5CQ1A

Disproportionating enzyme 1 from arabidopsis - cycloamylose soak
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
517
structure length
514
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 182
structure length 514
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cq1A01
3F5KA 1CENA 4NRSA 4BQ4A 5KEZA 1PX4A 4H8UA 4XB3A 1JYNA 5A8QA 4UFIA 3VKKA 2FGZA 1BGGA 2X2YA 3OGSA 2PB1A 1IZJA 5ABGA 3AS2A 4MJ2A 1JAEA 1GQIA 1UWRA 1WZMA 2UWFA 4UFKA 1ZU8A 1W2PA 3UESA 1ZL1A 4PTXA 3NUKA 1QW9A 6TAAA 3VGDA 1TR1A 1NOFA 4UZSA 1VAHA 4FLQA 3GTNA 1O7AA 3MUZ1 3N11A 1JFXA 2PC8A 1AQMA 2BVTA 2QHAA 2VUYA 3AIVA 4GQRA 1UD3A 2E9BA 1X6NA 3CHDA 3FN9A 2YBTA 4QLKA 4NRRA 2WPGA 1R7AA 4DUWA 3VDHA 3EDKA 1ZS2A 4HPHA 3I3EA 3A6OA 1EDGA 1G01A 2OWXA 2ZUUA 3BCDA 1J0KA 2W62A 3U57A 3T08A 2GK1B 3WDHA 4JKKA 5DF0A 1CXHA 4UCFA 1W3LA 3CPUA 4AZCB 2C7FA 4F9DA 3AIUA 3CMJA 2VQUA 1BG4A 1UR1A 3S6TA 3EMCA 2GSJA 1XYZA 3WMSA 5GQBA 3F4VA 2BY1A 4WKHA 1C8QA 5A6KA 1CXEA 2QMKA 4RE2A 1OT1A 3NYDA 2UY2A 4P8WA 3TOPA 3A4AA 3U7VA 1V6UA 3PZQA 2UY5A 1ZBWA 5E9AA 1MWOA 1ZBKA 3A4WA 5BRPA 1W1TA 1XD0A 2Y4SA 3EBVA 2RGMA 3T2PA 5BXSA 5AY7A 3VMNA 2CIPA 4CKQA 1J18A 1NQ6A 3N18A 3B9AA 3TTQA 2VX7A 4Z2HA 3VIOA 3K46A 1BTCA 1HL8A 2J7BA 4D6JA 1H4PA 1HXJA 3ARXA 2VX6A 1QHOA 1ZJBA 2J77A 4HTYA 1V3LA 2EO7A 2XVGA 5A95A 4KH2A 5AYBA 4P7LA 2O9TA 3SUUA 4KRUA 3EDEA 1C7TA 3WN6A 2YIHA 1FHDA 4P8VA 3WBAA 1J12A 1TFVA 1CYGA 4M29A 1V3HA 2OSWA 4QLLA 3WY1A 3MMWA 2XG9A 2ZUSA 4V27A 3FHQA 4S3JA 3FY1A 3W25A 1PX8A 3OLGA 4J3TA 1I1WA 1Q6FA 2YBUA 3M6DA 4MJ4A 3RMEA 1GHSA 1DTUA 2BXZA 1W1YA 3KWXA 3VGHA 2BHUA 2XJ7A 1E43A 5IHSA 2GFTA 4D71A 2EPNA 2YDQA 2WWDA 2DT0A 2CYGA 2DH2A 3L4WA 4XZBA 2WZEA 3NSXA 4XUYA 1LWJA 3CLWA 4HMDA 3EDDA 3KEHA 1UOKA 2CKSA 3AQUA 1KB3A 1ZBVA 4CN1A 1GZJA 1FH9A 2BNJA 4JKLA 4WSJA 1SR0A 1HVXA 4UFHA 1UD4A 4TTGA 3ZT6A 3WD0A 5EBAA 1CXFA 3K4DA 3EDJA 4FK9A 2DSZA 4CCEA 2D1ZA 3ZQ9A 1E56A 1E6ZA 1MXDA 3AYRA 4AEFA 3WDPP 1WDPA 2XHYA 3PHAA 1VFOA 2NSXA 2ZX7A 4ACZB 4GPNA 1LG1A 1HJXA 1JNEA 1M01A 1WKYA 5HOSA 1V0NA 2YLLA 3APGA 5ABFA 2F2HA 4P7QA 4D6GA 1GPFA 5HXMA 4HA4A 4JIEA 3RJXA 4UFLA 5FL0A 1E72M 1QI3A 1ITXA 4PTWA 4PSPA 2DQXA 3M07A 2J7EA 1MW2A 4BQ3A 1EA9C 3T0AA 9CGTA 2VZTA 3CUHA 1TCMA 1KCLA 1EDQA 5BYWA 2ZOXA 4J3XA 3ALFA 1OIFA 4C7DA 1J10A 3WQVA 2V38A 3IJ7A 1L0PA 1VJSA 4PMVA 4PTVA 5KZ6A 2F61A 1CGWA 1WPCA 2MANA 4KGJA 4Z2GA 1UD6A 4W5UA 1WCGA 2J7HA 2YLAA 3RILA 2QF8A 1B3XA 3CUFA 3WL1A 2FHFA 4MNLA 3HU7A 1XSKA 5CGTA 1H09A 1PBGA 2CITA 1UKTA 3QOKA 2OWWA 4WK9A 4AXNA 1JZ7A 2G3NA 1OBAA 1CTNA 1V3IA 2IXUA 1UR4A 1CPUA 4PMUA 4MNJA 4J3WA 1C3FA 3DYOA 3BAWA 3MS8A 5HPOA 1K9FA 2ZX9A 4W93A 2PWFA 1IT0A 4NF7A 3VGFA 5CQ1A 4CGTA 1E4IA 5A2BA 2OSXA 2VJXA 2ZXDA 4AD2A 4TTUA 3WF1A 1OIMA 1GORA 2VR5A 1UQZA 4WJXA 2VRKA 3TTSA 3WD4A 1LJYA 2WCAA 2WYSA 1HJUA 1H0IA 3BLKA 4V28A 3WDRA 2CETA 3OBAA 1J0JA 1BQCA 1U33A 3UG3A 3MMDA 5A6AA 4W88A 4RL3A 1JL8A 4HU8A 1LG2A 2WM0A 3RDKA 1B3VA 3N12A 1GVIA 4YPJA 1C93A 1UUQA 1V08A 1XH2A 4WKAA 3RCNA 3E1F1 5IDIA 1A47A 1TA3B 4Z2IA 4D1IA 1WB0A 4GI6A 2ZUVA 2GK1A 4W8LA 1CECA 4R5EA 3WDJA 1C90A 4AW7A 4PCSA 1UH3A 2WKGA 3VD4A 3WQ8A 3OB8A 4KMQA 5HDRA 1KXHA 4DM2A 4OUEA 3DHPA 3GBEA 2VQTA 3S2CA 1GONA 2G4FA 2JF7A 2ZIDA 4CVUA 1KQZA 3MSGA 3ZR6A 3DC0A 1D2KA 3WNNA 5EMYA 1EGZA 3PZUA 1HJSA 1V3KA 4S3KA 1CZ1A 1CBGA 1B2YA 4JAWA 1JFHA 4D72A 5GNXA 1HL9A 3W26A 3POCA 2WMIB 5A8NA 4BCEA 2FHCA 4ZXLA 5CLTA 5C70A 2ZXAA 1WDSA 4EANA 2VX5A 1JG9A 3AMCA 3VIKA 5FD0A 1EOKA 1M04A 1BYAA 2VMFA 3THCA 2DIEA 3SUWA 3CHFA 1UH2A 3F5LA 2ZUWA 1B30A 1V3MA 3OZPA 2J7CA 2XVPA 1CXIA 2D3LA 1J01A 2VZVA 1KBBA 1W9PA 4PTMA 1EQPA 2VX4A 3SUVA 4EAMA 2VVSA 1NWRA 1B1YA 3L4YA 3VD9A 4M81A 5D9NA 1KXVA 3ZJ7A 3VDAA 1TG7A 2FGLA 4FF5A 2QLYA 3AS3A 3AJ7A 4H2CA 2DIJA 2J7FA 3ZR5A 4W7VA 1H41A 1Q6DA 1WNOA 3OGRA 3WF4A 2O9PA 2BY2A 1Q6CA 2GJXA 3SCWA 1JZ4A 2CBVA 1ODUA 1QI2A 1OT2A 1W9VA 1V0MA 2W4XA 4URIA 1C7SA 3TONA 1CGTA 3IJ9A 1US3A 5A6LA 3CGTA 2XPKA 4W86A 2A3BA 1QPKA 2XSAA 1B31A 4CU8A 3BXWA 4F8XA 1E4MM 3AMKA 1G9HA 1Z32X 2X05A 2VC9A 3FW6A 4Z2JA 3L2MA 5E6ZA 5AC4A 3K8LA 4PRWA 4W84A 5CPSA 2G3IA 5CGMA 3WUFA 3W28A 1GOOA 5JBDA 2VI0A 2WHLA 3ZT7A 2WK2A 3BAXA 3W6LA 4QLJA 4ML4A 3SCVA 2J7DA 4QCFA 1WO2A 4DUXA 1SYTA 2D2OA 3CUGA 4WLCA 1UD2A 3GXIA 2Y5EA 2EQDA 3SURA 1HN1A 1E3XA 3TP4A 3SUTA 3SCQA 4OZOA 4ZE4A 5I77A 3AIRA 2J8FA 4XV0A 2EBNA 4M80A 3O2LA 3WMBA 4QCEA 3VD7A 1K9TA 3PTQA 5BCAA 4W5ZA 4OIFA 4JCLA 1GJUA 4UNIA 2VRJA 3K8MA 1ISVA 5GPRA 3T0BA 1E6RA 2CESA 4U5KA 1G0CA 1OD0A 1R87A 2IUZA 3VIPA 3RM4A 1UWUA 2CHNA 4N42A 3B9EA 2V3DA 2WANA 4DM1A 1VB9A 5EFFA 4BQ5A 3KL3A 4JCMA 4JL2A 3KE0A 4XX6A 4IUGA 1W1PA 2YL8A 3MV01 4UOJA 1ISWA 5DT7A 4QDMA 4GXPA 2G3JA 3GDBA 5I5RA 1AMYA 1P6WA 1YQ2A 1BPLB 4BS0A 4TUFA 4CD6A 3ECQA 2W67A 4AZBA 3ARZA 1EH9A 4AZGA 1ODZA 3WD3A 3WH6A 3VUPA 1GCYA 1J0ZA 1A3HA 2A3AA 1YHTA 4JL1A 2XGIA 3BC9A 1KWKA 1UQYA 1NARA 1V02E 2VCAA 1B3YA 4X0VA 1QI0A 2RGLA 1VEMA 3ZM8A 4CU7A 3NSNA 2D22A 2Y8KA 2W92A 1B9ZA 2QPUA 5A6BA 4U2YA 4KGLA 4HMCA 1NWUA 1HP5A 5E0FA 3OG2A 3RM8A 4AISA 2X0YA 4GZJA 3CZKA 1WDQA 3WF2A 1W1VA 4OOZA 3WNKA 4UR9A 1J9YA 3PZVA 5BXTA 1GQKA 3IJ8A 1BG9A 1HT6A 1BYCA 1H49A 1LWHA 3ARRA 4AD4A 3QGVA 4UFMA 1MW1A 1OGGA 3BLPX 4PMNA 3IAPA 1ZBCA 4MADA 8A3HA 4MB4A 3MKKA 3VTRA 2V3FA 1PIGA 3RM9A 1AQHA 2UY4A 3SCPA 4Z2LA 4W87A 4ZEPA 5I6SA 3W29A 3BSHA 3PZ9A 1M7XA 1MW0A 1ISXA 3F5JA 1JDDA 3B9DA 2XFYA 3W6MA 3OGVA 1BSIA 2PWGA 1XCXA 1H11A 1GJWA 3L4ZA 2XM2A 3MANA 2YL6A 1W3KA 4HOXA 5FL1A 4MDOA 1LF1A 2J4GA 1GW1A 1XH1A 2WMIA 3POHA 1GQJA 2J47A 1HJWA 2EPMX 4MB1A 3IANA 1E6NA 4AD3A 4J3VA 4AZHA 2JALA 1E5JA 1NM9A 1W9DM 3FXYA 5DT5A 4EK7A 4TVCA 1XH0A 4CCDA 3LPPA 2CERA 3KL0A 2DPEA 3WF0A 1X6LA 2CEQA 1FP8A 1X1NA 4X0NA 3FAWA 1E71M 1KXQA 1QVBA 1ZB5A 3O9NA 3WQWA 4AIUA 2E9LA 3FAXA 2YDRA 3AICA 3ARSA 3ARVA 2JEPA 4Q22A 4D6EA 1JF5A 3MMUA 1E0XA 1XHGA 3BMVA 4J7RA 3OA5A 4W7WA 3BGAA 2WLYA 4UOZA 1E9LA 2Y2WA 3WD2A 4AC1X 3MUIA 2ZUNA 4GZIA 1EDTA 4HZ6A 4OBSA 2NW0A 1HJVA 1EO7A 2D23A 3AI0A 2G8ZA 3AMGA 4B16A 1OGBA 4CD4A 3B8SA 5HBFA 2X0HA 5F7UA 2AMGA 2NT0A 2WCGA 1WP6A 2WLZA 2OSYA 3MO4A 5DEZA 1QNRA 3SEPA 3L4VA 1EHNA 3HMCA 3SCTA 5CZKA 5HNNA 4LQ1A 4PMZA 3JUGA 3UETA 3T2QA 3N9KA 3VM7A 3WEZA 1MQPA 4LX4A 3VO0A 2PWHA 4NZCA 1M03A 2YA2A 5D9MA 2G3MA 1FFRA 1L8NA 5A6SA 1JD7A 2OYMA 1V03A 3A47A 1R86A 3AIQA 1PX3A 1PZ3A 1E6XM 5GNYA 3VIIA 3AS0A 1V0LA 4B9YA 1HIZA 1U2YA 4OOUA 1C8YA 1EO5A 4MTVA 2C8NA 4M8UA 4D6HA 4WF7A 1BLIA 4AY1A 4D6FA 4FLSA 3N13A 1BVNP 5A8PA 1BGAA 2VO5A 2D0FA 4AIOA 4GQQA 2GJPA 3ARYA 1MFVA 1RP8A 3PTMA 1Y7VA 2ZXQA 3UERA 1JZ5A 2GUYA 1CWYA 1V3JA 5CJ5A 1NH6A 3GXFA 3DYMA 1MXGA 2EPKX 2WBGA 1ESWA 1JXJA 2DT2A 2Y8VA 5A94A 3GZAA 4W89A 1UA7A 2E4TA 2WVSA 1UR9A 2WXDM 3WF3A 3AZSA 3MUAA 3VD5A 3ARWA 3CZ8A 1E15A 2WBKA 3PZTA 1J0YA 1QNOA 2VURA 1R85A 3NCOA 1B0IA 2AAAA 2QMJA 1H0GA 1JZ6A 1FH7A 2CPUA 1OINA 4PMQA 4R27A 2J78A 2UY3A 5CG0A 1XSIA 2DH3A 3NIYA 3CTTA 2O9RA 3NSMA 1FOBA 1V6VA 3IK2A 2VZSA 2DSUA 2F8QA 1CGYA 1S46A 3K8KA 1GNXA 5FIPA 4N0RA 1DWJM 1H3GA 2D20A 1B90A 1E4LA 3AZTA 4H04A 4QFUA 4UFJA 2CXGA 2PWDA 2GJRA 2E9MA 2D3NA 5I23A 2V3EA 5LA1A 1LL7A 1FA2A 3BAJA 4M82A 4PSRA 2ZXBA 1QHZA 5ECUA 2BVDA 2VCCA 3VDBA 1JYXA 3AMLA 4UOQA 1JZ8A 2XSBA 2BVYA 4V2XA 3WNOA 3U7BA 5AC5A 4WIWA 2JF6A 2XIIA 2Y24A 1Q6EA 2YJQA 4C7FA 4BF7A 1CGXA 3WD1A 3W37A 2XWDA 1D3CA 4DWSD 4AZCA 1GOWA 2CBIA 1TUXA 4JHZA 2XWEA 1KWGA 2X09A 2JIEA 1JIBA 3VGBA 4RE4A 2VRQA 4P7OA 3RJYA 1VBRA 1B3WA 5LYRA 1E0WA 1XRVA 4ZENA 1W9XA 3U5YA 2VL4A 5IXEA 5A8OA 5EB8A 3UEQA 3VIGA 5A8MA 1BVZA 2PI6A 2Q8XA 1GVYA 2YA1A 4PMRA 2Z1SA 1LL4A 1E4NA 3GXMA 1V02A 1HKMA 5E09A 1UZ4A 5M5DA 1RH9A 2G41A 2YL9A 1OCQA 1W9BM 1NOWA 4LXFA 3U5UA 3BAKA 2DEPA 3AIWA 3VIHA 3EMZA 5JBEA 4TX8A 2EEXA 3NDZA 3PZIA 3MV11 3WH5A 3VM5A 3PZMA 3WNPA 7CGTA 1LL6A 3UCQA 3VVGA 3UG4A 1CEOA 2CBJA 1UKOA 1QNPA 1V6WA 3AZRA 4DWSC 5E0CA 2OYLA 1BHGA 3RIKA 1W2VA 4UQEA 1KGUA 2YKKA 3VX0A 5A6JA 2J75A 4UQAA 4GI8A 1JI2A 4UQDA 1HNYA 1OWQA 2DDXA 1LQ0A 2J79A 3EYPA 1VEPA 3OIHA 3W24A 1UR8A 3ZSSA 2CHOA 3L4XA 5LA2A 4MDPA 1R7OA 2WC3A 5FCZA 4ZXOA 1R8LA 2XIBA 2E3ZA 1KCKA 1E6SM 1DWAM 4IPNB 3WUBA 1UKSA 5A2CA 4J3SA 1HVQA 4WKFA 1CXKA 5D4YA 4HP5A 3GXDA 1UWTA 3WQ4A 3L4TA 4CUCA 5CSYA 4F79A 2DSKA 3WL0A 2J7GA 3ARQA 4MNKA 4YHGA 5CXPA 1TVNA 1H5VA 5JIPA 5M17A 4KRTA 3W53A 4D6DA 1TVPA 4H41A 4ACZA 1DWIM 1B3ZA 1G94A 3SCOA 5C71A 5BWFA 3WQ6A 2B31A 4PMYA 3CH9A 4TX6A 1PZ2A 2ZX8A 1TZ7A 4W7UA 1VJZA 4AZIA 3SIMA 5I24A 2BHYA 4J28A 3AXHA 4AD0A 2XGBA 1GUVA 4CN6A 2WKLA 3LMYA 4HZ7A 1RPKA 4BQ2A 1UKQA 1GOKA 1I75A 1E55A 3DECA 2XM1A 2VZOA 5BROA 3WMCA 1DWFM 4HA1A 3NJ3A 1JNDA 3GNPA 3HJEA 5I79A 1J0IA 4CD5A 1BFNA 2O9OA 4B3KA 4JFWA 1XC6A 3W81A 3CZLA 2D24A 3ALGA 1GOMA 2WVVB 1E40A 2WW5A 2PBGA 2WAGA 4H7VA 2WZHA 5A3HA 3ZJ8A 2WCSA 1UHVA 3I3BA 5ABHA 5I2UA 4C7GA 3L2LA 1BAGA 3QR3A 3WDQA 3VU2A 5CPTA 4PMDA 3DHUA 4A3HA 4HZ8A 2A3HA 2WVTA 1UWIA 2CBUA 3WFLA 3VGEA 2BXYA 4GINA 4AD5A 4K68A 3WENA 5HPCA 2WNWA 4U33A 1VFFA 3WKZA 2WB5A 3VX1A 5D8WA 4CCCA 2V5DA 1JF6A 1UD5A 2ZWZA 3N15A 4J3UA 3EMQA 4Q7NA 3K1DA 3WH9A 1VRXA 5C8BB 5CPQA 5CLWA 2E0PA 3PZOA 4P7RA 4A4AA 1OB0A 4U3AA 5M03A 3AISA 5D8ZA 1V6YA 4YN5A 3TTYA 3OLEA 1DP0A 4CN4A 1UR0A 1WZAA 3EDFA 3VDCA 4M1RA 4IISA 4MB3A 4UQBA 2ZX5A 3GBDA 1GOIA 3VNYA 1PAMA 3ZIZA 4W8BA 1E6QM 1TA3A 5FOOA 5A2AA 4E4PA 5I78A 3T2OA 1CGUA 2VT0A 1EOMA 3AHZA 1XD1A 2ZE0A 3GH4A 4OKDA 2CKRA 1US2A 4UQCA 1JXKA 3AIEA 1W3JA 1I1XA 2W61A 3AXIA 2Z1KA 1QHPA 2HISA 4GO8A 1UZ1A 1UWQA 1MVYA 1XV8A 1KXTA 3GM8A 3WUEA 4D6IA 5IFPA 1QOXA 5LA0A 3VMOA 1UWSA 4TVDA 3UR7A 2PWEA 1FH8A 3CZGA 3WBEA 3T09A 1C91A 4UZUA 3J7HA 4AZ7A 3L4UA 1MQRA 4LYQA 3AHYA 3MSDA 1UKPA 2YL5A 3A4XA 2O92A 5FKYA 1W9UA 1O6IA 5A69A 3ZOAA 2WC7A 2JEQA 4AIEA 4JFSA 3SCSA 1CNVA 4H8HA 1QI5A 1BYDA 3K4AA 1UH4A 1JD9A 2ZUTA 3VNZA 3BMWA 3WH8A 4H8VA 1J11A 4J27A 1W32A 3LPFA 2EPLX 2WMHA 3WSUA 4PMOA 1JI1A 4GZEA 4M56A 1SMDA 1NOUA 1QI4A 3ARUA 2CCRA 1K9DA 2W66A 2DT1A 2WMJA 3AIBA 1VIWA 1BF2A 8CGTA 3SCRA 4DUVA 2ZICA 4D1JA 4PBGA 1F4AA 2XVLA 2J62A 1KR1A 5JBFA 3N1AA 4ATDA 2XTKA 1LLOA 4BZYA 1MW3A 3N17A 3SCUA 1AVAA 2WMGA 4E2OA 2ESCA 1DEDA 5DMYA 2GJXB 1JYVA 1VFMA 2IXVA 1PPIA 2VOTA 2W63A 1VFUA 2X1IA 1N82A 2VZUA 1C92A 4ZFMA 1XYFA 3CZJA 2EPOA 5CSUA 2XUCA 4B3LA 4PMXA 3ZJKA 1QNSA 4MB5A 2TAAA 1JDCA 4NSBA 1V0KA 4UQ9A 4GIAA 4ZE5A 4HA3A 1CLXA 3CHEA 2YOCA 3AFBA 2E8YA 4OBRA 3VD3A 4F66A 3AOFA 4F9JA 2NT1A 1PIFA 2J8GA 3MU7A 2C0HA 3WDIA 3G6LA 3WFZA 1ECEA 5DO8A 2WSPA 2A3EA 4Y7EA 3CIVA 2WHJA 3RPMA 4CD8A 2DT3A 1VF8A 2ZWYA 1FP9A 2DGAA 5D9PA 3VIFA 3BSGA 3TTOA 3WELA 4CD7A 1Q6GA 4E8DA 3LPGA 2VR4A 1OD8A 3W4RA 2E8ZA 1E73M 2OLHA 1RP9A 2WVVA 1HKKA 4KWUA 1DHKA 1IV8A 1UA3A 3FNDA 1GHRA 1XSJA 3AMDA 5A6MA 1KR0A 2WHMA 1E1EA 2D0GA 1ISYA 2J25A 2W5FA 1JYWA 1K9EA 2WC4A 1QW8A 3ZSTA 3VILA 1EIBA 1UG6A 5TD4A 1E0VA 3N04A 4ATLA 4P8UA 3PZNA 1AQ0A 4B15A 4LGXA 1KGWA 4DWSB 1ISZA 1OM0A 6CGTA 3BAYA 2DSVA 3WQ5A 1PJ9A 1KQYA 1ITCA 1UR2A 2GVYA 4LYPA 4PEEA 4RE3A 3W38A 3AHTA 4WSKA 4A3YA 3QOMA 4EE9A 4E8CA 1KFWA 7A3HA 4NI3A 2EJ1A 3G6MA 4ACYA 2J74A 1C8XA 2XFRA 3BCFA 3NDYA 1QBAA 1IZKA 1CXLA 2VCBA 2WMKA 1WZKA 3QHOA 4FMVA 2BY0A 2FH6A 3D5HA 3WH7A 1PEZA 4U2ZA 5I3DA 4Z2KA 4JHOA 1BYBA 2ZUMA 1V6XA 3OLDA 3DYPA 1HP4A 3WEOA 3II1A 4HOZA 1G5AA 3VIMA 2DSWA 1DWGM 2BS9A 4GI9A 4P7NA 1WAWA 1JZ3A 3QHMA 1HX0A 1UD8A 3AXXA 4U31A 4PCTA 5BXRA 1JGIA 4IPLA 1DWHM 4HU0A 2FHBA 1J0HA 2PBOA 1D7FA 3GNOA 1UYQA 2WHKA 3AS1A 4IM4A 4LYRA 1KBKA 3T0DA 3VPLA 3GNRA 1XGZA 2V3GA 4AZ6A 3UR8A 1FHLA 4QAWA 7TAAA 1E70M 4TXEA 4AYSA 3KL5A 1CIUA 2JIWA 2XVNA 2PF0A 3KZSA 1VEOA 2V5CA 2E40A 1HJQA 4CVWA 4L4OA 3WEMA 3A3HA 5GNZA 3W27A 4HPGA 4FLRA 1MQQA 3W82A 4PUDA 1NWSA 2ZX6A 2WWCA 4AZ5A 3OLIA 3BAIA 5A6BD 1JAKA 3AYSA 4X9YA 1QBBA 2A3CA 2OWCA 3I3DA 4JFVA 2BFGA 4AMCA 2XFFA 3OZOA 2QV4A 4YHEA 1E5NA 2VNCA 3ARTA 3CZEA 4JZ5A 4MPKA 2EXOA 3RO8A 3SCNA 3VOCA 5IHRA 1FFQA 3M46A 2YA0A 3SUSA 1RD6A 3CBWA 4UTFA 1JDAA 2HVMA 4D6CA 3VIJA 3GYCA 4L4PA 5M3WA 3ARPA 3TA9A 2WSKA 4TVUA 1G1YA 1CDGA 1KGXA 3ZMRA 1EQCA 3GH5A 1WE5A 1WDRA 4U3CA 2YDSA 4PUEA 3AHXA 5DFAA 2GDUA 4AD1A 2XVKA 5IFTA 2JE8A 3CHCA 4HOWA 1GOQA 5ABEA 3AHVA 4OJYA 1NP2A 3VINA 5E70A 3CMGA 2GDVA 4PN2A 2QPSA 2FDMA 5AYIA 4JKMA 3WUGA 2WMFA 4PYSA 4LPCA 4W8AA 4ATWA 1MYRA 4GO9A 3PN8A 2BV9A 3ZJ6A 3CUIA 4AEEA 1U30A 3BH4A 3PZGA 3VGGA 1W3HA 1HKJA 5BRQA 1OGSA 2VVNA 1XCWA 1WZLA 4U5IA 2VTFA 3W0KA 4AWEA 3FHAA 4FLOA 1OSEA 1Q4NX 3QHNA 4BA0A 3MUY1 2D0HA 3M7SA 6A3HA 1H1NA 5A1AA 1VENA 4XZWA 2BHZA 2AOSA 3ZO9A 1MFUA 3AROA 4CU6A 3PTKA 1CGVA 4MAZA 2OYKA 5JUVA 1H2JA 3THDA 2X8RA 3WIJA 1W91A 4MAVA 2JFEX 3CUJA 1CLVA 1K6AA 1SFSA 5BXPA 4JFTA 3O6AA 1E3ZA 1NP0A 3HN3A 3IAQA 2CNCA 1HKIA 5EFDA 4EKJA 4TOQA 1EHAA 4MNMA 5ABFB 1M53A 1E1FA 4W85A 1GQLA 2WZIA 3GH7A 5I0DA 4JFUA 1HF6A 1VBUA 3PBGA 3WNMA 4P8XA 5D9OA 3D3AA 3LPOA 4M24A 2FH8A 2WVUA 3WNLA 1E6PA 1JZ2A 4B9ZA 4DWSA 1TMQA 1EXPA 1TE1A 1SMAA 1NWTA 4HMEA 2XYLA 3VMPA 5JIWA 1F4HA 3UG5A 2BY3A 2W91A 1QNQA 3CO4A 4GKLA 4QP0A 3ZT5A 5E6YA 1ZJAA
chains in the Genus database with same CATH superfamily
3NQBA 4M6PA 2V68A 4NRSA 1PX4A 3IJ6A 4XB3A 3O05A 5A8QA 2J6VA 3ANUA 2PB1A 1IZJA 2FVLA 2AMXA 1DKWA 4TV5A 2YW3A 1WZMA 2UWFA 4UFKA 1D7KA 3SIZA 3IJDA 3NUKA 1SVDA 1F7BA 3VGDA 1ONWA 3HQ1A 1VAHA 1XISA 3M7WA 3T42A 3UWYA 3QV6A 3TJLA 1AQMA 2BVTA 2QHAA 4MZ1A 4NQ1A 1GEHA 2VFFA 2V5JA 3DH7A 1R7AA 3VDHA 3EDKA 3VI2A 4MY9A 2IQDA 3AAMA 1EDGA 4JIHA 4IP7A 1G01A 4Z08A 4ROPA 2OOFA 3BCDA 1PSCA 1TB3A 4ZQCA 3WDHA 1NDZA 3M9YA 2C19A 3H8AA 1O4UA 1W3LA 4BR1A 2YCJA 3AWOA 3GXNA 4Z1BA 4N6EA 4HCHA 1W8GA 3IJIA 5LNUA 3QMTA 2QDGA 5GQBA 1CXEA 1RY0A 2QMKA 2FZ9A 4IGSA 4IPPA 2G50A 1QOQA 4DO5A 5BRPA 3EBVA 3CQIA 2ZZ2A 5AC8A 1UMYA 4CKQA 1KV5A 2PE4A 1FWAC 3W2LA 3K46A 1XDLA 1WKEA 2Z2AA 2J7BA 1I45A 4IP5A 4D6JA 2CZFA 4MMWA 1ZJBA 5LIUX 2J77A 2XVGA 4FNQA 2OEMA 3SUUA 4KRUA 3IVSA 3EDEA 3G0XA 2YIHA 1FHDA 1TFVA 4GYPA 5FJTA 1SO6A 4EAYA 3UXLA 1RALA 4RV8A 4V27A 1F8IA 1U5JA 1PX8A 1BXNA 3OLGA 4WJ8A 5DMNA 3G1SA 3RMEA 1GHSA 1DTUA 3UCDA 3GHTA 3VGHA 2BHUA 2XJ7A 3EKZA 3BK0A 4DZHA 2GFTA 2WQPA 4HHLA 2CYGA 4Z0JA 2DH2A 2WZEA 4EX4A 3CLWA 1XCFA 1P7TA 3BZGA 4ZOAA 4EIVA 1KB3A 2OR2A 2BNJA 1GPWA 2YGYA 4K2SA 3R0DA 3M41A 1M7JA 4TTGA 2OX4A 4MVAA 3NURA 4ZCWA 1XG3A 1VPQA 3K4DA 4FK9A 1RXOB 2DSZA 4CCEA 2H8ZA 3ZQ9A 1E56A 1E6ZA 2IPJA 5BZAA 2CLFA 1WDPA 3M0MA 3PHAA 3CQJA 3D3FA 3EPMA 1EFZA 2NSXA 4O16A 2RH9A 5HOSA 2YLLA 1QDSA 3PS7A 3OHIA 5ABFA 1ENUA 3N4FA 2F2HA 2ZRVA 1FBAA 2HCVA 2VEMA 5CAHA 2VDHA 3B8DA 1XBYA 1H5YA 1ITXA 3NFUA 4PSPA 2DQXA 1BTMA 5I3JA 3M07A 4ZQNA 1YX1A 3H70A 1MW2A 4BQ3A 5D2XA 2HXUA 3ALFA 1OIFA 3UY8A 2NX9A 3W1TA 1SZFA 4XKYB 4FOJA 1VJSA 4H9XA 1H51A 1CGWA 2MANA 3F2DA 1W1ZA 2Z00A 3U4FA 2IQTA 4MNLA 4ADTA 2G5WA 2VOMA 5CGTA 3QOKA 3UR2A 4RLIA 4R7OA 1JZ7A 4O54A 4PMUA 4J3WA 4IIBA 3KTCA 4Q8UA 1VP5A 3ONCA 3W23A 2ZX9A 3W1XA 4Q6JA 3VGFA 5CQ1A 4CGTA 2P1FA 3PJXA 1R3TA 3LBCA 1FCQA 2MUCA 1AJ0A 3O7UA 3NGJA 4YVPA 2FPTA 1OIMA 3EXSA 2VRKA 4F4RA 3N9SA 1HJUA 3BLKA 3OBAA 4RL3A 1JL8A 3ZS4A 3N12A 1V51A 1NFGA 3TH6A 4PMJA 3NM1A 3MY9A 3RCNA 3E1F1 1A47A 2G0WA 1FQ0A 4D1IA 1WB0A 1ZAJA 4GI6A 4W8LA 3R94A 5K2ZA 4UTLA 1ZCCA 1RD5A 4AW7A 4PCSA 3KHDA 3VD4A 3OB8A 4QIUA 4KMQA 3L66A 4DM2A 3KVJA 3A13A 3EB2A 1EYEA 5HMDA 1GONA 3KRZA 2NV2A 5MKGB 1WKDA 4CVUA 4V15A 4EWND 3STGA 5AYZA 1CZ1A 1CBGA 4GC4A 4KEMA 3ES8A 4D72A 3W26A 3POCA 3MPGA 3S1VA 5C70A 2ZXAA 3C0JA 2RUSA 6REQA 3VIKA 4GGHA 1ZZMA 1EUNA 3ITXA 3INPA 2DIEA 3SUWA 2A7PA 4Q33A 1CXIA 2D3LA 1TPC1 3SAZA 3LHUA 4UXDA 4PTMA 1XDMA 1NWRA 2PGEA 2YXOA 3VD9A 1KXVA 3ZJ7A 2QLYA 3AS3A 3AJ7A 3TR9A 3ZR5A 5BRBA 4J9JA 3GO2A 1Q6DA 3WLHA 1BRLB 2GJXA 5HJLA 1A50A 4LUYA 4HNNA 2CBVA 3PUOA 4QBXA 3GG7A 1BD0A 2ALDA 2XPKA 2A3BA 1QPKA 2C1IA 2D2JA 3H2FA 3HO8A 1Y5XA 1HZYA 2VC9A 3BICA 4QJ3B 2Z27A 1VFHA 3N2CA 5AC4A 1IT8A 2NWSA 4PRWA 3MW7A 3LCLA 5LKYA 3T0CA 4Y9OA 1ZCOA 4WDTA 5HINA 1GOOA 1MEWA 2WHLA 2P0OA 2R8WA 4PUJA 5AYYA 4WD0A 4AFYA 4I7WA 3FDGA 4GQGA 4QLJA 1EWEA 1MRQA 1XPYA 5DCBA 1O94A 4QCFA 3E5BA 4HNTA 4DUXA 1UD2A 3SURA 5K7JA 2YXXA 4OZOA 2J8FA 4M80A 4FR6A 4QCEA 1G4TA 1UR3M 3R4IA 5BCAA 4U10A 4WOQA 1AZ1A 1GJUA 2ZQ0A 2VRJA 4U5KA 3TX9A 1G0CA 1XKYA 3C0QA 3BGGA 4DO4A 1EP1A 2CC0A 2RDTA 2V3DA 4KWVA 4R33A 4QXIA 4DM1A 2HNEA 1OABA 1VB9A 2BSLA 2E6FA 2V69A 2ON3A 3KL3A 4JL2A 3KE0A 2ZRWA 3AYTA 3WK2A 2ZBTA 4KT2A 1IIHA 4EPKA 4NXKA 1DIEA 3GDBA 4QITA 3K4WA 4BS0A 4TUFA 3U8GA 1SM9A 2Q6ZA 4AEOA 1EH9A 4AZGA 3WD3A 4DJEC 1OADA 3HGSA 4I8YA 4GCAA 2Y8UA 4IGHA 4MY8A 1FUYA 2UZ9A 3N6JA 2XGIA 2E1DA 3I10A 5I3IA 1N8FA 1I2RA 3W7OA 2PAJA 1ONRA 1QI0A 2RGLA 1VEMA 2D22A 4GA8A 5DXYA 1DTNA 1ZFJA 1HP5A 1UCWA 5DBUA 3WYZA 3PBUA 1AL8A 3MWCA 3WNKA 4DF1A 2QVNA 3AALA 3DKJA 4ENLA 4RR4A 2HRWA 1GQKA 1ZY9A 3QFWA 4AD4A 1G67A 5D02A 2X1SA 4F40A 1OGGA 1JUEA 1GW9A 2FZDA 4MADA 3NL5A 3NVTA 3RM9A 4C6DA 1R2TA 3AU2A 4ZEPA 5LIXX 4RK8A 3CNYA 1YBQB 1XIGA 4ILSA 3W29A 4FIRA 2XIOA 2Y7EA 1TREA 1O95A 1R47A 2NQLA 3GU9A 4BHYA 5C54A 2XN0A 5MKGA 3OGVA 1UP2A 2PDJA 4PBEA 1XF0A 1XCXA 4GK8A 3MANA 5A6TC 4MDOA 1UIPA 3KBWA 3WJSA 2Y7DA 1G69A 1GQJA 3ORWA 1LT8A 2EPMX 3R10A 4IGMA 4HJFA 3UBPC 4AZHA 1VFTA 2JALA 1O1ZA 1NM9A 2O7QA 3MHUA 5DT5A 4LBRA 1UP3A 4DF0A 3UWQA 3SRKA 4N02A 1XH0A 3EX1A 4CCDA 4M7TA 4XZMX 3WF0A 1X1NA 1E71M 4HJWA 4HZMA 3C8NA 1XM3A 1QVBA 3MI2A 3S5YA 2ZRUA 4Q22A 1BRLA 3URNA 3TK7A 3OA5A 3PJUA 4GNKB 4MJZA 4UOZA 2W9MA 3GAKA 1E9LA 4GZIA 4UMCA 3QLLA 4HZ6A 5HUPA 2F6XA 3KCLA 1ONEA 5G1MA 4L9YA 1HJVA 4W4QA 2D23A 5A5WA 1S2CA 3QPEA 2YCKX 3AMGA 4B16A 3B8SA 2G97A 1FX6A 3DFPA 1PS9A 5F7UA 4IGNA 3KVMA 3MO4A 1TQJA 3SEPA 2VD8A 4KERA 2IPGA 1KD0A 2A5HA 3OW1A 5CZKA 4HNUA 4YCPA 3QPYA 5DRIA 3T2QA 1TPWA 3SSJA 1MQPA 4DI9A 4KKXA 2AL2A 3PTDA 2G95A 1M03A 1O12A 5D9MA 1RJQA 1FFRA 1ICSA 1R9ZA 4NY2A 2NSOA 2R1LA 1R2SA 1XIJA 5I3KA 2OYMA 3M5XA 1R86A 3AIQA 1FWFC 2YZ5A 5K9CA 1E6XM 2WZMA 4JYEA 3MBFA 3CL6A 4A35A 3GVWA 1W0MA 1K4HA 1GVEA 3EB3A 1YRRA 1OG6A 2YXGA 1KV8A 4OOUA 2AQWA 2X42A 2X7WA 4L1GA 3QMSA 3W88A 1VLWA 1BVNP 2R91A 1NU5A 1Q8JA 4F0LA 4HIBA 4HKPA 1RJRA 4K36A 1NFBA 1MFVA 1RP8A 3G0UA 4O0ZA 2ZXQA 3UVIA 2GGGA 1CWYA 3UA4A 3ELFA 2ZFAA 3USZA 2DT2A 4V1YA 5A94A 3GZAA 4W89A 3W7KA 4B5XA 4KWWA 3QKZA 1OFPA 4GUIA 3RITA 1YADA 3MUAA 3RR1A 3A3XA 3IIVA 3W7NA 1QNOA 3Q67A 2QS8A 2VURA 4WXYA 2XZ9A 1B0IA 3HMJG 2QMJA 2O4MA 4PMQA 4GBUA 2J78A 1XSIA 3MO7A 2O9RA 2OZ0A 2DSUA 1GNXA 1B90A 4H04A 4S23A 4UFJA 2PWDA 3FFSA 4N9DA 5I23A 2BASA 2F2KA 5LA1A 2EG8A 3FV9A 3M5ZA 4M82A 2OT0A 4WDXA 1FWEC 2XSBA 4JS3A 5AC5A 2PFHA 4WIWA 3G0SA 4WY0B 1G7UA 2Y24A 4C6NA 2G37A 1XBZA 2B7PA 2I5QA 3T4CA 4HGXA 1WYIA 2C0AA 1MZHA 1X97A 3E12A 2XWEA 1JIBA 3NL6A 3BW3A 5LYRA 3S1GA 4H19A 2NQ9A 1E0WA 4XISA 1RR2A 2VC6A 3ATYA 1WDDA 3FXGA 1PV8A 5EA9A 5IXEA 3V36A 3QTGA 4FXFA 2DY3A 4RZ6A 4WHBA 3KBVA 4EXQA 3NDOA 5E09A 1BEUA 1UMLA 1UZ4A 2OEKA 1SW0A 4GOAA 2DEPA 1F73A 4LUTB 4B92A 3PG9A 1QPRA 3NDZA 5LHEA 3DG6A 4LVFA 4Q8TA 3WNPA 1F2JA 2YCLA 2HZGA 1GVRA 1OZQA 3UG4A 3LERA 1W17A 4YWSA 2CBJA 4DWSC 3BG5A 4GI4A 1W2VA 4UQEA 3SN4A 3VX0A 2QUTA 3V3WA 3B0UX 4JXCA 1ZP3A 1LQ0A 4UR8A 3P0XA 1S5MA 3W24A 4L61A 3ZSSA 2ACRA 5LA2A 1R7OA 2WC3A 4MSSA 3HM7A 1I8JA 4K3ZA 3IPWA 2QUUA 1OJXA 1CXKA 3LMZA 1XLHA 3KRSA 3FGCB 3PJTA 4CUCA 3ZFHA 3B8VA 2J7GA 1ICQA 3W02A 3F2CA 3P8IA 5E0KA 5IRPA 5CXPA 1ITQA 4I5UA 2R9RA 4KRTA 2RDUA 3ZLFA 4AY8A 1G94A 2DORA 2DZXA 4KCTA 2DUXA 2B31A 2QPXA 2FB2A 4R85A 3WFAA 2ZX8A 1SO3A 4US6A 4AZIA 3SIMA 5I24A 3CWNA 1OC6A 1DJHA 3B40A 1LORA 3NYZA 3QSTA 2J13A 1E55A 5BROA 2VZOA 3CB3A 3RUBL 5D38A 7REQB 2VM8A 3P5ZA 4CD5A 2VENA 3UPBA 4JFWA 4XIAA 4US5A 4C91A 1Q7MA 3CZLA 4FNUA 3TROA 1WOBA 1E40A 1ZGDA 3NPXA 2PODA 2GVEA 4H7VA 4CEUC 2WCSA 3BJFA 3I3BA 3L2LA 3QR3A 4NAEB 3RN6A 4RPQA 4HSHA 3LD5A 2PPGA 1US0A 1QPOA 2BXYA 2OEJA 4L4MA 5GJPA 4K68A 5HPCA 1VFFA 1UWAA 4ICCX 3VX1A 3DDMA 3H12A 2OFJA 4J3UA 1XRSA 4QS5A 3K1DA 3WH9A 2WV8A 5CPQA 2YB4A 1OB0A 5M03A 3AISA 4CNUA 5KZMA 1K7FA 1V6YA 2JKAA 1Q6QA 3OLEA 2QCCA 3ANYA 1JDFA 3EDFA 3DG3A 1X7FA 2W27A 4UQBA 3QQ0A 1WAUA 3FK4A 3E96A 2FZ8A 1TA3A 3NQCA 4O53A 2Y61A 3Q37A 3TNBA 5I78A 1EJSC 1CGUA 4WQ6A 2EF9A 1F07A 1FDYA 3WBWA 3W2JA 2DZWA 2W79A 2CKRA 4UQCA 4B2DD 5TAOA 3T6CA 1R3RA 3AXIA 1HGYA 3NQFA 1XLIA 1MVYA 1XV8A 1L6SA 1KXTA 1RCOB 3GM8A 4K38A 1WXZA 4D6IA 5LGXA 2Z29A 1TIMA 1XIHA 4IIFA 2POTA 3VMOA 3NL2A 1UWSA 4M5PA 2FVKA 3AO0A 3N73A 2OVLA 1TPUA 3T09A 1SSDA 1LQ2A 4AHOA 3L4UA 2QT3A 1OQFA 2HPIA 3EOLA 2F6KA 3CO8A 3EOSA 1I2QA 3M5VA 3A4XA 4GGBA 1TPDA 3BLOA 3ZOAA 4ML9A 5H8UA 2JEQA 4AIEA 3E3HA 3QZEA 3D46A 1XLGA 4JX5A 4R3UA 2DZBA 1XRTA 4LUTA 2W3ZA 1BYDA 4X2PA 2QZRA 1BVWA 1UH4A 1JD9A 3VNZA 4GJJA 3URQA 2V9DA 1XLDA 1A5OC 5JH1A 1ADOA 1J11A 4J27A 2NVCA 1R3SA 2ZTJA 2WMHA 3SBFA 3S46A 3P8JA 4GZEA 3T4WA 1IXOA 4JD4A 5C9RA 3ARUA 3O16A 4Q7IA 3TOYA 3SY1A 1ZNNA 3V35A 3SCRA 3EWYA 5C0QA 2XVLA 2XTKA 4NXSA 2G4JA 3N17A 3SCUA 4ICNA 1TJ2A 3OEXA 2ESCA 3PR2A 1DEDA 2YX0A 2PDWA 1A5MC 4JX4A 1VFMA 2DFAA 3Q2DA 4QNEA 1VFUA 4RNJA 3FGCA 4FIQA 4XAPA 1N82A 1C92A 1SZGA 5G5IA 3ZJKA 3PPCA 4Z42C 2TAAA 4NP7A 5HNRA 1V0KA 1YPXA 4LC6A 1GKQA 4GIAA 1XFBA 5DY3A 1A3WA 5HATA 4OBRA 3VD3A 1OCNA 1SZEA 1HKWA 3AOFA 1PIFA 4REQB 4XK2A 4J5NA 5AHIA 3S6OA 5DO8A 5CC5A 4E4UA 1HFBA 1XLEA 2VEFA 4IUOA 2O55A 2DGAA 3C52A 4K7YA 2GJLA 5FJRA 3S8HA 3A5VA 7REQA 4RW5A 3OVQA 3BSMA 3PFMA 2VR4A 4ECLA 4NNBA 1HKKA 2QIIA 3K1GA 5DMMA 2PTYA 4K8GA 4RPPA 1UA3A 3FNDA 4DZIA 3F4CA 5A6MA 1K9EA 3KAOA 1FWDC 3S5SA 3JS3A 1EIBA 4NAEA 4AX6A 1W56A 5TD4A 1E0VA 5LHFA 4ATLA 4HVXA 4WR3A 3WJWA 2DZSA 1W3TA 5BOOA 1AD4A 3BAYA 2DSVA 3GYEA 1IWBA 2DIKA 3WQ5A 1QK2A 1RJPA 4RDYA 4H9VA 3DFTA 3UZXA 1UR2A 2GVYA 4HSNA 4LYPA 4YWIA 3AHTA 1W5QA 4NI3A 7PTDA 5G2IA 3NDYA 4IIHA 1QBAA 3CQ0A 1CXLA 2BY0A 3D5HA 3KBMA 4U2ZA 1NDVA 5I3DA 4NJIA 4PCNA 3LV6A 1D8CA 4DF2A 4HOZA 3VIMA 3HPZA 2YZRA 5FI8A 4MUPA 3W87A 1M7OA 3TYZA 3AXXA 4U31A 2IKGA 2X30A 3KM8A 3L5MA 4S39A 2HSAA 5D04C 3NQ6A 1D7FA 4GIEA 2WHKA 4CNOA 3AS1A 3O6YX 1XR2A 4LYRA 4MUZA 5BW6A 1KBKA 3T0DA 4QGCA 1XGZA 2V3GA 2OODA 3LI1A 1E70M 3HG5A 4TXEA 4IIEA 3K2GA 2PF0A 3KZSA 1VEOA 3BV7A 2E40A 4NUWA 1DL3A 4M6UA 3UR5A 3WEMA 4TR9A 3MVIA 4FLRA 4NVTA 3GTHA 1MQQA 3N4AA 3NQVA 4JX6A 4AZ5A 3GW3A 4DJFD 1Q6RA 4NL1A 2XFFA 2JKPA 4XO7A 4A2SA 4LVGA 1IEXA 2VNCA 3MI3A 4M3PA 3S9IA 2DZUA 3GU1A 2GGIA 5C2XA 3SCNA 2BWGA 3VOCA 2VELA 1VFSA 4UTFA 3GKAA 3FYOA 3GU2A 5M3WA 4IMCA 4A8RA 1YIXA 2WSKA 1DJZA 4Q4QA 2Y89A 3UJRA 1KGXA 1ZALA 4QEHA 5K4XA 2ODOA 1WE5A 4GFSA 4U3CA 2IQ0A 2GDUA 4AD1A 5IFTA 3UG8A 1AK5A 5ABEA 2BOGX 4GYJA 4M1BA 4NJHA 4C60A 4R88A 2GDVA 5CPOA 4IL0A 3BQ5A 4H9MA 1V4YA 3D6NA 2WSYA 4JKMA 3WUGA 3E0VA 1MYRA 1O60A 1EJRC 1GJPA 4N4PA 2GUBA 3U4AA 3FHAA 2A79A 2IPFA 4BA0A 5BU6A 4DI8A 3TLQA 3Q94A 3MJYA 1QR7A 4G7FA 2BB0A 1VHCA 5A1AA 3DENA 4XZWA 3T0TA 3ZO9A 4CU6A 2PRLA 3KS6A 4FALA 2OYKA 3H2MA 3HGOA 2BG5A 1RHCA 1EJ7L 3WIJA 2IW0A 4QJ1A 4MAVA 2V5KA 1DIOA 3GHSA 4GVGA 3O6AA 4BJHA 3PUEA 1NP0A 1X7IA 3EKGA 3MHFA 2XU2A 3EWDA 3GKFA 3RR4A 1AW5A 4R7WA 4W85A 3TXZA 5I0DA 2QUMA 3C2YA 1VBUA 4FXSA 3WNMA 5D9OA 4AB4A 3LPOA 5FSEC 1M1BA 2FH8A 1A5CA 1E6PA 4X2RA 4B9ZA 1TMQA 2ZRZA 5HR6A 1NWTA 3MJMA 4LEQA 2XYLA 3VMPA 4H9UA 4I5XA 3HQPA 1L2UA 4G56A 3U2OA 2YCEA 1JPKA 3VAVA 1F4HA 4ZO7A 3APYA 3UG5A 3SRFA 4QP0A 1TRDA 3KRUA 3USBA 5E6YA 3IVUA 3GIQA 3CQHA 2DW7A 3F5KA 3IGXA 4BQ4A 2I9UA 1EBGA 4XWUA 4O15A 3AXKA 3VKKA 2X2YA 4ZBCA 1LUCB 4C65A 4MJ2A 2J6XA 1GQIA 1UWRA 3FJ6A 2OLAA 3GHUA 1CX9A 1MMFA 3M0YA 1ZU8A 4DZ5A 2PWVA 3S2JA 5KMYA 2I57A 1OYAA 4LUIA 3H2OA 3U3HA 1TR1A 1NOFA 3CV6A 1JCXA 1H62A 1A80A 1CB2A 4L6OA 1DJGA 3GTNA 2FJKA 1JFXA 5F1VA 1VHNA 2VUYA 5EMJA 5FEZA 4WY0F 4QLKA 2ZVIA 2ACQA 3VZYA 2WPGA 3TYUA 1PKLA 4Q8MA 5CG7A 2J9ZA 2ZZ3A 3VOHA 1UP0A 1PZ0A 3U57A 5I00A 4KF1A 1L6GA 3SO7A 3QEZA 4UCFA 3UWWA 4F9DA 3HG4A 1BG4A 1UR1A 1OFDA 3LCFA 1Z42A 2YBVA 2GSJA 3LHWA 1HL2A 4HPJA 3FYPA 1J79A 3F4VA 3VOFA 4TIMA 1EJTC 1P5BA 4JR5A 3IJQA 3OZYA 3TOPA 3QZAA 3U7VA 4YIWA 3R8HA 3PZQA 5E9AA 2FTYA 4LS1A 4MG4A 1SJBA 3TUUA 4XZIA 2RGMA 1W31A 4IIDA 3VMNA 2CIPA 1J18A 4GX9A 2Y6ZA 3B9AA 3M1ZA 5KINA 4Z2HA 2VX7A 1JPIA 1A5SA 3U6WA 1HL8A 2YSWA 3OYXA 4CCZA 1H4PA 3IRDA 1HXJA 1SU5A 2VX6A 3JRKA 5H1WA 2OO6A 2C6QA 1DJYA 2EO7A 2BGQA 4DO7A 4PBFA 1EJUC 3HPSA 3VFLA 2FJUB 4I7VA 4NX5A 4L64A 3SFKA 3ABQA 4YYFA 4QLLA 3GHRA 3MMWA 4GZ7A 2XG9A 4J2MA 2GSEA 4GCXA 2X41A 1W54A 4J3TA 3DFYA 1XUUA 1SZNA 4MJ4A 1V7AA 2BXZA 4QG8A 3TN6A 3R11A 2H8XA 4JEQA 4MM1A 4IL2A 5IHSA 1POJA 2EPNA 3L4WA 1LWJA 4LBUA 3EDDA 3VCCA 1H7RA 1UOKA 2CKSA 3GDTA 1K02A 3GVRA 2J9XA 4GVHA 4MWAE 1FH9A 4TU1A 1HVXA 1UD4A 3ZT6A 1CXFA 4M51A 3MVTA 3RLGA 3IUIA 5LSMA 4FPSA 2NQHA 3APTA 3L0KA 4Y6GA 1MXDA 3AYRA 1S2AA 1GZGA 1LP6A 3L12A 4XIMA 3D0CA 2ONEA 1GKPA 4IXXA 1IXPA 1IIGA 2PP3A 1JRBA 1M01A 1RQHA 3CV1A 4IMFA 3C6CA 5AC7A 5HK4A 3U2ZA 2PTWA 5HXMA 4JEJA 4JIEA 4PCPA 4LVDA 3RJXA 1FWWA 2PDFA 3TXVA 5JQ9A 5FL0A 2INZA 4UMAA 1E72M 3RHGA 3RU6A 3S2LA 2HPMA 3KDOA 3W1PA 3CUHA 4Q8OA 4ADSA 4Q8QA 4MZYA 3WQVA 1L0PA 1H7WA 4GMEA 1JRCA 2WM1A 3RILA 4RDWA 1U22A 3JVAA 4YL2A 1XSKA 1I2PA 1PBGA 2CITA 3LV5A 2OWWA 3C86A 4AXNA 3L0GA 2G3NA 3MZNA 1YNPA 4QRNA 2DV0A 2L5HA 2IXUA 4JOMA 1CPUA 1SW3A 1YDNA 3PP7A 4MWAB 2PLMA 1MUWA 3PNZA 1CT5A 4AAJA 3NTYA 3DYOA 3MS8A 1LUCA 3TWAA 1A0DA 1K9FA 3XISA 1AFSA 2INEA 1E4IA 5A2BA 1KM0A 2PDGA 2QUVA 3DGRA 2ZXDA 4IMDA 3FA4A 4WJXA 1LJYA 1H0IA 4V28A 4OTKA 1J0JA 3VZZA 1XIFA 1IQ8A 1K70A 5A6AA 3BG3A 3IV3A 2FVMA 1B3VA 1XS2A 4X63A 3R25A 1GVIA 4US5D 1H7NA 1AA1B 1V08A 2E67A 4WKAA 1XUZA 2ICSA 4ZODA 1F05A 5IDZA 1MDLA 4EP8C 1PHQA 1C90A 1AL7A 2BDQA 4PUUA 5CKSA 2MNRA 2PMQA 4Q4PA 1F3XA 4WGHA 1TTJA 4G2DA 4OUEA 1W1IE 2VQTA 4CQ9A 2XISA 2G4FA 2JF7A 3V0TA 2YYTA 4GIYA 1GYLA 3AC0A 3L2IA 3LRMA 1J2WA 3MSGA 2ZC8A 5TIMA 3DC0A 3U0HA 3WNNA 2NVDA 5EMYA 1HJSA 1V3KA 4NHVA 1WDWA 4GUGA 5HQEA 4JAWA 3DFHA 1JFHA 1Q5MA 4K39A 1HL9A 3M0VA 2WMIB 2FHCA 5CLTA 3UWVA 4EANA 4F0KA 1JG9A 5G4WA 4JY8A 3W75A 4Z1DA 5FD0A 3HQOA 4GYKA 1U1JA 4NNCA 3W6YA 3THCA 1EX5A 3F5LA 1UH2A 3NQ2A 4A3UA 4WRHA 3R7MA 4C1NB 6XIAA 2HEJA 1EQPA 1UASA 3GX9A 1B1YA 3L4YA 4YXGA 3LSCA 4HMNA 4RX0A 4M81A 2Z7KA 1CB7B 2DU2A 4W7VA 1H41A 1LCOA 3OGRA 2BY2A 4XKMA 4E38A 1PTDA 3SCWA 5IBXA 1EZWA 1PKMA 1V0MA 4ADUA 1RA0A 3TONA 3IJ9A 3PBVA 3DX5A 3CGTA 4BWLC 1BQGA 2Y88A 1VKFA 2YCIX 1DQWA 1Z32X 4LRTA 2HROA 2NUWA 4Z2JA 3RX4A 3CEUA 4DVOA 3R0KA 1WX0A 2ZC1A 3E02A 3RX2A 4W84A 1KM5A 1X8FA 3BMXA 4O4VA 3DFSA 3PVFA 4DHGA 3LY0A 4GWEA 2WK2A 3SZ8A 1P6CA 4FSAA 4PTNA 3ERPA 2JGQA 3IV8A 4X22A 5F4XA 4F0RA 2D2OA 3T9PA 5I06A 4IG2A 3GG1A 5U7SA 4XV0A 2X1RA 3OQEA 3Q4DA 4X60A 3P2VA 3IUHA 4PB3A 1CI1A 2NXGA 3I4KA 4UNIA 1Q6LA 3K8MA 2CLKA 4E2DA 3T0BA 1E6RA 4R9OA 1L2QA 1G4EA 1OD0A 3TYBA 1UWUA 2CHNA 2WANA 4W9TA 1JJKA 4IFKB 3WLOA 1FHVA 5EFFA 5EYWA 4ZFCA 3WZ0E 4JCMA 4RV3A 4XX6A 3N3MA 3V5FA 1D3HA 5PTDA 1Q2SA 5I5RA 4O10A 2RDWA 1H63A 1YQ2A 4XZLX 1Q65A 1KRBC 1V79A 4UTWC 2W67A 4MWAA 4EPDC 3DHFA 1TJPA 4Q32A 1GCYA 1J0ZA 1A3HA 4C6BA 1X38A 2OG9A 3KDNA 2OU4A 3G8EA 2A3AA 4UTTA 3REQA 4KESA 1EPVA 1LM1A 1OYCA 1NARA 1V02E 3WO8A 1B3YA 1KFJA 4LJ3A 2VXNA 1XRFA 3QW4B 3ZM8A 2HV5A 2HTMA 1B9ZA 3VC6A 5A6BA 4HMCA 3RRAA 4O52A 3OG2A 5T9BG 8XIMA 1D3GA 4GJ1A 3O6CA 3RM8A 4IFRA 4HNCA 3R12A 4GZJA 3LBOA 1WDQA 1VBHA 1W1VA 4OOZA 3C2FA 2Q8ZA 3Q45A 4LTSA 1LLZA 1VPXA 3EWCA 3S83A 3F4NA 2ANUA 4FXRA 3LG3A 1HT6A 1TPFA 3QGVA 1MW1A 1POKA 5FAGA 2ABAA 2PDCA 8A3HA 4FOKA 4MB4A 4Q4RA 1PIGA 3SGGA 1AQHA 4NX0A 3SCPA 4Z2LA 1KCXA 3D47A 5I6SA 3DFNA 1ZHAA 2OB3A 1O5XA 1MW0A 3F5JA 1JDDA 2XFYA 3N2TA 4DNMA 3P82A 2PWGA 2ZZ1A 2I56A 4XAGA 3MCOA 1NDWA 3L4ZA 2YL6A 4HOXA 5FL1A 4ZOCA 3P14A 1F76A 4IMEA 2J4GA 2UV8G 1XH1A 2WMIA 3POHA 4O1BA 2XGZA 3DI0A 1ECQA 2YR1A 2J47A 2V2DA 1HJWA 2XZ7A 9XIAA 1EGVA 2PLKA 1E6NA 4J3VA 2NV1A 3ZWSA 1W9DM 2VP8A 4UC5A 1X98A 2I7GA 5G4EA 2FMNA 2XIJA 3GC2A 1QT1A 1LYXA 1RVGA 1K3UA 4DJDD 4AH7A 2QXWA 4PR4A 2BX7A 1JUBA 4X0NA 3LQGA 2Y62A 4LUJA 4Q3MA 2E9LA 4S3DA 5D32A 3W1MA 5FEWA 3DUGA 3ARSA 3ARVA 4NI8A 3WQPA 2POZA 1P0DA 4RE0A 1JCJA 2WLYA 2JKEA 3A21A 3MUIA 2ZUNA 3W2NA 1EDTA 1XIBA 2NW0A 2E09A 3R5EA 4QG6A 3AUJA 1EO7A 3RCMA 2PP0A 1SJDA 3EA1A 1DOSA 1WQ5A 2Z2BA 2AMGA 3GDMA 2GDQA 2WLZA 4S38A 5DEZA 1QNRA 1TWSA 3L4VA 1XP3A 1EHNA 3HMCA 1H7OA 1ML1A 4AG0A 4LQ1A 5LNVA 3JUGA 1UJPA 4HK6A 3N9KA 1Q6OA 4KFNA 4NZCA 2YA2A 5FF7A 4GACA 1EZ2A 4IPJA 4IHCA 3LNMA 3CIXA 5A6SA 2VYOA 1V03A 2AQVA 1DJNA 3EX3A 3EWZA 3VIIA 1V0LA 4B9YA 1HIZA 1LT7A 4MTVA 4Y9MA 4PB5A 4AY1A 2NXIA 2R1NA 2HNHA 1A5KC 2D0FA 4AYGA 2HDJA 3B9OA 2FPYA 1RBLA 4IFKA 5H8MA 1X1ZA 3ARYA 2ATMA 1WBJA 1Z48A 1JZ5A 1GZ1A 2CZEA 1V3JA 5FJJA 2QCMA 3GXFA 2ISFA 1MXGA 1EXBA 1ESWA 1FWGC 1OK6A 4L6HA 2Y8VA 1SW7A 2WKJA 3KX6A 1UR9A 2PLJA 2HVOA 3DBPA 3IWPA 1P0NA 3PZTA 1R85A 1X96A 3NCOA 1M7PA 2XSXA 1H0GA 2CPUA 3H22A 3ZZ1A 3CQKA 1GT8A 4R27A 3TU9A 5CG0A 4A3RA 2OPJA 3NIYA 4DNHA 1A0CA 1V6VA 4NJGA 3IVTA 3DOPA 2VZSA 3PAOA 4B91A 1UOZA 5FIPA 4N0RA 1GYMA 4IZGA 3VC5A 1DWJM 1XQLA 4BI5A 1E4LA 3AZTA 5BNKA 1ADSA 2P0IA 2EPHA 4Q8NA 1RQBA 3W1RA 1GTEA 3DZ1A 2V3EA 2EG6A 4UTUA 1KKOA 3BAJA 3HQNA 5IBXC 3VDBA 2VCCA 1JYXA 1K8XA 2WO5A 3S47A 1E9YB 3CIWA 2ZRYA 3P93A 3PPHA 2NUXA 4V2XA 2FMOA 4HK7A 3U7BA 3BURA 2JF6A 4JN8A 1VLIA 2PTXA 4C7FA 1CGXA 3WD1A 4NILA 3W37A 4PFHA 2FFIA 2PDYA 4AZCA 1TUXA 4WCJA 1KWGA 3ZVHA 4DPPA 4ZTXA 3VGBA 3N14A 3VOIA 4P7OA 4C6QA 4GFIA 5AC6A 1B3WA 4XBKA 1KFCA 4NZJA 4EWJA 4JTSA 4PRTA 4L56A 3S0CA 4IIGA 1GEQA 3GNXA 3QPZA 3R0UA 3VIGA 4Y9PA 2ACUA 3HBLA 3UW6A 3U9IA 2Z1SA 3CMFA 3LQLA 4ES4A 4BEUA 1V02A 4CQBA 4IQJA 5M5DA 2AQOA 5H6HA 3DFQA 1QWGA 2G41A 2OXNA 4E4FA 2YL9A 1OCQA 1OFQA 3AIWA 3L5AA 4IQEA 3EMZA 5I7GA 1TWDA 5J04A 5FACA 5G2HA 9RUBA 3MV11 2UBPC 2QR6A 3OBEA 1PDYA 1F6YA 7CGTA 3PZMA 3VVGA 3R1ZA 3A4JA 2YDAA 4XQ6A 4GXMA 1UKOA 3AZRA 5EGRA 4DWDA 3S5OA 3IK4A 1KGUA 3F1QA 1XGDA 5A6JA 1EF2A 1RVKA 4UQAA 4UQDA 1VC4A 3QC3A 3ABOA 1DHPA 1TYGA 2EG7A 3OIHA 4F0HA 1PCKA 2CHOA 1RCQA 3GUGA 3L4XA 1XIMA 4MDPA 2CFFA 3BDKA 2CHRA 2RDXA 5LNRA 5FCZA 1OZMA 3JU2A 2XIBA 1KCKA 1QO2A 3LSBA 4I9AA 4IPNB 3PSWA 5HQMA 1UKSA 2OELA 1DBTA 4ZSUA 4L65A 4LAUA 3WQ4A 4B5SA 3C3NA 1OF8A 3WL0A 5ENLA 5CC7A 4IPIA 4MNKA 4YHGA 2VDIA 3L5LA 1TVNA 3QY8A 3FYYA 5JIPA 4H4IA 1YDOA 4H41A 2HK0A 4ACZA 1JGMA 3UNDA 2E6AA 1AW1A 2VC7A 4GIRA 5BWFA 4PMYA 3IGUA 1EGMA 1A5BA 4TX6A 1EYWA 1VJZA 1MEHA 1F9CA 3TAOA 2CLPA 4QX4A 1GUVA 4LUSB 4TMBA 4HZ7A 1XLAA 4HA0A 4O14A 3W7QA 1Y8BA 3DECA 3L21A 3WMCA 2Y5JA 1DWFM 4ZQPA 1JNDA 2VKZG 3GNPA 5I79A 1XJBA 1BFNA 4S3CA 4JTHA 3OVRA 3ALGA 4ZO6A 3WMLA 1Z41A 2OKTA 4M19A 2WZHA 1KM2A 3MCNA 1UHVA 5D33A 3FEMA 3STFA 3VUSA 5ABHA 1BAGA 2YPIA 2CLHA 3MYPA 3WDQA 3FVMA 2XN2A 4OECA 2IKJA 1H1YA 3DHUA 1SUXA 1KBIA 2CBUA 8XIAA 3WFLA 3VGEA 7XIMA 3KTSA 4CNNA 3WENA 2PS2A 3H2CA 2GQ8A 2CW6A 1ZP4A 2R1PA 4RXFA 5D8WA 2V5DA 3V7PA 1JF6A 1UD5A 3N15A 3B0VC 1R9YA 2PDPA 3MSRA 5ABTA 3PZOA 4ZO9A 4PZVA 1AMKA 1FWIC 3LK6A 5D8ZA 2ZRXA 3TMLA 3T55A 3TTYA 2Q8LA 4CN4A 3N19B 1UR0A 1KBJA 5AVNA 3VDCA 2HE8A 2NWRA 4GQ0A 3GBDA 3ZR4A 1GOIA 5DANA 5DQPA 2YW4A 3HJZA 1ADDA 3H24A 1EOMA 1NF0A 4ASTA 4F2UA 1FWCC 1XD1A 2HWGA 1VCFA 3A9BA 1US2A 3UJSA 3AIEA 4YYCA 1WUFA 4LAMA 4AF0A 3CAWA 4XVEA 3JZEA 4GO8A 1NY1A 1UZ1A 1TPB1 2P8CA 2VEPA 1UWQA 4FZIA 1IYXA 4XVDA 3WUEA 3FOKA 1P0BA 3SJ3A 1QOXA 2C79A 3WBEA 1FH8A 1S3HA 1EB3A 4UZUA 3QY6A 5LNSA 3MA8A 4AZ7A 3TCSA 4E5TA 3P61A 4KCWA 1MQRA 3OG3A 3E9AA 2ISSA 2FZBA 3TNOA 1P43A 3VOJA 4Q8PA 5A69A 4DBUA 2WC7A 4ZMGA 1XLCA 4JFSA 2BLEA 5RUBA 2VGIA 2LLEA 3PANA 3MZ2A 5LZLA 3E5PA 2ZUTA 4DJEA 4CQ8A 4H8VA 3PPFA 4CQAA 6REQB 5EBUA 3LPFA 2D69A 3NZ1A 4A22A 4PMOA 1TMLA 5DMLA 1KRAC 5I3GA 3UZWA 4JIRA 1K9DA 3AIBA 3W86A 4L1XA 2EJAA 1W5PA 3BLDA 2ZICA 4D1JA 4PBGA 1NVMA 3CV7A 5JBFA 4DY1A 1K7XA 1MW3A 2HMCA 1E9IA 1AVAA 1YE6A 3Q58A 4ZO8A 4K1WA 2GJXB 3FX4A 2W63A 3E2RA 4HK5A 2X1IA 1H1ZA 3FKKA 1T5AA 3QBUA 2XUCA 5FJUA 1X8CA 2VGGA 4B3LA 5HMEA 1QNSA 3I6TA 1C8VA 4MB5A 3GR4A 3TLLA 4KWSA 1JDCA 2NLYA 4Z1AA 3I7RA 3CHEA 2YOCA 3M4HA 4XAZA 4MLRA 1G6CA 3N4EA 4Z17A 3MU7A 5FJPA 3URBA 3G1XA 3GC5A 1OCBA 3P0WA 3EOOA 2Q09A 3MUCA 2Z1WA 5AHFA 4DYKA 4Y7EA 1FCUA 2WHJA 3OOQA 1MDRA 4LUSA 4FS9A 2BODX 3H2EA 3RO6A 1FP9A 3LX9A 2ZZ7A 2PDXA 3P81A 1KFEA 4DELA 3TTOA 4CD7A 1S5WA 6XIMA 4E8DA 3LPGA 2I1OA 3TAKA 1OD8A 2DP3A 1TWZA 4Q8VA 3C3UA 3FA3A 4DEFA 4QISA 4PGLA 5LIYX 4G9PA 5MF5A 4KWUA 6ENLA 5F4SA 1IV8A 1ME9A 2C91A 4QE5A 3SR7A 1E1EA 1ISYA 3H7UA 1QW8A 4JTUA 1YNQA 1TO3A 3ZSTA 4Q4MA 2H3BA 5HWJA 3N04A 3A12A 4IP4A 4AY7A 4DWSB 3VYLA 1PYMA 1U83A 3TSMA 3GFXA 3C0SA 1ISZA 6CGTA 3AWNA 4UWMA 3H55A 5HAOA 4HYWA 2ACSA 1DQUA 1ITCA 3BW2A 3WBYA 2PZNA 2Y7GA 3QV7A 2ZYFA 3QOMA 9XIMA 3G6MA 1P4CA 2ZZ5A 2E28A 1IZKA 2WMKA 1WZKA 2DZAA 3IRSA 1OCJA 5FEPA 2CZVA 2FH6A 1KLZA 3KWSA 4DBWA 3P62A 4ZQMA 3JR2A 4Z2KA 2YYUA 1BYBA 4JHOA 3L7RA 2DSWA 1DWGM 3C2OA 1WAWA 2WPBA 3QHMA 1UD8A 3VOGA 3GC4A 3B8WA 4N9EA 3G8RA 1NEYA 1JGIA 4IPLA 4F3HA 3V1PA 1UUMA 3S9YA 3UR8A 1Z3NA 1FHLA 4IWWA 3G2GA 3ZLHA 4MWAD 2FIQA 4AYSA 3M0IA 1VYPX 3QV8A 4PL1A 2JIWA 4RDVA 5CJMA 3SN1A 1YDVA 2V5CA 2ATSA 4N9BA 4H7ZA 1QCWA 4L4OA 5E93A 3BLLA 2Z26A 2XH2A 4O17A 2Y0FA 3W27A 4IMAA 2V2HA 3EB4A 2EAWA 7ODCA 3W82A 3LM7A 2ZX6A 3LYEA 4IMGA 1DJWA 1I0DA 5A6BD 1JAKA 2OWCA 3I3DA 4CNPA 4JFVA 2BFGA 4MKVA 3FA5A 3OZOA 1K1DA 3G24A 2QV4A 4U4MA 3TA6A 2BOFX 4GBDA 1IEQA 3CZEA 3GRIA 4JZ5A 4FX8A 1T7LA 4JHMA 2ZTKA 4LB3A 4GH3A 4D8ZA 5F2MA 3O3RA 2C18A 5DCEA 2YA0A 3CBWA 2GVLA 4Y96A 2HVMA 3T78A 1UZDA 3ARPA 2PDLA 5HJXA 4DXXA 4NU7A 2W6RA 1TZ9A 4JTCA 4DRSA 1YYAA 4TVUA 1G1YA 1CDGA 3ZMRA 1EQCA 2FFCA 1K7EA 3CAQA 3GH5A 2HS6A 4H6EA 3BWWA 5DFAA 2XVKA 2JE8A 3CHCA 1GOQA 2CLIA 2RAGA 4JPGA 2PGFA 5E70A 3N29A 3UYIA 2EHHA 3G3DA 1XKJA 4NAFA 3MQTA 1IHIA 2BV9A 3RAOA 4AEEA 4C6CA 4RZ4A 4GVFA 4HNVA 3QFEA 4U5IA 1I2OA 4PRRA 3SJNA 1QASA 3O1NA 4WJEA 4ICMA 1OSEA 1Q4NX 3NQEA 4CEXC 4KBXA 2D0HA 6A3HA 1GVSA 2PD9A 3GK0A 2AOSA 4PFMA 3PTKA 3UY7A 3RX3A 4D8AA 5JUVA 2AL2B 4JTIA 1NAL1 1W91A 3KFTA 2JFEX 1CLVA 5HWNA 3PFRA 3T7VA 4XAYA 2V2CA 4LBSA 5M1TA 1N8WA 1FXQA 4IT1A 3WLKX 3SADA 1HKIA 5LNWA 1EHAA 1KFBA 1M53A 3EAUA 4ZQOA 5CH9A 1XLLA 4WXZA 1AH4A 3PBGA 3NEVA 3VKJA 1J2BA 4YTQA 3D3AA 1YPIA 3MKCA 3WNLA 2GGHA 1QPNA 4KEUA 5CZTA 4DWSA 3M0JA 4C5YA 4LU0A 2GGJA 1SMAA 4DN1A 5I3FA 4WSHA 1Q63A 1GG1A 1BKHA 4IX2A 2GYIA 1VBGA 3KOZA 3MT1A 4O4WA 4GD0A 3GLCA 1QFEA 2IKHA 1CENA 2QULA 3JZUA 1UC5A 2ISDA 2J27A 2PDQA 3GSMA 4R53A 3B03A 1A5AA 1M3UA 3QVQA 1JYNA 3C2VA 3W7IA 4H6RA 4UFIA 2FGZA 2OKOA 4FB7A 3AS2A 4UTJA 2O7SA 1RSCA 1IWAA 3EWXA 4LEFA 3UESA 4PTXA 3TJ4A 3DGBA 1QW9A 1J8VA 1YMYA 3LNPA 6TAAA 4UZSA 3H53A 4FLQA 5AHEA 3T1GA 3WLJA 1O7AA 5AVHA 1ELSA 1NSJA 3AIVA 1UD3A 2E9BA 4RCXA 3CHDA 2YBTA 3HZ3A 2PP1A 4DUWA 1ZS2A 3A6OA 3PM6A 4EVZA 1TMHA 4QHRA 2OWXA 3P60A 2IMRA 1J0KA 3PG8A 4DLMA 1R9XA 2W62A 3DN5A 3T08A 4UB9A 5DF0A 2P53A 2REQA 1CXHA 4EF8A 3CPUA 2C7FA 3TJIA 5CC6A 1XLKA 3GQYA 1OX5A 3EMCA 1JCYA 1W37A 1F3EA 4AHQA 1QJWA 2V30A 4WKHA 1OT1A 3QM3A 3NYDA 4P8WA 4G1NA 3EOEA 3A4AA 3BOXA 1TJ0A 1V6UA 3UD6A 1ZBWA 2WNNA 1ZBKA 3A4WA 4QDWA 5JVLA 1W1TA 1XD0A 4KETA 2OZTA 5BXSA 2I5IA 5AY7A 1DORA 3CAVA 3G1FA 1NQ6A 3N18A 1LTDA 3TTQA 1J5TA 3VIOA 2C15A 1PWMA 4KW2A 3C0LA 1Z6KA 1W1A1 1EKOA 3V18A 2XH0A 3LTYA 4EPEC 4HTYA 2OLSA 1UW9A 1UBSA 1V3LA 2AKZA 4KFOA 2GVGA 4KH2A 4P7LA 3YPIA 2R14A 3N2BA 2E5BA 2J24A 3GXTA 1B9BA 3WBAA 1CYGA 1M6JA 4OUIA 2YCLB 1V3HA 2A0NA 4FF7A 3WY1A 1XX1A 4E3VA 1J6OA 1PB0A 4GISA 3FHQA 4AX7A 2NUYA 4RNHA 4WZHA 3W25A 1Q6FA 2QCNA 3KLLA 3M6DA 2WSRA 3VE7A 3KWXA 3BARA 4I6KA 4D71A 5B7ZA 2WWDA 2QCFA 4XZBA 3MBDA 3NSXA 4JQ1A 1QU4A 3CV2A 4HMDA 3LGEA 2O56A 3AQUA 1BSLA 1ZBVA 4CN1A 1JR1A 1YXDA 1TVLA 1U1HA 5E5CA 4IOTA 4TX9A 3NZPA 5D2WA 4HNOA 4LY8A 3EDJA 1S5NA 1RK6A 1V93A 1E1CA 3ATZA 4AQLA 4AEFA 1F8MA 3NR0A 1KTBA 3KVLA 1JDEA 1F61A 4IJBA 3THAA 2F6UA 4A6GA 2XHYA 4OU1A 1OF6A 3ANVA 1K6WA 5I09A 4GPNA 1GWJA 5ECVA 1JNEA 1WKYA 3BOFA 3EA2A 4ERGA 5CAKA 4GY0A 2Y85A 1MUMA 4LYKA 4P7QA 4D6GA 2A1YA 1GPFA 3RG6A 4UCGA 4IJRA 4YTSA 4NZ3A 4FAMA 3BO9A 3UJEA 3SRHA 3LCXA 4HB7A 4IF2A 4WEVX 3VNDA 3ZYZA 1DV7A 4Q6XA 1YXCA 2V81A 5JMUA 5MHBA 4JICA 2J7EA 3KOFA 2DZTA 1EA9C 4C1LA 9CGTA 3DXIA 1EDQA 5BYWA 2ZOXA 4J3XA 3TFCA 2V38A 4PMVA 1S2VA 3O15A 2F61A 5KZ6A 1L9WA 4KGJA 4Z2GA 4GJIA 4W5UA 1WCGA 4DBEA 2QF8A 3CUFA 3WL1A 2FHFA 3CPRA 4HHMA 2ASHA 1OBAA 1CTNA 1EUAA 4JNZA 2PTDA 4MNJA 3VCNA 2B7QA 4AVOA 3Q65A 5C9UA 3M0KA 3BAWA 2P5NA 3LLXA 1JCMP 1IT0A 1Z9AA 3A5FA 3TZFA 2OSXA 1VPYA 2H90A 4AD2A 1QUMA 3WF1A 1GORA 2V6AA 1UQZA 4UNLA 3TTSA 3WD4A 2Q02A 4OBTA 1BKSA 3I7SA 1NDYA 1Z44A 3N6HA 1U33A 2OCZA 3MMDA 4UTMA 4H01A 3B3DA 4HU8A 1LG2A 4B5UA 2GZXA 3QRHA 2PDIA 4JBRA 3W7CA 3IS4A 1C93A 1KCZA 3H6OA 5CPLA 3ICJA 2IS7A 4HPXA 3F2BA 1LBLA 1FDZA 1TA3B 4S3FA 2ZUVA 1CECA 4R5EA 3H4WA 2XIMA 1UH3A 4NZFA 1EP2A 4Y8EA 4QQUA 4KS0A 3TYDA 5XIAA 5FAJA 5LIKX 2QGHA 4XTDA 1PUDA 3DHPA 3GBEA 2GPTA 3S2CA 4ZA0A 1TJ1A 1E0TA 1OFRA 3H4GA 3I6RA 3V4BA 3DBNA 2FYMA 3S42A 4HN8A 1A5NC 3ZR6A 1J6PA 1EGZA 4S3KA 1Q3NA 4BI6A 1B2YA 4UR7A 3V5OA 5A8NA 3S4TA 1RUSA 4E2BA 4XD5A 4BCEA 1X6UA 1WDSA 2QJJA 4GKTA 1M04A 1BYAA 1IEWA 3CS2A 1OC7A 2ZUWA 4H9ZA 3GG8A 3OZPA 4PEKA 2VZVA 1FCBA 4YTRA 4N2YA 3QN3A 1DQXA 2VX4A 3SUVA 4EAMA 2VVSA 3FLUA 3FJNA 4BF9A 3VDAA 3W1AA 4UMBA 2DIJA 2XH7A 1I60A 3QR1A 3NVDA 1GG0A 1WNOA 2OOGA 4MFEA 2O9PA 1Q6CA 3K13A 2C1HA 1EIXA 1TX2A 2X16A 2QJIA 1EC9A 3WLNA 5J5RA 3C2RA 1JUKA 3PSVA 1OT2A 3WQOA 5FEXA 2W4XA 4URIA 1LLWA 1F6KA 5A6LA 3HURA 2BMBA 5KZEA 5KITA 4CU8A 1TV8A 3BXWA 4Y90A 2QV5A 2Y7FA 2X05A 5L9FA 2HQAA 4QG9A 1S38A 3L2MA 3GE7A 2IKIA 5E6ZA 4O1CA 3TEVA 3G5EA 2R1KA 3L65A 3STPA 5CPSA 1MRAA 1W1B1 3WUFA 3UPMA 3W28A 3W22A 2PZ0A 2VI0A 3ZT7A 1H7XA 4DJED 4PL2A 3BAXA 3TYCA 4ZOBA 3RYSA 5FJOA 4ZOEA 2R24A 3VFCA 2J7DA 3BLFA 4POCA 1WO2A 4HCLA 3ZVIA 2Y5EA 1PVNA 1E3XA 3SUTA 3SCQA 5I77A 3E74A 2EBNA 3O2LA 1JPHA 3H23A 3E2QA 4FR1A 3WMBA 2FPVA 3VD7A 2VGBA 4NT0A 3PTQA 3EXTA 1S5TA 4OIFA 3OPSA 2QJGA 3KVKA 5B7YA 1O5RA 1ISVA 5GPRA 4BI7A 1VJIA 1R87A 3RM4A 1XYCA 4N42A 1KM6A 2V82A 1EL3A 3G22A 3BG9A 4BQ5A 1TV7A 1YXYA 2ZKMX 5DT7A 2QUNA 5K3VA 4QDMA 2G3JA 1PTGA 3GVVA 4ROQA 4TV6A 1AJ2A 5FF0A 4CD6A 4AZBA 4LV9A 3ARZA 1XL9A 1ODZA 3LB0A 3VUPA 3VNKA 3I4EA 3M0HA 4JQ2A 1YHTA 3O8AA 5TBOA 3CH0A 3BC9A 4AUBA 1UQYA 3QYSA 2VCAA 1AD1A 6PTDA 5GJMA 4X0VA 3MP4A 4MYAA 3S5ZA 4CU7A 5AECA 2QPUA 4U2YA 4KGLA 1NWUA 4HTBA 5E0FA 2PGRA 4AXKA 4O19A 2X0YA 4ZSTA 3WF2A 3KP0A 4UR9A 1J9YA 1TZZA 3PZVA 2NQJA 3UXIA 3IJ8A 4DLFA 2NVAA 1BG9A 1MO0A 1TRIA 1BYCA 1LWHA 3ARRA 3KHJA 1I6NA 4GUFA 3BPWA 4LVBA 2CLOA 3BLPX 4PMNA 3H21A 3VTRA 2V3FA 1LBFA 2UY4A 1ITUA 3T81A 4GVIA 4G8TA 4J3ZA 1M7XA 1Q2RA 1QRQA 3WLPA 4LAZA 1ISXA 1UB3A 3TSBA 4P61A 1B5TA 3B4UA 5H91A 4IFOA 1W3KA 4NZ1A 2EGZA 1LF1A 1GVOA 5U4NA 4LWWA 1T0OA 1W6TA 4LRSA 2ZE3A 1Q66A 3V5CA 3PJWA 2PEVA 3GZ3A 4BKNA 4MB1A 3IANA 4S2BA 4ZTYA 2A2IA 1E5JA 3W01A 4XTIA 3SDOA 4LV4A 3WJYA 3TSDA 4EK7A 3WLSA 1XG4A 4O1FA 4TVCA 4S3GA 3F4WA 3U2EA 2GWNA 3LPPA 2CERA 3KL0A 2DPEA 1P6BA 1FWBC 2C3ZA 2PRHA 1FP8A 3UXAA 3FAWA 7ENLA 1Q85A 3O9NA 2SFPA 3LGDA 1FTXA 2PTZA 3S6DA 4ZGYA 2YDRA 2GQAA 2JEPA 1JF5A 2PC4A 1E0XA 3KOWA 4W7WA 4AC1X 3WD2A 4QJ4B 1S5VA 3W2MA 4TMCA 1AUSL 1Z69A 3LHVA 3W7HA 3GR8A 1XYMA 3QW3A 2VEGA 5SWUA 2E6DA 3EOUA 2FTPA 1WUEA 3NZRA 2Z25A 2G8ZA 1LRQA 4KQNA 1OGBA 1YLVA 4KCUA 5FESA 5HBFA 1R3WA 4L4LA 2QGYA 1B54A 4LVAA 1KM4A 1WP6A 3URAA 2OSYA 1EWDA 3TQVA 2AAMA 3LI0A 5D2VA 1VYSX 5EMLA 4MIMA 2Z7GA 3UETA 4DX3A 3CL7A 3VO0A 2PWHA 4CQDA 2OQYA 2ZCGA 3WLRA 3N9RA 1FXPA 1L8NA 3SY5A 1JD7A 4WGXA 4ONVA 3OVGA 3EX2A 1FWNA 1PZ3A 2YB1A 3W71A 3UZYA 3AS0A 2QKFA 2BGNE 2PDNA 1RY8A 3LLFA 1C8YA 3KS5A 1BLIA 2E5CA 4RXGA 4D6FA 4FLSA 3BLEA 5A8PA 1BGAA 2VO5A 2VD9A 4GQQA 1HW6A 1TV3A 1TPVA 3QF0A 1VQTA 3V0SA 1R30A 1Y7VA 4WVXA 2PDMA 3UERA 2H3DA 1NH6A 4UIOA 4KCVA 4B2DA 3L23A 2EPKX 3ITGA 4E3TA 3E2VA 3TC7A 2WVSA 1NIUA 3CPGA 3WF3A 3AZSA 5CZ0A 1YTDA 3R2GA 2X1UA 5J8LA 1QXLA 1J0YA 2Z1XA 5D2YA 5AYXA 1XLMA 3NAVA 4GHRA 2AAAA 3B0PA 4OHQA 1FH7A 3W2UA 1OINA 5I02A 1WKFA 1BXCA 3V1HA 1TPEA 3CTTA 4MKNA 4UTHA 1A5UA 2GL5A 2F8QA 1S46A 3K8KA 2OZ8A 1H3GA 2D20A 1J5SA 1E9ZB 3BUVA 3NXLA 2CXGA 1UIOA 2GJRA 1FVPA 1TX0A 1LRNA 3CM4A 4ZZ9A 2Z2UA 1EJXC 1FA2A 1I0BA 5ECUA 2BVDA 5REQB 1JPMA 5KETA 3DC8A 3NQGA 1JZ8A 2BVYA 3C2EA 3UP8A 2XIIA 2QJNA 1VYRA 2J88A 1JQVA 1XGEA 2XWDA 1D3CA 3GAYA 5HULA 3S2NA 4DWSD 2CBIA 1XYBA 3NOEA 4WUIA 2JIEA 3UU0A 4WDUA 2QCDB 1VBRA 3QLDA 4GY1A 3QGKC 4S1FA 3G1RA 3U5YA 2VL4A 1N2VA 5A8OA 1YEYA 3UEQA 1BF6A 1WA3A 5A8MA 4GY7A 1BVZA 2PI6A 3KCOA 1GVYA 4PMRA 3T8QA 1E4NA 1FWJC 4DQWA 1EC8A 4DUOA 4MY1A 3PUGA 4S3EA 1VFLA 3ES7A 5C7VA 1NOWA 3FIGA 3TE9A 4LXFA 4I90A 3IEBA 3VIHA 5JBEA 1O68A 4TX8A 4E8GA 1WOAA 3UGRA 3WH5A 3FS2A 1LL6A 2PD5A 3MTWA 3UCQA 2R82A 4PUWA 4AIBA 1CEOA 2VR2A 2OTDA 5XIMA 2OYLA 1BHGA 3RIKA 2YKKA 3QH2A 3OODA 4N9CA 2PSNA 2J75A 4AVNA 1JI2A 1BWVA 3O0FA 3NQMA 2DZPA 4LCRA 2J79A 3VKDA 2P3ZA 3KLKA 1VEPA 3PNUA 4O50A 5AZ0A 1O5KA 2Z6IA 3MDWA 3M0LA 4GRSA 3TQ0A 4YVVA 4ZXOA 1R8LA 4A29A 1E6SM 1TWWA 4Y2WA 5JU6A 4WKFA 1FKWA 3EZ4A 1BWKA 1S2TA 4HP5A 3R79A 3L4TA 3LCHA