1ZJBA 2J25A 3VU2A 5IDIA 4PSPA 3NSNA 1BYBA 3HU7A 3W26A 2J77A 2XGIA 3LPPA 4Z2KA 4NRSA 4UZUA 1V08A 5CJ5A 3ARVA 1V3IA 3EDDA 4K68A 1UR1A 1B1YA 3ZR5A 4F66A 2VX7A 1JG9A 4AC1X 1TR1A 3ALGA 7TAAA 2WAGA 3L4TA 3GNOA 1HP4A 2E4TA 2YLLA 3HN3A 3W4RA 5CLWA 4CD4A 5I0DA
chains in the Genus database with same CATH superfamily
4KPLA 4O18A 1H09A 2CITA 1BGGA 1ZAHA 2FGZA 3EGJA 1ME9A 3R11A 3P8JA 2IXVA 4OT7A 2BHYA 3FS2A 3OIXA 5H2ZA 3TN6A 3EXRA 1RQBA 2UWFA 1FWWA 2PU0A 3AXKA 4JTLA 6REQB 1W6TA 4XZNX 4DYJA 3KW3A 1PZ2A 1W0MA 4OJYA 4K8EA 2VVSA 2DY3A 1LWIA 1FWRA 4Z1CA 4GZJA 2GGEA 3HO8A 5LIKX 4FMVA 4ACYA 4O0ZA 4IH3A 1WZLA 1YTKA 3HG3A 1HX0A 3FA3A 2CKRA 3HOJA 3N17A 3TSBA 5JIWA 3GM8A 4HGXA 1W8GA 3WQ5A 2CBIA 3RF9A 1BTMA 3OBAA 2E0PA 4I9TA 3MO7A 1A4LA 1GOXA 1JDDA 3WH7A 3W07A 2E67A 2H3DA 3W2UA 1BSLA 1TPFA 2X0SA 1ONRA 4NZ4A 3QHOA 2NWRA 1UQYA 1QO5A 2QUUA 4XD4A 5DCEA 4IF2A 4GYFA 4LRSA 2IUZA 3ARYA 4AMAA 1OBAA 3KP0A 4L9ZA 2P3ZA 2WMIA 3AROA 3FLUA 3INPA 4MF4A 4GO9A 2JKEA 1SZRA 1VPXA 3OIHA 4CEXC 4NJJA 1E6QM 1TQXA 3BC9A 2GPTA 3CT7A 2DSUA 4DUXA 1X97A 2QGYA 4X3ZA 4NP7A 4NYYA 3CV2A 3T09A 3NZGA 4Q8MA 3PUOA 3WNMA 3KCOA 3EX1A 5BCAA 2VURA 4RJEA 1UR9A 2OLSA 3SN0A 2HZGA 4MNKA 4QROA 3LPOA 4FR1A 1LQAA 2ADAA 3C2FA 3S42A 1OCQA 2Z1VA 3UWZA 3KBVA 5HPCA 1XLHA 1JXKA 1OGGA 1XINA 1W3LA 1DXEA 4D6FA 3B4UA 3PFMA 1MW1A 2WPBA 4GZIA 2V5BA 1QR7A 1W9PA 3AHXA 3G1VA 3STGA 3WLMA 4TTGA 1QMLA 3FYPA 4DO7A 4RV3A 1XBXA 4CQBA 1GTEA 1JPKA 5FF3A 1JCJA 5G2WA 2XSXA 1KM5A 1GJPA 4QJ3B 1MUWA 1KXQA 5CLTA 3V7PA 1UH4A 1U5HA 1R86A 4GYPC 4H9YA 4GUGA 4ALDA 2Y24A 2ZYFA 2NV9A 3ARTA 3RX2A 3QMSA 5AYZA 1NFPA 1AG1O 2DORA 2X8RA 1HNYA 1RQEA 1VRDA 4E5TA 2I14A 4PEEA 4UTKA 3P81A 2YCKX 1FA2A 1VEMA 1BXNA 2VRJA 1CW2A 1R38A 1UP2A 3VC5A 2FHFA 1VEPA 1LLWA 4GRSA 3F4VA 4PC8A 1WV2A 1Q85A 3WQOA 4B4HA 4Q33A 3VD5A 3W7LA 2QZRA 1AMKA 4JIEA 4DJFD 2BG5A 2VDHA 3QC3A 4GINA 2G0WA 3ME3A 2JKAA 1SZEA 5EY5A 3LLXA 5GNXA 4QQ3A 2PF8A 1VEOA 3ZOAA 1EFZA 4IPPA 3N2BA 3OLGA 3L66A 1X8FA 1UH2A 1I6NA 4C6CA 4IQJA 5KINA 1CWYA 3NGFA 2YYUA 4LX4A 3UWYA 4JN8A 1KQZA 3H55A 1VKFA 1ISYA 1O5RA 3TWAA 4DXKA 3A21A 4NX5A 4EXAA 3W22A 1PE1A 5A8NA 5A6BA 1IQ8A 3QSRA 2ZX7A 1A5LC 2QJNA 1SFJA 3GG1A 2QJHA 3CQIA 4N9CA 4CCDA 1ADDA 1HKIA 2PSNA 3NL3A 3KEHA 3PPCA 1B57A 1JQXA 2PCQA 4OBSA 1NF0A 2E25A 2WPGA 1H7OA 3WEOA 3BURA 3SZ8A 2WZEA 4L4PA 2XIQA 4OV9A 1RK6A 2J75A 1R9XA 3IAQA 5CZKA 3K2GA 5LIYX 4ZQOA 1JZ7A 1F05A 3ZIZA 2PWUA 3HG2A 1HT6A 1U5JA 2PRLA 3T1GA 2WSPA 2P8CA 4U28A 4NASA 2WK2A 3G8RA 1NOFA 2XIJA 1UWTA 1QPOA 2OOGA 3CZLA 2NLIA 4NJGA 1KM1A 4PRRA 2V69A 4UIOA 4WD0A 4JY8A 3PANA 5JMUA 5D2XA 5F2MA 3IK2A 5M17A 4HYVA 4OWGA 3RITA 3DIPA 1JCTA 3C6CA 2J24A 4Q32A 3PF3A 3WH9A 2PRHA 5A6LA 1MNZA 4Q8PA 4F0RA 3LSBA 2IMRA 1ZU8A 2GK1B 1E73M 3LTYA 4ERAA 1OX5A 1J0JA 3BCFA 5IBXC 1XIJA 5IFTA 1A5BA 3GR7A 2QEZA 4ACZB 3GXIA 2PTWA 3S1GA 1T40A 1HKJA 3BG9A 3BJFA 3TA9A 5I7GA 3UG4A 5AB3A 4KCUA 3UZWA 2L5HA 3WQPA 4PUMA 1OCJA 4O17A 5KITA 2VCAA 1XQLA 3IJLA 1KFWA 4MYXA 2DEPA 3GYEA 5FF7A 4AWSA 3N14A 4B9ZA 1SZFA 3U2CA 1DE5A 1W9DM 1AW2A 4I7UA 5CQ1A 1MXSA 5T91A 1HJVA 4YTRA 1FWCC 1ENUA 2J7GA 4FB7A 1OX4B 3PC0A 4NZFA 1GVIA 2V5DA 4KGLA 3A4WA 3T0BA 2BXYA 3HZ3A 2GUUA 3TQ0A 4UQEA 5T8GA 4K7YA 4JEJA 2J9YA 4IX2A 5LKYA 3UXIA 4LW7A 1G4EA 1UA3A 3R12A 1J96A 2D69A 4GX8A 3SADA 2YB4A 1LWHA 3KCJA 3VNIA 2BTMA 2F38A 5LIWX 2D73A 1UD4A 1KFKA 3TOYA 1RBAA 2G3NA 1LBFA 4IHCA 2C71A 4YHEA 3F4DA 5EBAA 4ENLA 1KCXA 2FPVA 3VX1A 3EX2A 4RZ5A 1P7TB 4IP4A 3OVPA 2ZX8A 5DCBA 1XG3A 3DG7A 3MDUA 4WOQA 3NQBA 5HBFA 4L4LA 2V63A 4AFYA 3R43A 2VC7A 3VKDA 3LPFA 1KGUA 5REQA 3VIOA 3EEGA 3GU2A 2PZNA 3KTSA 4B5SA 8TIMA 2PD9A 4IMDA 5H1WA 3TC3A 1NU5A 4U3AA 2F2KA 4JNZA 3LCFA 2DUXA 3DC0A 4AWTA 3MC5A 1F74A 3V3WA 1HUVA 4IUOA 1J93A 3TSDA 3VD3A 1UZ4A 4ATDA 3LCIA 1XDLA 1B30A 1ZBVA 4G7FA 3KBMA 2VZUA 3IUIA 3MUY1 3TTOA 5E09A 3B0VC 1BG9A 4K38A 4PODA 2NUXA 3EA1A 1KGWA 1EF2A 1K8CA 3CIXA 4NILA 3UP8A 4V27A 3DGRA 2A7PA 4FXFA 1C8QA 1H7XA 3SGUA 2PA6A 1UMYA 1FHDA 1QI2A 2CNCA 1OABA 3WQ4A 3W7EA 3NG3A 1N55A 5A8MA 1P6BA 4XZ9A 3QYSA 3WD2A 2G50A 1ZENA 3LB0A 5JVLA 1JULA 2C8NA 4KCVA 3N19B 4AW7A 1PX3A 5LNRA 1U33A 2GJXA 1NDZA 1R6WA 1E9IA 2I5QA 1LROA 2I5GA 3LTSA 5K9CA 1OT1A 3TOPA 7TIMA 3AXMA 2Q3RA 1JPMA 1KBLA 3QM3A 3WUGA 4PUEA 4IMAA 3AIEA 5HXMA 3BE7A 4NAEB 4TX9A 2VTFA 3U5UA 3TUUA 3PSVA 3UW6A 1EJSC 3W84A 3FXYA 3T8QA 4Y7EA 1X6UA 4O0QA 5G1TA 3IIVA 3WFLA 1VRXA 3GFZA 4NJIA 1TMHA 1TJ2A 1UROA 2BOFX 2CHRA 1Y0EA 4UOJA 1HN1A 2XTKA 2ZA3A 3SJ3A 4JIQA 2VOTA 2G8ZA 4Z1YA 3WBXA 4Q7IA 3CB8A 3NQ6A 3GDMA 1XWYA 4LAUA 3SCPA 1XJBA 1OGBA 5FJUA 1ZJIA 3DYOA 4H6RA 4JTEA 1F3EA 3W7IA 4Z17A 1XFBA 3GRIA 4LUSA 2G96A 4IJRA 1A4MA 3WJZA 3W72A 1H1ZA 2A7RA 2AL1A 3W6YA 3LGDA 4JAWA 2W62A 3QVQA 1YNQA 1KM4A 1OFRA 3GR8A 2BGQA 3WLQA 3DFOA 4JCLA 3KOFA 1EO5A 1OFEA 1EEXA 2EHHA 4JNYA 2HNHA 4S2CA 1WDPA 4ASTA 5EMMA 4NXSA 2Z6IA 4FXSA 1TPH1 1P0KA 2OKTA 4O4WA 3CWHA 1RUSA 4G9PA 2RDWA 2VX6A 3PZGA 1H60A 4FX6M 2DT3A 2AL2A 1FWBC 2AGKA 2ZIDA 2ZRWA 1CPUA 4Y90A 4AWEA 4KWVA 2V68A 3GIQA 4QSHA 1NH6A 5DFAA 4M29A 5CPTA 1TTPA 3KM8A 4UNIA 3V18A 2OLHA 2V5LA 3ABXA 2VGGA 2YXOA 2J74A 3B04A 3EWWA 4NYUA 5LGXA 2QDEA 2Z26A 2R1PA 4OUIA 1ZUAX 4MKVA 4NRRA 1KBKA 2WXDM 4FOKA 4KWSA 1CXFA 5I24A 3MMUA 4F9DA 3UCQA 4FS9A 4JYDA 3MBDA 5HMEA 4RL3A 1YRRA 3OYZA 3B03A 4LH8A 2FZMA 4TUFA 3WL0A 1JZ8A 2OODA 2DVTA 3RLHA 1BF6A 2CLPA 4MNLA 5A6JA 1QRQA 1CGVA 1KTNA 1A0CA 1JNDA 4YPJA 2XIMA 1ZJAA 2W0UA 4HCLA 1H5YA 3M41A 5U4NA 2VRQA 4L56A 3LG3A 3HA1A 2PTDA 4NNCA 1N8IA 1WUFA 4CNUA 4QJ4B 2ZVRA 2RDTA 1P5BA 4B2DD 3VGDA 1G69A 2QULA 1JPDX 5FF0A 3NCOA 4I90A 3TEVA 2F6UA 4H01A 4F48A 3KBSA 3EX4A 2OYMA 3HBLA 2E5BA 1CBGA 4RXFA 3KBJA 1LLOA 3QRHA 2ZRXA 3A24A 1KBJA 1A5UA 1QPNA 3DECA 5HATA 2HK1A 1EC7A 2WCAA 2NXGA 4AVOA 5A8PA 4WRHA 4KEUA 1KLYA 5I79A 3RDKA 4AD5A 2XM1A 4ZGYA 2NVCA 3ZT7A 1C7TA 1RCQA 4ZQCA 1ZBWA 3SN1A 3S9YA 4C5ZA 2CLLA 5I3JA 2BVDA 3G6MA 4QAIA 4POCA 1U1JA 1R3QA 4TV5A 3AOFA 1EWDA 1VJZA 4FZIA 4G6CA 3AYSA 1FH9A 1EZ2A 4LCQA 1E0XA 4IG2A 4AYSA 1H7NA 3M5YA 3NZPA 1B3YA 2ZUTA 4WDUA 1WZKA 2XVNA 5LZLA 1S2AA 4K3ZA 3BAIA 4C6FA 1W54A 3PJXA 4S3BA 4DJDA 3O63A 3LU2A 1GOIA 1QBAA 2NVAA 4J7RA 3QLLA 3R8GA 2VR2A 4GBUA 1UWAA 1G01A 4MVAA 2OT0A 1DQUA 3SCRA 3W2KA 2WWCA 3MI6A 5HMDA 1OVDA 4GJ1A 1LCOA 2W92A 2VFDA 4HP5A 4MFEA 3PZMA 2OQLA 3GFXA 4GYJA 4DUOA 4JTCA 1L6FA 1AQMA 3AIBA 5DELA 4KEZA 1VIZA 3O0FA 1JUEA 4DPPA 4HNOA 4UTUA 1XQKA 1Q8JA 1JXJA 1R8LA 1XLGA 2PWEA 1HO4A 1ELSA 3ZWSA 3BSGA 2OQHA 4IIBA 2O9OA 3CL8A 4KIRA 5CPSA 5IRPA 3RLVA 4WSHA 3G1DA 3G6LA 3OOQA 5M3WA 2YCLB 3UNDA 4B3ZA 4QLLA 4EPBC 2INZA 4O13A 1KRCC 3QPZA 5REQB 2BY0A 2DQXA 3F5JA 4D1JA 4DJEC 4UQBA 4UB9A 5EA9A 3Q94A 3QR0A 2BY2A 3E38A 1LOQA 3L12A 4GVGA 3WNLA 4AISA 1P48A 4W4QA 3BGGA 3N9KA 2C7FA 1K8ZA 3B9AA 3S0CA 3CH0A 4MFDA 1ISVA 3O7UA 2MANA 1PZ1A 2F7FA 2X7VA 3VZYA 1IR1A 1VYPX 1GTHA 5D30A 1LL4A 2HQAA 4AC7C 1GHRA 4MAVA 3EWZA 5HWNA 3G0SA 1JDAA 2BVTA 3E0WA 3SRDA 4BHYA 1PIIA 3TJLA 3TTEA 5A6BD 2VOMA 4HSOA 3IVTA 2FVKA 5FEWA 4IXHA 4OIFA 3OLIA 1E1CB 2XWDA 1J0IA 4LUTB 4PBEA 4D6JA 2V5JA 4JXCA 3QW4B 4QS6A 3W9ZA 5EFFA 1E0VA 2HTMA 1LL7A 2ZWZA 4P8XA 5A2AA 3FGCA 2OYKA 4UTFA 3WK0A 4H2CA 1V77A 2HBXA 2WO5A 3QSTA 2VDIA 2WMJA 5CAHA 1QOXA 4AXKA 3CO4A 1K02A 3PBUA 4Q7NA 1ME8A 3SUVA 3M0JA 3AISA 3W6MA 3C2EA 3TNOA 5B7YA 2A3LA 4PTVA 1K9TA 3KRSA 4Q4PA 1AJ0A 2BZNA 3CHFA 3P93A 1A0DA 4EKJA 3BAKA 3UWWA 4F40A 4HHMA 3WH8A 3HFTA 2RFGA 2GJXB 2QT3A 1O95A 5I06A 3QQWA 5C71A 1VYSX 2YJQA 1XM3A 2GUBA 4A4AA 1AUSL 4E38A 4TTUA 5HJLA 3TDFA 2G3MA 4MZ8A 4IFKA 3LZ5A 4GC3A 3RYSA 5BMXA 3MO4A 5K2ZA 3FY1A 1KM3A 2ZA1A 1KGXA 5I3KA 3R8RA 1AH3A 3E2SA 1S39A 4LVGA 3GVWA 3ZJ6A 4HYWA 1XLCA 2X7WA 5BW6A 1JQVA 5EYWA 1UR3M 4F79A 3SGGA 2WKGA 4C60A 5ABHA 5C70A 3CEUA 3J7HA 4HA1A 1VFFA 2NQLA 3NQCA 1T41A 4LCRA 3QV9A 2V38A 4PMQA 2YDRA 3PTMA 1YE6A 1KA9F 2GJRA 3IS4A 3PZNA 4LUSB 4O0KA 3TQPA 1EH9A 4R85A 4IPNB 3W7HA 3MW7A 3ZT5A 4JTJA 3MUCA 4GYPA 1IEWA 1EDTA 1QNPA 3MS8A 3QPEA 1SO5A 1W9XA 5A3HA 1FQ0A 4CCCA 4HK5A 2CZDA 1XIIA 4FEZA 1W2VA 2ZC1A 5XINA 2YYTA 4QE4A 2GDUA 3RXZA 1XDJA 4TR9A 3EOUA 3S1WA 3SCUA 3R13A 3HQ1A 4YN5A 5ECVA 3FKKA 4FNUA 3W00A 2A3AA 4UCGA 3VE9A 2QMJA 3KAOA 3O0KA 1BRLA 2PAJA 1E9LA 3BW3A 1ME7A 3USZA 3SN4A 2EAWA 4NY2A 1UZDA 2BX7A 3K5XA 3RO6A 2O4QA 1E6ZA 1E0UA 2VHLA 3NPVA 4Y6GA 1H2JA 2QPSA 1FWIC 1S2CA 5BU9A 4FALA 1NFGA 2H9AA 2YPIA 1XIGA 4A8RA 3L2IA 5KEZA 4GCAA 3GKAA 3B0UX 2ZE0A 2CFFA 4E4FA 4GK8A 1XYCA 2XGBA 3A4AA 2FFIA 3GTHA 3WDIA 1GUVA 3TTSA 3IIZA 4S1FA 1YNPA 4CVUA 1KM0A 1SSGA 4GG9A 1SR9A 2Z4GA 1DWFM 3SUTA 4A3UA 2AKMA 2QIWA 3CAKA 1B90A 3MJMA 3BAWA 1S2VA 5FJJA 2BODX 2YCJA 3GYCA 2WC3A 2BY3A 2V81A 1IE7C 2G5WA 1SMAA 4G8TA 1K1DA 3WN6A 4HHPA 1EHAA 2NX3A 3U4FA 4KWUA 3KZPA 3TQVA 1BWLA 1FWNA 1OG0A 4EOUA 4UQ9A 2FTPA 3RM4A 4GJJA 3WQFA 2INEA 2ZQ0A 4O1FA 1NAL1 2W9MA 3SCWA 3OQ8A 5E9XA 3PN8A 3O3RA 3I7SA 3O1NA 5GNZA 3HQNA 3I6RA 2PCEA 3T2OA 4DYKA 4NI8A 2WB5A 4PMJA 5H8UA 5BWAA 4DXVA 1WO2A 5JBDA 2PWGA 1CZ1A 1Q2RA 2OT1A 3LCGA 2YOCA 1QW8A 1G7VA 3VOJA 4QNWA 1KC7A 3FAWA 4WKFA 3Q45A 3UPWA 4ATWA 4JTIA 1K7XA 2LLEA 1HXJA 4L5ZA 5F1UA 3URQA 1OYBA 3RAOA 9CGTA 3BGJA 2WNNA 3VAVA 2GOKA 5DY2A 3CO8A 1RLCL 1TR9A 5CSSA 1CLXA 3FHQA 1I1WA 3KRBA 2CCRA 1GOOA 3LQLA 2X0HA 5LA0A 3AS0A 2XFFA 3IGUA 3UG3A 1POJA 4LQ1A 3U0HA 1DWAM 3QFEA 1UBPC 3CQ0A 5HMFA 1KQYA 4ZB5A 4E4UA 3S2JA 1QNRA 1ISXA 1G1YA 2E9BA 4RDYA 3V36A 2VEFA 1E15A 1K8XA 3VDCA 1S5WA 2ZUMA 3ZQ9A 1W5QA 1V3HA 4A8IA 2WM1A 2WVVA 1SR0A 3NXFA 1W9UA 4ES4A 1W3HA 1A53A 1HL8A 2TRSA 4KERA 2PE4A 4LAOA 1XGDA 3E5PA 2D2JA 4UR9A 1X8CA 3NDZA 1TE6A 4BCEA 5JBEA 3G24A 4W8BA 3WF1A 1Q6LA 3BLKA 3GDBA 4C7FA 3QH2A 3LBMA 4MIMA 2Y70A 3U2OA 1OCBA 4IQLA 4OTKA 3FEMA 3W70A 1I8JA 4JTRA 1ONXA 5ECUA 4OOUA 3GBEA 2OPJA 5A2CA 4BQ4A 2PU1A 5K3VA 1GEHA 2QJGA 3DERA 1SJCA 1V93A 3DH7A 2VL4A 4CD7A 4MWAC 4RDWA 3OGVA 5HNRA 3B9NA 4JFVA 3S2CA 6XIAA 1EWEA 1WQ5A 2VC9A 2OTDA 3ARZA 4MNJA 2A6NA 1WX0A 3GAYA 3MTWA 3N4FA 2Q09A 4GC4A 3WLPA 2BSLA 1KFLA 4W7UA 1L8NA 4NG3A 4REQB 4AZHA 1KNWA 4Z08A 2WMGA 3OGRA 4D6IA 1TREA 3M0MA 1F4HA 4LNYA 5MKGB 3TX9A 3N29A 2C0HA 5EMLA 3WLJA 4DXXA 3S3GA 1Q6OA 2YFOA 3PUDA 1GOKA 3MP4A 5CG7A 4QQUA 1MO0A 3ARUA 2QJIA 1FWTA 1SZNA 5A6KA 3P67A 3NIYA 3N18A 4D6HA 1CB2A 3L21A 4FNQA 1F6PA 1O66A 2ASHA 1B9ZA 4IJBA 3GHSA 4PB4A 3WLLA 1PXGA 2D23A 1EJTC 4LEQA 3OEXA 3EBVA 2O7QA 3U2EA 3G3MA 2IPFA 2DUZA 4HHHA 2Y8VA 3CLWA 4I5UA 4HMNA 3VNJA 3B8IA 2GGJA 2BOEX 2NLYA 3S6OA 1TV4A 3IUHA 3FJ6A 2QPXA 1FOBA 2GVEA 2EG6A 2KX9A 3MANA 3WY1A 3W1AA 2DT2A 4UR7A 2JALA 4JX6A 4BA0A 1JF6A 5IOBA 3TR9A 4GY0A 2J62A 4JCMA 4Y2WA 4JL1A 4TV6A 1SYTA 1MXDA 1PTAA 3RGTA 3WL1A 2ZDSA 3KVJA 2ALRA 4PB5A 4J2PA 4LXFA 1HGYA 4IFKB 3IJ6A 3AIWA 4O53A 1QNQA 4GUHA 1PKNA 1TJPA 1DJQA 4ORMA 3VKBA 2QJMA 3VCRA 1ZCOA 2JGYA 1UKPA 3NVTA 4CNSA 1ZJBA 3CMFA 1W3TA 3BTNA 1GYMA 1FWHC 3C61A 2QXWA 4GE8A 4KCWA 4NRSA 3QQ1A 1SJDA 1V08A 4LBRA 2HEJA 3STPA 4L1GA 3EDDA 3F03K 4K68A 4INFA 2X16A 2YFNA 5DLCA 4BFAA 1TR1A 1WKDA 3R10A 1MNSA 4AYGA 3A22A 7TAAA 1IWAA 5CLWA 3W4RA 1UB3A 4KQNA 4PCNA 2FZ9A 4A8LA 3AFBA 2QUMA 4XAFA 1RH9A 3NJ3A 1HF6A 3KBNA 4I8DA 3S1XA 3V0UA 1JJKA 2J6VA 3P84A 3VXGA 1LOSA 3T8LA 5DT7A 4TVCA 3FIGA 4A3HA 5CXPA 3HURA 5JXQA 3T2PA 4NVTA 4CN4A 1Q6QA 3QZEA 3E0VA 3GK0A 4PCSA 4JTFA 4GY1A 2JGQA 4D8LA 1TRIA 3EB2A 9XIMA 2QS8A 5SWUA 4K1GA 4MZYA 5G5IA 4CCEA 2ZWYA 2B7PA 1NFBA 1VJSA 3GUWA 4GVFA 4Q6JA 1XHGA 4TMCA 1RSCA 1BRLB 5TIMA 2Y5SA 1NY1A 4AZGA 4CNTA 2GSHA 1V3MA 3G1HA 4K8HA 2VWSA 3HV8A 5C7HA 3ZLGA 1J10A 3LHWA 2D20A 3WDJA 3PJTA 1Q2SA 1AFSA 3GHRA 4AEEA 3WQGA 1JD9A 3OB8A 4CN6A 5FJTA 5PTDA 2NQHA 1TTQA 2CIPA 3G2GA 1UD3A 1FWEC 1E9ZB 5KZ6A 2EXOA 4RW5A 1I0BA 1A3WA 4WDWA 1CGUA 4D9PA 3LN3A 1VP5A 1DKWA 3BMXA 1WDRA 3ALFA 5F7UA 1IZCA 5E6ZA 5D02A 2Y8KA 2V67A 4XX6A 1OC6A 4LCSA 4IMFA 4CD8A 2Z24A 1EXBA 3GWQA 4FXJA 1GKPA 3ARWA 2GVYA 3UXDA 4PE8A 4QCEA 4H3DA 3BOLA 1UKOA 4EPDC 3E49A 1TZZA 5KZEA 4X0NA 3UWVA 4ZMGA 3QFWA 3MKVA 4I7WA 3GD6A 2QIIA 4FSAA 4WJEA 4MDPA 2VDGA 3EX3A 1M53A 5GVJA 3L4WA 3NQ7A 3TZNA 2QCMA 1K9FA 1TMQA 1OINA 2YCEA 3EMZA 4NJHA 3QJAA 1RR2A 1DIEA 1MEWA 3QGVA 2VD8A 3DHUA 2P50A 3BAXA 2V5CA 1XLFA 2W91A 2XVKA 4HOZA 4N9EA 3UA4A 2BWGA 1GQJA 1S3HA 1ZL1A 3NA8A 4JQAA 4O54A 2X05A 5HDRA 3KVLA 3I68A 2ICSA 1ZNNA 4F0KA 1J12A 3TA6A 4EF9A 3B8DA 1VR6A 1RXOB 4ZA0A 3QOMA 3L65A 1EOMA 2QPUA 4IIGA 4OU1A 3QHNA 4X22A 6XIMA 4O52A 1XRSA 1Q63A 2CXEA 2FPYA 3ZLFA 1XLKA 1KCLA 4O57A 4PFMA 2ZTJA 2YKKA 5BWFA 3RNDA 1OB0A 4J28A 3PWIA 3NDYA 2WVVB 1OADA 2CZEA 3K1DA 3KZSA 1GNXA 2POTA 5D9MA 3U4AA 4AVNA 4ZO8A 1ZRQA 1P4CA 1TV5A 3CL7A 5F2IA 1TV7A 4JKMA 1TJ1A 3BMVA 4CU6A 3NOEA 4PTDA 5DMLA 1RPXA 2OKOA 1KTCA 1SFLA 3U6WA 4ZFCA 3AIUA 3SRFA 2VUYA 3ZZ1A 4HHLA 1E3ZA 1RV8A 2ZBTA 3W7PA 2EG8A 3R5EA 1E71M 1OY0A 3BARA 2MUCA 2PP1A 1UCWA 1DBTA 4CQ9A 3GU1A 3ZSTA 4NUWA 5EB8A 1KLZA 4K1WA 1J9YA 2ISSA 3PPGA 3B0YA 2A5HA 3W2LA 2Y0FA 3N4EA 3KUMA 2WHJA 3ZLHA 1XUUA 3FXGA 4FLRA 4DJEA 2RGLA 3A4XA 1V3LA 4B9YA 1XL9A 3CV1A 1N8WA 3TAOA 2VGFA 2NXIA 4PN2A 2XVGA 4C6LA 2J66A 3TTQA 1XH0A 5CC7A 4GUJA 4N42A 2HVOA 1ITCA 3MJYA 1JDCA 4WY0A 4S23A 4QGCA 2DZSA 3WYZA 4AZ6A 5AY7A 3W28A 3W1XA 2XIIA 3V5FA 1QPKA 4LF1A 1TO3A 3N15A 5G4HC 5D2VA 4NU7A 1LQ0A 2C79A 4PUJA 4V33A 2BLEA 4H6KA 3P61A 4CGTA 4XBKA 1R87A 3AC0A 3TYDA 3Q2DA 3IAPA 4R88A 5CC3A 5BXPA 3KFTA 3LQGA 4JY9A 3HMCA 2YL6A 4B91A 1L9WA 3T05A 3VK5A 1ZLPA 4H8HA 1E6XM 1F07A 1GVOA 3S5ZA 3F1QA 3PUGA 4AHPA 4C6JA 3H6OA 3PAJA 3R6IA 5TAOA 4EANA 5LGZA 4GBDA 5AVNA 5ABFB 1TFVA 2DT1A 4YMZA 4R5EA 3PG9A 3S6DA 1UBSA 4GNKB 3OLDA 4LUJA 3DBPA 1L6WA 1D3CA 1V6TA 4DEFA 4S3EA 4DWSC 3CZKA 4YYFA 4UQCA 2GJPA 4AQLA 4IOTA 1MEHA 4Q8VA 3WF0A 2OMAA 4O19A 3ZJ8A 3N04A 1ZSXA 5MHBA 3V5CA 2WBGA 4I9JA 3BXWA 3WG6A 2O0TA 1X96A 2J6XA 7ENLA 2DZPA 5CSYA 3W7QA 5DXYA 4FX7A 3H54A 2CKSA 4PUDA 4D6EA 1XRFA 4JNMA 3LY0A 4GD0A 1UWSA 3GHTA 3N12A 2R1KA 2W6RA 3I3DA 3GB6A 3CZ8A 3MUZ1 4GIRA 1KR0A 1LM1A 4HU4A 1FCVA 3BLFA 1GWJA 3QR1A 3VOHA 2ZXQA 1HQTA 2YGYA 4RE2A 1MW3A 1VS1A 2V6AA 1E56A 2HWGA 3WIJA 3R2GA 4GH3A 3AJ7A 3WNNA 5CSRA 3L0GA 1S38A 4PMRA 2Y1HA 5DF0A 5BOEA 1XLLA 1JR1A 5HA7A 1UJQA 3FN9A 2PTZA 1YIXA 3T6CA 4MWAD 2WSYA 1XLEA 3PNZA 4B92A 5IXEA 3LXBA 4IGSA 1IEXA 1B54A 1QNSA 4WZHA 5ABGA 4GQBA 3MT1A 1SVDA 3AXIA 4Z1AA 3Q4DA 4A3QA 3HGRA 1OGSA 1JCYA 3M4HA 2OWWA 1O60A 1YEYA 1H49A 1K6AA 4KMQA 1GW1A 4WX2A 3L4UA 4ZO9A 3II1A 4AB4A 4K37A 4YIWA 2VVNA 3F2DA 2JFEX 5FD0A 3GAKA 3LMZA 1T0OA 1D3GA 1JDFA 1Q6CA 4PBFA 3VKAA 1IZJA 1XCWA 1VQTA 4X60A 4HPGA 1GPWA 3UETA 3P6LA 2Q8LA 3W6LA 1FKXA 4RNHA 2PS2A 3CZEA 3R94A 1UPPA 1H63A 5EFDA 1EIBA 1UD6A 2YW3A 4HNCA 4BWLA 1LT7A 3JZUA 4GQGA 3HF3A 3MSRA 4M81A 1LJYA 3LA4A 4XUGA 1XLAA 3I6EA 1Q6EA 4JYEA 3LBCA 2CZVA 1V6YA 3W7MA 3M0KA 4JTDA 2OXNA 4XAZA 2XFYA 3UVIA 1UD5A 3OBEA 4I6VA 1ZQ5A 5BRPA 2CC0A 3GHUA 4KEVA 4S3DA 2WJZA 4JICA 1BWVA 3C52A 4E3VA 3DFHA 4L65A 5A6MA 4PL1A 3QOKA 1QCWA 1OG6A 4DM1A 1DP0A 2WMKA 4N4QA 3WNPA 3VNMA 1RP8A 2FJKA 1RAKA 3CXOA 1THFD 2PDJA 3KOZA 5DCDA 3SURA 1UASA 1GQNA 4DJFC 4ZXOA 2PD5A 3KWSA 1UUQA 1CECA 3T2QA 1SSDA 1VBHA 1QI0A 4WKAA 1KBIA 1GOWA 2ZX9A 5AHFA 3UR7A 4GZ7A 1JZ5A 1PPIA 3RMEA 1A5OC 1I4NA 4R7JA 4LJ3A 1REQA 5C2CA 1FWDC 4O4VA 2DW6A 2A1YA 1JYXA 3P7YA 1K4GA 2JKPA 4Q7BA 2BMBA 2P8BA 1OFOA 3DKJA 1F5ZA 2E1WA 2CLIA 3WMBA 5K7JA 4FOJA 2VR4A 3ZYZA 4PULA 1DL3A 3W1RA 4PA8A 1PX8A 4D6CA 4JHMA 2V82A 3FK4A 3BL3A 1CENA 4DYEA 1OYAA 1U22A 4JIHA 4WOZA 3FV9A 4GXPA 1DYSA 3RU6A 2FTWA 3VIPA 1H61A 2HCVA 5M1TA 3VD4A 5T9CE 1H7WA 3PK7A 4MKSA 4XZMX 4HBKA 4HNUA 2EKGA 4LALA 5E9AA 2PLMA 4RXGA 3GTIA 4KT2A 1Z3NA 4ZQPA 4AUBA 2GFTA 4RNFA 1GVFA 4P7LA 1VBGA 1RJRA 5AHIA 4A3YA 1C9DA 5TF0A 4EIVA 1FDYA 2YL5A 4OOZA 1Q7ZA 2FLIA 4WIWA 3ID7A 4H2HA 4YXGA 3VNDA 1I2NA 3QR3A 1SFTA 4ML9A 1FKWA 4AY8A 1XBZA 4G1KA 2EKCA 3ABQA 4CD5A 1FCUA 5C9RA 1EKOA 2DJXA 3W7OA 3TCSA 2BFGA 1SFSA 4V15A 3DBNA 3VM7A 1XIMA 3ENLA 5HUPA 3GG7A 4QE5A 2P0IA 4BJHA 2ZUUA 4L7ZA 3V1HA 4BI7A 4ZOEA 4YNGA 1KV8A 2QCFA 3KLLA 3UJRA 1B3ZA 4BZYA 1IGSA 4HSHA 3VZXA 3SB0A 3LRMA 3VPLA 2EJ1A 4M5PA 2ZZ5A 4UTTC 4YTTA 1SW7A 3RCMA 3LCHA 4X2RA 4ZO7A 1R3WA 3W1LA 5CPQA 3AMDA 3RPTA 2CLHA 3GR4A 4J4KA 2PDFA 3EB3A 4H8UA 2F6KA 1UIOA 3GDLA 3CB3A 1YXCA 4O8AA 1A80A 2V3GA 3GNDA 3VC6A 4XISA 4XAPA 4DWSB 2ZOXA 3KDOA 1O5KA 1K7EA 3AU6A 1JD7A 3PZUA 2Z1SA 1V6VA 1ZALA 3U7VA 2ZADA 3MWAA 1NTHA 4ATLA 5HMSA 1B0IA 1PKYA 3R79A 4OBTA 1BG4A 4QG6A 1RVGA 1D7FA 3QY8A 3HJZA 2NSOA 1JI1A 2JIEA 3PM6A 2EGZA 2NSXA 4TMBA 2IKHA 3NNTA 3QY7A 2WVSA 3S9ZA 3BG3A 2C13A 1MDLA 3CS2A 2Z28A 4XB3A 3SY1A 3F4CA 1FDJA 4GNVA 3BH4A 4Y9AA 3IRDA 4O16A 2JF6A 4PRWA 3CHEA 1NEYA 1XLDA 2F2HA 4XD5A 3NQEA 3AMGA 1QT1A 3AHTA 1ITXA 1ML1A 1UPMB 2PUZA 2YX0A 2BHUA 4DZAA 2HVMA 3H12A 2OCZA 1Q6DA 3KTCA 3NGJA 1YDVA 4YHGA 3NL6A 4IIHA 3WLOA 4I9AA 4H83A 1GVEA 3H23A 5JH1A 4O28A 2DSKA 3QZAA 4PH6A 4V1YA 3SCNA 4BQ5A 4EK7A 3OTRA 2WYSA 4YVVA 4O14A 1O7AA 1YKWA 1ZZMA 4AU0A 1DJGA 2FZDA 1M7JA 1SMDA 4LYRA 3REQA 2QNEA 3OODA 4PTNA 2X40A 2IQDA 3B05A 3H7RA 4J3SA 4C6DA 4AG0A 2E8YA 3EXTA 2D0FA 3VIJA 1OZMA 1EP1A 4TX6A 2D1ZA 4MKNA 4CNPA 1G4SA 4MYAA 2QUNA 2VEKA 4DHGA 2G4FA 2XH7A 4LVBA 1WZMA 1VFUA 3GXPA 1VB9A 2NQZA 1XICA 1RBOB 4RW3A 2G41A 4ZTYA 5FAGA 1XV8A 2G3IA 3B40A 1T6MA 5TQLA 5XIAA 4ZSUA 4W87A 5K9XA 5EKYA 3DYMA 2XZ9A 2I17A 2GGHA 3SUUA 2DQWA 2VD9A 1ICSA 5TD4A 4KWOA 3IVUA 4DRSA 1J6OA 1RY0A 3BCDA 4P8UA 5BXSA 1NELA 3G0UA 3QGKC 4XO6A 1LUCA 1D8WA 4UFHA 1XW8A 4HJFA 4IIFA 2CHOA 3L67A 1DXFA 1G9HA 3V75A 3JRKA 3OU8A 4TQTA 2Y63A 1OM0A 4GQRA 3QTPA 1NJJA 3W38A 2WLZA 1FHUA 4YTQA 3W1UA 2BGSA 3FSTA 3UZYA 2GYIA 3EDEA 3P0XA 3HGSA 3SSZA 3AYRA 5FA5A 4NZ1A 3MSYA 5C54A 1BVNP 1NQKA 3L23A 2Z6JA 2E9LA 4O1BA 4UTWA 1ISWA 3LPGA 2HS6A 3THAA 1YNYA 4Q8TA 4MB5A 1DQWA 2JEPA 3CM4A 1BLIA 4QNEA 4B5XA 4DLFA 8RUCA 1GQIA 2KAUC 1I45A 5LNUA 1XH1A 1IEVA 3E74A 4IP5A 3S2LA 3TLLA 4Q4QA 1R2TA 3CHCA 2G3FA 4WXYA 3W1TA 1DOSA 1X7FA 2E09A 1FH7A 3SCOA 1JZ4A 3E3HA 3LCXA 3F4WA 4YTUA 3CWOX 1LT8A 2GGIA 4Q4MA 3THCA 3N2OA 3P8IA 3NAVA 3PSWA 1F3XA 1P6CA 2NV2A 4FIRA 4DWSD 1K4HA 3N2CA 3A47A 4LB3A 4M3PA 1VLIA 3DEQA 4HK6A 1V03A 4DBWA 1X7IA 2BXZA 2A85A 3C5QA 3H4XA 3Q65A 3GC4A 4BEUA 4TXEA 4O1CA 3ES8A 2YDSA 1BAGA 4ONVA 4JR5A 3CC1A 4V2XA 1Q45A 3IJ7A 1Z44A 2BY1A 4HKPA 4F3HA 2REQA 3RMJA 4IP7A 1WOAA 3W81A 1WKFA 1K77A 4ICMA 2W66A 3PB0A 1Q13A 3QBUA 1TJRA 5AKQA 5FSEC 3ZJ7A 3FCPA 2Z7KA 3LYEA 2GWNA 1C9WA 4EACA 3LSCA 1W32A 2IPWA 4JX4A 4UMBA 4U5KA 3FEQA 5KZMA 3ONBA 4MPKA 1G5AA 1FCQA 3NQVA 3KBWA 4X0VA 1REQB 1UYQA 4ZQNA 3ABZA 3PZQA 1O1HA 3T78A 1UJPA 1C3FA 3FJNA 3NWRA 4TOQA 1VCVA 4UNKA 4QG8A 4DF0A 1UR0A 3F5KA 4H19A 2YL8A 4C6PA 3VM5A 2BOGX 4Q3MA 3VIIA 4P7NA 2DVXA 1XP3A 1F61A 2D22A 2C19A 5I23A 1EL3A 3KXQA 3EOEA 3EWBX 5AFDA 4ZZ9A 1HZYA 2VCBA 3FJLA 4GI6A 3IGHX 3EKLA 3KS6A 3QXBA 1RCXB 1RD6A 4HTYA 5I3HA 5AHEA 3POCA 4D6DA 4PEKA 3OVRA 3M0VA 4E3TA 3UEQA 4ZTXA 1PTGA 4ZB2A 1W3NA 1FDZA 3TNBA 1LG1A 3UR8A 1ODZA 1EJVC 3UYCA 2WC4A 3GO2A 2XISA 2GDVA 1DTNA 4MJ2A 1QOQA 1LORA 2NZLA 3JU2A 3PWGA 3VIGA 4YWIA 3NM1A 5AYXA 3FJ4A 4JBRA 3WMLA 2RJGA 5EGRA 4L80A 1FCBA 1WUEA 4PTWA 1EDGA 4O15A 1J8VA 3Q67A 2DUAA 5DMNA 2QHAA 1EOKA 4MUPA 3VFCA 3UA3A 1CCWB 2Z7GA 4FF7A 2XN2A 1FTXA 3N13A 4CQCA 3W1QA 5FEPA 5HNTA 1JCXA 4N02A 3WDHA 4ERGA 2UY4A 5FL1A 4GIYA 1WCGA 3LNPA 3B9OA 1Y5WA 4QS5A 4Z0JA 3H4WA 2ZVIA 3M44A 2QAFA 1CLVA 3WENA 3CU2A 3LGGA 3W71A 2QVHA 4R34A 4HYRA 4NHVA 4LB4A 2J7FA 3L4VA 4XZIA 2QUTA 2DSVA 3RPMA 2HROA 2PDLA 3W85A 1Z69A 4XSMA 4W86A 1GZJA 2C6QA 4PGLA 2V5KA 2E68A 3L9CA 1HJWA 3DHFA 1Q65A 4PUUA 1WDDA 1TA3B 2Y2WA 2G95A 3TKFA 2DZUA 3TMQA 3PBMA 2FVMA 4W8AA 1VFLA 4IMCA 4EXBA 3KDNA 1LZOA 4PMOA 1XGZA 5BNKA 4HU0A 3QMTA 2NWSA 1QHPA 2X1TA 2XJ7A 1LL6A 2YIHA 4DAIA 3KL5A 3CNYA 3HIJA 3KTXA 3NZQA 2ZXBA 4N6EA 1VH7A 3N3TA 3ABSA 2QGHA 4LS1A 1UP0A 2H8ZA 4WUIA 3TYAA 4BF5A 4AD0A 3MMTA 4JN6A 5CAKA 1V02E 3MCNA 4RPQA 4PCTA 4MHBA 3T0DA 3LGEA 2CBJA 4UZSA 4GY7A 3DFYA 4AXNA 1ZBCA 2VJXA 3V35A 2C1IA 2F84A 3CUZA 3UR2A 1KXHA 4W88A 4TVDA 4M6QA 2Y6ZA 3M0XA 1H41A 1VFTA 3BICA 1ITQA 4NNAA 3GDTA 2A3HA 4D8ZA 2XHYA 1W1B1 1JPHA 3MSDA 3B8SA 3UXLA 3UVAA 2E5DA 3R89A 1KFJA 2MNRA 3SIMA 3CUGA 4RZ6A 1K9EA 1HVQA 3C2YA 1DXIA 2Y7GA 4KFOA 1JRCA 2VCCA 4D1IA 3BK0A 4LYQA 4FOUA 2ISDA 3UU0A 2EBNA 2AAAA 4K6AA 4HA0A 4XTIA 1R9ZA 3C0SA 1FUYA 3LV6A 3MV01 1NP0A 3F7JA 2GQ8A 1RCOB 4H04A 2OLAA 3ZJKA 1AZ2A 4FNTA 4IQEA 1L6GA 1IWBA 2FPTA 1UWRA 5RUBA 2G3JA 4LFYA 4MY1A 4I5RA 3GH5A 3PS7A 1W37A 3TQKA 3M7WA 1V6UA 2Y7FA 1IXOA 3CIWA 4Q4OA 2OSYA 3WLNA 1ICPA 2PDIA 1QPQA 1XPYA 4ADUA 4U2YA 1QATA 3CGTA 4R53A 2PDGA 4GNJA 3A23A 3T42A 5LXXA 4HZ7A 4YYCA 3CQJA 1EP3A 1YW1A 2ZRUA 1LUCB 4K39A 1PZ3A 4XV0A 4NL1A 1AQHA 2WJEA 8CGTA 2A6LA 1HJUA 1C93A 4LY4A 2KZHA 2XSBA 3T07A 4AF0A 1TZ9A 3TJ4A 3UESA 4XKYA 2WHLA 3A9BA 1QPRA 4AZCA 5FF2A 2Y4SA 2VENA 4DZHA 4X9SA 4MJMA 4OUEA 3VI2A 2ON3A 4L9XA 3GTNA 3VZZA 5D03A 1BHGA 2EPNA 3OO2A 1Q3NA 2XIBA 3T08A 4YVXA 1UZHA 3DFPA 4B5VA 3HMJG 1XYLA 3C4UA 1YLVA 1VFHA 4WQ6A 3AMKA 3GSMA 4R27A 4XTDA 2O9PA 2BP1A 3Q37A 2QCDB 5CZTA 4B3LA 3GE7A 4A2RA 4MMWA 3WQ8A 1NARA 4C6MA 3UZ5A 3WF2A 4HT3A 3PG8A 1I75A 4N9BA 3MB9A 2PDNA 1S3TC 2PDWA 2VEMA 1FXPA 2QVNA 3OVGA 4YTSA 4I7VA 2YB1A 3H7UA 2VFGA 4KGJA 2CW6A 4Z2JA 3V5OA 1R3SA 2Z1WA 3WLKX 2PBGA 4H41A 2YBVA 1QW9A 3KOWA 3VCCA 3DHPA 4Y96A 2V0TA 4FPSA 4PSPA 3NSNA 2XGIA 3LPPA 5EL1A 3HPAA 2FKPA 1OC7A 3B8TA 1V3IA 4Y9PA 4HNTA 4DNMA 4NZJA 1RJQA 2E6YA 4XK2A 1KW1A 4JYFA 4F66A 3NXLA 2WSQA 1X1ZA 4AC1X 5K4ZA 3W7KA 4Q4SA 3I10A 2XFWA 3CPRA 2GVGA 3ALGA 3NTYA 1YDYA 2OVLA 2Y7DA 2WAGA 3L4TA 3GNOA 1HP4A 3HN3A 1Z7AA 2C0AA 4B4FA 4F0HA 5I0DA 2GVLA 4DJFA 1EHNA 3UWQA 2VI0A 4MSSA 4MB1A 1JUBA 2AOSA 4G7EA 1W1PA 3W7GA 1EC9A 1K6WA 3LTPA 4LYPA 2J78A 1XBYA 4MLRA 1D8CA 2RH9A 3BZGA 2PDHA 1V02A 2J8TA 3LM7A 1V4YA 4RDZA 3PZ9A 1OEPA 2D2OA 4J27A 1QO2A 2DJLA 3HJEA 4QLKA 2WCSA 3EWYA 4MPQA 4IJCA 2WMIB 4Q6XA 1PZ0A 2Z0IA 2VO5A 1V51A 1BD0A 3IGXA 3QPYA 1XBVA 4W7VA 4PMYA 5T26A 3LHYA 3E0IA 2W5FA 1W5PA 5C0QA 1MI3A 3GNNA 1A3XA 2PDPA 3OGSA 2OWXA 1W2PA 3UG8A 1RK5A 9RUBA 4HZ6A 4HPHA 3BZJA 1KRAC 1UOZA 1JCNA 4HMCA 4RNJA 2DGAA 1QK0A 4XZLX 4JTTA 4C5YA 1UZ1A 1E6PA 3KCLA 4HMDA 2ACUA 2I9UA 5HJXA 4LPCA 3ITLA 3NQAA 4QDWA 3SCVA 4AD2A 5IHSA 1D3HA 1OF8A 2HXUA 4AY1A 4HU8A 4FA3A 3JVAA 2PDKA 4QG9A 2C91A 1UH3A 2XPKA 5DY3A 4PMVA 2POZA 3L2MA 3VVGA 4Q4KA 3CUFA 2DZAA 4E8GA 3OHMB 1J2BA 4RE4A 4QEHA 4UBPC 1QHZA 1OSEA 3P80A 4JEQA 2GJNA 4BR1A 2ONEA 1F3TA 1JUKA 3GXMA 1PIFA 4ZENA 1EBHA 1MWOA 2A3CA 4A05A 3AS2A 4DX3A 2DV0A 4JDBA 3MSGA 1R0MA 1SJBA 4HK7A 5K4XA 4GQ0A 2E28A 4W5ZA 3T4CA 3LOTA 5I5RA 1R9YA 1TWDA 1PBGA 1AA1B 1E9YB 2IKGA 4JKKA 4R33A 2GQ3A 3AZRA 3R58A 4UTTA 1GPFA 3RCYA 1AW5A 4RZBA 5F2GA 4OZOA 4NT0A 4CKQA 2W61A 4US5D 3PUEA 2OX4A 2X41A 2BHZA 2DZXA 3OZMA 4PMDA 4UUIA 3E0LA 2UY2A 1B3XA 2VR5A 2X1SA 3LX9A 3UXAA 3NDOA 4C6IA 3VOGA 2VFHA 7XIMA 4S3AA 2FMOA 1W31A 2WMFA 4CLMA 5LA1A 1M01A 5C8BB 2TAAA 2PLJA 3WD3A 4YL2A 2OZ3A 3VGFA 3IV3A 1NIUA 3KHJA 1GVQA 4JQ4A 1DWJM 1YE4A 1QOPA 2X1UA 4KRZA 1UWUA 4UQAA 3UY8A 4OHQA 1JFHA 3DU0A 1WDSA 3BOXA 4ML4A 4LUYA 1JI2A 4L1XA 2PDMA 1BSIA 2F6XA 3AYVA 1AJZA 3H2EA 4QP0A 1XI3A 3MDWA 3WK2A 2FHCA 2FZBA 2WZHA 3O05A 2O9RA 5ENLA 4H8VA 3W23A 1VD6A 3AHYA 3C56A 3QMRA 2XN1A 3WSUA 1ZP3A 4QBXA 1MW2A 4PB3A 1XYAA 4X63A 3KE0A 3GW0A 1AD4A 3M5VA 4QFUA 7ODCA 4BI5A 5ABEA 3SGZA 3VNZA 2X0YA 1E6SM 3DKLA 2V30A 3FDGA 2EPLX 4DWDA 3MYOA 1OYCA 2QAPA 4QCFA 2IW0A 4PCPA 3PNUA 3MHUA 1BQGA 1FHVA 2D0HA 1A3HA 1XLIA 3U5YA 3GY1A 1XRVA 1BTCA 3ARSA 3BLOA 1CGTA 1XD1A 2V2CA 1UG6A 6TAAA 1YXDA 1WAWA 1XCFA 3M07A 3TYCA 5FOOA 3BWWA 3APYA 1UA7A 4EX4A 2O92A 3SQSA 1H1NA 3RRAA 3CV7A 3WFZA 5D09A 1K70A 4NJKA 3ZO9A 2PGWA 1WNOA 3RN6A 4HA4A 1SM9A 2Y5EA 1GYLA 1X6LA 3HPSA 2WMHA 5AHLA 5A95A 3BV4A 4U33A 2VYOA 1XYZA 1IR2A 1EUAA 2VEPA 3HV9A 2DIEA 2TPSA 2PGEA 3MUXA 4WR3A 5BMWA 5HOSA 2G4JA 1YPFA 2Q01A 1RVKA 2HS8A 1T99A 1OK4A 5BROA 4PUKA 2OFJA 1E5JA 1JVNA 2H6RA 2ZE3A 4M0XA 4W5UA 2P1FA 2ZZ3A 5F4SA 1MEIA 5U7SA 3TW6A 5FL0A 3VFLA 1KV5A 3JS3A 1A5CA 1Z48A 4ZCWA 1PO9A 2PWHA 3I7QA 4D71A 4UCFA 1CGYA 2VUNA 3AS3A 4P61A 1WXYA 4XKYB 4FP1A 1J79A 3S47A 1GVSA 3T40A 3GVGA 3IJIA 4ZB0A 1GONA 4H9XA 2QV5A 3N9RA 2VX5A 1R85A 3UT0A 2Z00A 4PSRA 1NOUA 3GZAA 3KRUA 5D2YA 2J7EA 2R14A 1H0IA 2GK1A 3W2MA 3U57A 3CTTA 4V1XA 3DZ1A 3GVVA 3NYDA 3VOFA 4QJ5B 2OX1A 1TPVA 3SO7A 1KWKA 3AYTA 3RPDA 4NKCA 4WXZA 3SR7A 5I3DA 1ADOA 1PJ9A 4XZWA 3B06A 2OQYA 2GLKA 2J7BA 3G77A 1LLZA 1WA3A 2QW5A 1ESWA 1JNEA 3AXHA 2DZBA 2XU2A 1H3GA 1IIHA 1DVJA 4IISA 2XH0A 1KD0A 3ZS4A 5BOFA 4H6QA 3M46A 1OX4A 1KR1A 2ZX6A 5AHNA 2C16A 5AECA 3SY8A 5DBUA 4KETA 4QHRA 3WNOA 1XYMA 3MPGA 4W84A 1PIGA 3VDHA 2YA2A 3O6AA 3B9DA 3WLRA 2HNEA 1QI5A 3NOYA 5J8LA 1E6RA 3TN3A 3PZOA 3L7RA 3F4NA 3VDGA 1QTWA 2Q71A 4N0RA 2ZUSA 3PPFA 2NX1A 3GTFA 3O6DA 5C2GA 4RE3A 3D46A 4WSJA 4AAJA 3NQDA 4C6BA 2PTXA 4G1NA 1H1YA 4CEUC 4CQ8A 1CI1A 3MA8A 3W3OA 2FB2A 1OT2A 4E8DA 1VHNA 2CWNA 5TNVA 1AQFA 2PRMA 4G7EB 4LV4A 3ATZA 2C18A 3S1UA 4LOCA 1YADA 3RK8A 5D8WA 2PGFA 2R8WA 3I65A 1R2SA 3G1FA 4N4PA 5EU9A 3A3WA 1GYNA 1TIWA 4QITA 5HR6A 4GQQA 1DHPA 4KKXA 1BGAA 1LP6A 4LAKA 2D24A 5CZSA 4C7GA 3PZIA 2C1HA 1T5AA 2Y88A 2NQ9A 4LVAA 1QFEA 3EAUA 3TN5A 1J0ZA 4J3UA 1OIFA 1MSSA 1BFNA 2NUWA 4CQAA 5GJPA 1EJWC 3AALA 3KRZA 1MZRA 1GCYA 4C90A 1S1PA 4GKLA 5C9XA 5CBJA 5A8QA 1XKJA 2FH6A 3OZPA 3WLTA 2ATSA 1MVYA 1RZMA 3MU7A 3T0TA 3BUVA 3UJ2A 2PI6A 1FVPA 1GEQA 1E43A 2C1GA 1G4PA 4AHOA 3W1PA 4B2DA 1JYNA 5CBBA 1CT5A 1PTDA 1YXYA 2BB0A 2ZCGA 3K13A 2XGZA 2O55A 2PF0A 3AI0A 4M51A 1EGVA 3UWEA 2ZKMX 4M6VA 5EMKA 3IIPA 4C6EA 3VOIA 1J0KA 1X6NA 1BF2A 2ZX5A 3DGBA 2A79A 1M04A 2PDXA 1JYWA 4C6KA 3VGEA 3ZT6A 1H4PA 4MOZA 5DXXA 3RO8A 5CJNA 4S3JA 2QJJA 3UCDA 4WDTA 4GIEA 2Q3OA 3HGJA 3KHDA 3AMLA 3PAOA 4F2BA 1B4EA 2HE5A 3CPUA 4XZHA 3PY2A 1KTBA 4L9YA 4RZ4A 3GDKA 1ONWA 5EPDA 4F0LA 5I6SA 4NIRA 3C0LA 5F4XA 3DYPA 3UY7A 2GSEA 3CUJA 2AAMA 2FZ8A 5CZJA 2J47A 2GJLA 4XD3A 4ZE4A 2HDJA 3B0XA 3PWAA 4ZOBA 3VNYA 5FIPA 1E55A 3FOKA 3TW9A 4HOXA 3HQOA 1YMYA 1E0TA 1UIPA 4R9OA 4M6PA 3MP3A 1NDWA 1RHCA 2PP3A 1JCMP 2WJFA 2QCCA 1W3IA 5LNVA 4NAEA 1FP8A 4JL2A 3ZSSA 1YPIA 1SO6A 2QMKA 2AL2B 4EWJA 3FX4A 3WK3A 2PWVA 3DESA 5GNYA 3CUHA 3R8HA 4QXIA 3PPHA 3PZVA 4D2JA 2QLYA 2W67A 2OZTA 1NDVA 5C7VA 3MMDA 4LVFA 1M1BA 3K30A 1EQPA 3W1MA 2Y7EA 4AZ5A 4BQ3A 1OHLA 2WWDA 9XIAA 4LSBA 1IGWA 3C3UA 2BXVA 2AQWA 3CPGA 3ZWTA 1E51A 3O9NA 1P0NA 3VIKA 2AKZA 2CYGA 3EOSA 3M7SA 3DG6A 4DZIA 4MNMA 1YQ2A 4WK9A 4HZMA 4ROPA 3E0FA 1OIMA 3UXKA 1J5SA 2WHMA 4W9TA 3WLIA 3M0HA 1TJ0A 3ARRA 1VC4A 2DDXA 4MJ4A 4K2SA 3T0CA 3QV6A 2NQJA 3IJDA 1BQCA 4XIAA 2YL9A 4I5XA 1CTNA 1CGXA 2XSAA 1OFBA 5GJNA 3WUFA 4Q8UA 2HE8A 3TJXA 1C90A 1JZ2A 1C7SA 1JCLA 3VA8A 3BGAA 4ZBCA 1EPVA 4IX0A 4BF7A 3ANVA 2OOFA 2DIJA 3QV7A 3GNPA 2OYLA 1TWIA 3A6OA 3DI0A 1Z41A 1A47A 3RILA 4E0CA 5HNNA 1J6PA 2YBTA 1XGEA 3W75A 1FRBA 3DUGA 1UKSA 2ZFAA 4HA3A 1NP2A 2VM8A 2YDQA 5FJPA 2XN0A 3O8AA 2EJAA 5LHEA 3EKGA 4UTIA 2OSWA 3LERA 4KIEA 2ZZ1A 5DRIA 1ZCCA 3GLCA 1SJAA 3CHDA 3BLEA 1HO1A 3A3HA 4EAYA 2R1LA 2BGNE 3R0KA 1M7PA 2HPMA 4PRTA 3WBEA 1HVXA 2QYGA 1IT7A 3LZ3A 3VNKA 3W76A 5IBXA 4OECA 3QV8A 3WUBA 1JDEA 4IG2B 4AIOA 1AZ1A 4UWMA 3B0PA 1EJXC 1L0PA 5F1VA 4AIBA 3K46A 4D8AA 4HN8A 5DBTA 1ECQA 1P0DA 4AIUA 3ECQA 3PBWA 1BEUA 3L0NA 3UBPC 4A8NA 4HSNA 3CK5A 2GGGA 1TB3A 3HM7A 3PP7A 4ORIA 2NT1A 2PC4A 2RUSA 2OWCA 3KWXA 3IGSA 1HKMA 1E6NA 1G7UA 3W2NA 4Y9MA 2CHNA 3VX0A 3L4XA 1PHQA 3WLHA 4CNNA 3H70A 5CG0A 5FEXA 3GDRA 5E70A 2GL5A 2VFIA 4FNRA 1FXQA 1H50A 3T81A 3IJ9A 1ZY9A 4DZ5A 1JIBA 1XIHA 4ZR8A 4O50A 5C6MA 2B7QA 5G2HA 1S5MA 2JEQA 4C6QA 4GUFA 4F2TA 2EPOA 4ADSA 2VT0A 4XO7A 3TXZA 5KMYA 3KOYA 2OG9A 2X30A 3UJSA 2CLOA 3DOPA 4EPKA 2WV8A 2PC8A 4C1KA 4F2UA 3CQHA 1R30A 1EDQA 2QCLA 1DHKA 3RCNA 1Q6FA 1N7KA 3CYJA 4M1BA 1NF7A 1RQHA 1EZWA 1DWHM 4LS0A 3G0XA 1E40A 4W7WA 1BKHA 5LNWA 2UBPC 1W91A 1WKYA 1OJXA 3CUIA 4UFJA 3CZJA 2I16A 1LTDA 2P88A 1NWTA 3BV7A 1EPXA 1KB3A 2NX9A 2XG9A 1H51A 4QEEA 3H22A 3W24A 3ZR6A 2HXTA 4H8NA 4YVPA 3UG5A 2WNQA 1F9CA 3EMCA 4WEVX 4AIEA 2QR6A 4DI9A 5BRQA 3LBOA 1DTUA 5D8ZA 1IIGA 1R3YA 3NQMA 4H1ZA 1POKA 3QF0A 2PWDA 3OG2A 4DB7A 5KTLA 2A4AA 3FW6A 3ITOA 5D05A 4J3ZA 1F6KA 3EZ4A 3NM3A 4URIA 3L68A 3WKZA 1W3KA 1U1UA 2QF7A 3A9IA 4KCTA 2NT0A 3RX3A 1PV8A 1BYDA