1LF1A

Crystal structure of cel5 from alkalophilic bacillus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
298
structure length
296
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGITVFRAAMYTSSGGYIDDPSVKEKVKETVEAAIDLGIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWDNQIKPYAEEVIPVIRDNDPNNIVIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cel5
publication title A novel combination of two classic catalytic schemes.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 109
structure length 296
sequence length 298
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lf1A00
1O7AA 2QHAA 4HZ7A 1OSEA 5ABHA 3PTKA 2WBKA 3N04A 3QGVA 4Q22A 4D6IA 3SEPA 3BH4A 1JNDA 2OSXA 4HP5A 1RP8A 4D6DA 1BTCA 2UWFA 3WQ6A 3NSXA 3ZJ6A 2WMGA 4CVUA 3CHEA 1UWTA 3AHTA 3AS3A 3WQVA 3HU7A 1W1TA 3F4VA 4HA4A 4UFHA 4D1JA 5A6SA 4FMVA 5CQ1A 3AS2A 4BF7A 3GZAA 2VX6A 5FKYA 1UWIA 4K68A 5HNNA 1JZ4A 2AAAA 4J27A 1NOUA 3AMLA 3T0AA 1WZMA 4AEEA 2Y5EA 1MQRA 4PTVA 3QOMA 4ZEPA 7CGTA 3VOCA 3B8SA 1TVNA 3IANA 2OYMA 5GNZA 2XM2A 5JIWA 2D20A 4GO9A 3UG5A 4ZXLA 1UR9A 4WJXA 1DWFM 4V28A 1J0KA 1ODZA 1VFMA 1NH6A 1UD8A 4OBSA 2YA1A 4R5EA 3BSGA 3TTQA 1I1XA 5EB8A 1W9XA 1HF6A 5E9AA 1XH1A 3BAXA 3AMGA 1SMDA 5CGMA 2FHBA 4AIUA 4QCFA 4S3KA 2VI0A 2VNCA 1X1NA 1B9ZA 1ZL1A 2WHMA 1PX8A 3S6TA 3VMPA 4TTGA 2XWEA 2WW5A 3JUGA 1E72M 1JDAA 1EO7A 1CGYA 4PMXA 1HXJA 3W24A 4PUDA 3AMCA 1QI3A 1GOKA 1KFWA 3KE0A 2YBUA 1E6QM 3VD4A 3AIUA 3LPGA 1OCQA 1JIBA 4PMOA 3WF2A 1CXLA 2YL6A 2YA0A 3NIYA 1ISYA 1H49A 1ODUA 4U2ZA 2O92A 4P7RA 4FF5A 4AD2A 4JFUA 2EBNA 3ZMRA 1E4IA 4CD7A 2V3GA 5A6MA 2ZXQA 3GXIA 3D5HA 3AFBA 1QI0A 4DM1A 2ZX6A 1BPLB 1JL8A 1G0CA 4BS0A 3VX0A 2ZUVA 3VX1A 1UG6A 1CGXA 2VQTA 1Q6EA 2QPUA 5EMYA 2WMIB 1V3JA 1E3ZA 2AOSA 2XVGA 3M6DA 1KXVA 4GINA 3WDIA 3T2QA 3J7HA 4U31A 2XIIA 3A4XA 3BAIA 5CJ5A 1EXPA 4QLLA 5A1AA 3WSUA 1JG9A 4NRRA 1CGVA 3WEOA 1CLVA 4B9YA 3O2LA 1TMQA 1J18A 1QVBA 3RILA 1W9UA 1L8NA 3IAQA 3II1A 1XGZA 3WQ4A 4BCEA 2DSKA 2ZOXA 4J3XA 4MB5A 1HL9A 1JNEA 3T2OA 1JDDA 2PWEA 1V6UA 9CGTA 1GQJA 4E8DA 1OWQA 3MUY1 3SCPA 2J7EA 1W3KA 3VO0A 4LQ1A 1MVYA 1FH7A 1JZ2A 5A8OA 2BY2A 1B90A 2WAGA 3I3EA 2WKGA 4HA3A 4IPLA 4PYSA 4P7LA 3VUPA 2WMIA 1VBUA 5AC4A 1J10A 1QPKA 1EHNA 2W66A 2W92A 3TONA 4M8UA 3ARUA 4UFIA 4PMYA 1N82A 3CZ8A 3ARZA 3OLEA 4ZE5A 2VZSA 3GNRA 1UKSA 4MNJA 3AIVA 1Q6DA 1V0NA 3BAJA 2XWDA 1EOMA 4PCSA 3ZO9A 2FHFA 4FLSA 3W38A 2DSUA 3SUWA 7A3HA 4GZJA 1J0ZA 5JBDA 3TP4A 1Q6CA 2J8FA 3M46A 5DO8A 1R7AA 1EO5A 4A3HA 5D8WA 2FDMA 1EQPA 1US3A 4AZ5A 1E6PA 4BA0A 1B3VA 3K4AA 4LGXA 3RO8A 5BXSA 1B2YA 3VD5A 1M04A 1XSIA 3B9EA 1FA2A 3OBAA 5CPTA 3VPLA 4H8VA 4UOQA 5I79A 4YN5A 3WNKA 3CHFA 4AISA 4H04A 2X0HA 1JYXA 1E71M 3RM4A 3OGRA 5ABEA 3VM7A 5FOOA 1PJ9A 2WVSA 3WDHA 1JI2A 3L4WA 4Z2KA 3SCUA 5FD0A 5GNYA 5D9NA 1V08A 1GOQA 2J25A 2VOTA 1HVXA 3ARPA 1C8YA 2WK2A 5BXTA 1BF2A 1JZ8A 1KGXA 1MW3A 1UKOA 3WUFA 4ZENA 1VAHA 4XX6A 4H8HA 1HP4A 3SUVA 1UUQA 3AZTA 4D6FA 1G01A 2WCAA 3ZOAA 3VM5A 3N1AA 1C3FA 1HN1A 4U33A 3BC9A 4NF7A 5IFPA 3POHA 5ABFB 4RL3A 4UOJA 1YQ2A 4CGTA 3KZSA 1VJSA 2WVUA 2YL8A 2WC3A 1MFUA 2DT0A 4WK9A 4MDOA 1IT0A 2CCRA 5GNXA 5I77A 4BZYA 1C92A 4PUEA 1EA9C 5D9MA 2Y24A 4JCMA 3CZKA 1F4AA 1PZ3A 3SCQA 4W93A 3CTTA 3PHAA 1XYZA 2JIEA 3MS8A 1BVZA 3W6LA 1E15A 4AZHA 1LLOA 2D0HA 3NSNA 2XSBA 5IFTA 4E2OA 4BQ2A 1QNRA 2ZX9A 5I3DA 2IUZA 1C8QA 5D9PA 4TVDA 3PTMA 1CECA 2ZWZA 2X09A 5A8QA 2GDVA 1D7FA 5JUVA 3ZSSA 3W29A 3AROA 5FCZA 1US2A 2OLHA 3FNDA 4WSJA 4JHOA 5ABFA 2RGLA 1D3CA 1DWIM 1W1YA 1KR0A 3L2LA 5AYBA 2VQUA 3OA5A 1V3IA 4RE2A 3PZVA 1DTUA 3VNZA 1MQPA 1V3HA 1V6WA 3OLGA 3ALGA 4Z2JA 4Q7NA 1B30A 4EANA 1FHDA 1QNPA 2ZXBA 4PMQA 2G3IA 2PI6A 1W3LA 3UG3A 3UETA 2B31A 2RGMA 2JEQA 1OINA 4B16A 2WNWA 1W91A 5E70A 3GH4A 1WO2A 5E6ZA 3T08A 4U5KA 3PZGA 3AS1A 3VD9A 4UFMA 1F4HA 5IHRA 3W0KA 1UWRA 3CGTA 5HBFA 3VNYA 3PZMA 3GXFA 2Z1SA 4AZ6A 3K8KA 4J3TA 5A6BA 1CXFA 2PF0A 4AYSA 4OBRA 4RE4A 2WMJA 3AS0A 2YDQA 2J62A 2ZX5A 3WF1A 4JFSA 3A3HA 2DQXA 4WF7A 1UKQA 1V03A 2DSVA 4GPNA 3A47A 3ARVA 2J7HA 1QNSA 3CUJA 1WDRA 4MNMA 4QLKA 1Q6FA 1BYBA 4W8BA 3PBGA 4JKMA 4E4PA 3G6MA 1GONA 3BCDA 4YHEA 1DWGM 3GNOA 1E73M 3CBWA 3QHNA 1LL6A 2CITA 2D0FA 3ARQA 1QW9A 3MANA 2VX5A 3VGEA 2V3FA 4QDMA 2CYGA 2VVSA 5I5RA 4FLOA 3BSHA 3WH8A 3L4YA 3IK2A 4ATLA 5ECUA 3PN8A 3U5YA 4TOQA 2BVTA 3K46A 2WMHA 3W81A 1IZJA 5E6YA 1QBBA 1QBAA 4EAMA 2BHZA 1LG1A 1JZ6A 2YDRA 4CCDA 3F5KA 2C8NA 3W82A 5A2BA 2WWCA 3WNLA 1VIWA 2EPOA 3VILA 5CGTA 1NWUA 3ZR5A 3FY1A 2D0GA 1E40A 2CXGA 4CD4A 2DDXA 1M53A 1FH8A 1E0WA 4CD8A 3VDBA 1OIFA 2D3LA 2CBVA 4DM2A 2VRQA 3ZM8A 2EO7A 1V0MA 1VFUA 1NWSA 3CMGA 1J0HA 1UYQA 5HOSA 4HOXA 5I0DA 3ARTA 4N42A 2OWCA 2BVDA 3SCRA 1GUVA 3CUGA 1HJQA 2A3BA 3CIVA 1BQCA 2TAAA 4U3CA 2W61A 2WMKA 1KWGA 3F5LA 4AD0A 3N11A 4HOZA 2YL5A 1MXGA 3FAWA 5LYRA 2W4XA 4TXEA 5BYWA 4W7VA 1ECEA 4XV0A 1UWSA 4MJ2A 4A3YA 2DT3A 3IAPA 1NWRA 5CSUA 4P7QA 3HN3A 2JF6A 2XIBA 5CSYA 5M17A 2PWHA 2PBGA 3VGDA 4BQ3A 3KL5A 4LYQA 2G3NA 4DWSC 5BRPA 1E6XM 4UQ9A 3KWXA 1H11A 3APGA 1KXHA 2PC8A 2XVLA 4DWSD 1HVQA 3AZSA 4Y7EA 1TE1A 1E43A 3K4DA 3KL3A 5A2AA 1E6NA 4JFWA 4HPHA 1OB0A 5I78A 8A3HA 2ZX8A 4AY1A 3PZIA 2FH8A 3IJ7A 4NZCA 1SMAA 2O9OA 1JF6A 4PMNA 4TTUA 3VIJA 1W9BM 3WF0A 3T0BA 4M82A 3IJ8A 4LPCA 1UD2A 4MADA 1CEOA 1CWYA 3ZJKA 1FP8A 1FHLA 2WANA 1FP9A 1CTNA 4WKAA 1Q6GA 3WH5A 3T09A 4MAZA 1GHRA 3HJEA 6TAAA 5EBAA 3FHAA 1BFNA 3KL0A 4UQAA 3BCFA 1W2PA 1NARA 2VR4A 4UOZA 1UQZA 4CUCA 3AZRA 2J7FA 5CLTA 2QV4A 3W4RA 1KCKA 2WZIA 2J79A 3MUAA 2E0PA 5LA2A 4AWEA 1NOFA 3QHMA 2X8RA 5E0CA 2QPSA 2W62A 1J0JA 2OYKA 3MMWA 3WD0A 1LF1A 3VVGA 2V38A 4JIEA 1BHGA 3AHYA 1U2YA 3LPFA 3W6MA 4AZCB 1QNQA 2W91A 3K8MA 2YJQA 3UG4A 2O9PA 4AIEA 1H1NA 1I75A 1BVNP 4M24A 1B3ZA 5DFAA 4QCEA 5CG0A 3UERA 1KXQA 3IJ9A 4ZE4A 1EHAA 4MNKA 3WQ5A 1BG4A 3WFLA 3ARXA 4UNIA 1LWJA 3EMCA 2YDSA 4TX6A 1BYCA 2WZEA 5CZKA 1HT6A 1C90A 1XCWA 3CLWA 3L4UA 3NSMA 1FFRA 3AXXA 3VIHA 2PBOA 3AXHA 1V02A 1U33A 5IXEA 5C71A 1JZ3A 4GXPA 3L4ZA 4OOZA 5BWFA 1OD8A 4KH2A 3RJYA 2J47A 3WMBA 4AD4A 1JAKA 3CZGA 2NT0A 1NM9A 2D3NA 4HOWA 4AEFA 5DMYA 3DECA 3TTYA 1GPFA 5DT7A 3WDJA 1W9VA 1FOBA 5M5DA 4XB3A 5A95A 1X6LA 1EH9A 3DHPA 1IV8A 4AZCA 2ZE0A 1UR8A 3QHOA 3TA9A 3GM8A 2OWXA 2XVNA 3WH6A 1E70M 2A3EA 2CPUA 2OSWA 1HJVA 3MO4A 5E09A 3EDJA 1OT2A 2Y8KA 3OLIA 3WQWA 4M1RA 1WE5A 3EDEA 2E9MA 1CGUA 4F66A 1NQ6A 1QI4A 2WCGA 4P8UA 3VIPA 2BNJA 4UQCA 1KQZA 3WFZA 4W7WA 1R85A 3W26A 5D4YA 1VENA 4AXNA 2YA2A 4PCTA 4NSBA 1GJWA 2PWGA 4D6GA 1CNVA 2J77A 2BVYA 2XHYA 2D23A 1KXTA 2WLZA 3WNNA 4PSRA 4LXFA 1XV8A 1AQHA 3N18A 2G3JA 1E0XA 4D1IA 3WBEA 1AMYA 5AC5A 2XVKA 3NCOA 1CGTA 3SUSA 4UQDA 1HL8A 1W1PA 1J12A 4GZIA 2J78A 2WVTA 1XC6A 2HVMA 4IUGA 1WNOA 2X2YA 2VZUA 3FAXA 1BAGA 3MUIA 3NYDA 5I2UA 1HJXA 3T0DA 1W3JA 1GVYA 1JYVA 1BSIA 4LYRA 1M01A 3E1F1 4HZ6A 1SYTA 4H8UA 4AZ7A 4GI8A 1JFHA 2ZIDA 1CXHA 2PB1A 1ZBKA 4CU7A 3OIHA 1QOXA 1LL4A 3B9DA 3OG2A 2BHYA 4KGJA 1ZBWA 5BCAA 4D6CA 2WKLA 2VURA 3BMVA 3UESA 2JF7A 2A3AA 2E3ZA 4JZ5A 1V0LA 2DH2A 4PMUA 1UA3A 3WDPP 4IISA 1WDPA 1XSKA 2VMFA 3GBDA 2ZUWA 4Z2HA 5EFFA 1VFFA 3WENA 3WBAA 4QAWA 2VL4A 2XTKA 2DT1A 1GJUA 3GH7A 4IPNB 3FW6A 1OIMA 1W3HA 3I3DA 2O9RA 5BXRA 2QMJA 3ARSA 2VX7A 2DT2A 1VRXA 1UZ4A 4MPKA 4D6JA 1H0GA 1O6IA 2VZTA 4HZ8A 1V6XA 4M56A 3HMCA 2XJ7A 2Y2WA 1ITXA 2WCSA 4HA1A 1C91A 2WYSA 1VEMA 2EJ1A 2JEPA 3W53A 2F61A 1WDQA 2CHOA 1VF8A 3CO4A 1RD6A 3ZT6A 3CUFA 8CGTA 3TTSA 2CNCA 3GH5A 1UWQA 1LQ0A 3POCA 4L4OA 3BMWA 1PX4A 2J74A 1GOIA 1J01A 5FL1A 1UWUA 3BLPX 1JZ5A 1UR1A 1E6ZA 1JF5A 1CYGA 3N12A 1D2KA 2DIJA 2E8ZA 1C7SA 2BHUA 2ZUTA 4W5ZA 1ITCA 3GNPA 2PWFA 1V3LA 1R87A 5KEZA 4WLCA 2CEQA 2DSWA 5BXPA 1GCYA 2GDUA 4CKQA 4B9ZA 4XZBA 4MAVA 3VIIA 1ISXA 3WUEA 5BROA 1MW2A 3WKZA 2JIWA 2G8ZA 4WKHA 4AZGA 4X0NA 1V3KA 4S3JA 4Z2IA 5A6JA 2D1ZA 2XFRA 3WY1A 2J7BA 1B3XA 2MANA 4R27A 4W86A 2VCCA 5JBEA 2ZICA 1XRVA 1H5VA 3L4TA 5I23A 3EYPA 1M03A 2WVVB 4OKDA 4AD3A 3SCWA 1KGWA 3BLKA 3WD3A 3RDKA 1L0PA 4WSKA 2VVNA 1NWTA 2CERA 1M7XA 3ARWA 1V6YA 3VGHA 2AMGA 4HU8A 3WEZA 4TX8A 5FL0A 3GTNA 4CN6A 1GQIA 2BS9A 4CCEA 4GI6A 3GBEA 1H3GA 3W37A 3LMYA 3AI0A 3AHZA 2G4FA 4KGLA 1G1YA 1KR1A 1NP0A 5DF0A 1DWJM 1U30A 1S46A 4P8WA 2DEPA 3SUTA 1TA3B 1KQYA 4UZSA 2GSJA 1ZBCA 4GO8A 1VJZA 1ZJBA 2Q8XA 3GYCA 3ECQA 1GOOA 3SURA 3M07A 1Y7VA 2GJPA 4PEEA 4AZIA 1PIGA 1WDSA 3WL0A 1UH3A 5DEZA 4JFTA 2C0HA 4OIFA 1XH0A 2FHCA 3ZQ9A 5A6KA 1E9LA 1PAMA 1HIZA 2UY5A 2DH3A 4L4PA 2WWDA 2WVVA 5JBFA 5CPQA 3WMSA 1DWHM 1Z32X 1OM0A 2YL9A 4JKLA 1DP0A 1XSJA 4H7VA 1YHTA 4HMDA 3UCQA 2DIEA 4PTWA 3A4AA 4MNLA 4OJYA 2OYLA 1TUXA 3ZJ8A 1TG7A 1EGZA 1UR2A 4ZXOA 1WAWA 4JKKA 2BFGA 1J0YA 4W8LA 1QHOA 2Y8VA 3MMDA 3GXMA 3VIGA 1IZKA 2JALA 2XGBA 1JGIA 2G3MA 3VIMA 1XD0A 4NRSA 4P7NA 4P7OA 1TA3A 2UY2A 2IXVA 3TTOA 1MFVA 3W27A 2GFTA 1J0IA 5A6LA 5E0FA 4PTMA 1EIBA 2CBUA 3AIRA 3MSDA 1ZB5A 3OZOA 3WDRA 2D24A 1K9DA 2YLAA 4X9YA 3L4VA 4JHZA 3D3AA 3VDAA 4JL1A 1GVIA 3ZT5A 2VJXA 3AYSA 2CETA 4C7FA 3U5UA 4M81A 2QLYA 4UFLA 1W9PA 1JFXA 1R86A 1MXDA 1JI1A 2WHKA 3BAWA 6A3HA 1KCLA 3L4XA 1E1EA 4AIOA 3BAYA 2D22A 1JXKA 3MSGA 2VT0A 1UA7A 2XVPA 3VIKA 1K9TA 4ACYA 4GIAA 4GQQA 1NP2A 4H41A 2A3CA 3SUUA 1GORA 4FLRA 2CKSA 1BYAA 1QI5A 1DEDA 2VO5A 4UR9A 5AY7A 4UCFA 4DUXA 3GXDA 2J4GA 1WB0A 3PZ9A 2BY3A 1CLXA 3SIMA 4C7GA 1UD4A 4FK9A 2JFEX 4QFUA 1EOKA 2OSYA 1JAEA 4AW7A 2WHLA 2Z1KA 1OGSA 5LA1A 2EPNA 3DHUA 4PMRA 4WKFA 2F2HA 2X05A 3AJ7A 3N13A 1JZ7A 1WKYA 1P6WA 5IHSA 4J3UA 4DUWA 2EPKX 4V27A 1ISZA 4UQEA 5C70A 3CUHA 4W89A 3OB8A 4YPJA 5EFDA 3THDA 3ARYA 3VKKA 4AZBA 1E55A 2XYLA 4P8XA 4MB4A 3WQ8A 2JE8A 4WIWA 5M3WA 1E4MM 5A3HA 4HTYA 1PIFA 1GOWA 1GNXA 1MYRA 1G5AA 2CHNA 3WF3A 3FN9A 1E5JA 4ML4A 4KMQA 1QHZA 4JL2A 5I24A 1Q4NX 3W28A 1UD5A 1KGUA 4YHGA 1PBGA 4PSPA 1JYWA 1K6AA 2Y4SA 1W2VA 3WL1A 3L2MA 3CUIA 3VTRA 3WELA 2VUYA 1XD1A 3DYPA 2VRKA 3N15A 3OLDA 2E8YA 4LX4A 1KBKA 1H09A 3F5JA 4J7RA 4J3WA 3SCNA 1KWKA 2FGZA 4W87A 3AIEA 3PZQA 5DT5A 4NI3A 3PZUA 3RPMA 4P8VA 1UR0A 2CBJA 1X6NA 2BY0A 1ISWA 7TAAA 3ZIZA 3AYRA 4D72A 3N9KA 4DWSB 2DPEA 1V0KA 3SCSA 1C93A 1TCMA 1VFOA 4HU0A 1CENA 4CVWA 1B0IA 3BGAA 2XSAA 3SCTA 4F8XA 2EQDA 2GJXB 4X0VA 1UD3A 1CIUA 3OZPA 2NW0A 1NOWA 3WH7A 1UKTA 4HPGA 1WPCA 1CZ1A 1BLIA 1SFSA 3CZLA 3GDBA 3CHDA 3VDHA 1KBBA 1A3HA 3VINA 1G94A 4J3VA 1WP6A 3AMDA 4CU6A 2V5CA 3RJXA 1PX3A 1QI2A 1OBAA 2GUYA 2VC9A 4HMCA 3KEHA 4PMZA 4XUYA 3VD7A 3CPUA 4W8AA 3WDQA 5I6SA 4ACZB 3VMNA 5A6AA 3AICA 5ABGA 1BGGA 3ZJ7A 1UR4A 4FLQA 1E56A 1UH4A 4ZFMA 2ZXDA 4DWSA 4OUEA 2ZWYA 5KZ6A 1EDGA 1GZJA 1ESWA 2A3HA 3WUBA 5M03A 2WC7A 4W85A 2XPKA 3MMUA 2WLYA 3RM8A 2J75A 2GJXA 1XH2A 1OT1A 3VGBA 2VRJA 4CD6A 2E9LA 1R7OA 1G9HA 4D6HA 2W63A 4F9DA 5A8NA 4N0RA 4KRTA 3SCOA 1HJSA 1OGBA 4PBGA 5LA0A 3MU7A 4CD5A 4W84A 2WBGA 2F8QA 1LJYA 1V02E 1UQYA 2GJRA 1WCGA 2CESA 1H41A 4CN1A 2FGLA 5JIPA 1ZS2A 1UOKA 2X0YA 4Z2LA 5FIPA 3UR7A 2DGAA 1QW8A 5TD4A 3WD1A 3K8LA 4W5UA 4ACZA 2ZUMA 3W25A 4W7UA 1W9DM 3G6LA 3QOKA 5A2CA 2EXOA 3UR8A 2VR5A 2EPLX 3EDDA 4HMEA 1AQMA 2WMFA 2PWDA 3MV11 4PTXA 5D9OA 3AISA 3MV01 4MTVA 1FH9A 2GK1B 1JXJA 3DYMA 1RH9A 4OOUA 3EMZA 5A94A 4TVUA 4GKLA 1XYFA 5HPCA 1HP5A 2O9TA 2J7GA 1R8LA 3UEQA 2ZUNA 1HJUA 4U2YA 1W32A 3CZEA 1JD9A 1GW1A 1GQKA 2OWWA 3NDYA 3VMOA 4J28A 3SCVA 1UZ1A 5A6BD 4GQRA 2BXYA 1BG9A 1HX0A 3N17A 2UY4A 2XUCA 3VU2A 3PZNA 4UTFA 2J7DA 4OZOA 2WC4A 3ZR6A 4M29A 1TVPA 3U7VA 3EDFA 1ZJAA 3VDCA 4D6EA 1V6VA 3EMQA 4F9JA 2CBIA 2XGIA 4A4AA 3AMKA 5HXMA 1UD6A 1VBRA 2GK1A 4C7DA 3O6AA 4EE9A 3EDKA 4E8CA 1LWHA 2YKKA 1JDCA 1GQLA 1PEZA 3LPOA 4U3AA 2X1IA 1DHKA 3AIBA 1FFQA 3AHVA 2CKRA 2V3EA 4CU8A 1TFVA 1OD0A 5HPOA 1OGGA 1K9EA 2BY1A 2YLLA 4D71A 3ARRA 3WD4A 4UFJA 3O9NA 2W67A 2WM0A 1KB3A 3FHQA 3OGSA 3BXWA 2VX4A 1I1WA 2UY3A 3M7SA 2E40A 1W1VA 4B3LA 2ZUSA 3PZTA 2V5DA 1JD7A 3VGFA 3TOPA 2WHJA 2ZX7A 4LYPA 4MB1A 2WSKA 4V2XA 5F7UA 3PTQA 5AYIA 1ISVA 2YIHA 4BQ5A 3NUKA 2WXDM 1TZ7A 2W5FA 2EEXA 4KRUA 2VTFA 3OGVA 3T2PA 2CIPA 3NJ3A 3CMJA 4AD5A 3CHCA 1VEPA 3BAKA 2VCBA 4TUFA 2G41A 1B31A 4DUVA 1H2JA 4PN2A 1HKMA 4IM4A 5IDIA 3VIFA 3PZOA 4MJ4A 1B1YA 1J9YA 1XHGA 3WNPA 1MQQA 3WMCA 1RPKA 3MUZ1 4B15A 4UZUA 1LG2A 3AOFA 4QLJA 2E9BA 2J8GA 2NSXA 1V3MA 3VD3A 1EQCA 4UFKA 5CPSA 3WN6A 3WEMA 2EPMX 2XG9A 1MWOA 2WZHA 1AQ0A 5GPRA 5CLWA 1UH2A 2WB5A 4URIA 1JYNA 1C7TA 3CH9A 3DC0A 1BYDA 3ZSTA 3NDZA 4PRWA 3WD2A 1CGWA 1EDTA 3A4WA 2VCAA 1UKPA 2IXUA 2QF8A 1WZLA 4JFVA 4W88A 1E6SM 4UQBA 4CN4A 1XCXA 1CXIA 1UHVA 5A8PA 2XM1A 1VB9A 2GVYA 4AD1A 4AC1X 4JAWA 4B3KA 1EDQA 3EBVA 1E1FA 1HKIA 4ATDA 2V3DA 4TVCA 1H0IA 1A47A 1H4PA 3RIKA 3WF4A 3VGGA 1WZKA 1ZBVA 1GHSA 1GOMA 3U57A 2WPGA 1PPIA 3QR3A 1C8XA 3WUGA 2HISA 1E3XA 1K9FA 4GI9A 4AMCA 1LL7A 1ZU8A 3DYOA 4J3SA 3I3BA 3U7BA 2J7CA 3ALFA 2D2OA 2XFFA 4KWUA 1CDGA 1J11A 4CCCA 2VZOA 3RMEA 4EK7A 1WZAA 4MDPA 2E4TA 4H2CA 4PMDA 4Z2GA 2ESCA 3LPPA 5HDRA 5C8BB 4EKJA 3WNMA 4F79A 1RP9A 3AQUA 3B9AA 4GZEA 2VZVA 2XFYA 5GQBA 4BQ4A 1B3WA 5BRQA 1CPUA 1B3YA 2YOCA 3WNOA 2NT1A 2YBTA 2ZXAA 1CXEA 3AHXA 1E6RA 1SR0A 3K1DA 3S2CA 3AIWA 3VIOA 1E4LA 3ZT7A 3RM9A 1AVAA 1BGAA 3MKKA 1HNYA 4XZWA 1QNOA 1HKJA 2C7FA 1DWAM 4QP0A 2FH6A 5A8MA 2BV9A 2DSZA 3A6OA 1MW0A 1HJWA 1E4NA 4U5IA 3THCA 2WSPA 3RCNA 1PZ2A 3AXIA 1E0VA 2QMKA 3WIJA 3CZJA 3AIQA 4PMVA 5A69A 1CBGA 1E5NA 5D8ZA 1VEOA 1TR1A 4ATWA 3FXYA 4MB3A 1HKKA 4RE3A 2ZUUA 4M80A 1CXKA 1MW1A 3WH9A 6CGTA 2BXZA 5CXPA 4JCLA 1QHPA
chains in the Genus database with same CATH superfamily
3NL3A 3CL8A 5TQLA 3P2VA 3PTKA 4A3QA 1GYMA 3ZVHB 3N04A 1XICA 3QGVA 3BH4A 4HP5A 1RR2A 2IKIA 2FZMA 3CHEA 3AHTA 1AUSL 4NJGA 3S8HA 2QCHA 3GRIA 4MIMA 2QCGA 3WQVA 4BEUA 3M0JA 4D1JA 5A6SA 1PL9A 3VC6A 3E74A 5KETA 3YPIA 5HNNA 2OPJA 1Z89A 1UC5A 1K03A 1QPOA 3IGSA 1V5XA 4GKTA 3AMLA 1XXXA 3C5QA 1MQRA 3B03A 3QOMA 2ATSA 1TVNA 5HWMA 3IANA 2XM2A 1OX6A 4WJXA 1DWFM 3UPMA 2AL1A 1HTIA 1VFMA 1NH6A 3BVJA 1E9YB 1M7PA 2R1NA 4GUHA 3VKAA 1I1XA 3GQYA 4KCTA 4JR5A 1A3WA 3F4DA 3E6EA 3NM3A 1Q6OA 4AIUA 4QCFA 2VI0A 5KTLA 1VFLA 2A7RA 4PUUA 5DMNA 4B5XA 4IMCA 3BURA 3ITVA 3W24A 3FDGA 2Z1XA 2YBUA 3CWHA 2GOKA 3PK7A 2DUAA 2YL6A 4LAOA 2W3ZA 2JGQA 5FA5A 3OHMB 4FF5A 5HMSA 3ZR4A 4JFUA 3WK0A 3I10A 1E4IA 3ERPA 4AF0B 4WY0F 1ZAJA 3Q4DA 1IEWA 4LV9A 5D09A 2ZX6A 1D8WA 1T8XA 1G0CA 3VX0A 3S1UA 5AC7A 5FF4A 2PFHA 2ALDA 3LGGA 2AOSA 5HULA 3E0FA 4F0SA 3T2QA 2XIIA 3OO2A 1BWLA 1EJXC 3QMSA 5CJ5A 3G0UA 4JQAA 4MKNA 1EXPA 4QLLA 3LTSA 3T7VA 4NRRA 4DUOA 4HNLA 4H9MA 1M1BA 3D3FA 4BKNA 3TYCA 4I5RA 1E0TA 2OQHA 4FNRA 3UJ2A 1JDDA 1V6UA 4E8DA 1WAUA 4REQA 3MUY1 2VEGA 2YXOA 3N9RA 2YZRA 2XINA 4AEOA 1VH7A 3N25A 3NM1A 4C65A 2WKGA 3CQ0A 4P7LA 1QK2A 2WMIA 1RJRA 5BOFA 5C9WA 3SB0A 1SO5A 3CZ8A 5FACA 3CAKA 3OLEA 4ZE5A 2PP3A 2VZSA 3GNRA 3B8DA 2NV9A 1A5UA 3BAJA 1IXOA 2XWDA 1EOMA 1UW9A 5HQEA 1KNWA 1XRSA 4X60A 3TU9A 3ZO9A 1VBHA 1EBGA 4RK8A 2FHFA 5CZTA 4CEXC 4FLSA 2DSUA 3GU9A 7A3HA 1A5MC 1J0ZA 4EF9A 2FB3A 3M46A 4JQ4A 5DO8A 1EO5A 4A3HA 5D8WA 1V7YA 2ZCGA 4NZJA 1SJBA 4PB5A 3WLHA 4I3GA 1RJQA 4BA0A 1B3VA 2FDSA 4ZZ9A 1B2YA 3HMJG 1M04A 3VPLA 4X9SA 4WDWA 5I79A 1SW0A 1W5QA 5I3GA 4C6FA 4AISA 3NVDA 4S3FA 3LRLA 3ES7A 4RDVA 2WVSA 3PTDA 2XH2A 1JI2A 1DIKA 1GOQA 4HYRA 4K37A 5D02A 1DE5A 2YXXA 4I9JA 2VOTA 4ZO9A 2WNQA 2WK2A 5A5WA 1TV4A 1KGXA 2B7PA 4GY1A 3P61A 1UKOA 1I4NA 3HFYA 4ERAA 3WUFA 4WGHA 1FWCC 1XINA 2YXGA 2Y5JA 4DXXA 3TXVA 4LB3A 2BBFA 1THFD 3N1AA 3WK3A 1UZHA 2VKZG 4H19A 4U33A 1E51A 5ABFB 4UOJA 3WQCA 1VJSA 5AYXA 2YL8A 2F38A 3UZJA 4MDOA 4GWEA 5F1VA 3RK8A 1FWAC 5GNXA 4AY8A 4MMWA 4BZYA 3UWVA 3IEBA 1P5BA 1L6WA 1F4AA 5E1QA 3PSVA 3BUVA 3SJNA 4HMNA 2JIEA 2QUTA 2BVWA 3S1GA 2J66A 4TMBA 3W2UA 1EC8A 3M5VA 4QIUA 1YNYA 5DBTA 3R13A 3UPWA 1C8QA 4TVDA 1TRDA 5EMJA 5AECA 1D7FA 3MPGA 1H1YA 3ZSSA 2VWTA 1LQAA 1QWKA 4MJMA 4F2UA 2RGLA 2R8WA 1DWIM 1GYNA 1T5AA 1W1YA 1ZRQA 2VQUA 3OA5A 1Z9AA 5FEZA 1V3IA 1HFBA 4ZO7A 3RHGA 1G4EA 2NQ5A 2VELA 3S9YA 2BGNE 5TNVA 3OLGA 3ALGA 5F4WA 4EANA 3DZ1A 3QKEA 4YTQA 2CC0A 3UETA 1UUOA 4WRHA 5DCDA 1V4YA 2RGMA 1XDMA 2JEQA 1QPNA 2V5BA 3QZAA 4XBJA 4A3UA 4RNJA 2NXGA 4ROPA 1J2WA 3AS1A 2BLEA 1F4HA 5IHRA 3GFZA 5HWNA 4JTRA 3VNYA 2KAUC 1EGVA 1Q45A 4J3TA 1CXFA 3W2MA 4EPEC 2YDQA 1A5BA 3NQ6A 2ZX5A 2DY3A 3A3HA 1ITUA 3DHFA 4WF7A 1UKQA 1V03A 2DSVA 2JKAA 1ELSA 2OTDA 4Q4QA 2D69A 2G5WA 4ADUA 1FWEC 3PBGA 3FSTA 3BCDA 4TIMA 4ZQOA 3W07A 3QHNA 1GGOA 2ZRYA 5LXXA 4O52A 2VX5A 2V3FA 2I9UA 2PS2A 1TPEA 3QPZA 3BSHA 3F03K 4NXKA 1WKDA 1P0BA 3IK2A 4WX2A 2IW0A 4XD5A 4CLMA 4CNSA 1XBZA 3K46A 3S1WA 3RCYA 2WMHA 3LGDA 2PTDA 3QQWA 4R3UA 1A50A 4EAMA 2BHZA 3WLIA 2YDRA 1DPMA 4GYPC 5DRIA 2C8NA 5AB3A 1FWIC 1FDJA 1A4MA 4PFHA 1SUXA 3GSMA 2WWCA 1PSCA 1VIWA 2EPOA 4GVGA 4R7WA 3W7KA 3VILA 1NWUA 3PSWA 2PTXA 1A5AA 2RJGA 1E40A 2RJHA 4IXHA 3T4WA 3F2DA 4CD4A 2DDXA 1M53A 4CD8A 1TPFA 3QMTA 3JR2A 5KMYA 3OEXA 4PUKA 4DM2A 1DJYA 2VRQA 2C1IA 3KRUA 3ZM8A 2EO7A 1V0MA 3VE7A 3L21A 4UMCA 3HB9A 5J04A 4HU3A 5HOSA 2PGRA 1NELA 4I8DA 2RHGA 1TV8A 1FWBC 3NG3A 2A3BA 2A6NA 1NDYA 3G1AA 3M41A 2Z6IA 2NVDA 3QFEA 2A5HA 1ZY9A 2OB3A 1EUNA 3NA8A 2Q6ZA 3CQJA 3WJWA 4AD0A 3N11A 2YL5A 1P6CA 3FAWA 1UBSA 1RK6A 3BQ5A 5EBUA 4W7VA 4A3YA 1DKWA 3C2EA 4QJ1A 1EJVC 1SZEA 4P7QA 3MYOA 2VYOA 4L6HA 3WLPA 2XIBA 5K3VA 5CSYA 1GYLA 5M17A 4QSFA 2PWHA 2PBGA 3ME3A 4W4QA 3BJFA 3HIJA 3WK1A 2F6UA 1TREA 4IFOA 2PC8A 2XVLA 1HVQA 2QVNA 3S9IA 1TE1A 1E43A 3GTXA 3KL3A 4DYEA 1TWSA 4WY0B 3LNPA 3FYPA 3KDOA 2FH8A 2V81A 3IJ7A 1SMAA 4RX0A 1N8WA 3WF0A 4JIRA 3RU8X 1O1ZA 1XX1A 3ZLHA 2Y61A 1CEOA 3F7JA 1DORA 4Z0JA 3LCWA 1XF0A 5F1UA 4WKAA 4HPJA 3WH5A 4YVVA 2R91A 3P0WA 1WQ5A 4UQAA 3O3RA 4TR9A 1IEIA 4HZMA 1H61A 1UQZA 3AZRA 1OK4A 1Q6RA 4FZIA 5ENLA 2FPVA 3W4RA 1KCKA 2G37A 1EB3A 1ME7A 2P50A 3G0XA 4PEKA 4AWEA 3QHMA 5LHFA 4IMEA 5E0CA 1J0JA 4GK8A 4PA8A 2V38A 4HA0A 2ATMA 3A5FA 5GJNA 1BHGA 2WSYA 3HPAA 3LPFA 3W6MA 4AZCB 4L9XA 3K8MA 1OYCA 2O9PA 1BVNP 5DFAA 1PDYA 3KVKA 3MW7A 3SADA 3WQ5A 3ARXA 2HNEA 4IIFA 3IUDA 5AC6A 1LWJA 3U9IA 4DYKA 1XG4A 3PJUA 1FQ0A 4GGBA 5HJLA 3CLWA 1VLWA 4QDPA 3VIHA 2PBOA 3AYVA 3K2GA 5LIKX 2PDQA 4GXPA 4FP1A 4OOZA 2NVCA 1WA3A 1XGEA 2YBVA 4KH2A 3RJYA 3WMBA 3C8FA 4AD4A 2WJDA 2NT0A 3ABQA 4DJDD 3ELFA 1B57A 3DECA 1QWGA 3SDOA 3W7CA 1FOBA 3MKCA 2GL5A 2Z1BA 3S46A 4F0HA 4UTWC 4LUYA 4ERGA 4MFEA 3IV3A 3WBXA 4ZOBA 2OSWA 4B5TA 5E09A 1MZRA 3NEHA 1RBAA 2VOMA 4M1RA 1WE5A 4XO7A 3DERA 2ACUA 4HK6A 1QI4A 2WCGA 4S38A 2OZTA 1VPQA 3U2OA 2V30A 1R85A 1LM1A 2GSHA 4DVOA 4MKVA 2E6YA 3G3DA 1GJWA 4IIDA 2PWGA 1NJJA 1H7NA 3MA8A 2XHYA 5CAKA 5H8PA 2MUCA 2G3JA 2HRWA 3B8IA 5AC5A 3W2NA 4K7VA 1CGTA 3SUSA 2QAPA 3CV2A 1OFDA 4UTMA 5DCBA 4GZIA 2WVTA 1XC6A 1S2AA 1WNOA 4DJED 2QCDA 2HVNA 1S2CA 1EL3A 1Y0EA 4CQ9A 4R9XA 1EYEA 2FTPA 1BKSA 3NZGA 1Q7MA 5AKQA 2ZIDA 2Z2AA 3UR5A 3W7NA 1ZBKA 4CU7A 4ZQRA 3TFXA 1LL4A 3B9DA 2A1YA 3VZXA 2Y7EA 3R58A 3C2RA 1KTCA 1MSSA 3BMVA 3UESA 1LYXA 2E3ZA 1XUZA 2DH2A 4IISA 1DV7A 3GBDA 4Z2HA 5EFFA 3P6LA 4QE1A 2DT1A 1V7AA 3VNKA 1TMLA 4ZMGA 1GJUA 2NX9A 1WKEA 1AH3A 1AMKA 2OGYA 1SW7A 2C15A 4DIAA 2WSRA 3I6EA 3REQA 1JPHA 3B04A 2C13A 1W8SA 2VX7A 1N8IA 2TSYA 2VFHA 1UROA 1H0GA 2BOGX 5HAOA 1O6IA 2QUNA 3EX4A 1OZMA 4M56A 3ITYA 2WCSA 3PPFA 3EGJA 4J9JA 1PKYA 2F61A 2INZA 3WLJA 1VF8A 3CO4A 3ZT6A 1QUMA 2DZAA 2QJGA 1VBGA 1YNQA 1XL9A 1S5TA 4L4OA 1DIDA 3BMWA 2DV0A 3N6JA 5JMUA 2P3EA 2QJIA 3PBMA 3BLPX 3BO9A 3EX1A 1UR1A 1E6ZA 1IYXA 3C0SA 3N12A 1Q85A 5DY2A 4C5ZA 3F4WA 3GE7A 1M65A 2PWFA 1FKXA 1V3LA 4ZB5A 2CEQA 1IEQA 3HQPA 5BXPA 3RN6A 4LT9A 1K70A 2PUZA 5E5CA 1TUFA 1P0DA 3DFHA 3FVMA 1P48A 1XGDA 2G8ZA 4WKHA 4AZGA 2AQOA 5CKSA 2Z1WA 3EOUA 1OFBA 4GUFA 5LIUX 1TTIA 3WY1A 3S2MA 4R27A 4W86A 2V8ZA 2FPTA 4Q8WA 1XRVA 4O57A 2Q02A 3L0NA 3PFRA 4F48A 4C60A 2DQWA 1SW3A 1GEHA 1K77A 4CNUA 3JRKA 4H6KA 5D32A 3RDKA 1L0PA 3FGCB 5LIWX 4ZL1A 2VVNA 3UGRA 4E6MA 1DJGA 1RXOB 2Q3OA 1M7XA 5HNUA 1XLCA 1V6YA 3V0SA 4HU8A 3TH6A 3GTNA 4CN6A 4DHGA 2QCCA 3AHZA 5AVNA 2E28A 4KGLA 1KCZA 1NP0A 4CQAA 1DWJM 1MXSA 4P8WA 1REQB 4MUZA 1KQYA 4GO8A 1KTBA 3DFYA 3TC7A 1UWAA 1VJZA 3M0HA 1ZJBA 2P88A 3GYCA 3ECQA 1GOOA 1OY0A 4CQCA 5CSSA 3SURA 4IQEA 1PIGA 2AL2B 4FS9A 3TSBA 2CLPA 3GG0A 4IMFA 4IL0A 1XP3A 5CAHA 4NUWA 2FHCA 3ZQ9A 1SPQA 1E9LA 5CBBA 2WVVA 3SRDA 1Q7ZA 1LT8A 2J6VA 1OM0A 5I03A 1IQ8A 1YHTA 2H6RA 2BSLA 4PTWA 1YYAA 4OJYA 5GVJA 3CB3A 3HFTA 3ZJ8A 1GVOA 4PODA 1WAWA 4JKKA 5BW6A 2YCJA 2Y8VA 3UXLA 4J5NA 3EKZA 3GXMA 3EWZA 1IZKA 2JALA 3C3UA 1BKHA 3HO8A 4HSOA 3PWAA 4QROA 2RH9A 1TA3A 2UY2A 1ICQA 3A4JA 1EC7A 1U5JA 5CH9A 2GFTA 4IPIA 1J0IA 1XKYA 4WSHA 3T05A 3QZ6A 2CBUA 3KOZA 1R6WA 4QQ3A 3AIRA 3PY2A 4EPDC 4DZAA 3ITGA 2VWSA 3PG8A 2YLAA 1OC7A 1RSCA 3S4TA 2DU2A 1KRCC 4DBUA 3VDAA 1TX0A 4JL1A 1R2SA 3GYEA 4HHMA 3ZT5A 1OG0A 3FXGA 1LZOA 3U5UA 3GC5A 3MUCA 1FWGC 1BWKA 3LCFA 3T40A 2WHKA 3O16A 3BAWA 3THAA 6A3HA 4N7QA 3BAYA 5L6UA 4Z1CA 2QDDA 1P0NA 3MSGA 2VT0A 4HB7A 5JXQA 2XVPA 3VIKA 4ACYA 3CQIA 2W0UA 2REQA 1XLKA 2PDUA 3W1AA 1RQEA 5HK4A 3FSUA 4YWSA 4GUIA 3CK5A 3U0HA 3PUOA 4UR9A 5I07A 1BXBA 3AXKA 2J4GA 1OEPA 3NDOA 3QC0A 4LAZA 4FK9A 1J5SA 4Y96A 2WHLA 1NDVA 1EZWA 2Z1KA 3M0XA 2EPNA 2WM1A 1EC9A 1RVKA 4HYVA 1EGMA 3DHUA 1U1JA 4NI8A 3TLQA 4PMRA 3F1QA 1WKYA 3TN5A 4J3UA 1PYFA 1GVRA 4V27A 4JYDA 3QXBA 1VLIA 4R7OA 3CUHA 4W89A 3BOLA 1Q65A 3EZ4A 3THDA 3ARYA 4U10A 3A64A 4AZBA 1UIPA 4LUSA 2XYLA 3WQ8A 2JE8A 1MNSA 1R2TA 4EVZA 4TO8A 5HATA 4YTRA 3LTPA 5DBUA 3TX9A 4LC6A 4HTYA 2ISVA 4KWSA 1G5AA 3FN9A 3UVIA 4GYPA 1QHZA 4UTUA 4EXBA 2QXWA 2Y4SA 2HNHA 4O1DA 3L2MA 3WELA 4DXVA 3WQFA 3F2CA 3H7RA 2VUYA 3UT0A 2E8YA 3R4IA 1QASA 2FGZA 4IIBA 6REQA 1H63A 3PZQA 4YTUA 2D2HA 2GGHA 1S1RA 2DVTA 3RPMA 3WJYA 4FPSA 2BG5A 5DXXA 3TJXA 2X41A 3W7QA 5C2CA 2DPEA 4JNYA 5MF5A 1S5NA 3L2IA 1ZSXA 3OPSA 5IBXC 1MRQA 3G3MA 1GZ1A 2EQDA 4KS0A 3NQ7A 3NPWA 3V18A 1W31A 1CZ1A 2ZRWA 3EEZA 4NZ4A 1XLDA 4H4IA 3C2VA 2B7OA 1F73A 3FKKA 2V5CA 4AWUA 3RJXA 1JQVA 1OBAA 4AWSA 5HUOA 3KEHA 3CPUA 3LHVA 3Q2DA 3S5YA 5I6SA 1T8QA 1UASA 3KS6A 5ABGA 4FLQA 2FJUB 1CT5A 1UH4A 3W02A 5E0KA 3QKZA 3M1ZA 4MYXA 1FCUA 5KZ6A 3O06A 3S5NA 3UZ5A 1ESWA 4UWMA 4ZBCA 2WC7A 3SGUA 4W85A 3MMUA 2WLYA 2GJXA 1OT1A 2E9LA 1G9HA 2W63A 4F9DA 4N0RA 1Z7AA 5DMMA 2NLIA 7ODCA 1HJSA 3Q94A 3M0MA 3ITXA 4POCA 3MU7A 3P5YA 4DNHA 1ZCOA 1AL8A 3M0IA 1ZFJA 3BW3A 1SQ7A 5KINA 1GWJA 1YEYA 1ZS2A 3UR7A 3KUMA 3T8LA 3SI9A 5SWUA 1TV2A 5LGXA 1O5RA 3WD1A 3EXTA 4JTJA 2PWVA 4H6RA 3VC5A 1XDLA 4C6OA 2IPFA 3H23A 3MV11 2QCMA 3AISA 2OEMA 1EWEA 1FH9A 4GIEA 2NUWA 3M5ZA 1RH9A 4OOUA 5M2FX 1WDWA 2GGGA 2OJPA 3RMJA 1XYFA 4IQJA 3W85A 4Q4KA 5D05A 1HJUA 4O17A 3C0JA 3OZYA 4RW3A 4IIHA 1K7FA 3Q37A 2PDJA 5AVHA 1TVLA 1KBJA 1OFAA 2O7QA 3VU2A 1L9WA 4PFMA 4NAFA 3TQVA 1P4CA 1V8EA 4LVDA 3H22A 4IGHA 3EKGA 3THQA 4IH3A 4A4AA 3M4HA 4C6LA 4J40A 2G0WA 4DI8A 5LNWA 5MKGA 4OVXA 3O6AA 4L61A 3BLLA 3A21A 2V6AA 3E3HA 5CG7A 1JDCA 3HF3A 2Z24A 3O6CA 1DHKA 2CKRA 1F3TA 2F9RA 3BPWA 1ALDA 4YXGA 3KM8A 4D71A 3NO3A 4UFJA 4S3CA 2W67A 1KB3A 1O1HA 3OGSA 3SY1A 1KKOA 4NJKA 3DIPA 2VX4A 4LYKA 1I1WA 3C56A 4FXJA 1EP1A 2UY3A 5IOBA 2E40A 2V2CA 1LT7A 2ZUSA 3OVQA 2OEJA 1VP5A 5TF0A 4ICMA 4DBDA 4V2XA 3W1UA 2GVGA 4XZMX 5G4HC 4QITA 1ISVA 3FKRA 2VP8A 1TB3A 4AFYA 4AYGA 5FESA 2IKHA 2EEXA 2O4MA 1H62A 2VTFA 4AQLA 2CIPA 1U83A 1O66A 4AD5A 2OELA 5K7JA 3CQHA 3S0CA 1ENUA 2GJLA 5HR7A 1GG1A 1H2JA 2VFEA 4XISA 1R3VA 4DF2A 2Y6ZA 3HG2A 4DBWA 1TJ0A 1XFBA 2NQ9A 3W1XA 3PZOA 4MJ4A 3FJ6A 3TSDA 3W7RA 3QC3A 1MQQA 3L12A 3WMCA 4RXFA 5CPOA 3UA4A 3AOFA 4KESA 4QLJA 3RU6A 4Q4PA 3EWUA 2NSXA 1F8IA 1X98A 3WN6A 3TWAA 1AFSA 3TV8A 5F2LA 4L1XA 4IP4A 1UH2A 3NO5A 4URIA 1KTNA 1KV5A 4PRWA 3N2CA 1PWLA 4EPKA 3WD2A 2GWNA 4C6NA 1H7XA 3NNTA 2ZA2A 3QTGA 3OODA 3K30A 3QFWA 1UHVA 5A8PA 2XM1A 1XRFA 4AC1X 1VR6A 1EDQA 3RG6A 3C2FA 4C1KA 3BG3A 3TR2A 4HBKA 1A47A 4RUBA 4XBSA 1ZBVA 3U57A 1GOMA 1XM3A 3H21A 3MHUA 3AU6A 1WXJA 4Q8UA 1XLEA 3DYOA 3GU1A 3I3BA 4E5TA 1XLHA 3ALFA 2D2OA 3RRAA 4L9ZA 4CCZA 2J13A 4KEMA 2JKEA 4IFRA 1W5OA 3WCZA 4GJIA 1TJRA 5C8BB 4WDXA 1DYSA 4GZEA 3MMTA 1PKNA 3EA3A 5BRQA 5BOOA 1B3YA 3ANYA 3CAWA 4JGDA 1CXEA 3PC0A 2OT1A 4WDUA 3ORWA 3S2CA 3AIWA 2WOQA 3VIOA 4QX4A 1OVDA 2C7FA 5A8MA 4G1KA 2DSZA 3KRSA 3A12A 1YKWA 1NDWA 3RCNA 2QMKA 3AIQA 1ZENA 4PMVA 3GZ3A 1VEOA 5AYYA 1YNPA 1R3YA 4GJJA 1MW1A 2E1WA 3KTSA 4MY1A 1W6TA 5B80A 4U28A 4X63A 3MDWA 5CXPA 4JCLA 1O7AA 4HZ7A 2XH0A 3BGJA 2EF9A 3CXOA 3P8JA 2B7NA 1JNDA 4R34A 1RP8A 4D6DA 3ZJ6A 2WMGA 1MNZA 4XD3A 4B4FA 1SO6A 1UWTA 3RPTA 3GIQA 1U1UA 3VOFA 3AC0A 1IF2A 3N2XA 4R85A 3AS2A 3GZAA 5KITA 4K68A 3H53A 1DJWA 4F4RA 2QPXA 1F5ZA 1JZ4A 1TIWA 4LUIA 3FDKA 3QSRA 3EA1A 1WZMA 2Z27A 4PTVA 2G95A 2QS8A 5GNZA 5JIWA 4ZXLA 4V28A 3LD5A 3KTXA 1ODZA 4HCLA 1UD8A 4OBSA 3DGBA 3ZVHA 2YA1A 3UXAA 1TWWA 1W9XA 1W37A 1XH1A 3BAXA 4EAYA 1EXBA 2VC6A 3ZZ1A 1SMDA 2FHBA 1RLDA 3TZNA 3CV7A 3G1SA 1ZL1A 2WHMA 2LLEA 1PX8A 1Y5VA 3W9ZA 4TTGA 1DIEA 3W1LA 3KCOA 4NIRA 5AHLA 2QCFA 1XPYA 1EO7A 3LHZA 1HXJA 4K39A 3CO8A 1QI3A 1KFWA 1IXQA 2HBVA 3LPGA 1OCQA 3PG9A 3KDNA 1JIBA 4PMOA 4U2ZA 1AW5A 3KCJA 4AD2A 3C8NA 1Y65A 1CB2A 4GVIA 3WK2A 4X3ZA 3TVAA 4ZTYA 4ILSA 2Y0FA 3NZ1A 3CT7A 1BPLB 1JL8A 3PANA 3MSRA 3VX1A 2HBXA 1M6JA 2Y89A 1Z44A 3IARA 3SSJA 5EMYA 1H7OA 1E3ZA 3M6DA 4KIRA 1EKOA 5K4ZA 4GINA 1KCXA 1XI3A 4OE7A 3C6CA 1JUBA 3BANA 1HG3A 1EZ2A 3BZGA 3TR9A 1RLCL 1J18A 3BV4A 1EP3A 5C6MA 4NZ1A 2TRSA 3A9IA 2YCLA 1XLBA 2ACQA 3SQSA 4AF0A 3NOEA 3WQ4A 4BCEA 2DSKA 3UF9A 4J3XA 2XN2A 4FA3A 3T78A 3M0VA 1R38A 3IJIA 4BWLC 1L8PA 1HKVA 2GPTA 2ZZ3A 3KP1A 1Z8AA 2J88A 5F4XA 5FF3A 2J7EA 2V5KA 4JNMA 4YCOA 1JZ2A 4RJEA 2BY2A 2WAGA 1SFTA 1KA9F 1XIJA 2ISWA 4GE8A 1Q6QA 3E5PA 2V0TA 1QPKA 2P1FA 2Q8ZA 1EHNA 2W66A 2CLHA 2W92A 3QH2A 3ARUA 4UFIA 4PMYA 1XLGA 3FYYA 1JUKA 4MNJA 3AIVA 1Q6DA 1V0NA 7REQB 4AH7A 5FJPA 1KM5A 1YDNA 4X22A 4AU0A 3RITA 1S38A 4Y9AA 4GZJA 1EFZA 2OLAA 3LG3A 3B0YA 5JBDA 3IIPA 4NZ5A 1Q6CA 2J8FA 2QZRA 2FDMA 1OFQA 1YW1A 1ZQ5A 2WJEA 3TSMA 3T6CA 4AVNA 4S1FA 3K4AA 2P53A 5BXSA 2XH4A 3M0LA 1XSIA 3B9EA 5CPTA 2ABAA 4HNUA 4TU1A 3PFMA 5C9RA 9RUBA 3CHFA 4O18A 4H04A 4NP7A 4B3ZA 1DVJA 1JYXA 1XPGA 1E71M 3RM4A 3OGRA 3KVLA 5FOOA 1PJ9A 3WDHA 3MB9A 4Z2KA 3SCUA 5FD0A 2CLOA 1V08A 2J25A 3FLUA 1M41A 5IBXA 2V82A 5BXTA 1BF2A 4FOJA 1JZ8A 2ZA1A 1XW8A 1MW3A 4K8HA 4KWOA 1E0UA 1R3SA 3P84A 1UUQA 2HWGA 3ZOAA 1HN1A 3TW9A 3ZS4A 1FDZA 1P0KA 4NF7A 4R88A 2XZ7A 1EPVA 4RPPA 3POHA 3S6DA 5IFPA 2YYTA 4RL3A 4CGTA 5LXEA 2WVUA 3OP2A 4HHHA 3VNIA 4CNNA 2CCRA 2I56A 3W01A 3H55A 3TQ0A 2FVMA 3G1RA 3GC4A 1B54A 1QW7A 1EA9C 5D9MA 2ZTKA 1UMYA 4RZ6A 1PZ3A 2OR2A 3W75A 3KRBA 4W93A 2Z29A 3W6LA 4H2HA 5H8UA 2WJFA 4AZHA 1KM0A 4IX2A 4KQNA 4L5ZA 4E2OA 5I3DA 1F8MA 3DXIA 2IUZA 4QXIA 2QJJA 5D9PA 2ZWZA 2I1OA 2E5CA 4MFDA 5FF7A 5M1TA 2BMBA 2XIJA 1UJPA 3AROA 1GG0A 1US2A 2BXVA 3B06A 1WYIA 3FNDA 1LLWA 5ABFA 3B8WA 1KLZA 3WYZA 4FIRA 4IMDA 1D3CA 2WV8A 3TAOA 5DMLA 1DTUA 2ZDSA 4GG9A 2TPSA 3I65A 1YXYA 4Q7NA 1JEZA 4Z2JA 1FHDA 1PS9A 4I5XA 4BI7A 5EL1A 2G3IA 3WLNA 3OVRA 3H4XA 2PI6A 1Q2SA 1UZDA 3WJXA 3DDMA 2B31A 2X16A 1IWPA 4UTTA 3T44A 4B16A 2WNWA 4NILA 2CWNA 1WO2A 4XAZA 4U5KA 4UTLA 5JVLA 2VFGA 2OCZA 1KKRA 3G1FA 1UWRA 3VNDA 3T4CA 4O11A 5A6BA 2WJZA 4B5VA 1PZ0A 4DY1A 2WMJA 3KLLA 1DHPA 5G5IA 3TUUA 2DQXA 3EX3A 4GPNA 1FWHC 3A47A 1KFKA 4AHQA 4MNMA 1GKPA 3PB0A 2X1RA 4A8LA 1Q6FA 1BYBA 1EYWA 1GONA 1YBQB 2OG9A 3GNOA 1RY0A 4LCSA 4K1WA 4QE5A 1RUSA 3L5AA 2J9XA 3IGXA 2CITA 3SGZA 1QW9A 3SN1A 4AX6A 4FX7A 2YYUA 3SN0A 3L4YA 4M6QA 4ATLA 4LY4A 2ZZ4A 3OU8A 1IZJA 3A9BA 5E6YA 2P8CA 1QBAA 3PWGA 3UZWA 4LU0A 3TC3A 1VCFA 1GVQA 3SQLA 2V63A 1PCKA 3LERA 3QR1A 3IVSA 1JRCA 1XYMA 4F0RA 5A2BA 2UV8G 1TPH1 3BW2A 3EWXA 3GXNA 4PGLA 1C9WA 3FY1A 2D0GA 3CV6A 3TYEA 3SQMA 2R14A 1YLVA 1OJXA 1XCFA 1FH8A 2C1HA 4RZBA 3QGKC 3BSMA 1GTEA 5BOEA 3VDBA 1OIFA 6XIAA 1EF3A 2C1GA 3H26A 2CBVA 4ROQA 1VFUA 1TIMA 4GISA 4JQ1A 8XIMA 1J0HA 1UYQA 4H6EA 4DNMA 4FALA 1XIMA 2BODX 4OQVA 2FZBA 3CUGA 4LNYA 2PDLA 1ZHAA 4GHRA 1I2NA 1BQCA 1W17A 2A79A 2QR6A 2TAAA 3FK4A 3GHUA 5AHNA 2W61A 3E12A 4ZOAA 1KWGA 3NQVA 4H00A 2EG7A 3R94A 1HO4A 3TYAA 4TXEA 3AUJA 1R30A 1ECEA 3N34A 4XV0A 1UWSA 3CB8A 3STCA 5LKYA 3H6OA 4JDBA 4WEVX 3HN3A 2HXUA 1YE6A 4MWAD 2HTMA 1K3UA 2JF6A 2QGYA 2HK1A 4Y9NA 2WNZA 3LI0A 4Q33A 3VKJA 2G3NA 3PWIA 5BRPA 1E6XM 3CU2A 4JTHA 4H6QA 1KRMA 4DWSD 1W0MA 3MT1A 3M5XA 3C86A 3K4DA 5A2AA 3NPUA 4MZ8A 4LAKA 5I78A 3B8UA 1O4UA 3LX9A 3LGEA 4Y90A 4AY1A 3EXSA 2O9OA 4PMNA 4LOCA 4TTUA 6ALDA 1FUYA 2NWRA 4DN1A 1YMYA 3GWQA 4MADA 5C2XA 1L6FA 1CWYA 1FP8A 2WANA 1FWJC 1R3WA 3G1HA 2W9MA 1Q6GA 5DCEA 5HWJA 6TAAA 2INEA 2XGZA 3S9ZA 6XIMA 3KL0A 1KM3A 4D2JA 3BCFA 1TPC1 2GZXA 1VCVA 4C1NB 2YGYA 2QV4A 3W76A 3WQPA 3KBMA 3MUAA 4WY0A 4HCHA 1J2BA 2W62A 1SSDA 3MWCA 2OYKA 3QZEA 3VVGA 3T1GA 1PTAA 5CPMA 4MLRA 5G1TA 1AJ0A 3ABOA 1H1NA 4M24A 1B3ZA 4B91A 3IJ9A 4ZE4A 4LVGA 3CL6A 2XIOA 1VPXA 3TE9A 1BG4A 1IT8A 4Q8NA 1D7KA 4TX6A 5CZKA 1FTXA 1HT6A 4H9ZA 4RNFA 1FFRA 3AXXA 1G7VA 4GZ7A 1SO3A 3XINA 1VFHA 4O4VA 2VM8A 1YX1A 1MEWA 2HPIA 3FA4A 2R1KA 5ABTA 3FX4A 1W5NA 2PLCA 2VFDA 1QOQA 1GPFA 1C9DA 1GKRA 1DXIA 1OCJA 3GR7A 5M5DA 4XB3A 5HR6A 1N55A 1EPXA 4JN6A 3UU0A 7PTDA 1IV8A 4AZCA 4PBEA 3A24A 2XVNA 1E70M 2A3EA 2CPUA 1KFBA 4L4MA 3TDFA 2Y8KA 3WLRA 1DQWA 1KQZA 3WFZA 4HNNA 5D4YA 4AXNA 2YA2A 1AW2A 5KZEA 3PUDA 2ZDRA 4D6GA 4KCWA 3G22A 1CNVA 2BVYA 4WJEA 2RDWA 4GRSA 1KXTA 3WNNA 4QAIA 4PSRA 4LXFA 3T0CA 1AQHA 3UYCA 3N18A 4NT0A 1ME9A 1XISA 4GLEA 1F7BA 4O10A 2EG8A 1JCYA 1AMYA 3V0TA 1XFCA 2XVKA 3NCOA 4UQDA 1HL8A 2Y88A 4DB7A 5K9DA 4ZB2A 4NZ3A 3FJLA 4UBPC 1VZWA 1X7IA 2FZ9A 3LRMA 5EA9A 5I2UA 1W3JA 4WUIA 1GVYA 3CYVA 1S2WA 2E1DA 1LBFA 3E1F1 4HZ6A 1ADSA 1QPRA 4H8UA 4PBFA 4AZ7A 4GI8A 4US5D 1CXHA 4Q7BA 3ZWTA 5G2IA 2PLJA 3ES8A 3D6NA 4RXGA 3BQ6A 3TYUA 2INFA 1XIBA 3OG2A 4KGJA 1LLZA 1A0EA 3G8EA 2PDWA 2VFFA 3BDKA 4HNOA 3URNA 2PTYA 3WDPP 1WDPA 2VMFA 2ZUWA 2CZFA 1TRIA 3W00A 2VDHA 4NNCA 3EWCA 1ZALA 1MZHA 1PDZA 4QAWA 2E6DA 2VL4A 4WD0A 2ASHA 5CBJA 4G5DA 4IPNB 2EJAA 3SSZA 3FW6A 4EX4A 3WLTA 1TV5A 1W3HA 1RCOB 5BXRA 3HPFA 4KFNA 3STFA 4PR4A 3SFKA 4MPKA 1KFLA 4XAFA 2VZTA 2E67A 2FMNA 2XJ7A 3LXBA 3EOEA 2VGBA 1ITXA 2A21A 3P60A 4EXAA 2EJ1A 1A5KC 4BWLA 3W53A 5LNRA 4I7VA 4QDWA 2CHOA 3IJDA 4QHRA 4DF0A 8CGTA 4EIVA 3MHGA 3TTSA 3DG3A 1LQ0A 3POCA 1N2VA 3NQBA 3BL3A 4XKYB 5FF2A 5C9UA 3QSTA 1CYGA 3DCPA 2E8ZA 3IJLA 4XKMA 1C7SA 1POKA 3IIZA 3PVFA 4LF1A 4XBKA 3RLVA 1GCYA 1KD0A 2GDUA 2DW7A 4GVFA 2PE4A 1UOZA 2X1UA 3ICJA 1ISXA 3GKFA 3ABZA 4X0NA 4S3JA 3DBNA 3LZ5A 4NZFA 3UPBA 2TMDA 5A6JA 3B0XA 3UZZA 2MANA 1B3XA 3ENLA 3URQA 5JBEA 4NYUA 3TAKA 2GVLA 1MUWA 3MCNA 4RNHA 4A2RA 2TODA 2JQXA 2PDBA 1M03A 3KAOA 3E0WA 3LEPA 1TTJA 4OKDA 2QJHA 5FJUA 2XSXA 1DJIA 3BLKA 3RLUA 3FVDA 4OECA 4JIIX 4XD4A 4NKCA 4GCAA 3VABA 2AMGA 1P1XA 4TX8A 1UR3M 2BS9A 4CCEA 3ITLA 4GI6A 3DI0A 2ICSA 3AI0A 3VKCA 3KTCA 3LCLA 1U30A 4AMAA 1R2RA 1PCWA 3TCSA 1LBLA 4DX3A 3NQAA 2ZE3A 2Q8XA 3WG6A 2HV5A 5U7SA 3M07A 1WDSA 3E2SA 2XFWA 4IPJA 3KS5A 2ZADA 3ZFHA 5A6KA 1IIHA 1PAMA 4HHLA 2UY5A 2DH3A 4L4PA 4AAJA 1DWHM 1Z32X 2P8BA 4F0MA 2YL9A 1FWWA 3QVQA 1XSJA 3FGCA 2DIEA 1PKMA 1YADA 5CC7A 2ADAA 2CU0A 2A0NA 2FFCA 3H2FA 1W3TA 4AG0A 2BFGA 1K1DA 3O07A 3DKLA 1G7UA 1XR2A 2PODA 1P6BA 2BWGA 1TTQA 2XGBA 3FIGA 1B9BA 3VIMA 5FEWA 4EWND 1XD0A 3W7GA 1REQA 5C7HA 2XN0A 3N73A 4UC5A 4CQDA 3TTOA 4H9VA 1ONWA 3W27A 4GMEA 2AL2A 5A6LA 1XIGA 1SFLA 5J5DA 3CV1A 1TZZA 4MZ1A 4PTMA 3V75A 3TCEA 1TCDA 3N4FA 1MEHA 3QRHA 1ZB5A 4DZIA 2BZNA 4LSBA 1FWTA 3LRKA 5I3JA 4HU4A 1K9DA 3FJNA 4M5PA 1TV7A 3D3AA 3QPYA 4IOTA 2YB4A 1G6CA 1GVIA 2A7PA 3V1HA 4K2SA 3AYSA 2CETA 3HPZA 4C7FA 3LBOA 4M81A 4J2MA 2QLYA 2OZ8A 3W1NA 5K4XA 1W9PA 1JFXA 1MXDA 4KETA 4KPLA 3W7LA 4E3VA 3I7SA 3L4XA 5BWAA 2FZNA 1U22A 5DELA 3GTIA 1TPUA 3WLMA 1AD1A 4GQQA 2OQYA 4H41A 3OVPA 3E9AA 3SUUA 1CCWB 1RQHA 1QI5A 4L1WA 4DUXA 4UCFA 3GXDA 2HE5A 4N9BA 3LU2A 4M1BA 3PZ9A 1NU5A 3SIMA 1UD4A 2GGEA 5HA7A 4QFUA 3MCMA 1JAEA 2ZYFA 4I7UA 3C2OA 3TMQA 1H51A 3MZNA 3R0DA 4Z42C 3IVTA 4B4HA 2F2HA 3IV8A 3AJ7A 4DO5A 3N13A 1JZ7A 1FWDC 4ERIA 2P5NA 4ZO8A 4DJFC 4P5UA 1TR9A 1JCXA 3HQ1A 4F2BA 5C70A 3QJAA 2QW5A 3THUA 3GO2A 1TWDA 5KSWA 2OX1A 3RO6A 4IUOA 2CZEA 1E55A 3RRXA 1F6PA 1YDYA 2DZUA 1E4MM 5A8GA 4XO6A 4QG6A 1GNXA 2FZDA 2CZVA 4WR3A 3OTRA 3WF3A 1W54A 4KMQA 2CW6A 3W28A 4IIEA 5E9XA 1YE4A 1JYWA 1K6AA 3MVTA 3R7MA 3BV7A 1W2VA 4GI4A 1UPPA 2ZVRA 3DYPA 4BF9A 1AK5A 4G2DA 3OLDA 3AO0A 3F5JA 3QLDA 4JTUA 3SCNA 1W8GA 4QJ3B 4MWAB 4W87A 1XUUA 3AIEA 3NQDA 4H7CA 3PZUA 1UR0A 2C0AA 3M16A 1R5YA 2BY0A 3ZIZA 3AYRA 2ZKMX 4DWSB 1KM2A 1C93A 3ITCA 1CENA 3WBYA 1YDVA 4Z0SA 2PMQA 1PHQA 1EA0A 4LAMA 4JQ2A 1KV8A 3OZPA 2GQ8A 1NOWA 3B8VA 4MY9A 1BLIA 4C6BA 1SFSA 3CZLA 3EPNA 3LHYA 3UYIA 3VDHA 1A3HA 3B40A 1G94A 5T9CE 3AMDA 2FYMA 4J3ZA 4NASA 1OHLA 1QI2A 1F3XA 3RPDA 1NVMA 5REQB 4HMCA 2VUNA 3VD7A 4W8AA 3LCIA 2Z00A 4C6EA 3UP8A 2QUVA 4JIQA 1UR4A 1EEPA 1RCQA 3FA5A 4IQLA 1GZJA 4B5SA 2C19A 5M03A 3WMLA 3P7YA 4JTTA 5DANA 3I4KA 3RM8A 1XH2A 3VGBA 4FNTA 3GAYA 5A8NA 4AWTA 1W56A 3STPA 1R3TA 1IXPA 3SCOA 3CS2A 5LA0A 4XZIA 4GH1A 5K9CA 3C61A 4FO4A 3EOOA 1LJYA 1RALA 2WO5A 5KZDA 2GJRA 1WCGA 3V4BA 3N9SA 3PR2A 3EWDA 1BWVA 1A5OC 1UOKA 4Z2LA 5FIPA 3O6YX 5C9ZA 4ZR8A 4JTQA 4W5UA 4V1XA 2ZUMA 4RE0A 2VEIA 2YW4A 1PZ1A 1W9DM 1MUMA 3REQB 3QOKA 3O0KA 3GS6A 3ZLGA 4HMEA 4YMZA 5D9OA 2PURA 3MV01 1K4GA 2GK1B 4H9YA 2PD9A 3HM7A 3W2KA 3RR4A 4KIEA 5A94A 4TVUA 3SFWA 3H24A 5HPCA 1I8JA 4C6KA 2Y8UA 1Q5MA 2GLKA 1R8LA 2ZUNA 4KEUA 5I3KA 1JD9A 4PUWA 1TELA 3CASA 3RLGA 3O7UA 5HINA 1Z3NA 4YYCA 3CYJA 2BXYA 1GEQA 2PDHA 1HX0A 3N17A 3PZNA 2OO6A 2J7DA 3CIXA 2WC4A 4GIRA 3U7VA 3EDFA 4G8TA 3G1DA 1V6VA 4L65A 3EMQA 4F9JA 3AMKA 4I5UA 4DJDA 5HXMA 1VBRA 2PP0A 4S3EA 4C7DA 1KFEA 3ONCA 4EE9A 3EDKA 2HCVA 3GVQA 4PZVA 1GQLA 3LCXA 4IG2A 2C14A 4JIHA 2PGEA 1SSGA 1G67A 2V9DA 2IMRA 3AIBA 1KM6A 5LZLA 1M9HA 3PPCA 1K9EA 2BY1A 1LQ2A 1T7LA 3ARRA 3WD4A 3F4CA 3O9NA 4XSLA 4Y9OA 3HA1A 3BXWA 4Q8MA 1I2PA 1W1VA 2GSEA 2QDEA 4QRNA 3NOYA 4ICNA 1JRBA 3TOPA 2WHJA 4LYPA 3TNBA 3PTQA 4F0KA 4F0LA 3IVUA 5AYIA 4ZVJA 1JCJA 2O55A 4BQ5A 3NUKA 3TWBA 2RFGA 1TZ7A 4KRUA 3OGVA 1GQNA 3MHFA 3T2PA 3MWAA 3VFLA 3LSCA 1FHVA 2G41A 3KOWA 3EOLA 3ABXA 4QJ4B 5IDIA 2ZZ7A 3VIFA 1J9YA 1XHGA 4C6CA 3JW7A 3TYZA 3MUZ1 4IGSA 2AQVA 4UZUA 3B0UX 4FXSA 3VI2A 4UFKA 3M5YA 3WEMA 2IQTA 1AQ0A 4QE4A 3DOPA 4O19A 1F6YA 2WB5A 5AOUA 3S1VA 1JYNA 3VYLA 1BYDA 1O5KA 5FAJA 1FWSA 2QULA 1JPMA 4GGHA 1F76A 1EDTA 5AHEA 4IXXA 3BE7A 1XIIA 1E6SM 4UQBA 4LF2A 4CN4A 1CXIA 2QV5A 1VB9A 4AD1A 1LUCB 3ONBA 5H8MA 3GY1A 4FNQA 4B2DD 2X1SA 1NFGA 1JQXA 4O8AA 3WF4A 3O1NA 3CH0A 4KFPA 1WZKA 4LUTB 2I14A 3PS7A 4ZQNA 2WPGA 1YTDA 2E7FA 2GDQA 1C8XA 1U5HA 2XIQA 4LANA 2AQWA 3NR0A 4J3SA 2J7CA 1PXGA 3STEA 4MVAA 4D9PA 3TFCA 1TYGA 4KWUA 1CDGA 4EK7A 2E4TA 8XIAA 4Q4SA 2ESCA 1XQLA 1F3WA 2XISA 4HVXA 3WNMA 1AA1B 3HJZA 4LS2A 1E9ZB 1MDRA 1RP9A 3AQUA 3B9AA 5GQBA 1CPUA 3MKVA 2WQDA 3WNOA 1SZRA 2NT1A 2CLKA 3NQFA 1E6RA 1Q8AA 1T41A 2D2JA 1ONEA 3ZT7A 4E8GA 1BGAA 4O0KA 3KOFA 2GUBA 3LENA 3A6OA 5MHBA 3LNMA 3GG1A 1E4NA 1ZLPA 4G7FA 3LM7A 3THCA 3DG6A 2WSPA 3C0QA 1PZ2A 2D2GA 3C3NA 4JX5A 2PRHA 3TTEA 2IS7A 3DFQA 4L6OA 1M5WA 1HL2A 5D8ZA 2Y1HA 3EB3A 1A49A 1XLMA 4M80A 1CXKA 4JTEA 3NFUA 3WH9A 1GT8A 4KW2A 3LCHA 6CGTA 2BXZA 1JULA 1QHPA 2QHAA 1IZCA 2PTWA 3R10A 1EIXA 1OSEA 1N8FA 1W5PA 1YRRA 4OV9A 2X1TA 3S5OA 4PRRA 4ZSTA 1H7PA 4JEJA 5ECVA 2Z2BA 3ATZA 3VKDA 3C52A 2OSXA 4GFSA 1OFOA 1BTCA 2UWFA 3NSXA 3O15A 1K4HA 4GQGA 4N6EA 3HU7A 1W1TA 3T81A 1RY8A 3PUGA 3GU2A 3P93A 2PDGA 5F2GA 1WV2A 2VX6A 5FKYA 1UWIA 2XDFA 3Q65A 1G4TA 2AAAA 1XLJA 1NOUA 1HUVA 2FPYA 4HJFA 3VNJA 4AEEA 2Y5EA 3Q45A 4HHPA 4ZEPA 3VOCA 3B8SA 2OYMA 4JN8A 2D20A 1ZP4A 3KX6A 4GO9A 4QISA 1UR9A 2OFJA 4GX9A 2GQ9A 5HJXA 4KWWA 3W70A 1PE1A 3B4UA 2ZRZA 3M6YA 1X8CA 2OOFA 3NQCA 4R5EA 3BSGA 3TTQA 4P61A 3UWYA 2QUMA 3GAKA 3LM3A 3VFCA 5E9AA 1RV8A 4JTLA 3E2QA 3GLCA 1X1NA 1ZJHA 3HOJA 4J2PA 2AAMA 4MZYA 3BLDA 2I5QA 2WW5A 2XWEA 1V93A 3JUGA 1QO2A 1E72M 1J93A 4QS5A 3SJ3A 3NQ2A 1CGYA 5FSDC 3AIUA 3FA3A 4OV4A 2HROA 4K8GA 3G2GA 4G7EB 3OVGA 3UWWA 2CHRA 3LHWA 4FR6A 3NIYA 1ISYA 1H49A 3LZ3A 1ZJIA 2C79A 2DZSA 2EBNA 4JIPA 4DPQA 2PLKA 5DX7A 1H50A 2V3GA 4OHQA 2ZXQA 1UC4A 4NJHA 3GXIA 1F2JA 3D5HA 3AFBA 2F84A 4FX8A 4LEFA 4NAEA 2CZDA 3GDRA 1UP3A 2NX3A 2ZUVA 4DZHA 1EJTC 1CGXA 2QPUA 4O4WA 1V3JA 1QRQA 1Z6KA 4L56A 1RVGA 3NXFA 1KXVA 3H12A 3WDIA 3QW4B 4U31A 4JTCA 4J35A 1XG3A 2G4JA 3BAIA 2DVXA 5C2GA 5A1AA 3TJIA 3GUWA 5I3FA 2P0OA 3TROA 3K1GA 1EEXA 3CL7A 3WEOA 2DZWA 1TMQA 3D47A 5HQLA 3RILA 3APTA 4S3BA 1Z41A 2AKMA 1RZMA 3QN3A 1L8NA 3IAQA 4MM1A 3II1A 5HMDA 1AH4A 3RXZA 1HL9A 3T2OA 3QV7A 2PWEA 4GYFA 9CGTA 2HS6A 4PMJA 4DLMA 3TNOA 1FH7A 1B4KA 1B90A 4Z08A 4HA3A 4DJFA 4IPLA 4RZ5A 3NZRA 4PYSA 5EMKA 2DZXA 3S3GA 2Q8LA 2OU4A 1EF2A 2DORA 2OKTA 2OO0A 4LBSA 5C0QA 1QT1A 1N82A 4IGMA 3ARZA 4HN4A 3CEUA 3W74A 1MEIA 2WQPA 2Q09A 2E5DA 4H01A 5L9FA 2F6XA 2PGFA 3BLIA 2ZRUA 3WBWA 2EKCA 3SUWA 4TV6A 2J9ZA 3TA6A 4MWAE 3BG9A 4CEUC 4PB3A 3I68A 1FDYA 3TP4A 3IACA 3QPEA 1FKWA 3DGRA 1US3A 3PPHA 4FNPA 1E6PA 2C91A 3RAOA 3Q58A 4LGXA 4O0ZA 3H7UA 3CUXA 1IIGA 1S2TA 5FJJA 1EJWC 4NJIA 3R8HA 4Q8QA 3RYSA 4UOQA 4Y9MA 4WVXA 1SJCA 3GFXA 3WNKA 1XBVA 3WLKX 1GJPA 3KBJA 5ABEA 7REQA 4X61A 5GNYA 5D38A 3IJ6A 2NXHA 4JN7A 1Z69A 3ARPA 4BK9A 1PYMA 3L0KA 2A6LA 1OYBA 4HSHA 4O54A 5XIAA 3E5BA 2Y7FA 2Z28A 1PB0A 1T99A 1H7RA 3HGJA 3SUVA 1VGAA 2WCAA 2Z6JA 1G4SA 1NAL1 4QJ5B 2BGSA 3BC9A 1O12A 4K38A 1YQ2A 9XIAA 3RCMA 2WC3A 1MFUA 3KHJA 5I77A 1RQBA 4C6JA 2DZBA 2ON3A 2HMCA 3IK4A 1A4LA 1C92A 2FMOA 4PUEA 1GW9A 3W7PA 4MOZA 5D2WA 2Y24A 3SCQA 3GW3A 3MVIA 2GWGA 3CTTA 3MS8A 5CJMA 1LLOA 2D0HA 3DUGA 2XSBA 1ADOA 3UWQA 4BQ2A 1QNRA 3QF0A 4L9YA 3PP7A 4MY8A 1YTKA 2OODA 3QYSA 4JYEA 2X09A 3DN5A 5A8QA 2GDVA 5LNSA 5JUVA 1X96A 5FEXA 2OLHA 3QV9A 4WSJA 4JHOA 1KR0A 5AYBA 3DFNA 3LDVA 3PZVA 3UW6A 3TXZA 1MQPA 1RPXA 1V6WA 4A05A 2FJKA 2ZXBA 2VDGA 3IGHX 5EMMA 4GACA 4B5NA 4BI5A 3WLSA 1AZ2A 1W3LA 2NQJA 3UG3A 3LA4A 3HPSA 2UBPC 4H3DA 4PULA 1T40A 3H2EA 1LOLA 3GH4A 4ZFCA 3H4GA 3A23A 1LWIA 5E6ZA 4TMCA 2IKGA 4K7YA 1R9XA 1SZNA 1VIZA 3VD9A 4UFMA 3M43A 5D2VA 3CGTA 3LB0A 5T26A 3PZMA 2Z1SA 8TIMA 3R8GA 2PF0A 3KFTA 4AYSA 3ZXWA 4RE4A 2ZC8A 3L0GA 3CUZA 4ZSUA 1J5TA 1XBYA 3UJFA 3SM0A 3UWEA 1O5QA 1WDRA 4QLKA 2E09A 4K8EA 4JKMA 3RX4A 4I7WA 4XZLX 3G6MA 4IZGA 2V69A 3PBVA 4MSSA 3HGSA 1XJBA 3AWNA 1H60A 1LL6A 1XLLA 3U48A 4ONVA 4QDMA 2CYGA 3HGOA 1ZAHA 4FLOA 2X42A 5JU6A 3WH8A 4OTKA 1A3XA 3U5YA 4TOQA 3CAVA 2BVTA 4S2BA 3W81A 4FOKA 1LG1A 3HBLA 4CCDA 4NNBA 5LSMA 2YW3A 4H7ZA 2QAFA 2J8TA 4PUJA 3EB4A 1WBHA 3B9OA 2ZTJA 5CGTA 4AX7A 3ZR5A 1F07A 1VBJA 1B5TA 2CXGA 1UIOA 1YBQA 3TYDA 3VCCA 2PDMA 3GUGA 4BJHA 5HJYA 3P74A 1T6MA 1TPVA 1E0WA 1PWMA 5I09A 1W3IA 2NV2A 4GQ0A 2GQ3A 1CI1A 3NZPA 1G69A 1XLAA 3CMGA 4CNOA 3KZPA 4GX8A 3ARTA 3BMXA 2KZHA 1A0DA 1IT7A 3BWWA 3VA8A 1TSIA 3SCRA 1DL3A 1HJQA 4HTBA 4L64A 4QGCA 3WO8A 3MYPA 1SZGA 3FFSA 3M7WA 4XIAA 4HOZA 3T8QA 5GJPA 1MXGA 5LIYX 3VOHA 2W4XA 3H4WA 4IT1A 3R43A 4Z1DA 1I2QA 4MJ2A 2P10A 2B7QA 2DT3A 4Y6GA 4MWAC 5FAGA 1P7TB 1SVDA 4AXKA 2VD9A 2Y7DA 2R94A 3UJRA 5I06A 3U4FA 1BRLB 4CQ8A 1P1MA 3ITTA 2XH7A 3KL5A 4DWSC 1H11A 2V67A 1KXHA 1S5VA 3AZSA 1M7OA 2O0TA 3PF3A 4Y7EA 1VYRA 2QCEA 4MYAA 1E6NA 4JFWA 3WJSA 1OB0A 3V35A 4V1YA 1HQTA 4HK5A 8A3HA 2ZX8A 3PZIA 3O8AA 4S3DA 1JF6A 3VXGA 1OFRA 9XIMA 4PTDA 3FS2A 1W9BM 3VOIA 3T0BA 1RAKA 4LPCA 1UD2A 3INPA 4I6KA 5IRPA 3IUIA 4O14A 1ZNNA 4I90A 1GZGA 4D8ZA 2C6QA 1FHLA 1QFEA 1FP9A 1CTNA 4O15A 3T09A 5JQ9A 3HJEA 4LBUA 2J27A 3W83A 3FJ4A 2QDHA 1W2PA 1QK0A 1HKWA 1NARA 2VR4A 4UOZA 1K8CA 4BEQA 4ZOCA 2GVEA 4EPBC 2VEFA 1JR1A 2YCLB 2J79A 2E0PA 3H2CA 2X8RA 5CJNA 3QY6A 2QPSA 3MMWA 3WD0A 4GXWA 3W7HA 2G96A 4JIEA 3AHYA 4GH3A 5LHEA 2YJQA 1ZAIA 3UG4A 3W1QA 1KXQA 3L68A 2CLEA 5HANA 2V5JA 2FGBA 1W5MA 4BF5A 5T8GA 3OOQA 4UNIA 1YXCA 4UMBA 3BLFA 3EMCA 4FF7A 2DVUA 3OHIA 2J6XA 3NSMA 3RGTA 4C1NA 3AXHA 1SU5A 1U33A 3CC1A 1DJNA 1JZ3A 1TKKA 3TKFA 3N4EA 3E0VA 1H1ZA 5BWFA 1OD8A 2ZZ1A 4K3ZA 4QS6A 3CZGA 3LS9A 4JD4A 3RX3A 2D3NA 2IPGA 4HOWA 2Z26A 1W1IE 3IUHA 3WDJA 4D8AA 4PCFA 4TX9A 4UTJA 4RR4A 5A95A 1X6LA 4Z1BA 3DHPA 3DG7A 2ZE0A 3TA9A 2OWXA 3WH6A 1P43A 2NWSA 1PKLA 4JBRA 3OLIA 4LVAA 3WQWA 1SJAA 3CWOX 3W73A 3VCRA 3H2OA 1TQXA 4RDYA 2C3ZA 1XIDA 1NQ6A 5BZAA 4P8UA 4UIOA 8RUCA 2Z1VA 1S3HA 1VENA 2H3BA 4PCTA 3EAUA 4NSBA 3MZ2A 4NG3A 4QR6A 2WLZA 3MI6A 3PBWA 3NQ8A 5FJIA 1GVEA 4NU7A 4D1IA 1S5MA 5AHFA 5BMXA 2WPBA 4E4FA 1K8ZA 5AHMA 2NZLA 4DPPA 1J12A 1S3TC 2J78A 5EMLA 2HVMA 4IUGA 4Q4OA 2VZUA 1JCMP 3WQEA 2D73A 3NYDA 4H1ZA 1S5WA 2OMAA 1U5VA 1JYVA 4DWDA 4FAMA 3HG4A 4UTTC 3VNLA 2FZ8A 4RW5A 4A8NA 2PB1A 3E49A 4RV8A 3D46A 1Y5XA 4XZNX 2ABBA 2PU1A 5AZ1A 4EACA 4IGNA 1KM4A 3TEVA 1EJSC 1ZBWA 3L67A 4ZA0A 2WKLA 4O1AA 1FX6A 2P76A 2FVLA 1KBIA 4LTSA 2A3AA 3UVAA 1V0LA 1UA3A 1XSKA 3LMZA 1H7WA 4C6DA 3EPMA 3A3XA 3V0UA 3WZ0E 4AHPA 3TZFA 4UTKA 1F3EA 2GQAA 2O56A 1EP2A 2ZA3A 3W7MA 4DBEA 3I3DA 1KRAC 4B5WA 2QMJA 2J24A 3S6OA 4NHVA 3RUBL 5CEWA 1VRXA 4D6JA 2FKPA 4KFOA 4O1FA 3XIMA 1FY6A 2ISDA 4OGZA 4HZ8A 4F3HA 3HMCA 4IFKB 4FXRA 4HA1A 2WYSA 5D33A 2JEPA 1LDCA 1WDQA 1RD6A 3B8TA 2DIKA 4GCXA 2CNCA 1UWQA 5FL1A 3SW6A 3EB2A 3NZQA 2CLFA 1JF5A 3FEMA 4US6A 5FJTA 1D2KA 4XZ9A 4X2RA 2ZUTA 3W86A 1VHCA 2I5GA 3GNPA 3MSYA 4FHAA 1VRDA 3MO7A 4RKAA 4JTGA 1QTWA 4O16A 1D3HA 3TK7A 3P81A 4RLIA 4CKQA 1ZPTA 4MAVA 1JCTA 3PB2A 1OC6A 1WXYA 4LRTA 4FNSA 4Y8FA 1MW2A 5HNTA 3WKZA 2JIWA 1I60A 3IIOA 3KP0A 1V3KA 1GKQA 3UY8A 2XFRA 4ZQCA 2J7BA 2VCCA 4GOAA 4LS0A 3L4TA 3RLHA 5I23A 2QVHA 3CIWA 5BRBA