1LF1A

Crystal structure of cel5 from alkalophilic bacillus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
298
structure length
296
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGITVFRAAMYTSSGGYIDDPSVKEKVKETVEAAIDLGIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWDNQIKPYAEEVIPVIRDNDPNNIVIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cel5
publication title A novel combination of two classic catalytic schemes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 109
structure length 296
sequence length 298
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lf1A00
4AMCA 2VC9A 1HXJA 2ZICA 1JF5A 3FY1A 3ZJ7A 3WQ4A 4QLKA 3FAWA 1UD3A 4OIFA 4W7WA 4JHOA 2XGBA 4H8HA 3K8KA 4UFKA 3W29A 4PSPA 3D5HA 3MKKA 5E70A 1E73M 2WMHA 4AZHA 2FGLA 4W87A 3WUGA 4UFLA 2JFEX 1B9ZA 1WCGA 3AMGA 4CCDA 2V3DA 3FW6A 2ZUUA 1IZKA 2GJRA 4AEFA 1UD2A 2WMGA 4F8XA 2VCBA 4L4PA 2WVUA 2A3HA 1H1NA 1ITXA 1WNOA 1Q4NX 3FN9A 2PWHA 2D0GA 1FH8A 1EOMA 4FMVA 1VJZA 3IJ9A 1E4MM 2D23A 2BHZA 1HKMA 2VZVA 5I77A 3IJ8A 1D3CA 3VDHA 4OJYA 4PRWA 1LJYA 2X09A 5ABHA 1ZBCA 4TTUA 1NP2A 2WWDA 5FIPA 4BQ5A 1VBRA 3MV01 3PBGA 3UR7A 5M3WA 5CG0A 4E8DA 1B90A 4Z2JA 1W1VA 2WVVB 6TAAA 3VMPA 1R7AA 2XVPA 3LPPA 3CUIA 4DWSD 2VZUA 2YLAA 3PTKA 1VEPA 5FD0A 1E3ZA 4TXEA 3BSHA 1EO7A 4V27A 2WAGA 3BLPX 1OB0A 1WE5A 2NT1A 4HMDA 1KXHA 1H11A 4CN4A 2W92A 3OG2A 4AZ5A 5E0FA 1CZ1A 1HX0A 3JUGA 1BQCA 1WDSA 2WVVA 1HN1A 1UQYA 1UH3A 3W4RA 1GOOA 4D6IA 5IXEA 2W62A 4CU6A 2VMFA 1UWSA 4AYSA 3ECQA 2DT1A 5HXMA 1A47A 1GOQA 1UUQA 1I75A 1HKKA 4LYPA 2D20A 4H7VA 4RE3A 3ZIZA 3CZKA 3AXIA 4UQBA 4GI6A 1NARA 2J7GA 1MFVA 3WH5A 2B31A 3WENA 1WZMA 4TVCA 3M46A 4BA0A 1RP8A 3CUGA 4U5KA 5JBDA 3EBVA 3VGBA 4P7RA 1ISVA 4C7DA 5JBEA 5EFDA 5M5DA 4MB4A 2FHCA 4W84A 2DH2A 3OGSA 3U7VA 4UTFA 3WNMA 1GUVA 1QVBA 2X8RA 3N04A 2QLYA 3QHOA 1EQPA 3FHQA 5A2AA 3RDKA 3VNYA 2WCAA 1TMQA 3AMDA 3U5UA 2WHKA 4A4AA 2V3GA 2CEQA 3PZIA 3T2OA 3VILA 1XHGA 2W67A 4U5IA 3PN8A 3AHVA 3O9NA 4TOQA 4V28A 3VMNA 3GBDA 5ABFA 2BHYA 3WF0A 2WHLA 1CXFA 3POHA 3VGGA 1HJUA 1J18A 2J78A 4B3LA 4WKAA 2OYMA 2WKLA 1V3HA 3VKKA 4HTYA 4WKHA 2JE8A 5A2BA 4WJXA 3TTSA 2VJXA 1XC6A 4GIAA 1SMAA 4OKDA 3AYRA 1SMDA 4MAZA 5I3DA 3WSUA 3WELA 1JF6A 4UZSA 1E6QM 2PWEA 4H2CA 1XH0A 1MQQA 4H04A 3AMCA 3T08A 2IXUA 4N42A 1BG9A 3CZGA 4XB3A 4JKMA 1PJ9A 4MNKA 4MPKA 4URIA 5GNXA 3WDHA 2BHUA 2MANA 2XIBA 4NRSA 3DYPA 3WF3A 4NI3A 3T0DA 2OSWA 3WNPA 1ZB5A 3CLWA 4Z2GA 4JL2A 4ACYA 3BAXA 1CPUA 3OIHA 3VIGA 1LG2A 2WK2A 4UOJA 4M80A 5IFTA 1FA2A 3RIKA 3S2CA 4JFVA 4M29A 1BYAA 4QFUA 4DWSB 4J28A 2G3IA 3ALFA 4D6EA 3CHDA 1JAKA 2NW0A 2X0YA 3N9KA 1VJSA 4WSJA 1W1PA 2J79A 4D6FA 1CYGA 1VENA 1KQYA 3B9AA 3PZ9A 1KWKA 4ATDA 5CZKA 2YL6A 2GK1A 5BCAA 1ISZA 4UR9A 1VFFA 1BHGA 4HZ6A 4YHEA 3VD9A 1GQLA 3OZOA 1C91A 5D9PA 3EMQA 4AZIA 1UYQA 2Y8VA 3WEMA 2VX6A 1E6RA 3ARQA 4WIWA 2HISA 5E0CA 1I1WA 1HJSA 1K9FA 3UG5A 2J75A 4GI9A 2FHBA 3ZJKA 3CUFA 1L8NA 1W32A 1MQPA 1BF2A 1ITCA 1G0CA 4JCLA 5AC4A 1US3A 2DSVA 1ESWA 2CXGA 3WNOA 2BXZA 2WYSA 3ARSA 3WMCA 2VRKA 1Q6DA 5CPQA 3VIJA 1F4HA 2FHFA 3L4WA 1VBUA 3AHXA 9CGTA 3VIIA 3AMLA 1X6NA 2WLZA 3BMWA 3WFZA 2VTFA 4GZJA 1J0ZA 2CERA 5EB8A 1V6UA 2CETA 2ZUNA 3WMBA 1HP5A 1Q6GA 2XM2A 4GO9A 4S3KA 1WKYA 4GZEA 1IV8A 1QI3A 2X05A 6CGTA 2ZXBA 4J3TA 1RPKA 2XTKA 1QI5A 3SCWA 4C7FA 1GZJA 2ZUMA 4W93A 3VIKA 3NCOA 2XWEA 2Y2WA 2WCGA 2DT0A 3BAYA 1UWTA 2O92A 1HJWA 2J62A 2VRQA 3K46A 3OZPA 3EDJA 3SIMA 5LYRA 4PN2A 1WPCA 1JD7A 1M53A 2CHOA 1E43A 1NOUA 4MJ4A 2WNWA 1HT6A 2WVSA 4X0NA 5A6SA 4XUYA 3WF1A 1QBAA 4HU0A 3WDIA 3W27A 1L0PA 2XJ7A 4MAVA 5D8WA 1LQ0A 3WD4A 3UCQA 3BAWA 2VT0A 2XPKA 4D1IA 3WH9A 3ARRA 3NYDA 3OGRA 1GHRA 5LA0A 4IPLA 5JIPA 2E0PA 1JI1A 4K68A 1HIZA 2GDVA 3VGDA 2WB5A 1WZLA 5A95A 2QPUA 3SEPA 3A3HA 1PZ2A 5CGMA 2YBUA 3VTRA 1HNYA 1OWQA 5HDRA 5A2CA 1E4IA 1QW8A 4UQCA 1O6IA 2PB1A 1UH2A 3ARWA 1OM0A 4JAWA 3KL3A 1RH9A 2E8ZA 1QHZA 3SUSA 2VQUA 1R86A 1ISWA 2UY4A 1EIBA 4U33A 4BF7A 1E5NA 4ATWA 3EDEA 1VFOA 5AC5A 1HJXA 5LA1A 3IJ7A 3WNNA 3SUVA 1X1NA 5BXTA 4DWSC 3POCA 3EDFA 1BVZA 2ZUWA 3WBAA 3ZM8A 3AYSA 2PWGA 2A3AA 1K9DA 3WD0A 2WZHA 1PX8A 2V5DA 4P8VA 2YDQA 1ODUA 3RJYA 2VL4A 4UQAA 1U2YA 2WWCA 5CQ1A 1QNOA 2PWDA 5JBFA 3RILA 3AS2A 2VZTA 2PBOA 4MNMA 2ZX5A 3AS0A 1QI0A 2WSPA 3MSDA 4LX4A 3WBEA 1EQCA 3SCRA 4BZYA 1W1YA 1XSKA 2UWFA 3VX1A 3VIFA 3ZO9A 3WH6A 1UR1A 1J0JA 1JYNA 2GVYA 1UWIA 4U2ZA 3SUUA 1BGAA 2PC8A 3W37A 1LLOA 3GNOA 3PZUA 5I24A 4GI8A 1VFMA 3ZT5A 1W9BM 1HVQA 2DSWA 4A3YA 1HVXA 3UEQA 2VURA 4BQ3A 2CKRA 1AVAA 4PMZA 4BQ4A 1KGXA 5BROA 1H4PA 4PMDA 2WC7A 1MW0A 1KFWA 2VX7A 2NSXA 3WH8A 4D72A 3WNLA 1H09A 1GHSA 2CBUA 4M8UA 4P7OA 2XG9A 1JDAA 2CKSA 1M7XA 2OYLA 2WMKA 5TD4A 4BQ2A 4TVDA 1H3GA 2D24A 1W3JA 3SCTA 3WQ8A 5M03A 5A8MA 2DT2A 1LL7A 3VD4A 3MUY1 3CZEA 1JAEA 4PCTA 3WDJA 1MW2A 3N15A 4AZ6A 1E4LA 4BCEA 3CMGA 4FLRA 1KB3A 1QHPA 1OINA 2A3CA 4HZ7A 4F9DA 5BXSA 2VO5A 1UOKA 4B3KA 2CIPA 2XM1A 2XVLA 3U7BA 3W25A 3GXMA 4HA1A 3ARTA 3TP4A 1LL4A 4PTMA 2UY3A 4WSKA 4PMYA 4UOQA 1NOWA 5CPTA 4AD1A 3ZT6A 2J7DA 2OSYA 1OIFA 4Y7EA 1D7FA 4UQDA 2XYLA 4P7QA 4TTGA 4JKKA 3WY1A 2DQXA 3SCUA 2W4XA 1V0NA 4YPJA 5ECUA 4C7GA 1CXKA 5IHSA 3WN6A 3WQ6A 4AZCB 3T2PA 4X9YA 2WBKA 3M07A 3WD3A 3KL5A 4MDOA 3W53A 2WHMA 5EBAA 3PZGA 4CUCA 3L4VA 2DIEA 2E40A 4JFUA 5BXRA 3OLIA 1Q6EA 1WDQA 5ABGA 4KRUA 2WHJA 2J77A 3PHAA 5CXPA 1KR1A 1W9XA 2VRJA 1ZBWA 4CGTA 1OGGA 1MWOA 4LYQA 1KR0A 2OSXA 4UFMA 2Z1SA 1B2YA 3AHYA 1V0LA 2GJPA 1JZ2A 1NP0A 4AD2A 4AZCA 2OWXA 1XYFA 1UR8A 3K8MA 1GOIA 1EDGA 3VM5A 1KXTA 2BY1A 4JZ5A 1WP6A 1ZJAA 4PMUA 4LXFA 5A6BA 4FK9A 2JIWA 4JKLA 3VGHA 4W88A 4AC1X 3BH4A 1XCWA 2RGLA 1K6AA 3E1F1 2E4TA 4UQ9A 2C8NA 4UQEA 4AD3A 3B9DA 1NM9A 1QNSA 1EA9C 2W66A 1C3FA 4ZXOA 5I23A 2A3BA 3F5LA 4PMOA 4W85A 1EXPA 2FGZA 3GBEA 4W8LA 5A6JA 3OB8A 1EDQA 3T2QA 4QLLA 1OSEA 2AAAA 2XFFA 4HP5A 3AHTA 4RL3A 1XH1A 3ZT7A 2YL9A 3U5YA 1UA7A 1QI2A 2Y5EA 1JDDA 3K4DA 1WDRA 1JXKA 2VOTA 4PBGA 4AD4A 4UZUA 3BAJA 4EK7A 2XIIA 3AJ7A 1OIMA 3RO8A 1VEMA 4HA3A 4KGJA 2WANA 4E4PA 3CGTA 3TA9A 1UKQA 1GJUA 4ZXLA 4PYSA 1N82A 3IAQA 1AMYA 3F5KA 4MB3A 1SFSA 2VR4A 2FDMA 1TG7A 1R7OA 3AIBA 2YOCA 4W5UA 3WMSA 2WZEA 1WDPA 4B15A 2WCSA 5HNNA 3CUJA 1DWIM 1CXHA 4PEEA 5I5RA 1UD6A 1MXDA 1W2PA 1VAHA 1MW3A 1JNDA 2PF0A 1S46A 3KZSA 1QBBA 1TFVA 2JEQA 2BY3A 1B1YA 2TAAA 4Q22A 4ML4A 2WKGA 4AIOA 4PUEA 3BMVA 2QHAA 4E2OA 3O6AA 2BS9A 7CGTA 5EMYA 5KZ6A 3AS3A 1E5JA 1AQMA 1V3MA 3F5JA 2UY5A 1JYWA 4Z2HA 4E8CA 3MUAA 5I79A 1DWFM 3MMUA 2YA1A 4UCFA 1W9DM 4LPCA 3ARZA 5EFFA 1GORA 1J0IA 5FOOA 2YDRA 1UWUA 3RM4A 5D9OA 4M82A 3LPOA 1OD0A 4OUEA 1PEZA 1GONA 4CCCA 1E4NA 3W0KA 1OCQA 4HU8A 5IFPA 4CD4A 2VX5A 3KE0A 1BYBA 2PI6A 1CLVA 2YDSA 1DWJM 1UR4A 1JZ6A 4GPNA 1BTCA 3GH4A 5DT5A 3VIPA 4IUGA 3W38A 4A3HA 2WMFA 2BVYA 4HOXA 2OLHA 1G1YA 5CLTA 5AYBA 3B9EA 1W2VA 1GQKA 3OLGA 3PZTA 1E6ZA 3GYCA 4QLJA 3VPLA 2DSKA 2CESA 1OT1A 4KRTA 3VD7A 3PZVA 1A3HA 4D6HA 2YL8A 1HJVA 3I3BA 1TCMA 1UD4A 4HZ8A 4PTVA 2DPEA 4M56A 3VIHA 3D3AA 4DWSA 3AS1A 3UETA 2ESCA 2DSUA 4F79A 1UR0A 2GFTA 1ZS2A 2WXDM 3MS8A 3FAXA 1E40A 3F4VA 2J74A 1MVYA 2O9RA 1E15A 4QCFA 4AEEA 3WEOA 2EJ1A 4JL1A 3ARXA 4W8AA 4MNJA 3CHFA 3IK2A 2XWDA 3NJ3A 4EAMA 2DSZA 1C8YA 1UH4A 4PTWA 1E1EA 2ZX9A 3T0BA 1EH9A 3VUPA 3MV11 4MADA 2GJXB 1WO2A 1E9LA 1WB0A 4JFTA 1B31A 5JUVA 3VDCA 4WKFA 1VRXA 3BXWA 3GNPA 1GOKA 2YLLA 2NT0A 5BYWA 3W6LA 3CBWA 1FOBA 2OYKA 1W9PA 2WVTA 3THDA 3K1DA 2CCRA 4ACZB 5CPSA 2EPMX 1OBAA 3WH7A 1TUXA 3QHNA 3I3EA 1JYXA 4JFWA 4M24A 1H0IA 4OOZA 1UZ1A 2CNCA 3CZJA 5A6KA 1BPLB 2J8GA 1GW1A 1ZU8A 3GXDA 1LG1A 3A4AA 5BRPA 5DEZA 2AOSA 1D2KA 1EO5A 1V6YA 4ACZA 4CD8A 3N12A 3WQVA 4P7NA 4CKQA 3DHUA 3WFLA 5A6LA 5FKYA 4D6DA 1UWRA 1W3KA 1ZBKA 4PUDA 2FH6A 3MUZ1 5BWFA 2G8ZA 5HPCA 2ZX7A 1UG6A 1CXIA 1JZ8A 1BYDA 2YL5A 3VINA 2YA2A 3CZLA 3AQUA 4RE4A 4FF5A 2CITA 4FLSA 4D71A 3GXIA 4HOZA 2V5CA 4D6JA 5GQBA 2BVDA 2XVKA 3K8LA 3EDDA 1JYVA 2X1IA 2W61A 3GH5A 2ZX8A 1FHDA 3CZ8A 2YKKA 4PCSA 2J47A 4J7RA 4OZOA 1MW1A 2J25A 2D0HA 1BG4A 3QOMA 1C92A 5D9NA 3SCPA 1DHKA 3MMWA 2VUYA 2EO7A 4JCMA 4J3XA 3VGFA 4NRRA 4YHGA 4GZIA 1BAGA 1CTNA 2YA0A 5A8QA 4PMQA 4UOZA 1VEOA 2WMIB 4JHZA 1Z32X 2O9TA 4AIEA 2VZSA 4AISA 1M01A 3L2MA 3HN3A 4MDPA 3M6DA 2O9PA 3AZTA 3WD1A 1DEDA 3N1AA 2EPLX 2CPUA 3TTYA 4TVUA 4ZEPA 4GINA 4YN5A 3SCQA 1V6XA 3AIEA 2XUCA 1EHAA 2DH3A 3BAIA 1BVNP 3WNKA 4OBRA 1TVNA 5E9AA 3L4ZA 1OT2A 3WL1A 2VI0A 3BLKA 4ZE4A 1H41A 1W3HA 1G9HA 3AMKA 1C7TA 1G01A 4CVUA 1B3XA 4AZ7A 1EGZA 1B3ZA 4PMXA 1PIGA 2J7BA 1WZAA 5DFAA 3PZMA 1J0HA 1U33A 3S6TA 1TR1A 8A3HA 2G3MA 3T09A 2C7FA 1DWHM 2XSBA 1GCYA 4UNIA 1KBBA 2A3EA 3AIRA 5A8PA 1FHLA 3NUKA 2VCCA 2J7FA 1GVIA 4FLOA 1MXGA 4AD0A 2JALA 2OWCA 2XFYA 3EYPA 4KH2A 1C8XA 3NIYA 3SCVA 1B3YA 1XH2A 1OGSA 4MJ2A 1ZJBA 4PMRA 2XGIA 1CNVA 3WQWA 2J8FA 4IISA 2XSAA 3PTMA 4R27A 3NSMA 4QP0A 2FH8A 3RCNA 5A8NA 4TX8A 4CVWA 3AXHA 3N13A 4KWUA 1B0IA 3VD3A 4LQ1A 1LL6A 4BS0A 2ZXDA 2J4GA 1UR2A 3A47A 1JZ3A 3VX0A 3WUBA 1LWJA 2QV4A 4CD7A 2CBIA 3TOPA 3N17A 4S3JA 1SYTA 4XV0A 1KXVA 2ZX6A 1EHNA 4CD5A 5GPRA 4B9ZA 1TVPA 4U3CA 3WDQA 3CIVA 2VZOA 4MTVA 2G3NA 3PZOA 2XVNA 3ARYA 4CN6A 1VIWA 2ZUVA 1SR0A 2E9MA 2IUZA 1UKOA 4J3SA 5DF0A 1PIFA 2ZIDA 1ZL1A 2OWWA 2WW5A 4GO8A 1B3WA 1H0GA 1MYRA 1ODZA 3M7SA 4EANA 1QNQA 1PAMA 2EPNA 2EXOA 1QPKA 2Z1KA 1HF6A 3K4AA 4W8BA 1FFRA 3FXYA 1WZKA 5BXPA 1CLXA 2G4FA 3ZJ6A 4CU8A 3TTQA 1GJWA 3G6MA 2BY2A 1AQ0A 3OA5A 4OOUA 4W86A 4B9YA 2YIHA 1JI2A 4CCEA 2VVSA 3EMCA 2QMKA 1NH6A 1XRVA 3SCNA 2J7EA 1V3JA 1NWSA 4M1RA 1NWRA 5F7UA 3WF4A 4AWEA 3ZJ8A 2VNCA 1LWHA 1UHVA 3W81A 3VDAA 1JZ7A 1QHOA 3CHCA 3VDBA 2CYGA 4PMVA 1JFXA 4QCEA 1NOFA 1K9TA 5GNZA 1QOXA 3VIOA 1AQHA 1CDGA 1KCKA 4NSBA 4Z2IA 3APGA 3BAKA 2WC4A 1X6LA 2WLYA 3CTTA 4P7LA 5D4YA 1CEOA 2ZXAA 4W89A 3G6LA 4Q7NA 3DC0A 3KWXA 1XD1A 1J12A 1C90A 1FH9A 1JXJA 3CH9A 1P6WA 2WM0A 2X0HA 3WEZA 2QMJA 4D6GA 3CMJA 3GM8A 3KEHA 2RGMA 1G94A 2ZWYA 1B30A 1V3IA 3QGVA 3L4YA 2BFGA 3NSNA 4DUVA 5C71A 3W26A 2DIJA 1E71M 3NDYA 2W63A 1XYZA 3WF2A 3BC9A 5I0DA 3MMDA 1GQJA 1XV8A 5GNYA 4L4OA 3ZSSA 2G3JA 1IT0A 2D3NA 1V02A 4MB1A 4AY1A 5D9MA 2AMGA 2V38A 4PTXA 1QW9A 1PX4A 4AZBA 1R85A 1RP9A 3J7HA 5A69A 3ZR5A 2D22A 3QOKA 4PSRA 4UFHA 3AIVA 3MU7A 2ZE0A 4HPGA 4N0RA 5A3HA 2QPSA 4KMQA 2DEPA 1WAWA 4NF7A 3W24A 1CXLA 2EEXA 2E9LA 4ATLA 2GSJA 5KEZA 3BGAA 1H2JA 3DYMA 5ABFB 5DT7A 3QHMA 2DGAA 5A6MA 1E6PA 4XX6A 1UKTA 4V2XA 1W9VA 2WSKA 3RJXA 3SUTA 4CU7A 1FP8A 5HPOA 1XD0A 2VQTA 1XSIA 1UD5A 4P8UA 3UG4A 1XCXA 2UY2A 4P8WA 4M81A 1W1TA 1E6XM 2PWFA 2W5FA 3VU2A 3IANA 4NZCA 1E0XA 1KGWA 3ARUA 2XVGA 3AI0A 1E0VA 3ARPA 3AZSA 1NWTA 2ZUSA 4UFJA 1VF8A 3NSXA 2YBTA 1KBKA 2G41A 3MSGA 5C8BB 1C8QA 3T0AA 5CSUA 2CHNA 3GZAA 3MANA 1QNRA 2F61A 5FL1A 1JDCA 1DTUA 5AY7A 1J01A 4HPHA 3BSGA 4IM4A 4H8UA 3VM7A 2JF7A 4TX6A 1DP0A 1IZJA 5HBFA 1NWUA 1CIUA 1CGXA 2D1ZA 1H5VA 3PTQA 1KXQA 1CBGA 1E56A 3L4UA 3W6MA 4OBSA 2BNJA 4WK9A 4QAWA 1YHTA 3CO4A 2D2OA 1V3KA 3WUFA 2F8QA 1JD9A 1R87A 2BVTA 2EBNA 2E3ZA 1BSIA 1U30A 3UESA 5A94A 3MO4A 4Z2KA 2DT3A 2VCAA 1CECA 3W82A 1J9YA 4MNLA 1HP4A 1VFUA 4J3VA 1CGUA 3WKZA 2GUYA 5M17A 3LMYA 1FH7A 4EKJA 1GOWA 3WDPP 2VR5A 3HU7A 4W5ZA 1CGVA 1GVYA 3B8SA 4J3UA 1OD8A 2GK1B 3L2LA 3U57A 1I1XA 4JIEA 2Y24A 1GPFA 3WD2A 4HOWA 1GQIA 2EPKX 3A4XA 1E0WA 1UA3A 4U3AA 4DM1A 3ALGA 4AD5A 1C7SA 1W9UA 4AW7A 3QR3A 1TZ7A 3AIWA 2E9BA 4RE2A 4KGLA 1J0YA 1FFQA 5DO8A 3VMOA 3AISA 3L4TA 3OLEA 1CGYA 3CUHA 3GH7A 4CD6A 1LF1A 3KL0A 1B3VA 1BGGA 1BFNA 1UD8A 3CHEA 4DUXA 1MFUA 1V3LA 3L4XA 3W28A 2F2HA 1TE1A 1DWAM 1G5AA 4XZWA 1E3XA 2E8YA 5AYIA 5CLWA 5CJ5A 2V3EA 2ZXQA 1CGTA 1HKIA 4HA4A 2WBGA 4D1JA 3WQ5A 7TAAA 4AIUA 1RD6A 1PZ3A 3VGEA 1H49A 3GXFA 2BV9A 5I2UA 1Q6FA 5BRQA 3ZQ9A 1XSJA 5ABEA 2EQDA 3HMCA 2HVMA 4JFSA 3AXXA 4LYRA 5C70A 4F9JA 1QI4A 4GQQA 1ISXA 3O2LA 1US2A 4FLQA 1V08A 3DECA 2ZWZA 4WLCA 1J10A 3LPFA 6A3HA 4LGXA 5A6AA 3VIMA 5HOSA 2WZIA 1V02E 4QDMA 2GJXA 2ZUTA 3PZNA 2XHYA 1NQ6A 1KGUA 1JZ5A 3FHAA 3PZQA 1E55A 2ZOXA 1C93A 4H8VA 3MUIA 3WUEA 1EOKA 2X2YA 4W7VA 2W91A 4ZFMA 2PBGA 1CENA 2VX4A 1V6VA 2Y8KA 5D8ZA 1JG9A 3IAPA 4ZE5A 3LPGA 1DWGM 1CWYA 1UKSA 3A6OA 2YJQA 2DDXA 3NDZA 1W3LA 4DM2A 1J11A 1VB9A 3AROA 1EDTA 3BCFA 1W91A 3BCDA 1ZBVA 1XGZA 1V6WA 3DHPA 1JZ4A 1TA3B 1QNPA 1E6NA 4WF7A 4AXNA 1J0KA 1E70M 3AZRA 2VVNA 2WPGA 1O7AA 3GNRA 2J7CA 2JEPA 2IXVA 4H41A 4CN1A 3VVGA 3UERA 3A4WA 4GKLA 3RM8A 1TA3A 5IDIA 1JIBA 4EE9A 4Z2LA 3AIQA 1Q6CA 4AZGA 1PBGA 5E09A 3AHZA 1UQZA 2BXYA 2D0FA 4XZBA 3N11A 4ZENA 3TTOA 4TUFA 2O9OA 2V3FA 3WDRA 1HKJA 1BLIA 3ARVA 1UWQA 1M04A 3UG3A 5A8OA 5I6SA 1JFHA 4IPNB 1ISYA 3SCSA 3VD5A 1UZ4A 3TONA 5LA2A 1R8LA 5IHRA 1Y7VA 1PPIA 4HMCA 1GOMA 4DUWA 3DYOA 3SURA 7A3HA 4HMEA 3II1A 2EPOA 3RM9A 2WMIA 3WIJA 5A6BD 1PX3A 2C0HA 2BY0A 1JL8A 1HJQA 5CSYA 4X0VA 3AFBA 3VNZA 1HL8A 3ZR6A 1YQ2A 4J27A 2Y4SA 4W7UA 4GXPA 3GDBA 1V0KA 3WL0A 1F4AA 1KCLA 3AIUA 1KWGA 3EMZA 4U2YA 3AOFA 3AICA 1JNEA 2Q8XA 3ZOAA 2JF6A 3RPMA 5FCZA 3ZMRA 4R5EA 1MQRA 2XFRA 1M03A 2CBVA 1BYCA 1HL9A 3OBAA 3EDKA 3N18A 5E6YA 4J3WA 4UFIA 1CGWA 2WMJA 4PMNA 3UR8A 1E6SM 1GNXA 3HJEA 1V0MA 3THCA 3SCOA 1UKPA 3GTNA 3CPUA 5JIWA 4P8XA 5E6ZA 1UR9A 3ZSTA 4MB5A 3VOCA 5DMYA 2QF8A 1FP9A 1K9EA 1JGIA 4B16A 4D6CA 3SUWA 3VO0A 5CGTA 3OGVA 2CBJA 2J7HA 1E72M 3I3DA 3OLDA 1V03A 4U31A 2GDUA 1OGBA 5I78A 1E1FA 8CGTA 5FL0A 4GQRA 2WC3A 1CXEA 5A1AA 1ECEA 3RMEA 2D3LA 3FNDA 4F66A 1KQZA 2JIEA
chains in the Genus database with same CATH superfamily
5EMKA 4AMCA 2VC9A 1HXJA 4GK8A 1I0DA 4LCSA 4NI8A 4OIFA 4W7WA 1P4CA 3QR1A 4ZVJA 1H7WA 3WK0A 3A22A 1OFQA 4FPSA 4AZHA 4W87A 4E3VA 3S47A 2QR6A 3FA3A 1XIIA 3AMGA 2V3DA 3FW6A 3UT0A 1KFKA 1YX1A 2IS7A 3G0SA 1BEUA 1WNOA 1Q4NX 4O1FA 3MB9A 1P0KA 3CIXA 4F40A 4A3QA 3IJ9A 5CKSA 1KFCA 1K3UA 3UQNA 2D23A 3BLDA 1D3CA 1RK6A 4B4FA 1YPIA 4PRWA 3LBCA 1RVGA 2O7QA 4EOUA 3VFLA 4TTUA 3MV01 1M7JA 4Z17A 1H5YA 3MY9A 5KINA 2YB1A 4Z2JA 1W1VA 2WVVB 5I7GA 3VMPA 1K7XA 1R7AA 3CUIA 2YLAA 4IOTA 5FD0A 4WJEA 2YYUA 4LF1A 4O28A 2WAGA 3HGOA 3BLPX 4JDYA 3TJIA 3UWVA 2PDXA 2V8ZA 4F4RA 5E0FA 5DRCA 1SM9A 1JCNA 1KO0A 3ANUA 2CLOA 1ZY9A 1BRLB 1KBJA 2GL5A 4AYSA 1XKJA 3NZ1A 3R4IA 1XPYA 3CL6A 4L65A 3GHUA 4H7VA 3AXIA 4ZOAA 1RZMA 2NUWA 3CEPA 4I7UA 2J7GA 4EWJA 3RX3A 1FWFC 5CAHA 4ZO6A 4CNNA 3W88A 4QAIA 1ISVA 3FVDA 4MB4A 3STGA 3U7VA 3SSZA 4UTFA 2Q8ZA 3NGJA 1TO3A 3LN3A 3TYBA 1XI3A 1JVNA 1GUVA 1LCOA 3N04A 3EWYA 3P80A 3KP0A 1DJQA 4YNGA 1A5UA 3DZ1A 3EXSA 2WHKA 2V3GA 4CNPA 2CEQA 4KFOA 2Y63A 2WM1A 4U5IA 4H9XA 3PN8A 3QYQA 4V28A 4L6OA 3VMNA 3W3OA 3S5SA 2FZMA 2VFDA 3POHA 1J18A 2J78A 4WKAA 1KTCA 4L5ZA 4WKHA 2WSQA 3TTEA 5A2BA 4WJXA 3W75A 2DZTA 3CAQA 1T8QA 4OKDA 4MIMA 3E9AA 4MKSA 5I3DA 3WSUA 1TMHA 3GO2A 4EVZA 4MUPA 1JF6A 4UZSA 1DIDA 4L80A 4GC3A 1B3OA 2DV0A 5MHBA 4AWUA 4Z1BA 4H2CA 1XH0A 4FF7A 3C86A 4DXVA 3H21A 1PHQA 2A85A 3KHDA 4JKMA 1XIBA 3V5FA 1Y65A 4MNKA 1R5YA 4URIA 2DUZA 3SO7A 3I6EA 2BHUA 2XIBA 4NRSA 1TV8A 2GYIA 3DYPA 3FJLA 2OSWA 3STFA 3QMSA 4MF4A 3CLWA 4ACYA 5FF0A 1CPUA 5FEPA 1UP2A 3OIHA 2BX7A 1V7YA 1XRSA 4UOJA 1K7EA 1IIHA 1KFJA 4M29A 4WGHA 4HHMA 5SWUA 4GRSA 3FX4A 1WBJA 4OUIA 1W0MA 3N9KA 1VJSA 3ZVHA 3LCGA 4RR4A 4X2PA 3TCSA 4D6FA 2ISWA 1KQYA 1MRAA 3PZ9A 1KWKA 1OC5A 5CZKA 2YL6A 1R9ZA 1EP1A 1ISZA 4RDYA 5DRIA 4DNMA 3F2BA 1BHGA 2Y89A 4ADTA 3GUWA 4IMCA 4ASTA 3SQMA 1UYQA 2VX6A 4XD5A 3SJ3A 4WIWA 3SAZA 2FZ9A 4LEFA 4RUBA 4AF0B 3UG5A 3C3NA 2FHBA 3ZJKA 3PPHA 1TTIA 4DJEC 4JQ4A 1MQPA 1M6JA 1YMYA 3WNOA 1UW9A 4G1KA 2Y7GA 3DXIA 3URNA 5CBIA 4HSNA 2FHFA 3K1GA 3S1WA 1VBUA 3TQVA 1BKHA 2WLZA 3DAQA 4AX6A 4JIPA 3ZFHA 2UV8G 4Q4QA 4GZJA 4GYJA 2BSLA 2HRWA 2H6RA 4DO6A 5EB8A 5FF4A 1GZGA 4KT2A 4IFOA 2F2KA 5AHLA 4I8YA 2ZUNA 1TR9A 2XM2A 4GZEA 5HQMA 3URAA 2HK1A 3QKZA 1RPKA 1UP3A 3H22A 3V75A 4EWND 4C7FA 2XWEA 4B5SA 3EX3A 3LTPA 3EX1A 2O0TA 4XZLX 2GUUA 3KP1A 1JCMP 1D3GA 3S0CA 5HA7A 3SIMA 1FWAC 4PN2A 5LYRA 1JD7A 1M53A 3REQB 1TE6A 3QFWA 3IUHA 4MJ4A 1E51A 1AZ2A 4X0NA 1CCWB 4XK2A 4XUYA 2XINA 4GY0A 4MKNA 3O06A 2DZUA 3QMRA 1EXBA 1LQ0A 1NDZA 2A79A 1PTDA 4MWAD 4QE5A 4ZSTA 2PF8A 2GDQA 4J35A 1QRQA 3BJTA 3VOJA 1LT7A 1DVJA 3QKEA 1TJ1A 2GGJA 3WH9A 1J2WA 4ZB2A 5JIPA 4K68A 3RG6A 2RJGA 1V5XA 2QPUA 4KFNA 3M0IA 3HGJA 2C18A 3HFTA 1HZYA 3WQEA 4C6OA 4ALDA 4GYKA 3VTRA 4JTDA 4UQCA 1KFBA 1S38A 5GJNA 3SUSA 1R86A 1ISWA 4C91A 4U33A 4J4KA 1E5NA 5HMSA 3G1HA 4XWUA 4ATWA 1VFOA 3CO8A 1GYNA 4LY4A 3ZM8A 4UC5A 3CL7A 5AB3A 3RO6A 3S2LA 3TUUA 1GT8A 4GIYA 2ZADA 3OHMB 3WD0A 2WZHA 1PX8A 1WAUA 2HVNA 2PS2A 3BK0A 3E96A 4PFHA 4UQAA 1U2YA 1YXDA 1ADDA 1R3TA 2PGRA 4I9AA 5JBFA 3AS2A 4GQ0A 1WV2A 3HGSA 4LX4A 3WBEA 1EQCA 1XSKA 1GPWA 4DRSA 1J0JA 2GVYA 1QPQA 4U2ZA 1AH4A 4C6FA 3W37A 3PZUA 3STEA 1VFMA 2CZDA 4XSMA 4Z1YA 1I6NA 4FEZA 1W9BM 3IUIA 1DORA 3O16A 2DSWA 5CJMA 1HVXA 3B9NA 2VURA 2CKRA 3FEMA 1UR3M 4DBDA 2DW6A 1KFWA 1KLYA 1FXPA 1M7XA 4L56A 3W7KA 2KX9A 3B8WA 4TVDA 1H3GA 2V5JA 1J8VA 3WLQA 3SCTA 7ODCA 3CWOX 1YTEA 1Q6OA 2PWVA 3M41A 1LL7A 2W27A 1TREA 4GYFA 1NU5A 3N15A 4N2YA 1E4LA 4DB7A 4R85A 2OCZA 1AH0A 3B0PA 1QHPA 2PU1A 1OINA 3QVQA 1EC7A 3KZPA 4JTJA 4F9DA 2CHRA 3CS2A 4RW5A 3KBJA 3WLOA 4AHPA 1DJIA 1T40A 2XVLA 5ENLA 3TP4A 5KMYA 1X6UA 1UMLA 2CXEA 1X39A 3N9RA 4AD1A 1OIFA 3COTA 4UQDA 1MO0A 3DEQA 5HJYA 1I45A 1W3TA 4N9EA 2VOMA 4P7QA 3OA3A 4JKKA 3V35A 2DQXA 1XWYA 1WXZA 1AK5A 1ITQA 3E5BA 4C7GA 1FWNA 4FP1A 1EJTC 5D05A 3WQ6A 1GKQA 4AZCB 4GX9A 4X9YA 4IPJA 3M07A 3WD3A 3I7QA 4GABA 1Q6EA 5ABGA 5CXPA 3R94A 1ZBWA 3GTIA 4JIIX 4DZHA 3KTSA 3RX2A 3IIXA 1XFCA 1TTJA 3EB3A 1H60A 2NXIA 1JZ2A 1S3HA 1XYFA 1UR8A 1XLJA 5D33A 1UZHA 4XIAA 1ZAHA 4LXFA 1POKA 2JIWA 1LOSA 4JKLA 1S2WA 3VGHA 1VQTA 3GVWA 4O53A 2DZVA 1QW7A 1U22A 3NZQA 3EOSA 3LM7A 3UF9A 3B9DA 4HGXA 4N4QA 1H7NA 3DBNA 1LYXA 3KFTA 3P14A 1S5VA 3FLUA 1ICSA 4W85A 1EXPA 3R11A 2A4AA 3GIYA 3OB8A 1BRLA 7PTDA 3BW2A 3HG5A 5CZTA 1VLWA 3D47A 3MQTA 5HJXA 2Y88A 3RYSA 3KX6A 3K4DA 2VOTA 3L21A 1BXNA 3LXBA 4AD4A 4UZUA 2YSWA 3BAJA 3DI1A 4UCGA 1IWPA 4E4PA 4A35A 5D04C 3VKDA 4LBRA 1UKQA 3DI0A 1VIZA 4PYSA 4K37A 4XSLA 4MB3A 3KLLA 1TG7A 4KCUA 1R7OA 4YTSA 4W5UA 1NTHA 4LAKA 2WZEA 1WDPA 1TV5A 4A3UA 3EOOA 1XW8A 3MBDA 5HNNA 1YADA 1DWIM 1EX5A 5KTLA 1W2PA 1MXDA 1VAHA 1MW3A 2GWGA 4RLIA 2DORA 4IXHA 5LIXX 3KZSA 1QBBA 3PJXA 2QGHA 2BOGX 3RRXA 2JEQA 1VLIA 3BQ5A 3CQJA 2YFNA 3S1VA 1B1YA 1F9CA 4ML4A 2WKGA 4PUEA 2RFGA 3GFZA 1JCJA 4E2OA 2VEFA 5G2WA 2HTMA 3FVMA 1JYWA 4O14A 4O1EA 5I79A 2GSHA 3GU9A 2YA1A 3MMUA 4GIEA 2VKZG 4ZQCA 1Z41A 3W70A 1GORA 3PPGA 5U7SA 4YYFA 4B5XA 1Q7MA 1PEZA 1GONA 2NV1A 4CCCA 3I10A 1OCQA 4LAZA 3OQ8A 4DBSA 1PDZA 3IJDA 2P88A 3URBA 4NZJA 1BYBA 4NNCA 5FAGA 5B80A 4B90A 4R53A 1BTCA 4Q4RA 3W38A 4A3HA 2PDUA 2Q6ZA 4WY0F 2BVYA 2YCLB 1ZP4A 1R2RA 1EIXA 2DZBA 4HVXA 4UMAA 5HJLA 3DFNA 3W1RA 2Y1HA 3GC5A 3N2CA 1OT1A 4KRTA 1AMKA 1A3HA 2A7RA 4HZ8A 3VIHA 1OY0A 4CQDA 1OJXA 3MPGA 3EWWA 3DN5A 2DSUA 2WXDM 3F4VA 5K2ZA 4HKPA 4JY9A 1Z42A 2O9RA 3GZ3A 3T9PA 4AEEA 2EJ1A 3CAWA 4JL1A 2KAUC 3DENA 4N4PA 4W8AA 3W85A 2PDJA 1TJPA 2XWDA 2PCEA 3FJ6A 1YNQA 2C1GA 1UH4A 1CI1A 4HZMA 2Z0IA 2ZX9A 4JNMA 1ONXA 2YX0A 1Q66A 5KSWA 4MADA 1WB0A 4AF0A 4O8AA 3C3UA 4Q32A 4DJDD 1RHCA 2ACUA 2XZ9A 4IQEA 2WKJA 3KOZA 2NT0A 5BYWA 5H8UA 4IFKB 3THDA 2I1OA 3NL5A 4DF2A 2YXOA 2VDIA 3QHNA 3IUDA 3BUVA 4MYAA 2J9YA 3CZJA 2XDFA 5DX7A 3NYZA 2G95A 4NXSA 4NNAA 3E2SA 4ACZA 4CD8A 3WQVA 4FA3A 3U48A 5FKYA 2PDCA 3CC1A 4S3DA 1GW9A 2O55A 1ZBKA 1TPH1 4IH3A 4O16A 1Q4WA 4KEMA 4M6QA 5BRBA 2QCHA 4BY3A 5MKGB 2NVDA 3DC8A 1IWBA 3DGRA 4GA8A 2YA2A 3B0VC 3CZLA 3REQA 2BOEX 3G1VA 3WBYA 1FDJA 2BVDA 4EP8C 5C9XA 4ECLA 1JYVA 2W61A 2D69A 1MNZA 3GH5A 3BSMA 3W87A 3PNZA 1BQGA 4HNUA 4C1NB 5LXEA 4NAEA 3TEVA 4PCSA 1FDYA 4UTWC 3MI2A 2GGGA 2J25A 4ZQRA 1C92A 3HV9A 3SCPA 1C9DA 3BARA 3DFQA 4H9ZA 3TMQA 3VGFA 2Z7KA 4YHGA 3M0JA 1RVKA 1M7OA 1IEQA 2YCKX 1SQ7A 3KRZA 2R94A 3OJGA 2WMIB 1Q6QA 3CQHA 3HBLA 1OX4A 4AIEA 3L2MA 2FFIA 1K1DA 1O1HA 2AKMA 3FYYA 2O9PA 3TTYA 3E0IA 3WX7A 4U10A 3SCQA 4IT1A 2EKGA 2WSRA 3AIEA 2XUCA 3GW3A 3R0DA 2V67A 4L9ZA 4LV4A 2DH3A 3BAIA 4KCWA 4EXAA 4OBRA 5E9AA 1X38A 4DBUA 2ZYFA 3WL1A 3MKVA 2VI0A 4B3ZA 3NO5A 3GAYA 1PZ0A 1C7TA 1B3XA 3R0KA 1B3ZA 2ACRA 2A2IA 1GYMA 5DFAA 3S6TA 3W76A 1A5MC 2G3MA 2C7FA 4CNSA 1Z6KA 2A3EA 1W3IA 2VCCA 1GVIA 1W17A 4AD0A 1JPHA 2XFYA 4DLFA 3NIYA 3SCVA 2HMCA 1OGSA 4MZ1A 4PMRA 2Z27A 4DXKA 3MZ2A 2FH8A 1OZMA 1P7TB 3UA3A 5DY3A 3O6CA 1S2UA 4FNSA 4BS0A 3B9OA 4DYEA 3M0HA 4POCA 3MT1A 3LRMA 3EOEA 4CD7A 2CBIA 3PB2A 3U4FA 4UR7A 1P0EA 4XV0A 4CD5A 2OX1A 3EB4A 5GPRA 4B9ZA 4NZ1A 4U3CA 3WDQA 2VXNA 1RY8A 1ZSXA 3VK5A 3RN6A 4GUHA 1UP0A 3ARYA 3N4AA 1BD0A 4NZFA 2J88A 2FPYA 3GR7A 2XU2A 3LQGA 2E9MA 2IUZA 4J3SA 1JULA 1PIFA 2WW5A 1EJXC 4UTMA 3KS6A 4MJMA 3RAOA 4Q4OA 1MYRA 3M7SA 4IHCA 1TZZA 1N8FA 2YW4A 2P50A 4Y8FA 2EXOA 2Z1KA 3WO8A 1XBZA 1E0UA 3K4AA 4W8BA 3FXYA 4N6EA 1MXSA 4ROQA 1CLXA 3H2MA 4QRNA 1AQ0A 3OA5A 4W86A 4B9YA 3OEXA 3NL3A 2PTXA 3C6CA 3USZA 4ONVA 3NVTA 2J24A 4AWEA 2VNCA 3P8IA 4GH1A 1R2TA 3NEHA 2QT3A 1DJNA 3SY8A 1JZ7A 4NY2A 3UXIA 3MP4A 1K9TA 1NF0A 3VIOA 1KCKA 4GUIA 5T91A 5KZEA 2WC4A 3VI2A 3CTTA 4P7LA 5D4YA 4C5YA 1YLVA 4PGLA 1CEOA 2ZXAA 3M0LA 1KV5A 3BTNA 4D2JA 1JXJA 1JRBA 2QMJA 1TRIA 1OYAA 1WOAA 3YPIA 3GK0A 3OYZA 3T78A 1GTEA 5FSEC 1G94A 2GVLA 2H8XA 2TSYA 1LWIA 3MUXA 1T6MA 3RPTA 1XGDA 2ZA1A 5HINA 1VJIA 4LS0A 1XYZA 1F6KA 1AJ0A 4FB7A 3BC9A 4JTFA 2MUCA 5I09A 4JEJA 3UVAA 5C9UA 5GNYA 1ZRQA 2QUUA 1SU5A 4FNRA 4HSHA 2D3NA 4MB1A 4M6VA 2OVLA 2POTA 3A5VA 2ZQ0A 4XIMA 5I02A 4C6NA 1R85A 5A69A 3VA8A 3ZR5A 2D22A 3GDTA 3IVTA 3W7IA 3PUGA 1PKLA 2YYTA 2DEPA 4PTDA 4NF7A 1GVQA 5LIYX 3M0XA 2C79A 2E9LA 3M5VA 4WXYA 1EWDA 1H2JA 2D2JA 2J9XA 3QHMA 1U1JA 3N9SA 1E6PA 2Y62A 4XX6A 2E6DA 1W9VA 3E2VA 2WSKA 4XG1A 2WZMA 4XO7A 2FFCA 3KS5A 1XD0A 3E5PA 2VQTA 4B5UA 3VCRA 1XCXA 2DZXA 2E5DA 1E6XM 2PWFA 3VU2A 3UCCA 4L9XA 4QG8A 4CQAA 3AZSA 1NWTA 4UFJA 3PWAA 1VF8A 1VR6A 3GDLA 2YBTA 4YWSA 5C8BB 3S4TA 3QW3A 5CSUA 3G2GA 3T4WA 1QNRA 3BANA 5DN1A 4IM4A 2JF7A 4TX6A 2DZSA 2W3ZA 1CIUA 1F2JA 2D73A 1CGXA 1FUYA 2D1ZA 3CWNA 3LZ3A 4MHBA 5HMFA 3L4UA 3W6MA 2BNJA 2JKEA 4WK9A 1RA5A 1EBHA 4O1DA 1YHTA 2D2OA 1QPOA 1F5ZA 1V3KA 3WUFA 4DAIA 2BVTA 3SFWA 4UB9A 4F0LA 3GG7A 2PMQA 2PTZA 4GVFA 5H91A 2EBNA 4F0MA 2ADAA 4Z2KA 3MI3A 3W7MA 3W82A 1VFUA 3QPEA 4J3VA 1CGUA 2DZPA 3LMYA 3HMJG 1LLZA 3WDPP 2PWUA 3M6YA 4EAYA 1F3TA 4W5ZA 3TYAA 2PRLA 3B8SA 4M6PA 1OD8A 3KAOA 1LTDA 1ADSA 1AG1O 1I1XA 4IF2A 1ZCCA 1GPFA 3WD2A 1PS9A 3W7JA 4HOWA 1S2CA 1BKSA 1NEYA 4L1GA 1E0WA 3QEZA 3ZWSA 3MA8A 1C7SA 4LUJA 1PWMA 2YCLA 1I8JA 3R2GA 3CUHA 3TYUA 1G7VA 1DTNA 1RQBA 1UD8A 3CHEA 4DUXA 1V3LA 3GXTA 3L4XA 3W28A 5J04A 1TE1A 3DG6A 2EF9A 2E8YA 5AYIA 1H7PA 1MNSA 5CPLA 3P6LA 2QJHA 5CJ5A 4PUNA 1FCBA 2V3EA 4MY9A 2PU0A 2ZXQA 3EWCA 4MGGA 3W1UA 4H6RA 3WQ5A 3H2NA 4IIGA 5BNKA 2OXNA 2BV9A 3M0YA 3MKCA 4CNOA 2KZHA 2QDDA 3W2MA 1XSJA 3L23A 2EQDA 3IEBA 4LYRA 3BWWA 4GQQA 4CQ8A 3W02A 2XH7A 4WLCA 1XS2A 2R9RA 6PTDA 5HQLA 2FDSA 1EUNA 3QSRA 3NAVA 4OV4A 3C8FA 3S5YA 4IMDA 4JN8A 1J2BA 1KGUA 3NNTA 1XLMA 3JZUA 5D03A 1GG0A 3EB2A 3JRKA 2RDWA 4IFKA 2PA6A 3HQNA 2R1NA 4PZVA 3WUEA 1EOKA 3A12A 2PBGA 4PL1A 1WKFA 1V6VA 3ANVA 3PUOA 3T44A 3GTHA 3HJZA 3UJ2A 5D8ZA 1JG9A 1YXYA 3LPGA 1DWGM 4GX8A 1FWJC 2YJQA 1ZAJA 3TWBA 5FESA 1W3LA 4DM2A 1V8EA 1VYRA 5EKYA 4O1BA 2HSAA 1VB9A 3ZLFA 3IIVA 3BPWA 1ZGDA 1TA3B 3W1LA 4WF7A 2FJUB 2VVNA 3CM4A 3CV6A 1O7AA 1ZALA 5T9CE 5LNSA 3W7DA 1FTXA 4IJRA 4I6VA 4H41A 4QEHA 1TJ0A 4XKYB 3KXQA 2G3FA 3A4WA 1EP3A 3RM8A 3LHYA 4AZGA 5E09A 3BGJA 2VEPA 2XZ7A 3W86A 3RK8A 2QJGA 2ASHA 1XIEA 3N3MA 1QO5A 1JUKA 2NVCA 3O6YX 4C1NA 3BCJA 3WQPA 2YCEA 1GVRA 2J66A 3S42A 2WNZA 2HBVA 4N9CA 5DMMA 1YPFA 3QN3A 5G2IA 1UZ4A 2QUTA 2DVTA 7XIMA 1PPIA 4PUWA 6ENLA 2NXGA 1IWAA 4XD3A 7A3HA 1XFBA 4HMEA 4ZR8A 2P8BA 4FNQA 3RM9A 2WMIA 5CPNA 5BU6A 3FDKA 1PX3A 4S38A 2C1IA 4LEQA 4OHQA 3HA1A 1JL8A 1OCBA 3VNIA 3VNZA 3AFBA 1IE7C 2JK2A 4J27A 3RUBL 1R3VA 5F2LA 3W71A 1TJRA 4W7UA 5FJJA 3UP8A 2OR2A 2B7NA 1EP2A 3WL0A 1F4AA 5IOBA 3NWRA 3EMZA 1LUCB 2WNQA 3AOFA 4LAMA 1H61A 2Q8XA 3O3RA 3QZAA 2XFRA 3HTWA 3QQ0A 4H7ZA 1UBSA 3KRSA 3NFUA 4I9JA 1PO9A 3UWUA 4PMNA 2FTWA 1XX1A 3HJEA 2V6AA 3TAOA 2ZDSA 5CCZA 2A7NA 3BV7A 3XISA 4IGSA 1ME7A 1XLLA 4NYYA 4KFPA 5E6ZA 3UGRA 4OECA 2YGYA 2ALDA 3ID7A 3VOCA 4IJCA 4D6CA 1ML1A 3OZYA 3SUWA 3S9YA 5CGTA 3OGVA 3SB0A 2ZRXA 2CBJA 4JTKA 4H9YA 3A3XA 1E72M 3SN1A 5CH9A 1EB3A 2QJIA 3URQA 1G4TA 4U31A 2GDUA 4KEVA 3GU1A 3VE7A 4K1GA 1QNVA 2WC3A 1UC5A 1TV3A 3TNOA 3FY1A 1R3SA 4QLKA 2CZEA 2EG6A 1MEWA 3IIZA 1UD3A 3KBSA 4NJIA 4JHOA 2XGBA 1UBPC 1Z8AA 4LBSA 3D5HA 3HOJA 3A21A 3USBA 3RLGA 5C7VA 3N2BA 3WUGA 4UFLA 1WCGA 1EC9A 4QHRA 2GJRA 1UD2A 2WMGA 3CPGA 2VCBA 4L4PA 3LXAA 3UR5A 1H1NA 4LAOA 1FWEC 1NF7A 3C2YA 3FN9A 3T42A 4LJ3A 2D0GA 1FH8A 3P84A 4E2BA 1EOMA 1S2VA 3WFAA 2X1RA 1OFRA 3GDRA 3FGCB 1HKMA 2PDMA 3K4WA 3IJ8A 1XPGA 1TWZA 4OJYA 2ZKMX 4IQDA 1LJYA 3A4JA 4ZMGA 2B81A 2WWDA 1KC7A 1VBRA 5CG0A 1G4SA 3H6OA 6TAAA 3C0SA 1AH3A 3GHRA 2Y85A 3NZRA 3KBMA 4DWSD 1VEPA 2REQB 1RR2A 4TXEA 3BSHA 4N6FA 1EO7A 4F3HA 3W83A 3W7OA 1OB0A 2QDHA 3NQVA 2F6XA 3QLLA 1FHVA 4QTGA 3LCXA 3UZZA 4DJFC 3G22A 3G77A 4AZ5A 3C4UA 2X0SA 5K9CA 3WK3A 3JUGA 2PLMA 1RUSA 4IIDA 4WXZA 1HN1A 1UQYA 3W4RA 3LTYA 2OB3A 5REQB 1GOOA 1V51A 2W62A 1HGYA 4CU6A 1UWSA 4TR9A 2QULA 5HQEA 2DT1A 5HXMA 1UUQA 1I75A 2NX9A 3QR0A 1YTKA 1GG1A 2BASA 4LYPA 2D20A 4LFYA 4C6IA 2ZTKA 1O60A 3LLFA 3ZIZA 3H2AA 3CZKA 4E3TA 4UQBA 1SFLA 3VC6A 3WH5A 1MZHA 4BA0A 3CUGA 1AD4A 3TVAA 5JBDA 3EBVA 4P7RA 3LCIA 2Z1BA 4HD5A 4C7DA 5JBEA 1Y8BA 3WLRA 1KW1A 1WYIA 5FEZA 1GQNA 5KITA 3KM8A 2X8RA 2QLYA 3LM3A 3MCOA 3QHOA 3SI9A 5A2AA 2WCAA 3LLDA 3AMDA 3SY5A 1GVSA 4A4AA 3LI1A 1XHGA 3LMZA 3N34A 4OFCA 3AHVA 4TOQA 1HTIA 2VM8A 4ZQNA 3LZ5A 5XINA 3UWEA 3VGGA 4IP4A 3APYA 4NKCA 3FK4A 2FVMA 1XLDA 4HTYA 3KOXA 2JE8A 4P61A 4PRRA 4O8RA 1SJCA 3AYRA 3KTCA 3CU2A 5D2TA 3HB9A 3DG7A 1IYXA 3KBWA 1IXQA 2GSEA 4QG9A 4H04A 3T08A 3ANYA 1XP3A 2WQDA 2BODX 4XB3A 4BEUA 5FJPA 4AXKA 3WK2A 1PYFA 2QF7A 3SRFA 1PJ9A 4AMAA 3L0KA 1QCWA 4QJ1A 1XIDA 3WDHA 2MANA 2YCIX 1P6BA 3T1GA 1UB3A 4JQAA 1K6WA 3T0DA 1S3TC 1F8IA 4Z2GA 4JL2A 5MF5A 2VR2A 3BAXA 4QQUA 2X42A 1XYAA 3LG3A 4Q33A 1TWWA 1LG2A 3MYPA 3RIKA 1BYAA 1JJKA 3KDNA 4QFUA 3ZS4A 4D6EA 3HO8A 1JAKA 2NW0A 2PODA 2J79A 2PDIA 2Q3RA 1CYGA 1OABA 2CZVA 3V0TA 4QBXA 1IEVA 4O19A 5D37A 2ZDRA 3KOFA 4UR9A 3GW0A 5GVJA 4IICA 4Q8MA 2QKFA 1MDRA 2Y8VA 2ISSA 3BJFA 4L4LA 4V15A 1XLHA 1XM3A 3QFEA 1A4LA 1XG4A 3IWPA 1K9FA 3WLJA 3CV1A 4MLRA 3NVDA 1DIEA 1W32A 1DL3A 1ITCA 4JCLA 4BHYA 4MM1A 2CXGA 1EKOA 4HYWA 3OG3A 5G4EA 5HR7A 4MMWA 1Q6DA 3IJIA 3I7RA 3VIJA 4JNYA 1J5SA 2RJHA 1X6NA 3EWUA 1FWGC 4LTSA 4R88A 3WFZA 2Y70A 1QMLA 3JVAA 3P61A 2Y7EA 3R8HA 3VAVA 1HP5A 4GO9A 1RALA 4ICCX 4S3KA 3WMBA 3GX9A 4YL2A 4NUWA 3VIKA 2EHHA 1FWSA 3B06A 5EMUA 4H3DA 1EZWA 3BAYA 3NOYA 1LLWA 3DFHA 4ROPA 1UWTA 3O63A 1XISA 3GC4A 2QAPA 3LX9A 1HJWA 1TIWA 3B04A 2VRQA 3K46A 2NUXA 2OZ3A 3OZPA 5G2HA 2GVJA 1QK0A 4BEQA 3U3HA 2YXGA 3R10A 3UXLA 1NOUA 1EA0A 1VZWA 3WF1A 2ABBA 2HJPA 3WDIA 1L6YA 1WDWA 3W27A 1DQUA 1EJVC 2TODA 2XJ7A 4EPBC 4JIRA 1TPWA 4HPNA 1K7FA 2Q09A 1YNPA 2I14A 2NX1A 4G7EB 4JIHA 4HIBA 1YDNA 4R3UA 3ARRA 5AN7A 1GHRA 4A29A 3N25A 3FV9A 2IKHA 4PL2A 2WZTA 1WZLA 3A5FA 5RUBA 4MSSA 4S23A 1EJUC 1XRFA 4MG4A 2CC0A 4XKYA 2XH2A 1G6CA 1E4IA 1TRDA 2HZGA 1FWTA 3ARWA 4X60A 3KL3A 1RH9A 2E8ZA 4GOAA 1QHZA 4H1ZA 2VQUA 3ISIX 2RDUA 3E12A 4PCPA 1EIBA 2Z1WA 2PRMA 1XCFA 3G1DA 3W00A 4B5WA 4HNOA 3W74A 3IJ7A 5BXTA 5DXYA 5T9BG 1EYEA 5HNRA 2E6AA 3AU2A 3IJLA 4Q8PA 4FO4A 5BW6A 3EA1A 2E67A 2PZNA 4DNHA 4JTUA 1K9DA 3DDMA 3OOQA 3UNTA 1DE5A 3RJYA 4DJFA 2Y5SA 1Q13A 2VL4A 2YBVA 2WWCA 3SQSA 3GVVA 1HL2A 3PAJA 2A0NA 2PBOA 1Y5WA 4NU7A 3B0YA 3AS0A 1OYBA 1QI0A 3WCZA 4H9MA 2VGBA 3EWDA 4US5D 2UWFA 3VX1A 1SJBA 4WD0A 4Z1DA 1KTNA 3ATYA 3WH6A 1UR1A 2OU4A 5BOFA 1IXNA 1EEXA 1VHCA 1YE6A 1LUCA 3FJNA 4N9BA 3ZT5A 2FTPA 1JEZA 3ITYA 3S1UA 1DIKA 1KGXA 5BROA 1I2RA 1MW0A 2VX7A 4D72A 3WNLA 3MO7A 4HSOA 4M8UA 1FQ0A 4FX6M 2OYLA 2VGFA 3ELFA 4DXXA 3G1XA 2I16A 3F2CA 4AY8A 4BF9A 3LEPA 2ZZ2A 6XIMA 4DELA 4AZ6A 3WQOA 4FLRA 3UY7A 1A49A 2P10A 1KB3A 5D30A 4MWAB 1ONEA 2PLCA 2HEJA 2VO5A 2AGKA 1JQXA 4HNNA 2CIPA 3W25A 5DELA 2HVOA 4JBRA 4PTMA 2QJMA 2UY3A 4UOQA 3BDKA 1NOWA 5CPTA 4KWWA 4RDVA 5BU9A 1ENUA 4JX6A 2OSYA 4Y7EA 2QCLA 2BP1A 3AWOA 4TTGA 1FKWA 4NG3A 2W4XA 4XAPA 5IHSA 4UUIA 3T2PA 5BOOA 1O1ZA 3KL5A 3N29A 1YRRA 1RY0A 5EBAA 2QCCA 3PZGA 3L4VA 4RDWA 3OLIA 5C55A 2Z24A 4CGTA 4EPKA 1OGGA 5BOEA 4UFMA 3FGCA 3E0WA 1RXOB 2P8CA 1B2YA 3AHYA 1XQLA 3VZYA 1K8XA 2PDPA 4IGNA 1QTWA 4DO5A 4DQWA 3HIJA 1EDGA 3UVIA 1KXTA 2BY1A 5A6BA 2VC5A 4HB7A 1ZCOA 3PF3A 5EGRA 4RV3A 3SDOA 3BH4A 2REQA 2FKPA 3UZ5A 2IQDA 2RGLA 1K6AA 1SJAA 1NDYA 4J2MA 1F07A 3U8GA 3H54A 2W0UA 4AD3A 1NM9A 1QNSA 3RLHA 1X98A 1PXGA 2A3BA 3F5LA 1VH7A 1NELA 1P5BA 2FGZA 3GBEA 1EDQA 2PC4A 3T2QA 3FFSA 2I5QA 1OSEA 2AAAA 2XFFA 2ZCGA 2FVLA 4WGXA 3ZT7A 3LCHA 3U5YA 2Y5EA 4XISA 4PULA 4PBGA 4HN4A 3LV5A 3TNBA 2IKGA 4EK7A 2XIIA 1OIMA 3RO8A 2FLIA 2CWNA 1TPEA 4L64A 4KGJA 4FAMA 2QCEA 3M64A 4AB4A 4KCVA 3PS7A 1P1XA 2OTDA 2R6OA 1UC4A 3GIPA 1GKRA 1GJPA 2VR4A 2FDMA 3BG5A 4AVOA 3R25A 3OYXA 3NURA 1UJQA 2VFHA 1L6SA 4ZOCA 1SO3A 3W9ZA 5CBJA 1TFVA 1MI3A 2TAAA 4Q22A 4FIQA 4FHAA 2QHAA 3G8RA 1R30A 3HFYA 2DVUA 3O6AA 2BS9A 7CGTA 5EMYA 2YR1A 4MWAC 5KZ6A 3B3DA 3WJSA 2QZRA 4AH7A 3F5JA 4JX4A 4XKMA 4E8CA 4IMAA 1DWFM 4QQ3A 2BLEA 4LPCA 2YZRA 1UWUA 2P3EA 3JW7A 4WEVX 5D9OA 3P93A 3BOFA 2Z6IA 1SO4A 3VZXA 1DXEA 1OD0A 1QOPA 5JH2A 4OUEA 2BGSA 2EJAA 3W0KA 4HU8A 4R34A 3QF0A 3QY7A 3KE0A 2VFGA 4ZTXA 4JGDA 2PI6A 4B2DD 3C0LA 1UR4A 1JZ6A 4GPNA 1N55A 3CUXA 3W7LA 2CLKA 3V18A 3HV8A 2OLHA 1W2VA 1GQKA 1S5NA 3PZTA 2B0MA 4RKAA 2VELA 1M9HA 1OF8A 2DSKA 2ZZ6A 1SFJA 4XO6A 2FB2A 3PZVA 1YXCA 2YL8A 3NDOA 1ICQA 3I3BA 4LVBA 4PTVA 1PTGA 4MPQA 4F79A 4G7FA 1BWVA 2I5IA 1E40A 3ERPA 4BI6A 1MVYA 3H7UA 1TQJA 1E15A 3WEOA 4C6KA 3GD6A 4MNJA 1XUUA 2X40A 1TTQA 3NJ3A 4EAMA 4RX0A 1C8YA 2WJFA 4PTWA 2OQHA 2Y61A 2VD8A 1H7XA 3T0BA 4NXKA 3LK6A 2FGBA 3NQCA 1WO2A 4QG6A 3GVRA 3TFCA 4JFTA 2I7GA 1B31A 2RH9A 5JUVA 3BXWA 3FKRA 3NXLA 1GOKA 4BJHA 4XBSA 1JDEA 3OU8A 4E0CA 3IV8A 2HNHA 1U83A 2CCRA 3KW3A 3SBFA 1XG3A 4GVHA 1TPUA 4Q8OA 2GJLA 3XIMA 3SGGA 1YTDA 2NWSA 1TB3A 4M24A 1H0IA 1Q2RA 3A13A 5AYYA 1UZ1A 2CNCA 1AW2A 3AYTA 3MDUA 1LG1A 1PZ1A 2HK0A 3BG9A 4NIRA 4QSFA 2QDGA 5DEZA 5HMEA 1B5TA 4G1NA 1V6YA 4QISA 3N12A 3CB3A 5TF0A 5A6LA 8XIMA 1DV7A 1WOBA 4WVXA 3DCPA 1W3KA 3MUZ1 2E5CA 5BWFA 4JDBA 2G4JA 4DAFA 5EYWA 4C1LA 1UG6A 3RNDA 1CXIA 4U28A 1BYDA 3B4YA 1KM1A 5HUPA 2TRSA 4F2UA 4RE4A 1R38A 5LHEA 3ZLHA 2XVKA 3K8LA 3EDDA 2X1IA 3FJ4A 4FOUA 3UU0A 1IEWA 4IG2B 1CB7B 5G5IA 3MCNA 2ZX8A 4QM1A 4UTLA 1FWRA 2QXWA 4ZQMA 2IQ0A 4A05A 3UW6A 3LB0A 2FZNA 4NASA 1MW1A 3A9IA 2CZ5A 2D0HA 2ZE3A 4G7EA 3BJSA 3QOMA 5FI8A 5D9NA 2W9MA 2VUYA 2GPTA 4JIQA 4NRRA 2EGZA 4GZIA 5I3JA 2O7SA 4IPIA 5XIAA 2OGYA 1KBIA 4FX8A 3HG3A 1VEOA 4TIMA 2I56A 4JHZA 4ILSA 2Y8UA 2O9TA 4E5TA 5J5RA 3HN3A 3RLUA 1NY1A 4MDPA 3M6DA 4LUTB 2EPLX 3S83A 4FZIA 3GVGA 4O50A 4YN5A 1PB0A 1V6XA 2CU0A 1UMYA 4KESA 4J2PA 5I3KA 1EHAA 1BVNP 3KLKA 4LWWA 1TVNA 3PBUA 4GE8A 4UTTC 4YTUA 3RU6A 3L4ZA 1LP6A 3VXGA 5C2CA 4AWTA 1G9HA 4U4MA 1L9WA 1G01A 3DKLA 4AZ7A 4JN6A 4PMXA 1PIGA 4K6AA 4BWLC 3THUA 4WX2A 1YDOA 2XSBA 1GCYA 2GVEA 2PGWA 3C0QA 1FHLA 3CPRA 4CCZA 3SRDA 3R79A 1MXGA 3GIQA 3EYPA 4LW7A 3GAKA 4LVAA 2X30A 4KH2A 1B3YA 1XH2A 4IL2A 4FXFA 4MJ2A 1OC7A 4QX4A 4GYPC 2J8FA 1Z3NA 2XSAA 1TPC1 4PTNA 3IV3A 4O1CA 3RX4A 3L5LA 2A6NA 3LU2A 3BMXA 3H2EA 2GQAA 3N13A 1B0IA 3VD3A 4I6KA 1RJQA 2EG7A 2ZXDA 3B8VA 3M4HA 3TK7A 1YDVA 4FIRA 3N17A 2OEKA 1SYTA 1KXVA 2ZX6A 4K7YA 1TV2A 5G4WA 1H1ZA 1X96A 1VBJA 2VZOA 2XVNA 1GTHA 4WDWA 1SR0A 2OWWA 4C6PA 1IGWA 3ZLGA 4QEEA 3OZMA 3KVJA 5F1VA 2G0WA 1OFAA 2WSYA 2FIQA 4X2RA 1W5NA 3C2EA 1DHPA 3BLLA 2PEVA 4FX7A 1FFRA 4MFEA 4MWAA 3E2RA 1WZKA 4JQ3A 5BXPA 4QITA 1GJWA 1U1HA 1RQEA 4JTCA 4UNKA 4NX5A 1JI2A 4CCEA 1P43A 1MRQA 2W79A 4IIEA 4M6UA 1WXYA 4AQLA 4PCFA 3VOFA 2GWNA 2J7EA 1NWSA 1NWRA 4NZ4A 5F7UA 3SGUA 3ZJ8A 1Q2SA 3ITGA 4GXMA 1DQXA 3W81A 3VDAA 2ZTJA 1LRNA 1JFXA 3FDGA 1NOFA 5GNZA 3PSWA 5I3HA 1FHUA 2UZ9A 1CDGA 3ORWA 3APGA 3BAKA 4GXWA 5U4NA 4PFMA 5AC6A 3G6LA 4C60A 5CC6A 3KWXA 1XD1A 4HQVA 2WM0A 4QROA 3WEZA 3W6YA 2CLIA 4QJ4B 2HS6A 3KEHA 2RGMA 4GMEA 3L4YA 5C71A 2A7PA 1YDYA 4Z0JA 4GCXA 3O15A 2W63A 3W1XA 4Y9AA 3DHFA 3AUJA 3ZSSA 5HULA 2G3JA 3QV8A 2IKJA 3JR2A 4DX3A 1O66A 1PX4A 1RP9A 1U5HA 4GJ1A 3WLHA 4PSRA 3AIVA 3MU7A 1I2NA 1DOSA 4N0RA 2QPSA 1Q8AA 4LB3A 1CXLA 1AL7A 2EEXA 4PBEA 3MW7A 4DJDC 1XGEA 4EXBA 1OEPA 3S9ZA 2GSJA 1FWWA 5F4WA 5F4XA 4JX5A 3DYMA 4RCXA 5A6MA 3W7RA 1K4HA 2E25A 4LS1A 1FP8A 3NQMA 2ZFAA 2EG8A 3OVRA 3PR2A 1IGSA 3W7HA 3E0LA 2BBFA 4QDPA 4P8WA 1W1TA 4CEUC 2CFFA 2NQZA 4AX7A 7REQB 5TIMA 4XBJA 1THFD 4K3ZA 2G41A 8XIAA 1C8QA 3T0AA 1MZRA 2CHNA 3GZAA 4NAFB 1JDCA 1DTUA 2AGTA 5AY7A 1J01A 3BSGA 5C9WA 3KHJA 1XIJA 1TPVA 3CYJA 4H9UA 2OO6A 1NWUA 3BURA 2PTDA 2OLSA 1H5VA 3PTQA 4OBSA 4X63A 2NQHA 4FXRA 3WLIA 2F8QA 1R87A 3BO9A 3QQWA 4S3CA 1U30A 1I2PA 4PUJA 3LRLA 2VCAA 2GUYA 1EZ2A 4EKJA 2E6FA 3WJWA 3I4EA 4JTAA 5A6TC 5T26A 1GVYA 2DQWA 4J3UA 3W72A 3L2LA 3N4EA 3R58A 4A6GA 3UYCA 4IIBA 3TYEA 3P8JA 3H24A 5F2GA 3H23A 1FWCC 2EPKX 4Z42C 1UA3A 4U3AA 3Q45A 2NZLA 2D2GA 1FWBC 2VGIA 1NSJA 1TZ7A 4RE2A 3G0UA 1FFQA 1Z69A 1KRAC 3L4TA 1LM1A 3HPFA 1CGYA 1LF1A 3SECA 1BFNA 2IPGA 3NQAA 4H9TA 4JXCA 3TW6A 3LA4A 1TX2A 4UTTA 3QJAA 4XZWA 3THAA 2GQ9A 1WBHA 1CGTA 3INPA 2WBGA 4HJFA 7TAAA 4AIUA 1S5MA 3VGEA 1H49A 3GXFA 3CK5A 3QZ6A 2C16A 1Q6FA 5BZAA 3C61A 5FACA 1U1UA 3CMFA 3OHIA 4H7CA 5ABEA 1I60A 1L2UA 1VCFA 4F9JA 1QI4A 3ME3A 3O2LA 3LY0A 1GEHA 4FLQA 2WJEA 2ZWZA 1J10A 6A3HA 4LGXA 5HOSA 2E09A 4GYPA 1V02E 4ZFCA 1TIMA 3H53A 2XHYA 1JZ5A 1JUBA 3FHAA 1E55A 3B4UA 3WJXA 1QDSA 3C52A 3CT2A 4E8GA 1UJPA 4H00A 4M3PA 3MUIA 4CLMA 3BL3A 3ZZ1A 4H4IA 3AXMA 2Y8KA 2AAMA 2ZRWA 2R1KA 2ZA3A 4J5NA 4Z0SA 3A6OA 1UKSA 3NM3A 3LHVA 3HM7A 3MVTA 3UZWA 3NDZA 1DPMA 3DX5A 5C5YA 1XKYA 4IMGA 4LUYA 3D46A 1FX6A 2BXVA 1ZBVA 4D9PA 3U2ZA 1T5AA 3DHPA 3PFRA 1E70M 3TCEA 3CNYA 1G67A 3EOUA 1EJ7L 5LIKX 4F0RA 1EL3A 2J7CA 3W1QA 5CBBA 3VVGA 3UERA 1M68A 1M5WA 5TBOA 3S1GA 5IDIA 3S1XA 2BXYA 4K8GA 3N11A 2RKXA 2PLJA 3PSVA 4IG2A 5DMLA 2O9OA 3WDRA 3PUDA 4LF2A 4Q8UA 3OW1A 1UWQA 1REQB 2NQ9A 5I6SA 1JFHA 3HPZA 4G56A 1ZFJA 3TONA 5EL1A 4N7QA 2HXUA 4HMCA 1N8WA 4O11A 2BOFX 4Q8QA 3RRAA 9XIAA 2ACQA 3DG3A 2EPOA 4ERGA 1KCZA 1SGJA 4GUFA 3WLTA 2RDXA 3BICA 2E68A 3WIJA 3M44A 3NXFA 1H51A 3FOKA 1Q3NA 4DZIA 3M5XA 5CSYA 5PTDA 5G4HC 1GVOA 4X0VA 3KOWA 1BTMA 1LRTA 5GJPA 3ZR6A 4UTIA 4XBKA 3L67A 1BF6A 2ZZ7A 4GXPA 3GDBA 5F2IA 4QR6A 3R7MA 1KCLA 1GWJA 1PV8A 2VFFA 1VPQA 3AIUA 1F76A 3IACA 1EPXA 1TCDA 1F74A 2DP3A 3BZJA 3ZOAA 3RPMA 1MQRA 3TYZA 1DIOA 1KM6A 4HPXA 2CBVA 3QSTA 1I4NA 5CZJA 3B03A 5CC5A 1CGWA 4XD6A 1FBAA 4C6CA 4DJDA 3TR9A 3CPUA 1A4MA 3AO0A 1C9WA 4XD4A 1UR9A 3RLVA 1A0DA 3UNDA 5DMYA 1QFEA 4O17A 2RHGA 2QF8A 3TDFA 1K9EA 4HHPA 1SZGA 2Z4GA 3VO0A 3E74A 3GFXA 5J8LA 2FPVA 1A5BA 1VS1A 1XICA 1Q7ZA 4IMFA 2J7HA 4FR1A 2E6YA 4LUIA 3VNMA 1NDVA 4S1FA 3P82A 1M41A 3CTLA 4JYDA 1CXEA 1ECEA 3SADA 4GVGA 3AAMA 5I3IA 2ZICA 1YE4A 3PPCA 3ZJ7A 3WQ4A 5LIWX 3STPA 4Y8EA 5HR6A 4ZB5A 4OVXA 1WXJA 3G1SA 3VCCA 4H8HA 3K8KA 2OT0A 5JU6A 2FGLA 2JFEX 2WV8A 1B9ZA 3O6DA 2ZUUA 1IZKA 4HA0A 1E9YB 4F8XA 3CQ0A 2ABAA 2A3HA 2RDTA 3PC0A 3R0UA 1Z48A 5DQPA 1W56A 5K3VA 4FMVA 2FJKA 2FZDA 1E4MM 3ITCA 4AU0A 2HQAA 2BHZA 2VZVA 5I77A 3PFMA 1W1IE 1W8GA 1R3WA 2ZC1A 4RZBA 2X09A 5ABHA 1GYLA 1ZBCA 1N8IA 1NP2A 2VEIA 5FIPA 1BSLA 4BQ5A 1C29A 3PBGA 3UR7A 1C8VA 3P81A 3M5YA 3OODA 4JD4A 3LPPA 3CASA 2VZUA 3PTKA 1F3WA 3PY2A 1E3ZA 1WE5A 5I03A 3UFYA 2NT1A 4HMDA 1KXHA 1B4KA 3NL2A 4IFRA 1HX0A 1IEXA 3V7PA 1BQCA 2WVVA 1UH3A 3U2OA 3QTGA 4D6IA 2DW7A 4G9PA 5HMDA 3UA4A 5L6UA 3M1ZA 5DY2A 3P5YA 1QXLA 1HG3A 3AYVA 4C6DA 4GI6A 4DJEA 5HWMA 4GZ7A 1MFVA 4KWOA 1JQVA 2B31A 3WENA 2NQLA 3Q67A 4TVCA 3M46A 2HPMA 1RP8A 4GBUA 1VCGA 3C2OA 4WDUA 4C6LA 5EFDA 3FXGA 3OVPA 4W84A 4XVEA 5LNUA 2DH2A 3OGSA 4S3AA 3WNMA 1CB2A 4L1XA 3RDKA 3VNYA 1TMQA 5EU9A 3WG6A 4GH3A 3T2OA 4Q8NA 4Q7IA 4XQ6A 4YVXA 2PDBA 3GBDA 3G1AA 2BHYA 3WF0A 2WHLA 1TUFA 1CXFA 2PDNA 3UBPC 4HNCA 4US6A 2OYMA 2WKLA 3V3WA 4LBUA 1Q8JA 3RGTA 4R9OA 4LVDA 3ABQA 3NR0A 3BLFA 4YTRA 2VJXA 1XC6A 1RJPA 2EAWA 1SMAA 3BLIA 2IMRA 3T8LA 1SMDA 2PP1A 1QU4A 7REQA 3WELA 3G1FA 2PWEA 1T7LA 4YTQA 3AMCA 3QLDA 2DJLA 4N42A 4JHMA 1JPDX 1BG9A 5CSSA 3CYVA 3IRDA 4OV9A 4XAZA 3H26A 4JTQA 1XLAA 3TOYA 4PUKA 4MPKA 5GNXA 3EEGA 2J13A 3P5ZA 2NLYA 5CG7A 2X2GA 5AHMA 3WF3A 4HNVA 2V68A 3WNPA 4Z08A 4WOQA 4AFYA 3AALA 3HQOA 3NG3A 3VIGA 2WK2A 1JDFA 4M80A 5H6HA 1FA2A 3S2CA 1W5OA 4JFVA 4DWSB 2QIWA 1ONWA 1GK8A 3BLOA 3H55A 1H62A 3CHDA 2H9AB 2X0YA 4WSJA 1W1PA 4H83A 3VOHA 3UWWA 2YCJA 4H8NA 1VENA 5H2ZA 3V1PA 3WQCA 1TTPA 5A8GA 4ATDA 3PWIA 4OT7A 1VFFA 4HZ6A 3H7VA 3QPYA 2Y7FA 1A3WA 4JN7A 1C91A 5D9PA 1VYSX 3EMQA 4AZIA 5HK4A 3WEMA 3ITVA 3H2OA 3N3TA 1E6RA 3ARQA 2QQ6A 2HISA 1I1WA 4FR6A 1HJSA 2J75A 4GI9A 4O10A 4OTKA 1EUAA 3CUFA 5FJTA 3G3MA 3RMJA 1BF2A 1TPB1 1W5QA 4JTIA 2BXZA 2WYSA 3GKFA 2VRKA 1FRBA 3UXDA 4TU1A 5L9FA 3G8EA 3TFXA 3STCA 4LB4A 5AZ1A 4BI7A 3AMLA 2HCVA 3UJSA 4G8TA 3BMWA 4GQGA 4DF0A 2VTFA 1V6UA 4O1AA 1QJWA 1ICPA 4QS5A 3NPWA 3Q4DA 1W1ZA 1WX0A 2OO0A 1I0BA 1WKYA 3UWQA 1QI3A 4GUJA 1EBGA 1DJHA 6CGTA 3P3BA 3IK4A 2Q8LA 1D3HA 1GZJA 4ERAA 2Y2WA 2WCGA 3NQBA 2DUXA 2Z1VA 4G2DA 2PDQA 3MP5A 2CZFA 2O92A 2HXTA 4E2DA 4J1OA 4KIEA 3MVIA 1PDYA 1KM0A 2CHOA 2Z26A 3QRHA 1IQ8A 4LCRA 2WVSA 3V5CA 4WDXA 1LQAA 2OFJA 5T8GA 4DPQA 4HU0A 5XIMA 1VGAA 4UTJA 3RPDA 3UWZA 1L0PA 4MAVA 3TV8A 3N6JA 3WD4A 2V5KA 3DHDA 4A22A 4A3RA 1X8CA 1YW1A 2XPKA 4DO7A 2ODOA 2C6QA 3PTDA 3NYDA 3OGRA 1RCOB 5LA0A 1JI1A 1HIZA 3SM0A 3GDKA 4XUGA 4MKVA 2ZVRA 3LBMA 4WUIA 3SEPA 1JPKA 4WQ6A 1PZ2A 5CGMA 4NHVA 3H2CA 5LKYA 1D9EA 3FS2A 1T0OA 1RBOB 4I5RA 1OWQA 5HDRA 5A2CA 3ITTA 3LI0A 1O6IA 2B4GA 1OM0A 4JAWA 3GQYA 4N9DA 2V82A 2OPJA 4JY8A 2UY4A 2PP3A 3SUVA 4NJKA 1NJJA 4DWSC 5M1TA 4MZYA 1BVZA 3TSDA 3WBAA 4NYUA 4GG9A 5CAKA 2PGEA 1PYMA 3RR1A 2Z25A 4DY1A 1BWKA 1OZQA 2V5DA 4P8VA 5LIUX 2ON3A 3M47A 4GQBA 1SFTA 2EKCA 1EFZA 1QNOA 2PWDA 1KKRA 2YPIA 3RILA 5AKQA 3LSCA 4F48A 3LUTA 2WSPA 3LHUA 1ONRA 3SCRA 3NQ8A 1R0MA 1W1YA 4J40A 3VIFA 3ZO9A 4JR5A 4AHOA 2J6VA 1PKMA 1UWIA 3SUUA 1BGAA 2PC8A 1SJDA 4GI8A 5EBUA 4JQ2A 1FXQA 2V0TA 1W5PA 1HVQA 2PPGA 1LDCA 4C65A 4PMZA 4LUSB 3QZEA 1ZP3A 2QYGA 4BQ4A 5GJMA 1H4PA 1M65A 1KBLA 3H8AA 3L2IA 3RHGA 1H09A 4P7OA 2P0IA 3CAVA 1JDAA 2CKSA 3TX9A 1UUMA 2Y0FA 3P62A 4JOMA 1SVDA 1PTAA 3M7WA 5AHEA 2D24A 1W3JA 2XN2A 4MLJA 1XJBA 2V63A 4LC8A 4RZ5A 1RK5A 3U2EA 5A8MA 2DT2A 4UTHA 2GUBA 3VD4A 1PE1A 3UXAA 1W1A1 3QGAC 3CZEA 3WDJA 4PCTA 2Q02A 3N2TA 3EWZA 3HURA 1SO6A 3VNJA 1OQFA 2P5NA 4JTRA 1KCXA 2A3CA 4HZ7A 1TPFA 1DYSA 1A5SA 4JTTA 3GVQA 3RXZA 2WJDA 2XM1A 5K9XA 3TROA 3U7BA 3GXMA 3HPSA 4HA1A 3ARTA 1SR9A 4XTDA 2OKTA 1OHLA 2GQ3A 2C71A 2DU2A 1B54A 2XYLA 1DJXA 3GE7A 3Q2DA 4ML9A 3PVFA 3SCUA 3L5AA 1V0NA 1D8CA 4YPJA 3EGJA 2I9UA 3T81A 5ECUA 1XLIA 1CXKA 3WN6A 3CL8A 2WBKA 4C6QA 3FSUA 4MDOA 3W53A 4CUCA 2DIEA 4JFUA 1DJWA 1WDQA 4E4FA 3QYSA 4KRUA 3TR2A 3TZFA 2WHJA 2J77A 3BG3A 2VYOA 2VRJA 1MWOA 4LYQA 3SR7A 4GGBA 2TMDA 2NQ5A 4YMZA 2Z1SA 1ME9A 3VE9A 1V0LA 1ZHAA 4JQ1A 1NP0A 1ZNNA 2HV5A 4AZCA 1IHIA 1SW0A 1XYMA 4UNLA 4ERIA 3K8MA 1PIIA 4JZ5A 4MZ8A 1WP6A 1ZJAA 1FVPA 3FSTA 6XIAA 1RLCL 4FK9A 1X1OA 2QDEA 4IJBA 5FJOA 5KETA 4W88A 4AC1X 4O0QA 1OVDA 1KM5A 2V81A 1XCWA 4GWEA 5E93A 4IPPA 1SZFA 3KVKA 4UQEA 3TN4A 1TQXA 3EPMA 2OGJA 3HQ1A 1EA9C 4NP7A 2WNNA 1C3FA 4ZXOA 3S5OA 5ECVA 4A8LA 1KLZA 2QJNA 4X61A 4LAUA 4RZ6A 4HP5A 4RL3A 5DCEA 1TV4A 4QNWA 2Z2UA 1HGWA 1PCKA 4MVAA 1JDDA 1WDRA 1JXKA 1DXIA 3SRHA 4I7VA 2SFPA 3GSMA 5HUOA 4YVVA 3T4CA 3WLMA 3CGTA 3I4KA 4KIRA 3TA9A 1GJUA 3OO2A 4ZXLA 3P74A 1N82A 3THQA 5D02A 2ISVA 2GGIA 3VNKA 1SFSA 1POJA 3AIBA 4IP7A 1Y0EA 4BF5A 2WCSA 1CXHA 3UGVA 5I06A 1UD6A 2G96A 3M9YA 1DJZA 4JTGA 3TYDA 3TQPA 1XF0A 3TW9A 2BY3A 4AIOA 3MCMA 1MDLA 5LGZA 2A6LA 1ITUA 3CH0A 3AS3A 5FEWA 1E5JA 3VKBA 1AQMA 3HG2A 1IR1A 4KKXA 4Z2HA 2V5LA 4I7WA 1WUEA 3MUAA 1TPDA 1XBXA 1W9DM 3T6CA 4QE1A 1XDMA 4K38A 5EMLA 4GFIA 1J0IA 4R33A 4M82A 3GLCA 1I9CB 4XZMX 3LPOA 1V4YA 4E2VA 3VFCA 1F6YA 3EPOA 1F05A 1DKWA 5K4ZA 2OOFA 4IIHA 1PKNA 3TW7A 3FA5A 1Q7QA 1CLVA 2YDSA 4UTWA 1FCQA 4MWAE 1XQKA 1EJRC 3ATZA 3E0VA 3GH4A 5DT5A 1SSGA 4IXXA 6TIMA 2WMFA 3N6HA 2YDAA 4HOXA 1G1YA 5CLTA 5AYBA 3B9EA 4CEXC 2R8WA 3E02A 2TPSA 1E6ZA 4QLJA 4RNFA 4O4VA 2CESA 1V79A 2O56A 3FA4A 3VD7A 1E9IA 1ZTVA 1Z9AA 1HJVA 1UD4A 4HYRA 2DPEA 4M56A 3D3AA 3DESA 4DWSA 1TWSA 3W73A 3UY8A 2H9AA 2OX4A 3GNDA 3SN4A 2J74A 2PTWA 4A8RA 4PMJA 3UPBA 4V33A 2BDQA 3LTSA 3ARXA 1UIOA 2XIMA 5E0KA 4AY7A 3H12A 1EH9A 3MV11 4MUZA 4QJ3B 4C6JA 1P1MA 2PDKA 3VCNA 2GJXB 4YCOA 1E9LA 1F61A 3TQKA 1GZ1A 2PZ0A 1B9BA 1RQHA 4WKFA 5JVLA 4UMBA 4XAFA 2E1WA 4B92A 1O95A 2YLLA 4F2TA 3R8GA 1IIGA 1K4GA 4L6DA 1IT7A 3CLMA 4ACZB 1JCTA 4JEQA 1A80A 4GCAA 4WY0B 3NQFA 1OBAA 3WH7A 3BQ6A 4WZHA 3I3EA 1E9ZB 1CLKA 4JFWA 2CLLA 4OOZA 4Q6JA 1MEIA 1BPLB 2J8GA 3MJYA 3TA6A 4IMEA 1GW1A 5D09A 5JH1A 1PUDA 5BRPA 2AOSA 2DJXA 3R13A 1R3QA 2XN0A 4D6DA 1XRTA 2E28A 4PUDA 3W7PA 2G8ZA 3F03K 5HPCA 2DZAA 4GGHA 2ZX7A 2IQTA 4K2SA 4YVPA 2AL2B 1JZ8A 2FMNA 2FPTA 4NAEB 4P2VA 5D32A 1XDLA 3L7RA 4A21A 2J6XA 2CITA 4FLSA 4D71A 4HOZA 1D8WA 2V5CA 1JCXA 3S2MA 1AUSL 4RW3A 5MKGA 2EPHA