1CXLA

Complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q
Total Genus 243
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
243
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
total genus 243
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxlA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxlA01
1D6VH 1S78C 5I1GH 3OV6A 1HQ4A 4LQFL 4JAMA 1FA2A 4DAGL 2HRPH 1VAHA 3K0WA 4M6NH 3LQAH 3KS0J 5DD3L 5E2UH 2MFNA 5EN2B 5EU6D 3G08A 5A16B 5T33H 4UQ3B 1M03A 3MNWB 5H8DA 1WE5A 1C3FA 4KH2A 5GRUL 2Q76A 5GNXA 5HDQH 4A3YA 5D1XB 3G5VB 3JZ7A 3NCBB 4XPHH 3Q2CA 2VB5A 3MODH 5FDYA 4DW2H 3U9PL 4I5BB 1EJOL 3BAWA 1IBGL 2DYPD 1KIPB 3V4UL 1CK0H 5A3ID 2YBRB 3SDDC 1A1OA 2C3VA 1X4XA 1H15A 2ZCKL 1KCRL 4X6EB 1I8KA 4NRXA 2W66A 3MYZA 4LSSL 3KPLA 5CCKH 4HWBL 4R7NB 1XGUB 1MFEL 2XZAH 3QIUB 1T80A 4Z0XA 4XC3L 3LMJL 4I0PB 3ET9F 3B9KC 4PTWA 1FYTB 3BZDA 4M7KH 4QHNA 3RAJL 2X4SB 4PJFF 4U3AA 4JFPA 1NDMA 3P30H 3V4VH 1RH9A 4HAFA 3HC4H 4FQLL 4YDJB 3HZYB 4LSDA 4P4KD 1JNDA 4C7FA 1W9UA 4Q9CA 1SM3H 4PJ8A 3MKKA 2QR0A 4OIFA 3RFZC 4WHCA 4BK5A 2F5AL 1OOAA 3OL2A 1IM9A 1K5NA 2YIHA 1VPOL 5M17A 4JFEB 1MCOH 4X80L 3FMGH 2ADIA 1G7PB 4PV9B 1AQHA 1EDGA 6FABH 2RAMA 4MJIB 1OGAA 2DSWA 1RFDH 1CFBA 3V0AC 4QYOB 3QXAA 4NKOA 3TC9A 4N0FA 2OK0L 3MQIA 3IFLL 5E6YA 4ZE4A 3AS3A 4Y2DD 1TENA 4PJAB 1R5WA 4IDLA 3FFCB 5C0ND 2IGTA 4M1GH 1DQLL 4OF5A 2ARJQ 3SKNA 2VNCA 1M71A 4JGMA 4OSUH 4PJEE 3VO0A 5E6ID 4MDJB 5GGVY 3CAFA 2O5XH 3VXRA 3WH6A 1KELH 3WL0A 1U8JB 1MJUL 1Q94B 2UY6A 3TO2B 3C9NB 3QUKA 4ISVB 4K8RH 1OAZL 1E3ZA 4JN2B 3RWHB 4DTGL 4G7VL 2AEWA 2F1BA 4MGXA 3RTQC 1GHFH 3W6MA 1AQDB 2FRGP 3ROOB 3DLQR 4N8VB 2YKKA 3MV7A 5J7CC 1P7KA 4DEPC 4KAQH 3QOMA 5FECA 3MRBB 3BWAA 4O51A 4UTFA 1Q38A 2VDPL 3VXUB 3W0KA 5LXGH 2P8LB 1JPFA 4KKNA 1HSAB 3OAYK 1FFPA 5E2VL 1FSKC 3L3KA 5FYLE 4FG6D 3RNKB 4HZLA 3FRUB 1ZK9A 4A6YL 1JGEA 3C6LB 5FA4A 2R0WH 2OTPA 4PLOB 3VFGL 4CNIB 2AI0L 1M1SA 1MCPL 2A2QT 1T03H 3STZA 3RGVB 3GSUB 3IDNB 1CZ1A 4WV1A 4EQ2A 3QXUA 3S7GA 5FB8B 4PJIF 2ITCA 4ZUWA 5TQ2H 1W1YA 5D9SB 2F5BL 2W92A 4ATWA 1H1NA 5K9JL 3U7YH 4ALAH 3VWKA 4ZEPA 3K3QA 3C2AL 5EZLB 4UU9A 1XAUA 1S7VB 3HNSL 3MRPB 3H2WA 5I1IL 3TO4A 3WKZA 3WXWH 2CD0A 2R23A 3HMXA 1D5XA 1YC7A 3DXAD 1WDRA 4W85A 1WWCA 1NCCH 1QYGH 5HHOD 3UJJH 5B4MD 3BEWB 1XEDA 5EO1B 3KPMB 4JDTL 5IB3B 2EYSB 5HHXL 5L2JA 3O6FD 1IKFH 2YDQA 1VEOA 3SUSA 2I9LB 1KUMA 1E6QM 4XPGL 3BSGA 1YN7B 3SDXE 1HIML 1YEJH 4WO4D 4D6CA 1OGTA 2DN7A 3MREA 5GRWA 2AK4E 3R4DA 4YR6A 3N1MC 4F7TB 5KG9B 4TSBH 3G6AA 4KQ4L 4KTEH 1E6OH 3EHBC 2J8OA 3RPIA 2DKUA 2YXMA 1CICB 3MSDA 1OAXL 4PJHE 3WLWC 4YHYB 5HYJA 4KZDH 4JHWH 3F6LA 5EMYA 4WWKA 2GY7B 3H9SA 4PS4L 5IKCB 2PYFA 3TOPA 2B0SH 2GVYA 5CEZL 1F45A 4LCUB 3MGOA 2A77L 4GRLC 1AD9A 1XF4A 4J12A 3HN3A 2EC9T 5D2NB 3BZFA 2AV1A 5KVEH 4Y7EA 4PLNC 3WQWA 2IALA 4EDXB 3QHFH 1GJUA 4UILL 2BMKB 4DKAA 5C09B 1CU4H 4AEIL 1AXTL 4Z7UB 5DMJB 3WMSA 3QXWA 4U1IB 5DQ9B 4OGZA 4JKPL 3VI4E 1EEZB 4HS3A 4DQOH 2XZCL 5I24A 1XSKA 3EOYG 1U8PB 3L3DB 3KLAB 3VWJD 2YUVA 4UT6H 3V5KA 3F58H 5E9DE 2J25A 3GZAA 1RZKC 4N1EA 3GB7A 3FHAA 3WBAA 4EBQH 1FZOB 5C1MB 1IGTB 2DOCA 1E4IA 2IBGA 4PV8B 2PO6C 3BZ4B 2IEPA 1NP0A 4YDLC 1FO0B 4FFZH 2PWFA 4JO2L 4DN4H 4XNQA 2EEAA 1M6OB 1MIMH 1JMXA 1RUKL 1BOYA 2C7UA 5EOCJ 3B6SA 3OR6B 3B5TA 2VX4A 3CDCA 1YEHH 4MNQA 3BVXA 4G6AD 2ICWI 3CFBA 4RDQF 1LP9A 3BN9D 4HIIB 3OKMA 2CDGA 2CUIA 3O8XB 5HY9A 1JTPA 1K2DB 2NY0D 4ZFGL 1KT2A 3RJYA 4L29B 3HE7D 2XTKA 3KPOB 1JWMB 1T04B 3OAUH 1NOFA 3VD3A 3LPWA 2C4XA 5E94A 1T89A 3JV4B 2O9OA 3V9FA 1E70M 3MJ7B 3LB6D 25C8L 1CFSA 4Z7NF 3WD1A 3WNOA 3QUMA 3GNRA 1SMOA 4IRJD 5EPMA 3VRIB 4X6DB 3V6ZA 5JXED 5JQHC 2GDVA 4ONGH 4PJ7F 3HMWL 2J88H 4X7TA 1DWGM 1KOAA 3GM8A 3A22A 3GMNB 4K2UH 5HGHB 3LY6A 4OZIB 2NX5B 3P77B 3P9LA 4MD4A 2VRAA 4X7FC 4OZIF 1K4DB 1IFHL 2D31B 3GNPA 4B50A 3L7FB 1A2YB 5IXEA 3MRDA 5KANG 3OKLA 3CUJA 2NY3C 3S36L 1QNSA 4GZJA 2FYYB 2DICA 1FFQA 4FQCL 4KK8D 4R0LB 1KLGA 2WBJD 4KDWA 3P73A 4M1CC 3OB0H 5DDHA 4FTVA 3BIKB 5DD5H 4YAQA 1PW3A 4OM0H 1NFDB 2EDYA 5FUZH 1AQKH 4EOWH 5A3HA 1PG7L 4C4KO 2GTWA 3IVKA 1J1OH 5B3JE 3DX6B 4X6CB 2DDQL 2OBGA 2ICES 4X6CF 1IV8A 3VSVA 4P8VA 1DANU 5L9DH 3FQTB 5LJYH 3QI9B 4YXLH 2CKRA 4ZO7A 1FV1B 4QCIA 3VFUB 4PRNA 2W9DL 3PQYD 5K59E 3KPPA 4OKDA 3BKJL 5F96H 3B5HA 2R2CA 1IGMH 4AEHH 3QUZA 1ZVYA 3BRGC 3AICA 3VFRA 1DN0B 1RZ7L 3RZWA 5IQ9B 1T4KA 4RGMB 4DKFH 5BV7H 4G8FA 4PR5A 4TOQA 4OZGF 2XICA 3HRPA 1LILA 2X4PB 5KW9H 4EK7A 2GCYB 4NDMA 3O6ML 3QDHA 1QNZH 2QQKH 1UH4A 5KBNC 4KHTH 5KS9B 3IJHB 3FOMA 1UQSB 2WYSA 1A5FH 4HGKC 2HJKA 3GNML 1XF3A 3FB8A 2Z4QB 1RJYA 1NQBA 3DECA 3NIYA 2WZIA 1CXFA 1G6RH 1L4IA 3FZUC 3IDJB 4WU7A 1MQKH 2MTPA 4JFDA 5CINL 1YA5A 4ZS6D 2Z92B 4TSCL 5SWQB 1NGYB 3WDPP 4PN2A 1EPFA 3U1SH 4WW2A 2N7BA 2BSED 3SCMB 3AB0C 5DWUL 1GNXA 2B8OT 4BH8A 1FORH 3DVFA 4NJAH 3NH7H 3NZ8A 1A6WH 2YN5A 3UTOA 1ZS8A 3SCTA 3M07A 4XVTL 2IFFH 2GJPA 3BLKA 1UZ6F 4AT6B 3A6BL 4PGCB 4K9EC 5ABEA 3KWWA 1KPUB 3BVWA 5JDJA 3D3VA 5F7DA 2GJRA 1OSEA 1ZLUK 4J3SA 3BRFA 5I1LB 5IF0A 4W8LA 3MLTA 3HC3H 4LIQE 4TTGA 2DI7A 4NWTL 3PZVA 3TNNA 1HHGA 3LSOB 4Z8FH 4AD1A 3C8KA 4JVWA 4HKXA 4UNUA 1RAMA 4Z95L 2Z8VC 3DRQA 1J1PL 4V2CB 3AXIA 5I30L 2X4TB 4KJQD 1W0VA 4OTXL 5JLZB 4QRUA 1IQWL 2YOCA 2AGJH 1SBSH 2B7DT 5J3HD 4ENED 5D7IF 2PWGA 3C08H 4K94L 1ZBKA 1KTCA 4JPKH 4W86A 3GEWB 2BVQA 1BG9A 1FNGB 2VAJA 2YEZB 1B31A 3EMQA 2FEDC 1AE6L 4MA8L 1UM6L 2UWEF 1MVUA 1KEML 2IXUA 1ED3A 3WDQA 1YDPB 1KCVL 1Z9MA 2IQ9L 3CCHB 4HS6A 5DRZB 3V6OE 4X9HA 1RJCA 3K7UA 1AIFB 2X1PA 1A3RH 5D6CB 5DS8B 1H5BC 4GPNA 3SJVD 2HTLD 2IPTH 4U5KA 4OLXH 4OJYA 1ZB5A 3QCVH 2J8UB 1P2CB 2A6JB 3FO9A 3GMRB 4LLUB 2FATL 1RURH 4NQXB 3IU4L 4WHTB 3OLEA 4PFEA 3IJSB 4G8GA 4QHKJ 3FB6A 1DQML 4BSWB 2VDOH 3WD4A 4U05A 2JCCF 4PP2A 4S1SL 5CBEB 3MNVA 3VXSB 4LQFH 3L4WA 4FQ2H 1W1VA 3ARBC 43C9A 2AJXH 2EKSA 2P5WB 2H1PL 1W9PA 1H0DB 3EFDH 4AZBA 4AH2A 1V5JA 2E5EA 2W5FA 1QO3B 3DV6B 3GXPA 1Q9WB 4PGBB 4PJFE 3ARWA 2FX7H 5IQ7L 5DJYB 5JORB 4HWZB 1BQUA 1HQRB 2H26B 1HE7A 4JDZA 3WUWG 5A2FA 4CCCA 4DKEH 1TQTA 2EADA 2W0FB 3U9PH 1EJOH 5D70L 3WELA 5AYBA 3V4UH 3HE6A 5CSYA 1D5ZB 3QR2A 5FO9B 1J12A 3THMH 1J05A 3DTXB 1KCRH 3U0WH 4CDHA 4LSSH 3ZT6A 1PKQB 4HWBH 3GXTA 3R8QA 3TCLB 1YY9D 4PREA 3MXWH 5HVWA 2APBA 3KEHA 4E2OA 4JQXC 4MDIB 4XC3H 3D39D 3SE8L 1MHCA 1NBVL 5HD8C 3JUGA 4PG9A 3VM5A 4RIRB 5I3DA 3W9DA 4UQDA 4JFSA 3VH8B 2F2HA 3O3EB 1MY7A 2FJFB 1IM9D 2IPUG 4QRRB 1RZGB 3TONA 1VESA 3IJYB 4NQEA 5JIWA 1ZLSH 5EIIB 4DVRL 3QIWA 4OI9A 1LD9B 3DHPA 3WLBA 3BH8B 4Y19B 5K9KA 3UTPD 3MBEA 1BJ1H 4W5UA 1EDQA 2XGIA 1I9EA 1CCZA 3K4ZA 1FJ1A 2NY2C 2VWEE 5EOQL 3F5WA 3CUFA 4ORGA 5TF1L 5D5MB 3ZHLA 2HJFB 1MI5A 1SY6A 1DQTA 5C86A 4PRPB 4HDIA 5I8KL 4FQ1L 1UQYA 3CU7A 2CLZA 4PJGF 2X42A 3INUL 3VXRD 2F7OA 3G6DH 3IFLH 1F90L 4ZSOB 1F97A 5C70A 4TNWK 4PG2A 2ZX7A 3W81A 5FL1A 4F66A 3LIZL 2DWEA 3TBSA 3ULSB 1GQLA 1DQLH 4OCXL 5L8LB 3QUXB 5F3BB 3FT2A 3T4AB 3RX5A 3V5HA 4Y4HB 3RM4A 3QSKB 3VG0L 1BIIA 3V6FA 1IZKA 1OAZH 3DETC 3VFVB 4UQAA 3THDA 1S9VB 4YHOL 4G7VH 1N2RA 1TLKA 4NC2B 4NKDB 4DTGH 5DFWH 1KXVA 5IB1A 2MPAH 2R8SH 2BVEA 2IG2H 4P9HH 2CHNA 4PJIE 1I8LC 2OLHA 3BJLA 2APWA 3FB5A 5C0CE 1UCTA 1ZWIB 5K9QI 3QA3A 3QXVA 3VXQB 1HZHL 4I2XE 4ZDHB 4S10A 4NN5C 4X5WA 1QW8A 4OCMC 5E2VH 1SJEA 5HYQB 1OHQA 2OM5A 2HA1A 2QBWA 5ESQB 1QI0A 1NC2D 5IBTH 3BZEB 1U2CA 4ODUA 2O9PA 3VFGH 3QUYC 4FP8H 4CVZA 1CF8L 5C6PB 2AI0H 5LG1A 2Y5TA 3LQAC 3AREC 3MRNA 3VWKD 4MXWL 3U6RA 4H7VA 3NIDF 4LARH 3SPVA 4ZPTA 2DSZA 5KSAC 5MENB 2FHBA 1IGJA 2EJ1A 1BGAA 3MGTA 4OGXL 3TO4D 4K3JL 2F5BH 4R2GB 1MAKA 3L7EB 2YD6A 2NY4B 3WY1A 1QSVA 3VNZA 5DJXA 1S9WB 1CGTA 3QIBB 2FJGB 1MCNA 4W4OA 2APTA 3C2AH 3VTRA 2VLKB 3CC5A 3AI0A 4QOKA 3T0VA 4MCZA 4NNXB 1QX1A 4AQ1B 1A9BA 4HPOL 5I1IH 2H32A 2PXYD 3NA4A 5A2LH 1IC5H 1C91A 2QSCL 1BF2A 1YQVL 3MNZA 5C07E 1IEBB 3HKFA 3MANA 1EO8L 2YPLB 3GSQA 3RWIA 3MV8A 1QBLL 4XMPH 2G5BB 3WDIA 1OPGL 3VXMA 1YEIL 1UEMA 1CLYL 4R3SB 4CN4A 2ZUUA 4RRPG 2EKJA 4ML4A 5HHXH 1IEAA 4PTUB 4N42A 1KPVB 2BS9A 4EUPG 2A1WL 3CVHA 1HIMH 1JNLL 2QTEA 4NO3A 4QKXB 5JHDD 4Q22A 1HOCA 1M7IA 4S0TD 4OOUA 1JGLH 1EFXB 3CMGA 4BH7B 4KQ4H 1JHTB 3SURA 1RULL 5LA2A 4MQSB 3U7BA 3SDAA 3FCTA 1DBAH 1YPZF 4BELD 2VABA 5FYJU 3WUWA 4U6XB 2X4UA 3QFJA 3NFSL 3DX7A 5KTEL 4QO1A 4JM4L 4XRCA 5CIPB 3A47A 5JOEA 5CEZH 3MRRB 3TBYB 7TAAA 1ZTXL 2WMIB 5I1JH 4NFDA 2R0ZH 2WC3A 3SDDB 4NM8H 1OTUC 5HPMA 2D9CA 4KROC 4UILH 1DQDL 3LRSA 3N50A 4EN3D 2W9LA 2ZCLH 4AEIH 1N6VA 1AXTH 5ALBL 4KY1L 1GQJA 1GZPB 2FJHB 4J27A 1QSEB 3B9KB 4KGLA 3VD5A 1MRDL 4JKPH 4K8RC 3AU1A 1MWAB 3UMTA 5ITBH 4WUUB 3LX9A 1AD0B 3KL5A 5INCA 4TXEA 3FT3B 1FAIL 1HHJA 4MX7B 3VA2C 4HMDA 3UG4A 1D5MA 2EDKA 4MAYA 2VSDA 4M4PA 2GSIB 1GVYA 1E55A 4GO9A 5AAWA 4NUJA 4C59B 1BAFL 2OL3L 4RAUB 5IK3B 1KSRA 2GUYA 2OSXA 4JZOB 3EO9H 4A2MA 2J4GA 1G7MA 3RQ3A 4JO2H 3SBWA 1LE9A 3G5ZB 1A7RH 5IVZA 4Z7NE 3Q6FA 2PBGA 5MEPB 5HYFA 2V5MA 1JGDB 4IRSD 4JFWA 5HI4D 2MJWA 4AIZA 4NXKA 3CUGA 3MROA 2OMBA 2EPNA 2G8ZA 4PJ7E 4ELME 4UNVA 1EJ6A 1HX0A 5IMOB 3N1AA 4PTTA 4NQCD 3KLHD 1V7ML 1FGVL 2GITB 3ULUF 2J2ZA 1UZ1A 3BXNA 1S8DA 4BKLB 1OTSC 3WUZA 4H8VA 4YK4C 4UFJA 3H7BB 5DK0A 3QDJB 3GJFA 3UJTL 2ZXAA 1OD8A 1ZXQA 3JTSA 2C4FU 4FA8A 4UOJA 2ICEB 1MW0A 1TCRB 3PIQB 4G8IA 3AOFA 1F3JA 25C8H 2JIXB 3VE0B 3W6LA 5C3TA 3CFIC 3QEQA 2JK5A 3RTQB 5IM7A 1LO5A 4IEFB 5HHQA 4NFBA 5LYRA 5F21B 2X2IA 3HMWH 2LU3A 2F54B 5DJZA 4KI5C 4UTBL 3OMZA 2AXFA 1S7UB 1CXLA 3T0WA 1FSKB 3F7VA 2ZXBA 3GXIA 1LO2L 1IFHH 4CKQA 2IANB 1AHWA 4OZHF 5DJ8A 1UJ3C 5ISZD 2VYRE 4KVCL 2WUCL 4HGWA 5DMGC 1IAIL 4FQCH 5A8OA 2R1WA 3P4MA 2IH1A 4YNYA 4U2ZA 4X83A 3KXFE 2FR4B 5C0BB 1FIEA 1CGVA 2LVCA 4OZGE 1PZ3A 5EIVA 2OZ4A 1IJ9A 4PRDB 4FABL 1U93B 1WC7A 1PG7H 3WJLA 2V2WB 5DA0B 4GI6A 5E8DL 5IMLB 1JYVA 3MV9D 4WFEE 3PGDB 5HHNB 4BF7A 5T3XE 2DDQH 5CGYD 1WTLA 3KPNA 1GC1L 2AABL 1NJ9A 1JK8A 2Z31A 3EJJX 5J13C 3BKJH 1R3JA 4ZFFA 4Z6AT 3OKEB 5CILL 2WC4A 1EBPA 3BGMA 1N6UA 1OF2A 5ENWB 2BSSB 4E9LA 3O6MH 5BW7A 3LRGA 4JFDD 5GGVL 4JRYB 2KUTA 4RRPA 4UUJB 4AISA 2UV3A 1UZ6E 3GNMH 5HGAB 2VURA 3CIVA 3C87A 4AMCA 4NN7C 4UTAH 2W0KA 4LVNC 5JW3L 1JMZA 2DKMA 3SGKC 2V5SA 2R2EA 2XGBA 5E56A 3C5SB 2ZOKB 1VKXB 1U58A 1V3MA 2I27N 4Y88A 3FFDB 2UZYB 2Y7QA 4HX1B 5HGGS 3VX0A 3AAZB 5DUBA 1WIOA 4CD5A 1CLXA 2J7CA 2OWCA 1I7UB 1V08A 2CDFB 2YHGA 3ARGC 5T1LB 2WBKA 3QR3A 1ZBVA 1TQBC 3RVXC 1IGCL 5D1QA 4QLJA 3MRGB 1NAMA 2CR3A 4XVTH 4J6RH 1V7NL 2Q86A 5IJVB 3RNQA 4FQQA 5CEYB 5ABFB 1YN6A 5D7IE 3A6BH 1HP4A 3TIDA 3NACH 1D2KA 3MRMA 4LGPB 3HR6A 2H6PB 4PBGA 3HZVA 2ZE0A 2KZWA 1OIMA 4KDTA 4TUKL 3ZKND 4PJEA 2UWEE 4LOUD 4NWTH 3ES6A 2OYPA 4YHNA 3CC1A 1IGFL 1H41A 3CZFA 1KEGL 3WF2A 2V2XB 3M17A 2H8PB 5DLMH 2P5EB 2QPUA 2PW2B 3MXVL 4GUPB 1HHIB 1W72L 4TVPH 1XCTB 4OTXH 2OR8A 2CPUA 1IQWH 2GYSA 4GMTH 4Z7QE 3RWCB 3AMCA 2JCCE 2PO6B 4K94H 4YDLB 2XTJE 1N7MH 4ODWA 3T8XA 1J86A 3WJJC 4ZTOH 2D3VA 4P23C 3OGCA 1RQ5A 3CFDB 5KSBF 1ZA6B 4Y0GA 2DQEH 2D7PA 3RVWD 1UKSA 4G8GD 3RJXA 3MCLL 1KYOJ 3GHBL 2BCKA 2NTSP 5AY7A 4MXQD 3IDXL 1VJSA 2CHOA 5FIPA 1JWUB 5LBSL 2HFFA 3DROA 1N0XL 4I18C 3B8SA 1UWRA 3VDCA 3IU4H 3S6TA 5JW4M 5L7XL 4ERSL 1Q0YL 2HRLA 5EZJB 4JFXB 5CGTA 4CN6A 3LKSA 4OZ4B 5I8EA 1IL1B 1H4PA 1RI8A 4U6HB 2ICWJ 3HRZB 3WE6B 1NCBH 5FYJE 2BC4A 5IT2L 3RIAK 4DK3A 3DRTB 1VFBB 2VERN 4JQVC 2H1PH 1KFAL 4WFGD 5DD0L 1FNLA 4U3HA 2NTFB 1CD1A 3UZQA 4N9OB 1IAII 5BV7C 4V28A 1Z6JT 4XZWA 2XN9E 1F11A 2QHAA 4QHMB 4TUOB 1CLOL 1KJVA 4M6ML 1OINA 3WUEA 2EZ0C 1RJLB 4F9PA 2VIRA 2DDXA 3QJFB 2WANA 5HYEA 3MMEB 1U42A 4B5EA 5D70H 2VC2L 3GMMB 4DO5A 3F5KA 5T1MA 4AMWA 5CJXA 1A1MA 3L95B 2NY3B 3SDXA 3ILPB 5ECUA 3EJQA 4X5XA 2AK4A 4CW1B 5DK2A 4KRPD 4JM2D 3V7MA 3I75B 5TE4H 4GI8A 4NQED 3E3QE 5E8OB 4GRWF 4F3FB 5FV2A 2EYRA 4J23A 4PJHA 3SE8H 1NBVH 1XSJA 1OM0A 4R5EA 3MBED 1J01A 1UWGL 1RK0B 1YECL 1KULA 3QDGB 2XVLA 3L3GB 4PJGE 3Q5YA 4JFZL 4AENB 4H20L 1NCDL 2E7HA 4K71C 3EJPA 3C60C 5E4IA 3AIEA 5CWSB 5EU5B 4LVOC 3J7HA 4CMHC 2YL6A 3LKOA 5BQ7A 1KB5A 4C7GA 1CD0A 3OKNB 4P57B 3ZM8A 1X5XA 4LKCA 4MMXC 3PN8A 2AS5M 1GORA 2C3GA 4PJCB 3BYYA 4YGVA 5EOQH 4PJBB 1X1NA 4HQQL 4PBVC 5TF1H 2A3CA 1X44A 1DBBL 3OZPA 5AWNH 1DZBA 2XNAA 1NBQA 4F57L 1UA3A 5I77A 5E9DA 4TSAL 3OKOB 4LSRH 4WI5A 1PY9A 2Y07L 1MELA 5EB8A 3GMOB 5CPTA 1FZJA 4G6FB 5EH1A 2WIIA 5BXTA 3TV8A 1E0WA 1F90H 2BXZA 4AZ5A 3CHFA 5CQ1A 1LHZA 5IEHA 1FDLL 2R2HA 3WO3B 5E0CA 1C5DB 1TIUA 5GSVB 5JZ7D 3UTQB 3RI5K 1XH3B 3AB0B 5L88L 1NGXB 4XBEH 1QQDA 1LE5A 1I9JL 12E8L 4PMZA 1UEYA 2WIMA 3IJ7A 1H0IA 3UC0L 3HI6L 3T65A 1GPOL 1QRND 3VFNA 4I4WB 4YHOH 2V9TA 1AP2A 4RFEA 4YH6A 2XWBB 4YHEA 2WMHA 3ZMRA 5I1KL 4GRLA 1S46A 3LZFH 4JZNA 4HHAB 1T21B 2A6IB 2OTWA 4K7PX 4OGYL 1V0LA 1HZHH 3RP1A 2VUYA 3KPSD 5CP7A 43CAA 3JWOH 7FABL 2I07A 5HI5D 3T0XA 3VIJA 3TZVD 1JUFA 5HHMD 1FE8L 3GH7A 1CF8H 2XY2A 5C8JB 1I7TB 4M61A 2VLJD 3LKPB 4PJDB 3THCA 2HN7A 4NP4L 2YPLE 3MFFB 2GJ6E 5AYUL 4PBWD 5A2JH 1ZLUH 4LPVA 4LASL 2XQYK 4AL8L 4M8QB 3ULVD 5EULV 1C7SA 5C2UB 1S7TB 5E8EA 3RY5A 4UV4L 2AXGB 4H0GA 4GBXD 1EERB 2NR6D 2OYMA 1OT2A 4M8VA 3V8OA 4JJ5B 3MRQA 3EDJA 1BVNP 4UQ2A 4UFHA 3TESA 5FGBC 2VDLL 4PTXA 3GKZA 2E6JA 3DV4B 4KJYA 4CADB 5GGSA 1PGRB 1ETZA 1H5BB 2QSCH 1JZ3A 5IBUG 1EO8H 1YPZE 1BTCA 1D9KA 1EAPA 2ZUQC 1RK1B 3EFFA 1OPGH 1YEIH 1GZQA 4B7LA 3TBVB 2BNRB 2AJZB 2F19L 4X6BB 1Q6EA 3AS2A 3WENA 1J1XL 4TVUA 1N4XH 4HA3A 5GS1C 4PD4K 4X4YA 3ARBB 3CFEA 2EDFA 3TBTB 3G5YB 3RVVD 1TUXA 4H25B 5K9OB 1Y0LA 2DQDL 2FLBT 3TJHC 4Y4FC 1P9MA 1KG0B 3D87B 4XCNB 2Y36H 1UZ4A 1RMFL 1MCCA 4MS8C 1NUFA 4MJ5A 4RA3A 4JE4B 3IFOA 1IAOB 1VGKA 1TZIA 1VDGA 1YUHB 3EGSA 5KTEH 1KFWA 4N9GA 4JM4H 4ONHA 1UACL 1Y18B 1UWIA 2IADB 3ISWA 4Y8DC 3AMGA 4RAVA 1ZTXH 4U7MA 4YWGL 4QRQA 3K1DA 3SDCC 1UXSA 3CLFH 2NW2A 1DQDH 5F1IA 1JN6B 1ZHLB 5DR5L 1R3HB 4F7PB 2O61A 3KGRA 4L3EE 3QO0B 5IHUH 2R1YB 4M8UA 5ALBH 3A4WA 4H04A 5I73C 2D7NA 2J78A 2A3EA 1MRDH 3NJ3A 3RKDC 2ZSVB 1WV7T 1MJJB 2IUZA 5M95B 4P9HC 3AIRA 2AERT 2ED8A 4FMFA 3TNMA 3M8OL 3ULUE 1W9DM 1IC7L 3OQ3B 3MYJB 3Q5TA 2OL3H 2Z35B 3QULB 1CVRA 3FQWB 5F9AC 1KIQB 2BSRA 1T2QH 4D8PB 1AR1D 1F4YH 5GS0D 4MZ2A 4XGZB 3EOAA 1BPLB 2AEQH 4TTUA 2NY2B 2JB6A 2Q8AL 4D6EA 4IJ3C 2VVSA 4HZ8A 1KTLA 4LDLB 3O2DA 3MOAL 5C08B 4U1KA 3GMPA 1YMME 3IU3A 1TFVA 2ICCA 5CKAA 1CDYA 4M56A 5IB2B 5ETUB 3VIMA 3HFML 3RJDA 4CD6A 1EEYA 1QFWL 1V7MH 1BBJA 1DEEA 4FXLA 1DJSA 5ESVA 3QNXB 3WS3B 3PBGA 2GK1A 3TIEA 1ADQA 4U1NA 1QFHA 4UOW0 3VW3L 4OZHE 2ZXDA 1JV5A 1NL0H 2EXWC 5DXWA 2AAVA 3UJTH 7CGTA 1YY8B 2IC2A 1LQSR 2D0HA 5TDOB 4K3EH 1MIEL 3V6OA 2XSBA 3OXRB 3SE9L 3WBDA 4XBPB 1VEMA 1C16B 4HH8A 4Z7WB 1QLFB 1IMHC 2JFEX 1JJUA 3FXYA 3N18A 2VLRD 5A2IH 3WFZA 2GI7A 5GGUB 1XZ0B 4UB0L 1BD2B 2FSEB 2B2XL 1KJ2B 3BEVB 4AG4L 1K8DA 3P11H 4PJ5E 2FGLA 3K81A 4NN5B 1I1AC 4MPKA 3LCYA 3MJGX 3U9UB 2R4SH 3CMOL 2DMKA 1U8QA 3EJYD 4KVCH 4QY8B 3L9RA 4LAQL 3QUYB 2WUCH 1M7XA 1LG1A 1IAIH 4KKBC 3SE3C 1FL3A 5F7MC 1U8MA 3ARFD 5IW6A 3AREB 1H5VA 1U3ZA 3AM8C 3QIUA 5CJBA 5E1QA 4NRRA 1C5CL 3GH4A 3GUTA 3HG2A 3B9EA 4PJFA 2JJTA 5D2LB 1J7VR 4FABH 2BP3A 5FOJA 5IFJA 4NZUL 5E8DH 2VL5A 4HUWA 3GJFK 2V3EA 1B3VA 3LQZB 3FT4B 3GJEB 2PF6A 1FH5H 1H3GA 1N5AB 2QSQA 1R75A 2AABH 4FZ8H 1IT0A 3N13A 3PHQB 1RZ8B 1TMCB 3PGCB 2KQNA 3OKKB 4R7DA 2DT2A 4EDWL 4G9FD 4HH9A 2WQ8A 5CILH 5IROA 1WB0A 5EIQA 1NOUA 3U2SB 5J9PA 3WL9B 4O58L 3KPRB 4HWUA 4I9WE 2EDBA 1UYWL 3WF1A 5J0BA 1N8ZA 5D7LB 3EZJB 3FW6A 1IGYB 4CMMA 4RZCA 4XUYA 2YPKB 2JELH 1ES0B 1SJHA 3STBA 2X89D 4XMKL 4P2RB 4W5ZA 1MCFA 3GM0A 1KCKA 3GMQA 1O7AA 5J1AB 4WEBL 5SWZE 3VFWA 3CX5K 5D1QD 1PZ5A 4Z77B 1BQHG 5I16B 3EYFB 2XQBL 4LHUA 4MQ7B 3BP5B 5HJ3B 5GGTA 1CPUA 1SYSB 3HNTL 3PUCA 4JN2A 2X2HA 3IYLW 3RRQA 1RPKA 1KGCE 1K9FA 1DVFD 1A3LL 3F7YA 1CFTA 5J1SC 4ACYA 2FIKA 4JGJA 5JR1L 4P2OC 5KSVA 3OXSB 5LAXA 5DHVH 4QCEA 4MHHI 1E43A 2GFBB 4FQXA 1EQCA 3C5ZA 1K8IB 4NHUB 5E2JA 2JALA 1IAKB 4KROB 5F9OL 4E41B 3F7RA 5KSBE 5F1OB 1AKJA 2F58H 3UPRA 1WZMA 2BOBB 1P7HL 5C71A 1IGFH 1E0XA 4Z7VF 5HHPB 1KEGH 3SCWA 2ESVD 1VEPA 3EO0B 5JW5A 3L5WA 1WBZB 1FFOA 5KVDH 3MXVH 4P3DB 4PJIA 3OX8B 2ARJA 2R2BA 5JA8B 4JFUA 5C0CA 4JQIL 3ULVL 3D0LB 3HMXH 5FUCC 1ZVSB 3KYNA 4I2XA 5BRZB 5H35A 3WUGA 4Q9QH 4BFEA 1TVPA 4Y8AA 4QNPF 1SQ2N 2CRZA 4QF1A 3FO2B 5A3IC 1QFWI 3AIWA 5EUOF 1S7VA 2FZ3B 2DJUA 3GDBA 1J5OH 5I75C 1KNOB 1F3DJ 5ID1B 3OPZH 4JY4B 3BVTA 4XNUH 2WMFA 1X5ZA 4DVBA 5IDIA 4F9LC 4DUWA 1XC6A 4JHAL 2XV6B 5BYWA 4JDVA 2EIBA 3MCLH 4L3AA 1QVOB 3B9VA 3RZCD 3CVHL 2PR4H 1CDJA 2M1KA 1TTUA 3NN8B 3IDXH 4H5SB 3T0AA 4JG0H 5KANI 3B43A 4P4KC 1BGGA 2EDLA 3PP4H 4YK4B 4L3CA 5L7XH 1Q0YH 1BWWA 3AROA 3NAAL 4M1RA 1RVFL 1NSNL 4B3KA 4JEGB 4YFDB 1AGEA 5EU6E 5A6AA 1J0JA 3IXAB 5C0IB 2AJVH 4BFIA 4LCCB 5IT2H 2WP3O 1FVCB 5KG9A 4GRWE 1KFAH 1GJIA 3O9WD 5C07A 5DD0H 2VZSA 5LWYL 4Q6IA 2HT2C 4Y4KA 5D7SL 1ZLWH 2WVVB 3MUGB 1CLVA 4DGIL 2AK4D 4M6MH 3FQUB 4JO3L 1BLNA 1JDDA 3LRHA 4AC1X 4GQRA 3UTTE 4ETQA 1L0XA 5DRWA 3TA3C 1KBKA 2VC2H 2J8FA 4IMKC 1CXKA 4DWSD 1UJ3B 4UZGA 5C0NC 1UUQA 2SEBB 3U7VA 4P7RA 1Q9OA 1JPST 5J11C 4NO0B 3CH1A 5E6IC 5I23A 1DBJL 2EDJA 5BXSA 4UIMA 5HPOA 1TJHL 1RHHB 5EU3A 4YQXL 5JDSA 5C0GB 1EEZA 5FDWA 2VLLB 3LPOA 1UWGH 4GKSB 3VILA 4NCDA 2AAAA 4U1HA 1KIRB 4UIKL 1V05A 3KYMA 1NQ6A 1X9QA 5C9JB 4JFZH 3QQ3A 3SIMA 4H20H 2Q7YA 2X0HA 1NCDH 4FG6C 3HG1B 1B4JH 2GUOB 3UDWA 5GS0L 3GMLA 1GUVA 3D5HA 5J13B 1ZT4A 4DO6A 1YMHB 5INDA 1UD6A 1WQVT 2ZX8A 4RFNC 3MZTA 4DZBA 1MFUA 1G9HA 2A74A 3UZEA 2YDRA 1S7XA 4XCFH 3WD3A 1ZANL 5A40E 3MPCA 2X9WA 4G42B 4HQQH 3W82A 2UUDK 2OSLB 4F57H 1RU9L 4TSAH 3MRIB 3IDIB 3PHSA 3QUMH 4EVNB 3BAJA 3E8UL 1A9EA 4NN7B 2N1KA 4LVNB 4HUUA 5ICXA 5F7KC 4KI1A 5K93A 4F7CA 4NT6A 4Z76B 1FP9A 4MNKA 5D7KD 1BQHA 2CSPA 1G0XA 5BS0D 5I78A 3O41B 5LQBL 1NM9A 3H0TA 2B5IC 4NHCL 2C0HA 3IKCA 1AGDB 1RUAL 3IXTA 5L88H 3A4XA 4OOZA 1I9JH 12E8H 1WIPA 1U8OB 3ARGB 3UC0H 3O0RL 1GPOH 1TQBB 4V2XA 2IWGA 4I3SL 4PJ7A 4ELMA 1U2HA 3AS0A 5MEQB 5T1KB 3FONA 4LBEB 1TG7A 1KLFA 3MMUA 32C2A 1O7SA 1NGQL 3QQ4A 1UD2A 2IXVA 4PMNA 2CIKB 3MJ9L 3OGRA 4H1LB 4OGYH 4QRPD 2BY2A 3A3HA 1CIUA 1Z9SA 3QJHB 1AGFB 1S7RB 3BRDA 3AFBA 3O81A 7FABH 3BW9A 4D0BB 2JEPA 4I8DA 1HL8A 3BC9A 1HH6B 2QADC 2FEEL 3DIFA 1RIHL 2FYYA 5F93C 3S35L 1FE8H 4J4PD 1AC0A 2F74A 2G75A 3RL1B 3W26A 3EYPA 4JZJB 4I48B 3BP7B 3AY4C 1U8IB 2X1WL 1EX0A 1E1FA 3QEGH 5JBFA 5MP6H 4ZO8A 3VI3F 5J6GA 4ZOCA 4WJ5A 4ZPVA 3VH8G 4P9ML 1EA9C 4AL8H 1OSPL 1EH9A 4YFLF 4BYHA 1NC4B 3SE4A 5IHZB 2L0DA 4UV4H 4L5FL 4APQC 4UOQA 4XPAL 5CEXA 4P23B 4ZOEA 3VGEA 3HPJA 2PCPB 4QT5B 1D9KD 5EBWA 3NSMA 3DSFH 4MVBD 5IUSA 3CFKA 2PNDA 3DXAE 1E4XL 4KUZL 4URTB 4OIAA 1FNEB 4N8CL 5HHOE 3KXFA 5CZXD 4UOZA 5ICZA 5BJTB 2ZG2A 1P1ZA 4OZGA 4JJHA 5IOPB 2WNGA 2ED9A 3FQRB 2AOSA 1KTBA 3W29A 2B1AL 5IVXB 4RX4A 4JPIA 4I18B 1I8IB 2J6EA 1L7TH 1HSBB 1R0AL 5EBMB 4EKJA 3S5LG 4OI7A 2F19H 2VXSL 2WHMA 2QQNL 4XCYA 1UWTA 2LTQB 2DMBA 3BH9B 4Y5VA 3KL0A 4U5IA 1KCSH 1J1XH 1K6QL 3OKDA 1IC4H 4HLZG 1G7IA 5FK9B 5CPQA 4NSBA 4HJJL 1SVCP 3EAKA 4RNRA 3VFMA 1XV8A 1MCSA 2WW8A 2DQDH 2LU4A 1ZGLM 5EBLA 2Q6WB 4C56E 5BV7B 5DURB 4P4RA 1MFAL 1RMFH 4PMQA 1W2PA 4ZUSB 2JJUA 2WVUA 2PYEE 5I74C 2WWDA 3MCKB 3TP4A 4PY7A 1UACH 3EDEA 5JPMB 3S96B 4DGVL 4TPRL 4R4BA 1REIA 3W27A 3BD3A 4YHIB 3P4OA 4ESKA 4YWGH 1J9YA 1CQYA 4YLQT 1G6RB 1EQPA 3U4EB 4RSVA 1R5VA 4OV5B 3VX1A 3LB6C 5DR5H 4B3LA 2YRZA 3LSOA 5K33A 2Z8RA 4IRJC 4HK0B 3RUGE 4AEEA 2CETA 4PJXB 2GK2A 2X44D 5JXEC 1CFVH 4M48H 5DI8A 4HCRL 3PGFL 4NN6C 4X6FB 1XF5A 3O2VL 1ZLVK 1FIGL 1VBRA 2J7DA 5D7IA 3ZOAA 4NQDD 1IC7H 3AXLA 4K71B 2A6KB 3WCYA 5ESAA 4F7EB 1A6VL 3C60B 3M46A 3DBXB 2AXJA 3JWOC 1JTOA 4LVOB 4CMHB 1B1YA 4WFHD 2UWEA 4B9YA 5FYKE 2GEEA 3ALPA 1F2QA 1RZFL 4BQ4A 2Q8AH 1I4FA 2YFNA 3LV3B 4XZUA 3RDTA 4QHUB 4MSWB 1EVUA 3HZMA 3MLZL 2X1OA 1PG7W 3SUWA 3SCPA 4MB1A 2DM7A 2OXGA 3VFPA 3HFMH 4O5LH 1OD0A 4OD2A 1QFWH 1JWSB 1XCQB 3MR9B 4WIWA 1W0WA 3MLRL 4OQ1A 4YHPA 2JCCA 4W4NA 1GHSA 3JUZA 5EC2A 8FABB 1OAQH 5F9JA 5DFTA 1KQYA 1ESWA 1YZZA 1WTGT 2QHRL 5CG0A 1T5WA 5F6HJ 2F53E 1MIEH 1HEZB 3JTTA 1U2YA 4X99A 1OD9A 2V3DA 1XIWA 2OTUB 1B3ZA 4MADA 2FEEI 1QO3A 4PCTA 1HXMA 4C58B 2C1PA 2XPGA 4UB0H 3CH8A 3OJDA 5JORA 3D85B 2B2XH 4XVUC 4H41A 2PWDA 1BOGA 1NUDA 4C57C 4X0KB 4YO0B 5F9WB 4PRIE 3QIUD 4GW4A 5LCVL 1XFPA 4I0PD 1VADB 3CMOH 2D3LA 2Z91B 4NZCA 4JFOB 4XV0A 1M7DA 1U8NA 3WUFA 1D5ZA 1T1YA 4LAQH 4ZFOB 1T7YA 3MGAA 1EXUB 4K3DL 5I8CA 1CDBA 1HHHB 5JW4Q 3A4AA 3O4OC 2W4XA 3S5YA 3O3DB 4YDVA 3SKOA 1WDPA 1EBAA 4TVSa 4OAWA 1MHEA 3GSNB 1C5CH 5B8CC 4NUGL 2VAAA 1BIHA 1Q9KB 1LK2B 2XN9A 1E4XI 4GH7B 4LSTL 3WS6C 4G43B 1RSFA 4C55A 3IJYA 5F88A 2QKIB 1XR9B 4JFED 1AGCA 3VMOA 2XZZA 3PQYE 4X9BA 5LGJA 4BQ8A 5F97E 4CCEA 1SY6H 4NZFA 4MJID 2ATKA 4HPYL 5D9PA 1IKNC 1CFQA 4IMLA 4M5YL 4WVRA 2E40A 4W88A 4EDWH 2C1OB 3RMEA 2YSSB 3WFDL 3EYOB 4WFFD 5I2IB 2BDNH 2GJXB 4L9LA 1UENA 2N4IA 2ZUQB 3FFCD 5JIKA 1UYWH 1UD3A 1DN2A 2JF1A 4KJQC 4YGAB 1HHKB 5M03A 3S5LA 1JI2A 3A5VA 4PJGA 1DDHA 4UR9A 4NOFA 5J3HC 5A6BA 4LNRB 4XMKH 3N1PC 4NQVB 4YUEL 3O3UN 3LEYH 1JGVL 3ARTA 5IB5A 4GG8A 4HXAH 5GS1B 1JNEA 3U5YA 2J1KA 3VFSB 5ERWA 5I1DB 1AXSA 1OARL 3PWPE 4WEBH 4WSKA 1QSFB 1WFTA 1AC6A 4XNMB 4U1JA 2XQBH 3TJEL 4Z7VE 3VXUD 4Y4FB 3MRJB 3HNTH 4FQXD 5ADPL 5L2KB 4FFVD 5JHLH 4P5TC 4R4ND 1GGBH 4HKBA 4MNGB 3C6LD 1O5DT 4MA3B 5JR1H 2HT3C 3I9GL 5FO8A 1U8KB 1CG9B 4HUMB 4D0CA 5GZND 4QNPE 4GAFB 3SDCB 2EXYD 2WSKA 5ANMB 4XCEA 4XH2A 2C3HA 1R3LB 5E9AA 1HJUA 1WPCA 5EUOE 2ZXQA 1YC8A 5DFAA 3BZEA 1YEKL 1XD0A 1BEYL 5F9OH 3D9AL 2ICWB 4HSQA 2P44B 3EOTL 5I73B 3HCVB 2DL2A 2NLJA 3BP6B 4YHLL 5C0FB 1NFIA 2JF7A 2B4CL 2HFEB 4HJGA 4M80A 3HA0A 1Z9OA 2VR4A 1UR0A 5DEZA 5LGHH 4K3HA 3U0TA 2H32H 4K7FA 3RIAF 5ILTH 1CE6B 5C0EB 3I2CL 2X70B 1PLGH 3EJZC 4GKLA 3REWA 4NIKB 4UDTA 2R0KH 2R56L 4AZ6A 1R3IL 4D9QE 1HH9A 3HR5B 2QL1A 2VCBA 3ZYZA 2P24B 3KDMA 3SJVE 3CHCA 4E42B 4BK4A 2ZWLT 3WY2A 4PJ8C 4UOW1 2VDKL 3L3IB 3K46A 4ETYA 4JHAH 5DQDL 5D9MA 3TBWB 3CVHH 4F9DA 2YPLA 2GJ6A 2P4AB 3X14A 5CHNB 3T04D 5HI3D 3ARQA 1JD7A 4ZFZB 2FO4A 3VVGA 1TVBA 2FX8H 1FP8A 1WZKA 2G5RA 1PDKA 4PB9L 1AO7E 4ZQKA 4O4YH 3KNBA 3NAAH 1RVFH 4XPTL 1CICD 3PV7A 3G5XA 3AMLA 2VDML 3TA9A 1SYVB 2BNJA 4S2SA 3VDAA 5FKAA 1X6NA 5DJCA 1NMAH 1RY7B 2A9ML 5DJAA 3B2UD 2HG5A 3RWDB 5LWYH 1HJSA 1YPZA 3ZR6A 2OWXA 4NYLA 5D7SH 2OJZH 3O4LB 5EZIH 1I85A 2CPCA 4DGIH 4FFWD 1I1AB 2O5YL 5I18H 1JF5A 1HYRC 4P59L 1KTDA 4L4VB 4LLYA 4P48A 4BZ1L 2RBLA 4YHZL 3GIVA 1DLHA 4U6YB 5BXPA 4CVXB 4NQUA 4CU7A 1CE1L 1BP3B 3D39E 1CR9L 1CZ8L 3B2VH 4OQTL 1L0QA 4MAVA 1E6SM 2AJ3B 4YQXH 3BT2L 1GJWA 2BSTA 4XX1E 3GRWL 1MHHB 1EGJA 3DHJA 2A6DB 3UTSB 5DRXA 3RI5F 5AYQA 1VACA 4UIKH 4D0DA 4WJXA 5GNYA 3GI9L 1N0LA 3NFNB 4B16A 2E6PA 3QNYA 1WWWX 2YD7A 3UTPE 3QDME 3I02B 4KXZI 5MEOB 2D4FA 3FJTA 4ORZC 4JM2F 3WIFB 4WV1C 4Z2JA 4N0UB 4L3EA 2G3JA 2APFA 3O8XD 5C0RL 2GK0B 4OT1L 4IOFD 4H88H 3MA7B 4RBPH 5CLTA 1JPTH 3H53A 3VWKC 4F9JA 2BFGA 3GJFH 3C09C 3HC0B 5GGQL 4ZXBA 1ONQB 3WSUA 3POHA 5BXRA 1N82A 4GZIA 4Z2KA 1AGBB 3TO4C 3I50H 2G9HA 4GW1A 4JKMA 4KK6D 1E56A 2MKLC 4PRAB 4R90H 1H3UA 3C2SA 5BZWB 1S9YA 1FLRL 4YHKL 1PY4A 5FGCB 3CPUA 2UY5A 2GJZA 2I60L 1T7WA 2XTLA 4OGAC 4Y1AB 1K85A 3V0VA 4QLLA 4ZNCD 3EO1A 1IM3A 1FG2B 3BP4A 4RAHA 2WAHA 5E2WH 1JXKA 5M7QA 3IF1A 4NXSA 4LCWB 4LPCA 5B38G 2J8GA 2XVPA 5EA0H 1NGWB 3O0RH 1YMMA 4PJ9A 4NC1E 3UG5A 2E9IA 4P2OB 3VI3E 1OL0A 5SV3A 3GSRB 1NGQH 3DVGB 1A22B 3WMBA 1XGTB 3QEUB 1J8HB 2P46B 4KTDH 3BVVA 1AXIB 3TH2T 2IQAB 3QQ9C 4OZHA 2YC1B 2OZ4H 3QBTB 1V3IA 3MI6A 4Q6YA 1FL6B 1UR8A 5BOPA 1HDMB 3WMCA 5EC1B 1RIHH 1D3CA 4WWKC 3ECBB 3S35H 2BVTA 3EDDA 5IMMB 4IPLA 4OCSH 4HUVB 2IBZY 4UV7L 1WK0A 5DVLA 1Q6GA 2ERJC 5E8PA 3VGDA 1BVKA 4KKAD 3K80A 3QI9D 1INQB 4W7WA 1MF2L 3JWDH 4JHBA 3WHE1 2NPLX 4PJ5A 4X98B 4NM4H 1VGEH 1ISYA 1F2XK 1OSPH 3U48A 5H2BA 2F7RA 4A6YA 5EORL 3GIZL 1QR4A 4L5FH 4W89A 4XPAH 5CSBA 4TN9A 2EBNA 1H3TA 1P4BL 5CJQL 4ACZB 5I75B 1NCWL 1KBGL 1NBYB 5GXBB 3UBXI 2J12B 1E4XH 5D8WA 1YEDB 5DJ2A 2CGRL 4WFED 3LVEA 1GCYA 4EUPH 1SEQL 1G84A 1Z0NA 3LN9A 1FZKB 4JFFB 2BSSA 5BO1L 3ULVF 3LMYA 4P4KB 3IFNL 5TQ0L 2B31A 1R0AH 4TVDA 4XB3A 4XWGL 3SCMD 3SCOA 1YEGL 2VXSH 1QKZL 1U95A 4PSPA 2G2RA 2QQNH 4MLSA 5EU4B 3ZKQD 4IOIA 4U0RC 5JHDE 5C0JA 3MLWL 4ODHH 3NGBC 5ITFB 3B83A 1UZ8B 4HJJH 4S3JA 3DVNB 1HKIA 4AIOA 5H94B 4V1DB 3DO7A 1CGYA 3VRJA 2DBLL 2BNUB 3RM8A 2Q8BL 2YLAA 1MFAH 3M7SA 1FN4B 4NZRL 1E28B 1YEFL 1T89C 2IH3B 3PNWA 4R4FL 3MUIA 3VGAC 5EOTA 4DOHE 2M8XA 5EU7E 3AVEA 2O92A 3TA3B 2Y24A 4JY6B 4DGVH 2ZKHL 1H09A 4HA1A 5SX5K 1XMWA 3W24A 5EBGA 4ZS7L 5J11B 4X4XB 3MOBL 3L3HB 5SWZA 5E6IB 1MEXL 4YHGA 3HI1B 3I85A 4NKIL 4HV8A 2CLRB 5E1AA 4CKVX 4HAGA 5A8NA 1FVEA 3H9HB 2R4RH 3NZHL 1QR1B 4PGEA 1GOIA 4XWOC 3X11A 1NEUA 3ZTJG 3V5DB 3PGFH 4J1UA 1DANT 2MKWA 3O2VH 1FIGH 3SCUA 3QAZC 3CSPA 2E3VA 3S5ZA 1MRFL 1P84J 3S98A 3BHBA 4XAWL 1PYWB 5JUEH 3NDZA 1FZMA 5KSBA 4RFNB 4OFDA 3WDJA 1JP5A 3PL6A 1UQZA 3T1FB 5K9QG 1TR1A 3TH3T 4NQCE 3TVMA 4G3YH 4LLVB 2CBUA 1HCFX 3Q5OA 5E03A 2LABA 5DD6A 3MLZH 1UD8A 2ZICA 1FNAA 2YDSA 5FCZA 2A73B 3VXSD 3RKPA 5JW4N 4XNXH 1T1ZB 1E6XM 4NZTL 4RGNC 3QUZC 1V02E 3NCCB 4NO5A 4JL2A 5KOVC 2H41A 5CGYC 1C8QA 4M7LL 2EDDA 4P2QB 5IESL 4W8BA 1NBZA 3DUSA 2B5IB 2EDNA 3QXDB 3N1FC 2EACA 5B38A 35C8L 2QQQA 3DGCR 4QXTA 5SWSE 2VC9A 4P99A 2XHYA 2LVEA 4HP5A 2E9WA 2O5ZL 4W7UA 4A3HA 3IAQA 5CS7A 4I77L 5DVMA 1IE5A 4WW2C 5I66B 5ISZE 1JF1B 5C2BH 2UY7A 5IR1B 1OIFA 1HCVA 5LCVH 1AI1L 4UT7L 1N5YL 2FBJL 1DUYA 4GAYB 2YD5A 1E0VA 2LAAA 3L5IA 2QLYA 2QADB 2CJUL 3I6KB 5EU6A 1MUJB 2NT1A 2CLVA 2VDQL 5GIRA 4FNTA 4Q74A 2AP2A 4NO2B 4QRRD 2GSGA 3RL2A 4K3DH 1FHLA 2Q7NA 4LPYA 2R1XB 4F3FA 1CD8A 3MO4A 3NA9L 1ZVHA 5JXAH 1FO0L 5E09A 3QNZA 3MV9E 4Y19D 5KSUB 1S5HA 3ABZA 2DYPA 1KB5H 2CUHA 4LSTH 1OP5K 4GW5A 3GSXA 3UTTA 2VUOA 3EYUL 3TPUA 1G94A 3H42H 4FXGA 4KTYA 4EE9A 4J3WA 4APQB 2QV4A 1MJ7H 3PZUA 5CMAA 5DHXB 4ZUVB 2H2PC 1QA9A 3L3JA 1ZV5A 2K3TA 1I9IH 1MFDL 4M5YH 3BUYB 2AQ3A 4XHJD 3LRKA 3CSYA 2EH7H 1FFRA 4FQHA 3WFDH 1BZ7A 3SKMB 4UFIA 2R29L 4JCLA 2DB8A 3REVB 3JV6A 4ZYKA 3BCDA 4KXZH 2YLLA 1BBDH 1DSFH 4GKOA 2D0GA 4LLQA 3MV01 1KLUB 4JANB 1WZLA 1VFMA 1LNUA 4J3TA 4YUEH 1UB5B 2DH3A 2BHUA 3TWCH 2V2TB 3X12B 4L8DA 3BSHA 3GGWB 1OARH 3VGGA 2J7LA 4MA1C 3QPXL 1S7WA 3PABA 2XFFA 4PP1C 2NXYD 5DVKA 1FRGH 2FWOB 3TJEH 2G60L 4HG4J 1SJXA 4MXQC 5HGDA 5I74B 3VJ6B 1J0KA 4D1JA 4WLCA 1DQQB 1H3VA 4HBQA 1T22A 4Y2DA 3I9GH 1MH5B 1T21A 2L7UA 4GMSL 3PZGA 3JXAA 3WSQL 5TFSL 2FHFA 2HH0L 2YD8A 4YPGB 3PWNA 1E6JL 4JPWL 2YL9A 3L5XL 4S1QL 2XWTB 1LJYA 1UB6A 5MEND 2HVKB 4GG6F 1JDCA 1RJZB 3D9AH 1XF2A 3FB7A 4M3JA 4R2GD 1QACA 2H9GB 2NY4D 4EI5B 4AD4A 3QIBD 4NN6B 3MFFA 3ROLA 3HE6C 3UAJD 4AK1A 3P0YL 4F7MB 1T1WA 1CFNA 3JWNC 5DSCB 1U8HB 5E4EC 4FXKA 1N3NB 5E6ZA 2OI9C 2PN5A 3I2CH 4G80B 3D18A 1F6AA 3GXDA 4QTIL 1UXWB 1HINL 1I8MB 4HFUL 1B2WL 3VD4A 2YPLD 1UOKA 1A1NA 2R56H 1SEBA 5JNYB 4JKLA 1R3IH 4KQ3L 3SCRA 4KRPC 1T83A 5GGRY 5GGRA 1W1TA 3N9GL 1FL5A 3QIWC 3MV11 1F42A 2W38A 1UM4L 4BUGA 2P8PA 2XY1A 4PLJC 3KAAA 4OCYL 3MBEC 5F3HA 4NI3A 4PUEA 3WFLA 2CYGA 1FFNB 1FH8A 4RE4A 1QZ1A 1U92B 4U1LA 2JE8A 2Y06L 4PRBB 3BGAA 1NDGB 1LEKB 4NRYB 5ICYB 4AZIA 2UYLB 4NSKB 4DCQB 5IV2B 4JFQB 1QWNA 4WFGE 2VDMH 1OSZB 2ADGA 1T7ZA 3DXAA 1UASA 4PEEA 3RWGA 1OAYL 3TBTA 5HHOA 1A0QH 4BFBD 3T3PF 2WINB 5B39B 3P9MA 4PG2C 1JYNA 4S3KA 1FC2D 4WW1A 4NPYB 2HJLB 5I1AB 4XVJL 1P4LA 3O6FA 3O11A 1YUHA 2XKNB 3IDMA 3EMCA 1MJ8H 2NW3A 1Y18A 1WZ1L 2O5YH 1G7LA 4WO4A 4HIHA 4KJWC 5DJ0A 3D4YA 1LO4L 4P59H 5CUSH 3B9KD 4EXPX 4Q0XL 3BKCL 5DRNA 4TRPL 4YHZH 4WUUD 1KXVC 2FL5B 3HLAA 4QXGL 3DX2A 4PMOA 5JZ7C 3UTZA 3WXVL 5FV1L 5DJDB 1HILB 1CR9H 1CZ8H 3QO0A 1XYFA 5HSFA 2RFXB 3QH3B 3STLB 5B8CB 1CXHA 4M62L 4C56A 4JLRB 1UVQA 3BT2H 1I3GL 2PUQT 2VISB 1Q0XL 3U46A 4LIQH 1QPXA 1KXTB 3BUTA 4Z2HA 4FNLL 3ME0A 2PYEA 1E1EA 3Q6GH 1NLDH 2OR7A 4L3ED 3GI9H 1JFQL 3O2DH 4KRNA 1KTKE 3IRPX 4M1DH 3KLDA 3KLKA 1VFAB 5FCSH 5HI5C 3RWJA 2GT9B 4ZXBD 1A21A 2ITDA 2ADJA 5FFLA 1G9NH 1FG9C 2YZ8A 5TGBB 5GZOD 5E5UB 3ULUD 1ZHBB 5C0RH 3W0WB 4OT1H 2X7LB 3VWJA 2AK1L 5BVJA 3RUGA 1KR1A 4UFLA 4JPVH 1V0KA 1TZGL 1D5BA 4NQSB 5GGQH 4W4OC 3DX3A 3R1GL 3QDJD 4NBYB 2A83B 5GRVK 5GJSH 2EYTB 2AKRB 5IW1B 4WDIA 5JPNB 1UJTA 4OF0A 5KVMC 1M04A 4D6GA 2NY6D 2JIXD 1WWBX 4HC1L 3DX9A 4LRNH 1TQSA 1VJZA 1FLRH 4PJ9D 1YMMD 2JJVA 2OL3B 3RTQD 1ZMYA 4YHKH 4FFYH 2HMIC 4NKQB 3N9KA 1E4WL 2I60H 4XB7A 5IIEB 1O0VA 4E5XA 1FPTL 1NP2A 1QRNE 2YZ1A 2X1QA 1GGTA 2HKHL 4I1NB 5AG9A 1C16A 2BY3A 3WFHB 4UBDD 1ZGLB 4P5TB 2DJSA 4L4TE 3GSWB 2DQIL 2Z9TA 3UO1L 4BZ2H 4RMTA 1HQ4B 2CRMA 2X4RA 2YRLA 3QG7L 3CVIL 4JAMB 5TDNA 3KPSE 3HE7A 1QHOA 1KJ2A 4HBCL 4Q7DA 1Y7VA 4LXFA 3NMEA 4D9RD 3QZWA 1H3XA 3JSSA 3G08B 1YYLL 3RIFK 2FBOJ 1WBXB 5C0BD 2D7MA 5HHME 4HKJA 3SDAC 4OI8A 1W32A 4TQEH 3IFPA 4LHQB 5DGQA 4IRJA 1RPQA 1TZHA 2VLJE 5EDXA 2F53A 5JXEA 5DVOA 3RA7L 3RVVC 3D5OF 4UV7H 1P7QA 5I17A 1R6VA 1UR4A 1WITA 4PB0L 1A1OB 3ULVE 1H15B 1MF2H 4NRXB 2J7HA 4D72A 4ZAKA 3KPLB 1MPAL 5F1SA 4DK6A 1QWUA 4PTMA 4PRIA 4P5MA 1A6ZA 3GIZH 4QHNB 2WBJA 1I3VA 1NDMB 3BQUA 4JFPB 1JZ4A 2NW0A 3UR8A 1P4BH 3PJSA 1RZ8A 3PGCA 3ALXA 4PJ8B 2UVEA 1JI1A 2NY1C 4MAYC 2QR0B 4Z5RA 1QEWB 2YXFA 5I8OL 4OZFG 3AIBA 1X5FA 4D94A 4E0RA 1SEQH 2H2SD 5J89A 2VMFA 1J0IA 4OFKA 1JGIA 4U1MA 1IM9B 1G0DA 1HI6A 1K5NB 3OSKA 4U7SA 4XX1G 4QP0A 1T6VN 3SBWC 2YD4A 1OAKL 1T20A 2ADIB 5GGTH 1A3HA 1UR1A 4V27A 3PQYA 4XWGH 4L4PA 1JYXA 2C4FT 2P8MA 3PHOB 3WLWD 1OGAB 2ZX6A 2Y8KA 4ZTPL 3QXAB 1AR1C 4HZAA 3PV6A 1HKKA 4NKOB 1MAML 4N0FB 2W9EL 3BP5A 1WEJH 1R5WB 1XGRA 2D7TL 4WK9A 2Q8BH 3U0PA 2MQCA 2EIDA 1U8LA 2IAMA 2WPGA 4K23L 4LLAA 3SKNB 4NZRH 1M71B 2DSUA 5SWZD 1CWVA 1YEFH 4R4FH 3VXRB 3V0WL 3SGEI 1X5LA 4X7EC 3QUKB 1A4KA 2ZKHH 2NXZC 4H1LG 1A47A 1G7HA 3MUJA 4HIEA 4OCLC 1WDSA 4P7NA 4P8XA 4ZS7H 3PWPA 3MV7B 1P7KB 2P5ED 2YD9A 1MCKA 2NZIA 3MOBH 4JVPA 4XCCH 3QRFM 1MEXH 5FECB 3CXHK 2G3IA 2DQCL 3BWAB 4O51B 3ALGA 4NKIH 2HYMA 1YJDL 1JPFB 4Z7VA 1FFPB 2H3NA 3L3KB 1B4RA 4HZLB 5AUMA 1X5IA 2PO6D 1AHWC 3NZHH 3OTTA 4MCYA 1JGEB 1FVDA 5FA4B 2W62A 4B41A 4TOYL 2ARWA 4C4KT 4X9YA 3KPQA 2XN0A 1IKNA 4LSPH 3PDDA 4OCRL 3GBML 3IRZA 4WV1B 3EJYC 4N0RA 2DQHL 4MAUL 5EUOA 3WHXA 4XAWH 5AG8A 2ZOLA 2ITCB 4ZUWB 3L4VA 3WJLC 2YJQA 2K9UA 1A7OL 3ARFC 3MO1A 3VXOA 1RZJH 4KWUA 5F7LB 3VWKB 1UCBL 3NCYP 4KUCD 1I1WA 3C09B 5EG6C 3ALFA 3CFCH 4UU9B 5TJWK 1U6AL 3K2UL 1HNFA 3TO4B 1N26A 4HK3J 2J7GA 2Z31C 3JWDC 1B9ZA 2R23B 4NZTH 1D5XB 5AZEL 3QWOA 4CL7A 2XZQL 1CBVL 4XTRC 3MTRA 4ODTL 5T3ZD 3OIHA 4WKAA 3ZL4L 1XR8A 5BW7C 5IWLA 3U4BH 5AYIA 3EIFA 2VLRE 5GRVL 3SJVA 4LCCA 35C8H 4JG1L 3MRKA 5L2JB 1MLBA 3D4ZA 3BE1H 2NY3D 2NQCA 3MREB 4YR6B 5DJ6A 4XXCA 2BVUA 1MFBL 2CNCA 3ZHKA 3G6AB 1AO7A 4M1CD 1TNNA 3RPIB 5GS2H 1MWAL 4JO4L 1AI1H 4UT7H 5A6LA 5HYJB 5CD5C 1EGJL 3MMDA 1VBUA 2CJUH 2DQJL 4WWKB 3H9SB 5D1QC 2PYFB 2VDQH 6CGTA 3MJ8A 3PWUA 2P45B 2OSYA 2ERJB 3UTTD 3MGOB 3ZE2F 3AMKA 1AD9B 1XF4B 1AMYA 3BZFB 2AV1B 5F89A 3WIHL 1NKOA 4MNJA 5A6JA 2IALB 1B3YA 4Z2LA 3LXBA 2X9XA 3VG9B 2VLLA 1XYZA 4KDTC 1JRHL 5D8JL 2WSPA 3DDGA 2WCAA 4JY5L 2JB5H 2DL9A 2A3BA 3MRLA 1XGQA 4OLYL 4HS3B 3QRGL 1T0MA 3W9EA 4G9FE 1WKYA 4OM1L 1R5IA 1MFDH 2RR3A 3ULUL 5ABGA 1O7VA 3D39A 2VZ3A 3GB7B 4OZFA 5HNNA 1ND0A 4O2EA 2R29H 3FZUD 4G42A 1CENA 4WI3A 5IFPA 3BPOC 1FBIL 2GTZA 5E2TL 4XNQB 2C7UB 3B6SB 4EVNA 3OLDA 1Q9LA 3AZRA 3QDMA 4MNQB 5IVNA 3BDYL 2ZX9A 4U0RB 4BS0A 1H3WM 1BM3L 3NGBB 5J4MA 3CFBB 3O45A 1ZSDA 1LP9B 1ZGLP 1Y6MR 2J79A 3CDYA 3UROR 4GG6E 3MRHA 3OKMB 2BFVL 2CDGB 3LN5A 3QPXH 5HY9B 2ENSA 2XFXA 2ZWYA 5FOBA 5F7EL 2A0LD 4PJAF 4MDPA 4G6MH 4OLEA 2FDBP 1HXYA 3NABL 3RZCC 3UERA 3GXNA 5E94B 1OM3L 3VGAB 3GXMA 5DZNA 1F5WA 1JNNL 3LEVL 1CFSB 3QUMB 3UG3A 1C5BL 4H1LA 5EPMB 2VI0A 3KYAA 3WSQH 4I0KA 5TFSH 3CX2A 2OSWA 2HH0H 3IDGA 3EYSH 4GAJL 2X0YA 3DYOA 4QRSA 2Q87A 1E6JH 3ORJA 4JPWH 2P7TA 3PZNA 4S1QH 4X7TB 3S37H 2ESVE 1G6VK 1ZT1B 2P43B 3PHAA 3SCVA 2VITA 4F9PC 1B0WA 2AV7A 3PXJA 3P9LB 4MD4B 5IGXL 1DUZA 4R8WH 3MRDB 5CJXC 3OKLB 4YZFF 2BVPB 2FEDD 5DHVA 3PWLA 4WU5A 5SX5H 1E5JA 3P0YH 4KMQA 3H9ZA 4HS8H 4KJPD 5D1ZA 2HT4C 1KLGB 5I19H 3QAZB 5B3NA 2BXYA 3P73B 2MQ0A 1KB3A 1NC2A 1HKMA 5DDHB 4FTVB 1J11A 5T5NF 4KU1A 5M5DA 4YAQB 4F79A 4AYGA 1BFSA 3LPGA 4HFUH 1B2WH 3K4DA 3MLVH 1MY5A 3GO1L 2J6EH 2DQFA 3GI8L 5M94B 2GTWB 2W0LA 4HUKB 1I9RH 3IVKB 5T3XH 1E6RA 3T3PE 2DGAA 4GAGL 5CFHA 4UAOC 1MREH 4UQEA 1W72A 1ZHKA 4QCIB 4PRNB 3KPPB 1I7RA 2BVOA 4OCYH 3EBVA 1A3QA 4RGNB 3QUZB 3VFRB 2E4TA 1Q6DA 3RILA 2COQA 5CSZA 4G8FB 4PR5B 5GRYA 4WIQA 4NWUL 2AVGA 4NDMB 2PXYA 1LGVA 3UEZA 2EECA 2DTML 3AIQA 2E27L 2EDEA 3FOMB 4EEEA 2HJKB 3GZKA 3FB8B 1RJYB 1OB1A 4KMLB 4WU7B 1WZAA 2ZG1A 3KJ6L 4GLRI 2D20A 4IS6A 4JFDB 2HKFL 4XVJH 1T0NA 3GKWH 3FOLA 4WW2B 3VD9A 3L4XA 1QFUL 4BH8B 5E00A 3N0PB 1HKLH 3G04A 4ZUTA 1LO4H 4NFCA 5HD8D 5JHDA 1BQLL 3NZ8B 4C56D 1YNLL 3BKCH 5FHAL 4TRPH 1OP3K 5L6YH 2BY0A 1WFUA 4QXGH 1ZS8B 2OJEA 1RZKL 4OV5A 4FNRA 1ZA3A 1W9XA 2YBTA 2PYED 3WXVH 2E9LA 4L9DA 1UG9A 5AC4A 4H0IA 1MLCA 1A14L 3KWWB 4RGOL 4XI5D 4M62H 4NGHH 3SGEH 3D3VB 5F7DB 1Q0XH 4LU5H 5IF0B 3NCJH 3MLTB 4M5ZL 4Z7UF 3G6JB 1HHGB 3G6JF 2KL6A 3WKML 1N6QL 1P6WA 3C8KB 2O93L 1CL7H 2NY2D 4HKXB 3WD5H 1CD9B 5DFVC 3DRQB 2A6KA 1CGSL 3K8LA 3HTLX 4JO1L 4EN3A 5EB9A 5C08D 1A6PA 2RQ8A 5DEFA 2HWZL 4FNQA 3D0VA 4QRTA 3MS8A 1TVHA 3F12A 1W0VB 2XJ7A 3T2OA 2AMGA 4YIQA 1CGWA 2EEDA 4QRUB 3OHXA 4ELKA 2AK1H 5AZ2L 1LO3L 4MHHG 4OF7A 1RV6X 2BVQB 3WN5A 1TZGH 2X40A 3LKNA 1ZT7A 3R1GH 1X5JA 4Y16B 3VMPA 4XXDA 1MVUB 2NY5H 1ED3B 5HVHC 3BUQA 4KDVA 5FYKD 1XCXA 4JL1A 1UKQA 5D7KE 5BS0E 1NOWA 5T3ZL 2J4WH 2W60A 4OD3H 5IJKA 2VQ1A 2DLFL 2FH8A 5FKPA 3ZE0F 3OAZH 3PTKA 4UT9H 4IRSA 2D9QB 4MA1B 1D9KC 3FO9B 1FPTH 1I1FA 3ZTNL 4PTVA 1WUNT 3W2DL 4ZENA 4GXUM 3IDYC 4G8GB 4DGYL 5T1DL 3FB6B 4NQCA 2HKHH 4PP2B 3BSZL 3MNVB 5ABHA 4QRPE 3CVIH 5FYJH 3W4RA 3QUYD 43C9B 1J9CT 2EKSB 4HMEA 2F53D 4DZ8A 1H11A 1V02A 3CPLA 4X6DF 5I1EL 5KVFL 4QEGA 3RWEA 4AH2B 3ARED 2VZOA 3FN9A 3SQBA 1P7QD 4MWFA 2JJWA 4FN0A 4MTVA 1P9MC 5BWFA 4JDZB 5AD0A 1QOKA 4ZAKD 1EXUA 3K2MC 5SWSA 4XP5L 5TD4A 4CAGA 3OZ9L 4IUGA 4PRID 5FEBA 4P5KA 3QG6B 3UP1A 1G9EA 3HE6B 4PB0H 5A43C 4MD5A 2FX9L 5JW4R 1BVLA 3BQUD 5E4EB 1J05B 2FGWL 4W81A 2VCAA 4JN1L 1UWXK 5D6DA 1ZJAA 2OI9B 2X4NA 3JUYA 4PRHB 5ISZA 1HTYA 4PREB 1RUQL 5BZDA 1CIDA 2RGSA 1NFDF 1NWTA 1VA9A 1MHCB 5MI0C 4PG9B 3KPRD 1B0IA 1JL8A 3CUPA 3W9DB 5DC9B 2F1AA 3VIFA 2DQTL 5D7LD 4MQXC 5DK3A 2ADFL 4KRPB 2W07A 2F8XC 4NQEB 3FAWA 5TE6L 1DE4A 3MLXH 4W6XB 5C6TH 4F58H 1FQ9C 3MRFA 4FZEL 3O3BA 3TGXA 3QIWB 5I8OH 3BN3B 4P2RD 1BFVL 3WLBB 2D0FA 4YHMH 4HLZH 1P4IL 3MBEB 1DQJA 3MV9A 2AJYH 4XC1L 1S7QA 3S2CA 4XBGA 4BQ6A 5DZLA 1HKJA 1OAKH 2EIZA 1FJ1B 5I1CH 3E6HA 4L4JA 3F5WB 1GRWA 5ACZA 1E72M 3MRCB 4ORGB 1KQZA 4FLSA 3WIIL 4Z78A 5KS9F 1MI5B 4J2XA 3AIUA 2IAMD 5CD3A 4ZTPH 4HDIB 1G5AA 4K9EL 3ESUF 2CLZB 4XNMA 1E40A 1G9NC 3HZKA 4U1GC 2W9EH 1WAWA 3WNPA 2XQYG 1RZIA 2MNUA 3U57A 2RB8A 1I1YA 4QTHA 1JAKA 1BMGA 2D7TH 2DWEB 3TBSB 1OTUD 4O2FA 2GIYA 5F1NA 1H3PL 4K23H 4KROD 4OD1L 5MERA 3FT2B 3PWPD 3V5HB 2OYKA 4E41D 1PG7X 3SKJL 3V6OC 1T6WA 3V6FB 2X4QA 4ZXOA 3HPLA 4N5EC 3QFDA 4K8RD 1MWOA 1N2RB 3E1F1 5IB1B 2EO1A 1QOXA 2XVNA 1W2KT 3BOVA 4RE3A 3FB5B 3S88L 2DQCH 2PTTA 1I1CA 4G6JH 5D71L 1D5IH 1YJDH 4X5WB 3MSGA 1JNHA 2HFEA 2WV3A 1SJEB 3BCFA 3HU7A 2NNAA 4G9DA 1S5IL 3PTMA 4NQDE 4ODUB 5JOPD 4F8QA 2Z0BA 1PIFA 3DURA 4CVZB 2DQGL 2BOCA 2Y5TB 4C7DA 1W8NA 5JMRA 3MRNB 4WFHE 3QIUC 4H26A 3U6RB 3SPVB 4ZPTB 4E8DA 1YNTB 4I0PC 2GQHA 2DQHH 4L8CA 1IGJB 2JJTC 2C7FA 4PUBL 1X5HA 5EZOL 1T1XA 1F58L 5DJXB 1PEWA 4FLOA 1OTSD 3O6KL 1E71M 5DT1L 1ACYH 3CC5B 2I25N 4QOKB 2BHZA 1NGZA 4MCZB 1VFFA 4OFIA 5KN5A 4D9QD 2NCMA 3K2UH 4JRXB 3I3BA 5GRJH 2H32B 5EOCL 4FLRA 4LYPA 5AZEH 1GXEA 5IROC 3MNZB 1FHDA 5EWIH 3GSQB 3MV8B 2J8UF 4Y5XA 1T0PB 1BPVA 3WF4A 2VTFA 4OJFH 3VXMB 3ZL4H 2KH2B 5JOFA 4KI5D 4C54A 3QWRD 3V7AE 5DEGA 3ZE2E 4L8SA 4JG1H 4LLMA 1AO7D 1IEAB 3HG5A 3WEXA 2CBJA 4DAGH 3CVHB 2MSPA 5ABDE 5HVGB 1T66C 5EUKA 4PLKC 5DD3H 5DMGD 1HOCB 1M7IB 3BI9X 4NO0D 1MFBH 4AD2A 1EAJA 3BPCA 2I26N 2NYYC 1FYTE 1HVQA 4DM2A 5IHSA 5GRUH 1DWIM 2VWEC 4N0CC 5IVOA 4HTYA 4PIRF 4GXVL 4JO4H 3SDAB 3F65A 3FCTB 4H8UA 3WUWB 3TFKC 2D22A 1EGJH 2X4UB 3QFJB 3V6BR 4D6DA 4LKXA 3DX7B 2YWZA 1G9MC 1H8SA 1IBGH 4XRCB 4WNQA 4AMXA 5KZCB 4PMXA 3CDGA 1KC5L 3AC0A 3AHXA 5DYOA 3H8NA 4FQXC 3MBXL 2ZUVA 4HF5L 5L0QC 2ZCKH 2HFTA 5HTSA 3C5ZC 3HG1D 4WI9A 5DHYA 5HPMB 4JFEE 1I3RA 1XGPA 1MFEH 1OAUL 3LRSB 4GKNA 3PTQA 5D8JH 2FECL 4NRZA 3AHYA 4JFHD 1H9VA 3LMJH 2XWEA 3LAFA 3BKYL 5DO2C 2VOTA 3O6LL 4U6TA 2J8HA 2N56A 1DFBL 4MJIE 2QV2A 5CJOL 3RAJH 1G0CA 3W25A 3AU1B 4OLYH 2EXYC 4FQLH 4JM2A 5INCB 3AXHA 5IW3A 3IAGC 1HHJB 4H0HB 4LLWA 1MAJA 1DWHM 4WFFE 3TH4T 3ULUH 2NY1B 1D5MB 4MAYB 1IT9L 2YKLL 15C8L 4PJAE 2EDHA 3FFCE 3IETA 2F5AH 4NUJB 1C1EL 3QDMD 1MQRA 4AWEA 4OUUA 4U1SA 5FF6A 1VPOH 4IHOB 3JV0A 3ZKMC 1G7MB 5FYKL 5GRXG 4X80H 1LE9B 1ONQA 3LKQA 5E2TH 2ZPKL 1INEL 3Q6FB 5EFIA 3MJ6A 1AGBA 5GQBA 3T0EB 1X7QA 4HJ0D 5D5MF 4AIZB 3MROB 5I6XC 3VINA 2JIWA 3ARGD 1GIGL 2MHAA 3BESR 1BM3H 4EIGB 3RVXD 4PTTB 1KJ2L 1EOKA 3VXUE 4I3RL 4WI2A 2OK0H 2DPEA 5FM8A 2BFVH 4WSJA 3C6SA 3BXNB 5F7EH 1RZJC 1OW0C 4CDGC 5DK0B 1D6VL 3FY1A 4YZFE 5I1GL 3JTSB 4HZ7A 2BV9A 1MJUH 4BQ2A 2EDWA 4G8IB 3VIGA 1JNNH 1F3JB 3BVNA 2WMJA 4M6NL 1DL7L 3LQAL 1N59A 3QEQB 2JK5B 2NXZB 3QEUA 1C5BH 3MACL 3SO3C 5IM7B 1OLZA 4GIAA 4WRLA 4F8TA 4GAJH 5HHQB 1AQ0A 1P6AB 2VDPH 3ARZA 4Q6IC 4TTDC 4Y4KC 4ODXA 5DJZB 2HLFD 4XPHL 1QRNA 5D1ZD 1JF6A 3MODL 2AXFB 4J3VA 4DW2L 1Q1JL 3EW3B 3F7VB 4TNVK 4A6YH 1PZ2A 4L4TA 1E4KA 1KGXA 3Q3GA 5DJ8B 3W37A 4JIEA 3VGHA 2QMJA 3ILQC 1HVXA 2BY1A 3KPSA 3PZIA 1MCPH 4GINA 4HGWB 3LXCA 2R1WB 3P4MB 2IH1B 5HYIA 4FFWC 4YNYB 4EI6A 1V03A 3TZVA 3O6AA 3SCNA 5E5MA 5F9DC 3EOBA 2WCSA 4LX4A 9CGTA 2GAZA 1EDTA 4AJ0A 3DUUA 3GO1H 2VLJA 3GSOA 5K9JH 3GI8H 3HC4L 3RIKA 3VA6A 1OGSA 3ARRA 3TT3L 3ZYIA 2R69L 5F7NC 3UXFA 4PSRA 4LEOA 1Z5LB 1KJMA 3IK2A 4GAGH 3KPNB 1GCFA 4K68A 3HNSH 1O7DC 3WO4C 3VIHA 5KJRL 3UDWC 1NJ9B 2W91A 1DHKA 2Z31B 3H3PL 1R3JB 2D3NA 5FCUL 2CBVA 4W7VA 4ZFFB 4GBXA 4R26L 1SVZA 3VFTA 3E2HC 5IB4A 1QI5A 1C12A 3WY3A 3BGMB 3EMZA 3TEUA 1OF2B 1VSCA 1S9XA 4NWUH 1RFDL 5DURD 4L4OA 3VIIA 3CJJA 2DTMH 4JDTH 1KB9K 2WCGA 2EZ0D 4GRMA 5DMYA 4YDIL 1D6EA 3TV3L 1QLEL 5D2NE 4IOFC 4XPGH 2WZHA 2R2EB 2IFGA 2DWDA 3KJ6H 5C09E 1Z32X 1KB9J 2OQJA 4Z7UE 1U58B 4OSUL 4RQQA 2O5XL 3G6JE 3M1BA 1QRKA 1KELL 2C3XA 2EE2A 2Y7QB 4LCIL 3KLLA 5DUBB 1C08A 1OAXH 3KS0H 4JY6A 4K8RL 3WDHA 4UZSA 3E6FA 2YUZA 1E27A 1GHFL 2BERA 3ARVA 4AZHA 1BQLH 2FECI 1YNLH 4PS4H 5FHAH 2X4OA 2Y5EA 4LPTA 3ZZ1A 1TQUA 5D1QB 1RZKH 4KAQL 1MNUL 4N90D 1NAMB 2A77H 4F2MA 1BX2A 3AXXA 2Q86B 3ARYA 4FQQB 3OF6D 3RNQB 5LXGL 1YN6B 4CJ0A 2W65A 1A14H 3TIDB 2DD8L 3GSVA 5GHWL 3N11A 3C60D 3O3AA 5LA0A 2PTUA 4R96A 4LLDA 4PJEB 3S4SG 4J7RA 5IFHL 3ES6B 3WKMH 1TTGA 4YHNB 1N6QH 2XZCH 1T03L 3CZFB 1U91A 4LAJH 1CGSH 5JUVA 4JO1H 3M17B 4P3CL 3ZE0E 2HWZH 5D7JA 3V79C 1AJ7L 2JF6A 3QCUL 5JO5A 2P48B 4OKVA 5CZVL 3SN6N 4ALAL 1K4CA 4D6FA 3RIFF 1LO3H 3QISA 1MQ8A 3SE4C 4ODWB 3BPOB 3T8XB 2Y6SC 5SV4A 1N64L 1RUKH 3OGCB 4AM0A 3EYVA 3P4NA 1QNPA 3ARDA 3WXWL 4DO4A 4X6DE 2CKBA 2VX5A 1OP9A 3CHDA 1BAGA 3VCLA 1ERNA 2BCKB 2FD6L 4KRUA 2UZXB 4IIQA 4N0YL 3B3IA 1UT9A 4ZFGH 4OZIE 3QXDA 2HFFB 2NX5E 2F7PA 3D85D 3VU2A 1CNVA 2VXQL 3W2DH 4G8EA 4RFOL 1IKFL 1LEIA 1CI5A 4AIUA 3LKSB 3BSZH 5I8EB 4Y5VC 3QEHA 4NZDA 3A23A 1WWAX 3P0GB 4L8BA 5FGRA 3VXTA 4UQCA 2BC4B 1J0ZA 1FC1A 4GRWH 4TSBL 3SY0A 4PRHE 1JIBA 5SWSD 5I1EH 4DEPB 5ID0A 1NFDE 1CD1B 4WHYG 1OTTD 3QO1A 4KZDL 3BWUC 3VXPA 1F11B 4PGDA 1KJVB 5TH2A 2VXVL 4X6CE 2VIRB 2B0SL 2VLRA 2P1YA 4GQ9L 4XP5H 1C8XA 3WV0A 5T1MB 3OZ9H 3RWFA 5ECJE 1A1MB 3S36H 3AHTA 5KVEL 1EIBA 1EZVX 3SDXB 2WBGA 2YD3A 2OXHA 2OS7A 4X5XB 2AK4B 3MJ9A 2ZSWA 1B2YA 3N15A 5DK2B 4JN1H 3TCXA 1CU4L 3CZ8A 4HIJA 3OAYH 2QPSA 1RUQH 1XHGA 2E7BA 4O00A 4XMLL 2EYRB 5KS9E 4PJHB 1EEQA 3ARFA 4LGXA 1BFOA 1B0RA 2HVJA 1S3KL 1DWAM 3DGGA 1A4JA 2DQTH 4N5UA 3BUYA 2ADFH 4XX6A 2Z1SA 2WKGA 4EBQL 5TE6H 3BAIA 1X3DA 4X4ME 3DDFA 1VF8A 4HU8A 4FZEH 4NNYA 3EJUA 1ORQA 4LSQL 2W9DH 2RIKA 3AMDA 1BFVH 2YBUA 1XSIA 3CBWA 1LK3L 3HHRB 4FFZL 5IFAL 1S7SA 2VE6A 3T77A 3LKOB 2EDRA 2Y1VA 1RZ7H 1KB5B 4QHKI 5BQ7B 4X0NA 4UINL 4LKCB 1QSFD 5A95A 2Z8SA 4YGVB 3N1GC 4OLWL 3W11D 3DI2B 4Y4FD 1P5UA 2B39A 3WIIH 3RDTC 1ISVA 5L2KD 3RY4A 4G9FA 5E8NA 2XNAB 2XWJB 1A6AA 1SR0A 5E9DB 1PX4A 3LS5L 2AW2A 1QNRA 5GRZA 4EUPA 3R06A 4K9EH 3HG4A 1FZJB 5EO0A 2Y72A 3VXNA 2WIIB 2PW1B 1HF6A 3OAUL 5CINH 5IEHB 2R0LL 2R2HB 4TSCH 2XTJC 3SDCD 3HAEG 3F4VA 1PSKL 4BA8A 2D1ZA 2X89A 1H3PH 2V7NA 4XP9L 1CWYA 4OD1H 2FNBA 5DWUH 2YS4A 1LE5B 5C0DA 3R0NA 1IAMA 1QQDB 1GAFL 3OLGA 1U3HA 2NY5C 4X0VA 3SKJH 1NWRA 5CBAA 4NNPL 2CQVA 3V2AR 5HGBA 5D4QA 3T65B 4WGWB 3VFNB 3PE9A 2IPKA 1AP2B 1XIWC 2BK8A 1IQDA 4RFEB 3ZTJH 4ONGL 1JHLL 2J88L 3KVQA 2XWTA 3MUZ1 3OB8A 5GSRA 4GRLB 2DT3A 1EGZA 3IAPA 4GG6A 1YEEL 1DTUA 4JZNB 2OTWB 4K2UL 1T5XA 4TX6A 2AJUL 1DVFA 1P69B 5CP7B 2WQRA 5D71H 2ID5A 4GKZA 5MHSD 43CAB 2Z93A 4Q2ZA 1NCNA 3TT1L 4EI5A 1HNYA 3LPPA 1E4NA 1QPPA 2I07B 3WFCL 3DOSA 3S4SA 3B9DA 1S5IH 4P46A 5IMKA