5CQ1A

Disproportionating enzyme 1 from arabidopsis - cycloamylose soak
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
517
structure length
514
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
total genus 182
structure length 514
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cq1A01
4ML4A 3AMDA 2QLYA 2WW5A 2XWEA 3WD0A 2XVKA 3VNYA 2CHOA 2EO7A 4J7RA 3W82A 1LQ0A 1VBUA 4BZYA 5EFFA 3WDHA 1B9ZA 4H8VA 3L4WA 4PTVA 1OT2A 3IJ8A 1E4NA 1B3WA 4LGXA 4AZGA 2WZHA 3PTKA 1ZL1A 1WDRA 2VX6A 3IK2A 4PMUA 3GH5A 3MV01 1H1NA 2UY3A 3WH5A 1P6WA 1UWQA 3RM9A 5I5RA 1CIUA 4XB3A 1V0MA 2IXVA 4K68A 2YKKA 4GZIA 2VO5A 1DWAM 2F61A 1JZ4A 4RE2A 1QNOA 2YDSA 3WQ6A 4Z2LA 4AD3A 2VVSA 3AHXA 1H0IA 1VEPA 3AIQA 1TVNA 2FGZA 1KWKA 3T0BA 3KWXA 1XCXA 4UQAA 3NCOA 3VM5A 1GVYA 4GKLA 3K8LA 2VCAA 4TX6A 5FCZA 4UOQA 3O9NA 5EFDA 5JBFA 5CQ1A 3AROA 3OG2A 4H41A 1LG1A 2WHLA 3N9KA 4JKKA 3RIKA 3WQVA 3SUWA 4H2CA 2WWCA 3WSUA 3ZR6A 2VX7A 2ZWZA 4PSRA 3PZTA 1R8LA 1GOKA 4FMVA 3NJ3A 1G1YA 1OIMA 1H09A 2O9PA 2ZX7A 1V3JA 2E0PA 2XWDA 2J8FA 4F66A 1ODZA 4XX6A 1HJXA 3VIIA 3EMCA 2G41A 2WHMA 4U3CA 1ECEA 3BLPX 1U2YA 3BH4A 5F7UA 1UZ4A 2CHNA 2C0HA 1S46A 2V5CA 1ISXA 2A3AA 1M03A 2EPKX 5IFTA 3DHUA 3EMZA 4MAZA 1W9PA 3ZO9A 4D72A 3CZKA 4J27A 1GORA 4ZE4A 1HKKA 3SCUA 1GOOA 2XSBA 5C71A 1CEOA 3HN3A 3WH8A 5BXSA 3QOKA 3WQ8A 2WSKA 1OD0A 1V6UA 3K4DA 4HTYA 4P8VA 1GOMA 4V27A 4HPGA 1E72M 2GJPA 2XVLA 4W93A 3DYMA 3CUGA 2CBUA 5AYBA 4Z2KA 1YQ2A 2YA2A 2XVPA 2AAAA 3MSDA 2A3CA 2OWWA 2CKRA 5A2BA 4D1IA 3AS1A 4RE3A 1C90A 2JEQA 5D9PA 2Y4SA 1BTCA 1EQCA 3RPMA 2Z1SA 3W38A 3ZOAA 5E0FA 1UOKA 4AXNA 5D9NA 4BQ4A 3TONA 1WDPA 3SUSA 1JD7A 3WY1A 1BSIA 5CGMA 1W3KA 1CGWA 1NOUA 5D9OA 3THDA 1LG2A 1V3MA 1WZAA 3ALFA 2ZX9A 5JIPA 2V3GA 1JXJA 3CHEA 1KCKA 3L4VA 2WCAA 1R7OA 4AEEA 1XD1A 3J7HA 2C8NA 1UYQA 4CUCA 1X6NA 1NARA 1DWFM 3RM8A 3WD3A 3VGFA 1HL9A 1W2VA 1W3HA 6A3HA 1UD6A 4HMDA 4IPLA 3DYOA 3VD7A 3KZSA 4S3KA 2AOSA 5LA2A 3WD1A 1C92A 3SCNA 1G01A 2D20A 4AD2A 2G4FA 1PX8A 3KL0A 5AYIA 3WF4A 1CXEA 1BG9A 4MDPA 3CMGA 2VJXA 1W9DM 1Q6GA 2WVTA 3AZTA 4X0NA 2GDUA 2O9TA 2J7HA 1J01A 2CBIA 5DT5A 3VO0A 3ZJ7A 1UR0A 4WF7A 5CPQA 1E6XM 2EPMX 1HVXA 2D23A 1JYXA 3GH4A 1QVBA 1OSEA 2VVNA 5BRQA 1ZBWA 1UKOA 2J7EA 4X0VA 2VI0A 1UWUA 4ZXOA 1GHRA 1L8NA 3MV11 2Y5EA 2Y8VA 5A8PA 1JZ6A 3ZJ8A 1UWSA 1FFQA 7CGTA 5D9MA 3WDJA 3VIOA 4JFUA 1BQCA 3AMGA 1E9LA 4UOZA 5CSYA 4PSPA 1XYZA 3TP4A 5FL1A 1XH2A 4HMEA 4CD8A 2ZUSA 2W92A 1B31A 5CXPA 1X6LA 2DT3A 3WEZA 4F79A 5JBDA 1W1PA 4XZBA 4W8LA 1EO5A 3VMOA 3MMDA 4RL3A 3AFBA 3UERA 3IJ7A 4EKJA 3L2LA 3CHDA 3VM7A 4CCDA 4DM1A 5EBAA 3WDIA 4WIWA 1X1NA 2WXDM 3ARSA 3B8SA 3CZJA 1PEZA 4J3VA 2GJRA 3T2PA 2NT1A 4YHGA 2X0YA 2J7GA 2A3HA 1CXFA 5E09A 1YHTA 4AEFA 2V3DA 3AHYA 3AXHA 2GJXA 4CN6A 1BF2A 4CKQA 2V38A 6TAAA 3T2QA 3F4VA 4PMVA 3AIBA 1ODUA 1OT1A 1AQMA 1MFVA 3WNMA 1UQYA 2BFGA 1MW2A 2WHJA 4KRUA 3BMVA 3PZIA 3VD3A 1QPKA 3IAQA 1NM9A 4DUVA 2DT0A 2W61A 2QV4A 4LYPA 3L4UA 5ABFB 3A6OA 4KRTA 3CZ8A 3VPLA 1JFHA 5D8WA 4PCSA 1VJSA 4PMXA 5A8QA 5CLTA 3TOPA 3NDYA 4IUGA 2XFRA 4JKLA 3M7SA 3NDZA 2G3IA 1SFSA 1WP6A 1ITXA 5CSUA 1AVAA 2JALA 3MUAA 1BYAA 1QOXA 4Y7EA 1VRXA 5A6MA 2CEQA 4HP5A 1EHAA 1CDGA 1EOMA 1CXHA 3OA5A 4P8WA 2FDMA 1UR1A 3FN9A 3AICA 1WKYA 1FH9A 1EDTA 5DO8A 4FLOA 5ABGA 4TUFA 5GNZA 4CCCA 3TTQA 4HZ8A 4DWSC 3W6MA 1G0CA 2W4XA 1WE5A 1CGVA 2EJ1A 4UFJA 2YIHA 4GO8A 3W26A 1CYGA 3F5KA 2GSJA 1B90A 2OYLA 3W29A 1F4HA 4BQ2A 2VT0A 4CVWA 3VOCA 4M8UA 4D6HA 3WNOA 2FHFA 4QAWA 2YBUA 3WUGA 3WL0A 3SUTA 1ZBKA 2WSPA 2CERA 4WLCA 4M80A 2WVSA 1U33A 2E9BA 2EPNA 1EHNA 2GJXB 1JYNA 2BY3A 3VX1A 1EGZA 3GXMA 2VNCA 3PZQA 2DQXA 3L4ZA 1J18A 2DSWA 2YL6A 3BC9A 1XD0A 4UZSA 1R86A 1KFWA 1CPUA 3VMNA 4W88A 3CBWA 1FP9A 2JFEX 1HIZA 4J3SA 3SIMA 3GZAA 4M81A 4GIAA 1BVNP 2PWHA 3OLEA 4FLRA 4WJXA 1LL7A 2XVNA 3EYPA 4PMYA 1G5AA 4UFIA 3WH6A 4CD4A 4UFKA 3QHNA 4P7LA 3AS3A 1GUVA 4TTUA 2Y8KA 2UY2A 3BAKA 2ZXBA 2W62A 2WCGA 4NRRA 3BSHA 1UWTA 1GQKA 3CHFA 3T2OA 1E3XA 4PRWA 2ZUWA 5DEZA 3VIPA 3VD9A 2O9OA 1B30A 4F9JA 1I1WA 4UZUA 2V3FA 4A3HA 3K4AA 3M46A 2J74A 2CYGA 5IHSA 1HJQA 4P8XA 3VDAA 3RJXA 5CZKA 3W6LA 1J0ZA 2D0HA 4HA3A 3ZSTA 3WUBA 3FY1A 1W2PA 3MUZ1 1ZBCA 4MB3A 3VTRA 1NQ6A 2E8YA 1B0IA 3AS0A 3B9AA 3MUIA 4D71A 4PMZA 1C7TA 4D6CA 2BVYA 1WNOA 4UQDA 4ATDA 3PBGA 3U5UA 3NSMA 2GDVA 3AIEA 1LLOA 2WVVA 2VC9A 1PX4A 3SCPA 4UR9A 1VIWA 2E3ZA 1E15A 3BLKA 4DUXA 3WF0A 1WCGA 1MW0A 2CITA 2DH3A 4JKMA 1J10A 4PTMA 4D6GA 1QHPA 1QW9A 3AI0A 1V02A 4HOWA 3LPOA 1UKQA 4EE9A 1O6IA 2EBNA 3GDBA 4MNKA 1BFNA 4HZ6A 4ACYA 4AZHA 1TUXA 1ISYA 1VFFA 2G3JA 4OUEA 5A6KA 1CXLA 1WB0A 2CKSA 3SCSA 4MNLA 5I0DA 3FXYA 3UG5A 3WIJA 3RDKA 1BG4A 8CGTA 1B3XA 2J8GA 1WAWA 2D22A 3N12A 1BYDA 2IXUA 1D3CA 4OBRA 3M6DA 3AMKA 3WUFA 5C8BB 1C8XA 1TG7A 3T0AA 4MB5A 2D2OA 4MB4A 3RMEA 3QHMA 2X0HA 3SEPA 1OD8A 1E4MM 3AOFA 2UY4A 3VNZA 1XHGA 1Q6FA 1SMDA 3WBAA 3W25A 2ZUTA 1CZ1A 1CXIA 1TE1A 3T09A 2OSWA 1B3ZA 4PUDA 4J3UA 4P7OA 4H8HA 4GXPA 1Q6DA 2DEPA 3LMYA 5BXRA 4CN1A 4UCFA 1J9YA 1MWOA 2WMIB 3WH9A 3VIGA 3G6LA 2Y2WA 2VRKA 2VZTA 1A3HA 3EDJA 1DWHM 1QBBA 1GZJA 3MANA 5CPSA 5E6YA 4PYSA 1E1EA 3OLIA 1Q4NX 3A4AA 1H41A 4AZCA 2CXGA 5JIWA 2DT1A 3AZSA 4UOJA 4AD1A 2WHKA 3PZMA 2ZUUA 5EMYA 3EDEA 1HJSA 3N17A 1XC6A 5I3DA 4IPNB 3WENA 2QPSA 2G8ZA 1JG9A 2OYMA 3ZJ6A 4W86A 3D3AA 2PC8A 4GINA 2ZXDA 4KGJA 3K46A 3PZNA 4PMDA 1UR8A 3APGA 4JZ5A 2FH8A 4WKAA 3HMCA 1ZJAA 3QR3A 1QNPA 5HBFA 1RD6A 2W91A 3W81A 1XRVA 4AY1A 3WELA 1V08A 4QLJA 2W66A 4Q22A 1HL8A 4Q7NA 3EBVA 4TVDA 1V6WA 2YBTA 3W24A 1W32A 5E0CA 2WYSA 1BVZA 4NZCA 4ACZA 2ZXQA 2VURA 1QHOA 5IDIA 1ISWA 2D0GA 2QMKA 3RM4A 1GOWA 4W7UA 2IUZA 1CGTA 4W8BA 3POHA 2YA1A 3WMCA 2BNJA 1MXDA 3ZM8A 5BCAA 1GJWA 4M56A 1W9VA 2PWDA 4AC1X 1GQIA 4PMQA 4A3YA 3F5LA 4D6EA 2XFFA 3WDRA 3ZT5A 4TTGA 3N13A 3K1DA 2CCRA 4AZIA 3AHZA 4HU8A 5BROA 1W1VA 4FLQA 2XHYA 1E70M 3FAWA 5HXMA 1LF1A 5DT7A 3RILA 4CCEA 1QI5A 4QFUA 1DWJM 1US2A 3ARVA 1KXQA 2ZICA 3VIJA 2YLLA 3JUGA 3PZOA 4E4PA 1E0VA 1K9EA 1C8YA 3KE0A 2WMIA 6CGTA 5I79A 1XV8A 2EQDA 1BAGA 3N04A 2JE8A 2PF0A 1MXGA 3EMQA 2A3EA 4NRSA 2G3MA 4U31A 2VMFA 4U5KA 2XFYA 1MW1A 2J7CA 1HP4A 3WD2A 2E9LA 1B1YA 1E43A 1GCYA 3CGTA 4MPKA 5LYRA 1LJYA 4UTFA 5A69A 2PBOA 2EPLX 3CIVA 4GI6A 4MDOA 2WMHA 1OGSA 3GNRA 4AISA 1PX3A 2X8RA 4CU6A 1KBBA 2XJ7A 1NWUA 1OINA 1E6ZA 1NOFA 1L0PA 3L4XA 1B3VA 3BXWA 5E70A 2FHBA 4URIA 4U3AA 2X09A 2J47A 1VENA 3CTTA 1W91A 1UKPA 2JF7A 1GNXA 2C7FA 3MMUA 4UFMA 3FW6A 1UQZA 5IFPA 1PJ9A 5ABFA 1EA9C 2JEPA 1PZ2A 5DF0A 1H4PA 5A8OA 1JNEA 4NI3A 4M1RA 3EDKA 1W1TA 1ZB5A 4U2YA 4LYQA 1KQZA 2VR4A 3WNLA 4WKFA 1MVYA 3K8KA 2YL5A 2DDXA 1A47A 2A3BA 2WVVB 5CPTA 1WZMA 1TCMA 3WNNA 5TD4A 5FD0A 2VOTA 2WZEA 3KL5A 3W37A 4B9YA 1FH7A 3OIHA 4X9YA 3UCQA 1E1FA 4FF5A 3EDFA 1NWTA 1XSIA 5JBEA 2FHCA 2VRQA 3VGEA 2WANA 3KEHA 2PWFA 3AMCA 4HU0A 1KGWA 3VIKA 5CLWA 2DSKA 3VDCA 3VD5A 1TA3A 2JIWA 1E3ZA 1UG6A 2CPUA 3N15A 2EXOA 5GNYA 1W3JA 4ZENA 4EANA 5D4YA 2ZX6A 4PBGA 1BGAA 1WDQA 2XVGA 3FAXA 5A8NA 2O9RA 1BHGA 4ZXLA 1TA3B 3QHOA 3E1F1 1FOBA 1EDGA 1DP0A 1H3GA 1TZ7A 1CNVA 1PAMA 1UR9A 4W84A 3WUEA 1UD2A 4P7NA 5HDRA 2F8QA 2BY2A 3O6AA 4QLKA 4KMQA 3VIHA 3NYDA 2UWFA 1CLVA 2Z1KA 2DH2A 2XYLA 4MNJA 1HP5A 1HXJA 3BGAA 1EDQA 2NT0A 4ATLA 2D3NA 2ZWYA 3VGHA 1C93A 1E71M 3A3HA 1JZ8A 4QCEA 3AS2A 1E55A 2W5FA 3WMSA 2ZX8A 2WAGA 1OWQA 5AY7A 5BXTA 5AC5A 2PWEA 4AIEA 4CU8A 1JI2A 1XSKA 2PWGA 3CHCA 4S3JA 1MFUA 2Y24A 4B3KA 4TVCA 1HVQA 4CN4A 1K9TA 3BCDA 5IXEA 4J28A 1E56A 1WZKA 4H04A 3LPGA 2E40A 5BWFA 1JDCA 1J0JA 3ZMRA 2B31A 2VQUA 1JDAA 2VUYA 5FOOA 1JIBA 1JFXA 1UKSA 1J12A 1UD3A 1UH2A 1V02E 1UWIA 3AIVA 4W87A 2X1IA 1HF6A 2CETA 2X05A 3U57A 4H7VA 1JZ2A 9CGTA 1FA2A 1KQYA 2J77A 2QPUA 5BXPA 3U7BA 3TTOA 3ZJKA 4DM2A 1VJZA 2VX4A 3ZR5A 4J3XA 5FIPA 1VBRA 1V0KA 1JAKA 2WPGA 1HT6A 1OB0A 1NP0A 3GM8A 3UETA 2WZIA 1JGIA 1XYFA 3CUHA 3HJEA 3WF3A 3ARWA 1E73M 4MAVA 2YJQA 4JAWA 1VEMA 3W28A 3PTQA 4MB1A 1QNRA 3EDDA 5GQBA 4B9ZA 3ECQA 3OGVA 1GOIA 3VU2A 1KB3A 3ARRA 3WN6A 1NH6A 5GNXA 1IZJA 1OIFA 4W89A 4V28A 4UFLA 4AZ6A 4KH2A 3CZEA 1M01A 2VZUA 5EB8A 3RCNA 2YA0A 1CBGA 3I3BA 3GBEA 1I75A 3CLWA 4HOXA 4DWSD 4CVUA 3QOMA 3VGBA 3WF2A 3ZQ9A 1JYVA 4GPNA 1J11A 2WC3A 1HX0A 4TOQA 1C91A 4EK7A 1BLIA 1E0WA 2DSZA 4W8AA 1C3FA 1RP9A 1R7AA 2WMGA 3I3EA 3WH7A 3ARXA 5A6BD 1Z32X 1W9XA 5A95A 2XPKA 2NW0A 3AXXA 2XTKA 1K6AA 3WQ4A 3G6MA 1TR1A 3WNPA 1QHZA 2WM0A 3OGRA 2BS9A 1UH4A 2WMJA 4W5UA 1SMAA 1UD5A 3ARTA 1SR0A 1F4AA 4L4OA 3AZRA 1W9UA 1WPCA 5A6LA 1OM0A 3VIMA 4AZBA 1FFRA 1GJUA 2J4GA 3L2MA 3S2CA 1GQLA 1UA3A 5DMYA 2XGBA 2BXZA 4GO9A 4JFTA 2J7DA 4CD6A 4WSJA 4R5EA 4MNMA 4PN2A 5C70A 3IANA 1UHVA 1JF5A 1JI1A 1JZ7A 2J79A 1QI0A 1RH9A 1E40A 1PPIA 2E8ZA 4UQBA 4D6DA 4HOZA 1E6QM 1FP8A 2QF8A 4OOUA 5GPRA 1H0GA 1B2YA 1VFOA 3CMJA 1LL4A 3A4WA 1OCQA 3UG4A 5IHRA 5KEZA 1GQJA 2D24A 2ZXAA 2W67A 4OBSA 3WEOA 1V6VA 3BAIA 3N11A 1HN1A 3WD4A 1E6SM 1GW1A 3OLDA 3UESA 4JIEA 1EQPA 2GUYA 5A2AA 1CGYA 1KWGA 1QI3A 2BHUA 2DT2A 4WSKA 1ZBVA 3VGDA 3VDBA 4MJ4A 5JUVA 4GI8A 4J3WA 3VX0A 2WNWA 4Z2GA 3ARZA 1KXVA 1OBAA 1QI4A 3N18A 2D3LA 3CZGA 1H11A 5A6BA 5I24A 4BQ5A 2GVYA 1C8QA 2JIEA 4FLSA 4HZ7A 3TA9A 4JL2A 1XGZA 2CBJA 3WDPP 4JCLA 1CWYA 1JL8A 4C7DA 1Q6CA 2XG9A 4DWSA 1J0IA 3CH9A 4ATWA 4N42A 1V3IA 2BV9A 5LA1A 2DGAA 1FH8A 1QI2A 4XUYA 3KL3A 3BCFA 4GZEA 4IM4A 1V6XA 4AZ5A 4PMOA 1HNYA 3WL1A 4AZ7A 4XV0A 1W9BM 2WKGA 3CZLA 4QDMA 4UFHA 3WDQA 3VILA 2ZUNA 4RE4A 1KCLA 2PBGA 3O2LA 4JL1A 7A3HA 4PMNA 4AIUA 5ABEA 2BY1A 4H8UA 1BPLB 2YDQA 3QGVA 5CG0A 2WC4A 4M24A 2BY0A 2WLZA 1WZLA 2NSXA 3IJ9A 3RJYA 1PBGA 1Y7VA 3ZSSA 4HMCA 1NOWA 4LX4A 3PTMA 3TTSA 4D1JA 3GXDA 3U7VA 4LQ1A 2J75A 4HPHA 3N1AA 2DSVA 2WBGA 1E6NA 1QBAA 4U5IA 1KBKA 2YOCA 3S6TA 5I77A 1XSJA 2Q8XA 3GXIA 2OLHA 4TVUA 2CBVA 1FHLA 2VL4A 2OSYA 1QW8A 2VZOA 3HU7A 4L4PA 5I6SA 1JYWA 3K8MA 4CU7A 3ZT7A 3PZ9A 2BHYA 1O7AA 2V5DA 4UQ9A 1E4LA 4PEEA 4P8UA 1CGXA 1JZ5A 3B9EA 1TVPA 2BXYA 2RGLA 1RPKA 1NWSA 4D6IA 3WFLA 3M07A 3VINA 2GK1B 3VMPA 4M82A 2QMJA 1J0YA 4MJ2A 3DECA 4NF7A 2W63A 2WCSA 5M5DA 3SCRA 1HKMA 4LYRA 3SUVA 5A3HA 2AMGA 3AIWA 4D6FA 1QNQA 2GK1A 4GQRA 1AMYA 3MS8A 3OBAA 4AD4A 1H49A 2BHZA 3SCTA 2TAAA 5M17A 2F2HA 3PZVA 4HA1A 5HPCA 3SUUA 5A6JA 3AISA 3SCVA 1UZ1A 3GXFA 1JZ3A 4J3TA 4JCMA 4UQCA 4Z2JA 3IAPA 4LPCA 3VD4A 2DIEA 2J78A 3CUFA 4JHZA 3AYRA 3WEMA 3CO4A 3AHVA 2XM1A 2OSXA 5E6ZA 1ZS2A 1UR2A 2VRJA 1LL6A 4UQEA 1V03A 1GVIA 5A94A 2ZIDA 2VCCA 1MYRA 4KGLA 4AD0A 3THCA 1G9HA 4BF7A 2BVTA 4JHOA 2FGLA 1KGUA 2OYKA 2HISA 1LWJA 4BS0A 4AMCA 4AW7A 5FL0A 3WQWA 1EOKA 3RO8A 1PIFA 1MQQA 4ZE5A 5A8MA 1JF6A 3A47A 3ZT6A 1E6RA 2FH6A 4OJYA 1TMQA 4TXEA 3ALGA 1J0KA 3FNDA 1XCWA 1MQRA 2WVUA 1W1YA 4CD7A 1JDDA 1UD4A 3WBEA 5A6SA 4YHEA 3ARQA 3TTYA 1CENA 3POCA 4U2ZA 3MSGA 1R87A 4CD5A 3W53A 2PB1A 5I2UA 4P7RA 5M03A 1JXKA 2WBKA 1U30A 3PZUA 5CJ5A 4Z2IA 1D2KA 3GH7A 2PI6A 3LPPA 1PIGA 4W85A 4E8DA 4F8XA 3L4TA 2YL8A 3W27A 1M04A 1GHSA 1ISVA 1M7XA 3DYPA 2QHAA 1IV8A 3WQ5A 1GONA 1OGBA 1GPFA 2ZE0A 5D8ZA 1V6YA 2WB5A 1CXKA 3NIYA 4B3LA 3OGSA 4E8CA 1BYCA 1R85A 2YLAA 1UUQA 2ZUMA 1HJUA 2J25A 1C7SA 3UR8A 2XIIA 3UR7A 3ARUA 1JNDA 1WDSA 2ZX5A 4TX8A 4LXFA 1Q6EA 3L4YA 1K9DA 1V3LA 3AQUA 2ESCA 1VEOA 5E9AA 3ARPA 4EAMA 1TFVA 4F9DA 1G94A 2XM2A 3PN8A 4C7FA 4P7QA 4R27A 1E0XA 2D0FA 5BRPA 3VIFA 1XH0A 5LA0A 3CUIA 3AJ7A 2X2YA 3VDHA 3BAJA 5DFAA 4PTWA 1IZKA 2GFTA 2CNCA 1B3YA 2OWXA 4N0RA 3U5YA 5HOSA 4GQQA 3GTNA 1JD9A 4PUEA 1DEDA 2EPOA 1V0NA 4KWUA 2XIBA 4JFSA 4MADA 2VTFA 4HA4A 4M29A 3W0KA 4W5ZA 5HPOA 1HKIA 3AYSA 1MQPA 1UA7A 1VB9A 2VQTA 2ZUVA 2WKLA 3GNPA 3AIRA 1QNSA 1N82A 4JFVA 4CGTA 3VGGA 4AD5A 2G3NA 1OGGA 1UKTA 2J62A 4YN5A 1M53A 1WO2A 1D7FA 5ABHA 1HJVA 1SYTA 3SCOA 1UD8A 1E5JA 3AMLA 4B16A 1XH1A 5ECUA 3BSGA 2VZVA 1CTNA 2JF6A 4C7GA 1HJWA 1KGXA 3VUPA 2BVDA 4ACZB 4UNIA 2WC7A 5BYWA 2WK2A 4BQ3A 1K9FA 1JAEA 2XGIA 3MO4A 2WLYA 3GBDA 1ISZA 2ZOXA 2E4TA 3MU7A 3BAXA 1ZJBA 1CECA 3WMBA 3FHAA 1E5NA 3WKZA 4GZJA 1EXPA 2VX5A 1AQ0A 1GOQA 2YL9A 1H2JA 4GI9A 2WWDA 3AIUA 3OZPA 4ZEPA 1DTUA 1UR4A 2RGMA 3SCWA 3SCQA 1DHKA 3NSNA 5KZ6A 4PCTA 1EIBA 3WF1A 3OZOA 4QP0A 4FK9A 5AC4A 4OZOA 1ITCA 1KR1A 5I23A 3NUKA 4PTXA 3ARYA 5I78A 5HNNA 3CUJA 1VFUA 4OOZA 3PHAA 2VR5A 3PZGA 4QCFA 1V3HA 4NSBA 1VAHA 4DUWA 4IISA 2VZSA 4JFWA 4AZCB 2DIJA 2YDRA 3I3DA 1PZ3A 3DHPA 4AIOA 3WFZA 4U33A 2OWCA 2WMKA 1FHDA 3OB8A 3NSXA 2EEXA 4B15A 3VVGA 2VCBA 1UWRA 2J7FA 3OLGA 1KR0A 4OIFA 3BMWA 1W3LA 3UEQA 3LPFA 1EH9A 1BGGA 2XUCA 3ZIZA 1LWHA 4XZWA 2DPEA 4BA0A 1CGUA 1NWRA 3B9DA 3W4RA 4WK9A 3WNKA 3F5JA 2E9MA 8A3HA 3T08A 2DSUA 3BAWA 3BAYA 4V2XA 4WKHA 1HKJA 2XSAA 2UY5A 4OKDA 3UG3A 3D5HA 2CIPA 4DWSB 1E4IA 4D6JA 1EO7A 2CESA 3T0DA 5A6AA 4E2OA 1V0LA 5FKYA 4AYSA 5CGTA 4YPJA 5M3WA 1BYBA 1I1XA 1RP8A 1V3KA 1DWGM 4PMRA 4BCEA 3GYCA 3MKKA 4Z2HA 7TAAA 3MUY1 1VFMA 1ESWA 4W7WA 1VF8A 1CLXA 3AXIA 1H5VA 1MW3A 4W7VA 1IT0A 1KXHA 2HVMA 2MANA 1J0HA 1KXTA 1DWIM 3GNOA 4MTVA 1ZU8A 3II1A 2O92A 1E6PA 3VKKA 3MMWA 1NP2A 2D1ZA 4A4AA 3CPUA 4AWEA 3AHTA 2WMFA 4ZFMA 5A1AA 1UH3A 3A4XA 5A2CA 3FHQA 4QLLA 3SURA 1US3A 1AQHA 2V3EA 2J7BA 3DC0A
chains in the Genus database with same CATH superfamily
4ML4A 1OFDA 2QLYA 1H7OA 4H9TA 1B4KA 2HXUA 3WLPA 4L65A 3VNYA 3C52A 2V82A 2EO7A 1RY0A 4J7RA 1JCYA 2PDXA 2OB3A 4IL2A 4O11A 3GNDA 1TPC1 2FTPA 2WO5A 3R4IA 4YMZA 5XIMA 4H8VA 4AWTA 3CQHA 4RDZA 4PTVA 3SIZA 4BKNA 4LGXA 1F76A 3PTKA 3IK2A 4S2CA 2A3LA 1E9ZB 3ZVHA 3R89A 4QG6A 4O10A 3KUMA 1I6NA 2YPIA 3WH5A 2GYIA 5I5RA 3I4KA 1CIUA 2P1FA 3QY7A 3ZFHA 1WV2A 3NURA 3WQ6A 4AD3A 3C8FA 2VVSA 2FGZA 1XCXA 3UZJA 3SADA 3PWIA 4GKLA 3K8LA 2VCAA 4TX6A 3O9NA 3K30A 1MNSA 5CQ1A 3OG2A 3MBFA 2PCEA 4H41A 2WHLA 3WQVA 1DV7A 3GVVA 3SUWA 5AHMA 2TRSA 4Q8PA 4O53A 2ZWZA 3OZYA 1R8LA 4GUJA 3PG9A 2PDLA 1U22A 2E77A 2ZX7A 4NYYA 3TN6A 2E0PA 4XZLX 1YTKA 5C9WA 1ODZA 4XX6A 5L6UA 2CLLA 1TV2A 3LHYA 1WDDA 2WHMA 1CI1A 3BLPX 1UZ4A 4GH1A 1ZHAA 2A3AA 1M03A 3MJMA 2L5HA 2FDSA 4WUIA 3EMZA 1XLEA 1GORA 4NJIA 3ITTA 5BU6A 1CEOA 3HN3A 5DY2A 3EPNA 3EWWA 4I90A 3GUWA 1YNPA 2PDFA 4IIDA 4EPBC 4HTYA 4P8VA 4V27A 3TYZA 1E72M 3S1GA 3DYMA 3QFWA 2CBUA 4Z2KA 3HZ3A 3AUJA 2IKIA 4AU0A 1F73A 2YB1A 1Z3NA 4XAFA 2A3CA 4IG2A 2CKRA 2PTXA 2BDQA 4FNRA 4GYKA 5LNRA 1C90A 2Y4SA 1UJQA 5CEWA 1T40A 3NQMA 2Z1SA 3ZOAA 3BURA 1UOKA 1GVQA 2DZPA 3L66A 1GVEA 5D9NA 3ITGA 1WDPA 4C6BA 1JD7A 2ZC8A 3W7RA 4XG1A 3WQOA 4K8GA 2O4MA 1MEHA 2QCLA 3SZ8A 5D9OA 4AIBA 1ME7A 3UP8A 4BI7A 1JXJA 2IKJA 3CH0A 3NGFA 4H7ZA 4OGZA 4JQ2A 3RAOA 2SFPA 3EZ4A 1L6SA 4CNTA 1WXYA 1FDJA 3N19B 3VGFA 5HMFA 1IWPA 1GVSA 2AL2A 4H2HA 4S3KA 3MP5A 4CQ8A 3SCNA 1G01A 3N2BA 3KL0A 3WF4A 3RCMA 4MDPA 2YCJA 1XYCA 1PCWA 2VWSA 3CEPA 4X0NA 2HSAA 1IEWA 2AKZA 3NQCA 2J7HA 2OEKA 3ZLHA 5DT5A 1UR0A 3R7MA 2Z2AA 5CPQA 2Z24A 1U5JA 3CYJA 3W7KA 4C91A 2VVNA 4NX0A 1ZBWA 4NYUA 3G22A 2WOQA 6REQA 4JQ1A 2VDHA 3R6IA 1GHRA 4LWWA 1B57A 3MV11 1XBXA 5FF7A 5FF2A 1A5OC 2X2GA 3ZJ8A 4ZCWA 5H8MA 1ITUA 4NT0A 3VIOA 4JFUA 4RKAA 1BQCA 3AMGA 5GVJA 4KEVA 3O7UA 2BSLA 1NFBA 2OX1A 4KS0A 3TP4A 4Y9PA 3LYEA 4DO7A 4ICMA 5AC8A 5JBDA 3AYVA 2QIWA 3W87A 4NP7A 2AMXA 3IGHX 4WGHA 1IIHA 5D09A 2QCHA 1YIXA 4M19A 1PHWA 4O15A 4XIMA 4IMDA 5F4WA 3HQNA 4RV3A 4EKJA 2Z2BA 3ITXA 3S5OA 1IXNA 1KC7A 4CCDA 4DM1A 3ANVA 3LTYA 2ISVA 2P76A 4WIWA 3ARSA 1XLMA 4L5ZA 3B8SA 4RV8A 1PEZA 4J3VA 2EG7A 3EB2A 1Z44A 4I8YA 2VEPA 4I9JA 3VI2A 5E09A 1YHTA 2HDJA 4AEFA 4ZSUA 5LGZA 1KFCA 3GHTA 3BMXA 2B4GA 4L1XA 3U3HA 5EA9A 2OGJA 2V38A 3F4VA 4R34A 1OT1A 5DXXA 3ME3A 2VFGA 1F8IA 3KOFA 4JTEA 1QPKA 3IAQA 4NNAA 4DXKA 1BWVA 3N2TA 3G1FA 4C1KA 1OZQA 3LGGA 5MHBA 1TJRA 5C9XA 1EZ2A 3B4UA 3N4FA 2CZFA 5A8QA 1CLKA 2OKOA 3R8GA 1DVJA 2HVOA 3F4CA 3M7SA 4JKLA 3V7PA 1SFSA 1WP6A 1OK4A 1AVAA 2XU2A 4JTJA 1YX1A 4Y7EA 3QY8A 3OVGA 5ABTA 4QR6A 5I09A 3Q4DA 4XD5A 2VEFA 1CDGA 4P8WA 1JRCA 3FN9A 2DZUA 4FLOA 3U2EA 5GNZA 4CCCA 4UBPC 1Q45A 1WE5A 1X7FA 4GO8A 1RBAA 1F4HA 2VT0A 4XBKA 1CX9A 4CVWA 3VOCA 4LFYA 3V0UA 2GWNA 3WNOA 4KBXA 2FHFA 4TV5A 5FSEC 4DJEC 4NAEA 3G1VA 3EOUA 1AL7A 1OCJA 4WLCA 2WVSA 5CC6A 3C2YA 4GLEA 2ZRXA 3CK5A 3S83A 3SJ3A 1GGOA 2DZAA 1SR9A 2BY3A 2WKJA 4LRTA 1EGZA 4FIQA 3PZQA 2EHHA 1J18A 3QR1A 4MHBA 1VHNA 1U83A 3BICA 2D69A 2PTDA 3V0TA 1CPUA 1L8PA 6PTDA 1DJQA 1HIZA 2NWSA 4C6FA 4M81A 1BVNP 3PJUA 2PWHA 1BWLA 3DG7A 3KM8A 5LHFA 1G5AA 2VKZG 3N2OA 2BOFX 3WH6A 2Y5SA 4KCWA 4N9CA 3BAKA 2ZXBA 3C0QA 3LERA 2W62A 2NQHA 1F5ZA 2VENA 3CHFA 4C1LA 3TLQA 4PRWA 2HVNA 1Y5WA 3VIPA 2V5KA 3EAUA 3QGAC 4F9JA 3WK0A 2GQ8A 4DJFD 1DORA 3K4AA 2CYGA 1S5WA 2H9AA 4P8XA 3VDAA 1XS2A 2QUUA 4I9MA 3GDLA 4CQBA 4IFOA 1MUCA 2D0HA 3W73A 3WUBA 4A6GA 3W2UA 3FY1A 2PURA 3C56A 5HMSA 1W2PA 3P81A 3VTRA 3P5YA 1B0IA 3B9AA 4D71A 4H9ZA 4D6CA 1SU5A 1DE5A 4UQDA 1VD6A 3U5UA 2VC9A 2PODA 1PX4A 2F38A 4O1BA 2VGIA 3WF0A 1WCGA 1MW0A 3RK8A 4O13A 4IICA 4ZQPA 4Y8EA 2V5JA 4JKMA 4MLRA 1R38A 4Q8MA 3RX4A 3NOYA 3LPOA 4EE9A 2EBNA 3GDBA 1BFNA 4ACYA 1TUXA 4OU1A 3CNYA 3KX6A 4OUEA 1CXLA 2BGSA 4Z1BA 2FZBA 4AHPA 4NHVA 1JUEA 4NAFA 3VNLA 3RDKA 5BMWA 2R1KA 3L5AA 3A22A 1B3XA 4HNLA 3N12A 3BG9A 2DIKA 3M6DA 3WUFA 5C8BB 2CFFA 5CZSA 3FX4A 1QFEA 3USBA 2R82A 4LVDA 4A21A 3GTIA 1JPKA 5HMDA 3DENA 2O0TA 3AOFA 1K70A 2PZNA 3M0ZA 1PCKA 3VNZA 1XHGA 3BQ5A 1SMDA 1UROA 3L68A 2C14A 4K7YA 3BANA 1Q6DA 4WJEA 5BXRA 1HKWA 2YW4A 1J9YA 4IMGA 3GFYA 4UR8A 1TELA 4PR4A 3EDJA 1DWHM 1VS1A 3EGJA 4LVAA 3F2BA 1R2TA 4LB4A 5E6YA 4FB7A 3LTPA 4UTKA 3EWXA 4GY1A 3W7DA 4O0KA 4GC4A 2ALRA 1WKEA 4ZBCA 3WENA 5D2VA 3ZJ6A 1FWRA 4W86A 3D3AA 4ZTYA 3K46A 4V1XA 3R79A 3LA4A 3HMCA 1ZJAA 1FWNA 3DN5A 4NU7A 1RD6A 3W81A 1X38A 1LM1A 5EL1A 1ZTVA 1HL8A 3FJ6A 1HUVA 3MQTA 1V6WA 3WJZA 3W86A 3O16A 3GTHA 1W32A 1PB0A 3PB2A 3CAKA 3S2JA 3SSZA 5AVNA 3G1AA 3HG4A 1MRQA 3UJFA 1QHOA 2CXEA 1V79A 1ZJIA 2QMKA 1GOWA 4W7UA 1FWHC 4NIRA 3POHA 1JPIA 3HQPA 1I45A 3GC5A 3W2KA 1N8FA 3WQDA 2CU0A 2PU1A 3WQPA 3U8GA 1GJWA 1KV5A 3GXPA 4M56A 1W9VA 4WDXA 3TROA 1IR1A 3T8LA 4A3YA 5C9UA 4D6EA 2YDAA 3PBVA 2XFFA 4RUBA 3N73A 2UV8G 3RLVA 4AZIA 4FLQA 3OPSA 1P43A 5FJJA 4QQ3A 3DERA 4CCEA 3P67A 4MJMA 4YL2A 1FWWA 1US2A 3KRUA 1NSJA 3ARVA 1RCOB 3JUGA 4LUTA 3RLUA 2PDYA 1ZAHA 5B80A 3KE0A 3TJIA 1XV8A 1S5VA 2JE8A 3BPWA 3UJRA 1MXGA 2Y5JA 7XIMA 4CNOA 4UC5A 3QVQA 2QT3A 2XFYA 1YXYA 2OELA 4FI4A 1B1YA 1E43A 2Y88A 3CGTA 4REQA 3CIVA 4A29A 1OF6A 1RLCL 4N4PA 1KBBA 1V5XA 1NWUA 5DY3A 4C1NA 1KCZA 3D6NA 1L0PA 3L4XA 3S5NA 1B3VA 4GFIA 5AFDA 3BXWA 4URIA 2X09A 2ZKMX 1S5NA 1DXIA 3S4TA 1TMLA 3DHFA 4X60A 3KVMA 3ISIX 2JF7A 1NVMA 2C7FA 3MI2A 4Q33A 5IFPA 1W1B1 5ABFA 3R0DA 1PZ2A 1H4PA 4PUJA 4QRNA 2CW6A 4RW5A 1KV8A 2REQB 4HYWA 4U2YA 2R94A 2VR4A 3W74A 4WKFA 1MVYA 5I03A 3ZWTA 4J35A 2DDXA 1A47A 2JGYA 2A3BA 2WVVB 4ROPA 5CPTA 1TCMA 3MKCA 4JQ4A 5TD4A 5FD0A 5HINA 4JTGA 3W7GA 3W37A 3UCQA 1E1FA 3CV1A 4FR1A 1AZ1A 2A0NA 2WANA 3HGSA 4AVFA 3O3RA 4IPIA 4HU0A 1KGWA 1ZNNA 4U28A 1K8YA 4I5RA 5KTLA 3KTXA 1BRLB 1L2UA 4I7UA 2CPUA 1RVKA 2PDQA 2EXOA 5H6HA 4PBGA 4RZBA 1MO0A 1P0KA 4GVGA 1FKWA 1Q5MA 5A8NA 4ZXLA 3QHOA 1XFCA 4HN4A 1E1CA 1UD2A 4P7NA 4LY4A 5HDRA 3W72A 1DTNA 4GC3A 1Q66A 2FKPA 1IHIA 1CLVA 1LBLA 1Z69A 2XYLA 1KA9F 2H90A 3RFAA 4AY8A 3BGJA 3QH2A 3DEQA 4PBFA 1X1ZA 1F6YA 4Z1AA 3BLLA 1QASA 2NT0A 5AHIA 4HK5A 3UR2A 3LCLA 3VGHA 1AW2A 1LBFA 3UBPC 1E71M 1XBYA 4QCEA 2Z7KA 3BDKA 1UASA 2CZVA 3TW7A 1EJRC 1SW3A 1PKYA 5FEWA 3MWCA 5AY7A 5BXTA 5AC5A 4AIEA 1Q3NA 3CXOA 1JI2A 3N14A 3LCWA 2PWGA 3TYDA 3GAKA 1MFUA 1PXGA 4TVCA 4CN4A 4H01A 1GTHA 2PZ0A 4GVFA 1EP3A 3WJYA 4H04A 3W1QA 1O4UA 3LXBA 1JDCA 3ZMRA 3LBMA 4LEFA 4F0RA 4OT7A 2VQUA 3V0SA 1JIBA 1JFXA 4QE4A 5C54A 3EWBX 4W87A 5HJXA 1V02E 1UWIA 3MDUA 3LOTA 1HF6A 4AQLA 3WJWA 1JZ2A 1Q8AA 4PUUA 4IG2B 2J77A 5TAOA 2X30A 3N29A 4PRTA 3NR0A 2BMBA 4AWSA 5I3IA 1VBRA 3I65A 3DU0A 3GLCA 3KCOA 1ZLPA 4C6LA 2TSYA 4NNBA 1XYFA 4FNQA 4UWMA 4PTNA 3HJEA 3A4JA 3GFZA 5L9FA 4RXGA 4GRSA 4LF2A 4J5NA 1XW8A 1QNRA 3EDDA 1DIDA 4B9ZA 5F1VA 7ENLA 3A64A 3ARRA 3NQVA 3WN6A 1R30A 1V51A 4LYKA 5GNXA 3UVIA 1IZJA 1QW7A 3HTWA 3TQKA 4AZ6A 4I6VA 4KH2A 1VR6A 1M01A 5IBXA 3RCNA 4NZ1A 4B91A 1CBGA 4JS3A 2QCDB 3RNDA 3WQCA 4DZ5A 3CLWA 3I6RA 4HOXA 4CVUA 3QOMA 3UYCA 1KD0A 1JYVA 4ADTA 4A3RA 1J11A 2NVCA 3C0SA 4MUZA 1E0WA 3DG3A 4QM1A 3C0JA 4IQLA 3ARXA 1SQ7A 5A6BD 2NQZA 5EKYA 5A95A 2ZZ2A 2XTKA 3EPOA 4PL1A 3WQ4A 1LRTA 1XIFA 1TR1A 3GHUA 4S3FA 5H2ZA 4XQ6A 3E2SA 4JTDA 1SZNA 4BEQA 3P3BA 5FEZA 1I0BA 1SMAA 3ABQA 1SR0A 3AZRA 4EAYA 2PS2A 4I7WA 2QXWA 5A6LA 2PLJA 3LRLA 6XIAA 1FFRA 2YZRA 5FF4A 3W2LA 4I6KA 5FF0A 1RA5A 2QNEA 4QEEA 3QQ0A 4HSOA 3HM7A 4PB5A 4H19A 4GO9A 4JFTA 3NNTA 4GXWA 2FTWA 2J7DA 4WSJA 2PDWA 3TK7A 4WDTA 1A3XA 1JF5A 2DFAA 3M41A 4JNMA 1JI1A 1JZ7A 2J79A 4RCXA 2GJLA 5HULA 1E40A 4JTAA 1HFBA 1PV8A 4DJFC 1AH0A 4KIEA 4HOZA 1E6QM 1JUKA 2QF8A 2V68A 1VZWA 3YPIA 1VFOA 3Q2DA 1LL4A 1EEPA 4H83A 5AHEA 4FNPA 1FTXA 4KWVA 2ZXAA 4OBSA 4L6HA 1S1PA 1V6VA 1WAUA 3BAIA 3N11A 1KBLA 3IV8A 4JQ3A 3GIPA 3WLKX 1XRSA 4DBEA 3OLDA 3MZ2A 4LC8A 3IVUA 3UYIA 2C13A 4M0XA 1TPWA 5A2AA 1RPXA 3BGGA 1CGYA 1KWGA 2BHUA 2NV1A 4ZOEA 3L5LA 4CEUC 4J3WA 3EXSA 1KXVA 1UC5A 1OBAA 3KRSA 2D3LA 3EA1A 1FUYA 2WZTA 5BOEA 3OW1A 1RJPA 1C8QA 3TA9A 1PO9A 2Y7FA 3V36A 4NL1A 2ON3A 2ISWA 3EX2A 3UA4A 1CWYA 1EPXA 1Q6CA 1EJXC 2Y70A 1J0IA 3B3DA 1IGWA 2NUYA 4N42A 3HFYA 4YTQA 5FJIA 3MUCA 3UU0A 4UTJA 4J3ZA 4MZ1A 2X0SA 4GZEA 4DLFA 3PK7A 4PCFA 4PMOA 4HMNA 4EXAA 3W70A 1LT7A 3B0YA 3OIXA 3WDQA 2ALDA 3JU2A 8XIMA 2PBGA 1VQTA 3NVTA 2J88A 4GQGA 4PMNA 1L9WA 4H8UA 3TYUA 3MHGA 2WC4A 2A79A 2WLZA 4C90A 2XIOA 4LX4A 3NA8A 2QPXA 3HIJA 3UPBA 1QK0A 3TTSA 4D1JA 3TUUA 3U7VA 1PDZA 1HO1A 1E6NA 1IT8A 1V7AA 3TC7A 5F2GA 3HGRA 4R7OA 5I77A 2Q8XA 4EF8A 1P48A 1TSIA 2CBVA 4JGDA 2Z0IA 3GDKA 1QW8A 2VZOA 2Z1XA 4MIMA 4XKMA 5AYXA 3SAZA 4A8IA 4R7WA 1A5KC 1Y0EA 5G1MA 2QV5A 4KKXA 2RDTA 3U0HA 1XBZA 4PEEA 3PWGA 3BG5A 1Z6KA 2BXYA 5U7SA 2R8WA 4QEHA 4AB4A 2GK1B 4PTDA 4ZQOA 4JTFA 3G18A 4WRHA 2W63A 2A5HA 3ES7A 3SCRA 1HKMA 3SUVA 4KETA 4GABA 4Y96A 1EUAA 3IIOA 2AMGA 2ZRUA 4D6FA 4RJEA 1XIJA 4GQRA 1H49A 3SCTA 3LV6A 2OO0A 1TPFA 3SUUA 2P0IA 5IOBA 3BOXA 2HEJA 3VKJA 4Z2JA 1F9CA 2VFHA 4LEQA 2RJHA 3VD4A 3PM6A 2XH2A 2QEZA 3B97A 2ABBA 3AYRA 3GVQA 3NTYA 2OSXA 2VDGA 2Y7DA 2VRJA 4UQEA 1GVIA 1T8QA 3FIGA 2ZIDA 2VCCA 1IGSA 3SFWA 2Y63A 1BEUA 2ONEA 4A35A 3PPGA 4JHOA 3PSWA 4OHQA 3WYZA 2OYKA 3SFKA 1X8CA 4BS0A 4AW7A 2RHGA 3P82A 1XG3A 3Q45A 2NUXA 3TR9A 3RO8A 1MQQA 3P80A 4ZE5A 6ALDA 3VE9A 5A8MA 4JTCA 1J96A 2ZTJA 1MQRA 4GGBA 4CD7A 1EF3A 1I4NA 2DY3A 3WBEA 5A6SA 3ABXA 3ARQA 3TTYA 1CENA 4NXSA 4H6QA 3LNMA 3LTSA 2WJDA 3PB0A 1D2KA 3K2GA 3LPPA 4CNUA 3A13A 4F8XA 3MKVA 4HB7A 3I7QA 1ISVA 1OHLA 2QHAA 3GR4A 2F9RA 1OGBA 2NV2A 3CQKA 4B3LA 2X7WA 1FCBA 1R85A 1DJZA 2ZUMA 1ICQA 3TWBA 3W2NA 1K1DA 1KRCC 4C6NA 4Q4OA 3L4YA 2W3ZA 1T99A 1VEOA 1FDZA 3KCJA 3BLEA 1TFVA 1W8SA 4HSHA 4C7FA 2OEJA 3QZEA 4AF0A 1J79A 3QC3A 3NZQA 2ZA3A 1R0MA 4ECLA 1XKYA 5D38A 3VDHA 3ANUA 2VFFA 3SY8A 2GFTA 4BWLA 4K1GA 2CNCA 3T1GA 3H12A 4H1ZA 1GKQA 3F2DA 5HOSA 2NWRA 3UW6A 3GTNA 1JD9A 2WPBA 5FJUA 2F84A 1DEDA 3S8HA 1DJGA 3C2OA 5DCDA 3KCLA 3XINA 2Z1VA 4I9AA 4KWUA 3GDTA 4GUFA 3CEUA 4ZTXA 4AHOA 4JFSA 3F4DA 4MADA 2VTFA 3IGXA 2FQIA 3OODA 1BXNA 1HKIA 3AYSA 4TU1A 4Y9NA 3SM0A 1UA7A 4I9TA 2VQTA 2ZUVA 1XPGA 4H7CA 2V2CA 4PZVA 1LQAA 1PKNA 3GC4A 4JIRA 4JFVA 3FS2A 2OO6A 2RFGA 4XO6A 1EJUC 4YN5A 4LRSA 1M53A 4V15A 1WO2A 2HTMA 1UD8A 3C0LA 4KWOA 1XH1A 5ECUA 3BSGA 1EB3A 2PRLA 1KGXA 2WC7A 3I6EA 4J2MA 3ITYA 1TQJA 1G4PA 5CSSA 4Q4MA 2WLYA 1FWIC 4LVFA 1ISZA 3HPZA 3B8WA 1JCTA 4H9XA 1M1BA 2H8ZA 5EYWA 4IMAA 4LV9A 4GHRA 1EXPA 4Q8NA 3QSTA 2CLEA 1EF2A 2YL9A 3DFNA 4NJJA 4Q4QA 1TV4A 1VFSA 3AIUA 2QAFA 4F0SA 4ZEPA 2RGMA 3RPTA 3SCQA 4PRRA 1RY8A 4DJDD 2G97A 4Q4KA 3OBKA 5MKGB 3LLFA 4F0KA 5HJLA 5AC4A 1BVWA 3ARYA 5I78A 4DAFA 2ZVRA 1POKA 3R43A 3FEQA 1VAHA 5AYYA 4OWGA 1WKFA 2DIJA 1N8IA 1FWSA 3WFZA 1FHDA 3TTEA 3SQMA 3W85A 4BI5A 2QCFA 4GWEA 4TMBA 3MVTA 3LPFA 4GISA 1EH9A 1F3WA 1AL8A 3ZIZA 4XZWA 4TV6A 4WJ8A 1F3TA 1NWRA 2FVKA 3BWWA 3JZUA 3F5JA 4C1NB 1S5TA 3ENLA 1OYBA 2DSUA 1B5TA 4H9VA 4V2XA 3M5ZA 2GVJA 4W9TA 2UY5A 1KKRA 4F4RA 1BKHA 2OVLA 3UG3A 3TCEA 4NZJA 2Y62A 3T0DA 3B8VA 3MWAA 1EP1A 2QDHA 1V0LA 5DMMA 3NQ2A 1IEQA 4YPJA 1DJXA 5M3WA 3MW7A 1RP8A 1V3KA 1XJBA 1Y65A 4V1YA 1R2SA 2XN0A 1W5OA 4JN7A 3RRAA 1BF6A 2HVMA 3RX3A 3M0XA 4QS6A 1XICA 1WYIA 1ZU8A 3M1ZA 4ZZ9A 4A4AA 4AWEA 3AHTA 5CZTA 4QLLA 2Z25A 2J7BA 5C0QA 3ICJA 4YVXA 1OX4A 2RDXA 2XWEA 3O63A 3WD0A 4O14A 2CHOA 2HV5A 1QTWA 3RN6A 1R3RA 5EFFA 3RHGA 4C5ZA 1FBAA 5KITA 3L4WA 4YCPA 3IJ8A 1E4NA 1B3WA 7TIMA 1BXBA 1WDRA 3SB0A 5BW6A 3BCJA 4PMUA 3GH5A 3LMZA 1P6WA 4ZO6A 1KFLA 3NQBA 3CO8A 4K2SA 2IXVA 1DWAM 1JZ4A 4X9SA 1X8FA 3PBYA 2ZRWA 1RSCA 1DQXA 1H0IA 1VEPA 1TVNA 4GIEA 4UQAA 2VHLA 3VM5A 1FWCC 3K13A 1N7KA 4B5XA 3VZZA 1NIUA 1QO5A 3WMLA 3AROA 3O0KA 3LRMA 3RIKA 3SRHA 5KSWA 4H2CA 1PTAA 4KWSA 1MZRA 3WSUA 4DLMA 2E6DA 1BTMA 2TODA 4FMVA 4S3BA 3IIVA 1J6OA 1RR2A 1OIMA 2OG9A 2EG8A 3GIYA 5DBTA 4DPQA 2XWDA 4KIRA 2J8FA 4Z0JA 3P6LA 1HJXA 3HF3A 3EMCA 2G41A 4M5PA 3TX9A 2QCGA 4NX5A 2EPKX 2J6XA 5GJNA 5IFTA 1PTGA 2FTYA 4MAZA 3HURA 4IP7A 3SCUA 3CMFA 5K7JA 2IKHA 5C71A 3REQB 3APYA 3WH8A 1JCLA 1XM3A 3QOKA 3WQ8A 1GK8A 1YPFA 4JY9A 1ZPTA 1Z42A 3LCXA 3NL6A 1S2UA 3SRFA 2ZZ1A 1OJXA 1FKXA 3CUGA 2ZZ5A 4LNCA 5AYBA 3AXKA 1W5MA 1XLLA 2GUUA 2AAAA 4IFRA 1XDMA 2VEKA 3SN1A 4EIVA 3P2VA 4RE3A 3FVDA 3RF9A 2O7QA 1ELSA 2FFCA 4NAFB 1D3GA 2NZLA 4N9DA 3HO8A 3UXKA 3FOKA 4BQ4A 3HPXA 1BSIA 3ONBA 1CGWA 1UBSA 2OLAA 4MPQA 3HGJA 1RQEA 4M6UA 1V3MA 3T40A 1WZAA 1LQ2A 5JIPA 4XISA 3CHEA 3H2NA 4CQDA 1KCKA 2AGKA 2G95A 3LLXA 2WCAA 4B2DA 2QDGA 2FMOA 3B4YA 3J7HA 2C8NA 1UYQA 1P0DA 3U6WA 3BW2A 1NARA 3RM8A 3WD3A 3URBA 4M6VA 5CSRA 1HL9A 3LXAA 4QTGA 6A3HA 4HMDA 4IPLA 1OK6A 3KZSA 2AOSA 5LA2A 4C6DA 1Z41A 2G4FA 3G0XA 5AYIA 2D2GA 3MA8A 1BG9A 4KW2A 2VOMA 1XDJA 3W3OA 3AZTA 2WVTA 2GDUA 1XLBA 1QUMA 1TIWA 2CBIA 4WF7A 2A1YA 1D8CA 1F07A 5DRIA 4RZ6A 1QVBA 2GUBA 2J7EA 1YDVA 1JPMA 2Y5EA 4RLIA 1OX4B 5FEXA 2REQA 4Q8QA 4S3DA 1GVFA 3DI1A 7CGTA 3A3WA 3TSDA 4PSPA 5FL1A 1XH2A 4CD8A 1QCWA 2I5GA 1W1PA 4IIFA 3VMOA 1EO5A 1KCXA 1I60A 1OQFA 4RDVA 4E4UA 5C9ZA 3IUDA 2FJKA 3WLMA 4GCXA 3VM7A 5EBAA 1OC7A 3GR8A 3GKAA 4O8AA 1X1NA 3T78A 4B3ZA 4E0CA 2GJRA 2J7GA 2HBXA 4LALA 1XI3A 2V3DA 3ITLA 5I3KA 2GJXA 4MLJA 4J1OA 1BF2A 1XRTA 4MKVA 4A3QA 4KEZA 2NLYA 4PMVA 1MFVA 4WR3A 5SWUA 1QMLA 4YXGA 2DVUA 3PF3A 3M7WA 2WHJA 2QJJA 1LOLA 1W6TA 1F2JA 1F7BA 2Z1WA 1NM9A 5IM51 4C60A 4DUVA 4LYPA 3T8QA 3L4UA 4JYEA 4N4QA 5ABFB 1DQUA 1TPUA 3CZ8A 3UWYA 1JFHA 3R8RA 5D8WA 4Y9AA 4PCSA 4PMXA 1IT7A 5CLTA 3TOPA 1OEPA 3O6CA 3B03A 3P84A 3NDYA 3EPMA 3L2IA 4DNMA 1TV3A 1B4EA 4HQVA 1ITXA 4GQ0A 3QF0A 1O1HA 3Q65A 1BYAA 1JQVA 1W3TA 4HHHA 4OVXA 2CEQA 2VC6A 1ZAJA 4HP5A 1QRQA 4KESA 1QXLA 3OA5A 1LZOA 1XQKA 2B7NA 3I4EA 1EDTA 5KZMA 5ABGA 4TUFA 1W5PA 4RDWA 3N4EA 1CGVA 2EJ1A 4ZO7A 1CYGA 4JIIX 3PTDA 5BU9A 1IIGA 2VD8A 4NZ5A 4B5TA 3NEHA 3RGTA 1Q7ZA 4M8UA 4O16A 4D6HA 1DHPA 4QG8A 4QAWA 2C18A 3W88A 2YBUA 3WUGA 3SUTA 2WSPA 4X3ZA 4G5DA 4ES4A 3IJDA 3UJ2A 2CLFA 3UT0A 2GOKA 3VE7A 1U33A 2E9BA 3W1TA 4AHQA 4HJWA 1XR2A 3VX1A 3GXMA 3GHRA 3ZVHB 1QR7A 4UZSA 1KFWA 5G4EA 3VMNA 3GQYA 3WJXA 4J3SA 1NDYA 2OOFA 3GZAA 2FB3A 4GIAA 3OLEA 4NILA 1J5SA 1MDRA 4WJXA 2XVNA 3A24A 3ZXWA 4GYJA 4UFKA 3WLHA 4P7LA 3AS3A 2GLKA 3TE9A 2Y8KA 2UY2A 2YR1A 3TA6A 1UWTA 1GQKA 1E3XA 3I68A 1X96A 4GUIA 2C3ZA 3VD9A 4DJFA 3R94A 4A3HA 3SY1A 4XZIA 1XCFA 1HJQA 3ATYA 4Z1CA 5JH1A 2QCDA 2DW7A 3ITOA 3ITVA 4HKPA 3SRDA 3NEVA 2I56A 4KCUA 3A5FA 1REQB 4MB3A 3E74A 3IUIA 4O57A 2E8YA 4HNVA 5E93A 2PDNA 4L4LA 1C7TA 5D03A 2BVYA 1WNOA 2VP8A 1XLJA 3PBGA 1PTDA 2PAJA 4K1WA 3VC6A 1XINA 3NSMA 3AIEA 1JCXA 4B5VA 4UTIA 4QISA 3CPGA 4UR9A 3BLKA 1E15A 3E2VA 5F2MA 3QLDA 2AGTA 1P6BA 1SW0A 3L12A 3LLDA 2DH3A 4KFPA 1QW9A 4UB9A 1V02A 3PBMA 3VXGA 4FF7A 3TSBA 4GY0A 4AFYA 3E3HA 2HK1A 1ISYA 1S1RA 4JDBA 3EEGA 4F0HA 3DFQA 5I0DA 3W2MA 3FXYA 4FR6A 3S47A 3R25A 3P74A 3CL8A 3OJGA 4JTQA 4L56A 1TX0A 5AB3A 3THQA 4QDPA 1JQXA 5G1TA 3ERPA 3T0AA 2WM1A 2D2OA 1J5TA 4D2JA 1OD8A 3NM3A 2EPHA 1Z9AA 2I1OA 1Q6FA 4WD0A 3T09A 2OSWA 3SQSA 3O05A 1JGMA 4PUDA 2PSNA 2PRHA 4H8HA 4GXPA 1Q13A 4WX2A 1C8VA 1NELA 4XO7A 2VRKA 1HGWA 1XGDA 1K7EA 1GZJA 4TX9A 1Z48A 3NQ7A 1YBQA 1TJPA 1MDLA 3OLIA 3A4AA 1H41A 2X41A 2F6KA 3AZSA 4AD1A 4PUNA 2ZUUA 3VFLA 3EDEA 3RR1A 3N17A 2H8XA 5E0KA 2VR2A 4LCQA 1XC6A 1QOQA 4IPNB 2JBMA 2PC8A 5HAOA 4GINA 4P61A 3W1PA 2ZXDA 4KGJA 1MRAA 4BI6A 3PP7A 1ITQA 4DBSA 4G6CA 4Q8TA 4PMDA 4ZOAA 4JZ5A 2RKXA 3SBFA 3QR3A 4DJDA 2F6UA 5HBFA 2W91A 4MFEA 1XRVA 4AY1A 4KT2A 3UQNA 5D04C 5I3FA 1V08A 4A2RA 3VOFA 3NQ6A 3FSTA 2V0TA 1TPB1 4Q22A 4TVDA 1SZFA 3O0FA 5E0CA 1NDVA 2O7SA 4NZCA 3T4CA 4ACZA 5CC7A 2D0GA 3TJ4A 5LNWA 1SUXA 3IRSA 4W8BA 1YMYA 3WMCA 1W5QA 2BNJA 1MXDA 3GSMA 4AC1X 1GQIA 1Z8AA 4PMQA 3F5LA 5KZDA 4F0MA 1N8WA 1TVLA 3PY2A 2BBFA 3E0FA 2CCRA 3E6EA 4RNIA 4GVHA 4JIPA 3B0VC 3FAWA 4OECA 1NFPA 1LF1A 1AZ2A 1EJTC 3B04A 2Q3RA 5DT7A 5GJMA 3PJWA 2ANUA 4B5SA 1QI5A 4QFUA 1I8JA 4CNNA 3RITA 2CZEA 1KXQA 4UUIA 2YLLA 4R85A 3PZOA 1YTEA 5HNUA 3RUBL 4ZR8A 1RBLA 2GVEA 2FB2A 2EQDA 1BAGA 5FA5A 3N04A 3TJXA 1WKDA 4NRSA 1DXFA 2G3MA 2HS6A 4U31A 2J7CA 3QRHA 2KAUC 3DDMA 3B0XA 3QPEA 1GCYA 5LYRA 2OCZA 3COTA 4GYPA 2CLHA 2YX0A 1OGSA 3Q37A 2YCKX 1PX3A 3DFTA 3T44A 2G37A 4EPEC 2WNQA 2EF9A 2WQDA 4LVGA 2FHBA 1T5AA 1TWWA 3CTTA 3TZFA 4WGXA 3EWCA 1EWEA 5CAKA 1UKPA 4W4QA 3QTGA 1YW1A 1GVOA 4G56A 4UFMA 2YCEA 1UQZA 2ZQ0A 5AYZA 1PJ9A 1W3NA 1UPPA 1AH4A 1UZHA 2JEPA 5DF0A 3CUZA 2BXVA 1VIZA 3TR2A 2CLOA 4LYQA 3M16A 3WLRA 3MB9A 5TNVA 3K8KA 5J04A 3O06A 4J40A 1NFGA 4GA8A 3W7PA 2QCCA 4Q6XA 1F74A 1FH7A 4X9YA 3PFRA 4HPNA 4FP1A 1NWTA 1XSIA 3G3MA 2QUNA 3LG3A 3TW6A 3NZGA 3KEHA 2WQPA 3TSMA 1PWLA 3VIKA 5CLWA 2DSKA 3VDCA 2V30A 3VD5A 3VOJA 2JIWA 1E3ZA 1UG6A 3N15A 2EG6A 1W3JA 3EKLA 4ZENA 5D4YA 4S3EA 3S42A 1WDQA 1GYMA 3FAXA 1XQLA 5AHLA 1EJSC 2O9RA 5K9DA 1BRLA 1EDGA 3M0KA 3M0IA 1H3GA 1TZ7A 2VYOA 3UVAA 3EOEA 2GSEA 4MFDA 3AXMA 1XYLA 2CLKA 2V6AA 2PUZA 1K8CA 4KMQA 3SGGA 3NO3A 3PVFA 1JVNA 2INEA 3PUOA 3UZXA 1GKPA 3WLLA 2DH2A 3DG6A 2NX1A 3BGAA 3RG6A 4IIEA 4R7JA 3MCNA 3LM7A 2ACSA 2FGBA 1CB2A 3CQ0A 5M1TA 4UTTA 2D3NA 2ZWYA 4FIRA 5TIMA 3RPDA 3HFTA 4P5UA 4QE5A 4ZQCA 4Y8FA 5D2XA 3TN4A 2P53A 2ZX8A 1J2BA 2WAGA 1Q6OA 2BG5A 2PWEA 1XSKA 1VBGA 3AWOA 4OFCA 4S3JA 2XGZA 4LUYA 2JGQA 2Y24A 1M9HA 1K9TA 3LI0A 3T7VA 3E96A 3CAQA 2YCLB 1S5MA 1W17A 1Y8BA 1J0JA 3IACA 2B31A 2YFOA 4M1BA 1J12A 3AIVA 4EX4A 1MNZA 3U57A 3VFCA 3TWAA 9CGTA 1FA2A 2VFEA 4OQVA 1W8GA 1S2WA 5BXPA 4LBSA 3TTOA 4GK8A 4DM2A 4UMAA 3UD6A 4Z08A 4NAEB 3ZR5A 4DYKA 4J3XA 5C2GA 3VKDA 1UW9A 1V0KA 4K39A 1HT6A 4PMJA 1OB0A 1NP0A 3UETA 3ARWA 3CWOX 2YJQA 3MSYA 4JAWA 3QEZA 1F05A 3G8EA 4MB1A 1M41A 3CLMA 3ECQA 3OGVA 1LDCA 1GOIA 3VU2A 1OADA 2J66A 1NH6A 4KPLA 3HA1A 1QPNA 5HA7A 2FZDA 4DQWA 1TRDA 1SSGA 2QKFA 4O4WA 4QSFA 1I75A 1J6PA 5MKGA 3UPWA 3IEBA 1F3XA 1S2CA 2WC3A 3M44A 1HX0A 1BLIA 2A6LA 4FXSA 4AEOA 1RP9A 3GXNA 3I3EA 2YB4A 4IX2A 4G1NA 2DORA 5D2YA 3AXXA 4IWWA 4IL0A 4IPPA 1K6AA 4L80A 2FPVA 5D05A 1QHZA 1L6YA 2WM0A 3OGRA 2BS9A 4W5UA 1Q65A 3AYTA 3CB8A 1QPOA 3A9IA 1W9UA 2V63A 1OM0A 4YCOA 4H9YA 4R9OA 4AZBA 5HWNA 3B0PA 2J4GA 3WLTA 1XIBA 3QZAA 2HNHA 5LZLA 3EA3A 4M3PA 1UA3A 2YZ5A 2XGBA 2BXZA 3NZ1A 1UJPA 1VYSX 3S1VA 4AH7A 5K2ZA 3NPUA 4Y9OA 3EX3A 4MNMA 1HTIA 5C70A 2DVXA 4RNFA 2QVHA 4I5UA 4JXCA 1OFOA 5CPMA 3LK6A 3BUVA 3LUTA 3TV8A 4D6DA 1F6PA 1NQKA 2IQ0A 4K36A 2OT0A 4JN6A 4K38A 5IHRA 1HL2A 4D9PA 5F2IA 4IIHA 4JNZA 1MI3A 3C2RA 2W67A 4DYEA 4HHMA 4XIAA 2E5DA 2GZXA 1GW1A 4XVDA 4JIEA 3C5QA 3V5OA 1W1A1 5LIKX 2GUYA 1EC7A 1JDEA 4DIAA 4IUOA 4WZHA 1T8XA 3C4UA 3T07A 4JTRA 1QI3A 3C3UA 3LHTA 4DBWA 4MJ4A 2WNWA 2MNRA 1QI4A 3N18A 1WDWA 3TYAA 2Q02A 1H11A 5A6BA 2I5QA 1LRNA 4WHBA 4HZMA 1XIGA 2GVYA 3OHIA 4BQ5A 4HZ7A 4QE1A 1LOSA 4IH3A 1L6GA 4JL2A 2A85A 2FZ9A 1XIIA 4DJEA 3W83A 3MHUA 2DJLA 5LKYA 4O1EA 4C7DA 2XG9A 1DIEA 2AL2B 4ICCX 2UBPC 1V3IA 2DGAA 3BV7A 1W37A 3M4HA 4RK8A 3BCFA 3NZPA 3QM3A 3WL1A 2E7FA 2WKGA 3CZLA 3NQEA 4O1DA 3P0XA 4UTWA 4WY0B 3O2LA 4JL1A 3N6HA 3NYZA 2J9ZA 4AIUA 4XKYA 5EMLA 4JTIA 1BPLB 5I02A 2H3BA 4IGMA 3DH7A 4M24A 1TTQA 2NSXA 3W7HA 3MBDA 1PBGA 3SQLA 3W71A 4HMCA 1YNYA 2QW5A 1TX2A 2Z1BA 3PTMA 2J75A 3QPZA 3LQLA 4U5IA 1AA1B 1DE6A 3QW3A 3MCOA 3S9ZA 4KQNA 2OLHA 4G1KA 2QUTA 1G7VA 3E38A 3HU7A 2NSOA 5I6SA 5FESA 1JRBA 3K8MA 4CU7A 4O52A 3ZT7A 1ME9A 1WOAA 3PR2A 4K3ZA 5JU6A 1FHVA 3A5VA 2HE8A 4Q8VA 2DUAA 3NQ8A 1DIKA 2BHYA 1O7AA 5C7VA 1E4LA 2VDIA 1YPXA 4P8UA 4FOKA 1JZ5A 2RGLA 4DX3A 5T91A 4GZ7A 3JR2A 4UTUA 3VINA 3VMPA 4PGLA 3HQOA 1DJHA 2QMJA 1TJ0A 4ASTA 4MJ2A 5I7GA 1OYAA 4LYRA 2ABAA 5KINA 3AIWA 4JQAA 1QNQA 2GK1A 1AMYA 3OBAA 1EL3A 1DJIA 2BHZA 1A5UA 4XVEA 5A6JA 3QMTA 1XBVA 1UZ1A 1IXQA 4J3TA 3LGDA 5BMXA 4LPCA 5HUPA 3GE7A 4IGHA 1H7NA 5FAGA 3EOSA 3WLIA 2XISA 4JHZA 3WEMA 4HYRA 2NQ5A 2A21A 3NL3A 1SVDA 3R0UA 4AG0A 1MYRA 4AD0A 3THCA 4UTTC 1ZFJA 3LDVA 2Y85A 3EWDA 4HSNA 2B0MA 4B5UA 3UR5A 3QYQA 5CC3A 1KGUA 4J4KA 2XIQA 3IPWA 1I0DA 1KO0A 2HISA 1LWJA 5FL0A 3WQWA 5HMEA 4ZL1A 1PIFA 2YW3A 1WXZA 3A47A 2OMAA 1E6RA 2FH6A 3FCPA 1LT8A 4TXEA 3GIQA 3FNDA 1XCWA 2WVUA 1KTCA 1JDDA 3W1RA 1KM3A 1UD4A 3W7JA 3QV9A 1TZZA 1CW2A 1FWEC 3M0VA 1R87A 1B3OA 3UA3A 3W53A 1FX6A 3MI6A 2Z7GA 4E2VA 4C6JA 1U30A 3L5MA 3PZUA 4Z2IA 1M6JA 1PIGA 4W85A 2R1LA 5B7ZA 2YL8A 3H4XA 4QJ5B 1A0DA 1P6CA 2VFDA 1WQ5A 3H21A 3STEA 4MYAA 1M7XA 2PDMA 1OC6A 3DYPA 4L9YA 1S38A 1K4GA 3OEXA 1GPFA 2ZE0A 3KHDA 3MYPA 4CQAA 5D8ZA 1H60A 2UZ9A 2WB5A 1CXKA 3NIYA 3OGSA 4E8CA 3VAVA 1JJKA 1H1ZA 3QPYA 5BOFA 3ARUA 4GYFA 4TX8A 4DF2A 4LXFA 1K9DA 3O6YX 2ESCA 5E9AA 3ARPA 5AKQA 4BF9A 1G94A 3PN8A 4P7QA 4R27A 2QS8A 1E0XA 2DV0A 3W01A 3H8AA 2D0FA 1TJ2A 3GZ3A 4HU4A 1IWAA 1TIMA 5LA0A 4M7SA 1ZCOA 3BAJA 4PTWA 3BTNA 1JEZA 2Y89A 1M7OA 4GNKB 4UMBA 3LSBA 3UXIA 3WK3A 3GKFA 4IF2A 4PUEA 2FVLA 4ZQRA 2R9RA 2XDFA 2EPOA 3DESA 3QN3A 5K3VA 1SW7A 1NY1A 2AQWA 1ZRQA 2ISFA 4N9BA 1FWFC 4BEUA 3BE7A 3RXZA 4M29A 4HA4A 3NPVA 3KOYA 5HPOA 1W5NA 1HZYA 2WKLA 4GX8A 3GNPA 2V67A 2NV9A 3CQIA 1N82A 1M65A 1CCWB 4CGTA 2G3NA 2VXNA 1OGGA 3W1UA 1KBIA 2QULA 3TFXA 1HJVA 1SYTA 4HVXA 3TYCA 3PBUA 1CTNA 1WBJA 3VCNA 4C7GA 3ATZA 3G2GA 4NJHA 4ACZB 3A3XA 4JTLA 3USZA 4UNIA 3VOHA 4Z0SA 4HTBA 1SSDA 2XGIA 2HS8A 3GBDA 1FRBA 3IIXA 2B7PA 2ZZ7A 3BAXA 2ACUA 1VFHA 3QZ6A 4RX0A 3SW6A 3VNIA 3LQGA 3MTWA 5D2WA 1R9YA 3FA4A 1GJPA 4NI8A 5C2CA 3OZPA 1UR4A 3SCWA 4X63A 1TQXA 3NSNA 4RZ5A 1FCVA 4XZNX 4C6IA 1YYAA 1FHUA 4AYGA 4IGSA 6ENLA 2FPYA 4PCTA 5J5RA 4ZOCA 3KBWA 5E1QA 3CU2A 2FIQA 2QQ6A 5DANA 4XD3A 3S3GA 4FK9A 4XAGA 4KCTA 4PTXA 1I2PA 1E0UA 2VR5A 5B7YA 1WOBA 1XPYA 5D32A 4BWLC 4DUWA 3M47A 4AZCB 3I3DA 1PZ3A 3RYSA 4U33A 2OWCA 1U1UA 5LHEA 2WMKA 4QJ3B 1TE6A 3NSXA 1QK2A 2EEXA 1DJYA 1D8WA 4AC7C 3JW7A 3OLGA 1KR0A 3BMWA 1W3LA 4LAUA 4LANA 1B54A 1EYWA 4FNSA 2RAGA 2DPEA 4BA0A 1RVGA 1Q6LA 2ZFAA 4AVOA 4QS5A 3WNKA 3OP2A 3HQ1A 1LOQA 3LCGA 2DVTA 3FGCA 1EXBA 3JRKA 4GGHA 3T08A 3N9RA 3QFEA 3MZNA 5G5IA 5K9CA 1G7UA 4OKDA 2ACQA 3FJLA 3D5HA 3LEPA 2CIPA 3QKZA 3BLFA 3OQ8A 4D6JA 3O15A 1EO7A 4JD4A 1PDYA 3DGBA 1XKJA 3HJZA 2I17A 5FF3A 4FX6M 1G67A 4GY7A 1OABA 1DWGM 1RQBA 4PMRA 3GYCA 3MKKA 3MUY1 4U4MA 1VFMA 1OFPA 4W7WA 1THFD 4HJFA 1VJIA 3F1QA 3E9AA 3AXIA 4W7VA 1R46A 3INPA 4QAIA 4XSMA 3L0NA 4PEKA 1AW5A 3GW0A 3GYEA 3GNOA 4MTVA 3AUOA 4FAMA 1E6PA 2P3ZA 4UTHA 2I57A 3NM1A 3TLLA 3VKKA 1NP2A 2PGEA 2D1ZA 1PSCA 1P4CA 1VCFA 4ZFMA 2WMFA 1VPYA 4MMWA 3QBUA 3A4XA 3IK4A 4DB7A 3SURA 3CWHA 1YADA 3XISA 3DC0A 3PZGA 5IXEA 3AMDA 3U48A 2B81A 3V18A 3SGZA 4AX7A 2XVKA 4Z42C 3D46A 3EOLA 3W82A 1T6MA 1FXPA 1OC5A 1LQ0A 1VBUA 3WDHA 1B9ZA 1OT2A 4Q4SA 2VGGA 4UNKA 2WZHA 2X1RA 1UP0A 3P8JA 4WCJA 3V75A 2Z28A 4DN1A 3OO2A 5JMUA 2PD5A 4UMCA 3MV01 1O95A 1H1NA 4IMCA 2A6NA 1G4SA 2E67A 2Z26A 2VO5A 4GZIA 4RE2A 4S3GA 2YDSA 2E25A 1J93A 4Y6GA 1VC4A 3AIQA 1ZJHA 3T0BA 1KWKA 1UWAA 3NCOA 3EX4A 1GVYA 1N55A 4IQDA 5CG7A 5FCZA 3WQEA 4UOQA 5JBFA 2ZADA 5CJMA 3N9KA 1FVPA 2WWCA 3VNJA 2G50A 3HB9A 3ZR6A 2VX7A 4PSRA 1G1YA 2O56A 1R3VA 4JTHA 1O12A 4G7EA 4F66A 3STCA 1TKKA 2FJUB 3H2AA 1ECEA 3S1WA 3BH4A 5F7UA 4LUIA 1S46A 1ISXA 4PCPA 3H70A 3DHUA 4D72A 4J27A 2GGEA 3GG8A 1Y5VA 1AODA 5BXSA 3N6JA 4Q3MA 1V6UA 3K4DA 5G2WA 4HPGA 2XVLA 8TIMA 3MT1A 3H26A 2XVPA 2PP0A 3MSDA 1TO3A 1I2QA 3F4WA 5HWJA 5A2BA 4HNOA 1E1CB 1EQCA 1C9WA 3U2ZA 3RPMA 3W38A 2VWTA 5FACA 5E0FA 5TBOA 4AXNA 4DYJA 2OZ3A 4WSHA 3TONA 3SUSA 1XL9A 3WY1A 5I3GA 1SGJA 1W3KA 3G0SA 3SGUA 3LCHA 5DCBA 2Z27A 2HXTA 1LG2A 1G4TA 3ALFA 2HZGA 1NDZA 4FNUA 3TFCA 2V3GA 1YBQB 4F3HA 1FY6A 1HG3A 2R14A 4ML9A 1AJZA 5LGXA 3VKBA 1XD1A 3EA2A 5D33A 4CUCA 3LV5A 1OFQA 2NVAA 1W2VA 4LUSB 1W3HA 4N6FA 2DZVA 4Y2WA 1P1XA 4HA0A 3CJPA 3VD7A 2BWGA 1EX5A 1ONWA 3WD1A 2D20A 1PX8A 3F2CA 4A05A 2QJGA 1CXEA 5J5DA 4PA8A 3U9IA 3KBSA 4JDYA 4EPDC 1EYEA 1Q6GA 2PCQA 2D2HA 2O9TA 1J01A 3W00A 4HPXA 2W79A 3NQAA 3VO0A 1MMFA 3O07A 3IIZA 2EPMX 1HVXA 2D23A 4IFKA 3TJLA 1GZGA 4RPQA 1UKOA 3CASA 1OX6A 4ZXOA 1A5CA 4F48A 1L8NA 1E9IA 2Y8VA 5A8PA 1JZ6A 3K1GA 1TPEA 3D0CA 4GNVA 1FFQA 1R2RA 2TMDA 5D9MA 3WDJA 1MEIA 3H7RA 1H1YA 5CSYA 1XYZA 1RALA 1U1HA 4Q32A 3KVJA 4Z1DA 2Z29A 4HMEA 2ZUSA 1B31A 2DT3A 3WEZA 1IZCA 3MO7A 3FA3A 4C6CA 1R3TA 4BJHA 4XZBA 1GYLA 1ICSA 4W8LA 3MMDA 4MSSA 3AFBA 3GHSA 2OQYA 5FJPA 1UIOA 5TF0A 5HQEA 3S1UA 3UERA 3IJ7A 2V5BA 1VCGA 5G1YA 4MOZA 3CHDA 1LWIA 3W7NA 2XN1A 4Q4PA 3P14A 5G2HA 2HRWA 1TTJA 1TV5A 3CM4A 5HR7A 4PODA 1M7PA 4H3DA 3BLIA 4YHGA 2A3HA 1EJWC 3PC0A 3TAOA 4CN6A 1DPMA 3AXHA 1Q85A 2PLKA 4K8EA 5ECVA 1S2TA 2QIIA 2W0UA 1ZCCA 2Y0FA 3M5XA 6TAAA 1IE7C 3M5YA 1ODUA 1Y5XA 3M9YA 1AQMA 3TOYA 2FMNA 4YYFA 5G4HC 4O17A 4MGGA 1UQYA 3W7QA 2BFGA 3UGRA 4O50A 4KRUA 5LIWX 3N2CA 3BMVA 3PZIA 3VD3A 4P2VA 4B92A 3V3WA 2F2KA 4ZB2A 2DT0A 1FXQA 2W61A 4GH3A 3PULA 1VJSA 5HNTA 1K3UA 4B2DD 3HGOA 4US5A 2ZBTA 1P7TA 3MDWA 3QLLA 4QJ1A 5CSUA 2E5CA 1XWYA 3BARA 3GFXA 4JN8A 1CB7B 5A6MA 1K7FA 1EHAA 1EOMA 2TYSA 1CXHA 2FDMA 2DUZA 3AICA 1WKYA 1FH9A 3QQ1A 3S5YA 5DO8A 3GG7A 3MVIA 2E09A 4HZ8A 2QDDA 1G0CA 2W4XA 2IPJA 2XZ9A 3I6TA 4R53A 1KBJA 3OQEA 4UFJA 2YIHA 1EUNA 3F5KA 4N9EA 2PTZA 1B90A 2OYLA 2EAWA 3W29A 3KRBA 4BQ2A 5I3JA 3LENA 3AJXA 2R91A 4AX6A 3BZGA 4EF9A 1ZBKA 1YKWA 1P0NA 2WV8A 4M80A 1RK6A 2ZZ6A 2GJXB 1YXDA 3DXIA 2G5WA 3CB3A 3GU1A 4FX7A 2QGYA 4ONVA 3G1RA 2DQXA 3L4ZA 4TR9A 2DSWA 2YL6A 2ISSA 5J8LA 1M3UA 2J9YA 1R86A 3KBJA 4B5NA 4JBRA 4W88A 3CBWA 3FDGA 3TQ0A 1FP9A 2JFEX 3M0MA 4LT9A 3E5PA 3MI3A 4FLRA 1IEVA 4PMYA 3R2GA 5DCEA 2BX7A 2Q6ZA 4MM1A 1GUVA 2ZTKA 1SO3A 2RDUA 4RPPA 3EB3A 2WCGA 3FKRA 3G77A 3L0KA 1JPDX 3T2OA 3VOGA 2ZUWA 5CJNA 5DEZA 3PNZA 4D8ZA 4XAZA 1AMKA 2CWNA 3GS6A 3TH6A 2O9OA 1I1WA 2E28A 4HK6A 4LH8A 4FNTA 2V3FA 3FVMA 1EC8A 1O60A 3VNDA 3M46A 2NXHA 3HBLA 2J74A 3PWAA 5IHSA 5CZKA 2NVDA 3S0CA 4UIOA 4C6KA 4GXMA 5EGRA 4Q8UA 1K77A 4WXYA 3ZSTA 1PIIA 2INZA 4GI4A 1KM6A 3MY9A 1H7PA 2V81A 4LY8A 1ZBCA 1QDSA 1BWKA 3AS0A 3MUIA 1PE1A 2IKGA 3LX9A 3CV2A 1FDYA 4RZ4A 1F3EA 3NVDA 3W1XA 3C61A 2GDVA 1LLOA 2WVVA 1O5XA 5KMYA 4XTDA 5C6MA 1VIWA 2E3ZA 4HHLA 2CITA 4YVPA 1RD5A 2ZVIA 1J10A 4PTMA 1RK5A 1FWJC 2NQ9A 3VZXA 1UKQA 1FWAC 4AZHA 4B5WA 3HPFA 1XLGA 1VFFA 2G3JA 1H63A 5A6KA 3PAJA 2PP3A 5EMKA 2PGRA 1WB0A 2CKSA 4EXQA 1Z89A 4DVOA 3SCSA 2ADAA 4MNLA 1O1ZA 4DNHA 4RE0A 4A8RA 4WXZA 4BFAA 1MEWA 1WAWA 3ES8A 1YXCA 4L6OA 2D22A 1LBMA 3AMKA 1Q4WA 1TPVA 1TG7A 3UWUA 2ZRZA 3RMEA 3OOQA 4QX4A 3P60A 3OYZA 3QHMA 3TN3A 3SRKA 3KP1A 4KFNA 3MMTA 2UY4A 1A5SA 3CV6A 1EIXA 2ZUTA 3W76A 3O1NA 5K4ZA 1CXIA 1TE1A 1VHCA 3BJTA 3ELFA 1ME8A 1SPQA 3IUHA 3LMYA 2PDHA 2OZ0A 3EKZA 4YNGA 3CV7A 2WMIB 3WH9A 3VIGA 1L6WA 2Y2WA 2VZTA 3G6LA 1A3HA 3LHUA 4R88A 5CPSA 3WLSA 4R9XA 4GJJA 4PYSA 1E1EA 1Q4NX 2PRMA 4AZCA 2CXGA 2X40A 4I5XA 5JIWA 2DT1A 1NDWA 1YNQA 4REQB 1R9ZA 3TXVA 3HV8A 4PCNA 4GBUA 4HYVA 3V1HA 5I3DA 3CPRA 3G1HA 2G8ZA 1JG9A 2OYMA 4F2TA 1UCWA 3QV8A 5GJPA 4DELA 2RJGA 4F2BA 3DGRA 1T0OA 1PL9A 2I14A 4LS2A 3PZNA 4IHCA 3D3FA 4WKAA 1ZP3A 4YJ5A 3Q58A 2NQJA 4QGCA 3S2MA 3NWRA 3HOJA 3ZLGA 3LCIA 1A4LA 4HBKA 4ORMA 3OHMB 4QLJA 2W66A 4A8NA 3O8AA 2YBTA 1FCQA 3OTRA 4H8NA 1NF7A 2WYSA 3KS6A 2ZXQA 2VURA 1OFRA 3KVLA 3V1PA 4US6A 1LCOA 3IIPA 4MKNA 3VKAA 4CLMA 4OTKA 3JVAA 4FZIA 1GTEA 2PWDA 1XF0A 1OCNA 4CNPA 2OZTA 3T0CA 3ZT5A 5F2LA 4TTGA 4HK7A 2PLMA 3N13A 3K1DA 3EOOA 3VCRA 2HWGA 3DUGA 5C2XA 3AHZA 4HU8A 4WY0F 1W1VA 3BG3A 3B9OA 1XYBA 2H6RA 1G6CA 4CCZA 1DWJM 5CZJA 3GG1A 3C2FA 3BV4A 2WJFA 4JTTA 2GL5A 3VIJA 4E4PA 1E0VA 1K9EA 2I16A 1C8YA 2RUSA 2WMIA 3DZ1A 3PPHA 5I79A 3FGCB 3IGSA 3R10A 5JXQA 2OJPA 2PF0A 3HV9A 4LVBA 2VMFA 1ZGDA 1MW1A 1HP4A 3PANA 3WD2A 3PNUA 2E9LA 3D47A 1LJYA 1KM4A 2GOUA 2EPLX 1GPWA 3H6OA 3GNRA 3VC5A 4ERIA 1YLVA 2X8RA 1AJ2A 1EZWA 4CU6A 1NEYA 5DMNA 2DUXA 4I3GA 4A22A 4U3AA 5D2TA 5LSMA 4WOQA 1VENA 3FYPA 2YXGA 1GNXA 3VNMA 1FCUA 4TQTA 3PJXA 3FW6A 1EA9C 3G1SA 4K6AA 4IP5A 5A8OA 4FXRA 4EP8C 1F8MA 4NI3A 1SFJA 3L23A 1WXJA 4XKYB 1IEIA 3LZ5A 1ZB5A 1KQZA 3NO1A 4I7VA 2G0WA 3IJLA 4GACA 2E1DA 2YL5A 3W7OA 2JKAA 1H50A 1WZMA 3WNNA 2VOTA 2WZEA 3P0WA 4HIBA 2PA6A 3KL5A 3NPWA 3EDFA 4L7ZA 2A2IA 4DI9A 2VRQA 3VGEA 1XGEA 1R3SA 2OODA 3AMCA 3TW9A 3SECA 4IT1A