1CXLA

Complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q
Total Genus 243
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
243
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 243
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxlA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxlA01
2VXQL 5D96B 4BH8B 2WQRA 1T2XA 3UTQB 4F66A 1AI1H 2ICWA 3OB0K 4KKBC 1NWUA 5D1ZA 5BS0E 1KB5L 1Y6NR 3SJVA 4HKJA 1UYWL 4G42A 1MW0A 5J7CC 3D2UB 4IS6B 5AG9A 2PWEA 1HHJB 4CAGA 2D7NA 4NYLA 1S9WA 5J8OA 3CHDA 1QHPA 4O4YH 3MRRB 4F7CA 1KXTB 3KDMA 2EDXA 3OQ3B 3DC0A 2ZOLA 1F3DH 5D6CA 1DQLH 3D18A 1OWQA 4XZUA 1C7TA 4UV4H 4WFEE 3OR7A 2Z35A 5ACZA 4MD4B 1OGAB 4HUVB 2X4NA 2A1WH 3GHEH 4PJ9B 3WY1A 4L4TD 4NJAH 4W7VA 5DQ9A 5IFPA 3AC0A 1KXHA 3LPGA 3L3KA 4GZIA 2ZSWA 2HVJA 4N8PA 3PL6C 4WI3A 1IKFH 1CBGA 3SUUA 5ISZB 2PYED 2BV9A 2OL3B 1H5BA 1I9IH 5FDWA 3BYTA 3L7EB 1JRHH 3WKMH 4OLXL 3QUMA 4P7RA 3WXWL 3DDGA 4HP5A 1IFHH 4HIXH 1XZ0A 3TBYA 4G6FD 3IGUA 1QLEL 3MLXL 3II1A 4PG2C 4XWGL 1QWUA 5K9OB 2F7QA 1D9KB 4JY5H 2D9QB 1UWGL 4NQCD 3ZT7A 2P5EB 3NBNA 1EMTH 5JQ6H 3BPNB 1PY9A 4LYPA 3DYPA 2HT4D 4P5KB 1Q9OB 4U1NA 4A6YL 3WQ4A 2VABB 3AHXA 1G9EA 3QO1B 3QWRD 4LHUG 4ZYKA 5E95B 3OKMB 3MXWL 3ZKQD 3N04A 43C9B 2EECA 1SYSB 5I1LB 4S11A 3D39E 1J1OL 3OG6B 3QHFL 3QUKB 2VLLB 4HQQL 5D6DA 4CW1A 3PQYB 1LNUA 5IIEA 5ELIA 2IQ9L 4PS4H 5SWSD 2XM2A 3VFSB 3U46A 1Q6DA 5DYOA 1KTRL 4L8BB 3RAJL 3LEYH 1ZT1A 3QIWD 1HCVA 5DUPH 1YEIL 4UNIA 1J8HB 5T3XD 2YS4A 1F97A 1BZ7A 4JAMA 5I1EH 4K8RC 2YN3A 2UUDH 4MQXD 1MVYA 1AMYA 1HHIB 4WO4C 3BAEL 3MMDA 4HCRA 1U8PA 1FC2D 4R97B 2OP4L 5CILL 2ZUSA 1KB5H 2DI7A 1R8LA 5EBLA 3MLWL 2C3VA 1E4WL 1UYWH 1JG9A 3UESA 4D6DA 3ISWA 4OGAD 3GHBL 1Z5LA 3CFJB 3R0MA 4JN2B 3L95B 2NW0A 3C2AL 3SE3C 3KS0J 4UI2A 1WO2A 5HYSG 2NNAB 2MTPA 4BK4A 1R47A 2VCCA 5J6HA 3TN0B 2WWKO 4OQTL 4OCWL 4FXGB 1CLOL 2X4PA 4G8GB 1CDHA 4RFOL 4U6HB 3DRTB 4IMKA 4NZUL 2AVGA 5DJXB 1NAMH 4JFWA 3BP7A 4Z2HA 4WI7A 2WBWB 4Y4HD 2A3HA 1A2YA 3UTSE 3BIBX 3PF2A 3FQTA 5E00B 4XXDB 4OI9A 5D2NA 4PJ8A 1HHKA 2HT3C 4OLXH 3H0TB 3WXWH 4BFIB 5C0CE 1IC1A 1T89C 4BA8A 1M7DA 1QLEH 2J7BA 3MLXH 1BREA 3IU3B 3UTZA 4XWGH 1M7IA 1O5DT 2XACC 4GT7A 3L4XA 2UVFA 3GMQB 5D2LB 1UWGH 2DQFB 1U3JA 2EYSB 2JJVA 2YPKA 1B0WA 5D7JC 3BGFB 3KGRA 3BVXA 3DV4A 5GGTL 5BXTA 1GH7A 4YK4C 1G7LB 5IF0B 2YUZA 4A6YH 4ZAKD 4RSVA 2BVYA 4GMTL 3IF1A 3V52L 4J1UA 1U8MB 4PJXB 1HYSC 3MXWH 3NPZB 3RGVB 3DROA 3QUYD 2YD7A 1M4KA 3AIVA 3K8LA 1XEDA 3MA9L 4KK8D 3F58H 3QHFH 1NKOA 2Q7YA 4HQQH 5T33L 1FNFA 4PRPB 1J10A 2IQ9H 5D7IB 5IHZB 2JJSA 1BBDL 3VA2C 1F4HA 3RAJH 1OSPH 1R33A 4M7JL 1YEIH 1CGXA 3AXIA 4ZDHB 1M05A 2FECL 5D8JL 1GOFA 1S7TB 5KN5A 3EJPA 5DJZA 2GFTA 3RPIB 3GGWB 4ZXOA 3BAEH 5DJAB 1KACB 2OP4H 5CILH 1FO0A 2EEDA 5IWLC 4CD5A 4Y16D 4FMVA 2VJXA 3MLWH 4HXBH 1E4WH 5DD5L 4APQB 3GMRB 1CL7L 3LQAC 1G7MA 3S5LA 4HDIB 2H45A 3H9SD 4XCYB 3GHBH 1EFXA 1C90A 3BKJL 5E8PA 1FLRL 3C2AH 5D1XC 3VXUB 5L2KE 4XPHL 4YQXL 3MLYL 1XGRA 5E1AB 1EXUB 3N9GL 5IROA 4NKIL 1IGFL 4LNRB 4Q6IB 4HC1L 4XBEL 2WMJA 4LDEB 3I2CL 2XN9D 4OQTH 1FVCB 4OCWH 5TH2A 1CDBA 1CLOH 5EZJA 4GW4B 5GGUA 1G9NC 2VL5A 4K94L 4RFOH 3EYUL 1KTLB 2AQ2A 4LX4A 4NZUH 3W0WE 3C8HA 4C7DA 3QI9D 1A6AB 5A2BA 1U8KA 5FA3A 3L4WA 3RNQA 2J7LA 4YNYA 3VG0L 5HPMA 3BH8B 1IM9B 5D2LF 2CETA 4E5XB 3C6LD 5F6HI 4HF5L 5MI0C 2WMIA 2EKSA 3TO4A 2FJGB 5HVHC 3WUWG 2YD8A 5EUOE 3HZMB 4KUCF 3OGSA 2IBZX 4XAKE 4AM0B 1BFOA 4HZ6A 1QRND 3EYPA 4D0DB 1HINL 5GGTH 3FZUD 2FIKB 2NXZB 5A8PA 1MHPL 1EERB 1X5JA 4GMTH 3ILQD 3V52H 3NCYP 1UACL 1WGOA 3BEVB 1HILB 2J5LC 4XZBA 1QZ1A 3DBXB 3FT2B 4M6AA 1E40A 5IW3A 3QOKA 5BS0D 1JNLL 3QG7L 3MA9H 3QXDA 4ZXBB 4Q97A 2KZWA 5I1KL 1JXKA 3S7GA 1VFBB 1IGTB 1P4IL 1G9ML 1UM5L 2V2WB 4GUPA 5TE6L 3UPRA 2JCCE 2KUTA 4PJEF 2ZWZA 1AGDB 3D3VA 1BBDH 5JIKA 4MNQE 4YDLC 1T6WA 4M7JH 4WFED 4TTDC 1XGTB 4DVBA 5D8JH 2NY1D 1YN7A 4XHQA 1FHLA 3SCMC 4NC0B 4PJBE 3IJHB 3TIEB 3LV3B 1G0DA 1YQVL 4DFHA 3U6RA 4JFFE 3H9YA 4RE4A 3PP3K 1WAAF 2VH5L 4NBXB 5DD5H 5EFIB 5HJ3A 2AXGA 1CL7H 3WBDA 3MV7B 2DF3A 4R90L 3BKJH 2W59A 1FLRH 1QNRA 2X4RB 1B0GB 3MLYH 4YQXH 2NY6D 2KBGA 3K7UA 3N9GH 5I1HL 5C8JB 1YNKL 1W9XA 1HHHA 4NKIH 5T3XL 1IGFH 3TBSB 1JPFA 2Y07H 4HC1H 4ELKB 4XBEH 2IC2A 3DI3B 1AHWA 4U5IA 1WDSA 4KK6C 4K94H 1CTOA 2GEEA 3EYUH 3MV8E 4JO3L 5ILTH 3EJUA 3TH2T 3HG2A 1JGLL 4PGBB 1R46A 2XGIA 3IGAB 5L8JB 1INEL 4JFED 2GTZA 4B9YA 3QGVA 2YFNA 1JP5A 3D39D 3BP6A 3PWLB 5DK3A 4LVHC 3VG0H 4MJIB 3IFPB 2FHBA 2DQGL 4HF5H 4YX2L 2D4FA 4LK4A 5FUOL 3VGEA 4KU1A 2R0ZL 1UCBL 4HGWA 3LKPB 5IMOA 4ZPVB 5CJXC 1HINH 1XGPB 2DEPA 1HSAA 4L29B 3DI2B 1XH3B 4X9BA 1NCTA 4DK3A 4S10A 1MHPH 5CP3A 2GITB 4AZCA 2BNUA 1UACH 1UJ3C 5SX4I 1JNLH 3QG7H 1CD8A 2AABL 4AG4L 1AFVL 4XCEA 4F9LC 3VRJB 5I1KH 1V0MA 1P4IH 3RZCB 1UM5H 5TE6H 4FLSA 4DZBA 1Q9WA 2HVKB 4K7PX 3QQ9C 1UXWB 4EJ1C 4JVWA 3DXAA 1NL0L 3V6FA 3WBEA 1EAPA 4ZUVA 1GZPA 5CEYB 4AENB 1X6LA 3JV6B 4JFDE 4L4JA 4N0FA 5KS9E 1M7XA 1OT2A 5T5NF 3WFCL 5I1GL 2ESVB 1LEKA 2EPOA 4F37F 3FQUA 3MXVH 3O3AA 2J8UF 2EDLA 3D50A 1UVQB 3UTSD 1YQVH 3DWTA 1MFNA 5B39A 5ICXB 1DANU 4LCWA 1KV3A 3INUL 2VH5H 2VKWA 5IMMB 3TOPA 1H4PA 3JZ7A 5JBEA 4FNLL 4PJHA 3S5LG 4R90H 4OUOA 3L1OL 2VLRA 5F1NA 3L4UA 4AZ6A 5IEKB 3QDMB 4XCNA 1B4JL 4GSDL 2BMKA 4QHMB 1CBVL 1E6XM 5I1HH 4IJ3B 4AXNA 1YNKH 3GEWB 3PWPB 5T3XH 4K07A 4ZTOL 3S37L 5JR1L 2GJXA 3LRGA 4R9HA 1OIMA 4WI5A 3BO8A 2E27L 4OF6A 1L0XA 1F3JA 4IISA 3IDYB 3NFNB 4JO3H 2HMIC 3UAJD 1CN4A 1JGLH 1INQB 4M6ML 5IB2B 1CPUA 2EXOA 1P2CA 3KPRE 3VXOA 5IVXA 3LQZB 1NARA 1INEH 2EEXA 2ADGA 3C8KB 3SKUD 3F8UB 3FO1A 4GRWB 3RCNA 3FOLB 3RJDA 3EFFA 3U2SA 5F93C 2DTML 2H2SD 1FC1A 2DQGH 1D5ZB 3KNBB 3H7BA 3MUIA 4YX2H 3W2DL 3PZQA 4P46D 3QIBB 3F5WB 2C26A 1AGFB 5IW1A 1YMHB 3MRJA 4PMNA 5FA4B 1UCBH 4U49A 1AR2A 5C0JB 2IBGA 1E15A 4YAQA 4BM7A 2XKSA 4Y7MA 2UY2A 4YHKL 3HTLX 1R6VA 4ZFZA 1W1PA 5ERWA 1JVKA 1E6SM 1RK0B 3LMJH 4MADA 5DO2C 1CK0L 4QRRE 3MRGA 3OKNA 1IE5A 4PMZA 5F44A 3MRDB 2AABH 4AG4H 1AFVH 1RAMA 3F7VB 3LPOA 4U6YA 2OI9C 5CBAA 5L2KD 4LVOB 3SE8L 3ZTJH 1WV7T 5FCZA 2AK4B 2FJHA 1CECA 4OZOA 1NL0H 3B9KB 3E8UL 4M9OA 5C0AB 5F6HJ 1AD9B 2YL5A 4KQ3L 1Z9MA 3BRDA 1HN1A 4BZ2L 4WHTA 1KG0A 3WFCH 5I1GH 5DFTA 1K2DA 4XC1L 3Q6FB 3SKMB 3W0WD 4B7IA 5LAXA 1O7VA 3N1FC 2HFFB 4ZMAT 3KLKA 4LF3B 2BOCA 2LAAA 3CCHB 3HMXL 3MUJA 3INUH 1JHKH 3SQOL 4X6FB 5HBBA 4ZSOE 1UZ6E 4FNLH 2G2RA 3SDXA 1HOCA 3L1OH 5AUMB 3TCXA 1EFQA 3MANA 3P4LA 3O3EB 1XGUB 1ISVA 1B4JH 4GSDH 2K1MA 4F15C 3FMGL 4XAKD 2WWKT 3QUXA 1CBVH 4OZHE 2QKIB 2Y5TA 4ODTL 1XIWB 4O2CA 4ZTOH 3S37H 3W4RA 5JR1H 3C5JA 3GZKA 4CVUA 2E27H 5C1MB 4L3EA 4KI5C 3RUGB 2V7NB 1DUZB 1S7UB 4P2QA 2W66A 3HUJE 2XIIA 4NNYB 4M6MH 4Q2ZA 1S9VA 3FQRA 3VGFA 1JK8A 2L7JA 1NLDL 3W26A 5HHMB 1DHKA 4JRXE 1UG9A 3RDTB 5FGSA 3JWOL 3U5UA 5B4MD 4CU8A 2R23B 5DDHB 1CT8B 4LSTL 1ZS8A 1K4CA 4PJAA 4YZFE 1UR1A 2DTMH 1A1NA 3CZFB 3W2DH 4MNQD 3BFOA 3ARFB 3TNMB 1L7TL 3BMVA 4K9EL 1UWIA 4RGMC 4Y2DC 4JFOB 4OKVA 4XNXL 4TVSa 1A7NL 2V38A 4S1RH 3NFPB 5E7FA 1ZTXL 4BQ2A 5DJ0A 2HA1A 1D5XA 4YHKH 2XIDA 3HC3H 3K8KA 2Q3ZA 1EEZB 4W7WA 1GYAA 1CK0H 5GISL 1FAIL 5FHBL 3IXAA 2OR8A 5HGHB 1LO0L 4LPCA 5JZ7D 3LXCA 4UQ2A 2EDDA 3FFCA 2WWCA 4YWGL 3G5YA 3SE8H 3M8OL 1XF3B 1ZLVK 3TLRA 3R06A 4OZFA 1KB5B 2VUYA 4YHOL 3T0AA 1R0AL 3E8UH 4MB1A 5I0ZA 4FABL 3TA3C 3TNNA 4KQ3H 4M93C 4FQQB 5J1AA 4BZ2H 3PZIA 4R4ND 5I79A 1ISWA 3MV8D 1S7RA 4HAFA 5I1AB 1T5WA 1EK3A 4XC1H 3N13A 2RBLA 5IP4A 4G9FB 3BCDA 4XXCA 5EDXA 3O3DA 1MVFA 2DT0A 1JNHA 4WGWB 3UZEA 4JFUA 4JFQB 5B39G 3DVGB 4GRMA 5ESVA 5T5FL 3HMXH 3ROOB 3SQOH 2ZCHL 1XF4B 1T1ZA 1OM3L 1CFNB 1HXYA 1NAMB 3BPLC 3UTTE 2F53B 1QNSA 3WS6C 1KJVB 5IV2A 3QHMA 1XD0A 5DEFA 5C08A 2QPUA 4P4KA 1T22A 3FMGH 3KWXA 4ODTH 2BCKB 3MQIA 4R2GB 3QFDB 4Z5RA 2LV4A 1PX4A 3C6SB 3L6FA 1BJ1J 1RK1A 4K2UL 3MSGA 4DGVL 2FGWL 3BVTA 4CD7A 4NKQB 3SBWC 1NLDH 1G7QA 1IZKA 3GSNL 3SCTA 4HX1B 5JO5A 2HWZL 1C5CL 3EYFA 3C9NA 1OD7A 1FCGA 4HUWB 4M1CD 3JWOH 3UROR 1A4JB 4H5SB 5FO8A 4LSTH 1KLUA 2F1BA 4WRLA 4TUOA 1JWSB 4LLQA 5F1IB 3W9DB 2BFVL 1IKNC 1L7TH 2VXTH 3HG1E 4PTXA 1JI2A 3GBML 1R7OA 4JFDD 1TZ7A 4XNXH 4WWKC 1CQKA 1YPZA 2DSKA 1A7NH 3NZ8A 5AYUL 2A3AA 4G6JL 3WIHH 2WHMA 3CPLA 1ZTXH 5FHAL 2CIIB 3EGSA 3ZKNC 2G41A 2IADB 4JHBA 3AGVA 4CD4A 1LHZA 1MFAL 4ZUWA 5CKGA 4ZO6A 5GISH 1FAIH 5TDPA 2EYRB 5FHBH 3FXYA 2EQDA 3B5GA 3VXME 1MHCA 1LO0H 3I02B 3MBEB 4NKMB 2NW3A 1NCWL 2Y23A 2OZ4A 4YWGH 1QLRA 3M8OH 5F9JB 1V0KA 5KSVB 2PN5A 3S97C 1PGRB 4YHOH 1R0AH 1JPTL 5C8BB 4OJFL 4FABH 2JF1A 4X6DB 1MY5A 1A6TB 5BZWA 3T4AB 4RZCA 2GJ6A 2WIIA 4ZPTA 4DM1A 5EU6E 1KJMA 5J11B 4JG1L 1ULVA 3KPRD 1H3GA 4JPWL 5C6TL 1YNTA 5BYWA 4KZDL 2EDJA 4LPXA 3K2MC 4IEFB 2ZCHH 4NN5C 3FHAA 1OM3H 3GBLA 1I7TB 4Z2IA 4LBEA 4JLRB 4PSRA 3WUBA 3DSFL 3BJLA 3O9WA 4N5ED 5KG9B 4WV1B 4QO1A 3U30B 3WY4A 4PJCB 3KPNA 3PV6A 4X4ZA 2X4QA 2H41A 4J7RA 3SO3B 1ZL1A 5I8CA 4YUEL 3NTCL 4K2UH 4LLUB 4S3KA 5T1DL 4FFWD 3PDOB 3TT3L 4DGVH 2FGWH 3CDGA 2AEPL 4QRRD 4PMYA 3GSNH 2XWTB 1O7DC 2G9HA 2G4FA 2HWZH 1C5CH 1KLFA 3QDGA 2ZUQC 2E6QA 2HTKD 3FTGB 1RZKC 5EOQL 4U6XA 1FZOA 1Q9LA 4TVPE 2JIEA 4AJ0A 3HCVB 4ZQKA 4HPGA 4FG6D 1H5BC 1UHVA 4GBXD 2D24A 4G80A 2BFVH 2IALA 1GC1L 1QOXA 4HJGA 2DQCL 5IFHH 2R2HA 3GBMH 3CUGA 2ADJB 4RX4D 3A4XA 5EU5B 2WAGA 5AYUH 4AIZA 1U3HA 4LKXA 2VZOA 4G6JH 3JTTA 2BRRL 4OQ1A 1GZJA 4PTMA 1DUYA 1MCFA 5FHAH 2X4UA 3QDJA 4JM2B 3BP5B 2YL8A 2A6JA 4JO1L 3CDFA 1DQDL 1VCAA 5D93C 1MFAH 4P23D 1IM3A 2B4CC 2DL9A 3LHPL 4CN1A 4X6DF 2ZIDA 1MCEA 4XPAL 2EADA 1NC2D 3GB7A 1NCWH 5CHNA 4UZUA 4LVEA 3T3PE 2P42B 4GS7C 2ZOXA 1L8NA 5E99L 2XV6B 4OZFG 5C70A 5IFJA 3HI1B 4N8CH 5D6DC 1JZ2A 1JPTH 2A9NL 4XMLL 3UO1L 4OJFH 1E70M 5DK0B 4YFEA 4HU8A 3QEGL 1TQUA 4ZS6D 3AMGA 2LABA 1V5JA 2HKFH 3QWOA 4WTWA 4JG1H 1OD0A 3VXRE 4DN4L 3RY6A 2CITA 1T5XB 2E9BA 1T3FB 1TENA 2ATPA 4JPWH 5HHOE 5C6TH 1UWTA 1CDUA 2J7HA 2IH3A 1JCKA 3ARPA 4JRXD 4PJCF 4KWUA 4TSCL 5T1LD 4KZDH 4QAWA 3VMNA 1J0HA 4PLOB 4QOKA 1N0XL 4U3AA 3WL1A 5C07E 3P30L 3LRSA 1S9YA 2HLAB 1T0MB 5EO0B 1HQ4A 2C7UB 4AH2A 4MZ2A 1C1EL 3ALPA 4Y5XA 1Q72L 1U8IA 5DJ8A 5ID0B 2Y36L 2DIEA 3VIOA 4CJ0A 4HGKC 2FL5A 1PD6A 4YUEH 3NTCH 2EACA 2R0LL 4GAYB 1G7PB 5BMFL 3WLBA 2A6KB 3TT3H 5DFVC 5MP6L 2Q87A 4D8PA 1GHSA 2AEPH 1OAYL 4L4TB 3AZRA 4H7VA 5D5MF 1MCPH 4N0UA 4C7FA 1GHFL 5EU3A 4OSUL 3T4YB 2E9MA 5DT5A 3V5DA 5EOQH 4KV5F 2HVMA 4OI8A 2PYEB 1V08A 5IR1B 2PTVA 2BC4B 1FSKC 4MJ6A 1AXSB 1CCZA 4JREC 5D2NC 5IG7B 5TJWK 2EJ1A 4PJ8C 2X10A 1GC1H 1WCBB 2DQCH 4TUKL 5J12C 1FJ1A 1X1NA 5E08H 3AIUA 4M02A 2FGZA 1LD9B 4K7FA 1TVDA 2EDFA 4G6FB 1U2HA 1JGVL 3OGCB 2BRRH 3MOAL 4HMCA 4TNVF 4NQDE 4Z7UF 1WDRA 5CEXB 4JO1H 4GW5B 2EC9T 3RP1A 3P77A 4NQCB 1DQDH 2D7OA 2HJFB 2I9LB 4U7MA 4ONGL 1JI1A 3KYOB 3V0VB 1BF2A 1QFWI 3LHPH 5TDNA 4Y4KA 2OJEA 2FR4A 1A3LL 1RI8A 4XPAH 4A3YA 1JGDA 3UTTD 5C9JB 3WEXB 3UYRL 1FL3A 1E4XL 4RAUB 3DOSA 4PJ7F 2X89D 4EI5B 4U1KB 3BW9B 2BVQA 5E99H 5IMLB 1UG6A 4UIKL 2DYPB 2H9GA 4UNTA 3GMPB 2A9NH 4XMLH 3UO1H 1TQBB 4ZUUA 4X6BA 5SWSB 3ALXA 3QEGH 2JJSC 3W11D 2E7CA 4PGCA 2ZUNA 3WYRA 1U41A 4DN4H 3T0EE 3FO9A 4MWFA 4X6CB 4QHKI 2J8FA 3NACL 5DSCA 1OL0A 2EICA 2VZSA 3L4YA 4TSCH 2EDQA 4E4PA 1BVLA 1A4KA 1UM4L 1YUHB 4C4KO 2F54B 3VO0A 4OZIA 3ARQA 5GS1B 3P30H 1P4LA 4GKOA 4XMPL 1U92B 3NCBB 2BSRA 4WDIA 1BWWA 4GG8A 1C1EH 1NANH 3FT4B 1PG7W 5F7LB 1Q72H 1XH1A 3HG1D 3VKKA 2R1XA 2Y36H 5E6IA 2OX5A 1HIMH 1SJEA 3CFKB 3WNPA 1BECA 2R0LH 4IOFC 5E8NB 5BMFH 3OAYK 2AAVA 2DLEA 5IROC 4BZ1L 5MP6H 1GL4B 1WBYA 3JV4B 2VZ1A 2B1AL 1QNQA 1OAYH 3WD3A 3VXMD 1ZLSL 2Y7QB 3O8XA 1GHFH 4KK6D 5A1AA 4OSUH 2ZX5A 5H94A 5CGTA 1AP2A 1R34A 4NO5B 2JELL 2VQ1B 4YDIL 4LRIA 3FB7A 4UU9A 1P7KB 3FN0L 3GJFH 3WIIL 3OPZL 4BSWB 1FH7A 2YC1B 3GUTA 5JDSA 4NQSB 3MNVA 4TUKH 3G5VA 1XH2A 2W9LA 3L9RB 5HHXL 3U4BH 2K3TA 1YEDA 4JR9L 4RFNC 3FO2B 5EU6D 3CD4A 3TO4C 1BYCA 1U8JB 1JGVH 5EFFA 4IRSA 4WUUE 1H3PL 4X9FA 4CRPA 3MOAH 2ZOKA 5L9DL 2OBGA 4GXUN 3GXDA 4PRIA 4LCYB 2E7HA 4ZOBA 4ONGH 2XVKA 5HYEA 1OB1A 1CU4L 2AOSA 1A3LH 2Q7NA 2XG4A 5A3HA 5GJSL 3MLVL 15C8H 3AICA 3UYRH 5ESAA 4EKXA 1E4XH 4PYSA 2R8SL 3L5WA 3O9NA 5IJVA 1R3LB 5B8CA 3HS0B 4IM4A 1D5BB 2V5SA 4F37K 3G6JB 4UIKH 4X6CF 1JRHI 5DI8B 2AS5M 3I75A 1NGXB 1E5JA 3FONA 3RRQA 2FNBA 4LLAA 2HFEA 5GNXA 2ZJSL 3RVTC 3WFHB 1AR1C 1B2WH 3QIUD 2VLJE 5EC1B 2X1IA 4HUNB 3VH8B 3U7VA 1M71B 4POYA 3RJYA 2V5RA 3NACH 4PBVC 1WIOA 2X4TB 3U5YA 3A3HA 5DJ6A 2OCFD 4Q9CA 1UM4H 4UZGA 1US2A 5A8QA 3O3UN 1E3ZA 1T04A 2BZDA 1VJSA 4DO6A 2VIRA 4XMPH 4TVPD 3F7PC 4UBDD 1ZEAL 3RILA 2WVVB 3H9SB 1T4KA 4QXGL 4ZG1A 3KPQA 3IVKB 4R0LA 4WCYL 4NRXB 1DR9A 1MFCL 4OLVL 2WCGA 4OZGF 4BZ1H 4UDUA 5TGBA 2XN9B 3TJHD 3PWJA 1BYAA 2B1AH 1AHWC 1WFTA 4QRUA 1U95A 4WHDA 4FFVD 5DTFA 5I71C 5JXAL 3U9UA 1QFPA 1ZLSH 3GXPA 1S7XA 2XM1A 4HSQA 3LN5B 4RMRA 3QI9B 2IPUK 3HB3D 2JELH 4YDIH 2O5YL 3FN0H 1EEYB 3WIIH 3OPZH 1ZLUK 3VFRA 4KRUA 2XKNA 1YMME 1E0WA 2OSXA 3TPUA 2R2EB 4XB7A 4CVZA 4PJGA 3F7YA 3MODL 4WY7L 2GVYA 1J1PL 1NFDE 3GSXB 5GSRB 5HHXH 4JR9H 3P4MB 2ENSA 1CWYA 3CFIC 4LEOA 4U1MB 3MJ8B 4WNQA 1H3PH 4NUJB 3VXRD 3X13A 1QRNB 4L3CA 4M8QA 5L9DH 4DEPB 1BIHA 3ET9F 1PZUB 3G6JF 1R86A 2BNQE 3QHTC 3MCLL 1I4FB 5EBWA 5JW3L 3HPLB 1A5FH 5SWZB 1KIPB 1CU4H 4OIAA 5I76A 1LGVA 3CDCA 3MLVH 1X7QB 5GJSH 2OLHA 1NBZB 2E3VA 5C07D 4TTGA 1KJ2B 2VDOL 2R8SH 3OKEB 5BS0B 5HHPA 3QR3A 5BWFA 4MAYB 2CLZB 5DO2D 4PJIA 4KDTA 3VFNB 4YPJA 5IEHB 1RJYB 5CZXC 4JEGB 1D7FA 2ZUWA 2ZJSH 4ODVH 4QRPE 2IGTA 1TCRA 5EO9A 4I5BA 5E94B 3LXAA 3QSKB 2QSTA 5DFWH 1BFSA 2E40A 1FN4B 4W4OA 2AJ3A 1DZBA 1WP6A 4ISVA 4BSVA 2XTJE 2NY1B 2R9HC 1UFUA 2OM5A 5K59F 5LXGL 3UG5A 4HJJL 3TVMA 5FO7B 3IRZA 5F7YC 3RWGB 2DSWA 4CD8A 2UY5A 2GAZA 3CMJA 1ZEAH 4JDTL 2XWDA 4ODXA 4Z78B 3TYFB 1U91B 3QH3A 4HEME 3BXNA 2R1WA 4WCYH 5A2JH 4CMHC 3WO4C 1MFCH 2NY6B 4OLVH 3JSSA 4HPOL 1H11A 5I2IA 2RGMA 4UFJA 4NQDD 1ROWA 3DHPA 2X7LA 4UT7L 3D0LB 1X4ZA 4PYGA 4MXVF 3CZKA 3KLAB 1JWMA 4Z7VE 3LB6D 4Q9RL 1CI5A 5JXAH 3S8WA 1JGEB 1FG9C 1T66C 3VW3L 1BVKB 2GK2A 4QHKJ 1XF5B 3GSOA 2O5YH 4JFEB 3D39B 2B5IB 1R24A 1GOMA 1US3A 4K71C 2ZG2A 3NPSC 4JFYB 3MO1A 4KK5C 3MODH 4WY7H 2WC4A 2BSTA 1J1PH 4HS6B 3N12A 1PX3A 3F5KA 4PGDA 1N4XL 1NBVL 4AZIA 1F00I 3ZIZA 5F3BB 1J0ZA 5I0DA 3U7AA 2FRGP 3D5HA 3T0ED 3EMQA 2YDSA 2AJZB 2P47B 1XCQA 2K9UA 5ANME 3MUGB 4MCYB 3PZMA 3MCLH 3HC0A 5BZDA 5JW3H 4OAWB 1E55A 3MROA 2ZICA 3ZKSD 4JKPH 2X6MA 1SY6L 1J8KA 3ZKXB 3SCQA 3CFEB 2VDOH 4W6YB 1KYOJ 2P8PB 4JN1L 1FVEB 3I6GA 2V5DA 1F42A 3HRZA 5MEQB 2IUZA 2BVOB 3PUCA 1ERNA 5CPTA 3SCPA 2LQRA 3GRWA 1GNXA 1BP3B 4D0BA 2K7QA 4P0DA 3U0WL 1ITCA 1J5OL 3KWWB 2DMBA 4JY4B 4FQXD 3MSPA 1PDKA 2IANE 1V3HA 2Q3AA 1Y18B 1HSBB 4WW2B 4PR5A 1MREL 2AJSL 5T1KA 1G0XA 1X9QA 1F3DJ 5M03A 2NXYD 5CEZE 4H88L 5JORA 1NQBA 2D7MA 2A6DB 3DGGB 3JXAA 3WV0A 3HZKB 3UTSB 4F3FB 2W07A 3C60A 2UY4A 3GSNB 5I9QB 1N5AB 1PZ2A 3TFKC 2YPLA 4JDTH 2VXSL 4ZODA 3S34H 4HS3A 1PKQE 3AIRA 4Z9KB 2R1YB 1ZE3C 4A3HA 3REVA 1OM0A 4CCDA 3PDGA 4AMKH 1QSEE 2NX5E 5C0DA 4WUUD 4HPOH 4J4PA 3R0NA 2UWEE 3QUXC 3MKKA 1Q1JL 2VL4A 3GMMB 2Q86B 3UP1A 4OCMC 4X4ME 2FECI 1MOEA 2V5CA 3G5ZB 4Q9RH 1UEYA 1TVBA 1AKJD 1UWUA 4TVPL 4ZNEA 4JQIL 3NIGE 1EOMA 1V6VA 3NSXA 4NC2B 1CL7I 4W5ZA 5DJCA 4LL9A 5C0FB 4PMQA 5D7KE 4OCXL 2J8OA 5D1QD 3WKZA 1RPKA 3T2OA 2BNRE 2R29L 1VA9A 5DC0A 3STBA 1KGWA 4M62H 3K2UL 1N4XH 1NBVH 1KULA 1YEHL 2I26N 2NY4B 4NQVB 2VLJD 4NT6A 4Y19A 2P8LA 3SDAC 4F33B 2XKUA 2BJML 3MNWA 3WDQA 1NEZA 2D31A 4WWKD 3JTSB 2D0HA 2CLRB 1KTDA 2EO9A 2XY1A 5F89B 5MERA 4AMXA 3I6KA 3VJ6B 3ZKND 1C7SA 4OD1L 2CPUA 1MWAB 3QA3A 4HZ8A 3V0WL 4JN1H 3EYOA 4URIA 2P7TA 2QPSA 4WSJA 2Z1SA 3IDNA 4XNZB 2BHUA 1E4IA 2IQAB 1FL6A 1JZ4A 1W0WA 1EA9C 1AXIB 3U0WH 1J5OH 3BZ4B 2JB5L 2Y6SC 1HH9A 4EN3D 2CD0A 3KVQA 2HG5B 3OLDA 1W0VB 3NDYA 5HI3D 2AJSH 3CHFA 1FNGA 3WN5C 1E0XA 4HD9A 3WFLA 1X5FA 4C4KT 4KKLD 4R4FL 3OGOE 4MD0B 2E8YA 1QVBA 4NRZA 1NDMB 5DF0A 4MNGB 3MRIA 1MCOL 1II4E 1YMMD 4G9DB 3VWKA 5DHYB 5F9WB 4F2MB 5BJTA 1B0RB 3KR3L 1TZHA 2VXSH 1UA6L 8A3HA 3PXJA 3AAZA 4KMLB 3T65A 5FCUL 1ZGLB 1UWXK 5DJYB 2DICA 3S36L 4P4KC 3IT8D 2WP3T 3SDYL 2ERJB 3ZSSA 3CLFL 3SKOB 1Q1JH 1REIA 4EE9A 2QR0B 2BNQD 4ZUTB 5D4YA 3OJDA 1GONA 2PXYA 2HKHL 5EPMB 3MLPA 2X70B 2HN7B 4G8IB 2LU7A 3O3BB 1S5IL 1DQQA 3MRPA 4TVPH 5H2BA 3ULUE 4N8VB 5DK2B 3I9GL 3VIJA 1MW3A 4NNXB 3LKNB 5JW4Q 3WDRA 1OLZA 1K9FA 1WC7A 4OCXH 3D85A 2JCCB 5DFAA 4HUUB 2R29H 1TE1A 1HQRB 2LAGB 4QRPD 2ZX6A 4NF7A 3K2UH 1YEHH 1XR8A 1S8DB 2DWDB 4HH9A 3STZB 2P8MA 1WZAA 2V3FA 4BQ9A 5KAQG 2RIKA 2W0PA 2D3NA 1KCUL 1U93B 4C56A 3HLAB 2VC2L 2BSSA 2BJMH 2XTJD 1CLXA 2XSAA 1W72L 1AJ7L 5FO9A 4ELMB 2CRIA 2UV3A 4PJBB 2A74B 3O4OC 1TJGL 4OD1H 4QRTA 1XR9B 2DQIL 3KYKL 4Z0XB 3V0WH 4W8AA 2YA2A 2ED8A 3STLA 2LTQB 4JGMA 4MJ5B 4UILL 2YHGA 4IOSD 1MCWW 3IJSB 3FHQA 1N0LA 1HDMA 3CMGA 1MLCB 1LO4L 1G6RL 1MCQA 3D25A 1MHEA 2JB5H 1WE5A 3DX8B 5INCB 2VRJA 3L3OA 3EZ8A 1OAUL 2VXVL 2Q6WB 2EDTA 5E5MA 5JHDE 4X9GA 2EC9U 3IFNL 3HR5A 3MV8B 4B16A 4R4FH 5HVFB 5JPMB 2OWCA 3EJYD 2B39A 5EUOF 4CKQA 2C1OA 2WZHA 1CENA 4I0CC 1MCOH 4HZLB 4IPLA 3S3JA 5SX5H 5E7BA 1ACZA 5DHVH 3KR3H 1MH5B 5CMAB 1UA6H 1BFNA 3VWJD 1E4NA 3EO1A 2A73B 5FCUH 1V6UA 1KR0A 1TQVA 5BRZE 3S36H 3O9WC 1ZHNA 3HA0A 3SDYH 1T7ZA 4ENEC 1DWGM 5CSYA 3CLFH 1AQDB 3MRCA 3G5XA 1J11A 2AXFB 1BQCA 3DX9B 2Y1VA 3RTQD 4UQCA 2AJVH 2VAAA 4X7CC 4MPKA 1MFEL 3E3QC 2JCCF 2HKHH 4M7ZC 5F1KC 4FZEL 1Z2KA 1I1YA 1VFAA 1S5IH 5DFVD 4RWYL 1AGBB 3X3FL 4TNVK 3I9GH 5CFHA 5FK9A 3HKFA 2ZWLT 3ECBA 3ZMRA 1C08B 4X9HA 2WINB 3EUUA 1LO3L 1KIRB 4PJBF 5FM8A 1LEIB 5MEPB 2O9PA 3VVGA 3SGEH 5EH1A 3GJEA 3WIJA 4EVNA 2ITDA 2IAND 1WICA 4LGSB 3BSGA 2WWMD 2XVGA 5F88B 5GRVK 4JFDB 4WU5B 1MW1A 1KCUH 4NCDA 5TQ2L 2VC2H 3ULSA 2WMPA 2QADD 1NEZG 1I75A 1T7VA 1W72H 1U3HC 1AJ7H 5CEZD 4Y7EA 4B9ZA 5HI5C 5KSBE 1EAJA 2V9TA 1TJGH 4UQDA 3T1FB 3ZDYF 2DQIH 3KYKH 3W6MA 1T2QL 5AYIA 1VFUA 4HPHA 3AY4C 4ZFOL 3ARBA 5DZNA 4R7DB 1E71M 2APFA 4BFEA 5A8OA 2MANA 1QSED 1LO4H 1G6RH 2NX5D 4L4VE 2XVPA 1V3KA 4XBGA 5D9PA 4AIUA 1JN6A 4GLRI 4QTIL 3BUYB 1PQZA 5IOPB 1OAUH 2VXVH 1H49A 2OSLB 4DK6A 1UKSA 3AMLA 3BIKB 4ORZC 4O00A 2D2OA 2EIZA 4H0IA 1HEZB 3M1BB 3RY6C 1B3XA 1EHAA 3FT3B 4U3CA 1NBYA 4PREA 3UJTL 4HHAA 2JK5B 4RGNE 4LP4A 3DURA 4PV8B 1F4XL 5KTEL 3S35X 5D7KD 5A2CA 5I1JL 1EBPA 3BAIA 4NP4L 4WO4B 5D7SL 1GQIA 2BNRD 3MREB 4HKZB 4YO0A 3FOMA 1T1WA 3E6FB 1MNUL 4WU7A 4ETQB 1H1NA 1H15B 2A3BA 4TUJB 1LO5A 4U6VL 5I18L 5FM5M 4Y5XC 5D4QA 3IDMA 4JY6B 5IQ9A 2VVNA 1KSRA 1YYML 3AYRA 1EEQA 2J2ZA 4J8RA 3EJQA 2XG9A 1MFEH 4R96B 3X12B 1PLGL 4FZEH 3SGDI 3OHXB 1LWHA 1SQ2N 4LKCA 4RWYH 3R8QA 3X3FH 1B3WA 1D6VL 1BQHA 3C87A 4CKVX 2WW8A 5KS9F 4P99A 1BJ8A 1KXVA 3ROLA 3L3GA 5HHQB 5EU7C 3DUUA 5IVZA 4MHHI 2DSVA 3GMLA 3HU7A 1A21A 1OTTC 1LO3H 4BH8A 4YHPB 1LQ0A 1LP9E 2UY7A 4GH7B 4GBXB 4OBRA 2QQKL 4P5TD 4MNJA 1LDPL 1T0OA 4PRNB 5E9DE 4Z18A 3D2UA 4CVXB 5TQ2H 1PIFA 4IS6A 1VDGA 1HHJA 1IQWL 1RZJL 2XY2A 3MRRA 3DSNA 4RA0C 4PJ5A 1IL1B 2DM4A 3VTRA 1D5IL 1GCYA 1T2QH 4RCAA 3MRKB 1QSFB 4EQ3A 5D71L 4Y4KC 4PJ9A 3LY6A 4PN2A 1NC2B 5HD8C 3SE4A 3DTXA 4M81A 1JWUB 2WWDA 2PETA 3ARGD 1CFSB 3BPCB 2AXHA 2P5WE 5A6BD 3E6HA 4OZHB 4LSUL 3UEQA 4QTIH 5ISZA 2OL3A 1OGAE 1G6VK 3BWAB 3LKSB 4F58L 2B7DT 1MUJB 2YLLA 7A3HA 2DBLL 5GGVL 2CIPA 4UAOB 3RVTD 1A3QA 2Z93B 8FABB 3NCMA 1W9BM 2VZTA 4LOUD 4PUDA 5K9OA 3ULUD 3UJTH 2ZNWA 1D9KA 1U8NB 5D9SA 5T1LB 1EO5A 3CZ8A 5GRWA 1F4XH 5KTEH 3HAEH 2P5EA 5I1JH 1JF5A 4NP4H 5D7SH 5E5UB 2E9JA 4P5KA 4RQQA 3FY1A 1VGKA 2PW1B 5HVWA 1MNUH 1I1CA 3WFZA 2C9AA 5E0FA 3OKMA 4XPGL 1HL9A 43C9A 3VSVA 1AE6L 5I18H 3WQ6A 1SYSA 3WJLA 5ID1B 1NUDA 1S7VB 5E6IC 1YA5A 1YYMH 4ZOCA 4L9LA 1A7PL 2UY3A 5D1XB 2Q76B 3PQYA 1PLGH 4CU7A 3VFSA 1G01A 4UIMB 2R4SL 5KANI 3TTQA 1I1AD 4YDJB 3F62A 1D6VH 3IK2A 4D71A 3O8XC 4JFZL 2EXWD 4LRIC 3IDJB 5DJ2B 4ESKA 1HHIA 5CGYC 1MQPA 4XAWL 1OP3H 2WBJA 5DQJB 3H53A 1J8HE 2QQKH 2X4SB 1TVPA 1U0QA 2SEBB 1NGYA 5JHDD 1B9ZA 4I48B 5TPWL 1UZ6F 3T1WA 1IQWH 3L95A 1RZJH 4JN2A 3RQ3A 4IRSC 1WNOA 5CWSB 2MQ3A 3BVNA 1D5IH 2NNAA 3BAXA 1TA3B 3TN0A 4PBWD 4IHOB 5MEOB 5FOBA 1L9NA 5D71H 3IDGB 1M01A 4R7NB 3UTTB 1QVOB 1CICD 2NR6D 3CUHA 1WWAX 3DRQA 4G8GA 4BA0A 4U6HA 5C92A 4MXWL 5BRZD 1IAKA 3HUJF 2EE6A 4UFHA 5B8CC 3TA9A 4KJWC 1ZAGA 4QYOB 1ZJAA 3TBWB 3ECQA 4LSUH 1SJHB 4O9HL 2W0KA 3MRBB 3NVQA 1I3GL 3TTOA 3L5XL 4NFCA 4F58H 5HGGS 3ZT5A 5JMRA 4G8GE 4IRZL 2OQJB 5CEZL 3F7QA 2DBLH 4QHNA 5GGVH 1NCCL 3H0TA 4YZFF 2AEQL 2VUOA 5J3HD 3SKJL 3IU3A 4EDXB 1AD0A 5I8OL 3VDCA 3VMPA 1MJ7L 1JYNA 5D2LA 4W6WB 2DQFA 2EYSA 3F6IA 1CXKA 4W6XB 1BG9A 3QXUA 1G7JA 4XRCB 3SCMB 2DT2A 4PJAF 3BIAX 2WKLA 1G7LA 2L0DA 5HTSA 3U7BA 5HDRA 2CLVB 2VOTA 3VFTA 3K46A 4HIJB 2CBJA 3HR6A 1EIBA 4XPGH 5KSUA 3B2UD 5CLTA 3HG1B 1AE6H 3PWVB 4LCWD 4QLJA 2FZ3B 3FFDB 2VCAA 4R0LC 4PRPA 1A7PH 2BX5A 3W5NA 3NCFB 4OGZA 4F9JA 3RX5A 5IHZA 4PJXE 4M1DL 1AGCB 4O58L 2MSPA 2R4SH 3P2TA 4L8DA 1J0IA 1EHXA 4IOIA 1KNOA 2WZIA 1TTGA 3H7LA 4KKAD 3O6AA 1V7NL 1TVHB 3VXMB 3H3PL 3POHA 1BQHG 3VX0A 3EYQD 5JMOC 4W8BA 3QQ3B 3EFDL 4JFZH 4PJEA 5D7IE 3MJ9A 5KJRL 4LCCB 5GZNC 1B31A 2W67A 4L4VD 3LKOB 3EW3B 2BK8A 1QO3B 4XAWH 3BESR 4LVHB 5FM5O 4JG0L 1UD6A 2QMKA 3GNRA 1D6EB 2JIXD 1XGQA 4ZO8A 1D2KA 1OTUC 3AU1B 4APQA 2OJZH 4PGEB 4PRDB 3KPMA 5EU6B 3AYSA 5GGQL 4HDIA 5TPWH 4XCYA 4YDKL 3P9LA 5AYBA 4OGYL 4YGAB 4GAGL 2EO7A 3RIAF 4YBQC 3O2WL 4HAGA 1EXUA 2OTWA 3APGA 3O6LL 3MU7A 4LNRA 4RGND 3W9EA 1C5DB 1WAAA 2J12B 4XP5L 2ZKHL 4P2RE 4LVNC 4GW4A 4I2XB 3MFFA 3VDHA 4AWEA 4KMTL 4HBQA 3VXUE 3SKNA 4M5ZL 1UJ3B 3K1DA 4GQQA 1A6AA 2Y25A 1KELL 3OL2A 4O51B 3RWCA 4KDTC 3V5KA 1E3XA 1BIIA 4PV9A 4O9HH 2EKJA 4QGYA 4QCIA 2IH1A 3L5XH 5F7EL 2B0SL 3NH7L 1IM9A 3MGTA 4IRZH 1WBXB 1GOHA 3WE6B 5CEZH 4E5XA 1NCCH 2KPNA 4LLYB 3QIUB 3VRIB 2AEQH 1WK0A 3O2LA 3HZMA 3VFPA 1JFQL 4W4OC 3SKJH 4KY1H 3U48A 4AM0A 4YC2B 1OWWA 3AS0A 2V7HA 5I8OH 4O2FB 4D0DA 1MJ7H 3TVMC 5I8KL 1Y6KR 3OXRB 2FIKA 4OFDA 4ZFGL 3ARTA 1UH3A 3HE6C 3BEVA 4YHNB 4PTUB 4V27A 3DBXA 3FT2A 5GZOD 4C54A 2XFYA 4OT1H 4W5UA 3PWNB 3ZJ6A 1JMXA 4ZXBA 5E9DD 4MDOA 4P2OD 5EUKA 5BV7L 5HPCA 3O4LB 1IGTA 1OGSA 1U42A 1CS6A 5CAYB 4G6KL 3MV9A 3QB7C 1AGDA 4M1DH 2W38A 4GKNA 5DD6A 4Z7WE 4O58H 3VRLE 3ULUL 1EDQA 1JGUL 4QRSB 2KKQA 3OKOB 3P9WB 2XVLA 4L8SC 5DMGD 4R3SB 1OGTA 1V7NH 3FRUB 3H3PH 1XGTA 3KAAA 1QA9A 2M2DA 4PD4J 2JIWA 3EFDH 2NLJB 1F90L 2PWFA 1A9EA 1DDHB 3IJHA 1A0QH 5DVKA 3GBNL 5KJRH 2P5WD 1NANI 2ALWA 5JBFA 4QEGA 3WFDL 2ZNXA 4JG0H 2VRQA 2ADIA 4MA7L 2A2QT 1FZKB 4Z77B 1OGAD 4BZYA 3BJ91 3VGAC 4MDJA 5EFIA 2N7BA 5GGQH 4YDKH 3LS4L 4OGYH 5IKCB 3CZGA 3VXRB 5FF6B 4P8VA 4GAGH 1XF2B 3JWDL 3MMEA 4NFDA 3BGAA 1S78C 2X4RA 4LFHD 3O2WH 4JANB 4YJZL 3DV6B 3V8CA 5C8JA 3O6LH 2WHKA 3QZWB 1DCLA 3SDAD 3QG6A 5J1SC 1ZWIB 5E2TL 4ELKA 4HV8B 2VN7A 4X7TA 4JKKA 3MV7E 4XP5H 4TRPL 2F61A 2ZKHH 2FDMA 2F5AL 5C07B 3G9AB 3MX0A 5EIVA 5JNYB 4M5ZH 4PGBA 5I73C 4JZNB 3RM4A 3S6TA 2VXUL 1LL6A 3RWIB 3IGAA 3E1F1 1DE4A 2HTLC 3PWLA 4UMGA 2OI9B 1A1MB 3IFPA 5F7EH 5I1DB 2B0SH 3NH7H 1FNSL 3C5SB 4U7SA 4AT6B 4W84A 4M56A 5C3TA 5JLZB 1RJLA 3V5HB 4AQ1B 4F8XA 4X99A 1FQ9C 3GXMA 4MJIE 4JRYB 4HZAA 2GK0B 5FUCE 1E4XI 1L0YA 2PCPA 2WYSA 4F9PC 5SWQB 1XH3A 4ZFGH 3G04B 3PHAA 2N7AA 1H2JA 3C60C 3VCLB 5T3ZE 4E41E 1I8MB 1J8HD 3CVHL 5M7QA 4ODHL 2J3SA 4NKDB 2EIDA 3UJIL 3OJMB 4UFLA 4G6KH 1ZXQA 2XNAB 4J4PC 3T3PF 2HVKA 1OW0A 4OF7A 4G8EB 4OF5A 3ULUH 2APXA 2OLDA 1JGUH 2GTWA 4XVSL 3IAQA 2C0HA 1ZT7A 1IGYB 1EV2E 2GKIA 2NMSA 3JV6A 2Z1KA 3MR9A 2VLME 4Y5VB 1F90H 2ESVA 3AVEA 3GBNH 2MCPL 2LVCA 1DWJM 3MCG1 3QPQD 3WFDH 5ICXA 3LVEA 4MA7H 1U36A 2XXMB 3GMOB 4NC1E 4I18B 2FEDD 4JFXB 3VA6A 5KBNC 3NCOA 5AD0A 1H0IA 4NZDA 3LS4H 1LK3L 3WSUA 3B8SA 3BLPX 3GH7A 1U8QA 3T0EB 1NAKL 3PGDB 3QDMA 4XVJL 3LD8C 5JW5B 1DBBL 2H6PB 4UOQA 2D7PA 2YD9A 4RGMB 3PWPA 4Y2DB 5DURB 5E2TH 3RKDD 4TRPH 2CESA 1N2RA 3VD3A 2Q1EA 4UOW0 43CAA 3NFNA 4H8UA 4PMOA 1FHGA 4ETYA 1I85A 2FX7L 3MUY1 1I9EA 2VXUH 1KPVB 1IGCL 4PLJC 4GKSA 3IAPA 3CH1B 3QWQB 4D6HA 3MJGX 3C8KA 3MYJB 4LHUB 4YXHL 3WEZA 1FNSH 3FQNB 1N5YL 3FOLA 4JIEA 5FCSH 3BN3B 4L8CB 1D5ZA 1Z6JT 1QBML 2B2XL 3OZPA 3EDDA 2VLKA 1YMHA 5FA4A 1QEWB 4ZE4A 4AYGA 1G9HA 3NDZA 4QWWC 2H32B 3H9HB 1OHQA 3EOBA 2X1OA 4MMZC 4XH2A 3O6FD 1MFUA 1FVDA 5HGAA 1E6NA 4KROC 1QR1B 1RK0A 5E8OB 1G5AA 3RMEA 2GYSA 3DPBA 2AMGA 2DDQL 4TX8A 3CVHH 3BPLB 3KJ6L 4IDLA 4ODHH 3F7VA 3PJSB 4X4XB 4ONOA 4DCQB 3LEVL 4CNIB 3UJIH 9CGTA 3O9WD 4FQHB 3S4SA 4PCSA 4YDVB 2AK4A 4H8WL 2UWFA 1KLGA 3AZTA 3B9KA 3VFUA 5IT2L 3PGCB 3B3IB 5C0AA 2VC9A 1AD9A 1IARB 2PXYC 4OD2B 3QXAB 4P2RD 4X8JB 5CSZA 5HYSB 2EBNA 3ZYJA 4WTZA 1V3JA 3VXUD 2LVEA 1E4LA 1JV5B 3SKMA 3Q6FA 2UVEA 2HT2D 3MUHL 4B53A 2MCPH 3H3BC 4AL8L 2YD6A 5IBUG 5AAWA 3VM5A 3TZVD 4LF3A 1K4DB 1E73M 1W9VA 1BQLH 3CCHA 3MRNB 3RBGA 3TJEL 5CPSA 4X6FA 5T5NG 1QW9A 3DIFB 4CN4A 1TZIA 5AUMA 4XNYL 1NAKH 4XVJH 2PTTA 2B8OT 1DBBH 4S2SB 4F7TA 3BHBA 3BH9B 2QKIA 4DZ8B 1XIWA 4WWKB 2VYRE 3HNTL 4YFDB 3MC0A 1Q6EA 2W4XA 1JD7A 5BXFB 1P69B 3VNYA 1DLHB 1ODUA 3WL9B 3W29A 1NMCB 3NABL 1UR2A 3OKLA 2V7NA 4NFBA 4G8FB 5I74B 4WJ5B 1EPFA 3GJFK 4ZS7L 2A83B 2Z8VC 1IGCH 2WBKA 4FN0A 5DEGA 1YJDC 4PYHA 1R75A 2W60B 2HJLA 4N0CC 3MRQB 1JYVA 2YWYA 1V02E 4Y89A 3HMWL 4YXHH 5TF1L 1N5YH 5DDHA 2V5YA 3RUGE 1CT8A 1LG1A 3I6LE 2ZE0A 2B2XH 1QBMH 3WQ8A 2XHYA 3WQWA 2BHYA 1A1OB 4J3XA 2EAEA 1SEBB 3K8MA 1VB9A 5FXCH 1P7QA 1MCWM 4JFOA 3I3BA 4FK9A 2ED7A 1QTYT 5T1MB 3OKDB 1EUTA 5JA9A 1KPUA 1MI5B 2I07A 4PG9B 3SE9L 2JE8A 1B6DA 2BVUA 4PRBB 1A22B 1S46A 5F6IC 2VDPL 2QMJA 3WUEA 2CGRL 5D72L 2DDQH 4EOWL 3B2VL 5HGHA 2IPUG 3KJ6H 5E4EC 4MAZA 2ICWB 1T7XA 3O2DL 3LEVH 1U3YA 3CDYA 1NH6A 3SJVB 1XF3A 1MRDL 4HKJB 2WMHA 2QQLL 4H8WH 1KB5A 4PTVA 4CDGC 2BNQB 2W9EL 2XN2A 4NYLB 1S9WB 5IT2H 2EZ0C 2PO6A 3KDMB 3W53A 1MCIA 3MV7D 4HWEL 2ZOLB 3IJYB 3SGJA 1BLIA 3D18B 5I1AA 4RBPH 4XZUB 5F9OL 1RMFL 1JYXA 2Z35B 5ACZB 4U1HB 4G9FA 1SBBA 3VGBA 3T77B 3O11A 1NMBL 5DQ9B 2Z31D 3DECA 3OA5A 1R87A 4JFQA 3VM7A 2ZUQB 1WCGA 3L3KB 1HP5A 5LA1A 1RZ7L 4FQJL 4QRPB 3RVVC 3TJEH 2YDRA 3RWEB 1NAMA 6CGTA 2F53A 1KJVA 4GW1B 1RJCA 1H5BB 4Z76B 5F7DB 5FDWB 5CCKL 5F7WC 3W5MA 2XTJB 1LWJA 1TNNA 4MJID 3DYOA 3HNTH 4HWNA 3QFDA 3WUWB 4H26B 3TBYB 1CWVA 3BI9X 1LE9B 2H8PB 2NY3C 3NABH 3FO0L 4NHCL 5T3ZD 4HWUA 4E41D 2BXYA 2KQMA 2G3IA 4ZS7H 3ARBC 1J9YA 4X7EC 1F5WA 5A3IC 4HX1A 4U1NB 2DM2A 3X17A 5IB1B 1Q4NX 4HUWA 4A6YA 3HMWH 1FZJA 3BAJA 2YDQA 1JHLL 2PWDA 4H5SA 5TF1H 2R2BB 4PMVA 2YBTA 3O81A 4BQBA 1HL8A 3CIVA 3BD3A 5F1IA 4DTGL 4CW1B 4HK3N 2CH8A 1LNUB 4JPVL 5IIEB 5IMKB 4X98B 3SEPA 1UR4A 4I3RL 4MLSA 5E0QA 5AZEL 4M80A 2QBWA 1ZKAA 1NFDF 4S1SL 2L7UA 1W1TA 4JQXA 4WVRA 2YLAA 3RZCD 2VLMD 1K8IA 2CIIA 2YJQA 3SE9H 1DWAM 3ARVA 5DWUL 2VDPH 1V6WA 2CGRH 3LQMA 5D72H 3VWJB 3B2VH 4EOWH 6TAAA 1WCQA 1UOKA 4NKMA 1U8PB 2DMCA 2CO7B 1OF2A 4OCRL 3O2DH 1WZKA 4GQRA 1LDSA 5EBLB 5EORL 5GQBA 2XN1A 1MRDH 2C3VB 5KSVA 5FGCE 3S4SG 2QQLH 1P6WA 5CIPH 3BUDA 1Z5LB 2W9EH 3RTQB 4F9DA 2KL6A 5E8EA 4X6DA 5EULV 1RV6X 1QWNA 4B7LA 3LEXB 4HWEH 2MWCA 3T4AA 4OFYA 4WTZG 3BLBA 1CDJA 4YXKL 3H54A 3A6BL 3WDJA 1OVZA 1QKZL 1HJQA 4F79A 5F9OH 1RMFH 2HP4A 4PJIF 3NSMA 4BH7B 1JZ7A 1KXVC 4OQTA 4C58B 4IRJA 1NMBH 2NY5L 3MI6A 2OR7A 2DQEL 1RZ7H 4FQJH 5LG1A 2WSKA 5D96C 3T0VA 3T0BA 3L7FB 1A2YB 1I7TA 1E56A 3FQTB 1FSKB 2FCBA 3SN6N 4JREB 5D2NB 1OT1A 4PJ8B 4D6CA 3RPMA 3OF6A 3P9MB 1HHKB 5CCKH 5KG9A 2FJFB 1A64A 5J12B 4PJCA 3LH2L 2QADB 4HK3J 4P59L 4OCNC 1HKKA 1M7DB 3RNKB 3UTZB 3RU8L 1M7IB 5HGBB 4S1DC 5JW4N 2AEWA 3FO0H 4V1DE 3QIBD 2Q8AL 3NZHL 3IXTA 3DV4B 1UQSA 1PKQB 2V2XB 4Y4FA 4PJ9C 5IVOA 4WUKL 4Z7VF 1UD2A 3H9ZA 5GGTA 1HHGB 3SE4C 2A0LD 2NX5B 1MVUB 2NSXA 5IM7A 3TH4T 3FTGA 1JHLH 5ABFA 3DROB 5DRWA 1I8IA 3BUTA 3K4AA 2OTUB 3V2AR 2IWGA 3FN3A 1VEOA 2Q7YB 4DTGH 4TPRL 5D5MA 4JPVH 5CZVL 4PP1D 2NT1A 4I3RH 5AZEH 1BEYL 4FXLA 4Z8FL 4S1SH 1BAFL 1Z9OA 2BSED 1FZMB 3MS8A 2FB4L 1UZ8A 3E0GA 1W1VA 4AD0A 3BP5A 1D9KC 1F8TL 2O61B 4XHJC 4POZD 5DWUH 1ZBWA 4P48A 1F02I 5DJZB 2BNRB 4B15A 4HMEA 1GHRA 5EA0L 3VNZA 1HNYA 1OPGL 3TV3L 4M1RA 4OCRH 4WI9A 1FO0B 3SUTA 4Z7UA 2G75B 5EORH 5C2BL 2WVTA 3WJLC 4DGYL 2QV4A 1G7MB 3S5LB 4MJ2A 5ABGA 3HI1A 4L9LC 5E8PB 1C8XA 3MRMA 4JJ5B 3PXHA 4JDZA 4P9ML 3NCJL 1XGRB 4YXKH 3SDCA 3MOBL 1QKZH 2EDNA 1RHHB 4KJYA 1KN4L 4N1EA 2EYTA 3RIAK 1OAQL 1T3FA 4HC1A 4EXPX 5GGUB 1KC5L 2VL5B 1XSJA 3GBDA 2NY5H 2X5PA 3OAZH 2NYYC 2F9BT 3RVWD 4HIHB 3UCQA 2DQEH 1DVFD 1LVEA 1P1ZB 4TOQA 1XSKA 2VERN 4LHQB 4HFUL 5FOOA 3I6LD 4X5WB 4YNYB 3V6OA 4R97C 3MLSL 2WBJC 4KKCC 1TETL 4IIQB 1T0MA 5EO0A 3RWJA 3J7HA 1EBAA 5ID0A 3LH2H 4JVPA 3RDTD 4RFNB 4P59H 2EKSB 3TO4B 4WTXA 2OMNA 4LLDA 4PTWA 1MQKL 2A3EA 3RU8H 3BN9D 3V4PH 2UWEF 4M48L 1X4XA 2ZG1A 3ARFD 4KK9C 2Q8AH 3TN0C 3NZHH 1GPFA 1H9VA 4XPTL 5IBLC 1PS3A 4L4TA 2XIBA 5E6YA 5D9OA 3X3GL 1YY9D 2AV1B 3BISA 4WUKH 4BK5A 5EOTB 3M7SA 4OV5A 3SGEI 3T4YA 2ZCLL 3BYYA 1QHOA 1HJUA 3H55A 1E0VA 4C83B 4XX1E 2L4OA 2BHZA 2PYEA 4DJMA 3WH6A 1XGYL 1AXSA 4TPRH 5IG7A 5LGJB 1NOWA 3UPRB 4BF7A 5F7KC 5CZVH 4K3EL 3QEQA 2GSJA 1BEYH 5FKPB 4Z8FH 3AB0C 1BAFH 4H1LG 4NJ9L 4GRLD 1T0PB 2FB4H 4RDQF 4WIWA 1HJWA 4FMFA 3QP3A 5T3ZL 5CEXA 5BW7A 1F8TH 2FYYB 3L3IA 4NQCA 2HJFA 2YOCA 2I9LA 5HDQL 1NJ9A 3KYOA 3V0VA 4QHLA 3EKCA 5EA0H 3MSDA 1S7WB 1OPGH 3TV3H 1X5IA 2DLIA 3QWRA 3GXIA 2BVPB 3HE6D 5DD3L 1E27A 5CINL 2XZAL 4KFZC 4OTXL 5C2BH 2ARJB 2R69H 3BW9A 5IMLA 2A38A 1PG7X 2AXGB 3GKZA 4DGYH 3U7WL 3BP4B 1IAIM 3GMPA 2GSGA 4TTUA 5SWSA 1PEWA 4P9MH 2A77H 3NCJH 4KI1A 2VDRL 4C55A 3LPFA 4CL7A 5C0EB 3QIWA 3MOBH 1PZ5A 1OP5H 3QNYA 4GZJA 1KN4H 2MHAA 4GKZB 4J3VA 4X6CA 1OAQH 3GSVB 3IDXL 2JJWA 1KC5H 3O2VL 1UQZA 1KR1A 4UQ9A 3PZTA 3MNZA 5B3NA 4HFUH 4XBPA 3SUVA 5GS1A 3DX7B 1E6JL 3QXTA 1JTOA 3ZDXE 5KSAC 1OAXL 3MLSH 2D23A 3BCFA 3JV0A 1TETH 3M17A 4X8XA 2Z8WC 2VI0A 4I1NB 3Q48A 1WKYA 5JHDB 2Q8BH 3SCUA 3FT4A 4APQC 1JFHA 1QQDB 2F54E 3CFKA 1YQ2A 1UENA 1JF1B 2MNUA 3BAYA 1MQKH 4HGWB 1KCRL 1GQKA 3BRGC 4M48H 3ULVC 1HSAB 1TJHL 3CH8A 4XPTH 3ZJKA 1TUXA 3FAWA 1N8ZB 1CGSL 3X3GH 1I1WA 1QNPA 1N82A 5E56A 4AZCB 1RZGA 3KPPB 4V2XA 3O45B 4F8QA 4Y4HA 1P7KA 4XNMB 3KPOA 5HI4C 5DJDA 3ULUF 2DRUA 4AD5A 4UUJA 1LLOA 1OAZL 3CVHB 1XGYH 1RJZA 3LN4B 4E8CA 4NQSA 4K3EH 1A3RL 3MBED 3V6BR 5CPQA 3LS5H 4NJ9H 5IB3B 3WN6A 4FFYL 1BZ9A 4KJQC 1EAPB 1DN2A 5DZOA 4ZUVB 2AK1L 5T3ZH 3WHE1 3Q0HA 4N0FB 1MAJA 2CK2A 3DX1A 1J01A 2YEZB 4XMKH 3MO4A 3NGBB 5HDQH 2F7PA 1LEKB 3CLWA 5FECB 1GJIA 4ZAKA 2NXZC 1ZBKA 3CFDA 3ARXA 1RURL 3O3AB 5D70L 5J9PA 4QXWA 3C60D 5DD3H 4CCCA 3RL2B 3QUYA 4LCWB 1R3LA 3CLEL 5CINH 3HS0A 2XZAH 3U7YL 1WQVT 2CEQA 3G6JA 2FO4A 3BGMA 3L3DA 4PJHB 4ZXBC 3U7WH 5DI8A 1W2PA 1NGXA 4NKOB 5F1NB 4CMHB 5F7NC 1A6UL 4XCNB 2F8QA 2BMKB 2AW2A 3CK0L 3D1MC 1OY3B 3WFHA 2VDRH 3FB6A 1M6OB 3NIDE 3QUZA 3RBSA 4V1DD 1QI4A 2GJXB 5EC1A 4G3YL 3VH8A 3BO8B 4UTBL 4XGZA 5J6GA 3IDXH 3VIFA 3O2VH 2X4TA 3KPLB 1HWHB 1O6IA 1TMQA 5SX5K 1K9DA 3VXOB 1EVUA 2ADGB 4UFMA 1E6JH 1OAXH 4Y16A 5FIEA 4FLOA 3FO1B 5LQBL 2YUXA 3NPSB 2WVVA 1KGUA 4M82A 1FYTE 3H9SA 3H7BB 2EDOA 4QHUA 3UXFA 3IVKA 1MRCL 4NRXA 1RH9A 5IW1B 3SCOA 3MRJB 4K23L 2PWGA 4PP2B 1KCRH 3THCA 4RGNB 4NI3A 1QSZA 2IMNA 2WMKA 3MUZ1 3ARUA 2XN9A 1TJHH 4NZCA 3EJZD 4YAQB 1YEFL 2UY6A 1CGSH 3DX6B 1MWOA 2AV7B 2ICWI 1K6AA 3LN5A 3QI9A 1JIBA 3QEHA 2OSWA 4JM2D 3AHTA 4NX0A 1DWHM 1EEYA 5IGXL 2CDEB 3ZHDA 1UC6A 5JQ6L 4PJFE 4U6YB 4UINL 1HCFX 1UD3A 1W3HA 4PY8I 2YD5A 1BVZA 2LE9A 1A3RH 2QSQA 3C6LA 1B90A 1QPPA 5GSRA 3FRPG 3RIFF 1WDPA 2W62A 3PDDA 1E4MM 4ODBD 4U1MA 3MJ8A 4Q74A 3WHXA 3A23A 5F71A 2AK1H 1QRNA 4XC3L 5A6SA 3ILPB 4MXQC 3LAFA 3L2LA 2GJPA 1I4FA 5DMIL 4U1GC 1K2DB 3L4TA 4AZBA 5LAXB 1KIPA 1NBQA 3MCKB 5KSBF 1RURH 1TXKA 3BAKA 1X7QA 2FWOA 1NBZA 5DUPL 3ORJA 3EOAB 2BOCB 5BS0A 3U7YH 3CLEH 3U9PL 3OWEA 2CLZA 1N3NB 3VFNA 4P2OB 3AQUA 3HMXA 1HOCB 5IEHA 3WNKA 1V6YA 3D69B 2CHOA 5SWZE 4GI9A 1NGQL 1A6UH 2DT1A 5ADPL 5A2KH 3CK0H 1OW0C 3A67H 5E94A 3C5JB 4TOYL 4G3YH 4Z2LA 1V0NA 1FN4A 4UTBH 4L3EB 3SDDC 2PXYD 1SVZA 4K3DH 4KUZL 4DWSA 4Y8AA 3SUSA 2P5WB 5TF0A 3DVFA 1Y0LB 3HG4A 3K74B 4HIEB 3PZGA 2X1XR 3CNKA 1O0VA 5LQBH 3QJFB 2Y2WA 4OFKA 5H8DA 1ZS8B 3SCSA 2NT0A 4N42A 1U91A 1A1NB 1NAML 5JIIA 4W81A 5IHUL 3ZL4L 1MRCH 2NY0C 4W68A 4YR6B 1G94A 2CBUA 4XWOD 4K23H 3VXNA 4ODWA 3SDAB 5IB5A 4FNQA 5DMKA 3D0LA 12E8L 2OS7A 3KLAA 3MBXL 3N18A 4PGJA 1YEFH 5DJ0B 5LKNA 3ZHLA 1CGTA 4XP4L 1I7ZB 1HJXA 1KQYA 1I85C 1XF5A 2APVA 3VFWB 1NOFA 3OMZA 1KT2B 2FBJH 5I75B 5IGXH 3D39A 5BOZG 4N0CD 4UINH 2YN5A 1CXLA 3G5YB 2X2YA 1ACYL 5JIPA 1BD2E 3VXTB 4FNPA 3ZTJG 1LP9F 4NZTL 3GI9L 1KXQE 5CIPB 4JFEE 4NBZB 4EI5D 1KCVL 5F3BA 3F58L 4XC3H 3WN5B 1TJIL 2JB6B 2NY2D 2DYPD 2UZYB 3DVNB 3PHOA 2DJSA 5GRXG 5A6MA 1WISA 4OIIL 5J1AB 3MUGA 1L9MA 1PSKL 1S7RB 5DMIH 1T5WB 4OAWA 3DX2A 2BDNL 3WO3B 4JB9L 2Z91B 1OSPL 1JNHB 4DOHE 3CFEA 3VFOB 4GJTB 2P8PA 4GRMB 1C16A 4RAHA 3O41A 3OV6A 1FVEA 4NM4L 3HC4L 5HGDA 1GGUA 3U9PH 2CYGA 3RDKA 2QLYA 2XPGB 1HXYB 1DEDA 3GSRB 3L3JB 3OR6A 5DEFB 2F54D 4LCIL 1NGQH 1EH9A 2YMXL 1RSFA 1TFHA 5ADPH 3KWWA 2CIKB 4JY4A 2R56L 3IKCA 3VI4F 4Z5RB 3DETC 4HXBL 3B9KC 2P4AB 1HSBA 4TOYH 1TLKA 3VH8G 4B5EA 2EZ0D 5I19L 1I1RA 1HI6B 4HS8L 1B4RA 5I1CL 4X0NA 4KUZH 2GJZB 3H6JA 2UYLB 3DGCR 1G7QB 2A6DA 1OTSC 3U0TA 3HZKA 1P5VA 3UTSA 1AQ0A 3QEUB 4I0PD 1MCBA 3GI8L 5EC2A 2WUCL 5F21B 3GSNA 4D1IA 5FO8B 3REWB 3RVVD 4TUOB 4NM8L 3WUZA 1PYWB 5C0CA 4D9RE 5IHUH 4EKJA 4QRQA 3ZL4H 2Z8RA 3KYNA 3FB8B 1AO7E 1EVTC 2DLGA 3L5HA 4ONHA 5F7UA 5GGSY 2D20A 1XIWC 3P3YA 5H37H 1YPZB 4MVBC 5E4IA 3GMMA 2Q86A 5IVNA 12E8H 3NZ8B 3DHUA 4U1JB 2GSIA 2E0PA 3O4OB 3MBXH 2ZX8A 3EGSB 4XP4H 4YBHA 3PWUB 2NY3D 2CXGA 5ETUA 2YUVA 4ZUWB 4CJ1A 5C6WH 1YECL 1LK2A 1MHCB 1XFPA 2BP3A 3WFBL 3UG4A 2DT3A 1OP3K 5C0FA 1Q6CA 1QLRB 4IUGA 2NZ9C 1VFFA 2VNCA 1ACYH 1QNOA 1H8SA 5L2JB 3IJ8A 5GS0L 4P46A 4NZTH 3GI9H 5TQ0L 2CDGA 4NQVA 5E2UL 1KCVH 3T8XB 1TJIH 3CZNA 2GJ6B 4F33A 4WFHE 4OIIH 1KJMB 1PSKH 2NW2B 1QI3A 1I3RB 3JTSA 4DKAA 5I8EB 3O6FB 2CLRA 1QW8A 2BDNH 3WF2A 3HZYA 5DGRA 3VX1A 3VJ6A 5EZIL 4JB9H 1VENA 1YNTB 1IAIL 1MIML 4GQ9L 1UZ4A 4NM4H 2ICWJ 3HC4H 4NN6C 1FYTD 2IMMA 4MDIA 4U5KA 2X42A 5L2KA 3HJEA 4LCIH 3O9WB 2YMXH 3N85L 4MHHG 3O6MH 3EHBC 3BZ4A 2RJMA 2DPEA 2R56H 4PY8J 1N6UA 1RIUL 2CKBL 2VMFA 1SYTA 2A3CA 3WH7A 2PO6C 3VIIA 2HG5A 5M5DA 1W0VA 4L4PA 4P2RB 3CXDL 3GSUA 1KPRA 2P48B 4M7LT 5I19H 4HS8H 4HPYL 5I1CH 3F65A 1K8DA 4M7ZB 4ZFFA 3QYCA 3SGJC 3W0WA 3CDGB 3CUFA 4MD0A 4AEIL 4BELD 4ERSL 3GXFA 3DMMC 1FCCA 1MFBL 2Y07L 5IB4A 1NDMA 2G9HB 2H2PD 4PB9L 2ESCA 3TZVB 2WB5A 3GI8H 2AJYL 2WUCH 4G9DA 4YE4L 3FNDA 4F2MA 4QP0A 5ILTL 4FNUA 4OCYL 3TBVA 1KENL 2LU3A 1FZOB 3QHOA 1X44A 4NM8H 3VD4A 1U30A 1DLFL 5DJYA 5EUOA 2V3EA 4WSKA 1IGJA 4MNGE 4HJGB 4F57H 5M17A 3OG4B 4R2GC 1U3HB 2QR0A 1HJSA 3QXVA 1R3JA 2VR5A 2YBRB 2X4UB 5EPMA 1GOKA 4PJ5D 2A6JB 2X70A 2HN7A 4LLVA 3MOQA 4HWZA 3EJTA 4PJXF 3O3BA 4G7YL 5ICYA 4N8VA 5DK2A 3RWHB 1YECH 3WFBH 4NNXA 1OSZB 3LKNA 4NN7B 1IEBA 5CHNB 2ATKB 4LPVA 4MA1B 5SWZD 2JCCA 4HUUA 3BT2L 1B3ZA 5D7IF 3KG5A 1JJUA 2OXGA 5LVEA 4Z7WB 5GS0H 1U2CA 4MNQA 4QFUA 5TQ0H 5B38A 1G7IA 4P5MA 4FRWA 5C0NC 4MAYD 5E2UH 1AGEB 2DWDA 3STZA 5J1TC 1PIGA 1U93A 3VIHA 2HJKB 1HH6A 2FHCA 4JQXC 2XSBA 4E8DA 1CGWA 1K6QL 4F7MB 2VCBA 4PJBA 2A74A 2ATPB 4XTRC 2J8UE 2WCSA 5EZIH 5GNYA 2IH3B 2OYPA 1XR9A 2DWEB 4Z0XA 1IAIH 5FAAA 3PABB 3RKPA 1MIMH 1W8NA 4GQ9H 4JFFA 1HKFA 5KANG 5IK3B 1NC4D 1ZSDA 3WLWD 2MQ0A 4ELME 3GSWB 2R15A 1S9YB 4B3KA 2EEAA 2B20A 3IJSA 3MXVL 4YEEA 3UZQA 3N85H 4PEEA 4KVCL 3WHE0 4MNLA 4Y5XB 5DJ8B 2RGSA 3BQUD 1F4WL 1T1YB 1RUQH 3ULVF 1RIUH 2CKBH 3ABZA 4GO8A 4IMLB 1H8NA 2YL9A 2QF8A 2Q6WA 4XZWA 4JKWA 5BXRA 3CXDH 4HPYH 4JFPA 3T0WA 3M07A 5D7LE 5EN2B 3MV8A 4AYSA 2K7PA 5C0BE 2V6HA 4AEIH 4D8PB 4ERSH 1LJYA 1MFBH 3C5ZD 3U1SL 5SV4A 1QUNA 2Z31B 4PB9H 1VEMA 3WF0A 4IRJC 3WY3A 2AJYH 5E0CA 5HYQB 4YE4H 1MCDA 1WBZA 3V5DB 4OCYH 5CMAA 1GUVA 1KENH 1RIVL 1IJ9A 1BD2D 3GJFA 1DLFH 1E28A 2EC8A 3UTPE 3IDIB 1R3KA 4H20L 1PY4A 1AQDA 1FJ1B 3U30C 2ZCKL 4JE4B 2F18A 3DX9A 4G6ML 1QSVA 4P57B 3WIFB 4MQTB 4B0MM 3GMNB 2ICCA 5DD1L 3OLEA 4E41B 2IAMD 4G7YH 2DQHL 4KRPC 1ZGLM 3QULB 1AGBA 3KL3A 4X7FC 1B3YA 4KHTL 4Y4KB 2OJEB 4Y4FC 2JEPA 3CHCA 1JGDB 1FL3B 2WNWA 1JBJA 3QAZC 2X1PA 1E1EA 2Z8SA 2WINA 3BT2H 5IDIA 4AEFA 2ZUTA 5B3JE 5CD3B 1LEIA 5MEPA 3I3DA 3LMJL 3JV5A 4WFGE 4WJXA 5F88A 3MJ7B 4JFDA 4WU5A 5KS9A 3ME0A 4PGCB 3BVVA 5BRPA 5EB9A 3H8NA 4RGOL 1K6QH 4Z7NE 5DA4A 4XNUL 3KXFE 3FO9B 1BOYA 4QNPE 4HKBA 5A6AA 2M8XA 2DQUL 3CSBA 3T1FA 4W8LA 2GCYA 1GOGA 4KTDL 5GGRY 4KC3B 2JALA 4XI5D 4G6AD 1WIPA 2WK2A 2GFBA 4LLMB 4PLKD 4D9RD 3ELAT 2BSRB 2FLBT 3P73A 2YL6A 1A3HA 4KVCH 3CUIA 1AO7D 5DUML 1F4WH 2R1XB 1JHKL 1NCDL 5IOPA 2OSLA 4ZOEA 4LGRB 3NOIA 3SDCC 1WBYB 3WNOA 3M1BA 3OX8B 4L3AA 2VWEC 3CH9A 1SMAA 3KPRA 3TIDB 3U1SH 4U1SA 3CFBB 3O8XB 5H94B 4K94C 4UU9B 4WKAA 3MREA 4HKZA 1RIVH 4O02L 4YPGB 3GUTB 3V6OC 3BEWA 5D8ZA 5KSAD 4ETQA 1HKLL 1W3LA 3MMUA 4TUJA 5A6JA 3MNVB 2DIJA 4H20H 1YEDB 2ZCKH 3ZYOA 3QQ4A 4WFHD 4I4WB 4G6MH 3AIQA 2EIBA 4IRSB 3SE3A 3A0OA 1JUFB 2QQNL 3WXVH 4Q9BA 4R96A 3X12A 5HOSA 1ZVHA 2YD2A 5DD1H 2NY4D 4PRIB 3OHXA 1MQQA 2DQHH 4NQEE 4OM1L 4QRRA 1HX0A 1NQ6A 1OB1B 4UQ3A 4KHTH 4N8VG 1IT0A 4X6EA 3A6OA 1A9BB 5E2VL 4S1RL 5HHQA 5CZKA 1XD1A 3HC3L 4YHPA 4DKEL 2R0KL 4OM0L 3I75B 5I30L 5B38G 4GBXA 1MHHB 1QI5A 25C8L 1ZLVH 2VVSA 4RX4A 1G9MC 2QHRL 1NGWB 3W39B 3OKKB 1E43A 1MW2A 4KH2A 4RGOH 1ORSA 5JPNA 4XNUH 3LX9A 4KJQD 1IL1A 3N50A 1XAUA 1LQSR 1KN2L 4ZO9A 1XF1A 2DQUH 5BW7C 1JE6A 3ZT6A 4P23A 5DJ6B 4KTDH 1ZLWH 3OGVA 5KVFL 2HT4C 5C0GA 1R3IL 1T04B 4ZSOA 2G3NA 1NC2A 1S5HA 1GZQA 3KLHD 32C2B 2WUBL 1KJ2L 4P8UA 1CFSA 3NA4A 3BPCA 4GKLA 3MZGB 1CXIA 4NQXB 5DUMH 1T4KB 4OZHA 3Q3GB 5DS8A 2PNDA 1QSFE 3KPQB 1NCDH 3QOMA 2W92A 1TQBC 3LKSA 5HBFA 1MUJA 4KGLA 2DKSA 4PUBL 4PRHE 4NRYB 1G0YR 8FABA 3HUJA 3QIWC 5TGBB 5AG8A 5FUZL 3NIFE 4G5ZL 3PWJB 5F8RC 4QRUB 1TPXC 5DTFB 3U9UB 1U8NA 2C4XA 4JRXA 5T1LA 1RUML 4JRWA 1DVFB 4MQXC 1T83A 4GRWF 1C5BL 4HLZH 4FXKB 2BY0A 4LMQE 4O02H 5GS1C 5CG0A 2Z92A 3CVIL 3TPUB 1E4JA 1HKLH 4LSSL 4PJGB 3F7YB 4P8XA 1N6VA 4OGAC 3P4NB 5GS2D 1HNGA 2HFTA 4C59B 1S7VA 5CJ8A 4LEOB 4WNQB 1CXHA 1VACB 3LN9A 4JFVA 3U4EB 2QQNH 1X5AA 4L3CB 1M53A 1UB6B 4M8QB 3DUSA 1B3VA 1CYGA 4UIMA 3AXLA 2NCMA 2VXTL 4MZ3A 3RIFK 2PF0A 5EBWB 4GLRH 4OM1H 3UBXB 2W61A 5CXPA 3W38A 3P4OB 2XFXA 1HP4A 5E2VH 3WIHL 4NPYB 2VZVA 5HHPB 4Y4HC 4NRSA 3WFEL 1CD0A 1W9PA 4EAMA 4DKEH 2R0KH 4OM0H 3RWFB 4QTHB 5I30H 5DQJA 1LE5B 1J05B 5DVNA 3PBGA 25C8H 5EO9B 2B1HL 4I5BB 4GRLB 4I48A 2QHRH 5D7LD 3ARDD 1GJUA 4M6NL 5C0BD 4XX6A 2AQ1A 1ZA3A 4KDWA 1KN2H 3ZKMD 1K85A 1MSPA 4BSVB 4H8HA 4MXQD 2V17L 4JZJB 3TVMB 4IHOA 1U9KA 5KVFH 4ZAKC 1R3IH 3IDGA 1GOIA 1WB0A 3UTTA 3HE6B 1V3LA 2WUBH 4AC1X 5K9QI 1KJ2H 2X89A 4MQSB 2IF7A 3QUYC 3UTPD 3SGDH 5HYJE 4RISL 3HNVL 3KL0A 1WJ3A 3BXNB 5L0QB 3MRBA 4H25A 4KJPD 1D5MB 4PUBH 3BD4A 5L6YL 2IPTL 3RUGF 4GI8A 2J6EL 3QUZC 4KKBD 2WZPD 2X7LB 4J3UA 2A6IB 2IPKA 1XH0A 5FUZH 4ZUSA 4G5ZH 3BUBA 2UZXB 4L8SB 4UQEA 1JWMB 5ECJE 1ZA6A 4EDXA 3SDDD 4I8DA 1RUMH 1F58L 2X1WL 5DXWA 4H04A 1ZBVA 1C5BH 3VSTA 4M7KL 4EUPH 3BZEB 4LQ1A 2CLVA 2PKDA 3CVIH 4MX7A 4HIJA 2HRLA 3IFOA 4WFGD 4Y16C 1YZZA 4LSSH 2I9TB 2R0WL 5E1HB 4JDVB 3HG1A 1FFRA 3VGAB 1UWQA 1NPUA 4N68A 3SCVA 2FZ3A 3FFDA 4U1IA 1OARL 5CJ5A 4B3LA 3KXFD 3PL6D 1T03L 1ZJBA 4H2CA 1XCQB 1QNZL 1GGCL 1VKXA 4DO5A 1ODZA 2WPGA 4RBPK 5IFHL 3QQNA 4WI2A 1J1XL 2ZPKL 4EQ2A 1FP5A 2ZWYA 4P9HC 1TVHA 3VXMA 2HFGL 4Y5YA 4U3XA 1HXMB 1IRAY 2V9RA 3VGDA 4BYHA 1LEGB 1AQKL 4KRNA 1SY6A 1WFOA 4WEBL 3I6GB 4A2LA 3WFEH 5FGCB 4DW2L 4LCCA 3IFLH 2VDML 3OAUL 1CFQA 3CC5A 1V6XA 1QO3A 2P24A 4GPNA 1D6EA 2DQDL 4D0BB 4IDJH 4LCUB 3C6LC 3AU1A 2B1HH 5EU6A 5AAMA 1ZBCA 2G5BB 1IEAA 5JW4M 4M6NH 4PR5B 4GOSA 5F8QC 2W63A 3VG9C 4N8CL 5EU4B 3V7MA 4EBQH 4YHGA 1Q9KB 2VDNL 4RIRA 5DC9B 3K3QA 3WMCA 2V17H 5JORB 3FZUC 4RE3A 4X0KB 2HKFL 2D9CA 4P7QA 1HYRC 3C60B 4XCFL 1MWAL 2VX6A 2BVEA 5E1QA 4D6GA 3I85A 4RISH 4H8VA 3GM0A 3HNVH 4K8RD 5ICZA 2VB5A 5CSGA 3BH4A 5E5RB 3NJ3A 2D22A 2OWWA 4I2XE 4WO4D 2VISB 3FJTA 1MELA 3KHQA 5L6YH 2IPTH 2J6EH 2DQXA 4YGVB 4V1DB 5D1ZC 2YXFA 3QIUA 3T09A 3VRIA 5J57B 1VGEL 1GGYA 5DVLA 4URTB 2GHWB 4NQED 2IFGA 2JTDA 4HUKB 1B3JA 4HT1L 1A47A 2NY1C 4HGMA 4GG6E 1F58H 1J9CT 4NO2B 1V3MA 4DWSC 4L5FL 4M7KH 2D7QA 2XTLA 2CXKA 4UT6L 1K9EA 4TX6A 4Z7QE 4N1CA 5C7XL 1MCPL 4PTUA 2R0WH 4Q6YA 5J13C 1MJJB 3JWOC 3PWNA 4HJ0C 4ORGB 1MEXL 4U3HA 5HHNA 5DRXA 3RY4A 1TZGL 4CU6A 1RFDL 2E3ZA 1OARH 4P8WA 3G6AB 2VT0A 2H26A 2NY6C 4QCEA 4Z2GA 1IEHA 1T03H 4NT6B 4FTVE 1QNZH 4MD5B 1GGCH 2DLHA 1NEZB 4K9EC 2QTEA 3TF7C 1ND0B 2X8RA 1J1XH 2ZPKH 4FHBD 5E08L 2HT3D 4R3SA 1UA3A 3FRUA 2HFGH 2YUWA 4TULH 3I6KB 3EDKA 3O4LE 3CPUA 3EBAA 4J12A 2WSPA 1VEPA 1AQKH 2NLJA 4PJ7E 4WEBH 3RWDB 5KW9L 1YEJL 2IGFL 4DW2H 2VDMH 1JPGA 3OAUH 3NFSH 5K9KB 1QSFD 5D7JD 1WFUA 4HG4J 1FZKA 2DQDH 4FQ2H 1EJOL 4S1QL 4PRHD 2AXJA 1HH9B 1HYSD 1W3KA 1RZIB 2APTA 3VXRA 2FO1A 5FF6A 4UDTB 1PAMA 2CKBB 3ES6A 1R85A 4JANA 5HHOA 3ALFA 1Z32X 2VDNH 2VDKL 1ZWIA 4XPFH 4NRZB 5C07A 1ZHBA 3RHWF 3MRIB 4KROB 4XCFH 3U83A 3ZKXC 1XGZA 1MXDA 1MWAH 3PG2A 4PJDE 1EJ6A 3D52A 1R5VA 4RMWA 3AAZB 5DHVA 2EIEA 3T65B 2V2TB 3WEMA 3BUQA 1A1MA 4ML4A 3AHZA 4ALAL 3C5SA 4LDOB 3FQXA