1CXLA

Complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q
Total Genus 243
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
243
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
publication title X-ray structures along the reaction pathway of cyclodextrin glycosyltransferase elucidate catalysis in the alpha-amylase family.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 243
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1999-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxlA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxlA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxlA01
3PWVB 3QG7H 4NQCA 5CMAA 2VCBA 1MWAL 3RJDA 2E9BA 5CP3H 4JDTH 2JF1A 2ARWA 1GCFA 3LSOB 5I8KL 3ARSA 1A6AB 1HYRC 1BD2B 3CUPB 3VD7A 2YLLA 4I77H 4G8EA 2QQKL 5GJSH 3S97C 1C8YA 4PJBA 2J88L 3PV6A 4PJ8A 3RP1A 4JFED 1I4FB 1FAIH 3BUPA 1ZL1A 3RDKA 1R24A 5DEGB 3LPPA 5DJXA 3UZVB 2K7QA 1EFQA 1NKOA 3TYGL 2OSWA 1TZHA 5L2KE 1I8MA 4Y5VC 3HC4L 1A3LL 1A7NL 4BELD 2XSAA 5ANME 1AD0A 4ZPVA 2B5IC 1PKOA 3QHNA 2C1OB 1ZHKB 2FLRT 4MCZA 2EAEA 1KT2B 2VXVL 3HRZB 3FFCB 4PS4H 3T4YA 1N6QH 3EJUA 3VG9C 2WHLA 2YWZA 3G5ZB 3IVKB 3VXTA 5TE6H 2XTJD 1YPZA 4P8XA 1NC2D 4L4PA 5L8LB 5BXFA 1JNNL 1OLLA 3DRTB 3KPNA 3VJ6B 1S78C 2VDPL 4I4WB 3O4LB 3TNMA 5TF0A 1FZMA 4HK0A 4JPVH 4GXVL 5GRYA 1FFQA 1XIWA 1XH0A 4PJDE 1EZVY 1QW8A 3EZJB 1HQ4A 4PMZA 3A3HA 5A3HA 2CMRL 4W84A 4YXLH 5DRZB 1U8QA 5MERA 1H15A 1BLNA 3L3GB 3S96B 1LO0L 5E1QA 1AD9A 1J1XH 3RPMA 2Z4QB 3O41B 1RMFH 4OT1L 1JE6A 4DM1A 1ZT4A 2P49B 1KTLB 2IC2A 3MXWL 5LCVH 4L4OA 1YN7B 2AV1B 4FNUA 12E8L 5J9PB 2XWBA 4M82A 5DYOB 2Z31A 4OZIB 1OTUC 1AGCA 2ESCA 4B7IA 4PCSA 3KPRA 3PGCA 5DO2C 5LWYL 5F1OB 3BI9X 2XZQL 3QUXD 1TDQA 4WEBH 4M81A 1G7LA 2APBA 1LE9A 4FG6C 4IRSB 3OKDB 2VZSA 4M93B 1PD6A 4MD0B 5CIPA 3T3MF 3DX2A 4LQ1A 5E70A 5DEFB 3UTTB 3JSSA 3LZFL 2F7QA 2VMFA 4U6HA 5CLTA 1F6FB 3QFJB 2GJJA 1T1ZA 1IZKA 3HI6L 2HTLD 4AIXA 3NZ8A 1KIRB 2KQMA 4QRPE 2G8ZA 2QV2A 2VQUA 3DWTA 5DS8A 2IFFH 2EO9A 3QIUD 4JFZH 4PJDF 5D7JA 4AD1A 5SV3A 2MMXA 1NBVH 3WBDA 3N11A 5IB4B 1A0QH 3DVNB 4QXGH 1C92A 5LGJB 43CAA 4YN5A 3C60B 1HZHH 4YX2L 1OWRM 1AQDB 4DQOH 3GMPA 1PS3A 2R0KH 5A6JA 1GGUA 2IQ9L 5DMIL 4GO8A 1IT9L 3SCMB 4KPHL 4ALAH 4P46C 4K7PX 5EFFA 1KJMB 2R4RL 5IEKA 4HA1A 5E99H 3T2QA 1WAWA 3WF3A 3MJ9L 2HMIC 2CKRA 2HVKB 4HEME 3SOBH 2EH8L 5D2LA 4PMXA 1S7QB 5CJ8A 4HKXA 3WIFA 4KAQH 2EYSB 1RUMH 3RIFK 1QSFD 1EHXA 5HHOB 2Q76B 4U3AA 2CCRA 3IJHB 4XCCH 1G0DA 3HC0A 1BREA 4OZHE 5BCAA 4YDKL 1RY7B 4X8JB 1RZIB 2XN2A 1EXUB 1A02N 2CETA 1MRDL 4JVUA 1B31A 4Q7NA 2AV7A 5B22A 3ORJA 5FGRA 3HTLX 3AGVA 1DVFC 1DUYB 4FXGB 1R5IA 2QEJA 3S3SA 4WDIB 3KXFB 4JFOB 2BOCA 5E9DD 1FYTA 5IQ9B 1LDPL 1NGXB 4PRNA 1BAFL 3M45A 5D6CB 3GHEH 1VACA 1TPXB 3V0WH 5I6XC 4C7GA 4H7VA 1KCUL 4WHTA 4D0BB 2PWGA 1QSZA 5DZLA 2MCPL 1KR1A 4I3SH 3JV4A 2F9BT 4HKBA 4FTVB 4EBQH 3OKLB 5J3HC 3HFML 2V5RA 1CD0A 4LX4A 1BBJA 2ZX5A 4ZO8A 2J77A 2XFFA 4OZFG 4OSUL 2WWDA 3P0YH 5IMMA 1G9MC 5C0IB 1EHLH 4NCDA 4K7FB 4HUXB 1MVUA 4O2EB 1ORQB 3V0AC 5J4MA 2DT0A 5JIHA 2J3SA 1HHHA 4TTDC 1DCLA 1XCTB 1AGDA 1CDYA 1G7JB 3SKMB 4HAFA 4QTIH 1IGFL 1R85A 4LLMB 5ERWB 3GRWL 4QOKB 1JBJA 4JANA 2N7AA 3FB6A 4OZHF 4GBXA 2PBOA 3U1SL 3HUJB 1WO2A 4GKNA 1FE8H 3QCVH 3UJTL 2XA3A 4U6VL 3X13B 3ARFD 3TBWB 4CU6A 2WCGA 2WCSA 4GAJL 2Z8VC 4FFVC 3QEGH 4R97C 3Q3GA 2E9MA 4KJYB 5D7IA 1EDQA 3C87A 3POCA 3BSGA 1Z5LA 2JIEA 4LNRA 4Q6IC 5F6HJ 2BFVL 2Z91A 3DUSA 4XBGA 5D9NA 1MJJA 5KBNC 2Y5TA 3AJ7A 1YHTA 4JB9L 3T08A 3ABZA 3DSFL 1RUAL 5D71H 5BO1H 4LPYA 2B4CL 1QBBA 4XXDA 1RHHB 2IH1A 5HOSA 1ZHBA 2XZCL 4Z7VA 2W92A 4GXUM 5FIPA 2ADJB 1UCBH 4BFBD 2GUOA 4M7JL 5IJKA 4GZJA 1N2RB 4PD4J 5JLZA 4GS7C 1UXWA 1KELL 5BQ7B 1NCWH 1E70M 3BKMH 4APQC 1HOCA 5DJCB 1FVDA 5BZDB 4NKMB 4TUJB 3RGVD 3OPZL 1KFAL 2WBJC 4X9HA 1MXDA 3QFDA 1TR1A 5EIIB 4PRID 4KU1A 1OWWA 5EORH 1F4YH 4NJ9L 3SGJA 3DROA 4X6DA 2F5AH 4OCNC 3V5HA 2ZCLL 6FABH 2OL3H 3U0PB 3R0MA 4I3RH 4MNMA 3PHQA 3VSUA 3HR5A 1KXHA 1GOQA 5FYKD 5JXAL 3AIVA 1GZQB 3MCKA 2G5BB 2X4NB 5IW1A 4FQXB 2RCSH 1TMQA 4TNWF 5ESQB 3D5HA 2QHRH 4HA3A 4M6NH 3IDNA 1KJ2H 3T2PA 1S7UA 3WNKA 1S7VB 3TFKC 3MNVB 1DL7H 4JO4H 35C8L 3EYQD 3Q5TA 4WNQB 5KSUB 2EDNA 2WV3A 3KLHD 2F74B 3H7BA 1N7ML 1FCCA 5CWSA 3HZVA 1EJOL 1ZGLM 4P3DB 4GG8B 5CEZE 4TRPL 4PRBA 4M7LT 1QR1A 4Q58C 2GFTA 2Y07L 1JNDA 4K68A 3MV9D 5BS0E 1CDGA 5GISH 3O2VL 5DI8A 3EJJX 4LSVH 4AJ0A 4AMXA 4Y4KD 1E4XL 3K2UL 3DETD 1RZ7H 5DJ2A 1HN1A 1WWCA 2PXYA 1AXTH 3CDFA 5J89A 1W2PA 3HE6A 3ULUF 1MH5B 4WJ5A 2NY7H 4HDIB 1P2CB 2GTZA 5B8CC 1T2QL 2VL5A 1FIEA 1HINL 3PGDA 3RX8A 1KBBA 1UEYA 4JJ5A 1WV7T 1WBXA 4PIRF 1JGLH 4F3FA 3G04B 5CEXA 1OCQA 4PLKD 1QRNA 4M61A 4CADB 2EKJA 4O5LH 5ENWA 4MNGB 4HAGA 4Z2JA 1H3XA 4P57A 2J7DA 1WFUA 2V5CA 3W25A 3H9HB 4N0CD 5HHME 1VF8A 5ACMA 5D7LA 2EO7A 2HJLA 1TZ7A 4UNUA 1TCMA 4Z7UB 3GXFA 3GXMA 3IDGA 2RQ8A 1TQTA 5I76B 1FORH 4JGJA 1NCDL 1KTCA 2DQHL 5A6AA 4JFTA 2XWDA 3P11L 5E03A 4FP8H 3WD1A 5BV7B 5EO0B 1P7QD 5ACLA 2R4SL 2DQGH 5T3XD 1E9LA 4FK9A 5CG0A 5DD1L 3IFNH 1RZJH 2FBJL 2X9WA 4F79A 3C2AH 3QUZA 4KK5C 1CCZA 5DA4A 3EMCA 5DJYB 2GK0A 4C7DA 4K8RL 5I8EA 1YN6B 3ARDA 2A77H 5FYLL 4EI6A 5FHAL 5JIPA 1A3RH 1MEXH 1QOXA 3C09B 4LVOB 1HXJA 2ZNWA 1WGOA 5MHSE 2EQDA 3ZKQD 4YHPB 5GGVH 4AZIA 4X7SH 4HH9B 3POHA 3G5VA 4P9HL 1NOUA 3SUWA 1BIIB 1TLKA 4LAQL 3OJ2C 1U6AH 2NZ9D 3QXVA 5C0CE 1JPTH 1OAQH 4IISA 1MRFH 1QA9A 2MJWA 5CZVH 4ZTOL 5BOZG 3SBWA 3AVEA 2VVNA 4AIOA 2FEDC 5DSCA 2AEQH 3NACH 4NP4L 4PRPA 4NO0A 3O11A 3WCYA 4NQCD 3M8OL 3TBVA 1W1TA 4J4PA 5CKAA 1L9MA 5K9KB 3HG1D 5E6IC 4M6ML 1EDGA 4GW1A 2QLVB 4LCUA 1IGYB 4NN6C 5KS9E 1GAFH 3BPOB 2C4FU 1MCEA 3MRDA 1D6EA 3PDOA 4O4YL 1NBYB 4YHKH 4L8SA 4PB9H 3P9MA 4PBVC 4D6DA 1QI4A 4HZLA 5DQ9B 1FVCA 1HHIA 4PJ8D 3UTPE 2I5YH 3MV7A 3X3FL 3QEUB 4ZXBC 1R3LB 4BH8A 1XCWA 4OQTL 1CGXA 5C0GA 1HNFA 2N7BA 3PL6B 4GI8A 1J86A 5JPNB 4XMKL 5HYEA 1AHWA 1S5HB 4BZ1H 4F7MB 2ORBL 4YC2C 2Q7YA 4S11A 3U4EA 1NGPH 4HWEH 4IRJC 5IFHL 4XMLH 1MFAH 2ZKHL 4MWFB 3VXMA 5HYFA 2M2DA 4D2NA 1R7OA 4NO2B 2NY6D 5T3ZH 1ZK9A 2C1PA 1JHLH 3MJ7B 4WO4A 1W72A 3NH7L 3SKJL 1AIFA 3WNPA 2BSTB 1BWMA 3RDTB 2F1AA 5AYBA 3EHBD 5HGBB 4NHUA 4Y1AE 3PWPB 4V1DA 3OJDA 3O4OB 5F7UA 5KSBA 2R69H 4UU9A 1A7BA 1E4XI 2GJRA 2F58H 1VBUA 4B9YA 4P4RB 2YMXL 4AD5A 1E15A 1V3JA 2E4TA 1XF3B 5E5MA 3EFDL 1W3LA 1G94A 4MDJB 3AMLA 4OB5H 2XIIA 3WD3A 1OAUL 2RGMA 4AYGA 1A4KA 1JPSH 4NQDD 1MJ7H 5FYJE 5BXRA 2HH0L 3GNRA 4PN2A 3WUGA 1V6YA 2OW7A 5KW9L 3QNZA 1BYBA 2E27H 2DQJL 1UR2A 2J7GA 1IGIH 2DD8H 5TF1L 2HN7B 5I1KH 4HKZB 3WEZA 5J6GA 3BZFB 2VXUL 3HZYB 3GBNL 1A5FH 1QLRA 3ZT6A 3CVHA 2CJUL 4PJEB 4XAKE 2ZUXA 4IPNB 3PWLB 2Z31D 3HE7C 4OCYH 4NO3B 4X9FA 3S9DB 3VX1A 4WW2A 3FQXB 4JPKH 4MXQD 2MHAB 3KPRD 1IFHH 1PAMA 3DX8B 4NM8L 3BZEA 1PSKL 3SCRA 2R2EB 1J8KA 4GKLA 4PMVA 2JTDA 3F6IA 4KRPD 5E8EA 3E0GA 1U8LA 5ABFA 3BE1H 4C56E 5FXCH 4ENED 1HH6B 3BKCL 5E7BA 2EPNA 4YIQB 1WC7B 1YMME 2XPGB 4ONGL 1CWVA 3GXPA 3TOPA 2FWOA 1BOGB 4KUCF 4FN0A 4F58L 3R8BB 5D1XA 5AG8A 1DWHM 1OGAE 2Z93B 5L0QB 1N64L 4KMLB 2XTKA 2FECI 3N0PB 5D7JD 4XPAL 3NFPA 3D69B 3K4AA 4YHLL 2XVLA 3UTOA 1LK2A 5ILTL 5CBEA 4QHLA 3SO3C 2PWHA 1KTDA 4M62H 3DX9B 5DGQA 4AY1A 1JVKA 3QOKA 1MPAH 3KPTA 4W5UA 1JGDA 2EE3A 1X7QA 2HP4A 4GAGH 2J7HA 4LOUD 2O5YL 5EBAA 3L3DB 3MO1A 1YEGL 1K9TA 4AL8L 1RJLB 3FO0L 1DLHB 3QUYD 5FK9B 5EZJA 2I24N 3SGEI 1NOWA 1L4IA 4W4OC 1JWUB 3ARPA 1VB9A 1OSEA 2YL8A 2E40A 5I16B 4KFZC 3CZ8A 4CD7A 4ONFH 1NAML 4WWID 3CFDB 4W8BA 1YEJL 4PLJC 2VKXA 2WMIA 3AQUA 5DRXB 2DM2A 1US2A 4OZ4B 1ADQH 2OYMA 2NY5L 2WUCH 1IQWL 4TSBH 1IC7H 2D9CA 5T5FH 2ZX7A 2A6DB 4DVRL 5C86A 4I0PD 3MBEB 1UWGL 3SJVE 1KXVC 4KRTA 2YS4A 4ODUB 3GJFH 3H42H 1I9JH 4PJXB 4RMUA 5F7EL 2ICWB 5A8MA 8FABA 2QPUA 5EB8A 3C5ZA 1BQCA 1K9FA 1FYTD 1RIHH 4OLUL 4BA8A 5C0JB 3D6GA 4L4VE 2CIIA 3MRHA 3MGOA 3DHPA 3LQZA 4KQ3H 2HKHL 1Z3GL 3MLUH 2WWMD 2B20A 4EXPX 2KQNA 3GSRB 3DSNA 1N82A 1KLUB 2VABB 1BJMA 1QNZH 2FO4B 3IXTA 4O2FB 4O9HH 3SQBA 1QFWL 1ZA3A 1MHHA 3GH5A 2AJZB 1BVZA 1XYFA 1KULA 4JFFD 1AI1H 4BK4A 2FRGP 4EQ3A 3ZKNC 2NY3D 5CJOH 3GSOA 1OY3B 5MEOA 1QI0A 2AK1H 3B9KA 1JZ7A 3MODL 4ZUSB 1WWBX 3MU7A 2DWEB 4LEXL 3GH7A 3VRJA 1DWIM 3AIWA 3ZKMD 4UFHA 1B2WH 1MHEB 4LRIA 3ALPA 2M8XA 2PYFA 4OF8A 1ZKAA 3K7UA 4URTB 1A4JB 3A67H 4E0RB 4C55A 4GBXD 3QI9C 4PUEA 4MA1C 2F54A 4P5TB 5D7KD 2P5EE 2FSEA 1FRGL 3JWDL 3ULVC 2Z35B 2OR9H 4OQ1A 1OVZA 1PKQA 4E9LA 4DEPB 3BW9B 2FX7H 1JAKA 2WC4A 4ONHA 3G6JA 4PR5A 3V4VL 1VJSA 2ZE0A 5D1ZC 4DGYL 3E6HA 3OR6A 1YMHA 2AGJH 2V38A 4M56A 2FJFB 2DYPD 5EZIL 2NW3A 4CUCA 4CN4A 5CHNB 2GCYB 2E7LC 2R15A 3WY2A 1U92B 2BNQA 3TH2T 5ID1A 3UG5A 3PHAA 5L2KB 2Y24A 4YJZL 3HI5H 4L9LA 1JPGB 1DWGM 1CE6B 1VGKA 4Y16D 4PJHE 3MROB 5BRZA 5HGHA 4N8CL 3EYOA 2D31B 2JB6B 4H5SB 5HGAA 1PFCA 3Q6FA 3R8QA 3UYPA 1CU4L 5EZOH 3ZE0E 1LWRA 2CKBH 3DPBA 1F42A 3BVNA 3VWJD 2DB8A 1SEBA 2BVOA 3CFEB 3MMEB 1NJ9A 4GMTL 4H41A 1KENL 4TX6A 3D39B 4XBPB 4DKFH 2VR5A 4DWHA 2CEQA 3W27A 3O6FB 5J0BA 3UP1A 3LPWA 5HYJD 1FCGA 3W9EA 1UM4H 3FQNB 1RVFL 4EKXA 4FQCL 3TJEH 2CLVA 5HD8C 1G7MB 1HH9B 4HGMA 4NUJB 4Z2HA 4NPYB 3EJQA 4ODSH 3TA3A 5A6KA 5A6BD 3CFCL 4ZD3L 3S36X 1V3MA 1VFFA 3KG5A 3DXAA 5JW5A 5MP6L 3CPUA 4KVCH 2VX6A 3EJSA 3N13A 2CBJA 5BOPA 2WZPD 4AC1X 1BQHA 1KBGL 3S37X 4UFIA 1YJDC 2K3TA 1XH1A 3RJYA 5GRJH 3VE0B 1MFUA 2AJXH 2AW2A 2ZWLT 5T33H 1GC1C 2XWTB 4U1SA 1PEZA 2BVQA 4IMKC 4OF0A 1S9YA 2R0ZL 3WUZA 4P9HC 2ERJC 1GQKA 3OZ9L 1XV8A 4G9FA 3NAAL 4HIIB 5JPMA 2JJTA 1NM9A 5K59E 2HFGH 1JYNA 1C12B 3ZE0F 5JDJA 4JFDD 4U6YB 4UV7L 3IF1A 4EAMA 1D9KC 4C59B 2OYKA 4HPGA 4HIJB 3HE6D 3OXSB 1L9NA 2M1KA 3P2TA 1S5IH 1EEUA 4IOIA 3QG7L 2J7FA 4QRPB 4MDPA 4JDTL 5FV2A 3STLB 3SCUA 3LMJH 1JFHA 1XYZA 1EO8H 2PNDA 1CECA 1C5CL 2J5LC 1IT0A 4I77L 3WMCA 2SEBA 1QRND 4F9LC 5GJSL 1I8IA 4GKZA 3NIGE 1QFWI 3L3KA 3RGHA 3BP5B 3OKMB 3ARUA 1FAIL 3GIVB 1MFCH 3LPOA 1ZLWK 2R1XB 5DD3H 1E6QM 5ESAB 1JF1A 2OP4H 4GLRI 2AJSL 1GOOA 3O8XB 1JI1A 4BQ6A 5D7LD 5ISZB 1JNHA 3EO1A 4QHMB 4AD2A 2HTKC 5J12C 1VIWA 2X4TB 4WV1A 1U2HA 5D70H 5D9MA 1A8JH 1E4LA 1RUPH 4PS4L 2GY7B 3QXTA 4LEOA 1N6QL 2ATKA 4CKVX 1ISWA 2W65B 5TE6L 3QUZD 2FZ3B 4JM2A 2X1IA 1S7RA 4W8LA 3U46A 5EBLA 1BX2B 5DK2A 2NY2C 3ARDD 4U7KA 4AD0A 2E5EA 4JPVL 1MAJA 1E3ZA 1FFNB 4JRYB 4PPTA 1BZ7A 4YXLL 3ILQC 1DANU 3BVVA 2J2ZA 2QADB 4GRLC 1J1XL 3VXPA 1RMFL 4X6CE 1T20A 1SBSH 3I6GB 1HHGB 2IANE 4N68A 3I84A 2GVYA 1P4LB 2NX5A 3MBXL 4YFEA 3T1FA 3PWUB 5A2FA 1N59B 1MCCA 1U8KA 2QPSA 5LCVL 2H3NA 2GFBB 4PJ9B 4NO0D 1P53A 1C7TA 2CLRB 4DGVH 5MENA 2J8GA 4KUZH 4JFQA 4P2RA 4PGBA 4JAWA 2GJZB 1HQRB 2VSCA 1C8QA 4ACZB 2FJGB 2XWJB 4WEBL 3MRFB 1NAMB 1U8JB 3RVVD 1CLCA 3ZDYF 1A3QA 5TJWK 1I3VA 5GSVB 4S1RH 1ROWA 3BRGC 3MTRA 3MV7D 1P4IH 4X80H 1RULH 4WFHE 3FAWA 2J62A 5IVNA 1RHFA 5JHDA 1PZ5A 2HLFD 3BX7C 1MFDL 1HWHB 4NO5B 1I1YB 4X7EC 2IFFL 3NABH 4JFZL 1CICB 1XGUB 2DMCA 1NBVL 5IR1A 5JMRA 1N5YH 1A0QL 3KPSD 4QXGL 3FHQA 1ETZB 4PUBH 1QBMH 1HZHL 2CQVA 3CZKA 2JCCA 1FN4B 1R47A 4DQOL 1G1YA 2R0KL 3QQ4A 4X6CF 4DFHA 4YH6A 3DUUB 4WHYG 3UJIH 1EOKA 4XZBA 1RJZB 4ALAL 5JNYB 1NOFA 4LL9A 1F11A 1P7KA 1QFOA 3BP7B 4MX7B 1QNRA 5E99L 1UJ3A 3AB0B 1LO5A 3THDA 1UUQA 4GPNA 5E1HB 3ARZA 3SOBL 1RU9H 5GS1B 2D4FA 1HWWA 3CLEH 1NEZB 5JZ7D 3TM6A 5T1LA 1Q1JH 1T3FA 4KAQL 3W24A 1Q94A 1HDMA 1RUML 3NN8A 5T5NG 1I1XA 4P3CH 3CX5K 4JFHD 3VRIA 4XCCL 5DVOA 4ZS6D 3QDAA 4M6AA 1IRAY 3RU8H 1A6ZA 3UTZB 3WIHH 1V02E 4UINH 2Y06H 1T4KB 2W61A 1OAKH 3AHTA 2Y25A 1Q38A 3GMRA 1ZWIB 4RMQA 2XJ7A 3P9LB 2UZIH 1JN6B 3WMBA 3VD3A 2Z8RA 4Y7MA 2DWDB 3SKOA 3V0WL 3GHEL 1U93B 2O9RA 4AY0A 1OB0A 5C07A 3QR3A 4I3SL 5HHQA 4EBQL 1G7HA 1IAKB 4CDHA 4KROD 4PB0H 3MUZ1 3C8KA 1OW0C 4I2XA 1CD1B 3P73A 4M5YH 1U3HA 2LU7A 3P0YL 4AG4H 2P46B 3ILPB 5BW7A 1EHLL 3F5WA 4OD2A 5I75C 5D1XD 1E6JH 43C9A 3BPCB 5DHVA 3G9VA 1ERNA 1T7ZA 2P8MA 3QEQE 5D2NB 4X0VA 1S9WA 5IW6A 1HKIA 1FNGB 2H9GA 4DKAA 4QTIL 4RFNC 2R8SL 5GIRA 1UB6B 4HLJA 3U6RA 1CENA 3DMMB 5D5MF 1US3A 3FOMA 2FX8H 3OWEA 2YPVH 1F4HA 2BCKA 3ZO0A 2NTSP 2VRQA 4CJ0A 1FE8L 1ZS2A 3QCVL 3ZO9A 2DLTA 5CFHA 3AREB 4OZGB 1I1CA 4H20H 1N5AB 4PJIE 1QVOB 4WFFE 1Q9OB 1GGYA 2I07B 4P4KC 4F7TB 5FUZH 5I18H 4NQEE 4JAMA 1QPKA 4HIHA 4PRHA 3REWA 3CSBA 2JLLA 3DBXB 3PHOA 5IHLB 3UYRH 2YUXA 4OFKA 1BFOB 2EDEA 5I2UA 5LBSH 5T1DH 5D6DA 2OWWA 3HAEB 1PIGA 4TPRH 4ZYKA 5D71L 5BO1L 1T5XB 2EKSB 2WW5A 4IS6A 3ULVE 5ETUB 1TA3A 5DMJB 1NEZG 5CD5C 1X5YA 3LN4B 5DVNA 1G7QA 1UCBL 4D9LH 4P2QA 3AZRA 3S34H 2VZVA 3TPUB 3P4NA 4PG2A 5CQ1A 4X5LA 1CGTA 5J11B 3C5ZD 2EC9T 3OJMB 1NCWL 1I8LA 3C60D 1BLIA 2H2SC 3ZR5A 4EANA 1HIZA 1E4WH 2ZCHH 1AY1H 4XTRD 5EORL 4DKEH 1PBYA 1F4YL 1N6UA 4JL1A 1CF8H 4IM8A 1MFNA 1LK3H 2F5AL 4MJ4A 4Y5VB 4Z7WE 4UT9H 4NKQB 4RIRB 3O81A 6FABL 3MRKA 2OL3L 1LG2A 2EXYD 5KVEH 2B5IB 4I3RL 4I18B 1PG7H 5JQHC 4WIQA 1UZ8B 4NI3A 4HOWA 3MO4A 1XCQB 4PJIF 2UYLB 4ELMB 1I1AB 5E94A 3VG9B 4MQXC 3AYRA 1F3DH 1UACH 5KSAA 5FYKU 2RCSL 3MV8B 3VGFA 3A47A 1DFBH 4WFEE 5IOPB 2P8PA 2QHRL 1FSKB 4M6NL 5HHOD 5CLWA 1KJ2L 2BHZA 4UOW0 5K9QG 1TNNA 2XN9E 1DL7L 3Q5YA 1ZT7A 4JO4L 2DGAA 1BFTA 4LQFH 5EIQA 5DQJA 1E4IA 4NN5C 3ULVF 3OKNB 1A7OH 5DD0L 1UR1A 1S9VA 1K3ZA 2F54D 4J8RB 1T0NA 1I7ZA 3QCTH 4R3SA 5EOCH 2EZ0C 3KXFD 3HI1B 4RQQB 1XF5A 2V17H 1VADA 5IK3A 5GISL 3LIZH 4LSVL 4IJ3C 4F2MB 2EYTB 3IU4H 2FJHB 5IKCA 4HH8A 4HUUB 4O2CB 1RZ7L 3GMLB 1AXTL 1JDDA 2WANA 1P6AB 1CQYA 5C08E 4FTVD 2NY7L 2Y6SD 3G6MA 1G01A 4AZ5A 1A6WH 3RNQB 3LXCA 4LAJH 1HJQA 5TQ2H 3S35X 4F8TA 4RA0C 5AZ2H 3UPRB 1UWRA 1JGLL 1FVEA 1F97A 1NCCH 4RZCA 3P30H 3HAEG 5IG7A 5BRZD 4O5LL 4QRTB 5T3XH 1WE5A 4OCMC 3H53A 1G7PB 4YHZH 4QHNA 4UDTB 3N12A 3LCYA 4QXTB 5F93C 1UR8A 2B2XH 5TDOB 5GS0H 3DYMA 5J13C 2DM7A 3MOQA 3QQ3B 2JEPA 3ARQA 3QHMA 3MNWA 4JN2A 1TITA 1FORL 4XB7A 2X2JA 2VLRB 2C3GA 4KMTH 1FFPA 3BZ4A 2IJ0C 2ZUVA 2XQBH 4FP8L 3CCHA 5MI0C 2I9TA 2D9QB 3PQYB 4GKSA 4DUVA 5IB1B 1NQBA 1FPTH 9CGTA 3IFNL 1RZJL 2GJ6E 1H3UA 4MHHI 1C16A 3ZJ6A 3OGCB 2ZUSA 5GZOC 1FO0L 3L3HB 2P1YA 3A23A 4OI8A 2A77L 4F37F 5TGBA 1A3RL 4BSJA 3K1KC 4YGAB 1KR0A 1K2DB 2FX9H 2OTWA 3CIVA 5CSUA 4X5WB 2YPKB 5GGVL 3V6FB 4X7SL 5F3BA 4NBYB 4PJAE 3O6AA 4G9FD 4PP2B 1A9BA 1ODAA 3N9GH 1F45A 5SX4H 1U6AL 5HI4D 1JPTL 4Y5YB 2ZUMA 1OAQL 1MRFL 5CZVL 4G42A 1DQQA 5DJ6A 5BJTA 1T5WB 2AEQL 2X10A 3NACL 5EU7C 4AENA 1XGPA 1A7QH 3KJ6H 4JM4H 4PJDA 3L4TA 3C9NB 1ZVSA 1N3NB 4DK3A 3D2UA 1GAFL 2P45B 1WB0A 3U7AA 2AJYH 2GHWB 5C9JA 5K9OA 4YHKL 5J06A 2NY0B 4NNYB 5C2BH 3PE9A 5CP7B 3BUYB 1KXQE 4PB9L 3TIDA 1R5WA 1CXEA 1U8NB 5E8PB 4GG6E 1M53A 3BQUC 2RFXA 4GXPA 2I5YL 1KGXA 2PW1B 2UWEE 5I1LB 1HEZB 2W0PA 4XH2B 1MW0A 5LA2A 1IAOB 3I3BA 1ZSDA 1CT8B 2BMKB 5E6ZA 2PO6D 5IMLA 4EDXA 1A1NB 3R1GH 3RWCA 4BFEA 1ZLVH 3DNKA 1WICA 4BZ1L 4WHDA 1JK8A 2H6PB 2BY1A 3M17A 4DO6A 2G3IA 1AKJB 1MCBA 3WD5H 1NGPL 4HWEL 4AMWA 4RISH 4XMLL 5EBGA 1LHZA 1MFAL 3VFPA 3VDBA 1T1YB 5C8BB 5T3ZL 5MEPB 1JHLL 3GSWB 3VILA 2HG5B 4JM2D 2AK4A 3K8MA 2DI7A 4L3EE 5FUOH 4D0CB 3TVMA 4UAOB 1NDGB 2K9UA 1HXYA 3SJVB 4Z76A 2ITDB 2X4PA 2R69L 4ZDHA 1F6AA 3LS5H 3QQ9D 3WFLA 4UQ3B 5F8QC 3QUMA 2F58L 4C4KT 4NRZB 4DVBB 1ZU8A 1ED3B 3KNBA 3MRGA 4LSRH 1JPFA 3ZYJA 4WIWA 5CSGA 4WJXA 4Q6IB 4CD8A 1UA6H 3TZVA 1CTNA 2N4IA 4WI9A 5B21A 3WFEH 1XSJA 4LLYA 3AIQA 1JPSL 2VLMD 1MJ7L 4YR6A 4XPBH 2F7OA 1XIWC 2AS5M 4LLVA 2MSPA 2X4SA 4UQEA 2LFGA 5EC1A 3EZ8A 2AI0H 1R3KB 4JY4B 5DT1H 1OGSA 2E27L 5CIPH 3MCG1 5E4EC 4FRWA 2UWEF 1IGIL 2DD8L 3V0VA 4OZOA 4WWKA 5I1KL 3PZQA 2NX5D 3U7YH 1IQDA 1WKYA 4XNQB 5IMKA 3RI5K 3KPLA 3VXUA 3AXLB 4PMUA 1A5FL 4ZE4A 3MLWH 3OB8A 3IJ9A 5EOTB 1GQIA 3RZCA 3TN0B 4J1UA 4JPKL 3RX7A 2GSGB 4HPOH 3VSVA 4P2RD 1IFHL 4PREB 4MLIA 3LQAH 1NAKH 5F88B 3NUKA 4OZHA 2OW6A 3ZT5A 3WFDH 3BE1L 3RTQA 5EN2B 3HNVL 2WBKA 1JV5A 1LWHA 3WNMA 1R87A 4XRCA 1GHSA 3ZHKA 3EJPA 3CSYB 3CAFA 2WBWB 4U1IB 3GXIA 2H45A 4JCMA 4HEPG 4F33A 4GRMB 4WSKA 5C0BE 2R1YB 4I9WE 1E6ZA 4E5XB 1GOWA 1IEAB 5C2UB 2J4WH 2ZOKB 2Y2WA 2O9TA 3GKZA 3RVWD 4UB0H 4M62L 3SURA 1KCRL 1MPAL 2GITB 3EFFB 2ED9A 4GAGL 3AAZA 4RFEA 3WN5B 1G9EA 3LN9A 3BP6B 4ODXA 3FNDA 3WY3A 4QGYA 2A74A 3CZEA 4JZNB 3F12B 4QHUA 3QUKA 4ZAKB 3IDJA 4PJHB 1HP5A 2OL3B 4HXBH 4ODHH 2EDWA 5E6YA 3WJJA 3FO9A 1RIVH 2VLJD 3NCBB 4LGPB 4ONFL 5B38A 1W0VB 2GW5A 3BESR 5T1LD 3L3IB 4M8QB 5AY7A 2CERA 3IAPA 4H1LB 1ADQL 4LLDB 2WUCL 4TSBL 3K2MC 4RRPA 1IC7L 3SY0A 3RFZC 1KJ2B 1NGQL 2EEAA 3CLWA 4JEGB 4LYRA 5HYQA 3PP4H 2R2HA 4HJJH 4BQ3A 4M8VA 4MS8C 1EAJA 1SBBA 3QPXH 3KPPA 3H42L 1TVBA 1KLGB 2VISA 3MRMA 1BPLB 2VITA 2A6IA 4Y4HC 1ORSA 1MSPA 4H8WC 1RIHL 4AEFA 2EDDA 3VMPA 4FMVA 4LLAA 4NGHH 3UTSB 3SPVB 4HUVB 1OGGA 2PR4H 3JWOH 5LGHH 4DN4H 2FHCA 3SDAC 4NQUA 1I8KB 1P1ZA 2ADGB 2NY4B 4KQ3L 4MHHG 1G6VK 4MD5A 3MLUL 4HUMB 1MRCH 4YHIA 4L1DA 5KVGH 1A6TA 5J1SC 3UR7A 1VFUA 1QNZL 3MLXL 4O9HL 3TO4C 5ESVB 1BJ8A 1U3HD 2AJUL 4RAVB 2EBNA 1W2VA 2E8YA 2OMBA 1AI1L 1AC6A 2V5MA 2AXFA 3MYJB 4PGCA 1FNSH 3QP3A 3OQ3B 5CJOL 1FZKB 3L5XH 1DQLH 2AK1L 5KN5A 2OXGA 1JF5A 2RIKA 1NWUA 1XR9A 3VH8B 1B2WL 4DO4A 3O3EA 3A67L 3QDME 3TYFB 5J57B 4BQ5A 1K9EA 1C08B 3VU2A 1CG9B 2OR9L 5SWSB 1KPRA 1HKFA 2OWCA 1JCKA 1TCRB 5GGQH 3WEXA 1WIOA 3FRUB 1DDHB 2FX7L 3KPOB 3K1DA 1QEWB 3OHXB 4UQBA 3CFJA 3UBXI 1P84K 4PRHD 5EUKB 2AGJL 4MQTB 1RZGB 2E7CA 5IROC 4NZRH 1VHPA 1OD0A 3AHZA 4LCCC 2DQTH 1R34A 1FO0B 3AS1A 4QHKI 3QAZC 3DHMA 1G9NH 2YXFA 2APTA 3QWOB 3EJRA 1D5MA 4PGZA 1EFXB 3HI5L 3LPGA 4W6XB 3IS1X 1KACB 2Q3ZA 4CU7A 4P2QD 5BS0A 3WFHA 4ODWA 4HWBA 4H1LG 1GOIA 1KIPB 3AMCA 3BHBB 3WELA 3EMZA 5CPTA 5EZOL 2CKBL 3GJEA 1NANI 2K1MA 5M17A 2OK0H 3L6FB 4HIEB 2UY2A 2DRUA 4DKFL 2J1KA 1EX0A 1DWFM 4UMGA 1T80A 2DSZA 4AZ6A 4LPTA 1UM4L 3LXAA 3TJEL 3EDDA 4MVBD 5L7XH 3VFVB 1I7RB 4ODSL 2VX4A 3SCNA 3CXHK 2WAHA 1Y7VA 3WIIH 1V3HA 2GJXA 2DQIH 3BIKA 1INEH 2EIDA 4WUUE 1GOGA 3ZLQC 5E95B 1UM5H 5KSAD 4KVCL 4YBQD 4UZUA 1MCOL 3AU1A 3TBYB 4R7DB 3B3IB 1GXEA 4W85A 5D72H 1A6VH 5SV4A 2XVGA 1IVLA 2BVEA 5F7DB 5GRJL 1HYSD 2VYRE 2AJXL 5I1AB 5KANI 3NA4A 5DJZB 1LEGB 5T33L 4NRYB 4V2XA 3UZQA 1UD5A 5IESH 1OTTC 4Y5XC 1FIGH 5I8CB 3SDCB 4WI8A 3FJTA 2WKGA 1BFNA 4UDUA 4WI7A 4E41E 2VE6A 3BYYA 2AVGA 3TO2B 1CFVH 3VI3E 2HFGL 2PETA 4Z7NE 2CXKA 3VXNA 4PTUA 2PCPA 2W91A 4BZYA 4LFHD 3EYVB 2G2RA 3H3KA 2HT4C 4XP1H 1MHCB 5H2BA 3W39B 5JIKA 3UCRA 4I48B 1NGWA 1LP9E 4J23A 4NXSA 3E6FA 3LMJL 1BZQK 4X4YB 2EXOA 1EO8L 1RPQA 1CXFA 3LV3B 5EPMA 1GCYA 4NT6B 3SDXE 2YFNA 5C0CA 1UD6A 3PXHA 5HYSB 3M07A 1W9UA 5C0DB 4CD4A 2DT3A 3REVB 4XVJH 5AAMA 1MFCL 3SQOH 4NQSA 5EU7E 2NY1B 3N15A 5DD3L 1GOMA 1E6SM 2OP4L 1BD2A 1AMYA 3MRCA 3T3PE 1I3UA 1KJVA 1M05B 2NXZD 2VH5H 2V3EA 3SCTA 4H25B 4WI4A 5KS9A 2QR0A 4MAYB 3T0EB 4M1CD 3KDMB 4WKFA 1J0JA 1CK0H 2A9MH 3BPLB 3DX7A 3ROOA 1J0KA 4YHOH 5DJDA 1GQLA 1WLHA 1ISVA 1JGVH 2F7PA 1TQWA 4G8GB 3VI3F 2OMNA 4D3CH 4Z7NF 1KIQA 5E08H 4Y19B 2V2TB 3UJJH 2NR6C 5TDPB 4HUKB 1E71M 1FA2A 4Z9KB 3QA3A 5IFJB 2EXWC 1K4CA 5M94B 3FQWA 4OLZH 4JKWA 5L2KD 1VAHA 1YEDA 3IDIB 4GMSH 5FM5M 5ID0A 3P4MB 1XAUA 4Z8FH 4LSSH 3ECBA 4A6YA 5IVXB 3SDXF 5EFIA 5C0AB 4XUYA 1MFEL 4CCEA 1ZGLP 3OTTA 5F6IB 5F9JB 1ZJAA 1J9YA 4KRLB 1SBSL 1JWSA 5DC0A 3PDDA 4H26B 4Y1AA 3V6OA 3PGFH 4S2SA 3TH3T 1MQPA 1OARH 1CYGA 3LVEA 3CH8A 1FDLH 1JIBA 3W29A 2JIXA 2FATL 3ZE1F 4DGVL 4XWOC 5F3HB 1ZBCA 1RUKH 3GUTB 3I6LE 4KUZL 4U7SA 3GSXB 3D2UD 5FF6B 1XGTA 5DLMH 5A2CA 2VSDA 2NMSA 4G6FD 5ECJE 2DIBA 4PMDA 1BAGA 2LE9A 4DGIH 2BVDA 1OGTA 1H3PH 1KF9B 3BISA 4PLNC 3D3VB 1VGEH 4S1RL 4OZFA 5FA4B 1P4IL 4L8SC 1RULL 5GZNC 4QLRA 1XT5A 4Z78A 3APGA 3ARBC 5AAWA 2WK2A 5AUMB 3LRSA 2NXYB 2X7LA 5HYSG 3NABL 3GJFB 1J7VR 2VRKA 3MRJB 5FKPB 1MHPH 4YAQB 1N5YL 3QFJA 3QIBB 5KOMC 5JUEH 1HSBB 3QULA 4XMPH 2PWEA 1QBML 4MJ6B 3T8XB 2A0LC 3AZTA 3IRZA 3C6LC 4XCYA 1EGZA 1A1MA 3BEWB 4MA1B 3D50A 2NQCA 4ZOAA 3A4XA 1YMMA 3VXRE 4QT5B 4U05A 2VJXA 5F1IB 2H1PH 1DUZB 4R0LB 3LKQB 3MLZH 3UJIL 1DVFA 2PUQT 5EOQH 3D18B 3EDEA 3TVMD 2JJSC 1NMBH 1OGAA 4QRPD 3UXFA 3U7VA 4WO4C 3P77A 5LAXA 1JYVA 2FIKA 1KB3A 2KKQA 4U2ZA 5I73C 1HTYA 1BIHA 3NFNA 3CNKA 1RU9L 3SCMA 1Z0NA 4AM0B 1MAMH 2X70A 3CLEL 3TZVD 2ARJQ 1VFAB 1Q1JL 1IAMA 1DWJM 3OG6B 2BRRH 4P3CL 4QTHA 5FGSA 1LLOA 1NBZB 2F8XC 4K3GA 4UBDC 3SO5A 2G9HB 3FFDA 4Z7WB 5KG9A 1H3GA 2X4UA 3RU8L 3O8XD 3QHFH 2VXSH 1V6XA 2EYSA 4WWKD 3WIHL 2Y06L 2IQAB 3D0VB 2Q76A 1YY8B 3CDGA 3I50H 3RJXA 2UZIL 5E00B 4DOHB 4WTXA 2GT9A 4IHOB 4XP5H 2DSVA 4DCQB 4AZCA 3FT3B 3RZCD 4EI5B 3B5GA 1FL3A 5KZCD 4R7NB 4EOWH 5JW4R 1FGVL 3MJ8B 1HHKA 5IJVB 5HPMA 2X4RA 3F7YB 5CSBA 4PB0L 3EYFA 3MJGX 1T22B 5IQ9A 3RTQD 3WUWG 3OKEA 4HWZA 1UWEH 4M5YL 4UIMA 4HBCH 1NFIB 4AG4L 1VESA 2WINA 3U79A 2FLBT 4YE4H 4LLUB 1E6JL 1NC4A 2D7NA 3VFNA 4M6OH 4IDJH 3JTTB 3BVTA 4NNXA 4L4VA 2DT2A 1M7IB 4ETYA 3MI6A 4PRAA 3HZMB 3KHOA 4JY5H 3FONB 2FX8L 3FZUC 3WF1A 4DWSA 2EEBA 2ALWA 5JQ6H 1FL6A 3CC5B 2BNRE 2X1WL 1UM6H 2QF8A 3T0XA 2CKNA 3FB8B 4PJ9D 3RWJB 4RE3A 4XZUA 1Q0YH 1AC0A 4H20L 2F53B 1MYRA 4U5KA 5JORA 3TIEB 1ITXA 4APQA 2ZUQC 1TVPA 2BC4A 4KTDH 5FUZL 5I18L 5F9WB 4H0GA 4ZFZA 2WBJA 1TQUA 3BUQA 4AZ7A 1JWMB 1UADC 1JZ8A 5FFLA 5A43C 5FUCC 3VMNA 3UYRL 1KEGH 3IU3A 2DIEA 4P2OB 5LBSL 2KUTA 3VXSB 5T1DL 1ITBB 5TDNA 1MCWW 4TPRL 4X7DC 5JDSB 4LLQB 4AT6B 2P5EA 1S9XA 2JKXA 2YC1B 5CJXA 5DUBB 3RM9A 3MR9B 1QPXA 2Z9TA 1W9XA 4P3WA 3DX1A 4F7EB 3AMGA 4D9LL 3AXXA 4S3KA 3LOWA 3S34L 2OZ4H 4RE2A 1AP2A 5FYKL 1XSIA 3FCTA 5GXBB 4MXVE 1AR1C 5JO5B 4F9DA 1XD1A 5B39B 4U0RC 4QFUA 2R0LH 3WD4A 3NTCH 4MTVA 2JJWA 5INCA 1V8HA 3MRIB 1E4WL 2ZCHL 1AY1L 4HFWB 4JFEB 5KAQG 4KZDH 1CF8L 1UKOA 1V6UA 1LK3L 3VFOB 5DDHB 1IC1A 5CEYB 4UT9L 3RA7H 3UTQB 5HVWA 5JXED 4P7RA 2H26A 4ZPTB 5KVEL 4ZUUB 1HJXA 3IDMA 4WVRA 1PG7L 3QNXB 1M04A 4PJAB 4Z7VE 2P7TA 3IKKA 3NJ3A 1UACL 4UFMA 4KJWC 3GJFK 4JDVB 1MIMH 1DFBL 1YQ2A 3SE9H 2XV6B 3S5LA 1MWAA 5B8CA 1E73M 2BV9A 3WXWH 2NY2B 2UY7A 4MLSA 2VIRB 3FT2B 2XTJB 1WK0A 1IEBB 4RGMC 5C0EA 1OSZA 3H9SB 3B9KC 4FQXA 4LQFL 3KLKA 4PGDB 5EZLA 4DK6A 3KYNA 1A7OL 3ARTA 3BN9C 3QRFM 4UUJA 5AYUH 3V5KA 3QCTL 4F7PA 1GOKA 3MRQA 3GMOA 5E0CA 2D7TH 5EOCL 1PYWB 2UY4A 4TX8A 3G08B 2ADIB 4HOXA 2YIHA 4QP0A 4JZJB 2V17L 4HHAA 3NSXA 1H0IA 2D7PA 3PZIA 3LIZL 1IL1B 3VXOA 4OLYH 3IU4L 2EE9A 3LH2H 1MVFA 4YWGH 3LEYL 5D1QC 1D5XA 3AROA 4Q97A 4FLSA 4FF5A 4XNXH 2B7DT 1IEHA 4CVXB 3TCLA 3OKKA 3O3DB 2BNJA 3DURB 1W9DM 3AS3A 5TQ2L 5CEZD 5AZ2L 3J7HA 2IADB 1GIGH 4RGNC 1NCCL 5BS0D 3P30L 3RWFA 4RBPH 3A6BH 5T3XL 2K7PA 1WZAA 3QUXB 4YHZL 1OQXA 2EACA 2YA1A 3F58H 2B2XL 5GS0L 1NH6A 5ICZA 4EN3B 1YDPA 1RV6X 4PLOB 1KTBA 5K9JH 2J75A 4L4TE 5GHWH 4O51B 3WNNA 1SJEA 4U5IA 5B39G 2QQQA 2HJFB 3U7WH 1W1VA 5DRNA 4NQXB 3T77B 1X5IA 4XAWH 2XQBL 3QIUB 2E7MA 4JHBA 1F2QA 4GQPH 4JG1H 3SDDC 4YZFE 4UTAH 1FPTL 1F00I 4G6AD 2GK1B 5I23A 3LD8B 5FDYA 5HHMD 1E6RA 2WVVA 5E6IA 2X1XR 3GGWA 1C8PA 1HVQA 1V7NH 2GTWA 1OD7A 5IB2A 3GSNA 1T1XB 3BH8B 4F7CA 1ZHNB 5CBAB 2FX9L 2X4OB 3L2LA 1QQDA 2Q1EA 5DJYA 1B30A 1P69B 2OR7A 3O3AA 4AWEA 1ONQA 4PMQA 1YUHA 4LKCB 2DJUA 4U6TA 2LVEA 3PZOA 2JEQA 5BYWA 3N9GL 2V7NB 3FB5B 4ZXBA 2EICA 2XIBA 3MA7A 3OG4B 1QSFB 1MREL 4F8QA 1M6OB 2HJKB 4YHML 2ID5A 4FOMA 2HTLC 5C6TH 1JUFB 1LG1A 3K74B 1A7QL 4HOZA 4PRWA 4YPGB 3KJ6L 3RL2B 4FXKB 4A3YA 4IRJA 5EBWA 1SY6A 5ITFA 5MHSD 1WZLA 2R56H 4KDVA 1VKXA 3LKNB 2AJYL 3VNZA 2J4GA 5C2BL 5E9DB 5A8OA 2CPCA 4LYPA 4C58B 3GNMH 4CMMB 2HYMA 4X6CA 2UUDH 5C0CD 3HCVB 3QH3B 2W60B 1TJIL 2IANA 3ULSA 4MAUH 3GIZH 1S78D 4UT7H 1I7TA 1W1YA 1NDMA 2YBTA 3WUFA 2DLHA 2VLLB 1NWSA 1ZA6B 4JPIB 3ARGB 1MQRA 2YK1H 5DJ8A 3WHXB 3R1GL 4YDVA 4PRPE 5I9QC 2DKSA 4JHZA 1R3LA 4QRRE 2AMGA 2CIPA 4YEEA 2W5FA 3NSNA 1NUFA 4RFNB 2H32A 3WD5L 2A3AA 2OTPA 1DN2A 4RISL 4G8FB 2QLYA 1LO2H 3BP4A 1FNAA 4L29B 3GB7B 5JPNA 4RSVA 4MNQE 4HC1A 3K0WA 1RZKH 5E7FA 3TNNB 2C7UB 3UTPD 4P2YA 4KV5F 4Z0XB 5IM7A 3BMWA 3BFOA 5F8RC 5FUOL 3HE7A 5IV2B 1OTUD 3LS5L 1XZ0B 2LABA 3MJ7A 1EEYB 1NMCC 3MYZA 5DO2D 1K8DB 2B8OT 3ARFB 4LSRL 3S6TA 5F1NA 1EDTA 1UA6L 5HGDA 4DUWA 5BV7H 3NPSB 1CFNB 4JVPA 3WFEL 1BBDH 4M8UA 5LWYH 2VOTA 4FG6D 4XPBL 5ICYB 4YO0A 4EXKA 2AI0L 5IB3B 5DT1L 4Z2LA 4D9RE 2VXTH 4Y8DC 2DMKA 4Y1AD 4Y2DC 3U7YL 2V9QA 1O7SA 4WEUD 4PMRA 4YK4C 4Z5RA 3DX6B 2JIXD 3LDBB 4DO5A 3MLWL 3PV7A 1CLZH 4HZ6A 4V1DE 5EU3A 2PB1A 4UI2A 5KSBE 4XPHH 3KLAA 3NCJH 4HPOL 4EK7A 1E4NA 3DJ9A 3QHOA 1UENA 3OLEA 4R4BA 3VFRB 3LQAL 5FYJD 3A6CH 1NAKL 5D5MA 4WU5B 1LL7A 2PTTB 2EYRB 4UFKA 3GDBA 3RGVB 4E8DA 1RJYB 3JTSB 2XVPA 4P46D 2RGLA 4PRIB 3VIFA 1V02A 2ZOLA 3RWHB 1V0NA 4ZFGH 4PJ7E 3HJEA 4KJPC 2HMID 5CGTA 3FOLB 1Z6JT 4XAKD 1H8NA 2D23A 5FCUH 1BYAA 4GW4A 5HY9B 2XFXA 4RA3A 4DUXA 8CGTA 3TT3H 5C09E 1BOGA 2EH8H 3PTKA 3MLYH 2J4WL 4K94H 2Z93A 4JFVA 4TUOB 1LQ0A 4UT6H 3RILA 4UB0L 2WWCA 5DHYB 3VGAC 1SYSA 3O9WC 4NN5B 1ZGLB 4C56D 1KXVA 2J7LA 3WFBH 1U9KA 2ZJSH 1NBQA 1XGQA 2P8LB 3ZYZA 1QG3A 1AXSA 3CFBA 3LRKA 1DVFD 3PIQB 3ELAT 4P5KB 4Q9RH 5SX4I 1MRDH 3PXJA 1OGAD 5DVLA 4PJCB 1YZZA 4HXBL 4HS6A 3RMEA 4ODHL 3QEQA 5KSVA 4FQJH 4OAWA 1Q6GA 4JREC 3VD9A 4BSWA 1RIVL 1Y18B 3MV9B 4LCIH 2VCCA 2AXJA 2DQXA 1D5ZA 1NFKA 4X9GA 1LDPH 5J3HD 4L8DA 4Y4KB 4L5FH 2B1HH 3MREA 1ZT1B 1YEEH 4YEFA 1TTGA 4PP1C 3PP4L 3QDHA 2QBWA 4HJJL 5HDOA 3EOBB 4PJ7F 1X5ZA 4LSUH 3QPXL 4PJIA 3W5MA 1YC8A 1UWSA 4YHGA 3WBAA 5T1MA 1W9PA 1JGUH 2WHKA 4DZ8A 4NQEA 3T4AB 4TTDD 2C9AA 4XWGH 1QLFA 5DHVH 4YUEH 5FUCE 3EOYG 4ORGA 1JGEA 4Z0BH 3MBEA 2DOCA 3GSUB 5LKNA 4BUHA 3WV0A 5FGCE 3QI9A 1YEFH 2PR4L 1IBGH 3JWOL 4XPGH 3EYQC 5E2UH 4DN4L 5LGHL 2FYVA 3BIBX 2YSSA 2EDJA 2C26A 3OKOA 1MRCL 4KKCC 2LAAA 5KVGL 2NW0A 3SJVD 4FFVD 2CDEA 3VM5A 2W07A 5D1ZA 3L9RB 4FFWC 4QRSA 1W0YT 1QO3A 3TTOA 1AH1A 4E41B 3BGMB 1FNSL 2YOCA 5DK0B 1U8HA 3WDJA 1DQLL 4HV8A 1L0PA 3BD4A 3W9DB 1C5DB 3B6SA 4P7QA 1P7QB 4L4VD 2E7LA 2FIRT 1S3KL 4NJAH 3L2MA 3SCPA 1BJ1J 3MRRB 5KAQF 1U8IB 1HJUA 3L7EB 4C54A 1MQKH 4EDWH 1I7UA 4PTTA 1M71A 1LP9B 4LPVA 1TQBC 2OWXA 3EUUA 1BOYA 2OTUA 5DMGC 3VINA 1NFDB 5GGQL 4PLKC 2EIBA 1TVDA 4K3HA 2FL5A 2XGIA 3QEHA 4APQD 4U1NB 3TN0D 2XVKA 4PY7B 4EIZC 3N1FC 2WBJD 5L6YH 2C3VB 2OJEB 1FHDA 2ZXAA 3CMGA 1EMTH 2ICCA 1OL0A 1S7WA 4NZRL 3T2NH 2XN9A 3M7SA 2EPKX 4U1HB 3CUJA 1KFAH 3ZL4H 4AEHH 3WXVH 1FG2A 3MRLB 2DPEA 1A6UL 1G9NL 2XZAH 4JQVA 2P5ED 3GM8A 3BSHA 2AEWA 3CSGA 3UC0H 2XVNA 4NQCB 5CMAB 4BCEA 1WQVT 3FQUA 2WZEA 3VFTA 1N0XH 2ATPA 3GH4A 3KEHA 5E0FA 4KKAC 5J1AA 4DKDC 5GS0C 1FAKT 4LCWE 2OS7A 3G6JE 3TFKD 2OK0L 5C08A 4G8EB 1CE6A 3G5XA 4MB4A 1XH2A 3C6SA 3V8CA 4PJBB 3NIYA 2HWZH 3CFKA 2D31A 3PV6B 4PJ8B 4IMKA 4BSVB 5IHZA 1J01A 1R24B 1X5JA 1E1EA 5DJXB 5JHLH 5TD4A 4JVWA 2BERA 4RGNE 5L7XL 4GT7A 2BNQE 3LS4H 1EJOH 3DO7A 4S0TD 5FA3A 5I71C 1TZHB 1I8MB 5HTSA 5JIIA 1D9KA 2DQIL 2NZ9C 1INEL 4Z2KA 1D5IH 1DQJA 1AD0B 3HN3A 4P48A 4X6EA 4ZPVB 1W9VA 3HU7A 2V6HA 2DL9A 4MCZB 4JZ5A 3DARA 5GJTH 3T4YB 4DN3H 2NY6B 3F5LA 5D72L 3WO4B 1A6VL 4U1LA 4LGSB 3BCDA 1JMZA 3VXTB 3HNTH 1YPZB 5BXFB 5GGTH 2V2XA 3KPNB 1IC5H 4PEEA 4X9BA 1V3LA 3FMGH 3TNMB 1FZMB 4F9LA 2IAMA 5E8DH 1FIGL 4HMCA 1XIWB 2XTLA 2IBGA 4WTWA 2GJ6A 3IAQA 1HK6A 1CFVL 1HQ4B 4XCEB 1LVEA 1FNEA 1U8QB 5MERB 1H15B 1BLNB 5DT5A 2GAZA 1AD9B 3P9WB 2XGBA 5C8JA 2VT0A 3DI2B 4XNZC 4XP1L 1ZT4B 1D7FA 1TNMA 1H5BC 5A8NA 1B0IA 3KJ4B 5HSFA 3IETA 1OGBA 4NC2B 1V6VA 5D96C 5FGBC 5MEQA 3VD4A 4OGYL 2XWBB 2Z31B 1XF4A 1IAIM 1AGCB 1WUNT 3MUGA 2A6JA 3KPRB 3PGCB 4KK5D 5DFWH 3TEUA 5C71A 4KI1A 1TTUA 1CFSA 1DEEA 4OGAC 1AXIB 4XVJL 3SQOL 4KRPB 3CVIH 3NOIA 1VEMA 1G7LB 1LE9B 3WUBA 5CIPB 1U58A 1RP9A 2VH5L 3FHAA 4U6HB 3O45A 1RZ8A 1NEUA 3KYAA 2KPNA 3V2AR 1T1ZB 3VDAA 3NZ8B 4GRLA 1CK0L 2A9ML 2CK0H 1KXQA 5DS8B 2WLZA 5D7JB 3W11C 4YHOL 5JW4N 4GG6A 4H8VA 1JGVL 2FEDD 4D3CL 4KRMB 2UWEA 3S88H 5E08L 43CAB 3UJJL 4RAHA 3CPLA 4MADA 1OHQA 4BZ2H 2X41A 2R29H 3G5YA 2CRYA 3GMPB 1RK1A 5E6ID 3IJ8A 3CTTA 4OLZL 5BZWA 4JKMA 4NP4H 1HJWA 1KB9J 1J0IA 4GMSL 1NP0A 3OZPA 4BQBA 5IEKB 4JRXE 1ZBKA 4YPJA 4Z8FL 5D9SA 3DVIA 4G9DA 4LSSL 1DBMH 3F7VA 4Y89A 2IFGA 5D2LB 4XZWA 4G5ZH 3RKPA 4ENEC 4HKXB 3WIFB 3QJFA 1OTSD 4PV9A 3MUHL 3PZNA 2X2HA 2D7OA 4L3EA 3UO1H 1ES0A 3PGFL 1OARL 3HC0B 3H7LA 5GSRA 1Z32X 4LARH 4W7UA 1OWQA 3AIUA 3SUSA 3WF2A 4I0PB 3OXRA 4CVUA 5ALBH 5IMOA 2QSVA 1ZV5A 2V2WA 1CGSH 1RUKL 4IRJD 1T7VA 2AV7B 5GS2D 5DLML 5L8KB 3HB3C 1BZ9A 4GW5A 4HS3A 4BFIA 1R5IB 2AXGB 2ORBH 4FXLA 1YQVH 2BY3A 3GI9L 2BOCB 1FYTB 2CLRA 2XIDA 5EBMA 1B3JA 3ALFA 4DGIL 4PRNB 5DF0A 4MZ2A 1H3PL 1QPPA 1VACB 3NCFB 5EU6A 4OOUA 1H2JA 3D52A 2IAND 4WHTB 2Y1VA 1VGEL 3RUGE 2CXGA 3X14A 3JV4B 3PG2A 4HKBB 2GQHA 3U0TA 1JZ5A 4NBXB 1HVXA 3RBSA 4R96A 2P24A 1BBJB 4R2GC 1CFBA 5F9OH 1V6WA 4IUGA 3Q0HA 1XR8A 4OM1H 4FLQA 1Y0LA 5DMYA 5IMMB 4PBWD 2F5BL 1OAYH 5GGUA 1MHPL 2PYEE 1MVUB 2XY2A 1N8ZA 4S1SH 5JUEL 3PDGA 4PGEA 4D6GA 2NY3B 2VO5A 4XMPL 1FV1B 4BH7A 1HHHB 2O93L 1EBAA 5JOPE 4G80A 1AGDB 4U3HA 1XGUA 4RNRA 3QISA 5E09A 2H1PL 4G6KH 4WFHD 3MLZL 3TBSA 4JANB 4MJ5A 4MD4A 5EOQL 1NP2A 4W7VA 3FB6B 4GBXB 2VDKH 1W8NA 1NMBL 1KNOA 3HE7D 1QHPA 4GKNB 1AGFA 3CVHL 5C0BA 2NT0A 5JHDE 4OIFA 1MAML 1EGJA 3Q3GB 5D7IB 1ZLVK 2F8OA 2BRRL 1Z5LB 4JE4B 2D3LA 4M3JA 4LNRB 4POYA 1OW0A 5FO9A 3QWRD 4G6JH 4MJIE 2Z91B 2DYPB 2ZNXA 3DUSB 4XBGB 4XHQA 3U30C 1MJJB 5INDA 2Y5TB 5C0NC 2XKSA 2YPLE 3QHFL 2VXSL 4K9EC 2F7RA 2VLKE 3SUVA 5E2TH 4XXDB 3I50L 5DFVD 3RL1A 2IH1B 1G9HA 4MQSB 4F58H 1ZHBB 4Z7VB 4OGZA 1FH5H 4XP5L 1CZ1A 2GUOB 1C8XA 4Y16B 4LLWA 4K7PL 2J8HA 3NCYS 5JLZB 1D3CA 4EOWL 2J8UE 3JWOC 1UXWB 5I19H 3U5YA 1U36A 4HP5A 1F6LL 1H4PA 1UD3A 3MA9L 2P5WA 2W9LA 3BWAA 3WF4A 1HOCB 1FVDB 4JGMA 4NKOA 2JB5H 3QFDB 3MACH 2OQJA 3RIAF 5BXPA 4BKLA 3CJJA 3H9ZA 5ITBH 1N4XH 3C8HA 1UVQA 5HYJB 1UWEL 3AFLA 4P4KA 3DROB 4X6DB 4GO6B 4S1DC 4PV8A 3TJHC 3E3QC 5C6WH 4M24A 1E43A 5EUOE 4GOSA 1H9VA 4M6OL 1GGIH 2EDRA 4IDJL 3STZA 4OF3A 1O7DC 3PHQB 4PLJD 5DQDH 3HR5B 3ARWA 3UMTA 4F57H 1IZJA 3MCKB 1L8NA 1BSIA 3ZKSD 3ZM8A 5IW1B 1JGIA 3VI4E 3HS0A 3DV4A 1UXSA 4JY5L 2YN5A 1BPVA 1GYAA 3RWIA 5HDRA 4E42A 3JV6A 3L5WA 5JW4M 3IDNB 3RHWK 5C07E 5JQ6L 1S7UB 1UM6L 5DWUH 3DECA 1KPUA 4MDOA 3H7BB 1U91A 3SCQA 5CSYA 3T04D 5CWSB 1YEIH 4NFDA 2V7HA 3CDCA 3HZVB 2XPKA 1L0XA 4KTDL 3QEQD 1UB5A 2IALA 4PRBB 1QR1B 1GQJA 5JOEA 3ZOAA 4U31A 1ZS8A 1BQSA 2J8UF 1KEGL 1D5BA 1F5WA 2P47B 5DI8B 3QDMA 2BHYA 4JFDB 2ILLA 4AH2A 5BMFH 3QHTC 4QLKA 2PXYB 3HE6B 5F97E 2W9EH 1J9CT 4WJ5B 2AEPH 3TBTA 1T0MA 3EYSL 3NBNA 2GTZB 2ZCKH 5C1MB 3NDYA 2VL5B 3ZKND 1JMXA 4WFFD 2OZ4L 3PGDB 4L1HA 5EUOF 3SDYH 2I9LA 4NQED 4JJ5B 1CE1H 3PJSA 1WBXB 3IGAA 5F71A 1NGYA 2BVUA 3QNYA 4F3FB 3QIBD 4N8VG 1EQCA 1JYWA 5CEXB 4HPYH 1QRNB 4M61B 1B6UA 2R0LL 3NTCL 4CW1A 1RIUH 3TPUA 4ZFMA 5ENWB 4PJ5A 3QI9D 1BVNP 3LN5A 4KZDL 3EGSA 1X5AA 1OP5K 2EE6A 3ULVD 3FN3A 1U95A 3IANA 3RA7L 5D7LB 5CAYB 2HJLB 5IQ7H 5FIEA 3VWKC 3IDGB 5HHPA 1ZBVA 4LGRB 5DD5L 4HG4K 5D1ZD 1XF2A 3C2SA 3SUUA 4OKVA 1MIML 3TH4T 4HZ7A 3SE9L 4DGYH 4OBSA 5J56B 5CP3A 3WXWL 4P23C 1UQSB 1GHRA 2D0GA 3I02A 4K3DH 4JKKA 2JK5A 3QRGH 4FQ2H 3QUZB 3RKDC 2ESVE 1LMKA 2GK0B 4JFXA 5I8EB 3V7MA 3LRMA 3ARDB 5AYUL 5CEZH 4EI6B 2VQ1A 1AO7A 2CBIA 2EH7H 2D7TL 3RM8A 1B3YA 4TNVK 4N0UE 4HWBH 4WUUA 2D2OA 5BVJA 4WRLA 1WFNA 2M26A 4EI5D 5IVZA 4OLYL 4WFED 3LH2L 1ZHLA 4XCNA 3WKNA 3G5VB 1IMHC 4AISA 4YWGL 3HG1E 2XN9D 5ADOH 2FGWH 5IXEA 1RD6A 1QA9B 2VKWA 4R4ND 5HD8D 2VDLH 3MPCA 5DSCB 3CHDA 4ODTH 4NO0B 3O11B 3TBVB 4WLCA 1TMCB 1GIGL 1GHFH 1URLA 3AICA 4GW1B 1E6XM 4LCUB 4GRWB 4FABH 3A6BL 3ZKXC 4WGVB 3MNZA 2YR3A 3MRDB 2JFEX 1D6EB 3DRQA 5I79A 3PDOB 2UWFA 1G84A 4ZD3H 1XFPA 3KWWA 1JNLH 3PP3K 2Q87A 3F58L 5F44A 5ADPH 4M7ZB 2VDMH 3P9MB 1XD0A 5C08D 1MJUH 4W6WB 4HZLB 1FVCB 1Z9MA 1HHIB 5K9JL 3RVXC 3MV7B 5GHWL 5HVHC 4UDTA 1K85A 4BH8B 5C6PB 5I2IA 4R5EA 2A6KA 5C0GB 2WSPA 4Y4FC 2BXYA 2F53D 4QRUA 4EJ1C 4XAWL 2ZSVA 4DFIA 3SDXA 3GMMA 5I1CH 2Y4SA 1AHWB 4JG1L 2Q7YB 5T1KA 1YEKH 1D9KD 2CO7B 2OYPA 3LKSA 3K3QA 1IGTA 4Y88A 3KLSA 1A7RH 5ELIA 3VXMB 1X5LA 4P2OD 3NSMA 4X5XA 1CGUA 3O2WH 4AZBA 2C1PB 4WO4B 1AIFB 4EQ2A 1FBIH 3AY4A 2LV4A 4QYOA 4NHUB 2I60L 4V1DB 3OJDB 2ARJA 4NQDE 5JR1H 5KSBB 4UU9B 3IDUA 3M1BA 4UQ2A 4WU7A 5H35A 2ZXDA 3CHCA 1ZB5A 3BQUA 3K8LA 5TPWH 2Q8BH 1C5CH 4P0DA 5E5MB 4ZTPH 2PWDA 2GJ6D 1BG4A 1OT1A 5J6HA 4WW1A 1A4KB 4XNYH 2EDKA 1G0XA 5I66A 2QKIA 4I13B 2BNUA 2HLFC 5C6TL 1CDCA 3IDYC 3QNZB 2FH8A 2AJSH 4N1HB 4PTWA 4ZNEE 3VA2C 2HTKD 3BT2H 5J6GB 4YHYC 3BRDA 1CD8A 2CITA 2R56L 1WCGA 1CXIA 1BGGA 1MW3A 1QLRB 2Y7QA 3NGBC 3RVTD 3CVHB 3S7GA 3BVUA 5HHXL 1MI5E 2KBGA 3L3OA 5TE7H 4U3XA 4WW2B 3QGVA 3TTYA 3GNML 4YBLB 3RY6C 1E1FA 3QDGE 4MAUL 1R3JA 3GIZL 1F3JA 2NY2D 4UT7L 5E8EB 5ABFB 1U8LB 3VFUA 3T3ME 4KROB 2O92A 4P5MA 1Q4NX 3H9SD 4FQ1H 2YK1L 3P4OA 3B43A 1ZEAH 2FWOB 5JZ7C 4B3LA 3ILQD 5D1XB 4JG0H 4GRLD 4OF7A 2XKNB 3FQTA 4QHKJ 1LO2L 3MGTA 1Y6MR 3NFPB 4PJGE 1NCBH 1RZKL 4M4RA 4TVPE 5IT2H 3AI0A 2YEZA 1CVRA 1LK2B 5CBEB 2MWCA 4QHLB 5M3WA 1KTDB 4GXUN 3WFCH 2HAZA 5F21B 3L7FA 5HXMA 1JGDB 1KPVA 3MBXH 4ML4A 1X7QB 2L4OA 3W0WA 3KL5A 3MO1B 1CLVA 1K8IA 1KCSH 2JELH 5EZJB 4F15B 3D85A 5BV7L 1PQZA 1C3FA 3MFFA 1BBDL 4HK3J 2C4FT 4I0KA 5FYJH 1KLFA 1TZIA 2X40A 3X3GH 3OG2A 3VXRA 5DJAA 1MLCA 2WMIB 1J8HA 2VXTL 2D7MA 4AMCA 1B1YA 4L3ED 4EN3D 3QIWA 5DEZA 5GRVL 4KWUA 1LGVA 1UWIA 2AK4E 1CLZL 4JY4A 3GMNA 3EJTA 5DO8A 3V6OC 1MFDH 3O2LA 3QO1A 1HJSA 4XPHL 3NCJL 3R0NA 3CC1A 8FABB 1BFSA 3C5ZB 1R8LA 3A6CL 1XCXA 4PTMA 2AQ1A 4PJGF 1JHKH 2CH8A 5FYJU 1JRHH 3N9KA 4HJ0C 1X3DA 4OUOA 2CIIB 4JFFE 1RK0A 1FH8A 3LQZB 4ZFGL 3A21A 3SGKC 2IPTH 5CINH 1NWRA 1UGNA 4LASH 3MS8A 3GBMH 1YY9C 5EULV 3IXTB 3PZVA 5FCUL 4PJFE 1ZA3B 3N1PC 1MHHB 3VXUE 1I1RA 5E5UB 3TT3L 1LEKA 4J3XA 4HWNA 3U82B 3MLYL 4YHEA 5FHBH 3GSOB 3ARYA 1II4E 3OJVC 1LD9A 4IRSC 4K94L 5MEOB 1B0GA 4UT6L 3B9KB 4HXAH 1UD2A 4U1IA 4NWUH 2Z8WC 1T1WA 4GRMA 3VRJB 1WTGT 2ZJSL 3I2CH 3WFBL 4M43H 3L5IA 4NZDA 2PYFB 1WCBA 3E3QE 4Y4HA 4Q9RL 4BUGA 3A5VA 1R75A 3P0GB 2ED8A 2F54B 1S7SA 4TVDA 1A22B 1Q8MA 2FSEB 4FQLH 3RNKA 1E27A 4FQJL 4M1DH 4JQIH 3LX9A 1PKQB 2IH3A 5C0BD 3BGFB 2VZ1A 4I9WD 4UFJA 3C60C 3SDAA 4LCIL 1A2YA 3G6JB 4ONHB 4PR5B 3ZDZE 4IOFC 4XTRC 3QO0A 2UVFA 3E6HB 2ZUYA 4L5FL 3OR6B 1YMHB 2B1HL 5F7YC 1E0VA 3SCMC 3TO4A 1YEEL 2BNRA 1VBRA 1A7PH 2NW3B 5A2KH 1I1FA 1ZMYA 1JPST 2DLGA 4S0SD 4LSUL 2CUIA 3ARGD 1LEIA 5ID1B 1YYLH 1JGUL 2PBGA 1SM3H 3KYKH 4XWGL 3HLAA 4L9LB 4PJFF 1CD9B 3K46A 4LKXA 4YUEL 1JL8A 1VGKB 4Z0BL 4MA7H 5BRZB 5HGHB 5F9DC 3EYOB 5DUMH 6A3HA 3JVGC 3W5NA 4F9PC 3B2UC 3D9AH 5HGAB 3Q6FB 4ZFFA 3L4UA 1YEFL 4XPGL 1IBGL 5E2UL 2R8SH 1SEBB 2BVOB 3BAIA 1NJ9B 2YKLL 2OI9B 1TVHA 5LVEA 1J0ZA 5CPSA 1M7XA 4P4KD 3W9EB 1IM9A 5GGRA 2CLVB 2WSKA 5IROA 4U1KA 1TPXC 1EH9A 4XB3A 1MY7A 1YNTB 1QVBA 2JE8A 3UDWC 3TA3B 4LCCA 3ZDZF 5I17A 3N1GC 2QMJA 4HX1A 4NJAL 3VIHA 5GNZA 3DXAB 5JW5B 5CD5D 1MQKL 4EDWL 1VFBA 2V3DA 4TVSa 1S8DA 1ISXA 3MRPA 2E8ZA 3NCMA 3V7AE 4NYLA 2YBUA 4U1SB 2NYYC 3TYFA 2BVQB 4DWSC 4RX4D 1X5XA 2V9TA 3CBWA 1S9YB 5JA9A 2H2SD 3LB6C 5GRWA 5L6YL 4JO1L 4PFEA 4G9FB 1EMTL 4Z77A 5JPMB 3T2NL 4X6BA 5FCSH 4YQXL 3QDMD 4OGXH 3CV5A 3W81A 3IF1B 3ZL4L 3ULUE 3CO4A 5IGXH 4AEHL 1OT2A 3MKKA 3WXVL 3I6KA 4U6XA 2XZAL 3UC0L 4BM7A 1P4BH 4IOIB 3CUFA 4TQEH 1RI8A 2APXA 1JG9A 1N0XL 3QZWA 4JL2A 3BXNA 1T7WA 4XP4H 5CJXC 4JHWH 2VAAA 2DBLH 1BQLH 2SEBB 3FQRA 1Z0MA 3N85H 4Q0XH 5DC4B 1I8IB 4GKZB 4H1LH 3WDHA 2HWZL 3L3KB 3AM8C 3BEVA 3MLTA 4L3CB 1JF1B 3IFOA 4Y5XA 5JHLL 2EZ0D 2PO6B 1JNHB 4PD4K 4LDEB 5DD0H 3THMH 3EO1B 3LS4L 3DUHA 4NUGH 1X5KA 2L0DA 1MCIA 4NRSA 2GK2A 4Q2ZA 1D5IL 5SWZA 4WV1B 4CCDA 2IMMA 4LBEA 5GJTL 4D6EA 4LEOB 4DN3L 2ATKB 4ATDA 2YRLA 5B4MD 4E8CA 2FYYA 3HNTL 4L4TA 1IAIH 4JM2B 4B5EA 1S7RB 3QXDA 4TULH 1EVTC 3U46B 4OBRA 5GGTL 3FO1A 5EBLB 1IC5L 1I9IH 5DK2B 1UH4A 2DQFB 3FMGL 3DV6A 5E8DL 5CGMA 2FR4A 3WL1A 4FQXC 4JY6A 1K4DA 3CU7A 1CGYA 1BZ7B 1SQ2N 4OIIH 4CNIA 1JXKA 1CNVA 3WL9A 4U1GB 3CD4A 4UNIA 3VXPB 1DN0A 1T20B 4N5ED 5ABHA 1YNKH 1I3RA 1QRKA 2NX5B 4LP5A 4WENB 3T1FB 1U8KB 2CLZA 1K6QH 2H3NB 3I75A 1CEOA 5FO8A 5MENB 1T89C 1RP8A 1SEQH 4UR9A 1WP6A 4YGVA 4E41D 4JLRA 2HVJA 3ETBF 5C0FA 4CMHB 4JFQB 4L8BA 4P2RB 4PGBB 5GZOD 4ATWA 2MOVA 3ZTJH 5DRWA 4UZGA 3VXQA 1H8OA 5CGYC 2BVYA 3CVIL 4FQHA 1C90A 2OSLA 1FO0H 3QQ9C 2EIEA 4D9QE 4B3KA 3GSNH 5HGGS 2YN3A 3KPSE 3L4ZA 2WNWA 5JHDB 1PZ5B 4ZFOA 4M03A 1XC6A 2JJUA 2CK0L 4PG9A 3W28A 2F61A 3AZSA 1M7DA 2HT3C 1RZKC 3UBXA 5IR1B 1HSAA 1X4XA 2NNAA 4MAYA 2YXMA 1W3HA 3K80A 3S88L 1QYGH 1E6PA 5BWFA 4RBPK 5BRQA 4RL3A 2R9HD 2JCCB 4BZ2L 4AIZA 5L88H 2R29L 1V3IA 4PY8J 3QQ4B 1V5JA 5C70A 1BYDA 1BD2E 1F11B 4QRRA 1P7KB 3ZJKA 1VFOA 5CZKA 1SY6H 5BV7C 5GS2H 2VB5A 1GUVA 2VWEC 1BYCA 3SCSA 4OKDA 1UJ3B 2CDFA 4OV5A 1LO5B 3NYDA 4EUPA 4MNQA 2VLJB 4R8WH 4GKOA 1DBML 2GDUA 5KOVC 4W68A 4XX1G 5IIEA 4G5ZL 1ZXQA 4DW2H 5T1LB 1T3FB 1Q94B 1HDMB 3NN8B 3UO1L 3A22A 4D0DA 3ARBA 3E2HB 3VRIB 5IFAH 5FM5O 1HI6A 1XGRA 1KOAA 4LARL 3BSZH 3C09C 4LVOC 2DKMA 2CUMA 3LY6A 4W81A 1A6ZB 5ALBL 3RIFF 3MSDA 1R46A 1CGSL 2X8RA 4FQPA 4ESKA 3FFCE 2VDOH 3GMRB 4OUUA 1IKNC 3C6LA 3QWQB 2J7BA 1JP5A 2XNAA 2H32H 1E4MM 1ITCA 1YQVL 4X99A 3QXAA 3JWNC 4OD1L 3SKOB 4ZQKA 3O4LE 4X8XA 2JJSA 4FZEH 2KL6A 3L1OH 3WUWA 5LYRA 5GGSA 2ICWI 5C07B 1CIDA 4I8DA 5HHQB 5JOFA 1U0QA 2R23A 5A2AA 1G7HB 3T0VA 2E7HA 3C8KB 5IEHA 3HG4A 3V6OE 4I2XB 2QSCH 3P73B 5F9OL 1GH7A 3I6LD 4POZC 5D93B 5F7NC 3QUML 2YFOA 4OM1L 1U3HB 3EIFA 4YDLC 4X98A 1ADQA 3F5WB 1OAYL 4OD2B 1XIWD 4S1SL 5M5DA 43C9B 3F6LA 5DHVB 3K81A 5I1DA 2P8MB 1OAXH 2Z1KA 3GMQA 1S9WB 3BO8A 5IW6B 4RMWA 4PBXA 2H9GB 4NQVA 1CN4A 5CXPA 1NWTA 1DANT 2Z8SA 4QY8A 5GIRB 3AIRA 2F8QA 5IUSA 3U6RB 3WHE1 3I9GH 2ZICA 4PJ7A 4G6KL 1FP8A 3QYCA 3DDGA 1MUJA 1KYOJ 2UUDK 3PL6C 2O61A 3HG5A 2VDKL 3FOMB 4FQQA 4P9MH 3DYPA 2BCKB 2DJ4A 1JF6A 4M1GH 4ACYA 1O5DT 3O6MH 1LO4H 1FNLA 5C09A 2C0HA 3RWGB 5FKAA 3D85D 2J7EA 4PRDA 4M29A 1TUXA 4JAMB 3UTTE 4HIHB 5FB8A 4PRHB 3REWB 2YZ8A 3RDTC 3QFJE 3PHOB 1A1OA 4G6JL 3VXRD 5AC4A 1WDRA 1P6WA 1EVUA 1E4KC 4IM4A 3HNVH 3O2DH 1H0DA 4ZYKB 3H9YA 3WSQL 4A2LA 2EPLX 3WKMH 4RWYH 4IS6B 5E2TL 1TA3B 1FJ1A 4MA3A 2DQCH 1FH5L 1T0OA 1G7QB 3RWEA 1QSEA 4P2QB 5FCZA 1OQOA 4FA8A 3P4NB 4D1IA 3EYPA 1O0VA 5I19L 2PW2A 2VC9A 2WZHA 4UCFA 3GTNA 3L3JA 1BQUA 2O26U 2ZG3A 3KYMA 2YDSA 2JB5L 4N0FA 1KCRH 3MACL 4RMTA 2EIZA 2BRQA 4OZIF 5ITBL 1N4XL 1WZMA 3FO2A 3PZ9A 3MRKB 1U8PA 5GRVK 1BFVH 1GGIL 2Q86A 2WHJA 4ZNCD 4OLEA 5DQDL 1WZ1H 3AHYA 4D71A 4N9OB 4F57L 3MRBA 3G6AA 5E94B 2RB8A 5KTEH 1E6NA 3ES6A 2YD1A 5KSAB 5HPOA 1P5UA 2X9XA 1E56A 2NW2A 3S4SA 3C8DA 3JTTA 4MS8D 2P8PB 4GUPA 4D1JA 3QDJA 3VDCA 2B4CC 3KXFE 1NGQH 1ZT7B 4XHJC 5DWUL 1RFDH 4Y4HD 5HI5C 5L0QC 3QSKB 2CKBA 2UZYB 5DQJB 1XMWA 3MX0A 4WCYH 1T21A 3OGVA 2LQRA 2XOTA 1HNYA 1ACYH 1S9VB 1YEIL 3VIPA 3BKYH 1T0NB 2VXQL 1I7ZB 1A47A 1NUGA 4R3SB 2A73A 1F3DJ 4FTVE 5HDLA 3CH9A 1XF5B 2Y36H 1VADB 5IK3B 2W62A 4X4XA 5BMFL 1IM3A 5IKCB 2XYLA 3IFLH 2DAVA 3LKPA 3TO4D 3ULVH 2VRJA 2R2CA 4TYUA 4GJTB 2BNRD 2W9EL 1UQZA 3CDYA 1BVLA 2AEPL 2FGZA 2C3WA 5A8QA 4NDMA 2ZCKL 4YXHH 1RURH 3O3BA 5E2WH 5E24E 3MLXH 5KVFH 2E3ZA 4LHQB 2ITCA 1FFRA 4XXCC 5EOCJ 3SDYL 2ZWYA 2AJUH 2EABA 1BVKA 4HCRA 4ZEPA 1CE1L 4Q9CA 2WVSA 4QOKE 3CX2A 4RZCB 5IG7B 4PGJA 3WKZA 4HPYL 3WFZA 3HUJE 5IWLC 4G7VH 2J25A 1RIUL 4MPKA 1N26A 4WKAA 4QHNB 4WY7H 5H94A 3MBEC 4JFSA 3FW6A 1KN2H 3LEVH 3OX8A 3OF6A 3UAJC 1TQVA 1ZBWA 1F58H 1EOMA 5IQ7L 2NXZB 2BVPA 1R3HA 5FO7A 3MNWB 4JCLA 4JN2B 4F8XA 1IM9D 5L2JA 3VFOA 5DMKA 1MXGA 4K55A 4R90H 1FFPB 4ISVA 3BZ4B 5D1QA 4LCWA 3UEQA 2Q20A 3CCHB 2I9TB 1CBVH 3OMZA 4GKSB 5E2JA 5I1JH 1B0RA 4YDIH 3D4YA 2XM2A 4K3DL 3QRGL 4FQ2L 1C16B 5GRZA 1VENA 2AP2A 2J7CA 1U8MA 1IKFH 5AD0A 1JNEA 5CEZL 3ZE2E 1ZOXA 2AABH 5TGBB 2GIYA 2EH7L 3B5HA 3B8YA 5AYIA 3ZSTA 2OTWB 4HWBL 1NC2A 1FGNH 5ANMB 1WT5C 3AHXA 5I74B 1Q9WA 3TLRA 1DEDA 2XG4A 1QWNA 1KGUA 5F3BB 2BOBA 1QFHA 5DTFA 3HUJF 1YJDH 5EU5A 1A9BB 1CL7H 5FL0A 3T65A 2G5RA 1GC1H 3EAKA 5ADOL 1UZ1A 4P5TC 2FGWL 4G42B 5KVDH 2VDLL 5DJ6B 1SJVA 1HF6A 5BJTB 4DEPC 4Z2IA 1TVNA 3H3BC 3TV8A 4ODTL 3SDDA 1XGPB 4AENB 3FRPG 4H2CA 4PJDB 3SGEH 3KL3A 1ZVSB 4NIKB 3H0TA 1GHFL 4OJFH 4FABL 2W59A 2AKRA 3D2UB 4JQVC 3OKYA 3U2SA 3TESA 4LFHG 5H37G 1SYTA 2WP3T 3SKNA 5C9JB 4G6FB 5K9OB 4DM2A 1JNLL 5ADPL 2VDML 1TZGH 3TIDB 1R5WB 1MJUL 1MCOH 3D1MC 3IJSA 1WVZA 4K8RC 2RFXB 3WH9A 3B9DA 4DZBA 4HGWA 4M4PA 2CK2A 1MCQA 4NZUH 3ZE2F 1ZSDB 3CZJA 5IMLB 4LU5H 4EDXB 3LKRB 3RWCB 5I1CL 2BSRB 4XCFH 4B0MM 1JK8B 1YEKL 5M03A 4C4KO 3GNOA 2HJFA 3BD3A 1A7RL 1JHTA 3HC3H 2HT4D 3O6FC 3VFPB 4QCEA 1TQCB 4Y0GA 3ALXA 3O2WL 4LK4A 1NL0H 2DSKA 4N9GA 2PXYD 4FNTA 4GI6A 3FT4A 1E5JA 4L4TD 1FBIL 2IPKA 2AK4B 2G75A 1WDPA 4HJGA 3TVMB 2Q8AH 3VIGA 1HXYB 4Z76B 2X4PB 4MNGE 5JR1L 4ZDHB 1F6AB 3QUMB 4UTBH 3CLFL 3KNBB 3MRGB 1JPFB 5TPWL 2Q8BL 2CDGB 3KPMA 4NC0B 4ZTPL 1ULVA 3TZVB 3N17A 4Z7UE 3RM4A 2IAMC 4LLYB 4XNYL 5I3DA 1PX4A 4JFPA 4LLVB 2X4SB 2A1WH 4D6CA 5EC1B 1NGZA 1EAPA 5FECA 1P9MC 4GSDH 4W7WA 5IDIA 3RZWA 3V0VB 1DZBA 4WWKB 3D0LA 3BT2L 4LF3A 1UA7A 1WAAE 2VWEE 2Q6WA 4JIEA 4JRXA 1EEZA 5IMKB 3KPLB 4TVCA 4QLLA 1OSPH 4I5BA 1HT6A 3BAWA 1DE4A 2OCFD 3I3DA 4ZUWB 5TE7L 4GZEA 3RZCB 4J1UB 5KZCB 3VFWA 1PLGL 3CFIC 2NR6D 4WEMB 3GSQA 3LKNA 2EXWD 3ZDYE 4OZHB 4MNKA 1KC5H 3UR8A 3RTQB 4UQDA 4U7MA 1OD8A 1JV5B 3FB7A 4FQ1L 4YHNA 3OGOE 4QKXB 4OCWL 1ZEAL 4JZOA 3HG2A 4XRCB 1PX3A 4JG0L 1AVAA 1ZA6A 4KH2A 4JPIA 4UV4H 3OAYK 3ZIZA 6TAAA 2BHUA 4Z95H 2LAGB 2LTQB 3VW3H 4F33B 5AC5A 1PY4A 3WIHA 3QR2A 2DDQH 1NCBL 4Y2DA 4Z7UF 5IT2L 2UY3A 3RUGA 1MFEH 3O8XC 5K9QI 3V9FA 3VG0L 4P59L 1Q72H 3WFCL 1AGEA 2VVSA 5E8NA 4G8FA 4XWOD 4N5UA 3PABA 4G6MH 4C83A 5DA0B 1EO5A 4TVUA 4UILH 3AAZB 1XEDA 4RFEB 1HXMA 5I24A 3WNLA 2ICEB 3CZFA 1W3JA 4PRPD 2YD2A 1WAAF 1KB5A