1CXLA

Complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q
Total Genus 243
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
243
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
total genus 243
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxlA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxlA01
1WITA 4ZFGL 5KSVA 1SYVA 3RTQA 4ZFOL 4EI5C 3BSZH 1HQRA 3FZUC 5D72L 5DHYA 3W11D 4YFLF 2VITB 4FP8H 2BSTA 2P5WB 3BPNB 4KV5F 5GRJH 1RZKH 3GSNL 3MV9D 4BQ3A 3JTSB 3HAEA 4LIQE 4XPAL 1E9LA 3EJYC 5K9KB 1ZGLM 5EBLA 2QPSA 4YHEA 4WW2F 1DEEB 1PLGL 4JFED 4P5TC 4ZO9A 2J62A 4QXTA 1HYSC 4NT6B 1NFDA 2I07B 5IG7A 4YHNB 3MRRB 1ZS8A 3SOBL 5I77A 5T1MB 1QLRB 2E7CA 3KWWA 4PJCE 2ZP0T 1WNOA 4RZCA 4WV1C 5GNZA 4GOSA 2ARJB 2VURA 4PUBH 3KLKA 1OLZA 1T5XA 2VRQA 4XPTH 1ZT4B 1KGCD 1FZKA 4XNYH 4WCYL 5IGXL 1UC6A 1B0GB 1PY4A 2CXKA 2X4UA 3HS0B 4OF6A 1T1XB 4MSWB 1OD7A 1M7DB 3UJJL 2Q7YB 4ZOCA 5IJKC 3NIFE 4Y89A 3CUIA 2PTTB 1F2QA 4AMKH 4XHJD 3HI6L 2D4DA 5A6BA 3QWRA 4PJDF 4JDZB 1I7TA 3QZWA 1IRAY 1DTUA 4PB0L 2ADFH 3CPLA 2H45A 3G5ZB 4HT1H 2Y2WA 2FLBT 4HKJB 2C3VB 1J0JA 3P73B 3LPGA 3BEWA 3I85A 4FQ2H 2J8UB 2HAZA 3IETA 3WO4B 4LQ1A 3TJHC 3T65B 3AMLA 3I84A 5ISZD 1KJVA 4KRMB 4LP5A 4O51B 3QH3B 3TA3D 1E6PA 4WIQA 4EANA 4F8XA 5B3JF 4NKDA 4CMHB 2F61A 4ZYKB 5I2UA 2LFGA 4JRYA 4YHIA 2AOSA 5D7KE 5D7JC 1XSJA 2AK4B 1IJ9A 2Y36H 1KIQA 4R7NB 1SMOA 1QI2A 4GW4B 2FSEB 3VXUE 1Q8MA 4X98B 3SPVB 3PZVA 1DN2A 2ZCHH 4LHUA 3VWJD 2R56H 4E41E 1LL4A 1I8LC 2R1YA 2VXTL 3FB5B 3IVKB 4YK4C 1B4JL 1H3VA 3IAGC 5FUZH 1MWAB 2DQUL 1LDPL 2JIXA 5IW6B 1R46A 3HMWL 4NKOB 1WKYA 2WWMC 3IDMB 1AE6H 3MTRA 2V38A 1C93A 4I0PD 4KTEL 4RWYL 2IJ0C 1BX2A 1CYGA 5EU6D 2AJXL 3ELAT 3QXAA 3ET9F 3K4DA 4OFYD 4X7TB 3D5OF 1E6SM 2ARJQ 4HP5A 1VADB 5IHRA 3CMOL 3VRIB 1F6LL 4MD5A 5AG9A 1NFDB 5EBWB 1AI1H 1OSEA 5B39B 1NC2A 3P9WB 4KPHL 2P7TB 2QEJA 4K71C 4ZPVB 1BVKA 1C5BH 4QRUB 1WFTA 2EKSA 4JFEB 4AD0A 2CJUH 1A3RH 3BVUA 2N1KA 1U42A 1HHHB 2H1PH 1NCAH 4QXUH 3FB5A 3QNYB 4HH8A 1MW0A 1YEKH 1GOOA 4TVPD 1S7WB 3MU7A 1HL8A 3A3HA 2Z91B 1HX0A 3L3GA 4Q0XL 3BN3B 1TMQA 5BOZG 3RDTB 4GRLA 3O41A 5I73B 3S5LA 1HKLH 1B0RA 3C8HA 4U1NB 5E8OB 5F96H 3TJEL 3MGOB 4OCYL 5A2JH 4NM4L 1PG7H 4YBLB 1SMAA 4OD3H 1D5BA 4WU7A 2GT9B 4TN9A 4ZEPA 4JFYA 4HIJA 1E4IA 4NN6C 1PG7W 2PR4H 4FTVA 3QPXL 4UTFA 4Y4HA 4MA1C 4AZBA 2VDRH 3CX5K 5CJOH 1AQHA 4AWEA 1T1ZB 4NNXB 1LK2B 4P3DB 3DPBA 3MRBA 1EUTA 1UM5L 5FKYA 3PXJA 3WQ8A 1KJVB 3HPJA 3TBVA 3SKOB 1ZANL 2AAAA 2EIZA 3CUPA 2AJXH 2TAAA 5BRQA 3PL6C 4C56B 2GJ6E 2D3VA 2J2ZA 4XGZB 4OFDA 2V6HA 1P4IL 2GTZB 2CBJA 3QEGH 4NHCH 4Z7UF 4CKVX 4L8CB 4IMKA 5EU7C 2NT1A 2R1XB 2W62A 1V08A 2EXWC 5J3HC 5ABGA 1TQBB 4FQCL 2ZX9A 3MX0A 1BVLA 5SWZA 3AS3A 5TE6L 4YPGA 5IGXH 4M9PA 1FG2B 3S88L 1GIGH 4HPOH 4ZPTA 3PABA 4HOXA 5I0DA 3FONB 5C09D 5IMLB 2XTJD 1WT5C 1ZEAH 3VI3E 3NTCL 1UCBH 4NWUL 4X6CE 5DUBB 2NXZC 4GRMB 1LG2A 2D7OA 3QT2A 3RKDD 3EYOA 5L6YH 3D3AA 2Y7QB 1TQUA 5L2KD 4KTYA 3WSQH 3PQYE 4P5KB 1H0IA 2OMBA 3QUML 3F5WB 1A7PH 1TJHL 1VFOA 4JFDD 5GGSA 1T83C 5FM5O 1WFUA 1UJ3C 2CQVA 4XH2B 1DCLA 4ZUTB 2X42A 3VU2A 5A3ID 3UTQA 3BGFC 1A0QL 1TIUA 4UAOB 1JGLL 2EAEA 4JPKL 5E4IA 1ZA6B 4FQ1L 1FO0L 2QADD 1NMAL 4PJGB 5JW5B 5EBAA 2OLHA 4RMVA 4OAWB 2DLFL 1RZ8A 1FVDB 4UUJA 3QDMD 5D8WA 3W26A 2GEEA 2C5DC 3G6AA 4WTZG 3CFCH 3CK0L 4WI9A 2BV9A 4X9FA 1F3DJ 1KIPB 3JTSA 5HGBA 3S3PA 4NBXB 1OCQA 4J1UA 3GKZA 3SE8L 1PX3A 1KJ2H 2GK0B 2DWDA 2QSVA 1JV5B 1ZT7A 4E8CA 5BV7B 1OAQL 5T33L 4HKBB 3BHBB 3QIUB 2IADA 3H9YA 3VO0A 1VF8A 4L29B 4JPVH 4U7KA 1TVNA 1JFQH 1BFSA 3NIGF 1RUKH 2EDFA 1B1YA 3HRZA 1B3XA 3CUHA 5JO5A 3BEVA 3LRHA 3RWEB 3CIVA 4L9DA 2WIMA 5DUMH 4FQHB 2MQCA 3TO4A 4N0FA 4GRLD 3D85A 2A0LC 3VFUB 2X70A 4R3SB 4Y5XB 2FB4H 3HAEH 1U93A 1TZIA 4MNJA 3EGSA 4MNKA 1CDYA 2I5YH 4GAFB 4UQBA 5HHQB 1C7TA 5GS0L 2VC2H 3EO0B 4UOW1 5CIPA 3HG4A 3I75B 3DMMB 1E73M 1S7UB 2J6EH 3TFKC 1NM9A 1CE6A 3CLFH 3WH7A 4FXKA 2HFGH 1TTUA 2R29H 4AD2A 3TPUB 4GXUN 2YLLA 3F5JA 1QRNE 1IAIM 5J6HB 4MAZA 4JRXB 1OP5K 3X3GL 2WC4A 1T4KA 4JFXB 2V9QA 3DMMD 4XX6A 4QLLA 2J3SA 3L4ZA 1YNLH 1P4BL 2ZCKL 1L0QA 3UTOA 5GS0D 2BFVH 1MLCB 3BWUC 1BD2B 1MJ7L 4AH2A 3C6SA 4PRBB 3G6DL 5MENA 1TTFA 1E55A 2GITA 4JR9L 3RNQA 3BCDA 1JWSA 1DBAH 1T7VA 4N68A 4Y19A 2FJGA 4CNIA 1KELL 3O4LB 4CW1A 2PYEA 3OSKA 1CXKA 2A6JA 4F33B 3MRMB 3KXFB 2Q76A 4TNWK 3MUGA 4Z7WE 5ID0A 3EOTH 2PYFA 1VEMA 3IXAA 5IWLC 4HUWB 1A6VL 1YPZF 4TVCA 1I9RH 3QG7H 2HN7A 2ATPA 4TVSa 1HN1A 4JRWA 2VUOA 3CU7A 1NCWL 2WVVA 4JQIL 2OP4L 4UR9A 1MIEL 1WZKA 3CX2A 3ROLB 1UJTA 3A6BL 4YEEA 4XZUB 2JJVA 3LKRB 1HL9A 5CEZE 1G6RB 3ARSA 1U8OA 1NLDH 2ADGA 3LKOA 5DJ6A 4Q9QL 4P5TD 1OF2A 4I3GA 2JFEX 1L9MA 5ABDE 5DHVB 4LSUH 1Z9OA 3NCFB 4AEFA 3N1AA 4GUPB 3WEZA 4UTAH 3LX9A 2GKIA 3FT3A 5EU4B 3W38A 3GZAA 3LDBB 1JZ7A 1XF5B 4LLUB 5CJQL 3B9KB 1PIFA 2FCBA 2XZAH 2YSSB 1XZ0B 4JFEA 4F3FB 1HI6B 4BQBA 3B8SA 4UFMA 3BVTA 1Z0NA 4KK9C 4EAMA 1YNTB 3KLHC 4HV8A 1XR8B 4NNPL 5EIIB 4JR9H 4X6BB 4H2CA 5HI3D 3K1DA 1VAHA 3Q6FA 1RJZB 1MHHB 1QYGH 4AYFA 3BXWA 4AD5A 1FOBA 5AWNL 1V8HA 2F58L 1FO0A 2DQTH 3HCVB 3TP4A 5BYWA 5L0QC 1N7ML 3OJVC 2UZIL 4KKCC 1S9KC 3VXMA 1EMTL 1F4XH 5HVFB 2H2SC 2M1KA 4XI5C 2Y1VA 4UQAA 5BVJA 4CVWA 3WUEA 1LE9A 3S4SB 4S1SH 4G43B 5K59E 1PZ5A 2GJZB 2QLYA 4Y7MA 3PDOB 5CP3A 3WLWD 2GYSA 2DJUA 3SDAA 3KPSD 3BC9A 4KRLB 3AS2A 3PHAA 4YHGA 5EC1A 4ZUSA 3O9WC 3BX7C 4X7CC 4C56A 4XXDB 4TNVF 4U1JA 2CLRA 1FZJB 2P48B 2C1PA 4KRPD 3QNZA 2HH0H 4Y1AD 5DJCA 4CN4A 1EQPA 5DUML 1UQZA 1MCPH 1WLHA 3BPCB 4K8RC 1JDCA 4RA3A 1U8KB 4NF7A 1ZVSA 3MOBL 4W4OC 5GGVH 1DVFB 2VAAB 2B39A 2IADB 1XD0A 2J47A 3W28A 1TVDA 3QQ4B 2CKRA 3CFJA 4A6YB 4WK9A 1ZVYA 2ITCB 4H0GA 1GJIA 3KLLA 3QRGH 5I76B 5E5MA 5HHOB 2HMID 1PKQA 1BBJB 4L4VA 5IVXE 2W1NA 3RDTA 5M5DA 5F7LB 3DLQR 5EUKB 3OAZK 5FK9B 4HWZB 4PJ9D 4PREB 4X6FB 3IFNL 5B3NA 1EVTC 3OKKA 3TYFA 2X2JA 3S2CA 2FD6H 1UA3A 1V3IA 3CZKA 4KKNA 2QKIB 3KPMA 3K1KC 1NAMH 4G9DA 3NA9H 4KMLB 3QPQC 1S9WA 3C5SA 3ESVF 3ZDZF 4LPYA 5J13B 3PWJB 1XYZA 4OF8A 4WSKA 4BH7B 4OGYH 1QVOA 2FX8H 5GHWL 4NUGL 3GSVB 3QWQB 4Y2DA 3BAKA 1OCWL 1W0VB 5EOTB 4I0CC 1PZ3A 4MMZC 4GLRI 4GKNB 4FMFA 3MLSL 1KIRA 1JP5A 5T5FL 2DJSA 1IZJA 3ARFB 4AJ0A 3VXRE 4Y4KD 3LMYA 2P42B 2ZG3A 3CGTA 1IAII 5A6MA 4TUFA 2FH8A 3SQBA 4HWZA 3AXHA 2CK0L 4HPOL 4OLZL 4MX7A 1LGVA 3SKJH 1KCSL 1Q9WA 3VA2C 1UB5A 2DTML 2ZJSH 4HXAL 3EOAB 1CXFA 1SYVB 5JIKA 5ISZA 3U9UA 4IRSA 3L3OB 3JWOL 3GHEL 5HI5D 5CGMA 2R0ZH 2G2RA 1MCFA 4PTWA 4CCEA 3VG0L 3AY4C 5DFVD 5IW1B 4X5WA 5JW4R 2H32B 2IWGA 5BQ7A 4XMKL 1RU9L 3PL6D 2OSLB 4JVPA 1AP2B 3BAJA 4ZMAT 3TBTB 4P59H 3C09B 4GO8A 3VFGH 1DL7H 1QQDB 4HK0B 1LO2L 3I6KB 4X8XA 2HLFD 5IEKB 3CFDB 4ZUVA 1PFCA 4ODTH 2BVOB 2CRIA 5E6IB 2FJGB 3FQWA 1I7ZB 2C1OA 3WQWA 3GSNB 2NTFB 2JIXD 4GI8A 7TAAA 3D69A 3QULA 4ZXOA 4PRPE 1RJYB 4AXNA 3FMGL 4YN5A 4MA8H 43C9B 5D6CB 5HYJD 4C7DA 2Z93B 4LHUG 5GGTH 3FFCB 1DR9A 3QWOB 5E1HB 2WMIA 2ED9A 4MLSA 1X44A 1LE5B 3JWNC 4F7CB 1ZHLA 1GL4B 2F7QA 4RGND 5HGDA 1H0DB 2A73A 3ZZ1A 5FM8A 1E6XM 3OG2A 4JZJC 3RY6C 5JLZA 3UTTD 1I9JL 1EVUA 2EPKX 5H37H 3LS4H 4YXLH 3MJGX 4JHWH 5DRXA 2HMIC 2ZUYA 4G8EA 1OP9A 2K3TA 3MRJB 2OL3H 2CEQA 2CMRH 4Z7QE 4OF3A 2QQKH 3B9DA 1EGZA 3OWEA 5HYSA 1E6OH 3PQYB 3D39B 3D9AH 4OD1L 4ONHB 3EYUL 3KJ4C 3OLEA 2ZX7A 4NRYB 2OYPA 3HC3H 2ZOKA 3OJ2C 2YD6A 1KN2L 3VGHA 1MCPL 1U95A 1OAUL 2HWZL 2IH1A 3ULVL 1KJ2B 3UCQA 1DL7L 3MNVA 2WBJA 3E3QE 4PRAB 1JI1A 2VDPL 1F42A 1FZMA 3MR9A 2J6EL 3K46A 1YDPB 1UH2A 1PPIA 2VR5A 2IBZY 3F7RA 3ZJ6A 2DL9A 4LU5H 4DOHE 3IVKA 4HUXB 2NY2D 1WIPA 4GS7B 1CWYA 1HHJB 2D7MA 1OGAD 4NO3B 3CHDA 4PRHA 1IL1B 2V5TA 4JDTL 1FIGH 1KNOB 3HI6H 4ERSH 1AQKH 3RWGA 1K5NB 2HJKB 3T0EB 3DBXA 5KG9A 2AJZB 4H1LH 4MXQC 1UWXK 1FNHA 2DN7A 4H1LA 4N5UA 4NN6B 4PJFA 3RIKA 1C08A 5KANG 1UWRA 1CZ8L 1A3LH 1Q1JL 3QI9C 3MLWL 2ICEA 5H35B 2IH1B 1JGUH 4BKLB 1KXTB 6FABL 4PS4H 4M5YL 4YXLL 4AEEA 1F3JB 4HG4K 5EA0L 4JN1H 3IETB 1E6JH 1V03A 4Z5RA 4NUGH 4PJIF 2W0LA 4HZAA 2HTKC 1NL0L 3P9LB 5C1MB 4Z2GA 3N9GH 1S9WB 4O2CA 4PJIE 5ISZE 3PIQB 4JQIH 1FJ1A 2UWEF 3T09A 2HLFC 4D0BA 1E27B 5JHDB 3QA3A 5D7IB 2P43B 2Y7QA 3BH4A 1ZBVA 5I1HH 1HXYB 3FB6A 3F58L 3LRSA 5ICZB 2DM2A 3W0WE 4PJHA 1RI8A 1NDMB 1CR9H 2EE2A 3CVIH 4GAYA 5FYJH 5FO9A 3WKNA 2BSRB 1J1OH 2WIIA 3VFMB 2UVFA 3ZT5A 2JIWA 3WFZA 4ZDHB 1XCWA 5F96L 3TJEH 5E8EB 4OCWH 2OCFD 4OZIF 4PTMA 3MFFB 5D70L 5D93B 2K1MA 4OV5B 4JFHD 4GKSB 4UBDC 4DGIL 3NACL 3EYPA 2NX5E 2EDJA 3GNPA 4NCC2 4O2CB 1T04A 4XPAH 1VGEH 1TZIB 1A7NL 1LO5A 3MODL 5IB1B 4HK0A 1QQDA 1G9MC 5GGVY 4KKLC 1RUPH 3S37H 5JZ7C 3BZFB 3JUGA 3HAEG 2VDLH 3HE6B 2AV7A 3AXLA 2XKSA 5EU6B 1I7TB 3VKKA 2YBRA 3U46B 5DC0A 2BVPB 1QLFB 1HXKA 5D9SB 5GRZA 4ONFL 3DROB 1CCZA 4MA8L 1BBDH 3RX5A 5BJTA 1GZPB 3BVNA 3V5DA 3AIWA 5E6YA 3NABH 1P9MC 3CZNA 1BQLL 4AT6B 3HR5A 2FL5B 1UQSA 3VWJB 4M61B 2ZUNA 2XWTA 2NNAB 3RZWA 3U30B 1A14L 3V7MA 3B6SA 5DQJA 1R33A 5A6JA 2IUZA 5CPQA 3RVWD 4P9HC 1QEWB 1IQDB 1B3JA 1DQLH 4PTTA 2FJFB 3QIBC 3QIWC 3PIQA 5L2JA 3WY2A 1EERB 1T7XA 3CSGA 2EDKA 4DN3L 4NZUL 3V9FA 1R86A 4M48H 5DEFB 5FYKE 2WVTA 3OKLB 5E2VL 1RIHL 4LPXA 1V02A 5A8MA 2VYRE 2OLDA 4NRYA 5IK3B 1XGQB 2IBZX 2IH3A 4JZOB 2ESVE 5F3HA 3OKLA 2EIDA 3TT3L 1MVFA 5FD0A 4FQ2L 1UH3A 1S5IH 5IF0B 3E2HC 3HG3A 1N64L 5D7SL 5L8KB 5DRXB 3CVHB 4R97C 1IC4L 2DLFH 5DJ0B 4HJGB 2M2DA 3C60C 1O7VA 4R4BA 3UP1A 4FABH 5ENWA 1E4XI 1R0AL 3THMH 1R5IA 1G9ML 4KVCH 2E7LC 3MPCA 3T4AA 1KXHA 4P4KC 2J7HA 5A8PA 2A9NH 3RM9A 2NR6C 4NCDA 3D51A 3FQXB 2X4TA 1FNSH 2Q8AH 4OZOA 1CL7L 2GK1B 2X89A 4LKXA 3BIBX 1BQHG 1JN6B 1FIGL 4JFUA 5TH2A 4ERSL 5D9MA 4OIFA 4LNRA 3MREA 4PJAF 4D6CA 4HW6A 5GSVB 3L6FB 4K8RD 1UQYA 5CCKH 5IIEB 4AD3A 4HA4A 4G6AC 1K9FA 1GUVA 5B3JE 1ZVSB 2NX5D 5EO0A 3VWKC 3O8XC 1K3ZA 3UAJC 2CERA 4PS4L 4FZEL 1MJUL 1IC5H 1E5NA 1FORH 4DN3H 4HIEB 4PJ7A 2IMNA 3U1SL 4HHAA 5FOBB 5T5FH 3PQYA 2IMMA 1GQJA 1VSCA 5JUEL 5E6IC 3WY3A 1ZT1B 1A1OB 4NNYB 4PJXB 4OT1H 2DKSA 4NN5C 1JPTH 3OLDA 2VERN 1H5BB 1KLGA 2BVQA 4RMSA 2LQRA 1QBBA 2CO6B 3FRPA 3C6LA 4KFZC 1HHIB 2X09A 3NABL 1OAKH 4BFBD 4XCCH 3MBEB 1KWKA 3KPNB 1AHWB 2A3CA 3QEQD 3EJRA 3TV3L 3S8WA 2Q7YA 4JG1H 1QFWH 4K94C 1UB5B 2DL2A 4KRNA 4HC1L 5JORB 1JNHB 1NMBL 5MI0B 1DE4B 4N0UA 1HXMB 4OM1L 2R2HA 3NCMA 4UB0H 4ODUA 1JYVA 1GJUA 1FFPB 3LZFH 3RY4A 1D3CA 1H49A 2DQDL 2WXDM 5AG8A 5FYLD 2VL5B 1NGPH 3LPOA 3TM6A 3S9DB 3VNZA 4B15A 5J7CC 1YY9C 4NZJA 4C83A 5E9DB 1WE5A 3B83A 5I74B 3ARDD 5EOQL 1VFMA 4RFEB 5DK0B 1KPUA 4QXGL 3EOTL 1D9KA 5ERWA 4LLYA 1KACB 1RD6A 5HI5C 4PMQA 3S6TA 1JE6A 5IHUH 4X7EC 3KHOA 1WSST 2EDYA 1R3LA 3V4PH 3P77B 1L0XA 3EOAA 3TWCH 2VMFA 1MHCA 1UKPA 3DGGB 2H2PC 3EJQA 2ZUWA 1D6VH 2R69L 3NZ8A 1FZOB 4AZ5A 3OGOE 5JMOC 3RWCB 4GG6B 2PUQT 4G6MH 3VILA 3BKJH 5KSVB 1YZZA 1GAFL 3V6FA 1A14H 5B21A 1ZV5A 3U46A 3KDMA 4P7QA 4M43L 3RBSA 4M1DL 3K2MC 3TA3C 5T3ZL 5CXPA 2GQHA 2J7FA 5CSYA 3OGSA 3S6CA 2XN9B 2OYKA 4NZUH 4MJIB 1JGIA 3PZTA 3MRPA 5BRZD 4G9FB 4WIWA 4KTDH 1XIWC 3VFSB 5F6IB 1V0NA 1HKKA 5BV7H 4L3EE 4OUUB 5D1XB 1HP5A 3W29A 3KPMB 4DUWA 4FLRA 1QYGL 3RAJL 1V0MA 1K4CB 2XRAH 2DAVA 1UD6A 3QEUA 2BVYA 2IBBA 2VRJA 2ZWYA 1WDPA 1ODUA 4GSDH 4I0PC 4Y88A 1DBML 5EOCH 2AJYH 2C3WA 1TQCC 1PZ5B 3VI3F 3EOBB 2N7AA 2GSGB 4U31A 1UB6B 3KZSA 3OA5A 3FO9A 3REVB 3H7BB 4PYGA 5ACZA 5INDB 1KJ2L 4R5EA 4WUKH 2IANA 2PBOA 2UWEB 3VXPA 3VJ6B 1MFDH 1G7MA 2AXGA 4FHBD 1QBMH 1KCRH 4Y4KB 4NNPH 1JPSH 3EJZC 4EEEA 1ZBWA 4LARL 5AY7A 3CFBB 2P5WD 3A22A 1CD9B 1VFBA 1OGTA 4YFLI 5CHNB 1I7ZA 2DQJL 5HOSA 4ZO8A 2WWKT 4WUUA 4P4KD 3MBEC 1O6IA 3MGAA 3OZ9L 5IG7B 4JHOA 5I18H 5A8OA 1FORL 2XTJE 5KAQG 4QRPE 3RWEA 2H6PB 3ZYZA 4K7FA 2GI7A 1A9EA 1K6QH 3ULUH 4MPKA 3SQOH 1Q6CA 1BZ7B 5TQ2L 3RPMA 4OZIA 1UWQA 1MWAL 2OSLA 4PP2B 1FL3B 1LK3H 3SBWA 1S9XB 3ARBC 1JRHH 1JZ3A 1UWSA 3GSQB 5IHZB 3AIVA 3VRJB 4LEXH 5IMMB 4G6AD 1K5NA 2HJKA 1XT5A 2Y4SA 3ARDC 3KDMB 5KG9B 3EAKA 2G3NA 1ES0B 3O3DA 1NC4D 1CLYL 1GGIH 2W60B 4W6WB 1R3KA 1OSZA 3PDOA 3GGWB 2YEZA 2WPGA 1F4HA 3ARWA 5EZLA 3IYLW 2D0FA 3T4AB 3UPRA 4HPHA 5A16A 4UUJB 1S3KH 1X5YA 2X6MA 4LHJB 1J8HA 5IB4B 4H88L 5GRWA 2FO4B 2K9UA 1A7RH 4LXFA 5EFFA 4CVZB 3QBTB 2YLAA 2CNCA 3HMXH 2HRLA 5GGRY 3WN5A 3HMXA 2LABA 3IGAB 3ULVD 2EXWD 5J3HD 3BPLB 4M7JH 1ZTXL 5D7LA 1MHPL 3G6DH 5EOCJ 5SX5K 1S7SB 2ZCLH 1QVOB 5I1LA 4ESKA 4ZFFA 4WFFE 1T89C 1XGTB 2EE9A 4PJ5E 2EO9A 3D3VB 1IKNC 3P0YL 1NCDL 3GMQA 3RJYA 1XZ0A 1KTDB 1OCWH 4M24A 2XTJC 4WFGE 2Y36L 1G84A 1U33A 4RQQB 2VZUA 2DKMA 3QXWA 1EO8H 1CK0H 2DQHL 4OLUL 5CJXC 5ITFA 5FM4A 4OGAC 3GI8H 1NDGB 3D2UA 5DQDH 1L6XA 4NRXA 3EYVA 2FIKA 4Z7VB 1KB5H 1MCEA 3AREB 4RISL 4CU6A 5LGJB 5I30H 4D9LH 3T3MF 1AXTL 5MHSE 5D5MA 2XPGA 4KAQH 3U7VA 3O81A 2YXFA 3SJVA 3U2SB 1GZQA 5BXPA 5I2IB 2QTEA 4JZJA 1G7LB 3V0WL 4YHML 5K9OA 4KRUA 5C9KA 1E6OL 1OAXL 3IXAB 3P4MB 3LKSB 1HNYA 1SMDA 4WW1B 1N4XL 1WQVT 6TAAA 2XZAL 4P46D 3AIBA 4LAQH 5D7LE 2DQGL 3WUWA 3MA7A 1UR1A 4YDJB 2Z31D 3BDXA 2PTUA 1KLUA 5C6TL 3SDCA 2VQ1B 5DMYA 2YDSA 5ACMA 4LEXL 1IC4H 2CLRB 3EMQA 2UVEA 3LKPA 3WMBA 3S98A 4GKSA 4Y4HC 4HIHA 5FYLL 4UCFA 1J8HE 3MRDA 3PGDB 1MCSA 3QIWB 1Q94B 5M95B 2XN0A 3TVMD 4LLVB 1CL7H 1XF4B 1MLBB 3B2UD 2WP3T 4P5TB 2J8FA 4HDIA 2D73A 4ZS7L 3DX1A 4JPWH 4FQJH 1SZNA 2IGFL 5JQHC 2EH7H 1E56A 5DUPL 1VACA 3QCVH 4NDMA 3THDA 1MFAH 4U1HA 4KRTA 4LASL 3SEPA 1BECA 2EKSB 3VXMB 3GMRA 1UXSA 1LO2H 3O0RH 4WV1B 5DK0A 2ZX6A 4DTGL 3TO4D 1EV2E 1SBSL 3T77B 3VDHA 4TULH 4Z7UE 3GHBH 5JIIA 4P4KB 3NIDE 1GRWA 1DWGM 2NY5H 2VXVH 3TOPA 3KNBB 4MD4A 5I0ZA 2PO6C 5T1KB 4LSQH 3BPNC 4OTXH 4LAJH 2BNRA 2VDKL 1HIMH 4WFED 4XRCA 1MFEH 5A69A 2R1YB 5KN5B 2NNAA 4QP0A 5D6DA 3WF0A 2FSEA 2YPLD 2X4RB 3VIJA 5BJTB 3RTQB 3GJFK 3LOWA 2VIRB 4ZAKB 4M4RA 3T2PA 5IVOA 2D7NA 3ZT7A 2W60A 1R3JA 1PEZA 1CTNA 3WDJA 1JGDA 1K8DB 3MRCA 4JM4H 2FWOB 3FRUA 4PRIB 3HRPA 1X5XA 2IGFH 4YHLL 2OWXA 1B2WH 2WK2A 3T2NH 2RGLA 1QUNA 2AXFA 4D71A 5F88B 5GZND 2V5MA 1H5VA 3MA7B 4HIXL 2HWZH 2XFYA 3MYZA 4WENB 3NPSB 2MOVA 4WW1A 4CBPA 2DT0A 4ATDA 1Y18B 2ZE0A 1F45A 4N0RA 1F8TL 1P84K 1KTLB 1Q0XL 43CAA 3RL2A 5DSCB 4J28A 4QLJA 4F15C 4Y8AA 4LRIC 3U7BA 3ES6B 3KVQA 3P2TA 4EDWH 3I6LD 4XMLH 4F7PB 1F6AB 5INDA 1R3JB 1A3HA 4L1HA 4GBXC 2PKDA 4R96B 3GB7A 4UQCA 4G6ML 5DURB 1XC6A 2FIKB 1JHLH 2P5EB 4QY8A 4K3HA 3WD1A 1RUAL 1I1AB 2P1YA 4GAYB 1GNXA 1OAZL 2WM0A 3ZJ7A 1EK3A 4B53A 1EO5A 1BTCA 1S7WA 2GJXA 1AKJA 4DKEL 5FOJA 1JD7A 5KANI 2R1XA 4Z7WF 1M7IB 3FCTA 1ZWIA 3L5HA 3E1F1 4G3YL 5IF0A 2YKLL 4D0DB 1JNLH 3SE3C 4RIRA 4HPYL 4XNMA 1G7QA 3C87A 5BO1L 3VFVB 4PGCB 5HHVH 4PJEE 1G7IB 5C0CE 2HJFB 3VFNB 3OJDB 1I1XA 4ZFZB 2MNUA 2F54B 3H2WA 3FOLA 1KG0B 5EBLB 3BEVB 4PMRA 5C71A 3D1MC 1RPQA 5I1DA 1NFIB 1T2QH 2CBVA 4PV9A 3V95A 1U8PB 3RZCB 4HS6A 2APBA 2UY6A 35C8H 5CGTA 2WMHA 5T3XE 4J7RA 1MCRA 1GCYA 2XT1B 3CCHB 3ROLA 4UQDA 4YXKL 3G5VA 2CKBH 1HSAB 2B31A 4BSJA 2XWJB 1MEXL 2X7LA 1AJ7L 5DD1L 1K4DA 3ULUF 1YEGL 2YD8A 1GCFA 3GBEA 1FH7A 1UCTA 1KPVA 4X6DE 3S5LG 4TOYH 4M29A 2DIJA 4HX1A 5L8JB 3L7FB 2E8ZA 2IFFH 4X99A 1U2HA 3CVHH 3LRMA 3ARFA 1X5ZA 5KS9E 4HZ6A 5IQ9A 1J5OH 4E0RB 5I19H 1KG0A 4PJGA 5JW5A 5MEQA 2KQNA 4RE4A 1K8IA 2R4RL 3S36X 3U6RB 5IJKA 1BZQK 4DWHA 3CDGB 3VXQA 4Y19B 1DUZB 3SQOL 4D94A 2IPTL 1MCIA 5GGUB 5F7EH 5IXEA 2F5AH 1P84J 4QHNB 3ZJ8A 4MAYC 1EBPA 5GRUH 4NHCL 4K8RH 1E4XH 1UT9A 3C6SB 5MENB 5GGSB 2NY5L 1XSIA 1E4MM 2B0SH 2I25N 2GFBA 2WW5A 5TDOB 5FCUL 1LQSR 1KB5A 2OJZH 4O4YL 3PV7A 5FF6B 2PF0A 2HLAB 2A73B 3WMCA 1WP6A 1K9TA 1HE7A 4FFVC 2AQ3A 3GBDA 4X5LA 3UZVB 2XJ7A 2XACC 3MRLA 1NPUA 1WT5A 4JG0L 4DGYH 2ZUXA 4NGHL 1KXQE 2H8PB 5EWIL 2O93L 2CIIA 2QMKA 4L8DB 1E4KA 1Q0YL 2XKNB 3HZMB 2ICWB 3MBED 4HMCA 3VXMD 1C91A 1AXSB 1IGIH 4OCNC 1NOUA 3RVTC 1F4YL 1JBJA 1JJUA 3DO7A 3R06B 2EEAA 3S36H 1GONA 1IQWH 4TOYL 2J7BA 4NC0B 4RFNC 4PBXA 3AU1B 5HVGB 2A83A 1GHFL 1INDL 1MNUH 3VXSA 1HILA 5JBFA 2AI0H 3DVNB 5J4MA 5GS1B 4R4NC 5HDBF 4ODSH 1QO3A 2DIAA 5TE7H 3FOMB 1LD9A 3GI8L 4D9QD 4JREC 4Y4HB 3MV7E 3UC0H 3C9NB 5BV7C 1GHSA 4M03A 1WFOA 5DFVC 1JXKA 5A3IC 3KLAB 4B3LA 4RBPK 5D2NB 4RCAA 3CCHA 2G2RB 4W5UA 4OZFG 3HLAB 1DVFC 5T3XD 5D7IF 3H9SA 5IT2H 3VIMA 5E08L 2QADC 4JPIA 3WHXA 2LU7A 2GJZA 3TV3H 3ULVC 4UDTA 3UO1H 1GOQA 5A94A 2VUYA 5B8CB 1I75A 4PJ8B 1DANT 1SJXA 1U6AL 1J8HD 5F8RC 3IU3A 4IIQB 1UCBL 4NWUH 3DX7B 3GSQA 4FZEH 4EBQL 1BG4A 3TZVA 4ZTPH 2XQYK 3GMQB 1OINA 4LVOC 3DIFA 3FHAA 4K7FB 4WI3A 4GFTB 3MRRA 4YWGL 4NHUB 4L4PA 3AHVA 4DVBB 1A7NH 3Q6GL 4D8PA 2VLKA 4OF7A 3FO1A 4FQLL 4R4FH 3RGVB 3V6OA 4D0DA 4JCMA 1AGEA 3W2DL 2ID5A 3IDGB 4TTGA 4GQ9L 5F89A 3U7AA 3G6JF 4PJDA 2Z92B 4JKMA 1HYRC 1S7TB 1SVZA 5F71A 5C0DB 1VPOL 5C7XH 4NKOA 5FK9A 3IDYC 3VM7A 2AK4E 3QQ9D 4PGDA 5CLTA 4LBEB 4G8FB 1M05A 3ALPA 3NN8B 1B3YA 1B2YA 4R96A 1MAML 3JZ7A 4H0HB 5IFJA 5AZ2L 3IU4H 1WBZB 3M1BA 1GZPA 3LZFL 3V5DB 1E4WH 3OJMB 2X9YA 3CMJA 4Z7VE 3JTTA 2DICA 3WKMH 3KLDA 3PZNA 1WFNA 3VG9B 2EC9T 3HZVB 4D0CB 3X12B 4U3CA 4XP6L 4RAVB 2AJSL 4H8WC 2VLRA 3DX3A 2NW2A 3TBSA 3U4EA 4JB9H 3S34L 4EJ1C 3BWAA 4M7ZC 3UZQA 3BUPA 4L5FH 2DLIA 3CVHL 2YPLE 3ECQA 3MV8D 2AV7B 3AXLB 2FECL 3B2VH 3WDPP 4KTEH 2XA3A 4RWYH 5JNYA 3T1FB 2NY4C 3S7GA 4MQSB 5IV2B 2AJUH 3FTGB 1CICC 1V7MH 1UJ3A 1P2CB 1MRFH 1KFAL 4QHMB 3MV01 4KKBD 1XH1A 5T5NF 2DT3A 5D9NA 4U3XA 5MEPA 4D9QE 5GS0H 2BHUA 4MXQD 2JEQA 3STLB 2DQTL 3TCXA 2YA0A 2NY3B 1SHMA 5D7KD 5J9PA 1U9KA 2XFXA 5DQ9A 1XGRB 3EBVA 1L7IL 4N1CA 3VGBA 4TX8A 4A3HA 5J6HA 2MJWA 1DQDL 5DA4A 3O6KL 4XCNA 1YUHB 3QDHA 4TVPH 4EIZC 3R1GH 1I8MB 1W9DM 1N26A 4PEEA 4K3JL 2BJMH 1FP5A 2GTWB 5EFIA 3SDXA 2A6IB 3WIIH 2XVNA 2MKLC 1NC4B 4X4ZA 5CJQH 1NWTA 4JGJA 1WK0A 2EDBA 2PO6D 4GW5B 4NQDE 3BMWA 1QSZA 2HTLD 2FLRT 4MNLA 2R9HD 3LHPL 1RVFL 3B9EA 1Q0XH 5GGSY 4OI8A 5BROA 1T20B 4X6DF 2D3LA 1DEDA 2W92A 5SWSA 2W65A 5IFAL 5KZCD 3GXTA 1ZLWH 1UADC 3LQAL 1BX2B 1QOKA 3GBMH 4HV8B 3UPAA 1XF5A 3LN5B 3G9AB 1RIUL 4WJ5A 3W9DA 1UM6L 3F5KA 2XN2A 1TCRB 4UI2A 2COQA 2HJLB 3RVXC 2V9RA 1WZMA 1OHQA 4R7DB 2H32H 5CPSA 3U82B 1GHRA 3AHTA 4R2GC 1JGEB 2VITA 3BVWA 1I1YA 1FVEA 2XZQL 1AGBA 2JJTC 3MC0A 2BNQA 3I3BA 1JGEA 4KKLD 3KPNA 4PB9L 3OG4B 3MRDB 4X6CB 1D7FA 4YQXH 4P9HH 2R2EB 1R75A 4I2XA 2WNGA 4HZ7A 1T0NB 4LVHB 1G01A 4P4RA 2VN7A 1TMCB 2A77H 4FLOA 2O9TA 4U1MB 2YXMA 1G7JA 3NA9L 5I8CA 2QJDA 4GBXD 4JO3L 3BLKA 3DSFL 1H3XA 1WVZA 2VH5H 3ALWA 1FYHB 1IAIH 4NC1C 3MGTA 1NBZA 5FHAH 5AUMA 1DSFL 4MB1A 3NGBC 4PRBA 5DRZB 3KPRD 2CIIB 3EUUA 3S4SG 4PJ5D 1V5JA 5GGRB 4WUUD 2CKBB 3QXDB 1XEDA 5I5RA 1FNGB 1XCQB 4NUJA 3W0WD 3PNWB 4GRLC 1I1AA 3RIFK 3PABB 4P57A 3QDAA 1V7NH 2WAHA 1XGRA 3QHNA 5EIQA 1KCSH 1ORSB 1HTYA 3BT2L 1S7VA 4NUJB 5EZJA 1EDTA 1MFAL 3U36B 4QRRB 5KSAB 2P5EE 1XCXA 5K9QG 3WKZA 2F1BA 2Q7NA 1OAQH 4XNQB 3TBWB 4G6JL 4F7EA 1Y6NR 2O5YL 1U3HA 4EIGB 4OLVH 4OZFB 4D3CH 4TULL 2A3EA 4M1DH 3R4DA 3RWHA 1S7SA 1ZS8B 1JD9A 4D6GA 3N9GL 4RGOL 4FQHA 5BXFB 1P6FA 4PJBB 4FFYH 1UM6H 3LY6A 1PSKL 2ICEB 3P4LA 2HTLC 4BKLA 5H35A 4Z7QF 5D5ME 4PBVC 5E24E 3CZSA 3DX8A 4UINL 3H3PH 3RPIB 4H1LB 1EEYB 1MY7A 2AK1H 3S3SA 3LEYH 4OBSA 4HLZG 1BF8A 2AEPH 5LA1A 3I02B 1V6XA 3L4UA 3VWKD 4BZ2H 5DYOB 4KY1H 4NM4H 4W8BA 5ELIA 4QCIA 5DMGC 2GJRA 5A8NA 4LBEA 1N5AA 3BVNB 2FZ3B 1S8DA 1QKZL 4XBGB 2AABL 1Q9OA 4R4BB 5ITBH 2CBIA 3P11H 3VW3H 1YN7B 3P0GB 5FGBA 2NZIA 4V1DE 1FVDA 4KHXH 4P59L 2IPKB 1JPGB 5ERWB 1W72H 3ZR5A 3FB8A 1G7IA 3U83A 4NRZA 3OX8B 5CZVL 4IMLB 3NSXA 3VX1A 2O5YH 4IISA 1I3RA 5HVHC 5FYKL 1G1YA 5BXTA 3NFPB 1N6QH 4F7TA 1EHAA 3QHMA 3NFSH 4Z7WB 3EYUH 1D9KC 2Q3ZA 1S9VA 3HFML 3QIBA 3VJ6A 1UEMA 1I7UA 3W11C 4TRPH 5IOPA 3TZVC 3MLSH 3JV4A 3KAAA 1GQKA 3MLYH 1UB6A 2JTDA 2QBWA 1QR1B 3KPSB 3LH2H 3RCNA 1PQZA 2J8OA 4M6AA 3GSUB 2OR7A 3BUQA 3WQ4A 3DHJA 1G9NC 2FDBP 3OGCB 4CADB 5DT5A 1LEKB 4LDEB 2NT0A 1FRGH 1FGVL 2OR9L 4KROB 4KH2A 2W0KA 4I0PB 3GYCA 3GDBA 1RJYA 3MBEA 1T3FB 1ISXA 4D0BB 4YGVB 3TPKA 4XZBA 4CUCA 2RGSA 3W6MA 5HPCA 4NJAH 1FIEA 3SO3B 2MKWA 5C0IA 3GSWA 1NGXA 2VXUL 5INCA 1JVKA 4GAJL 2DIEA 3V5HA 4FFYL 3PE9A 1J11A 1ND0A 1WF5A 1LWRA 5L88H 4LYQA 4Z7NE 4Y5YA 3MSDA 2W67A 2H2PD 3AGVA 1NARA 2ZX5A 1DUYA 4JDZA 2XNAB 4W84A 1MI5A 2V2WA 3L95A 1JTTA 5IB2A 4NZFA 2O9RA 4K7PH 2H26B 2BRRL 1PJ9A 3HNTL 1U3HD 3ZYOA 4R8WL 3HI1B 1RZJH 4I0PA 3BAYA 4FTVB 1ZLVK 4LNRB 1A6UH 4N8VG 5E1AB 3MJ9H 5LGHL 1A21A 5GGQL 3X3FL 4KRPC 4LCIH 5CG0A 5KSBB 4PJAE 2J7CA 1XR9A 4X7DC 5FL0A 2WUCL 5DFTA 1MQQA 1KIPA 5E09A 5DVNA 1O7SA 3IK2A 1MJ8L 5ADOH 3X11A 2Y23A 4D9LL 3ZTNL 3LEXA 4UDUA 1KBBA 1TDQA 3QIBB 2GFBB 4NBYB 1MRCH 1DJSA 1GGCL 4I3SH 3PJSA 3IDGA 1AFVH 4C59B 4RZCB 2H9GB 4HBQA 1I8IB 2OJEB 5TE4H 2PNDA 1D5MA 5B8CC 4K3DL 3X14B 2MSPA 3RWIB 4TOQA 1QACA 3VWJC 1EOMA 1OB1A 2XN1A 3MLYL 1JPST 3GRWL 1U8MB 1WJ3A 2FO4A 4XB7A 3TNMB 4GRMA 2O5ZH 1NEZG 3BE1L 3UTPD 1IQDA 4POUB 3SDDC 1U91B 5B8CA 3W27A 2WBWB 3KPOB 2DI8A 1FLTX 1HHJA 2XWTB 2D0HA 4DAGH 4BZ2L 3B5TA 2PWEA 5LGHH 1Q94A 3H9SB 1VB9A 5SWZB 1KXQA 4K3EL 5E94A 3C6LB 1AIFB 5I1DB 2F8OA 3WBDA 1PYWB 1J0YA 1XGUB 1CICD 1KT2A 1VJSA 4ZE4A 3DECA 1HT6A 2YRPA 3VW3L 5A6SA 3GSOA 1MJ8H 4YBLC 4TYUA 2L7JA 1YYML 5D71L 5AAMA 4YXHH 3BKML 4GQQA 3WS3A 3BJLA 1CLXA 5SWZD 1HINL 5HHMB 5C8BB 1J12A 3MRMA 1K9EA 3BQUB 1RK0A 4QLKA 1B6DA 1ED3A 1KJ3L 1R8LA 3RWHB 4U1JB 4KUCF 3MNZA 5F9JA 3OKDB 1MHEB 5ESVA 1TJIL 1ZHNB 3BN9D 4I13B 2J1KA 3HNTH 3ULUC 3MRJA 2J88L 4KMTH 4XC3H 1QLEH 3STBA 4XB8A 5JOPE 1KBKA 3SY0A 3TYGH 1B9ZA 1VESA 5CJXA 3WUZA 4RRPA 3QFJA 1WAAF 2C26A 4JJ5A 5EFDA 5D1XC 5IFJB 2FH6A 5AYBA 3A24A 1OM0A 1QFOA 4A2LA 1IT0A 2D31B 1MCHA 2HYMA 2YHGA 4J4PC 2QPUA 2NY1B 5FO9B 4N0CD 1Q9WB 2DQXA 3WFLA 1IGYB 1WICA 5TF1H 3UR8A 5HBBA 2DTMH 3AFBA 2K7QA 2VQTA 4HXAH 3DX2A 1U8NB 5I19L 4KDWA 1X7QA 4M1GH 1XF2A 1X4ZA 2DM4A 2JALA 1KPRB 3E2HB 5EUOF 4AZIA 1A2YA 1D5MB 3PDGA 4JO3H 4V2CB 5CZXC 1MVUB 4YDVB 3UBXB 3CO4A 4B7LA 2CRYA 5D7JB 2K7PA 2AV1B 3CD4A 1JGVH 1QNZH 2X9XA 3U79A 4F8QA 2B2XL 2X4QB 3SGKC 1HINH 3C5SB 5AD0B 2BC4B 4HUUB 4MJ4A 4WV1A 3QCUH 5L2JB 2GJJA 3QIWD 4NO5B 1JF5A 3DX7A 3EFFB 4LCWE 2G4FA 2HFGL 2EEXA 1XGYL 5DHVH 5K9KA 4KJPD 2IF7A 3D2UD 1FAIL 1HKLL 3WH5A 3KYNB 4NQCD 2XWJA 4LDOB 5I24A 4HMDA 4F8TA 4AT6A 2D7QA 1EDGA 1CDIA 3NCYS 2D1ZA 5TE6H 1MF2H 3A67L 4L3AA 2PCPB 5JBEA 1NLDL 4MX7B 1BJ8A 2OTUA 1IE5A 5CILL 3QQ4A 4V27A 2Y25A 3RNKA 3BRGC 2ESVA 4P2QB 4ZS6D 2WCSA 1MI5B 1Z9LA 2V2WB 2YBRB 4HUMB 4HGWA 2GDVA 3MOAL 1UWUA 1NQBA 4OAWA 3RKPA 1T6VN 4OZHB 2EYRB 1KLUB 3W5NA 3U1SH 3DWTA 4WHDA 2NR6D 2W9DH 1PIGA 2ZOLB 4HFWB 5FDWA 2J7EA 4E8DA 1LO3L 4H5SB 1BJMA 4NYLB 1UR8A 3PV6B 3SDCD 1HKMA 4IMKC 1XD1A 2WVSA 5MERB 1JRHL 4M8QB 1FZJA 1F58H 1HWWA 1A0QH 4B9YA 4GMTL 1K6AA 3PL6B 3C6LC 4GO6B 4J3TA 2PO6A 5SV4A 3U7WH 4MMXC 2UZXB 1XH3B 2HA1A 2ALWA 2YKKA 3WL1A 3UO1L 3O45B 5JA9A 1WAWA 1RZJC 3IS0X 2X4UB 3O6KH 5JUVA 1QKZH 4LPWA 1T5WB 3B5GA 4HC1A 1BYCA 4Q2ZB 4GG6F 35C8L 5JXEA 3D0LB 5J1TC 2HLAA 2VWEC 4H25B 1F6AA 2DRUA 3ZHKA 3PWVA 4YXKH 4GW1B 1EXUA 4APQA 4TSAL 2XM2A 4XVSH 1NUFA 4BJLA 1RULL 3EYSL 1QD0A 1A3LL 5FYKH 5ANMA 2F58H 3A21A 3RA7H 1IKFL 4OFYA 4OCRH 3S5ZA 3SJVD 3KJ6H 1OM3L 1XH0A 5D8JL 3DGCR 5E5UB 1DQJB 1Z9MA 2R2EA 4PLNC 4H7VA 4I18C 3I9GL 4U1LA 3HPLA 1PGRB 1IV8A 1SEBA 1PS3A 1QRNA 1Q9OB 3OAYH 4UV4L 4PRHE 4NZTH 3WLBA 4OOZA 4WFHE 4NSKB 3P0VL 3LDBC 4NO3A 3ARFC 4N90D 1FYTA 3U9UB 4BH8B 2AEWA 4TVDA 1CGTA 1G6RA 1I9EA 5D9PA 4PG9B 2LU4A 4R4ND 1CFBA 3IDJB 4L5FL 3IB4A 4L4TA 5EZIH 2XA8L 3TA3A 3RPIA 5CAYB 3MR9B 5IHZA 4EVNB 3IT8D 4MCZA 2G5RA 1U3ZA 2W9EL 4JO4H 1D5IH 4LDLB 2YK1H 2OMNA 4FG6D 2XVKA 3NCOA 1YNLL 4JM2A 3V52H 3C5ZB 3ROOA 2HG5A 2V7HA 3RGVA 4M7LT 1HQ4A 2Y24A 3BO8B 1MRFL 4Y19D 2X0YA 4MD5B 1OWWA 1YC7A 3THCA 4LGSB 1EFQA 2D2OA 4P46B 1HOCB 5E99H 5L2KE 2JF6A 3O9NA 4MNMA 3DI3B 1JWSB 3H0TB 4PJGE 1Q4NX 4D6DA 4D6IA 4YHOH 1AD0A 1JFXA 3QRGL 1HEZA 5GGTL 1RIUH 2EPOA 4U6XA 3AOFA 1CGWA 3OKKB 4LVEA 3R1GL 1I3VA 4EK7A 3B6SB 1V7NL 3P4OB 3DXAA 5I16B 1I8MA 2YA2A 5CWSA 4DZ8B 2PW2B 1KSRA 4QTIL 4P5TA 5IB5A 4H04A 4RE3A 2IG2H 3MNWA 3BPLC 5JA8B 1ES0A 3O3DB 3W4RA 2E8YA 1F11A 2H3NA 5LGKA 3QEUB 2GJ6A 3D18A 2FX9L 4RAHA 5J56B 5C3LD 3DYMA 3IKCB 4WF7A 3ARQA 1RK1B 4HIEA 4PJ7B 1R7OA 4G8GA 3UG5A 4H5SA 3ULSB 3EO1B 2E7LA 2WANA 3MRBB 3IFLH 5DJDA 2YD5A 4YNYA 1M6OA 3DVGB 2V5SA 4NZRL 3AHXA 3BP7A 3MLTB 3QPQD 4EN3A 3SKJL 2C0HA 4XC1H 2FJHB 2EBNA 4I48A 1RSFA 5ECJE 3D3VD 2GT9A 3BLPX 4XVTH 1A6WL 1FFOA 3FQTB 5IROC 1F11B 2H3NB 2HRPH 2DWDB 5DTFA 5HPOA 3BSZL 2BNQB 2QSCH 2XG9A 2VLJA 4N90E 4POZD 5CP7B 4GSDL 3W5MA 1U91A 4JFSA 1JHKL 4X8JB 1T66C 1WO2A 3LXBA 1NGWA 1KENL 1ZLUK 1X5FA 4HXBL 3ARBB 1K2DB 4UTBL 5F1KC 1WZ1H 3FO1B 1ERNA 1S9VB 5ESAA 3ZE1F 4RAUA 1MHPH 1U8IB 4XP1L 2VNCA 1XFPA 3VRIA 3P9MB 5E2UH 3H42H 1UENA 3VFUA 3OKOB 5ECUA 1JZ4A 4H41A 5HBFA 2E7MA 4WNQB 3CFEB 1AXIB 4JFWA 4E0RA 4MDIA 5IVNA 3CFKA 1LEIA 3KJ6L 3NZHL 1OM3H 1T0PB 1CBVL 2XQYG 4HEPG 2HFEB 1I3UA 4MLIA 1HXMA 4IS6A 4KZDH 1XIWA 3RWGB 4JFDA 2QL1A 2MHAA 3AS1A 3ZDXE 3RDTD 2DT2A 4A4AA 1FG9C 1FRGL 3T8XB 1X4YA 1YY9D 4XCEB 3GJEA 4NP4H 3MSPA 4Y2DC 1GGYA 4F57H 1HHKB 3FB7B 3FL7A 3MV9A 1R87A 3P40A 5FO7B 4LF3B 5FA4B 4IDJL 1TETL 4HWNA 1V05A 4QF1B 4GAJH 2BSSB 3MODH 1ZHNA 1P2CA 2EIBA 3QO0B 3H8NA 3QUYB 2YK1L 2D23A 1FLRH 4O5LL 4KZEH 1Q72L 4WTWA 3IF1A 1ED3B 4PTVA 2ERJC 3QOMA 1FBIH 3BLBA 2DI7A 3VFVA 4OFPA 4L3EA 1N3NA 3X17A 3G6JB 1TFVA 5HYSB 2QSQA 4G5ZH 5IKCB 1IGJA 4Y16C 3NCJL 5K9OB 1CXHA 2P8LB 4LFHD 3UMTA 4Y4KA 5IIEA 5GZOC 2E3VA 3EYOB 3NAAL 4U1SB 3MJ9A 3KXFE 2F15A 3NCBB 1VFUA 4LX4A 4KJYB 1W0YT 3VXNA 1T22A 1T21B 5CMAA 2XHYA 3ZKXB 1BQLH 3LB6C 5I75B 4G8GD 5IMLA 1JCKA 1ZK9A 4ZS7H 1JUFA 4PUEA 1PQZB 5HHXH 4KZDL 4OLZH 3VFWB 4G8IA 4F7CA 1N5YH 4G7YL 3S4SA 1W0WB 2GDUA 3D4ZA 2CESA 2EPNA 4MHHG 1AR2A 5I1EL 1GGBH 5GGRA 3TNMA 3CVHA 3KJ4B 3O0RL 4KK8C 4KC3B 4JO2H 3CHFA 1CDCA 3TN0A 3ZLQC 5ALCH 3PL6A 3FHQA 3GJFH 1J18A 3QQ3B 5TDOA 3KWWB 5GHWH 4V2XA 5IP4A 1I3RB 4UT9H 1GPFA 2PYEE 3U6RA 2AKRA 1VGEL 4S0TD 4BYHA 2RJMA 3QFDB 4KPHH 1JNDA 1DUZA 1HJVA 4HFWA 3MRPB 1BFVL 1T7WA 1FHGA 2J77A 3TBTA 5F88A 5HYJB 4KVNH 2WMGA 4P2OD 4CVZA 1LVEA 1Q6FA 3GI9H 3VMNA 3QHZL 4P23A 1MFVA 3OR6B 5AZEL 2FDMA 1UD2A 4BF7A 4OSUH 1BM3L 5SX4I 1N5AB 2YWZA 5DQJB 5CUSL 1C8PA 3AI0A 2R4SL 5E2WL 2HRPL 3AIEA 3O3AA 1FZOA 3ZO9A 2I60H 3MLZH 1T83A 1DBMH 3W9EB 2NY4D 4X0VA 1X1NA 4L9LC 3BVXA 1R3LB 1YMHB 4TNWF 1KXVC 5I66A 2C7FA 4OZGB 1CBGA 1KENH 1S46A 2OW6A 4UQ3A 4K07A 3VX0A 5T1DH 3VFNA 5EU6A 3BKMH 4Z2KA 3IJYB 3N50A 4QTHA 4WUKL 3H9SD 5C3TA 1JZ5A 3RWIA 1HHGB 4JFOB 1SEQH 1NGZB 2PXYD 2OL3L 5F7DB 5TDNA 3E6FA 1YY8A 3ARGB 3RWDB 5ANMB 5B39G 1C1EH 3L3IB 3QDJD 5FUOH 5GRYA 3JWOC 2X2YA 2VLLA 2YD1A 4QRPB 5DD5H 1MCNA 5DJ8A 3RIFF 1VFAB 4W4OA 1RP8A 1I1AC 4LP4A 4TUOB 4J6RH 4LRNH 3SHSA 3VSUA 3GIZL 3P4NB 4WWKA 1KN2H 2F5BH 1R6VA 3ULVH 3OGRA 1MH5A 1S7VB 5EZJB 3VD5A 2QV4A 5A1AA 4UINH 3SDXB 1LEKA 4JG1L 1H3WM 2FEDD 3VXTA 3G5YA 1CE1H 3JVGA 2J4GA 1T5WA 1OAYL 5IWLA 5I8EA 1CTOA 1MW2A 1A5FL 4GZJA 1X6LA 1MJJA 3RY6A 4OLYH 4U7SA 2GUYA 2EZ0C 4LKCA 1AO7E 3QR3A 1REIA 1UG9A 1AD9B 1ORQA 4J3UA 4NC1E 4QHUA 3ZL4L 3DVGA 1VFAA 3UYOD 2VDRL 2X1WL 1DQTA 4JO1L 4Q6YA 4KHXL 1KQYA 3DUUB 4UMGA 3VFTB 2X70B 3ZKXC 4L3CB 2D0GA 4ISVB 2KPNA 1ACZA 1AGFB 5DT7A 4NRZB 1F3JA 1V3HA 5HJ3B 2LTQB 4OGXH 4Y2DD 5AZEH 1DEEA 2DYPB 3JV6B 4Q0XH 5IHUL 1N6QL 2XZCL 1JRHI 5CZKA 1QPPA 4AENB 5IESL 3WFDL 3ZKQD 5I66B 3MFFA 3K8LA 5KVFH 2VX4A 2ZUSA 3MREB 2Z8VC 3FXYA 1OQXA 2EDXA 3HE6C 3TGXA 4GIAA 3BZ4B 2R1WA 1BOGB 1MAKA 4LLQB 2CO7B 2DOCA 1S7RB 2DM7A 4F7MA 5DQDL 1QR1A 4PY7B 3OB8A 2AEQH 2ADJA 4X4XA 2XQBL 4KQ4H 1ACYH 4ZQKB 3MV11 3I6GA 1R7AA 3WFEH 3QUMA 2CIPA 2Z35B 3O6LH 1PDKA 1MHHA 5C8JB 4DW2H 5CEYA 3ULVE 4UT9L 2E3ZA 2ZNWA 1FDLH 4CVXB 5D9OA 2XUCA 4OZ4A 4XC1L 1N59A 4JPKH 1BLNA 4PV8B 2ZNXA 3CC5A 4S0SD 4PBGA 1JPGA 3PJSB 4APQD 2X4OA 3O6ML 3CDFA 3RVWC 2YJQA 4HWEL 1YQ2A 2YD3A 4EI6A 4KKAC 3WDQA 1YEEH 2GTWA 4IOSD 4ETYA 4PR5A 3AMGA 1Z3GL 2BVTA 1MUJA 4O2FA 1I1AD 1Z0MA 2IALA 4LRIA 4XB3A 5E6ID 3N85L 4W7UA 3BP4B 1UUQA 4WDIB 1JI2A 1Y7VA 1M04A 2BNRE 4LVHC 4HUXA 1E4KC 5DR5L 3TCLA 2FD6L 1MFBL 5T3XH 5D2NA 4UU9A 1TQBC 4TSAH 5FGBC 1FH8A 3ES6A 4QOKE 2F53E 1OSPL 4QRRE 1L0PA 2DMBA 2DYPA 3JV6A 3QCVL 4U1LB 5DJDB 3TIDA 3RMEA 1LP9A 3LPWA 5EU5A 5BXRA 3L4YA 4M4PA 2B2XH 3E6HA 3WDHA 3MCKB 4OZHF 1AGFA 2Q76B 3CFDA 4ZUVB 3SKOA 2V2XB 5C0CA 1XHGA 2YD7A 5C70A 2YN3A 3N06B 2IGTA 5D1QD 3MJ7A 1PX8A 3CFBA 1FL5A 3CPLB 3M17B 1BMGA 5FGCE 4YWGH 4FNLL 5C0IB 1XGZA 1E6NA 1U8QA 4HSQA 5FO7A 3SDAC 5GIRB 4MNGE 4BQ2A 4WTZA 1ITXA 2BDNH 4OIAA 2ITDB 5IB5B 3VWKA 1YC8A 5F9AC 1EUUA 5I17A 3AMCA 2WMKA 7FABL 3QJFB 3BH9A 3P3YA 4JFVA 4BQCA 4E5XB 1JL8A 4G80A 5DD6A 3K4AA 1FNGA 3QWOA 2OTWB 4RWHA 3WL9B 5KJRH 4XTRD 3T1WA 5DJXA 5LCVH 4GPNA 3VXRA 5ITFB 4PJ5A 1AGCA 1D9KD 4I77L 4HZLB 1BYBA 4ZENA 4MVBC 4BELD 4NQCA 4JANB 1QNQA 3LS5H 4N8CL 2NPLX 3GSNA 5D1XD 2W0FB 1OSPH 5KSAC 4X6BA 2MCPH 3EGSB 1RFDL 3MV7A 1IEAA 4MAUH 4IRSC 3EYSH 4LOUC 3QDJB 4G5ZL 2VLRE 1NWUA 1AQDB 1J0HA 3A6OA 3QUZD 1NGZA 1WB0A 4M1RA 1DLHA 1E1FA 5HDQH 4I2XB 1OPGH 2C3XA 4KUZL 3N1FC 3RVUC 4N0YL 3ARBA 1Z3GH 3KYOA 3PTQA 1QEWA 5C0EB 3GMOA 3HNSH 4NQTA 2A6IA 4L8SC 3ZM8A 4U6VL 3I2CL 3HG1E 1FNLA 4KK6C 5LWYL 2V5CA 3IDIB 4MJ2A 5EPMB 3GTNA 4RMTA 2PBGA 3DOSA 4PMUA 1PG7X 4M6MH 4KKAD 4RDQF 5CBAA 1F3RB 4ODXB 4XVSL 1CIDA 4OM0L 4OI7A 3QIUC 2DSVA 4EN3D 3CC1A 4R26L 5DJZA 2NY5C 8FABA 3QDGA 5CSGA 1UA7A 2AJ3B 2GSJA 1L9NA 4NRSA 1VEPA 2YL8A 4DKFH 3AREC 3QH3A 5F70A 3EJPA 3O3UN 4EI5A 5DLMH 1QG3A 2VI0A 3DV6A 4EZMA 2HFFA 3OR7A 1FP9A 2OZ4H 2VLJD 2YR3A 3BPCA 4FQIL 3H6JA 1FCCA 4RGNC 3QG6A 4U6YB 5E2VH 5KZ6A 3EDJA 3D4YA 3SCUA 1WTLA 4L3ED 2QQQA 2AGJL 2W66A 4LSTL 3N04A 3RDKA 1YNKH 1NOWA 1E6ZA 4RRPG 2RCSH 3F5WA 2NY7L 2AK4D 5FM5M 1FO0H 1X5AA 2BDNL 2F74B 1MRDL 1T4KB 2GUOA 5CFHA 1H2JA 1N2RB 1E28A 3CIQA 4Q9QH 4J23A 1A8JH 1TENA 5DD6B 5T1LA 1H0DA 1OTSD 1A1NA 1YN6A 5HDBE 3UTZB 4LCWA 3BGMB 4G8IB 1NBVL 5I1CH 4XX1G 3KPSA 3BH8A 1RJLA 4JO4L 3SCPA 5DJAA 1SJHA 1LE9B 1JMXA 2IPUG 6FABH 1E3XA 1DWJM 5MEOA 1IAOA 1F4WH 3LHPH 5TQ0H 5J0BA 3WIJA 1G7HB 2NY2C 3JVGC 3AB0B 4R26H 2Z1KA 4MNQE 1CD0A 1MCOH 2CH8A 3W6LA 3OXSB 4AM0A 1OAXH 1RUKL 5DD5L 3NIGE 5KZCB 1T1WA 3OKEB 4YDLB 5IEHB 5JW3H 5CEZD 4CN6A 3L5XL 4DKDC 3OBAA 2EPLX 1CD8A 5B22A 3CZEA 1TE1A 4NO2B 4S2SB 2BSSA 2ESVB 4UNTA 1VIWA 1J88A 4Q58C 3AIRA 3VMOA 2R2BB 1UZ6E 3PHOA 5GGVL 4D0CA 1CZ1A 2DWEB 2AJ3A 3H55A 4XP5H 3LQAC 5EPMA 1P1ZB 3T08A 4I9WE 3CX5J 4GXVL 4HIIB 1P1ZA 4JRXE 1R5VA 5FYJD 5C0FB 1QRNB 5SX4H 4JG0H 3DURA 4NQDD 3PP4L 4P23B 4KK6D 3MRKA 1KEGH 1EPFA 2HFEA 4OZIB 4EDXB 3F7YB 4QFUA 4IBLT 3NH7L 3KNBA 4MD4B 4OCMC 4MS8D 3B9AA 2IH3B 4ODTL 2HT3C 2XWDA 5F7UA 2QF8A 3SGKA 3RKDC 3WY1A 2KQMA 1A1MA 2QR0A 5HSFA 3O2DL 4L8BA 3GK8L 4X0NA 4J3SA 3UDWA 3TH4T 3BAEH 1UVQB 3NAAH 1JWUB 4APQB 5L8LB 2Z4QB 3QFJD 4HJ0D 5F97E 4YHZL 1VACB 2EDHA 1IVLA 4AK1A 1JNHA 4MXWL 4DN4H 1A9BB 2VN4A 5T1LB 1XCQA 3C5JA 2AEPL 4CVUA 4LLVA 2BOBB 2CHOA 4WI5A 2EE3A 2DBLL 1MOEA 8A3HA 1OTSC 3MXWH 1E71M 2GTZA 5D72H 4U2ZA 3MRGB 1AGDA 4UFJA 4P2OB 2HKHL 4CD4A 1MCOL 2JK5B 2VTFA 5T1LD 4F2MB 1WBXA 2EC8A 1H3TA 4YHLH 3HC3L 3PV6A 3RWJB 1EFXB 5FIEA 4PGEB 5D7LD 3WUBA 5HYFA 4PRHD 2WKGA 4LCUA 2C3VA 4N0FB 4F9PA 4KI5D 3RWJA 3ILPA 4PMVA 1IGCL 1JNNH 2YBTA 3NIYA 1TZGL 2CK0H 2ZCLL 3F6LA 4PJAA 4U6HB 3U57A 3QDGB 5ADPL 2VXSL 4JGUA 5E94B 3X12A 4W87A 2UZIH 4PRDA 7CGTA 3FQUB 2YPKA 2Q8AL 1WBZA 3M1BB 3ARDB 3QQNA 5JHLL 1AQKL 5EBGA 4JM2C 1MCDA 5I8KL 3BP4A 3LH2L 1ZOXA 5KN5A 2G8ZA 3UTTA 4PV9B 1MW3A 2YWYA 1JIBA 1WWAX 1JNJA 4HK3J 4WWKD 5BVJB 4TQEH 1CI5A 3DSNA 3TFKD 1D9KB 2BNRD 4Z77A 1JWUA 1UD5A 2JJTA 3PN8A 4L4OA 4M7JL 2FGLA 1ZANH 1NCBH 5D6DC 3C6LD 1QTYT 1WIUA 1K9DA 3OJDA 3OV6A 1I4FB 3FNDA 2YKLH 4Z5RB 4C83B 5F3HB 3HE7C 2WC3A 3NCJH 2BRQA 4DVBA 3QXAB 3REWB 3Q5TA 5IBUB 4K8RL 3BAEL 2XXCB 2VL5A 4S11A 5D96C 3PHSA 2NZ9C 3EJJX 3HUJE 3RU8L 4BZ1L 1N0LA 1SJEA 4MGXA 2IPKA 1FFPA 2OYMA 4CDHA 4S1DD 4AIXA 4HKBA 1BQUA 5F72S 4KI5F 3LKQA 5JORA 1LP9F 1J9CT 5H8DA 1RZFH 1OGAA 3R8BB 4P2CG 3MRNB 1BFOB 1UA6L 4J8RB 3DHPA 3PBGA 1QFUL 4HK3N 5JXED 4Y2OA 3GO1L 3SKNA 4HJ0C 1JF1A 4NQXB 3WH6A 1NAKH 2NXYD 3E3QC 3QIWA 1UACH 4QXWA 3WSQL 4Q9CA 5C9JB 4OCSL 5FECB 4P2RA 2J12B 1BGXL 2A9ML 5IVXB 3DV4A 4NFCA 5EU3A 5I8KH 2NY6C 4NKDB 5JIWA 5FYLE 4AZGA 3ZL4H 3J7HA 1KGXA 5D1QC 3ZDYE 5CJ8A 1FZMB 1JMZA 1WAAA 3D0VA 3FOLB 1FL5B 3WSUA 2VZTA 5HHPA 5FKPB 1DQJA 1A9EB 3DRTA 3EKCA 3V6BR 4V1DA 3QUXC 4XNUL 4HKJA 2BY3A 3HZ3A 1AQ0A 4HAGA 1MVUA 4YDVA 3UBXA 1H4PA 3F8UB 4TSCL 4AM0B 3O2LA 3IRPX 1A4JB 5E8NA 1S7XA 3VCLA 4D6EA 1FNAA 1BFTA 2YD4A 3UTTE 5FYJU 3HZVA 5F7YC 4LLMA 2J7GA 1J1XH 5DWUH 3WIFA 3BIKA 3VXUB 4GKOA 4P2RB 3VOCA 3V8OA 1H15B 1A3QA 2DQHH 4OLUH 4BQ6A 1HIML 4CRPA 1NCAL 4MVBD 2IALB 2EH7L 4K94L 4LYRA 1FQ9C 4B50A 2WKLA 1R3IH 4N8PA 5D7IA 4Z8FH 3N12A 4IRSD 4E42A 3NJ3A 1YQVL 4LOUD 4UZUA 1DLFL 4ZTOL 5AUMB 4JM2D 4QYOA 3HCVA 2A9MH 1H3PL 4ZFFB 5D1XA 1CG9A 1P7QD 3CH8A 1YY8B 3ARGA 5E6IA 4L4VD 4LSDA 5D7LB 2B0SL 4NT6A 3GZKA 4XHQA 4X6EA 3U30C 1RUPL 3S37L 1YMMB 1CDHA 4NJ9L 3DYOA 1HIZA 3QDJE 4XVJL 1FBIL 5F7KC 3S35H 1JYWA 3HE7D 4ZQKA 4PRPB 3DV4B 5EU3B 3CSYA 1CGSL 4P2QA 5K33A 3QIUD 4NDMB 2WMPA 2EXOA 5A2LH 2FYYB 1C5DA 2XZCH 4EN3C 2QADB 3FB7A 4QWWD 4XCFH 5TPWL 4LGRB 4XC3L 3RWFB 3QCTL 4LHUB 2KDGA 1QSVA 3O41B 3W37A 4PMYA 4XPHH 1BPLB 1UXWB 1GOWA 2CRZA 2X2HA 2JJSA 4X9YA 2W91A 4K94H 3WCYA 4S2SA 2DQJH 3O9WA 1BVKB 2A6DA 1CDGA 5L6YL 2NLJA 4PJBA 4F9LA 1FYTD 3K7UA 4LSRL 1ZBKA 2J75A 4L3CA 4ACZA 1U95B 3WEXB 1ITCA 2I9LB 2Q1EA 3WS6A 5ABEA 5EO9A 1U2YA 2AV1A 4O00A 3BSHA 5DMGD 1VDGA 4POZC 3W81A 2P49B 1B3WA 1IBGL 4H8VA 2VZ3A 1NH6A 5C0BB 2PTVA 3U48A 2QHRL 2D03H 3OAUH 4UV4H 3ZDXF 1HYSD 3GSXB 4P5KA 4QKXB 3UXFA 4O2EB 1CGVA 1YEJH 5DJAB 2VDPH 5DJXB 3CSPA 5E8EA 4GXVH 1NANI 3MV7D 4NQVB 1BP3B 3W82A 3TN0C 1DQDH 3WNOA 4Q22A 3AICA 3PZOA 3SGJA 3QUKA 1R5WA 4D6JA 3SGEH 3ULUD 1EGJA 1FFOB 2WMIB 5M3WA 4IUGA 3SCQA 4KJYA 2X10A 2IQAA 2X1QA 2NY0D 3IJHA 2JB5L 2NW3A 1IGJB 3UJIL 1JZ6A 1ZGLP 1HJUA 1DVFD 5GRXG 1U0QA 5HGHB 2BVOA 5FO8A 1L6ZA 2QHAA 2W61A 4G8GE 3NFPA 1U8KA 4M00A 4LSSH 5FCSH 1U30A 3L1OL 2ZOLA 3K0WA 5FDWB 3RI5K 5CEXA 4YHNA 1R3HB 1N64H 3BXNB 4W8LA 5EA0H 4NFBA 3V6ZA 1LF1A 5KS9A 1NCNA 1SM3L 4OZHA 4D2NA 3VIFA 1DWHM 4BM7A 3N1GC 3LQZB 3G5XA 3TIDB 1ZA3B 1G7LA 3CK0H 4TNVK 2YL9A 2XI9A 2DJ4A 1GGUA 4ALAL 2A9NL 5C0FA 1MAJA 5D5MB 4YFDB 3TNNB 4H26B 3GH4A 3NZ8B 4DJMA 1HDMB 5K9JH 1T89A 3BZDA 3W0WB 4XNYL 3PTMA 1O7DC 3S5LB 3BP6B 3FT2A 4EXPX 4TVUA 1EEZA 3ARPA 4IS6B 1DFBH 4KXZH 5J13C 4R97B 3N1PC 5EZOH 3GNMH 2YMXL 5F9WC 4OKVB 1MPAL 3MXVL 2CHNA 4BK5A 3PHOB 5KJRL 3VM5A 4S1QH 3FQNB 1DLFH 3POCA 4ZTOH 4WEMB 4KUCD 1U3HC 3VXOA 3EW3B 1B88A 4HPYH 2P45B 3AZRA 1JPTL 2VXUH 1TVBA 4TTDC 5FEBA 4C54A 2WWMD 1GYAA 4M62L 4LSSL 1KELH 3W53A 1I9IH 4ZS6C 4HZLA 1JHTA 1YEJL 1KB9J 4YHKH 4Z9KB 1B0IA 1X7QB 2BY1A 1C12B 3O9WD 3MRHB 2NW0A 1QSEA 4M3KB 4YDIL 1U8JA 4M3JA 3KL0A 5C09B 4YR6B 3EFDL 2NY1D 2CCRA 1XF3B 3SCMA 1FFQA 4YPGB 3MACH 4NOBA 4A6YH 3KPSE 4IRJB 1BQCA 3X3FH 3TH3T 1HZHL 1ODZA 2EYTA 4LCIL 5I76A 4JL2A 3IFOA 4M7LH 2BVQB 4APQC 2VAAA 1W3JA 1KCVL 1F4WL 3WUFA 5TFSL 2ATPB 2NY6B 2A38A 5KVDL 1FE8L 2YMXH 2YC1B 4F9JA 1ZAGA 1KIUA 2EDEA 5CSZA 1WC7A 3ZTNH 5GS1A 3BKCL 5L9DH 1BVNP 1INDH 1MNUL 5BRZA 3GNOA 1QI5A 4YDLC 3STZB 4NO0B 1W9PA 5J1SC 2JB6A 2E0PA 1WC7B 2CBUA 1CBVH 4AIUA 2XGIA 3TBSB 4FFZL 3U4EB 4NQDA 4PJ9C 3T0AA 1EHXA 1OD0A 3D18B 1BGGA 4MB4A 2AXJA 4Q7DA 5GS1C 3IJ9A 4BUGA 4MNHB 4LKCB 3Q48A 3IDUA 2DTSA 3MV9B 3HC4H 4AYGA 3FKUS 3VIKA 4QRQA 4MB3A 2RQ8A 1J86A 1BJ1J 4JRYE 3CUGA 3UTZA 1OGAB 3ORJA 3POHA 1MCJA 4PJHB 4H88H 4X0KB 5E5RB 4EBQH 3RHWK 4LVNB 5DLML 2V7NB 5BVPH 3OIHA 5IVZB 1A4KA 1CDUA 3I75A 1NP0A 3V52L 3JUYA 3ABZA 4HF5H 4NQEB 3VFGL 1MY5A 5E0FA 4DEPC 3A6CH 2VLKB 3ARYA 4Z95H 5I73C 1NAMA 3MV8A 3EDEA 3MROB 1LO4H 4M02A 5IQ7H 3NDYA 2V7HB 4LSVL 4W89A 3SGDI 1GOGA 2LAAA 3SDYL 3UTSE 4QDMA 4UNIA 5D1ZD 3L3HA 3OXRB 1ECEA 1J1XL 5JO5B 4GW5A 3K74B 2XSAA 4ZODA 5DWUL 1CECA 1B3VA 1K2DA 2QHLA 5KW9H 3B3IB 1J8KA 3CHCA 3NPZB 1FHDA 1ZVHA 5HHXL 5EORL 4QRRD 5KSAD 1JDDA 2BY0A 4ODXA 3WELA 4WEBL 2ADGB 2B1HL 3LS4L 4Y5VC 3H54A 3VWKB 4HS6B 5J9PB 4FLSA 2AK4A 4MHHI 4ZFMA 5K9QI 2H26A 4GRWE 1D6EA 4F37F 3G5XB 4HC1H 2WWCA 2WVVB 3VFRA 4UTAL 1QSED 1SR0A 1S9XA 2DLTA 1AO7B 5F1IA 3CTTA 3FO0L 5DVKA 3UPCA 4FQQA 3D52A 3HMXL 1UWGL 4U3AA 2E9IA 3WUWB 4UTBH 2D7TL 1KTKE 2V5YA 3ZT6A 2AKRB 3RPKA 3GI9L 1TZHB 3MS8A 5GSRA 2ZUTA 1L0YA 1NMCC 4AH2B 5B38B 3DX9A 2V3FA 3H9HA 1E4LA 4PRPD 1IKNA 4JAWA 5I3DA 2IBGA 1FNEB 1AGCB 3W2DH 4Y4FC 1A4KB 5HY9A 1KR0A 4J12A 4WVRA 2OTWA 5C7XL 3LMJH 5ACZB 1IC7H 3E8UH 1SJHB 1E0VA 1GXEA 4QAWA 1VGKA 2R56L 4HU0A 3DX6A 1YECL 2BJML 1WPCA 2P8PB 5I71B 4W93A 4PGDB 1X5KA 4GG6E 1IM9D 6A3HA 3EYQD 4KDTC 3SO3C 3EO0A 2Z8WC 3U9PL 4NWTH 1MIML 3HNVL 1DWAM 4MB5A 1C3FA 3A4WA 1MI5E 1BF2A 1RUQL 4R90H 2RAMA 3O6FD 1KC5H 1KCKA 2BFGA 3MMEA 3BYYA 3L5IA 4OZ4B 5KVDH 2G75A 2ZSWB 3UEQA 4ZXLA 3NFSL 1UHVA 4K3DH 15C8L 3KPLB 4FQXC 5HDOA 1YNTA 2CK2A 1V3JA 3UYRH 4WO4C 2V2TA 5CSZB 2A77L 2HFFB 3OR7B 4NX0A 1LO3H 3AYSA 4P3DA 3IFLL 2VLKD 4TX6A 3M07A 4X5XB 2O5ZL 1YMME 3UAJD 1LILA 3QI9D 2FBOJ 4DQOH 5TH2B 2XV6B 4JRYD 3ZE2F 2VVSA 2Z8SA 3WXWH 2UY2A 4FK9A 4HWUA 4PB9H 4JZ5A 2WHLA 4IEFB 2WVUA 1GOIA 5T3ZD 4BQ8A 2ENSA 1JWMB 2APXA 1UZ8A 4PG2C 3SDDB 3OR6A 5CJOL 3GNRA 2G60H 3DX4A 4NXSA 1ZA3A 5DUPH 1UKOA 2HVJB 3GXDA 5DEGA 3W9DB 1ZA6A 1KIRB 4XXCA 1X9QA 2NXYB 4U33A 1NAML 4CW1B 5DGRA 2VO5A 4AIOA 1DBAL 4PG2A 3GXFA 2Z35A 5I9QC 3PWJA 3QYCA 2FR4B 5TE4L 3MV8B 5HVWA 5CINL 5E03A 4JKWA 3K2UL 3MJ9L 1US2A 3E8UL 2YOCA 2BERA 1I8KA 5ABFB 2QV2A 2CJUL 2RFXB 3L3KA 4K7PX 2YRLA 2IPUK 2VLJE 5EFIB 3VGEA 3QHFL 2FBJL 1RUAH 3VDCA 3WL9A 5J8OA 2BOCB 1E72M 1XR9B 1YHTA 1S7QB 3BT2H 1BM3H 1IGYA 3SCTA 3EZ8A 1DQLL 3WQ6A 1PKQB 4L4VB 5D2LB 1ZLSH 1YEDA 3L5WB 1G0DA 2ITDA 5SV3A 5A43C 4G3YH 4PRNB 3QUMH 1R47A 4J3XA 5I1AA 2EDQA 1V0KA 1MI5D 1RIHH 2NTFA 1WDRA 1DVFA 2DGAA 4O51A 1F02I 2DSUA 4WI2A 1D5ZA 5DVOA 3ILPB 3CXHK 4P9MH 3SCMC 3KE0A 1F2XK 4W7VA 5C08B 1QHZA 1W3HA 4Z76B 2R23A 2MWCA 3MLWH 3IF1B 3FTGA 3WIHH 2OWCA 4ATLA 4FQ1H 3IGUA 1MCBA 4ACZB 1G0XA 1Q6GA 3O6FC 5JDSA 3WNKA 3QCUL 3CXHJ 4OF0A 3O9WB 1A7QL 1ZE3C 3UBXG 1YA5A 1UWIA 1G0YR 2E6JA 3HZYB 2DD8L 1TVHA 2F19H 1W9XA 1K8DA 4K3GA 4ORGA 2JCCA 2ZUVA 3WDRA 1NCDH 1BVZA 1N7MH 3QEGL 4WO4D 5A6AA 5I1IL 3ZHDA 2Y6SC 4EKJA 1T0MB 5I1JL 1W2KT 3RP1A 1M7DA 3IU4L 2HT2D 4JL1A 1CS6A 3TTYA 3L3GB 1O0VA 1UYQA 5JBDA 1R5IB 3N18A 3ECBA 4JFZH 3VRLE 5BW7A 1RZ8B 4Z18A 3L4VA 2EDRA 3B2VL 2Z4QA 1KEML 1ZLSL 3G08A 2QMJA 2X5PA 3L3HB 5I74C 2HVMA 1QPXA 1SEQL 5IFPA 4P8WA 2BX5A 3C60D 1JHTB 5H94B 4Z7WA 4QRUA 2CMRL 2FYVA 2QQKL 5GGUA 1BZ9B 4PJIB 4FFZH 4FN0A 4F9LC 3U5UA 3BYTA 1I8IA 4GMTH 5JHDE 4O4YH 1PKOA 4QYOB 5CSUA 4XPTL 2JF7A 3OL2A 4G8EB 3AC0A 4XVUD 4PD4J 5C6TH 1E1EA 1ZMYA 4OD2B 3F58H 4MJ6A 4KJQC 4XV0A 2AK1L 3CDYA 3PHQA 4DKAA 3T3PF 1CGSH 5DHYB 3R0MA 4JDVA 4K3JH 5E5MB 1QA9A 4Z0BH 5I17B 2D9QB 4MQTB 1GOFA 3LKOB 1A6AA 5DJ6B 3L4TA 4FMKA 4PRDB 3HI1A 4AEHL 4L8SB 2MANA 3WD3A 4JDTH 4I48B 4HIHB 2A0LD 3CSYB 5C0GA 4RA0C 1MJ7H 3ZE0F 4RGNE 4W85A 4E41B 1YEHL 1AJ7H 3OF6A 4YX2L 4AL8L 1HJXA 1YJDH 1TVHB 1FFRA 2Z9TA 4CCDA 3LQZA 3LVEA 2DQUH 3WF4A 1PD6A 2IFFL 4OUOA 2A2QT 4TPRL 5EOQH 4HQQH 5C2UB 4NO0A 1HILB 4DTGH 3T4YA 5FUCE 2J8UA 1BYAA 3KLSA 5K93A 3RX8A 1AC6A 4C56E 1XV8A 5C0AE 5FHBL 2DD8H 3QEQB 4MA7L 4UT6H 3OB0H 4W7WA 4DM1A 1G7HA 3D0VB 5J11B 3O3BB 3P30L 2ZWLT 2ZUQB 2GJ6B 4OQTH 1BD2A 2H32A 5BQ7B 3M6DA 2OP4H 2UWEA 3VXPB 3RUGF 1INQB 5CZXD 1AKJB 2OK0H 3SDAB 2G41A 1T1XA 4PY8J 1YEFH 1R24A 3MYJB 5DZNA 3U7YH 3OZPA 3MV9E 2Y07H 1Q38A 3E0GA 4LMQI 2YN5A 5ICZA 5T3ZH 1HH6B 5F3BB 4AC1X 1QFUH 5KVEL 3WN5C 2D9CA 4I3SL 4LSRH 5A6KA 3WD5H 1KB5B 4AQOA 4XPGH 3KPRA 2WZEA 2NSXA 1TQSA 1DZBA 2CUIA 2AQ1A 3FT4B 1E4XL 2O61A 1W1PA 4PCTA 3OAUL 1FC2D 2F8VA 3X13A 3KPRE 4HS8L 3C5ZC 5DO2D 1DP0A 4G6KL 1KJ3H 3HE7B 4F58L 1FH5H 1FSKB 3LV3A 4ZXBD 1QFWM 1YN7A 5DHVA 3LD8C 4AZHA 4P46C 1K4DB 2YIHA 4NC2B 2V3EA 1UKQA 5ISZB 4M61A 3KYMA 4WHCA 3EDFA 1GVIA 3BMVA 1BBJA 2B4CH 2P5ED 1G7PB 4X9HA 1NKRA 4MTVA 5HYSG 4ZNCD 1WCGA 4KJQD 4IRJC 4ORZC 1IILE 4MDOA 3ILQD 4Y4HD 3RZCA 3O4OC 1YPZB 4KGJA 5E8DH 3NFNA 1C5DB 1N5YL 5AYUH 1ZHBA 1K85A 3UJTL 4BK4A 4JFZL 1G9NH 3B3IA 3HZYA 1QO3B 3BKCH 2VR4A 3G9VA 4YO0A 4Y4FB 4OFKA 1F90H 4N1HB 2WHMA 4EE9A 3ZHLA 1LL7A 3OXSA 1AY1L 3OKYA 1T20A 1M4KA 2WP3O 4JAMB 4G9DB 4M7KH 1UXSB 2IANB 3OF6D 1UZ4A 1V0LA 2NYYC 3G6JE 4H8HA 4ODUB 1GZQB 1NUNB 5BZWB 3TEUA 4O58L 1WCQA 4AD4A 4YPJA 5LJYH 2QSCL 5EMYA 3L7EB 1YUHA 5EZOL 4Q6IB 5FGRA 1EAPB 3TC9A 3VFWA 3QXDA 3O2VH 1J05B 2HFTA 3WIIL 3C08H 5A95A 3NDZA 3MYJA 2F53D 3N15A 2PWHA 3FQTA 3NSNA 4LLDA 4OD3L 1CIUA 5E4EB 5DJ2A 4JKKA 3WD5L 3SDAD 2F8QA 5GIRA 1U3JA 4TUOA 1GAFH 4Q9RH 1NUGA 5EC2A 3MZTA 3Q1SH 3ARFD 4XP6H 3DVFA 3ZO0A 3BKYH 1QRND 3UJTH 4C56D 3RL2B 4IJ3C 2ORBL 1JFQL 4AMXA 5IHSA 3GK8H 1MJUH 4JFOA 4YHKL 3O4LE 1F90L 5I8CB 5IEKA 1MQRA 1W3LA 2D24A 1WBXB 2NLJB 2EYRA 3VG9C 4EI5B 1KB9K 5DMKB 5F7HA 3BZEA 5JXEC 4CD5A 4Z7UA 1IT9H 4RFOH 3MBXL 4PJFE 3KEHA 4M8UA 2YD9A 3NFNB 5SX5H 3P30H 1C90A 3LAFA 3MFGB 4FNLH 2XTKA 2XIDA 1LDSA 1YNKL 1JWMA 2BOBA 3AHYA 4ODVL 4HIJB 3ZKMD 2OJZL 1Q9LA 3OB0K 4K9EL 2VABA 4K9EC 4LHQB 4MDPA 2B4CL 1CL7I 3IXTA 3GIVA 5DC9B 4I18B 1EFXD 4J1UB 3GJEB 3MGOA 3QUZC 3II1A 5KVGL 1JYXA