1LF1A

Crystal structure of cel5 from alkalophilic bacillus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
298
structure length
296
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGITVFRAAMYTSSGGYIDDPSVKEKVKETVEAAIDLGIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWDNQIKPYAEEVIPVIRDNDPNNIVIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel combination of two classic catalytic schemes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Cel5
total genus 109
structure length 296
sequence length 298
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lf1A00
2EQDA 3CUIA 2BV9A 2F61A 3DHUA 4MB1A 3OZPA 2YA2A 3PZVA 1QI0A 2O9OA 1E72M 4U2ZA 1UR9A 2DPEA 3AMLA 5E09A 4URIA 5GPRA 5JBDA 2UY2A 3LPPA 5ABFA 3SUVA 1JF5A 4HOZA 4AD0A 1UWTA 1JYVA 1DTUA 4HPHA 5A95A 2PWHA 3WH8A 5E6ZA 1J9YA 3VDBA 5M5DA 2XVLA 2ZWYA 3WUFA 4H04A 1NH6A 2YL9A 2YKKA 5DT7A 3N13A 4AZIA 1GW1A 2WXDM 4CVUA 4OIFA 3J7HA 1WZAA 4ACZA 4AZCB 2BXYA 1CGWA 1XH1A 3AMKA 1KCLA 3GNOA 1HF6A 5A8NA 4RE3A 2ZUMA 4J7RA 1LG2A 3SCOA 3N11A 4TXEA 3WH5A 3VDCA 1UD3A 5E0CA 1JFXA 3IAQA 4D1IA 4CGTA 5HXMA 2VX6A 3FNDA 3CMJA 4Z2HA 3GBDA 4MTVA 4XX6A 2EXOA 3A6OA 3FY1A 1GJUA 2DT1A 4DWSD 4QCEA 3VIPA 1VF8A 3VIGA 2ZXBA 2HVMA 5BROA 4ACYA 3A3HA 5I0DA 2CIPA 3ARYA 4PMVA 1E73M 4ZEPA 1VFFA 1F4HA 4HZ8A 4GZEA 1W9BM 3WEZA 4TOQA 2VI0A 2GFTA 3VD9A 1QI3A 3NSNA 3ZIZA 5I24A 3O6AA 2CBJA 1PZ3A 2J79A 3CTTA 1P6WA 2GDVA 3CZJA 2BXZA 4FLQA 2VT0A 1NP0A 3OGVA 3A4AA 2XGIA 1EOKA 2NT1A 4JCLA 4OOUA 2PWDA 3VIKA 1ZBWA 2BS9A 1U2YA 3D5HA 2WM0A 4UQCA 4OJYA 1D7FA 4K68A 1V6VA 1JZ3A 2YDSA 5C70A 2NW0A 2XFFA 1HKMA 2UY3A 3ARZA 2W63A 2J75A 2V3FA 1JFHA 2WC3A 2BY3A 5D8ZA 3VNYA 1ZBVA 1L0PA 2GJXB 3EDKA 4ZENA 1JD9A 2YA1A 1GOWA 3SCWA 4UOJA 4Z2LA 1QNSA 3GNPA 4ZE4A 4AIOA 4MB4A 3U5UA 4CUCA 5LYRA 2CPUA 1SMDA 4W7UA 3WD4A 1ODZA 3W29A 3CUHA 2CCRA 2VRKA 3W0KA 3AISA 1VEOA 3VOCA 4B16A 2X0YA 3UEQA 2QPUA 1UR8A 1ISWA 3WDHA 7TAAA 4PSRA 4W89A 4W8BA 3GTNA 4J3XA 1CTNA 1EHAA 2X8RA 4PCTA 5CZKA 1OD8A 2VR4A 3EBVA 4UTFA 1E6RA 5CQ1A 1QHOA 4J3SA 3GM8A 5CG0A 4AD1A 1UR0A 4UR9A 3SEPA 4E8CA 1R7OA 5IFPA 2OSXA 2XGBA 5IHSA 2W92A 4MNLA 2E3ZA 4ZFMA 4M82A 4AD3A 3KE0A 5IFTA 3L4VA 3HMCA 4U2YA 3PZNA 4UQBA 2ZIDA 3U57A 3OBAA 3E1F1 2G3NA 1QNOA 4MPKA 1V02E 3SCSA 1DWFM 1E55A 3MO4A 3A47A 2EPMX 2G3MA 5M03A 3UR7A 1EQPA 1ECEA 4U3CA 2C0HA 4AZ6A 1ISVA 4NZCA 1PEZA 3ARTA 1XYFA 3KL5A 1W3HA 2XVNA 4D6CA 3VTRA 1UR4A 5D9NA 3THCA 1JI1A 4N0RA 4QP0A 3WFZA 1ISYA 1HJXA 1JZ8A 3B9EA 2E9MA 5A3HA 4GO8A 1OINA 3POCA 4R27A 3WENA 1JDAA 4MB5A 5LA2A 3VIIA 5FD0A 2J7EA 1H5VA 1US2A 5EB8A 3GH4A 2EPKX 3SUTA 1MW1A 1UZ4A 2VX4A 1GHSA 1E6NA 2PC8A 4PUEA 1QNQA 5D9MA 4KRUA 1CXHA 2WB5A 5DMYA 2E9LA 3VKKA 3W6LA 2BHZA 1NQ6A 5GNYA 2VJXA 2VURA 5I77A 1CZ1A 2FHBA 3AIRA 2WW5A 4W8LA 2WSKA 4WK9A 2W61A 2VTFA 1TCMA 4UFLA 5A8MA 3WUGA 2J77A 1ZB5A 3LPFA 2XSBA 4LYPA 4F9DA 3CIVA 3K8KA 1NOFA 1CGYA 2XVPA 4UFKA 4Z2IA 4QFUA 3W28A 1H4PA 3CGTA 2CHOA 1WDRA 3S6TA 1UWSA 4PMQA 1G5AA 4PSPA 3NUKA 2WBKA 1V3JA 4AZGA 3KEHA 1GQLA 4W86A 2OWCA 4L4OA 1JZ4A 3PZGA 3BGAA 1MW3A 1FH7A 3K4DA 1CXEA 2FH6A 4D1JA 3N17A 2D0FA 1QW8A 3M6DA 1J11A 4OKDA 2OYKA 3RCNA 1EDGA 2G4FA 4MDPA 4AXNA 4JIEA 4LQ1A 1OD0A 3TOPA 1VFOA 3ARWA 2VCCA 1E6SM 4W5ZA 4W85A 1CWYA 1BQCA 1XH2A 1ZL1A 3EMCA 1CEOA 5IXEA 1DWAM 1J0JA 1IV8A 2CETA 1E6ZA 1W9PA 4GO9A 5CPTA 1XSIA 1QVBA 1JGIA 5DT5A 3WD2A 3AHTA 3GH7A 3CHFA 4D6IA 3ZT5A 2CBIA 2DIJA 3AYRA 3CZLA 2EEXA 4P8VA 2VNCA 2CEQA 5C71A 1CXFA 2ESCA 3CZGA 2XWEA 2PBOA 3AXXA 5GQBA 3W25A 2J7BA 3IANA 3O2LA 1UKPA 2VZUA 1OIMA 4Q22A 2B31A 4ZXLA 5HNNA 3POHA 4F79A 2PWFA 3G6LA 3PZ9A 3T2PA 2XTKA 1LG1A 3VIMA 1JL8A 1WB0A 1CXLA 2D1ZA 3L4UA 1HP5A 3FHQA 5A2BA 5I3DA 1R7AA 4QLLA 1V6UA 1C90A 2XG9A 5I5RA 4NF7A 3O9NA 3VO0A 1TZ7A 5CGTA 3PTMA 4AWEA 1UYQA 3DYPA 3W53A 3WD1A 4TUFA 5JUVA 2CERA 1OWQA 3AXIA 4AIUA 4PMDA 1KWKA 3JUGA 1R8LA 1JZ5A 1HJQA 1W1TA 3VD4A 1GQJA 1OGBA 1G1YA 1HKJA 4MADA 2WHMA 2C7FA 2XVGA 5GNZA 4JAWA 2VX7A 3SCVA 5HPOA 2WCAA 1O6IA 1OGSA 3MS8A 3SCQA 1E5NA 4UQEA 4X0NA 1GCYA 1EDQA 4BQ4A 3BSHA 3AQUA 1JZ2A 3SUSA 1GOIA 1XD0A 4W84A 4D6JA 1DWHM 1XRVA 1UR2A 2DDXA 4CD8A 3VVGA 1K9TA 2GSJA 1WNOA 1UWUA 1OM0A 1PZ2A 2FH8A 2OWWA 4D72A 3VM7A 1CECA 1DWIM 2DH3A 3VGDA 2IUZA 3AIUA 3ZMRA 1E0VA 1GVIA 2QPSA 2DSUA 1DWGM 4GQQA 3BAYA 1UD8A 3UETA 1BGAA 2XM2A 2VVSA 2DT0A 2QF8A 1JYWA 2WC7A 1E40A 2E4TA 1SYTA 3F4VA 4J3WA 4OZOA 2Y8KA 4HZ6A 4NSBA 3ZM8A 1R86A 3EMZA 3HN3A 1QOXA 1IZKA 1EOMA 2ZXAA 1BYBA 5I78A 1GOOA 1JAEA 3WNMA 4JL2A 1H49A 3CMGA 2PF0A 3UCQA 1KFWA 3WSUA 1O7AA 2VZOA 4HOXA 2YLAA 1W1VA 1CDGA 1XV8A 3SCRA 4LPCA 3L4ZA 2VZSA 1UD6A 3CUJA 2JF7A 1GUVA 1JF6A 1C93A 1PBGA 1V03A 4MDOA 3W38A 3K4AA 3B9AA 3MUZ1 3ZSSA 3W27A 2A3EA 5A6AA 2J7DA 1LF1A 3OLGA 4X9YA 5JBFA 3WBAA 4PMNA 5HDRA 4P8WA 4UCFA 1PIGA 2QMJA 1W91A 4N42A 1E71M 4B15A 2PWEA 3WMCA 4E8DA 1WO2A 4PUDA 4BA0A 2O9RA 4P7RA 3EDJA 1H41A 2J8GA 1ZS2A 4KMQA 1SMAA 5LA1A 3AHZA 2CHNA 5E0FA 1XSJA 3FAWA 3VD7A 3FXYA 1X6NA 1N82A 3FW6A 4BQ3A 2X05A 2G3IA 1ZBCA 1E5JA 2BFGA 5CLTA 1BTCA 3VX0A 3T0BA 5BXSA 2XYLA 4U5KA 3AS1A 4ML4A 4PTMA 1E0WA 4NRRA 3WH7A 1EXPA 5F7UA 3CZ8A 3BLPX 3T0AA 1WDPA 2DEPA 2WNWA 3WUEA 2D20A 1TUXA 1KGUA 1B30A 4LYQA 4ATLA 5D9PA 3L4WA 2E8YA 3I3BA 1M01A 1VFMA 3MMWA 1MW0A 4UOZA 1FA2A 2DSWA 2CYGA 5CSYA 3DYMA 3QGVA 4KRTA 2D2OA 4U33A 2PBGA 4B3LA 4JKKA 1E56A 4AD4A 4E4PA 1BFNA 3CZEA 4EK7A 1E15A 2X2YA 4GI8A 1MW2A 3QR3A 3WQWA 4UFHA 5CSUA 2AMGA 1G0CA 3NDZA 1VBRA 3AMCA 2CBUA 5AYIA 2DIEA 3RJXA 3AJ7A 4PTVA 1CLXA 2J25A 2E8ZA 3OLEA 4HA3A 3ECQA 1E6PA 1CNVA 4YHGA 1GJWA 3T0DA 3AHVA 4EAMA 1YHTA 3WF2A 1GZJA 4BF7A 3AIVA 1JD7A 3W4RA 1JIBA 1DEDA 4M1RA 3A4XA 3T08A 1FH9A 4AZBA 2QMKA 2AOSA 3VD5A 1Q6GA 4TVUA 1SR0A 3NJ3A 5E70A 4MAZA 4PEEA 1QBBA 5A6BA 2OYLA 3N1AA 4CU8A 3HU7A 4BCEA 3OZOA 3U7VA 2Z1KA 4Y7EA 1XHGA 9CGTA 3WY1A 1LL4A 4D6HA 3GDBA 2CITA 3U7BA 1JXKA 3L2LA 2W91A 4P7QA 2DGAA 4H41A 3UG3A 3ZJ6A 2GVYA 2O9PA 2Y4SA 4F66A 3SUUA 3VGGA 1V0KA 4IM4A 1TA3B 3EDEA 3AS3A 2VZTA 3WDRA 4Z2KA 4CKQA 4DWSA 1E1EA 1I1WA 3SCPA 5A69A 4HTYA 2WC4A 1I1XA 1AQ0A 5BCAA 4CVWA 3QOKA 2XIBA 4WKHA 2WMFA 2V3GA 3ZJ7A 3W37A 4KGLA 3K8LA 1VEMA 4J3TA 4PYSA 3W26A 4FLSA 3VIHA 3CH9A 1E4MM 4A4AA 3U5YA 4FLOA 1JG9A 2DT2A 2VMFA 1LL7A 3IJ9A 1V3HA 1UA3A 5DFAA 1GQKA 3TP4A 3VGFA 3OGSA 1V02A 4M29A 5FCZA 1V0NA 1VAHA 3BLKA 1V6YA 4LXFA 1XD1A 2XM1A 1XH0A 6A3HA 4V27A 1X6LA 1HJUA 1W9VA 5D9OA 4GZIA 3L4XA 3BSGA 1IT0A 3AMDA 4D6FA 5D8WA 5CGMA 1UH3A 2VCBA 3RPMA 1BAGA 3VILA 1S46A 3QOMA 3UG5A 1H09A 5CLWA 1M7XA 2YJQA 1V0MA 2WAGA 2WBGA 2VX5A 3AOFA 3WKZA 4GPNA 4AMCA 3B8SA 2J8FA 4GI9A 1MVYA 1X1NA 4R5EA 2WMKA 1E4IA 4H7VA 1E9LA 2VUYA 5AC5A 3PZOA 1Z32X 3NYDA 2A3BA 3K46A 2ZXDA 3NIYA 3RILA 3WNPA 3OIHA 3TTQA 1HIZA 2E0PA 3GXMA 1QNPA 3IJ7A 1H0IA 2XVKA 1E4LA 2J74A 3AIBA 4DWSB 3MUY1 1BGGA 3II1A 1CYGA 2UWFA 3W6MA 4IPLA 2BVYA 1W1YA 1RH9A 3WF3A 1XC6A 5LA0A 1JXJA 1LL6A 1W9DM 6TAAA 4PN2A 2V38A 3WD3A 1WCGA 4WF7A 4CD6A 4F9JA 5C8BB 1QI5A 1GONA 3VUPA 3CUGA 2XFYA 3AICA 3WNOA 5A6SA 1DWJM 5HPCA 3BAXA 3TTSA 1PX8A 1WZKA 2VZVA 3NSMA 2WVSA 1SFSA 4BQ5A 4PMRA 5A2AA 4JL1A 4JZ5A 2ZUTA 3CHDA 1MXGA 3RM9A 2F8QA 4W8AA 3LPGA 2JALA 2YDQA 2CESA 1Q4NX 3BC9A 3TTYA 1FP9A 2WHJA 1KB3A 1FHLA 4HMDA 1Q6CA 2CBVA 3VMOA 1QHZA 3ALGA 4IPNB 5A8PA 4P7LA 1CLVA 2VRQA 3AZTA 3LPOA 2X0HA 3MSDA 4CD7A 3WH9A 2W4XA 3AIWA 3FN9A 4NI3A 4PRWA 4ZE5A 3L4TA 3WFLA 3L2MA 2J78A 3SCUA 4P7NA 4WLCA 3FHAA 4A3YA 3ZJKA 2DH2A 3THDA 4CCDA 4D6DA 4FK9A 1WAWA 2AAAA 4AZ7A 5E6YA 2V5DA 4CD4A 1CPUA 1KR0A 2CKSA 3F5KA 1M53A 1HL9A 3ZR5A 3GZAA 3B9DA 3D3AA 1HL8A 3VIFA 4OUEA 5FKYA 5IDIA 2V3EA 1LJYA 1UKQA 5BXTA 1UKOA 2JF6A 1FOBA 3N04A 1PX3A 2J7GA 4DM2A 3AIQA 1ITXA 1V3LA 3ZO9A 1JNDA 2ZX5A 1RD6A 4A3HA 1HJSA 1TR1A 3UERA 5A6MA 4DUXA 2JEPA 3OLDA 4UQDA 1L8NA 1FFQA 4Q7NA 3AFBA 4XUYA 3FAXA 1WDSA 4HPGA 1BYAA 4DM1A 5AC4A 2PWGA 1UH2A 3CO4A 1C92A 2BVDA 1ZJAA 4OBSA 3GYCA 1WZMA 3BAIA 2YOCA 3BAJA 1UHVA 1MQQA 3VGBA 5A8QA 3WL1A 1B9ZA 1W3JA 4JFUA 2WMIA 3N18A 1HX0A 2OLHA 3ZOAA 1MFUA 2WVUA 1BF2A 5TD4A 4HOWA 2D22A 1WPCA 4UQAA 4MNKA 4TVDA 3WEMA 2J7HA 1TMQA 1LQ0A 1CXKA 2UY5A 4QLJA 3GXDA 3OA5A 4PMZA 1NWSA 1G9HA 5JBEA 1V3KA 3MUIA 3VINA 1UUQA 1OT2A 4XZWA 4PMOA 2YBTA 3OGRA 2BY2A 4M81A 3S2CA 1MYRA 2RGMA 2GDUA 4M24A 3ZQ9A 3WF4A 3EDFA 4P7OA 4L4PA 4UQ9A 4PMYA 4AW7A 2OYMA 1C3FA 2QV4A 1IZJA 3ZT6A 4AZ5A 2VQTA 5ABGA 2J62A 2CXGA 1NOWA 2FHFA 2ZX8A 1EA9C 3WDIA 2J7CA 2Y8VA 4W7WA 1HP4A 2JEQA 1KQZA 4V2XA 5E9AA 3GH5A 4FMVA 1GOMA 4CN1A 1I75A 1MFVA 5M17A 4QCFA 4WSJA 3GXFA 3WEOA 5A6JA 2G41A 1BG4A 3MSGA 3VGEA 3NSXA 3WQ6A 1GNXA 2VCAA 2BY0A 1MQRA 3W82A 2GK1B 3ZT7A 1AQHA 2J47A 2PI6A 1C91A 4AC1X 8A3HA 2ZUNA 3QHOA 1BLIA 1HN1A 3ARVA 1XYZA 2YLLA 2DT3A 4NRSA 2WK2A 4ATDA 1CBGA 2VR5A 1EO7A 4CN6A 4CCCA 3ARRA 2JIEA 1B1YA 4KGJA 4GI6A 1CXIA 1BHGA 4P8XA 1AQMA 2WVVB 5JIPA 2VC9A 1OCQA 1WDQA 2VL4A 2ZOXA 4JFVA 1OB0A 2WKLA 3MMUA 4YPJA 2W62A 1EIBA 2YA0A 3MKKA 3T09A 5A6LA 2W66A 4WJXA 3WNKA 3EDDA 3VDAA 4EE9A 2VRJA 1K9FA 3RO8A 3SIMA 1B3VA 1BSIA 4J28A 4HMEA 4YN5A 1H0GA 1KR1A 3SURA 2YIHA 3WDJA 5ABHA 4JCMA 1U33A 2ZE0A 3F5JA 2J4GA 2WWCA 3ZSTA 5M3WA 1H1NA 1VIWA 3BMWA 4LX4A 1HJWA 3I3DA 1JZ6A 3DHPA 3WN6A 3SUWA 3DECA 4HU0A 2C8NA 4WKAA 4EANA 2RGLA 3CPUA 2WVTA 3ARXA 1J0KA 1E3XA 2E9BA 1J18A 4TX6A 3M46A 1MWOA 4GIAA 5DO8A 5EFDA 3WIJA 1HXJA 2XFRA 2BNJA 4XV0A 2YDRA 1ITCA 4JFTA 1ZJBA 3TONA 4OBRA 3QHMA 2WHLA 3N9KA 4C7FA 4AD5A 3CZKA 4W7VA 2OSYA 1J0YA 3IK2A 1MXDA 2NSXA 3WD0A 1LWJA 1EH9A 1U30A 1US3A 2A3CA 4M8UA 5I6SA 1V0LA 4PCSA 4H8UA 5AY7A 4CU7A 3UESA 1NOUA 1AVAA 1EQCA 4X0VA 4GINA 5FL0A 5I79A 4TVCA 1CGUA 5KEZA 1JNEA 3VX1A 4QAWA 3T2OA 4AIEA 1LLOA 2W5FA 2WKGA 3AMGA 1BYDA 2XJ7A 1QI2A 2BHYA 3AHYA 1UWRA 5CPQA 1NWUA 3WMSA 4W5UA 4B9YA 1V6WA 1GOQA 4QDMA 1FH8A 2XIIA 1GPFA 3BXWA 3WQVA 4AY1A 4UZSA 1H11A 4UOQA 1HVQA 2VQUA 3I3EA 1B3YA 1C8QA 3VIOA 2VO5A 4AD2A 1W2VA 5DF0A 2XHYA 1ZBKA 3DC0A 1XGZA 4P8UA 5ABEA 3NDYA 2EO7A 1W3KA 1UKSA 1KGXA 1BVNP 2WWDA 1OT1A 2WCSA 2XPKA 2F2HA 1OIFA 4U31A 1W2PA 1M03A 1UQZA 2DSVA 3BAKA 3RMEA 1PJ9A 3IAPA 4BS0A 1VFUA 1JAKA 2DSZA 1W3LA 1LWHA 1GHRA 3GBEA 2D24A 2QHAA 4CU6A 2A3AA 4ZXOA 5BXRA 1V3IA 3PZIA 1NWRA 1KWGA 1NWTA 3RDKA 1VRXA 2O92A 3ARQA 1QHPA 1K9DA 2WLZA 4B9ZA 2ZUVA 1RPKA 4U3AA 5BYWA 2V5CA 1K6AA 1UD2A 4JKMA 2CNCA 2WPGA 3ARSA 4GXPA 1J0ZA 2X1IA 2D0HA 1J12A 1UWIA 2Q8XA 3ZR6A 5GNXA 1JZ7A 3RM4A 2BVTA 1BVZA 1BYCA 3HJEA 4MNJA 2XUCA 3BH4A 4IUGA 5A94A 2GJRA 4LYRA 2ZX9A 3PTKA 2WVVA 3MUAA 3WF0A 2WYSA 3SCNA 4V28A 2ZUUA 3VPLA 2VOTA 1V08A 2GUYA 1ODUA 1VJSA 4Z2GA 2IXUA 2E40A 1CGTA 3VM5A 3M7SA 4MNMA 2Y5EA 2ZX6A 5FL1A 3KZSA 1D2KA 1G01A 1TFVA 1R87A 1E70M 4JFSA 1CENA 1B3WA 4HZ7A 5KZ6A 1JI2A 3KL0A 3CUFA 3W81A 3G6MA 4XB3A 5CXPA 4AZHA 1B0IA 1QI4A 4W87A 4JFWA 4AEEA 2O9TA 2MANA 5D4YA 3N12A 3CBWA 1PPIA 1MQPA 1J0IA 3MV11 1BPLB 1ZU8A 2UY4A 4TX8A 1EHNA 3AI0A 3WL0A 2JE8A 1E1FA 4PTXA 4C7GA 3AYSA 2WZIA 3QHNA 2XSAA 1TE1A 1EGZA 5A6KA 1KCKA 1C8YA 2OSWA 2ZXQA 5EFFA 3UR8A 3WQ4A 4RL3A 2D3NA 3VDHA 1XSKA 3BCFA 3PZQA 3OB8A 3WF1A 1KXTA 4MAVA 2WHKA 3PZUA 1Q6EA 4FF5A 3DYOA 1OGGA 1DP0A 1V3MA 2BY1A 2CKRA 4KWUA 8CGTA 1W1PA 2DSKA 3M07A 4QLKA 3VD3A 1VENA 4S3KA 4H8VA 1J01A 1DHKA 1Q6FA 1D3CA 2EPOA 5I23A 7CGTA 1J10A 3ARUA 1A47A 3KL3A 4WSKA 4TTGA 1J0HA 4UZUA 1JYNA 3WH6A 1R85A 2VVNA 2EPNA 1CGXA 5A2CA 4GZJA 1WP6A 4H2CA 1E6QM 1KXQA 4WKFA 4MJ4A 4E2OA 2GJPA 1TG7A 1H3GA 2A3HA 4OOZA 1CIUA 3BCDA 2YL8A 2XWDA 3A4WA 3MU7A 2D0GA 4M56A 2FHCA 3WDQA 1B90A 2EBNA 3LMYA 3NCOA 2WMJA 5FIPA 1ESWA 4F8XA 2G8ZA 1GORA 1UWQA 1HJVA 1QNRA 1BG9A 1W9UA 1UR1A 4AYSA 4HMCA 1ISZA 3RJYA 1H2JA 1VJZA 1FFRA 3TTOA 4J3VA 3WELA 5BWFA 5A8OA 4CD5A 1QPKA 2PB1A 3UG4A 3AS0A 1Y7VA 4GQRA 4BZYA 2IXVA 1PX4A 2FDMA 1E4NA 1C7TA 1KBKA 3OLIA 3GNRA 3ARPA 3MV01 3AXHA 3AZRA 4WIWA 3VGHA 4DUWA 5AYBA 2Z1SA 1W9XA 1E6XM 1EO5A 3SCTA 1XCXA 1A3HA 3CLWA 3CHEA 1JDCA 4Z2JA 1JYXA 4DUVA 6CGTA 2WLYA 4AISA 3WDPP 3VMNA 4MB3A 3K1DA 1HNYA 2QLYA 3AROA 2WMHA 2YBUA 5JIWA 1UD4A 4RE4A 1UZ1A 1KGWA 3PBGA 4AEFA 4JHZA 2FGLA 2WMIB 3WMBA 4CCEA 5A1AA 4U5IA 2WCGA 3VNZA 3IJ8A 1B3ZA 3KWXA 3F5LA 3CHCA 3K8MA 3RIKA 2EPLX 1KBBA 7A3HA 4J3UA 1W32A 2GK1A 1XCWA 2V3DA 3BMVA 4LGXA 3W24A 1PIFA 4HP5A 4DWSC 3RM8A 1Q6DA 1OBAA 2OWXA 4S3JA 5BXPA 2G3JA 2EJ1A 2ZICA 3BAWA 1B2YA 5BRQA 5IHRA 3EYPA 1E0XA 3MMDA 1HVXA 3WQ8A 3WUBA 5CPSA 2W67A 1V6XA 1G94A 4H8HA 3L4YA 4PBGA 1GOKA 1WZLA 1E43A 1UH4A 5I2UA 1TA3A 4C7DA 3WBEA 4CN4A 1OSEA 1K9EA 1WKYA 2ZUWA 1KXHA 5BRPA 3N15A 1UOKA 3PTQA 5HBFA 1WE5A 2J7FA 4UFIA 4BQ2A 4XZBA 1ISXA 4ACZB 4AZCA 1EDTA 3OG2A 4UNIA 1FHDA 4FLRA 1UA7A 2D23A 2JIWA 1GQIA 5A6BD 4W88A 2HISA 3APGA 1F4AA 4UFMA 2WMGA 1FP8A 3VIJA 2BHUA 1HT6A 1VEPA 3WNNA 1C8XA 1YQ2A 2YL6A 1HKIA 4KH2A 3PHAA 4JKLA 3AZSA 4YHEA 5DEZA 4UFJA 2FGZA 5EBAA 2X09A 3T2QA 1C7SA 1M04A 4HU8A 1GVYA 2TAAA 1B3XA 3TA9A 1KXVA 4M80A 4PTWA 4PMXA 4B3KA 5CJ5A 5HOSA 4TTUA 5ECUA 1PAMA 2Y2WA 2JFEX 1UQYA 4IISA 4ATWA 4D6EA 4J27A 4D71A 3ALFA 4GKLA 1TVNA 1UG6A 4PMUA 4MJ2A 3PZMA 1NP2A 1JDDA 2GJXA 3WQ5A 4HA1A 3ZJ8A 2ZX7A 4RE2A 1NM9A 1CGVA 1NARA 5ABFB 4W93A 3AHXA 3AIEA 1UD5A 1RP9A 1AMYA 3VMPA 3WNLA 1QBAA 2WZHA 2D3LA 3MANA 2WSPA 1UKTA 1KQYA 1B31A 4D6GA 1HKKA 1E3ZA 4JHOA 3AS2A 2ZUSA 1VBUA 4EKJA 5FOOA 2DQXA 2YL5A 2ZWZA 1RP8A 3PZTA 2Y24A 3EMQA 4HA4A 5EMYA 3VU2A 3PN8A 2WANA 1TVPA 3GXIA 1VB9A 1QW9A 2NT0A 2WZEA
chains in the Genus database with same CATH superfamily
2EQDA 3CUIA 3MSRA 4IXHA 3DHUA 2C13A 4IQJA 2YA2A 3KHDA 1C9WA 2O9OA 4U2ZA 3WJZA 2QS8A 3TLQA 2DPEA 4I5RA 5E09A 5GPRA 2UY2A 3LPPA 1AZ1A 5ABFA 4EPKA 2H3BA 1UWTA 3OJGA 1JYVA 1DTUA 4LV9A 3LN3A 4R7JA 1NH6A 2YKKA 5DT7A 1GW1A 1EZWA 2FJKA 4JEJA 1WZAA 4ACZA 4O15A 3CWOX 3WQPA 3AO0A 1HF6A 4I5UA 1ME8A 4X2PA 4J7RA 1PCKA 3SCOA 1IHIA 4RZ6A 4TXEA 4D1IA 4CGTA 5MHBA 4JQAA 1K8YA 4XKMA 1JPIA 1FHVA 4MTVA 4XX6A 2FZNA 2DY3A 3UJ2A 3VIPA 1VF8A 4YTQA 4JX6A 4P2VA 4GQGA 1LLWA 1P43A 3QTGA 5I0DA 3P67A 1XUUA 1E73M 4ZEPA 3WEZA 1I6NA 1W9BM 3WLIA 5DMLA 4PR4A 3LQGA 1YNYA 1K6WA 3IIXA 3MY9A 4Y9NA 3Q2DA 3GW3A 2WNQA 1NVMA 5TBOA 1F76A 2J79A 3F4CA 2P53A 4FLQA 2XGIA 2NT1A 4OOUA 1Y5WA 1ZJHA 3VIKA 3KLKA 5F2MA 3VZXA 2QIIA 4Q4KA 4K68A 4F2TA 2NW0A 5HUPA 1DXIA 2E1DA 2UY3A 3EZ4A 1ADOA 3LRKA 3U8GA 1IWAA 2QCNA 2BY3A 1T41A 3ZZ1A 1HG3A 3VNYA 3LERA 4DBWA 1TWWA 3GTFA 2DZBA 5KITA 2I7GA 3QTPA 4JBRA 4Z2LA 1QNSA 4ZE4A 1JDFA 5FESA 3R0UA 3WK1A 4W7UA 1MO0A 2NV1A 4Y8FA 3GG0A 3WD4A 6REQB 3NEVA 1J93A 5AB3A 3DAQA 4LV4A 4WXYA 3DDMA 3UJFA 1XP3A 1YXCA 3R43A 2QPUA 2YW4A 4L1XA 1UR8A 4AC7C 4XZMX 7TAAA 4KBXA 4W8BA 2Y7FA 2VC5A 4OHQA 5H6HA 1EHAA 5CZKA 3W7QA 4JYFA 4FHAA 4RZ5A 1PSCA 1QHOA 1JCYA 1R3SA 5LIUX 3H2NA 1UR0A 3C52A 4E8CA 3ENLA 2W92A 4A2RA 3URQA 1BEUA 2OZ3A 3W7KA 3EB2A 5G1YA 4U2YA 1QASA 4Q4RA 5ENLA 3G22A 4IF2A 2GQ8A 3E1F1 2G3NA 4M19A 4AY7A 4GFIA 4MPKA 3GYEA 1DWFM 3NQ6A 2WKJA 3MO4A 4R34A 4J4KA 4PUKA 3N2BA 1TQXA 3O6CA 1VYPX 3AALA 3DI1A 4GG9A 2DW7A 4AZ6A 4JYEA 1N7KA 4ADTA 3N14A 2XVNA 5TF0A 1DBTA 3WQEA 4DWDA 4AF0A 1M7PA 2X1SA 3B9EA 5A3HA 3SZ8A 1X1OA 4R27A 3WENA 4XO7A 3RHGA 3KOWA 1FX6A 2C18A 5FD0A 3TFXA 3GHRA 3WLKX 1QATA 2WSYA 4DHGA 3Q65A 7REQB 3JZUA 4KPLA 1GHSA 1E6NA 2PC8A 2OGJA 4KRUA 1WYIA 2QCLA 2VWTA 3FSUA 2WB5A 4DO5A 3NR0A 3W6LA 4NL1A 3P80A 1S5NA 4H6EA 2OELA 1Q2RA 3ABOA 1CZ1A 2WW5A 2WSKA 3QZ6A 2VTFA 1TCMA 5A8MA 4F9DA 4LYPA 3OW1A 3CIVA 1MI3A 1NOFA 4XBJA 1PTDA 2WSRA 2XVPA 1AD4A 1H4PA 1NFBA 1VFHA 4KWWA 2YBVA 3LM7A 2Q6ZA 2HS6A 2CHOA 3TYEA 4FALA 5EMUA 5C9ZA 2ONEA 4DRSA 4IJBA 3GXNA 1H7PA 1V7AA 3KEHA 1QW7A 5DMNA 2PCEA 4D1JA 3N17A 4RDZA 3CYVA 3M6DA 1EDGA 3K2GA 4MLRA 2QW5A 3DFPA 4DO7A 4AIBA 1X96A 3CT7A 2VD8A 3H21A 3ITTA 3NEHA 3IVUA 2J6XA 2DZVA 4BKNA 4DN1A 4W85A 3L0KA 1BQCA 1EJVC 5G4HC 1DWAM 1BXBA 5ECVA 1EYWA 1E6ZA 4GO9A 1FWGC 1W56A 5CPTA 5K4ZA 3NFUA 2H3DA 4MUPA 1R6WA 1L2QA 3WD2A 5CBJA 3GH7A 3CHFA 4X22A 3MJMA 4P8VA 4CCZA 2CEQA 3ITCA 4WOQA 2XH7A 2ZC1A 3IJDA 1YNQA 1UIPA 3ITYA 1UKPA 2PODA 3W83A 3EEGA 5HNNA 1XLIA 4KEUA 4YVPA 2W27A 3BDKA 3RPTA 1NQKA 4JTRA 1HP5A 1Q6RA 4QLLA 1C90A 2JGYA 4AQLA 3LCWA 2YPIA 3NURA 2DQWA 1XDMA 4GNJA 3WD1A 2HBVA 1WKEA 3UPBA 4I7WA 5C6MA 4CQ9A 3JUGA 2ZVRA 2OXNA 2V82A 4QG8A 3TZFA 3VD4A 1G1YA 2XVGA 3E9AA 3PP7A 1OGSA 3SCQA 1E5NA 1YLVA 3NPVA 1JZ2A 3H12A 5D33A 1XD0A 3CPRA 2HTMA 4XZNX 1UR2A 4XKYB 3OTRA 3IJLA 4NZJA 3VVGA 4UBPC 1TE6A 1HUVA 3N2TA 3VM7A 2X1UA 3F03K 1DJHA 2IUZA 3MA8A 3ZMRA 3LLXA 3JW7A 1KLZA 3BAYA 4DQWA 4U28A 3VE9A 2QF8A 4UB9A 3S2MA 3STFA 4ADSA 2WC7A 3HG2A 4KFOA 3MI6A 1YMYA 2PDBA 3E02A 4O1DA 4HZ6A 2Y8KA 3MHFA 3ZM8A 4O8AA 1XLHA 1Q7QA 2CZDA 4GLEA 3S2JA 1IZKA 2GZXA 2ZXAA 1BYBA 3CLMA 4N6FA 5AHLA 3KLLA 1JAEA 1H49A 4LH8A 3A13A 2QGHA 3E0WA 3ITGA 1O7AA 4HOXA 5K2ZA 1CDGA 3UP8A 3BURA 3H7VA 4H2HA 3L4ZA 2VZSA 1UD6A 3CUJA 1GUVA 1JF6A 3OG3A 1PBGA 4MDOA 5HATA 3PUOA 3K4AA 3W38A 4RZ4A 3W02A 2W9MA 1KM1A 3W27A 3M0VA 1TV5A 4X9YA 4TU1A 4GMEA 3B3DA 2G0WA 4PMNA 4P8WA 4UCFA 1OFAA 1IEWA 2Z0IA 2F6XA 4C1NB 4TMBA 1JDEA 1V7YA 2VXNA 3U48A 4BF9A 4FSAA 3DGRA 1QPNA 1AL8A 3EDJA 4HVXA 4KMQA 1O1ZA 3BLEA 4G1KA 4FI4A 1XLAA 4WX2A 1SVDA 1O4UA 3VD7A 2F2KA 2PU0A 3VNMA 2OFJA 3THUA 2PDJA 4QG6A 1E5JA 1MZRA 4DBUA 3RRAA 4MJZA 3T0BA 2F84A 3WBWA 3HPSA 3AS1A 4ML4A 1NAL1 3W2LA 4PTMA 3TYUA 3WH7A 1EXPA 1ME7A 3CZ8A 3BLPX 3AAMA 4B4HA 3WUEA 2QZRA 1KGUA 3BL3A 1SW3A 4WDWA 4LYQA 4HB7A 3HV8A 3N6HA 4QGCA 1MW0A 3FLUA 4JIRA 2DSWA 2CYGA 3NZRA 3DYMA 2DIKA 3N3TA 1P1MA 4U33A 3T81A 3NXLA 4B3LA 2ICSA 2KX9A 4AD4A 2PDWA 3TH6A 4EK7A 1TPEA 4GI8A 2DUAA 2GGGA 1MW2A 3AUOA 4UFHA 3G8EA 2CZEA 1VBRA 4ZSUA 5H1WA 4HA0A 3U2OA 3HG5A 1UCWA 4PB4A 2X7WA 3B9OA 3RJXA 2E8ZA 3TEVA 3ECQA 3KZPA 2PTZA 4KWVA 1XM3A 1DIOA 4FEZA 5H8MA 1GZJA 3AIVA 2IPWA 1JIBA 2FB3A 3REQB 4AZBA 2A21A 4RJEA 3VD5A 1ZCOA 1Q6GA 5JMUA 4S3AA 3H2OA 2XINA 3N1AA 3CMFA 3RGTA 4QJ5B 5C5YA 2Z1KA 4Y7EA 2PPGA 1XHGA 3P5ZA 3BOLA 3GDBA 5FACA 4D8LA 2TRSA 1ZPTA 1LUCB 4UR8A 4QISA 3W01A 4HK6A 2A4AA 4LUYA 5HQEA 3T40A 1XKYA 2W3ZA 2HQAA 3W7PA 2QJMA 4NZ1A 3UG3A 1D8CA 2GVYA 2O9PA 2Y89A 4LNYA 4GFSA 3VGGA 1V0KA 3HQNA 3NPXA 3QRHA 3GKAA 1SJDA 2YFNA 3P74A 2WJFA 4YYCA 3QFWA 5C55A 4M1BA 1I8JA 4JDBA 3NZ1A 4DJFA 4A3QA 4F2BA 1E1EA 4MUZA 2HXTA 1Q6OA 1ML1A 3BMXA 2BOGX 3LRLA 4PCFA 1AQ0A 5BNKA 3QOKA 3C3UA 3EXTA 2NX1A 3M5VA 3G3MA 3UY7A 1KKOA 3A9BA 3UXLA 3U2EA 4LT9A 3I65A 4J3TA 2PLCA 3W7GA 4MFEA 3W26A 3DKLA 3VIHA 2Y0FA 4O50A 1TMHA 1EPXA 2E6AA 3U5YA 1MRAA 1DJXA 4LF1A 1V5XA 3IJ9A 5KMYA 3RYSA 1UA3A 2PDCA 5DFAA 4LBSA 3S4TA 1GQKA 3OGSA 1V02A 1FWSA 1V0NA 2ZZ5A 3GTXA 1OADA 1XH0A 1EBHA 1NJJA 4V27A 2HPIA 3PSWA 2OTDA 3QBUA 1MUWA 2OCZA 3GG8A 1OYCA 2PA6A 3RPMA 1T6MA 2WPBA 3MKVA 1EJWC 2OT0A 3I6RA 2Y61A 3QOMA 2HCVA 1H09A 3EWYA 3UG5A 4WUIA 5G2WA 3CAVA 3W1TA 4S3FA 1I4NA 1NU5A 3AOFA 4GPNA 4ZTXA 4AXKA 5HR7A 3WO8A 2ZC8A 5AC5A 1ECQA 2A3BA 3K46A 3RX3A 3QZEA 3LTSA 3RILA 3OIHA 4IUOA 1TJRA 4FX7A 4DB7A 3LNPA 4LAKA 2V6AA 4HHPA 6PTDA 2Z7KA 5T9CE 2HMCA 2XVKA 3OVGA 4GISA 4BK9A 1OCBA 3GNDA 2QDDA 1CYGA 1LM1A 1T99A 1OFQA 3IJ6A 5LNSA 2QAPA 1W1YA 1RH9A 3WF3A 1XC6A 1LL6A 3HB9A 4O16A 6TAAA 1YTEA 4BI7A 4WF7A 4CD6A 4F9JA 1EJRC 2DORA 2A79A 1EX1A 4IIFA 3VUPA 1S2VA 3CYJA 5A6SA 5LIXX 3TTSA 2QJIA 3REQA 2CZVA 3MPGA 2FIQA 3NSMA 5CGQA 3WQDA 3PFMA 1SFSA 4BQ5A 4JTJA 5A2AA 4KWSA 4CEXC 4XSLA 2ZUTA 3CHDA 2F8QA 1PO9A 2E25A 4ZO8A 1FP9A 2HE5A 4RW5A 1KB3A 3SRDA 4QBXA 2QNEA 4QQ3A 1Q6CA 3HPAA 1QHZA 3S9IA 2IQDA 4IPNB 4DAIA 3R0KA 3EX2A 2G97A 5JU6A 4JTQA 2VUNA 1AODA 4ZE5A 3WFLA 4A8LA 1N55A 4C6FA 5D2XA 3L0GA 5CH9A 2AAAA 4AZ7A 5E6YA 3HPFA 4QDWA 1CPUA 3F5KA 1A80A 1HL9A 3ZR5A 2TSYA 1TZ9A 1G6CA 5IDIA 4LVAA 3AU2A 1LJYA 4QDPA 1CW2A 1UKQA 4DF2A 3LA4A 1ENUA 2JF6A 4ZO9A 1SO6A 2QT3A 4XBKA 4DM2A 3ZO9A 1XF0A 3B4UA 5CPMA 1RD6A 4A3HA 1XX1A 5FSEC 3IS4A 2JEPA 1A49A 1CLKA 5TQLA 3CO8A 3AFBA 1WDSA 3PJXA 3TNBA 1BYAA 5AC4A 1S2AA 2F6KA 3DBNA 1RCOB 2ZQ0A 4LVFA 3CO4A 4O57A 4NJHA 1TR9A 1X39A 5EMMA 1WQ5A 5TNVA 4JFUA 3RAOA 2WMIA 4DX3A 3N18A 3ZOAA 1MFUA 2WVUA 4JHMA 3TVAA 5TD4A 5B7YA 1X97A 3M47A 2DZPA 4G9PA 3LI1A 2J7HA 2X1TA 1LQ0A 1RBLA 5K9DA 1KM0A 2YX0A 4DJFC 1G9HA 2B0MA 5LNUA 1R9YA 3UCDA 4PMOA 3OGRA 3ELFA 4M81A 2BY2A 1XPYA 3GVVA 3I68A 3CNYA 2XFWA 3EDFA 4L4PA 4MWAB 4AW7A 3SQLA 2OYMA 5AHMA 3W7OA 5C54A 2A1YA 5GVJA 2NXHA 3UXAA 3GAYA 3N9SA 1IZJA 2REQA 3KP0A 1RJRA 1FUYA 5ABGA 1OX6A 2J62A 4KT2A 1S2TA 2VFFA 4DVOA 3UVAA 4W7WA 3XISA 4V2XA 2FVKA 3W71A 2C15A 2YXOA 4FMVA 3WQGA 1GOMA 3QM3A 1MFVA 1PE1A 5EMJA 3GXFA 2CLPA 3NZGA 3PG9A 1BG4A 3M1ZA 3VGEA 1DJQA 3CB3A 4NNAA 2BY0A 1YDNA 3E5PA 1GVQA 3W00A 1M3UA 2GK1B 3EX1A 4H9XA 3QHOA 1BLIA 4FS9A 3ARVA 3QR1A 4GACA 2CLKA 4NZ4A 4CCCA 2ZZ4A 4U4MA 4JQ2A 4EACA 1BHGA 4P8XA 1ZLPA 3K13A 1WDQA 3NL5A 1KBLA 1SZEA 1Z41A 4L6DA 4RZBA 3MKKA 2YA0A 4AUBA 5A6LA 3DC8A 3EDDA 4C65A 3S5SA 1F3WA 1J4EA 2RUSA 4AX7A 4IPPA 2VRJA 1KO0A 1JPKA 4FX6M 1BSIA 1X1ZA 1B4KA 5I7GA 5AHEA 1H0GA 1KR1A 3SURA 3TQKA 5ABHA 1EEPA 4UMAA 1XFCA 3T0TA 2WWCA 1TUFA 2HS8A 3QMRA 4LX4A 4EXBA 3WN6A 3DECA 1NDVA 3IK4A 4V1YA 3I6EA 1J0KA 1E3XA 2Y7DA 3VOHA 4TX6A 3M46A 4B5TA 1FWRA 4UNKA 2G95A 2P5NA 3GIYA 4AX6A 3T1GA 3LY0A 1K7EA 4I6VA 3VCNA 4HNLA 2QVNA 3TONA 4OBRA 1JCXA 4I7UA 3QHMA 9XIAA 1XQKA 3FDKA 3B03A 1J0YA 4OGZA 1SJCA 2GSEA 4M8UA 5CBBA 4CQBA 4EWND 3GDRA 5KEZA 1U1JA 1UUOA 3W2JA 2YCIX 3LHYA 3CPGA 2NZLA 3T2OA 2W5FA 3C56A 4W9TA 5CPQA 2PDUA 1SR9A 1W5MA 5G4EA 3QZAA 2A3LA 2ZZ3A 2QUMA 1FH8A 4QE1A 4LBRA 1GW9A 1GPFA 2GOKA 1DQWA 1S1PA 4ECLA 3WLOA 3BUVA 1HVQA 2NV2A 1UBPC 1C8QA 4PUUA 1F73A 1E9YB 5DF0A 3W2NA 4P8UA 3WBXA 3P5YA 3NDYA 1VBJA 1KGXA 1BVNP 4W4QA 1OT1A 3V75A 4JIHA 3VFCA 1ZUAX 3G1VA 1BWKA 1W3NA 4PA8A 2XPKA 1M5WA 2F2HA 3E38A 1M03A 2DSVA 4LW7A 3GHUA 1UPMB 3RMEA 3IAPA 4R7OA 1W3LA 1AJ2A 1GHRA 1QFEA 3DG6A 1YPXA 4RDVA 3GBEA 2OGYA 3QN3A 3T4CA 1DIEA 2A3AA 4NXKA 1WV2A 1V3IA 4IQDA 1A5KC 3PZIA 1KM2A 1KWGA 3GFYA 2CLOA 3RDKA 4B9ZA 4GNKB 2OZTA 2NSOA 1UD2A 3W88A 4I9TA 5A8GA 3ARSA 4GXPA 4XKYA 2VEFA 1KV8A 2Q8XA 5GNXA 2D2JA 3TN6A 4P61A 2BVTA 3KVMA 4MNJA 4FO4A 5F4SA 2DP3A 4HJFA 5A94A 4UMCA 4LYRA 3MTWA 4KCVA 3COTA 3WF0A 3UYIA 5HJXA 5I3HA 1R3WA 3HG4A 1IEXA 4Z2GA 3Q37A 2E40A 1CGTA 1XYMA 2ZX6A 5CBIA 2D73A 2Q8ZA 5FJPA 3V7PA 1JI2A 3KL0A 3W81A 4A29A 5CXPA 1IYXA 3A3XA 3N12A 1B54A 2XIMA 1MQPA 2RDXA 1BPLB 2UY4A 3OHIA 1F2JA 3WL0A 3AYSA 1XLEA 3IGXA 1NFGA 4XAYA 4AVFA 3QGKC 1ZAIA 3BCFA 3PZQA 1KXTA 1JCJA 4XAGA 1LOSA 4F0MA 3G0SA 2EKCA 3T44A 1DP0A 1KFCA 4YVXA 4EX4A 1I9CB 1XLGA 3ATYA 1VENA 2PD5A 2POZA 1QJWA 1Q6FA 1VLWA 2EPOA 4J9JA 7CGTA 1J10A 5IM51 1GOXA 2IPJA 1A47A 1L2UA 4UTIA 3CK5A 4UZUA 1JYNA 3WH6A 4YNGA 1P0DA 1XGDA 1TPC1 4C6EA 3DFYA 4MJ4A 4E2OA 4E0CA 2A3HA 4OOZA 4FNQA 4PB3A 1CIUA 3MDWA 3MU7A 1B90A 4ZOCA 2EBNA 3L12A 3RUBL 3B06A 1N8WA 2G8ZA 3CEPA 1OG0A 1QNRA 4HQVA 1ISZA 3RJYA 1EKOA 3KS6A 1VJZA 2QXWA 4ZMGA 1XBVA 3SSJA 3S1WA 1L8PA 3NO3A 2EG7A 3AXKA 4BZYA 3EOOA 1K02A 1P0NA 1LTDA 3LSBA 1PX4A 1VD6A 2FDMA 1E4NA 2XN1A 4AH7A 3OLIA 1TTJA 3GNRA 3ARPA 2V2DA 4B92A 1SO3A 1ZNNA 5AYBA 1W9XA 1WXJA 1TREA 4C6MA 1JYXA 4DUVA 4JTFA 4C91A 4N02A 2ZA2A 4MB3A 1HNYA 3HGRA 3B8UA 3AROA 4QSFA 4DLFA 5JIWA 1UZ1A 2CW6A 2EKGA 4JHZA 3TUUA 5EBUA 5TIMA 3ITLA 2WMIB 4NZ3A 4QTGA 5A1AA 3N2CA 4HK7A 2WCGA 1JUEA 3VNZA 3M5YA 1TVLA 3CHCA 4Q32A 3RIKA 3W73A 3L66A 1W1IE 3R10A 2Z24A 3W24A 4DWSC 3RM8A 1TELA 5BXPA 3QH2A 2OEMA 4H7CA 3S3GA 1B2YA 3MT1A 5G1MA 4YTRA 4A3UA 3M0JA 3MMDA 1HVXA 3BGJA 4S39A 5CPSA 4QG9A 2FQIA 3QPEA 2B4GA 4WD0A 2XZ7A 1E43A 3HOJA 5I2UA 5D30A 3CTLA 2ZRUA 2VHLA 1OSEA 5AKQA 3ONCA 2OKTA 2GJNA 4MY9A 2ZUWA 4JTUA 1RJQA 1LBLA 1OYAA 1WE5A 2OLAA 4Z1AA 2PDYA 2J9ZA 4IGSA 3LCGA 1O5RA 1ISXA 4GZ7A 3UJRA 3MDUA 1E9IA 4FLRA 1GQIA 5A6BD 4XD3A 4NJGA 2QJNA 4IPIA 4V33A 4UFMA 3KVLA 3DXIA 1QU4A 1VEPA 3QMTA 1P6CA 2L5HA 3WNNA 5I09A 1SSDA 3AZSA 4NIRA 3WLSA 5EBAA 4ZODA 1M04A 1B3XA 3VNDA 1RY8A 1K4GA 4OECA 1K3UA 1O12A 2R1PA 5CJ5A 1H1YA 4TTUA 1PAMA 4GH3A 3HGJA 4PMUA 4MJ2A 1NP2A 1HFBA 1ICPA 1JULA 7PTDA 3ZJ8A 1CGVA 2R1NA 3DU0A 3FGCB 3AHXA 4OTKA 3AIEA 4Q4SA 3UZZA 1U1UA 1U22A 3HIJA 5GJNA 4WY0F 5HQMA 1KQYA 1HKKA 2BTMA 1AK5A 4EAYA 2AMXA 3R12A 3NQ7A 4ZVJA 1VBUA 2DQXA 1BTMA 5U7SA 3HM7A 2Y24A 3PZTA 2Y5JA 3EMQA 4FOKA 4O13A 1QW9A 2NT0A 3FYPA 3UF9A 4JICA 2TODA 3OZPA 3PZVA 1OX4A 1QI0A 1E72M 3LGDA 4CNUA 4Q8NA 1YTKA 1UR9A 2R14A 1Y5VA 4QM1A 1MDLA 4URIA 4BEUA 4NVTA 3SUVA 1J96A 1MXSA 5E6ZA 1K4HA 1J9YA 3L67A 3I4EA 1TTIA 3QLDA 3QV9A 4AZIA 3N13A 1Y0EA 3HZ3A 3TJ4A 4O1FA 2A85A 2BXYA 1XH1A 3NOEA 1BQGA 2NUXA 3GNOA 3R5EA 3KX6A 3HGOA 1LG2A 1VBGA 4YCOA 4RCXA 5EY5A 5DXYA 3APYA 1ITQA 5HXMA 4C6JA 1OHLA 3GBDA 3WQOA 3A6OA 4PMJA 4QCEA 3BANA 3WLQA 3VIGA 2ZXBA 2HVMA 4AYGA 4A05A 1M7JA 5E93A 4AVOA 5BROA 4ACYA 3A3HA 9RUBA 4X61A 3RK8A 2I5GA 1VFFA 4GZEA 5HNUA 4PCNA 3TQ0A 3QEZA 2VI0A 2GFTA 3LLDA 3NSNA 3GXPA 3ZIZA 3O6AA 2CBJA 3LCIA 1VKFA 2DUZA 3LDVA 1VHCA 3RX2A 1P6WA 1GT8A 2GDVA 1KRCC 2BXZA 2VT0A 1L6FA 3A4AA 3LGGA 1E0UA 2H6RA 3TYAA 2BS9A 1U2YA 3D5HA 3H2MA 2WM0A 3GC5A 2QGYA 1BRLB 2QVHA 4EOUA 1K77A 1D7FA 2YDSA 5C70A 2YXGA 1OFOA 3CT2A 2XFFA 1HKMA 4HPJA 1XBYA 3ARZA 5AC8A 2J75A 3VABA 3PBVA 3NQFA 4M5PA 4WGXA 1ZBVA 3ITOA 1U5VA 4NT0A 2XISA 1JD9A 4IIDA 3S47A 4UOJA 5C9UA 2GWNA 4MB4A 5LYRA 1RK5A 1SMDA 3FDGA 4NILA 3W29A 3CUHA 3EOLA 2ZVIA 1EC8A 4RNJA 2X0YA 1EWEA 5BMXA 3UPWA 4IGHA 4PSRA 3TNOA 3GTNA 3F4NA 4Q6JA 1S2CA 3P0XA 2CLEA 3HJZA 4Q8PA 3EBVA 3S5ZA 1E6RA 3DFNA 2OMAA 4J3SA 3GM8A 1GG1A 3CWNA 3PPCA 1NSJA 2NX9A 3KCJA 1XDJA 2Y8UA 2OSXA 5IHSA 4G5DA 4O19A 3UGVA 2PU1A 1DJYA 2RKXA 3N4FA 1HQTA 1TIMA 3EWXA 4XISA 4GYJA 3R11A 3L4VA 1G4SA 3HMCA 4UQBA 1VCFA 3OO2A 3TK7A 1UPPA 4DJEC 2PEVA 2AAMA 4V15A 2EPMX 3KRBA 3OBKA 4HD5A 4PUNA 2B7OA 3N2OA 3ZXWA 3PPGA 4HYRA 5FSDC 3RRXA 1XYFA 3F4WA 3SW6A 1W3HA 4H1ZA 4GYPA 4D6CA 2AL2B 1A5OC 4RX0A 4N0RA 3R2GA 3P93A 3BOXA 4GO8A 1OINA 2HNEA 1JDAA 2DZSA 1XRFA 3IEBA 4IFOA 4JQ4A 4MB5A 2R8WA 4HU4A 4JTAA 2J7EA 4QX4A 3GH4A 2HVOA 2ZRVA 2VX4A 3WYZA 3LTPA 5EMKA 3PNZA 5RUBA 1GZ1A 3CEUA 4I8YA 4ZQPA 2E9LA 3CU2A 3VCCA 4DJFD 4S3CA 3LBCA 2FHBA 3TR9A 3U2CA 1OG6A 4UFLA 3WUGA 3BICA 4HHLA 1JPHA 1FWWA 4QFUA 5AHIA 2GL5A 1NF0A 1DJZA 3ZVIA 5I03A 3V0SA 1UWSA 1L9WA 4L6OA 3GO2A 3P81A 1S5MA 3EB3A 2VOMA 3NUKA 1V3JA 1TPFA 4W86A 4IMGA 1JZ4A 1Z69A 3PZGA 4WQ6A 1FH7A 3T55A 4NAFB 2G50A 2CHRA 2FH6A 2YYUA 4LJ3A 3QY7A 5DY2A 2OG9A 2OYKA 3RCNA 1W1ZA 4QROA 3WCZA 1XWYA 4MDPA 4JIEA 4LQ1A 3TYBA 3R89A 4JQ3A 3TOPA 3C2OA 1PKNA 3ARWA 4ZZ9A 1XI3A 1Z3NA 4O17A 5IXEA 1J0JA 1IV8A 1OF6A 3H8AA 2ZZ2A 2WJZA 4GYFA 1XSIA 3QFEA 1QVBA 2VEPA 4D6IA 3C3NA 2CBIA 1F5ZA 2VNCA 5C71A 3VZZA 3S1UA 1M7OA 1RHCA 2C1IA 2XWEA 5GQBA 3UVIA 3P84A 4RW3A 3GTIA 4Q4QA 4LY8A 3G1FA 2R6OA 4Q22A 2VWSA 2B31A 4ZXLA 5T9BG 2DVUA 3KM8A 3RX4A 2INZA 3T2PA 1LG1A 1JL8A 5KSWA 1CXLA 3RR1A 3ES8A 3G1HA 3O7UA 1E1CA 2C79A 5I3DA 2ISVA 1TZ7A 2BP1A 1DJNA 1TV3A 3DYPA 3RG6A 4TUFA 5JUVA 1KBJA 1OWQA 3VNIA 1R8LA 2INEA 1V4YA 3P62A 4MZ1A 1HJQA 1W1TA 1HO4A 1GQJA 1R0MA 4MADA 4ZA0A 2WHMA 1JCLA 5GNZA 2WCAA 4JTDA 1BXNA 2ACUA 2DZAA 1OK6A 1XDLA 4NYUA 4BQ4A 4LUSB 1WXZA 3HF3A 3SUSA 4NYYA 2JBMA 4JNYA 4D6JA 5K9XA 1DKWA 2VYOA 4K38A 4CD8A 3E6EA 1WNOA 1OM0A 4D72A 1DWIM 2DH3A 3BJFA 3VGDA 4XD4A 1GVIA 5I07A 4GQQA 3KS5A 1IQ8A 3O3RA 2J13A 2YCLB 4EPDC 3A22A 4GBDA 2DT0A 1SFTA 1D9EA 3M16A 2IKIA 1JYWA 3V5FA 3KBNA 1E40A 2GDQA 3N6QA 1SYTA 3MHUA 4AHPA 2DZUA 4YJ5A 1A4MA 5D09A 3FOKA 4WHBA 1V51A 5I78A 1GGOA 3BSMA 3P0WA 2V2CA 3PAJA 2VZOA 4RPQA 2YLAA 4LPCA 4Y9MA 1ZAHA 3DCPA 3ZWTA 2V0TA 3IARA 1YDYA 3MW7A 3ZSSA 1US0A 3SRFA 4YTUA 1S2WA 4HCHA 3STCA 5LHFA 1XLMA 2PUZA 1GYNA 4XD6A 3H2CA 1PIGA 2QMJA 4RDYA 3S6OA 5EGRA 1E71M 2ZA1A 3SSZA 3IJIA 4HGXA 3UFYA 3UJSA 4E8DA 2QAFA 1Q2SA 4R9OA 4PUDA 3EWDA 2FFIA 3S1VA 4MOZA 1H41A 1FBAA 1ZS2A 2J8GA 1SMAA 3ZLHA 5LA1A 4UR7A 4UTMA 5AECA 1XSJA 4CQ8A 3GG7A 1R30A 2A5HA 1X6NA 2PLKA 1DOSA 1VZWA 4ML9A 4LWWA 2X05A 3QXBA 3M44A 1ZBCA 2Y1HA 3OOQA 4IHCA 5BXSA 2JKEA 4WVXA 3RMJA 3LLFA 1LRNA 2HBXA 4FNRA 5F7UA 2G5WA 2WO5A 1EUAA 5DY3A 1OABA 3SFKA 5I06A 2DEPA 5K4XA 3VYLA 3HFYA 3VC5A 1B30A 4K1GA 3SN0A 4ATLA 4DNMA 1XLJA 4IMDA 5AYYA 2VFHA 1M1BA 3VKJA 2NLYA 4UOZA 1FA2A 3QYSA 4F0SA 1SPQA 5CSYA 2BWGA 4C5YA 2D2OA 2REQB 3HMJG 5CEWA 1X38A 3W1MA 4IIGA 4E4PA 3CZEA 2X2YA 2I16A 4TIMA 3LS9A 3MC5A 3CAQA 5JQ9A 1SO4A 3QR3A 3WQWA 3OZMA 5FJUA 1A5CA 1UP3A 1G0CA 3AMCA 2CBUA 3LHUA 1U5JA 2VFIA 4IG2B 3QJAA 2DIEA 4JN7A 4PTVA 2J25A 2BGSA 1DIKA 1KM4A 2V5JA 4B5UA 1XBZA 1E6PA 3C0JA 3QPYA 1CNVA 1G67A 3T0DA 3AHVA 1YHTA 3QQ1A 4BF7A 5SWUA 1JD7A 3CV1A 3ES7A 1DEDA 4M1RA 2AOSA 3L0NA 1XIEA 5E70A 4E38A 5A6BA 1JGMA 2QUUA 2ZRYA 4CU8A 1KFJA 2OR2A 4MPQA 2YCJA 9CGTA 3EX4A 4D6HA 4M6VA 5AOUA 2CITA 3NQ8A 4O12A 3VOGA 3I7QA 3KBJA 1XKJA 5I3GA 4MKSA 4F40A 2W91A 1GTEA 4P7QA 3GU2A 1OFBA 4RXFA 3ZJ6A 1PYMA 2FGBA 3FVDA 1JCTA 2O56A 4IM4A 3EDEA 1GVFA 3B8DA 2Y63A 2NVAA 2VC6A 4FXSA 4DWSA 3SCPA 3YPIA 5A69A 4HTYA 4JY8A 4G7FA 1Y8BA 4LNCA 1I1XA 1QTWA 4HZMA 4MY1A 5K9CA 4B5VA 3W37A 1R47A 4GUHA 4E6MA 5CZ0A 1ONXA 3RU8X 2RHGA 1THFD 4PYSA 5I3KA 4FLSA 3BLLA 1MEHA 2ZBTA 4GGBA 1O68A 2BOFX 3EWUA 1LL7A 2BDQA 3PUGA 3DG3A 2GVJA 2XN2A 1WOBA 1SSGA 5FCZA 4K39A 3BLKA 1XD1A 4MMWA 3KBWA 1HJUA 1JQVA 3L4XA 3BSGA 4D6FA 5CGMA 5D8WA 4LRTA 3L9CA 3QY6A 2VCBA 2PLJA 4HT3A 4OUIA 4PUMA 2BODX 3VILA 5KZEA 1MUMA 1JUBA 2YJQA 4JOMA 2XDFA 5LNRA 2WBGA 5FAJA 3FA5A 1G69A 2E5BA 1S5VA 4L4LA 3BW2A 4YTTA 4I9MA 3A9IA 3S6DA 1ME9A 2O4MA 3NIYA 2P1FA 4RNHA 5EL1A 3AJXA 1TO3A 3TTQA 2WOQA 3TMLA 4H00A 4CQAA 1L6YA 3GXMA 1QNPA 1TV4A 2ZADA 1H0IA 3LUTA 2J24A 3TXVA 3B0XA 1WKDA 4DO6A 1Q63A 4QSHA 4WGHA 3LXAA 4Y9AA 3H53A 4PC8A 5BOEA 4GX9A 2UWFA 4H3DA 4LUTA 4IPLA 1EGMA 4ZB0A 2PDXA 3MP5A 4H9MA 3UZXA 4WRHA 4A22A 3GC4A 1W9DM 5EA9A 5IBXA 3APTA 1R3TA 1YPFA 1Z48A 5MKGA 5CG7A 1QI5A 3M0XA 1IR2A 4MM1A 3FK4A 5HA7A 3R25A 3G1DA 3IACA 1XL9A 3AICA 5HPCA 1PX8A 5HJYA 3WK0A 2WVSA 3SI9A 3L65A 5CKSA 1QK0A 1R2TA 2X2GA 2HVNA 3MMTA 4JPGA 4W8AA 2JALA 2YDQA 4EXAA 3TTYA 3GR7A 1OFRA 4NG3A 1FHLA 3GTHA 3UWWA 1BD0A 3VMOA 1QWKA 1O94A 5I3JA 1VIZA 5A8PA 3ERPA 2PF8A 1VPXA 4GH1A 2QJJA 3W1NA 3FN9A 3TXZA 3WJYA 2Q02A 1YTDA 1LROA 2OQYA 1ZENA 3L2MA 2J78A 3SGGA 4C6CA 1WAWA 4H6KA 2Z1WA 4POCA 2V5DA 1KR0A 4FR6A 4L1GA 1M53A 1ZCCA 3B9DA 3G8RA 3GNXA 3OQEA 3KCOA 4OUEA 5FKYA 4ZGYA 1AQFA 1AA1B 3H22A 3T0CA 4EPEC 4I9JA 3ZFHA 2DFAA 1BWVA 1V3LA 4DZAA 1JNDA 2ZX5A 1HJSA 4UXDA 3UERA 5A6MA 4F0RA 3DUGA 3M4HA 2V68A 3NTYA 4MZ8A 4J35A 4UTJA 4R9XA 4Q7NA 4LEQA 4A21A 4XUYA 1T96A 3MSYA 3G1YA 5JH1A 4AHOA 2PWGA 2HJPA 4G8TA 2BVDA 2HV5A 4HCDA 5G2HA 2QCHA 3V5OA 3UWUA 3GYCA 1H7RA 2YOCA 3JZEA 3BAJA 1MQQA 2B7NA 3DFQA 3VGBA 4PRTA 4AFYA 1HX0A 3LZ3A 1DXEA 1R5YA 1WPCA 4UQAA 2R91A 3WEMA 1CXKA 2UY5A 3EOEA 3A5VA 5LSMA 2QUVA 4YXGA 2IKHA 2QYGA 3GK0A 1UUQA 4IP5A 3G1RA 4ZR8A 4KQNA 3IV3A 3S2CA 1QT1A 2GDUA 2G3FA 2OO6A 3LXBA 4B90A 4UQ9A 4PMYA 1DPMA 1RZMA 1P4CA 5LGXA 2QV4A 1XIBA 3M41A 1ZAJA 3UY8A 4IQLA 1OZMA 1NOWA 1EA9C 1Y65A 4HHHA 5C7VA 1JVNA 1HP4A 3UA4A 3GH5A 4OT7A 4S2BA 5LNWA 1BKHA 4CN1A 4MKNA 1I75A 4QCFA 1PTGA 2OZ0A 5HINA 3MSGA 2OT1A 5IOBA 4CQCA 2NQLA 3WQ6A 3V1HA 2IKJA 2PI6A 4C6DA 1C91A 4AC1X 1YXDA 1V77A 3SQMA 1X8FA 4O1EA 1IT8A 4QJ4B 4NRSA 2WK2A 1LDCA 3HG3A 4CN6A 1J6PA 3G0UA 4AF0B 4GI6A 1AQMA 5C9RA 2OU4A 1PWLA 1OB0A 1Q6LA 4PGLA 2MNRA 3E0VA 4PODA 4EE9A 2O4QA 3RO8A 4J28A 3S5YA 4YTSA 4IWWA 2A6NA 1W17A 4JCMA 1Q66A 3S5OA 4OQVA 1HJWA 1ZP3A 3TROA 1JZ6A 3DHPA 5AHNA 1SJAA 1DYSA 3W1PA 3BVJA 4JS3A 4HU0A 4WKAA 3CH0A 2RGLA 4DUOA 2BVWA 3P82A 5H91A 2R24A 3SO7A 3W86A 1JRCA 3BQ5A 3WLMA 1P0EA 3RLUA 3T6CA 1DE5A 5LIKX 4CNPA 3EXSA 2G96A 3N2MA 5IRPA 1QPRA 3FKRA 3CQ0A 3NQMA 2VGFA 5HR6A 2RDUA 4JFTA 1UR3M 2ISWA 1ZJBA 3VOIA 3V1PA 3T78A 5XIAA 3SGZA 2WHLA 4E3VA 4ILSA 3M5XA 1KFKA 5C7HA 1E0TA 1US3A 1WUEA 5I6SA 1V0LA 3OYZA 4H8UA 5AY7A 3B8VA 3OU8A 3UESA 3ZWSA 1AVAA 1EQCA 4X0VA 4QJ1A 4S3BA 1CGUA 1S5WA 1UROA 3GDLA 3VOFA 1JNEA 2YGYA 5KZMA 4NX0A 1LLOA 2WKGA 4N6EA 4G6CA 1BYDA 4KETA 1TWZA 4AB4A 3WMSA 4NY2A 3UZWA 3WQFA 2QUTA 3LCFA 1V6WA 1GOQA 3C2FA 6TIMA 3EAUA 3CQIA 1TPWA 5FF2A 1D8WA 2B81A 1A4LA 4S1FA 3URBA 5LXEA 2XHYA 5ABEA 1O60A 3VDGA 2FZ9A 1UKSA 2ATMA 1IEIA 1X7IA 4B91A 2ALDA 4KEMA 3TOYA 3FJLA 3KP1A 1OX4B 1QUMA 4E3TA 1UQZA 3BOFA 1I60A 4BI6A 4BS0A 3T42A 2Y70A 4X9SA 2I9EA 3LHVA 3GU9A 1LWHA 1ONEA 1Q7ZA 1UMLA 3VKBA 2D24A 4ZXOA 3O0FA 3E96A 1NWTA 2CLHA 4C6NA 3ARQA 1QHPA 2ZUVA 4YIWA 4U3AA 2KZHA 3W85A 5BYWA 1E9ZB 1K6AA 2CNCA 4UC5A 1F8IA 2VFDA 3A24A 2Q09A 2PDNA 2WQDA 5EU9A 3RM4A 1BVZA 3HJEA 3LG3A 2GJRA 2WVVA 3MUAA 1OFEA 4XUGA 3PB0A 3VI2A 4V28A 2ZUUA 3V0UA 4I9AA 2GUYA 1ODUA 2XIQA 2IXUA 4JNZA 4MNMA 3RF9A 4GIEA 5FL1A 3KZSA 1OK4A 4Q8OA 4JFSA 4XAZA 1F74A 1AJZA 1B3WA 4HZ7A 1W54A 4ORIA 2FZ8A 4AZHA 3NGFA 5FEWA 1TJ2A 2F9RA 2MANA 1ADDA 5CPNA 4BFAA 1ZU8A 1EHNA 2JE8A 1E1FA 2C1HA 3ZLFA 4Z0JA 2GQAA 1SFJA 1KCKA 1NF7A 2Z1VA 2ZXQA 5EFFA 3UR8A 3RLHA 4O1CA 5REQB 4Y6GA 1EF2A 3R6IA 1M6JA 3WF1A 3KHJA 1Q6EA 1VFLA 1IWPA 1XIIA 1V3MA 2BY1A 2FJUB 4B5XA 2CKRA 1H7OA 5D04C 4G1NA 4KFPA 3KOFA 3M07A 5MKGB 1J01A 1DHKA 1P1XA 4GGHA 1D3CA 3FX4A 2CC0A 1OFDA 4D8AA 1IXOA 3KL3A 4N4PA 1J0HA 2FPYA 4G56A 1KTCA 1R85A 3E0IA 3VC6A 3LCXA 3VNLA 1WP6A 1E6QM 1KXQA 3Q4DA 1H60A 1IZCA 1TG7A 2YL8A 2XWDA 1BKSA 4MSSA 2D0GA 3ZS4A 2FHCA 1NELA 2OQHA 2ACRA 3WDQA 2GSHA 4I7VA 3S8HA 3NCOA 3RFAA 1XLKA 1UWQA 1KBIA 1W9UA 3C86A 4HMCA 5BU9A 5CAKA 1H2JA 3PNUA 2R1MA 3TTOA 4IFKA 4JXCA 2X42A 4ICMA 4J3VA 2FPVA 1FTXA 1Q4WA 2Z2UA 1QPKA 3TJLA 2E67A 3AS0A 2C91A 4GQRA 4QRNA 4FR1A 4JIIX 3EKGA 1KBKA 4DELA 3K1GA 1V93A 1S38A 3UXIA 2PTXA 3AXHA 3AZRA 3JS3A 4I8DA 3H7UA 1W5QA 3ANUA 3KBVA 3IGSA 1I2PA 3EA1A 2FMOA 2ODOA 5M2FX 3USZA 3SDOA 3RNDA 2WLYA 1LUCA 3W1LA 2V69A 2QLYA 1RQHA 2YBUA 1UD4A 1W8GA 1KGWA 4AEFA 1ZRQA 2GUBA 3GKFA 1VQTA 4RV3A 4GQBA 1BSLA 3IJ8A 4K3ZA 1B3ZA 3V36A 3W2UA 2V3DA 4I6KA 1QWGA 3E2RA 4S3JA 3CWHA 3V4BA 2DU2A 1FWFC 3CL7A 4L1WA 3W87A 2FKPA 5BRQA 5IHRA 3PWGA 3GUWA 4AMAA 3EYPA 3W7JA 4HCLA 2W67A 1EB3A 3O63A 1S3TC 3UWVA 4H8HA 3F1QA 3NQDA 3CB8A 1TYGA 4CN4A 3L5LA 4NAEA 1WKYA 4IP7A 3BWWA 1KXHA 3WFAA 5BRPA 3N15A 2QULA 4KW2A 3ABXA 2J7FA 3U0HA 3QF0A 1RLDA 4RK8A 1RR2A 1WUFA 4BQ2A 1W1B1 4XZBA 3V35A 4AZCA 1CB2A 4UNIA 3A4JA 3LV6A 3NQVA 1UA7A 1UMYA 1O5XA 2JIWA 4C5ZA 2HISA 2R1KA 2WMGA 1FP8A 1QXLA 2XU2A 1F07A 5CPOA 4ZOAA 1FCUA 4XZHA 1C8XA 1GPWA 1YQ2A 4LY4A 1UIOA 1HKIA 4KH2A 1S5TA 2W79A 2HE8A 2FGZA 4NNCA 3BV7A 2HRWA 3T2QA 4C6OA 1RSCA 2VDHA 4OV4A 4PTWA 1DIDA 1Q13A 4GIRA 1FY6A 3O06A 3N19B 2JFEX 1HGWA 4IISA 4J27A 3Q67A 4D71A 4GKLA 2F7FA 5E1QA 5GJMA 6ALDA 1DVJA 2GJXA 1HKWA 4RE2A 1NM9A 1HTIA 4IX0A 2PDPA 2GVEA 2ZE3A 3CXOA 5ABFB 4FOUA 4ZOEA 1T0OA 1RP9A 1AMYA 1I2RA 3VMPA 1QBAA 2I5IA 4PEKA 2WZHA 2NUYA 2WSPA 2XN0A 3MWCA 3FSTA 4B3ZA 3MZ2A 5FOOA 3CM4A 3KOZA 1TV2A 1F8MA 3HPXA 5CJNA 1Q6QA 5HMEA 5EMYA 3VU2A 1AL7A 3N9RA 4XD5A 2IQ0A 3PN8A 2WANA 4JTEA 1GWJA 3UXKA 1O95A 2BV9A 2F61A 4MB1A 5FJRA 1KM3A 1UW9A 1TSIA 3HFTA 1OY0A 3CQJA 3O6YX 2QIWA 3AMLA 4XK2A 3F2CA 1ZJIA 3TSDA 2IS7A 3CUZA 1JF5A 4AD0A 5A6TC 4ERAA 2PWHA 4QS6A 3O0KA 1G4EA 2ZWYA 5BMWA 3WUFA 1OC6A 4HSHA 2YL9A 4CVUA 3KCLA 1RJPA 1RBAA 1SZRA 3J7HA 3PK7A 2Z6IA 4AZCB 4LBUA 1CGWA 3NA8A 1KCLA 5A8NA 4RE3A 4Z1DA 1NDYA 2AQOA 2JK2A 1UP2A 5E0CA 1JFXA 2GWGA 4U10A 4NJKA 3ABSA 4DI9A 1LYXA 3PFRA 4DZ5A 4YLWA 4PFHA 4AY8A 3FY1A 1GJUA 2DT1A 3ITVA 5B80A 3L7RA 3T8LA 4ZQCA 4NX5A 4O1AA 2CIPA 3ARYA 3A12A 4PMVA 2QCGA 1UP0A 3E3HA 3IGUA 2R82A 3VD9A 1QI3A 2NLIA 3R13A 5HMSA 1VS1A 2INFA 1IIGA 1ZHAA 4ADUA 3AYVA 3CZJA 3FGCA 3EA3A 5C0QA 4NAEB 1NP0A 2QKFA 4FXRA 5C2CA 2YSWA 5DBUA 4PL2A 3A3WA 3TYCA 2QR6A 2PWDA 1L6SA 5CAHA 1F3XA 4GA8A 3IWPA 2Y6ZA 3GRIA 2GGHA 4OJYA 1L6GA 2XIJA 3UYCA 1ALDA 3IVSA 4JYDA 1S3HA 4IJRA 2W63A 1JFHA 3K4WA 1XIGA 4DPPA 1PCWA 1L0PA 4ZENA 1EPVA 2YA1A 1GOWA 3SCWA 4JTKA 4AIOA 3UWYA 2CPUA 4BWLC 4MWAE 5E5CA 2VRKA 3W0KA 3QSTA 1T5AA 3AISA 4B16A 4BHYA 3KOXA 3KRUA 3E5BA 4UUIA 1EYEA 1H5YA 5L6UA 5BOFA 4J3XA 1P0BA 3MP3A 1CB7B 2X8RA 4ZOBA 3OVPA 1OD8A 4AWUA 3N3MA 1J2WA 2V67A 1O5KA 5CQ1A 1RV8A 2BX7A 4AD1A 4UR9A 3SEPA 3ZVHA 1YKWA 3EEZA 4WY0B 3NO5A 1WBHA 4MNLA 2E3ZA 1QOPA 4PBEA 4AD3A 3KE0A 4UCGA 5IDZA 3W7NA 3MBFA 3TN3A 2J27A 3W1RA 1A5NC 2ZIDA 5FF0A 4GHRA 4QXIA 3U57A 3OBAA 2E6YA 5G2IA 1QNOA 1V02E 3SCSA 1AH0A 5EMLA 3WJWA 1E55A 3PC0A 3A47A 4KERA 4NNBA 3OHMB 2G3MA 1SJBA 1GQNA 3UR7A 1EQPA 1ECEA 4Q3MA 4IL0A 1XJBA 2Q71A 2C0HA 4NZCA 1XISA 4K37A 5HWMA 5C9XA 1YX1A 3BCJA 2C3ZA 3THCA 1GKQA 3CL6A 1KW1A 4QP0A 3WFZA 1ISYA 1A5LC 2PC4A 1LORA 5LA2A 4INFA 3VIIA 4O0KA 1GYLA 5DXXA 1H5VA 1FQ0A 3S9ZA 3SUTA 4H01A 3TKFA 4XAFA 1QNQA 1D7KA 3OQ8A 4O28A 1QO5A 3GU1A 3W70A 3LGEA 5DMYA 4UIOA 4IG2A 3E12A 3VKKA 1HGYA 4TQTA 1Y5XA 3V0TA 4LAOA 5GNYA 2VJXA 3AIRA 4W8LA 4WJ8A 4LC6A 4WK9A 5HQLA 1ZB5A 3LPFA 3U4FA 4CNTA 2ADAA 1W37A 4Q4PA 5DLCA 5BRBA 4Z2IA 4K8HA 3CGTA 4R33A 2I9UA 4BR1A 1H7NA 3TR2A 2OLSA 4PMQA 3TCSA 3TQPA 3N2XA 4PSPA 3ABRA 2EF9A 4LANA 4WSHA 3U4AA 2PSNA 4AZGA 2Z2AA 2CLIA 1GQLA 2OWCA 4PFMA 3H2EA 2PRHA 3A21A 3K4DA 3P2VA 4GXWA 1CXEA 2OOFA 3FEQA 5DCBA 2D0FA 1QW8A 1TCDA 4OKDA 3NQ2A 1EZ2A 1J8VA 4HNNA 4A35A 3R79A 4AXNA 1GVEA 3QKEA 1NFPA 2WSQA 2VCCA 4YMZA 5HAOA 4F2UA 1CWYA 1ZL1A 1CEOA 3OA3A 3WBYA 2PCQA 3UWZA 1VH7A 1W9PA 4ERGA 2YCEA 5D2WA 1JGIA 2ZDSA 3KDNA 3AHTA 3LHWA 4HMNA 3XINA 3SBFA 4A2SA 3ZT5A 3AYRA 4QAIA 1VHNA 4B4FA 2ESCA 3V3WA 4GVHA 3W25A 2J7BA 1U83A 3C2YA 3GQYA 5C2GA 3SY8A 2VZUA 1OIMA 3OEXA 1RAKA 3BK0A 3POHA 2O0TA 2X1RA 2PWFA 1TWSA 3BPWA 3PZ9A 1ZY9A 2XTKA 1TJPA 4KEVA 1SGJA 2D1ZA 3L4UA 5DMMA 2NVDA 5I00A 4JIQA 2ZA3A 3UW6A 1V6UA 5I5RA 4NF7A 3O9NA 5BOOA 3VO0A 2YB1A 5CGTA 3PTMA 3MQTA 1UYQA 2YFOA 4O52A 1TX0A 4Q7BA 3TC6A 4ASTA 4GY0A 3GFZA 2CERA 3GDKA 5CC7A 3AXIA 4NHVA 4PMDA 1KWKA 3EXRA 1TX2A 3LENA 1XCFA 1OGBA 4N9EA 1QDSA 2VEMA 4D2JA 1HKJA 2HSAA 4JAWA 4JTSA 2VX7A 2GPTA 4DXVA 5HPOA 3N25A 1EXBA 1WX0A 4WXZA 5LIWX 2XH0A 1GCYA 3WK2A 3BSHA 3AQUA 2VM8A 4RDWA 1XUZA 1GOIA 1DWHM 2I17A 2PGFA 1K9TA 2GSJA 2GQ9A 5CC6A 1PZ2A 2OWWA 3WLHA 3AIUA 3G2GA 1E0VA 1DWGM 4JX5A 1KLYA 2O7SA 2WQPA 3UETA 4MWAA 3B04A 1RUSA 1BGAA 2XM2A 2VVSA 5CC5A 1VR6A 4LCQA 2E4TA 2CFFA 3CC1A 1XIMA 4JEQA 1R86A 3BQ6A 1K70A 3EMZA 4L80A 5F1VA 5LZLA 3W1AA 1EOMA 1RVGA 3THQA 1PXGA 3LNMA 1I0BA 2PMQA 4L9XA 2GQ3A 3WNMA 1GJPA 3CMGA 1KFWA 4NJJA 4PUWA 4QR6A 7XIMA 1W1VA 4QEHA 1XV8A 3BG5A 5E0KA 2WNNA 3W9ZA 2JF7A 4KEZA 1C93A 2Z7GA 2VENA 4YYFA 3I10A 5AYXA 4EP8C 2NX3A 2PDQA 2WJDA 3LZ5A 1V6TA 3G1XA 4NUWA 3FJ4A 1FVPA 2FB2A 5JBFA 3WBAA 4UTHA 4Q8QA 3T05A 1W91A 4N42A 5REQA 3L68A 6XIMA 4HYVA 3WMCA 2V5BA 3S2LA 1WO2A 4BA0A 4FP1A 2O9RA 3URAA 1TJ1A 3D47A 4Z1YA 5I3IA 3OYXA 2CHNA 3IGHX 4GUFA 4ZO7A 4FIQA 3LK6A 4JN8A 4LB3A 4LFYA 2R94A 2ISSA 4BQ3A 3BARA 1RALA 4RXGA 2PDLA 3SM0A 1W3IA 4A3RA 1F61A 4YWSA 4MJMA 2BFGA 5CLTA 3TTEA 3CV2A 3VX0A 2OOGA 3OODA 4PH6A 1EEXA 4JTHA 1E0WA 2BB0A 4LS1A 4NRRA 2YDAA 3T0AA 1WDPA 2WNWA 3QC3A 2PRLA 4O8RA 2OJPA 3L4WA 5FI8A 2E8YA 3FCPA 1M01A 1YW1A 2YCLA 1C9DA 3LU2A 2EJAA 4H9VA 3QGVA 1FDZA 4KRTA 2PBGA 4M7SA 1E15A 2ZRWA 1KV5A 5D32A 3DIPA 3BLIA 5CSUA 2PFHA 3KFTA 3M6YA 4PBFA 3WJXA 3R58A 2P0OA 2ZKMX 5AYIA 5LKYA 3KVJA 3AJ7A 1EFZA 3MCMA 4JX4A 4YHGA 1EC9A 4UWMA 1GJWA 4EAMA 5CC3A 1TB3A 2PDGA 3W4RA 1TPH1 3S1GA 1UJPA 5HMFA 3A4XA 3GUGA 1TPUA 3RCMA 4XZIA 4TVUA 1SR0A 5AVHA 3NJ3A 1Q7MA 1KKRA 2FLIA 3LB0A 1QBBA 4X60A 3TW9A 1RBOB 3USBA 3F2BA 2ABBA 3SGUA 3HU7A 3AWNA 4BCEA 3U7VA 1CCWB 1KRBC 1R3RA 4F0HA 1SUXA 3U7BA 4K7VA 1JXKA 3QY8A 3L2LA 2UV8G 4IMCA 3GC2A 1E51A 2DGAA 3D46A 4NXSA 3VA8A 2GGIA 3QLLA 2Y4SA 4WZHA 1A5UA 4F66A 3SUUA 5D2VA 3AS3A 3KBMA 2VZTA 3W7IA 2ZZ1A 4HJWA 3H4XA 3SB0A 3P60A 3KTXA 4Z2KA 4DO4A 1I1WA 1TWIA 2HNHA 4JNMA 5BCAA 1VPYA 4C1NA 4CVWA 2HPMA 2XIBA 4WKHA 3H2AA 2V3GA 3WZ0E 3ITXA 4KS0A 4NKCA 2AKMA 1CI1A 1NY1A 3SY5A 4KGLA 1NEYA 3KBSA 3K8LA 1VEMA 1DTNA 4Y96A 5I02A 3NQBA 4QIUA 2BOEX 2ACQA 3CH9A 1E4MM 3B0UX 4A4AA 4FLOA 1JG9A 2VMFA 4HBKA 3UD6A 2OEKA 4K7YA 5AYZA 3H4GA 3VGFA 1F6YA 3PF3A 1VAHA 3P8JA 1KRMA 1TRIA 5A5WA 3BJTA 1X6LA 6ENLA 1T7LA 1W9VA 5D9OA 5CSRA 4XO6A 4GZIA 3NXFA 3AMDA 4KWOA 4LF2A 4EVZA 2GYIA 4JTTA 4ZB2A 3CQHA 1S46A 2C14A 1XLBA 4IQEA 5CLWA 4REQB 5TAOA 3W2MA 1M7XA 3ZYZA 1V0MA 3B97A 2VX5A 2DVXA 3MCNA 4B5WA 6XIAA 3B8SA 4GI9A 3QQ0A 2WMKA 1E4IA 4H7VA 4G2DA 2VUYA 4QQUA 4D9PA 1FDJA 1AUSL 3NYDA 1SW7A 3M5ZA 5IBXC 3VOJA 2ZXDA 1YIXA 3SECA 3HA1A 3GX9A 4PRRA 1OC5A 3K30A 1JPMA 3GZ3A 1ZGDA 1HO1A 2P8CA 1J5TA 4RKAA 4QE5A 5F2GA 4K6AA 3EPOA 3IJ7A 2PE4A 1YRRA 1E4LA 1B3OA 2J74A 3KUMA 5J5DA 3H26A 3AIBA 3GB6A 5DQPA 1PB0A 3TFCA 3MUY1 3U2ZA 1BGGA 3QV6A 1XICA 4K2SA 5ABTA 3W6MA 3BG3A 2BVYA 3GR8A 3M0HA 4FB7A 1ITUA 2W6RA 4Y9OA 1S39A 5LA0A 2V38A 3RR4A 3T7VA 3F7JA 1Q65A 3WD3A 4EF9A 1WCGA 5C8BB 2QCMA 2CZ5A 4R88A 3GHSA 1DWJM 3BAXA 3TA6A 1WZKA 5KINA 4Q7IA 1GTHA 5KETA 1EC7A 4NP7A 4X63A 4JL1A 4JZ5A 2O7QA 1GKPA 2ZYFA 2OO0A 3K5XA 3RN6A 4YCPA 1MXGA 3RO6A 1O66A 3LPGA 2POTA 4ZB5A 3C2RA 4ORMA 3RU6A 1Q45A 2EG8A 1Q4NX 3BC9A 4KFNA 2PWVA 1QRQA 2F6UA 3QVQA 3FJNA 2P76A 3TAKA 4HMDA 3UWQA 4LUSA 2FVLA 5FAGA 2PZNA 3LPOA 1MDRA 2X0HA 3MSDA 4CD7A 3WH9A 2W4XA 4NI3A 1H63A 4MGGA 4PRWA 4QITA 3SAZA 3L4TA 1VPQA 5LGZA 3SCUA 3JR2A 2BXVA 2DH2A 1R3YA 4CCDA 4HKPA 4X2RA 2CKSA 4ZQMA 4C6QA 1OVDA 3GZAA 1HL8A 2P0IA 1W5OA 3VKAA 3T9PA 2BSLA 4AU0A 5DANA 4HPNA 2VGIA 1JCNA 3GWQA 5BXTA 1X6UA 1UKOA 4S3EA 2JKPA 4JTCA 1R3VA 5CCZA 1FOBA 3N04A 4M51A 4DJED 2J7GA 3W07A 3AIQA 3VZYA 1K8XA 2AQVA 4NQ1A 1TR1A 4DUXA 3M9YA 3F4DA 4UQDA 4L7ZA 3E2QA 4S38A 2I56A 4O54A 3N29A 3MUCA 3GFXA 4EPBC 2QDGA 4IMFA