1CXLA

Complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q
Total Genus 243
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
243
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
total genus 243
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxlA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxlA01
3LQAC 3NN8A 1RIHH 4P8WA 4F37F 3W53A 3Q5TA 1J10A 3JTTA 2Q76A 3MU7A 4E41D 2Z9TA 3P9MA 1CNVA 1NWTA 1FYTB 3ALGA 1KPRB 2O92A 2IBZY 3GMPA 4ZOEA 3MA7B 1JK8A 3F7VA 5IDIA 1CD9B 4LYPA 1XF2B 4P2CG 3Q1SH 4OF3A 3O3BB 4ZNEE 4PJGF 3KVQA 4UINL 4Z7VE 4CL7A 5JHDE 3F7PC 4EDWH 3RIFF 2Z4QB 5ITFA 3QBTB 2FWOA 4MA1C 2G9HA 4W8LA 2OR9H 2YPLA 5FO7B 3II1A 2HJKA 4LBEA 3CFKA 4PJCA 5F7YC 1UJTA 4LEOA 4BFEA 1MY5A 1XF3A 3HKFA 3IJ9A 1Y7VA 3BP5A 3V4VH 1TJIL 1LHZA 3P77A 2HFFA 4XWOC 3AROA 1T21B 4PJIA 4WEMB 4YH6A 4P2QE 5ALBH 1F58H 5IF0A 4D6EA 1CGVA 3BVTA 4HIXL 3VFRB 3RWFA 1U91B 1J1XL 4FQQB 2YKLH 3HA0A 2WB5A 4NQTA 4YLQT 3HI1A 4APQC 1U8KA 2E7HA 2FR4A 4JO3H 1T1WA 2Y72A 1DWFM 1J87A 4PJXE 4MAYB 5DEGB 2QPUA 4OIBA 4QHNB 1E15A 1BFTA 1K8DA 2Y9RT 4XB7A 2DM7A 3G6JF 4S1DC 3G5ZB 3F5WB 1CL7H 4GG6F 3CFEA 2BVDA 2ZX5A 2ESCA 5LGHL 3UG3A 5A69A 3I02A 3VU2A 3QXAA 3CVHB 3GBNL 1JFQH 5EO1B 1KBBA 1VFBB 3DVIA 3HPLB 3V5KB 3L3GA 5K9JH 4NWTL 4KAQL 5HGBA 4DZ8B 1RMFH 4QHLA 5TDOB 2MNUA 3IKKA 5E1QA 4GBXB 3BAIA 3KPTA 4UZGA 4JAWA 5C8BB 4ZENA 4JFEA 3AIWA 3H3PH 4JLRA 4XTRD 5IMOA 3IDUA 3LCYA 3N50A 4UFIA 1WDSA 3MBED 4PJ5D 4HW6A 2J88L 2GTZA 4PGCA 4WWKD 1KG0A 2BNRA 1D5IL 4OCRH 3LPPA 5KEZA 2X5PA 2YUVA 3AXLB 4MLIA 4UT9L 4LLQB 3C87A 5ECUA 2JJSC 1JTOA 2Y24A 3O8XA 4U1GC 2CIIB 1TJGH 1RHFA 2OSYA 1KXVC 1W2KT 5I19H 5C9JA 4JKKA 1IQDA 5A2FA 3BQUC 4I5BB 4PJ7A 2DWEA 4K3HA 4YO0B 3UXFA 1G6RH 3HG1B 5HYFA 2CKBH 4V28A 3AREC 5D70H 5DRWA 1URLA 2R23B 3VXSE 4PSPA 4Z7UF 5HHOB 4G7VH 4XXCA 1ZS8A 5T33L 1LGVA 1MXDA 1YEFL 2VI0A 3VWJA 4P4KB 5DJZA 1MIEH 4U6XB 3UBXI 2HJFB 3PZVA 4CBPA 3AS0A 4H2CA 3T65B 3VFWA 1Q0XL 3MMEB 2P8LA 5M17A 3EYUL 1HDMA 1XCWA 3LKRA 1W9XA 1FIGH 3UTSB 2ZUMA 5D2NC 3QUYB 3TT3H 3FQXB 5T1DL 1TETL 3MSDA 4Y8DC 3U7WL 1U3HD 3OQ3B 5FEBA 5FUZH 1YEIH 1QSFE 4DGYH 1V3HA 2AJXL 2R9HD 5DMGC 5CKGA 1QP1A 4XB8A 1GOFA 1CZ8L 2VC2H 3HRZB 1P1ZB 2X4OA 4ZFOA 3BUPA 2XUCA 1JTPA 2XFRA 5I8OL 4ZUSB 3WXWH 2O9TA 1BVNP 4XI5C 4UV7L 3SIMA 2O61B 5J6HB 2NY5C 4UMGA 1BX2A 5DJ2B 3GMRB 4DEPB 1JNLL 1VGEL 1PG7H 3HAEG 3F4VA 1C8XA 4KH2A 1Z9OA 2B8OT 1DWAM 1EDGA 1V0LA 3S5YA 4F15B 2GJ6A 2DWDA 3U0TA 3CNKA 1BQCA 2L0DA 4IRSB 5DI8A 3N15A 1RVFH 3VXUE 2ADJA 2P8PA 3MRGA 2YJQA 1FAKT 1RY7B 4NGHL 4WUUE 2QR0B 4XAKD 4DOHE 1NDMA 3TBSA 2DLGA 5F3BA 1RJZB 4NKQB 4GUPB 1QLRA 1H3VA 5E94A 2YK1H 3LKSB 3O6LL 4YK4B 3FQXA 1RU9L 3OMZA 2EDTA 4GLRH 5KS9F 3OKOA 3LRMA 4XNZB 3I84A 4M6MH 3TT1L 4KRTA 2XZCH 2H41A 4Y2DD 1KELH 2H3NA 1CU4L 1GC1L 4PBWD 5FL1A 5J0BA 1Q72L 1MQPA 1A4KA 2WWKO 4JFOB 4M1CC 3AREB 3VXSD 3W28A 5EZIL 1KTKE 1TE1A 5EU5A 4NNXB 4K94L 4G8IB 4F33A 2WWKT 2VCAA 2VABA 2O61A 1MHPL 3DTXA 4AZGA 3HNTL 2AK4B 3PP3K 1VJSA 4OFPA 2PTUA 2ZUSA 5GSVA 3WCYA 1IILE 3X17A 5HPOA 4OZIB 3STZB 2BNJA 3QJFB 1FVDB 5HHNA 4XPTH 4MXQC 5DS8A 1R3HA 4RQQA 3HRPA 4G9FA 4JFFA 5CAYB 1LO2L 4EE9A 1S3KL 2Q7NA 3ARED 4HWNA 1LO0H 4OQTL 2VZSA 3PHSA 5J6GB 4L8BB 2R2EA 4YHKL 2WUCL 1S7TA 2BJMH 3T0ED 5ACMA 2X9WA 3TJHD 3B8SA 2WZEA 4NKDB 4NF7A 1ZHBA 2Q6WB 4OLXH 4Y5VC 4YQXH 1CDGA 5F3BB 4GH7B 2ZSVB 3RWJB 1QLRB 5EULV 3MNWB 3KE0A 5EB9A 3WEOA 3QWOB 3GMOB 1L0PA 3V9FA 1QZ1A 4GI8A 3VXRA 3T09A 3EJUA 1PW3A 4MA3A 1P7KA 4KJYA 1KB9K 3R4DA 2AI0H 1FZJA 4O2CB 2IMNA 3JUYA 3WS6C 1KGXA 4PRIA 4JQXA 5FV1L 1MVUB 3MMDA 4Z7NF 4PMUA 4RGND 4KQ4H 1PVHA 4TPRH 3AREA 1X5YA 1ZLVK 2DRUA 3EYOA 1YN7A 5DRNA 4ONOA 5C0IA 1A7QH 3A6CH 5FV2A 1PJ9A 4FFZH 4JFPB 3ZHLA 4TVSa 1ZXQA 4Y5VA 3MREB 1KIRB 4WTZA 2EBNA 3VI3F 4J23A 5F71A 4Z2IA 1QVOB 2NY1C 1ZSDB 3I75A 3U9UA 1JP5A 3PP4H 4LLWB 3BIAX 2VLJB 4BYHA 1UACL 1GOIA 1LO0L 4OQTH 5GHWH 1B2YA 2EDBA 4MZ2A 4LAJH 4OF8A 1GZQB 4BK5A 5EBAA 2X1WL 5E8PA 2VIRA 2YDQA 4ZODA 5ANMA 3VXSA 4K9EL 1P6WA 1G7PA 1IC7H 4NQCD 3VMOA 4MNKA 4OLXL 2GDVA 4XRCB 2WP3O 4X99A 3S88H 4MAVA 3OR6A 4AQ1B 3ZYOA 5C0DA 3TNMA 4EQ3A 2JCCF 4UI2A 1ZBWA 3WIHA 3MRBB 1U8JA 1RJLA 1KACB 1LILA 3JWOC 4AM0A 2VLME 5E24E 3BRDA 5KSAA 4F7CB 1BPVA 1NGZA 5CD5D 1CG9A 1QO3A 1X5LA 4WEBL 5B39A 1A5FL 4HIIB 1CICB 2CYGA 3ECQA 2XWTB 3VTRA 4DGIH 5F7UA 5DJXB 3CMJA 2DPEA 3ZO9A 3RGVC 1VERA 3E3QE 3V4PH 4G6FD 3THDA 4GG6B 1QFOA 5I73C 2NXYB 3QUKA 5EU4B 2W61A 3O4LE 1MLCB 3QFJB 4H8UA 3TOPA 2PWHA 2UWEB 1RIVL 2F58L 4QGYA 1FHLA 1A9BA 4S1RL 4NPYA 1B6DA 2O5YH 1KIRA 2FGLA 2LTQC 5INCA 1G7IA 2E9LA 4F37K 4D0DB 4LASH 4YBQD 4XCYA 5I6SA 3LEXA 4MDIA 4APQA 4UQ9A 1I9EA 1RK0B 4GRMA 1KEGH 2NX5A 2PW1B 4OBSA 1TZGH 3TYFB 2J8HA 3U7BA 1HSBA 3FRUA 3WEMA 1NMBL 3DBXB 2PR4L 1X7QB 1A6VL 2PTVA 3OB0H 5DYOB 1KYOJ 4FABL 3B9VA 3K4AA 5HI5D 3HZMB 1ZHKB 3M8OL 3DMMD 5I24A 1LDPH 3ME0A 1VFMA 5SWZB 1P2CB 4LCCB 1HK6A 4ACYA 3DXAA 4KKAC 3WD2A 4PTTB 2CBUA 1FFQA 1OTUD 3D2UB 4JFZL 1QFWH 4U1HA 3BDBA 4AEFA 4M1GL 4POYA 4OLEA 1UG9A 1OT1A 1G7HB 3X3FH 3BZEA 2GHWB 3MROA 4PMDA 1UD6A 3O6FB 4Y4HA 3F7RA 5KBNC 3U4EB 3QQ4B 3QIBC 1SJEB 5K9QI 1NGYB 1EMTH 3D69B 1HHKB 3S98A 2X1PA 3C2AL 5GZOC 4YHYC 1XSKA 1F3JA 1KN4L 1X5ZA 4EUPG 2EIDA 1Q94A 1CLYH 3SCMD 4BZYA 5IESL 5ILTH 1EERB 5GS1B 2ED9A 5D7IF 3U46A 4O5LH 3DYMA 2P5WA 4AZHA 4P59L 1HHGA 1CLZL 3QUZB 5HDBE 3BVUA 1RZGA 3UDWC 3H42L 3PJSB 4JG1H 4KRPC 2GT9B 4NQVA 2GYSA 3V52L 4NT6B 3MRIA 4YHOL 1FFOA 2LU4A 2VX4A 4PMZA 2XKSA 3FN9A 2FIKA 3FO2A 4W84A 1I8LA 5KS9E 2E0PA 2XSAA 4R8WL 4JQIL 4JG0H 3T2QA 2BC4B 5EUOF 5C0BD 5FYKH 4PJ7E 3VNZA 4EXPX 2JCCB 1NGPH 3RY6C 3SE3A 3CLEH 1BFOB 4PTTA 4MPKA 4EDWL 2FGWL 2GY5A 4LGSB 3JV6A 4NC1C 5AG8A 2E7LC 3C5JA 1A7PH 3DSFL 3QUMH 4JY4A 2EC9U 5JPNB 4XP1L 4OZGA 4ERSL 3RU8L 1A0QL 1L0QA 3MLSL 5BOPA 1NCAH 4OV5B 1T7ZA 5TE6L 2JF7A 1IKNC 3ZE0F 3FNDA 4YBLB 1XF1A 4GI6A 4OLWH 5IWLA 1ZANL 3IU3B 4Y4FC 4OFKA 5A6BA 3AS2A 2HISA 3LOWA 1DDHA 4OFVA 3TNNA 4ZUUB 3GXMA 3QUXB 5GZNC 4N8CH 5CQ1A 3DGCR 1EBPA 2M26A 3WJLA 3O9WD 1ZBCA 1G6RA 43CAB 3KJ6L 1J1PH 2AK1H 3X11A 2ZUXA 4P5TD 3QDJE 3Q1SL 4RGMB 1RZGB 1EGJH 1I8MB 2YXFA 1WIOA 4ZD3L 5BXFA 4HZLA 4RA3A 1AO7B 4S0TD 4GMSL 2P5WD 5D6CB 1D6EB 3R0MA 4J4PA 5ISZB 2J78A 3ARFB 7A3HA 1CBGA 3C09C 3P4OA 3ARRA 2W9EH 3NA9L 1AI1H 2Z4QA 3D48R 4BCEA 1OP3K 1IL1B 5INDB 1QI5A 4XWGL 5C09B 2F54E 3BYYA 2MFNA 4JPKL 1CGUA 4NSBA 2NY2C 4I13B 4PTWA 5E8EA 1J86A 2G8ZA 4QLJA 4XP1H 3WF4A 5E8NB 1G0YR 3QIUD 1YMHA 4TSCL 1FG2B 1AP2B 3FB6A 4PR5A 1DEEB 5F7KC 3ZTJG 2VDRH 1IJ9A 1KF9B 2VXQL 4YFDB 3RI5F 4TN9A 5C0CA 1F13A 3LPGA 1S7SB 4OCYH 3DV4B 1QBBA 3QDGA 2QLVB 4IMLA 2OYLA 3M17A 4LF3B 4JR9H 4PMXA 4JJ5A 1AGBA 4PJIE 1K4CB 1NEZG 2Y07H 1QR1A 5CSGA 4IOFC 5J1AB 4NRSA 1NC4A 4U7SA 4PGZA 1KOAA 2JF1A 5ERWB 3CD4A 5DEGA 3X11B 4GIAA 2DSVA 4C7DA 2XN9E 1NUFA 2QQLH 4UTBL 4AG4H 1BG9A 5D2LE 1DFBH 3DV6A 4YEFA 1W1TA 1QI3A 3VG0H 3MCKB 4PP2B 3I50H 4QFUA 3ARFA 3QEQE 3WIIH 5K9QG 5DD1H 5I74C 5INDA 3WFEL 2JK5B 4F58L 1R87A 1N4XH 4RE2A 4XVSL 3DPBA 1RURL 3RWGB 3SCOA 5GSRA 3HUJB 4QHLB 5HGAA 2CRYA 5C08E 1D2KA 1BF8A 4GBXA 5IB4A 3QDGE 3HI1B 4UT7L 3N12A 4L4TA 4U33A 2ZCHH 5FCZA 1PPIA 1FVCA 1MIEL 4OCYL 4LXFA 2OTWB 4Y4FA 5J12B 4NRYB 1NLBL 1T1XB 1S7SA 1WCQA 2CPCA 4OZHF 4Q6YA 2RGLA 2JIXA 1FIGL 4Y4HC 1TJGL 3RNQB 3SKNA 2K7PA 4E9LA 1W1PA 4WNQB 3SKOB 2CIIA 3OHXA 1V3LA 2AERT 2AJXH 4PV9A 2DIAA 3RWDB 3L7EB 3LV3B 3PGDA 1PD6A 1YMMA 3MRCB 4AIZB 1V0MA 3WNPA 3L3GB 1MI5E 2NY7H 2EIBA 2BVPB 2Z8RA 3HMXA 3PWPA 3QP3A 4LNRA 3SE4A 3U4AA 1X1NA 1NAMA 1XH3A 4GT7A 4UFHA 5DGQA 2A3CA 4HWZB 1B1YA 1W72B 3DNKA 1QYGH 2EEDA 3NOIA 4PUBH 1FN4B 5A2AA 4JRYE 4P23A 4P5KA 4FQXD 2RGMA 1B30A 5H2BB 4NC2B 4P4KC 4M7KH 2ICWJ 3G6AA 4OGXL 4NQXA 3SGDI 3KZSA 1A3RH 2FZ3A 3TV3H 2IAND 5EU3A 1CVRA 3A22A 3BHBB 3O8XB 2XFFA 2BHYA 4HHAB 3U0WH 2AJ3A 3TF7C 2MSPA 2AW2A 2HKHL 4JL2A 5DJCB 4G80A 4Y19A 1WTGT 1DBMH 3U5YA 1R3JA 1TPXB 4ODWB 3IXAA 1NJ9A 5LGJA 3A4WA 4XBGB 5E1AB 3ZKXB 1H2JA 4QRPB 1T83C 1MRDH 1W9BM 3BVVA 4HX1A 3VXTA 4M7LL 1XF5B 3T0VA 1GAFL 1E1EA 4QT5B 3V5HB 1HH9A 3ZE2E 1FIEA 2YD2A 1KJ3L 1MCKA 1D5BB 2Z31D 2FATL 3UJIH 3S36X 5EO9B 3K8LA 5I18H 4LOUC 3KPNA 4OQ1A 3RX7A 4OGXH 4HH8A 2BSSB 2D23A 5FD0A 4OCLC 2ESVA 3WUZA 1G9NC 4L3CB 1IAKB 4KMTL 4NN7B 3MJ7A 3N9GL 5F9WB 3HAEB 3X3GH 1C5DA 3SGKC 4KTDH 4S0SD 5DJ0A 4PMRA 3G6JE 4XZUB 3QNYB 4FXKA 4GKSA 2FNBA 1J0KA 3ZKNC 1J05B 2VH5L 3LQZB 1QRNE 4ZG1A 4ODUA 2OSLA 5DUPL 4YDVA 3TT1H 2YIHA 4LFHD 4LSSL 2UWFA 2A1WL 3INUL 4HS6B 2ZOKA 1GUVA 4C7GA 2X89D 1U42A 5SX4I 3BIBX 1IGIH 4XNZC 4W7WA 1H9VA 2Z35A 5KVGL 1BGXH 4L8DB 5FYKE 1PBGA 1WQVT 4ODTL 2PXYA 5KZCD 1RIUL 3D4ZA 4GRWB 5I6XB 1NP2A 3QCUL 4JFEE 1MJ8H 4DK6A 4DVRL 8FABA 1GCFA 3NGBC 1H3XA 1W72L 4KVCL 1MCHA 4PJBE 4LLDB 2EXYC 2JB5L 4KI5D 5SWZD 3PDOB 4ODHH 3FTGA 4XMKL 1HIZA 1JXJA 2OK0L 4XHJD 5IQ7L 4Z77A 3KDMA 3QT2A 4FNPA 4GXUM 5JA9A 2XXCB 2XN0A 1EZVX 4V1DD 5DJ0B 4AMKL 3MV7A 4GJTB 1XGYL 4GW1B 1J9YA 3ULUH 5HGGS 3FB8B 3QWQB 5DSCB 4JO1H 3F62A 3ULUD 3FO9B 1BBDL 4P3CL 5D5MB 1OSPL 2EO9A 1LEKA 3S4SB 2AEQH 3SGEH 1GJIA 3LDBB 5EFFA 4Z8FL 4AC1X 4KQ4L 1MPAL 1WF5A 4L1HA 3VFOB 4HWEH 2ZSWA 2E40A 1FH7A 1B31A 1TENA 3WQ4A 5IGXL 1DQJB 5EUKB 1L7TL 2YPLB 1M6OB 3V6OE 3VWKB 3EYOB 1XF3B 4JZJB 3L4YA 2V9QA 2APTA 5TH2B 5TE7H 3ZKQD 4LKCA 4HDIA 2GK2A 2XI9A 1H3PH 3BP7A 3PP4L 4D1IA 3OAYH 3QEUB 2DL9A 3EMQA 1QVOA 2AK4D 4MAUH 3MXVH 5GZND 5FB8A 2IPUK 4PJHF 4RGNE 3GSXB 1H5BA 2XG4A 3L3DA 1CDYA 3CH1A 4HMCA 4MNGE 3CXHJ 1SJHA 1J8KA 1KCKA 3ARBC 4NZRH 4QXUH 4G9FD 1AKJB 4ISVB 1UH4A 1UXSB 1OAQL 4MJID 2QLYA 4ZSOE 1RFDH 5IKCB 4CDHA 2DQXA 1S7XB 2ICWI 5D2LF 2WBJA 4Z7WF 1NDGB 2ADGA 5JIWA 1YMME 2OW7A 4P7OA 4Q58C 3O4OC 4Y5VB 2H32A 3P77B 1GYAA 3VM7A 1IGML 3MGAA 3MLVH 2IH3A 1ES0B 3PWJA 2B39A 5IW6B 4Z9KB 2DLFL 4E41B 3FFDB 4CCCA 3CK0H 2VAJA 3WL9B 2N1KA 5HGBB 3AHYA 2EDFA 5I15L 5E8PB 1UM4L 3B9KC 3JV0A 3GXFA 3UTTA 4QDMA 1N8ZA 1OT2A 3O2DL 4F8TA 1A9BB 1MHEA 5ESAA 3RDTA 3T08A 4HZ7A 3LXBA 1XGRA 3IKCA 1U6AL 3SCUA 2XM1A 2G41A 5KSBE 2QJDA 2DTSA 4OZHE 2VL5B 3PWLA 4MNQD 4MB4A 1ORSA 3QNXB 3UZEA 5J4MA 3SO5A 5DTFA 4TNVF 1A1OB 4XPBL 4N0CC 1OGSA 2NXYD 1T5XB 2VDLL 1BJ1J 4I77L 4MNGA 3OAZH 5CG0A 2XWTA 1NSNL 3QUZC 3D9AH 3BGMA 4OCSL 1HYRC 5AYIA 2F7QA 3S6TA 3KR3L 3CUFA 5JNYA 4U6TA 2GJXA 5EIIA 2UYLB 1ZT4A 4TTDC 2CKRA 1KXVA 4JFFE 4F9PC 2KH2B 3SDDC 5BO1L 5L2JA 3CZSA 4OD3L 1W2VA 3MTRA 3ILQC 4WW2C 1V0NA 5IQ9B 4R97B 3RKDC 3CZFA 4UIKL 1U2YA 4PJEB 1E4MM 1NCWL 5DJZB 4HUUA 1ODAA 1H41A 3WL9A 4KJQD 3L5HA 2F53B 5E9DB 4LCYA 4WUUA 2NTFB 3FT3B 3QG6B 4KHXL 3WFDH 3SCTA 1Q94B 1CGYA 3BH9B 3H3BC 4A6YH 1XGRB 2VURA 4NUJB 3HC4L 1XCTA 3OR7A 3HZMA 3PHQA 2X4QA 1KYOK 4PJ7B 1Z3GH 5FM5O 3QXWA 1JGDA 4GAFB 4ZE4A 5L2KE 2G5BA 3HB3C 4HPYL 3IGUA 35C8L 3MRDA 4KRPB 3BH8A 1T66C 1T5XA 3CXDL 3GSUB 2E27L 2Q7YA 1KGUA 3HUJF 2D7OA 4X7SL 3BD3A 1FNSH 1HEZA 4XP5L 1I4FA 4WO4C 3WLWC 4UOW1 1XGTA 2J4WH 1WKYA 2YL8A 3WFLA 5E4EB 1MREH 3RX5A 3FB5B 2NTSP 2UY5A 2Y36L 3PZNA 4GOSA 3OGSA 3TTSA 2ADJB 1H3GA 2P8PB 3QPXH 4PJEA 3R0NA 3LPOA 2NW3B 1FNAA 1CT8B 5GGTA 4TVUA 4PJ8B 3RVXD 1XIWA 3SKMA 2FX7L 3O45B 1KFWA 2XXMB 2B2XH 5C0FA 1RZIA 3I6LD 1CEOA 4YAQA 1AGFA 2ZCLH 3TNNB 1WZLA 3DX8B 5MEQA 4FQXB 1UG6A 1J1PL 1ZA3B 2AK1L 5D7KE 3ZQ9A 1N59A 5L6YL 2JIEA 3AU1A 1BX2B 4J12A 4GMSH 3VSUA 1A6UH 4U5IA 3JV6B 1YEEH 1V7MH 2OP4L 4HBCH 4DCQA 5FO9A 3P4NA 1R3LA 4OLUH 2ADFL 3CUPB 4QRRB 4YDIL 1N5YL 3CU1A 1GCYA 2OL3L 1FLTX 3V0WH 1KTRL 4M5ZL 3ZTNH 4AL8L 5D96B 1SVZA 3ZSTA 1I7UB 3UROR 3WIJA 4WGWB 1QACA 2F74B 1ETZB 5CEZL 1DEEA 1JTTA 3MLZH 4I3RH 5I74B 2Y5TB 1ZVYA 4ZFOL 3D50A 3BN9D 4MCZB 4BM7A 3EJTA 1N0LA 1LJYA 3T04D 1SYVB 5L88L 4HSQA 2V38A 1V0KA 1KT2A 1U3ZA 2OR9L 1FPTL 2EABA 4MAZA 3NZHH 4UQDA 1X4ZA 4WW1A 1E71M 3WD5H 5D7JA 3DVGB 3BKJH 5AUMA 5JLZA 2AJZB 4JJ5B 4N5UA 3QHNA 5MEQB 3WMBA 3GMOA 5CJBA 5CEYA 1C08B 1PX4A 4X6DF 2VQ1A 1CDIA 3WN6A 4QP0A 5EOCH 3EOTH 4HPHA 3VXMD 1G7QA 1NEZA 1C12B 5ICYA 3SCNA 5I71C 3BGFC 4B3KA 3AU1B 1HWHB 5LBSL 1E6PA 4JFXB 1QW8A 1R75A 3NIFE 4NQED 1LK3L 4RMQA 4JANB 4FMVA 4MDOA 1CR9H 1IC5H 1YECH 1JZ7A 2A83B 3HS0B 3VGGA 5DMYA 1MYRA 1ZWIA 4ONFL 2OJEB 3BKYL 1T83A 5LG1A 3WEXA 1MH5B 4FNLL 3BSHA 1NLDL 3I9GL 1ZSDA 3HMWH 2WIMA 3I75B 1QYGL 4GXUN 1FL3B 4NZUH 5HHME 2D7QA 2R29H 1RUPH 3QIWB 1F8TL 1QNRA 3SKJH 3ET9F 5EG6C 4Y16A 1LL4A 3VXSB 4BFGA 3QWOA 5EB8A 4M7KL 5J1AA 1YC7A 1U8HB 2ATPB 5FYJU 4U0RC 3MYJB 3SPVA 3ZHKA 4KHTL 3WD5L 3DX1A 2MCPH 1RV6X 1OGGA 3MV8A 4YUEL 2DT3A 1J0YA 3OR6B 3RNQA 3SKNB 5KN5A 3PXHA 3TO4C 3OAYK 4OKVB 5DJAB 4YDJA 2DT0A 3KPQA 1X4XA 1GHFL 4U1IA 3LN4A 1VHPA 5MEOA 3G5XB 1L7IH 4V1DB 4Y2DA 4BQ2A 5BRZB 4ZNEA 4MAYD 4EUPB 3NSXA 2VLJA 5IB1A 1B3WA 3QQ9C 1RUAL 4TX6A 4JKWA 1HJXA 2AMGA 1FLRL 1TXKA 4P9HH 4KTEH 2M1KA 2XIDA 3NPZB 1NAMH 5FA3A 2VLKE 4LARH 1FNFA 5IK3A 2XTKA 1F58L 1U92A 3AFLA 3HMXL 1KNOB 2R29L 2CHNA 2D24A 5IVZB 5D7IE 2RQ8A 3BKCL 4X80L 4WUKH 2AKRB 2XN9A 1HVQA 3B9KD 2DLTA 2BNUA 3EJJX 4PRPB 4X98B 2HWZL 3T0AA 4R26H 4Y1AA 4EOWH 1TETH 3TP4A 1CFNB 2X4UB 1HHHB 1YEFH 1IAII 2XN9D 4JY6A 1MFBH 2EO1A 5JR1L 1R3IL 4NFCA 2PWGA 1BD2A 2OW6A 1A22B 3A67H 5KTEL 5HSFA 5E1AA 3SQBA 1ZHKA 2JELL 3BUTA 2GSJA 3S3SA 1JFHA 1ZEAL 3KPMB 4V2BA 3B2UC 4ZOAA 2WVVB 1L7IL 5AWNL 1MLCA 3QFJA 2CITA 2GK0A 2ZKHL 4RSVA 2CLVA 1JNHA 5JQ6L 3VXRE 4MXQD 5MEOB 3MLRL 1BGXL 1U95B 2CUMA 4L3EB 5JIIA 4QEGA 4M1RA 3JVGA 3TBTB 4AD4A 3G6DH 4UQ3B 4UU9B 1FV1A 2DQDL 1UYWH 2R4SH 1C16A 4K71B 4LU5H 4PLOB 1SY6H 5I6XC 4XC1H 4WSKA 3KPNB 4MNJA 2V7HA 1ODZA 2E9IA 1KGCD 5IW3A 4DZBA 1E4KC 2NY3B 3PV7A 2L4OA 4KTDL 3TH3T 2V3EA 2H26A 1TZHB 4AQOA 3RZCA 1MEXL 5D1ZA 5EFIB 4G9DB 3TBVB 4UT9H 3ULVC 4FZ8H 4E8DA 4XTRC 3VWJD 3EHBC 2VOTA 4FTVA 4PJAA 3ARUA 3O6LH 3OGCB 4JDVA 4X4XB 4PB0H 1ZHLA 3U0PB 3GM0A 1S9WB 3FW6A 1M7IA 5LJYH 5KVGH 3MV9B 4P9HC 2VLRD 5AZEH 2V5CA 3LS5H 1FL6A 1EAJA 4KJWD 5TE4L 4TVPL 1N7ML 4BUHA 1UQSA 1IAIL 3WUEA 1Q6GA 3IRPX 4RFEA 3S97C 4DWSD 3RVVC 1U41A 3K8MA 4G8FB 4MVBC 4Y4KA 4F7TB 1L7TH 1LVEA 3GBEA 1EEZB 4P57B 5FUOL 5HYJE 4JN2A 3F5JA 1KELL 5IG7A 2GVYA 2HFTA 3NGBB 1EEUA 2XWBA 3MODL 3SDAC 4ELMF 1OB1B 3D85D 3WDQA 3UZVB 4MXWL 1S3KH 3NCFB 3ZDYF 1G7MA 1J7VR 3E6FA 4Z2GA 3QDHA 4FZ8L 4QHKJ 5K93A 4U1LB 5B8CB 1O7DC 3GSQB 2ERJB 1OP9A 2G2RB 2WUCH 2CLRA 1XGYH 3L5IA 4I0PB 3BJ91 1BBJA 2EKJA 3D6GA 5KVEH 2BOCA 4L8DA 4MDJB 1I7TB 1M05B 1Q9OB 1U3HC 1U3YA 1LO3L 4WTWA 3EYQD 1T3FB 2J1KA 5IHRA 3U6RA 3LS5L 3IVKA 1HZHL 5ISZA 4A3HA 2G60H 1HVXA 2LVEA 4HQQH 2VDQH 1NC2D 1JNLH 4M6OL 4FQIH 2NW2A 4Z7WA 3NPSB 1M6OA 4Z0XA 3IS1X 3MLVL 1OTTD 3PWNA 1JCKA 4OIIH 1EHNA 1B3YA 4PR5B 1E6JH 4K07A 4ZUUA 2DLFH 5D7LD 1A6TB 1UM5L 1MJJB 3ARDD 1R7AA 2RBLA 2IAMC 3RO8A 2UWEF 1MW3A 4M61B 3RVTD 1HI6B 4X7TA 5E70A 2ITCA 1GQJA 3ULVF 3KPRA 3O6MH 5DHVB 2FEDC 2R2BA 5AYQA 3GSXA 3O4LD 1P6FA 2C7UA 4ZFGL 2YD8A 3M1BA 1S9XB 4I9WD 2FECL 3F8UB 3T2PA 4R4NC 5IVXE 4ISVA 4EN3D 3MUY1 4HF5H 3BMVA 4P49A 1I75A 2FJGA 3OKNA 5ICZB 1TZIA 5DFVD 4NWUL 5A6SA 3HLAA 1DN0A 2DJUA 1X5IA 1HP5A 1YNLL 4G43A 3MCLH 4O2FA 1HX0A 2OS7A 3BKMH 4PJ9A 4HDIB 1YY9C 2XY2A 3L4TA 5BQ7B 4PS4L 4W89A 3OKKB 4LHUA 4L3EE 4PJ9D 2DQUL 3EOYG 3DV4A 1VDGA 3HE6D 4GAGL 5HD8D 5CFHA 5BJTA 4NOFA 4BQ6A 3WUWG 5HBBA 2K9UA 1OAZL 1CD1A 3WH9A 3BEVA 1U2HA 4L4TB 4Q22A 3STLA 1AKJA 1AGBB 3LAFA 3T0EB 2NR6D 2P49B 4HIEA 4HIHB 3DDFA 2VRAA 3BPCA 4U3AA 1OWWA 4S3KA 4AXNA 2UUDK 3DLQR 1FYTA 2ADIA 3B5HA 4OGAD 4IBLT 4X8JA 4Y19D 3MNVA 1J11A 3FN3A 1ZLWK 3WO3B 1UASA 1WWAX 4B9YA 3W11C 4IJ3B 3MRRA 2BY0A 4NYLB 5I1IH 5JHDB 1IV8A 1L9MA 3RWHA 2EACA 4J4PC 4TULH 1AY1L 2APVA 3ARBB 5EZJB 2FWOB 2I25N 1JPFB 2VR4A 5EO0A 3RBGA 3P73B 5BO1H 2GKIA 3TA3C 3UMTA 4FG6C 2FECI 4E2OA 1OVZA 3AB0B 4MD5A 2HFFB 2FSEA 3BH4A 1NCWH 1MAKA 4RDQF 2R69H 5JHDD 4KRUA 2APXA 4AD3A 4K3JH 4NM8H 4D0CB 2EDXA 5CSYA 4C83A 2F53A 1ORSB 2VISB 4XP9L 3GK8H 3QULB 1AXIB 4RIRB 4YR6B 4W4OC 4NO3B 3MLXH 2X9XA 1QBAA 2AJVH 1FH8A 1CXHA 4HUVA 3W6LA 4WK9A 2HN7B 1BIIA 5K9OB 3O3EA 1II4E 4JHBA 5HGHA 3HZVA 5SX5K 3TPUB 4ORGA 2QADD 5DZNA 1DSFH 2G5RA 1HHIB 1UM6H 3W37A 4JVWA 4KI5F 1LG1A 2FEEI 2B5IB 5HHPB 4M82A 2E27H 1DLFH 4FFWD 3VI4E 1CLYL 4PRID 4YXLL 2GAZA 2A3AA 5C08A 4GBXD 4P5KB 2WANA 1T6VN 3NA4A 1KLUB 3LIZL 3OZ9L 5FXCH 1JPSH 2ZUQB 1BM3H 5I77A 2W62A 5ICXA 4PMYA 3EMZA 1RZ7L 5EO9A 5M7QA 4FLSA 1DQML 1WT5A 2JTDA 1UZ1A 1DBJH 3FQTA 3HNSH 4MDPA 3SDYH 3CDYA 1KCRL 4O58L 4URTB 4GAYA 3T0DA 3DRQB 1QPKA 3VD3A 4WW2B 5D96C 5BS0B 2DD8H 5D9PA 1BOGB 4XZUA 2J75A 4I3RL 2W65A 3BZ4B 5ID0B 2COQA 5KSUB 2YLAA 1UWRA 4NO5B 1W3JA 4HD9A 3FZUD 1A6VH 3I02B 4NQDE 4DVBA 4HH9B 3RZCD 1DSFL 5JW4M 5L6YH 1D5MA 5FYKD 4K3DL 2QF8A 3MLSH 4HS6A 2J7GA 1F11A 2ARJA 3WFCL 4V2XA 2X4NA 5C0EA 2AS5M 2R2HA 1MCBA 4R4BB 3CHCA 1NCUA 4DUWA 2XPGB 5C0CD 3PZUA 4OKDA 5E0QA 5ELIA 5GPRA 2J8UA 3V6ZB 4JFZH 5I66A 5F72S 2NY5L 4JFEB 4LSTL 3EOTL 4C54A 1TVPA 5A8OA 1EAPA 4UILH 1GGYA 4NQDD 1WAWA 1H15B 1G01A 4OF6A 1M7DB 3OSKA 5J06A 1ZAGA 4PRNA 3D18A 1IGTA 4LLQA 3C5SB 3A3HA 3GSRA 3ARDA 5FECA 2EDEA 4S1DD 1ZBVA 4JREB 1U93A 4UQAA 4U3HA 3ARZA 2ZX7A 4PJAE 1OSEA 1MQQA 3VIHA 4P59H 4KTYA 3OG6B 2ALWA 5E8OB 2D7MA 4KK9D 5E2VH 3U2SB 2GEEA 4W87A 3VRLF 2DN7A 2J7EA 4ZFOB 4PY7B 2HT3C 4WDIA 5F96L 5LQBL 2C3VA 4KK5D 4TSCH 3V52H 3B2VH 1BAFH 1WICA 1FA2A 4KDTA 1ZGLA 1AQMA 3CSBA 4PRIE 1NEUA 2DKUA 2XTJD 3NACH 2V2WB 4NM4H 3QYCA 1OAUL 3G5VA 2I60L 5I1AA 1JBJA 4HBQA 5MI0C 5IB2A 1QSFD 1Z9MA 4H25B 4IRSD 4RMUA 4QRPE 3BSGA 1R7OA 2F5AL 3TO4B 5EMYA 3DX0A 3VGBA 1UZ8B 4PRDA 2J8UB 3H3KA 2H8PB 4WU7A 5CILL 4IM8A 2VQTA 1Q6CA 2IPUG 2DEPA 4FNLH 4OM0L 4MCZA 4TOYH 4CU6A 4F57H 1EBAA 3PL6B 3BP7B 4MWFB 3WFEH 2W60B 4M4RA 4GMTH 2O5ZH 1B3JA 3VG9B 5CZVL 3VFTA 2QR0A 4PV8A 1S9VA 2IMMA 5C6TH 3OKEB 5CSZB 1KB9J 3TBSB 4NQDA 3AMLA 3GGWA 3AXXA 4DWSA 1WBYA 2BSTA 1E4XH 1RZFL 3LD8B 5I8CB 5T1KB 2P42B 1A1NA 2ATPA 5TPWH 3AIVA 3IFNH 3LKQB 1E56A 1R5WB 1C12A 1K9FA 4FZEL 1TG7A 1HILA 4XVSH 4S3JA 3WQ8A 2R0ZL 3AMCA 2XVPA 4OKVA 5DJAA 1JDDA 4K7PY 4LPCA 4QGTA 5DQ9B 5EN2B 1IFHH 2D20A 1Y0LA 3BAXA 1LL6A 4P5MA 1PZ5B 2OQJA 1F4WL 4JZOB 4K9EC 3HN3A 4YFEA 4NN6C 3AIBA 5DS8B 2IAMD 4Y16B 1XAUA 2R39A 3C8DA 3MLRH 4MD4A 1MCIA 2X7LA 4XP6L 3MLPA 2GDUA 4LQFL 4N0FB 3BPOC 2X42A 3MBEA 1FCGA 1GGIH 4PJ5A 3WBEA 2R1XB 1QSEB 3JXAA 3GSOB 1XF4B 1LF1A 1V6VA 3BT2H 1RUML 1T22B 1J1XH 3GB7A 2WMHA 3ALWA 3M07A 4FQPA 1SEQH 1WBZB 3RM8A 1BZQK 2HKHH 4ZQKB 3C08H 4JM2B 4HULB 3AM8A 3EFDH 4G8IA 4GKZB 1WZ1L 3JV5A 5F8RC 3OAZK 4GW4B 3IFPA 1P7KB 4KJYB 2NX5E 5CBEA 1NWUA 3D3VB 3MRLA 2DKMA 1I1RA 4O2CA 3IDXL 4D71A 1JG9A 4KK8D 3HUJE 2F54D 3CVIH 1Q0YL 4ACZB 4OGAC 5D2LB 5JNYB 2CBVA 3A4XA 3WS3B 3T3PF 3RGVA 5D8JH 4HGKC 2FX9L 4M7LH 4JRXE 4F9DA 3TN0A 2VR9A 5DD1L 1ITXA 4FQ1H 1EJ6A 1T21A 4PJIB 4OD1L 1X9QA 4P5MB 4P7RA 1CF8L 3GIVA 2XN9B 3CVHH 4M7ZB 4NWTH 1O7AA 3S37L 1WDQA 3PHOA 4PRPA 4X98A 3WFZA 2AJYH 1JGLL 3FB7A 2J7FA 2QV2A 2IBZX 1V02E 2G3IA 5E6ID 4MA3B 1ADQL 4YHGA 1DJSA 1RUMH 1INEL 5I1KL 4Y89A 2VLJD 1LK2B 1WDRA 3TNMB 5C0DB 2PYED 4PB0L 3DVNA 4JO4H 2HFGL 2WBKA 1NCBH 4XHQA 1IGFL 1ZA6B 1NGZB 2WVUA 2X4TA 5B39B 4URIA 5IQ9A 3MV9A 2NY7L 4HS3A 1IEHA 2FLRT 1RVFL 2WNWA 1KTDA 2FBJH 1MW1A 5SWSB 5IMLB 1FL6B 2X2JA 2XIBA 2VCCA 1TCMA 1HCFX 5FIEA 2J7DA 3MKKA 3QXDA 3F5LA 1KJ2B 4NN6B 5TJWK 4PGEA 3OXSB 4HKXA 1R3KB 1KSRA 3UTQB 4QLKA 2H26B 3LPFA 1IRAY 2A73A 3QHFH 4ODSL 4YX2L 1EEYB 4FQHA 1A3RL 3K4DA 5EC1A 5C8JB 3VD7A 3MRBA 1WEJL 4FNSA 3O3AA 3SO3C 4OLZH 1RJLB 1AD0A 5D5ME 1QX1A 1CGSL 5D1ZD 2CSPA 1RZIB 4YFLI 2J8FA 1Q6FA 1CG9B 3LSOA 3MQIA 3OKDA 3MJ6A 4JM2F 2W9DH 3R1GH 4GG8B 4Q6IB 2DWEB 4TTUA 5I76B 1IGJB 4KKBC 3WLBA 2WCAA 3HCVA 3QB7C 4LOUD 5CINH 4XNQA 1MAMH 3MV11 1I7RB 4R96A 4GZJA 3BUIA 3ZE1E 1MNUL 5C3TA 3ARQA 2B1HL 1CQKA 5C9KA 1Q6DA 3EGSB 3BAYA 2Z92B 1KTDB 2UV3A 5FDWB 3CUPA 3IU4L 4QCIB 4M3KB 3UBXA 3DHJA 1OB1A 2NZIA 4WKFA 3I2CH 1R0AL 4CMMA 5JHLL 4ELMB 3LPWA 5IFJB 1WCBB 5IFHL 5CD3A 4P3CH 2Q8BL 4G8GA 2AJUL 3LS4L 2BY1A 5CSUA 1BBJB 3OBAA 2YEZB 4B7LA 4PJDA 2QMKA 1INQA 5E95B 3QNZA 3CZJA 1DQDL 2EEAA 5DO2C 3AISA 4F66A 4JEGB 5HI3D 5GS0C 4U6YA 4PP1D 4ZS7L 4K7FA 3MANA 2IF7A 3RJXA 2YC1A 5FO9B 3AAZA 3WKMH 3MI6A 1MCFA 1TCRA 3O6FA 4FFZL 1NUGA 3RDTD 2OZ4A 3AHVA 3D2UD 2ZCKL 7FABL 1X6LA 4R2GC 5JOFA 3PQYA 1WFOA 2VDPL 4JFXA 1RH9A 1CFSB 2FCBA 3NDZA 4I0PC 1TPXC 4P7QA 3GNML 3N1GC 1MJ8L 1ISXA 1YY8B 3X13A 4NZTL 1UWXK 2GCYA 5BXRA 3OKLB 4J27A 1SYVA 5FDWA 1AGCB 5JHLH 3N1AA 4R4ND 5DT7A 2D03H 4PBXA 4W68A 1NDMB 4CRPA 1WAAF 1FL3A 3SGDH 4WHCA 3BEVB 2OMBA 4UOJA 1S9XA 1HKJA 4X5XA 3STLB 5DUBA 2VITA 4OF0A 1UD4A 5CP3A 2LFGA 5A3ID 4JHAL 4XT1C 4PJ8D 3RJDA 2YDRA 4ZDHA 5IHUH 2X05A 2VZ3A 3A6OA 4MS8D 4ETQA 5FO7A 3MLWH 2DM4A 4N9GA 3GXIA 3G04A 1T0NB 4O2FB 1KPVB 2UY2A 4NN7C 5J11C 4TNWK 1D6EA 3KYKL 1JHKL 4LGRB 2JLLA 3QO0B 1KPUB 5B38A 1JNDA 2E7CA 5JW3L 3VFNB 5MHSD 1N0XL 5CPSA 3IJYA 1BQHB 5JOFB 2LTQB 2YPVL 5HPMA 4YDLC 4K94C 1FVDA 3WIHL 3CUJA 1T1ZB 3QIWA 3ZDYE 1UWTA 4FQCL 4UDUA 3CZGA 1YNKL 4QOKD 2W0KA 2YFNA 2B4CC 3KPSA 5FOJA 4U31A 2AXGB 5TGBA 4JM4H 3TVMD 4F79A 4KUCF 4NO0B 1ZLUH 3IJSB 3KG5A 2B4CL 2Z91A 2VISA 3P40A 5JIHA 3WHXB 1DP0A 2BVQB 1OW0A 3WQ5A 3TM6A 4RIRA 5C71A 5C7XL 4HUWA 2JJTA 2WLZA 3TBWA 1EO7A 3QXAB 5T5FL 3BEWA 4TQEL 3VE0B 3NFPA 3P4OB 4EXKA 2E5EA 4HG4J 1OSZB 4PTVA 1RIVH 2F58H 4QLLA 2FH6A 1J8HB 4LSUH 1QI4A 4RL3A 3UC0H 3S5LB 4G6AD 3O6FC 3P73A 4L8CA 1ZS2A 5ENWA 4LLMB 3Q0HA 1XFPA 1UR0A 2YZ8A 5C07B 1CDJA 4MD5B 1QNZH 1N0XH 1WO2A 2HVKB 5IMOB 3G6MA 4ORZC 3AIUA 4WO4A 3EBVA 5C08B 4JN1H 1GZPB 4R7NB 5EOQL 5B4MC 1AH1A 3VGHA 2YSSB 3PZTA 4N0UA 5HPMB 2DOCA 1RZKH 4NKMA 3IDYB 4HU8A 4N0RA 1BQUA 3E1F1 3BP4A 3FO1B 4WWKB 2V7HB 1U30A 1MQRA 1BIIB 5K9OA 2WUBL 1Z2KA 3PTQA 4GAYB 4ORGB 5FGBA 3HG2A 4WW2A 2VDOL 3HG1A 3O2VH 3N06B 1JWUA 5T5FH 1LL7A 4Y2OA 1FNGB 4ZXBB 3OJMB 3WV0A 3CV5A 1C5BL 2I26N 4JREC 4JG0L 3KPMA 4A3YA 1MFDH 3OHXB 3BAWA 3T3ME 2UY4A 1K6QL 1S46A 4DKDC 4AIEA 1IQWL 3CAFA 5DVKA 3FN0L 4DO4A 3D9AL 4IRZL 1TVNA 3B5GA 2CK0H 1F11B 3SY0A 3MV8D 2YN5A 4E42B 2NXZD 3U7YL 2X4NB 1KB3A 1MVYA 2GJPA 1A1MB 4YHZL 4PJEF 2V2TB 1OB0A 3L6FA 4J6RL 4HK0B 2KZWA 1GZPA 2E8ZA 3O6KH 1TJHH 4Y4FB 4PJCE 2V7NB 1TA3A 3NZ8A 3MBXL 4D72A 2ZUVA 4F7TA 1ZT1B 2F54B 5IJKC 1BIHA 4HCRL 2VKWA 1NCNA 1QOXA 4G9DA 3TBVA 2D7TH 4ZO7A 3VXQB 2R15A 4DW2L 3D39D 1QBML 1KXHA 5DD3L 4N5ED 4FNTA 4POZC 1A3QA 1CFTA 3NCYP 4X7CC 1JV5A 4PCTA 4YXKH 5FYKL 3BGFB 2GITB 1LE9B 1ZHLB 3TTOA 1N5AA 2VLLB 3D39A 1MCRA 3NCCB 4CN4A 5E8OA 4PJFF 4OI8A 1MCNA 1NM9A 1AI1L 3HG5A 5E2WH 5A95A 4XNUH 3QAZC 4OIFA 3SQOH 3MYZA 5EUOB 4EBQH 1S7WA 3BWAB 3R8QA 1HKIA 3BOVA 1XSIA 1S7VA 4EJ1C 5K9KB 3UCQA 5I0DA 3RUGA 5H2BA 5CCKL 4LIQE 5DEZA 5BV7H 2GIYA 3PABA 3LN5B 3MJ8B 1UR8A 2LV4A 3QHZH 2D3NA 5IG7B 1AGDB 3POHA 3ROOB 4M3JA 4UCFA 3BHBA 2DH3A 4AH2B 1TVBA 4WI6A 4HHAA 3WDPP 1GGBL 2RFXB 4ML4A 3E2HC 1GPOH 1HKFA 4PTMA 1A7PL 4JFHE 3W0WE 2V7NA 1TA3B 2UUDH 3MLYL 3HAEA 3S96A 5C6TL 4K3GA 4RFNC 4I0PA 5SWSD 1OINA 1CTOA 2Z31B 4S1SL 4Z76B 3UAJD 5BS0E 3SCWA 1QLEL 1S9VB 3MR9A 1RZFH 4D3CL 3V6FB 4ODUB 1Q8MA 4HAGA 4JFYB 5FOBA 3PJSA 5EU5B 4ZUWB 1OP5K 2YRZA 1A6WH 2VABB 3WN5C 3ZZ1A 3J7HA 3P4LA 1NANH 3WIFA 3I9GH 3EBAA 4LSPL 2XYCA 1P7HL 4XCNA 5EUOA 1BLNB 2BC4A 4M9OA 5KVMC 3WH7A 1QUNA 4GQ9L 2VDNH 1MFUA 1YA5A 3VI4F 3IAGC 4HFWA 4HV8B 1XIWD 3BDXA 5EIVA 1UC6A 1GZJA 4RFOH 1UENA 2JJTC 5LCVH 4XBEL 5HYSG 5D8JL 2AXFA 1GPOL 1I8IA 4GKSB 1JRHH 4D9LH 4PMOA 2QQLL 4AG4L 1ACZA 3UPRA 3M1BB 3WENA 1DTUA 3VG0L 1YEJL 2BXYA 1JZ3A 1KFAL 5SX5H 5C92A 3MUZ1 4MZ3A 1NCTA 2VXVL 3HJEA 2XQYG 3BAJA 3IXTB 3NIFF 2AJYL 1KEML 1JGLH 4MNLA 3PV6A 4H7VA 4XVTH 4BKLA 3RFZC 5CXPA 2QTEA 15C8L 3VG9C 3T3MF 2AOSA 1VJZA 1ZVSB 4KQ3H 5DRNB 43C9A 5GGRY 4GKZA 7TAAA 4ZPTB 4HLZG 4KK5C 4LSRH 4O2EB 4AMCA 2XRAH 4ZO8A 4B5EA 3CDGA 4DGVH 2CIKA 3OKKA 2EQDA 1JGEA 1PZ3A 1TVDA 1RI8A 2FX9H 2VDNL 4UTBH 4R5EA 4K7PH 2BCKA 2XIIA 2J88H 2CUIA 1T1YB 5AWNH 1H8NA 4WFGD 1GOKA 5CJOL 2NLJA 3CUGA 1UEYA 3SN6N 1WV7T 1E73M 3KYAA 4X0KA 2X70A 1P9MC 1CCZA 3A67L 4JZNB 4KVNH 4CCDA 3Q6FA 4D0CA 4QHNA 4MQXC 2D73A 3GB7B 1EHXA 4LCWA 1H5BB 1UJ3B 2ILLA 4AM0B 1F6FB 3MNVB 4P5TA 3S6CA 4LVNC 3OAUH 3MC0A 3T1FB 3GH4A 3MLUH 1MCDA 3QI9B 2F18A 1SY6A 3VFOA 3N13A 2FYYB 3TPUA 5HGHB 3KXFA 4LVEA 2EZ0D 2EE3A 1MRCL 3CZLA 2R4SL 3VRLE 1PY9A 1NDGA 2ADGB 1ADQA 2WQRA 5HBFA 2BNQA 3L3OB 5F7EH 1B88A 3VDCA 2QMJA 1DBAH 1EGJA 4O2EA 2VXSL 4YHIB 4QXTA 4BQ8A 1C1EH 4D0DA 4OGYH 1DBML 2HJLA 2BNQD 1NBYB 4WENB 1CE1L 3GBLA 4OJFH 2BCKB 3AY4C 4RAHA 2FL5B 4DGYL 5BRPA 2W92A 1JGIA 2D0GA 3IGAB 2NY4D 3BVNA 1MHEB 1VRXA 1KIPB 3EJQA 1FVCB 4W4NA 3VWJC 3C60A 1NOWA 4X6BA 2JFEX 1U8OB 2ICWB 1FCCA 2CO6B 1BVKB 3WQWA 1FYTE 3QGVA 3I6KA 4BSJA 1Q1JL 1A6ZB 1XGUB 2CKNA 5ABHA 2AJUH 2BVOB 2OYKA 2EDKA 3DHMA 4JPVH 5DTFB 1BVLB 3FQNA 1RMFL 3FOMB 2VLRA 1E4WL 2XZAL 3K3QA 3DX6B 3GH5A 3KPOA 2J6EA 1XCXA 6FABH 2CRZA 4FP8H 4WV1B 4PGDB 1HHKA 3B8YA 1DBAL 4LNRB 5JMRA 2VXSH 3KLSA 3UTTB 3WKML 4N42A 3FL7A 3MUHL 4DN4H 2BVUA 1CICD 4R0LA 3MACH 4JKPL 4Y4HD 4YHIA 2P5WE 3HZYA 4X7DC 1F97A 1H49A 5D4YA 3U46B 4ZMAT 3BSZH 1UA7A 4AMWA 2DMKA 2GFTA 1X5HA 3SE3C 2CLZB 3LHPL 1S7QA 4EDXB 5JMOC 4MJ2A 4HUXB 2Q8BH 1C90A 2GT9A 4NQVB 2D1ZA 2XZCL 3W25A 1HYSC 5FM4A 4I4WB 4HH9A 3DYPA 4QRPD 2V5RA 4DWSC 4AENA 2E9WA 4Z2LA 3QCUH 1G0CA 3LVEA 4HWBL 2BV9A 3TBYB 1XT5A 1BHGA 3I6KB 3MNZB 3HZKB 3N0PB 5I76A 5GGQL 1P84J 5IOPA 4JAMA 5L2KB 2V5TA 4ZFGH 2UYLA 1BFOA 2YUXA 5HNNA 3B6SA 5FKAB 4TUFA 4LPUA 5F1KC 1EHLL 5GRUH 3NUKA 4TXEA 1ZGLB 4W70A 5GIRB 3TFKD 4LSSH 4QRUA 3DMMB 4XH2B 3INUH 3HE7D 1M7DA 3SDCC 2N56A 1ZV5A 3RL1A 5AD0A 1UHVA 4WY7H 1I8KA 1T0MA 3MACL 5IHZB 3PZ9A 1UZ8A 4RMVA 1KB5B 4WU7B 2HA1A 5GS2H 4RQQB 3T2NH 4Q6IC 5CGMA 1PKQE 2X0HA 5JXED 3F58L 4HIXH 4DVRH 3C6LA 1TQCB 4U1NA 1R5VA 3OKOB 4GQQA 1YC8A 3QNZB 1P4IL 2EPLX 1W72H 3EOBB 3VFTB 2CLZA 3Q3GB 4P5TC 4FQCH 2F9BT 5M5DA 3O45A 2DT2A 4LCUA 3MRDB 3AHXA 1J18A 4LVHB 1RZJC 4I0PD 5I8CA 2VN7A 4BH8B 1TCRB 1NP0A 3IJ8A 5A6LA 3BC9A 4XAWH 3ARDC 4FXGA 3BQUB 3ZDZF 1US3A 3G04B 1JHKH 2NZ9D 1YMHB 2YHGA 3W2DL 3UTSE 5JW4R 1R3HB 3S2CA 1F3DH 3EHBD 4G42B 1DQLL 1ZHNA 3L3KA 5E5RB 1BBDH 1R3LB 1Q9LA 3U83A 4P2OB 5DJDA 5JUEH 4M93C 5C0CB 3MREA 4M24A 4LEXL 4D8PA 5DJYB 1MUJB 1UZ4A 5F6IC 3C5ZC 1P6AB 2LQRA 3BQUD 4KPHL 5D7SH 5C0AD 2WSKA 2W38A 2ZWZA 1ETZA 4Q9BA 4R2GB 3WL1A 2VIRB 5C6PB 3RVWC 4XMPH 1X5JA 2DQFA 1XIWC 1TTUA 4X6CB 4IHOA 3WL0A 3BE1L 1R5VB 2GQHA 3K4ZA 4ONHA 3VIIA 2VDKL 4NRXB 1KT2B 1JWSA 2BNQE 4S11A 4X5WB 5D93B 4ZUVA 5ESQA 3GKWH 2VKXA 4WW1B 3GK8L 5DJ8B 3HNTH 1KLFA 3VGDA 3NCYS 1QFWM 2E9JA 3NFPB 1IC4L 5B38B 5ANME 3AMDA 2R69L 3IFPB 4GW4A 5HJ3B 1CICA 5C6WH 2HMID 4LYRA 4P46A 5SWQB 4YHKH 3LEYL 4O9HH 2IGFH 3REVA 1KCLA 1T1ZA 4PJ7F 1HKKA 3ILPB 4YXLH 6CGTA 2WWCA 4N0FA 1BFVH 1TZGL 1MUJA 1TQCC 5A8PA 4N0UB 2K7QA 5T3XH 2X4RB 1AXTH 1GGTA 4NKMB 5CGYD 5ADPH 5A2LH 4EN3A 3MOBH 1T22A 5DD0H 5JO5A 4TYUA 3AS3A 3MBXH 5CWSA 5BRQA 1EX0A 3QCVH 2VX7A 1U8LA 4WU5A 1EO8H 1OGTA 2EPOA 3C60D 5DD6B 4TX8A 2X09A 4LSDA 1QBMH 3CPLA 1KCSH 1OAKH 4M1GH 5IFPA 1VKXB 1IGYB 2WVTA 4K7PX 5D2LA 1KWGA 4L8SA 2XZQH 2KPNA 1FVEB 2IAMB 2P24A 5LAXB 1JXKA 3B9EA 1A8JH 3AMKA 3SDYL 4YC2B 2IWGA 3RIFK 1OAYH 2GSIA 4BQ4A 4OTXL 2FRGP 4KMLB 5ID1A 5SWSA 5CMAB 5IMLA 1E5NA 5FGSA 1MFNA 3ZE0E 2YMXL 1Z3GL 5TF1H 5EBMB 3QUZD 4M1CD 3VXME 4N8PA 5BZDB 4HA3A 5E00A 1CI5A 4K3DH 3UTQA 3WE6A 4M8QA 2EAEA 2FDBP 2Y1VA 5DD3H 3QUMB 2B20A 1LWJA 1JWUB 4PUEA 3VFVB 1EO8L 3O81A 5KAQF 3G5YB 4ZEPA 4LCCA 3BP6A 2NY4C 1AGEB 2EIZA 2H2SC 2BX5A 2E6JA 2HG5A 3NTCH 2X4UA 2VLLA 1I3UA 3LSOB 3CO4A 5C0BB 4PY8J 4D6FA 3P3YA 2FGWH 5BRZA 3SQOL 1ERNA 3RM4A 3WY4A 3CMOL 3AGVA 4OI7A 4JQVC 2GJZA 4GKNB 1JGUH 4NQEE 1S7WB 4M8VA 2O9OA 3EW3B 1H8OA 1EQPA 4UV4L 2CLVB 2LVCA 1GGCL 4KV5E 2DJ4A 5E9DD 1U8MB 1XCQA 1J1OL 3LMJH 3GRWH 4TUKH 4WI2A 3LN5A 5IVZA 1GJUA 4LPYA 3N85L 1CECA 5AC4A 3SJVA 3KNBB 1R6VA 5CZKA 5I73B 4IJ3C 2NXYC 3W26A 4OIAA 5GS3A 3SOBH 1MJUL 1QRKA 2DJSA 5BVJA 3FMGL 4HJ0C 5FAAA 1MREL 1M01A 3RY6A 5CEZD 1HHHA 4UQEA 4PJ9C 2EE6A 2JF6A 1QLEH 2VZ1A 2X9YA 1MFEH 2XGBA 2Z35B 3O8XD 4JDTH 1YJDL 4GG8A 4Q6IA 3NCOA 2OL3H 3JTSA 3W38A 2JCCA 3EOAB 5I71B 2EIZB 1EOMA 3AVEA 2WZHA 3WO4C 3O2DA 1W3KA 4V2CB 1BD2D 4C4KT 2VT0A 1W0VA 5CEZH 2YC1B 2A6JA 2VMFA 3GM8A 1HXYA 4BS0A 3PABB 2PYEB 4W88A 3BKYH 4K8RH 2AQ3A 3MA9L 4KQ3L 2D22A 1MELA 1UXWA 2R0LL 5EOCJ 3EDJA 3ORJA 5IBUG 1YDPB 3FB6B 4ZFFA 5A6KA 1V7ML 2OP4H 4RFEB 4Q9QL 2WIIB 1SHMA 1U8MA 1XCQB 1TQTA 1I1AD 4L3AA 1Z6JT 4Y7MA 1E6NA 2R4RL 1FDLL 4FFVC 3SJVB 4JRYB 1JF6A 1QNQA 4NKOB 3QJHA 3MR9B 3I6LE 5ACLA 5CJOH 1JPST 1FFRA 4U1JA 1ZMYA 4DTGH 5DSCA 1LEIB 3TJHC 2J5LC 3U0PA 3S9DB 1LK3H 1F42A 4N1HB 5KOVC 4DKAA 3GMQB 2VITB 3IRZA 4FXLA 2DQJL 4WF7A 1KIQA 2PYFB 1MRFL 4GRWF 4U1MB 1N3NB 4YNYB 4U7MA 2BHZA 5F96H 4PJEE 5JORA 5LQBH 5F88A 3D85B 4JPIA 1SEQL 4H88H 2D31B 1AP2A 4HEPG 1RUPL 4KTEL 1IEBB 2CPUA 4OZFB 3CZ8A 1QA9B 4MA7H 4KZDL 4MAYC 4JGMA 1J88A 2P48B 2YD7A 3PUCA 1GH7A 1FGVL 2NW2B 5TQ2H 2WAGA 3LXCA 2VR5A 1T03H 5F9DC 3CH1B 3AY4A 4IMLB 3MPCA 3BRGC 3HI5H 1QWUA 2F74A 1PSKL 3BX7C 4FQ1L 4ELKA 1BPLB 3X12A 4A4AA 3T1WA 1XGQA 1M71A 4X9FA 2AABL 1Q9OA 5KSBB 1E9LA 4N5EC 1E6RA 4BQ5A 3RL2A 1UJ3A 2DLEA 4ZPVB 5H94A 43C9B 2OCFD 3BAEL 1ZT7B 3VXMA 5FO8A 2VLKD 1YHTA 4LRIC 4AZBA 2EDNA 1OLZA 1INDH 4HKZB 4JFFD 5JXAL 4PIRF 2WBGA 4XVUC 3TTQA 3OG2A 5DMKA 1QKZH 3FKUS 4KMQA 4NSKA 1T1YA 4MSWA 4P2QA 3RZCC 5TFSH 3QG7H 5ENWB 3EZ8A 3LN9A 1SY6L 5MHSE 3RDTB 1ADQH 1H4PA 4BSWA 4OZFG 3GNRA 3JTTB 1EMTL 1IGCL 4IEFB 4B41A 1EFXD 4JZNA 1FC1A 1E0VA 1MEXH 1SYTA 1JHTB 5DR5H 1HJSA 1D6VL 1ZEAH 3C6SB 4XNXL 5I1GL 1A7RH 2AABH 1V6WA 4MJIE 1R86A 4G80B 2FEDD 4HIHA 2WWMD 4M80A 5DVOA 1CL7L 2K1MA 5LGJB 5J57B 3AZRA 2PCPB 1ZLSH 4DN3L 2QHRH 1CDBA 3WNOA 1SMDA 3QHMA 5AZEL 4BELD 2CXKA 4GKLA 5KSAD 2V6HA 1KJ3H 3LKPB 3QDJB 4WJ5A 4R9HA 4JFVA 4FP8L 3DX6A 1NCDL 2WINB 4LVNB 5EO1A 3R1GL 4M00A 3WXVH 5FHBL 2OLHA 4PMNA 4EUPA 4ELME 3RGVD 3EIFA 1EHLH 3DC0A 3P0GB 1EFXA 5F9AC 2D2OA 1IKNA 1D5IH 3DMMC 1NCCL 4OCRL 4K2UH 3VFSB 1U8OA 5D9NA 1F4HA 4LP4A 1VFOA 1HSAB 3MJ7B 3MRMB 3QQNA 4YBQC 5IHLB 4W6YB 1J8HD 3AXIA 5I19L 4XPGL 2G3MA 4NZDA 1MFAL 1TNNA 2X8RA 4L5FL 2MHAB 2WMKA 2OSLB 1I1AC 4WHTA 4GW5B 4K23L 1CFNA 1OY3B 3WEZA 1IAIH 1UD3A 4JDZB 1TFVA 4GRWE 3TBYA 1XSJA 1HH9B 4ZS6D 1AQKH 2VDQL 5FYLH 5ESVA 4NDMB 1XH2A 3WDHA 3DIFA 2R23A 1FAIH 4HXAH 4NN5C 4PY8I 4N0CD 2XN1A 3T3PE 3I6GB 2LAAA 1XR9A 3UDWA 3ULUF 5FHBH 2NYYC 5EBWB 2W0PA 3L5WB 3SDAB 3RL1B 4H20L 1QRNB 3P2TA 3MMEA 1NFDF 2DIJA 1TJIH 1Y6MR 4XPFH 1RJYB 1JPGA 4ZXBD 4ZS7H 2JALA 2IFGA 1DVFC 3BN3B 3NMEA 3OKYA 4YHNB 2PW2A 5SWSE 4AZ7A 2RFXA 5ABFB 2DYPD 5IP4A 5IVXF 3UX9B 4QTIH 3QIBA 1W9VA 4L5FH 2ED8A 3G6JB 4HQQL 5D1ZB 4UB0L 5EFIA 5D1QC 1OD9A 2IPTL 3HE7B 3ULVE 2MHAA 3KJ4B 3MV9D 4W81A 4LK4A 5KSUA 4HWEL 3KPLA 2YUWA 4GW5A 3P4NB 4MCYB 1D5MB 2DM3A 1BGAA 1V6YA 5C0BE 2FX8L 4H41A 4LRNL 2HH0H 1FRGL 3I50L 2ZG1A 3OPZL 3EAKA 1WWWX 1U8QB 5D7KD 4KJWC 3MUIA 1N82A 3X3GL 5CINL 5HDQH 3MRNA 2GJ6B 4PPTA 2NY6B 2Y5TA 2ZPKH 3GBNH 1RURH 4JJHA 4D1JA 5ADOH 3KPPA 4HV8A 5BCAA 4IM4A 4PBGA 4LAQH 2WWDA 3S96B 2IFFH 1IM3B 4UT7H 3GMNB 3VGFA 5GJTH 3C5SA 1IGIL 4NO2A 4YHLL 2O93L 1PEWA 2ICEA 4MX7B 5F9JA 3V6BR 1VCAA 1B90A 4ATLA 2I9TB 4ODXA 2W63A 3LS4H 5CEYB 3FO9A 5D5MA 5E7FA 4HPGA 3L3HB 1GC1H 3D3VE 3MZTA 1LNUB 3CPUA 3RKPA 3G6JA 5C0EB 3ARFD 2ZUNA 1AY1H 5DJ2A 3HPJB 1M03A 3G08B 4A6YB 4Z78B 3SCVA 1ND0A 4X4ME 3WD4A 5A6AA 4IIQC 4WDIB 4OV6F 5E9AA 1F6AB 1LO5B 4RISH 4GAGH 1T0OA 2X41A 4DQOH 3ZYIA 1U8NB 4I18A 4MQ7A 2W5FA 3O9WB 5CS7A 3AB0C 3JWDC 3ZL4L 2CDGB 4JM4L 3TVMA 3ZR5A 4DFHA 4CDGC 3TO4A 3ARDB 5FECB 3BESR 4GKOA 1WBXA 5AZ2L 5D7IA 4QOKA 4FFVD 1HXKA 3E8UH 1DWIM 3GO1L 3RVXC 1AD9A 2DQFB 4LGPB 4L9LC 2PO6B 4X6CA 3WY1A 5JBDA 5GJTL 3MYJA 5D2NE 5KANG 3SPVB 3VX0A 4P8VA 2WXDM 5ADPL 4PRAB 4PS4H 7CGTA 1VEPA 1RZKL 1HI6A 4X7TB 3MO1A 3FT2B 4EN3B 3LQAL 4BKLB 3O6AA 3HE7C 3QNXA 1KC5L 4R4FL 2F7PA 4W6XB 2PWEA 3ESVF 4JHAH 3QEQB 3QI9A 3MGOB 2BY2A 1ZL1A 1ZB5A 4A6YA 1US2A 5F1NA 1A02N 3PNWB 3A6CL 5FYKU 2Z8WC 1BM3L 5J7CC 1G9ML 2ZNWA 3ZHDA 1MCOL 4NQUA 2P24B 5LAXA 1DBKL 3VM5A 4F7MA 4NQEA 3O9WA 1L6ZA 4X0KB 1JGUL 4QAWA 2QQNH 3CZFB 2YPVH 3HR6A 1VGEH 4E8CA 3ZDXE 2VDOH 1H11A 1MF2H 3OKEA 4HUUB 1M4KA 1QNOA 1ED3B 3BO8A 3OLIA 1MCWM 5T5NF 4ZUTB 4J6RH 5TD4A 4WI5A 1AD9B 4M02A 1A1OA 2XACC 5HGDA 4JY6B 1UWGL 4WEUD 3RVWD 4HPYH 4PYHA 3VXOA 4XRCA 2VVNA 4PRIB 1MVUA 3WF2A 2X4QB 1RJCA 1FZKB 3VKKA 3LIZH 2W07A 4D6CA 4HA4A 4Q9RH 2A1WH 1CWYA 4LEOB 5J9PA 2OBGA 4X8JB 4ZTOH 2GK0B 2B1AL 3T0EE 4Z7UE 2V3FA 1RU9H 3GRWA 4A2MA 4XVJL 4IUGA 1JZ8A 5JHDA 3IAPA 2YR3A 4XCFL 4BA0A 3RJYA 2UZIH 4PN2A 2P5ED 1FV1B 5JDSB 3BRFA 1HEZB 1CLOH 1JPFA 3TFKC 3UR7A 3VUPA 2FL5A 3QPXL 4CADA 5KSAC 1DE4A 3N11A 1SR0A 1DLFL 1G7PB 4OD2A 4JZJC 4TNWF 3BCDA 1DBBH 2FSEB 3MA9H 2E3VA 2J4GA 1W1YA 1E70M 2XN2A 2YFOA 3F65A 5DQDL 1N6VA 3KNBA 3PHQB 5GISH 4YDKH 2W0FB 2ICES 1ED3A 4G7YL 3WN5B 1BREA 4OCSH 2YD3A 5CBAA 4DO6A 1E28B 1S9WA 4ZYKB 1A21A 2VWEE 3MJ9A 2D4DA 4OZ4B 2J3SA 4PJFE 1L8NA 3PTMA 1UWEL 3UTPD 1IQDB 5DC9B 2GJZB 4PYSA 4WV1A 2CGRL 5E6ZA 4C56A 1OSPH 3DVNB 4OLUL 4HP5A 4P7LA 3WY2A 4W86A 1MY7A 4XCFH 5D71L 1MW0A 4ZFZA 2PKDA 3GI8H 2A6DA 1UWXH 3VO0A 3IANA 5GIRA 2BVTA 4XPAH 1EEZA 4P57A 1MW2A 4H1LB 2YDSA 1UYQA 1SMAA 1Z0MA 4JN2B 4TOYL 3DRTB 1NBVH 2NW3A 1K5NA 3PHOB 4RRPA 4Q7NA 3SDDB 1PX8A 2OTPA 3GSNH 1BMGA 3C09B 4HKXB 3D0VA 4HOZA 3C5ZD 4FQXA 1N59B 2YZ1A 2C3GA 1LD9B 4JRYA 2P5WB 3C6LB 4PLJD 4LPVA 1J5OL 3V0VB 1WZAA 1CFVL 3CXDH 2Q86B 5IJVA 3DUSA 5BS0A 1KJMB 4FZEH 1D5ZA 5GGVH 2KQNA 1PSKH 1IEAB 2KKQA 3PWPD 3HG3A 1QLFA 3CFCL 1FP8A 3BZ4A 2EYTA 5LBSH 1KFAH 4ZYKA 5FCUL 1PQZB 2QKIB 3S88L 3OKDB 1EOKA 3VH8G 2WP3T 3CLEL 3F6LA 1FC2D 1KEMH 4UFMA 1DWHM 3DX3A 3PL6D 2XPGA 3ARSA 3GI8L 4AZCB 4O02L 3U79A 1YDPA 3B2VL 1D3CA 1HDMB 3NAAH 4Y4KC 3V6OA 4QNPF 3UTSA 2A83A 2DQEL 3BWUC 5GNZA 1PDKA 1EEYA 3QHZL 4NNYB 4XP6H 1QSVA 4MD0B 5D9MA 2OLDA 2XM2A 4OOUA 1GOWA 3BPOB 5KW9L 2CD0A 5KZCB 1AD0B 2V3DA 3JBG7 4N8CL 4AY0A 2R1YB 4LCUB 3CHFA 3WKNA 5EBGA 2XFXB 5L9DH 5FGCB 5JIPA 1OOAA 3QUXA 5CLTA 3X12B 4OGZA 1NFIB 3BZFA 5B39G 2JIWA 3U48A 1WZ1H 3VXPA 3S34L 3LEVL 3IDXH 4NRXA 5FYJL 1KJMA 1HHJA 1AIFB 3CH9A 1K3ZA 4U6YB 5IB3A 1WITA 1T7VA 2EEBA 1ZT7A 3VXMB 4AL8H 3ULUC 4JY4B 1ESWA 1QA9A 2DQCH 5TQ0L 3PWUB 2KBGA 2P7TB 3IFNL 1JN6A 1FLRH 3LN4B 3WFBL 1R5IB 4LQFH 5C09A 3DJ9A 3DTXB 1TVHB 4G3YL 5FGRA 1E4LA 2D4FA 5D1QA 1EUUA 4E0RA 2F5BL 1CFQB 3H3PL 5E7BA 3BKCH 3NH7H 3OAUL 3P0VH 3NZHL 2YD6A 1JZ4A 4WTZG 4W6WB 4RAUB 1U8HA 1B0GA 1CE6B 5DHXB 2A6IB 1C5CH 1I3GL 3NFNA 3EDEA 1F4WH 2X4RA 4HLJA 3O41A 4JY5L 3TPKA 3LY6A 2ZX6A 4ZPVA 5H94B 1KN4H 4JVUA 5IESH 3LD8C 5MP6H 5DK3A 5F7EL 2OR8A 1K4CA 3WLWD 1T5WA 1X5KA 4GQPH 1MLBA 1UCBH 3M45A 3VXPB 3BD5A 5HY9B 3REWB 4J4PD 5H35A 3PTKA 5DZLA 3R06B 3H0TB 1DANU 2V9TA 2AK4A 2X10A 3RNKB 3HC3L 3RIAF 1WK0A 4WKAA 2DS4A 2FJHB 5AAMA 5FL0A 5IROA 3RWCA 3EO1B 5B3JF 4X6FA 2C1PA 3ECBA 4YHOH 3LKPA 3QDJA 4WJ5B 2Y2WA 3QEGL 3SUVA 2P47B 5DK0B 4G9FB 4IMKA 1FVEA 4F58H 3ARWA 1KPUA 5FA4A 3KYNB 4H04A 1YEGH 1AGCA 3QSKB 1T04A 3FRPG 1UH3A 3CVIL 1JRHI 4AT6A 5GSRB 4LLWA 1S7UB 1P4BL 2AKRA 2VZOA 4OUEA 1C16B 3POCA 4TUJB 1WEJH 2EXWD 1ZK9A 4J8RB 1NLBH 4X7EC 1I3GH 1UA3A 2YLLA 3IFLL 3RVVD 1HT6A 3S4SG 4R27A 1S7RB 2V5YA 5E4IA 5ERWA 1ULVA 5F1SA 3S35H 3A21A 4XPFL 1CF8H 2JIXB 4DWHA 4M62L 3A23A 4OFIA 2IADA 4JFDA 4OB5H 2PWFA 2AK4E 1AR1D 3MLUL 2WVVA 3BUDA 4S2SB 2FD6L 4PV9B 3RBSA 4F7CA 2MTPA 4JFPA 5TE4H 2WHLA 4YHMH 3ZJ6A 1WIUA 4GRLD 1K4DA 3QIUC 4GFTB 2C1OB 2VRKA 1E4XI 4HC1H 4YX2H 1KCVH 1F4YH 5ID1B 5ESVB 4UQ3A 1HQRA 4UU9A 2NCMA 4JFQA 4MA8H 1CK0H 5IB4B 4PRHB 2C1PB 2EYSA 4JO4L 3BMWA 2DT1A 1AHWC 3QDME 5GRUL 3SUTA 4CNIA 3DGGB 4LRNH 5HI4D 4D0BB 4G6FB 3SCMA 1NPUA 1HOCB 4NBYB 5H37H 4PG9B 5GS2D 3GBML 1MFBL 5C2UB 4DOHB 1R3IH 2I24N 3W4RA 2UZYB 1WAAE 4NFDA 3DYOA 2UVFA 3DECA 1TQBC 2W9DL 5I1JL 1SQ2N 3BP4B 2PW2B 2AJ3B 1MCLA 3QCTH 2OZ4H 4Z95L 2G75A 1BG4A 5I1HL 3FRUB 1U58B 2EE2A 3DBXA 4M62H 4WTXA 4WI9A 4PEEA 2VRQA 2QL1A 2CLRB 5D8WA 3BKJL 4KRNA 2A9MH 3N18A 3DXAD 2HP4A 3CSYA 4Y5XC 3HE6A 1MWAA 1U36A 2CDFA 2HLAB 3RQ3A 4JPVL 4UOW0 4XAKE 5C07A 5EOCL 1XR9B 1W72A 3TIDB 1FGNH 3IDMA 3K1DA 4ONGH 2UWEA 1W9DM 3IVKB 1MFVA 3SY0B 1FSKB 3JV4B 4UT6H 1KXQA 1FJ1B 2DYPB 1UJ3C 1CR9L 3QOMA 1OBAA 1YECL 3ES6B 5DRZA 1SJEA 4APQB 3BISA 2RCSL 5GRWA 4ATDA 3FFCA 1X5GA 5KVFL 5D93C 1V3JA 4G6JL 1T66D 3L7FA 3OIHA 3I3DA 5IIEB 4D0BA 1MHCA 3MUGB 4R7DB 2OL3B 3BIKA 1MJJA 4CVZA 3WNLA 4XBGA 3VXQA 4LSQH 3APGA 2XOTA 3GO1H 1OTSD 2AEPL 1LEGB 3O3AB 2PWDA 3ZR6A 5K59F 1CXKA 1XF5A 2NY3C 4NHCL 3D2UA 5EORH 3UJJL 3Q5YA 3GSNB 2VJXA 3EYFB 3PIQB 1ISWA 5IJKA 4J28A 5I23A 2A77H 4ONGL 1P69B 4Z7WB 3GJFK 1MWAB 1BZ9B 4P99A 4XCCL 3RAJL 3LKNB 3WF1A 4X7FC 4IRJB 5E56A 3KJ4C 4JO3L 3CSPA 1UACH 5C0AB 2CDGA 4RZCB 2XTJC 5FF6A 5IWLC 4NX0A 3RPIA 2L7UA 4MTVA 4XC3H 1S78C 5KVEL 4O4YH 4I3SL 1FHDA 1QI0A 1LEIA 4YDVB 2PO6A 4X80H 1FFOB 1LNUA 1MF2L 2D7NA 2GSGB 2AEPH 5A2JH 5SX4H 1P4IH 4GAJH 5CUSL 4B16A 5FGBC 2YEZA 3ARGB 1ND0B 1FFNB 5H8DA 2D03L 3CFJA 3DHPA 2FE0A 2QSCH 1SJVA 5E8DH 4M6OH 1HWGB 3HU7A 4YPGB 5KTEH 3MRRB 4I18B 4NYLA 1FHGA 1J8HE 3PDDA 1Y0LB 1J9CT 3TA3D 3VXRD 3HHRB 4G6ML 1FYTD 2N4IA 5DQJA 5BQ7A 2K3TA 1AXTL 4LLDA 1F90L 4JRYD 3PNWA 5C70A 4PSRA 2BFVH 1BZ9A 5EZLA 4HAFA 3UTOA 5DD0L 2Y4SA 2NSXA 3AYSA 2ZG2A 5I8KH 1B2WH 5E08H 1CD1B 4UOZA 4JGJA 2HRPH 1KTLB 3KYKH 2XWJB 3G6DL 4EK7A 4ELKB 1YEDA 3KWWB 3O4OB 2OYMA 4WWKC 2FDMA 3DX9A 2VLKA 3ARPA 3SE9H 2HFEB 2AXJA 3MV7B 1M71B 3FT2A 2V17L 4Z2KA 4PJXB 2XZQL 2PN5A 2XA8L 4E4PA 3QDMD 3QEQA 3DX7B 3SGEI 2H9GB 5AYUL 4WHDA 4QO1A 4HKBA 5E09A 4P2RB 4Z7UA 4OTXH 4ACZA 3ULSB 5IKCA 1UKPA 4QCFA 1FZOA 2BVYA 4ZTOL 1K3IA 3VILA 2WBJB 5E8EB 2YMXH 3TO4D 3CC5B 3BPLB 3ZOAA 1NBZA 1YY9D 3QPQD 5B3JE 2XNAA 4PREA 3T8XA 5I2UA 3CU7A 1YYLH 4NQEB 3SDXB 5CGTA 4UIMB 4QXGL 3PN8A 1PGRB 1TJHL 5EC2A 1FP9A 3TEUA 2CJUL 1RIUH 1FNEB 3IDIB 1S78D 1H3WM 3K8KA 3KLHD 5FUOH 1QNZL 4NO3A 3NN8B 1W91A 1VBRA 2ZJSH 3KWWA 2ZG3A 1IQWH 1NC4B 1LK2A 3C8KA 2VZTA 1A7NH 2AXGA 4HWUA 2ZXBA 4KDVA 1GOGA 3B9KA 5C0JB 4XCEB 4CD6A 3VFMA 4I77H 1XHGA 2ED7A 2GY7B 1GOOA 5I75B 5HHOA 4XHJC 2SEBA 4MNGB 1MFEL 2OXGA 4R6UA 1A9EB 3DX4A 1JGEB 4PJBF 4GXPA 4MB1A 3ALFA 2HJKB 2HT3D 1E6ZA 2JB6A 1DE4B 2NY1B 4K3JL 1SBBA 3F12B 4FFYH 1DUYB 3O0RL 5TE6H 5KZ6A 1AC6A 1V5JA 4LSVL 2B31A 2YPLE 5EC2B 3L5WA 1NBYA 1DANT 1HP4A 3BGAA 5IROC 3RTQB 3SKUD 4IPNB 1ITCA 3T0XA 2MANA 1H3PL 4OZGE 3D0VB 4NBZB 1U8KB 4LCWD 4X9BA 4ZUSA 1CFVH 4OZ4A 3DHUA 3TJEL 1ZTXL 5HVGB 1MHPH 3AQUA 3DUUA 2CDEA 5F93C 3QI9D 5JW5A 4JE4B 4LSPH 1XH3B 1U3HA 2ZUYA 4XPTL 4LYQA 5HVWA 2HVJB 2FYVA 3FQNB 3VMNA 2XV6B 1DQMH 5I5RA 1JGVL 1H15A 3HNSL 4K55A 5BZWA 3V5KA 4XX1G 4EEEA 2BSRA 1V02A 3EO9H 4H0GA 1QBLH 4ZAKD 3UBXG 4MQXD 3O0RH 3ZKMD 5IFJA 1S8DB 2VDRL 3BVNB 4YZFF 4FQ2L 4UFJA 2PTTB 3VFPB 4WUUD 1UWIA 5T3ZD 2F19L 3L1OL 4KROD 3SURA 1A6WL 4ODWA 2BNRB 3CFDA 2VB5A 4P3DB 4PJ8A 1DUZA 1AJ7H 4Z7WE 4POZD 4CN6A 2G5BB 5HHVH 2J2ZA 2DL2A 3SCRA 5C0FB 4HTYA 3QO1B 1WE5A 1BVLA 1ZTXH 4HX1B 1WBYB 5GGUB 1LE9A 1PQZA 2I9TA 1ZA3A 4MXVE 2ZICA 4PRWA 4MCYA 5TDPB 4U4BA 3G5VB 3DXAE 5GGVY 5I1AB 3T0WA 3RDTC 3IDGB 4RFOL 4BQBA 2BNRD 4DGVL 5DC0A 4XBEH 1L4IA 4AD0A 2GK1A 5GHWL 2XVLA 3HR5A 2BFGA 2JEPA 2H8PA 1JAKA 4EKJA 3BD4A 2VAAA 3O9NA 2ADFH 4Z2JA 3WFBH 5GS0D 1VESA 2J7CA 5IEKB 2E8YA 2YRLA 4M43H 3F6IA 3CBWA 3HG4A 2DI9A 2CQVA 4XZWA 1FQ9C 3MJ8A 1C5DB 2R0LH 4EI5B 4YXHH 1PEZA 1JD9A 4O51B 2ZCHL 3PDOA 2MQ3A 1RUQL 1S8DA 2DMBA 2ENYA 3GGWB 3QG7L 4N8VB 4D9RD 3SEPA 4AH2A 5IT2L 1OD7A 3H9YA 4QTHB 3VFPA 2EECA 3V4UL 3LH2H 4E5XB 3TH4T 1JYWA 2EXYD 2OI9B 4HS8H 4HMDA 4U1SB 5IB3B 2V2XA 4NCDA 5I1DB 2YWYA 4KGJA 1KBGH 1E27B 4BH8A 2D9CA 2X4SA 1PZUB 3S4SA 5ALCL 5F7FA 3SCPA 4U0RB 1ROWA 1S9YB 2VWEC 2VXVH 4Z7VA 2VUOA 5AC5A 4NI3A 2GK1B 1ORQB 3W5NA 3S5ZA 1MIML 4XCNB 4LKXB 4HZAA 4GMTL 4HEME 5CZVH 4PLJC 3ARYA 5GS1C 5AG9A 3U0TB 2HT4D 1NLDH 3E6HA 3A47A 4F7MB 1CQYA 3JWOH 3MRGB 3V5DA 2YPLD 4P9MH 5DJYA 1P4BH 4FQLL 2R1XA 1DBJL 3IJSA 1EJOH 3Q3GA 3DI2B 5CJXC 5IFAH 1ZVHA 5HD8C 1AHWB 4JHZA 2XQYK 3A6BL 3NDYA 3HI5L 3BO8B 2ENSA 3ELAT 4KHTH 1Y6NR 2O9PA 5A2IH 2P8MB 1RP8A 3KEHA 4K2UL 1UUQA 2DTMH 3MMWA 5HY9A 2DI8A 2HFGH 1NCDH 3NCBB 5EZOL 4FXGB 2Q8AH 3CDCA 2FHFA 4WI8A 5J3HD 1C1EL 3FONA 1J0IA 5T3XD 4NQCE 3GSWA 1HH6B 3EJYD 2J8GA 3CHDA 3O2LA 1EH9A 3ABZA 3DSNA 4WV1C 3EJPA 1OCQA 1E5JA 2W66A 3N1QC 3WXWL 4NJAL 2AQ2A 5F7WC 2ZE0A 2H32B 4H8WL 4NFBA 3QEUA 2C1OA 5E6IA 4FOMA 1S9YA 1T0PB 1CK0L 4GBXC 4JFQB 4RMSA 1KCUH 3TZVC 1RK0A 4GRMB 4MNQB 3ZMRA 3GXPA 1VPOH 3H42H 1J0JA 3UETA 4JG1L 1FFPA 4JHOA 2EDLA 5GGRA 4HZ6A 1S7RA 4MQSB 5IFAL 3V5DB 1I1XA 4G9FE 1KLGB 2LAGB 1UXSA 2A73B 1AQKL 3LRLA 4YBHA 4PD4J 2F7RA 4R8WH 1ZHBB 4U1GB 2Q6WA 1A3HA 3L4UA 2J8UE 1U0QA 2YK1L 2DF3A 5A6JA 4KUZH 3PZOA 2GUOB 4X9YA 1TTGA 5DD6A 5C0ND 3GIZH 1L9NA 2IQAA 3DSFH 3QUML 4JFWA 2A9ML 1G7HA 1HINH 4LSQL 4MHHI 3BZEB 3VSTA 1MAML 4JKMA 4F80A 5DUMH 2EZ0C 3U4EA 2ZKHH 1VKXA 3FFDA 1XC6A 5JQ6H 2HTKD 1FGNL 3KGRA 4WY7L 1A7BA 3CCHA 5C0GB 4JRXA 5C0IB 3FO0H 4KXZH 2W91A 3KLAA 1K9TA 1U92B 5GRJL 1UYWL 5GRZA 3UYPA 3WXVL 2RCSH 2XA3A 1NBQA 4GRWH 5D72H 3EGSA 3KLHC 2HJLB 3LRHA 1G1YA 4KRLB 2WBJD 5DVLA