5CQ1A

Disproportionating enzyme 1 from arabidopsis - cycloamylose soak
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
517
structure length
514
Chain Sequence
b'SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
molecule tags Transferase
source organism Arabidopsis thaliana
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
total genus 182
structure length 514
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cq1A01
1IZJA 3AXXA 1J11A 4Q22A 1H4PA 1B3XA 4GO8A 3MUZ1 1B3YA 4UQ9A 4FLSA 1X6NA 2OWCA 1NP0A 2D3NA 3AMGA 1JAKA 3MUY1 3VINA 4QCFA 3WH6A 2E40A 4QAWA 1RP8A 2ZWZA 2VX4A 1OD8A 1UWRA 2QMJA 3OLEA 3VM5A 1KXVA 3SCSA 2VCCA 2CERA 2EPKX 1CTNA 1E6QM 1JG9A 1HKMA 4PN2A 3WQWA 2PC8A 3ARPA 3WUBA 3QR3A 4QLKA 5GQBA 1V08A 3WD0A 2VX6A 3GYCA 1LQ0A 3W27A 3BAIA 4W5ZA 3WD2A 3KWXA 4CD6A 4ZE5A 1UHVA 1HXJA 2J7DA 4IISA 5E6ZA 1JFHA 2X8RA 2DPEA 5C8BB 3FNDA 4AZ5A 2YBTA 3AIUA 3AHTA 1JXJA 3FHAA 3UESA 2V5DA 1V3KA 1QHZA 3WD1A 2FGZA 4GZIA 5HOSA 2WC7A 2UWFA 3BCDA 2OSXA 3IJ7A 3WH7A 8CGTA 2ZUUA 5IHSA 2B31A 4J3TA 4D72A 1BHGA 2YDQA 3J7HA 1L8NA 2YL8A 2DIEA 4J3UA 4P8WA 2AAAA 1YHTA 1LL7A 4PMYA 3W82A 4HMCA 4HA4A 3UG4A 1CIUA 5E70A 3CTTA 1KBKA 4E8DA 1JXKA 3VDCA 2XGIA 2VRKA 1UD2A 1UR8A 1VEOA 3T0DA 2XPKA 4UOZA 4WK9A 3WMBA 1GOKA 1W9XA 2WNWA 1TVNA 3QGVA 3PZMA 4OUEA 2D2OA 4P7QA 4WIWA 3KZSA 4CCCA 4JFSA 3OGSA 5AC4A 2DT3A 3L4ZA 3VILA 1KBBA 4Z2JA 2BY0A 1U33A 3AS0A 1FP8A 1MXGA 2VR4A 3L2LA 4OIFA 3WMSA 3PZ9A 5CSUA 1KXTA 1LJYA 3CZGA 5A6BD 1E0WA 4DUXA 4WSJA 5A2AA 4AZCA 3DYOA 4ACZA 2ZXAA 2QPUA 5HPOA 1WPCA 1MW1A 5EFFA 1JF5A 1E5NA 1KFWA 3OLGA 4D6FA 4GQRA 3MKKA 1UA3A 3VGFA 2XFFA 4HPHA 2HVMA 4JIEA 5I2UA 1MWOA 3OIHA 4NRSA 1B3VA 2O92A 3AIEA 1G5AA 2WPGA 4U2YA 3TP4A 4C7GA 4PMVA 1GUVA 2WMIB 1E0VA 1ODUA 4MB4A 1WNOA 4EK7A 1TCMA 1J0HA 4DUVA 2GJXB 4PCTA 1GNXA 2WHJA 4QDMA 1H3GA 4MNMA 1HVQA 3OZOA 2BY2A 3I3BA 3RMEA 4A3HA 1ZU8A 3EDFA 4HZ7A 2CITA 3WF3A 4M24A 4B3KA 3SCRA 1MQRA 3GH7A 1H09A 1G0CA 1CLXA 2VURA 1EQCA 3AMLA 3SCUA 1PZ3A 4RE2A 4URIA 1JFXA 1ZJAA 4D6CA 1NWTA 1KGUA 2GJPA 5DFAA 3MMUA 3L4YA 3BC9A 4MJ4A 1M53A 1PZ2A 3ZR6A 1EHNA 3TTQA 3VIIA 4BQ5A 5FCZA 4Q7NA 1VJSA 1WAWA 2PBOA 1WDPA 1IT0A 4MNJA 3CH9A 4JCMA 2WHKA 4PBGA 3QOKA 5CPQA 1CGXA 2D20A 4AY1A 3W0KA 1C93A 5LA2A 1V6YA 1DP0A 3CUJA 3W37A 1V3MA 1BAGA 2WK2A 1E6SM 4WJXA 3K1DA 4LPCA 2QV4A 2HISA 5BXPA 1XSJA 2XVNA 2WCAA 3VU2A 3WQ5A 2DT1A 3CMGA 3PTKA 1X6LA 5BCAA 4AEFA 1D7FA 1FOBA 2PI6A 4CD8A 5A6AA 3N15A 4W84A 2PF0A 1HL8A 3CIVA 2DQXA 3CUFA 3ARQA 3BSHA 1OIMA 4J27A 3M46A 3M7SA 2UY5A 2RGLA 3EDDA 4H7VA 1E72M 3ZT7A 3AIBA 3CPUA 2E8YA 1OSEA 3ZIZA 3MMDA 4UFJA 1VBRA 3K4DA 3GNOA 4OJYA 3L2MA 1NWSA 2J62A 4AZGA 1LG1A 1CECA 4P8VA 2CKRA 4L4OA 3QHMA 4U33A 4M56A 1JZ6A 1QNOA 1MW0A 2ZX5A 4UFIA 1IV8A 3ZSSA 4J3WA 3VIKA 3A4WA 1DWAM 4CN1A 3AZSA 4RL3A 3CZJA 5A6JA 1VRXA 2OSWA 2XWDA 1UYQA 1E9LA 4EE9A 3BAYA 1E5JA 2OLHA 3THDA 2DSKA 4AZCB 5A2BA 2CBUA 1UR2A 3PZGA 1W1VA 2DSZA 3SIMA 4R5EA 1XYFA 2BNJA 4DWSB 2GJRA 2WW5A 4PMXA 1HNYA 3GH4A 1EA9C 1DWJM 3WQ4A 4Z2IA 1KB3A 3WF0A 4OZOA 4RE3A 3SUVA 3SUSA 3EDKA 1XH1A 1ITCA 4NRRA 2ZUTA 3D5HA 2G3JA 3VX0A 6A3HA 2O9RA 4MPKA 5JUVA 3G6LA 2WZEA 3SCQA 2WMGA 4GI6A 4V27A 5DT5A 2TAAA 3CUGA 2A3AA 4P8XA 2DDXA 5DT7A 4ZXOA 1MFUA 1GOQA 1C8YA 2DSWA 5E9AA 1SR0A 1UH2A 4D6EA 4PTMA 1RP9A 2V3FA 4KWUA 3VIJA 1B90A 1BTCA 5A8OA 3ALFA 1KQYA 5HNNA 4PRWA 1W2VA 5A6KA 4AD0A 2XTKA 1EH9A 1AQMA 1J0JA 2VVSA 3BCFA 2D3LA 4M81A 1HP4A 2VVNA 4IUGA 1B30A 3FXYA 5CQ1A 5TD4A 2PB1A 3MV11 1PIGA 4NSBA 3CZ8A 1CXFA 1I1XA 2WKGA 4AMCA 3WEOA 2EPLX 3BAKA 4OBSA 1VENA 2BHUA 3AS1A 1PPIA 4ACYA 2YL6A 1CXKA 4B9YA 9CGTA 3BXWA 5GPRA 1BYCA 3CUIA 4QLLA 1HJSA 1JNDA 1J10A 2YJQA 4HPGA 3W24A 6TAAA 1ITXA 3VD5A 1MYRA 1F4AA 2VZVA 1GQJA 2JIWA 4M1RA 1HT6A 4MB3A 3GBDA 2YL9A 4PSPA 3T0AA 4PTWA 5A2CA 1AQ0A 1V0LA 1VFUA 2VRQA 3AMKA 3GNPA 4DUWA 3GXFA 1BSIA 1XGZA 3WN6A 3RM9A 2W62A 2BY1A 3W29A 4UTFA 3VNZA 5FOOA 1QW9A 1UA7A 2YDRA 2FH6A 5EB8A 3RCNA 1JF6A 1OB0A 4KMQA 1GHRA 3ARWA 3LPPA 3BMWA 3ZM8A 1UH3A 1UZ4A 1WCGA 4XB3A 5M3WA 4YN5A 4JAWA 1H49A 4PMUA 1CYGA 3VPLA 4AD1A 2DSVA 4X0NA 2XG9A 1QI5A 3K46A 3WDJA 2XM1A 4V2XA 3RJXA 4W7WA 5AY7A 4NF7A 4UQBA 3MS8A 2XJ7A 1NP2A 1XC6A 5E09A 5DF0A 1M03A 1CGUA 3UG3A 3ZO9A 2J25A 3SCTA 1E40A 5CGTA 4ML4A 4AC1X 2W92A 3VO0A 2DEPA 2WM0A 3WNKA 2Y4SA 1CXLA 1W1TA 1HJXA 4GKLA 5BWFA 3NDZA 2VNCA 1BYDA 3AXHA 4W8LA 1E15A 1UQZA 2WMFA 1BLIA 3CZLA 4JFWA 2WCGA 3VGHA 2W63A 1UZ1A 1MXDA 1W3LA 3AIVA 5A6BA 5CLWA 4W7UA 1R86A 4H8HA 5I0DA 4W93A 4A3YA 4M8UA 2ZE0A 1H0IA 2WSPA 1OBAA 2J75A 3W81A 3T2QA 3QHNA 1E43A 2VJXA 3QHOA 1QW8A 3ARYA 2Y24A 1DHKA 3AZTA 4JKMA 5C71A 2E4TA 5A8MA 1ISVA 3AICA 2V5CA 1JDDA 3L4UA 3UR7A 4IPLA 3K4AA 3NSMA 3M07A 1E4LA 4HMEA 1NOUA 4CU7A 4GXPA 1VF8A 3ZT5A 5I77A 4JFUA 1C90A 3VDHA 2D23A 4UZUA 1UQYA 1KXQA 4XZBA 3VD9A 4S3KA 3GBEA 4RE4A 3UCQA 4D6HA 2WB5A 3VD3A 5DEZA 1PIFA 1QNPA 3U7BA 1WDRA 1TMQA 3AISA 1GONA 2VZTA 3U7VA 2JEQA 2QF8A 1MQQA 1K6AA 3PZIA 4DM1A 4HU8A 4UFHA 4D6DA 1B3ZA 1JI1A 1ZB5A 3AHZA 3W6MA 3CMJA 4MB1A 1KGXA 1QI0A 2JALA 1ISYA 4W8AA 2EJ1A 5HDRA 3AIWA 2VTFA 4CD7A 1M01A 1PJ9A 5A6LA 4FLOA 3SURA 1YQ2A 2BY3A 2YA0A 3OGVA 1V0NA 2D0GA 3VM7A 3SCVA 1UR1A 5GNZA 5ECUA 4LYRA 1LL4A 2VX7A 1VB9A 2WZHA 4AEEA 3WELA 1KR1A 1PX8A 4FMVA 2GDUA 3N04A 3UERA 4W88A 5AYBA 3RPMA 3UG5A 3LPFA 4CD4A 1E4NA 1LWJA 2X0YA 2NT1A 3TA9A 3PZOA 2Y2WA 4TX6A 4J3XA 3W28A 1V3JA 3VGBA 5FD0A 1US3A 2IXVA 2XSBA 4TOQA 3WKZA 3KL5A 4F9DA 2F61A 1E4MM 4N0RA 3U5YA 4PMNA 2PWFA 2EPNA 2DSUA 3TOPA 4M29A 2WHMA 2WMIA 4B16A 4HA1A 1Y7VA 1WZKA 2VZUA 4PMQA 3RO8A 1E0XA 1VEMA 4BQ4A 3DC0A 1C91A 1C7SA 2J7GA 2XVPA 3U5UA 4D1IA 2ZXQA 3WEMA 2XFRA 4OKDA 3T2PA 4CN4A 3AS3A 1WDQA 1UWTA 1GQKA 5ABHA 3WNNA 1LF1A 3WD4A 1Q6DA 1V03A 1J0YA 3CLWA 3CBWA 3T2OA 4F9JA 2E9LA 5CLTA 3N13A 3HU7A 4KH2A 3DYMA 1V02E 3ARXA 2PWEA 3D3AA 1BGAA 3W53A 2YL5A 4W5UA 3MUAA 4LGXA 4P7LA 1C8XA 3ZT6A 4W85A 1MW2A 1QBAA 2NSXA 3MMWA 3NIYA 1WO2A 5HBFA 1FH9A 3DHPA 5I23A 3VMOA 5IDIA 2CESA 2VI0A 4MAZA 1FHDA 4CN6A 1V6VA 4KGJA 4JHZA 1VJZA 1OCQA 2NT0A 1ZBCA 2ZX8A 1HJQA 2DT2A 1JYXA 4CVWA 1PBGA 2WC3A 3N9KA 2ESCA 4P7NA 3WDRA 1A3HA 4TVUA 3W38A 4AD4A 5IHRA 2C8NA 2BXZA 1BGGA 1E3ZA 4BA0A 5A69A 1JAEA 3FN9A 4HOXA 3VIFA 3W25A 3ARRA 3SUTA 4LXFA 1W3JA 5M17A 4UOQA 1DWFM 2J79A 1BYAA 2EPMX 1NOFA 1AQHA 3HN3A 3T09A 2NW0A 2YBUA 2D1ZA 3S6TA 3WSUA 2WHLA 4U5IA 3B8SA 4PTXA 4UFMA 5A95A 2YLLA 3SCWA 3VIOA 4MJ2A 1P6WA 1TA3A 2XYLA 2UY3A 4PMRA 4YPJA 3VIHA 3EDEA 3WUFA 4QP0A 1Q6CA 5D8ZA 1H11A 1EXPA 2F8QA 5I24A 4BCEA 4HTYA 4CKQA 1BQCA 3O2LA 3I3EA 3EDJA 4PSRA 3AYSA 1J12A 2OYKA 2FH8A 2VZOA 4AZ7A 3VTRA 3VUPA 1UKSA 4ZE4A 1XCWA 3U57A 1X1NA 3WBAA 1TFVA 4KGLA 5A8PA 1M04A 3BMVA 4P7RA 1VFOA 3LMYA 3F5KA 1ISZA 1AVAA 1UWSA 3OA5A 3N1AA 1HP5A 2WBKA 3N11A 1V0MA 1E6PA 3EMQA 5IXEA 2PWGA 1G1YA 2Q8XA 1UWUA 4LYPA 3NUKA 5I5RA 5JIPA 2V38A 4P7OA 2ZWYA 4JKLA 4GZJA 5EBAA 2YDSA 4UFLA 1E56A 1OT2A 1XD0A 1ZJBA 4GPNA 1UD5A 3UEQA 2XWEA 3OZPA 1VBUA 2GFTA 2Y5EA 4LYQA 1J01A 3OB8A 3VMPA 4F8XA 3SUUA 4UQAA 4CCDA 4TVCA 2BVDA 1GZJA 3BGAA 3FY1A 5EMYA 1HJUA 2O9TA 3EYPA 2JFEX 4AIUA 1W1YA 5ABEA 2E0PA 3A4AA 1MW3A 1HX0A 4UR9A 2J74A 1XCXA 1E73M 1ZBVA 2E9MA 3WDIA 1TZ7A 1JDCA 4FK9A 3WIJA 2WZIA 2VMFA 4TXEA 2BHZA 4U3CA 2VZSA 1WKYA 2DIJA 4J7RA 3VGDA 1BPLB 5I3DA 5A1AA 3VDAA 2FGLA 3TONA 1IZKA 4MADA 4CGTA 3MV01 1CXEA 1H0GA 1FP9A 2VCAA 2PWDA 1H41A 1JYWA 3WNOA 3L4TA 1ZBKA 1QVBA 3LPGA 2A3CA 3FW6A 4BQ3A 5D9MA 3O9NA 4YHGA 3OGRA 1EDGA 1A47A 2X1IA 4WSKA 5AYIA 3HMCA 1H2JA 1UR0A 2BHYA 2ZOXA 2BXYA 1FFRA 5E0FA 1ISXA 3MO4A 3PZNA 4KRTA 3ZMRA 1UD8A 4GI8A 2E9BA 1EHAA 5A6SA 2J7CA 4Z2HA 5HXMA 1UKQA 2WVUA 3A47A 2E3ZA 1GCYA 3BAJA 1MFVA 1S46A 1UOKA 1G9HA 1K9EA 2VL4A 3AMCA 5IFPA 1WE5A 2G41A 2WMHA 1UR4A 3S2CA 2GSJA 4JKKA 4B15A 1Q4NX 4JFTA 4JL2A 4D6GA 1XD1A 2XVGA 3KE0A 3WL1A 4U31A 4W87A 5FIPA 1CXIA 1OWQA 2YLAA 4HU0A 4UNIA 5CXPA 4IPNB 5LA1A 3NYDA 3OG2A 5A3HA 2C0HA 2OWWA 4V28A 1XHGA 2VOTA 2G3NA 4M82A 1TVPA 1SFSA 1C3FA 2G8ZA 2DH2A 4PYSA 2BVTA 2ZICA 3L4VA 4AD3A 3WEZA 5F7UA 4AD2A 6CGTA 2O9PA 2JF7A 2W61A 3WF1A 4F66A 3EBVA 1XH2A 3OBAA 4W89A 3CHDA 2WMKA 4C7DA 3WNPA 1LL6A 3CHFA 4N42A 2DGAA 3RM8A 2EEXA 1KCKA 4ZEPA 4PEEA 4UFKA 1R7AA 2FDMA 4TTUA 1VFMA 3W26A 2C7FA 3AHXA 4JHOA 2EXOA 2WVVB 3TTSA 3MANA 1QHOA 1B1YA 5IFTA 1W1PA 1XRVA 3GTNA 4CUCA 2YA1A 1GW1A 1JZ3A 4AZBA 1RH9A 1J0ZA 2J77A 1JYNA 1KQZA 5C70A 3KL3A 1VIWA 1EDQA 4XV0A 3AFBA 3MSDA 3ECQA 1QOXA 4PMDA 4Z2KA 4DWSC 1EDTA 1CLVA 1BVNP 1US2A 1GOMA 2IUZA 4MAVA 3WFLA 3BH4A 4TVDA 3WY1A 1WP6A 2Z1SA 1L0PA 4GINA 2W67A 2AOSA 1OT1A 1ECEA 1NQ6A 2WC4A 3WH8A 5A94A 4OOUA 4H2CA 4R27A 1GHSA 4OBRA 3GXDA 2AMGA 3A4XA 3AIRA 4IM4A 3VGGA 2F2HA 5CSYA 4W8BA 3PTMA 1B31A 2VRJA 4U3AA 4U2ZA 1QNRA 4FLQA 1HVXA 4HP5A 3ZJ7A 1DWHM 5LYRA 2CYGA 4AISA 1UD6A 3E1F1 3VIMA 5A8NA 4EKJA 3A6OA 3WQVA 1CGVA 2XSAA 3AYRA 3VIPA 2CBJA 2WCSA 4H04A 3M6DA 2GVYA 2J8GA 4HZ6A 3VD7A 2EPOA 1V3LA 3FAWA 1E1FA 3PN8A 1BG9A 3DHUA 1HKKA 1V3HA 4AD5A 3NJ3A 3HJEA 3AJ7A 1MVYA 1KCLA 5D9PA 2GK1B 2CHOA 1OM0A 4AIEA 2ZX9A 1E6RA 2X0HA 5BRQA 2X2YA 5EFDA 2W66A 2XUCA 5BXTA 5D9NA 2WYSA 1W9DM 2FHCA 1VEPA 2BV9A 1ODZA 1FA2A 1GQLA 5JBEA 5E0CA 4CCEA 4PMOA 1EOMA 2QLYA 3WD3A 3GDBA 5AC5A 3NDYA 1WZAA 3AHYA 3WL0A 4CU8A 3FHQA 3K8LA 3VD4A 1CNVA 2ZIDA 2GJXA 1ISWA 2WLYA 4U5KA 2RGMA 3WNLA 1BVZA 3AIQA 1EOKA 1HKJA 4CVUA 3SCOA 2ZX6A 2OYLA 1NARA 4WKHA 1E6NA 2QPSA 3LPOA 1M7XA 4MTVA 3DECA 4WKFA 1UUQA 4BQ2A 4D1JA 8A3HA 4S3JA 4B3LA 1LG2A 1CGYA 3N18A 1V0KA 1Q6FA 1W9VA 4PUDA 3WDPP 5CJ5A 1RD6A 1DWIM 3SCPA 4TUFA 2VQUA 2YIHA 1C7TA 4LX4A 4QCEA 3K8MA 3WUGA 2EBNA 3OLIA 2WWCA 1B2YA 4AXNA 1CGWA 2J4GA 2V3GA 3N17A 3GNRA 2WVVA 4A4AA 5CGMA 1ZS2A 4DWSD 2XM2A 3F4VA 1MQPA 2JIEA 1UKOA 1XSIA 2ZUSA 4M80A 1D3CA 2VC9A 3F5JA 3CHEA 3KEHA 2J7EA 2JE8A 5I6SA 3IAPA 2BFGA 2WSKA 5HPCA 1JD7A 5CZKA 1HF6A 1BYBA 1V02A 3T08A 4AW7A 7A3HA 2CIPA 4HMDA 2G4FA 4GO9A 1WZMA 2CKSA 3IANA 1ZBWA 1UWQA 1PAMA 4ZXLA 4OOZA 2ZXBA 1G01A 3WH9A 2W91A 3MU7A 2WWDA 1OGSA 3OLDA 2PWHA 1BFNA 4HA3A 5KZ6A 2VX5A 2VR5A 1KXHA 2FHFA 1W32A 2CNCA 1TG7A 1WZLA 1TA3B 3AQUA 4X9YA 3WNMA 1JZ2A 4QLJA 1B9ZA 3VNYA 4UOJA 3BLKA 3KL0A 2J78A 2WAGA 4FF5A 3AZRA 1E3XA 1NWUA 4JCLA 4J28A 2GK1A 5I78A 1JZ4A 1BF2A 4YHEA 7TAAA 1JGIA 2ZXDA 3SCNA 3ZQ9A 2XFYA 1CWYA 1LWHA 4C7FA 4F79A 1U30A 4ATWA 7CGTA 2WVTA 3L4XA 3TTYA 1ZL1A 4AZIA 1V6WA 1KR0A 1OGBA 4CU6A 3ALGA 3AOFA 3VVGA 4MNLA 3PZQA 1D2KA 3RM4A 2QMKA 1W2PA 3WQ8A 3IJ9A 3ZJKA 1VAHA 2OSYA 2ZUVA 5FL1A 1UKTA 1SYTA 2JEPA 2WVSA 2XIIA 4NZCA 4W86A 2WANA 4LQ1A 2J47A 1SMAA 4H41A 1E6ZA 1WDSA 3ARZA 2CBVA 3DYPA 5FL0A 3UETA 2XHYA 2CXGA 1QI3A 5ABGA 1OGGA 1CZ1A 2ZX7A 1HJWA 1U2YA 1EO5A 1K9DA 5CPSA 3MSGA 3ARUA 1JZ8A 3VDBA 1W91A 5D8WA 1GVYA 4ACZB 2A3EA 2IXUA 2X05A 4HZ8A 1HJVA 1K9FA 4K68A 2VT0A 2GUYA 1K9TA 3THCA 2CPUA 2XVKA 3CUHA 1VFFA 3L4WA 2XVLA 5ABFB 4UQEA 2WLZA 2XIBA 2BVYA 1W9BM 4GQQA 4MB5A 2EO7A 2G3MA 3VKKA 1WB0A 2OWXA 2VO5A 5KEZA 1H5VA 4PMZA 1EQPA 1C8QA 1AMYA 1JL8A 4B9ZA 1EO7A 2CEQA 3K8KA 2CCRA 1TR1A 1GOWA 2DH3A 1NOWA 4MDOA 1FFQA 3ARSA 4W7VA 5DO8A 3N12A 3ZSTA 1NM9A 3PZTA 3NSXA 4EANA 1E70M 5A6MA 1EIBA 3SUWA 2J7FA 1W3HA 5BROA 4UCFA 2XGBA 1UH4A 1KWKA 1CGTA 1JNEA 3VIGA 3I3DA 1UR9A 1GVIA 1JZ7A 1BG4A 4J3VA 3JUGA 2VCBA 5BXRA 5BXSA 1QNQA 3O6AA 2EQDA 4XX6A 5D9OA 1QHPA 5D4YA 4PUEA 1CBGA 3IJ8A 4WLCA 4JZ5A 1J18A 1CENA 3AROA 4JFVA 3PBGA 3II1A 3WDQA 2VQTA 4BS0A 5LA0A 1KGWA 3ARTA 3B9EA 3WFZA 2CBIA 3AHVA 1O6IA 1V6XA 2J8FA 4ATDA 2W4XA 4AIOA 1CEOA 3AXIA 1JD9A 4H8UA 4PTVA 3A3HA 3W4RA 3WH5A 1NWRA 5E6YA 1J9YA 1Q6GA 4QFUA 4WKAA 5GNXA 1OD0A 5A8QA 2Y8VA 2D0HA 3EMCA 4UQDA 4UQCA 4E4PA 3IAQA 1G94A 4ZENA 5M03A 1I75A 1J0IA 4KRUA 2W5FA 2WXDM 4BF7A 1CDGA 3CGTA 3ARVA 2ZUWA 3BLPX 1JIBA 4UZSA 3CO4A 3CZEA 3WDHA 1H1NA 1XV8A 3WMCA 4GIAA 3WF2A 1JZ5A 4X0VA 2V3DA 1R8LA 2ZUNA 2GDVA 4HOZA 1E55A 4AZHA 4JL1A 5CPTA 1R87A 1HN1A 2E8ZA 1TE1A 5I79A 2VUYA 4J3SA 5JIWA 1RPKA 5FKYA 4AZ6A 5BYWA 5DMYA 1JYVA 1XYZA 1SMDA 3GXIA 1B3WA 4XZWA 4PCSA 2Z1KA 3IK2A 1HIZA 2V3EA 1JDAA 2WMJA 4ATLA 1KWGA 1E6XM 3PZVA 3EMZA 4TTGA 3BSGA 1PEZA 2OYMA 1W3KA 3GZAA 3WQ6A 1UD4A 3PZUA 1W9PA 2CHNA 1PX4A 2J7BA 1TUXA 2UY2A 4CD5A 2ZUMA 1HL9A 3GXMA 3POHA 1E71M 3APGA 1GJWA 1Z32X 2D0FA 3SEPA 4GZEA 3VMNA 4E2OA 3F5LA 1XSKA 1CXHA 1NH6A 3CHCA 3NSNA 2J7HA 1O7AA 2QHAA 5ABFA 2WBGA 3QOMA 2JF6A 1N82A 1OINA 1I1WA 2UY4A 5JBDA 1F4HA 3BAXA 2D24A 2DT0A 4WF7A 4D6IA 3NCOA 3POCA 3B9AA 1FHLA 3WBEA 2YKKA 1QNSA 1R85A 2D22A 1PX3A 1V6UA 1FH8A 4MDPA 1GOIA 4EAMA 3BAWA 1CPUA 1GJUA 4XUYA 1W9UA 5M5DA 4D6JA 3GM8A 3T0BA 2O9OA 5GNYA 1HKIA 1UKPA 3VX1A 4HOWA 3ZJ8A 3MUIA 3ZOAA 2FHBA 2Y8KA 2YA2A 4AWEA 1E4IA 5JBFA 1FH7A 1QI2A 3ZR5A 2BS9A 5BRPA 1R7OA 4FLRA 4TX8A 4Z2LA 3RIKA 1DTUA 4P8UA 3TTOA 2WKLA 4H8VA 1DEDA 3GH5A 4BZYA 4MNKA 1XH0A 4E8CA 4Y7EA 1GPFA 3WUEA 1QBBA 1ESWA 4GI9A 3AI0A 5CG0A 3WENA 1J0KA 3CZKA 3UR8A 1E1EA 3FAXA 1JI2A 1QI4A 3RDKA 2CETA 1B0IA 3RILA 2MANA 4D71A 1GQIA 4NI3A 1GORA 4AYSA 1GOOA 1V3IA 2X09A 1UD3A 3B9DA 3WF4A 1EGZA 1UWIA 2A3HA 2A3BA 3PHAA 3VGEA 1DWGM 1QPKA 4L4PA 3AMDA 4DWSA 3VOCA 3AS2A 3ZJ6A 1OIFA 2YOCA 4DM2A 2G3IA 3RJYA 1LLOA 3W6LA 1Q6EA 3PTQA 4Z2GA 1C92A 3G6MA 2PBGA 4ZFMA 1UG6A
chains in the Genus database with same CATH superfamily
1IZJA 4MIMA 3W7HA 4DJFC 1H4PA 1AZ2A 1B3XA 3QFEA 1B3YA 3CH0A 2PZNA 2OWCA 3ZVHA 4M51A 3F4NA 3WH6A 3UCDA 2E40A 3P0WA 4QAWA 1RP8A 1OD8A 1RY0A 1YDYA 5U7SA 2VCCA 3QY8A 1GKPA 2EPKX 3ARPA 3EWBX 4AG0A 1V7AA 4FX7A 3IUHA 1J96A 3H26A 3EOSA 4DXKA 4GVGA 1V08A 2G37A 4ADSA 2VX6A 1PKLA 5I3IA 1XLDA 2C1GA 2ZRWA 3MPGA 1F07A 4W5ZA 3WD2A 1QJWA 3VYLA 4ZE5A 3W7OA 1TPUA 4UIOA 3TFXA 3MUXA 2DW6A 3PF3A 5K2ZA 3AHTA 1C8VA 3CQIA 1JXJA 1X39A 2Y6ZA 1OVDA 3L5MA 2FB2A 3MI6A 4I90A 2VEFA 3FHAA 2MUCA 3SN0A 4HHLA 2V5DA 5G4WA 3UESA 3M0VA 2ZA2A 4ZMGA 3QEZA 1BTMA 3LHVA 4OWGA 4UTLA 8CGTA 3B8WA 3GFZA 2FZ9A 4H9XA 3GDTA 3P62A 2B31A 4J3TA 3E2SA 3AWNA 3D46A 2AAAA 3JS3A 3CTTA 4XKYA 1Q65A 1OX5A 4J40A 1JULA 2DUXA 3I4EA 1UR8A 3T9PA 4UOZA 4O17A 3B0XA 4Z1CA 1GOKA 2WNWA 1IZCA 4MJZA 4JFSA 2PP1A 1JUKA 4Z2JA 4LFYA 3AS0A 1G7UA 2FGBA 4PZVA 1MXGA 2HXUA 2HPMA 3LX9A 4YMZA 3PZ9A 2I5IA 2PLMA 2AL2A 3UXDA 2OEKA 4KEZA 1E0WA 3G1FA 4Q4PA 1LTDA 3BLEA 1WPCA 4XAYA 4MY1A 3UNDA 4O10A 2V2CA 1BQGA 3VGFA 3EWCA 2P76A 4KIRA 2V9DA 1F5ZA 5D32A 4AVNA 5D2XA 2WPGA 5FJOA 5M1TA 4O18A 5J04A 4PMVA 1E0VA 3I6RA 3SQMA 2QVHA 4E4FA 1J0HA 3L66A 2GJXB 2ABBA 4QDMA 4H9YA 1O60A 3GTXA 2BY2A 4GISA 3WBYA 3EDFA 4IQLA 1T0OA 4LRTA 3S6OA 2P3ZA 4YCOA 3GVGA 1UOZA 1OYCA 1S5NA 3SCUA 4RE2A 4TIMA 2ZZ7A 1VKFA 4GGHA 4PUNA 1MUMA 4FI4A 4QG8A 3L4YA 6XIAA 3NNTA 3ZR6A 4EXAA 1MO0A 2FVKA 5FCZA 1WAWA 1IT0A 3CH9A 3R6IA 1IXOA 1CGXA 2C1IA 5LA2A 3U4AA 3WLNA 3QKZA 4LEQA 3PSWA 3LRMA 1RQHA 1DP0A 3CUJA 4IJRA 1V3MA 2IKGA 1MZHA 1E6SM 3B06A 2HISA 3IEBA 1QWKA 3G1AA 5BXPA 4PR4A 2PDYA 2Y5JA 2WCAA 4CNTA 1TJ1A 1O5KA 1GT8A 2DT1A 3N34A 4HHMA 3BK0A 9XIAA 3FYOA 1V7YA 5BCAA 4AEFA 2I1OA 4JEQA 4LRSA 1D7FA 1VPXA 4LALA 1HL8A 3ARQA 3FJ4A 4H8NA 3BSHA 4QS6A 4P61A 5DX7A 3M46A 3M7SA 3EDDA 2V5KA 3AIBA 1OSEA 1UC5A 2XIJA 3MMDA 3K4DA 4ZBCA 3L2MA 3UJ2A 4MJMA 3W01A 1CECA 4K8EA 1VZWA 2CKRA 1KFLA 4M56A 4GH1A 3DH7A 2XH7A 2ZADA 3HQOA 3UWYA 3A4WA 3TSMA 2XDFA 3E2VA 2OSWA 3RU8X 4A8IA 1UYQA 3BAYA 2OLHA 2OKOA 2DSKA 2PDPA 2CBUA 3NG3A 1H51A 2IMRA 3H2EA 5J5RA 1RBLA 2VYOA 5KITA 1VGAA 3VAVA 1JCXA 2WW5A 1HNYA 2PDWA 2QUNA 2DP3A 3WF0A 4RE3A 5CZSA 3EDKA 5JU6A 2G3JA 3U6WA 3VX0A 4I9AA 6A3HA 4QHRA 4Q4SA 2V0TA 5JUVA 3ONCA 3G6LA 5K4ZA 4DN1A 4GI6A 1SFTA 4ECLA 2IQDA 3CUGA 1DHPA 5DT7A 3N4AA 1GOQA 4OFCA 1O5QA 4Q8NA 3VKJA 1RP9A 3U2OA 5TAOA 4M6PA 3B4YA 4KWUA 5D33A 1BTCA 3UBPC 1VYPX 3V5CA 2R94A 3KAOA 4TO8A 3I68A 1KQYA 1T41A 5HNNA 5A6KA 4Y9PA 4EXBA 5LNRA 1IXNA 1FHVA 1K02A 3BCFA 2D3LA 4NX5A 4DELA 4IUGA 2X7WA 3FXYA 5CQ1A 4EVZA 3QYQA 2QQ6A 3MV11 3HOJA 1DQWA 2OTDA 4OU1A 4MYAA 2R1KA 3TQVA 3PNZA 3LENA 4AXKA 1PPIA 9CGTA 3LRKA 1E9IA 3JRKA 3V1PA 1S2CA 2BASA 2HV5A 4D2JA 3CUIA 3TN5A 4O4WA 1HJSA 4HPGA 6TAAA 1ITXA 1MYRA 5H1WA 2VDHA 1F4AA 1GQJA 2ZZ5A 2NQ9A 5REQA 3UZZA 4GRSA 4MSSA 1VIZA 3TC6A 5XIAA 1V0LA 2VRQA 4AWSA 3NR0A 3W2NA 4IP4A 3M9YA 3ONBA 4LU0A 4GIRA 4LF1A 3S1VA 3TU9A 3QLDA 1J4EA 3WN6A 3TNOA 2CW6A 3MKCA 5FOOA 1EEXA 2RH9A 1T6MA 3PUGA 3GU2A 3LGEA 1J8VA 3ARWA 2AQVA 1LBMA 1UH3A 4IZGA 1PSCA 1N2VA 3E2RA 4N6FA 3S6DA 4AD1A 4TQTA 3QQ1A 4PBEA 2PDUA 4L65A 4X0NA 1M1BA 1AG1O 3H6OA 4GNVA 3E2QA 4DO5A 4DHGA 2O0TA 4JTTA 1S1RA 4MLRA 4JN7A 3VE7A 3S46A 5E09A 3UNTA 2P1FA 2INFA 3SCTA 1S2WA 3UXAA 1I0DA 3G2GA 3LLXA 4KETA 4IX0A 2O4QA 2W92A 3VO0A 3GAKA 2WM0A 1W1TA 5BWFA 4RX0A 1R9YA 2D2HA 2QGHA 1E15A 1AL8A 2CZVA 1W5NA 2WMFA 1WDWA 1LUCA 2WCGA 4DF0A 3VGHA 3WJSA 3TXVA 1W8SA 4NZ5A 3AYTA 2CLLA 3LBCA 4DPQA 1SJCA 1A5NC 1KRBC 3QC0A 1H0IA 1IYXA 2WSPA 5C9RA 4MPQA 3W81A 4A3UA 2QCDB 2Z2AA 1E43A 1QW8A 1TPFA 4XG1A 3FIGA 2E4TA 4DBSA 3FFSA 5CZ0A 4I5UA 3K4AA 3NSMA 2RJGA 4A8RA 3M07A 1EYWA 1VPQA 1QMLA 1IEWA 3ZT5A 2E5BA 5I77A 3Q4DA 3VDHA 2D23A 4GVHA 2QDHA 4UZUA 1KXQA 3DUGA 1WKFA 1QCWA 3HZ3A 1TZZA 5MHBA 1TE6A 3D3FA 3AISA 2QJJA 1GONA 1SZEA 1MQQA 1A5SA 4DM1A 1JI1A 3AHZA 3KRUA 1KGXA 1MEWA 4XD4A 2GUUA 5BU6A 1ISYA 2VGGA 4IMGA 3OG3A 3TXZA 3IV3A 5E1QA 1J6OA 1XUZA 1PJ9A 2BY3A 1V0NA 5CBJA 1VLIA 3TMQA 2VX7A 4WY0B 5CC3A 1P4CA 3PR2A 4QDPA 4AEEA 3WELA 1KR1A 2WSQA 3NA8A 2JKAA 5AYBA 2HK1A 3UG5A 4HPNA 1LWJA 2C6QA 4A2SA 4W4QA 4TX6A 1FDJA 3V0UA 5FD0A 2IXVA 5HR6A 3DI0A 3LS9A 3N19B 3WKZA 4B91A 4F9DA 1ONRA 4N0RA 3A5VA 3TOPA 1EJVC 3A4JA 3S9YA 4DZAA 3VK5A 2WHMA 5FI8A 5F2GA 1Y7VA 3QV7A 1WZKA 2VZUA 3TKFA 3H4WA 4PMQA 3RO8A 3DFQA 1VEMA 4K8GA 3AYVA 4C6JA 1C7SA 3TR2A 1V93A 4Q8PA 1OC5A 4IFKB 4OKDA 1IXPA 3HJZA 1FWWA 4I3GA 3H8AA 4LT9A 4JIQA 1KV5A 3O3RA 4GQGA 1X38A 3VC6A 3PG9A 4C6KA 1LF1A 1V03A 5D37A 3P61A 3H53A 4GA8A 5CLTA 1RBOB 4PUWA 4KH2A 4L9XA 4JR5A 1RBAA 1TMLA 1GG1A 1OZMA 4HCDA 3S0CA 3KLLA 4L6HA 3NQAA 3LU2A 3WQGA 4P7LA 3ATYA 3ZT6A 3F2CA 3T07A 1WQ5A 4UMBA 3EB4A 2C14A 4EAYA 3MMWA 2FMOA 7PTDA 4R3UA 1P1XA 2J88A 5FF4A 4Q8QA 4JTKA 3BQ6A 3P8IA 5FAGA 1GVOA 2WJFA 4CN6A 3UT0A 1VJZA 4Q6JA 1F3TA 3CV6A 4PEKA 1DJHA 3N6HA 4KFOA 3ISIX 3QGKC 4XSLA 4UTTA 4HIBA 3WDRA 4P7NA 4DXXA 1A3HA 1KO0A 2BXZA 1BGGA 1E3ZA 4JDYA 3SSZA 1A4LA 4J5NA 3E0LA 5D02A 2BDQA 4P2VA 2Z0IA 4F2UA 5I7GA 2J79A 2DZWA 3ITTA 2DZAA 3VOIA 2NW0A 1AH3A 3PANA 2QCEA 4NAFB 2YLLA 3D0CA 2VC6A 1LQAA 1P6WA 1TA3A 5AFDA 1F8MA 3KWSA 2XYLA 2UY3A 4QP0A 3C8FA 5D8ZA 1H11A 4ADTA 3O0FA 3W70A 4QS5A 2G95A 1OCNA 4BCEA 4AX6A 3I3EA 4PSRA 2FH8A 4RLIA 3L9CA 3SRHA 5FF0A 1UKSA 4ZE4A 2XIMA 3U57A 1X1NA 4DWDA 1W8GA 2YCJA 4KGLA 1IWBA 1ISZA 4Q33A 3OA5A 3DI1A 4FSAA 5C5YA 1XIHA 3A3WA 3MI3A 5I07A 2Q8XA 5H6HA 1UWUA 5I5RA 2REQB 3IGSA 5JIPA 4L6OA 4OQVA 4JKLA 1W31A 3UVIA 1QXLA 2YDSA 3B8IA 3OPSA 1R3WA 1UD5A 5T26A 4C6QA 3S83A 1YADA 4LYQA 1J01A 3URQA 3PTDA 1Z42A 3DKJA 1X98A 4FOUA 3BW4A 2XH2A 4TVCA 2BVDA 2F2KA 3MO7A 3EB2A 4FO4A 4AIUA 3CB8A 1SR9A 4I8DA 1HX0A 3W23A 3O16A 4DO4A 1XCXA 3CAKA 1YBQB 1ZJHA 3WDIA 1GK8A 3USBA 1TZ7A 3WIJA 3W7LA 1A50A 4GWEA 3SY5A 1U5HA 3C3NA 1SFJA 1TWWA 1GYNA 2NX1A 1IZKA 1NY1A 2POTA 3MV01 1CXEA 1H0GA 1TX2A 2PWDA 1H41A 1JYWA 5D09A 3FW6A 4MHBA 1OC6A 4YHGA 3OGRA 1K7XA 1EDGA 4EX4A 1A47A 4WSKA 3HMCA 2BHYA 2BXYA 4Y6GA 1FFRA 1ISXA 4HNNA 4Y9NA 1XFCA 2WSYA 3EGJA 1KM6A 3PWIA 5A6SA 5JXQA 4TR9A 4Z2HA 1KTCA 3CQ0A 4NUWA 3LY0A 4JD4A 1S46A 1KKRA 1R38A 2TMDA 4AIBA 2VL4A 5G4HC 1WE5A 3M0ZA 1Q4NX 4JFTA 1VHCA 2Z7GA 1IE7C 3P6LA 5HATA 3PPFA 3EZ4A 3KE0A 4FNPA 3WL1A 2I9UA 3ITYA 1CXIA 1E1CB 1ZPTA 4HU0A 3WQOA 4HQVA 2Q8LA 2NLIA 5CJMA 1XHGA 4YYFA 3FYPA 4BF9A 1V8EA 2G8ZA 1W5PA 2HCVA 5LHFA 2BVTA 5DBUA 1XKYA 1LZOA 1H50A 1NDZA 4AD2A 2NLYA 1XIIA 1FWHC 4F66A 3W86A 4W89A 3CHDA 4C7DA 2W6RA 2DGAA 3BLFA 1X7IA 1X8CA 1RAKA 1R7AA 2Y5SA 4TTUA 1VFMA 5DELA 3MP3A 1YTDA 3OODA 4IUOA 2WVVB 3TTSA 5ENLA 1TQJA 5LIUX 5G1TA 4DI9A 8RUCA 4QE5A 1JZ3A 1HTIA 1SW0A 3UPMA 3W1RA 3KL3A 1UROA 3PBMA 1NDWA 2HMCA 5MKGB 3AFBA 4H4IA 5B7YA 1RK5A 3R58A 5CG7A 3LD5A 4DWSC 1L6YA 3D6NA 3CXOA 1EDTA 1US2A 1V79A 4MAVA 4Z08A 3WFLA 4UMAA 1Q7ZA 3WY1A 4AU0A 3H55A 3PNUA 3HFYA 1ECEA 3W85A 1SM9A 1ME8A 2WPBA 3DFHA 1GHSA 3GXDA 1XUUA 3VGGA 3BUVA 2F2HA 3QF0A 5C54A 4S23A 4FLQA 3GNNA 4HP5A 2QR6A 1XKJA 1L9WA 4LY8A 4IX2A 2Q01A 4EKJA 1CGVA 5E5CA 4KWWA 3AYRA 2WCSA 4H04A 2RJHA 3UXKA 3CV1A 3QW3A 3T78A 4HSOA 2EPOA 1V3LA 1TUFA 1HQTA 3FYYA 1O1HA 1BG9A 4AD5A 2IQTA 1KCLA 3CASA 3UZXA 2CHOA 4A22A 3VKCA 1E6RA 5BRQA 3DDMA 4IIFA 2DY3A 5BXTA 2WYSA 4N6EA 2FHCA 3N9SA 4GKTA 4K8HA 4M3PA 4B5TA 4YTRA 1I2RA 1WOAA 4QJ1A 4PMOA 1EJSC 4LS2A 4DJED 4QM1A 2QLYA 1PXGA 3YPIA 1FHUA 2CU0A 4GYPC 3WL0A 3DBPA 3FHQA 4AWTA 1CNVA 2CLKA 1XLGA 2A2IA 1ZY9A 3SBFA 1REQA 1PVNA 2RGMA 3H2CA 1BVZA 1EOKA 1MUWA 4MLJA 4YTQA 2XSXA 4CVUA 3SCOA 4QDWA 3KW3A 1S39A 2OYLA 4AFYA 1E6NA 3UFYA 2QPSA 4PC8A 1EUNA 3EKLA 4LBSA 5H8UA 1OFQA 1KBJA 5D04C 4JQ3A 2JBMA 2JGQA 1TIWA 1UUQA 3V18A 4D1JA 8A3HA 1CGYA 1V0KA 3UA3A 1HO1A 5CJ5A 3LN3A 4NT0A 1QUMA 2WJEA 2YIHA 5LKYA 4FA3A 3B04A 4JTDA 4JPGA 2OCZA 2J4GA 1X1OA 3IVTA 3N17A 3GNRA 2H8ZA 4A4AA 1O12A 1F6PA 2PPGA 3QV6A 1DPMA 1PTGA 2XM2A 1MQPA 4H83A 1OY0A 1GEHA 1UKOA 1ZNNA 2QJNA 3WJXA 3KEHA 1OG6A 1HKVA 4XKMA 4AVFA 5I6SA 2YYUA 5D30A 4N9EA 2QDDA 1HF6A 1A53A 1BYBA 3T08A 7A3HA 4HMDA 3URNA 3MBDA 4C6PA 3IANA 3VNIA 2RDXA 2X1RA 4FF7A 4FIQA 3SI9A 2ZXBA 3ITVA 4HVXA 4GY0A 3ZFHA 3QTPA 6XIMA 4U10A 5FEZA 2PWHA 1BFNA 3UA4A 3C3UA 3KVKA 1W32A 3IIXA 2XGZA 1WZLA 2ZRXA 9XIMA 4PMJA 4YCPA 3H70A 3AQUA 1TQXA 4QLJA 3XISA 4UOJA 4ZA0A 1FWCC 2V82A 3KBMA 2OELA 1GWJA 4LS1A 4C5YA 4AYGA 2GVEA 4J28A 2FB3A 1JZ4A 2Q02A 1P1MA 1BF2A 1XXXA 3E38A 1JGIA 2ZXDA 2XFYA 4GNKB 3S1XA 3NEHA 2WVTA 2INZA 3L4XA 4IMAA 1LOLA 1KR0A 3AOFA 1EEPA 3RF9A 1TPB1 2ZDSA 3ZVIA 3PZQA 3W1QA 4JTCA 1W2PA 2ZRZA 3IJ9A 3H2FA 1VAHA 2ZUVA 3KBJA 5FL1A 4AH7A 2JEPA 2WVSA 2XIIA 3KRSA 3QN3A 3ZLGA 2CBVA 3BLIA 2ZZ3A 1RJPA 1O1ZA 1G4PA 2CXGA 5HQEA 3SSJA 4HN4A 5C55A 3EWZA 2CZDA 2PU1A 4ZQRA 1WA3A 1AD4A 3HPSA 3QTGA 3R13A 5D8WA 3QW4B 3GK0A 4ACZB 2X05A 1XIJA 4HZ8A 1HJVA 1UP2A 2CXEA 4IT1A 4IP7A 1ME9A 2GUYA 4I9JA 1K9TA 3THCA 5ABFB 2XIBA 1R3YA 1AQFA 3B8DA 3TQ0A 4MB5A 2G3MA 4PB5A 2Z2UA 4L1XA 2NQHA 2OWXA 1YBQA 5KEZA 3STGA 1K8YA 4CNPA 4PMZA 4HU3A 3ZS4A 5IM51 3APTA 1WOBA 5AHLA 3APYA 1ZJIA 3W22A 4Q7IA 3CV7A 3KCJA 3SY8A 1GOWA 4PB3A 2DH3A 4BK9A 2X30A 3ZSTA 3U0HA 4GG9A 3PZTA 4EANA 3DG7A 4M6QA 3SUWA 1W3HA 4S3CA 4Q32A 1UH4A 3NQMA 1XBZA 4GIEA 1JNEA 1RQBA 3VIGA 3OIXA 2FQIA 1JZ7A 4H6RA 2VCBA 1P6CA 1F3WA 1VQTA 2E5DA 4RZBA 4P5UA 2Z00A 5LXXA 1KBLA 4MZ1A 3CWOX 4NJHA 1CBGA 3KOWA 2WKJA 4WLCA 1CENA 3AROA 3M0KA 3WDQA 5CKSA 2GGEA 3PPGA 1TB3A 5CBBA 1VHNA 1M68A 1JD9A 1RPXA 4GQBA 3M0YA 3UPWA 1NWRA 5H8MA 2I17A 2QKFA 1Q6GA 4QFUA 6PTDA 3ABOA 4EF8A 3LQGA 4DF1A 3OVQA 4E4PA 5BOOA 2ZDRA 4ZSTA 3RLHA 1I75A 2W5FA 2R14A 4LANA 4C6MA 3DGRA 1JRCA 4AY7A 3ARVA 2CZEA 4O8AA 3BLPX 1JIBA 3PC0A 3WDHA 1H1NA 1XV8A 4CQAA 3WMCA 4GIAA 3U48A 3WF2A 2XZ9A 3T42A 5TNVA 2V3DA 1FVPA 2QUVA 4HOZA 4AZHA 5CPTA 2E8ZA 5I03A 3E5BA 1N8FA 4O50A 4Y9MA 4H19A 2LLEA 3DXIA 1E51A 4Z1AA 3T81A 4J2MA 3GNDA 4XZLX 3OO2A 1HIZA 2V3EA 4ATLA 3STEA 1KWGA 3FEMA 4TTGA 4QNWA 3R8GA 1WXJA 4JY9A 4OT7A 2OYMA 3GZAA 1LROA 3B97A 1P7TA 5K9DA 1JPMA 4CD5A 2UY2A 3TA6A 1SO4A 1GJWA 1L6SA 1ZALA 3RFAA 4B5UA 1O66A 4DJFA 3NSNA 3EXSA 5ABFA 3P60A 3GWQA 3PFRA 2UY4A 3S5YA 1F3EA 4ADUA 3N9RA 2FKPA 5HMFA 3QRHA 4LVFA 3QVQA 1XDJA 3GSMA 3CU2A 4K36A 4H9ZA 1PX3A 2FVLA 1FH8A 1DIEA 1GOIA 5EY5A 4DJDD 1HG3A 2PODA 4WHBA 3GM8A 3T0BA 1W1IE 2O9OA 4PL1A 1HKIA 2YCKX 3NQ7A 3LI0A 4HNVA 4HOWA 3ZJ8A 2FHBA 2Y8KA 4JX4A 5BRPA 5I02A 4TX8A 1VP5A 1OEPA 1DTUA 3V16A 1XYAA 1JGMA 3PAJA 1XLJA 2OQLA 2OO0A 2VWSA 5C0QA 3WUEA 3OJGA 4X61A 3AI0A 3W72A 5CG0A 1J2WA 1ITQA 4HJWA 3BWWA 3CZKA 4WGHA 1QATA 4DYEA 2CETA 2J27A 3S2LA 3W75A 1K7EA 3RILA 1G6CA 2MANA 4HPXA 1GQIA 1Z9AA 2WZMA 5E9XA 1GOOA 2CLPA 2PDJA 2BVWA 3S3GA 1UWIA 2A3HA 4DO7A 3AS2A 1KNWA 1OIFA 4DM2A 3O06A 3WQEA 3ANVA 1Q6EA 3PTQA 2PCEA 2GJNA 4YTSA 3UWUA 3FOKA 1UG6A 1U1HA 3AXXA 4IP5A 1J11A 2G4JA 1Q45A 1UJPA 4RXGA 3SRDA 4IIHA 1J93A 3H2NA 3GZ3A 3HG3A 4FLSA 1L6WA 1X6NA 3A9BA 4GC4A 3MVIA 3MUY1 2Y7EA 3VINA 4ZQOA 1KFKA 2J9XA 3EX6A 3WLRA 2HRWA 3OLEA 1KXVA 3LM3A 3BARA 1E6QM 1JG9A 3WJZA 4PN2A 3WQWA 2PC8A 3WUBA 4S3EA 4NAEA 5GQBA 1S5MA 4WJ8A 2L5HA 2HQAA 1A5AA 4XZNX 1PB0A 1LQ0A 3W27A 5A6TC 2ISWA 4ORMA 1UHVA 4RR4A 3M0IA 1EJWC 3ATZA 1JFHA 1MMFA 2X8RA 4DJEA 5BOFA 3KRZA 4AZ5A 1R3TA 3GG0A 3IVSA 4UBPC 1M41A 4HU4A 3FJNA 4BFAA 3FVMA 1FXPA 1QHZA 5C9UA 3WD1A 4FPSA 3BCDA 3IJ7A 3BV7A 3PBUA 1UMLA 2C1HA 2G96A 1GZGA 2NWSA 4UTIA 2YDQA 3GHTA 1RK6A 2EPHA 2YSWA 3VE9A 4P8WA 1S3HA 3W82A 1CIUA 1JXKA 2R82A 1JUEA 4LAZA 1VEOA 3RR4A 3VZYA 4WK9A 3NURA 2J6XA 1Q6LA 1W9XA 1NF0A 1TVNA 3QGVA 4P7QA 2AGTA 3B05A 3KBVA 3KX6A 3O0KA 1IF2A 3L4ZA 3VILA 2DUZA 3GXTA 3LHYA 1KBBA 1WX0A 3BG5A 6TIMA 3L21A 1IEVA 5FJIA 2VR4A 3IRSA 4OIFA 3LGDA 5CSUA 1TJ2A 3NQ2A 1KXTA 1LJYA 1RCOB 3CZGA 4NQ1A 4DUXA 4US6A 5A2AA 4AZCA 2QPUA 5HPOA 5HWNA 1MW1A 3MB9A 3H7RA 1E5NA 3WJYA 1KFWA 3OLGA 1SJBA 3EA2A 4MY9A 3MKKA 5B7ZA 1N8IA 2XFFA 3W1AA 2DQWA 3EWXA 1NSJA 3QMRA 3KHJA 5KMYA 1TIMA 3TAOA 4ZO9A 1JPKA 4C7GA 2QJMA 3BO9A 3F4DA 4IFOA 2WMIB 3W83A 3TNBA 4MB4A 3CEPA 3EOOA 1OK4A 1NQKA 5LHEA 1ZQ5A 3OBKA 3MJMA 2WHJA 2HDJA 3N2CA 4MNMA 2VEGA 4L1GA 3LOTA 1XFBA 3OZOA 3I3BA 3RMEA 3IARA 1L2UA 4D8ZA 2CITA 2HNEA 3TYZA 3WF3A 4IF2A 4B3KA 2I5GA 3SCRA 1B4KA 2DZXA 2ZZ1A 1N55A 3GH7A 4GYJA 1X6UA 1CLXA 3RR1A 1A3WA 4URIA 4D6CA 2OVLA 3V4BA 2GJPA 1FY6A 3BC9A 3VNLA 2AL1A 3TLLA 1M53A 1PZ2A 3W1PA 4BKNA 1YPXA 4EXQA 3TW7A 4M0XA 1F6KA 3GS6A 3G18A 3VIIA 1VJSA 4ZQCA 2QS8A 3UU0A 2ZCGA 1PO9A 2R1NA 1XLIA 5CPQA 2D20A 2ALDA 2F9RA 3W0KA 1DJZA 1C93A 1P48A 4ILSA 1ENUA 2NQJA 3W37A 1BAGA 2PURA 3K1DA 4LPCA 3QMTA 2QV4A 2UV8G 3PM6A 1VFTA 3PSVA 1XSJA 1LBFA 2XVNA 3NQFA 4FOJA 4YTTA 5KZEA 3WQ5A 3S1WA 1X6LA 4AWUA 3U3HA 4Y8EA 4O28A 3ERPA 4DNHA 3PB0A 4CD8A 5A6AA 2PLJA 3CIVA 3CUFA 4GMEA 3CJPA 3TH6A 2R8WA 1OIMA 1R2RA 1GTEA 2IPJA 4JIIX 3TQPA 4IIBA 2QDGA 2VEIA 4L1WA 2RGLA 3ZT7A 3R94A 3H23A 3EWWA 3LLDA 4OJYA 4DO6A 3CIWA 6ENLA 3GHRA 2ISFA 5D03A 5I3KA 4QQ3A 4L4OA 3QHMA 4U33A 3EXRA 2DZSA 3TTEA 2ZX5A 4UFIA 1IV8A 2YZRA 3DEQA 2VFGA 2ZYFA 1DWAM 2ZBTA 3HPAA 2GYIA 1HKWA 3CZJA 5A6JA 1G4EA 1VRXA 4Y90A 1RCQA 2OT0A 2X1TA 1E9LA 4EE9A 2A79A 1FWRA 1J6PA 3THDA 4FHAA 2EGZA 5A2BA 1FCQA 2Q09A 2FZMA 4JN6A 3UR5A 3P74A 6REQA 2DSZA 2RKXA 4RNIA 1EA9C 1M6JA 4OZOA 1BD0A 1TV8A 1PHQA 3GTIA 1Z7AA 3BLLA 4GD0A 3HGOA 3F7JA 3CEUA 2V6AA 2JKEA 4Q4MA 2DDXA 4ZXOA 3BLDA 1PYMA 3RLUA 1SR0A 4PTMA 2V3FA 1TV5A 3KCLA 3ALFA 1FBAA 1W2VA 4H1ZA 4I7VA 4AD0A 1PDYA 3P14A 3RITA 2VVSA 3A5FA 2EG7A 4Q8WA 1HP4A 2VVNA 1IGWA 1B30A 1GGOA 3B8UA 4IPJA 4M5PA 2WKGA 1I1XA 2ZZ2A 4B2DD 2HWGA 2DVTA 1I9CB 1TR9A 3QQWA 3WLOA 3WEOA 4EP8C 2EPLX 3BAKA 4OBSA 3AXKA 4OV4A 4ACYA 2YL6A 5C2GA 3QPYA 4FB7A 5BNKA 4DJDA 4RDWA 1BYCA 3GW3A 4QLLA 2QCFA 2W3ZA 2NXGA 3EPNA 3TE9A 3QJAA 7ENLA 3VD5A 2C13A 2QW5A 4M1RA 3S5ZA 3G1DA 2YL9A 3TEVA 4PSPA 5CBIA 4YWIA 5A2CA 1TPVA 3R0KA 4DUWA 3GXFA 1GJPA 3QV8A 3NPWA 4DJFD 3RM9A 3RHGA 1AW1A 2PU0A 3VNZA 2PRLA 4KMQA 1GHRA 2PFHA 3FVDA 3BMWA 3GC5A 4E2DA 4K1GA 5M3WA 3OA3A 4PMUA 1CYGA 3R11A 4NKCA 4XBJA 4H01A 4HTBA 3WDJA 2XM1A 3SECA 1HZYA 3EEZA 4NX0A 4W7WA 4UQBA 2BOGX 2XJ7A 4ZR8A 5DF0A 1MDLA 1CGUA 1US0A 3UG3A 3UGVA 2J25A 3S9ZA 4LV4A 4Y2WA 3U4FA 1E40A 3HTWA 2JGYA 1W54A 2P53A 3MP4A 1SSGA 4I6KA 1EKOA 4GY1A 5HNRA 1XQKA 3NDZA 2QEZA 2Z1WA 4U28A 3AXHA 4W8LA 2QIIA 3CZLA 3W7PA 1P43A 1ZP4A 2E77A 3CIXA 1YDOA 1YRRA 3ABQA 3R8HA 3ES7A 4QR6A 5CLWA 3AIVA 4W7UA 4K2SA 5CPNA 4H8HA 3RX4A 2W79A 3GKAA 1F73A 3HQ1A 1OBAA 2J75A 3JR2A 1YPFA 1FCVA 3LHZA 2VJXA 3QHOA 3QYSA 4FNTA 2HSAA 2PTXA 4A8NA 3ARYA 1RHCA 4ICNA 5C71A 3CYVA 5LGXA 1N8WA 1JDDA 4DLFA 1TPC1 4HMEA 1NOUA 4PUMA 4CU7A 3CT7A 2C15A 1C90A 1S5VA 2ODOA 3RG6A 1FWSA 4ZOBA 4ENLA 4XZBA 3LTYA 3PAOA 5F1VA 3UP8A 4AMAA 3VD9A 4XZMX 5LSMA 5DEZA 1QNPA 3QBUA 3EKZA 3ZVHB 5TIMA 3U7VA 3PZIA 1FXQA 4UFHA 1B3ZA 1ZB5A 3GG7A 3W6MA 2Q71A 3NPUA 3CQJA 1QI0A 4TV5A 1XG3A 4MY8A 4W8AA 3W1UA 1RSCA 1REQB 4DNMA 5DCEA 3AIWA 2E28A 4CD7A 3SFKA 1DYSA 1M01A 4FLOA 3C2VA 2YA0A 2Y7GA 3S2NA 4F40A 2PDKA 1ADSA 3O6CA 4LF2A 2QCLA 5ECUA 1PX8A 3P2VA 2ZKMX 3N04A 4WVXA 4CD4A 1E4NA 3H21A 3SRKA 2PRMA 4GACA 3LRLA 4HJFA 2Y2WA 2BGQA 3BLOA 4GUHA 1R9XA 4HN8A 4J3XA 3TYUA 1V3JA 3W7GA 4HK6A 1ZSXA 2R6OA 2X16A 2RDWA 1S2TA 4OE7A 3FDKA 1BKSA 4TU1A 1NDVA 3MCNA 3NQDA 1CB7B 4ML9A 2PWFA 2EPNA 3RYSA 1TWDA 1IEIA 3A64A 1I60A 4JTQA 1E0XA 1SPQA 1EYEA 3T0CA 4BQ4A 4LUTB 2XVPA 3U5UA 3TK7A 1LQ2A 3NXFA 4DZIA 2XFRA 4POCA 3D47A 1XGDA 3T2PA 4CN4A 3AS3A 4C6NA 4NAEB 4Q8UA 3LM7A 5HJLA 3E12A 4ZOCA 1S2AA 4JTAA 3QH2A 4H3DA 3CBWA 3T2OA 3MHFA 4F9JA 3DBNA 1V02E 4WGXA 4B5WA 3ARXA 1DOSA 1R0MA 1XIMA 4I7UA 4AF0B 1MW2A 4O53A 3EPMA 1DJYA 2NSXA 4ZSUA 1WO2A 5HBFA 1FH9A 1OQFA 1DQXA 2CESA 2PDCA 3E0WA 3W02A 5CH9A 1H61A 2FTWA 3EPOA 4JHZA 1FWFC 2WJZA 2FTYA 4WEVX 2ZX8A 2VM8A 1XIGA 1JVNA 1XYCA 3UGRA 1PBGA 2RAGA 3GXNA 2ESCA 4L4MA 3ITOA 4TVUA 3SO7A 6ALDA 3HG5A 2C8NA 3SJNA 3CQKA 4Y8FA 5HJYA 3IWPA 3FN9A 1I4NA 1E0TA 4HOXA 4Q8VA 4O1EA 4M1BA 3SUTA 4LXFA 5M17A 1H7RA 4UOQA 1F6YA 4JX5A 3RK8A 1BYAA 1AQHA 2VDGA 4QRNA 5F4XA 4FXRA 4NIRA 2CFFA 3N4EA 3R0UA 4I9TA 3S6TA 4K7VA 2WHLA 3B8SA 4UFMA 2A7PA 3PG8A 3E74A 5U4NA 3VIOA 1TV4A 4RPQA 3GY1A 4KBXA 1Q8JA 3FLUA 3HB9A 3W1NA 4ZGYA 4XISA 2Z4GA 3E3HA 1S5TA 4UTUA 1Q6CA 2D2GA 2J24A 1EJTC 2F8QA 3PJTA 5AVHA 4CKQA 1J12A 3BZJA 4AX7A 4QJ4B 4HA0A 1VLWA 2DJLA 4L56A 1TFVA 5A8PA 2R1PA 3EWYA 2Y62A 3M5ZA 1FKWA 1VFOA 4NXKA 5F2IA 1NAL1 1JCMP 3LZ5A 1UWSA 3N1AA 5CAKA 1SSDA 1IIHA 1JCJA 3N11A 4E2VA 3Q45A 3EMQA 3LCFA 1ZTVA 4N7QA 1G1YA 4NJJA 3UWQA 5DBTA 1GQNA 4GCXA 1R30A 5AYZA 3MMTA 5EBAA 5HULA 3WLLA 1OFEA 4XQ6A 3PUEA 3M44A 1QASA 2XWEA 3SRFA 3OZPA 3O63A 4JYEA 3OB8A 4XZ9A 1YLVA 3L68A 1W1ZA 3N25A 1ZRQA 1PV8A 4R7JA 3SZ8A 3CL8A 3EYPA 5ABEA 4BR1A 3A4AA 2OLAA 2F6XA 1M9HA 4HNTA 4FK9A 2B7OA 2Z1BA 3BQ5A 2VD8A 2VMFA 4TXEA 4QAIA 3VGDA 1BPLB 2CWNA 4FZIA 1QTWA 3IRDA 2V5BA 1IQ8A 2OB3A 4WXZA 3KTXA 3W7QA 1U1JA 2Z6JA 4MADA 1V5XA 4CGTA 3STPA 3NPVA 4Z42C 1ELSA 4X63A 3G22A 3WNOA 3L4TA 1ZBKA 3LPGA 2A3CA 2H9AA 2O7QA 1R2TA 3BVJA 1RJRA 3AUJA 4BQ3A 5D9MA 4GNJA 3IJ6A 2X1IA 3LGGA 1W17A 1EWDA 4PBFA 3WQFA 5E0FA 4GZ7A 3ZMRA 1YXDA 1EHAA 1U22A 2PTYA 2DZTA 4OTKA 2YYTA 4UTTC 5HXMA 1Q63A 4KESA 5L6UA 1EP2A 4C1KA 1B4EA 3VKAA 5FF3A 2QULA 1K9EA 3CUXA 1QO2A 3OZMA 3TQKA 3R79A 2WMHA 1UR4A 3S2CA 1S2UA 3T4CA 3A24A 2OGJA 1ICQA 5T9BG 3LCXA 4NJGA 1OK6A 1F74A 2XVGA 3DU0A 3FDGA 4W87A 5FIPA 3B3DA 2YLAA 4ICMA 5LA1A 5A3HA 2VOTA 5BWAA 2R9RA 3C61A 4M82A 3R10A 1SFSA 1C3FA 1P0EA 2TPSA 3T40A 4EPBC 2ZICA 4QJ3B 1JUBA 5AHFA 3WEZA 2O9PA 1LOQA 2JF7A 2W61A 3TYDA 5I3GA 2OU4A 5FJRA 4YTUA 3CHFA 3AXMA 4PEEA 4Q8TA 3QMSA 2FDMA 4O1DA 3C2OA 1R3VA 4J1OA 4US5A 3UCCA 3PPHA 1PCWA 4MF4A 3F1QA 3MANA 1XIEA 1NVMA 2QV5A 2F84A 5IFTA 1W1PA 1I2PA 2XH4A 2X42A 1I2QA 4RUBA 3GTNA 2H8XA 2YA1A 3T05A 2BWGA 1YNYA 1J0ZA 1KQZA 5C70A 4KIEA 1VIWA 5K3VA 1EDQA 5CC6A 5LNWA 3MSDA 1JCLA 1QOXA 2GQ8A 2WNQA 3KCOA 4ES4A 1BSLA 1GOMA 4ROQA 3LNPA 5I3JA 4AVOA 3IGUA 2FPVA 4ZZ9A 1L0PA 3BJSA 2AOSA 4WX2A 1NQ6A 3WH8A 1BWVA 4HNCA 3URBA 3NTYA 3W7CA 3EWDA 3AIRA 2VEKA 3FGCB 3PTMA 1B31A 2PLKA 2X2GA 4H9MA 2VRJA 4U2ZA 3GUWA 2H6RA 1HVXA 2X1SA 1XISA 1JR1A 1F7BA 3VIMA 4J9JA 3O05A 3A6OA 2A6NA 2ISDA 2V69A 2FTPA 3EX3A 4JIPA 3VIPA 2CBJA 3C0LA 2GVYA 2J8GA 2GQAA 2ATMA 4HZ6A 1D8CA 4IHCA 1PDZA 3SADA 2O56A 1OF6A 3DHUA 5DXXA 1HKKA 1QU4A 4QJ5B 2Q8ZA 4HCLA 1W5QA 3PUOA 4UTMA 2W66A 3L12A 2XUCA 4AHQA 3TN6A 1W9DM 3H7UA 1VEPA 3V0TA 4HKPA 4ZB0A 4YU1A 4CCEA 1EOMA 3E0FA 4LH8A 2WQDA 3KS5A 1SVDA 4O15A 3HG2A 5CSSA 3K8LA 1LDCA 4LB4A 3W7NA 1M5WA 5EMUA 3PFMA 5LNUA 3W1TA 1JCTA 3LMZA 3C2EA 3LBMA 1YE4A 2NQ5A 4G6CA 6REQB 2OMAA 1OYBA 3ABZA 3MVTA 2OKTA 4RZ6A 1B57A 4OECA 2PC4A 1O94A 2A4AA 3BOFA 5HNTA 4S3JA 2VGBA 2XH0A 1YIXA 5K9CA 4XD6A 5LXEA 3HM7A 2OR2A 1AD1A 1M7JA 4IIEA 2IS7A 3TC7A 1Z48A 2YW4A 2PP3A 4ERGA 1ZAHA 1TELA 1C29A 2C16A 4AXNA 1ADOA 2V3GA 4O4VA 3O15A 4FIRA 1I6NA 1FCUA 4F0SA 3LUTA 4DWSD 1NFBA 2FLIA 1FWNA 3BG9A 4R85A 3PBYA 1XSIA 1I8JA 4M80A 1XLEA 2JE8A 3B4UA 1UPPA 3Q67A 3AALA 4XTIA 1GVQA 5D05A 3VA8A 4NG3A 4AW7A 2G4FA 1ZBWA 4JNYA 2GQ3A 4X60A 3TWAA 1UWQA 1PAMA 4OOZA 4PUUA 2A5HA 4IGSA 3UWEA 4JN8A 3GRIA 2VGFA 2VUNA 3MU7A 3V3WA 1EB3A 1OGSA 3LXBA 3MUCA 3E96A 1RXOB 5F4WA 1G69A 5KZ6A 1KXHA 2FHFA 3V1HA 3C86A 1TG7A 3S8HA 3BW3A 2HZGA 2V8ZA 4D9PA 3WNMA 3VCCA 1EJRC 1NFGA 5JQ9A 1B9ZA 3BLKA 1FWDC 3KL0A 3FKRA 5G2HA 2NVDA 2J78A 3L23A 1P0KA 3BOXA 1TKKA 2GK1A 1RUSA 5HA7A 3N3MA 3SCNA 3ZQ9A 3KOFA 5C9WA 1CWYA 1LWHA 1LLWA 3GO2A 2NV9A 3T8QA 4E8GA 4RXFA 4V15A 2E7FA 2GL5A 1EJXC 3ZZ1A 4F4RA 1OGBA 3DC8A 4E4UA 1D2KA 2F6KA 3ZJKA 2OSYA 1UKTA 1SYTA 4NZCA 3S1UA 3S5OA 4H7CA 2J47A 4H41A 4B3ZA 1WDSA 3ARZA 3DYPA 3CAWA 3E49A 1L8PA 3GNXA 3CUZA 3UETA 2XHYA 2R91A 4G7EA 3WLSA 1EUAA 4H9VA 2BB0A 4RDZA 1CZ1A 2RHGA 2PWVA 8XIMA 2E1WA 4KFPA 1EO5A 5CPSA 3PULA 3ARUA 1JZ8A 4US5D 3VDBA 4KERA 2A3EA 3GLCA 2QUTA 2GUBA 4S1FA 4KFNA 1PKYA 2CPUA 1VFFA 3L4WA 3U2ZA 2XVLA 4UQEA 2WLZA 3MCMA 3CPGA 1AJ0A 3LCHA 3P82A 2EO7A 1A5LC 2ACRA 3VKKA 2PDGA 3A21A 2Q6ZA 3U2EA 1K77A 4LY4A 1EQPA 1AMYA 4DUOA 3C0SA 4B9ZA 3K8KA 3MA8A 4W7VA 1RLCL 5DO8A 3N12A 1NM9A 4FNRA 4QG6A 3UXIA 2FFCA 2GGHA 1E70M 1POJA 3M6YA 4B4HA 5A6MA 2J7FA 1DORA 4UCFA 1FTXA 4DJDC 1XP3A 1ZAJA 3G1SA 1WV2A 4ZTYA 2EG6A 4XO6A 1SUXA 5BXRA 4JBRA 4MGGA 5IDZA 1LCOA 1GYLA 5D9OA 4FS9A 3N2BA 3ANUA 4JTJA 4CQDA 4JZ5A 4D8AA 3PBGA 1Y8BA 3Q58A 4GYPA 3ABRA 4Q7BA 3LSCA 2VQTA 2YFNA 1Q6QA 3ARTA 3GX9A 4KEVA 2CLIA 3AHVA 1V6XA 1EFZA 1CEOA 3N2MA 4PTVA 1CB2A 5E6YA 4PFHA 4XZIA 1KD0A 5LIWX 4KCUA 1HGYA 4XAGA 3BZGA 1K8ZA 4UQCA 2PGWA 3WFAA 2BGNE 3OU8A 5EMLA 2PZ0A 4JGDA 4G1KA 3PUDA 4UZSA 3CZEA 1AFSA 1I2OA 2QUMA 1JZ5A 4X0VA 1R8LA 3GR7A 1OFOA 3INPA 1FQ0A 1DKWA 3NPXA 1R87A 3KOYA 4WDXA 1TE1A 3PP7A 4PL2A 1ZHAA 4MWAD 2RUSA 3THQA 4PCSA 1JDAA 1ONWA 2EAWA 3B0VC 4C6CA 2HROA 3C4UA 4K38A 3FK4A 2C79A 1PEZA 1W3KA 3WQ6A 1UD4A 2TODA 3W7JA 4KQNA 1UB3A 1E71M 3H2OA 4R7OA 1Z32X 2D0FA 2Y89A 4GZEA 3FEQA 3VMNA 4E2OA 4IGHA 3HV9A 5A8GA 1F61A 5GJNA 3GHUA 3CHCA 2J7HA 2WBGA 3AJXA 3K1GA 1ALDA 2POZA 2TSYA 1OINA 3UZYA 4KS0A 4JDBA 5JBDA 1EX1A 3BAXA 2DT0A 1S3TC 4WF7A 5I3HA 4D6IA 4DPPA 3NCOA 3POCA 1LT7A 2FIQA 4HNLA 1DJGA 1BEUA 4J35A 1R85A 1VD6A 4MDPA 3RNDA 3PS7A 3VZXA 3BG3A 3PB2A 1W9UA 3BJFA 2ONEA 4S3AA 4JTUA 5H91A 4K3ZA 4F0MA 4DEFA 1GTHA 4JTSA 4AWEA 5JBFA 4B92A 1R7OA 4FLRA 4Z2LA 1K4GA 3R4IA 1KV8A 4FALA 2ACSA 2INEA 4H8VA 4C6FA 4H9TA 2VDIA 4Y7EA 3UW6A 1GPFA 3KUMA 1QBBA 3AU2A 1ZLPA 2AKMA 4ZCWA 3S9IA 2QCHA 4L61A 4GOAA 2Y8UA 1XRFA 3QXBA 3W76A 2PTDA 1UW9A 4D71A 1GORA 3C56A 3DHDA 4AYSA 1UBSA 3IIZA 1T8QA 2PDXA 3IIPA 1UD3A 3IGXA 1W1A1 3B9DA 3M0HA 1QRQA 3VGEA 1DWGM 5EL1A 5CPMA 4L4PA 3AMDA 3M16A 3ZJ6A 4LUIA 3KRBA 2H3BA 2ACQA 3Q37A 3G6MA 2PBGA 4Q22A 3W7MA 2OLSA 3B0YA 1JQXA 4BI5A 2B7PA 4UQ9A 1TTQA 1NP0A 2D3NA 3AMGA 1IXQA 1JAKA 3QLLA 3SAZA 4UXDA 4LAKA 3IJIA 1A4MA 1XLCA 2ZWZA 2VX4A 3QZAA 3MZNA 2QMJA 3WLQA 1B9BA 3VM5A 2P0IA 3SCSA 4WUIA 2CERA 1CTNA 2P50A 3TCSA 3GG8A 3QR3A 4JQ2A 4QLKA 4F48A 4FNSA 4O1BA 4LTSA 3DERA 1FWAC 3UY7A 3GYCA 3BAIA 3N6JA 1TWZA 3KWXA 4CD6A 2DZUA 1HXJA 2J7DA 4GABA 5E6ZA 3GIQA 4XIMA 5C8BB 2ZRVA 3FNDA 2YBTA 2ASHA 3AIUA 4ORIA 3NZRA 2VELA 4G7FA 1V3KA 3IJLA 4HSHA 2FGZA 3GC2A 1EJ7L 4GZIA 3RXZA 2WC7A 2UWFA 2OSXA 3WH7A 3B03A 5IHSA 5KETA 1P0DA 2NUYA 4D72A 1BHGA 1UR3M 4KCTA 3J7HA 2YL8A 4MKSA 2P8CA 1LL7A 2ZRUA 1XQLA 5E70A 1KBKA 4C6OA 5JH2A 1TYGA 5FACA 3VDCA 4UTWA 4F0HA 4NP7A 2XPKA 3HGJA 1YNQA 1KCZA 3WMBA 3WZ0E 2D2OA 5FESA 4E6MA 4WIWA 3UWWA 3OGSA 3UVAA 3PJXA 2BY0A 4F0KA 3QR1A 1OZQA 2H3DA 1TTJA 2BXVA 4DYKA 3A13A 3L2LA 3WMSA 3DFNA 2DU2A 2OQYA 5A6BD 4KWSA 1R6WA 4YVPA 1NTHA 2QCMA 1G67A 4WSJA 5CEWA 1DJQA 4FNUA 3DYOA 2ZXAA 3OQEA 2WSRA 2A85A 3MTWA 4GQRA 4LUTA 5XINA 1SO6A 3ORWA 2C19A 5I2UA 1MWOA 2D73A 1Z89A 4DZ5A 1B3VA 3AIEA 1G5AA 3UPBA 4U2YA 4XVEA 1XYBA 1GUVA 1YKWA 5T8GA 3RPDA 1XLMA 1TCMA 3BCJA 4CLMA 4DUVA 3DHFA 1GVFA 4NXSA 2YR1A 1GNXA 4X22A 4LEFA 3P84A 1KTBA 4JS3A 3EXTA 2QCDA 1MQRA 1H09A 1GVSA 1EQCA 2ZA3A 3AMLA 1PZ3A 2GJLA 3GDMA 2DZVA 1JFXA 1ZJAA 5AHMA 1DQUA 4BWLA 4HHPA 1NWTA 1JEZA 2PLCA 3MMUA 5DFAA 1VJIA 1P7TB 3ZXWA 3TTQA 1VBHA 5I3FA 1OX6A 3L0NA 1O4UA 1R3RA 2PBOA 1WDPA 4MNJA 4KKXA 4PBGA 1XI3A 5LNVA 1Y65A 2E09A 2A6LA 3NQBA 3UWVA 2PUZA 1EZWA 1V6YA 4QSFA 3BV4A 2WOQA 4I5RA 2WK2A 3P5YA 1OCBA 3E0VA 4YVVA 1X8FA 3TLQA 2AAMA 4O13A 4RV8A 1JPIA 3VU2A 3LHWA 3PTKA 4QE4A 3MC5A 2PI6A 2PDHA 4O57A 4W84A 3M5YA 4NVTA 2DQXA 4FR6A 3CB3A 1FCBA 4MWAC 4H7VA 1LORA 2R1MA 4I8YA 2OFJA 4WOZA 4HK7A 2VXNA 4S3BA 3ZIZA 3UJSA 5FJTA 4UFJA 1VBRA 2V81A 3GNOA 5EGRA 1NWSA 2J62A 3IK4A 3WLKX 4AZGA 4P8VA 4RZ4A 2GZXA 1QNOA 1PTAA 1MW0A 2GSEA 3ZSSA 4J3WA 2PDNA 4UC5A 3VIKA 4CN1A 3AZSA 4YS1A 3CL6A 2RDTA 1UASA 4I9MA 4Q4RA 4X2RA 1EL3A 1Z69A 4E3TA 1W0MA 2NUXA 3PZGA 4S3FA 1W1VA 3SIMA 1F9CA 4DWSB 3LI1A 2FFIA 3NVTA 2Z24A 2I5QA 3SUVA 4RZ5A 1KLYA 3NM3A 4N9CA 4NRRA 3D5HA 1AA1B 3P93A 2O9RA 2VEPA 4MPKA 2FDSA 2WZEA 3SCQA 2FZDA 4V27A 2A3AA 4P8XA 3R1ZA 2DSWA 5E9AA 1C8YA 3F2DA 3MSYA 1YTEA 1UH2A 3MYPA 4D6EA 2EG8A 1B90A 2FMNA 2V2DA 4XAPA 4PRWA 4QSHA 1K70A 4OHQA 3NZGA 1IHIA 2XTKA 3WBWA 4LCSA 3TSDA 1AQMA 4Z1YA 1J0JA 5CZTA 4N4PA 2PMQA 4S38A 1XWYA 3VZZA 4HPJA 4GBDA 1KA9F 5TD4A 4AY8A 4ZTXA 4C6DA 3O07A 1IT8A 5JVLA 1Z41A 3AS1A 1CXKA 4RE0A 4B9YA 5HNUA 3BXWA 3KP0A 3DX5A 3MY9A 5IOBA 1VYSX 2C3ZA 3K5XA 4QQUA 3L67A 2ISVA 4MB3A 3NQCA 5LIYX 3T0AA 4PTWA 1AQ0A 1BF6A 1BSIA 1QT1A 3FXGA 5F1UA 2GGIA 4Z17A 5KZMA 2BY1A 4IMDA 1UA7A 2YDRA 5EB8A 2UBPC 3M4HA 1JF6A 1OB0A 4ICCX 3LPPA 4RNHA 3C8NA 4YJ5A 1H49A 3F03K 2QJIA 1E9ZB 1RD5A 4FR1A 3LXCA 4GX8A 2VC7A 4EOUA 2DSVA 2XG9A 1QI5A 3K46A 3DIPA 1A0DA 4ONVA 2QF7A 4R9XA 2PD9A 3ZLHA 5AY7A 1XC4A 3JU2A 3UJRA 4NF7A 1NP2A 1DBTA 1XC6A 1M03A 2E6FA 3ZO9A 3USZA 4ALDA 3KLKA 2ZE3A 4GVFA 4LVAA 4AC1X 3GQYA 1H7NA 2DEPA 2Z29A 1IR1A 3W84A 1HJXA 2X0SA 5DRIA 5GJMA 2VNCA 3E9AA 5CSRA 1BYDA 2BBFA 4GUGA 1XIBA 1BLIA 4JFWA 4JTGA 4C90A 4S2CA 2PEVA 1UZ1A 4X3ZA 1MXSA 1XR2A 4CEUC 1W3LA 4WCJA 5A6BA 3M0MA 4W93A 3PJWA 4A3YA 2HVNA 4M8UA 1WBJA 4MFEA 2J66A 3G0UA 3T2QA 5BRBA 3QHNA 4RDYA 1BVWA 2PDIA 1DIOA 4GY7A 1QOQA 2QCNA 4LC6A 5DN1A 1DHKA 1UUMA 3AZTA 3T4WA 4AQLA 2DFAA 5A8MA 3L4UA 4NZFA 3UR7A 5FA5A 4LAOA 3QSTA 1TZ9A 4GXPA 1Q66A 2C71A 1YTKA 3NOYA 3KZPA 4GI4A 1UQYA 1YXCA 4S3KA 3LERA 4RE4A 4D6HA 3LDVA 1XG4A 4FXJA 4PB4A 3VD3A 1K3UA 2GQ9A 4CEXC 7REQB 3U7BA 1WDRA 4EIVA 4PRTA 1TMQA 1TV3A 2VZTA 2P3EA 4CQBA 2JEQA 2QF8A 1K6AA 4D6DA 3G0SA 2QVNA 3CMJA 4MB1A 1DL3A 2FYMA 3JZUA 2JALA 4JQ1A 1RR2A 3LXAA 2EJ1A 5TBOA 5HDRA 3FJ6A 2VTFA 5C2CA 4EWJA 2QDEA 1EWEA 3OGVA 2D0GA 1UR1A 1VPYA 1VFHA 4LBRA 2ZC8A 3MCOA 3MZ2A 1LBLA 1BXBA 4FMVA 2X1UA 3DKLA 2V67A 3B9NA 3UERA 4W88A 2Z27A 2X0YA 4XZHA 3W74A 1O68A 1VS1A 2NT1A 1S1PA 4J3ZA 1T8XA 3PZOA 3T1GA 3WLTA 4MZ8A 3W28A 4ZQNA 2P10A 2NVAA 1US3A 4UNLA 1MDRA 1B54A 3KL5A 3RN6A 2YGYA 1E4MM 4LVBA 4PMNA 4M29A 3CMFA 1ECQA 3QGAC 1WKEA 3DC0A 2ACUA 4ZB5A 2J7GA 4D1IA 4LAMA 3H24A 3WEMA 2EF9A 1R47A 2G3FA 3W71A 1OYAA 1WDQA 3TZNA 1UWTA 5IRPA 5ABHA 4N2YA 3GDRA 3CYJA 3PWAA 3WD4A 3LEPA 1Q6DA 1O5XA 3T7VA 1TMHA 3CLWA 4O54A 3HU7A 5MKGA 3DYMA 3TW9A 1EJUC 2PWEA 1V6TA 2NX3A 4JTHA 3OHMB 1Z6KA 3W53A 2YL5A 3N2TA 2I7GA 3A9IA 3H2MA 1C8XA 1MNZA 4IG2B 3SB0A 4W85A 3V5FA 4N02A 4G9PA 5M2FX 1VBGA 3XIMA 3N6QA 1E0UA 3QM3A 4MZYA 3DHPA 5I23A 3VMOA 3R8RA 5IDIA 4MAZA 4GFSA 4NNBA 1V6VA 2I14A 4IJCA 4TMCA 3MHUA 1OCQA 1WDDA 2NT0A 3THUA 1ZBCA 2OZ8A 4H00A 1JYXA 3DFOA 2Y7DA 2WC3A 3N9KA 5BMWA 3BGGA 4AD4A 5IHRA 1V51A 3OVRA 5A69A 3G77A 1KRAC 3W25A 5PTDA 3PY2A 3KHDA 4KF1A 1DWFM 5DXYA 4PCNA 3CWHA 1NELA 5FJUA 3HN3A 3GVRA 1D3GA 3ICJA 2YBUA 1NFPA 5A95A 4JIHA 3ZLFA 3C6CA 3SCWA 4MJ2A 3HGRA 4C6EA 1YDVA 5DCDA 5AECA 4YPJA 3VIHA 3EDEA 5K7JA 1EXPA 1WXYA 5G2WA 1UUOA 1Q7QA 3EDJA 4EPDC 1L6FA 2PTWA 4AZ7A 1PIIA 4U4MA 1DJWA 3WBAA 3CO8A 1M04A 1RV8A 3BMVA 5K4XA 1SZFA 4UTHA 1DIDA 1X7FA 3LMYA 2RFGA 5DCBA 3VOHA 2J9ZA 3F5KA 4IFKA 1AVAA 3LG3A 1THFD 4O14A 2WBKA 2NXHA 1K03A 1V0MA 5IXEA 5FSEC 4HB7A 4LYPA 3NUKA 4YYCA 3UZJA 3W73A 4GZJA 4FX6M 1ZJBA 1XD0A 2UZ9A 4GPNA 5AC6A 2Y1HA 4HYWA 2Y5EA 3UF9A 2A7RA 3VMPA 3AO0A 2PDFA 4F8XA 3SUUA 4UQAA 5FAJA 3H7VA 4OV9A 2ZZ4A 3NGFA 1GZJA 3BGAA 3FY1A 5EMYA 5DMMA 1H7OA 5LNSA 2Y70A 2JFEX 4A8LA 3MWAA 5KSWA 2E0PA 1XF0A 4R9OA 2J74A 3ZWTA 4GBUA 1P0NA 2QAFA 1D8WA 4AC7C 3L5LA 3NFUA 1E73M 2P8BA 3REQB 2Z25A 4H6EA 4NJKA 1LRQA 2BHZA 2VZSA 4U3CA 1KCXA 4J7RA 2HBXA 1LYXA 1Y0EA 5EBUA 5ABTA 4XK2A 5FEWA 1OX4A 2W0UA 1OX4B 2FGLA 4NZ3A 1XLAA 5JH1A 1HFBA 3TONA 4JQAA 3I7QA 5EMJA 1FP9A 3KDNA 2ON3A 3ZWSA 3NVDA 1A5UA 4FOKA 1KFJA 3P81A 4ZOEA 4F2BA 1GYMA 2NV2A 5HQLA 4EWND 3DFPA 1H2JA 5DY3A 2X40A 2ZOXA 3H4XA 3ITLA 3MO4A 1NEYA 1FWBC 1NIUA 1UD8A 1T7LA 2GLKA 2J7CA 4RW5A 4LV9A 3A47A 3FJLA 1YYAA 1UOKA 1G9HA 2PF8A 5IFPA 2G41A 3DZ1A 4JYFA 2IPWA 4B5SA 4B15A 3UYCA 5AVNA 4U31A 5C9ZA 3L65A 3OG2A 2C0HA 1A0EA 1ML1A 4V28A 5EMMA 1TVPA 1Q5MA 3BANA 3WX7A 3M5XA 3NAVA 3BOLA 3SN4A 4L6DA 3SDOA 5F7UA 1LUCB 2QT3A 3WF1A 3EBVA 3I7SA 3RRXA 2WMKA 1LL6A 1M7PA 1TWSA