4OQVA

High resolution crystal structure of human dihydroorotate dehydrogenase bound with dsm338 (n-[3,5-difluoro-4-(trifluoromethyl)phenyl]-5-methyl-2-(trifluoromethyl)[1,2,4]triazolo[1,5-a]pyrimidin-7-amine)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
353
Chain Sequence
DERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Fluorine Modulates Species Selectivity in the Triazolopyrimidine Class of Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 139
structure length 353
sequence length 362
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4oqvA00
1YTEA 2ZZ5A 1GG0A 5CZTA 4NT0A 2C16A 3KRSA 3L5AA 1IXPA 5I3GA 1TTPA 3MHGA 5EKYA 2QEZA 3LOTA 4H4IA 3TU9A 3GR7A 2FPTA 5DY2A 2A2IA 5DBUA 3C56A 3HPXA 3SY5A 2WPBA 3DBPA 3B04A 2ISSA 4M7TA 2DZUA 1KLZA 1N8FA 3NQEA 1HL2A 1R46A 3P80A 2CW6A 1OFQA 1R2TA 3DHFA 4QISA 1H7OA 2AGKA 4WX2A 3C2OA 2QAFA 5DXXA 2RDTA 1OFDA 2EHHA 4M7SA 3QQ0A 2NUWA 3SW6A 3W2JA 4H6KA 3MBDA 3O63A 3LI1A 4RXFA 4JTFA 3P60A 3G24A 4IQLA 3GDRA 3LHTA 1EEPA 3HMJG 4UR8A 3RNDA 2JKPA 1W5OA 3TKFA 1IXOA 1PCWA 4H3DA 4UTUA 3W1MA 1YDVA 1MSSA 1DOSA 2J27A 2R8WA 2YCEA 4NZFA 4EF9A 3LHUA 1R30A 2YYUA 1EUAA 4IMEA 2JGYA 2VOMA 5D2XA 3CHVA 3W7HA 1TPEA 3LGEA 3L5LA 4Z0JA 2CLIA 3A23A 3UWYA 2UV8G 4HNUA 1B57A 1AL8A 2YFOA 5AHLA 3MJYA 4DO5A 4LV4A 3UPWA 4QJ1A 3C0JA 1QWGA 1SPQA 2OT1A 2VFHA 4HIBA 5KTLA 2ZYFA 3MP4A 2YGYA 3MI6A 1OYBA 4HSNA 4M6PA 4O4VA 7TIMA 4HN4A 3NR0A 5GVJA 1OFRA 1H7XA 4FNPA 1EP2A 5AOUA 1MZHA 3GDKA 2FDSA 4BI5A 4EIVA 3EWYA 2G5WA 1A53A 3GNDA 3CU2A 3B0PA 4N9CA 3M5XA 1IXQA 1JQVA 5LNVA 1G4EA 4DEFA 3O05A 2I1OA 1TO3A 2NX1A 3FA5A 4X3ZA 1L6SA 2FB3A 3A9IA 1W5MA 1XI3A 1VH7A 3LV6A 3DFSA 5J5RA 5FEPA 4DF2A 5MHBA 3GAYA 2HTMA 2ZZ6A 3PUDA 4O1DA 4UTJA 5C54A 1VCVA 3STCA 1CX9A 3NA8A 4A22A 4NXKA 4ORMA 4R34A 5C2XA 1FWTA 1H62A 4ZQMA 4ZVJA 4PTNA 3TE9A 4NX5A 4GXMA 3R2GA 1KTBA 3HF3A 1ME7A 1TYGA 1GVOA 3Q58A 4TMBA 5BW6A 1DQXA 1VZWA 1OFPA 4RX0A 4Q4KA 3G22A 4XQ6A 3B4UA 4O28A 1U83A 3TFCA 2J6XA 2QUVA 1X7FA 1VQTA 2NX9A 3K30A 1EWEA 2X2GA 3MBFA 4PL1A 4JDBA 5D38A 1Q3NA 3W7QA 1PIIA 2CLMA 5A5WA 2BXVA 2QCMA 2RH9A 3P7YA 1GVRA 3T4CA 2R94A 1VGAA 1SO6A 3WK3A 3MW7A 3S6DA 1Z42A 2FPYA 4JYEA 3RLUA 2WNQA 3GNNA 1V7YA 3USBA 3BV4A 3LTSA 3PUEA 2TYSA 4K7YA 4XBKA 1OF6A 8TIMA 1UCWA 2W0UA 1EPXA 3OVPA 3GXNA 5U7SA 1OJXA 1ME8A 1YPIA 3W76A 1ZAIA 4AF0A 3I65A 2C14A 3I6RA 1XBZA 1AK5A 1MXSA 4OGZA 2YDAA 3W3OA 3IIOA 3QM3A 1KBJA 4M6QA 4GUIA 3TA6A 2WSRA 4TMCA 3RF9A 3NQ6A 3FOKA 5F2LA 3GKAA 1F05A 2FTPA 3TW6A 1WOBA 4MKNA 4RZ4A 4JX4A 3B0UX 3F1QA 2CZEA 4QSHA 1J5TA 4LU0A 5HUPA 5J5DA 1EB3A 1JQXA 4CCCA 3NYZA 2E77A 5DCEA 2QJGA 3N73A 2Y7DA 5AC8A 1TPH1 3TIMA 3TMQA 4O52A 3CIWA 1G7VA 3B0VC 4GNJA 1UASA 5CPMA 2A7NA 1IIHA 2WNNA 4M6VA 3IV3A 4AHPA 1VRDA 4AMAA 1OK6A 5IM51 1OX6A 2QCFA 5LKYA 2E5DA 5D32A 3NDOA 4FEZA 4UNKA 1ML1A 4PEKA 1GOXA 4IOTA 2FB2A 3LXAA 4UMCA 1BEUA 3M5YA 4Y6GA 4O10A 3W88A 4NVTA 3N9SA 1MEIA 1ZALA 5A8GA 4NNBA 2A6LA 4RV8A 3JR2A 1M5WA 4KKXA 3DKLA 4LOCA 4WZHA 3PBYA 3W7NA 3SR7A 2WOQA 3UQNA 3LXBA 2Y63A 3S8HA 5EL1A 3DFTA 3IGXA 1OFEA 3O1NA 3RFAA 3LHWA 5L9FA 3LCXA 5CG7A 1JUEA 1W5QA 3EEGA 4IUOA 2FLIA 1WXJA 4YXGA 4MY1A 1O95A 1SZNA 4JIQA 4S2BA 3EXRA 4X2RA 1LDCA 1MEWA 4X22A 3W1NA 3WJSA 5CSRA 3W7MA 3QMSA 3DENA 5EY5A 3NPVA 2NXHA 3KVKA 1VLIA 1TJRA 1YXYA 2QCGA 3IEBA 3KOFA 3LI0A 2FFCA 3QMRA 5AB3A 4N9BA 3IRDA 1QDSA 1OG0A 3PM6A 5CPLA 4LUJA 1SZGA 5HWMA 1WBHA 4NJKA 4DPQA 3EWBX 2J24A 1IXNA 3LDVA 2ABBA 1SSDA 2WO5A 4BWLC 4O1AA 4ZQCA 4K36A 4IX0A 3HO8A 1EWDA 1TTQA 1IIGA 1OHLA 1QO5A 4IX2A 1Q6LA 1TJPA 3SFKA 3WK0A 4PC8A 1YXCA 2I9EA 5KINA 4MZ1A 4ADTA 3C2FA 2QCEA 2KZHA 1F7BA 2J9XA 3P5YA 1TMHA 4XZ9A 3NQ2A 4WY0F 1OYCA 4CNNA 3TXZA 4O15A 1N7KA 1OVDA 3DFPA 4OE7A 3Q37A 2JKAA 2E09A 1LRTA 2NWSA 3E9AA 2Z6IA 4JTSA 4O19A 2CFFA 2ATMA 3GVGA 3O16A 5D04C 3QH2A 4LNYA 4CNPA 1RR2A 1SFLA 4DPPA 2RDWA 2DP3A 4JTUA 3R89A 3W73A 4MY9A 1H1ZA 1P5BA 3KVJA 2E6FA 3P82A 3QF0A 5DXYA 3W71A 3DU0A 1ZAHA 3N2XA 3UXDA 4KFNA 1OX4A 1E51A 2CLLA 1H63A 4JY9A 4OU1A 4A2SA 2J9YA 3NQFA 3VE9A 4O53A 1FCBA 3Q94A 3DI1A 4Z1DA 3T55A 4LY8A 2VEKA 1ZENA 3W6YA 2ZRXA 4R33A 3PWAA 2PRLA 1DQWA 4UTTC 1THFD 4ZMGA 4DO6A 1R2SA 1HFBA 2YSWA 3A5VA 3ZWSA 5EPDA 3PSWA 3TAKA 1XDLA 2W79A 1L2UA 3LCGA 5AN7A 4O1CA 3LX9A 4EVZA 3G0XA 1RV8A 4G1KA 3CC1A 2V30A 3W1XA 4FIRA 3TDFA 1ZCOA 5D2WA 3HPZA 5AYYA 5K7JA 2ZZ4A 2ZRYA 1WBJA 1K7EA 3EX2A 2QKFA 4DF0A 3R13A 5AHFA 1WAUA 2CLFA 1QCWA 4UMBA 2G97A 3TX9A 1P1XA 1YLVA 3GIYA 3UPBA 5D05A 1O60A 2ZFAA 2H3DA 2QCDB 2NV2A 1F76A 3NQ8A 1JVNA 2GJLA 2NUXA 3S5NA 4UUIA 3IVTA 1KW1A 5TBOA 1H7PA 3W23A 3BG3A 5G4WA 5EYWA 3QYQA 3BW4A 2BTMA 4OHQA 5H2ZA 3UWWA 3T7VA 1KTNA 1UBSA 3VFLA 3OVRA 3W85A 3LERA 1GTEA 4JD4A 3W1TA 3TC6A 5AFDA 3B06A 1NSJA 4JN6A 3CLMA 1VYRA 3QEZA 4NJIA 3F4WA 3H54A 3ABOA 4QIUA 5AYZA 1C29A 3T44A 1HG3A 1OX5A 1X6UA 4RJEA 1GVFA 1S5WA 4UFLA 2XN0A 2QCCA 2X1UA 5EBUA 3EKLA 3G8EA 2JKEA 3KAOA 4ONVA 5E0KA 1TPB1 3GLCA 3LCHA 2CLEA 5BOOA 5LSMA 3U2OA 5G1TA 2Y70A 3PULA 1W1ZA 4EF8A 5I3IA 1I45A 1X1OA 3FKKA 4LC6A 4MYAA 5F2GA 2ZDRA 3MO7A 4S1FA 3NM1A 5KITA 2B0MA 1I2PA 1JR1A 5L6UA 3TSBA 4K6AA 3EB2A 4Y96A 3CT7A 2DZXA 3B03A 4N2YA 3W7PA 2HMCA 3C4UA 3TAOA 4FX7A 4UTHA 5LGXA 4O50A 3FIGA 5HWNA 1UJPA 5BRBA 1H61A 1KM4A 1W37A 2VENA 1JRBA 1LRQA 1YDOA 1MEHA 3MMTA 2YXGA 2QR6A 3EX3A 2CZFA 4UC5A 1W3TA 4QNEA 3OG3A 1KLYA 4AEOA 1IGSA 3CWNA 4GUHA 4WXZA 1ZY9A 1YXDA 4K8HA 2NV1A 1N55A 4O13A 4BR1A 1TPUA 2LLEA 4MJZA 4ALDA 3B8DA 5KZDA 1FCUA 2A0NA 5ABTA 5K9CA 3QRHA 2E6DA 4YL2A 3P61A 3W7LA 3HBLA 3QC3A 5K4ZA 3HOJA 3P62A 1KFLA 5H91A 3OHIA 2E5BA 1AW2A 1W54A 4TU1A 4Q32A 2GJNA 1ICSA 2OZ0A 2V5BA 2ZZ7A 1O5KA 5FEXA 2E6AA 4NX0A 1AL7A 1I2OA 1LM1A 3O8AA 3TC7A 3BO9A 1SQ7A 5G2IA 1QPQA 3STFA 3KVMA 2PE4A 1K02A 1FY6A 2Y88A 1T99A 2C18A 5DBTA 3PBVA 3TSDA 1G67A 2ZA2A 5K4XA 2OMAA 4MLRA 1ZHAA 2A5HA 2VFGA 2WQPA 4NNAA 4K39A 4TX9A 3SIZA 1TPC1 1KFEA 4DF1A 2CLHA 1BKSA 1ALDA 2BWGA 1Z41A 3A21A 3S1UA 5HULA 3R8RA 4YLWA 2QCLA 1DKWA 3G1FA 3QQ1A 1GWJA 1HO4A 3G1YA 4GRSA 2ZRWA 4PFMA 1D3HA 2V82A 4LW7A 1QOQA 3W2UA 3LCFA 4MIMA 1K7FA 3UWUA 5CZ0A 1LROA 3G1HA 1JRCA 4O8RA 3W2KA 3KRUA 1OYAA 2VEMA 4ADUA 1K8ZA 3FLUA 1H60A 2EPHA 3RU6A 1WA3A 4MYXA 4GUFA 4ZZ9A 2ZRZA 5KSWA 2VELA 2B7QA 2QCDA 3GR8A 2BLEA 3WK2A 3OIXA 2C15A 1FXQA 1FX6A 5HR7A 1P0KA 5KMYA 2WJZA 3I7SA 3DH7A 1G69A 3DKJA 2YZRA 4BI7A 4LVAA 2ZA1A 3CQ0A 4HNTA 4HPJA 4O11A 4P61A 4CCDA 3G3MA 1TPFA 3NOEA 1LOLA 3W7OA 3F03K 4HHPA 4JTIA 3RK8A 3E96A 1G4PA 5C55A 4GE8A 2DORA 2V2DA 1L9WA 3C2EA 3BLEA 4LRSA 4LVGA 2WKJA 2ZTJA 5T26A 3PG8A 2ALDA 1XUZA 2GPTA 2PRHA 4S2CA 5K2ZA 1EIXA 4JIPA 4LVDA 1FWNA 1GPWA 3DXIA 3W7IA 3G0SA 4N4PA 3GX9A 1XBVA 4UMAA 1H7RA 3UXAA 3D0CA 2QUTA 3TR2A 3BK0A 4NJJA 1DJNA 4CCEA 2Z2UA 3GKFA 1DHPA 3FYPA 1SUXA 3M7WA 2BZNA 1OX4B 1NFBA 1W3IA 3SZ8A 3INPA 2Q8ZA 4IMFA 4MFDA 1TSIA 3EWWA 1NF0A 1KFJA 3A22A 4FF7A 2QJHA 2F84A 3W07A 1W0MA 1PL9A 2AAMA 2XFWA 3I68A 3TFXA 1I2QA 1TV8A 2TPSA 3V1PA 5D33A 2DU2A 3LRMA 4U28A 1JCMP 3FEMA 1PE1A 1H1YA 3CM4A 4JTKA 2V9DA 2ZZ2A 4E2DA 1Z48A 5D03A 1FWRA 1YADA 2GVGA 1QFEA 3P5ZA 3L9CA 2X1SA 3P81A 3NO5A 1JCJA 4GWEA 4KWWA 4I9AA 1TV7A 5EA9A 4FNUA 2FJKA 3LLDA 1G6CA 4FX6M 3MUXA 1OFBA 2E5CA 3LTPA 4R53A 3TV8A 1RPXA 3FKRA 2ZBTA 5G4EA 3STGA 3W1AA 2VEPA 1SW0A 1NAL1 2QDGA 3LHYA 3THQA 1XDMA 4JGDA 1HTIA 3PAJA 4JNMA 4LWWA 4FX8A 3QSRA 1SZEA 3TW7A 4TO8A 3UWZA 1ICQA 3IVSA 4ICNA 1I2NA 1KM0A 2EAWA 3C8FA 3H53A 3S9YA 1FQ0A 1ONRA 3T78A 4UR7A 1C8VA 2JGQA 4O16A 3GK0A 1KFBA 4Z1AA 2VC6A 2HS6A 1X1ZA 5F1UA 4BI6A 3W72A 1SFJA 4QQ3A 1PV8A 1K7XA 1SW3A 1O94A 3IIXA 4RKAA 4WUIA 4DBEA 1KM5A 2CU0A 2VFDA 4ZQPA 1XFBA 1LTDA 3ABRA 4N9DA 3DFNA 4KFOA 5KZEA 5F1VA 4O0KA 2EKCA 3L0NA 3MHFA 1GYLA 2A6NA 1LYXA 2NXIA 5CPOA 3ABQA 5D2VA 1FCQA 4R7JA 1RD5A 5HQEA 5AC6A 4ML9A 1H5YA 2ZTKA 3G1AA 5AHIA 4E2BA 3HGSA 2ISWA 3IGSA 3W70A 4ZL1A 4AAJA 1H7NA 3HIJA 3WFAA 2OCZA 3NG3A 2H6RA 3CB8A 3W86A 3GYEA 4LS2A 1SR9A 1LLWA 4NJHA 4Q33A 1VS1A 3NQAA 1M7PA 4AHQA 4NZJA 5KZMA 2NXGA 1DBTA 3PY2A 2ZA3A 3M9YA 3HB9A 5TQLA 1JJKA 3KFTA 4XKYA 3TJLA 3MHUA 3NQMA 2ZRVA 3P67A 4UTLA 3ELFA 4WOQA 1YYAA 3W2LA 1DL3A 4JS3A 3EXSA 1JUBA 3PF3A 1FDYA 1XBXA 1PVNA 1H7WA 3TSMA 3KVLA 4DELA 3LXCA 1W31A 1Y0EA 4IGHA 3LV5A 4AXKA 5LZLA 5FF2A 3LHVA 4MUZA 4HNVA 2Y7EA 3LLFA 2Z0IA 2O7QA 3M16A 2BX7A 2BSLA 1LP6A 1SW7A 2PCQA 3L67A 2ZCGA 4LT9A 3L0GA 2X1RA 1U5JA 4GC4A 3VE7A 3U8GA 2X30A 3GDLA 2Q8LA 2YPIA 4RLIA 3L2IA 3FJ6A 5HR6A 1R47A 1KA9F 3V75A 4HNNA 3WJYA 3SJ3A 3CTLA 3NL2A 3ZS4A 4FNSA 5HNRA 1VPXA 1LRNA 4JTJA 1GVSA 2ABAA 3GXPA 5DCBA 5D09A 1YPFA 1F5ZA 1XXXA 1BTMA 4PODA 1L6YA 3GB6A 3UWVA 2PURA 4YMZA 1WQ5A 3GZ3A 1B9BA 1EP1A 2C19A 5HWJA 4IXHA 3NQGA 4UXDA 5CSSA 5F2IA 1JULA 5TIMA 3BLFA 3H55A 3WK1A 3THAA 1OFOA 3NQDA 2ZZ1A 2X1TA 4JTLA 3EWUA 1W5NA 3AJXA 4IMGA 3BGGA 4IPIA 4NU7A 4WOZA 3NPWA 1VHNA 4JDYA 1AMKA 1YDNA 5IBXA 1B4EA 1ME9A 3SI9A 2R91A 3W1PA 1TQJA 4O1BA 1CI1A 3S42A 1NF7A 1SZFA 1A5CA 3UZ5A 4UTTA 1XC4A 2OX1A 5I3HA 1ZAJA 4OBTA 4AH7A 1KFKA 3C6CA 3EXTA 3FYOA 1K8XA 3E02A 4JX6A 4WQ6A 4UTWC 4JTGA 1VYPX 4J9JA 4NJGA 3ATYA 2CZDA 4NQ1A 4KWVA 5C5YA 5E93A 5G2WA 1VJIA 3A24A 4NUWA 3LBMA 1HO1A 4Z1BA 1VCGA 4AHOA 5AYXA 1W3NA 3O15A 3JS3A 3HGOA 3PB2A 1T8XA 4GUJA 3HJZA 3W84A 3N34A 1SO5A 1OF8A 4I7UA 4K7VA 2A85A 2C6QA 1OK4A 5AC7A 1KTCA 1QPRA 2OT0A 3BLIA 3S1VA 1P0NA 2QAPA 3GDMA 3LCLA 3C52A 5LNWA 2A7PA 6ALDA 5LNUA 2C1HA 3WJZA 3VKJA 2NX3A 2Z6JA 3FJLA 4WY0A 3I7RA 3NEVA 2RKXA 4MY8A 1XKYA 3N9RA 3S0CA 1FDJA 4UCGA 3M44A 4CQ9A 1Q6QA 2A7RA 3E0IA 3PR2A 1KM6A 3TMLA 1G4SA 4OV4A 5SWUA 5G1YA 3IIVA 3M5ZA 3WJXA 3BW3A 4CNOA 3W83A 3HG4A 1Q45A 3S5YA 3OVQA 3N14A 3QPYA 4K38A 1SU5A 3NPXA 3R5EA 5F4WA 2JK2A 1JCLA 1H51A 3BARA 5K9XA 4LVFA 4I7WA 1Q6OA 1VCFA 1ZJIA 3QFEA 3RMJA 3I7QA 2P10A 1TPWA 3LRLA 3MI3A 4BK9A 1JCYA 5CZSA 3QW3A 3TROA 3VCRA 5D2YA 3L66A 4JR5A 2QCNA 4JTHA 4UIOA 4GBUA 1KFCA 2Q3OA 1ICPA 4ZQOA 1ZFJA 5LNSA 4LRTA 4Z08A 1ZNNA 3CPRA 4UFMA 1G4TA 1WX0A 3F4NA 4KFPA 1IF2A 2H3BA 2WSQA 3S5ZA 1F2JA 3NZRA 3B05A 3KHJA 4IWWA 4QAIA 3EWXA 1Z44A 5HJLA 3L0KA 4WXYA 3GAKA 5FF0A 2IQTA 1QAPA 4LC8A 2EGZA 4ZQRA 2VKZG 3W1RA 5LGZA 2Y89A 5D2TA 3M41A 1W5PA 1TB3A 4BFAA 1JCXA 4CQAA 3C2VA 1D3GA 1YTKA 4L4LA 4XTDA 1LORA 4ADSA 2XN1A 2ZRUA 3W87A 4PA8A 4XTIA 1TIMA 1EUNA 3STEA 2Y62A 4A29A 3GDTA 1P4CA 1LLZA 3DAQA 3SSJA 3P84A 1QNVA 1RQEA 4FIQA 5U4NA 4Z0SA 5HINA 3M0ZA 3UNDA 1QOPA 3A5FA 3R12A 4LVBA 2DZPA 3EKZA 3MP3A 4IXXA 5DELA 3PB0A 3W7EA 1B3OA 1MO0A 2WSYA 5F2MA 1LOQA 2YYTA 4HPXA 2V2CA 1V5XA 4M5PA 3IIZA 2TMDA 2Y61A 1UB3A 4FHAA 1K03A 2EF9A 2J88A 3QPZA 3HQ1A 4WD0A 2B7NA 2J9ZA 2O7SA 1YTDA 1C9DA 3TCEA 3LB0A 2NZLA 4AB4A 4IJBA 5AHNA 2RFGA 1WDWA 3C61A 3T40A 3P8JA 2YW4A 3CIXA 4JYDA 1DJQA 4LS1A 2GUUA 2R14A 2C13A 3L5MA 1LBLA 4IPJA 4DQWA 3M6YA 3M43A 1KV8A 5G2HA 2V2HA 1QR7A 3LCIA 1WYIA 4MVAA 1GJPA 2P1FA 1FUYA 3L68A 4O57A 4O17A 4K37A 1AW1A 3TQVA 1T0OA 3TNOA 1GZGA 1J4EA 5LHEA 1XUUA 4JY8A 5G5IA 2DZWA 4DXVA 2E1DA 1NEYA 4N6FA 1S5VA 4DBDA 4MZYA 2RDUA 3L21A 3NGJA 3UY7A 4XKYB 3NL3A 5CZJA 3NM3A 2A4AA 1LBFA 4UNLA 3IVUA 1KM1A 3E49A 1I2RA 1DORA 2C3ZA 2GQAA 4I7VA 2FPVA 4ZQNA 1LZOA 3HG2A 4RZ6A 1FWWA 2DZTA 3SGZA 1AW5A 3PSVA 4YCPA 5CPNA 1X8FA 2GQ8A 3G18A 1PCKA 4LV9A 4MFEA 1XL9A 2H90A 3SGUA 3QJAA 4QITA 3UZJA 5LHFA 3G0UA 2VEIA 3CWOX 3IGUA 3PC0A 3NQ7A 3Q2DA 1HUVA 1BWLA 2WV8A 4PH6A 2DJXA 4JXCA 1LCOA 4AWUA 1VYSX 1KV5A 4CQ8A 2CLKA 3MWAA 1RQBA 4AWTA 3UWQA 3W1UA 4OV9A 3RLVA 4RXGA 3TQKA 3QMTA 5LNRA 2HSAA 5FF3A 3QW4B 4FXRA 2NUYA 3LHZA 4UTKA 1TREA 4FNRA 2YX0A 1PHWA 3NPUA 2VFFA 1SSGA 5DN1A 1TPVA 2VXNA 4GJ1A 3EX6A 2B4GA 1FBAA 1WV2A 1A5AA 4FNTA 1K8YA 3W2MA 3OEXA 2TRSA 3N2MA 2ZZ3A 1PS9A 3N19B 2B7OA 2XN2A 1EP3A 4X9SA 4NNCA 4Y8FA 2GOUA 1FCVA 1AG1O 4RCXA 1I4NA 2FQIA 4UFKA 4HSOA 4MJMA 3W7CA 3W74A 1TPDA 3DFQA 5BMWA 3M5VA 3DHDA 2RHGA 3OA3A 1DV7A 2ISVA 3W7DA 4JYFA 3ABSA 1PHQA 1TV5A 1DVJA 4IMCA 1XBYA 1TCDA 3W1QA 1BWKA 4HKPA 2GVLA 2G96A 3CEPA 4FO4A 1F73A 3HG3A 3TXVA 4FB7A 4QNWA 5FEWA 2YFNA 1TTIA 2JBMA 2GQ9A 2H8XA 1VR6A 4AVFA 5DCDA 5K3VA 2V81A 3C3NA 5I3KA 1M6JA 4OWGA 4N4QA 3PG9A 3HGRA 3UY8A 2G95A 2OJPA 4O54A 2VFEA 4BF9A 1J2WA 3NQCA 4WY0B 1O5XA 3MP5A 1GTHA 4AWSA 2Y7GA 2QDHA 4TIMA 1F74A 5F4XA 1TQXA 2E6YA 3LBCA 3NXFA 1NVMA 1CW2A 3ZFHA 2AQWA 4U4MA 4JICA 4Y9AA 3L65A 2D73A 2PRMA 4E0CA 4FXSA 4N02A 3FS2A 2QJIA 1GEQA 5D30A 4A21A 2F7FA 3PUOA 3UYCA 3JRKA 5D02A 1TTJA 3G1VA 3VNDA 1TRIA 4MZ8A 1L6WA 4N9EA 1JUKA 4JTEA 3E12A 4N6EA 3MI2A 2ATSA 4XWUA 1I8JA 3M1ZA 1EX5A 1GYNA 3SECA 3KX6A 5FESA 2QCHA 2PC4A 3MYPA 4A2RA 5HUOA 3W7GA 1H50A 1VHCA 3QSTA 4O18A 5FF7A 2H8ZA 3O6DA 4BWLA 3NVTA 5FEZA 3S5OA 1F6PA 1UUMA 1A50A 4K8EA 4MLJA 2VFIA 5C6MA 2QUUA 3G1XA 5CKSA 3NQVA 3DI0A 5E1QA 4UTIA 4C1KA 3M47A 4GUGA 4FNQA 3VI2A 3EX4A 2YR1A 3O07A 1GVQA 2E68A 1F6KA 3KRZA 3BG9A 3PBWA 1S3HA 2DJLA 3TJXA 3NAVA 3FFSA 3KXQA 4CLMA 6TIMA 3WJWA 3UD6A 4NXSA 1UUOA 4OQVA 1D9EA 4HT3A 1Q6RA 4WJEA 1QPOA 2CLOA 4YCOA 2Y6ZA 4XBSA 4JX5A 3GXTA 1K3UA 4EOUA 5FI8A 5AHMA 3W7RA 3DZ1A 3LCWA 3EWZA 2Y85A 3DGRA 4A3UA 1R2RA 3PS7A 4JEQA 1A5SA 3BPWA 2Q3RA 3G1SA 3CEUA 1FWSA 4O14A 1TRDA 1QO2A 1WOAA 4GFSA 4RZ5A 2V8ZA 2YW3A 3AO0A 3DFOA 3NL5A 2W6RA 3BW2A 3G8RA 5IBXC 4B5NA 5EMUA 2NWRA 5I3JA 1SO4A 2GVJA 3TK7A 3S1XA 4DO4A 3HGJA 4PCFA 3P8IA 2WNZA 4MOZA 3BVJA 3W2NA 4TR9A 4XUGA 3NNTA 4MPQA 3LTYA 4RK8A 4YWIA 1W8SA 4O0ZA 4W9TA 1RVGA 5BNKA 1M7OA 4JTTA 3BG5A 3O6YX 4RR4A 5K9DA 3O6CA 4UFJA 4L4MA 3NL6A 2NLIA 1EA0A 1W56A 1XM3A 2DZVA 2Y7FA 2TSYA 1OABA 1QPNA 4POCA 4ORIA 3OBKA 5F4SA 2CZ5A 1LOSA 3QZEA 1RZMA 4P2VA 2A1YA 5I3FA 4O4WA 1G7UA 5HMSA 1QMLA 1T96A 4LUIA 2ZQ0A 1JCNA 3EX1A 4O12A 4EWND 4OT7A 1VLWA 2DZSA 4D2JA 3ZR4A 1GT8A 3TQ0A 3C2RA 3IIPA 1GG1A 1KBIA 4PL2A 1RQHA 3NZ1A 4UTWA 2X16A 2C0AA 1KM2A 1VC4A 5AHEA 4C1LA 4LTSA 5DY3A 1O4UA 3W22A 2A21A 3HG5A 2B7PA 1ADOA 4UFIA 1A5BA 3PBUA 3HPSA 2QF7A 3PVFA 3W75A 3N3MA 1B4KA 1FDZA 3MYOA 2Z1BA 3W1LA 3U6WA 5FF4A 4IMDA 3G3DA 3YPIA 4M19A 4UTMA 4E38A 3O06A 1XCFA 3W7KA 3W9ZA 2HS8A 3ZWTA 3BGJA 1LBMA 2V0TA 2P0OA 4UFHA 3ATZA 3P74A 3W7JA 3ANYA 1SO3A 1FXPA 3TH6A 2I14A 3G1DA 4QM1A 1OFAA 2V5LA 3LRKA 5DLCA 5D37A 2CWNA 4AF0B 4Y90A 1KM3A 5CGQA 1S5TA 4LS0A 3S1WA 3LM7A 3TUUA 5BMXA 1GQNA 2FIQA 4Z1CA
chains in the Genus database with same CATH superfamily
5CZTA 4NT0A 3H7VA 1FWCC 2DVUA 5I3GA 2VUNA 2BGQA 5ABFA 3HN3A 2Z27A 3S5SA 2FPTA 5DY2A 5LIXX 3SY5A 3NFUA 1LUCA 3AJ7A 4M7TA 2CKSA 1KLZA 1J9YA 4LAOA 3OZOA 2G3NA 2CW6A 2DT0A 3DG3A 1R2TA 3DHFA 1QXLA 4WX2A 3C2OA 3H22A 2QAFA 3IJ6A 3H26A 5CAKA 4M7SA 3SQLA 4H6KA 2UY4A 3MBDA 4H04A 3O63A 4S38A 3VXGA 3M0MA 3LI1A 2ON3A 4TV6A 3DFYA 4ASTA 4JIEA 1SVDA 3B8UA 4F66A 2O92A 5CGTA 3MZNA 3GDRA 3LHTA 2YA0A 2HXUA 1PCWA 3EPOA 3W1MA 1DOSA 1VJZA 4A8LA 1IYXA 4EF9A 5FL1A 5CLWA 3DN5A 3NWRA 5D2XA 4C6IA 4U3AA 2Z00A 3NDYA 4XZHA 3TC3A 1U30A 1KFWA 3MJYA 3WF2A 3C0JA 2OT1A 2VFHA 2PWEA 5KTLA 3OLGA 2WPGA 4IFKB 2ZYFA 5C70A 2ZDSA 4O4VA 4MM1A 2XVPA 3WLJA 4HA4A 1F8MA 1SR0A 2WKGA 3NR0A 1UR1A 7XIMA 4BI5A 4FNPA 1W1PA 1O7AA 3GDKA 2FDSA 4EIVA 4PUWA 3CU2A 3U2CA 1ELSA 1V02A 2EPOA 3GU2A 2GDQA 1JQVA 4DEFA 3UXKA 2FB3A 3A9IA 5KEZA 3LV6A 3E3HA 1LWIA 4GPNA 4XVDA 4LF1A 1BG9A 1NIUA 1UWSA 1AUSL 2ZZ6A 3PUDA 1TE1A 4UTJA 1EJTC 5CC5A 3BCDA 4R34A 3RXZA 3MC5A 3TE9A 1KRBC 1CGWA 4DZ5A 1TA3A 1V0NA 2E4TA 5EMJA 2VRQA 1TYGA 1GVOA 3AHTA 2WC7A 4Q4KA 4XQ6A 3PTMA 4O28A 2QUVA 2VOTA 1H11A 2X2GA 1XG4A 3K4WA 4PL1A 3EDFA 1BYBA 5D38A 3W7QA 2JFEX 3OYXA 2QCMA 1GVRA 3BOLA 3MW7A 3S6DA 1TMLA 4UQAA 1SJCA 1SYTA 2WNQA 1V7YA 5FOOA 3WMBA 3LTSA 3PUEA 4FS9A 8TIMA 1KXQA 1E0XA 3ZVHA 4F8XA 5U7SA 1A3HA 5HA7A 2C14A 5D9PA 3QOMA 3AHZA 1XBZA 2Z1WA 3A3HA 3OYZA 1UYQA 1KBJA 4M6QA 2WMGA 3GVQA 3TA6A 1JF5A 1LQAA 3CL6A 3LY0A 1UKPA 3GKAA 1F05A 5A6TC 1Q7ZA 1HKIA 4UBPC 4F4RA 4JX4A 3B0UX 3SIMA 2CZEA 1ZBVA 4LAMA 4URIA 2CC0A 3WY1A 4GGBA 3BGAA 1UP0A 3NYZA 2I5IA 4CCCA 3N73A 3TIMA 1OBAA 4MNJA 3B0VC 1UASA 2A7NA 1IIHA 4AHPA 2Z7KA 4AMAA 2OG9A 1OK6A 3H6OA 5IM51 1OX6A 2E5DA 5D32A 4UNKA 4PEKA 1GOXA 3FNDA 4M24A 4IOTA 4PGLA 4DXXA 2O9PA 4Y6GA 3GW0A 3BAIA 2BVWA 3G77A 4NVTA 4IICA 3V5CA 1ZALA 4ZO9A 2P88A 3AOFA 1UD8A 4WZHA 1J8VA 2WOQA 3RMEA 2PWGA 3AMCA 2Y63A 2QDDA 3CAWA 2DZBA 4HNOA 3RDKA 1ADDA 2PLJA 5CG7A 3OJGA 1W5QA 4GG9A 3GW3A 3BAWA 1XYZA 1T7LA 4X2RA 4X22A 5CSRA 1XIGA 3DENA 2J62A 3A13A 3KVKA 1WKEA 5BZAA 3EMCA 3LI0A 2J75A 5AB3A 2YZ5A 1OG0A 4MB5A 1SZGA 3EWDA 3VTRA 4IG2B 3OW1A 4I5XA 2XYLA 4L56A 1UA7A 4DPQA 2ABBA 2D69A 4NIRA 2WO5A 1J10A 2QS8A 4MWAA 1EBHA 3IACA 3MO4A 2PTZA 3KOYA 3UR8A 1NDYA 3WFZA 4ADTA 3M0YA 1P48A 5HATA 1F7BA 4A3QA 2FZDA 1OINA 1CYGA 3OBAA 5GPRA 1OYCA 4FSAA 3GH7A 3WD4A 1OVDA 4OE7A 1HJXA 2NWSA 8XIAA 4H6EA 5E9XA 4JTSA 1B3ZA 4PRTA 3GVGA 1HVXA 1RR2A 2AMXA 3C86A 4YIWA 3T2OA 4F9DA 1OGGA 5EMYA 3ZLGA 3R89A 3W37A 3TOPA 2CBUA 3PPCA 3P82A 1RK6A 2QIIA 1EGVA 1UH4A 2VYOA 1J0ZA 1TFVA 1ECQA 4DN1A 4A8RA 4EAMA 3HURA 4WF7A 4JY9A 3A4XA 4JQ1A 5IFPA 3VE9A 3T55A 4LY8A 5ABGA 1O1ZA 2AL2A 2WJDA 3B8WA 2IPFA 1IT8A 4R33A 1IR1A 2O9OA 1THFD 3H7RA 4DO6A 1HFBA 2IPJA 3B9NA 4HZ8A 4JKMA 4Q8TA 5LXEA 4DO7A 1L2UA 3LCGA 1FH7A 2WZHA 4KRTA 4ERGA 4EVZA 4CD5A 3EDKA 3G0XA 1I60A 4G1KA 3RU8X 3G2GA 4FIRA 2EJ1A 2GGHA 5CPQA 4M3PA 4ACYA 4WSHA 3TDFA 1G94A 1DWIM 2ZZ4A 3D6NA 4GQ0A 3BOFA 2ZRYA 1Z9AA 1WBJA 1K7EA 1AMYA 4DF0A 3H7UA 3R13A 3KDOA 5TNVA 5AHFA 2CLFA 2G97A 1YLVA 3ES8A 3OZPA 4QXIA 4Y8EA 5FL0A 2ZFAA 2H3DA 3TN5A 2QCDB 2NLYA 2NQJA 4GIRA 1KW1A 4TOQA 5C9ZA 5TBOA 3AISA 3ARYA 3BG3A 3PJTA 1GZJA 5EYWA 4C6LA 3UWWA 3ANUA 1W9DM 3OVRA 1R3YA 1PKLA 1V6UA 1Q2SA 1NSJA 1JPHA 3QEZA 5TF0A 2PDKA 5AYZA 3QFWA 3WLSA 2WMJA 1OX5A 4AW7A 1GVFA 2XPKA 3D47A 1AQFA 4ONVA 3G8EA 4TQTA 2X09A 2PDJA 1TPB1 3GLCA 1GKRA 2CLEA 3WQGA 1WZMA 3WX7A 4W93A 4U2YA 3PULA 3DHPA 1ONXA 5I3IA 4AC1X 3IJDA 4YTSA 4UB9A 4MYAA 4S1FA 5KITA 1BXCA 3W00A 1REQA 3CT7A 4N2YA 3W7PA 3URNA 1ONEA 1BVWA 2RJHA 1JDAA 2ADAA 2FMNA 5LGXA 5HWNA 4PFHA 1EJVC 2D1ZA 3WNPA 5HQLA 2CZFA 4UC5A 4QJ4B 1W3TA 3OG3A 4AEOA 1IGSA 3FW6A 4GUHA 1ZY9A 1YXDA 1R8LA 4L1WA 1JXJA 3MVTA 4K8HA 4Q8VA 2OO6A 2NV1A 4UNIA 1N55A 2LLEA 2E1WA 1EXPA 3HM7A 3QOKA 2VUYA 3HMCA 5K4ZA 3P62A 1J11A 3UVAA 3GG7A 5H91A 2PDGA 4DYJA 1AW2A 1JDEA 4EKJA 4Q32A 5DT5A 3CL8A 3IARA 4J3VA 2F38A 2GGJA 2V5BA 2ZZ7A 5FEXA 5A6KA 1HP5A 2V68A 3OB8A 1JPDX 1B30A 1LM1A 1CCWB 3WBXA 3O8AA 4UR9A 3TC7A 2VGBA 3N2BA 5DMYA 1QPQA 5DBTA 4GVFA 4J2MA 3I4EA 1ZHAA 2B81A 3W27A 4TX9A 9XIAA 5T8GA 2BWGA 1L8NA 2XGIA 2YB4A 1EIBA 1Z41A 5HULA 3WMSA 1DKWA 3OPSA 3QQ1A 5DF0A 1EYWA 2V82A 4IQEA 1DIKA 1R3QA 3KRBA 3LCFA 1K7FA 4PB5A 3UWUA 4F9JA 2A3EA 5DMNA 3MQTA 1NM9A 2R24A 3FLUA 1H60A 1ITCA 3WF4A 3ARVA 4ZZ9A 2DQXA 4R7WA 4W8BA 3EDEA 2FVKA 3RLGA 3T05A 3KZSA 4I8YA 2BLEA 4HP5A 2Z4GA 2WCAA 3QYSA 1WKDA 5LYRA 4RNHA 1P0KA 5HR7A 3N17A 2IQDA 3N25A 4EX4A 2VCBA 4AUBA 4MF4A 5TAOA 3DH7A 3LZ5A 2YZRA 4BI7A 4GCXA 2ZA1A 3CQ0A 5EFFA 1PX8A 4HPJA 4O11A 4P61A 4CCDA 3BWWA 4NI8A 4H8HA 3F03K 3UGVA 3H2OA 1G4PA 5C55A 3LK6A 3WEZA 2V2DA 1X39A 1L9WA 3L12A 4LRSA 5T26A 1CNVA 3PG8A 2GPTA 4S2CA 1XIJA 1UMLA 1VAHA 3FHQA 3W7IA 4AY1A 1WDPA 2YKKA 3GX9A 2QUTA 3TR2A 1JNEA 1H3GA 4CCEA 4IIGA 3FYPA 1Q7MA 3CAKA 3M7WA 4HN8A 2CPUA 1EBGA 4JQ4A 1W3IA 1VBJA 4AD1A 5HMDA 2YLAA 3ZQ9A 3ZT7A 3A22A 2QJHA 3AUOA 5A3HA 2QPXA 2PP3A 4U3CA 4FXFA 1PL9A 1I2QA 1TV8A 1X98A 3V1PA 3KTXA 4U28A 4MB1A 1GOMA 3EYPA 3CM4A 5H8PA 4CN1A 1YBQA 3GBDA 3GRIA 1HGWA 3E2RA 2DW6A 4H7VA 3P5ZA 2X1SA 2WVUA 1WP6A 4HMEA 1B31A 4KWWA 3PPFA 4I9AA 3SN0A 4FNUA 4B3LA 2FJKA 2YCLA 3AU2A 4YWSA 3DDMA 1O68A 4ZOEA 2W91A 4R53A 4LYRA 5E6ZA 3BZJA 1V4YA 2VEPA 4AIUA 5HNTA 1IEVA 3VGEA 3UA4A 4HYRA 2CEQA 3PZUA 3V18A 2WJEA 5M1TA 1SZEA 1UWAA 1CXIA 1VBRA 1R3RA 2YL5A 1VENA 2EBNA 3WDQA 1LL7A 1B0IA 3ABZA 3HV8A 4NL1A 2JGQA 2P5NA 4XZIA 4ECLA 1V03A 3CV2A 1LG2A 2BOFX 2FZ8A 4W7UA 2GQ3A 1KM5A 3VNIA 1C8YA 3ABRA 4RPQA 3DFNA 1E1CB 4KFOA 2ACRA 3ALFA 4FP1A 5F1VA 2DUAA 4O0KA 1E4IA 2VO5A 3L0NA 5FACA 2WM0A 5CPOA 3ABQA 1VB9A 4NZ3A 5HQEA 2GSEA 5AECA 4ZA0A 3Q45A 3IGSA 1E0VA 1H7NA 1PIFA 3OZMA 1SJDA 5ABHA 2R6OA 1E3ZA 3UGRA 4EANA 4LS2A 3GG1A 6CGTA 3WN6A 1LLWA 4NJHA 4GYFA 6ENLA 4E4FA 1VS1A 1PSCA 1YEYA 3R0UA 5KZMA 2VZUA 5PTDA 1M01A 1TV3A 1VFTA 2PFHA 3VGGA 5TQLA 3FYYA 2GDVA 4LYQA 3BLPX 3ELFA 1YYAA 3W2LA 1DL3A 2DVXA 3G6MA 1FDYA 1XYLA 3TR9A 1BWVA 4OVXA 2W67A 2QXWA 3TYCA 1P0EA 5FJPA 2PTWA 2NQHA 2DSZA 1Q4WA 3LHVA 2DGAA 4Q6JA 4HNVA 2Z0IA 3M16A 2BX7A 4GC3A 1LP6A 1SW7A 3L67A 4QDPA 4GC4A 5REQB 3GWQA 4C6QA 1RUSA 3PTKA 2YPIA 2IPGA 1R47A 2VDHA 4CKQA 3SJ3A 3WO8A 2XH4A 1LRNA 4ZODA 1FFRA 3DHUA 3WEOA 4JTJA 1GVSA 3LLXA 2F6KA 3TTOA 4I9MA 4ICCX 1K6AA 3UWVA 3ZSSA 1XGZA 2I16A 1B9BA 2CKRA 3EBVA 4IXHA 3AMDA 4ZGYA 2DEPA 1UZ4A 3BLFA 3KUMA 2VP8A 3LSBA 3WLKX 2X1TA 1JDFA 1W5NA 4IMGA 3NPWA 2WM1A 1SJBA 5IBXA 1B4EA 1ME9A 2J47A 1QI4A 3EB3A 2PUZA 2INZA 1TQJA 2WBGA 4O1BA 1CI1A 1S3TC 1NF7A 3UZ5A 2UY3A 4J40A 1MRAA 1ZAJA 3QHMA 1QU4A 3EXTA 4MNLA 3OZYA 1S5NA 3E02A 1B90A 1Z8AA 4LF2A 4J9JA 4NJGA 2CZDA 3F2DA 3VFCA 1GZ1A 3N4EA 4NUWA 1F4HA 3CQKA 4Z1BA 4IQJA 2WNWA 3N34A 3CTTA 4YPJA 1XLBA 1SO5A 1OF8A 4I7UA 3VM7A 4HNCA 2NVDA 1JD7A 3AS1A 1KTCA 3BLIA 4RZBA 3GDMA 3C52A 4Z42C 2NX3A 4Q8MA 5AVHA 2Z6JA 3VOGA 3LG3A 3NEVA 2VGGA 1XKYA 4XSLA 1Q6EA 4UCGA 4YTQA 1Q6QA 3NSMA 2PF0A 5M5DA 4OV4A 4HYWA 2OKTA 3IIVA 3SCTA 3M5ZA 4CNOA 4AD4A 2FTWA 1J6PA 3N4AA 3OVQA 3E2SA 4XSMA 4AWEA 1SU5A 4QROA 4G9PA 2OEJA 2J13A 3BARA 5K9XA 1ZJBA 1Q6OA 3RJXA 1XD1A 3MCOA 1US0A 2P10A 2RJGA 3B9EA 3BICA 3KM8A 3VCRA 2P8BA 4GMEA 1UWRA 4JR5A 3LD5A 4JTHA 2D24A 1KFCA 2Q3OA 1ICPA 5JIWA 4ZQOA 1ZFJA 3NSXA 3VCNA 4Z08A 1ZNNA 3CPRA 4Q4SA 2PDYA 4ZENA 1AQHA 3S5ZA 1F2JA 1M03A 2EPKX 5HJLA 1A5LC 3L0KA 3GAKA 4PUUA 3TYEA 4LC8A 5CJ5A 3UXIA 4PCNA 4LX4A 9XIMA 3VDGA 3C2VA 1YTKA 4L4LA 2KX9A 1O5QA 4WVXA 4NYYA 4BF7A 1BPLB 4AD3A 2XN1A 3KTCA 3ME3A 1EJRC 1RSCA 1UWQA 2GWNA 4PA8A 3GDTA 4C7GA 1LLZA 4E8DA 1PWMA 1QNVA 1RQEA 2G8ZA 5XIAA 1C8QA 4BKNA 4QLJA 3MSYA 1VBGA 2NQZA 4CEUC 4FIQA 5U4NA 4X2PA 2O9TA 3UNDA 5CG0A 1OGBA 3DBNA 3GZAA 3U5UA 3FCPA 1B3OA 3WUFA 4Q8QA 1DXIA 4HPXA 2V2CA 1GKQA 3QY6A 1V5XA 4M5PA 3U7BA 5C9WA 2TMDA 4XBJA 1H4PA 3CB3A 3VZYA 2VL4A 4FHAA 3IJQA 2EF9A 4WD0A 3TP4A 4ERIA 3WG6A 2NZLA 3Q67A 4IJBA 4MB4A 4XIMA 3KBNA 2BDQA 7REQB 3P8JA 1DJQA 2R14A 3CZKA 4IPJA 3ITTA 2GUBA 4S3AA 2HVNA 4L9ZA 3LCIA 1GJPA 2BBFA 1FUYA 3VNLA 4IF2A 1GZGA 4D1JA 3VGBA 5LHEA 3CLWA 4CN4A 3DERA 4IP5A 1S39A 3MMWA 1OQFA 4DXVA 1NEYA 3GU9A 2AKMA 1PDZA 4MZYA 1WE5A 3L21A 3VMNA 4XKYB 1MDLA 1Q8AA 4UNLA 1Z7AA 2C3ZA 2GQAA 3F2CA 3MCNA 4ZQNA 3OGVA 3CT2A 1LZOA 4CQBA 5FA5A 3PSVA 2GQ8A 4HCLA 4C91A 1XL9A 3WLLA 2OOGA 2H90A 3B8SA 3BXWA 3SGUA 3QJAA 5LHFA 2YIHA 2VEIA 5LIWX 4GX9A 4AEEA 2HBVA 4JXCA 4C6OA 3VIPA 1VYSX 1HKMA 2CLKA 3MWAA 3PZMA 1EF3A 4PSRA 3UWQA 2VC7A 5XINA 3ANVA 4LBRA 3RLVA 2GGGA 3QMTA 5LNRA 1NQ6A 2AQOA 4AZHA 4FXRA 3WUEA 1TREA 5AZ0A 3GXDA 4FNRA 4YS1A 2OLHA 2IW0A 4MB3A 4XUYA 5HJXA 3NPUA 3O6AA 1ZGDA 4PYSA 4GJ1A 1JAKA 4WCJA 4ZO8A 3VUPA 1XR2A 4I6KA 4ZTYA 1R9XA 1EZ2A 4JN7A 3O2LA 3OEXA 3N2MA 1QHPA 3N19B 3KHDA 2POTA 2XN2A 4KGJA 3W26A 1QHZA 1M7JA 4X9SA 2OZTA 4P7RA 4HQVA 3B40A 3S4TA 5BYWA 4LAZA 4HSOA 5FSDC 5B7ZA 3B8IA 3VD4A 2PDNA 4YJ5A 3L4UA 3OQEA 3N18A 3OA3A 1EDTA 3W7DA 5GJNA 1PYFA 3MMUA 4WJ8A 1E0TA 4PMRA 5BU9A 5I7GA 1XBYA 3WMLA 3RX3A 3B0YA 2VRKA 2XWEA 4PZVA 2QZRA 1SFTA 1TWWA 2KAUC 2G96A 4HOZA 3TXVA 2E7FA 4QNWA 4AG0A 4XISA 1V0KA 3KL5A 2JBMA 2GQ9A 2H8XA 3VD3A 2WHMA 1F3EA 2V81A 2DZAA 1ISXA 4L1GA 3VIJA 5BXTA 4UQCA 3C2YA 3PG9A 3HGRA 2OJPA 2POZA 4WY0B 3NQCA 4FOUA 2QDHA 1MQRA 3SY8A 1FHVA 4TIMA 1OG6A 1PYMA 1YE4A 1TR9A 3PP7A 1EDQA 1NVMA 1W9BM 4IFKA 1RLCL 4PUEA 3ZFHA 3AXKA 3TZNA 1X6NA 4MMWA 3WBEA 4DAIA 4FLOA 4DM2A 1RCQA 3WL1A 4QDWA 2CXEA 3PAOA 4N02A 1GEQA 3GXFA 4OKDA 2VRJA 5AYBA 4A21A 1KXHA 4BHYA 3PUOA 4WEVX 3JRKA 3B0XA 1M9HA 4C6MA 4IJCA 3VNDA 1TRIA 1VEOA 1L6WA 1JUKA 2DH3A 3VK5A 4N6EA 4JL2A 4XWUA 3RR4A 1I8JA 1HXJA 2IXVA 2ISDA 5FESA 3VD7A 1QNOA 4RW3A 5A2BA 3EAUA 5M3WA 1KKRA 3QSTA 4O18A 1EQPA 1OB0A 3NVTA 1FHLA 1FHDA 1XF0A 4M80A 1RHCA 1QI2A 4K8EA 4MLJA 2QUUA 1PKYA 1OWQA 2PTDA 2Q09A 4UZSA 2PI6A 3R58A 3FXYA 4UTIA 4GUGA 4FNQA 3O07A 2E68A 2I9UA 4UCFA 3KBMA 2OX4A 3GUGA 4CLMA 2X7VA 3UD6A 1JZ3A 1J0HA 1Q6RA 4WGXA 4YCOA 3F4CA 2Y6ZA 3ZYZA 2V69A 4S39A 5AHMA 2VX6A 2A3LA 3LCWA 2Y85A 3LM3A 4A3UA 3DEQA 3BPWA 3G1SA 2ZVIA 3UZWA 4O14A 3N3TA 3V0TA 3VX0A 1JZ4A 3VU2A 2V8ZA 4LUTA 3DFOA 2GFTA 3BW2A 3RR1A 1AH4A 5IBXC 3CV1A 5I3JA 1TWIA 4RUBA 2GVJA 2D0HA 4E4PA 3MTWA 5I06A 3S1XA 4PCFA 5A2AA 3W2NA 4HOWA 1EJXC 4ML4A 3MB9A 4RK8A 5D9MA 3GC4A 4YWIA 3H2AA 4PBEA 1RVGA 3BG5A 3TLLA 5K9DA 1K1DA 4UFJA 4GI6A 7TAAA 2NLIA 4E2VA 1EA0A 1QHOA 2FHCA 2Y7FA 2YA2A 1TV4A 3FVDA 3DESA 5I07A 1GHSA 5EGRA 4GIEA 2CZ5A 3QZEA 4Y9OA 4O4WA 1KCLA 4DJEA 3WLRA 5I0DA 2GOKA 1JCNA 1VPQA 3EX1A 2BXYA 4EWND 1NTHA 2DZSA 3CV7A 1VFHA 3ZR4A 1I6NA 4QAWA 4GIAA 3VOFA 1KBIA 3LBOA 2GK1A 1XIFA 3VIGA 1RQHA 2ZC1A 4UTWA 1CXLA 5HNNA 3LZ3A 4ZFMA 1KM2A 4QP0A 1VC4A 5C7VA 4L4PA 3W22A 2B7PA 2A3BA 5C7HA 4UFIA 1JZ5A 4V1XA 1UD6A 2G4JA 2D23A 5E9AA 2PDUA 1JXKA 3H4XA 3N3MA 3RCYA 2Z1BA 3W1LA 2OU4A 4AYSA 3U6WA 3PK7A 3G3DA 3U4AA 3W9ZA 2HS8A 1LBMA 3ANYA 1XLAA 1SO3A 3ITGA 3TYBA 1ONWA 1Q65A 4QM1A 4QFUA 3LRKA 3COTA 2BOEX 2D20A 4Y90A 3SCOA 2V63A 1PPIA 1GOQA 2WWCA 4IG2A 1LWJA 4WDWA 1YTEA 4I3GA 2ZZ5A 4WLCA 4LGXA 3R8GA 3L5AA 2I56A 1IXPA 4NZ1A 3N2OA 4AX6A 5JH2A 4C6BA 1T8QA 2QEZA 2DT2A 1RA0A 4P7NA 3TU9A 2A2IA 3AXHA 4WK9A 3KWXA 3VIMA 1W2VA 3B04A 4AIEA 3SFWA 2DZUA 1LJYA 1N8FA 3PZTA 4ZB2A 1MZRA 1R46A 1NOWA 3P80A 3W28A 4F0LA 4EXBA 1OFDA 1F61A 2QF8A 4P8XA 4FI4A 1EL3A 2Z1VA 5ECUA 1UIPA 1CGVA 4ZSUA 1RJPA 3GC5A 4KIRA 1HJUA 4GHRA 3CZ8A 4Y2WA 3VCCA 1Q6FA 3VZZA 3GH4A 1EEPA 1QTWA 3ITYA 2QVHA 1W5OA 1F8IA 4H3DA 4GYKA 5E09A 1CECA 1YDVA 2ISFA 3WH7A 2Z2AA 3LHUA 1R30A 5IRPA 4FLRA 3W7HA 3LGEA 4CU7A 3ENLA 4Z0JA 4CU6A 4NZ5A 4HNUA 1AL8A 2YFOA 5AHLA 1FFQA 4DO5A 2HPIA 3SO7A 3GXMA 4A3RA 1SPQA 4JTQA 3S9ZA 4DZAA 2VWTA 2QT3A 3MP4A 2UBPC 4M6PA 2AQVA 1R7AA 1AZ2A 4KF1A 3EWYA 3R6IA 1A53A 1MW0A 2VCAA 2ZWYA 3IK4A 4QG9A 3K8LA 3AHVA 3EOOA 1G4EA 2BY2A 2GYIA 6XIAA 2I1OA 3FA5A 3GQYA 1W5MA 1XI3A 2P76A 5FEPA 3GAYA 4GKTA 4DI9A 4O1DA 1VCVA 3W25A 3STCA 1GK8A 4G8TA 4A22A 5C2XA 4ZQMA 4EPKA 2INFA 2O4MA 4PTNA 1KTBA 4NAFB 3H8AA 3Q58A 5G4HC 3SRHA 4MHBA 3FJNA 3ZIZA 4RX0A 3G22A 4QSFA 1MNZA 1M7XA 3K30A 1EWEA 2PS2A 4GO9A 3UJ2A 1N8WA 4JDBA 1W1TA 5DMMA 3WLTA 2CLMA 3R7MA 3P7YA 1W3HA 3T4CA 1KNWA 2W4XA 3SCPA 4RNFA 3WK3A 4JFSA 3KW3A 4Q4QA 1Z42A 2FPYA 3RLUA 3GNNA 2HEJA 1OF6A 3UYIA 3OVPA 4J3WA 5DX7A 3W02A 2EG7A 1ZAIA 2XM1A 4GVIA 3I65A 1YQ2A 4XAYA 2OKOA 2HPMA 3PBMA 1MXSA 4OGZA 2YDAA 4S3BA 1GEHA 2D2GA 3W3OA 4HU0A 1E71M 4K68A 1WDRA 2PDHA 5A8PA 4UOQA 3CK5A 1XICA 3FOKA 5F2LA 3PPGA 2FTPA 1XX1A 1M68A 3BQ6A 4RZ4A 3F1QA 1F3WA 1B5TA 4RE4A 4GVGA 2EJAA 7PTDA 4ZE4A 3AC0A 1BHGA 1J01A 1IWAA 5AC8A 1TPH1 4CU8A 2YXOA 3KS5A 1F07A 4O52A 3IAQA 4R3UA 5CPMA 2WNNA 3IV3A 1YPXA 3T08A 1MVYA 3ARSA 1DXFA 3OG2A 4GX8A 1I0DA 1ML1A 4JNZA 1GQKA 6XIMA 2FB2A 4W5ZA 1C7TA 4DUXA 3N9SA 3CJPA 3VGHA 5A8GA 4NNBA 3B8TA 3OLEA 3PBYA 3SR7A 3RO6A 4N7QA 4KERA 3S8HA 5EL1A 2YDSA 1V02E 2XZ7A 3PZIA 3SCSA 4QX4A 1WB0A 2GJPA 3LHWA 2NW0A 4NAEB 5L9FA 3LU2A 4J27A 3LCXA 1JUEA 2ACQA 1NP0A 1S2AA 2OSYA 4N0RA 4IUOA 2FLIA 1IWBA 4MY1A 1K6WA 3QLDA 1SZNA 3W01A 3WJSA 3THCA 4GFIA 3W1NA 3W7MA 3QMSA 2PBGA 3NPVA 2NXHA 5A8MA 1KCKA 1YXYA 4JQ3A 3IEBA 1QATA 2I57A 3KOFA 3DYOA 4NF7A 1T5AA 2YBTA 3PM6A 1V0MA 3AIBA 2J24A 2PTYA 4ZQCA 3L4ZA 1I9CB 1W3KA 3L4YA 1M65A 5AYIA 1V6TA 1EC9A 1XIHA 3HO8A 1XC6A 4W89A 1XWYA 4WRHA 1QO5A 2ZX5A 4IX2A 1MW3A 1Q6LA 1VBUA 4QS6A 2I9EA 1HKWA 3C2FA 2QCEA 2KZHA 1HGYA 1Q6DA 3WQWA 3WNOA 2REQB 3WF1A 1HJVA 1XLDA 5BU6A 2PWHA 2CHOA 4WY0F 2MUCA 4LSBA 4JQAA 4IQDA 3TJIA 3TXZA 4KETA 3Q37A 4HA1A 3AIVA 1LRTA 2PP1A 3E9AA 4O19A 1NP2A 1BRLA 1AQ0A 1RJRA 3QH2A 4LNYA 4CNPA 1IZJA 1SFLA 2RDWA 3BE7A 2DP3A 4AYGA 4F2BA 3DC8A 5ABEA 3APYA 1TWDA 4MY9A 1G01A 4PMNA 1KO0A 1ZAHA 3N2XA 1YX1A 1RCOB 2GJXB 1UZHA 4BZYA 2CLLA 4R9XA 3NQFA 1R3VA 4O53A 4HU8A 3Q94A 4B92A 3DI1A 3WLOA 4LPCA 1ZENA 3W6YA 4HU4A 3QQWA 3OLIA 2PRLA 4ZMGA 3PTQA 1DJGA 1R2SA 1AJ2A 3H23A 1BYAA 2YSWA 1XINA 3A5VA 2OYLA 3GTHA 2IMRA 2DSWA 4RPPA 3DIPA 3LX9A 1GJWA 3GE7A 3CC1A 3W1XA 3W0KA 4DJEC 4REQA 3C0QA 2QGHA 3HPZA 4MDOA 1DJYA 3EX2A 2ZX8A 3QXBA 4KESA 2VT0A 1DWJM 1QCWA 4IIFA 4C90A 3GIYA 3ID7A 3N9KA 1MW1A 4PUKA 3BDKA 1A4MA 2V3DA 2NUXA 3S5NA 2WCGA 3IVTA 4EPBC 1ZU8A 3STPA 2EEXA 4AFYA 5H2ZA 3GG0A 2VMFA 3TYDA 3LEPA 1UBSA 3VFLA 2WMFA 2XWDA 4C6CA 5AFDA 1EC8A 2PAJA 3JVAA 1VYRA 4NJIA 1X6LA 3F4WA 3AYTA 1U33A 1UZDA 4C60A 4QIUA 3UG8A 3OOQA 1C29A 3FSUA 3T44A 4DNHA 4GOAA 1X6UA 3T07A 2JIEA 4HB7A 2QCCA 2X1UA 1PWLA 4MWAE 4TUFA 2PD9A 2JKEA 3LCHA 3U2OA 2Y70A 1W1ZA 4EF8A 2W61A 1CGXA 3ALGA 1I45A 3OGSA 3WNMA 3FKKA 1Q6CA 3R0KA 5F2GA 9RUBA 1KXTA 2W5FA 5AVNA 5L6UA 3FN9A 2IKIA 3EB2A 1E4LA 2DZXA 2HE8A 3F7JA 3SCQA 4YYCA 2HMCA 3ISIX 1VP5A 4FX7A 3WQEA 4UTHA 1C3FA 1YE6A 4O50A 2VX7A 5C71A 5BRBA 1E9YB 3M7SA 2WKLA 2VENA 2GL5A 2QUMA 4MAZA 5A1AA 2VDGA 4D8LA 1BFNA 4IT1A 3UEQA 1KLYA 2J7DA 3IJ7A 1TIWA 4F2TA 4PTWA 2J4GA 3BLLA 5DQPA 1YNPA 4BR1A 4IISA 1TPUA 4MJZA 4RE3A 1HF6A 1K77A 5KZDA 1FCUA 2E6DA 3P61A 3W7LA 3TJ4A 1W1VA 3QC3A 1XYCA 3QGVA 3NTYA 3UCDA 2CBIA 3HOJA 3CWHA 3UZYA 1WCGA 3NUKA 2J7BA 5REQA 3RX4A 3OHIA 1G0CA 1MUCA 1OIMA 1W54A 1QNPA 3MMDA 4PUJA 3SM0A 4H7CA 1EO7A 1O5KA 2E6AA 1ITXA 1I2OA 1O1HA 1ZS2A 3FDGA 2PPGA 2EQDA 5EB8A 2C18A 3MS8A 2OPJA 4FXJA 2OMAA 2PDIA 4MLRA 2DT3A 1GVEA 2VFGA 4XX6A 1UPMB 1BSIA 4L9YA 3MV11 1KFEA 4DF1A 4P5UA 1ALDA 2VQTA 3BMWA 3A21A 4CD6A 4YLWA 3AMLA 3G1YA 4D8ZA 1YW1A 4L65A 2ZRWA 1D3HA 4LW7A 1QOQA 1E70M 3W2UA 1ISZA 2W66A 2SFPA 1S2WA 4PBGA 3WENA 2JF7A 3ZJKA 1E6PA 3KRUA 1OYAA 4G7EB 1K8ZA 1IR2A 2Z28A 5KZ6A 4MYXA 4LAKA 4GUFA 4C6NA 5KSWA 2VELA 1HKVA 3GFYA 2C15A 5FAGA 3WDIA 1G69A 3GNOA 4H2HA 4DJED 3UCQA 4P7OA 5IDZA 2H9AB 4J3UA 1TPFA 1LOLA 2DW7A 5LIYX 3W7OA 1TVPA 3RK8A 1XPGA 4QEHA 1E72M 3C2EA 3M4HA 3BLEA 4M29A 2ZTJA 1XLLA 1D8CA 3B3DA 1EIXA 4JIPA 4QHRA 1BYDA 3RGTA 3DXIA 2ZICA 3VVGA 2NV9A 4N4PA 1CLKA 3WLMA 1XBVA 4UMAA 3NQBA 3UXLA 5BRPA 2Z2UA 4LYKA 3GTNA 5DO8A 2BY1A 1JI2A 1MNSA 2BZNA 3SZ8A 4Q22A 3A4AA 3E2QA 1TV2A 3EWWA 3AHYA 2V3GA 4DYEA 3W07A 1FTXA 2JEQA 2VURA 1FOBA 4B2DA 4W85A 5I6SA 1PDYA 2IS7A 4U2ZA 3TA9A 1UROA 4TVCA 1XG3A 4LFYA 3N6JA 1H1YA 1R7OA 1AZ1A 4JTKA 1GOWA 5D03A 1FWRA 1JCJA 4GYPC 4L7ZA 2FGLA 2OYKA 1TV7A 5EA9A 1J0JA 3D3FA 3ITVA 3LLDA 1ZL1A 4LB4A 3ARXA 1OFBA 3TV8A 1RPXA 3IS4A 1VBHA 1RCXB 1NAL1 2PWDA 2BNJA 3LHYA 4AY8A 4L61A 1XDMA 4JGDA 3T0TA 2X1IA 4FX8A 3WD1A 3A4JA 4F48A 3RIKA 2OOFA 3TW7A 2RDXA 1J0IA 2P53A 1GYMA 4ICNA 2EAWA 2P8CA 3C8FA 4Q8WA 3H53A 3S9YA 1FQ0A 1L2QA 1ONRA 4HMNA 4KCUA 4D6CA 4AZIA 4UR7A 3CUIA 1I1XA 3EOSA 3GK0A 3CMGA 3CGTA 2HS6A 3ONBA 1X1ZA 1KR1A 2R1MA 4BI6A 3W72A 1SFJA 1RXOB 1SW3A 1O6IA 1XGDA 3IIXA 2VFDA 4ZQPA 1XFBA 4NYUA 4N9DA 1GW9A 4BQ3A 1W9PA 1K9DA 3L4XA 3DECA 2A6NA 1OCQA 1LYXA 8CGTA 3H70A 1LLOA 4AD2A 5AC6A 7REQA 1ZLPA 7A3HA 1H5YA 3G1AA 3T6CA 3HGSA 4DIAA 1NFGA 4ZL1A 4AAJA 3HIJA 1XIEA 2OCZA 4H7ZA 4KW2A 2OQYA 4EACA 3AROA 1MXDA 4ZE5A 5C9XA 2XM2A 1MQQA 3RPTA 2NQ9A 2NXGA 1DBTA 3PY2A 4C7FA 3M9YA 5DEZA 3HB9A 5CXPA 1KCXA 3UWEA 4XKYA 3RO8A 3HFTA 3NQMA 4C6DA 4UTLA 2AMGA 3WDRA 1D7KA 3EXSA 1JUBA 2IKJA 2VEFA 4Z2IA 2GVYA 2J7EA 3S3GA 1H7WA 3OODA 3MCMA 3BAYA 4GJIA 1RAKA 4AXKA 5LZLA 3LQLA 5FF2A 4MUZA 3RM4A 4GXWA 1BD0A 1ZSXA 1XLKA 3V4BA 4BF5A 3P0XA 4FA3A 3HQNA 3T42A 1DWFM 4GQGA 1AJZA 3L2IA 2JALA 1UR9A 2E67A 5HR6A 2XIJA 1WKFA 3NL2A 3VNKA 1UD5A 5HNRA 5JIPA 1VPXA 5H8MA 4LYPA 3QGKC 4DRSA 5DCBA 1YPFA 4AZGA 1HKJA 1L6YA 4OIFA 2PURA 1SM9A 3BJSA 1CENA 4YMZA 3GZ3A 5A8NA 4FAMA 2C19A 4UXDA 2QJJA 1MXGA 1JAEA 5TIMA 3THAA 3FY1A 1BQGA 3NQDA 1HL9A 3BANA 3AJXA 1US3A 3CHCA 4JDYA 3SI9A 1JPKA 3C5QA 1E6SM 3W1PA 1VEPA 3QHOA 1G9HA 3S42A 1SZFA 1A5CA 3GXIA 1H49A 4OBTA 1TWSA 4AH7A 2A79A 3GTIA 1WNOA 2PDXA 3CZLA 1YDYA 4OFCA 4JX6A 4WJXA 2J6VA 4WQ6A 2E25A 3VIHA 4NQ1A 1N2VA 2VZVA 5C5YA 5G2WA 1VJIA 3WCZA 5EMLA 4R88A 3S9IA 1R87A 4IP4A 3PB2A 4XZLX 1LT8A 3W84A 4GK8A 1ZZMA 3URAA 2C6QA 3GNXA 5AC7A 1QPRA 4PMXA 1IEIA 2WZIA 3NZQA 1E6NA 5B7YA 1RA5A 4M8UA 3WJZA 3EKGA 3N15A 3FJLA 4WY0A 3LS9A 3N9RA 3S0CA 2Z26A 1FDJA 3E0IA 4ZB5A 4HBKA 1JZ7A 1P0BA 1V6YA 1EKOA 3B8VA 4HA0A 3N14A 3QPYA 2XH0A 1IEWA 3QN3A 4R9OA 4GVHA 3NPXA 2FHFA 3R5EA 1JCLA 1H51A 4PMVA 1RH9A 4LVFA 3GO2A 3WDJA 1VCFA 1ZJIA 2R82A 3I7QA 3LRLA 4DZHA 5D2YA 3VIKA 1X8CA 3K8KA 4B15A 3R1ZA 4GBUA 2CBVA 3UW6A 4IJRA 1R6WA 5LNSA 1H5VA 4MNMA 3FDKA 2BY0A 1A4LA 4X60A 1NJJA 1IF2A 2H3BA 5HNUA 3CYJA 2DSVA 1OC7A 3KHJA 4IWWA 4WXYA 1HP4A 2IQTA 1QAPA 2EGZA 4ZQRA 4D6GA 5LGZA 1TB3A 2HQAA 2BP1A 4CQAA 4XO6A 2X42A 4ERAA 2Y24A 3P6LA 2PA6A 4ADSA 1JZ2A 3HFYA 4XTIA 1UHVA 4XAZA 3STEA 4A29A 3VUSA 2PDPA 4AEFA 4AVNA 4Z0SA 2I5GA 4US5A 1LQ0A 3A5FA 1DWHM 3CZJA 2DZPA 4Q8OA 1E4MM 3B4YA 9CGTA 2G4FA 5DELA 2QLYA 4O0QA 1R9ZA 1MO0A 1GHRA 4S3EA 1EPVA 2PODA 3QV6A 3UG5A 1JGMA 4L80A 3L2MA 2O9RA 2I17A 2J88A 3OA5A 3WL0A 3U4FA 2ZUSA 2J9ZA 2O7SA 3WQ5A 3GVWA 4KH2A 3H4GA 3URBA 5G1MA 2QMKA 4H19A 1X96A 4NZCA 3C61A 1L8PA 1OD0A 2Z25A 1W91A 5EMMA 3CIXA 4LS1A 1LBLA 4DQWA 3M6YA 3GTFA 4PUDA 4FOKA 4TV5A 2PZ0A 3UZZA 2DIEA 4A8NA 1WYIA 2P1FA 1TJ2A 3L68A 4O17A 2HE5A 1CB2A 4K37A 1AW1A 1X7IA 1GOIA 3ICJA 4XKMA 3APGA 4QCEA 2E1DA 4GYJA 4N6FA 3T0CA 3JUGA 3NGJA 4B4FA 3NL3A 3NM3A 2A4AA 1LBFA 4F2UA 3E49A 3R94A 3WQCA 3HG2A 1H1NA 4RZ6A 2DZTA 3SUSA 4C6FA 5C0QA 1VJSA 3VDCA 4YCPA 2OLSA 3K1DA 2ASHA 4LV9A 2QW5A 3EMQA 3L2LA 1OADA 1W17A 3B9AA 3BV7A 3T0DA 1Z89A 1QWKA 3JZEA 1EOMA 1UKTA 1TKKA 1U5VA 4C7DA 4W84A 2DJXA 3UR2A 4AWUA 3CH0A 3BLKA 4CQ8A 5HPOA 2JEPA 4AWTA 2RGLA 4HCHA 5JVLA 4RNIA 3AIQA 4OV9A 4L64A 4UWMA 2QGYA 4RXGA 5LA0A 4F3HA 3U7VA 2NUYA 3AS0A 4LUTB 4D8AA 1NY1A 2J8FA 1PHWA 3K5XA 2VXNA 2DPEA 4CEXC 1B3XA 3EX6A 4JAWA 2ZUMA 1TZ9A 1WV2A 1EDGA 4DHGA 1TUXA 4L9XA 1A5AA 1UKQA 3QV8A 1GPFA 3W6LA 2ZZ3A 3AS2A 2B7OA 5E0CA 2WC3A 4NNCA 2FHBA 5FJJA 4Y8FA 1YHTA 3HPAA 2R1KA 4RCXA 2FQIA 4OUIA 3W7CA 1OSEA 2BHUA 2WAGA 1AD1A 1R5YA 3GUWA 3XINA 5BMWA 2V67A 2HJPA 4S3KA 3GHTA 3M5VA 2RHGA 1SJAA 3K46A 2ISVA 5A6SA 3T0BA 3APTA 1TV5A 1B9ZA 4KEMA 3W1QA 3WUGA 1BWKA 3BMXA 4KCTA 3RITA 4R27A 3OU8A 1VFLA 1E1FA 5MF5A 3CEPA 1F73A 3HG3A 5FEWA 4AY7A 2Q71A 2GK1B 1ZP3A 4AVFA 5K3VA 5I3KA 4MPKA 4N4QA 2BHYA 2G95A 2VFEA 1FWEC 1J2WA 1NELA 3TYUA 5HDRA 5F4XA 1TQXA 1C9WA 5FJTA 1JFXA 3NXFA 3LUTA 1BSLA 4BQ4A 1CW2A 5I00A 1PX3A 2IXUA 4Y9AA 5J04A 3VO0A 3CUJA 1CLXA 2DSKA 2IKGA 3FS2A 1KQZA 4UQ9A 1G5AA 3AZSA 5ECVA 4WSKA 5F7UA 1A0EA 1J2BA 2EPLX 3UYCA 3CUHA 3GDBA 1ZQ5A 1R3TA 1Q63A 3SDOA 4AZBA 4PTMA 3CXOA 1PBGA 3VPLA 2Y4SA 1S2TA 3SB0A 5A8QA 4S3JA 3SECA 4LUYA 3WH9A 2PC4A 4A2RA 1XYMA 4IH3A 4LBSA 4AIBA 4NAFA 1EQCA 2H8ZA 2ZVRA 3KCLA 3O6DA 4BWLA 4E4UA 4HZ6A 1F6PA 1A50A 2HCVA 3LENA 4H8UA 1GUVA 2VFIA 4MJ2A 2IKHA 3G1XA 3DI0A 4GY0A 5BWFA 1V6XA 3M47A 2PWUA 3VI2A 3EX4A 1A5NC 3LNPA 4A3YA 3KRZA 2DJLA 3TJXA 4BEUA 3NAVA 3FFSA 3ZM8A 3NZGA 2Q01A 1V3MA 4W88A 2XVKA 1QPOA 4DWSA 3I10A 1HKKA 5FI8A 1BG4A 2X8RA 3W7RA 1XRVA 4G56A 3VMPA 4JEQA 4K1WA 2AOSA 2BGSA 1FWSA 4QS5A 4X9YA 2GVEA 1QO2A 3CQJA 3RLHA 2Y8UA 1WOAA 1ZB5A 2GGEA 2YW3A 1V3IA 3CHFA 2PWFA 4NILA 2TAAA 4GI8A 1DEDA 1DE6A 5IHRA 2XSBA 1JPIA 3HGJA 3AMKA 2WNZA 1GGOA 3UZXA 2GGIA 5A6AA 2V3FA 2WLZA 3FA4A 4AX7A 5D8WA 5BNKA 1M7OA 4B2DD 1UWIA 1JZ6A 4JTTA 3O6YX 3O6CA 4L4MA 4XZWA 2XTKA 3CASA 1AODA 1B3YA 2Y1HA 2VDIA 3N12A 1YMYA 3B9DA 2NSOA 1P6BA 1QPNA 4EE9A 4POCA 4DBUA 1LOSA 4P2VA 1RLDA 1ZBKA 2FVLA 4ROQA 2ZQ0A 4JIIX 4O12A 3IGHX 5A69A 2E9LA 4P7QA 4D2JA 3S1GA 3IIPA 1J96A 2C0AA 2HISA 2Y0FA 2A21A 1ZJAA 4XO7A 3CH9A 3PBUA 4NAEA 2QF7A 3W75A 3IJIA 4A6GA 3MYOA 5HMFA 3V7PA 3HQPA 4IMDA 4M19A 2EG8A 4UTMA 2YCIX 4E38A 2AAAA 3W7KA 2P0OA 4UFHA 3P74A 1FXPA 3CUGA 3G1DA 4RE0A 1OT1A 3K4DA 2PGFA 3PZ9A 1W9XA 6A3HA 3ABXA 1UKOA 4WGHA 3MZ2A 1KCZA 4XD5A 5CGQA 2NSXA 2OQLA 1T41A 3V16A 2FIQA 4Z1CA 4GH1A 1GG0A 5I2UA 5CC7A 3KRSA 3H2CA 1FWJC 3AYRA 2VR4A 3MHGA 5EKYA 3H4WA 5EBAA 4WIWA 3HPXA 1BYCA 3DBPA 2XINA 4KGLA 2ISSA 2PU1A 1S1RA 4LEFA 1C91A 4HCDA 1QK0A 1J79A 4TTUA 3TTQA 5AC5A 4QISA 2AGKA 1AH3A 1NWTA 3QQ0A 2NUWA 3SW6A 3UCCA 4DYKA 2REQA 4GD0A 4KQNA 4JTFA 1QPKA 3HMJG 4UR8A 2CXGA 4LEQA 3RNDA 2WZEA 4IIDA 2JKPA 4G5DA 3FVMA 5C2GA 1MSSA 1FA2A 1W6TA 2VZOA 2R8WA 4NZFA 4TXEA 1CXEA 2YYUA 1P43A 2JGYA 3CHVA 3I3EA 2CNCA 1U5HA 2GJXA 3UETA 2CLIA 2D0FA 2UV8G 1B57A 3PZNA 8A3HA 1U22A 4LV4A 3UPWA 3KLKA 4QJ1A 2VCCA 1HIZA 2HDJA 1V77A 4ZB0A 3MI6A 1OYBA 3BL3A 7TIMA 2QUNA 1E9IA 3WNLA 4HN4A 2VM8A 1H7XA 1OFRA 1EP2A 1MZHA 2WSKA 3RN6A 2G5WA 4N9CA 4CD8A 3UJRA 1Y65A 1IXQA 1UJQA 4UZUA 2YL6A 3O05A 4JFVA 2NX1A 3JW7A 1P0DA 1WZLA 4X3ZA 1L6SA 1AH0A 5I02A 2Y5SA 3DFSA 5J5RA 3RPDA 5MHBA 2ALRA 1FWHC 2HTMA 4D6FA 5C54A 1CX9A 3NA8A 4J3SA 3R11A 4NXKA 4ORMA 2CHNA 2E0PA 5C2CA 5GNXA 3UPMA 1KR0A 1FWTA 1H62A 2X0YA 4ZVJA 4NX5A 3R2GA 3UJEA 3HF3A 1ME7A 5JXQA 1XLFA 1FWGC 4TMBA 5BW6A 4H01A 4Z2KA 1DQXA 4IZGA 3P0WA 4OTKA 2WANA 3B4UA 4OECA 1U83A 2J6XA 1X7FA 3CL7A 3VINA 1VQTA 3F5LA 3R79A 4C5YA 1J5SA 4NY2A 2XVGA 3MSDA 1Q3NA 5A5WA 2BXVA 2RH9A 2R94A 3QR1A 1VGAA 4HOXA 3GFZA 4HSHA 4YYFA 3LN3A 2E9BA 2UWFA 4U5IA 3TN3A 4HPNA 3USBA 3BV4A 1Q8JA 2X41A 1BRLB 4XBKA 4B5SA 2JQXA 5D4YA 1OJXA 1ME8A 5BWAA 1QUMA 4Q8PA 1GVYA 3I6RA 1ZJHA 3T2QA 3ZOAA 4IM4A 1AK5A 1E43A 1IV8A 4KRUA 3OO2A 3QM3A 1OCNA 4U10A 3WUBA 3GS6A 1NFPA 2PC8A 4TMCA 3RF9A 4B9YA 4GI9A 1WOBA 3OGRA 4NHVA 1KWGA 4FLQA 2XU2A 1WZKA 3OBEA 4M0XA 4LU0A 5HUPA 1FH8A 3E74A 3F4DA 3O3RA 3V35A 1JQXA 5DCEA 2QJGA 4ZOAA 1BXBA 3ZLFA 4Z17A 1S38A 3TMQA 3CIWA 2G3IA 1QNSA 1CXFA 3NVDA 3IJ8A 2ICSA 1JYWA 4REQB 4H9YA 2BXZA 3VM5A 2R1PA 2FJUB 2QCFA 5LKYA 5HQMA 1HL8A 3K13A 3R4IA 4FEZA 4HYVA 4CN6A 5BOEA 5C8BB 1W9UA 1UP2A 5FKYA 3H24A 4EXQA 2UY2A 3M5YA 4NG3A 2ONEA 4O10A 4R5EA 3W88A 4E3VA 2Y8KA 4KKXA 4IFRA 1C7SA 2YCKX 3DKLA 4LOCA 3CMJA 1L6FA 3CHDA 1PX4A 3DFTA 4MKVA 1OFEA 3LPOA 3O1NA 4JHZA 3PPHA 3R0DA 1IT0A 4XAPA 1S46A 4GABA 2YB1A 3EEGA 1WXJA 4US5D 4YXGA 2OEMA 2FMOA 3UP8A 1EJ7L 4JBRA 1O95A 1LL6A 4UTFA 1LDCA 4DJFA 2PBOA 3SCWA 4PMJA 2XGZA 1JDDA 1POJA 5DFAA 1VRXA 2FFCA 1E5NA 4N9BA 5CSUA 2XIQA 5AKQA 4HZ7A 3KWSA 1GORA 4G7EA 3LDVA 4BWLC 1EGZA 1UG6A 4I90A 3VKBA 2RUSA 4P7LA 4IX0A 3IV8A 2ZOXA 4EP8C 1EWDA 3KBVA 2VVSA 1TTQA 1IT7A 3WK0A 4QEEA 4PC8A 3AHXA 3E0FA 4AZ7A 5KINA 4MZ1A 2J8TA 3CPGA 2H9AA 4W5UA 1KBLA 3RX2A 4Y9PA 4D9PA 3C3UA 3THDA 1PZ3A 2J9XA 3P5YA 3MJMA 2G3JA 4HU3A 4B4HA 3CIVA 4DWSC 3W4RA 1N7KA 2E09A 3QTPA 3FEQA 4X63A 1ESWA 4D6DA 4KRZA 1DXEA 4F79A 4JTUA 5LA1A 3W73A 3KVJA 2E6FA 5DXYA 3W71A 1TE6A 3DU0A 5CQ1A 2G3MA 4PTDA 3S2JA 5JUVA 4OU1A 4A2SA 2Z29A 2J9YA 3CO8A 3K4AA 2QVNA 4HNLA 2ZUVA 2VEKA 3CV6A 1A3WA 4RNJA 3MPGA 3GIPA 4MSSA 2PDFA 3ITLA 4UTTC 3S83A 3HZ3A 4NRSA 3OHMB 5EPDA 1DIOA 1TX0A 2YA1A 5JQ9A 3EA2A 1OD8A 2YBVA 3DUGA 4EAYA 1XDLA 2W79A 4BS0A 5AN7A 4O1CA 1E15A 1AQMA 1RV8A 2Z1XA 5AYYA 1TG7A 3C0SA 3SUVA 3VKDA 2PDMA 3N04A 1WAUA 3WYZA 1XYFA 1JYVA 3TX9A 3AXMA 5JBFA 3OTRA 2F9RA 5D05A 3MY9A 2XGBA 3BAKA 3U2ZA 2OGJA 3WH8A 1F76A 3NQ8A 1JVNA 1R0MA 2WVVB 3A3WA 4QLKA 1G1YA 1GONA 1T6MA 2F2KA 1H7PA 3W23A 1C90A 4MADA 4K1GA 3QYQA 3BW4A 2BTMA 4OHQA 1KTNA 1H0IA 1XPYA 3LERA 1GTEA 4JD4A 3W1TA 1EC7A 1U2YA 4LAUA 3QR0A 2ZXQA 1WUFA 1WXZA 4JN6A 1BF2A 1C92A 3NIYA 4AZ6A 3LNMA 4GZIA 2ZXAA 3H54A 3ZXWA 3ABOA 3O7UA 4C65A 4C6KA 3U2EA 2VVNA 1ISVA 1V79A 3KP1A 4W86A 1S5WA 4UFLA 2I5QA 1MRQA 1XSKA 2FFIA 5EBUA 5E0KA 3S47A 4US6A 5BOOA 5G1TA 5FJIA 3GD6A 3NSNA 3WBWA 2WHJA 6REQA 4HHHA 4IL2A 5DRIA 2ZDRA 3OIHA 1PJ9A 5HMEA 2B0MA 4B90A 1JR1A 3TSBA 4K6AA 1XRSA 4Y96A 1E9LA 3NO3A 4A3HA 2O56A 4H9VA 4EK7A 4IPLA 4QE5A 2OZ8A 3FIGA 3NOYA 1UJPA 2FTYA 4GCAA 3ZSTA 3I4KA 1W37A 3DG6A 4C1NA 3E38A 1RVKA 1JRBA 1LRQA 2YXGA 3EX3A 1T40A 1ZRQA 3UA3A 4QNEA 2RAGA 3T2PA 1P7TB 3CWNA 2WW5A 4RW5A 4TTGA 1MW2A 4G6CA 1OCBA 3E0VA 3B8DA 1EHAA 5ABTA 4YL2A 3HBLA 1OZQA 1A0CA 1F6YA 3K2GA 2CITA 4XZMX 2ZUTA 3FGCB 2NT0A 3SAZA 3CO4A 4JIHA 2PSNA 4H9XA 1J18A 1Q6GA 4HGXA 2XVNA 4LCSA 4NX0A 1AL7A 4IGNA 3M6DA 3BO9A 1ZCCA 5G2IA 3STFA 4DWSD 1K02A 4BY3A 2Y88A 5I24A 1N82A 3J7HA 3H12A 1G67A 1KGWA 2ZA2A 1W3JA 3ARZA 5K4XA 4H8NA 2A5HA 2WQPA 2XIBA 3CZEA 4HK5A 1UW9A 3BCJA 3SIZA 1TPC1 4H2CA 5JMUA 3S1UA 2QCLA 5I79A 2FZMA 2IUZA 1GWJA 1HO4A 2Z7GA 4GRSA 1XIIA 3SURA 5FJOA 2ZUNA 3TTEA 1OIFA 2PEVA 5I3DA 3WSUA 4MIMA 3IRSA 3OLDA 5CZ0A 1LROA 1JRCA 2ZXBA 4O8RA 1R85A 3BH4A 5A6MA 3W2KA 2RGMA 2EPHA 3RU6A 4RL3A 3WLPA 5DT7A 3U3HA 2NQLA 3R43A 4H8VA 4E8GA 3OIXA 3TLQA 3O9NA 1FXQA 3V0SA 1FX6A 1PEZA 3KCOA 2V38A 2WJZA 4QBXA 7CGTA 3ARWA 3I7SA 3BMVA 4CVUA 4DI8A 3DKJA 1IHIA 1QVBA 2VD8A 3D46A 4LVAA 4QR6A 2J25A 4HNTA 4FZIA 2VGFA 4YTTA 4GNKB 3G3MA 3NOEA 1TJ1A 3E96A 4HMCA 3AYSA 2OSWA 1RP9A 3GTXA 1XIDA 2J78A 4X61A 2OO0A 1N8IA 1XUZA 2PRHA 5K2ZA 4U5KA 4LVDA 4K2SA 3L23A 1GPWA 3FAWA 3G0SA 1DP0A 1H7RA 3UXAA 3S46A 3BK0A 3WBAA 4JCLA 4F0KA 4J3ZA 3GKFA 1MWOA 1OX4B 1QJWA 1NFBA 1EJUC 2Y8VA 3INPA 3ITXA 4IMFA 8XIMA 4MFDA 1ECEA 3SN4A 1NF0A 2OSXA 2J7HA 1XFCA 3TQPA 1W0MA 1CLVA 2VR2A 3I68A 4ZO7A 5D33A 2DU2A 4LBUA 4LB3A 4Q3MA 1JCMP 4GNVA 1PE1A 3VMOA 2QPUA 2V9DA 2GVGA 3L9CA 4YNGA 4JFWA 3P81A 4HTBA 3NO5A 1HNYA 3WFLA 1Q5MA 4PRRA 4GWEA 1DJHA 1KC7A 1G6CA 4FX6M 1AD4A 3QY8A 4V28A 3MUXA 4E6MA 4F0SA 3GSMA 3LTPA 2CZVA 1OZMA 1ZBCA 2D2OA 3FKRA 5A6JA 2VGIA 3STGA 3W1AA