1CXLA

Complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q
Total Genus 243
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
243
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 243
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxlA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxlA01
3DX2A 2R4SL 2PI6A 1E3ZA 4NOFA 3D0VA 2AEQH 1L7TH 1RURL 3QULA 1Y6NR 2IFFH 4XRCA 1HH9A 4BUHA 4ZNEE 2VKXA 1C08B 2XQYK 4JN1H 3GHBH 4FQ2H 3DVGA 5ESQA 3S5LA 6CGTA 4NQTA 2PTUA 4PGBB 1XF5A 4HK0A 4OFDA 2FSEA 1CDUA 2MWCA 5HJ3A 1KOAA 2XPKA 1X44A 2YD5A 1DEEA 5FKAA 3BKCL 1ORQA 5C0IA 3BZEB 4H0IA 4PJ8A 3HMCA 2DSVA 3L5WB 1A7NH 1CL7I 5HVHB 3OAZK 4PBXA 4PJBF 4TVPE 3QQ4B 4WUUE 1KFAL 2GK1B 4X4XA 1ZGLP 3U9UA 5DUPL 3BXNA 4PRDB 3WXWL 1BQLL 1NCUA 1WVZA 1NL0L 5KS9B 3MO1A 4HZLB 4OSUH 1DWJM 4G43B 3QEQA 3X14B 1N5YH 1Q9WA 3KYOB 1XH2A 1F11B 1BYBA 4LYPA 1ZTXL 1TZHB 1EDTA 1OHQA 5FHBH 1B4JH 4PJBE 3GDBA 1KR0A 4AD4A 2FJFA 1KLGB 3H53A 3VE0B 1TJIH 5AZ2L 5FL0A 3NZHH 1B3WA 1A6UL 2YDQA 1KCUL 3RVWC 4WHDA 4NKMA 5ESVA 3QNXB 1ZANL 3HLAA 1G5AA 2HRPL 4JFDE 4QCFA 2W9LA 3MV8A 5LCVH 2KZ1B 1MH5A 1QRKA 5FL1A 5FYKL 2JF7A 2WM0A 4M43H 3HG3A 1CDCA 3VFSB 5SX5K 2C4FU 3MJ9L 3GHEL 1F6LL 4LSUL 2Q6WA 3BAJA 1K85A 4PJFF 4MMZC 3MV7E 4CMHC 3AXIA 3S6CA 4JG0H 4EZMA 4PTWA 5CBEB 1NGYA 3TBSB 3QDAA 3VXRE 1O7SA 2UY2A 4R7DB 2QLVB 43CAA 1P2CB 1H0IA 3U0WH 5C0GA 3MU7A 3NA9L 1N64H 3DSNA 1UADC 3VGAB 4I18B 4PJFE 4FLOA 1KWGA 5CP3A 4ZFOB 1YUHB 3WXVH 1KJVA 3L3JB 4TUOB 4V1DD 4RMRA 4Z76B 3W39B 2DQGH 1ERNA 3NIDF 4W70A 2CRIA 2H3NB 4L5FL 4QOKA 4DGIH 1BQSA 4WDIB 2QF8A 1FL3B 4F15B 5CP3H 1LLOA 4NZRH 1WZAA 4OGXL 5JOFA 5HPMA 3O9WD 2XWJA 3EJQA 3S5YA 1N5AA 3MV9E 3O3BB 1PX8A 1A7OH 4TSBL 3QIUA 1E6PA 5FM8A 1ZGLM 1QSEB 4FNUA 2VLRA 3GH4A 5KTEH 3NIDE 5J1TC 1OAUL 1A2YB 3MRJB 2VT0A 2GJ6D 1MWAB 3E6HA 4DKDC 1RZKC 4TX6A 1DBBL 4HBCH 4UQBA 2NW3B 1CYGA 3DSFH 1FYTD 1KN2H 1KTCA 1VENA 5E8OB 1DVFB 3OKKB 3QXAB 4H41A 3BPNB 5A69A 3S2CA 3QIWC 1TVHA 3V6ZB 5A1AA 3QNZA 1A1MA 4P4KA 3WLBB 2HMIC 1DANU 2VAAB 2KZWA 2HISA 3CDGB 1WWWX 5JUEH 3QXVA 4W84A 4ISVB 3AAZA 3VWKC 5EBMA 1IEBA 3VXSB 3C5ZB 3V52H 5IFPA 1OWWA 3IDNA 4NC2B 4L8SA 1JVKA 5IMLA 2VXTH 3TNNA 2A3AA 2AXFA 4KUCD 5DJYA 2V2XB 4HIIB 4HWBH 2O93L 5C0ND 3QO1A 1ODUA 2D7TH 5ADPH 5D5MF 3OKLA 4HXAL 3K8LA 3FXYA 1F5WA 2VH5H 5CSBA 2GAZA 4FK9A 5TPWL 1LP9F 1MAKA 2VR4A 2AEWA 1EQCA 1DR9A 3HZVB 4PUDA 3S5ZA 4J1UB 2RR3A 4FFWC 4PUBH 3ARXA 5C0BB 2WQRA 5F7FA 4RGND 4LLQA 1NOWA 1W8OA 2ESVE 3NCYS 2R0LH 2LU4A 2VDRH 3EO9H 3NCOA 3FRPA 1HKIA 4ODXB 4QRUB 5D5ME 4XBGA 4LFHG 2CDFB 4PGDA 1LP9E 3MRMB 4LX4A 5IW1B 3TTQA 3SO3C 1SY6L 2VDKH 1IILE 5F9OL 5HI5C 5E94B 3O2DL 4YC2C 1Q38A 4N0FB 3P4LA 4FRWA 1G7HA 2VIRB 5FIPA 2J5LB 1W9PA 3DO7A 2IXUA 5JIHA 1BYDA 1NDGA 4PJ5A 3CH9A 2AJZA 3VRIA 1YJDC 5MEPB 3PTKA 2PYEA 1JWUA 4S1QH 2HJKB 1QI2A 4S1DC 3L6FA 3NZ8B 4YFLI 1OCWL 2ZXDA 4YR6B 3N9GL 4P2QA 4KK6C 4PP2A 3K2UL 5JXAH 3MODH 1D5ZA 2ZCLL 3CX5K 4GW4B 4S3KA 3LMJL 3TBTB 3KLAB 4HUUB 4NNYB 1OGAB 4PGEB 5ADOL 5JOEA 1VBRA 3I50H 4OIIH 4OUUA 2PW1A 4N5UA 4IM4A 4MADA 1FOBA 4CVXB 1MFEH 3LKNB 5CG0A 1EGJA 2IPKA 4KROC 1RHHA 3ARBC 3S35X 3CUJA 3V4VL 4GKNB 5IVZB 2BVDA 5T1KB 5J1SC 2YN5A 5CCKH 3C6LC 4OLVL 1X4YA 1J8HD 4JZJB 4R3SB 2KUTA 1U8KA 2NY1D 2G9HB 4NN6C 5GSVB 5CS7A 4L4TE 3MGOA 1NCTA 3GH7A 3RWCA 5IK3B 4GRWB 1GZJA 2A3HA 1F13A 4MLSA 3EOAB 4UIKH 2DWDB 2FR4B 3ISWA 1CXLA 1T2JA 5DZLA 5IVXA 3TT1H 2HFFB 3DHUA 5L8JB 5D9OA 2NZ9D 2V17H 1JGVL 4JFQA 4N0UE 4U6XB 3V8OA 4D72A 4YHYC 3X12A 1B0IA 4MNGB 3L1OL 3O4OB 3AXLA 4W6YB 3VFRB 4J28A 1VJSA 3O4LA 1WDRA 5GGVH 2HKHH 4KXZH 1F6FB 1HNGA 2EDWA 3BH9A 5IFTA 4IRSA 2BSED 4MJ6B 1OD0A 4NQVB 3R0MA 4HF5L 1ZK9A 4MB3A 5FUCC 1TQSA 4JFXA 5MI0C 3LKOA 3MNVA 3AZRA 4PJEB 1RIVH 5J9PB 5HOSA 3ARQA 4F9DA 5FYLL 2D7OA 4PJHA 1J86A 4MDJA 3S37X 5I1KH 4PMOA 3WBDA 3CHFA 3LZFL 2AJSH 5ISZA 2XKNA 3VIMA 3SE9H 3FCTB 3ZOAA 1Q0XH 2CJUH 2W59A 1EEUA 1KIUA 2VQ1A 5DJ8A 3L3HA 4G9FA 4JFZH 4Y4KD 5KVFH 2YC1B 3O11B 1KT2A 1G7QB 1HXMB 2CKBH 1MNUH 4OF8A 1LK2A 1GGYA 1PDKA 2EXWC 3LAFA 5A3HA 2Z92B 2XIIA 5L2JB 5C1MB 2ED9A 2HT4D 5FB8A 2DS4A 1S9XA 2WBJA 3ZKQD 4XVTH 5GNZA 3AIUA 1QEWB 1ACYH 3RBSA 4BK4A 2Y8VA 2F53D 2VVNA 5DQ9B 4LAJH 5BOZG 3CMGA 4W93A 1OF2A 4NWTL 2CEQA 4DKFL 3C8KB 3VFWB 1QFWI 5GZNC 1NLBH 1I1AD 5IB4B 3VDAA 5EFFA 4PMZA 3K46A 2R1WB 5E6YA 4WNQA 4FQXD 4ONGH 4NWUL 1Q1JH 3G6LA 1IQDA 5I3DA 1OGTB 2HG5A 4D6JA 1OWRM 1L7IH 4MQ7B 3DVNA 3U46A 4AZ6A 2X4NA 1J5OL 3WY4A 2JIXA 3TCLA 2EKSA 2E7HA 1JZ7A 4C7FA 5CZXD 5MENE 3ALWA 4QT5A 3UO1L 1BZ9A 1LNUA 3MRLB 3N9KA 3WNOA 5K9JL 2VWEE 3K4ZA 4ZTPL 2EDBA 2P8LA 3C5SB 5T5FL 3O8XB 2ZCHH 4XC3H 4LDOB 3RTQD 5KVGL 3SDXA 4MB4A 3ZYOA 5D70H 3CCHB 1NBZA 3D25B 3I02B 2DTMH 4YUEH 4JM4L 1ADQH 4FABH 1EHXA 2HKFH 4DGYH 1U0QA 4J4PD 1RUQH 2F5AL 2CNCA 5GGRB 1KJ3L 4Z95L 5JW5A 4NM4H 3UJTL 3DUSB 3ULUL 4IRZL 3VO0A 5BZWA 3DETD 4OUOA 2D7MA 1V0LA 4YO0B 1V3JA 1XT5A 3NSNA 1MJ7L 1MLBA 3QQNA 1F3RB 1JHKH 3FMGL 3IJ7A 5TH2B 2F19L 1PIGA 2A6IA 3I85A 5C70A 1SYTA 3QUXB 4HKZB 1WBYB 2OTUB 1J0JA 4M5YH 1D3CA 2BNRD 2XM2A 4M6NL 1E55A 5FGBC 4Y5YA 3HUJB 4QHLB 2FJGA 2X89D 4RZCB 1BFOA 5ID0A 3MSGA 4LSQH 3MYJB 1CFTA 5F1NA 3LCYA 1BEYH 3B8SA 4EUPA 5J13C 3CV5A 1NAML 2GTWA 1B2WL 1MW3A 3DX4A 1PG7H 4ZO8A 3C2AH 1E4LA 3WQ5A 4L9DA 2HTKC 5J6HA 4X80H 3BP7B 3P11H 2HVJA 3PJSA 4GQ9L 2QQQA 5F3HA 1LE9A 2XJ7A 2AK4E 1CZ1A 4HPGA 2MQCA 1JWMB 4BH7B 5C2BL 3O3DB 3PHSA 5EU3A 4KTEH 3FFCA 1MJ8H 5I6XC 2VL5A 4ONFH 2XVKA 1ULVA 4G6MH 3CZNA 5GGVY 5IM7B 2GW5A 4L3AA 3UETA 5E1AB 3GIZL 3V0AC 2EIZA 5A3IC 2X1QA 3ES6B 4P23A 4XPFL 3CVHL 2W67A 3O6FB 5C08E 3QIBA 2R0KH 1UG9A 5E00B 4M8VA 1JF1A 3BESR 3NABL 3P9MA 2DKUA 3APGA 4PRID 5IMOA 2RBLA 4AZCA 4L8CA 1IKFH 1KXVC 1MAJA 5I18L 4K8RH 1ZAGA 4HIXH 1T6WA 4GMSH 1LWJA 5ESAB 3W37A 5IFHL 2VX6A 3PQYA 2XFXA 2B4CH 4IIQC 5D9NA 1JNNL 3FQNA 4ZDHA 1FVCA 1YN6A 1XHGA 3QDME 4H0GA 4KK9C 4R0LB 5H35A 1IEHA 2F54E 2ZWYA 2Z31C 3LQAH 2BSRB 1UWEL 1DHKA 2FWOB 4YLQT 1GYAA 1MSPA 3SJVB 2ADGA 4KJWD 3X3GL 3CFKA 4Y5VB 5C0EB 1YA5A 4DQOH 1JNDA 3E2HB 3HTLX 3RY4A 1G0CA 5J8OA 2IQ9H 4Q6IB 1YEKL 1UD6A 1P4BH 2VXVH 5D72H 2YUZA 4I3RL 5DRXB 3ZIZA 3GNRA 3QOMA 3T0EC 2F58H 2XVPA 3T1FB 4W81A 1K8DB 2Y72A 3LEVH 3DX0A 1D5XB 1E4XI 1OSPL 1W2KT 2J7LA 5ENWA 4F7PA 3HN3A 1MHCA 4HD9A 2CUMA 1QVBA 5HVGB 5DA0B 4MA7L 3VSUA 2H41A 1I75A 1UZ6F 4WRLA 3RPIB 1MF2L 4S1SH 2A0LD 3F5WA 1RZFH 4NRZB 3EDFA 4HCRA 3QH3A 1A4JA 3QXWA 4TX8A 4QTHB 4QOKE 3LH2L 1YMHB 3VFMA 3RWDA 3DO3A 4BFIB 3UDWC 3BAWA 3GMQB 1VCAA 5T1DL 1GOIA 3DTXA 4DZ8A 3VINA 3HC3H 3BW9A 4WSJA 1UZ6E 1AO7E 3HPJB 4HKXA 5FV2A 4KKLD 2VLRE 2A9NL 1U3HD 4CU7A 5I1CH 1ACZA 2WVVA 3QPXL 1RY7B 3MRHB 5L8LB 5HGBB 1E4WH 4YXKH 2XACC 2ICWB 4WO4C 1REIA 2ADFH 2XN0A 1T7YA 3ZE2F 1BJ1J 1KN4L 1NGPH 1I8IA 3CHDA 4X0KB 4AJ0A 3PWNA 2EIDA 5SWZB 1V7NH 1FZJA 3BEVB 2A6JB 2GSGB 4WV1C 1V08A 1W1YA 4ZOAA 1U3JA 1UQZA 4CGTA 3KHOA 2OJZH 3KLLA 4PJDB 4GFTB 4GI8A 4JVPA 1QRNA 3ZE2E 5JA9A 3AICA 5GJTL 1P7KA 3QRFM 3OJMB 2DM7A 3H42H 2F7RA 2OTPA 3AVEA 2IBGA 4NSBA 2F8VA 5AZEL 4LCYB 1DBJH 5D7IA 3OBAA 1BBJA 5FM5O 2UWEB 1QQDB 4RFEB 4IRJB 4HS8L 3W82A 5FFLA 3W0WD 3WH7A 2YN3A 3HZKB 3UTPE 3RVXD 5LGHL 3AI0A 5I9QC 3KPPB 4O58H 2VC2H 1BMGA 5F6HI 3RDTB 4P2CG 3SQBA 1UD8A 3QG6B 4NXSA 3TJHD 4XMKL 5DURB 3STZA 3UJIL 5I66B 1FRGL 2Z91A 1XGUB 3VX1A 4JGMA 4NQCE 4Y4HB 1BVKB 4R6UA 3Q5TA 2CDGB 4PB0L 5LGJA 3RP1A 2J7BA 5EDXA 5AD0A 1TG7A 1OQXA 3HI5L 5CZKA 1LDSA 3V5HB 1GGBH 4OZHB 2AJVH 4DCQB 1MRDL 3D3VB 1ZLVH 5EC2B 3I9GH 3LRSA 4M7LH 1WAAA 3EKCA 1RFDL 4C4KO 2YMXH 3WL9B 5A2JH 2EH8H 1HDMB 1M03A 2PBOA 5CGYD 4OFIA 1QX1A 5KVEL 5D2NC 3NH7H 1AKJD 2VAJA 3QHFH 4GW5B 2MKLC 3UBXA 5C6TL 3L95A 4QP0A 1S9WB 4XPBL 1ZA6A 2G3IA 4G6AC 3O9WA 3OKDB 4PJIA 12E8H 4QHMA 3T0AA 1EHLL 1WZ1L 1EH9A 4RNRA 4W6WB 4X9GA 1A6VH 1JK8A 2NTSP 4X6EB 1NC4D 1N0LA 3BUTA 2QQNL 2GJ6A 4OKVB 2SEBB 2HAZA 4JO1L 1FYTA 5BOPA 3QEHA 3RIAF 4ORGB 1HNYA 1CFQB 1AFVL 4HSQA 3TN0B 1B0WA 4Z7VA 2AEIT 4Z8FH 3I2CL 4HJGB 1EFXD 3EZJB 2WP3T 3FO9B 5E2TH 5IVXF 5M3WA 3D39B 4JO4H 1ESWA 1AD9B 4HG4J 2HFGL 3HMXL 4YDVB 5DSCB 4J3SA 3V6BR 1TENA 1ZVSB 5E6ID 3MRQB 1SJXA 3BSZL 4Y4FB 3RO8A 1A7RL 3BPCA 5E2JA 4WLCA 4M9PA 4LVEA 4P49A 4MA8H 4X6CB 3HKFA 3A6BH 2VISB 2XN1A 3O6ML 2OR7A 1UB5B 3O6KH 5IVXE 4QRSA 3DMMD 4KWUA 2Z4QB 4H26A 4PJ7A 3PDGA 3TP4A 3DV6A 4XNMB 1LQ0A 1IAMA 5KAQG 4KY1L 1Z32X 2VDMH 1QR1A 2C4XA 4APQC 4N5ED 1G9NL 3HE6B 5ANME 3QUML 2OJEB 2XSAA 2QSCH 5CD5C 3V5KA 1I1YB 4OFPA 3IDGA 4CU8A 5TQ0H 1NJ9A 3P9LB 2XWDA 5EPMB 4JAMB 4OTXL 1FP8A 1DJSA 4G7VL 3VGEA 4LMQI 3NCBB 9CGTA 3A6OA 1UH4A 1AY1L 3GSRA 1RJLB 3FQRB 1S9VB 3VPLA 4R7NB 4OF5A 1AXTH 3UPRA 1MQKH 4J6RH 4NRXB 2DAVA 1W72L 2IBBA 3SCQA 3KDMB 2EE6A 4AG4H 5B38B 4KMTL 4H1LA 4KKCC 2GJZA 3ZT5A 4MCYA 2OW6A 1RJCA 5D4QA 3QUYD 1BVZA 4ETQA 1FHDA 3ROLA 3SPVA 2NT1A 1JNLL 4R90H 4G42B 5DJAB 4DW2H 1DWAM 1NP2A 2UY3A 4NZTH 4QXUL 3V6OA 4U6VL 3BLKA 1T7WA 2DM2A 4G9FE 1JGEA 4PB9H 5LBSH 4L4JA 7TAAA 3FO2A 1ZKAA 4LPUA 2ZXAA 3SGJA 3SCNA 2VQTA 3BRDA 1OGGA 3VFPA 1U30A 1JXJA 5BVJA 1H5BC 5IB5B 5FUCE 4PJGA 2BNUB 5HSFA 4JJ5B 4WHYH 3MLRL 3VXUE 1YEGH 2XPGA 3K8MA 1GCYA 5GNXA 4C56B 3CPLB 4K3DL 4Y16C 1KTRL 4FXKB 2NZIA 4XXDB 4ACPA 4MQXC 1RK0B 3EDJA 2ORBL 5K9KB 4IJ3B 4KUZH 4YBHA 3DURB 3PWUA 4OZFG 1IM3A 3RVUD 3WUWG 1J8HA 2NY3B 3AIWA 1KTLB 4OCMC 1JFQH 2QPSA 4JREB 4PRPD 3DX6B 1W9XA 4QLKA 3BYTA 2DI8A 1IGMH 2XOTA 3AMLA 2W1NA 3U1SH 1HL9A 3WY3A 3MCKB 1FHGA 3ETBF 2ZZUT 4FQPA 4E2OA 2DT0A 1OY3B 3WFDL 1XCQB 5LQBL 4G6FB 1IT9H 1QFWM 4F58L 3L3OB 3PV7A 3ESUF 4UINL 4Z7OF 4H2CA 4HZAA 1M6OA 2DQJH 2Z0BA 4LDEB 4Y19D 1MFBL 1LO0H 4TOQA 3GI9L 1KYOK 5KSAB 1E0XA 4WI4A 1MREH 2VJXA 4CJ0A 1OT1A 1F3DJ 2J8UB 3EDDA 1MCPH 4PYHA 2QHAA 5IGXH 3VH8A 3ZT6A 3OX8A 5GSRA 4AMCA 1I7UA 3SCUA 4MJIB 1YQVL 3HG1E 4Z7OE 1NMCC 3S97C 1DN2A 2GFTA 3OLDA 3N85H 2AJXL 3BP4A 4EI5C 2H32B 4N9OB 5HVFB 4WFHE 2FX9H 1BX2B 2CGRL 4U6YA 1PIFA 2KL6A 4C54A 4L29B 1NARA 5D2LA 4AIUA 1BD2B 1MIML 2JALA 1F4AA 4WCYL 3H8NA 3OXRB 3IJHA 3UTSE 2QQKL 3B9AA 4OZGB 5IVOA 2BS9A 2AABL 5DRNB 4RAHA 4U5KA 1IZJA 3HZYA 1E4NA 3KXFB 2D9QB 1R87A 1RURH 1YZZA 3NCCB 4OZIF 4I2XB 1E70M 4Y4KA 2WBKA 3JSSA 1PG7X 4NBXB 4NJ9L 5CD3A 5DEGA 4PJAB 1FZOB 2X4TB 3ZKXB 2GSJA 3AIEA 4F8XA 4KI5D 3LB6D 5I1LB 3GSNL 2V38A 3BKCH 5IEHB 4OV6F 5E5UB 4TTUA 3ZSTA 3BIBX 2F53A 4D0CB 2BXYA 4OZIE 3S3SA 1BIIA 3THDA 1VBUA 5F3BB 1WIPA 5EOTB 1IRAY 1ZWIA 5DUPH 1ZLWK 3H0TA 1I1AA 3WXWH 1BQLH 1M05B 4FQHA 1NL0H 2EJ1A 4JFSA 2ADJA 3WIFB 3IJYB 5CINL 4Z2IA 2OXGA 5GGRY 4M7LT 3VWJC 4FQXA 3KPNB 1ZTXH 2WNWA 4C7GA 4CJ1A 2B1AL 4JL2A 3QA3B 5CJOL 4LLWA 5HHVL 4I0CC 2VRKA 3GMLA 4KKBC 5AZ2H 3QFJE 2XFRA 1WTGT 4EKJA 1A6UH 4JGUA 5C3LD 1KCUH 2GFBA 4XNQB 1U8PB 1YPZB 1ZANH 3RTQA 1QHPA 1MFVA 3MUIA 2HRPH 4G9DB 1PX3A 3IDIA 5L0QB 2BVUA 5JO5A 5CP7B 4AQOA 4NRSA 2VR9A 5DD5L 1E28B 4J4PA 1BP3B 4WJ5A 3C2SA 4H1LG 5FYKH 1OT2A 2CLZB 3ZKMD 2VX5A 1S7UB 2ATPA 3ECBA 4L4VE 3FTGB 2D0FA 5FHAL 4LLVA 3L3GA 2CUHA 2VTFA 4BQ8A 5DDHA 3MJ9H 3GHEH 3MUHL 4LSUH 4LRIC 4R4BA 4FQQB 3WEMA 1NANI 3DI2B 3OAZH 4NKDB 3H3PL 1JFXA 4JDTL 5JPNA 3VIFA 5KAQF 2F5BL 4X6FA 3IVKB 5F88A 1FJ1B 1T04B 4EI6A 3PWVA 3OGOE 4GQQA 4PMRA 3VUPA 4AYSA 4WI2A 43C9B 5CEZE 4CD8A 3D2UD 2X70B 3OAUL 3S9DB 2O9TA 1PY9A 2L0DA 2BNRA 5BRQA 3NA9H 5D1XC 1IZKA 4Y88A 1CTNA 2Y5TA 3I6LE 2N4IA 32C2A 2X89A 4IOIB 4WI7A 3GZAA 4X4ME 3H7BA 3FOMA 3OV6A 4L5FH 2P8MB 4LHUB 1H3TA 1TLKA 2BNQE 2C1PB 1BZ7A 1QSFB 4M5ZL 1MXGA 5E8PB 1Q94B 3BH8A 4OGXH 2ZUWA 2LAAA 4I3SL 3CFDB 1CLZL 4JRWA 5DJXB 3TF7C 1WDPA 1S7WA 1WIUA 4XXCA 4TSBH 1H3VA 4E41B 3PWPD 4I0KA 5A8MA 1UZ8A 3WH9A 4BCEA 4B16A 5J1AA 1QSED 2EDLA 5BXFB 1OAUH 4UDTB 5SX5H 3QQ9D 5FF6A 2H26B 2DSUA 1US2A 4WEBL 1AI1L 3MXVL 2WLZA 2FH8A 3T0EE 3MJ6A 3HMWL 2COQA 1TQBB 4H25A 4HLJA 4NKOA 1MCDA 5L6YL 4ODUA 4OM1L 1K2DB 2XWTA 1BGXL 4B53A 3MV7B 3NIFF 1GQIA 3Q6FA 3RVVC 5HHXL 2EDJA 4CUCA 4LCCC 5FA4B 5I23A 3L3IB 3BSGA 2LVEA 4HH9B 1DVFD 1FNLA 1MHHB 3WS6A 1NLDL 1C92A 1AP2B 3KS0J 3ULVC 3N06B 3S4SG 3VH8G 4PRIA 4ZD3L 1QNQA 1DQQB 1HQ4B 1UCTA 4XNZB 4EN3D 3MRNA 1CICB 2D03L 4O4YL 1QRNE 4LKCA 4PJFB 5ACMA 5KW9H 3ORJA 2E7LA 1N4XL 1W0VA 3CZFA 3VIIA 1IEAA 2R2BB 3VXSD 2YD2A 2EEDA 1QVOB 4HIJB 5EBLA 2W92A 4CD6A 5AYUL 3EFFB 4UV7L 3G04B 4RA3A 3VXOA 4PV9B 1S5IL 2HT3D 2OP4L 2WCGA 3DV4A 4L9LB 2W63A 4RIRA 3MV9B 5HI4C 2YPKA 4HXAH 5IFJA 3AIQA 2J12B 5IWLA 4R4ND 1F2QA 3EBAA 3H9HA 2WMPA 1UWGL 2HTLD 5JW4M 2QQLL 4NQED 3W6LA 1UM5L 2EIBA 1YNTA 1KWKA 4JDVA 3BPLC 3Q6GL 1D9KC 3MOBL 3NA4A 1S7SA 1HK6A 3KYNB 1SY6A 5C0BD 1UJTA 4PGCB 4MDOA 3VCLA 4RAUA 3TM6A 2VYRE 1ZT1A 1LE5A 5BROA 4N1HB 2FJHA 2PETA 1T7XA 3EGSB 1SY6H 1HE7A 5FCSH 5F9OH 2EACA 3MMEA 2RCSL 2PWDA 3O2DH 3CPUA 3VNYA 5B21A 4TPRL 4KK5D 3DC0A 2VE6B 3MBEC 2TAAA 4PTXA 3EO1A 3WF0A 2GJRA 4PJ9D 4ZXLA 3WS3A 4AD2A 4HUKB 1AGFB 4J27A 1B0GA 4HKJB 2EDFA 1OCWH 5D1QB 1FL6B 3A6CL 4WI9A 5I8CA 5ABGA 5JHDB 3N9GH 1ZT4A 3PGDA 3IF1B 5F89B 4UFHA 3K2UH 1U3HA 2ZCLH 1XSKA 1S7QA 1E6SM 3HAEG 1IGYA 2BSSA 1B6UA 4PMUA 5ADOH 5A2CA 3RGVC 2ZE0A 5IHSA 2NTFB 3BDXA 3ZYIA 2VDLH 1OGAD 2VZ1A 3S34L 4XGZB 1QFOA 3SCPA 3OR7A 3V4VH 4JRXB 2GTZA 4OLVH 1R5IA 1GOWA 5D2NE 4UU9B 2DYPD 2X4PA 4JFFE 3TPKA 3LV3B 2HFTA 4P9HL 5T3XE 3WJLA 3ARDD 1WUNT 5ACLA 3AFBA 1K3ZA 4OI8A 3LQZB 2G2RB 1UJ3B 1M7IB 2OSLB 4EBQL 2D31B 4NHUA 4M9OA 5GRYA 5H2BA 4I0PD 1FFOB 1J1OL 2QHLA 3DI3B 2DN7A 5C0FB 3VILA 1JGVH 1FSKB 2WWDA 4NDMA 3DX8B 5BWFA 5H94A 3L1OH 3VFNB 3WN5C 3W0WA 4YDJB 2YZ8A 5EBWB 1G7PB 4N8VG 4Y7EA 3CDYA 1BAGA 4HMCA 4AD1A 1X5ZA 5EZLA 1GJWA 5IVNA 3O3AA 2IAND 4ALAL 3FB8A 2P5EE 1VGEL 8A3HA 4MA1B 4UI2A 3W5MA 5DMGD 2YA0A 4HF5H 1FG9C 4WTZA 3BZFA 4OIFA 1KQZA 1FLRH 1IAKB 3D6GA 3C6SB 1R7AA 2IFGA 5DK2B 1HHHB 2K7PA 3THML 2V7NB 5FYLH 4OOZA 5E1HB 2BVPB 1PZ5A 1N7ML 1RJZA 4ZYKA 4NZFA 3GMMB 5I24A 3LZFH 3X11A 5INCB 4NZCA 3CX2A 3OG2A 2E3ZA 4Y1AB 2DLEA 2EO7A 1K9DA 2UZYB 4P8XA 5F1SA 5BMFL 2CSPA 5GRJL 3PZ9A 2PKDA 1WIOA 2NXYB 2XVGA 5GZOD 5C0DA 1DUZA 1XF1A 3NFPB 3WQ4A 3UZQA 1FGVL 5IBUB 3F7VA 4HUXB 4K3EL 4XNYL 4Z0BL 1UWXH 3T0BA 5DEZA 3GBEA 4X99B 5HHNB 3RWGA 3AMCA 4AW7A 4A6YB 2BERA 4HX1A 1NC4A 3KGRA 1AGDB 4JHZA 3BZDA 4GKSA 4MNQE 1H0DB 3QDGB 2ZG2A 3FQWA 4NWTH 4DKFH 1N82A 2P5WD 1RZJC 3KPSD 1RULL 2R1XA 4TNWF 3OIHA 3EYVA 2FLRT 3V0WL 2JJUA 4NWUH 3U7AA 3ZDYF 3QGVA 3AXXA 1F2XK 4P7NA 3G5VB 3UESA 4LU5L 1MFAL 2NR6D 3VG9C 2P24A 3G6JA 1J5OH 4PJCA 1ZEAL 1OP3K 4NQDB 4NGHL 2EDTA 2J78A 5E6IA 2AJ3A 3UO1H 3CU1A 4XNUL 2FO1A 5I1HL 1NWTA 3NBNA 5K9JH 4ZTPH 5EWIL 1EAPB 3GTNA 3AS3A 5T5FH 3DNKA 5KVGH 3DX7B 4KJYB 5D7JC 3ZDYE 3MROA 1MQRA 3U7YL 4JM4H 3DMMA 3RZCD 5I2IB 5FO9B 5I17B 1QUNA 3IRPX 4YIQA 4M62L 1K3IA 2F5AH 4M7ZC 4P2RB 1J0IA 4OCNC 4AYGA 2J7CA 2X09A 4Z95H 2XZAL 3UJTH 1SHMA 4IRZH 4ZFFA 3ULUH 4H8HA 4XCFL 4KZDL 4ZAKC 5F6HJ 2WPGA 4P7OA 4LNRB 2O5ZL 1R3HA 4MWFA 2X8RA 5IEKB 3HZMB 2I5YL 5HHOE 1MJ7H 4LLUA 3FMGH 5IROA 1MAML 1AXIB 4TOYL 5SWSE 3T4AB 1EVTC 1H1NA 3KNBB 3ARRA 5DYOB 1S9YA 3X13B 2YA1A 2G75A 3C5JB 3SDDC 1X5IA 4M6NH 2FDMA 3WY1A 3BN9C 5A94A 1ZHKA 5D96C 1NAMA 4C55A 3U57A 3NFNA 3QUYA 1HX0A 2XI9A 1BIHA 2DDQL 2BHUA 3W81A 4ACZB 3QO0B 4RMSA 3WO4B 1HVQA 3QT2A 1Q9KB 1NAMH 4MZ2A 2D73A 1B2WH 2J1KA 4EQ3A 5BS0E 3PABA 2OWXA 5ID1B 4F7CB 4PLKC 3KPQA 3SUTA 4J7RA 1NWSA 2VLJB 4WFEE 4GQ9H 1QBAA 5FECA 1RPKA 3MXWL 2IUZA 5F9WC 3B43A 3RWJA 1NCBL 3ARFD 3U30B 5C2BH 5KSBB 4P8VA 1IVLA 1WGOA 4WHCA 2HVKA 2LU7A 3CVHA 1GQKA 2EDNA 3BIKA 5FD0A 1D5BA 1OW0A 1GVYA 5HGAB 4WW2B 2WYSA 4LCWE 3GIZH 2YL9A 4XPFH 5EBGA 2ZUQB 3CVHH 3TONA 1XF3A 2A9ML 4UIMB 3TC9A 2GI7A 4HGMA 1IGTA 3NABH 4GJTB 1KXTB 5IV2A 3K80A 4ODVL 5I18H 3IDXL 5JW4Q 3TVMB 3CFJB 4W7WA 1QHOA 5IFHH 3FT4A 4JHBA 1I4FA 4J8RA 1JNNH 5F21B 4OF0A 4KRUA 4XTRC 3RA7L 4MVBD 1C5CL 5EO9A 4X0VA 4Y19A 2QR0A 3KL5A 2VR5A 2XRAL 4CRPA 3LXBA 1QLFA 1UWEH 4WHTB 3X3GH 3W5NA 3RPKA 3DXAB 2FH6A 3NGBC 3TBYA 4G8GB 3BQUC 2WIIA 5DRZB 1IM9D 5A40E 1YEKH 2BY0A 1QYGL 4I3RH 4X6DF 1SJEB 1I9EA 1JPSH 1MFDL 3N13A 3U6RB 2PO6B 1OSPH 2XKUA 4MJ4A 1YN7B 2H6PA 5I16A 2JJWA 2EDKA 4MA7H 1E6OL 1U8IA 2JJSC 4N0YL 3O2VL 3D9AL 5EH1A 1MF2H 5C2UB 4Z77B 3WELA 5TGBA 3B6SA 1TZGL 2A77L 1DBML 3MUZ1 2VERN 4P5TB 4X6DE 4FA8A 3LH2H 4B41A 5DJ2A 3MNWB 1R5VB 2FZ3B 3VJ6B 3PN8A 5ITFB 1X5LA 2D7PA 4M93B 2IH1A 1GSMA 1HHJB 1QA9B 4LVOB 5T1DH 1C08A 2C7UB 4OCRL 1H0GA 3IETA 3H9ZA 3B5HA 5JMRA 2A9NH 2EC9U 3QPXH 2JK5B 2ZUTA 3GRWL 4C58B 3TBVB 1NAKL 4KDWA 1OTSC 4OLEA 3L5WA 2Y36L 1KN4H 3MREB 4Q0XL 5DJDB 3BZ4A 3QQ4A 1NMAH 1OAKL 2YRZA 4R97B 1X7QB 2B8OT 5LAXA 2VXUL 4PRDA 3VI3F 1JCKA 2H2SC 3NMEA 3WD5L 3QDJD 4AM0A 4G43A 4M48L 4R2GB 5E9DE 3KYOA 4OD3L 4WKFA 3IU4L 1NKRA 2EPNA 1F11A 1MCLA 2EYTB 3IS1X 2YXFA 3EYFB 3H9SD 3SQOL 1FZMA 3D69B 5GJTH 5T1LD 5E1QA 1GHSA 4IDJL 1UR0A 3VI3E 1KPRA 1AC0A 5AZEH 3NJ3A 3ULVF 5BVPL 3VGAC 4I18C 4HS8H 4OAWB 4JPIB 3CAFA 4CL7A 1B3VA 5C07B 1F97A 3EO0B 5LGHH 3CLFL 1KEML 3C9NB 3I3BA 4F15C 1INQB 4Q6YA 4XMKH 1FRGH 2OI9B 1JI2A 5C0CD 4PJXB 3ULVE 4PB0H 2A83A 3ZYZA 4HJJL 4UMGA 1HH6B 1MRFL 1NFDF 3QI9B 2IQAB 4D9QD 3HI5H 1JWSA 4JZOB 1P84K 5EZOL 5CBEA 5LJYH 4TN9A 2OL3L 3TBSA 1B1YA 2PTTB 2XGIA 1MRDH 4N0CC 1WITA 4TVPL 4WGVB 4LF3B 2JLLA 3ARYA 3RMEA 2YIHA 1XR8A 1CXEA 4ZFOA 1WKYA 4DFIA 3L3JA 4TUOA 5KVEH 4JO3L 1NFDE 1R3LB 5C6TH 3Q5OA 1AE6L 2H3NA 4NRYB 4PY7A 4XPBH 1ZJAA 2DIBA 4V28A 4HU0A 4P46D 2Z35B 4YE4L 5BRZB 3QIBC 3WIHL 1EHLH 3PWPA 1WZ1H 3RVTC 2R1YA 3C5ZC 2JIWA 4NUJB 2PB1A 1QSEA 1W1TA 3P4OA 5J56B 4X6BA 2QQNH 1LL7A 3GSUB 2YUVA 3LQAC 3HRZB 4A6YH 4EANA 1MLCB 3MRJA 4JO1H 3QIWB 5SWQB 3SDCC 4ZO6A 4JVWA 1QFUL 2NW3A 2GCYB 1AFVH 1JF6A 3I2CH 2R23A 1HILB 4I48A 1JD9A 4LQFL 5E8OA 3MRFB 3U82B 1DVFA 3DX3A 4TVDA 3TA3D 1A47A 3HRPA 4WFFD 3VWKB 3ARGD 2XWBB 1C12B 1HJQA 3EMCA 3PHQB 1HSBA 2HFGH 3HMXH 1JDAA 1FFPB 1NCDL 5KZ6A 5F7EL 1CDIA 3B3IB 4EN3A 3MACL 4O2CA 3DARA 4CKQA 4UOZA 1JUFB 4OCLC 3CMJA 4KVCL 1T83A 3VXSA 5K9OB 3T0XA 5LGKA 1CS6A 5FKPB 5GS2D 1XGRB 1X5FA 4B5EA 2XN9B 5HYEA 3QUMA 3O6AA 2OX5A 2AKRA 1NCWL 4GG6F 4U7MA 4KY1H 1U8JB 4HIIA 1C90A 1G9NH 3PZNA 3W0WE 4CU6A 3WL1A 4MNMA 3QUMH 3QR3A 3WH8A 2X4UB 3QUZD 2ZG3A 3HE6D 4V2BA 5I1IL 4HWUA 5AC4A 1W72A 3OG4B 4NQEA 3ZHLA 4G7VH 1BOGB 3NCYP 5F7UA 1JPTL 2WWCA 5JOPD 4GG6E 1AY1H 4JKPL 3GMNB 3HZVA 4ZUSA 2EDXA 4J1UA 1VGKA 5EUOB 5C0BA 1HYSD 1DLHA 3DYPA 2X10A 2QADD 1W72H 2PWHA 5HYJD 3RIFK 4KMTH 1WQVT 5A6LA 4YC2B 4QRUA 3VIGA 2DQHL 3VA6A 2CDFA 1I9RL 3CFIC 3EDKA 1N6QL 1E1EA 5D4YA 4ZOCA 1AQMA 3VM7A 4OKDA 1JNLH 1S78C 2NY4B 2F18A 3P30L 3V95A 1AC6A 4QXUH 5IHZA 4U6VH 3MBXL 1O0VA 2VIRA 4X4YA 1OP9A 4PYSA 4PJ9A 3UYPA 2GJPA 4ODTL 5CFHA 4HC1L 4NBYB 3JV6B 2X0YA 3W9EB 4JZJC 5HY9B 3KYKL 4XPTL 4NNPL 1NGWB 4MD5B 3MLYL 3NIGF 3NZ8A 3RFZC 2AOSA 3KE0A 4YR6A 4Z2LA 1VFAB 5TE4H 4PRHE 2R2HB 4TVUA 3MLRH 4QRRB 3G6JF 3WYRA 1ZHNB 4FTVD 3KLAA 3TBTA 1OGAA 4HOZA 2VLKB 3BYYA 4K3DH 3O4OC 5EFIB 4CVXA 3C6LB 1DLFL 4F7TB 2D0GA 3NIGE 3LKNA 1I3GL 2ORBH 4NN6B 1S5HB 4PRNA 4OV5B 4MHHG 4BFBD 1Z5LA 2DYPA 4QRPE 1X5JA 3G6JE 2C1OA 4HTYA 2D3NA 1NBVL 4W85A 1ZBCA 2FO4B 3JV4B 3PIQB 3ARDA 3C87A 5GSVA 2G9HA 1H3UA 1IC7L 2AV7B 4ZUVA 5C7XL 3WFDH 4ODBD 5LQBH 3UBXI 5EZJA 4F58H 3QSKB 1E43A 3KLHC 3GB7B 2DWDA 4PMDA 4UINH 4I0PA 4U1SA 5ACZA 3O81A 4OJYA 1Q9OB 3Q3GA 1MFBH 1TQVA 2ITCA 4QF1A 1HSAB 2CIKA 2HFFA 3GI9H 3QNYA 1HOCB 3EHBD 4YHLL 4C7DA 4FQCL 1G7JB 3BO8B 4U6XA 4PCSA 1LEIA 2ZX5A 3RNQA 3WBEA 1JRHL 5J11B 3MA9H 3RILA 1NFIB 5FK9B 3VFRA 3PWJA 1DDHA 5MI0B 4KKAD 1YQVH 4BA0A 3FB5B 2YKLL 2AJXH 2A3EA 2OQJB 2XYCA 4HV8B 2CGRH 1BVLA 1GIGL 1SQ2N 5FGSA 4U5IA 5HYQB 1MIMH 4WCYH 4PJEA 1BQHA 1D7FA 3RKDC 2AABH 5F7LB 1U58A 4D6EA 1TCRB 1CE6B 3RJDA 3P77A 3GSOB 4YHIA 3GXFA 4JANB 1HXYB 1WT5A 3FCTA 1CGTA 3NSXA 3L5IA 1CR9L 3GSNA 4NJ9H 4L3ED 2PC8A 3KZSA 2HP4A 1UWSA 3CHEA 3O11A 1XIWD 5F9JB 3P4MA 5I19L 4OF7A 2O9OA 3POCA 3L3KB 3BVUA 1XGYL 3GSNH 2VRQA 2Z92A 4OLXL 3KEHA 1DWGM 4OI9A 5CJQL 3O8XC 1VEPA 3UERA 4Y5XC 2VNCA 3SN6N 3O2WL 2FD6L 4M80A 1JYWA 3OKMA 5DQ9A 1YEDB 3KPSA 4JFYB 3FZUD 4HOWA 3VFWA 5CINH 3UTZA 2C3VB 2DF3A 5C0NC 1IL1B 5IB4A 3HNTL 4PYGA 4U49A 1EDGA 1CQYA 1L9MA 1MCRA 4B3LA 1F8TL 1WLHA 2B1AH 1PY4A 2OCFD 2V5MA 5CJOH 1OGTA 4Y2DC 5HHVH 1CWYA 1WDSA 1VFBB 4GBXB 4DN3L 2E9MA 4EEEA 4LDLB 2V5YA 5I0DA 5L7XL 1I7RB 3PGCB 3WFEL 3QUXC 1NOUA 2X40A 1I3RB 4HPOL 3MLTB 4RA0C 3HC0B 1Q9LB 2C0HA 5LXGL 5M17A 3OHXA 3RZCA 5DD5H 2CRYA 5DMKB 3CCHA 3SGKA 2CHOA 1ZS8B 4X9YA 3I02A 4AEHL 2VQUA 4N68A 5FHAH 3MRGA 1PQZB 1P4LB 4KGJA 5ETUB 4LEOB 4YHNA 5HHQA 3WF2A 3H3PH 4D6IA 4JDTH 5HYSB 4B7IA 4X7DC 2F5BH 4WW1B 5K9QI 1ZLWH 3CDFA 4NYLB 1AMYA 4TVPD 3OAUH 4WUUD 5TH2A 1E5JA 4AIZA 4TUFA 5DO8A 4JAWA 4HKZA 1WBYA 5EB9A 3RUGA 3GSWA 4NT6B 2ZX6A 1WBZA 2R2EB 4U1MA 2Q7NA 2K1MA 1JIBA 2VZUA 3HUJA 1CD1A 4KI5F 4M3KB 4JHAL 1W1VA 1I85C 4BQ9A 2CPUA 2E6QA 4L3CB 3DRTA 4AQ1B 1BFNA 4M5ZH 3MYJA 5IJKA 1GZPA 5D6CA 4LHUD 1N6UA 4WWKD 3O6FC 2G60L 3S36L 5A2KH 3V79C 1OINA 4I3SH 1JGLL 1CLZH 2XZQL 1I9IL 1KULA 4G5ZH 4GRMB 3AU1B 4LGSB 1H8SA 4KI5E 3PNWB 3TZVB 4ZO9A 3F7QA 3O3EB 3BP7A 4L4VB 5KS9F 3L4UA 5H37G 3WUGA 4WEBH 4ZS6C 5I78A 3MLSL 1AI1H 3MXVH 3SKNA 5BW7C 1MCJA 2BHYA 3SCMD 1JWMA 4LLYB 1CG9B 5K59F 5L6YH 4OM1H 2Q20A 3K4DA 1BGXH 2UYLA 3O3DA 1Q72L 1F4YL 2ZJSL 5HHXH 4DUWA 3U4EA 2DT1A 1Z3GL 3MV7D 4GZEA 1NLDH 5IM7A 2DQEL 5KS9E 1VADB 4HAFA 1WBXB 2R15A 4JM2B 4GH7B 1PS3A 4JCLA 4ZD3H 5E09A 1JNJA 1E6ZA 5E00A 5FM5M 4ELKB 1R5WA 4BQ2A 2W91A 2D03H 1AIFB 4O4YH 5K59E 1T1XB 1N4XH 1JD7A 5IFAH 4DK6A 5GGUB 3FB7B 7CGTA 1MCHA 3ZZ1A 5ESAA 5TDPA 1HHGA 5AYUH 4GW1A 4UV7H 1FDLL 1A4KB 3QJHB 3VM5A 1OB0A 5DQDL 1AGCB 4QYOB 1S5IH 2F2HA 4JRYB 2OP4H 4B9YA 5F6IC 4R0LA 3BP6B 1YEJL 2LVCA 3TIDB 4P48A 5CIPB 3REWA 1GGCL 5E95B 5DUBA 3MV9D 2FWOA 2IH3B 3SJVA 3FN3A 4Y5VA 1UWGH 1IM9A 5J12C 1IAOB 2QQLH 3BUYA 4Y4KC 2GVYA 3JV5A 3T0EB 3FT3B 1J0YA 3Q6GH 3MOBH 5C9JB 2XXCB 4Q6IA 3IDMA 1RP8A 4UNTA 4AZ7A 3MGTB 3ZJ6A 2XM1A 4QRQA 3ILQD 3T1FA 1R0AL 2ZOXA 2J25A 1D5XA 1FN4B 4KDTA 4GG8B 1LEKB 2RCSH 3A21A 4U1LA 1I1WA 4WGWB 1RUPL 3FO0L 2DH3A 5CXPA 4TPRH 3RPIA 1TA3B 1I1AC 1R3JA 1KCLA 3HE7D 1T1YB 3GK8L 2HT2C 4QTHA 2CLVB 3T8XB 1RZGA 1YMHA 2EICA 4RISL 4NX0A 3VTRA 2RJMA 1KB5A 4M7JL 4UZUA 4PD4J 3A6CH 4XCYB 3GMQA 1NEZB 1QWUA 4X5LA 4WO4B 2JCCB 4LOUC 1A7PL 4N9GA 3L3DA 4RX4D 4N90E 1BREA 2IWGA 2B39A 2Y06L 3MRHA 3RTQC 4GINA 1NKOA 2ICWA 1KXHA 4JZNA 4HPHA 2CMRL 3S34H 3ZT7A 1ISZA 5GRUL 2YBRA 5DC4B 3ZSSA 1A14L 5DJZA 1VAHA 3QDJA 1WAWA 3RL2B 3FN0L 2ESVD 3BEVA 2A6JA 4JRXD 4P9HH 3H9SA 2I9LB 4HUVB 4Y4HC 4PJDA 3NFSL 2VKWA 4P3DB 3MJ7B 2X44D 2YUXA 2DKMA 5C0AB 3SDAD 5T1LA 1ZJBA 4EBQH 3CZ8A 3B9KB 4ONHB 1QOXA 4MXQD 4X7SL 2BZDA 1J1OH 3LXCA 2W60B 5CSZB 4LCYA 1VESA 4DTGL 3OSKA 5E2WL 3VGDA 2M2DA 1NSNL 2UWEA 4JFPB 4RFEA 4IRJA 2YL5A 4KJPC 1N8ZB 4XBPB 5CEYB 3JVGC 1FIGL 3L5HA 4ALAH 3N11A 4PRAA 2DIAA 1VGEH 3KPPA 3RDTA 3TYGL 4RMUA 5C0CA 3F12B 3QG6A 4N42A 3CFBB 4UOW0 5KOVC 4AL8L 4KRPC 2VUOA 2E7MA 3T2QA 1BVKA 3GIVB 1GOMA 2ZCKL 5F7WC 2CDGA 2HLAB 3SO5A 1ES0B 2F7OA 4WHYG 1N7MH 3KPTA 2EKJA 4ZUUA 5L2KE 5K93A 3TIEB 1U8NB 2IBZY 1UWRA 5IKCB 4YDLC 5ICYA 4P2OD 2CR6A 5EOQL 4GKLA 3TN0C 2ZSWB 3JWNC 2I27N 5FDWB 5BMFH 4L4TD 1HDMA 5GRJH 3KJ6L 4OFVA 4BF7A 4P46A 2BP3A 1DN0A 1T3FB 3MLVL 3B2UC 1OAQL 2V5RA 3GXPA 2IPUG 1FGVH 1OARL 5HGDA 4Z0BH 4K3EH 4XNYH 1GORA 2ZXBA 3OKDA 1ZT7B 1FE8L 3CUPB 3LQMA 4DM1A 1RHFA 3LPFA 3WKML 3I6KB 3OR6A 3UR7A 1B3XA 5T1MA 4OKVA 2IG2L 4W4OA 3RJYA 1RULH 2P5EB 1OGAE 3JBG7 1TJHL 2XTLA 1ORSB 4Z7UA 3U36A 4AH2B 5JBEA 1QOKA 3V0WH 4HUNB 4H5SA 1CGVA 3TA3A 3SOBL 4LU5H 1MFAH 3ARGA 4HJGA 1V0NA 4S11A 3FO9A 2H2PD 3BVWA 3PZQA 1ZEAH 3CXDL 5DRWB 4NGHH 1GAFL 1NWUA 1O7DC 1AD9A 1FAIL 4XNUH 4G8IA 5I1HH 5EWIH 2VXSL 1F4WL 3GYCA 1U6AH 3AJ7A 3GSVB 3U7YH 5J3HD 1IGFL 1U8LA 4M8QB 4APQB 4M62H 5FA3A 1UB5A 1P9MC 4Z7WF 3LIZL 2Z4QA 5JNYA 2XZAH 5GS2H 4P2RD 2WC4A 3RIAK 4KZDH 2XTKA 2J88L 4MNGE 5HDBF 1RJYB 2IF7A 2O5ZH 3QUZA 3HE6A 2WHJA 4PJEF 2I5YH 1BM3L 1MHEB 1U8HB 4LGRB 2VDNL 5IMKB 2Y25A 5FOJA 5JLZA 1MAMH 4TOYH 5EPMA 4TULL 2X0HA 3MJ8B 2APFA 4MX7A 3DBXA 2BOCA 4QCIA 5FEBA 4RWHA 1PD6A 5EULV 3ROOA 1CBGA 3RM8A 2D7NA 4R7NA 5HYJA 2DWEB 4QRTB 1G9HA 3QG7L 5HDBE 3TO4D 1OP3H 3PZOA 4PJEE 2DDQH 5HPCA 1WZMA 5EU5B 4Y2OA 1VFOA 3MLPA 2AJUL 5D7LB 5IG7B 3AM8C 5JZ7D 5DHXB 2YWZA 1FO0L 1ISWA 5MEND 3SKJL 1G1CA 1EGJL 1MIEL 1T5WA 4F80A 3W0KA 1UQSA 4Y89A 3K8KA 2BDNL 5IF0A 3SE8L 5GHWH 3RZWA 1AHWB 1DQJB 4X7EC 4CW1B 1EUTA 4I3GA 3QUKB 3PL6D 3MXWH 3AYSA 1AD0B 1NCBH 1DBAL 1ZA3B 5C0JB 5EC1B 3CZGA 3QYCA 4FTVA 1RP9A 1BFVL 1CDJA 4JN2B 4JJ5A 3INUL 3WLWC 2YJQA 2HFEB 3O45A 2EZ0C 5KSAC 5FYJL 1R75A 3MNZB 1A02N 2QPUA 2J8FA 5AYQA 3N1FC 5IB3B 4YGVA 3VFOB 2A9MH 4XXDA 4OIAA 5F8RC 5IHUL 1MQ8A 5DD1L 3RVXC 1RUML 1K5NB 3DVFA 1FNEB 4ODVH 1FH8A 3IDXH 4PTVA 1TMCB 1LO5B 1KIQB 3DX6A 1C16B 2BY2A 2CPCA 4YZFF 4I1NB 3MCKA 4O5LL 1EK3A 1MCNA 3RA7H 5F97E 1KQYA 5IOPB 4E42B 1C5CH 2WVSA 1XCQA 4EVNB 1CXHA 3UROR 2XRAH 1QBBA 2V7HB 2BVOA 4Z18A 2WCAA 1TTFA 4NSKB 2BVQB 1N3NB 1NMCB 4YZFE 4UB0L 2J8UA 2VN4A 4CADA 2XTJB 4EI5B 3IKCA 2IXVA 3AREB 4ZS7L 2ENYA 2AK4D 5F44A 2R39A 5HHME 3MOAL 5JXED 4ELMA 1QYGH 3N1GC 1FV1A 5CSYA 1FNGB 3C60D 1MFDH 1RH9A 3BUDA 4QO1A 2H32A 1BX2A 3AB0C 1OTUD 2CBVA 1BZQK 5CJXC 1NC2B 2UY6A 4L29A 3WD4A 3D48R 1E6OH 1EXUA 3ILPA 4N0YH 5BZDB 3Q5YA 3O2VH 3D9AH 2P8PB 4K3JL 5C08D 1TZGH 2A77H 1DBMH 5F7KC 1J0KA 3HUJE 4OZGA 3SHSA 3LSOA 4CVWA 2AAAA 1QI5A 4HWZA 1B3YA 4MNJA 4L3EA 5E5MA 1OLZA 2JJTC 2DSKA 3GRWA 4OCRH 1RV6X 5M7QA 1TPXC 3BVTA 4PJAA 3OKOB 3AIVA 3QDMD 4Z5RA 1FZOA 2X4TA 5I1DA 2Q76A 2W0FB 1BYCA 2F54D 5E6IC 2DBLL 3GRWH 3K0WA 1ZB5A 1LK3L 1NAKH 1YYML 3GM8A 4FMKA 1F4XL 4FZEL 5T3ZE 1LO3L 4H8UA 3GSXB 2C8NA 1I9JL 4F9PC 2Y36H 4XBEL 4Q0XH 5GGTA 3IJ9A 3G6MA 2WUBL 4X8JB 3ULUC 3WY2A 1TXKA 5I1EL 1OAKH 1YDPB 3N1PC 2IBZX 2VXUH 4PRWA 3WIFA 3IJYA 4QY8B 3WD5H 2F7PA 4M8UA 3IGAB 2JB5L 4M48H 4LPCA 3W2DL 3BWAB 4OD3H 5FYJU 3IU4H 1VPOL 3SQOH 2JIEA 3BWUC 1Q6GA 1ZHLA 3RVWD 3HPLB 3U2SA 3EJSA 2UZXB 5B39B 2NY2C 4IDJH 1CN4A 2WAGA 4E0RA 4XNQA 4GLRI 1YPZA 3ALXA 4OIBA 4BZ1L 2C3GA 1WNOA 1UWIA 5BVPH 4QOKD 5DGQA 1L6ZA 1OTTC 4PLJC 4ZNEA 1DTUA 3SEPA 1DL7L 4TSCL 1E28A 5B38G 1A8JH 2CLZA 4FHBD 3T2NL 3CLFH 4JKWA 1S7UA 1PPIA 1KEMH 3UTTB 5B8CC 1KB9J 4PY8J 2I9TA 4UDUA 1AO7D 2JJVA 3SJVE 3OKNA 2VLRD 2GITB 4FQQA 2P45B 2OL3A 4NKDA 3FFDA 4UQ2A 1YMMB 1PX4A 4HJJH 4NO2A 5DQJB 1FJ1A 1MRFH 1T04A 2OK0L 3IJ8A 4WUUA 1SVZA 4YBQD 3SBWA 2GEEA 5EZOH 3CH8A 2OL3H 3BDYL 2MCPL 4ZFZB 4YPGA 2HA1A 3ABZA 4BKLA 4X7CC 3CSYB 4KTDL 1CT8B 5E9DB 4TVPH 2D3VA 4UBDC 2OTWB 3KWWB 1VERA 4NF7A 4P4KD 3PZGA 4YAQB 2EPMX 3C09C 3L5XH 2A38A 1QW9A 5GGSB 4JO3H 2YPLE 3RI5F 3V2AR 3VMPA 1AE6H 1BJMA 3SKMB 4LHUA 4YHPA 4WWKA 4E5XA 1SM3L 2GK0B 1Q0YH 3VI4F 3R06A 1QSFA 3EYSL 4YE4H 3VXTA 2HLFD 3WIHH 4BH8B 5JMOC 2ARWA 3RVUC 2WKGA 1CICC 4POZC 4YNYA 1A6PA 2IADA 1D5IH 4W87A 2YS4A 3IXAB 4QAWA 5INDA 4AEIL 3SCTA 4FOMA 4UDTA 3WDPP 5D6DA 3N15A 3LKSB 4NCC2 4R9HA 4LCCB 1DZBA 3FRUB 3VI4E 3ALFA 4LARL 3UTPD 1SEBB 4IS6A 1XF4B 4PV8B 1QFUH 1FFNB 4D2NA 4M82A 3QIWD 1BSIA 2O92A 4UUJB 1K2DA 1MOEA 1CE1L 4LQFH 5DFAA 5IIEB 3MV7A 2HMID 4NQCD 3JTTA 4P4RB 5FA4A 1EDQA 1T1ZB 2VL4A 2WWMC 3BAEL 4NO5B 5SWZE 1V6YA 1NCDH 3EBVA 5F7EH 3VWKD 3MACH 4ZODA 4UTBL 3F5KA 4QLJA 4KMQA 1DQQA 4UT6L 1HQ4A 4CNIA 4F33A 4KVCH 5FO8A 5ICZA 2EXYC 4PJFA 5CEZL 3MRPB 1QO3A 2EIEA 4X98A 1NFDB 2X1WL 4LBEA 5M95B 2JB6B 3SIMA 4EIZC 3DOSA 1HKJA 5CPQA 3B5TA 1NCWH 1FLTX 3GH5A 5FYKE 1BGAA 1E0VA 1CFNA 5GNYA 5IESL 3KPOB 3QISA 1TETL 4L9LA 4JE4B 1HH9B 1NGZA 3MV9A 1FAKT 4HCRL 1E4KA 2J2ZA 2W0LA 1XF2A 5I1IH 3BPLB 3M07A 2ATKA 3S5LB 3V7AG 3M8OL 2JELL 2QSTA 4XHJC 4FFWD 1NCAL 1XF5B 1JPTH 4HK0B 2FSEB 4OZHF 5HJ3B 4JKPH 4JQXC 3GKWL 5D1QC 5FKAB 1DEEB 2EO1A 5LWYL 5C0IB 4MNLA 1KCVH 1Y7VA 4RMTA 4PGCA 4C83B 2DQHH 5HI5D 3WJJC 2E40A 3BXNB 1I9RH 3MBEB 1MRCH 3DLQR 1N6QH 4W5ZA 3A4XA 3EGSA 4HC1A 4HMEA 1DQLL 3RY5A 4NO3A 4OZHE 1Q9WB 3D3VE 3P30H 1K4CA 4QWWC 3L4XA 2AXGA 4PMVA 3HE7A 3MBXH 2ZX7A 4S1DD 1ZGLA 3D51A 4ODTH 1T89C 3PF2A 4HC1H 4J2XA 4AEEA 3F7PC 4AIOA 3KYKH 4J3XA 4XPTH 2NSXA 4KK6D 4NNPH 3MLYH 3VGBA 4NKMB 3RGVB 5ESVB 1XGPA 3HLAB 1FL6A 4IOFC 5E8DL 3D85B 5JHDA 5HHPB 1JYNA 2BRRL 1MH5B 4RX4A 4HJ0D 2BJML 3DROB 1MVUB 1MW2A 2NTFA 4KROD 1DLFH 2R69L 3ARBD 1X3DA 1WK0A 5CAYB 1BOYA 1I3GH 4K7PL 1U41A 2E9BA 4OD2A 2Q6WB 1UR2A 1TZ7A 4ZENA 2ESVA 4X6CF 2A6DA 3K4AA 4JRXA 4MA1C 1NBVH 5D5MA 5C0RL 2Z1KA 3D39E 4UTAL 3D87B 2VX4A 4PSRA 1IC7H 3RKPA 3WO3B 2GJXA 5C7XH 1LP9A 3SDAA 4K55A 4QXGL 3IXTA 1QNZL 1U91B 3LQZA 2OSLA 1M7IA 2DQCL 3WN5B 2J7FA 1LDPL 2D31A 4GZJA 2GDVA 1FC2D 1KJVB 4X6CE 2UV3A 1JHLL 4YHLH 5C0FA 3TFKC 3OLIA 1S3KL 4FQCH 3UPAA 5BRPA 1E0WA 3MANA 2RHEA 1JRHH 5BQ7B 1E4MM 5JOFB 2NX5E 3EYQC 3CLWA 1UR8A 4PRHB 2XWJB 4JFEE 5F72S 2NXYC 4LHUG 4YHGA 3ULSA 2WBJD 3TTYA 2YKLH 1BJ8A 2DJ4A 3VXUD 2J62A 3BVNB 2OZ4A 2F74B 1GIGH 2X7LB 4NZUL 1E6QM 1XFPA 2AAVA 2HWZL 2GSIA 1B9ZA 2W0PA 2X42A 1HHHA 2J4WL 3WHE1 4TSAL 4P2OA 3EOTL 1X5XA 5A43C 1TVHB 2DQTL 2WAHA 2Z93A 1A1MB 3QNZB 2AGJL 1JTOA 2WMGA 2PR4H 1UVQB 1RZ8A 1K4DA 4M1RA 4XMLL 4U31A 2JIXD 1SEQL 4L4TA 3SE3A 4PLOB 1CR9H 2Q8AL 3KHQA 1JV5B 3EYOA 5CPSA 1EZVY 2EXWD 3HI6L 5I0ZA 1EJOL 1IEBB 3D5OF 1OOAA 2I07B 3MR9A 5KN5B 3AHZA 4L8SB 5T3XL 1XGYH 2E9LA 2WHMA 4DJMA 4EN3C 1T03L 4OLXH 3NCFB 5CJQH 3TNNB 4N0UA 5HHNA 4NM8H 1MCWM 2DLTA 5DJYB 4DM2A 1N0XL 1SZNA 3O2WH 4W89A 5CKAA 2FD6H 2VLME 1IT0A 5GZND 4PBVC 3P0VL 4GUPA 3QO1B 5FV1L 4GXPA 5A6MA 1EX0A 2ZXQA 3VG9B 1J05B 1UCBL 3HG1D 2GAZB 1QHZA 3HNTH 2VABA 5EOCL 3MPCA 4C56E 4NUGL 3R4DA 3G5VA 1OM3L 1X5GA 4DN3H 4LLQB 3CGTA 2DT3A 5D7JB 3V4PL 1MXDA 5L7XH 3SE4A 1GCFA 2KPNA 3DUUA 3WFEH 5D7SL 1E27A 3UTSD 2V2WB 4LSSL 4PGDB 1EAPA 4HPOH 4OFYD 5LXGH 4Z6AT 1F02I 3DX7A 1FC1A 3DPBA 1CD0A 3PV6A 2JEPA 4A3HA 2FYVA 1UA3A 4AEHH 1G7HB 1XGZA 3DO7B 4P2RA 1IAIL 1XR9B 4PJ5B 2AJZB 2X2HA 4NQUA 2PYEB 5A6KA 5DS8A 4KK5C 2J8UE 4DO4A 1WSST 2MCG1 5IEKA 1CGWA 5LVEA 3KR3L 1DE4B 2EH7L 3N1AA 4OZGF 4MJIE 4OB5L 4HUWA 2RB8A 3U7WL 4ZG1A 4M00A 5AEAA 3PG2A 3KNBA 4NKIL 2B5IC 5DYOA 5GS0C 4J3TA 4FQLL 3X13A 3MRIB 3WSUA 3U30C 5FYLE 1I1FB 1IGJA 3TO4A 1WFUA 3C5JA 1TVPA 1NANH 1MVYA 1BD2E 5CBAB 3PDOB 3W53A 4JHAH 1GHFL 3QCVL 1UB6A 5I74B 1IKNA 4AZ5A 1RHHB 4WW2C 5J6GB 1G6RA 3IKKA 4OZGE 3QO0A 3QXDA 1RK1B 3EJRA 4ZE4A 1UD4A 3QFJD 3RY6A 3V7AE 5MENA 2G60H 3KXFE 3S36H 4BS0A 5JDSA 1HJVA 3MFFA 4X7TB 1JGLH 2HTKD 1U8KB 4I2XE 1CLOH 2QSVA 2XZQH 3MGOB 1I9IH 5F9WB 2Y24A 4F7CA 1I3UA 4ZUWB 3TVMC 3EJZC 5D9SB 3ZMRA 2VLJA 3MLSH 2OSWA 2MMXA 2VCCA 2VC9A 1CDBA 4L4VD 3MLWL 1FGNL 2ARJA 1L0XA 4JFQB 1DP0A 4JQVC 1TZIA 1Q72H 1F4YH 2ZJSH 2XIDA 3AXLB 4YHKL 4HS3B 5I1JL 3P0YL 5A3ID 1UXWA 1Z3GH 2APXA 2HN7B 8CGTA 5HGAA 5JPMA 2DQEH 1OLLA 4ZO7A 1YPZF 3BH9B 2NXZC 3E6FB 4IRSB 3ZE0F 5CEZD 4UQDA 1WCQA 5ECJE 3W4RA 4UIMA 1DUYA 4JFXB 3H55A 3ULUF 4FQ1L 4P5MB 3MNVB 1P53A 3I6LD 3L7EA 3CFJA 2E27L 2EBNA 4MAVA 5EUKA 1SYVA 4KK9D 4D8PA 4QDMA 2PO6C 4DEPB 2LTQC 1FDLH 2WZEA 4PJHB 3DX9B 3JUGA 2Z31D 1YPZE 3VFVA 2BNQD 5DQDH 3ZE0E 1MCKA 3HR5A 2CKBB 4UQ3A 3HG2A 3NGBB 4UFJA 1YEJH 3OGCA 2VQ1B 4JRYD 4Z78A 1UKTA 1XZ0A 3BQUB 5DJ8B 3L3HB 1GGCH 4P5TC 3VU2A 3LKPA 2UY5A 3BKML 3HS0A 3AMDA 1OM0A 3DXAA 4M93C 3QRGL 1V5JA 4LVOC 2AK4A 2WW5A 2W38A 5DRZA 5JXEA 1S7VA 1GGTA 5GZOC 3T0ED 4PTTB 2FGWL 4GQRA 5GQBA 4K68A 3C60A 2E7BA 2MTPA 2CK0L 5FOBA 1V3HA 5E0QA 2VRJA 3JV0A 4MTVA 1SJEA 3PWLA 5IBUG 1R0AH 4WU5A 2CCRA 1M7XA 3GBNL 5DA4A 3U6RA 1UZ1A 5HI3C 4XNXL 3QZWB 5CHNB 4XZBA 5C08A 4MD0B 3VX0A 2EECA 1RUPH 2VLLB 3FO0H 4CN6A 4WNQB 1BF2A 4R97C 3G5XB 4OLYL 3OGRA 4Z77A 5MERA 4ZFMA 1R3IL 3GK8H 1QRND 3S35L 3DVNB 1NBYA 4R2GC 3CX5J 2X4NB 3T4YA 4RISH 6TAAA 1R5VA 4HDIA 2PWEA 1QD0A 4BFEA 1QSFE 4M7JH 3UTQA 5FUOL 3MRCA 2NR6C 1BZ9B 4AT6A 3LD8B 1HHJA 1LNUB 3PDDA 5KZCB 1UHVA 3CIVA 1KG0A 3QDMA 1OSZA 5F7DB 2C7UA 5EO0B 3UC0L 2F54A 1A7PH 3SDXB 4E41E 4WO4D 1NBZB 1CD9B 3MLXH 4WUKL 2Y06H 1BGGA 1DQDL 2XUCA 5IB2A 3TBVA 3D4YA 5DHVA 1F45A 2CMRH 5JW5B 5GRUH 3MREA 3LY6A 5BZWB 1W3HA 4G8EA 1A14H 3NUKA 1X7QA 4GI9A 1U2CA 1WPCA 2XIBA 3VA2C 1QLEL 3FN0H 3MCLL 2OXHA 5ALBL 5F1IB 4Q97A 5ERWA 2OI9C 1EZVX 4AMXA 2Z8SA 3NFSH 4P7LA 3WH5A 3U9PL 4XZUA 3D69A 3WDJA 3QI9C 2OSXA 3WDRA 2PXYC 1NPUA 4S10A 4HLZG 4U1HA 3BP5B 1WJ3A 3AUVA 4X7SH 5C0AD 3UCRA 2FJGB 1HJWA 4U6TA 2ADIA 1NUFA 3VG0L 1BFOB 4DTGH 2HVMA 5E2WH 1NSNH 5F9AC 4OAWA 1KSRA 2EDYA 4EUPB 2GTWB 4PPTA 5GGSY 4EDWL 1T5XB 1AO7A 1FIGH 5F1KC 1PLGL 5GS3A 1LF1A 3S96A 3WFZA 3TYGH 5J6HB 4G3YL 3L4YA 2ZPKL 1TVNA 3U5YA 4HZ6A 3B83A 4AL8H 3BE1L 3PJSB 5F3HB 1LE9B 4H8WL 2BMKB 2NT0A 2KQMA 2ZCKH 5I8EA 2FL5A 1KNOA 1HH6A 1KGCE 4KRLB 3UG5A 2NMSA 5EU3B 4L4PA 1G7MB 4FNTA 3FFCB 5KG9B 3FQUB 2VL5B 2OR8A 3ARFC 2JKXA 1HT6A 1GOFA 2ID5A 5DI8A 3WKNA 1CZ8L 5EOQH 3R8BB 2J75A 3QOKA 1HQRA 4P23B 4JFFD 1HCVA 4RBPK 3QIBB 2DQDH 5T3XD 2YEZB 1JF1B 3KJ6H 5LA0A 3U0TA 4G6AD 3GO1L 1CLCA 2Y7QA 5EU6B 1NQ6A 1FVEA 3VD9A 3MLVH 1OAQH 1AR1C 1OARH 5CKGA 2P44B 2NW0A 2XFXB 3W9DB 1FE8H 3SGDH 3BC9A 3FQNB 5BYWA 4ZDHB 1FVCB 3WKMH 1YN6B 2Z9TA 3SDCB 5JHDE 6FABL 5H35B 2YA2A 3W24A 2IG2H 2Y5EA 4K07A 3EMZA 1D6EA 1TJHH 3GKZA 3QIWA 5FYKU 2YKKA 2ADGB 1UKQA 2VDQL 2P5ED 3CFKB 1G9ML 1UM6L 5IUSA 4NQCA 2GT9A 3SOBH 3NTCL 4RFOL 4ENED 2EAEA 5E08L 3PZMA 4F79A 4GKZA 4OZ4A 2QEJA 4JFWA 3VWKA 5B22A 3CXDH 1C12A 1GAFH 2MHAA 3PHQA 2DLFL 4JRXE 1FAIH 4P59L 1FFPA 5L2KB 3ULVL 4LYQA 2XGBA 5AWNL 5I8OL 3IAPA 4GS7B 2VXSH 1F4WH 2CIIB 1JUFA 4F7PB 4X5WB 5HD8C 3VKKA 2YD3A 4NP4L 3CZSA 4MAYC 1XGRA 1KLUA 2B1HL 3F5WB 3LIZH 4APQD 1I3VA 3QH3B 1A4JB 5GS1A 4JPVL 3SUUA 5I73B 2G4FA 3RDKA 2NY4C 2BSTB 5CD5D 2QLYA 4P3CH 2J88H 5E99L 4Q2ZA 1BM3H 3DTXB 4DZ8B 4JN1L 1BECA 2WXDM 2VDNH 5DVOA 1NQBA 4CVZA 3BW9B 4HKXB 4TULH 4MNQD 5BO1L 4K94C 3T65A 1CEOA 2CXKA 2WVVB 5CILL 1RSFA 3QWRA 3EJYC 1FPTL 4F9JA 5KVDL 5DJCB 2X5PA 4JGJA 4KKCD 3QG7H 4FQIL 4XV0A 1S46A 1FO0A 1QLRB 4PUEA 4XPAL 3PWNB 5F93C 1HZHL 4KC3B 5DFVC 2AJUH 1P7QD 5DTFB 1H4PA 4O2FA 4F37F 1MCOL 4Y7MA 1FO0H 4ZTOL 4IHOA 3SKJH 4P9HC 1EGJH 1MIEH 2O5YL 4Y1AE 5EU4A 5AYIA 2EYRA 1ISXA 2VZTA 3BUQA 2BDNH 3ZJ8A 3SE8H 4NN7B 1P7KB 1TIUA 4JDZA 3LXAA 3CFCH 5HY9A 4NHCL 1EEYA 2ZNXA 2CYGA 3I6GA 4MD5A 1DBAH 1SYSB 5D7IB 2J74A 1KF9B 1VB9A 4IEFB 1BBJB 1UWXK 2NY5L 4FFVC 2GHWB 1J9CT 3HJEA 2XVNA 3WSQL 5ANMA 3INUH 3BD3A 4UZGA 3BJLA 2OYMA 4Y16D 1ETZA 3QDGE 4J3VA 4YHOL 1N26A 5FYJH 4HAGA 2VUYA 4MQXD 3ARBA 4HS6A 4PP1C 1SJHB 3OMZA 5HHOD 2V2TB 3A4AA 5DT7A 4Z7WB 3DHJA 3FHQA 5EFIA 3C6LA 4F7TA 5J11C 3IDYC 2YSSA 5IHUH 5SWSD 5DD1H 2Z91B 4YX2L 2DJUA 1RUMH 4IMLA 3LVEA 5HXMA 3GNPA 5SV3A 4JZ5A 5LGJB 4QHKI 1WV7T 1ZVYA 2X1PA 3PGFL 3QPQC 3NCMA 1VSCA 4NO0D 4NQDE 1WCGA 3T2OA 4ZUTA 4O5LH 2FO4A 3L9RB 1V6XA 2V5DA 1QG3A 2WLYA 3LKQB 4X9HA 1K8IA 1S7XA 3AGVA 4FS0A 2NCMA 3PBGA 4V1DB 3RWFA 4XX1E 5BS0D 4D9RE 5A8NA 25C8L 1V3IA 4G80B 3UBXB 1UR9A 3L95B 3WD1A 1ZA6B 4P2RE 3P73A 4XP9L 5JUVA 4UB0H 3PP4L 2P42B 3O9WB 4WFED 2FYYB 4PJIB 4QHMB 4ZS7H 5FK9A 4GXUN 3MOAH 4RNRB 1JK8B 3VXUA 2AXHA 3OTTA 2OQJA 2XG4A 4WSKA 1XYZA 1YECL 4HV8A 4CMMB 2YZ1A 4I9WE 1FYTB 4OT1L 4LCWD 3CMOL 3BEWA 3OJVC 3MA7A 4K3JH 1I7TA 4WTWA 1RIUL 1RPQA 1KN2L 1FCGA 4Q22A 4DWSC 1OB1B 3M7SA 1TCRA 1CE6A 1NUGA 1H2JA 3S36X 5MP6L 5IT2H 3HNSL 3BN3B 5KSBF 3CLEL 3QXTA 3J7HA 1PBGA 5T5NF 4GBXC 4MXWL 5DXWA 3MLZL 2XWEA 4Y5XB 1HIZA 5B4MD 5CQ1A 3L3KA 1U8MA 5MEQA 4M6OL 2DBLH 5F7MC 2QV4A 2Y8KA 2R0ZL 4WW2F 4U4BA 1YYMH 4BUGA 2JEQA 5IXEA 1F4XH 4FZEH 2VLJE 1MEXL 4QRSB 1LO3H 2K7QA 1NCCL 1I9JH 4PJ7B 4XBEH 1FZKA 2MANA 2WUBH 5I1EH 1D5MA 8FABB 2AQ1A 5KJRL 5KSBE 2MFNA 1QR1B 3VWJD 2FIRT 5HHMB 4PRBA 1Z6JT 5ICXB 3HG1A 4Y2DB 1RZJL 1UFUA 2C3VA 5ADPL 1NDMB 2JB5H 3W2DH 1ISVA 3X17A 1NJ9B 2EO9A 1IL1A 1KEGL 2VH5L 1FG2B 1UASA 1VPOH 3BLPX 1EIBA 4KKBD 3WUEA 4RGNB 4JQIL 3RHWF 5TF0A 1HXJA 2DD8L 1ZL1A 4UV4L 2VMFA 2A73B 3JUZA 3UTSA 1E6RA 2WINA 1M53A 3PGCA 3UCQA 1J01A 4BZ1H 4OFYA 2GJZB 1YY9C 2YLAA 4HZ8A 4DN4L 1I3RA 3QHOA 3MLTA 2VB5A 3HC0A 4ETQB 3MUY1 1XSJA 1P4IL 3ROLB 5BV7L 1DL7H 3FQXA 5DMKA 4M1CC 1ZS8A 1TQCB 1J0HA 3T2NH 2YFOA 2CRZA 1QFHA 2DMKA 1RI8A 3KS0H 2WSPA 4F2MA 1E5NA 1E4IA 3BH4A 4JLRA 4EUPH 2W61A 3DXAE 2IC2A 3L7FB 3O9NA 5GJSL 3EIFA 4G8GE 1E6JH 4OZIA 3HB3C 2OK0H 1EO7A 1BLNB 4ATLA 4NYLA 3TZVC 4OLWL 2H8PB 3BDYH 5D1XD 2MCPH 5FGBA 2VOTA 2XPGB 2WZIA 2E9WA 4KTDH 3RL1B 2V5SA 3U0PA 1A5FL 3HHRB 4NOBA 4MXVF 2RFXA 4LHJB 5E9DD 1GC1L 4URTB 2VITA 4MSWA 3QAZC 2GY5A 1WFNA 2DQFA 4MZ3A 3TO2B 3DIFA 3QFJA 4L3CA 1IM3B 1SM3H 3T08A 1J8HB 1M71A 3JWOH 1FVDB 3EYSH 3RCNA 2VDOL 1HN1A 2NY1B 4JM2C 3GFUA 2WC3A 2IMMA 3BJ91 3QFDB 4TNVK 2BC4B 3FOLA 4MXVE 1MCIA 3UEQA 3AU1A 4AEIH 1A6ZB 3PNWA 1UZ4A 1KBBA 1I8LC 1M6OB 4L4VA 1KCRL 4GRLC 1CGSL 4LARH 1RZIA 2W62A 3RVVD 3GXTA 2J7EA 4LLYA 4UFKA 5A2IH 3QWOA 1XRVA 1CE1H 1EMTL 5GRXG 1PZUB 4M4PA 2QTEA 3OX8B 4X5XB 3ULVD 5GSRB 1KJ2L 4NPYA 4AZBA 1T66D 3FONA 3BAEH 1KXVA 3MOQA 5EORL 1VADA 1WBXA 3CH1B 4UTBH 1LQSR 5AUMA 4FLSA 4UT6H 4ELKA 4U6YB 4IIQA 5CEZH 3F5JA 3CC5B 5D2LB 3WHXA 4X4MA 4G8FA 2IAMC 1T20B 4S2SB 2YPLB 5GGUA 4XWOC 1KIRA 3FB7A 5C09B 5F6IB 3IJHB 1Q6DA 2Z31A 4PG2C 2BNQA 1OAYL 4D6GA 5HI4D 3BUPA 5IESH 2JTDA 3BI9X 3EDEA 4PJXF 2PYFB 3M17A 4JRYA 1CFVL 1TETH 5HDLA 3HZ3A 5J12B 3BP6A 5JQ6L 4Y4KB 1PFCA 3BDBA 4HCRH 4PTUA 2FGZA 5CIPA 2XNAA 2EEBA 5C07E 3M8OH 5DT1L 2OYKA 3RJXA 1NCAH 4HOXA 1D9KD 3BAXA 3GKWH 3T0EA 3FT3A 1XIWC 2MQ0A 5LWYH 5LA2A 4X83A 4PJXE 5C9JA 4DGVL 2F53B 1NMBL 4FXGB 1BIIB 3WIJA 3F5LA 2FX7L 3MGTA 4MA3A 1ZWIB 5BJTB 2CHNA 3H0TB 1I1AB 4FQHB 3EOBA 1UT9A 1UC6A 1ZXQA 3VSTA 5E9AA 1FN4A 1DQLH 1PGRB 3MBED 4FQXB 2N56A 3O41A 1QWNA 1A22B 2FGLA 2FBJL 3FZUC 3WFCL 3UDWA 4LCUA 1U8QA 1YEIL 4LLWB 4LAQL 1IJ9A 3VFUB 3E8UL 1QNOA 4HIEB 2GFBB 3LHPL 3RTQB 4MLIA 5BRZE 5E8DH 3VXPA 1MCEA 5L8KB 1B0RA 3RGVD 4WO4A 5JO5B 3B9KC 2BRRH 3D85D 4XAKE 2VCBA 4YFEA 4OFKA 2BJMH 4WJ5B 1W0YT 4HIHA 2DTML 5MEOA 1J7VR 2ATPB 4OZFA 3ECBB 1UA7A 3AZSA 4LLVB 5E7BA 3WUWA 3L3GB 4MS8C 2R69H 5DDHB 1HEZB 4WV1A 4K7PH 5EIIA 3SKOA 4F7EB 4OZFH 3T2PA 1VDGA 5IW6B 5JPNB 3WQ6A 2WP3O 5EBAA 5F88B 3PWVB 5C0RH 3F6IA 4UTAH 5L9DH 5IMMB 2ICCA 2R9HC 4HUVA 5HYSG 1UYQA 1NGXA 2X05A 2X1IA 1KYOJ 4QXGH 4F57L 1QNZH 2W66A 2BNRB 2DKSA 2EYSA 2CD0A 4U6HB 5C0AA 5I1AA 3VD4A 2DQCH 4U3XA 1LDPH 1HI6A 5D71L 1EBPA 3H7BB 1JHLH 4LP5A 3AHXA 1JN6B 1S3KH 1T1WA 2W60A 3BKYL 2XN9E 4BZ2L 3FB6A 2YBUA 4K7FA 1BZ7B 2FX8L 4RAVA 1CCZA 4XH2B 5EUOF 4ZFOL 3QP3A 4L8BB 4KRPB 1N8ZA 3CSPA 1U8OA 4XBPA 3TNMB 4HKBB 4KV5F 4PRHD 1GQLA 3A47A 4UFLA 4X80L 1R3KA 4U2YA 4RQQA 3SUVA 3QEUA 4NZUH 4P99A 4YQXL 3GIVA 2HWZH 2CLRB 4YDLB 4H20L 4H25B 5EUOE 4AXNA 2EE2A 2Y6SC 5E2VL 4ODUB 3TESA 2J4WH 1AXSA 3KPLA 3SCMC 3TEUA 3RWEA 3WIIL 1BQUA 4KTEL 3Q6FB 4TSAH 3EOTH 2H9GB 4KV5E 1VKXA 1T0MA 2DQTH 5D1ZC 1MWAL 1A7BA 2ZOKA 5GISL 5D2NA 2AGJH 3KL0A 4QRPD 4JFFA 4XMLH 2P47B 3GJFA 1SEQH 2Q8AH 2Q87A 1VACB 4W68A 1WO2A 4PRIB 3DX1A 5IQ7L 3HI6H 3BGMB 3MRNB 4ZQKB 1EJOH 3N1MC 3PE9A 1MW0A 3GJFH 3CZFB 1W0VB 5T3XH 4YFLF 1IEAB 1T3FA 1F58L 2L7JA 1T03H 3DYOA 3AHVA 2XY2A 5EBLB 2OLDA 3CUPA 2ICEA 1N0XH 4POUB 1N2RA 3I6KA 1YHTA 1MQPA 3D18B 2NX5B 3P0VH 3DV4B 4D9LL 4IMKC 4JFEB 7A3HA 2V5CA 4QRRE 3BFOA 2X4SB 2P5EA 5DD0L 5IFJB 1UCBH 2XVLA 2VO5A 2VLKE 1ED3A 1ORSA 1ODZA 5EOCH 3DJ9A 4R96A 2O9RA 4NUGH 3H9HB 4YXLL 3AXHA 2VZSA 4OCYL 1J10A 3QHZL 1OM3H 1YNTB 1DQML 4BJLA 5F96L 4L1DA 4JDVB 1QW8A 1T22A 1S7SB 3V4PH 2ZIDA 5DRWA 5D7SH 1YEFL 4PCTA 5D7JD 3VCLB 4EK7A 4RAUB 3TYFA 2IGTA 2ZOLA 3ALPA 3V5DA 1JMXA 4LSSH 3MRRB 1ZT1B 1LE5B 2J8OA 1EGZA 5ABHA 2FJHB 3SCOA 4ZOEA 3H3KA 1SVCP 4H1LH 4M8QA 3P4NB 4APQA 2P49B 4KI1A 4GOSA 1KCKA 3IFOA 4ZAKD 2X1XR 1IAIH 3EO1B 4OGAC 1BG9A 4LGXA 1C5DA 2W9EL 1X4ZA 3WS3B 4LLMA 4WU7B 3RNKB 4Z0XB 1RJYA 2O5XL 3CXHK 3N04A 1QSZA 5I8CB 4OM0L 3GZKA 3KR3H 3PGDB 1ZT4B 4MNQA 2EH7H 1AHWC 1U3HB 4OB5H 4LSVL 1S7QB 2Z8RA 3T3MF 3NIYA 4MNHA 1IGYB 4QGYA 4H04A 3U7WH 3SDDD 4NKIH 2D0HA 1XYFA 1HHKA 3BN9D 1NEZG 4FQLH 1OGSA 3CU7A 1E4WL 2LAGB 4NKQB 2DWEA 2BCKA 4QRTA 3GMRA 3LEYH 4LKXA 4RCAA 1G0DA 3GEWB 2LV4A 1A6TA 1GHFH 3QCVH 3IB4A 4JJHA 2XQBL 1LO2L 1CLVA 4XVUC 1PKOA 3OR7B 3U79A 4F9LC 1P7QA 4DKAA 3T3ME 3IT8D 5EU5A 3UP1A 3HG5A 1R5IB 4U05A 2WMIA 3FT2A 4ZXBC 1JRHI 4PLKD 2J3SA 5D93C 4IPNB 3MGAA 3QXUA 1V3LA 1T4KB 1XGQA 4M61A 4DZBA 1H5BA 5KEZA 1WWAX 4YJZL 4NNXB 1Q8MA 2D7QA 2HJFB 4NHUB 5SV4A 5E2UL 3OJDA 1UWUA 1RUKL 2FEDC 3MLWH 5EO1A 1FGNH 1OPGL 5C0JA 5EC1A 4CCCA 5H94B 4Y16A 4YHKH 1H3PH 5I1JH 3S4SA 4U7KA 3P0YH 1YC8A 4U0QB 2HFEA 5HHOA 4HFWA 5ABDE 3G08A 2DLIA 3KYAA 1A1NA 3O3AB 3ARPA 4WKAA 4HH8A 4U1NB 3FB8B 5SWSA 1FHLA 3VFOA 3WQVA 2XTJC 4AIXA 3AREC 1EHAA 4XAWL 3OPZL 4N1EA 3BZFB 1ITBB 4FG6C 1KIPA 1LHZA 4FQ1H 4JHOA 4NO0A 3P2TA 5EB8A 3U5UA 1RIHL 2E27H 1LO5A 4MYWB 1PKQB 4CCEA 3GXNA 1QPKA 1C16A 1IQWL 1TMQA 4B15A 2R4SH 2PCPA 3G5YA 5JHLL 1GUVA 4ZYKB 1PZ5B 3RAJL 5HGHB 1I1CA 5IOPA 3WFHA 1IGIL 1ITXA 4NZJA 5C86A 4EVNA 4R4FL 1E0OB 5BS0A 4W86A 1NBQA 4OLUL 1OD9A 1AKJB 3M45A 3LKRA 3BKMH 3LN5B 2F8XC 4H7VA 1Q6EA 4C57C 1DUZB 2BY3A 3QRGH 2PWFA 1J1XL 2C3XA 4M24A 4PG9B 3AS0A 4EI5A 1LEGB 3RWGB 3AB0B 3AY4C 4RMQA 2FGWH 3DGCR 4HA1A 2CK0H 4JFOA 2N7BA 1KFAH 2DGAA 1FNGA 3FQWB 1ZMYA 3BOVA 1TCMA 3GBNH 4LCWA 4XNXH 1JYVA 3BVVA