4OQVA

High resolution crystal structure of human dihydroorotate dehydrogenase bound with dsm338 (n-[3,5-difluoro-4-(trifluoromethyl)phenyl]-5-methyl-2-(trifluoromethyl)[1,2,4]triazolo[1,5-a]pyrimidin-7-amine)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
353
Chain Sequence
DERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Fluorine Modulates Species Selectivity in the Triazolopyrimidine Class of Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 139
structure length 353
sequence length 362
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4oqvA00
3CWOX 2ZZ3A 1W5OA 4JXCA 2ATSA 3LHUA 3TV8A 1SFJA 2CLMA 4WX2A 3W9ZA 5F4SA 4LRSA 1KV5A 4D2JA 5D02A 3EX4A 4DELA 1TV7A 1LCOA 1SW7A 2QUVA 1BWKA 2X16A 5HUPA 1BKSA 1K7FA 1W31A 4JD4A 2A1YA 3NPWA 3O06A 4ZMGA 2NUXA 2YDAA 2CZ5A 3QYQA 4PEKA 1FWRA 3SECA 4PH6A 2OJPA 1ICQA 4N9BA 4E0CA 3TKFA 5DY2A 1QPOA 3PBWA 4G1KA 1OVDA 4DF1A 1FWNA 1WOBA 3DFPA 3A5FA 4CQ9A 4UTJA 3C8FA 1RQBA 1PL9A 1A53A 2QCFA 2V2DA 3DFQA 2JKAA 4AF0B 4O19A 3C2RA 1KM1A 4A22A 2JKPA 1EB3A 2TSYA 4N4PA 1H7OA 3I7RA 1IGSA 1T8XA 3PY2A 3PBVA 3W7OA 1OFPA 2X1SA 3STGA 3DAQA 4NNCA 4XZ9A 2Y85A 3EX2A 1OK6A 2VFEA 1TPVA 2A7PA 2ZBTA 4M5PA 5HQEA 1YDVA 1DV7A 1XUZA 4N4QA 4UTTA 2RDTA 1VRDA 1W37A 5GVJA 5E1QA 1S3HA 3NL2A 4JTIA 3W75A 1H7NA 1GOXA 2V81A 3MP4A 1TTIA 3BLIA 1XC4A 3MHFA 3PWAA 4XBKA 3LHZA 4NX0A 1IXQA 4UMBA 3O07A 4AMAA 6ALDA 1L6SA 5LNVA 1VPXA 1Y0EA 1SO3A 3DKLA 3M5VA 2DP3A 3HF3A 1V5XA 4IWWA 4FIRA 1I2PA 3HPZA 5DCBA 2IQTA 1B4EA 3R2GA 2Z1BA 4UTLA 4O17A 3B0PA 3EB2A 4LV4A 3W1LA 4NUWA 4O52A 3PULA 4LNYA 4ORIA 2A85A 3M41A 4GBUA 2FJKA 1V7YA 4JTHA 3UPBA 1TREA 1EWDA 1ME7A 3FOKA 1B9BA 4HPXA 1VYRA 3BW4A 4NJHA 4GFSA 2AAMA 2QF7A 3HG4A 4WQ6A 5KZEA 1HG3A 3CU2A 2FIQA 3TXVA 5I3IA 3PVFA 3UWYA 1OF8A 1JCLA 1W5QA 3N14A 3NQVA 2B7OA 1DVJA 1FDYA 3HB9A 4LU0A 3BO9A 3TCEA 1GG0A 2E6YA 3FEMA 1H60A 1BTMA 3NDOA 2QUTA 4Q32A 4W9TA 1KFEA 3TU9A 1ICPA 1WXJA 3TDFA 4DBDA 4BK9A 1QOPA 2GQ9A 5D2VA 1G4EA 3NZ1A 3K30A 1LOSA 3O6DA 4JS3A 4FX7A 1GPWA 4ADUA 2Z2UA 4N9CA 2A7RA 3W1AA 1QPNA 3QFEA 2P1FA 4CNPA 4MY1A 5C5YA 1UCWA 1A5BA 3L21A 3FS2A 3G1YA 3L5AA 3W2JA 1P0NA 2NWSA 4LS1A 1PS9A 1DJQA 2DZPA 4DQWA 1S5WA 4FHAA 3IIZA 2ABBA 5FEZA 1A5SA 3TSBA 4BI7A 1OYAA 3HMJG 5D04C 4O15A 3G8RA 5D30A 1YXCA 2VC6A 3V75A 4JEQA 4O50A 4WY0B 2Q3OA 1B4KA 4K36A 1KA9F 4YLWA 1JRBA 2W6RA 2VELA 1GJPA 5D2YA 3W2KA 1U83A 4JYEA 4ONVA 1TPDA 1RQHA 1JULA 3LBMA 3W7KA 1JRCA 1TTQA 5E0KA 4BI5A 2NUWA 3W71A 3ZR4A 1VYPX 4LT9A 4LY8A 3KXQA 3C2OA 4TX9A 1RZMA 3OA3A 5EKYA 4B5NA 3CTLA 2QDHA 3NQCA 2NWRA 3BG5A 3PG9A 4FF7A 4XTDA 1L9WA 1KLZA 4PA8A 4GUJA 3W88A 3W1QA 3F4NA 4M6VA 3W7MA 3DFOA 4UMCA 2V9DA 2TMDA 1I4NA 2TPSA 3OVRA 5AC7A 3LXBA 1JCMP 5LGZA 1VZWA 4LVAA 3A9IA 2FQIA 1RVGA 5A8GA 1OABA 2H8XA 1HUVA 2VEMA 2CFFA 4MFDA 4LUIA 3SGZA 2BSLA 2Q3RA 3N34A 3QEZA 3A22A 4BR1A 3KAOA 3BGGA 3TC6A 2OT1A 1DKWA 1TTJA 5CPLA 4Z0JA 4Z1BA 4OU1A 1G69A 3DFSA 3NNTA 3PB2A 3PF3A 3W2UA 1F5ZA 1P4CA 4IGHA 2A0NA 2ZZ2A 1K8XA 4UUIA 4UTKA 5EMUA 4MKNA 1I2NA 5LNSA 1OJXA 4ZQPA 3UWVA 2FLIA 1XDLA 3W07A 2X1TA 2NUYA 3IRDA 2W79A 2XFWA 1W1ZA 5AYZA 2YCEA 2YW3A 3TW6A 3NAVA 3GK0A 1FX6A 3WFAA 1F6PA 5T26A 3CT7A 2NX9A 1FDZA 4HHPA 1IXNA 5F4WA 4L4LA 1CW2A 1SUXA 4EWND 3QSRA 3STCA 1KFCA 4JTUA 3M44A 3FA5A 2D73A 3D0CA 1WYIA 3EX1A 4AWUA 4RCXA 1GT8A 4NJIA 4UFIA 5L6UA 5G4EA 2V0TA 2E6DA 3MYOA 5FF0A 2QCEA 2OMAA 2NV1A 4JTFA 1BWLA 4M7TA 5DBTA 3RFAA 1XFBA 4FXSA 1G4TA 2BZNA 3O6YX 3PUEA 1ZAIA 4O11A 4JGDA 2C19A 1SO5A 3UD6A 4TR9A 3OHIA 1YTEA 1ZENA 3W2MA 5K3VA 4UTWA 2PE4A 4WJEA 2A6LA 4UTTC 2Q8ZA 4AEOA 5FF2A 5IBXA 3A21A 3NEVA 4K7YA 4O12A 4C1LA 3P84A 1HL2A 1GQNA 2DZTA 4PODA 2C6QA 1OX6A 2F7FA 3NQFA 4XKYB 3QH2A 1DOSA 4FNRA 3UWWA 3C2VA 1H62A 3W1XA 3ZS4A 2BXVA 4RZ6A 4KKXA 4GJ1A 2KZHA 2QCHA 3WK2A 1O60A 3OBKA 5HJLA 3LI0A 4MLJA 3GKFA 2E1DA 1RV8A 1ALDA 1KM5A 1H50A 4RKAA 3PSVA 2RDUA 2Y7DA 3PB0A 1JJKA 4DO5A 4AWTA 2WKJA 2J6XA 2QJGA 3F4WA 1LZOA 1KLYA 3LDVA 3N9SA 1HFBA 3QZEA 2VEIA 1TPUA 2X30A 3P5YA 2GPTA 1EX5A 2G95A 4XTIA 5CGQA 5FI8A 1XBYA 3PR2A 3SZ8A 1VS1A 3QPZA 1TIMA 2QDGA 1O4UA 5HNRA 3DU0A 4HNNA 5TIMA 2QCNA 2GUUA 1TQXA 2YGYA 1QPRA 5MHBA 3W7RA 2VFIA 3W74A 3MI2A 4WD0A 4K37A 3QW3A 4CCDA 2R94A 4NJJA 4OGZA 1L6YA 3CHVA 1NFBA 4WXYA 3GR8A 1RR2A 4KWVA 4Z1AA 3LCFA 2ZA3A 1LRNA 4E2DA 4BFAA 1EP1A 3W70A 4ADSA 1F73A 3C52A 3PG8A 1Q6LA 4CNOA 4O8RA 5EBUA 1SFLA 1QR7A 4M6QA 2OCZA 3WJWA 1XDMA 3G22A 3HOJA 2EKCA 3GDTA 1OFDA 3GDKA 4JDYA 3R89A 4ZZ9A 4N9DA 2QCLA 1LBLA 2V2CA 2EF9A 2GQ8A 4UTHA 3W7JA 3CIXA 4NXKA 1ZJIA 3N2XA 2ZA1A 4IXHA 1EA0A 3C6CA 4JX6A 1O5KA 4JX5A 3BW3A 3S6DA 2H90A 3TX9A 1XI3A 3T78A 2CU0A 5C55A 2EHHA 3FJ6A 3LB0A 4M7SA 3MP5A 2O7QA 3ZWTA 1R2TA 5LHEA 2AQWA 2RFGA 1R30A 3B04A 1CI1A 5LZLA 4X3ZA 1D3GA 1C29A 3TA6A 1D9EA 3G0XA 1LTDA 3NPVA 2X1UA 4KFPA 5BNKA 3E0IA 4AF0A 3RMJA 1R47A 4N9EA 1FY6A 3P8JA 4WY0F 2ISWA 4O13A 5KZMA 3W76A 4ORMA 1TQJA 1F76A 3G24A 3PUOA 1ME8A 1K03A 4Z08A 3B03A 3HQ1A 4AVFA 5LSMA 3ABQA 1FCUA 1GVSA 2X1RA 3DENA 4A3UA 3LGEA 4A2RA 3W7EA 4S1FA 4NVTA 1ZALA 3NQDA 3MWAA 3NL3A 4FNQA 1AK5A 2QAFA 3GNNA 3S1XA 1JCNA 3NQ7A 4YXGA 3LCXA 3S42A 2A5HA 3N9RA 1FCVA 2R14A 3IGXA 1LROA 4K38A 2Y61A 3S5NA 4X2RA 1PVNA 4I7WA 4U4MA 5CSRA 5CPNA 1OHLA 3W7PA 5HMSA 1TPEA 5FF3A 5KITA 1FXPA 3P74A 3HG3A 2E5DA 3JRKA 4EIVA 2QCDB 1MZHA 1X8FA 2WPBA 3NG3A 3TROA 1DJNA 3W7QA 3S9YA 1EIXA 1T99A 1TRDA 2Y62A 5BMXA 3W85A 1FCBA 1W56A 3EWBX 5TQLA 3TXZA 4QNEA 3TJXA 4FX6M 1ZY9A 4R33A 4JN6A 4O28A 5DXXA 1NAL1 3NQ6A 3P7YA 4JTTA 3DHFA 2B7QA 1GTHA 2VXNA 2GVGA 1N55A 3R8RA 3HJZA 3NVTA 4UTWC 3OVQA 5KMYA 1VLIA 4RV8A 2V2HA 2ZZ7A 2FDSA 1SSGA 4OWGA 3GX9A 2DZSA 5IBXC 1QDSA 2QJHA 2YFNA 5FEWA 3DBPA 3BG9A 5E93A 3GIYA 3W87A 2V82A 3T4CA 4ZL1A 1SSDA 1Z44A 4GUGA 3SGUA 2WNQA 5H91A 2QJIA 2E68A 2Y89A 3W2NA 5D05A 1QMLA 3P80A 3TH6A 5D32A 2P0OA 3G3DA 4PL1A 5C54A 1ZAJA 3SI9A 4JICA 4OBTA 2A4AA 2ZRWA 4UC5A 5BRBA 1TJRA 4IOTA 4ZQRA 2DORA 4N02A 1EUNA 1EWEA 4M19A 4OQVA 4CNNA 1OFQA 4K7VA 4HNUA 3G1DA 3WK1A 3IVSA 3W1PA 3TE9A 3W7DA 3E12A 4HIBA 2NLIA 1KM6A 3I65A 4IXXA 5AYYA 5AHMA 3M43A 2J9ZA 4UNLA 3W2LA 4WY0A 1QPQA 2YZRA 3WK3A 4HNVA 3GXNA 1PHWA 1NEYA 3NQMA 4DF0A 1OX4B 3EX3A 5C2XA 2NV2A 3F1QA 4XUGA 1PHQA 1SZEA 4DO4A 3U8GA 2BX7A 1YLVA 1YXDA 2GJNA 3G0UA 4RR4A 1W5MA 3NM3A 3QC3A 3QMSA 3LHYA 2YSWA 3P81A 1AG1O 4UIOA 5EA9A 3TQKA 3EWYA 2VFDA 2NX1A 4MYXA 5G4WA 1SU5A 2CZDA 2GJLA 2Y70A 4A2SA 1VLWA 3CIWA 3O05A 3P8IA 4DO6A 1TV8A 3KVMA 3TQVA 5F1VA 1G6CA 3NQAA 3BPWA 5HUOA 1YTDA 4QITA 3G1SA 1PIIA 4UFJA 3HBLA 4GUIA 3QQ1A 4AHOA 1AL7A 3HPXA 5ABTA 2ZRYA 3M16A 2VFFA 3A23A 4O0ZA 1GVFA 3LTSA 1IIGA 2HTMA 1OF6A 3LXCA 2WO5A 3V1PA 4ZVJA 3QMTA 1EEPA 1KM0A 3IEBA 1QAPA 3MW7A 3RLVA 1JVNA 3PS7A 3N73A 1HO4A 1KTBA 1VQTA 1G7UA 3GLCA 4JY9A 3W1RA 5I3GA 3CC1A 5D2WA 3KFTA 5K9DA 1C8VA 1TPC1 2VEPA 3BLFA 3GAYA 4GNJA 1XBZA 4C1KA 3VCRA 3TW7A 3NA8A 1THFD 2NXIA 3GVGA 2O7SA 1WX0A 1J2WA 1G4PA 4FNPA 5K2ZA 1GVRA 4LVDA 2DZWA 4H6KA 2ZRXA 5HR6A 3KHJA 3TR2A 4UMAA 3FYOA 4AHQA 3S0CA 3G8EA 1YADA 1XUUA 1LYXA 3P61A 2E09A 2ZA2A 1OFEA 3R12A 4ZQOA 4FB7A 4JR5A 3T40A 1MXSA 2PRLA 3UXAA 2C14A 2YYUA 3HGRA 8TIMA 2I14A 3P5ZA 4JNMA 1TB3A 4TMBA 1ZNNA 3U6WA 5I3FA 4DF2A 2DJXA 3GYEA 3BV4A 4LVGA 3E96A 1ME9A 1JQVA 3UWQA 4CQ8A 1SR9A 4MFEA 1O95A 3EKZA 1S5VA 4JTEA 4JTKA 3FFSA 5BMWA 3H54A 4UFHA 1F6KA 4RXGA 1JUEA 4EOUA 3OVPA 5G1YA 2AGKA 1CX9A 1K3UA 1W5PA 1IF2A 3P67A 2JGYA 4OT7A 4JTSA 2YR1A 3UZJA 3Q94A 3HO8A 3EXSA 4FXRA 1LOQA 4U28A 4ZQNA 6TIMA 5FESA 4I9AA 3TAKA 4IUOA 3AO0A 3KVJA 3VNDA 4AXKA 3TSDA 4MUZA 5G5IA 3KX6A 4QJ1A 2QUUA 2ZTJA 4LWWA 1MO0A 1L6WA 2C16A 4IMCA 2XN0A 1DHPA 4PFMA 3TFXA 3G18A 4R34A 2E5BA 3WJXA 1I45A 5K4XA 3TSMA 4YCPA 4Z0SA 2LLEA 3C4UA 1JCYA 3ABRA 1F74A 2JK2A 2P10A 4Z1DA 2Y7GA 3G3MA 5CZTA 4NZJA 1NF0A 3HPSA 1KBIA 1Q6OA 2WQPA 1G67A 2ZDRA 4QISA 1FWSA 5F4XA 1Z41A 3THQA 2QKFA 4N6EA 4LTSA 3ATYA 1P1XA 2I9EA 3G1HA 2A6NA 3LCIA 2FFCA 2ISVA 3LCLA 3N3MA 1LDCA 2HMCA 2NXHA 2XN2A 3ABOA 1NSJA 3QJAA 1RPXA 4OE7A 1FDJA 4M6PA 3BG3A 1YTKA 4LC8A 3W3OA 4O54A 3JR2A 2RDWA 2G96A 5HWNA 5K4ZA 1P5BA 4O1BA 4TO8A 5G1TA 3SR7A 1GG1A 4AH7A 1UASA 3G1AA 3S5OA 4K8HA 3RK8A 1Q6QA 2A2IA 1LRQA 1B3OA 4HSOA 4NNAA 4FX8A 4UTIA 1T96A 1KFLA 3PBUA 3SSJA 3W7GA 4LC6A 3IVUA 2WSQA 5FEPA 2FB2A 1SZNA 1VHCA 1GTEA 2Y63A 2J9XA 1H7PA 1SQ7A 3GZ3A 2Y7FA 3B8DA 5U7SA 2PRHA 2PURA 2C18A 1EUAA 2FPTA 3HGOA 1IIHA 3QPYA 1X7FA 4UFMA 3WJZA 1WBHA 2Z0IA 3U2OA 3GNDA 1I2QA 5F2IA 4NQ1A 5CPOA 3G1XA 1YXYA 3CM4A 2NX3A 5AHIA 4O14A 2NXGA 4LV9A 2H3DA 4GUFA 2OZ0A 4HNTA 4WUIA 5DN1A 5DELA 4CCCA 4NJKA 3GR7A 4A21A 1SPQA 5F2LA 1JQXA 1WAUA 1K7XA 2ZZ1A 3LTYA 2CLHA 3EWWA 1F05A 4NU7A 3Q2DA 3NQ2A 1OK4A 4KWWA 4MLRA 4NX5A 4S2CA 1ONRA 1KFKA 2OT0A 5EL1A 3DFNA 1TYGA 5F2MA 4RZ5A 3NPUA 2R91A 4OHQA 5D33A 1FBAA 5FF4A 1TCDA 2G5WA 2VOMA 4Y9AA 1E51A 1F2JA 3LOTA 3CWNA 2CLIA 1PV8A 5DLCA 1P0KA 4AWSA 1QNVA 5IM51 4NXSA 3W1TA 3O15A 1DBTA 1R2RA 2ZCGA 1WBJA 1O94A 4K6AA 1FUYA 2CLEA 4BF9A 3I68A 1U5JA 3C2FA 3W1NA 3MI3A 2WSYA 3S1VA 3DI1A 1Q3NA 2BTMA 4MJZA 3RU6A 1G7VA 3HIJA 3TFCA 4OV9A 5LGXA 3BGJA 3M47A 5D37A 1VC4A 1J4EA 1KTNA 4ZQCA 2V5BA 5AHFA 4JX4A 2PC4A 4HN4A 4TMCA 3RLUA 2B0MA 1ML1A 3LRMA 3STEA 3LV6A 2WSRA 3EEGA 3W7CA 2E77A 1RQEA 4Y8FA 2J24A 3L68A 3Q58A 4IMDA 3AJXA 3YPIA 1QCWA 3NXFA 1XCFA 4O57A 3O63A 4JYFA 1FWTA 1JR1A 3WJYA 5J5DA 2ZRZA 3W84A 2RH9A 4NNBA 3W1MA 3KVLA 2ZQ0A 5L9FA 3FLUA 1HTIA 2C3ZA 1QFEA 3P60A 5LHFA 4H3DA 2B4GA 4LVBA 4DPQA 1W5NA 4O1AA 3TJLA 4ZQMA 3IV3A 1MEIA 2DJLA 4GUHA 2G97A 3PC0A 3L5MA 1KTCA 5HWMA 1XL9A 2H6RA 2QCDA 3IGUA 2CLOA 2CLFA 3NL6A 3LX9A 1T0OA 3KRZA 1O5XA 2RHGA 2YX0A 3GDLA 4DBEA 3C0JA 5EY5A 4FO4A 3W7IA 5D38A 4FNTA 4GC4A 2J9YA 4HPJA 5LNWA 4IPJA 5F1UA 1H7RA 2I1OA 2CLKA 2WNZA 1PE1A 2Z6IA 3BVJA 3QMRA 2WV8A 3RF9A 1JCJA 4AHPA 1LBFA 4QIUA 4UR8A 4R7JA 4TIMA 3E02A 2ABAA 1J5TA 3DKJA 1OX5A 2H8ZA 3S5ZA 1WOAA 4EF9A 3HG5A 2VENA 3T44A 2E6AA 1LM1A 5D2TA 1I2OA 1TMHA 2HS6A 1OG0A 1TV5A 4O0KA 2HS8A 1XM3A 1TTPA 1UB3A 2ZTKA 2Y6ZA 3W73A 1GYNA 4ML9A 3W83A 5LKYA 3SFKA 1H61A 2EPHA 4MZYA 5D2XA 2CWNA 2ALDA 3GXPA 3W7HA 1IXPA 5I3JA 3G0SA 2QCGA 1GVQA 1I8JA 3M6YA 1AW2A 1TRIA 3NQGA 1GWJA 1WV2A 1A50A 3QRHA 4QAIA 4YMZA 3DXIA 1TPH1 1LLWA 5FEXA 4JIPA 1FCQA 4YCOA 4YL2A 2EGZA 3CB8A 5SWUA 3S1UA 4S2BA 3LCWA 2WOQA 3L66A 1LOLA 3W7NA 3M7WA 5K9XA 3TIMA 1SO6A 4BWLA 1OX4A 5CZJA 4PCFA 3NPXA 3O6CA 3EXRA 3NQEA 4TU1A 3RNDA 4O18A 2ZZ4A 1SO4A 2WNNA 3P82A 4K8EA 4O4VA 3HGJA 3GB6A 4JY8A 1K7EA 3LCGA 3EWZA 4QM1A 4BI6A 4PTNA 4LW7A 1Q45A 2ATMA 2EAWA 3EWUA 5G2HA 3FKKA 3IVTA 3L0NA 4O4WA 3MO7A 4OV4A 3TMLA 2Q8LA 3O1NA 4I7UA 3S5YA 5EPDA 2FTPA 3PSWA 1BEUA 1FWWA 1GYLA 2J27A 3L9CA 3DHDA 1OFOA 3IIXA 1M7OA 3A24A 3W22A 4P61A 4WOQA 3QM3A 4O1DA 1GVOA 1L2UA 4JYDA 1AMKA 3TQ0A 4GXMA 4MYAA 3OG3A 4WZHA 1JUKA 3C61A 2YXGA 2PCQA 3KVKA 3DZ1A 1HO1A 3NOEA 1ZCOA 1DORA 2CZEA 1KFBA 1VCFA 3IIOA 1ZAHA 3E49A 1KV8A 3ABSA 2GOUA 4PL2A 3PAJA 2QEZA 4HSNA 2Z6JA 3TNOA 2V8ZA 1AL8A 5AC6A 2QAPA 1A5CA 1LBMA 5HWJA 4UNKA 5AHNA 4IMGA 1XXXA 2JBMA 4LUJA 3W23A 2CZFA 3N19B 3FIGA 5CZ0A 1N8FA 1X1ZA 1TPWA 3UY8A 3B0UX 1KM4A 4YWIA 3W86A 3UY7A 2V30A 1WQ5A 1EP3A 1H7WA 3VE7A 4N2YA 3CEPA 3I7QA 1MSSA 2NZLA 3NL5A 3QF0A 1ADOA 3UWZA 3G1VA 1M5WA 4ALDA 1PCWA 3LI1A 1KFJA 3A5VA 4L4MA 2X2GA 4HT3A 3STFA 3ELFA 4MY9A 5D03A 1H7XA 1SZGA 3LCHA 5HULA 4GWEA 4J9JA 4JDBA 1N7KA 4FIQA 4IX0A 4MIMA 4RJEA 5K7JA 5TBOA 5AOUA 4RXFA 1DQXA 5KZDA 2DZVA 3BARA 4KFOA 1ZFJA 4HKPA 1ICSA 3TMQA 3C3NA 1UBSA 4RLIA 2W0UA 2JKEA 1R2SA 2FPVA 3IIPA 2BLEA 1X1OA 3LM7A 3I6RA 3QQ0A 4ADTA 3IIVA 1XBXA 2C0AA 3MBFA 3S1WA 4ICNA 1Z42A 3EXTA 4X22A 3UPWA 2C15A 1TPB1 1TPFA 2FPYA 3MP3A 4IMFA 4A29A 1YYAA 1UJPA 3VFLA 3PBYA 1K02A 3M5ZA 2PRMA 2FB3A 1B57A 1ZHAA 3ZFHA 3UZ5A 2A21A 4JTGA 4DEFA 5AFDA 4UTMA 5LNUA 4XWUA 1XBVA 3LERA 3LV5A 1K8ZA 3IGSA 2Y7EA 1SW0A 1OFBA 2YFOA 3EWXA 2HSAA 3M5XA 5HINA 4GRSA 2H3BA 3GDRA 5KTLA 1KM3A 3FYPA 3QW4B 3USBA 3C56A 2ZZ5A 1JUBA 5CZSA 3Q37A 4E38A 4MVAA 2ISSA 4DPPA 7TIMA 3N2MA 1KM2A 4NZFA 3B4UA 3DFTA 1VH7A 3R5EA 1WA3A 1JCXA 3P62A 1YDOA 1YPIA 5DCDA 1I2RA 1OYCA 4O10A 2QCCA 3L2IA 1R46A 5I3HA 3LHWA 1YDNA 3TUUA 4XQ6A 5FF7A 3LHVA 3PUDA 3GXTA 4O53A 4Y6GA 1A5AA 3LXAA 1XKYA 1KBJA 3VI2A 4MZ1A 4AB4A 3DH7A 1W54A 1VCGA 2J88A 1IXOA 3FKRA 3MHGA 3O16A 1VCVA 5U4NA 4XKYA 4EF8A 4UFLA 4I7VA 3S8HA 1NVMA 1MEWA 2E6FA 3M5YA 2E5CA 5DXYA 3LRLA 4PC8A 3M1ZA 4EVZA 1DQWA 1WDWA 4H4IA 3SW6A 3TAOA 4O1CA 4GE8A 4N6FA 5CPMA 3GKAA 3THAA 1H1YA 5BOOA 3QSTA 5AHEA 3L65A 1UUMA 3VE9A 2A7NA 3B06A 1OFRA 1FQ0A 1Q6RA 4JIQA 5G2WA 3M9YA 3B05A 5CKSA 3L5LA 1UUOA 2GVLA 1QWGA 4FEZA 4AAJA 1AW5A 4POCA 1M7PA 4BWLC 4MJMA 2DZXA 3WJSA 2GQAA 2RKXA 3T55A 1YPFA 5CG7A 3CEUA 1PCKA 4LS0A 5H2ZA 3W7LA 2XN1A 5I3KA 2TRSA 3CPRA 3B0VC 3SJ3A 3NR0A 1H5YA 1SZFA 2GVJA 1VYSX 1OFAA 4IQLA 3E9AA 4NT0A 1Z48A 2VFHA 3OIXA 3TC7A 1S5TA 5AN7A 4Q4KA 3DI0A 1QOQA 4CCEA 4UR7A 4MZ8A 5KSWA 4CQAA 1DL3A 5AHLA 5DBUA 3UQNA 1W3IA 3NQ8A 3EX6A 3GDMA 3KRUA 3LTPA 3KOFA 4LOCA 3OEXA 3MI6A 5AB3A 5F2GA 4WOZA 3SY5A 4QSHA 2ZFAA 5KINA 3INPA 1W3NA 3ATZA 3UXDA 4RZ4A 2VFGA 1EPXA 4P2VA 5G2IA 3UWUA 5LNRA 3CLMA 4DXVA 4UCGA 1OYBA 5A5WA 1C9DA 2ZZ6A 3L0GA 3T7VA 4MPQA 1G4SA 4LVFA 2VEKA 1GEQA 3LBCA 2ZRVA 3CQ0A 1MEHA 3UNDA 1SW3A 4LRTA 5EYWA 3W1UA 2TYSA 1X6UA 4IMEA 3DGRA 3BW2A 5AYXA 1W8SA 2Y88A 5BW6A 3C2EA 3BLEA 3L67A 1LORA 2DZUA 3H55A 2F84A 3FJLA 2B7PA 2JGQA 4RK8A 3MYPA 1VJIA 5HR7A 2R8WA 2CW6A 4R53A 5DCEA 1W3TA 2C13A 3MHUA 3NM1A 4MY8A 3NZRA 1VR6A 3WK0A 1VHNA 2OX1A 3HGSA 3H53A 5CSSA 1TJPA 3GAKA 4IPIA 4Q33A 1FXQA 4QNWA 3M0ZA 4RX0A 3LLDA 1W0MA 4K39A 4LS2A 3EKLA 3KRSA 1RD5A 3PM6A 2ZYFA 3R13A 3LRKA 4E2BA 3LLFA 1NF7A 3NO5A 1TSIA 3G1FA 3W6YA 4Y96A 2ZRUA 2QR6A 3BK0A 1M6JA 3ZWSA 2YW4A 5K9CA 4FNSA 2VKZG 4MOZA 4WXZA 3LHTA 2YYTA 1EP2A 1KW1A 4X9SA 1D3HA 1H51A 4KFNA 3MJYA 1AW1A 1QO2A 3I7SA 3HG2A 4NJGA 3SIZA 4IJBA 3W72A 1H1ZA 1LRTA 4FNUA 4UXDA 5C6MA 4QQ3A 4Z1CA 3MBDA 3O8AA 4XBSA 3TK7A 3NGJA 4Y90A 1H63A 1LLZA 4JTJA 2C1HA 3L0KA 1VGAA 2V5LA 1QO5A 4UFKA 5DY3A 3VKJA 2YPIA 5AC8A 1TO3A 3JS3A 2B7NA 4CLMA 1LP6A 5J5RA 2BWGA 2CLLA 4IX2A 2QCMA 1GZGA 3NYZA 5D09A 1F7BA 4UTUA 2DU2A 4O16A 3UYCA 4JTLA 3MUXA 2WJZA 3F03K 2UV8G 3MMTA 3ANYA 1K8YA
chains in the Genus database with same CATH superfamily
3CWOX 5GPRA 3AYSA 3LHUA 4UWMA 1SFJA 3GU2A 4B15A 4E5TA 2OEKA 4LRSA 4UOJA 4JHZA 3GVQA 1TV7A 1IQ8A 1K7FA 2FGBA 2A1YA 3NPWA 3RM4A 3QYQA 4DAFA 1FWRA 2VEFA 4LB4A 3GUWA 4LX4A 3V0UA 4QXIA 3T08A 3N04A 4GIEA 5DY2A 1JAKA 1OVDA 4PRWA 4CQ9A 1RQBA 1JYVA 1A53A 2V5DA 2QCFA 2V2DA 4IM4A 4GI6A 4H9XA 4IIDA 2R1NA 4PUMA 2JKPA 3VX1A 1E5NA 1C91A 4YN5A 3U2CA 2XISA 4N4PA 2C71A 1J0HA 1T8XA 2GUYA 1UC4A 4JNZA 1CB2A 2XM1A 4DUOA 2BV9A 4XZ9A 4NYUA 1HKVA 3EX2A 2VFEA 2VZSA 4NZ1A 2A7PA 5RUBA 2VCBA 4N4QA 4UTTA 2VR2A 5GVJA 4GFIA 2GZXA 2G4JA 3MP4A 1ZBWA 3MHFA 3LHZA 4P8VA 3GH7A 4EXAA 4NX0A 5AC4A 3TA9A 4ATLA 4UMBA 6ALDA 5LNVA 1X96A 3V35A 3B9OA 1I2PA 3TN3A 2IPWA 4NAEB 3WH7A 1WKFA 2BGNE 1S2TA 3UZZA 3R2GA 5A8PA 3B40A 4UTLA 5CC5A 2UY2A 4U33A 4ZENA 4NUWA 4O52A 2BXYA 4JFSA 4WIWA 1WZAA 1XLEA 4GBUA 4D6JA 1F4HA 1ZLPA 1UW9A 3FOKA 1YDYA 3ARXA 3V36A 3FHAA 4OOUA 5ABFB 1ZTVA 4IHCA 3CU2A 2XIIA 5I3IA 4AD5A 1OF8A 2B7OA 4Q8PA 4GCXA 1H60A 2GSJA 1BTMA 3WN6A 2Y2WA 4LUTB 3U4FA 4E8DA 1E6XM 2W92A 3V0SA 1ICPA 4I5RA 4RE2A 1WXJA 3TDFA 1UH2A 4DBDA 1QOPA 2GQ9A 4L5ZA 3O6DA 1LOSA 4WSHA 1GPWA 2JE8A 3I4KA 4ADUA 1LQ2A 5M5DA 4IFRA 2DVXA 1QPNA 4DBSA 3QFEA 2P1FA 4CNPA 4JPGA 1QPKA 3UF9A 2WC7A 4C6DA 5C5YA 1KBBA 4KEVA 2X7VA 1WDRA 3L5AA 1OD8A 2O9OA 2NWSA 3BANA 4KRTA 1S5WA 3SRHA 1DWIM 2J78A 2IS7A 5FACA 1QI0A 3IJ7A 1A5SA 2PLCA 4J2MA 3N15A 2FJUB 4US5A 3MV11 4XAGA 1VFLA 2Q3OA 4K36A 2DVUA 2DZBA 1RAKA 4S3KA 1GJPA 1TPDA 2C0HA 2Y5EA 1OD0A 1JRCA 4BI5A 4C6CA 4IT1A 3CQHA 3C2OA 4TX9A 3OA3A 4ATWA 1XSJA 5CSUA 4CKQA 3VO0A 3W01A 1VFOA 3NQCA 2NWRA 3IV8A 1DIDA 3SEPA 2YB4A 4BF5A 1G9HA 2SFPA 2A3CA 2OX4A 3U7BA 3GSMA 3DFHA 2QMJA 3DFYA 4X0NA 4UMCA 2TPSA 3K2GA 1DJIA 2ALRA 5CBJA 1W17A 1AVAA 1JCMP 2QUMA 3SUTA 1HQTA 1B90A 3A9IA 2VDIA 5A8GA 3PZIA 2H8XA 1HUVA 4LUIA 4EK7A 3SGZA 7PTDA 3KTXA 3KAOA 2OT1A 1DKWA 3DFSA 1AODA 3PF3A 2DDXA 4HK5A 3F2DA 1PKLA 4WF7A 4UTKA 3HFYA 1I2NA 2DSVA 4REQB 4ZQPA 3WEOA 3ABZA 2NUYA 3ALGA 2ZDSA 3W38A 3SQMA 4JOMA 1W1ZA 3NAVA 4IISA 2F8QA 5B7ZA 2Q09A 4L4LA 4I9JA 3QSRA 3STCA 2ANUA 3N4EA 3MO4A 3EX1A 2ADAA 2CBIA 2XGBA 4UQDA 2NVDA 5G4EA 5T91A 4JL1A 3W25A 3WQGA 4AD3A 2PWVA 2NV1A 4JTFA 1XYAA 5DBTA 3RFAA 3C8NA 2OO6A 4X63A 3PFMA 5FD0A 2QVNA 1D8WA 2I17A 3PK7A 3UD6A 2PWUA 3BDKA 1AD1A 1HIZA 1O1ZA 5JXQA 4WJEA 3AXHA 2Q8ZA 1QHOA 4AEOA 5FF2A 5IBXA 4A8RA 3NOYA 5HJYA 1PYFA 1GQNA 3FSTA 4PODA 3EA1A 3GFXA 3QH2A 1DOSA 4DWSC 1BYCA 2QYGA 3W1XA 2PDIA 1XG3A 1OZMA 3E0VA 2KZHA 5CPTA 1BG9A 4D8ZA 5HJLA 3CNYA 2DUZA 4QDWA 1ALDA 1QNRA 2NSOA 2G37A 4DO5A 3S4TA 1FHUA 5DMLA 5FIPA 3VZZA 3AMKA 2WVSA 1T8QA 3URBA 4M8UA 3WL1A 3DUGA 3W27A 2P5NA 2YA1A 4M51A 2GPTA 1EX5A 2C1IA 4Q7IA 1KGWA 5CGQA 3CYJA 3AS0A 1X6NA 3T4WA 5C9UA 1R85A 3CV2A 1UMLA 5E5CA 3CV7A 3QV9A 3LQLA 3DU0A 5TIMA 3H70A 4QQUA 3W7RA 2VFIA 3MI2A 3BV7A 2O4MA 3K13A 3SCVA 1GOMA 1GVYA 2HQAA 3C2YA 1J12A 1UYQA 1GYMA 2PDMA 1ONEA 2PC8A 4HN8A 4E2DA 1OSEA 2EO7A 2GJRA 3VNMA 1GNXA 4CNOA 5DQPA 5EBUA 3KBJA 1TMQA 3RX2A 3WKZA 4M6QA 3OLIA 2HROA 2EKCA 3GDTA 1LL7A 4LUSB 3IS4A 4JFUA 3GDKA 2Y8VA 2V2CA 3RM8A 4UTHA 3ENLA 1DWFM 3W7JA 4H6EA 1T41A 2DVTA 3N2XA 2D3LA 3MCOA 3BC9A 1ZRQA 4JX5A 4H9MA 1XI3A 2EKGA 4M7SA 1Q4NX 1GOKA 2O7QA 5LHEA 2ONEA 3DX5A 2EG6A 3B04A 3N3TA 1C7SA 4X3ZA 1D3GA 1GHRA 4AZCB 2X1UA 4KFPA 5BNKA 3E0IA 4TVCA 1GKRA 4QAWA 1H2JA 2PU1A 3VGDA 1Y5XA 3K5XA 4BS0A 4IUGA 4PTMA 3ARRA 1GW9A 4ORMA 2CEQA 1F76A 3PUOA 3W00A 3QTGA 1K03A 3XINA 4OIFA 4AD2A 4H8VA 3FA3A 2J74A 4QS6A 1FCUA 2GJXB 2V67A 3VXGA 9XIAA 1GVSA 1KXVA 1TJ2A 4V28A 1MNZA 4A2RA 4QEHA 2HDJA 3D47A 1E55A 5JU6A 2QJMA 2Z2BA 4Z2KA 4FNQA 1AK5A 4MNLA 2Z2AA 4YXGA 2X8RA 3BUVA 2Y61A 1RK5A 3WIJA 1PVNA 3MMDA 4U4MA 5CSRA 2OOFA 2ACUA 1OHLA 3OLEA 4HA4A 4L1GA 1FXPA 4HU4A 1ZBVA 3A64A 3JRKA 3IJ6A 2QCDB 1MZHA 3BSMA 3NG3A 1HVXA 2BFGA 3GWQA 1D3CA 4PTWA 5C2CA 4Q8NA 3TXZA 4ACZB 2XVLA 3OLGA 1V3MA 4FX6M 1ZY9A 3H21A 4O28A 3NQ6A 4JTTA 3TYUA 4KH2A 4AIOA 4AZBA 1N55A 3T81A 4UTWC 1YNYA 1SSGA 1XW8A 2DZSA 1AD4A 3VNJA 5FEWA 3CPGA 2X41A 3DBPA 5E93A 3P3BA 3GIYA 3W87A 1Q4WA 1R0MA 4ZL1A 3KL5A 3CZJA 3EDEA 1SSDA 4IG2B 3RDKA 2WNQA 1UD6A 4FPSA 2QJIA 2GGGA 1F9CA 3FA4A 4KEUA 5D32A 2A4AA 6CGTA 4UC5A 1NWSA 5BRBA 1TJRA 4GH3A 3WCZA 2DIEA 2DORA 1EUNA 2XM2A 3UR2A 3R79A 4B3KA 4M19A 3F7JA 1AA1B 2POZA 1UOKA 4C1NA 4KBXA 3TE9A 4HIBA 1BRLB 3IWPA 4IXXA 1UWIA 5AYYA 4I90A 4B92A 4HMEA 3W2LA 5I02A 2C79A 3BSGA 3EMZA 3GD6A 1TFVA 1E6RA 3ANVA 1NEYA 4AZHA 1YNQA 5C2XA 2NV2A 1ISXA 4D9PA 4DO4A 1RA5A 1KQZA 1UH4A 2BX7A 1YLVA 1YXDA 3G0UA 1W5MA 2X40A 3QMSA 2YSWA 3GG7A 5EA9A 3TQKA 1KR0A 2NX1A 4MYXA 5G4WA 2I57A 4D6EA 1CTNA 5GNZA 2FZNA 5HANA 3PZNA 4R7OA 1R3QA 3O05A 3KVMA 3GY1A 3TQVA 3VDCA 3U48A 1HP5A 1G6CA 5A6BD 2BHYA 4ZB5A 3GHSA 3LMZA 1PIGA 2DV0A 1AL7A 3ONBA 3GXFA 4DWSB 1OY0A 3M16A 1W32A 4ERAA 1GVFA 1WUFA 2WZHA 2WO5A 8XIMA 3QMTA 1D2KA 1EEPA 1KM0A 1QAPA 3MW7A 1JVNA 1BSIA 1VQTA 4I8YA 1G7UA 5DANA 3W1RA 5HJXA 5HNUA 1ITCA 2CZVA 4M3PA 1TPC1 3B9DA 3GAYA 4C6FA 1XBZA 3I6TA 3H2MA 3TW7A 1SJAA 3NA8A 1BSLA 1THFD 3OYZA 1WX0A 4PMOA 3KLKA 1G4PA 5BRPA 1J6PA 2DZWA 3E5BA 1UKTA 3SB0A 4XAPA 1V0KA 3FYOA 5DX7A 4W4QA 3ZSTA 3GH4A 1XUUA 1Q5MA 4PBFA 1A49A 4KIRA 3LGGA 2YKKA 1ZUAX 3HGRA 1KKRA 2CLPA 3GO2A 4DJED 2WM1A 4JNMA 3U6WA 1PZ3A 2DJXA 3GYEA 3BV4A 3E96A 4BHYA 3APYA 4CQ8A 4MFEA 1O95A 3EKZA 3CH0A 3H54A 2OU4A 4RXGA 5G1YA 1DXFA 1ZP4A 4R9XA 1PTGA 1CX9A 3P0WA 1ZB5A 4TQTA 1W5PA 2JGYA 1XLIA 1QBBA 1XYFA 2XGIA 1OCJA 4PMUA 5DT5A 1WAWA 3GG8A 4TX6A 2IMRA 3VNDA 4MUZA 3KX6A 2Z26A 4LWWA 3RCMA 1EQPA 1E4LA 2E5BA 1R9ZA 3WLLA 4ECLA 1Q13A 4YCPA 3QVQA 2JIEA 2HJPA 4Z0SA 3S2LA 1BGAA 1F74A 2P10A 4Z1DA 2Y7GA 3G3MA 3PWGA 4D1IA 3L4WA 4QISA 4AD1A 3BAWA 3THQA 4A3RA 5E6YA 1JF6A 3LCIA 1ZGDA 4AYSA 2Z24A 4LFYA 1GJUA 2D0HA 2XN2A 4H7VA 1NSJA 3QJAA 5IDZA 1RPXA 1XISA 4OE7A 1FDJA 4XAZA 4M6PA 1YTKA 2W3ZA 3SCQA 2RDWA 5HWNA 1B3YA 5K4ZA 3ZVHA 4WDTA 3KOZA 3S47A 3WDHA 4AC7C 4PTDA 1UASA 1Q6FA 4E8GA 2A2IA 3ID7A 1VFFA 5FJOA 4MF4A 1AH4A 3KCOA 1W8GA 3IVUA 2WSQA 5FEPA 3CZ8A 4RUBA 4AX7A 3AYRA 5HPOA 2NQLA 4PE8A 3E0FA 3HV9A 1GTEA 2Y63A 2J9XA 1SQ7A 3LLXA 3THDA 3AXXA 1EC9A 5BWFA 5U7SA 4J1OA 3JU2A 2C18A 2UY4A 3N13A 2FPTA 1X7FA 4UFMA 4DJFA 4L61A 4W85A 2B81A 1DQUA 1MDRA 3BLOA 3PAOA 3U2OA 2PGFA 2GDUA 3NO1A 1CXFA 2HK0A 1EKOA 4U3CA 3TOPA 1R7AA 1R9XA 2NXGA 1BYDA 4IQEA 3RN6A 1L6GA 4TV5A 3GR7A 4WR3A 4A21A 2VC5A 2VUNA 2J25A 4IIGA 5F2LA 1K7XA 1QTWA 3GNPA 3NZQA 4HQVA 4ZXOA 2BB0A 2AMXA 1IEXA 4S23A 2PBGA 3TVAA 5EL1A 1J01A 5MF5A 4U3AA 5D33A 5FF4A 1GQLA 1U1UA 3GRIA 1F2JA 3AXMA 5AECA 3N2CA 3SCNA 1K4HA 4NZ4A 4NXSA 4OFCA 3POCA 1R2RA 4MWAE 1UR4A 3B8IA 3PANA 2G3JA 4CQBA 2ON3A 2BOFX 3C2FA 3W1NA 1OADA 4RE0A 3S1VA 1Q3NA 5J8LA 3RU6A 3B0YA 4W8AA 1VRXA 3M47A 4GGBA 2VZOA 1VC4A 1J4EA 1FTXA 3AYTA 4IIHA 2AKMA 3S3GA 3UXKA 4AISA 3UVIA 2PC4A 2PDKA 3RLUA 1SM9A 1E6QM 2OO0A 1UJQA 4KEMA 3EBVA 2F38A 4QDMA 8A3HA 2NW0A 4HOWA 1ISWA 3L68A 3AIUA 1RXOB 3YPIA 3M0JA 3NXFA 1XCFA 4O57A 1M68A 3O63A 4JYFA 3WJYA 3UGRA 3W84A 1PX8A 3ES7A 5C7HA 4FZIA 1WDDA 4C5ZA 5L9FA 2CNCA 1HTIA 1OGGA 1W5NA 4H6RA 1I6NA 2G97A 3PC0A 4B2DD 3L5MA 1CYGA 1PTAA 2H6RA 4HSHA 4J4KA 2RHGA 1PAMA 3GDLA 5C9RA 3C0JA 1XLLA 2WNWA 4W7WA 4BY3A 2YBVA 4FNTA 3BCJA 4UQBA 4GCAA 4EANA 2Z6IA 3QMRA 3BGAA 4ASTA 5BOFA 5CAKA 4UR8A 4MWAD 2NT0A 4UNIA 2ABAA 4RDVA 4P7LA 3WQOA 4CGTA 1WOAA 3HG5A 3T44A 4X0VA 1I2OA 1TMHA 1S46A 4V15A 4C6PA 3RJYA 2YJQA 5BXRA 3SFKA 2ZWZA 1H61A 2VD8A 4MZYA 2QS8A 5BOEA 2ZXBA 3GXPA 5FJIA 3W7HA 1IXPA 2G0WA 1OG6A 4NAEA 1EF3A 1TRIA 1ZSXA 4ACYA 5CSYA 2Z1VA 4DXXA 1SGJA 2IUZA 1A50A 2BASA 4QAIA 1BVZA 4YMZA 4KESA 1TPH1 2WHKA 4JIPA 1FCQA 1XQLA 1JGIA 3WBAA 4EAYA 4YL2A 2EGZA 1A3XA 1PB0A 3GIQA 5E9XA 3SJNA 3ITTA 5ABFA 2WQDA 1QK2A 2VRKA 1OX4A 1KGXA 5CZJA 3SRKA 3SADA 2ZX5A 3NQEA 2I16A 4LUTA 1I75A 3GQYA 4JY8A 4JCLA 1Q7ZA 2O9PA 3DG6A 1U5HA 3WQEA 4PTNA 1AFSA 3EWUA 1EZ2A 2ZC1A 4G9PA 5G2HA 2VGGA 3IVTA 2PDWA 4DXKA 2WCGA 3MO7A 1KKOA 4JKLA 2E9BA 3U2EA 2J27A 5CBBA 3APGA 3CQKA 3IIXA 4Y8EA 5JH1A 3WQ6A 3QM3A 4TVUA 3C0LA 1L2UA 4JYDA 3DGBA 1L8PA 1JXJA 4H00A 3OG3A 3ZQ9A 1JUKA 4EPEC 2YXGA 3KVKA 3S1GA 1HO1A 3AISA 4PN2A 1ZCOA 3CASA 3GU9A 1M7XA 1TR9A 5AKQA 3E49A 2XZ7A 3AZSA 3EB4A 2PGWA 2GOUA 5M17A 3PAJA 3TNOA 3CAKA 2V8ZA 3IUDA 2YCIX 5AC6A 1HKIA 1SFSA 1Z69A 1CGYA 3TJIA 3NZPA 4LUJA 4JFTA 3W23A 3N19B 3CAWA 3UY7A 4D8LA 4DYJA 1JF5A 1EP3A 4EWJA 3VE7A 3KBNA 3I7QA 1Q63A 2NZLA 3K4AA 2HNEA 3IAQA 2A79A 1V93A 1PCWA 4L4OA 3DESA 1AJZA 3IJDA 3H4GA 2C91A 4MKSA 1B5TA 3N6JA 3LCHA 5A6KA 1FWGC 1UQZA 5I6SA 3MUAA 3ZT5A 4RJEA 5K7JA 3P93A 3K4DA 4EAMA 2H9AB 3TMQA 3VNKA 5A2AA 1N82A 2FPVA 3NJ3A 1KXTA 3BAIA 3CXOA 3R0KA 4W93A 3SUVA 1AZ2A 1X1OA 3LM7A 3QQ0A 4ADTA 1XBXA 4S3GA 3MBFA 5EMJA 1EJVC 1Z42A 2PA6A 2FPYA 4B4HA 1G5AA 4IMFA 3H2OA 1FWIC 1K02A 4AZIA 1KNWA 2Z1SA 2PRMA 2OOGA 1E9ZB 4U5IA 4JTGA 2QHAA 2YOCA 3SN1A 4LEFA 1VENA 3LV5A 1DIKA 4IL2A 4EX4A 1AMYA 1IEQA 2YFOA 3EWXA 1LUCA 1M41A 3MANA 2DH2A 2XH7A 3Q37A 1L8NA 3OQ8A 3VDHA 1KM2A 4NZFA 3OBAA 4BQ2A 2OTDA 4CD5A 4DI8A 1M04A 2QCCA 4INFA 1K6AA 3LHWA 1YDNA 3B97A 2Y0FA 4PULA 2YL6A 2P76A 3PUDA 1V0MA 4O53A 4JNYA 3LXAA 1XIMA 1XKYA 4GYJA 2PMQA 4JFWA 4O1EA 3VI2A 3MUY1 3DH7A 4G5DA 4C60A 1VCGA 3M07A 3MHGA 4C6LA 4LAZA 3SBFA 1XRFA 2WK2A 4EF8A 4UFLA 3NVDA 1NVMA 2O92A 3G6LA 2YLLA 5FSDC 3M1ZA 1FKWA 4H4IA 3SW6A 4N6FA 5CPMA 1CCWB 3AU6A 4A3YA 3D6NA 2EPMX 3IJIA 2Z4GA 4JIQA 5G2WA 5CKSA 3L5LA 1UUOA 1XGDA 4PTXA 4HHMA 2XPKA 5HMDA 3TYEA 5GJMA 4B91A 4MJMA 4QBXA 6REQB 1J2BA 3T55A 3CEUA 3KP0A 4Q4MA 3QFWA 4CUCA 3B0VC 3W24A 1P6WA 3LMYA 1J0KA 1VYSX 4GVGA 2GWGA 3OGRA 3RPMA 4IQLA 5C9ZA 1NP0A 4HOZA 4NP7A 4LCRA 3TC7A 1NQKA 4Z2GA 3ARWA 1HJUA 3DI0A 3PN8A 4UR7A 1NDZA 5AHLA 3UQNA 3F4DA 3NQ8A 3KRUA 2W4XA 4LOCA 1EJRC 3ES8A 1NM9A 5AB3A 3WFLA 4GJJA 4WOZA 3SY5A 4JQ4A 3XIMA 3UXDA 1ISZA 1EJXC 2XH0A 3E2RA 1FWCC 3NTYA 1EPXA 4P2VA 5G2IA 1YNPA 5LNRA 1X1NA 1F3XA 1MWOA 1Z6KA 2W9MA 3OO2A 1HT6A 2VR4A 3H4WA 4PYSA 1G4SA 4F2UA 1J93A 3LBCA 1RLDA 5FJPA 3R10A 4GYKA 3T8LA 3QGVA 3DHPA 4LRTA 3W1UA 1E0TA 3AMLA 3O3RA 1TVNA 4UQCA 4RNFA 4FLOA 1OT2A 3OZPA 3EMCA 1JZ2A 5A6SA 5BW6A 2A3HA 3BLEA 3L67A 3UCCA 2B7PA 4RK8A 3F2CA 2J7FA 4FLSA 3JZEA 4MADA 4JQAA 5FSEC 1W3TA 4QCFA 2C13A 1CGVA 5A8MA 4MY8A 3WK0A 1VHNA 1V02E 2OX1A 1DP0A 2V69A 3N2TA 4K39A 4LS2A 4F0HA 2GJXA 3EKLA 4RZBA 5CLWA 4Z2HA 1TR1A 4AEFA 1JL8A 1W1VA 2E28A 1SJCA 3NO5A 1TSIA 3G1FA 4DJDA 4Y96A 5JH2A 1CXIA 4CNTA 5K9CA 1SR0A 2G3FA 2E3ZA 4I6KA 4WXZA 3B0XA 5AY7A 1YX1A 2ACSA 1LT8A 1A5UA 1GZ1A 2ZX8A 3WDPP 3W72A 1QW8A 4FNUA 2E1WA 2O0TA 4QQ3A 3MBDA 1JNEA 1WDSA 4QLKA 4CNUA 2DPEA 4DVOA 1LLZA 4KEZA 1VGAA 4H83A 3QV6A 3VKJA 1HF6A 1EA9C 2BVTA 2B7NA 2QDDA 1LP6A 1A5NC 5TD4A 3SQSA 4Z2JA 5A6TC 1E6PA 4CD7A 5AZ1A 4IX2A 2QIWA 5D09A 1E6SM 3SAZA 2DU2A 3QKEA 4A6GA 4O16A 4JTLA 1VBHA 3F03K 4AYGA 5FAJA 1K77A 1IR2A 4JXCA 4DM1A 4LALA 4HB7A 2DIKA 4WX2A 3W9ZA 1KV5A 2NVCA 4D2JA 5B80A 2IKHA 4DI9A 2Y8UA 3QGAC 2QUVA 1BWKA 1W3JA 4H04A 5HUPA 4YTSA 3LK6A 3CHDA 4IG2A 1W31A 1HL9A 3CLWA 1NWTA 3O06A 7ODCA 2YDAA 1RP9A 3W4RA 4GX9A 4DZAA 2OJPA 1ICQA 4N9BA 1A5KC 3TKFA 2CESA 1QPOA 4G1KA 4DF1A 2ZADA 3DFPA 4UTJA 3R58A 1PL9A 4ZB0A 3UERA 3WEMA 2OYMA 2JKAA 1V0NA 4O19A 3VKKA 4QE1A 5JVLA 4WSJA 1BRLA 4ZA0A 3R25A 4ZOEA 4GIYA 2PFHA 3PBVA 5GJPA 1ZBKA 2BVWA 3VOHA 2DQWA 4K2SA 2PDPA 1HP4A 3UR7A 4GK8A 4J3ZA 4GGHA 1OK6A 1QHPA 1VIZA 1TPVA 1DEDA 4KRUA 2HPIA 2WSPA 1KR1A 4GVFA 4M5PA 1JCTA 4ZSUA 1DV7A 4FOJA 3IUHA 5GNYA 5C9WA 1VRDA 2E0PA 5E1QA 1IE7C 1V3IA 2BGSA 1GOXA 2V81A 4M0XA 1TTIA 3BLIA 4OOZA 1XC4A 2ZOXA 3SIMA 4DWSA 5BRQA 2XSAA 1IXQA 2PD5A 1ZJHA 4Q4OA 5FA5A 3B8SA 4AMAA 4J40A 1L6SA 1VPXA 3DKLA 1UH3A 2DP3A 1ITUA 2PDQA 4KGJA 2XTKA 2IQTA 3AIEA 2FH6A 2XG9A 3VM5A 3C3UA 2Z1BA 3GW3A 3RPDA 2OQHA 4LV4A 1PX3A 3TTSA 4Z42C 1E5JA 2PS2A 2VGIA 1RK6A 1TREA 3TN5A 3QZ6A 2FZBA 2A3LA 3BW4A 4NJHA 4GFSA 1RPKA 5C7VA 5KZEA 4P7RA 4H9TA 1PDYA 2WCSA 4MDPA 3PVFA 1UIOA 3UWYA 1JFXA 1UR1A 1JCLA 1W5QA 3NQVA 3HB9A 3TCEA 4JQ3A 4U5KA 1Y65A 1U33A 4QDPA 3TYDA 3CHEA 4W9TA 1KFEA 2ZIDA 3PZUA 3DN5A 1HNYA 4F0MA 2WMGA 2WVTA 3GS6A 5D2VA 1G4EA 3NZ1A 4QJ5B 3K30A 3ICJA 2FKPA 2XIQA 3CV6A 3VIKA 1IWAA 2A7RA 3W1AA 1Z32X 2DQXA 1XLDA 1B9ZA 1PS9A 4IFOA 4UOZA 5DEZA 3IIZA 2CKRA 3L4ZA 3PBMA 1QK0A 3G8RA 3QHMA 3CUGA 4MJ2A 3V75A 4QJ3B 4JEQA 4R85A 4WY0B 1B4KA 1KA9F 2W6RA 1U83A 4EACA 1H1NA 1ITXA 3DC0A 1JULA 1XGZA 3LBMA 4J3WA 3W7KA 4IIEA 4GNVA 1TTQA 3EWCA 3U7VA 4M82A 5E0KA 5BYWA 2A3AA 4M6UA 1VYPX 1VFMA 4LY8A 4PMXA 3KXQA 4Y9MA 4W87A 1W1A1 3CTLA 3AC0A 3KUMA 5CZKA 2YL8A 4FF7A 4XTDA 1WCGA 2E7FA 4CVUA 4GUJA 2GGEA 3W88A 3W1QA 3F4NA 4J3UA 3W7MA 1JI2A 3VNLA 2HXUA 2WMKA 4WVXA 1QHZA 3AHTA 2TMDA 2Y24A 5BZAA 3BURA 3OVRA 2NV9A 3LXBA 1KCZA 5LGZA 1Y7VA 4ICMA 3ARTA 1RVGA 4G2DA 2VEMA 4DJEC 1QNOA 2JQXA 4PEEA 3N34A 3MSRA 4BR1A 5JBDA 4UZUA 1UC5A 4FALA 1R7OA 1UQYA 4A4AA 4AZ5A 3UZWA 3W2UA 4IGHA 1TX2A 2A0NA 4JFVA 4LUYA 4MKNA 5LNSA 3UWVA 1NDVA 2X1TA 3IRDA 3N6QA 4MG4A 1BXBA 4A8NA 5AYZA 2YCEA 3TW6A 1FX6A 1E6ZA 3CT7A 4YIWA 2NX9A 2INEA 3KZPA 1FDZA 4HHPA 1IXNA 1T40A 5F4WA 1DJYA 1KFCA 4H41A 4JTUA 3FA5A 2D73A 1WYIA 1XIJA 1E3ZA 4AWUA 2BY0A 1OZQA 3DG3A 3GC5A 2V0TA 3FN9A 2VC7A 3MYOA 3NSMA 1QW7A 2OMAA 4IMAA 3VGHA 4C6OA 1BWLA 1NTHA 3LPFA 2FHBA 1RJRA 3LZ5A 3VIJA 1UD2A 2C19A 4LYRA 4E4UA 2OGJA 5FL0A 4QLLA 4TR9A 3K8LA 1ZENA 5K3VA 4I9TA 4UTWA 2PE4A 1S39A 2GSEA 1R38A 4GZ7A 4O12A 3GHRA 1GHSA 1W1YA 3D3FA 3C86A 3VDBA 5CEWA 3C2VA 4GYFA 3CUJA 2BXVA 3BAYA 2TAAA 4GJ1A 4FMVA 2V3DA 3M0KA 4GISA 5CAHA 3WF2A 3TW9A 4MLJA 4LY4A 3GZAA 1KRCC 3L4TA 1H50A 2F2KA 2QW5A 1A0CA 4W8LA 4A3QA 1JJKA 4WJXA 4AWTA 2WKJA 3UXLA 2J6XA 2QJGA 3LDVA 3N9SA 2Z1KA 5A6AA 5HK4A 1W2VA 1MW0A 4M24A 3AICA 1TMLA 2V3GA 3ZYZA 3GFZA 4N42A 1TPUA 2X30A 4D72A 3P5YA 2G95A 2WVVB 3OHMB 1AZ1A 3SZ8A 1P6BA 3QPZA 1TIMA 2R1PA 4LAUA 1J96A 4PSPA 1A5MC 4Q8QA 2CPUA 1PSCA 1O4UA 2E67A 4XZWA 5HNRA 1YMYA 4HNNA 4PMNA 4NZ5A 2GUUA 1E73M 1TQXA 1QPRA 3V4BA 4WD0A 4K37A 1O5QA 2R94A 4NJJA 1L6YA 3ARUA 4PCPA 1RR2A 3V18A 2E9MA 4Z1AA 1LL6A 2PPGA 1R3VA 1ZQ5A 3L12A 4YYFA 1F73A 2HVNA 4IZGA 4O8RA 1QR7A 3O9NA 2CHNA 2OCZA 2XZ9A 3CUIA 3L2LA 3BJFA 3HURA 4Z2IA 5IOBA 2CHRA 3H4XA 2EQDA 3R89A 2J13A 1DTUA 1VBRA 3CIXA 1DJZA 4NXKA 5HMFA 3RR4A 1V03A 5EMMA 1P1MA 2B31A 1O5KA 2I7GA 3C6CA 2FZDA 1JDDA 1XCXA 4J3TA 1X8CA 2EHHA 3FJ6A 3LB0A 2OYKA 3MP5A 1R2TA 2DZAA 2VX5A 3V5FA 1R30A 4KWUA 1Q66A 3TA6A 1LTDA 3NPVA 3QOKA 4AF0A 1JD7A 3K4WA 1PBGA 2VZUA 1R47A 2PDBA 3P8JA 2PTYA 3WLHA 4O13A 3WNKA 4FOKA 3TN6A 3WD1A 5I5RA 9XIMA 1RLCL 3VAVA 1NIUA 5I77A 1W2PA 1QI2A 1BHGA 3B03A 3UG3A 1J5SA 3HQ1A 4A3UA 4HK7A 4AWEA 5EMKA 2PGEA 1L2QA 3LGEA 2G8ZA 3W7EA 4PZVA 1BPLB 1UA7A 1FFRA 3NQDA 1KBKA 4ZE4A 1TWZA 3GNNA 5BXTA 1FWEC 3V1HA 3LCXA 2Y5JA 3CL6A 4QS5A 3N9RA 1UWTA 4MWAC 3FW6A 3EB3A 4S3AA 2PLKA 3U5UA 1I0BA 3G6MA 1E0WA 4XUYA 4I7WA 1EHAA 1J10A 2PP0A 4GZIA 1XYZA 4MSSA 4ML4A 3IGHX 3RYSA 3BLLA 1X8FA 1P6CA 2AAAA 1TV3A 2WPBA 2F2HA 3AMGA 4M81A 3NXLA 3W7QA 3S9YA 1TRDA 5BMXA 1RP8A 3EPOA 2INZA 3WYZA 3CHCA 4J3XA 4R33A 3UT0A 4JN6A 3P7YA 3DHFA 1EXPA 3VDGA 3MKVA 2GVGA 1TA3B 3HJZA 3NVTA 5KMYA 1VLIA 2FVKA 2V2HA 5LIUX 1L6FA 2FDSA 4HGXA 3VM7A 4DY1A 2J7HA 3LUTA 2WJEA 1MUCA 2IPFA 2CXEA 4QFUA 4J3VA 4DJFD 2V82A 3T4CA 3UG8A 3KOYA 3M4HA 1GW1A 1Z44A 3SGUA 5H91A 7REQB 3TP4A 2FHCA 3N29A 3SCPA 2E68A 2Y89A 3W2NA 5D05A 1QMLA 2FMNA 1E4IA 3TWBA 5HMEA 2P0OA 3G3DA 3DYMA 3S2CA 3KDNA 1JEZA 2BG5A 3UCQA 4ZTXA 4FI4A 4IOTA 4ZQRA 3ZM8A 4R9OA 3PZTA 1EWEA 4PMQA 4PMYA 1CEOA 5D4YA 4OQVA 3MUZ1 2CBJA 4S3BA 5ABEA 4H9ZA 1V3KA 3GE7A 2NLIA 3VYLA 5DMNA 2D2HA 4CD6A 9CGTA 2X0HA 2J9ZA 3MKKA 3WK3A 4HNVA 3EAUA 5A6LA 1SZEA 3WZ0E 4AC1X 4DRSA 2GJNA 4RR4A 2BY2A 3NM3A 3QC3A 2PWGA 4B5WA 4ZO8A 1A80A 3P81A 2VFDA 3CUHA 2CZDA 3UEQA 2Y70A 4A2SA 3CIWA 1Z3NA 3OG2A 2FTYA 2BOGX 4NG3A 4RV3A 5F1VA 3BPWA 3E2SA 3MB9A 2WLYA 5HUOA 3MQTA 3G1SA 1PIIA 4UFJA 2VTFA 1TZZA 1TVLA 3MMUA 4GUIA 4MNKA 7A3HA 5ABTA 1B31A 2ZRYA 1FP8A 1PWLA 1XQKA 1VD6A 3FVMA 3ZOAA 5I7GA 4GQGA 3LTSA 2VMFA 2HTMA 3K1GA 4Y2WA 3KM8A 4P7NA 3V1PA 3UW6A 3DIPA 3PS7A 3RGTA 1HO4A 2Q6ZA 4JTCA 2GQ3A 5I3GA 2DSKA 1RHCA 3CC1A 3KFTA 1C8VA 1UMYA 5LIKX 1LT7A 4C1KA 1JG9A 3HM7A 3WBXA 1J2WA 1YW1A 3M6DA 4B9YA 4FNPA 5K2ZA 4P7OA 2VGFA 1BWVA 1UWRA 4IGNA 5HOSA 5LA0A 4GD0A 3LU2A 3KEHA 1XSIA 3Q65A 3G8EA 3CT2A 3HJEA 3SDOA 4C6JA 3ZMRA 3ARVA 4DM2A 3P61A 1CXLA 2E09A 3R12A 4ZQOA 4FB7A 4MB5A 4E4FA 1MXSA 2C14A 2VURA 2YYUA 3H7UA 1CECA 2O9RA 1W9XA 1S3TC 1TB3A 2MUCA 4TMBA 5I3FA 4R3UA 4DF2A 4PUUA 1JQVA 3RITA 4Q7NA 3MSDA 4JTEA 2PEVA 4AD4A 3FFSA 4B5TA 1C9WA 4UFHA 4TTUA 2AGKA 1LG2A 2PUZA 3F5KA 5HATA 2ACQA 1KFWA 3P67A 1VBUA 4EPDC 4CQDA 3N17A 2YR1A 5REQB 2OYLA 3WL0A 3PJTA 2XWEA 1Y5WA 4BQ5A 3SRFA 4ZQNA 4Y9OA 1MUMA 2OSWA 3TAKA 3AO0A 3KVJA 4AXKA 2QGYA 4QJ1A 1B30A 1L0PA 1NOWA 4IMCA 3AQUA 3TFXA 4QG6A 4WKHA 4R34A 3PZ9A 1F3TA 3ITGA 1I9CB 4L56A 7ENLA 1IT0A 2Z29A 1H0IA 2MANA 1JCYA 3ABRA 2JK2A 4NZJA 3HPSA 3QBUA 1Q6OA 1Z41A 1ZL1A 3PUGA 4H8HA 4N6EA 3PPGA 1US0A 3ZLFA 2FHFA 2D69A 1U30A 2FFCA 2ISVA 2VP8A 2UY3A 1EFZA 1LDCA 1LWIA 3ABOA 1YBQB 2QXWA 4HNOA 4PMJA 4YTUA 3EDFA 4I9MA 3REQA 3RX3A 5EMLA 4O54A 4GKTA 3A13A 1P5BA 4H01A 1DWGM 4U2YA 5LXEA 4HTBA 2DSUA 4AH7A 3G1AA 3H2AA 4FX8A 1T96A 2WCAA 3PBUA 2WZIA 3WQ4A 3W7GA 1UROA 1FWJC 3GXIA 4F0RA 1SZNA 3U2ZA 4MWAB 4XD3A 5A1AA 3UG4A 2R1MA 4URIA 3VIPA 2PURA 4HMCA 1IIHA 3TYCA 4YVXA 3CAVA 4PTVA 1YHTA 1WBHA 1UZDA 3VUPA 2EG8A 3FGCA 4NQ1A 2GFTA 5F2IA 2AQVA 3G1XA 3S83A 3GW0A 4AX6A 2WWDA 4WUIA 5DN1A 4CCCA 4NJKA 1SPQA 5HNNA 2XDFA 2GGJA 5HAOA 3NURA 1JQXA 1ESWA 4HNCA 4CD4A 1EDGA 2ZZ1A 2QLYA 4NU7A 3CPUA 4KWWA 4MLRA 5CGMA 1ONRA 2OT0A 4OBRA 1RH9A 2PTXA 2YA0A 3VKAA 1TCDA 1M1BA 2VYOA 4Y9AA 4JIEA 2CLIA 4X2PA 2CC0A 2GJPA 1XLCA 4HMNA 2XFRA 4YPJA 5G4HC 3DC8A 5IM51 1ISVA 3T9PA 3O15A 3VD5A 3SCRA 1WBJA 1FUYA 2CLEA 1K8CA 1U5JA 1MXGA 1UKOA 2VQUA 3MI3A 1V3LA 4H6QA 3S5SA 3VABA 5LIWX 4KCVA 1FWAC 3TFCA 1BXCA 4UZSA 2FZMA 2VWTA 4ZQCA 5AHFA 2CYGA 4JX4A 4Q8OA 1FHVA 4GC3A 4JIIX 5C0QA 3WD2A 1VFHA 1ML1A 2WSRA 3RUBL 1H41A 4Y8FA 3Q58A 4IMDA 1XGEA 2ZVRA 1QCWA 2V38A 2J7EA 3OJGA 1JNDA 5AVHA 2XH4A 1NWUA 1I60A 4NI8A 4NNBA 3KVLA 2Y5SA 3UG5A 3T0DA 1P7TB 3FLUA 3AHXA 1N8WA 4JCMA 5LHFA 1G94A 2VR5A 3UJRA 3A4AA 2Z25A 1EZWA 3NL6A 3OGVA 1SMDA 3BJSA 2YX0A 4GOAA 1MVYA 1GOWA 4FO4A 3CIVA 1XH0A 5D9NA 5LNWA 5F1UA 1M03A 2WNZA 1ZP3A 1PE1A 5CQ1A 1WKEA 4HZMA 1W9UA 2WV8A 1NP2A 1OIFA 1LBFA 1NELA 4FK9A 2VDGA 1RD6A 1OX5A 1G01A 2H8ZA 2HZGA 2J66A 1UR2A 4IP4A 2VENA 3NDYA 2E6AA 1LM1A 4JKMA 1XINA 2PWEA 4O0KA 3K8KA 1UB3A 3CMJA 4Z17A 3S2JA 1XLGA 3PZVA 1FHLA 1RCOB 2EPHA 3ME3A 5D2XA 3EOSA 1OC5A 4L4PA 1GQJA 5I3JA 3VX0A 5A2CA 1I8JA 3LPPA 4G8TA 4ZFCA 3WUGA 1GWJA 3AUJA 1GZJA 1JIBA 4ZXLA 3DG7A 1E1CB 1J6OA 1I1XA 3V5OA 1E15A 1P43A 3AUOA 4E8CA 3F5LA 4K1WA 2C1GA 1XDJA 3L66A 3LSCA 4JTRA 3W7NA 4MM1A 4K3ZA 3LPOA 4Q8VA 4HYWA 3VUSA 4JTAA 3H24A 3IJLA 4PMDA 3UJSA 3O6AA 4RL3A 3TYAA 4XX6A 1SO4A 3N11A 3P82A 4P5UA 4O0QA 1W9DM 4QM1A 3GC4A 3HPAA 2HK1A 1VEPA 1UD8A 4PFHA 3AIRA 3O1NA 4I7UA 3R4IA 5EPDA 2FTPA 3PSWA 2INFA 1B3WA 1FWWA 1GYLA 4NASA 1V6UA 3A24A 4JN8A 5ECVA 3VIOA 1GVOA 3H2EA 1AMKA 3TQ0A 1PZ0A 1XIEA 4GXMA 3MTWA 4MYAA 3C61A 1H0GA 3VOJA 1EIBA 3T42A 3NOEA 1DORA 1CXKA 5I24A 4HSNA 2Z6JA 1J18A 1GKQA 3CMGA 4FXJA 5H8PA 5LIXX 2QAPA 4C91A 3SY1A 1IHIA 3U4AA 2A3EA 4HCHA 2CZFA 3LNMA 3B0UX 4YWIA 1JFHA 1BF2A 1WQ5A 2O56A 3VD3A 2W27A 1E0XA 1MSSA 1M9HA 1ADOA 3SCTA 4DJDD 1GEHA 3LI1A 2QF8A 1ADDA 2QJJA 4ZEPA 4LBUA 4L4MA 2X2GA 1LLOA 3STFA 4MY9A 4GWEA 4IX0A 2PP1A 2XUCA 4I8DA 5C71A 5AOUA 4RXFA 5EU9A 2OWCA 1ZFJA 5CPQA 3R6IA 1UBSA 1OCQA 2JKEA 1BTCA 1R2SA 3I6RA 3IIVA 1E4MM 3S1WA 4ICNA 1V77A 3EXTA 3UPWA 2C15A 1GQIA 1TPB1 3QC0A 2NQZA 4B5VA 4S3CA 3VD7A 4A29A 4D6GA 1VF8A 3PBYA 4LF2A 4JKKA 3M5ZA 1GVIA 4DEFA 4WDWA 3U57A 4UTMA 4XWUA 2X42A 3L7RA 1K8ZA 2OLAA 5C70A 4I5XA 2BXZA 5I06A 3QQWA 2HSAA 3G77A 4V27A 1KM3A 3FYPA 3P0XA 5EFDA 4YVVA 3NZGA 2ZZ5A 1JUBA 3LG3A 2ISSA 3PPHA 2WXDM 1R9YA 5GQBA 1EL3A 3B4UA 3E0LA 2YIHA 3DFTA 5JMUA 1JCXA 3WLOA 1YDOA 1YPIA 5DCDA 3MSGA 1OYCA 4D6FA 2ZKMX 4XQ6A 4F0LA 3GXTA 4Y6GA 4GIRA 4IPPA 5DMYA 2J7DA 1CGXA 1XRSA 4B90A 1XV8A 2DT1A 3EDJA 4KWSA 3KE0A 5U4NA 2VX6A 1KQYA 4K68A 1TCMA 4I7VA 5TNVA 3S8HA 3C5QA 1NFPA 2WANA 1WDWA 4GE8A 2FTWA 3GKAA 3LN3A 4QG8A 1H1YA 3MPGA 3UJEA 2C8NA 1XLAA 5BOOA 3VA8A 5AHEA 3VU2A 1UKQA 2CCRA 2PI6A 2Z00A 3F5JA 4LGXA 3GG0A 4BEUA 3M9YA 3B05A 3WENA 4ZO7A 3FAXA 4AAJA 4GYPA 1MZRA 4ZOCA 2R24A 1NARA 1XYBA 2WVVA 1M7PA 4WJ8A 4BWLC 3CUFA 3V16A 2J6VA 1PZ2A 4DWSD 2GQAA 5H2ZA 1E0VA 2GVYA 6TAAA 1H5YA 4RE4A 4AVOA 2GVJA 3SSZA 4CCZA 3NYDA 3GTHA 6A3HA 4NT0A 1QI5A 1GK8A 3R7MA 3OIXA 1TUXA 5AN7A 5IXEA 1QOQA 4CCEA 2REQA 5KSWA 3WBYA 2YXXA 1W3IA 1ZPTA 3EX6A 5FAGA 4LCQA 3GDMA 3LTPA 3KOFA 5EGRA 3OEXA 4ZFMA 4MB1A 3MI6A 3WNOA 3CAQA 5KINA 1WZMA 2JALA 1W3NA 4PRTA 1VIWA 1HKKA 4S3FA 4OUEA 4HBKA 4UCGA 1OYBA 1EH9A 2ZZ6A 3L0GA 3LM3A 4LVFA 4GJIA 3CTTA 3UWEA 2D0GA 1SW3A 1KD0A 4FSAA 5A6JA 4ZGYA 1EJSC 4YNGA 4PMVA 3BW2A 3CS2A 2Y88A 4DO7A 2F84A 3FYYA 9RUBA 3MYPA 1EHNA 2I9UA 2XH2A 4FP1A 4C6EA 2DUXA 4KGLA 2ZXAA 1ZS2A 1VR6A 1E4NA 1K9EA 1U1HA 1WDPA 1TJPA 2YCJA 1FXQA 4S3JA 3M0ZA 3NWRA 1RBAA 2FFIA 3ARYA 1SJDA 3KRSA 1F3WA 4NIRA 3R13A 2YDRA 1E71M 3LLFA 3ZJ7A 4B5SA 5A6BA 4ENLA 1RBLA 4BF7A 3BICA 2ZRUA 1JDAA 1XIDA 4LSBA 2YW4A 1HJXA 5D9OA 3LHTA 2YYTA 2PWFA 4W86A 3AIVA 1H51A 3O2LA 4WRHA 3MJYA 4NJGA 3SIZA 1HZYA 4IJBA 5E09A 2VJXA 5CBIA 1OCBA 3O8AA 4M56A 3T07A 3BH4A 3CO8A 1EQCA 1H63A 4Y90A 1XWYA 6PTDA 1HXJA 3B9NA 2OKOA 2V5LA 5A8QA 4OUIA 5DY3A 5AC8A 4KERA 4ZODA 2XINA 1MW2A 2FVLA 4QG9A 3URQA 5J5RA 4N0RA 3WMCA 2BWGA 4I5UA 2QCMA 5I2UA 3W6LA 4GH1A 1UIPA 3RILA 4IGMA 4YHEA 1TA3A 4IP5A 4ES4A 1W5OA 2P8BA 2ATSA 4DLMA 3CQIA 4DJEA 2Q71A 4J5NA 1YEYA 1NY1A 2Y4SA 2CXGA 3WNPA 5F4SA 1AQHA 2WMFA 3GC2A 3G1RA 3S2MA 4DELA 4AUBA 2G41A 3NFUA 1SW7A 3T0TA 1U22A 1BKSA 1KRAC 7REQA 4ZMGA 3G5EA 4V2XA 5ENLA 4E0CA 1E56A 2HE5A 2FYMA 3KP1A 3PBWA 1JPDX 3CQJA 1FWNA 3A5FA 1GOOA 1FVPA 1IEVA 4WCJA 3BMWA 3W0KA 3RHGA 2PDLA 3VDAA 3AXKA 4NRSA 3SCWA 4C7FA 4A22A 2FGLA 3S2NA 4Q8WA 2BGQA 1EB3A 1NOUA 2YBTA 2TSYA 5AYBA 1HJSA 3I7RA 1B54A 3R8HA 3PY2A 3KWSA 3W7OA 3ALFA 4DUVA 4I3GA 4RNJA 4NNCA 2Y85A 3WSUA 4AVNA 4DBUA 1LG1A 2XFYA 5HQEA 1YDVA 3SUUA 4ROPA 2DY3A 3A3WA 4AZ6A 5H8MA 3AYVA 4L1XA 3M0IA 2E8ZA 4JQ2A 1WE5A 1S3HA 3NL2A 3W75A 1H7NA 3W53A 4XBKA 1B3ZA 1SJBA 3ARSA 3O07A 1XHGA 3COTA 1SO3A 3M5VA 3HF3A 4CNSA 2DW6A 5ABGA 4IWWA 1UWQA 5TF0A 4YS1A 3PTKA 1FH9A 1WNOA 4S39A 1IWBA 3B0PA 4F48A 3VOIA 3H6OA 3ITYA 3EB2A 2OSXA 3PULA 4LNYA 2A85A 2KAUC 2WW5A 1V7YA 4JTHA 1O68A 3VOFA 5BROA 5IFTA 4HPXA 2AAMA 3HG4A 3TEVA 1XIIA 4HJWA 2PDHA 3PZQA 4HD5A 3N14A 1DVJA 1FDYA 5I09A 4LU0A 2XSBA 4HCLA 2YBUA 3NDOA 2QUTA 4BCEA 4Q32A 3OIHA 4Q22A 1WZKA 1M65A 2VNCA 4G1NA 2HEJA 4QJ4B 4JS3A 2QV4A 2XVNA 2Z2UA 3U5YA 4N9CA 1DYSA 1EPVA 2D1ZA 4LF1A 1NWRA 4MY1A 1G0CA 1UCWA 3UR8A 3VVGA 1A5BA 3FS2A 3W2JA 1UWAA 1P0NA 1NFGA 4WHBA 2DZPA 1UD3A 2QNEA 5REQA 2ABBA 2D3NA 3AHZA 3HMJG 5D04C 3T8QA 5I3DA 3CL8A 6XIAA 3AIBA 3JUGA 4XZMX 4O50A 1JRBA 2VELA 5D2YA 1V3HA 3ZJ6A 4H7ZA 1RQHA 1N2VA 2IXVA 3ZR5A 2NUWA 4X60A 4A3HA 1EX1A 1QW9A 3WH6A 5EKYA 2Z27A 1AQ0A 3BG5A 1DXIA 1KC7A 3FK4A 2BODX 3PG9A 3OU8A 2YXOA 2AL2B 3MC5A 1KLZA 2WKLA 4AQLA 2UZ9A 3LD5A 3DFOA 1PUDA 3JVAA 2V9DA 3W28A 5AC7A 1P0EA 3DYOA 3AALA 1S38A 1YBQA 1VZWA 3UBPC 1FFQA 2XIBA 2FQIA 3T0AA 3DEQA 1OABA 2ZUVA 1ZJBA 2VRJA 4H2HA 2CFFA 3K46A 3LY0A 1AJ2A 4IH3A 2BSLA 5GNXA 2Q3RA 3NEHA 3QEZA 3A22A 3VTRA 3BGGA 3TC6A 2ASHA 5CPLA 4NRRA 4Z1BA 1RJQA 1G69A 3VKCA 2W91A 3NNTA 4PUKA 3VIIA 2PTZA 1F5ZA 1P4CA 1W1IE 2ZZ2A 1K8XA 1CENA 2AOSA 5EMUA 1XDLA 2W79A 3WQWA 4MWAA 1UKSA 1G1YA 3GK0A 3VKBA 1DE5A 3M0LA 5HPCA 3N4FA 1VFTA 1D7KA 1C7TA 4E3VA 1CW2A 2OEJA 1SUXA 4MB3A 5CC7A 4K8GA 4EWND 3M44A 3D0CA 3TJ4A 5H8UA 4QSFA 1GT8A 3E1F1 4OVXA 1EOKA 1V7AA 4WDXA 2R6OA 4ZBCA 1UD4A 2E6DA 2PP3A 2GGHA 4M7TA 1XFBA 3RR1A 2YCLB 1ITQA 3PUEA 1ZAIA 2V3FA 4O11A 1FOBA 4NF7A 1FH7A 3OHIA 1YTEA 3AXIA 4K1GA 4L64A 3CZLA 3E3HA 5JBFA 3WO8A 1JZ5A 2QT3A 2A6LA 3TYZA 3O0KA 3T6CA 3A21A 3NEVA 3GHTA 1HL2A 2DZTA 2C6QA 1ISYA 4GO8A 3NQFA 4XKYB 4ZSTA 4FNRA 3UWWA 3Q67A 3ZS4A 2EG7A 1D7FA 4IICA 2OR2A 4LYPA 2WBGA 3FXYA 1POKA 4LAOA 3WK2A 3WNLA 1NU5A 2VQTA 3MZ2A 4GBDA 3OBKA 4KRZA 3LI0A 1KM5A 2RDUA 2WMJA 3PB0A 1TV4A 5H6HA 4H7CA 3TNBA 1W3LA 3VC6A 1M7JA 3VCNA 1LZOA 4PCNA 3BAXA 1KLYA 3P2VA 2ACRA 1HFBA 3HFTA 1CB7B 4KCUA 2WPGA 4P7QA 5FI8A 3W81A 1RBOB 1P7TA 4EPBC 1HL8A 4AEEA 3FAWA 1BYBA 3MCMA 4L80A 4PUJA 3S6TA 3IJ8A 2ICSA 3WG6A 3UYIA 2G3MA 3QOMA 1IEWA 3MWCA 3NUKA 3QW3A 3OQEA 4CCDA 4OGZA 4LH8A 4HPGA 1BKHA 3CHVA 1BG4A 3L23A 1MW3A 3GR8A 1O5RA 4KWVA 4EPKA 3TTEA 3TTOA 3NSXA 3HU7A 4IL0A 2HWGA 2UBPC 4HA3A 1EP1A 3CZKA 4F8XA 3CB3A 3PG8A 2DSZA 1O66A 2WWCA 4XD5A 3T09A 3VOGA 5MKGB 2ZICA 3OGSA 3WJWA 4XAFA 1XDMA 1JZ3A 3HOJA 1CLXA 4E3TA 1IZJA 3PJUA 1XC6A 4JDYA 2VX4A 1J0IA 2ZE3A 3BXWA 2X0YA 1LBLA 1YE6A 1DJGA 3TOYA 5F7UA 3D5HA 1TZ9A 4PR4A 3VNIA 3BCFA 3M64A 1S5MA 4RPQA 3WQCA 4G56A 1H11A 2EPKX 1EA0A 3KBWA 4JX6A 4MMWA 3TX9A 4ZOAA 1FHDA 3U0HA 1UP0A 3ZWTA 4AW7A 4DUXA 2AQWA 2RFGA 4XD4A 2CBUA 1CI1A 1MFUA 3CZGA 3FDGA 3PTQA 3FXGA 3AAMA 2FDMA 1TE1A 5JIWA 1IZKA 2ISWA 1BD0A 4NILA 4AD0A 3CO4A 3M0VA 1TQJA 3H26A 1OGSA 1K70A 3G24A 1US3A 3B8WA 1S2WA 4AVFA 2J8GA 5LSMA 1XIFA 5M03A 3WBWA 3GHUA 3ONCA 4L1WA 1Q6EA 1ZALA 2W5FA 4ERIA 1JPKA 3O7UA 3ZJKA 3S1XA 3NQ7A 1VPQA 3S42A 4HVXA 3ZIZA 1FCVA 2R14A 2GSHA 4K38A 5FCZA 3EWDA 3S5NA 3WLQA 5CPNA 1RJPA 4XZNX 5FF3A 2HNHA 5D9PA 3TYBA 4IQJA 4D6CA 3P74A 2BY1A 3HG3A 1UWSA 2E5DA 5D9MA 1OEPA 1SZRA 4EIVA 3KL3A 5A95A 2V6AA 2PDNA 4XZLX 3TROA 1EIXA 2Y62A 3W85A 1FCBA 3RCNA 1W56A 1O1HA 2IQ0A 1R86A 3KS5A 3WQ8A 2F6XA 3VCCA 1LQAA 1NAL1 2ISDA 1GTHA 3R8RA 2PF0A 1DIOA 3PFRA 4RV8A 5HA7A 2ZZ7A 3DCPA 4OWGA 1QDSA 4C5YA 2QJHA 2G50A 3BG9A 4DYKA 4LQ1A 1O12A 1PZ1A 3GTIA 3N2OA 4GUGA 4Q8MA 2PDJA 2J79A 2DT3A 3P80A 3TH6A 3DERA 4PL1A 1ZAJA 4HZ7A 4OBTA 2ODOA 3EA2A 1UHVA 1YIXA 2IKGA 3BMXA 1JPMA 4JN7A 3QLLA 1OFQA 3BZGA 3ISIX 4HNUA 3IVSA 3W1PA 1XSKA 3E12A 3N6HA 1KM6A 5M1TA 2WLZA 3UJFA 1Q2RA 3M43A 1XLFA 4UNLA 1QPQA 5CXPA 2W62A 3GXNA 1PHWA 5IFPA 2KX9A 3L4UA 1IYXA 1OX4B 3EX3A 2J8FA 3F1QA 3V0TA 2XHYA 4TV6A 1Q8AA 3U8GA 3KBVA 1EGVA 3QPEA 3LHYA 1CLKA 2CKSA 1ADSA 4LAMA 5CC6A 2YZ5A 1RALA 1SU5A 2GJLA 1VLWA 3P8IA 4DBWA 4DO6A 1TV8A 4KCTA 4B5UA 3NQAA 1BQCA 2NQJA 3TTQA 3W02A 3AZTA 4P8WA 2RGMA 4W5UA 3QQ1A 3UXIA 2WC3A 4AHOA 4LBSA 3BQ5A 3S6OA 3B9AA 3ARZA 3IACA 2VFFA 3CZEA 3A23A 4O0ZA 4DJDC 1OF6A 3LXCA 2IQDA 3GVRA 3IEBA 3VOCA 4M29A 4QE5A 4UQ9A 1X38A 4NSBA 1ZCCA 4JY9A 3B4YA 3KOXA 2VEPA 3GTXA 1BGGA 1TV2A 2HCVA 2NXIA 2WMHA 4REQA 1A47A 2P0IA 1V6YA 2R9RA 4LVDA 4H6KA 4F9DA 3GDBA 4UMAA 3S46A 1HGYA 3OZMA 3BQ6A 3QZAA 3T40A 2PRLA 2IKJA 3UXAA 4QCEA 4BQ4A 8TIMA 2UY5A 3P5ZA 2VC9A 3GH5A 4RW5A 2PAJA 1ZNNA 2JF7A 2VVNA 1O7AA 4A05A 1SR9A 1I1WA 1UA3A 2AKZA 1JUEA 2HVOA 3OVPA 1IGWA 2RDXA 3QXBA 4HHLA 3M7SA 5A69A 4QHRA 1IF2A 3EDDA 3FVDA 2DH3A 3UZJA 3HO8A 1LOQA 4U28A 4M1RA 5FESA 4HNLA 1VB9A 1TVPA 4MB4A 3RXZA 1V02A 5G5IA 3WF1A 3FDKA 1MO0A