5CQ1A

Disproportionating enzyme 1 from arabidopsis - cycloamylose soak
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
517
structure length
514
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 182
structure length 514
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cq1A01
2X09A 2WMIB 3L2LA 1ZU8A 2JF7A 2A3EA 5AY7A 2E9MA 2FHCA 1HVQA 4EKJA 5BYWA 1R8LA 3WY1A 2ZXAA 1W1PA 1KWGA 1GW1A 1HVXA 2J62A 3B9AA 1NWUA 3PZVA 1PIFA 1WZKA 4MB5A 2J7HA 1VEMA 5CLTA 3WUBA 5C71A 4M8UA 2ZE0A 3GYCA 1E6ZA 1CPUA 1WDRA 4PMQA 1JDDA 1B3VA 1CGVA 1Q6CA 1CXHA 3G6LA 3L4YA 1WPCA 3ALGA 1W32A 1VF8A 2PC8A 1XRVA 4AD1A 1WZLA 3WDIA 3RJXA 5IFPA 3GZAA 2HISA 4W8AA 2A3AA 1G1YA 3PTMA 1E4LA 4M80A 2F2HA 3BH4A 2WWCA 2PWEA 2GUYA 3O6AA 5GQBA 4E4PA 2WVUA 4NI3A 4W5UA 4PMOA 3NIYA 3BSGA 4JKKA 5JIWA 4QFUA 4PSPA 1E56A 2WAGA 4IPNB 4ATLA 1Q6GA 2ZUVA 2NSXA 2E9LA 1V3MA 2X2YA 3CO4A 1H2JA 1GQIA 1GOIA 3AHVA 2PBOA 1OGGA 4BS0A 4E8CA 3WDJA 1KGXA 4OOZA 1E72M 2CKRA 3TTYA 3OB8A 4WK9A 3APGA 3GM8A 1CGYA 1JL8A 5IXEA 3BAXA 2J75A 2WHLA 1HP5A 4D6FA 1DWHM 1GHSA 3WFZA 2ZWYA 4UFJA 3NSXA 3NCOA 5M5DA 3SCOA 3L4VA 2DH2A 3OLIA 2YBTA 3RO8A 1KQZA 2DH3A 3POCA 4CD4A 3AZSA 4ZE5A 3CMGA 4B3KA 3W53A 4MNKA 3WUEA 2OWWA 3RIKA 1BAGA 2BVDA 1NOWA 2EQDA 3TONA 4S3KA 2VR4A 2Y2WA 3TOPA 4QCFA 2DSVA 4KRTA 1C8QA 4JFUA 4UOQA 1FP8A 1OT2A 1JZ8A 3ARSA 4HOWA 4BCEA 1M01A 2XFRA 3AMCA 1QW8A 1AQ0A 2TAAA 3SURA 1WCGA 2DT0A 3GXDA 2OYKA 1V02A 3NUKA 3QHOA 4GZIA 2J8FA 2PWGA 1E43A 3AS2A 1WP6A 1KWKA 2VX5A 2J8GA 3O9NA 2EPLX 5EB8A 3VD7A 1KCKA 5DO8A 1US2A 1KBKA 3WD3A 5HPCA 4JFWA 1XYFA 1FH7A 2YIHA 1QW9A 2CEQA 3OZPA 4OUEA 4GQRA 2ZX5A 1B3WA 1DWGM 2WHMA 4X0NA 4F66A 2VRQA 2BY1A 2EPMX 1W1YA 2OSWA 3WNMA 4CGTA 3WFLA 2EPKX 3VMOA 1ZL1A 3MO4A 4MNMA 3WH7A 5M17A 5TD4A 4HPHA 2VMFA 3CUIA 3O2LA 4PCTA 4DWSD 1E15A 5AC5A 4D6IA 3W29A 3MMWA 1W2PA 1XSKA 1CXEA 4D6JA 3SEPA 3GXMA 2XGBA 1VBRA 1JFXA 3MANA 2XM2A 3AMDA 3ARUA 2B31A 1OCQA 3A47A 1VEPA 4FLQA 4F9JA 1G0CA 2XIBA 2YL9A 1E6SM 4WKFA 2BY2A 1AMYA 4W84A 4P8VA 3ARRA 4M24A 1KXVA 1LWHA 2W5FA 4U31A 2J79A 1QI4A 3L4TA 4W93A 4QLJA 1CWYA 3WF3A 5BRPA 4AZGA 4RE3A 3I3EA 1H41A 3UG4A 4LYRA 3VX1A 1W9UA 3AIEA 1QPKA 4OOUA 2VQUA 4UOZA 3CZGA 1GHRA 2VTFA 3VNZA 3WDQA 3QOKA 2FHFA 4WLCA 5BXRA 3PN8A 4AIOA 1UUQA 4XUYA 4U5IA 3K8KA 1EO5A 4AYSA 3AMLA 3ZM8A 1ESWA 4CVWA 3ARYA 5JBDA 4JKMA 3CZ8A 4LX4A 2FH6A 1U30A 2ZX8A 3ZO9A 4WKAA 1JI1A 4BQ2A 3ZSTA 1RH9A 1W3LA 5DT7A 1NWSA 1CYGA 3VINA 4AZ7A 1BYAA 1NOUA 4UZSA 3UG3A 1HJWA 3CTTA 3PZOA 3QHNA 6TAAA 1JYXA 3SCRA 4KGLA 3HMCA 1PX4A 3N18A 4B15A 3UETA 2X05A 3N1AA 3W6LA 5GPRA 4GQQA 5IHSA 4XV0A 2WSPA 3MUY1 1S46A 3WSUA 1IZKA 1TR1A 2WNWA 5DF0A 4PMRA 3VDBA 1NWRA 4PCSA 3W81A 3AHYA 4C7GA 3VDCA 3N12A 5HXMA 5M03A 1OT1A 3ZT6A 2GDVA 2XFFA 4E2OA 4H04A 1F4AA 3N13A 4CN6A 2WB5A 5A1AA 3VUPA 4CKQA 2ZUNA 3W6MA 1JYVA 4MPKA 3ARWA 1E9LA 1QHOA 1E6XM 1TA3A 4EANA 2WMJA 2DPEA 4KRUA 3GXFA 5AYIA 1DWIM 3RDKA 4NZCA 3AHZA 3D3AA 4K68A 3IJ8A 1EOMA 1MXDA 1UKTA 1CBGA 5A94A 1MVYA 1QI2A 4LYPA 2MANA 2CPUA 2DSUA 1BFNA 2XUCA 5HOSA 1V0LA 1V02E 2V3EA 3OLEA 4CUCA 2DT2A 3VGBA 4P7NA 2W63A 2CERA 3VIFA 1E1FA 2WCGA 2ESCA 2YA0A 4CCCA 1E6PA 3EDDA 4PMXA 3BAIA 4AZHA 2WKLA 5E09A 1Z32X 3DYOA 4JCLA 4P8UA 1HL9A 4TVDA 3GDBA 4TOQA 3WH9A 5AC4A 3VIIA 2ZX9A 4Q22A 1MYRA 2WMHA 2WVVA 1H0GA 1DWAM 2WLYA 1WZMA 3EYPA 2XG9A 2VX4A 1V0KA 3GNPA 3BAKA 2XVPA 4P7OA 3RM8A 3GBDA 1UH3A 4AD2A 5C70A 1JFHA 4M56A 4U2YA 2ZUWA 1I1XA 3B8SA 3VGFA 1YQ2A 2VOTA 2UWFA 4TXEA 2E8ZA 3BCFA 2DEPA 4CCEA 1VFOA 2QMKA 1GOKA 4BQ3A 2G8ZA 4W86A 2VURA 4V2XA 3SIMA 1E71M 2VJXA 2WXDM 1BYBA 1W1TA 1V6WA 2ZX7A 4HP5A 3GTNA 1HJUA 2CYGA 1MWOA 3N15A 3AZRA 1C7SA 3WF1A 1W3JA 3TP4A 1HKMA 1CLXA 4H8HA 2F8QA 2J77A 1C8XA 1GNXA 1CXFA 2OSXA 1GQLA 4UQAA 4LPCA 4AISA 3PZ9A 2VVNA 1UKSA 4V28A 2XPKA 5A2CA 2FGZA 4LQ1A 1JZ6A 4H8UA 1FHLA 3CUHA 3WKZA 1E6NA 3ZQ9A 3RJYA 1NARA 4HU0A 2PI6A 4UFMA 4N0RA 2VCAA 3MSGA 2VZUA 2G4FA 3PZQA 9CGTA 1TUXA 4DUXA 1FFQA 3TTSA 3OGVA 5CPTA 2CKSA 1GVYA 1DWJM 3VIMA 3GH7A 1K9TA 1RPKA 4W7VA 1CEOA 1NM9A 1JI2A 1UH4A 4TVUA 3WELA 2OWCA 5FL1A 5A6BA 2VT0A 4BQ5A 1VIWA 2GFTA 4GKLA 3EDFA 4FLOA 1SR0A 5EFFA 3W82A 1G94A 3AI0A 1CECA 3TTQA 3ARPA 4QAWA 2J7EA 2V3GA 1BSIA 1OM0A 1R87A 5KZ6A 3PZUA 4AD3A 4A3YA 5CXPA 1OB0A 3K1DA 1VEOA 3MU7A 4HZ6A 4PYSA 4Z2JA 1UD5A 2Z1KA 1LL4A 1HJSA 2JF6A 3SUUA 4D6EA 4UFLA 1JNEA 5M3WA 2WHJA 1V3HA 1SMAA 3AS3A 2C7FA 2WK2A 5I79A 5BROA 3VGHA 4FF5A 1K6AA 1R86A 1C8YA 4HMEA 4PBGA 1XSIA 1KR1A 3NDZA 4W8BA 3U57A 4CU8A 4HZ8A 2QLYA 4EAMA 1WKYA 2WHKA 4P7LA 2GJRA 2CESA 4WSKA 2VUYA 3ZJKA 4ATDA 3KL3A 1DWFM 4PMNA 3QHMA 3UCQA 2E9BA 1C90A 1E6RA 4DM1A 5CGMA 1JNDA 1B1YA 2D3NA 1KCLA 4GIAA 1XSJA 2D20A 3GBEA 1NH6A 1UR0A 4EK7A 1H0IA 3EMZA 1E0WA 1O6IA 1V6XA 1KB3A 1TG7A 1IZJA 2UY4A 2XVKA 2YL8A 1HJVA 3NJ3A 4ML4A 4MNLA 4UQEA 4GI8A 1CLVA 3KZSA 4F9DA 2PBGA 2VCBA 2DIJA 2A3HA 1PZ3A 3ZJ6A 2VX7A 1UWIA 4P8WA 1KGUA 1QVBA 1BYDA 1EQPA 4LXFA 3NYDA 7TAAA 3KE0A 2V5DA 4UFKA 1ITXA 2WCSA 1QI0A 5HDRA 3ARZA 2ZWZA 1EDGA 2DSWA 4ZXLA 2BFGA 4GZEA 1QNRA 5FKYA 2VX6A 1UWSA 2DIEA 5IFTA 1PBGA 4R27A 5E70A 1XH0A 5LA1A 2J25A 2UY3A 4HPGA 3AROA 1JXKA 5DEZA 3WMBA 2WM0A 1NQ6A 1W3KA 2E40A 3WD2A 3CGTA 3VD9A 3IANA 2YDQA 3WMSA 4JFSA 3HU7A 3HJEA 2ZOXA 4TVCA 3L4XA 1FH9A 3GH4A 4PEEA 4L4PA 3RMEA 5BWFA 3ZT5A 4J28A 5D8ZA 1ISVA 1P6WA 2GK1B 1GVIA 1J18A 1UR9A 4M82A 2UY2A 3LPPA 4CD8A 3SUWA 3KWXA 1LG2A 2D2OA 1US3A 1BLIA 4MDPA 1IV8A 1PZ2A 3EDEA 4TX8A 3VIPA 5BXSA 1BTCA 4MAVA 2WYSA 3WENA 4TTGA 4OIFA 5EBAA 5HNNA 1SYTA 3VKKA 1PPIA 1GPFA 5GNZA 3T0BA 3WBAA 2J74A 4AEFA 4OBSA 1EH9A 2QHAA 1PX8A 1TVNA 3BLPX 2GDUA 2OWXA 1UD3A 2EPOA 1QBBA 3OZOA 2VNCA 3T0AA 1QBAA 3FAXA 1DHKA 2ZUUA 1B3XA 2J78A 3K46A 4D6HA 3L4ZA 2NT0A 2OLHA 2WZHA 3FW6A 1WDPA 3II1A 3CZLA 2XIIA 3T2QA 3UERA 3ECQA 4DWSB 1H1NA 5I78A 4W7UA 2WC3A 4U3CA 2BS9A 3CHFA 1DEDA 2EJ1A 1BGAA 1KGWA 1GOQA 5CSYA 4AXNA 4H41A 4E8DA 2ZXDA 5A6BD 2OYMA 2O9RA 4KMQA 2D23A 6A3HA 2EXOA 1VJZA 2Y8KA 5A6JA 1J0HA 4HA1A 5A6LA 1BQCA 4XB3A 2FGLA 2VL4A 3IJ9A 1R7AA 1ISXA 4WJXA 2RGMA 2XGIA 1OD0A 3W37A 3LPFA 4DWSC 1JIBA 3RM9A 3WQ8A 3DHPA 3MMDA 4LYQA 5A2AA 1TVPA 5E6YA 1E5NA 4Z2GA 4OZOA 2YA1A 3MMUA 3W38A 3WUGA 1CENA 2PWHA 3GNOA 2WLZA 1UG6A 1LLOA 3L2MA 1G01A 4UQCA 4D6DA 1HXJA 4TTUA 1CGXA 2V38A 1JF6A 1E1EA 5IDIA 1H49A 3D5HA 2J47A 5CG0A 3W0KA 3JUGA 4XZBA 5JBEA 1M53A 2ZUTA 3IAPA 3DYMA 3PZTA 4HOZA 4X0VA 3SCWA 3ZT7A 2NT1A 4RL3A 3AJ7A 2ZICA 1XC6A 3VPLA 3VDHA 3AS1A 5CJ5A 3MUAA 3BCDA 4ZENA 3UR7A 1QNSA 3DHUA 2WMGA 3AOFA 4D6CA 4KGJA 1D7FA 1SMDA 2AMGA 1K9FA 3VTRA 1TCMA 2W4XA 5I3DA 2BVTA 2ZXQA 3OBAA 2E0PA 3SUTA 3VMNA 1UKOA 2XVGA 1MW1A 1YHTA 3UG5A 2DSZA 3T08A 3WEMA 4NRSA 2PB1A 2GJXA 4A3HA 2BY3A 1ZJBA 2CCRA 4ACZB 4R5EA 4UOJA 1IT0A 2DT1A 2BY0A 1EDTA 3WDRA 3A6OA 1W9PA 2DQXA 1CGUA 5DMYA 5I23A 1U33A 1UWQA 1B90A 1FA2A 5FIPA 4CU6A 2ZUSA 4D71A 1B3YA 1HIZA 2W92A 7A3HA 4JHOA 3VGGA 1V08A 3FY1A 2G3MA 4AIEA 1W2VA 1KFWA 2BXYA 3M46A 1H4PA 1B3ZA 2YBUA 4JCMA 3OGSA 1ZJAA 4HA3A 3VD5A 1ITCA 1C92A 3AYSA 4JZ5A 1EOKA 2W66A 5CPQA 1XD0A 4W7WA 4UCFA 3SCVA 2Y5EA 3TTOA 3CHDA 2EEXA 1MFUA 5A95A 1UH2A 2XVLA 3AIWA 3A4AA 4IUGA 1I75A 1ECEA 3DYPA 3ZOAA 1E4MM 4WF7A 4ZEPA 3M07A 3CMJA 3DECA 1PAMA 1GQKA 3FHQA 5CLWA 2G3IA 3AMKA 4KH2A 4PMZA 3OG2A 1J01A 4QLKA 1MXGA 3AXXA 1EDQA 4B3LA 2WC4A 2WCAA 3ZIZA 1HT6A 1EO7A 1E5JA 3AXHA 3GH5A 1FP9A 4D72A 5FD0A 2J7CA 2V3FA 5D9MA 3AYRA 1U2YA 1LWJA 5BCAA 5CSUA 3K4DA 2D0GA 4GINA 4AY1A 1J0JA 2QV4A 2D0HA 1UD8A 1FFRA 2XVNA 1E70M 3VM7A 1FH8A 5KEZA 1KXHA 2XHYA 5D9NA 3SCQA 1CGWA 1JDCA 4IPLA 1D3CA 4U5KA 4MB1A 1GJUA 2VZOA 2G3JA 4M1RA 2WANA 5FL0A 4C7FA 3ZMRA 1NOFA 4CN4A 5A2BA 4F79A 3PZNA 3M7SA 4ZFMA 4BZYA 5CQ1A 1LQ0A 4C7DA 1K9DA 2JFEX 2VO5A 4URIA 3MV01 1V3LA 3WDPP 2C0HA 3VIGA 3VILA 2XFYA 2YDRA 1HNYA 2DSKA 4PTWA 1V3JA 4D6GA 4OBRA 5E9AA 8A3HA 1W9XA 3ARTA 5ABFB 3VD4A 1GJWA 4Z2HA 4CD6A 1VFFA 1V0MA 3T2OA 1UD2A 3N9KA 1EGZA 1BG9A 1UR8A 1HJQA 3EBVA 3W27A 2XJ7A 1EIBA 2O9PA 2WMIA 3WBEA 3EDJA 3A4WA 3L4UA 1V03A 4IM4A 5JBFA 2YL6A 2A3CA 4A4AA 2J7GA 4PMUA 1X6NA 3VO0A 1JF5A 4PUDA 1BGGA 1KXTA 5LA0A 4WKHA 2V3DA 3CHCA 3RILA 3MUZ1 4UQDA 2F61A 1VJSA 1ISWA 4Z2IA 4MJ2A 3TA9A 4JHZA 3WNPA 3POHA 5A6KA 1XGZA 3WQ4A 3WEOA 3FHAA 1FOBA 3OLGA 2XSBA 4ZXOA 3WD0A 1ZB5A 2DT3A 1UD6A 2EBNA 2VR5A 4GO9A 3M6DA 2YOCA 3DC0A 3OGRA 4CVUA 1ZBVA 3VVGA 2VCCA 3I3BA 3UR8A 1QNPA 1NP2A 2BXZA 5GNYA 2BVYA 3FAWA 5FOOA 3CHEA 1TA3B 5JUVA 1RD6A 1HP4A 3N04A 4FK9A 1L0PA 2UY5A 1WNOA 5A8PA 1WDSA 1HKIA 1W9VA 3KEHA 5LA2A 2O9OA 2GK1A 4D1IA 1UWUA 1UWTA 1HF6A 1UZ1A 3K8MA 1GQJA 1CDGA 1GCYA 1MQRA 2YLAA 3U7VA 2VRKA 4V27A 1D2KA 2WSKA 2VZVA 3CLWA 1GONA 2W91A 4HTYA 3LPOA 4W88A 3VIHA 2VRJA 1WDQA 1E55A 2X0HA 1WZAA 1ODUA 2QMJA 3FN9A 4H8VA 1HX0A 4D1JA 1QHPA 3L4WA 3BXWA 3F5LA 4W85A 4NRRA 2WC7A 3CZEA 2WVTA 1JZ4A 1W3HA 3K8LA 1JAKA 3U7BA 4JL2A 5A6SA 3KL0A 1PX3A 5AYBA 1RP8A 4ATWA 4X9YA 1H11A 1UHVA 4YHGA 3UESA 1J9YA 2A3BA 2J7BA 3AIUA 3WF0A 5IHRA 1BPLB 2BHYA 1A3HA 4M29A 1UA3A 3ARVA 1N82A 1BF2A 2CXGA 3RM4A 1GUVA 1JZ3A 1V6UA 4MDOA 1TFVA 2JIWA 1MFVA 1V3KA 2CETA 5A8MA 1TE1A 3B9EA 3MV11 2PF0A 3AICA 4WIWA 4M81A 4JFVA 2BHUA 5ABHA 1E0XA 3BLKA 1V0NA 4PTMA 5DFAA 4MB3A 1H5VA 4PN2A 1E73M 1VFUA 1HJXA 5D9OA 1EHAA 1UOKA 5HBFA 3A3HA 1E40A 1TMQA 3AMGA 3BSHA 4LGXA 3W24A 4HMCA 3THDA 1E3ZA 1GZJA 3WL0A 4XX6A 3GNRA 3VU2A 2VZSA 1XH1A 2D0FA 4AZCB 3VM5A 1ZBWA 3CZKA 3SCSA 3WH8A 3OA5A 1GOMA 3MSDA 4W5ZA 1OIFA 2WMKA 2VVSA 3QOMA 1QI3A 2IXVA 4EE9A 2Y4SA 3WQWA 3ARQA 2W62A 3PTKA 5E6ZA 3SCUA 1C3FA 1OIMA 4PUEA 1LJYA 4UQBA 5HPOA 3F5KA 5ABGA 1MQPA 3VOCA 1ISYA 4WSJA 4PTVA 1M03A 4FMVA 1UZ4A 2JEPA 2CHNA 1UD4A 3A4XA 4J3TA 4GI9A 4TUFA 1G9HA 1OBAA 1OGBA 5CPSA 1RP9A 2EPNA 2YA2A 4ACZA 4BF7A 1B31A 3K4AA 1UKQA 2CIPA 3CH9A 2RGLA 4UZUA 1ODZA 4UNIA 2BHZA 3BC9A 1JZ2A 2EO7A 1OWQA 1JDAA 1J0IA 1NP0A 2D24A 1C93A 1XD1A 2FDMA 3PTQA 3CUFA 1CZ1A 4GZJA 5A3HA 1W9DM 5A8QA 2YL5A 5FCZA 2IUZA 2G41A 1UR4A 1AVAA 4CN1A 3OLDA 1KR0A 4TX6A 4Y7EA 1HN1A 4HA4A 1UYQA 1OGSA 1QNOA 1MW2A 3PZGA 1E4NA 4AZIA 3WNNA 4PSRA 4Q7NA 3CZJA 3WIJA 5GNXA 1LG1A 2AOSA 1M04A 1LL6A 5A8NA 4H2CA 4J27A 4J3UA 3N11A 3ZR5A 1CXKA 3ARXA 3G6MA 2W61A 4GXPA 3BAWA 4OKDA 1ISZA 4GO8A 5A8OA 1JAEA 3ALFA 3VIOA 1J11A 4MTVA 1C7TA 3BGAA 3WF4A 2PWFA 3WL1A 2QPUA 3IAQA 3WN6A 4QP0A 4W8LA 1CGTA 1CXLA 4JFTA 1J0ZA 3VIJA 4PTXA 2FHBA 2VI0A 1VAHA 2W67A 1CNVA 5I24A 1XYZA 4CU7A 2D1ZA 3BMWA 3WF2A 4MNJA 3QR3A 2BNJA 1FHDA 4YN5A 3IJ7A 1Q6EA 1W1VA 4KWUA 1JYNA 1JG9A 3CBWA 4HOXA 2WBGA 5I6SA 2VC9A 3NDYA 3WH5A 3NSMA 7CGTA 4W87A 4P8XA 1V3IA 2JALA 4AD5A 4HU8A 3NSNA 1BVNP 4P7QA 5I0DA 3U5YA 3E1F1 4UFHA 1M7XA 4P7RA 3B9DA 4W89A 3FXYA 4PRWA 2O92A 3ZR6A 1EXPA 4PMYA 4FLRA 5CGTA 5ECUA 3S6TA 3EMQA 2YKKA 1L8NA 1PIGA 4PMDA 4QLLA 2O9TA 2XTKA 2XSAA 1CTNA 3N17A 4JL1A 1E6QM 3AHTA 1AQHA 5A6AA 1QHZA 1VBUA 1VB9A 1OD8A 3AIRA 2XWEA 3AXIA 1O7AA 1V6YA 3MUIA 4MB4A 4AEEA 2E3ZA 1AQMA 2JEQA 1JD7A 1J0YA 4OJYA 5DT5A 5ABFA 5EMYA 5D4YA 1XHGA 3VGDA 3MKKA 4AIUA 4L4OA 5JIPA 1KBBA 5D8WA 1E0VA 4AWEA 4DUWA 3PHAA 4MAZA 3EMCA 3EDKA 3WEZA 4QDMA 4XZWA 2BV9A 5E0CA 3SCTA 4ZE4A 1EQCA 3ZSSA 2J7FA 6CGTA 2WZEA 3VX0A 2G3NA 1WAWA 2WMFA 1GOOA 2CITA 4GPNA 4AW7A 1C91A 4B9ZA 3W4RA 2OSYA 3QGVA 1JZ7A 3WDHA 3VMPA 3WUFA 4AD4A 1R85A 2YDSA 4J3WA 3CPUA 3IK2A 4HZ7A 2CBJA 1BVZA 3SCNA 3S2CA 1E4IA 3BAJA 1UQYA 5F7UA 2WPGA 3WQ5A 3F4VA 5ABEA 3SUSA 1QNQA 2ZUMA 4PMVA 4U3AA 2CBVA 4Z2LA 2Q8XA 4NF7A 5C8BB 2D3LA 2GSJA 2VZTA 2OYLA 5BXTA 5A69A 1JYWA 1MW3A 2AAAA 3CUJA 3SCPA 1R7OA 2QF8A 4UFIA 5LYRA 4B9YA 3T09A 1K9EA 4AD0A 4JIEA 2PWDA 1G5AA 1CIUA 3W28A 1HKJA 4IISA 4HMDA 4YPJA 2GJPA 3FNDA 3UEQA 2CNCA 1MW0A 4AZBA 4UQ9A 3RCNA 3AIVA 3ZJ7A 2ZX6A 1UWRA 1UR1A 1XCXA 1H3GA 4MJ4A 2C8NA 1JGIA 2XWDA 3AZTA 1BYCA 3CUGA 1X1NA 2YLLA 1UA7A 4YHEA 2NW0A 1EHNA 4RE4A 3PZMA 2WW5A 2VQTA 4S3JA 1Q6FA 3LMYA 3WQ6A 1HKKA 1SFSA 1XV8A 1KXQA 2WZIA 3F5JA 3AQUA 4UTFA 1Y7VA 2GVYA 5EFDA 5I5RA 2GJXB 3PZIA 2Z1SA 3ZJ8A 4J3XA 4RE2A 2J7DA 5BXPA 3KL5A 5CZKA 5A6MA 4AZ5A 3WD1A 1KQYA 4AC1X 3LPGA 1LL7A 3AS0A 3VDAA 1JD9A 3THCA 1CXIA 2D22A 1GORA 3WD4A 4AZ6A 3WNLA 1JZ5A 4JAWA 2ZXBA 1WE5A 1I1WA 1VFMA 4J3VA 1VRXA 4GI6A 1MQQA 2CBIA 2YJQA 8CGTA 4N42A 3W26A 1XCWA 2Y24A 1W91A 3RPMA 2XYLA 3AISA 3PBGA 1PEZA 1QI5A 3SUVA 2QPSA 1BHGA 5D9PA 4MADA 1NWTA 4F8XA 2J4GA 1ZBCA 3CIVA 4CD5A 3VD3A 4DM2A 3U5UA 2CHOA 1WB0A 1EA9C 2DGAA 2WVSA 1DTUA 4Z2KA 3AIQA 4JKLA 1LF1A 1PJ9A 4AZCA 3AIBA 1E3XA 1QOXA 1J12A 1B9ZA 1UR2A 2WKGA 1V6VA 1B0IA 3I3DA 1GOWA 1TZ7A 3WMCA 4UR9A 2E4TA 2DDXA 2HVMA 1ZS2A 2X0YA 3HN3A 1OSEA 3W25A 3T2PA 2JE8A 1F4HA 1UKPA 3AHXA 5I2UA 4NSBA 4DUVA 1Q4NX 1ZBKA 4BQ4A 2IXUA 4ACYA 4J3SA 4BA0A 2X1IA 2FH8A 2V5CA 1W9BM 3WNOA 1WO2A 3J7HA 3AFBA 1JXJA 4U2ZA 2E8YA 4B16A 2WVVB 2WWDA 2X8RA 2JIEA 3MS8A 1OINA 1J0KA 1B2YA 1DP0A 4QCEA 4DWSA 4J7RA 1HL8A 4CD7A 5E0FA 3BMVA 4FLSA 3WH6A 3GXIA 1H09A 3T0DA 2CBUA 1J10A 5BRQA 3VIKA 3WNKA 3VGEA 2ZIDA 4AMCA 3WQVA 1UQZA 1X6LA 1Q6DA 3BAYA 2WBKA 3OIHA 2XM1A 4U33A 1A47A 1VENA 4H7VA 1B30A 2Y8VA 1BG4A 4CCDA 1XH2A 5I77A 3VNYA
chains in the Genus database with same CATH superfamily
1YDOA 2CLKA 2QUMA 4EVZA 3QVQA 1DQWA 1W3NA 1IHIA 2HJPA 1DXFA 5FEPA 4EKJA 4LRTA 1HVQA 2IMRA 3LLXA 1XL9A 1KWGA 4ZOBA 3QLLA 3B9AA 3ONCA 1I4NA 3IIXA 4H19A 3DIPA 1IEXA 4ZQMA 2ZE0A 4I9MA 3B0XA 5ENLA 1AD1A 2QJJA 4GUJA 3IV3A 1JDDA 2VEMA 4FO4A 1POJA 3L4YA 3SBFA 3E5BA 2NQHA 1WZLA 4A8IA 2HISA 4W8AA 1KV5A 1G1YA 1RA5A 4XQ6A 3P3BA 3V7PA 4XSLA 5HQEA 2GUYA 1CB2A 4W5UA 3OVGA 3SJ3A 3I10A 1RBAA 3PUOA 4PSPA 6REQB 1XLKA 4NNBA 4ATLA 1Q6GA 4MKNA 1HFBA 2X2YA 3CO4A 1TJ0A 1H2JA 1GOIA 3EB4A 3AHVA 4BS0A 2C79A 3MHFA 2D69A 4B3ZA 2OX1A 2Z1VA 3ELFA 3TXVA 3QRHA 3OB8A 3QYQA 4N9EA 5AC7A 5IXEA 3B0PA 3TW7A 1DWHM 2F84A 3L66A 1BWVA 4DVOA 3B4YA 1MNZA 5M5DA 3SCOA 3HGOA 1F74A 3L4VA 3N4AA 1TTIA 3RO8A 1F2JA 3POCA 1EJSC 2PSNA 3S5SA 1ZRQA 4ZTYA 4O0QA 3M0VA 3MMTA 2OLSA 1TIMA 1V4YA 3KCJA 2ISSA 4L1GA 3MZ2A 3NM1A 3RIKA 3ABSA 4JGDA 2BVDA 1NOWA 3TOPA 1ZP3A 4WRHA 1H5YA 2DSVA 3GXTA 1OFPA 1FP8A 2VD8A 3ARSA 3HURA 1M01A 2XFRA 5HULA 1QW8A 3G77A 1ONEA 3B8WA 3QHOA 2WV8A 3VE9A 3AS2A 3H23A 4J35A 1EF2A 4JXCA 3UXKA 1ZUAX 4H7ZA 5DO8A 4Q6JA 4DNHA 4R85A 5HPCA 1BSLA 1XYFA 3P74A 1FH7A 2YIHA 4PUJA 1KTNA 1F5ZA 4OUEA 4XO7A 5JXQA 1DWGM 2H3DA 2VRQA 2BY1A 1JVNA 3O16A 5HMSA 2DUXA 3G8EA 1Q6LA 7ODCA 3L21A 1YTDA 5TD4A 5KZMA 1EBGA 4HPHA 3P0WA 1RVKA 1XYMA 4DPPA 2VC5A 1N7KA 1E15A 5AC5A 4D6IA 4MSSA 5HA7A 3HO8A 3LV6A 3Q45A 2D73A 2EJAA 2E09A 4XBKA 1NTHA 3KWSA 3SEPA 3GTHA 1TREA 1VBRA 7REQA 4RPQA 2B31A 1YIXA 3W70A 3EB2A 4FLQA 1K6WA 4MKSA 2YL9A 1E6SM 4C6IA 2O0TA 4E2BA 1LWHA 3M64A 3H4GA 3ZLFA 3LD5A 1XDMA 1CWYA 4UTHA 3UWYA 3GR4A 5DMLA 3GIQA 4RE3A 1I45A 1YADA 3I3EA 1H41A 3C3UA 4AX6A 1GJPA 2JKPA 3TAKA 3PN8A 3G24A 2ZTKA 4IFKA 1HKVA 5HNUA 4EP8C 3K8KA 4LX4A 4C6EA 2ZX8A 4IP5A 3VCNA 3ZSTA 2CLLA 1W3LA 4UTKA 1CW2A 3VINA 2FTYA 1NOUA 4GUFA 1L6SA 3QHNA 3N29A 1JYXA 5F2GA 4KGLA 3HMCA 3W1MA 3SW6A 3N1AA 3W6LA 4O10A 1ONWA 1Y5XA 4XV0A 3WFAA 3WSUA 3R5EA 1PCKA 5IDZA 4FOUA 4GY7A 1OVDA 3VDBA 1NWRA 3T07A 3W81A 3KDOA 3AHYA 4LF1A 2QQ6A 3C0JA 2HMCA 3FKRA 2WZMA 2DZBA 3W7LA 4WVXA 1KW1A 3M5XA 4H04A 1F4AA 1DTNA 3OVQA 1ZGDA 3DKLA 4MPKA 4XKMA 4CNNA 1Z44A 4QG6A 1X1OA 4C6BA 1JCJA 4GVFA 3EOUA 2C1GA 3IJ8A 3NGFA 5I3JA 5TBOA 5A94A 4H9ZA 1MVYA 1IXQA 1QI2A 3MKCA 2CPUA 1K8ZA 2DSUA 4ES4A 1M7OA 2Z4GA 1V0LA 4XKYA 2VFHA 3OLEA 2ZRWA 4A3QA 4XAYA 3EPOA 1TMHA 2CERA 1R3YA 3VIFA 3H7RA 1Z7AA 4B5TA 4IPPA 2ADAA 3EDDA 2Y7FA 1AL8A 3LX9A 4PMXA 1I2QA 3BAIA 1Z32X 2CZFA 2OEKA 5C9ZA 3UWEA 1FX6A 4P8UA 1J6OA 4IF2A 4O57A 1I2RA 3BL3A 4TOQA 1WV2A 2J9XA 1JQVA 5AHLA 4Q22A 1MYRA 1W8SA 2ZBTA 4FSAA 3KRBA 1JDFA 3C5QA 1H0GA 2XG9A 2VX4A 2Y7GA 3GNPA 3TQVA 3UU0A 5C2XA 2XVPA 4J2MA 3W1TA 4UTWC 4US6A 3TVAA 1UH3A 3BPWA 4EWJA 1KRBC 1JFHA 4HNCA 1QDSA 3R10A 5CC3A 2ZUWA 1I1XA 2VOTA 1Q65A 1XR2A 5C6MA 2PDLA 3BURA 2V82A 4GK8A 3W73A 3BOLA 3GU9A 4W86A 1VFLA 2VURA 3LQLA 4V2XA 3PNUA 3GC5A 2VJXA 3QTPA 1V6WA 3WJZA 4HP5A 3GTNA 2CYGA 1RK6A 4L65A 1YW1A 3NQGA 1GNXA 1CXFA 2OSXA 4C1LA 4IP4A 2QV5A 4V28A 2C6QA 3VUSA 3RU6A 2A6LA 4WR3A 1IGSA 5AHFA 1JZ6A 3WKZA 4E4UA 3ITXA 3RJYA 3W02A 4UFMA 2H3BA 5I3KA 1EKOA 3TNOA 3ZFHA 1I60A 4C1KA 3GIYA 2ZZ7A 3WLSA 4MG4A 9CGTA 3QR0A 3FS2A 1FFQA 3DX5A 2CKSA 4WXYA 2WSQA 2AQVA 1DIDA 3VIMA 3PWAA 1K9TA 4W7VA 1EGVA 1JI2A 5G2IA 2VP8A 2QJIA 3R2GA 3S5ZA 3HPXA 4H00A 4RV3A 4GKLA 3V1PA 5EFFA 3TTQA 4QAWA 3PJTA 3TLLA 3W7MA 1R87A 4S3EA 3UJFA 2C0AA 3PZUA 4AHQA 5MHBA 4AD3A 4A3YA 3K1DA 4Z2JA 1UD5A 3SUUA 1RD5A 5M3WA 2Y1HA 3DH7A 4O54A 1W54A 1TWZA 2VEFA 3KRZA 4OGZA 4GYKA 1PXGA 1XSIA 4W8BA 3OOQA 4GYPC 1KFBA 1WKYA 4RCXA 3TWAA 4F2UA 4E5TA 3UCQA 3SGUA 4DM1A 3HV9A 4Z0JA 2D20A 3GBEA 4L6OA 3N25A 4FA3A 1O6IA 1QW7A 1OY0A 3C0LA 3LRMA 4Y96A 1IZJA 2UY4A 2YL8A 1ZNNA 4UQEA 2OO6A 4GI8A 2V81A 1CLVA 4IIBA 3KZSA 1IIHA 2DIJA 3SQSA 2V67A 1QVBA 1BYDA 3DC8A 3NYDA 3UWWA 3UPMA 3KE0A 4UFKA 2WCSA 4FXRA 4NJIA 4JPGA 3M5YA 2C14A 3W2LA 2ZFAA 4ZXLA 1DQXA 4GZEA 2BG5A 1QNRA 4HMNA 5FKYA 2VX6A 5IFTA 3E12A 3KAOA 5HK4A 1HQTA 1PBGA 5E70A 5LA1A 4XVEA 1ADSA 3AROA 1SO5A 2W3ZA 1W3KA 1TTPA 3PUGA 5HNRA 2JQXA 1VHCA 4JFSA 3HJEA 2ZOXA 4TVCA 3L4XA 1EGMA 2OEMA 4A8LA 1RCQA 5EKYA 5I09A 2VD9A 4J28A 5D8ZA 4UMCA 2PDWA 4M82A 1AG1O 1UR9A 2UY2A 3LPPA 1G7UA 1LG2A 1SFTA 2D2OA 1IV8A 3EDEA 3VIPA 5FSDC 3LBMA 2YZRA 1TV5A 4CNUA 2ZQ0A 4ZL1A 5HNNA 4ZB0A 1SYTA 1QFEA 1PPIA 3VKKA 1R3RA 4AU0A 2J74A 1KV8A 1TVNA 4MWAD 1WUFA 1UD3A 1H63A 1TWSA 2VNCA 1S2WA 1QBAA 2ZUUA 4QS6A 2INEA 2J78A 1MRQA 1YYAA 3L4ZA 1OX5A 2OLHA 2WZHA 3FW6A 1WDPA 3OQEA 2XIIA 3T2QA 3UERA 3ECQA 2YB4A 4H6QA 5I78A 4U3CA 1UMLA 5JH1A 3S6OA 3PJXA 1QO5A 1FHVA 5E93A 2ACQA 3CXOA 5C55A 2ZXDA 3GAYA 4L80A 4F2TA 6A3HA 3CIWA 2V2HA 1VJZA 1PKMA 4KEMA 1H1YA 1Q66A 3IJ9A 1M5WA 1QNVA 4IIHA 1PVNA 1ZCCA 3UXIA 4LFYA 5XINA 3LGGA 4MZ8A 3CV7A 3DHPA 3MMDA 4ROPA 1E5NA 4G6CA 1WQ5A 4LV9A 5HR7A 2QVNA 5KINA 1TSIA 2YA1A 1FXPA 9XIAA 3MJMA 2ZZ3A 3KM8A 4DLFA 1PTAA 2FJKA 1LLOA 5E9XA 1G01A 1YRRA 1OQFA 4AAJA 3TXZA 1HXJA 3TCEA 3FEQA 1JF6A 3D5HA 4QNWA 4N6FA 3CC1A 4C6DA 1QJWA 3RRXA 4X0VA 3ZT7A 4RL3A 3AJ7A 2HBVA 3VDHA 5CJ5A 3D46A 3SRHA 3LB0A 4HPJA 3V5FA 1QNSA 1ADOA 2Q6ZA 1D7FA 1FWJC 1K9FA 3VTRA 4WUIA 3DFOA 3HIJA 3OBAA 3KOYA 3FVMA 5BMXA 1UKOA 3N3MA 2XVGA 1LROA 1MW1A 4GXMA 2Z1WA 3WEMA 1XGEA 4V33A 4UOJA 3P14A 1S2VA 3CTLA 4JTGA 2NX9A 2BY0A 2I14A 2RDXA 4GMEA 5KETA 1IEIA 1W9PA 4I7WA 5F1VA 3W7CA 5CCZA 3UNDA 2DQXA 3VKBA 2QCNA 1FA2A 2FPVA 3CT2A 3NYZA 7A3HA 4JHOA 3S2JA 1V08A 4R33A 4RXFA 4AIEA 2BXYA 3M46A 3STEA 2AKMA 5MKGB 4O16A 1B3ZA 1OADA 4JCMA 4GFSA 3OGSA 3OJGA 1P43A 1YNPA 1YEYA 3LOTA 2OVLA 3NVTA 5J04A 1GT8A 4Q4OA 4UBPC 2PRMA 1E0UA 1X96A 4W7WA 1MFUA 1TO3A 2XVLA 3UYIA 4UWMA 4XZMX 1FWHC 2ZVIA 4WF7A 5AYXA 1O5RA 1PAMA 2V30A 1L6FA 4DYEA 4KH2A 3AMKA 4PMZA 1TV4A 2I5GA 4HGXA 3L12A 1J01A 4I5XA 4B3LA 2WC4A 1XLHA 2CC0A 1LRQA 7XIMA 4MY8A 3LHTA 4GQGA 3H22A 4GY1A 1FP9A 1QWKA 3EEZA 4D72A 5DY2A 3Q67A 3TC7A 3P7YA 5FJOA 3LGDA 2VGGA 4AY1A 2A4AA 4ADTA 4CQDA 1J0JA 5EA9A 1M65A 1UD8A 3GW3A 1E70M 3O6YX 5L6UA 2A7NA 1R3TA 2Z00A 5G1TA 4M1BA 3G18A 3GTIA 4JNZA 3SCQA 3XINA 4C65A 3PY2A 4Y9NA 1GJUA 2G3JA 1QU4A 2NXHA 5KZEA 1SO4A 3ITOA 1NOFA 1F73A 4CN4A 3EOSA 1EYWA 3EWDA 4S3GA 5PTDA 1RA0A 3F7JA 5BOFA 4LW7A 5D2WA 4ZQPA 4BZYA 5CQ1A 3PFMA 1K9DA 4ZOCA 1XPGA 3AC0A 4XAPA 1B4EA 3C2RA 1XP3A 2C0HA 1DHPA 2OXNA 3VIGA 4OU1A 2YDRA 2DSKA 4D6GA 1XYBA 1K8XA 2IPGA 4YYFA 1AMKA 1W9XA 2Y61A 1L8PA 4HQVA 3TU9A 1VFFA 2A3LA 2HTMA 3T2OA 1AW1A 3N9KA 4HSNA 3RX3A 3ZLGA 4GLEA 4S38A 2E6YA 1EIBA 1KLYA 2WMIA 3A4WA 1V03A 2F38A 5JBFA 3KFTA 1R3QA 2YL6A 2A3CA 4A4AA 2PMQA 4MZYA 1B9BA 3UF9A 2J7GA 2C16A 1W0MA 3D47A 4PUDA 2P8BA 1Y8BA 1KXTA 1R9YA 2V3DA 3RILA 3MUZ1 1VJSA 2GGGA 1ISWA 2IKJA 3DI0A 2PLKA 3GFYA 4JHZA 4KRZA 4M5PA 3C8NA 2OX4A 1R3WA 4O19A 1EJWC 3WEOA 4LBSA 3OLGA 4ZXOA 1S2UA 1QATA 1ZB5A 2VR5A 3EOOA 2YOCA 2PTZA 3EPNA 3TR2A 3OGRA 4LC8A 4CVUA 3VVGA 3QFWA 3KCLA 5C9RA 5GNYA 3W7KA 2BVYA 3ZVHB 1GOXA 2FQIA 4GQBA 3BK0A 3H70A 1NFBA 3N9SA 3M47A 1HP4A 3N04A 3NQFA 1WNOA 2CLFA 3T9PA 1ENUA 4Q8VA 3VNMA 3U2ZA 1UWTA 3K8MA 3G0XA 3WQPA 3DCPA 3GG0A 4NY2A 2PA6A 3I6EA 3CLWA 3CM4A 3IIOA 3QY6A 5FAGA 3KP1A 3LXBA 1E55A 2WPBA 4KIRA 2QMJA 3V0TA 2A2IA 4H9XA 3F5LA 2V0TA 2QDHA 4FXJA 4QQUA 2WVTA 3PTDA 3FKKA 4IMDA 4KWOA 1W3HA 2ZADA 1JAKA 4NX0A 5A6SA 3S8HA 2YCLA 1JUBA 1TELA 1H11A 3HF3A 1UHVA 4YHGA 2FTPA 4RNHA 4IQJA 4M29A 1RLDA 1ZAIA 8XIAA 1FDZA 3MBDA 1N82A 2ZRVA 1GUVA 1JZ3A 3NDOA 1W1ZA 1MFVA 2CETA 3B8IA 3HQ1A 3NPWA 3AICA 4PTNA 4C6NA 5AB3A 5DFAA 1DJXA 1H5VA 3DUGA 1A3WA 4PN2A 5D2TA 3VNIA 4YCOA 2E5CA 2P53A 3AO0A 4Q32A 3N4EA 2PDGA 3S5NA 3W24A 2I5IA 4TO8A 4XX6A 1LP6A 4LAOA 1VHNA 3VM5A 4WCJA 3A5VA 1XWYA 1I2PA 3CZKA 1PB0A 1X1ZA 2FFCA 3BJSA 3CYVA 2YZ5A 3V5CA 1RQHA 2VVSA 1QI3A 6ENLA 2F6XA 3TA6A 1W5NA 2YB1A 3OBEA 2IS7A 4EE9A 3QV9A 2E68A 3ARQA 2ICSA 5D02A 4PUEA 4IJBA 4MLRA 2ZC8A 2V5BA 4RK8A 3F5KA 2IPFA 3VOCA 3BW3A 1DJNA 2CHNA 3QXBA 2ZDRA 2ALRA 1H62A 4GI9A 2EHHA 3UY7A 1XICA 5D37A 3K13A 1OGBA 1TB3A 3HPFA 2EPNA 3GHTA 5LIKX 4O4WA 2J6VA 3M41A 2PU0A 1NDVA 2AGKA 2VDHA 3COTA 2RGLA 3WLPA 2BHZA 3SJNA 3N14A 5I06A 3KBNA 4QBXA 2BGQA 1ZALA 1CZ1A 5E1QA 3DBNA 3MP5A 2YL5A 3BICA 2VGIA 1KCZA 2IUZA 5G4EA 1TZ9A 1QOPA 1QNOA 1OFOA 2OCZA 3PZGA 4JIQA 4QNEA 4PSRA 1RBOB 2CLHA 1XDJA 1LG1A 2KZHA 2XIJA 4JS3A 2WSYA 4J27A 4IIEA 3THQA 5E0KA 2NVAA 4PFHA 1VPYA 3U8GA 1VBHA 3G6MA 1REQA 2W61A 4Y90A 4OKDA 1ISZA 4GO8A 3CHVA 3LG3A 4RDZA 1O5QA 3LQGA 3LZ3A 3V4BA 3WL1A 2QPUA 3WN6A 4QP0A 3OU8A 1OFDA 2R1PA 1J0ZA 1P0BA 4JFTA 3VIJA 3HA1A 2W67A 5DCEA 1CNVA 2PODA 1XYZA 4JQ3A 1IIGA 1AA1B 4XWUA 3BMWA 5C2CA 2EG7A 1FHDA 3IJ7A 4ILSA 1Q6EA 4C91A 1JPDX 1W1VA 4UTWA 2R8WA 3R8RA 2OFJA 3CU2A 4HK5A 2RDTA 2WBGA 5I6SA 1FWFC 5DELA 2J88A 3W01A 5I3IA 2JALA 1KFEA 4AD5A 2PDQA 4HU8A 4Z42C 4AHPA 1MDLA 4A3RA 2W9MA 1RY8A 4DJEC 3TSMA 2FPTA 3U5YA 4FXFA 1DE6A 3RF9A 3I65A 3B9DA 1OYCA 5EMMA 1M7JA 4RJEA 3ZR6A 1VQTA 4HHHA 4PMYA 4FLRA 5FEZA 3W88A 4B5VA 3Q2DA 1DJZA 5CGQA 3EMQA 2DU2A 4Q7IA 1PIGA 4NT0A 4RPPA 1CTNA 3N17A 3AHTA 2GWGA 5AHIA 1QHZA 1VBUA 4M19A 5FJJA 1OD8A 3QSRA 2XWEA 3LCXA 1O60A 2Q8ZA 5MF5A 3MUIA 4O18A 3SDOA 4S2BA 2G4JA 1RXOB 3ME3A 3SR7A 4M6QA 3VGDA 4AIUA 4F4RA 4L4OA 4LS1A 5JIPA 5D8WA 3W22A 3EMCA 5AN7A 2ZCGA 4PUWA 3SCTA 5D30A 4ZE4A 1O12A 4DY1A 1UP3A 1J6PA 2TSYA 2NV2A 3T42A 2RJGA 4GPNA 1VLIA 4B9ZA 2R6OA 3HMJG 5JVLA 3PBMA 1JZ7A 5AZ0A 3QC0A 4WJ8A 3P8JA 2FMNA 3DAQA 3HQNA 4ZA0A 3IK2A 1T8XA 4Z0SA 4HZ7A 1R6WA 3ZYZA 4B92A 4E38A 3BAJA 5KITA 3TUUA 3CWNA 1IWAA 3DBPA 6TIMA 1EEPA 4PMVA 2O55A 3B0UX 1RUSA 3TYUA 5C8BB 3BQ6A 4IMEA 4YTRA 3PG9A 2OYLA 3W2KA 4GYPA 3R8HA 4JN7A 2AAAA 3CUJA 3SCPA 4FHAA 2BOFX 4B9YA 4A22A 1F61A 4K39A 5LNUA 3M44A 7REQB 4KKXA 3GDRA 4IISA 3FNDA 1MW0A 1SZGA 4B4HA 1KFJA 3ZJ7A 1UR1A 3OBKA 3WBYA 2FZDA 2XWDA 1F07A 4RXGA 1BYCA 3CUGA 1X1NA 5BNKA 3W1LA 2PD9A 1DIKA 3VZYA 2WW5A 4JQAA 3GIPA 1FWCC 3NOYA 3BJTA 2LLEA 1KXQA 3F5JA 1DXEA 4XISA 2FPYA 3QV6A 1Y7VA 2GVYA 3MSRA 5I5RA 3R11A 1FCQA 1Y5WA 4LY8A 3UWVA 1TX2A 3GNDA 3JW7A 3N2XA 4ZCWA 3ZJ8A 3NQ6A 1LM1A 3DGBA 5CZKA 2F2KA 2OU4A 4X2PA 3T7VA 4KCTA 3A5FA 2QUUA 1C9DA 2XIQA 3THCA 4DF1A 3WD4A 4XZIA 3N3TA 3V75A 4AZ6A 4EIVA 4AH7A 2HXUA 3GB6A 3WNLA 3PNZA 3O63A 4YYCA 3LHZA 1V5XA 1Z8AA 4XO6A 3DHFA 1VRXA 3DN5A 1XCWA 1GK8A 1J2BA 4LUJA 3RPMA 3CJPA 3PBGA 2EF9A 2IPJA 3VNDA 3LCGA 3SUVA 4KT2A 4JX5A 1LT8A 2GGEA 3VOHA 1EF3A 4S3CA 3P81A 1O5KA 2PS2A 1N8FA 3CIVA 2CLOA 4FS9A 3M1ZA 3U5UA 4YVPA 1DTUA 1I0BA 3BO9A 3CPRA 3W7PA 1QOXA 1VFHA 2P50A 4DO6A 5EMUA 2WKGA 4V15A 3I3DA 3T81A 4EWND 4AQLA 3WMCA 2DDXA 4QM1A 4GNVA 3G2GA 3P8IA 1V6TA 3W72A 4IPIA 1UKPA 3ZS4A 3E0VA 1D3GA 3PWIA 1F6KA 1TJ2A 4BQ4A 4PA8A 3B04A 4ACYA 3LN3A 5H8UA 4TR9A 1J8VA 4GFIA 2FH8A 5C5YA 3QH2A 4LUYA 2JKAA 1WXJA 2NZLA 3MB9A 1WO2A 3L5LA 5BOOA 1JXJA 3G1XA 1P48A 5FJUA 3BCJA 3O06A 3MS8A 4XBJA 3W1RA 5EMLA 5I02A 4J7RA 1HL8A 1DQUA 4NZJA 3BMVA 3OYZA 3GXIA 3T0DA 4GCXA 4AWSA 4NJJA 3WX7A 3VGEA 2PEVA 3NZQA 2J13A 3WQVA 4LOCA 3LHUA 4J4KA 5AC6A 2V6AA 2C3ZA 2WBKA 4XAZA 1NF0A 4HJFA 2XZ7A 4BI5A 1LYXA 4HYVA 2XM1A 2OKOA 1KLZA 3O7UA 4F0KA 2Y8VA 2UV8G 4O1EA 3OHIA 1V7AA 5D04C 3EA3A 3KX6A 3L2LA 3C0SA 2OT0A 4E8GA 2JGYA 1TZZA 3KS5A 5BYWA 1R8LA 4KBXA 2ZXAA 3CNYA 4RV8A 3B8TA 1W1PA 1HVXA 1YXCA 1PIFA 4MB5A 4LS0A 1JCXA 1VEMA 1EB3A 5CLTA 5C71A 3E9AA 4OE7A 1CPUA 4KEUA 4PMQA 1F3WA 1UJQA 4HYRA 3TYBA 3TC3A 3RRAA 5EYWA 1CXHA 5I07A 3STFA 3W7QA 2PC8A 3WDIA 3RJXA 1XQLA 5IFPA 2TPSA 5G2HA 3TYAA 3W75A 1QWGA 4HB7A 3GDKA 3MDUA 2WVUA 3CYJA 4NI3A 3AUOA 1TJPA 1XRSA 3QM3A 3GYEA 1MUCA 3USBA 4DJDD 1KBLA 4NJGA 1W37A 4IPNB 2WAGA 2ZZ4A 1FKWA 2ZUVA 4RZBA 1B3OA 2PBOA 3S9IA 3O6CA 1V7YA 3WDJA 3KVKA 4GJIA 4IGSA 2XH4A 4OOZA 2GGIA 1R30A 4A21A 3BAXA 2X42A 2J75A 3EX1A 3VXGA 1XLAA 2ZWYA 4UFJA 3NSXA 2BBFA 4KFOA 3RLGA 3ABQA 3HPAA 3KOXA 3AZSA 4EXQA 4ZE5A 4XZ9A 3CMGA 1KO0A 3I7SA 4B3KA 1AZ1A 4MNKA 4C6FA 4G2DA 2OZ0A 2PE4A 2OJPA 3L68A 4S3KA 3BGJA 4UOQA 1JZ8A 3GLCA 1WCGA 1BXNA 2OYKA 1LOQA 3Q94A 4A29A 3SECA 4GZIA 3SO7A 2J8FA 2YCEA 3NO3A 4PC8A 4MPQA 4YJ5A 2ZRUA 3SY8A 3CASA 1G7VA 1QW9A 3TAOA 3NWRA 4NL1A 3P61A 1VCGA 4G7EA 4PCPA 3OZPA 4DBDA 4GQRA 2ZX5A 1UIOA 3U4FA 4QSFA 4X0NA 4F66A 5LHFA 1ZPTA 5DX7A 3IJDA 5IOBA 2OSWA 3O6DA 1YDNA 3WFLA 2Z2UA 4MNMA 3UJSA 3FYYA 1KFCA 1YDVA 3WH7A 4QIUA 2V5KA 2ZZ5A 3UR2A 2Y5JA 2P0IA 4PCTA 4DWSD 2NQ9A 1WKDA 3NFUA 3UXLA 1CXEA 3D3FA 3EKGA 4IL2A 5ECVA 1NELA 1JFXA 2XM2A 3ARUA 1OCQA 4E0CA 4LVAA 1RPXA 4F40A 4WX2A 3SRFA 1G0CA 1V79A 2FFIA 3DEQA 2BY2A 3PBUA 3ARRA 1T5AA 2FZMA 2W5FA 2REQB 3KXQA 1S2CA 4NNCA 2JK2A 5AYYA 3DDMA 1XBVA 1VFSA 3M16A 3UW6A 3UG4A 3AIEA 5CZTA 3F4DA 4UOZA 3CZGA 4MYAA 2HXTA 3VNZA 3QOKA 4L1XA 1FCUA 5BXRA 2ZZ2A 1SJBA 4XUYA 3NL3A 2E6AA 1ESWA 4CVWA 1H7XA 3CZ8A 3DOPA 3L23A 4BQ2A 2Z7KA 1RH9A 1Q2RA 4AZ7A 1BYAA 2G0WA 4GGBA 4UZSA 1HJWA 1YX1A 3PZOA 3O8AA 3R89A 2PGFA 1R2TA 4QTGA 3N18A 3GG7A 1KM5A 4C6PA 5GPRA 1WXYA 3BV4A 5CZSA 5A8GA 2J24A 5IHSA 2WNWA 3S2NA 2B81A 1LCOA 4H6RA 4CEUC 1OF8A 4B5NA 4C7GA 4N9CA 4H6KA 3IJLA 4KCVA 4YNGA 3ZT6A 3PG8A 3EZ4A 2GDVA 3S6DA 2Q02A 2XFFA 4I5UA 1EUNA 4E2OA 4LEQA 4MGGA 3URQA 4CN6A 3VUPA 2BXVA 4S3DA 2Y70A 4CKQA 3W6MA 3ISIX 4HTBA 4IFOA 4UXDA 1A5NC 2B7NA 4J9JA 2E77A 4LSBA 2DW7A 4O1CA 4CNOA 5AYIA 2DPEA 3LBCA 4KRUA 1DWIM 3RDKA 1S39A 4IMCA 2C18A 4K68A 2KAUC 3UGVA 1EOMA 1MXDA 4UTLA 1I2NA 2MANA 3B0YA 3NTYA 1EJRC 3NL6A 2XUCA 5HOSA 1XIGA 2B7PA 4JYDA 4Q33A 4CUCA 2DT2A 4LC6A 2P3EA 4CNSA 4HKPA 5K2ZA 4JIPA 5CC7A 4NU7A 1IXNA 1YNQA 2ESCA 2YA0A 5CZJA 4CCCA 1E6PA 2WKLA 3TQKA 2RKXA 4XVDA 5FA5A 3DYOA 4DWDA 2A85A 4JR5A 2J8TA 4I7UA 4YWSA 3WH9A 2A5HA 4ASTA 4AFYA 3LXAA 5DXYA 4GBUA 3G1YA 1KRAC 2WLYA 1WZMA 1V0KA 2PDUA 3GNNA 1RQBA 4Q4SA 5G4HC 4AD2A 3GO2A 3T4CA 1E1CB 1TWWA 4KQNA 2HK0A 4G5DA 2VEPA 4TXEA 3BCFA 1TRDA 2DEPA 4CCEA 1FUYA 3RFAA 2QMKA 3NXFA 1GOKA 4HSHA 1ELSA 3S9ZA 1E71M 1H51A 4BKNA 1S5NA 2G96A 2Y62A 3GC2A 2GVJA 2ISDA 2WXDM 1BYBA 1HJUA 4A6GA 5CBIA 3KBSA 3N15A 4B2DA 3AZRA 3WF1A 3W7NA 1W3JA 4FR1A 3ZLHA 1ALDA 3CL6A 2F8QA 4D2JA 1XLLA 4AISA 2VVNA 3ANVA 3AYVA 3TQ0A 2QDGA 2XPKA 3PWGA 5DMNA 5A2CA 3EOLA 3FA5A 1A5CA 4JTEA 3WQGA 3MBFA 2P5NA 2PFHA 2E1WA 4HU0A 1JEZA 3QLDA 1DORA 3N19B 3SADA 4XD3A 4EXAA 3AAMA 4UTIA 5CPTA 1DWJM 3M0IA 2A21A 1DKWA 1NM9A 1P0NA 3WELA 3EKLA 2PAJA 2PRHA 1XX1A 1Q6OA 4NP7A 5A6BA 3LCIA 2GFTA 4PB5A 4FLOA 4BF5A 3VFLA 3GKAA 2PC4A 4WDUA 4GACA 1G94A 4YTTA 2CWNA 3G1VA 4ZO9A 3ABOA 1OM0A 3E02A 2OQYA 4B91A 4RNFA 5CXPA 2WM1A 3MU7A 4QDWA 3UFYA 1Q6QA 2JF6A 2Y0FA 4BY3A 3R6IA 3W2NA 2C7FA 4HD5A 3HGSA 4LB4A 3HB9A 4PBGA 1KR1A 4CU8A 1SVDA 3ICJA 1EJTC 1BRLA 4WJEA 4Q3MA 2E5DA 3VKJA 2CESA 4WSKA 3R1ZA 2VUYA 3LRLA 3HV8A 3MA8A 1L9WA 2YCIX 2C91A 3QHMA 1E6RA 4OBTA 2INFA 5AOUA 1IR1A 4EAYA 2D3NA 4GIAA 2ONEA 4EK7A 1WXZA 3OYXA 1W1A1 1AD4A 2XIOA 4FNRA 3GW0A 1WKFA 4DJEA 3BGGA 2XVKA 3NJ3A 4ML4A 2HDJA 1P6CA 3O07A 1W5QA 4QDPA 4N7QA 2PBGA 3VAVA 4K7VA 3PS7A 2NQZA 4PUKA 4JN8A 2E25A 4GH1A 1EQPA 4CLMA 2X40A 3IIPA 4RDYA 1J5TA 3URBA 1JPMA 4HJWA 3EKZA 1K8CA 1I8JA 2O7SA 2CFFA 2DIEA 4WDWA 3FCPA 4HT3A 1XIDA 5HUOA 1YDYA 4R27A 1X7FA 2UY3A 1JXKA 3OVPA 5DEZA 3WMBA 5C9UA 2WM0A 2TYSA 3GXNA 3LLDA 4G7FA 4C6JA 4C6CA 3CGTA 5CJNA 2YDQA 3HU7A 3BVJA 2I57A 3RG6A 1IT7A 1NFGA 2ATSA 3M0YA 1L6WA 1JRBA 2BSLA 3WBXA 3DFTA 2OB3A 3MCOA 3RMEA 2XFWA 3C56A 1IT8A 4KF1A 1F9CA 3SM0A 1KNWA 4O12A 3KWXA 2R91A 1BLIA 4MDPA 4UTMA 4MWAE 4MAVA 4U10A 5FJTA 3WENA 5EBAA 1PYFA 3CQJA 4AEOA 3L0NA 1GPFA 4K38A 3WBAA 2O56A 2NX1A 3WJWA 4NUWA 4AEFA 4OBSA 1EH9A 5KSWA 3EX3A 2ZA3A 3XISA 2V2CA 2OWXA 2EPOA 3VKDA 1VC4A 3MJYA 3FAXA 3K46A 1EC8A 1CCWB 2WNQA 5AVNA 3LCLA 4D6HA 4DXXA 4LB3A 4IZGA 2ZRZA 1Q8AA 4DWSB 2YCLB 4W7UA 1Q4WA 3E2VA 1H7OA 3S5OA 4KESA 1GVSA 2BS9A 4G1KA 4UR8A 1QK0A 3SZ8A 1CI1A 3MC5A 4PFMA 3S0CA 1GOQA 3LBOA 5CSYA 4K8HA 4DZAA 5B80A 3RAOA 2OYMA 1XLIA 4YLWA 2HV5A 1SJAA 4MZ1A 2EXOA 3NQ7A 3EPMA 1OYBA 3KVLA 4M0XA 3WO8A 2IQTA 4D8ZA 5A6JA 1MEIA 5A6LA 1VPXA 1XLMA 2VL4A 4NAEA 5C2GA 2XZ9A 4AY8A 2YFOA 4UTJA 1OD0A 1KA9F 3VE7A 2ALDA 3W37A 4LEFA 4MJZA 4MKVA 5BRBA 3OA3A 4LYQA 1Z6KA 5T9BG 2XH0A 3CH0A 3BDKA 4OZOA 4NNAA 3MMUA 1CENA 1UPMB 3QJAA 4ORIA 1IXOA 3G3MA 3ITVA 2A6NA 2E28A 4XBSA 1U5HA 3P67A 1CGXA 4G8TA 2V38A 2XSXA 2CZ5A 1E1EA 1H49A 4ZQCA 3H54A 1M53A 1HO1A 1P7TA 3IAPA 4HOZA 1NU5A 4DBWA 1IE7C 3K1GA 2PTDA 3QBUA 1SW0A 5HWNA 3TN5A 2XINA 4KGJA 3GDTA 4UR7A 5I3DA 3N2OA 2I1OA 4IP7A 2ZXQA 1UWAA 2GSHA 3VMNA 4A2RA 1M7PA 4HA0A 1YHTA 4Q4QA 3UG5A 3T08A 2NXGA 2DZSA 2GJXA 3I68A 3C2VA 3IK4A 4GI4A 4R5EA 3W2MA 4US5A 4N4PA 3S47A 1RV8A 5IRPA 4FF7A 4H3DA 1EDTA 3WDRA 4QJ5B 5C54A 3URNA 2PDNA 2YX0A 3NQCA 1ME8A 4D71A 1B3YA 3MUCA 2H9AA 4PRTA 3VGGA 4U28A 3M4HA 4F2BA 5CSSA 4HPXA 2WO5A 1XIJA 1ITCA 2PWUA 2GGJA 3F2DA 1EOKA 4AIBA 3FVDA 3U2OA 3TJLA 1XD0A 2ATMA 3SCVA 3CHDA 2EEXA 4IUOA 3KTCA 3FLUA 4R7WA 3H2FA 4HNUA 4DJFD 3IGXA 1REQB 1B4KA 4ZEPA 1GKRA 3GVQA 3SSZA 1GQKA 3NVDA 1YMYA 3NQVA 5H6HA 2HNHA 3W9ZA 3S1GA 3TK7A 4XTDA 3AXXA 1EDQA 5H8PA 5BOEA 2WCAA 3B05A 1XBYA 3ZIZA 1HZYA 1EO7A 5FD0A 3H26A 1EWDA 5CSUA 4K7YA 4GINA 1Q6RA 2D0HA 1FFRA 3A23A 3IRDA 8RUCA 4PE8A 4ZODA 5KEZA 4FEZA 1KXHA 3LSCA 2XHYA 2ABAA 3BW4A 1A49A 3CWHA 1M1BA 1JDCA 4JX6A 4JTLA 4XZHA 2VZOA 3AU2A 3EWBX 5A2BA 1Y5VA 1J93A 1T7LA 4F79A 3W71A 4AF0A 2PWVA 3PZNA 5DRIA 4ZFMA 1LQ0A 4ICCX 4LCQA 4C7DA 3KVMA 4URIA 2Z27A 1AJ0A 3MI6A 2DZTA 2DVTA 2QXWA 2PDYA 4MFEA 3VA8A 2A7RA 5I3FA 1V3JA 2I9UA 2YXGA 3F4CA 3GR7A 4Z2HA 4CD6A 1V0MA 3WLQA 2GGHA 4AG0A 3EWZA 1HJQA 5FF7A 3W27A 3MHUA 1UR3M 2Q71A 4ZZ9A 3A24A 4IM4A 4JEQA 4DQWA 3GFXA 3C2OA 4QITA 1RJQA 3UWQA 1BGGA 5K9CA 2F61A 3W1AA 4Z2IA 3BQ5A 4MJ2A 3POHA 3PPGA 1S1PA 1ZHAA 5A6KA 1XGZA 4QAIA 4DO5A 4HCHA 1GVOA 2MUCA 4X22A 3GNXA 2HEJA 3WD0A 2EBNA 4GO9A 1RSCA 1KFKA 3M6DA 1E9IA 1FWSA 3NQMA 3L0KA 2GYIA 1K4GA 1QTWA 1NP2A 2BXZA 3FAWA 5FOOA 5I3HA 5REQB 3CHEA 1TA3B 2E1DA 3KBJA 5JUVA 3N2TA 2DV0A 1V93A 4FK9A 2PDBA 2PDMA 3UJ2A 2QR6A 1BEUA 3QKEA 5LA2A 1I2OA 2O9OA 2W27A 6REQA 4L6HA 3O05A 2V9DA 4REQB 2GK1A 4D1IA 3TDFA 1MQRA 1OABA 1SZRA 2DVXA 1N8WA 3BJFA 1D2KA 4X61A 4MUZA 2VZVA 5HWMA 3MHGA 5TIMA 1T41A 5CJMA 2OTDA 1WDQA 1FDJA 3PB0A 2X0HA 1WZAA 3FN9A 4O28A 2JBMA 4D1JA 4IG2B 2H8XA 3CEUA 1XUZA 3WJXA 5EMJA 3K2GA 4NRRA 3CZEA 3CV6A 4LYKA 5K9XA 2GJLA 3SN4A 1PWLA 3ANYA 4GQ0A 3JR2A 1YPXA 3F4WA 1FDYA 2J7BA 4S3AA 2ZTJA 4LANA 1BPLB 1L6YA 4GC4A 1GKQA 1UA3A 1W5OA 2QCMA 2VFDA 3ARVA 3A64A 1BF2A 1WUEA 1TX0A 3REQB 3RM4A 3UZJA 1W17A 4GOAA 3OG3A 1K02A 1TFVA 2JIWA 5A8MA 1JDEA 1PKNA 3UR5A 4DELA 3JZEA 4M81A 1XLDA 2QPXA 1E0XA 4RZ5A 1V0NA 4PTMA 2OT1A 4MB3A 2GJNA 4PGLA 1XF0A 1RJPA 1VFUA 3JS3A 5D9OA 3WK1A 3VC6A 1EHAA 5HBFA 1TMQA 3BSHA 4Y9AA 4LGXA 1GKPA 2C1IA 4HMCA 4J1OA 3TTEA 2ZVRA 4M6VA 4R88A 4C1NB 3TJIA 5DN1A 3TYZA 3MSDA 4W5ZA 1OIFA 2ACUA 4IXHA 3WBWA 5U4NA 1EXBA 2Z26A 2B7OA 1MDRA 1O68A 4NZ5A 1LJYA 4UQBA 5HPOA 3EWCA 4DZIA 4I9TA 1CT5A 2QT3A 5M2FX 1UZ4A 1Q5MA 2JEPA 4QG9A 3A4XA 3R0UA 4TUFA 3TWBA 4MWAC 1OCNA 3B03A 1RP9A 2YA2A 5G2WA 3H4WA 1XGDA 1SFJA 2QVHA 3CH9A 4UZUA 1ODZA 1JQXA 1Y0EA 2TODA 3JVAA 1JDAA 1W6TA 3ZZ1A 5D09A 3THAA 1NP0A 1DPMA 1AUSL 2FDMA 2RHGA 3DFYA 1W31A 1VKFA 4PMJA 1W9DM 4C5YA 3W23A 2P0OA 1UR4A 3TZFA 1DYSA 4TX6A 3SY5A 1EP2A 2FVMA 1M41A 1OGSA 2I9EA 4WGXA 1E4NA 4MHBA 1ZSXA 1T99A 2Z6JA 3CZJA 3WIJA 4PH6A 1K4HA 5FF3A 1X39A 5A8NA 1OG0A 1AJ2A 1DVJA 4WOQA 3G1AA 2QGYA 4J3UA 1W3TA 1S2AA 2DORA 3ITGA 3ARXA 3N6HA 4CQAA 1QR7A 2IQ0A 1Q8JA 5A8OA 3VIOA 1J11A 3NPVA 5AC8A 3TQPA 2INZA 3GTXA 3WF4A 1CGTA 4MLJA 1GTEA 3QQWA 4NASA 1MEWA 5D05A 3E6EA 4R9XA 1OHLA 4PTXA 2FHBA 2VI0A 1VAHA 1MXSA 4FNPA 3WF2A 2V63A 4MNJA 4AVFA 2BNJA 3DFNA 4YN5A 3H6OA 4L61A 1JG9A 1IZCA 1EUAA 1H7NA 1EJ7L 3WLNA 3WH5A 3NSMA 3AALA 4P8XA 1Q7QA 3RR1A 4P7QA 5I0DA 1XIMA 3E1F1 4JY8A 1M7XA 4P7RA 1T8QA 3BARA 4D8LA 3NO5A 3C8FA 3CS2A 2OZ3A 2PDHA 3CQ0A 3S6TA 2F6KA 3SSJA 3UVAA 1RALA 3R58A 3NOEA 1L8NA 2JGQA 2O9TA 2E7FA 3HQPA 4LU0A 2CZDA 4Q4PA 2QUVA 3AIRA 3ABZA 1O7AA 1F3EA 4KIEA 1JCNA 1ITUA 1TQXA 3W1NA 2Z24A 1ADDA 2OEJA 1BKSA 1T6MA 1ZZMA 5D4YA 3T1GA 1K7FA 1S1RA 1E0VA 3PHAA 1LTDA 2AQOA 3G0SA 4I90A 3C61A 4QDMA 4XZWA 4CQ8A 1V8EA 5E0CA 1HGYA 1PS9A 2Z1BA 3ZSSA 2J7FA 2WZEA 3B9OA 1QUMA 4H9UA 1D9EA 4FIRA 3NEHA 2CITA 3W7OA 5I00A 1C91A 3ZWTA 2YFNA 6PTDA 3R25A 2OSYA 1TVLA 1DE5A 4ZFCA 1PTDA 1FWNA 3WUFA 4AD4A 4R9OA 1R85A 2YDSA 4J3WA 3U2EA 2ABBA 1TV8A 3W7GA 1Z89A 3A22A 6ALDA 1MMFA 3SCNA 1S5TA 1E4IA 1G6CA 1XG4A 2QZRA 3UP8A 5G5IA 3WQ5A 1TV7A 3UWUA 5ABEA 2G3FA 1QNQA 2C19A 4HN8A 2C71A 3CAKA 2CBVA 3ATZA 3HOJA 4DAFA 3FDKA 3P2VA 2Z1XA 1EA0A 4AVOA 2P76A 4JIIX 2Z25A 3DG6A 5D03A 1DJGA 4HK6A 5LYRA 4UMBA 1PDZA 1EP3A 1I6NA 4GJJA 5E5CA 4HNTA 3ID7A 1Z69A 4HMDA 4IGHA 3UEQA 2V5LA 4AZBA 2PCQA 3I7RA 4UQ9A 3RCNA 1XCXA 1H3GA 2IKIA 1JGIA 3XIMA 4DZ5A 3AZTA 1XYCA 2ODOA 2DZWA 1YTKA 1UA7A 3QV7A 3C86A 3QQ0A 4YHEA 1TPB1 4C6LA 3QTGA 3STPA 4S3JA 1Q6FA 4I9JA 1SJCA 1XV8A 4Y2WA 4UTFA 2HVNA 5CPLA 5EFDA 3QY8A 1LBFA 3K4WA 1UBPC 4EXBA 4J3XA 1A0CA 1H7PA 1RVGA 1TTQA 2PRLA 1U1UA 1NFPA 2WQPA 3WD1A 1XUUA 2QAPA 1SW7A 4HHPA 3V5OA 1KTBA 1ICSA 1JR1A 3VDAA 2D22A 3EOEA 1ZTVA 3UA4A 1KD0A 4PB3A 4BR1A 1OC5A 2YJQA 1OC7A 1JCYA 3W26A 3RXZA 1W91A 3TN6A 3BLLA 2DY3A 5D38A 1BWLA 1W1B1 2DZVA 2QPSA 3V3WA 3ITLA 4BF9A 4MADA 2HBXA 2I5QA 3DKJA 1J96A 4RW3A 3VD3A 4H1ZA 2CHOA 1SPQA 1WB0A 3DFSA 1EA9C 2DGAA 4Z2KA 1XBXA 1LF1A 3C3NA 1YBQB 2FZNA 4ZSUA 4MOZA 4H7CA 3UXAA 4KWSA 3IJIA 1UR2A 1W8GA 2EPHA 1N2VA 2YW4A 1V6VA 4TQTA 1B0IA 1TZ7A 3HG4A 4A2SA 3GVRA 2HVMA 3FIGA 5A6TC 1S38A 3M43A 3KRSA 1EJUC 4Q6XA 3NL5A 2QULA 1A80A 3GHUA 2R14A 4GVIA 3RMJA 4NSBA 5CPMA 2PZ0A 1Q4NX 4J3SA 2WZTA 1L2UA 3IVSA 5F4SA 1BXCA 2YXXA 2V5CA 4DXVA 1WBHA 1W9BM 1GVEA 4O0ZA 1XBZA 4U2ZA 3GWQA 1O4UA 2VGBA 2JIEA 3UZXA 4GUIA 1B2YA 3P5YA 4JTQA 3FJNA 2B0MA 4FLSA 3WH6A 3VIKA 1G4SA 5AVHA 4MMWA 2P88A 2QF7A 5HWJA 3KTSA 2QCHA 4JTCA 4AMCA 3RYSA 1JCMP 1FCVA 1VYRA 1VZWA 1FHUA 2ZZ1A 3DHDA 1A47A 1VENA 3K5XA 1B30A 1BG4A 3W1PA 4CCDA 5I77A 3EWYA 3VNYA 1PKLA 1TCDA 5DRCA 4DAIA 1XFBA 1ZU8A 2JF7A 2ZZ6A 1TWDA 1NF7A 2E9MA 4LAKA 3RR4A 1LOSA 4DF0A 2B4GA 1ZJHA 4XAGA 1PHQA 3PZVA 1WZKA 4ZB2A 4GIEA 1GYMA 3WUBA 2D2HA 3VNJA 3KP0A 3GYCA 4DX3A 3GUGA 1B3VA 3LYEA 1CGVA 3FEMA 1WPCA 1Z3NA 4L4LA 4TMBA 3GU2A 1LQ2A 2H90A 2EKGA 4CQCA 2A3AA 4PB4A 4LUTA 3EX6A 2X2GA 1Q13A 3PTMA 1E4LA 4M80A 3BH4A 2WWCA 2PWEA 5GQBA 3NIYA 3BSGA 3GUWA 4JKKA 4QFUA 1E56A 4C60A 2NSXA 2E9LA 1V3MA 1GQIA 2HNEA 4HCLA 1Z9AA 1OGGA 4E8CA 1KBIA 1KGXA 1YE4A 4JNYA 2CKRA 3WLHA 3TTYA 3MY9A 1LUCB 2D2JA 4AWUA 1JL8A 3KLKA 2EG6A 4E3TA 1HP5A 1NJJA 3WFZA 4IHCA 3MT1A 4IT1A 2HZGA 4LCSA 1GZ1A 1XQKA 4IFRA 2YBTA 1KQZA 4QHRA 4DLMA 3QW4B 3DERA 2PDFA 3M5VA 5MKGA 1OZMA 3WUEA 2OWWA 3CQKA 4J3ZA 8TIMA 3TONA 2Y2WA 4QCFA 4Q8PA 4KRTA 2A1YA 3GX9A 1WOBA 1OT2A 4JQ2A 4DYKA 5LIXX 3AMCA 1R9XA 1LT7A 3SURA 3OO2A 3GXDA 3UT0A 3NUKA 1XINA 2PWGA 1E43A 4HYWA 1WP6A 4NJKA 4ZGYA 2VX5A 2R94A 1KWKA 3O9NA 4INFA 2EPLX 3M9YA 3OEXA 1KBKA 3WD3A 1DOSA 1RR2A 4JFWA 4RNJA 2CEQA 2GQAA 1B3WA 2WHMA 1A5SA 2W79A 1W1YA 3WLOA 1BKHA 1OC6A 4CGTA 1QT1A 4WDXA 1ZL1A 3MO4A 5F2LA 2YW3A 3HGRA 2VMFA 3LM3A 4HSOA 3O2LA 3SIZA 1YPFA 2PDJA 3W29A 3JU2A 4Y8EA 3MMWA 3LM7A 1W2PA 1XSKA 4D6JA 3HG5A 2GZXA 2QJMA 3KS6A 4POCA 2OGJA 3GXMA 3PB2A 1X98A 3VFCA 3NGJA 4FP1A 1AW5A 3A47A 3PR2A 4LH8A 4F9JA 3W1UA 1RLCL 4W84A 3HPSA 5AECA 4P8VA 4M24A 1KXVA 5CPOA 2WJEA 1SQ7A 1QI4A 4W93A 3LUTA 3GKFA 3INPA 3WF3A 3VZZA 2H8ZA 1CX9A 4Q7BA 5BRPA 1PUDA 1LOLA 1UASA 3MVTA 4LYRA 4L9ZA 3VX1A 3S2MA 1G69A 4H9YA 4OOUA 2VGFA 3UYCA 1AH3A 2VQUA 4PCFA 3H4XA 3M5ZA 4NAFA 3EA2A 4WLCA 1OFRA 4LT9A 2E67A 1UUQA 1OK6A 3W7DA 1IGWA 4H9VA 3G1RA 3VCCA 4AYSA 3AMLA 5CKSA 5JBDA 3PFRA 4ORMA 3ZO9A 4HNLA 4WKAA 1JI1A 4O52A 1OX6A 3TC6A 4LBUA 3QPEA 4OUIA 1CYGA 1HTIA 3QMRA 1PCWA 3G1SA 2XH7A 6TAAA 4KCWA 3SCRA 4H9MA 3PSVA 1PX4A 4TU1A 2X05A 3LS9A 1F7BA 1I9CB 4EPBC 2WSPA 3MUY1 1D3HA 1S46A 1IZKA 1H1ZA 5LXXA 1TR1A 5DF0A 4PMRA 2J27A 3QZ6A 4RX0A 4PCSA 7PTDA 1IQ8A 3SFWA 3O1NA 4GXWA 5M03A 1MUWA 2GVGA 4L6DA 1TPEA 4OTKA 3VC5A 4KETA 1WKEA 2FVLA 3LGEA 1EL3A 4JIHA 3S4TA 4FXSA 4IL0A 1JYVA 4XG1A 3ARWA 1E9LA 1BTMA 4RDWA 4ZQNA 4IX0A 2WMJA 3GXFA 5CH9A 4NZCA 3AHZA 3G0UA 1CBGA 3MWCA 4LYPA 4N6EA 4CEXC 5LIWX 1V02E 1N8IA 1AJZA 1M6JA 3VGBA 3W6YA 4P7NA 2O7QA 2W63A 1GYNA 3CPGA 1C8VA 1E1FA 4MYXA 2WCGA 4DNMA 3ANUA 4B4FA 2J9ZA 3P6LA 5E09A 3AYTA 2NUXA 4TVDA 5HMFA 2IW0A 3PAOA 5AC4A 3VIIA 2ZX9A 2WMHA 4WGHA 3QR1A 1KM4A 4WY0F 4TX9A 1DWAM 3EYPA 2VWTA 1E9ZB 3W7IA 4O13A 1SW3A 3RM8A 2PU1A 3GBDA 3FSUA 1K8YA 5DLCA 3A3XA 4EF9A 4GUGA 5C70A 3RLHA 3NZPA 2X30A 4DO4A 3CAQA 3B8SA 2UWFA 3DGRA 2FB3A 3G1HA 2H9AB 2PLCA 5AHNA 2G8ZA 1A5BA 4PEKA 1MRAA 2ZX7A 4DO7A 4NZ1A 3VKAA 3T0CA 1BD0A 5BU6A 1PIIA 2YPIA 3SGZA 3TP4A 1HKMA 4PUNA 2J77A 3T8LA 4CNTA 1GQLA 4UQAA 4LPCA 3PZ9A 1UKSA 4QE1A 1JUKA 4LALA 1CB7B 2VFIA 3WLMA 3DZ1A 1EZ2A 3CUHA 4MWAA 4X9SA 3ZQ9A 1NARA 2PI6A 2NXIA 5HATA 1KTCA 2VZUA 6XIAA 4ZOAA 3NG3A 3PZQA 1TUXA 4DUXA 1W5MA 2CW6A 4QEHA 4RZ6A 1TMLA 3RHGA 1UH4A 4H4IA 3ATYA 2QS8A 4JNMA 4YU1A 2OWCA 2DP3A 2VT0A 4BQ5A 3EDFA 3SRDA 1D8CA 1SR0A 3AI0A 1CECA 3HFYA 2OMAA 3GZ3A 3T44A 4BI6A 2DJLA 1OFBA 1DXIA 1B57A 1TV3A 4FX7A 1BSIA 2PDKA 4UTTC 1OB0A 2VFEA 3S1WA 1VEOA 3DFHA 4HZ6A 3RNDA 2I7GA 3WZ0E 4FAMA 3NZGA 2NLYA 1LL4A 2QCCA 2NVDA 4D6EA 1JNEA 3PPFA 3W00A 1AH0A 2GQ3A 4S3BA 4XZLX 1JCTA 4W9TA 2WK2A 5BROA 5I3GA 4RKAA 3TW9A 1X38A 1R9ZA 3NZRA 1M3UA 1ICQA 3U57A 2ZRXA 1POKA 1OFEA 3HGJA 3MCMA 4P7LA 2GJRA 3GS6A 2Q01A 3ZJKA 3B97A 1TPFA 4ATDA 3KL3A 1I0DA 4PMNA 2GPTA 5CGMA 1W3IA 2HSAA 1JNDA 1H50A 1B1YA 1RBLA 2XN1A 1ZFJA 1NH6A 3ABXA 2Q3OA 2VDIA 1R46A 3KUMA 1V6XA 1TG7A 3ES8A 1HJVA 1IEWA 3H8AA 4MNLA 1LORA 2VCBA 1FQ0A 4XAFA 1FWTA 5CZ0A 2A3HA 1PZ3A 1OCJA 1T96A 3HBLA 4DN1A 4O0KA 3C2EA 1NEYA 4LXFA 3APYA 3E74A 4P2VA 2V5DA 1ITXA 4N9BA 1QI0A 5HDRA 1SR9A 2X1RA 2IKGA 4N02A 3V0UA 3O3RA 2DSWA 3N4FA 1SUXA 2QAFA 2BFGA 3BLOA 3WLIA 2Q09A 1UWSA 3H2NA 5J5DA 3GHSA 2YYTA 3VNKA 4R7OA 1XH0A 2PPGA 2J25A 4HPGA 3N6JA 3EAUA 1T40A 3F03K 1XDLA 5HQLA 3B0VC 2ANUA 3WD2A 1S3HA 4DJDC 3VD9A 2V69A 3IANA 3TJ4A 4PBEA 1K3UA 1TJRA 1D8WA 4L4PA 5BWFA 3ZT5A 5FF0A 3S46A 2EKCA 2QJGA 2GK1B 4JHMA 1ZJIA 3IS4A 4RNIA 1OG6A 3H2CA 2VR2A 2BB0A 2DUAA 3A3WA 4H2HA 4CD8A 3SUWA 1QOQA 1XIHA 1LQAA 1US3A 1Q2SA 4QROA 5BXSA 1BTCA 2WYSA 4IOTA 1GVFA 4CCZA 5T9CE 3M0XA 4OIFA 2RJHA 1XC4A 3E49A 1SFLA 4FPSA 1G4TA 5GNZA 1Z48A 3T0BA 3UY8A 3HG2A 3BLPX 2GDUA 5HR6A 3OZOA 2OQHA 3T0AA 3R8GA 5FAJA 4ICMA 1FWGC 5K3VA 3H7UA 2BDQA 2NT0A 4EPKA 3CZLA 4GA8A 2YCKX 4S1FA 4BHYA 4BWLC 2WC3A 4L9YA 2J6XA 1DEDA 2X1SA 2EJ1A 1KGWA 4GNKB 4LUSA 1FTXA 4AXNA 1WDDA 3VI2A 2O9RA 4GCAA 5HQMA 3KLLA 4HA1A 3TZNA 4GVHA 1BQCA 4XB3A 1ISXA 4G56A 2RGMA 2XGIA 4YCPA 5K4ZA 3KW3A 3LPFA 3C0QA 4DWSC 1JIBA 3GSMA 4JTFA 4GKTA 4HZMA 3MP4A 5EPDA 3NEVA 2Z29A 3E3HA 3NNTA 3EGJA 3F4NA 5F2MA 2PDPA 2WLZA 4NJHA 1MI3A 2ASHA 3L2MA 1IYXA 4UQCA 2XIMA 3P84A 2FZBA 4TTUA 2NUWA 5K4XA 2BMBA 5F4XA 1SZEA 2POTA 2XDFA 3MI3A 3W0KA 4XZBA 5JBEA 3DYMA 4DHGA 3N73A 1R0MA 4HCDA 3NQDA 5KTLA 3BLDA 2HK1A 2VC6A 3AS1A 4ZENA 4Q4MA 4FNSA 4DZHA 2WMGA 4D6CA 1SMDA 2AMGA 2FMOA 1TCMA 3UZ5A 2E0PA 3SUTA 1GTHA 2DSZA 5HINA 3AUJA 4NRSA 2BOEX 5CC5A 2BY3A 1YTEA 4KS0A 3FYPA 2CCRA 3Q58A 1X97A 3LHVA 3TFXA 1IT0A 2HROA 3UJRA 3G5EA 1BQGA 3V18A 1YPIA 3LTSA 2YBVA 3C2FA 3W87A 1CGUA 2XGZA 5DMYA 1U33A 1UWQA 1BVWA 4Q8TA 1B90A 4FX6M 4CU6A 1HIZA 4XD5A 3FY1A 4H6EA 4HU4A 2G3MA 1W2VA 1H4PA 1EJVC 2V5JA 4JOMA 3LK6A 4LBRA 1HL2A 2YSWA 3VD5A 3S5YA 3P0XA 3LTPA 4K1WA 2VELA 1TYGA 3ITCA 4JZ5A 3EWXA 3V16A 5CPQA 3LV5A 4UCFA 3FA3A 1JULA 5A95A 1R5YA 3AIWA 1IF2A 1ZAJA 4IUGA 5LGZA 4AUBA 2PD5A 1XISA 4A8RA 3DYPA 2P1FA 2ISWA 4UIOA 3GE7A 5CLWA 3K30A 4H8NA 3YPIA 3KVJA 3UA3A 2TRSA 1EYEA 4QLKA 4GHRA 1TR9A 2XISA 1R3SA 1HT6A 2BP1A 3AXHA 3TROA 1O66A 5JMUA 4LCRA 5D9MA 1LWJA 3SN1A 2D0GA 2NV1A 2POZA 3IVUA 1GWJA 1XLGA 2HS6A 1LWIA 1OX4A 2VC7A 4EF8A 3RLVA 1XIIA 4LUIA 2FJUB 1O95A 2VEKA 1W1IE 3A9BA 3R43A 5D9NA 4FOJA 3LI0A 3OQ8A 3TIMA 1CGWA 3NQ2A 3CMFA 1M68A 4IPLA 3M6YA 1D3CA 4MB1A 1JJKA 5FL0A 4GC3A