1LF1A

Crystal structure of cel5 from alkalophilic bacillus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
298
structure length
296
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGITVFRAAMYTSSGGYIDDPSVKEKVKETVEAAIDLGIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWDNQIKPYAEEVIPVIRDNDPNNIVIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel combination of two classic catalytic schemes.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Cel5
total genus 109
structure length 296
sequence length 298
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lf1A00
3UG3A 2BVYA 4UQEA 3WENA 2YA1A 1CGVA 2E4TA 4MAZA 3VKKA 3AIVA 2WM0A 1M01A 3RM9A 1MXGA 3TA9A 3KL3A 3M46A 3EMCA 1B30A 5I79A 3WH9A 1C8YA 4AIEA 1X1NA 2X1IA 1AMYA 5CG0A 4BA0A 1KGUA 4DWSB 5IHSA 4AD2A 2YOCA 3I3BA 3CHCA 5A6AA 2GDVA 5A8MA 1OIFA 4NZCA 4CCCA 4JFUA 5I77A 1OIMA 4DWSC 3MSDA 4AISA 3BCDA 4UQDA 1YHTA 3GNRA 2J25A 1DP0A 1GVYA 3CTTA 2VQUA 3VIMA 4W93A 1W3JA 3T0AA 4EANA 2O9PA 2VX7A 5JBDA 2E8ZA 3WEOA 1H0IA 1SMAA 5FOOA 4P8WA 4D6HA 3EMZA 3CHFA 3EDEA 3K1DA 4W7WA 1RD6A 4TVCA 4GZJA 2CKRA 2D3LA 2YA0A 3VTRA 3WD4A 4M80A 4MB3A 2OSXA 1TCMA 3G6LA 1BLIA 1UWRA 1ITXA 1UWUA 4GZIA 1HL9A 3MUZ1 1J0IA 3VIKA 2WLYA 4D1JA 3VIOA 1J9YA 5E0CA 1QI2A 1BSIA 1UR0A 2CPUA 2VX5A 2J8GA 2EXOA 3OLDA 3SUWA 4HU0A 2VNCA 3W24A 4D72A 3WDQA 1H2JA 2OWWA 1HX0A 1W3KA 2ESCA 1EOMA 2WCGA 4CU8A 8CGTA 5ABFA 5I3DA 1W1TA 4H2CA 1PEZA 4BQ5A 5HDRA 3AZRA 4AD5A 1XSKA 1JIBA 2DPEA 2VRKA 1DWGM 3SUTA 2IUZA 3K4DA 1D2KA 2Y24A 4MTVA 2WKGA 4EK7A 3DHUA 2UY4A 3A4XA 4E8DA 2ZUUA 4E8CA 3BAKA 3F4VA 2XWDA 5LYRA 1JZ2A 1JYXA 3LPGA 1JNDA 4TX6A 4JCLA 2VX6A 1GQLA 2W67A 4PSPA 1DTUA 4N42A 2DT1A 1WZAA 1CXIA 1W9UA 1E0XA 3W38A 1HF6A 4UZSA 3W25A 2W5FA 3BGAA 5E09A 1ITCA 1JGIA 2YDSA 1UD2A 1V3JA 3UERA 4UQCA 3CMGA 3WQVA 5EFFA 1B90A 4MNJA 3ARXA 2CYGA 3U5UA 2WNWA 5ECUA 3ZR5A 4V27A 2DH3A 3L4WA 1E6NA 3MU7A 3UCQA 1QNQA 2WZIA 1CGTA 1G1YA 2OSYA 3MMUA 2XVLA 3BAJA 1D7FA 4KH2A 1QW9A 2V5DA 1V3LA 3AZSA 2G8ZA 4J3TA 3JUGA 3WDIA 3OGRA 2YDQA 3AYSA 2XGBA 3WH8A 1PX4A 2A3EA 3N9KA 6CGTA 4UOJA 3NIYA 4U5IA 4NRSA 5I2UA 4HMEA 1H0GA 2XM1A 4MNMA 4W85A 2HVMA 3OLIA 2J7DA 1UD8A 1VFFA 1I75A 3IK2A 3A3HA 3L4XA 2OSWA 2ZIDA 5JUVA 1WPCA 2QLYA 4AIUA 4PN2A 2G3NA 2FH8A 3PZ9A 5EMYA 2Y2WA 4J3WA 3WQWA 1J01A 3WEMA 4IISA 3VINA 1O6IA 5JBEA 3WQ8A 4PMZA 1UH3A 3K8MA 3SEPA 4TOQA 1EHAA 3T0DA 3OZPA 4F66A 3U5YA 2E0PA 4UZUA 1WAWA 4MNLA 1DHKA 1WP6A 2XIBA 4GINA 2J79A 2WPGA 4AD1A 4DUVA 2BY2A 3VIHA 2CHNA 3W27A 4U5KA 5IDIA 1C8QA 3EYPA 4HPGA 1C7SA 3SUUA 1JZ5A 1QNRA 4W8BA 3THDA 4IPNB 1TR1A 2YL5A 3GH5A 3SUSA 4IM4A 3W53A 1XC6A 3ZJ8A 1JYNA 4W7VA 1O7AA 2UY2A 1RH9A 1FFQA 3W26A 1EDQA 1UWTA 3PZQA 1E1EA 1VF8A 5KZ6A 3WN6A 4D6CA 1KFWA 2GJPA 4ZENA 5A2AA 2VR4A 1B31A 1FHDA 1Q6DA 4ACZA 1W9XA 3WBAA 5A2BA 4ATDA 2GK1A 2W63A 4CD4A 1L0PA 3OGVA 2VQTA 5CGMA 2YKKA 2XHYA 1W1VA 4FMVA 5KEZA 1XSIA 2J7CA 4Q22A 1FH8A 5GNXA 2WANA 1B3XA 2WC4A 5M3WA 2J7HA 2PWFA 2PWHA 3WFZA 1MYRA 2G41A 2X09A 4PMXA 5ABFB 1CGWA 2WVUA 3VGDA 2DGAA 2ZUSA 1UWIA 3VIJA 1HNYA 2VVSA 4NF7A 1VB9A 1JD7A 1A47A 1PZ2A 3WDHA 2D3NA 2VI0A 3EBVA 2YA2A 3U7BA 5E6ZA 2AOSA 1TFVA 4W86A 4H8HA 1K9EA 3CGTA 5D8ZA 3VIGA 3SCVA 2WXDM 3VIPA 4CD7A 1CXKA 1GQJA 3D5HA 3HN3A 1ECEA 1UD5A 1JZ3A 3GBEA 1SR0A 1QI4A 1HP5A 1JDCA 1ZBKA 3L4TA 3ARZA 3RIKA 1V6YA 4UR9A 2WVTA 2YL8A 2ZUTA 5E9AA 5BXPA 1OM0A 4ATWA 1KB3A 3W4RA 1B1YA 2VJXA 1A3HA 3KWXA 3UR7A 2BXYA 3ARWA 1CIUA 4ZXOA 3UEQA 4JFVA 1OBAA 2DSWA 2JIEA 3MV11 3OGSA 1WDSA 1OT1A 4UCFA 3DYPA 3I3DA 3WEZA 3N04A 1VFOA 4CCDA 3EDFA 1OD0A 3WFLA 3AIWA 5A94A 1JF6A 4C7FA 2FGZA 4A3YA 4QDMA 3AHVA 2DSZA 3GXFA 3VGFA 2VMFA 1CWYA 4AD4A 3MO4A 3EDKA 3WD0A 4R5EA 1G9HA 2PBGA 2D0FA 4P7RA 5ABEA 2J7FA 1JI2A 1E71M 4TX8A 3ARVA 1CBGA 3AHXA 1C92A 3POHA 5LA2A 1WDRA 1VFMA 3AMGA 1QW8A 3T2OA 2ZXBA 2ZWYA 3PZMA 1V3HA 4M1RA 2XGIA 1UD4A 2F61A 1U2YA 3GBDA 4S3JA 4IPLA 4N0RA 1EXPA 4LYQA 2VVNA 5CPQA 5JIWA 3ZJ7A 1HKKA 3RO8A 3AXXA 1GQKA 1HJXA 1FA2A 3VIFA 3HU7A 1ISWA 2WMFA 2ZWZA 2VZOA 1CNVA 3ARRA 2E9LA 3FHQA 1OT2A 3FN9A 1XH1A 1EA9C 5GQBA 3IAQA 4CD6A 4CN6A 2YL9A 2WCAA 1ZB5A 1ZBWA 4MADA 5A8OA 1BPLB 1EO7A 1W3LA 3MUY1 1JDAA 1UWSA 5D9MA 5FKYA 4JFSA 2EPLX 5CGTA 3II1A 5A6SA 4R27A 3TTQA 1MW1A 1EDGA 1E6SM 1NP0A 3PZTA 1KR0A 3AMLA 1JYVA 3K8LA 3AQUA 4AZHA 5DO8A 4WIWA 4PMDA 1FFRA 1V6XA 1V0NA 3LPOA 4U2ZA 3RJXA 3W6MA 5ABHA 2PC8A 3L4ZA 1UZ4A 4J3UA 1WE5A 4KWUA 4MDOA 2WAGA 1E4NA 4CD8A 3VMOA 2O9OA 4OIFA 1GOOA 4NRRA 4BQ3A 1DWAM 1ODZA 1V0MA 4AMCA 1HXJA 3WMBA 3W29A 1IZJA 2JF7A 5AYBA 4M81A 4P8XA 5GNYA 3T09A 3GM8A 2EPNA 1E40A 3NYDA 1JFHA 1W91A 1ISYA 1E6ZA 4PMUA 3SCNA 2A3BA 5M17A 2XUCA 2O92A 1HP4A 1E55A 1MW3A 1VEOA 4GO9A 2NSXA 5D8WA 4OKDA 3KZSA 2VO5A 4F79A 3ALFA 3QHMA 2YL6A 1RPKA 2J47A 3BSHA 1OD8A 4MNKA 5CLWA 1LL4A 1MW0A 1PIFA 2J77A 4MPKA 4PMRA 3GNPA 3BCFA 4F9JA 5F7UA 4JIEA 1EOKA 1CEOA 3WQ6A 2B31A 1JXJA 2A3AA 1HIZA 2DIEA 3MANA 2DT2A 4P7OA 2OYLA 4UTFA 3ARYA 3TOPA 1H09A 2ZX5A 2GVYA 2NT1A 2D2OA 1FP8A 3LPFA 3OA5A 1CYGA 3VM5A 2D0GA 4RE2A 3ARPA 3VX1A 1HT6A 3N12A 2X05A 4B16A 4GZEA 3QOMA 3RM8A 1FOBA 1DEDA 1CGXA 4Z2JA 2WKLA 3WF0A 1NQ6A 4HZ8A 3M6DA 1ZU8A 2GFTA 5CPTA 2W91A 4QAWA 5FIPA 3BLPX 3OZOA 1EDTA 2W61A 5A95A 2C0HA 4UNIA 1QI3A 1CLVA 1B2YA 3WQ4A 2VZTA 4AEFA 3OG2A 1LWJA 2ZXDA 1OGBA 1W2PA 4WJXA 4WKHA 1BVZA 1IZKA 3SCRA 1FH9A 1NOWA 2QHAA 1KR1A 4RE4A 3IJ8A 1HJVA 2FHCA 2ZUWA 3ZT7A 5BCAA 2GUYA 1BF2A 1ESWA 3VDAA 3WDJA 4PTMA 1E15A 3B9AA 3AXHA 3WD1A 4CCEA 2VZVA 3MKKA 2J8FA 3MSGA 2EEXA 1EGZA 2WC3A 3APGA 3AIEA 4CU7A 2GK1B 1B9ZA 3KE0A 4GXPA 2V3FA 2VCAA 1HKIA 1D3CA 1WDQA 4H04A 3FW6A 1H5VA 3WL0A 1EQPA 3VGHA 4MB1A 1V03A 3TP4A 2Y8VA 4AZ6A 2G3MA 2ZUVA 4JFTA 1JDDA 2BS9A 4LYPA 3AHTA 4FLRA 2VT0A 1QI5A 3OB8A 1FHLA 2BVTA 3DECA 2D0HA 3NJ3A 4FF5A 1CZ1A 3AIUA 5CXPA 4QP0A 4DWSD 5I0DA 4OBSA 4D6JA 1EHNA 4UQ9A 1MVYA 3ZOAA 3I3EA 1NOFA 1NARA 4AY1A 1R7AA 3ZSSA 4CKQA 2JE8A 5E6YA 4EAMA 1TG7A 2JALA 3M07A 3WNKA 2ZXQA 3PTQA 4QLJA 4YHGA 1VENA 2XFYA 4HP5A 2YIHA 1GOMA 2J74A 3WDRA 3WF3A 2J7GA 3W81A 1GHSA 4ZXLA 4DUXA 1JZ8A 4J3VA 1TE1A 2Y8KA 3THCA 4ZE4A 1LG1A 1E0WA 1UH2A 4LYRA 5D9PA 2XFRA 3RCNA 4WSKA 3AIBA 1CXLA 1QHZA 1WB0A 4Z2LA 3NUKA 1GQIA 1QI0A 1V02A 4QCFA 1E4LA 1MQRA 2QPSA 4AZCB 1HJSA 1G5AA 1XHGA 1K9TA 1W9VA 1BTCA 2D24A 1TA3B 1BVNP 1LL6A 1UR9A 3AJ7A 1KBKA 3PZGA 1V6VA 2XFFA 4Q7NA 4CN1A 4OOUA 4YPJA 4PEEA 3LMYA 3VD4A 2XVNA 4CU6A 3CUHA 4H8UA 5A8QA 2ZX6A 4DM2A 1LQ0A 2Q8XA 1VAHA 1K9DA 1GJUA 1TZ7A 2WWDA 3VMPA 3WMSA 1OWQA 2PBOA 4PCSA 1V6UA 4HOZA 1UR4A 2XSBA 5I23A 2GDUA 5LA1A 2J7BA 2VC9A 2WSKA 1JG9A 4LX4A 2QMJA 1ISZA 5BXSA 1KGWA 2EBNA 4PTXA 2XPKA 4AZBA 3PZUA 2VTFA 2CXGA 5GNZA 2VUYA 2ZX7A 3BSGA 1KWKA 1KQYA 3WDPP 3OLEA 2F2HA 1DWHM 1QNOA 1C8XA 3WBEA 1QHPA 1QVBA 1C3FA 3FHAA 2JIWA 2WMKA 4GKLA 1NM9A 3WNPA 4LGXA 3T08A 4WKFA 3CZKA 4MB4A 5FCZA 2HISA 2YLAA 1CLXA 4GQRA 3NSXA 3CMJA 1QNSA 3SCTA 4V28A 2UWFA 2XIIA 1JZ6A 2GJXA 3VO0A 3WY1A 1AQMA 1ZBVA 3O9NA 5HPCA 4AZ7A 4Z2GA 5DMYA 1M53A 4YHEA 2W62A 4LXFA 1KBBA 2BXZA 2FDMA 4CGTA 1J0HA 1W1YA 1M04A 4KMQA 4YN5A 1CGYA 1W9BM 2J62A 4RE3A 1WKYA 3NDYA 2CBVA 3BAXA 2AMGA 1UKQA 2YJQA 4B9ZA 5ABGA 3WUGA 1WZMA 4K68A 1B3WA 2QV4A 4JHOA 1UHVA 2DT0A 4HOXA 4OJYA 3BXWA 1V0LA 3DHPA 1BG9A 4FLOA 2FHBA 3EMQA 5JBFA 1OB0A 2F8QA 2NW0A 1GOIA 3O6AA 4DWSA 5IHRA 4J28A 1JF5A 1RP8A 4OZOA 4ZFMA 3QR3A 3L4VA 5A8NA 4D6IA 1XD1A 4JL2A 1WZLA 4UFLA 4W8LA 1UR1A 4MB5A 6A3HA 4TVDA 1I1XA 4Z2KA 1PBGA 3F5KA 3SCOA 5DEZA 2WBKA 2E8YA 5FL1A 3ZSTA 3A6OA 5DT7A 2CETA 1C7TA 5EFDA 6TAAA 4HTYA 3WNMA 3O2LA 1PZ3A 4FLQA 1GW1A 3WD2A 1SYTA 1L8NA 2DSVA 2GJRA 2Y4SA 3SCUA 1E6XM 3MMDA 1JD9A 2IXUA 3WH5A 1ISVA 1HKMA 1LF1A 4UFIA 2WVSA 1HJQA 3VVGA 2YBUA 2J78A 4ACYA 3ZIZA 2E40A 5CLTA 2XVGA 2ZXAA 3AS3A 3SCPA 4M82A 5A6JA 1BQCA 1J0ZA 1Y7VA 2EPOA 1J18A 1BFNA 2W92A 2WSPA 2X0HA 4HOWA 1CPUA 5A6BA 1ZL1A 3MMWA 3VD7A 1NWSA 1WO2A 1Q4NX 3PTMA 4AZ5A 1GCYA 2VRQA 2JFEX 3KL0A 4CD5A 5HBFA 1FH7A 5BXRA 1V08A 3GTNA 5IFPA 2A3CA 4Y7EA 4TUFA 4AD0A 2BV9A 3ZT6A 2CERA 1W9DM 3GXMA 8A3HA 4CN4A 2CIPA 5D9OA 2EPMX 3K46A 3AROA 3AMKA 3WNLA 1OGGA 2VOTA 3VMNA 3WF4A 1E1FA 4BF7A 2CEQA 1U33A 5A1AA 3TTSA 3GYCA 4WK9A 2WHMA 3B9EA 4AWEA 5JIPA 3RM4A 4P7NA 3AIQA 2CKSA 2CESA 1AQ0A 4D6DA 4EKJA 2ZOXA 2XYLA 4HMCA 4H7VA 1JYWA 3T0BA 4BZYA 4AIOA 1LLOA 3N13A 2UY3A 5A69A 1CGUA 4EE9A 4AEEA 1TVPA 4AZGA 1W3HA 4DUWA 1JFXA 1UH4A 4Z2IA 1E6QM 2E9MA 3AISA 3ZM8A 3WQ5A 3ARTA 4H8VA 2DIJA 1E73M 2BHUA 3ZO9A 1UQZA 1HKJA 4JL1A 2YLLA 1NWTA 3GXDA 5CPSA 7A3HA 1C91A 3UESA 3ARQA 2XTKA 3AICA 2O9RA 5A8PA 3WMCA 3VD5A 4WLCA 1XGZA 1LJYA 4JKKA 1GPFA 2YBTA 1PJ9A 9CGTA 3RPMA 2WK2A 2EO7A 1E9LA 5IFTA 4QFUA 3VD9A 4PTWA 3L4YA 1H3GA 3W28A 2E9BA 3SCSA 2BHZA 3G6MA 1UA7A 1XD0A 3GZAA 1ODUA 3NDZA 2V38A 2QPUA 4D6GA 4JKMA 3AMCA 2TAAA 1GNXA 3ARUA 3BC9A 2CBUA 3J7HA 4UQBA 1TUXA 4GI6A 7TAAA 2BNJA 5BYWA 4ML4A 5BRQA 2QMKA 1EQCA 3MV01 2WWCA 3CLWA 4HZ6A 4TXEA 3CZJA 2GSJA 2WMJA 1VFUA 4A3HA 5E70A 3SIMA 4UOZA 3CZEA 4L4OA 2CCRA 4BQ4A 2XG9A 1MFUA 2FHFA 1UKSA 3PHAA 3AIRA 2G4FA 3ZQ9A 1K6AA 3IAPA 3AXIA 1VEPA 2WZHA 4MAVA 4PTVA 3OBAA 1M03A 3A47A 2CHOA 1R85A 3EDDA 5A6LA 2PF0A 1UKTA 3HJEA 2FGLA 4UFMA 5DFAA 3D3AA 3WNNA 2DDXA 2V5CA 4W89A 4B9YA 2MANA 3T2QA 5CSYA 3CH9A 2WZEA 3DC0A 3VGGA 2VCBA 3WIJA 2WHKA 4B3LA 4X0VA 2VCCA 2NT0A 3L2MA 2J75A 3ZMRA 7CGTA 4QLKA 5HOSA 4JHZA 3FNDA 5C8BB 2CITA 1ZJBA 2EPKX 1BG4A 1V3KA 4ZEPA 1BGAA 1Z32X 4AYSA 5LA0A 2VURA 3CBWA 4KRTA 4J3XA 4W84A 3RJYA 1R86A 3CUGA 3NSMA 2OYKA 5I78A 1VBUA 1JAEA 2WVVA 1XCWA 3PZOA 4BQ2A 2IXVA 1W1PA 1CXHA 4PSRA 3MS8A 3GDBA 5C70A 3FY1A 3AS1A 2WMHA 2Z1KA 1WCGA 5HNNA 3KEHA 1KCLA 3UETA 3BH4A 1XCXA 3EDJA 1UZ1A 4HZ7A 4CVWA 4DM1A 3VDBA 1I1WA 1J0KA 4JZ5A 4ZE5A 5D4YA 4LPCA 2G3IA 3F5LA 1RP9A 1UKOA 3ZT5A 2X2YA 5DF0A 1AVAA 5A6MA 3FAXA 3QHOA 1HVXA 1YQ2A 2DEPA 4E4PA 2WHLA 1GOQA 4C7DA 3PZVA 1CECA 3W6LA 1Q6CA 1E5JA 2WC7A 4W8AA 3CPUA 1J0YA 3OIHA 1B3VA 1KQZA 1EIBA 3GXIA 4P8VA 3N18A 2WVVB 2PI6A 1CXEA 1GVIA 1LG2A 3N17A 1Q6GA 4JFWA 1UR2A 1JZ4A 1GOKA 4B3KA 4QCEA 3VU2A 3SCQA 1TMQA 3B8SA 4OOZA 1H11A 1F4AA 3CZ8A 4KGJA 4X0NA 1XRVA 1HVQA 3POCA 1GUVA 3B9DA 3ALGA 2WB5A 1UUQA 3S6TA 4PMNA 3U7VA 3AMDA 2XVKA 1XH0A 4GO8A 2Y5EA 1OCQA 2C7FA 3AS2A 1S46A 5A6BD 4PYSA 5EBAA 2V3GA 4H41A 1TA3A 3GH4A 2CBIA 3AS0A 1N82A 3T2PA 3CHDA 4AXNA 2YDRA 1M7XA 1UOKA 5M5DA 4M8UA 5GPRA 1ISXA 1ZS2A 4BCEA 3CUIA 3CHEA 4F8XA 2J4GA 2QF8A 3VDHA 2ZICA 5BRPA 2AAAA 1VIWA 2BY0A 1H41A 2OLHA 3N1AA 1WZKA 4J7RA 1U30A 4E2OA 3BMVA 2OWXA 3VDCA 3QHNA 3VILA 1Q6FA 1VEMA 2RGMA 4W87A 1MW2A 2XM2A 1JI1A 3VGBA 1HN1A 3PZNA 1BHGA 4TVUA 1G0CA 3KL5A 1QBAA 2BFGA 3CZLA 1GORA 4HU8A 3PZIA 3AOFA 1VBRA 2D22A 4U3AA 1V0KA 1R87A 2PB1A 3L4UA 1OINA 3MUAA 1E56A 1CTNA 2WMIA 4BS0A 4UOQA 5AYIA 4Z2HA 1CENA 1J11A 3W37A 5TD4A 1HL8A 1OGSA 1PAMA 3TONA 4WSJA 1V3IA 3WH7A 3A4AA 3DYOA 4PMOA 3BAIA 3ECQA 1BGGA 1US2A 3CUFA 5CQ1A 1BYDA 3WKZA 1B3YA 3DYMA 5HXMA 4W5UA 2ZUNA 3AYRA 3W0KA 3L2LA 1H1NA 2C8NA 3ARSA 2WCSA 2D23A 3N11A 3WD3A 5I6SA 5AC4A 3VD3A 1GJWA 1SMDA 3VOCA 4A4AA 1PX3A 2WLZA 1KWGA 3A4WA 1VJZA 4P7LA 1E0VA 2CBJA 4AW7A 3WELA 1IT0A 1MFVA 4C7GA 4HA3A 1NOUA 3QOKA 3HMCA 3VGEA 4UFJA 1KXQA 1QBBA 3UG5A 4URIA 1X6LA 1Q6EA 1MXDA 3WUEA 4OUEA 4AD3A 4XB3A 4PMYA 1BAGA 1R8LA 4XZBA 4M56A 3K8KA 1PPIA 2XWEA 1WNOA 1MWOA 5CZKA 5IXEA 3SURA 4F9DA 2BY1A 5D9NA 4U3CA 2ZE0A 1LWHA 1E5NA 2DSKA 3ZJKA 2JF6A 3WH6A 1GHRA 4MJ2A 3VX0A 3PTKA 3PBGA 4UQAA 1H4PA 4JKLA 1R7OA 1XH2A 1J10A 2EJ1A 1G94A 4W7UA 1TVNA 1UWQA 4U2YA 2RGLA 4PMVA 1DWIM 2BHYA 4JCMA 1CXFA 3FAWA 1P6WA 2WMIB 5C71A 1KCKA 2PWDA 1QNPA 4P7QA 3RDKA 1KXHA 1UA3A 4PUDA 1EO5A 1V02E 3WSUA 1H49A 1QOXA 1JXKA 2VL4A 1W2VA 3BAYA 1JZ7A 2BY3A 5HPOA 2XSAA 3AHYA 3F5JA 1NH6A 4W88A 2W66A 2PWGA 2G3JA 3WUBA 4J3SA 1PX8A 3S2CA 1UQYA 1PIGA 2BVDA 3CZGA 2WBGA 4GI8A 1VRXA 4U33A 1C90A 5AY7A 2EQDA 3SCWA 4IUGA 5M03A 1GONA 1E72M 3VNYA 4B15A 2JEPA 1MQQA 1E6RA 1WDPA 1OSEA 1B3ZA 1XYFA 1W9PA 4AZIA 1GZJA 2FH6A 2CNCA 5FL0A 4X9YA 3ZR6A 1F4HA 1UG6A 1BYAA 4MJ4A 5EB8A 3NCOA 1JAKA 1KGXA 1C93A 1QHOA 3ZJ6A 2VX4A 3QGVA 1NWUA 4FK9A 3BMWA 3VPLA 1E4IA 2Z1SA 5BROA 4JAWA 4ATLA 2DT3A 4HA1A 1ZJAA 4D6EA 3SUVA 4RL3A 1EH9A 3GNOA 5E0FA 3CO4A 4KRUA 3WUFA 4D71A 3LPPA 3UR8A 3WF2A 3M7SA 1SFSA 3K4AA 4KGLA 1J12A 3BLKA 1UKPA 2UY5A 3AZTA 1G01A 1BYCA 1DWFM 1XSJA 4XX6A 4CUCA 3W82A 5BXTA 3PN8A 4GI9A 2WMGA 4HA4A 4S3KA 2DSUA 1W32A 4NSBA 5A6KA 4PBGA 2ZX9A 4V2XA 1E4MM 1XV8A 4GPNA 2X8RA 2OWCA 4XZWA 2WYSA 3WF1A 5AC5A 5CJ5A 3IJ9A 1VJSA 3BAWA 3VUPA 1DWJM 1X6NA 3NSNA 2VR5A 3GH7A 4LQ1A 3AI0A 3VNZA 4CVUA 1UD6A 3IJ7A 2WHJA 1ZBCA 1US3A 3OLGA 2W4XA 3WNOA 2D1ZA 2WW5A 2A3HA 1IV8A 1JNEA 1V6WA 1K9FA 4WKAA 2GJXB 4TTUA 3AHZA 4XUYA 1E70M 3VIIA 5I5RA 1KXTA 1XYZA 3U57A 1J0JA 2ZUMA 4U31A 3TTOA 1FP9A 4L4PA 3N15A 2D20A 1HJUA 2VRJA 4ACZB 1LL7A 2PWEA 1B0IA 4FLSA 3FXYA 4GIAA 5BWFA 2ZX8A 1V3MA 3AFBA 4UFKA 3RMEA 4D6FA 4M29A 4HMDA 2VZUA 4QLLA 4PCTA 1BYBA 1UD3A 4GQQA 3MUIA 2JEQA 2OYMA 1GOWA 3IANA 1QPKA 1AQHA 1NWRA 3CIVA 4M24A 1E3XA 4PUEA 4WF7A 1UYQA 1JL8A 2XJ7A 2O9TA 1E3ZA 3VM7A 4W5ZA 2J7EA 5CSUA 5I24A 1HJWA 2X0YA 3WL1A 2V3DA 1NP2A 1MQPA 4PMQA 3CUJA 1CDGA 4AZCA 4MDPA 4D1IA 5DT5A 4TTGA 3UG4A 5A2CA 4AC1X 2DH2A 4NI3A 1UR8A 4UFHA 5A3HA 4XV0A 4P8UA 4HPHA 3RILA 5FD0A 2VZSA 1E6PA 4OBRA 4PRWA 2V3EA 3TTYA 1KXVA 2E3ZA 4J27A 3E1F1 1E43A 2DQXA 2XVPA
chains in the Genus database with same CATH superfamily
3UG3A 1K1DA 1CGVA 3NFUA 2ACQA 3P7YA 4QJ4B 4XAFA 1NTHA 4I5UA 4AMAA 1A3WA 1OFPA 3EMCA 3LCGA 1B30A 5B7ZA 1F3EA 4LUTA 4AIEA 3PPCA 1XYAA 1FWSA 1F61A 3VYLA 3CHCA 3NPWA 1AJ2A 4RZ4A 4PUNA 2FB3A 2J25A 4GGHA 4ZB2A 2VQUA 3V7PA 1PIIA 4FNUA 4LVAA 3T0AA 1Q85A 2ZRZA 1RJQA 3UBPC 2P53A 1EP2A 4M6PA 4W4QA 3LV6A 4RUBA 3E0LA 3LBMA 3EMZA 3EDEA 2CKRA 3WD4A 4MB3A 3VABA 3S2JA 1BLIA 4JHMA 1ITXA 1UWUA 2Q3RA 1R3YA 1JPDX 3GVQA 4DBSA 5D2YA 5E0CA 2VWSA 1JGMA 1QI2A 1F3TA 1UR0A 1KFCA 4ZBCA 2J8GA 2EXOA 1M41A 3W24A 1DYSA 2X16A 4D72A 5FJRA 2HXTA 4JTAA 5FF7A 4LFYA 4CU8A 8CGTA 5ABFA 3LEPA 4BQ5A 5HDRA 4AD5A 1LDCA 3GK0A 1F7BA 1KM6A 2OODA 3G8RA 2VRKA 5SWUA 2HPIA 4RDVA 3RAOA 5JU6A 3CV1A 3CIXA 1ZQ5A 1W1B1 2NV2A 5HJXA 4E8CA 1JYXA 4UTIA 1DJXA 5I09A 3C86A 1VCVA 1DXIA 4H83A 4PSPA 2PU0A 1B57A 4UR8A 4WOZA 1EJWC 3DCPA 3GUWA 5KMYA 2HEJA 1Q6RA 3BGAA 1ITCA 1LOQA 1JGIA 4XVEA 3G77A 2EHHA 4NUWA 1SZRA 3CWNA 1K70A 1PS9A 4MNJA 2ZRUA 4FPSA 1K8ZA 2WNWA 2VC5A 2X7VA 1E6NA 1V93A 1HGWA 5CG7A 4XBKA 1QNQA 2WZIA 2XVLA 3BAJA 4EF9A 2RHGA 1SZGA 4KH2A 1WQ5A 1UMLA 3FA3A 3LGDA 4EACA 2YBVA 3KVJA 3M0YA 5F4WA 1ZSXA 1F05A 3AYSA 2XGBA 4NJJA 1K8YA 1TX0A 2P5NA 3PWIA 3G1DA 4CNPA 1XGDA 2PTZA 3G0SA 5LZLA 2VGIA 1ITQA 2HBXA 3R13A 3TYUA 3STFA 1RY8A 4KQNA 1AZ2A 2XM1A 1OFAA 1TJ1A 2J7DA 2XIMA 2B7QA 1UD8A 1VFFA 2OCZA 1JJKA 3GFZA 5C0QA 2YXXA 3E5PA 5EMYA 4JN8A 4RNIA 2DZUA 3QZAA 4AX6A 3WQWA 4IISA 2QCMA 3VINA 5JBEA 1N8FA 4JD4A 4PMZA 4PB4A 1UH3A 3K8MA 5CSSA 2ALDA 3P5ZA 5HULA 1EHAA 1XIMA 1NDVA 3AU2A 3T0DA 3OZPA 2GLKA 4F66A 3U5YA 2I7GA 4N9DA 1WAWA 4JQ3A 4MNLA 4PL2A 2J79A 1ICQA 5FJJA 3VIHA 2CHNA 5IDIA 1C8QA 1A5NC 5D30A 3VK5A 4HPGA 4DO5A 1FQ0A 4W8BA 1S1RA 1XLBA 2QUNA 4IPNB 3CQ0A 2CZFA 2OT1A 1QRQA 3W53A 1XC6A 1JYNA 4H7ZA 5LIWX 3FJ4A 4CNUA 3W26A 1UWTA 1E1EA 2PZ0A 1DJNA 1XW8A 3T44A 1P6CA 2WNZA 4ZENA 2PRLA 4F0LA 3NQEA 1W9XA 3VXGA 3EX2A 3S8HA 1HQTA 3KBWA 4YTTA 2Y88A 5D38A 2YPIA 2V2HA 4HTBA 5KEZA 2J7CA 1BVWA 3CO8A 5GNXA 4IG2A 2QCDB 5M3WA 4F0MA 1VR6A 2PZNA 3V75A 2G4JA 2J7HA 2PWFA 1R2TA 1MYRA 1CGWA 3BTNA 4GH3A 3NNTA 1XR2A 4WSHA 4HSHA 1YTDA 4YL2A 4NF7A 1LCOA 3LHZA 1JD7A 2F84A 3TZNA 3SBFA 4AQLA 2YA2A 2EKCA 3U7BA 4PCNA 4F0KA 1TFVA 4H8HA 4B5NA 2WXDM 4EXAA 3W87A 4N4QA 3GNDA 3D5HA 1NAL1 4XIAA 1UD5A 1JZ3A 3GBEA 4DI8A 1SSGA 1HP5A 3H54A 1JDCA 3VOFA 3ARZA 3C56A 1V6YA 2GSEA 4UR9A 3W4RA 1B1YA 3UR7A 1RCOB 2BXYA 3UEQA 1OBAA 3W07A 3CYJA 2DSWA 1R3VA 2JIEA 1OT1A 8RUCA 3I3DA 3KX6A 4JQ1A 1S2VA 4DJEA 3PSWA 4DHGA 2PTDA 7REQA 3VE7A 3QV6A 5LIYX 4C7FA 4IGHA 4FALA 1Q2RA 4XSMA 1GT8A 3FDKA 4PFMA 2PWUA 5H8UA 3P0WA 3GXFA 1CWYA 4AD4A 3JVAA 3TOYA 2GJLA 2V8ZA 4H1ZA 1G9HA 3FKRA 2PBGA 2YYTA 1O94A 2D0FA 5H91A 3HA1A 4Q6JA 3Q37A 1XKYA 3EWUA 3LY0A 3VCNA 5LNUA 3FYPA 3HGSA 4Y9MA 2QIWA 1VFMA 3ZLFA 3PB2A 3P84A 3FSTA 1TQXA 2XGIA 2F61A 1U2YA 3GBDA 2PDPA 4DYKA 2VVNA 2PTYA 3RO8A 1KKRA 4IQDA 1NVMA 3MVIA 3H6OA 1RHCA 2A0NA 3GB6A 3OA3A 2IQTA 1HJXA 2WMFA 2VZOA 1O60A 3DEQA 2QKFA 3FVMA 3ARRA 4K3ZA 2CLFA 3HF3A 4S38A 3BCJA 4R9XA 4NAEB 1BD0A 1TPVA 5GJMA 1BPLB 1EO7A 2UZ9A 1W3LA 1MNZA 3MUY1 1UJQA 5CGTA 4X61A 3MZ2A 2DUXA 2HVOA 2FZ8A 4HQVA 1NP0A 3BMXA 3K8LA 5KETA 4MPQA 3FGCA 3RJXA 3L4ZA 1UZ4A 4J3UA 3LSCA 4CD8A 3VMOA 1V6TA 4ENLA 1GOOA 4Q8UA 1DWAM 3NQ6A 2FDSA 4QQ3A 1I45A 3WMBA 3M16A 3BOXA 1IZJA 4IGNA 3LERA 1Q3NA 2PFHA 1RQEA 4M81A 5AHFA 4O1BA 4P8XA 3T09A 2CLHA 3ITLA 3NYDA 1JFHA 4GFSA 1E6ZA 1UROA 4PMUA 3SCNA 1HG3A 3LENA 3C2EA 3W2LA 1P4CA 1E55A 1MW3A 5D8WA 3KZSA 3QHMA 3OQ8A 3NYZA 2YB1A 3WQEA 5CLWA 5LIXX 3H22A 3GZ3A 4L64A 4HCHA 3ERPA 3P2VA 4PMRA 3RPTA 3LCIA 1EOKA 1UCWA 1JXJA 2A3AA 3TQKA 4JNMA 3KTXA 1H09A 1SU5A 2D2OA 3O1NA 3TWBA 2QUMA 1F9CA 5REQA 3OA5A 3VM5A 4DNMA 4NZ1A 5DRCA 4LAUA 2X05A 4JX4A 2R24A 1FWEC 1FOBA 3LYEA 5E93A 2A79A 1DEDA 3LD5A 3DH7A 1CGXA 4IFKB 1UASA 4Q4OA 2HK0A 4HZ8A 3DOPA 3M6DA 2E67A 3TK7A 4HYVA 4GNJA 2C0HA 4C6OA 4ALDA 5CC5A 1R0MA 1QI3A 1CLVA 4BR1A 4GOAA 4AEFA 1W2PA 4XAYA 1V7YA 1MUMA 4B5VA 3PTDA 4LANA 2QHAA 1KR1A 1HJVA 3MWAA 2ZUWA 4Z1DA 1EYWA 2XH2A 3ZT7A 3AUJA 1THFD 3VDAA 1UOZA 1XRSA 1OFBA 5MKGA 1O68A 2HK1A 1KFJA 3AXHA 3WD1A 4YCOA 3QFEA 1FDJA 1I2QA 2WC3A 4RZBA 2XN1A 3I7QA 3VE9A 4PFHA 1SW7A 2QCEA 2XIQA 1VLIA 1D3CA 3HFTA 1I2NA 1XQLA 4KWWA 3GTIA 3S42A 1WDDA 4IX0A 4WDWA 2PDWA 3I7RA 1EGVA 4FB7A 2ZUVA 4FLRA 5JH2A 2GDQA 1H7RA 4B91A 4M1BA 2FZ9A 4RNJA 2C3ZA 1CZ1A 4QP0A 3W1QA 4ZCWA 2ALRA 5HUPA 4XZLX 3B4YA 3SAZA 1LYXA 4O53A 4KEZA 1PDYA 4L9YA 4MZYA 2YCKX 4QEHA 5D05A 1XUZA 4RLIA 4YIWA 2YIHA 1Q4WA 1GVRA 3WF3A 4Q8OA 4ZXLA 4GRSA 4J3VA 2VD8A 1ZLPA 3EB2A 4O10A 3W85A 3RLHA 3THCA 4ZE4A 2R6OA 1AODA 1E0WA 1UH2A 4LYRA 3RCNA 1A49A 1CXLA 3P62A 1WB0A 1E4LA 4F3HA 1HJSA 1G5AA 4PUMA 3C61A 2ZDSA 2LLEA 4K8GA 2PDCA 2EKGA 1BVNP 4I8DA 1UR9A 2B7PA 4HKPA 4H3DA 2XFFA 3FXGA 1KRCC 3A9BA 1NDYA 3LMYA 1SR9A 1ONXA 4GC4A 4H8UA 3W2UA 3A3WA 1EBGA 7PTDA 4WGXA 2ZX6A 1LQ0A 1LBMA 3NL3A 1KRAC 1K9DA 1TZ7A 1IWBA 2PBOA 4IIDA 4PCSA 1PCKA 4DBEA 1Z8AA 4ORIA 2C18A 1UR4A 4B2DA 2DQWA 3BLDA 1ZPTA 5AC8A 4Z17A 2P3EA 3SI9A 3BO9A 1JG9A 3P6LA 2QMJA 2NUXA 2KZHA 2TMDA 2QVHA 1KGWA 5BXSA 3TSDA 3ICJA 1FWFC 3PZUA 3HO8A 9RUBA 4OQVA 4UTLA 3RF9A 5GNZA 1RK5A 5F1VA 3OLEA 1DWHM 1WOBA 1QNOA 2R1NA 3EWXA 1C8XA 3L0GA 4UNLA 1NY1A 1QHPA 2B7NA 3WLLA 3W83A 4LBSA 1C3FA 4M5PA 2JIWA 1A4LA 1NM9A 3E3HA 1LROA 3CZKA 1AL8A 4UIOA 2HISA 1CLXA 3ITTA 4RW3A 1TV4A 1JUBA 3N25A 1JZ6A 3VO0A 1ZBVA 3O9NA 4ZO9A 3V5FA 3UGVA 3RLVA 5DMYA 4YHEA 2W62A 4V1YA 2JGYA 3UGRA 1T7LA 4LXFA 3B0VC 2FDMA 4CGTA 1J0HA 4L1XA 4KMQA 1XICA 1HW6A 1IEWA 1W9BM 1WKYA 4XZHA 3BAXA 2J27A 4EX4A 4R7JA 3O15A 3SSZA 5C7HA 4HOXA 4JTGA 4OJYA 3LUTA 1W0MA 1BXCA 2EF9A 1RA0A 1JVNA 1ZAJA 5JBFA 3AUOA 4F48A 1OB0A 4YYFA 3EX4A 1TWSA 5IDZA 4DWSA 1KTNA 1JF5A 3LV5A 1QXLA 1XYBA 3QR3A 9XIMA 1S2AA 3GFYA 1EBHA 2VM8A 2RFGA 3BG9A 1WZLA 3OIXA 3ME3A 2AMXA 5CGQA 1IXPA 1I1XA 1T40A 1PBGA 5DEZA 2IPJA 3N14A 5FL1A 3ZSTA 1MRAA 5DT7A 3QW3A 5EFDA 3HG3A 2PDMA 1PZ3A 4FLQA 2RKXA 1CB7B 3E0FA 1PYMA 3PUGA 3CAWA 1L8NA 1GVEA 3W1XA 1EGMA 4G7EA 1UPMB 2V2DA 4M6VA 3MMDA 2VGFA 5E0KA 4YMZA 5DBUA 2WVSA 3CNYA 2Y85A 4XQ6A 3W2MA 1OADA 4ACYA 1SO4A 2E40A 2MNRA 3GRIA 4LUJA 1FHVA 4OU1A 1YYAA 3WLMA 3DG6A 2VKZG 1S5WA 3JZEA 2W92A 3VOGA 2DFAA 1TZZA 5EMJA 2PODA 2PRHA 1W1A1 4DBWA 2V82A 1TPEA 2ZYFA 1GCYA 2VRQA 1EFZA 4LV9A 4GY7A 3UCDA 3KL0A 5HBFA 1QDSA 3GUGA 5K7JA 1V08A 3GTNA 1Y65A 3R2GA 4TUFA 4AD0A 1W9DM 4R33A 3GXMA 8A3HA 3U4AA 1GVQA 4FAMA 5D9OA 1EJ7L 3TFCA 2QR6A 3K46A 5G1MA 3EPNA 2OPJA 4O0KA 3NQ8A 1A0DA 4ADSA 3QZEA 5D2TA 3D46A 2WHMA 4AWEA 3I10A 1ZP4A 4MUPA 3OBEA 3AIQA 2CKSA 4UBPC 2CESA 3G1RA 4XKYB 3PM6A 1E51A 2GVGA 4H7VA 1XKJA 5T26A 1LLOA 3VCCA 2UY3A 1E9YB 2EAWA 1K6WA 1UH4A 4OV9A 3V0TA 3C6CA 1BWVA 3ZM8A 3KTSA 3ARTA 3TMQA 1I2OA 1KBLA 1XLIA 1E73M 2XGZA 4FIRA 1HKJA 1OYCA 4O15A 1NWTA 3GXDA 5CPSA 5AZ0A 1TV3A 2QAFA 1BKHA 3UESA 3ARQA 1D3HA 4N7QA 4AWTA 1LJYA 3LN3A 1W1IE 1GPFA 2YBTA 2C19A 3RPMA 4B5XA 4DI9A 3SN1A 5D2VA 5IFTA 3L4YA 1ONRA 3UR5A 3OBKA 3WK2A 1ODUA 5I02A 2ZDRA 4M3PA 3IJIA 3LXBA 3G1XA 4UQBA 3OVRA 1QW7A 3UZJA 1UR3M 2WWCA 4WY0B 3AXMA 4Y9PA 2Q71A 4BF5A 3FLUA 4AXKA 2WMJA 1FWHC 4H9VA 3SIMA 5IBXC 4QG9A 3G22A 2CCRA 2XG9A 2FHFA 1D8WA 3PHAA 2Z7GA 3ZQ9A 3T40A 1VIZA 3AXIA 2Q09A 4XZMX 4D8AA 3OBAA 3A47A 3EDDA 2CHOA 3UW6A 3GHSA 1H51A 4PL1A 3WNNA 2DDXA 2EGZA 4DWDA 4B9YA 4UTHA 1UC4A 5FAJA 3R0UA 1PKLA 1Z69A 1M7JA 1V5XA 4JYDA 4JIHA 2GGJA 2VCCA 2NT0A 1ZTVA 2C15A 2VEPA 4ERAA 2OZ3A 3FNDA 3PY2A 1VJIA 1BG4A 2RJHA 4HNVA 3ZZ1A 2P0OA 2VURA 1GKQA 4KRTA 5I78A 3AYTA 4YVXA 2INFA 4DIAA 2DP3A 3PZOA 5F4XA 4BQ2A 3AU6A 2E6DA 1W1PA 1LM1A 3GKAA 4FF7A 3MS8A 3GDBA 2WMHA 3B8DA 4DBUA 1WCGA 1FY6A 1A5MC 5HNNA 3KEHA 2Z4GA 1SW3A 3BH4A 1XCXA 3EDJA 3HQPA 4CVWA 1EWEA 3P60A 1TTIA 3E74A 4DX3A 3KBVA 3W71A 4WXZA 5DF0A 3PFRA 4Z1YA 4JX5A 2B81A 1AVAA 5DCBA 4LTSA 3FAXA 3QHOA 2DEPA 1OC7A 1QT1A 1H50A 1GOQA 4C7DA 3LHTA 4XSLA 4JTLA 3IVUA 3W6LA 4UTMA 2PDBA 5G1YA 2WC7A 1ZJHA 1PXGA 1J0YA 4L5ZA 1TIWA 1B3VA 4IGMA 2DY3A 3W84A 1LG2A 2ZVIA 1XWYA 4ORMA 2WQPA 2GQAA 1JZ4A 3SN4A 4B3KA 1XDJA 2QIIA 3L23A 1XIDA 3NGFA 4DLFA 4DAFA 1XRVA 2FTPA 2DZVA 1EXBA 4PTDA 4V15A 4NILA 2ADAA 4PMNA 4RDWA 1MEWA 3MUCA 1G4PA 2NV9A 4PYSA 5EBAA 5HMFA 1TA3A 3AS0A 1XRFA 3T2PA 2G3FA 5HNUA 3VOIA 4LF1A 3BW4A 1ZS2A 2OQYA 2WJDA 4S2BA 3QR0A 4XZNX 1S5NA 4C60A 1OVDA 3N9SA 4LC6A 2J4GA 4GJJA 2I1OA 4K36A 2BY0A 4FIQA 3M5YA 2OLHA 2NSOA 3QHNA 1AZ1A 1ZCCA 4NZ4A 3IIXA 4ZVJA 2XM2A 3QM3A 3W00A 1JI1A 1HN1A 1IIHA 3C2YA 4INFA 4TVUA 1H7XA 3KL5A 1QBAA 3DFQA 1GZGA 3NQDA 2G0WA 4PC8A 1OQFA 3F2CA 1J96A 2J8TA 3RLUA 1D9EA 1VBRA 4U3AA 1K4GA 3W7PA 4EPKA 4UTUA 1E56A 4GQBA 1QUMA 2BG5A 6PTDA 4UOQA 1RA5A 3UQNA 4O50A 4Y9OA 1HL8A 3L68A 1PHWA 3K30A 1QR7A 4LAZA 2ZRXA 3R4IA 4Q4KA 3CB3A 4YTQA 5H2ZA 2Z26A 3T05A 1US2A 5CQ1A 1BYDA 1R9XA 3DYMA 2WQDA 4CNTA 2ZUNA 4ZOAA 1OCJA 3W0KA 3L2LA 3EPOA 2C8NA 3JR2A 3N11A 3IUHA 5I6SA 3P8JA 3E5BA 2ZBTA 1X8CA 3TJ4A 1GJWA 3EKGA 1YIXA 3SO7A 4BI7A 1SMDA 4RK8A 3RHGA 2WLZA 3IV8A 4EVZA 1E0VA 1LQAA 2CBJA 2E6AA 3RX4A 4HGXA 3S5ZA 3B06A 3V0SA 4UFJA 1KXQA 1W37A 4NJGA 2HS8A 3WQDA 3GS6A 3UVIA 3DFYA 1D3GA 1R8LA 3O63A 2FPVA 4M56A 4F0RA 1PPIA 4ROPA 1KD0A 3UXLA 1WNOA 2RH9A 5IXEA 3W7JA 1YX1A 1D8CA 2YDAA 1ZFJA 4LJ3A 4U3CA 2E6YA 2P0IA 3MDWA 3LU2A 2NX9A 4HA0A 1OK4A 3VX0A 4Y9AA 3PBGA 3UJ2A 5HQLA 3LG3A 3WLKX 2E7FA 2EJ1A 4YNGA 3M6YA 3LNMA 4R7WA 2PD9A 4W7UA 1YE4A 4O1EA 2GPTA 5C9RA 4QISA 3VZXA 5C71A 2PWDA 2Y1HA 1UA3A 2IKIA 2QJJA 3LXCA 3LS9A 2X41A 1JXKA 3GHUA 3TAOA 3COTA 4MZ8A 3WQCA 1NH6A 4IFOA 1SM9A 5K2ZA 2AKMA 2W66A 1SSDA 3WUBA 1RK6A 3B03A 1PX8A 2V67A 1US0A 2PDIA 3CZGA 2OFJA 1PVNA 2X1UA 3H55A 4GI8A 3O16A 3VKCA 3ITVA 3R1ZA 4HU4A 5AY7A 2EQDA 3SCWA 5M03A 3CAVA 3KRUA 2OEMA 5JVLA 3F4WA 1E72M 1WDPA 3KLLA 2FZDA 3W88A 3NEHA 2I14A 4RKAA 3ZR6A 1F4HA 4XUGA 3VC6A 1W5QA 4FX7A 3DN5A 3M0XA 3N2TA 1C93A 3DFHA 3G2GA 3ZJ6A 2VX4A 2ONEA 3NXLA 1NWUA 4QGCA 4WZHA 3VPLA 1E4IA 3GDKA 5FEZA 2JQXA 4ATLA 1VFTA 4LEFA 4DB7A 2GGGA 2PDQA 3SUVA 4KRUA 2PUZA 3WUFA 4D71A 2F38A 3UR8A 4AHPA 1C9WA 3G0UA 1J12A 3BLKA 1UKPA 8XIAA 4NVTA 1BYCA 3QYSA 4Y90A 2DUZA 1XDLA 3MI6A 4CUCA 1H63A 3CUXA 4H2HA 5GJPA 4GI9A 1O66A 2WMGA 5F1UA 4S3KA 1C9DA 1VBGA 5CZJA 1VPXA 2ODOA 3S6DA 2WNNA 4V2XA 2ZFAA 3C2VA 3W7MA 1XISA 4XZWA 5CAKA 1F74A 4NYUA 3VUPA 1DWJM 3IVTA 2YCLB 1X6NA 1UJPA 5MHBA 3O6CA 3TLLA 2OT0A 3QQWA 1SFLA 4WUIA 1FWNA 3NL6A 2D1ZA 1MO0A 5RUBA 4WKAA 1W5NA 3AHZA 4YWSA 1E70M 3WJSA 4LSBA 1HFBA 2DJLA 3GY1A 3GO2A 2PDYA 5C9ZA 4ACZB 2J9XA 3WQOA 3N73A 4IF2A 3B0YA 3N9RA 3MPGA 4MUZA 4GIAA 3QR1A 3OVGA 3U48A 2ZX8A 4LAKA 1V3MA 3WYZA 4UFKA 3RMEA 4M29A 4HMDA 4KCTA 1Q8JA 1BYBA 3ANYA 5I3IA 3D0CA 3ZLGA 1QPKA 3L67A 3DAQA 1NWRA 4EXQA 5BZAA 1DJGA 1PV8A 3N6QA 3VM7A 4W5ZA 1FXQA 2J7EA 3FOKA 2X0YA 4FOUA 5AHLA 1P1MA 1NP2A 1XLKA 4PMQA 1CDGA 2PWVA 5CBJA 5F2IA 3R58A 4D8LA 3NQMA 5A2CA 4MWAE 2X42A 4R88A 4UFHA 1NEYA 4XV0A 1AFSA 3NVTA 1GVFA 5FD0A 3GW0A 5HINA 4MF4A 3SRFA 5XIMA 1KNWA 4E3TA 1YXDA 2E3ZA 2HMCA 1E43A 2XVPA 5HQMA 2Y5SA 3HFYA 5C2CA 1XBYA 3WENA 1TV5A 3N2OA 3V5OA 3GU9A 4MAZA 2VEGA 3AIVA 1P7TA 1M01A 5DMLA 3REQA 3DZ1A 3RM9A 3KL3A 3M46A 1TJ0A 4XTDA 1O1ZA 1VPYA 4GX9A 1KGUA 4BA0A 4ERGA 2QCNA 3GLCA 5CZ0A 4RPPA 1OIMA 4DWSC 4LS2A 3TDFA 3BCDA 4UQDA 3WO8A 1TPDA 1C29A 3GNRA 1EF3A 4FOJA 1YTKA 3VIMA 1KBJA 4W93A 5FEPA 4PRTA 2O9PA 4S1FA 1CT5A 4TIMA 4D6HA 3CHFA 3MJYA 1IWAA 3NZ1A 4G8TA 1U83A 2D3LA 3VTRA 4N9CA 2OSXA 1YTEA 2Y7FA 3W22A 2YX0A 4DAIA 1J0IA 4JEQA 2Q6ZA 4AWSA 1Q65A 1J9YA 5DMMA 2Y5JA 1XGEA 2ZZ5A 3UWQA 3NOYA 1KM0A 2VX5A 1TO3A 5EBUA 3OLDA 4NY2A 4A8NA 1P1XA 3WDQA 1WAUA 3PVFA 2OWWA 1W3KA 2ESCA 1EOMA 2G5WA 3M0VA 3M64A 5G2IA 3L0KA 3E96A 1R6WA 5C9WA 2IQ0A 5HNTA 2BGQA 5M2FX 2INEA 1JIBA 2DPEA 5DBTA 3LCHA 1DWGM 3TVAA 2WJFA 1D2KA 2Y24A 2PLMA 4EK7A 2UY4A 3IVSA 3MUXA 4E8DA 2PURA 1Z6KA 2ZUUA 4N4PA 4JTQA 2XWDA 1JZ2A 1JNDA 4OFCA 3GTHA 5G2HA 3T9PA 4F2TA 4JCLA 5C2XA 2VX6A 3H70A 4BI5A 1H60A 2DT1A 2ZCGA 1E0XA 4TV6A 1HF6A 4P2VA 5D33A 3W73A 3W38A 4CQDA 3NM3A 3GR4A 4TV5A 1KM2A 1H7OA 3TYZA 3KRBA 3UZXA 4UUIA 3I4EA 2YDSA 1VHCA 2B0MA 1S2WA 4UQCA 1XYLA 2J6XA 4MWAD 4RNFA 3THAA 3WQVA 5B7YA 4D2JA 3NQGA 4KIEA 4QDPA 2ZTJA 2QDDA 5ECUA 1SZFA 1NF0A 3L4WA 4YYCA 4GA8A 4KERA 1CGTA 2OSYA 2WNQA 3CYVA 4FXJA 1R3QA 3W7OA 4NYYA 1D7FA 2OXNA 1QW9A 2YGYA 3NTYA 3MCOA 1RJPA 3AZSA 2G8ZA 4Y8EA 5HMEA 4IG2B 3B05A 1J6PA 3WH8A 4XO7A 6CGTA 1A0CA 4GY1A 4UOJA 3B8TA 4H9ZA 5H6HA 3T0CA 4U5IA 1LP6A 2Z1BA 3MHFA 4NNAA 4NAEA 4NRSA 1QO5A 3PBUA 4MNMA 3OLIA 2PCEA 2QAPA 1SJDA 1LRTA 1WPCA 1PB0A 4PN2A 2G3NA 3PZ9A 1QFEA 3GTXA 2Y2WA 5LNRA 3JRKA 2OJPA 1O6IA 1QWKA 3QQ1A 5I7GA 3SEPA 4TOQA 3L12A 5TBOA 4UZUA 3BPWA 4C6LA 1DHKA 2WPGA 1JCYA 4AD1A 4DUVA 2GVLA 3IIOA 3LM7A 2QEZA 2GWGA 4U5KA 3F2BA 3EYPA 1W31A 2DZSA 1JZ5A 3GSMA 3SM0A 1TR1A 4ROQA 2BTMA 4GE8A 1EP3A 2HNEA 2VFGA 2R14A 4LUSA 2I17A 1VZWA 4C1NA 3ZJ8A 4KRZA 5LXXA 1N55A 3UF9A 1O7AA 2UY2A 4LRSA 1RH9A 1XYCA 1FFQA 1VF8A 4MVAA 5DMNA 2PPGA 3WN6A 4IL0A 3H7VA 4QIUA 2WZTA 1Q6DA 5BOFA 3WBAA 3NO3A 1REQB 2GK1A 1AH4A 3EPMA 4CD4A 2V2CA 1CB2A 2VQTA 4C90A 3LTPA 4K2SA 4Q22A 1FH8A 3CAQA 1SFTA 2BX7A 1JCMP 3QSTA 4JTDA 5ABFB 2ZUSA 4DJFD 1ME8A 3G1YA 2VVSA 2H3BA 3G1AA 1VB9A 4X63A 3QC0A 2QGHA 2QULA 1WXJA 2ATMA 1WA3A 3WDHA 2VI0A 3CC1A 5E6ZA 2AOSA 3UJSA 3CGTA 1VFHA 3VIGA 1O5XA 2PRMA 3VIPA 1GQJA 1R30A 2PGWA 3SRDA 3HOJA 3UZ5A 3VA8A 1JDFA 3PF3A 5FJPA 5A8GA 3NL2A 3RIKA 3VNDA 1GG1A 1RALA 3EGJA 1KB3A 3EWBX 4JFVA 2BVWA 3A9IA 3DUGA 1TPH1 1WDSA 4CQAA 3TWAA 3I65A 3WEZA 3OZMA 5FJUA 3SFKA 4CCDA 3M5VA 2Z00A 1OD0A 1W8GA 2NLYA 5A94A 3T6CA 1FCUA 4A3YA 3P93A 2YB4A 1EZ2A 3AHVA 2DSZA 3M7WA 2VMFA 4XAZA 2X1TA 1TPUA 2CW6A 2V81A 3O0KA 1OFOA 4H19A 4P7RA 5ABEA 2J7FA 1JI2A 1N2VA 1TVLA 4TX8A 3AHXA 3NA8A 1MSSA 3WLOA 2GGHA 3POHA 4RJEA 3GFXA 1WDRA 2OKOA 1N8WA 3SDOA 3PJTA 4B4FA 2ZE3A 2C6QA 1K8CA 4AY8A 1TPWA 2PP0A 3RN6A 1QOQA 2QCFA 4S3JA 4N0RA 1EXPA 5FAGA 3G1VA 5XIAA 4LYQA 1MZRA 3ZJ7A 1VC4A 1HKKA 1H62A 3AXXA 4GG9A 3HV9A 1FA2A 3VIFA 4ZOBA 1XS2A 2Z2AA 3N19B 1CNVA 4GUFA 1AJ0A 9XIAA 4C6DA 4PZVA 2E9LA 4L80A 5K4ZA 2ATSA 1DJIA 2Z1VA 5GQBA 4IT1A 2KAUC 3RFAA 4C6CA 1ZB5A 3CIWA 4MADA 1G7VA 4NKCA 3S3GA 1WBJA 1JDAA 5D9MA 4A22A 4FX8A 1H7WA 2YCIX 5A6SA 1KR0A 3TA6A 3VDGA 1JPKA 1FFRA 3UVAA 3W6MA 4U2ZA 1EC7A 2PC8A 3EOSA 1E4NA 3RMJA 1MDLA 1Q8AA 1EEXA 3W29A 4RV8A 2JF7A 5AYBA 3T7VA 3EWZA 3GM8A 1E40A 1W91A 1ISYA 1QPOA 4I90A 4KT2A 1HP4A 4MGGA 2FZMA 1Z3NA 1VEOA 4JYEA 8TIMA 4CNNA 2YL6A 3G8EA 1OD8A 4JEJA 4MNKA 2V63A 4HNTA 4FXRA 4DELA 1DIOA 1PIFA 3TYBA 4MPKA 4O13A 1MNSA 2CHRA 3WQ6A 4LH8A 2DIEA 3KBSA 3TOPA 2CC0A 2NT1A 2V5JA 3NL5A 1XIHA 3NPXA 3LPFA 3C2OA 1ZENA 4MKNA 3P61A 3VX1A 1HT6A 3FYYA 3N12A 3WK3A 4GZEA 1RV8A 3TR2A 2H90A 3CQIA 4IMFA 4Z2JA 4OV4A 4HHMA 1EPVA 1ZU8A 1TELA 1RCXB 2Q02A 2W91A 2VDIA 5FIPA 1GVOA 5FEXA 4Z1BA 1UP0A 2W61A 4LU0A 5A95A 3W7RA 4ZMGA 4LYKA 1B2YA 3M0HA 3EKLA 1LWJA 1EJVC 2ZXDA 3NVDA 4ZA0A 1ADOA 2XN0A 2GQ8A 3A23A 3IJ8A 3AXKA 4KS0A 2GUYA 4B4HA 1EEPA 1YXCA 3M47A 3WDJA 1AMKA 1E15A 2FYMA 3EEZA 3MHUA 2C1IA 5FF4A 3MSGA 5DLCA 1TTQA 3AIEA 3NO1A 2QW5A 3QYQA 4FA3A 4FNPA 4GXPA 3CEPA 1KFKA 4H04A 2AL2A 3TQPA 3FW6A 1EQPA 4RZ5A 3W02A 3IGXA 4JTRA 1PTGA 4NZJA 2G3MA 4LYPA 2BS9A 4Q3MA 3KBJA 3GVGA 3AHTA 2VT0A 4JNYA 1LBLA 1ENUA 3MSRA 3GX9A 3DECA 2D0HA 4FF5A 1YEYA 1PTAA 3AIUA 3IJLA 3NG3A 1TV7A 6ALDA 1IIGA 4J9JA 3LZ3A 1DQWA 1NARA 3HQNA 1R7AA 1Z48A 2HXUA 3ZSSA 2JE8A 1TG7A 1AQFA 3OO2A 3M07A 1XM3A 2PDNA 3PBWA 3HV8A 1VENA 2XFYA 4BF9A 1GOMA 2J74A 2PD5A 3OG3A 5G5IA 3A12A 3BG3A 3B8IA 4N9EA 3UYCA 4US5A 3RU8X 2Y8KA 2HDJA 4OGZA 4IIGA 3AIBA 3GWQA 1QHZA 2H8ZA 4MYXA 5HA7A 2PAJA 1V02A 1V77A 1P5BA 4RW5A 1EJSC 1UMYA 1TIMA 3S2MA 3W76A 2PMQA 3O07A 8XIMA 3AJ7A 5BMXA 1I0BA 4HVXA 2XH0A 4Q8PA 4GHRA 4CN1A 4YPJA 2GZXA 1LBFA 2XVNA 4CU6A 3CUHA 4ZQRA 1VAHA 1GJUA 5L6UA 5HWJA 4HOZA 1Z41A 1Q45A 2GDUA 2CWNA 1SGJA 5LA1A 2IS7A 4XAPA 2VC9A 4GQGA 1Q6QA 4LX4A 1ISZA 3W1RA 1M5WA 2EBNA 3I4KA 4PTXA 2XPKA 2O4MA 1FWGC 4BEQA 5AECA 4GFIA 3H4WA 2VC7A 4WGHA 1VS1A 2DZBA 3VZYA 4XBJA 1TE6A 1XBXA 3QPZA 3FHAA 1J8VA 2R94A 3C52A 3KFTA 3WNPA 2XDFA 2DORA 4LGXA 4WKFA 4DNHA 1I6NA 3B9OA 5FCZA 3R43A 4GCXA 3KCOA 4GQRA 1QNSA 5D09A 1YBQB 1ZRQA 3SIZA 1DBTA 1AQMA 4L1GA 5HPCA 4Z2GA 5EY5A 1S3TC 2VWTA 4FS9A 2CXEA 2QNEA 2HWGA 4NX0A 4X3ZA 4RE3A 1XP3A 4K68A 1B3WA 1JRCA 1R3SA 2QV4A 4E4FA 4YXGA 1UHVA 2PTXA 2PDUA 3CASA 1EKOA 3WLIA 5U4NA 2O4QA 3STCA 4FNTA 4X2PA 4HCDA 1R47A 1Q6OA 1GOIA 1XLDA 1RP8A 1P0NA 3E0WA 1QNVA 3NQ7A 2UBPC 1XD1A 2D2JA 6A3HA 4TVDA 4C6IA 3KAOA 4AF0B 2GQ3A 2RDXA 3SCOA 2WBKA 1ZZMA 5KSWA 4Q8TA 2G37A 3A6OA 4QROA 6TAAA 3O2LA 3TLQA 4HNUA 2Y8UA 5B80A 2YFOA 3WD2A 2PGRA 3NZRA 2P76A 1XLEA 3LLXA 2GJRA 2Y4SA 2VUNA 3KVLA 3ONBA 1OEPA 1LF1A 2TSYA 1HJQA 4CLMA 3PK7A 2YBUA 1YNQA 3HPSA 3B8VA 3CHVA 1CLKA 3GHRA 3PPHA 2ZXAA 3SCPA 3C4UA 1J0ZA 3LHYA 1FWAC 4ZR8A 2WSPA 4A6GA 2X0HA 4HOWA 1CPUA 4LBUA 1LUCB 7XIMA 2FTWA 1NWSA 1WO2A 5ABTA 1Q4NX 3ELFA 3PTMA 1ME7A 4R53A 5EKYA 2JFEX 3CV7A 4LY8A 1PWLA 4J35A 5IFPA 5CCZA 4MMWA 2CZEA 1RQHA 3EXSA 7TIMA 3VNKA 3ZT6A 1FDYA 3P3BA 1I8JA 5DXXA 3NDOA 2ACUA 2EPMX 4UMBA 3GC5A 3OODA 2F6XA 3H2MA 3AMKA 1DXFA 3WNLA 2VOTA 1XL9A 3CPRA 1A50A 4DF2A 1DL3A 3MHGA 4IP5A 4BF7A 1K02A 3HPFA 1U33A 1XIEA 4DF1A 5JIPA 3H7RA 3K1GA 2Z6JA 3T4WA 3PNUA 3SADA 1MXSA 4QXIA 4PBFA 4HMCA 1X96A 4C6BA 2QJMA 1O1HA 3WJWA 1JYWA 3T0BA 3V18A 4AIOA 3N13A 5A69A 3CMFA 4P5UA 1EJTC 1L6YA 4AZGA 4DUWA 2E9MA 4D8ZA 1IF2A 3AISA 1GEHA 5T9BG 1A80A 2OGJA 2PP3A 4KFNA 1H7PA 4N02A 1KV8A 3IK4A 3R0KA 3UXIA 1UQZA 4WOQA 3KLKA 3P67A 3V5CA 2X7WA 4LUIA 4UMAA 4IMAA 3VD5A 4X22A 1JR1A 3CWOX 3SQMA 3H2AA 4WLCA 4E6MA 4QG6A 1O5QA 1UBSA 3BJSA 9CGTA 3A4JA 2Y7DA 3DX5A 2Y7EA 4YLWA 3E38A 2QDGA 3U0HA 3K2GA 3G6MA 1AK5A 3TN4A 2V38A 2QPUA 2IPFA 4D6GA 1GNXA 3ARUA 4OWGA 3BC9A 7TAAA 1TUXA 2I9UA 4GI6A 3O3RA 5BYWA 4ML4A 5BRQA 1EQCA 5KZDA 3FA4A 3CLWA 5I03A 4ZB0A 4TXEA 4R34A 3CZJA 2GSJA 2AL1A 2HNHA 4GQ0A 4ZO8A 3O8AA 2GL5A 4HNCA 1Y5XA 3BLLA 1UKSA 3M0JA 5H1WA 1DJZA 1A5CA 2RDUA 3IAPA 3PPFA 4LEQA 1X6UA 3CT2A 1OYBA 4PTVA 4EXBA 1OCBA 3QMRA 4AH7A 4UFMA 3HJEA 3MB9A 1OK6A 1OFDA 3NZGA 3T2QA 3GDTA 5IM51 4KWVA 4PCFA 2VCBA 5BU6A 3VGGA 3WIJA 3W7QA 2J75A 3M1ZA 2QGYA 2QS8A 3W7LA 3W7NA 4QQUA 4S39A 4GYFA 4BY3A 2CITA 2EPKX 3TW6A 4ZEPA 1IEQA 1BGAA 1Z32X 4DJDD 4AYSA 5LA0A 3LCXA 3FCPA 1R86A 3URBA 1M65A 3L5AA 3NSMA 3LM3A 2OYKA 4QX4A 1VBUA 5FEWA 4O0ZA 1JAEA 2FVKA 1XCWA 1JCJA 4RNHA 3NWRA 4KCWA 4MOZA 3AS1A 1GKRA 4REQA 3QV8A 3H2NA 4E2BA 2NUWA 1KCLA 1PUDA 3UETA 1YKWA 1UZ1A 1YE6A 4DBDA 2FB2A 4DM1A 3PG9A 1I1WA 1J0KA 3U8GA 1OG0A 1DJQA 1RP9A 1UKOA 3ZT5A 2X2YA 3EXRA 2A85A 5AVHA 2OQLA 5AFDA 1CCWB 1XYMA 1HVXA 1EUNA 1YQ2A 5JH1A 5I3HA 2GOUA 3IS4A 1CECA 5FJIA 1E5JA 1S5VA 1EZWA 2Z24A 1T96A 4W8AA 4L4MA 2IPGA 2AQOA 1KQZA 4GWEA 3N18A 3GW3A 2BZNA 3LHVA 2WVVB 2PI6A 3TYAA 3N17A 1Q6GA 2C14A 4JFWA 2D73A 1WV2A 3SCQA 3S1VA 4WVXA 1F4AA 1RD5A 4EPEC 2PSNA 3B9DA 4QJ3B 2WB5A 3QPYA 4XZ9A 3E9AA 3AMDA 2XVKA 1GJPA 1OCQA 3AS2A 1S46A 5A6BD 4HN4A 4I7UA 3GH4A 4DYEA 1FCVA 1N82A 1DOSA 3EA1A 2YDRA 4XO6A 3N2MA 1HTIA 1ISXA 3RG6A 3HMJG 3CUIA 4IPIA 3Q2DA 4F8XA 3NM1A 4NAFB 4C6MA 4DF0A 1OX6A 2GOKA 2P8BA 3ZVHA 1M6JA 1WZKA 5LNWA 1KFBA 2BB0A 3QLLA 5AYXA 2R91A 3LQGA 3EOLA 1B9BA 5CH9A 1GORA 4QHRA 3AOFA 2D22A 2IW0A 4UTKA 4GH1A 1R87A 4H6RA 3USZA 2PB1A 3L4UA 3M5XA 5J8LA 5CPOA 1HZYA 1MEHA 4DPQA 1G7UA 4BS0A 1OY0A 2VDHA 3WMLA 1CENA 1XIBA 3RYSA 2VEFA 1FWTA 1J11A 3VKJA 3W37A 1XIIA 1GGOA 1PAMA 1RBAA 3ATZA 1V3IA 3NQ2A 3WH7A 1OC5A 3A4AA 3DYOA 2O56A 4C6KA 1VKFA 1BGGA 1FWIC 3CUFA 3WKZA 4ZQNA 3LRLA 1I9CB 4IXXA 3EEGA 5HK4A 2WSQA 3VD3A 2WSRA 1YPFA 3BG5A 3F03K 5BW6A 4A4AA 3CQJA 2I5IA 3NQVA 1IQ8A 2IQDA 4XKYA 3U2CA 5TNVA 1RR2A 1MFVA 3NQFA 4C7GA 2ZZ4A 3QOKA 3HMCA 3VGEA 2NQ9A 4LNYA 4IP4A 3APTA 3UG5A 1LRNA 3T4CA 2VYOA 4OUEA 1BAGA 1BF6A 4XZBA 3S1WA 4DJDC 1J6OA 4PGLA 3U2ZA 2XWEA 2E68A 2OZ8A 3W9ZA 3BGJA 1MWOA 4ZL1A 4NXSA 4KWSA 3C5QA 4S2CA 4A3RA 1NJJA 3VOJA 1E5NA 2JF6A 2RDTA 3LRKA 4H00A 5D2XA 3WH6A 1H4PA 3FS2A 2Q01A 4JKLA 4ONVA 5FSDC 1XH2A 3IRSA 2RJGA 1RLDA 4YTSA 4EAYA 1EC9A 4GUJA 4A3UA 2E5CA 2RGLA 1CXFA 4JDBA 2WMIB 3THUA 4GBUA 3U9IA 1GQNA 3RDKA 2Z1WA 4PUDA 1EO5A 1IEIA 1H49A 1QOXA 2XH7A 1W2VA 2BY3A 4AFYA 2BSLA 1U1UA 4RE0A 2C0AA 4NP7A 4MLJA 4PTNA 3CXOA 5CC7A 1V7AA 3I68A 3UZZA 2PWGA 1HUVA 4MZ1A 4ZZ9A 1W6TA 3S2CA 1UQYA 1PIGA 1VRDA 2PP1A 1VRXA 5AVNA 3QC3A 1WYIA 5FF2A 1GONA 4LAMA 4UNKA 1ADSA 4AZIA 1VFSA 1LLZA 3RCMA 3TQVA 2CNCA 5FL0A 3QW4B 2ABAA 4X9YA 4HJWA 1UG6A 5BRBA 4MY1A 4MJ4A 4IIHA 1JAKA 5LNVA 5GVJA 3QQ0A 3DHFA 3DGBA 3ABXA 1FKWA 2DT3A 2VEMA 4HA1A 3KP1A 4CQCA 4D6EA 5HQEA 2HCVA 3PULA 5E0FA 3S1XA 4DJEC 4JDYA 1GZ1A 4UCGA 3LHUA 1YDYA 3H2CA 3Q94A 3K4AA 4KGLA 3UCCA 4O1AA 3EKZA 2C16A 1P0BA 2ISFA 4FX6M 1DWFM 1EJXC 3RRAA 1OX4A 6REQB 2BMBA 3S5NA 3ITCA 5BXTA 1EL3A 3QF0A 3PN8A 4A8LA 1XIFA 2QDHA 2DSUA 1DIDA 5F2MA 1W32A 1W5PA 5A6KA 1E0TA 3CU2A 1E4MM 4GPNA 1O5KA 2X8RA 1UWAA 1QO2A 1VBHA 5CJ5A 1W56A 4WJEA 2POZA 3TN6A 1XLLA 4CNSA 3AJXA 3GH7A 4LQ1A 5ENLA 2B7OA 2WJZA 3AI0A 3VNZA 4CVUA 2WHJA 1OJXA 4C91A 7ODCA 1ZBCA 1US3A 4KEVA 2NQZA 3OLGA 3KZPA 4NJHA 2WW5A 1IGWA 4JTUA 5M1TA 1A5UA 4TR9A 4TTUA 3TNOA 1BRLA 3VIIA 1GPWA 1XYZA 3U57A 3JU2A 2BDQA 4LOCA 3W2NA 3PG8A 1J2WA 2ZUMA 4GIEA 1XINA 3N15A 4DLMA 2VELA 2VRJA 4AVOA 3A3XA 4EWJA 1LL7A 1S2TA 3QJAA 3GU1A 1X7FA 4RPQA 1UP3A 4O18A 3ITYA 3UFYA 3QGAC 1Q6LA 5PTDA 4BWLC 2BP1A 4S23A 4GBDA 3ABRA 3OHIA 3BV4A 4D6FA 2R1MA 2QV5A 4QLLA 1UD3A 3MUIA 2JEQA 2OYMA 2H3DA 2G97A 1U22A 4PBEA 3CIVA 3UPWA 4K8HA 1E3XA 4YVPA 3BWWA 1E3ZA 2Z1XA 1PCWA 3WL1A 3K5XA 4FNRA 4H8NA 3HJZA 2REQA 4NI8A 5DT5A 2P8CA 4AC1X 1R2SA 2DH2A 2XH4A 1UR8A 4MSSA 2ISWA 1XPGA 1YDOA 3RILA 2CFFA 3UA3A 4OBRA 2Z2UA 3WFAA 3O0FA 4C1LA 1PZ0A 3WCZA 3HG2A 6XIMA 4O16A 1ONWA 2BVYA 1KM1A 2YA1A 5CBIA 7ENLA 1XIGA 3U3HA 4JTEA 5FACA 3ES8A 4JNZA 3U2OA 1MXGA 3DFNA 3TA9A 4PR4A 5IRPA 5I79A 3B0XA 3WH9A 4HNOA 1Q7ZA 1EIXA 1X1NA 1DORA 1MMFA 3WBXA 5CG0A 4DWSB 1GTHA 2YOCA 2GDVA 4D9PA 4JTTA 4NZCA 4C6EA 4DJED 4JFUA 3W01A 2OKTA 4AISA 4QG8A 3VC5A 4QITA 3AALA 2OGYA 4MJMA 1JCTA 2GGEA 4I9MA 5H8PA 1KA9F 1OC6A 4J5NA 3EX6A 4PH6A 1PKMA 5JBDA 2E8ZA 1H0IA 1SMAA 2O0TA 5AB3A 4P8WA 1NFGA 2W3ZA 3K1DA 5C55A 2ZVRA 1RD6A 4TVCA 4GZJA 4IJCA 2QXWA 4M80A 3M4HA 4GYPC 1TCMA 4ZQPA 3UXKA 2OX4A 4GZIA 3MUZ1 3ZLHA 2PU1A 2WLYA 3FVDA 4D1JA 4QE1A 1BSIA 5HANA 3EB4A 3C0SA 2FIQA 4Z0JA 3SUWA 2VNCA 1OFEA 4IIEA 1H2JA 4HT3A 1W1TA 3CTLA 7REQB 1ECQA 2VR2A 1U1JA 4PB3A 3SUTA 5E9XA 2IUZA 3K4DA 2DVUA 4MTVA 3NXFA 2Q8LA 3QY8A 3QN3A 4NL1A 4GACA 3W3OA 2A7NA 3BAKA 3LPGA 1M7PA 3IWPA 4PEKA 4NNCA 2W67A 4N42A 1H7NA 4JXCA 3FJNA 3EWYA 1W9UA 4CEUC 2Y6ZA 3W25A 3L2IA 5E09A 2H6RA 1TRIA 1TV2A 3YPIA 4XIMA 3CMGA 3OYZA 5EFFA 1B90A 4O1CA 3ARXA 1FXPA 2CYGA 3U5UA 4S3BA 3A5FA 3WG6A 2PLJA 3BV7A 4V27A 1JUKA 5C6MA 1ADDA 2AQVA 3NQAA 3MU7A 4JQ4A 1G1YA 1NSJA 1P0KA 3HBLA 3C2RA 1SJCA 3WBYA 1KO0A 2DZWA 2V5DA 3FJLA 1V3LA 3GYEA 2YXGA 3JUGA 3WDIA 3TV8A 3LX9A 3QV7A 4R9OA 4HYRA 4O54A 4WDUA 3T8QA 3N9KA 4B5SA 3LHWA 1T8QA 5L9FA 2Y63A 3NIYA 3QEZA 3W75A 4O1FA 3KVKA 4O0QA 4LS1A 4Q8VA 5I2UA 4HMEA 4I6VA 4W85A 2FVLA 3LTYA 4IGSA 1BTMA 1I75A 3FK4A 3SJNA 3A3HA 3Q65A 1W54A 1LWIA 2ZIDA 2QLYA 4AIUA 4DO4A 2YR1A 3A64A 4TMCA 1N8IA 1LOSA 3WEMA 2E28A 3WQ8A 2DW6A 4JIPA 4OE7A 2A3LA 4AHOA 2HZGA 1PKNA 4N9BA 3HPAA 2XIBA 4GINA 1C8VA 2BBFA 3BGGA 2QJGA 3PJXA 1IEVA 2DVTA 3TUUA 2GQ9A 3VFCA 3ISIX 1AW2A 5G4HC 2QCDA 4QBXA 6TIMA 1C7SA 5I00A 3SUUA 2DZPA 4I6KA 4AYGA 4NQ1A 3XIMA 1J4EA 4J2MA 4ZQOA 3V35A 4GK8A 3GH5A 4Y9NA 3P80A 2OMAA 4W7VA 4KETA 2YFNA 3UJEA 4Q4QA 1ICSA 1BWLA 3MY9A 3M0KA 5KZ6A 1KM5A 3QSRA 4TMBA 4D6CA 1KFWA 2GJPA 5A2AA 1SO6A 4L65A 1B31A 1FHDA 4ACZA 5A2BA 3UYIA 2PEVA 4A2SA 1YDNA 1L0PA 3OGVA 3M41A 2YKKA 1W1VA 4FMVA 2OTDA 4IFKA 1KKOA 1XIJA 1QAPA 1TCDA 4QJ5B 2WANA 5BWAA 2WC4A 3S4TA 4NU7A 3WFZA 4PMXA 2WVUA 3VGDA 4ASTA 2DGAA 4E3VA 1UWIA 1HL2A 2ZADA 3VIJA 3T8LA 2HV5A 2NX1A 2A6LA 1OF8A 1EF2A 2D3NA 3EBVA 4W86A 3INPA 4RCXA 1VCGA 5I06A 3GXPA 4K38A 4GI4A 3HN3A 1ECEA 2INZA 4LWWA 1QI4A 2QVNA 3KBMA 3GIQA 4EWND 4NHVA 2WVTA 1A4MA 5BXPA 4IL2A 3U4FA 3CL8A 1A3HA 4M6QA 1DE5A 5C9UA 4XD4A 3ARWA 1O95A 1ZCOA 2RDWA 1IYXA 5LXEA 1TJRA 3MV11 1YXYA 2OR2A 3DYPA 1P0DA 4NX5A 3S9ZA 2X1SA 3EDFA 1VD6A 1K77A 3WFLA 3AIWA 5DN1A 5CPLA 1NDWA 3SGGA 2FGZA 3LOTA 4F40A 3TN3A 1QTWA 2BWGA 4QDMA 3S5OA 4E38A 3VGFA 4GNVA 2HJPA 2GYIA 3MO4A 4I9AA 1TWDA 3BURA 1IT7A 4NIRA 3WD0A 1M1BA 4R5EA 4J1OA 4B2DD 1FTXA 3CEUA 3GG8A 3W7KA 5TQLA 3W74A 3ARVA 1CBGA 3M9YA 3QTGA 4HPJA 3PUDA 5LA2A 2HSAA 5DCEA 1WX0A 1XLCA 3BW2A 5LHEA 3XINA 3DBNA 3T2OA 2FGBA 2ZXBA 3ITOA 2ZWYA 2OLSA 3PZMA 1V3HA 4I9TA 4G9PA 3W70A 2E5DA 3EZ4A 3DHDA 2HS6A 4KESA 1DHPA 3ABQA 3MP5A 2Z28A 5JIWA 3LK6A 3FEQA 2NZLA 3SGZA 1GQKA 1SUXA 4EF8A 1AD4A 3OTRA 3C0JA 3HU7A 3R8GA 1EP1A 4G7FA 1L9WA 5I07A 4PCPA 4CD6A 5KTLA 3UWYA 2YL9A 3G5EA 4B90A 3DXIA 5A8OA 2Y70A 3GU2A 4MWAC 5FKYA 3IJDA 4JFSA 2EPLX 3KTCA 3IACA 1W3NA 5HR6A 1E1CB 3CS2A 3PZTA 5HAOA 3IIPA 2W0UA 3MT1A 3AQUA 4AZHA 5DO8A 4WIWA 4PMDA 1V6XA 1V0NA 3LPOA 4YCPA 3EA2A 1WE5A 3UPBA 4MDOA 1TWIA 2O9OA 4NRRA 4F2UA 1V0MA 4AMCA 3BLOA 4FZIA 1HXJA 4JTFA 4KWOA 3UG8A 3C8FA 4UTTC 5AHNA 3HQOA 4MLRA 1Q66A 4Z1AA 4E2VA 2A3BA 3BW3A 2XUCA 1XQKA 2O92A 4GGBA 3S83A 1QJWA 4ICCX 3DFTA 4NJKA 3MDUA 3OVPA 1G4SA 2J47A 2NVCA 5EMUA 3IJQA 1LL4A 1MW0A 1H1YA 2J77A 2HROA 3S0CA 2MUCA 4FNSA 5AN7A 3GNPA 3BCFA 3MQTA 5F7UA 2B31A 2R1LA 1A5AA 1HIZA 4P7OA 4UTFA 1LRQA 3PAOA 3IPWA 2E77A 3OQEA 4G7EB 3UWEA 4QSHA 4RE2A 3ARPA 3G0XA 1O4UA 3ES7A 3QOMA 4JBRA 3QMSA 3KM8A 5DANA 3RITA 3PBYA 5CPNA 5JMUA 5LIKX 1NQ6A 2ACSA 5CPTA 1Z44A 4QAWA 3ITGA 2XISA 1L6FA 4UNIA 2J66A 3ABSA 1OGBA 2BOEX 1Z7AA 4WJXA 1TKKA 4WKHA 1BVZA 1IZKA 1GW9A 3AAMA 3DI0A 3GR8A 3ONCA 3SCRA 4E2DA 3PFMA 5T91A 5C7VA 4RE4A 3L0NA 4MFDA 1KCZA 3KCJA 1ESWA 1DVJA 3RX2A 4WDTA 4XBSA 3SN0A 3B9AA 1FCQA 4CCEA 2VZVA 3MKKA 4BKNA 2R9RA 1EGZA 3APGA 4CU7A 1AH0A 3W7DA 2V3FA 2VCAA 1IXOA 4R7OA 3RU6A 3WL0A 3VGHA 1GWJA 1K7FA 4MB1A 1V03A 2PCQA 4ADTA 2O55A 5LIUX 3TP4A 3FSUA 4AZ6A 1JDDA 1OF6A 4IOTA 4QM1A 1QI5A 1I2RA 3JS3A 3OB8A 1F8IA 2BXVA 2BVTA 1KLZA 1R9YA 3NJ3A 3TW7A 3UP8A 3W2KA 1BWKA 2WO5A 5CXPA 4DWSD 4D6JA 4GVHA 1XLFA 1XRTA 1NOFA 2XN2A 1P43A 4CKQA 3NZPA 4EAMA 3KP0A 2JALA 4JTCA 2Z2BA 4MG4A 1ML1A 3W6YA 2ZXQA 4B92A 3PTQA 4FHAA 2OOFA 2PE4A 4QLJA 3B8WA 4HP5A 4AVFA 2VOMA 1FCBA 3EOUA 1EX1A 1R38A 5DXYA 3W81A 1JZ8A 4O19A 5AHEA 2X1RA 5D9PA 4O1DA 4WSKA 4GXMA 3E49A 3CLMA 1GQIA 3NUKA 4QCFA 1MQRA 5AKQA 4A8RA 3TCEA 4AZCB 2PDHA 5LSMA 2Y62A 3UT0A 1JPHA 3CM4A 1W9VA 2OELA 2D24A 3LZ5A 1LL6A 4WCJA 3H21A 1V6VA 2ZZ3A 3B0UX 4PEEA 1TTJA 2AGTA 4U10A 1WUEA 3BSMA 1L2UA 3MKVA 4IQEA 2ZZ7A 2ASHA 3MC5A 3VMPA 4ZQMA 2CU0A 1QU4A 1XCFA 4R85A 5REQB 2J7BA 1QPRA 1NFBA 2PTWA 3UR2A 2VTFA 3LDVA 3T81A 5CKSA 3W1UA 2VUYA 4AC7C 4EPDC 1KWKA 1KQYA 1MZHA 3WDPP 1L6GA 3E6EA 2F2HA 2JBMA 2A4AA 3WBEA 2CLEA 1QVBA 4IQJA 2WMKA 1YPIA 2NQLA 4QS6A 2ACRA 4MFEA 4XG1A 4MB4A 2YLAA 2Q3OA 3KS5A 3NSXA 4C5YA 4UTTA 2V6AA 2UWFA 2XIIA 3BOLA 2GJXA 3IIZA 3ABOA 3WY1A 2TRSA 4AZ7A 4MKSA 2F6UA 3GXNA 3ZXWA 1MRQA 4WHBA 1SJBA 1QCWA 1SFJA 2BXZA 1WKFA 1M04A 3H2FA 4YN5A 3DIPA 2CBVA 1BRLB 4GXWA 3WUGA 4LVBA 1X98A 3R89A 1DQUA 4GIRA 4JHOA 3PUOA 4H01A 3DBPA 3F4NA 3BXWA 1V0LA 2W6RA 4MY9A 2NXHA 2FHBA 4LUTB 3AYVA 3EMQA 1XPYA 3DKJA 3O6AA 4G5DA 1RQBA 4J28A 4OZOA 3E02A 3GHTA 4ZFMA 4WY0F 2P1FA 2WM1A 5A8NA 1TREA 4JL2A 4IWWA 5JXQA 2A21A 4MB5A 3F5KA 3MW7A 2QF7A 4Q33A 2ON3A 3EWDA 3ZWSA 4WR3A 1BKSA 1C7TA 2V5BA 4HTYA 3WNMA 4M51A 1GW1A 2ZA2A 4GCAA 4IPPA 4FI4A 1SYTA 1OZMA 4NG3A 2DV0A 3CUZA 3SCUA 2PDLA 1G4TA 3KOZA 4C1KA 1JD9A 3BOFA 2XU2A 3RR1A 5TAOA 1HKMA 4DJFC 1B4KA 2W27A 4WJ8A 2QT3A 2J78A 4S3FA 1XJBA 2E09A 3ZIZA 2A6NA 3K13A 4NZ5A 5CLTA 2XVGA 3AS3A 2AGKA 2CWXA 1Y7VA 2EPOA 1ZL1A 3URAA 3MBFA 1UZDA 3VD7A 2IPWA 2F6KA 3EB3A 2F7FA 4CD5A 1FH7A 3L9CA 5BXRA 4ICNA 5FJTA 4IHCA 2H9AA 4M19A 1XI3A 4CQBA 3IV3A 4GVFA 4AX7A 4Y7EA 2NXGA 5F4SA 1KBIA 3ATYA