4OQVA

High resolution crystal structure of human dihydroorotate dehydrogenase bound with dsm338 (n-[3,5-difluoro-4-(trifluoromethyl)phenyl]-5-methyl-2-(trifluoromethyl)[1,2,4]triazolo[1,5-a]pyrimidin-7-amine)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
353
Chain Sequence
DERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Fluorine Modulates Species Selectivity in the Triazolopyrimidine Class of Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 139
structure length 353
sequence length 362
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4oqvA00
1F73A 3GXPA 4JTLA 4O52A 4POCA 1OX4A 3EKLA 2BZNA 3CT7A 3GAKA 1OFQA 1KFBA 3B03A 1UUOA 2R14A 2Y89A 3W1PA 3OHIA 1Q6RA 4FIQA 5G2HA 3W83A 1WDWA 3NL5A 5A8GA 5K7JA 5L9FA 2V2HA 3U8GA 5G2WA 2ZQ0A 2HS6A 1UJPA 3THAA 3NO5A 4W9TA 3CB8A 3WFAA 4DF2A 4O13A 4XTDA 1SZFA 2E5CA 5F4SA 3QFEA 2A6LA 5K4XA 3FA5A 4LVAA 4IXXA 4N4PA 3PY2A 3HG5A 4BI5A 4XQ6A 1A53A 5GVJA 1TSIA 2WSRA 3BO9A 4U28A 3LRMA 2KZHA 4IMCA 1T96A 3NQGA 3LHYA 3GVGA 4YCPA 4JDYA 1QOPA 5EL1A 1GTEA 2VC6A 5CG7A 2WQPA 1ICQA 1MEWA 3CWOX 1TPH1 1VRDA 4GUJA 3TE9A 1AL8A 4UR7A 4LVGA 1GVRA 1FWWA 3LCXA 5U4NA 4FF7A 1TYGA 2H8ZA 4DO5A 2RKXA 2ZZ4A 3LRKA 2R8WA 3L5MA 1OFEA 4A3UA 3NQEA 3DKJA 4JS3A 5HQEA 3IIZA 4K39A 5D2WA 4MZ1A 2B4GA 4MLJA 3ABRA 3QJAA 3PSWA 4WX2A 2Z2UA 2C6QA 5AC6A 1XBVA 1A5BA 3O06A 1KLYA 1KM5A 1ADOA 3BV4A 3GX9A 1N8FA 2Y7FA 4ZQNA 3KVKA 3W70A 1G4PA 3MP3A 4OGZA 5AOUA 2JBMA 1MEHA 3S8HA 1OF8A 1JVNA 3FIGA 2YXGA 2RDWA 1GOXA 1PIIA 2H3DA 1EIXA 1TTQA 4LS1A 4JTKA 1QDSA 3HGOA 2B0MA 2QR6A 4Y96A 1KM4A 3MMTA 1VCFA 3SGZA 2X30A 1O5KA 1GVQA 5FF0A 1W56A 3P7YA 3NEVA 1TTJA 2RFGA 4IPIA 3S5NA 2P0OA 2E6AA 1KBJA 3IEBA 4MOZA 2E6FA 1JJKA 2ABBA 3N19B 2O7QA 3LERA 1GT8A 4OT7A 5D2YA 3C56A 1E51A 3I7RA 3BW3A 3T78A 5AHMA 4NZJA 1TTIA 2YW3A 1LRQA 4WJEA 5I3IA 1JRCA 4GRSA 4RXGA 3PR2A 1U83A 2GQ9A 3LBCA 3QEZA 5DY3A 1VZWA 5EA9A 4I9AA 3W7HA 3NL2A 1HTIA 1EPXA 3R12A 1AL7A 3NR0A 1EP2A 1FDZA 4Y6GA 2WOQA 4MUZA 4RZ4A 3O6CA 1LOLA 3KFTA 3MYOA 4UFKA 1DJNA 5AHLA 3W1QA 3TH6A 1VYPX 1B3OA 5FF7A 1WX0A 4KWVA 1DJQA 1LOSA 3W74A 4KFNA 3BARA 1XKYA 2PRMA 1F74A 3G1AA 3UD6A 5CSSA 3Q37A 1VHNA 4GC4A 4JDBA 4LW7A 2WNQA 1P1XA 5K2ZA 1OHLA 3FKRA 4ZQMA 4L4MA 4C1LA 3EX3A 1M7OA 4O12A 3S1VA 1JCMP 1I2OA 4OV9A 2Q8LA 2A1YA 1FWRA 4O0ZA 4N9BA 3B4UA 1T0OA 4LC8A 3W86A 2A7RA 2YFNA 2C18A 2DZWA 3NM3A 2YCEA 1D3GA 1GVFA 3SFKA 4UTKA 3VE7A 5CKSA 1RQBA 2GVGA 1HO4A 5HWJA 1YTEA 1VLWA 1IF2A 4CNNA 3S1UA 4XWUA 4IGHA 3NAVA 3DXIA 3W1AA 1ZNNA 2QUVA 3LLDA 1UASA 3SI9A 1THFD 3W7CA 3KVLA 1SSGA 3P74A 4OU1A 2QAFA 1CX9A 3EWBX 1FCBA 4BI6A 3LTPA 2VFHA 4O10A 4NZFA 1H7PA 1F05A 5AHNA 4LV4A 2NWSA 3LHZA 4LV9A 3B0UX 3PS7A 3DHDA 4HNVA 3O05A 3TQ0A 3FOKA 4K37A 3S5ZA 4YL2A 5D38A 1C9DA 4WY0A 1TJPA 3SW6A 4Z1AA 2JKPA 3QM3A 1ZALA 1ZCOA 3MHFA 3GIYA 5CPLA 4WXYA 2YDAA 5CGQA 1XI3A 4JX6A 2A7NA 3TJLA 3QQ1A 2FJKA 3V1PA 4ZVJA 2C13A 2V2CA 3UWZA 3TUUA 2HSAA 4P61A 2XFWA 1GZGA 1VJIA 4EF8A 1XBYA 3JS3A 3W85A 1QPNA 4ICNA 4H3DA 1VCVA 3W7MA 1VS1A 3TC6A 1NVMA 4J9JA 2ZA2A 1M6JA 1I4NA 4NQ1A 1ZJIA 1I2RA 3IIOA 3L21A 1TQJA 3A24A 1RZMA 4UFMA 2G97A 4JEQA 4A21A 3FYOA 5CZJA 3O6DA 1QPOA 3TFCA 3E96A 3W2LA 1F76A 5D09A 4LNYA 4FX8A 1GJPA 3QRHA 1TJRA 5BRBA 3H54A 1SUXA 1KTBA 2Q3OA 1YLVA 3G1VA 4DXVA 4DQWA 3UY7A 1P4CA 3GDLA 1QO5A 1AW2A 1LLZA 4WZHA 1FWSA 5F2GA 2OMAA 4LRTA 4M6PA 5AHEA 3LHVA 3W23A 4JNMA 1K8XA 1DL3A 3G18A 2OT0A 1GG0A 5E0KA 3ATZA 4JTUA 1H7OA 1YXYA 5LHFA 3HPSA 3G1SA 3O16A 4LWWA 4DPQA 1H7RA 4FIRA 2RH9A 2ZRXA 3LCWA 4HKPA 3N9SA 2NX3A 1KFKA 2NX1A 1WBJA 1ICSA 1PL9A 5D2VA 1QAPA 4YXGA 3L0KA 3WJSA 3TCEA 5F4XA 4O53A 3MI6A 7TIMA 1SU5A 1WYIA 1YDVA 1S5TA 4N2YA 3ZS4A 2DZSA 3P67A 1IXNA 1G67A 1TMHA 4JD4A 4JN6A 5G1TA 3QZEA 4UR8A 3SIZA 3NA8A 1N7KA 2CW6A 3CEUA 2GUUA 4TMBA 1OK6A 3ELFA 3NNTA 1OYAA 3HB9A 4I7VA 3KRZA 3L9CA 1ZFJA 4O1CA 3TAKA 5D2XA 2C14A 2AGKA 3TQKA 3L68A 4ZQCA 4MY8A 1SFLA 4O18A 3LCFA 3LGEA 4JTTA 2NUYA 4UC5A 1WBHA 1XDLA 1A5CA 1P0NA 3QPYA 1RPXA 1W0MA 3MHUA 1DKWA 5F2IA 1O5XA 1H51A 2NX9A 4UIOA 1NAL1 2BXVA 3BLFA 4PH6A 1D3HA 1FWTA 4N9CA 3PUEA 1DQWA 3RF9A 2EF9A 3PG9A 2V8ZA 3MJYA 3G8EA 4A22A 3EXRA 2GJLA 1TPUA 2JGYA 5E93A 4XBSA 3E12A 1G7VA 3W1TA 2WV8A 3BGJA 5D30A 2H3BA 4C1KA 4PCFA 4NT0A 3GXNA 2QJIA 3BVJA 4IQLA 4KWWA 5BNKA 3UWYA 1H61A 2ALDA 3GDRA 5DELA 5DXYA 3C2FA 4K6AA 3HF3A 3E02A 4QNWA 1FXPA 5D05A 3O1NA 5BMWA 4ADSA 5I3KA 4AVFA 3E49A 1TTPA 3IGSA 3TSDA 3BGGA 3UYCA 1LBFA 4JX4A 4ALDA 3CEPA 3T4CA 1W1ZA 4FB7A 1F7BA 4Q4KA 1LYXA 2Y70A 4A2SA 1O94A 2CLOA 5CPMA 3M9YA 3MP4A 2QF7A 3ABOA 5DXXA 2AQWA 1FUYA 4BFAA 1W5NA 4AF0A 2WNZA 1F2JA 1B4KA 3NXFA 4GJ1A 1FQ0A 3HGSA 5KZDA 1G4EA 1B4EA 3QMSA 4X9SA 4OHQA 1JQXA 3BLEA 3H55A 3PSVA 2B7OA 3G22A 1QFEA 1HUVA 3SJ3A 4UXDA 1W54A 5I3GA 3NQCA 1A5AA 3M6YA 4LU0A 4PODA 1TV8A 1Q3NA 5DN1A 4E2BA 1LDCA 2JGQA 2FDSA 3B04A 3A21A 3QH2A 5D37A 2V9DA 2GJNA 3UXAA 3I65A 1YYAA 5CZ0A 3HPXA 1LOQA 2JKAA 2ZBTA 3C2VA 4CNPA 1GQNA 1EWDA 3EX2A 2A0NA 3DENA 3ZWTA 3W84A 3LHWA 3GLCA 5LGZA 3DGRA 2I14A 5DCDA 1XXXA 3CTLA 1W3IA 1OX5A 4DBDA 2QJGA 5D2TA 3I68A 3BPWA 2J9ZA 1OJXA 4Z0JA 3RNDA 4M19A 5BOOA 2IQTA 3NQDA 2PRHA 3L67A 2WKJA 3W9ZA 4TX9A 2VEPA 5LNSA 1IXPA 3W1XA 3W7LA 3EX4A 3S9YA 1WQ5A 3EWUA 1KM3A 3W7IA 2QCMA 4Z1BA 3PBYA 4HHPA 2G96A 2EGZA 1EUAA 3FKKA 1NF0A 3QW4B 5EYWA 4UNLA 5KINA 2NWRA 3HG2A 4X22A 3C2EA 3DFOA 1AG1O 2W0UA 3WK2A 1RVGA 1I2NA 3PULA 2ZZ7A 1TCDA 3MI3A 1Z44A 3MW7A 1NF7A 5TIMA 3M7WA 3R8RA 2CLEA 3AJXA 1SR9A 1EP1A 4O1AA 1CW2A 1C29A 4N9EA 3G24A 3GAYA 3ATYA 3VCRA 2VFEA 4DPPA 2EHHA 2GQ8A 1IIHA 4UTMA 4D2JA 1VPXA 3QPZA 3HGRA 3LB0A 3LCIA 4CCDA 3LTYA 4E2DA 1SW0A 4RZ5A 2CLHA 5CSRA 4K7YA 1H50A 3DFTA 4R53A 5AN7A 2XN2A 1GYNA 4FO4A 5FESA 3GDKA 4IX2A 2E5DA 3HIJA 4MIMA 3NL6A 1LBLA 5KITA 2EAWA 2ZTKA 4CCEA 2X1UA 2E68A 2ISWA 4BWLA 1EX5A 4MJZA 2CZDA 1W5MA 3DZ1A 2CZ5A 3A5VA 3L66A 4RKAA 2V5BA 4ONVA 1H60A 1OF6A 1LRTA 1XCFA 2YZRA 3NQ8A 4DF1A 1LBMA 3GNNA 3M5XA 5TBOA 2YGYA 4MFDA 3HOJA 3W7KA 4IMEA 1LORA 4XZ9A 1KM0A 2I9EA 3INPA 4DEFA 5K3VA 2CLMA 4BK9A 3KAOA 3PWAA 3C52A 3LI0A 1GVOA 1LP6A 4MPQA 4E0CA 1TPDA 3G1YA 2RDUA 1JULA 2AAMA 3NOEA 1V7YA 5BMXA 1RV8A 4R34A 5LHEA 3P62A 3B0VC 1X1OA 1AW5A 1GPWA 3W2JA 4ADTA 1Z42A 4GUIA 4HPXA 3NQVA 1P5BA 1C8VA 2H8XA 4R7JA 5E1QA 2X1SA 5LNUA 3DU0A 1S5WA 1VLIA 4RZ6A 4XBKA 3NQFA 1WV2A 2PC4A 3UPWA 4OWGA 5DCBA 2QDGA 1PS9A 4QIUA 4UTJA 3OA3A 2CZFA 1PE1A 2RHGA 3M47A 5G1YA 3OBKA 2Z1BA 1XC4A 2QEZA 3TK7A 1WOAA 2CU0A 1RQEA 1FCVA 1OFAA 1IIGA 1OX6A 1YTDA 3TXVA 4WOZA 4HSNA 2WSQA 2A85A 2HTMA 4NX0A 4UTTA 3QMRA 2QDHA 3TKFA 3UNDA 3NGJA 4HNUA 4MLRA 1K7XA 3BG3A 1W8SA 3PB2A 1L6SA 2J9YA 2A6NA 3M5VA 4AHOA 5F1UA 3PBVA 1KFLA 5BW6A 2EPHA 4QJ1A 4NVTA 1M5WA 4GNJA 1TPVA 5AB3A 4EVZA 3N2XA 1NSJA 4UMBA 1SSDA 2H6RA 4LC6A 1KV8A 3F1QA 4NX5A 2TRSA 3M16A 5HNRA 4JY9A 1W37A 4U4MA 3UZJA 1ICPA 3NQMA 2F84A 4JYEA 4X2RA 4O50A 3M44A 4MVAA 4O16A 3W7PA 4UTUA 4GXMA 4Y9AA 2C1HA 5EY5A 5AHIA 3L0NA 3WK1A 1OK4A 1FDYA 3FEMA 4DELA 2YX0A 3K30A 2FB2A 2WSYA 3HQ1A 3TW7A 1SZEA 3LCGA 1J5TA 1FX6A 3OIXA 3GXTA 2DZUA 5FEPA 5AC8A 1IXQA 4MZYA 5I3FA 2FTPA 4AWUA 3QSRA 1X7FA 4DO6A 2DORA 1B9BA 4JGDA 4CNOA 1K7EA 2CLKA 2ISVA 2OX1A 2Y6ZA 4MKNA 4QISA 3T7VA 3HO8A 1A5SA 1F6PA 5LGXA 4HNNA 2QCCA 4MY1A 2A5HA 1L6YA 2ZCGA 3W1UA 4RJEA 1R2SA 4FNTA 3TMQA 3TSBA 1UUMA 3TSMA 2Z6IA 2DZPA 4LY8A 5G5IA 5HULA 1JCYA 1Z48A 1KFCA 4MJMA 3LBMA 1DHPA 5AYZA 3Q58A 3BW2A 1YXDA 1SO5A 5F4WA 3PB0A 1DORA 1DV7A 2QJHA 1DOSA 1J4EA 4QNEA 3C61A 4N6EA 3N73A 2WJZA 3GYEA 3B8DA 3P5YA 1OX4B 5I3JA 2QCHA 4AWSA 2R91A 2R94A 4HN4A 3W1MA 5TQLA 5FEZA 4RX0A 2E5BA 1ZENA 1QO2A 2E09A 1TREA 1KTNA 3NVTA 3KHJA 3QF0A 2TMDA 3JRKA 4JTIA 1JRBA 2C0AA 3PVFA 2QCDB 4FHAA 5HUOA 3QQ0A 3H53A 5H2ZA 3CPRA 3M43A 5G4WA 4N02A 5EPDA 4CQAA 4JTEA 3CIWA 1S3HA 5HMSA 1BTMA 3N9RA 4WD0A 3LHUA 1IXOA 4FEZA 2J27A 4WQ6A 4IXHA 3RK8A 1B57A 4HSOA 4BR1A 2ZRVA 3M1ZA 3W7QA 3UXDA 4PC8A 3C4UA 2Y62A 1TIMA 4B5NA 4Z1DA 2E77A 3E9AA 1OFRA 2OJPA 1SPQA 4FXSA 4KKXA 3NPVA 2X2GA 2C16A 1SO6A 4HIBA 3W1RA 1JUKA 3KXQA 4TIMA 2QAPA 1HL2A 1K8ZA 3CIXA 2ZDRA 1SW3A 2O7SA 4LS2A 1QOQA 2DJLA 1VCGA 1BEUA 1KA9F 4NJJA 3FJ6A 2GVLA 1VHCA 1AW1A 3MP5A 3EX6A 1N55A 1PCKA 1SO4A 5C5YA 3W87A 4M5PA 1LROA 4FNSA 3S0CA 1QCWA 1H5YA 2VELA 3W7DA 3P81A 3LRLA 4JX5A 3S1XA 1LCOA 1FWNA 1QPRA 4LRSA 1W3NA 2FIQA 3RMJA 2ATMA 2QUUA 2VFGA 1I2QA 3FFSA 1G4TA 1MEIA 3QYQA 4UUIA 2CZEA 3IIPA 4IMFA 2PCQA 3SZ8A 4WOQA 4OV4A 3VNDA 3W2KA 1I45A 1YPIA 4H6KA 4AWTA 5U7SA 3DFNA 3HG3A 3TR2A 2G5WA 1SQ7A 2FPVA 1VGAA 2DJXA 2ZRZA 2VXNA 1EEPA 3EWWA 1K03A 2TYSA 2QCEA 2G95A 4O8RA 3ZFHA 3LHTA 1BKSA 1QNVA 2X16A 3C0JA 2WNNA 1O60A 2NV2A 5KSWA 3C2OA 2V2DA 1VC4A 2QCGA 3YPIA 4PEKA 3HGJA 3IGXA 1XBZA 3DBPA 2EKCA 3A5FA 1XUZA 3NQ6A 5D04C 3LX9A 3N14A 5LZLA 2ATSA 4RR4A 3KVJA 3O15A 4NJGA 2CWNA 3TQVA 1EA0A 1XFBA 3EXTA 3UZ5A 1NEYA 1RD5A 1JCJA 3STGA 1I2PA 3A23A 4ML9A 3NZ1A 1TPB1 3HJZA 1QR7A 1VH7A 1LM1A 3EWXA 1KM2A 1HFBA 1L9WA 3F4WA 4GFSA 2Q3RA 2E6YA 4UFLA 2P1FA 4M6QA 2Y63A 4DBEA 2VEMA 1ML1A 3FYPA 4YCOA 1G7UA 3GDTA 3VFLA 4YMZA 3W7GA 3CWNA 2OZ0A 2NV1A 3ABSA 2ABAA 4TO8A 2NXHA 1JUEA 6TIMA 3B06A 3SGUA 1M7PA 1K7FA 3PBWA 3OG3A 3N3MA 5C6MA 2YYUA 1JR1A 4UMAA 1H1ZA 4RK8A 3ABQA 3EXSA 3NQAA 4ZL1A 4E38A 3STFA 2FQIA 3GNDA 4KFOA 1VR6A 5DCEA 4LTSA 2P10A 3RLVA 4K8EA 2ZRYA 3DH7A 5IBXA 4IWWA 3L65A 4MYAA 1X8FA 4UTWA 1ZHAA 3C8FA 3G1FA 3NL3A 1F5ZA 3TROA 5HINA 1G6CA 1JCLA 1MO0A 2VOMA 4UFJA 3NZRA 4O28A 4QQ3A 3F03K 2Z0IA 3QSTA 4R33A 4UCGA 4Z0SA 2ZFAA 5CZSA 1YTKA 4AEOA 4NNCA 3W1NA 4O1BA 1J2WA 2TPSA 2BTMA 2XN1A 3LM7A 4M7SA 4O0KA 1R2RA 1K02A 1OFDA 3TIMA 3TFXA 3IVTA 3HPZA 4AMAA 2W6RA 1YXCA 1NFBA 3P8IA 3W2MA 1H62A 3W76A 4AAJA 4UTIA 4WY0B 2Y85A 4AHPA 4S2BA 2HMCA 3NM1A 1R46A 4BWLC 1PV8A 1X6UA 2J6XA 4FXRA 1DBTA 1KM6A 2DZXA 2WO5A 3OEXA 2VENA 5SWUA 1ZY9A 2Y61A 4OE7A 1VYRA 2E6DA 1L2UA 3IVSA 2V30A 3W7EA 1K8YA 3P60A 4UNKA 3IIXA 1Y0EA 1TB3A 4JR5A 3C2RA 4Y90A 1OFBA 1ME9A 4ORMA 2CLFA 2A21A 4M6VA 3W7JA 5EKYA 3W7NA 5FF2A 3G0UA 3NG3A 2QCDA 1ONRA 1IGSA 5G4EA 2YYTA 5HJLA 3ZWSA 5HR6A 3SECA 4YLWA 4ZZ9A 4ZQRA 4Y8FA 1EUNA 3I7SA 4EOUA 4AH7A 2OCZA 8TIMA 4GUGA 3G1HA 3P82A 5FF4A 3DFQA 1W5OA 4ADUA 4BI7A 1PHWA 3RU6A 4S1FA 1T99A 1QMLA 2ZZ1A 3DFPA 3M5ZA 4CQ8A 3VI2A 1O4UA 2JKEA 3P80A 5L6UA 4QM1A 1FCQA 1AK5A 3TAOA 3GK0A 3W73A 1FDJA 4LUIA 4Q33A 4JTHA 1TPC1 3G8RA 5K9DA 5LNWA 3W88A 1W5PA 1RQHA 3RLUA 5F2LA 4UTTC 2GOUA 1TQXA 3WJYA 3Q2DA 3DI1A 3DHFA 5H91A 4IX0A 1GWJA 1MSSA 1GEQA 4ZQPA 5KTLA 4GBUA 2DZVA 1R47A 1WAUA 2GQAA 1JCXA 3LDVA 2H90A 2ZYFA 3CLMA 3JR2A 1AMKA 2Y7GA 4CLMA 3IV3A 3OVPA 2A2IA 2CFFA 1I8JA 2BX7A 1LLWA 3PM6A 2A7PA 4GWEA 3TNOA 3A9IA 3S6DA 4O57A 1WXJA 3BW4A 1OG0A 2I1OA 4OQVA 1Q6QA 3W71A 3C3NA 1YPFA 3LI1A 4ZMGA 1TPWA 4WUIA 5EMUA 2ZA1A 1DVJA 2NXIA 3W1LA 4KFPA 1FY6A 5A5WA 1JQVA 1R2TA 4LS0A 3W6YA 3CU2A 5AC7A 1YADA 4X3ZA 3IGUA 4FNPA 4O54A 2X1RA 4IUOA 3R13A 4IPJA 5CPNA 2WPBA 3GB6A 2FPYA 3CHVA 3KRUA 4NNAA 4PTNA 3AO0A 1KW1A 4NJHA 1ME8A 2ISSA 4Z1CA 3G0XA 3BLIA 4NXSA 1XUUA 2YR1A 4I7WA 1DQXA 4O4VA 4O17A 4QITA 1QWGA 3HMJG 3EKZA 3MI2A 5F2MA 4UFHA 3U2OA 1Q45A 3QMTA 1ZAHA 4XKYB 3UWQA 1F6KA 4AXKA 3BK0A 4O11A 3PUDA 3N2MA 1JUBA 4FX6M 5LNRA 1HG3A 4NU7A 3N34A 5AYXA 1H7NA 1KBIA 1UB3A 3L0GA 4OBTA 3DI0A 3NYZA 3DKLA 2Q8ZA 3S1WA 5D32A 2NUXA 4RXFA 4FNUA 3O6YX 5EBUA 2CLLA 4WXZA 4XTIA 3W2NA 1GG1A 3TV8A 1WOBA 5G2IA 1KFJA 5KZEA 1WA3A 3G3DA 4K8HA 2VFIA 1XL9A 4AF0B 3UWWA 2VFFA 1GTHA 3SY5A 2LLEA 1OYCA 4IMGA 4PA8A 3NQ2A 4A29A 5IM51 1GVSA 3CC1A 3MYPA 4NXKA 3KVMA 4ORIA 2BSLA 3EWYA 2J9XA 3V75A 4HPJA 1U5JA 2NXGA 2B7PA 4K7VA 2RDTA 5DLCA 3ANYA 4RV8A 4Z08A 3SSJA 3NPUA 2ZRWA 3UWUA 4MY9A 1L6WA 1W5QA 5HWNA 3MHGA 4FNQA 3S5OA 1SZGA 1D9EA 4K36A 1X1ZA 3UPBA 3WJWA 3G3MA 1SW7A 3S42A 4N4QA 2ZZ2A 1S5VA 4EIVA 4ZQOA 2YSWA 3TJXA 4FNRA 3T44A 1OYBA 2VEIA 3DFSA 2B7NA 2GVJA 3BG9A 2XN0A 4LUJA 3QW3A 5HR7A 3Q94A 4I7UA 3W72A 3CQ0A 1TRIA 4IOTA 3IIVA 4JTFA 4GE8A 3KX6A 4NNBA 3GDMA 2ZRUA 1H63A 5K4ZA 2FFCA 3W75A 3LV5A 3TW6A 4DO4A 1HO1A 4WY0F 4UMCA 4O1DA 3B0PA 1SFJA 4UFIA 3TMLA 2QCNA 4MYXA 4JYDA 2HS8A 4LVFA 3GR7A 2VFDA 4JTGA 3MBDA 1KFEA 5KMYA 2C3ZA 3LLFA 2DP3A 4NUWA 2J24A 1YDNA 1G69A 3LXCA 3OVQA 3MBFA 4PL2A 3FLUA 3GZ3A 3LV6A 1Q6OA 2PE4A 3GR8A 4GUFA 2D73A 2W79A 4RLIA 5LNVA 3W22A 3NQ7A 3W2UA 3PF3A 5MHBA 2V81A 4PFMA 2YPIA 3STEA 2V82A 3WK0A 4TU1A 4CCCA 4UTLA 1Q6LA 3ZR4A 2V0TA 3EX1A 2TSYA 4MZ8A 5AHFA 4JYFA 4CQ9A 4H4IA 3USBA 5FEWA 1EB3A 4O19A 3EEGA 3TA6A 4M7TA 3C6CA 1PVNA 4JICA 3L5AA 3WJZA 1ZAJA 2VEKA 1BWKA 2QCFA 3W07A 4QSHA 1CI1A 3MO7A 3FS2A 3M0ZA 5DBUA 3TX9A 3E0IA 1TPFA 5HWMA 1GYLA 1K3UA 2JK2A 3HG4A 2DZTA 4EWND 4UTHA 2YW4A 3THQA 3TDFA 3MWAA 1JCNA 3LCHA 4HT3A 2E1DA 4JXCA 4TMCA 3NPXA 3R89A 3O63A 3B05A 5FF3A 3UWVA 1KLZA 2QUTA 2ZTJA 5C55A 3MUXA 2C15A 5D03A 1VYSX 2GPTA 3WJXA 3LXBA 1XDMA 3R5EA 1LRNA 3PUOA 1BWLA 3D0CA 4P2VA 4Q32A 1TO3A 1TV7A 4MFEA 1T8XA 2Y88A 3P5ZA 5HUPA 4PL1A 1XM3A 2ZZ6A 5AFDA 2FB3A 2QCLA 1TRDA 2V5LA 5IBXC 3KRSA 4JTSA 3G1DA 4UTWC 3P61A 3I7QA 3HBLA 4JTJA 3NPWA 3DAQA 2Z6JA 5DY2A 2BWGA 4FX7A 5J5RA 4O15A 1KV5A 2CLIA 1LTDA 3PBUA 4S2CA 2A4AA 1UCWA 3R2GA 3RFAA 5FI8A 1H1YA 1UBSA 5J5DA 1XBXA 3QC3A 3T55A 4LT9A 5D33A 3STCA 2QKFA 5T26A 4LVBA 1P0KA 3P8JA 3W7RA 4JY8A 1O95A 1ME7A 1FCUA 4XKYA 3WK3A 3LXAA 2FPTA 1KTCA 1OVDA 1RR2A 3TXZA 4AHQA 1KM1A 1MXSA 3PG8A 5CPOA 2B7QA 3TC7A 2VKZG 5K9XA 3VE9A 3GKFA 4IMDA 2J88A 4O4WA 2PRLA 2FLIA 2PURA 3GKAA 4JIQA 5C2XA 3PAJA 3EWZA 2NUWA 1FBAA 1H7XA 3LCLA 1H7WA 4BF9A 1V5XA 5AYYA 3W7OA 3IRDA 2C19A 5K9CA 3VKJA 3G1XA 4LOCA 1OABA 3M41A 2ZZ3A 3SR7A 3UY8A 4O14A 3UQNA 5FEXA 1PHQA 2F7FA 3L2IA 4EF9A 3I6RA 1PCWA 1EWEA 4XUGA 2ZA3A 2ZZ5A 2BLEA 1W31A 4TR9A 4A2RA 1ALDA 1TPEA 4K38A 3O8AA 4AB4A 4HNTA 4YWIA 2OT1A 3TU9A 6ALDA 1OFPA 3LOTA 4N6FA 4NJIA 1YDOA 1G4SA 2NZLA 3L5LA 3PC0A 5LSMA 4DF0A 1W3TA 3IVUA 1SZNA 4IJBA 3NDOA 3G0SA 3FJLA 3W3OA 4RCXA 2Y7EA 4G1KA 1ZAIA 1EP3A 4GUHA 2X1TA 3OVRA 5ABTA 1LZOA 2NLIA 1MZHA 2UV8G 4LVDA 3T40A 2DU2A 1A50A 3O07A 3BG5A 3EB2A 3A22A 1R30A 4L4LA 4N9DA 1Z41A 5DBTA 5I3HA 1TV5A 2YFOA 5D02A 5CZTA 5LKYA 5KZMA 4JIPA 3F4NA 5C54A 4NJKA 3LTSA 1SO3A 3U6WA 3P84A 1QPQA 1VQTA 3KOFA 1OFOA 3CM4A 4QAIA 1FXQA 3M5YA 2Y7DA 5F1VA 3S5YA
chains in the Genus database with same CATH superfamily
1F73A 1C93A 3CHDA 4POCA 3EKLA 2BZNA 3CT7A 2DIKA 1KFBA 3T07A 2ZE0A 2R9RA 3RU8X 3W81A 1UWQA 3NL5A 5A8GA 4JIEA 2V2HA 3RM4A 5G2WA 2ZQ0A 2HK1A 2HS6A 2I5GA 2WC7A 5A1AA 5CJNA 4DWSD 1YNQA 2OSWA 4A35A 2GWNA 1BVZA 4LYPA 4FXJA 4IIDA 2A3CA 3CMGA 4BI5A 1KCXA 2HNHA 5GVJA 1TSIA 2GDVA 2JEPA 3LU2A 4LYKA 1QOPA 3DDMA 3NZQA 5EL1A 1GTEA 4JFSA 3WQFA 2FZMA 3TE9A 2YCJA 4UR7A 4IP5A 3LCXA 1AJ2A 1E4IA 1UWRA 2J47A 1TYGA 3MS8A 1YEYA 3LRKA 3WO8A 2R8WA 3L5MA 1Q85A 3DKJA 5D2WA 1XIEA 4PSRA 3HURA 3ABRA 1UQYA 3QJAA 3T6CA 4Q4PA 2VP8A 1XBVA 5LA0A 2OR2A 2XVGA 2Y7FA 3L4XA 4FLSA 2CITA 3C8NA 2QVHA 3OGRA 3S8HA 2V63A 2YXGA 2PZNA 2RDWA 3VIGA 2H3DA 1Y8BA 3OGSA 3R43A 1E4NA 4QLKA 3GNOA 4JTKA 1BF2A 2QR6A 1KM4A 4KGLA 2VTFA 3BSHA 1D3CA 2E6AA 3IEBA 2E6FA 2ABBA 1E6XM 5RUBA 2PDYA 2O7QA 3KBNA 4TVUA 2PDXA 1E5NA 2C91A 3I7RA 3I4EA 4LYQA 1Z6KA 5BROA 3T78A 4NZJA 1YRRA 1TTIA 2QGHA 4XV0A 4GRSA 1ZJBA 1E0VA 1CGWA 3PR2A 1VZWA 2OQLA 4I9AA 3WEOA 1XRSA 1M7JA 1VFUA 2VWSA 1EPXA 1NELA 1QHPA 3NR0A 1EP2A 1DJWA 3O6CA 1LOLA 4GI4A 5FF7A 3UA4A 3IS4A 1DJQA 1EEXA 3W74A 2ZX6A 1GEHA 4XO6A 1XKYA 2W62A 2VEGA 2OEMA 1F74A 4ZOBA 3QV7A 5CPTA 4MJ2A 4LW7A 3PBGA 4ZQMA 4C1LA 3EX3A 1M7OA 4O12A 3VM7A 3I3BA 4OV9A 2Q8LA 2A1YA 3W02A 3HV9A 2E0PA 3B4UA 5A6LA 4HJWA 3BCFA 1UWUA 3SRKA 2DZWA 1R38A 3EOEA 3SFKA 3CPGA 4DY1A 5PTDA 1E71M 1VLWA 5C70A 4LBUA 5BXPA 4L65A 3AIQA 4IGHA 1VKFA 4DZIA 3NAVA 4C6PA 2G3NA 2QUVA 3T08A 5HMEA 3W7CA 1GYMA 3QHMA 2QUMA 2QAFA 3EA2A 4D6IA 3GIQA 1DJYA 1FA2A 3N9KA 1EGVA 3MV11 1FFRA 3O0KA 3L4WA 2V38A 3M4HA 3B0UX 3DHDA 3O05A 3TQ0A 3ZJKA 4YL2A 1TJPA 3B97A 3TYEA 3GNXA 1JAKA 4B5XA 1BXBA 1ZALA 1CZ1A 1GNXA 4MNLA 3KUMA 5CPLA 1E0UA 1QBBA 4DYEA 3P14A 2A7NA 3QQ1A 2FJKA 4PMDA 2V2CA 3TUUA 2DSVA 4E4PA 4P8WA 6CGTA 1OWQA 1JF5A 3OYXA 1RP8A 3UCDA 3UXIA 3JS3A 5B7YA 4H3DA 3TC6A 3QKEA 2ZA2A 1FRBA 2GSEA 2NQHA 5GQBA 1GVIA 3WLTA 1I2RA 1DYSA 4QJ5B 4KWOA 5I24A 4UFMA 3QQWA 4KCWA 7TAAA 3QLDA 1GOMA 1ZJHA 5M5DA 3W2LA 1E15A 1UKSA 1DTNA 2ZADA 4J1OA 4J2MA 1QRQA 1TWDA 5BRBA 3CWHA 3H54A 4F9JA 1R3VA 4KEVA 4LEFA 2PTXA 4HCDA 5HATA 3CAQA 2F6XA 3H7VA 5JMUA 1P4CA 3GDLA 1LQ0A 1FWSA 4C6OA 5F2GA 2OMAA 4M6PA 2O9RA 4B2DD 1XYMA 4H8NA 1EZ2A 1UP0A 4JNMA 4URIA 4XAZA 2ACRA 3AC0A 4JPGA 2EEXA 1H7OA 2VNCA 4DYJA 4P7RA 3HPSA 4KEUA 4KEMA 4MNKA 1H7RA 4FIRA 5DRCA 2RH9A 2FVKA 2ZRXA 2NX1A 4QXIA 2HK0A 3TYDA 1ICSA 1E0TA 1PL9A 2W4XA 1ELSA 3MI6A 1S5TA 2YA2A 3P67A 4JN6A 4H19A 1N7KA 2CW6A 3GVWA 3SB0A 3TEVA 1OYAA 3HB9A 3V16A 4I7VA 3ARUA 4HMEA 4HP5A 1ZFJA 1V93A 2FZNA 1FWJC 1TJ0A 2VEFA 4HK5A 3TAKA 1M41A 1AFSA 3B8IA 4FR1A 3PNUA 1CXIA 4O18A 2D2GA 4V1XA 2NUYA 4UC5A 1P0NA 1RPXA 3MHUA 1H51A 2A3EA 4ZEPA 4MJ4A 1IEWA 4PMNA 1DQWA 3RF9A 1FWBC 3PG9A 3LGGA 3G8EA 1TPUA 3MDUA 4Z2KA 1PZ3A 3H2MA 4LPCA 3BGJA 1F07A 4AUBA 4DLMA 4DJDD 1CT5A 4IQLA 4HD5A 3RR1A 3C2FA 3HF3A 3E02A 5D05A 1LL4A 1KWKA 3VD4A 3E49A 2VT0A 2QW5A 4GZIA 3TSDA 1LBFA 1PJ9A 2VO5A 4ALDA 3T4CA 2E3ZA 1J96A 1QW8A 2VX6A 3EB3A 1BG9A 1LYXA 2ZUWA 4A2SA 2CLOA 2Z28A 2OKTA 3SUWA 4MWAB 4ACZA 3ABOA 4C6EA 1W5NA 1B4KA 1FQ0A 4RE3A 4GYPA 3S6TA 3WBAA 1R3RA 1B4EA 3QMSA 5FD0A 1JQXA 3PSVA 1F3XA 4LF2A 1HUVA 2DZAA 3M0VA 5A8MA 3CQHA 1P43A 3T0AA 3M6YA 4QEEA 1Q3NA 3RCNA 5DN1A 4E2BA 3UPMA 4Q7NA 1JDAA 5BWAA 2QT3A 3P6LA 2GL5A 3A21A 3QH2A 1KR1A 2V9DA 4B15A 1QW9A 4J40A 1TX2A 1SJAA 2ZBTA 4CNPA 2UBPC 1GQNA 4G1NA 2DW7A 3N6QA 3PZTA 1UKOA 1B9ZA 4DRSA 1BPLB 4AIBA 5DCDA 1MZRA 3BSMA 3R4IA 3BPWA 2J9ZA 4M19A 4ZO9A 2CZVA 4BHYA 2ADAA 2QULA 3W9ZA 2VEPA 1BKHA 5LNSA 3KP0A 2QMJA 3W1XA 1UP3A 1PKMA 2G37A 1KM3A 3W01A 3K8MA 4HHPA 3DN5A 1XG4A 3QW4B 3EDEA 1J79A 1E73M 4GNKB 2CETA 1IEXA 1S2CA 1Q2RA 1AH0A 3DFOA 4HB7A 3WQPA 1H3GA 3PULA 5C71A 1TCDA 3MI3A 4AZCB 1R87A 3GNRA 1I1XA 1C29A 3W26A 1Q65A 2PEVA 3GAYA 3R7MA 2IKHA 2CERA 1IIHA 3QC0A 4LAOA 1AJZA 3QPZA 3LB0A 3LCIA 4CCDA 4G9PA 1SW0A 3KLKA 4PTXA 4CN4A 3IJ7A 3AUOA 5FESA 3SUUA 4IX2A 2E5DA 3HIJA 1LBLA 3BMVA 4XSLA 1EO7A 2WPGA 2ISWA 4MSSA 5LXXA 1TWIA 2CZ5A 4QP0A 3SCPA 4RKAA 1VFFA 4ONVA 2BODX 1XCFA 3VOIA 9CGTA 4YU1A 3GNNA 5TBOA 4LUSA 4DI8A 3EPNA 1UH3A 3PWAA 4FLOA 1GVOA 4MPQA 1PIFA 4H6EA 4HK7A 2GJXB 1JULA 1T5AA 3NOEA 1RV8A 4R34A 1RUSA 3CB3A 2EG8A 4GYFA 1RXOB 1T7LA 2EJ1A 2F38A 4ADTA 2JFEX 3NQVA 2X1SA 2OYLA 1VLIA 4RZ6A 4XBKA 3NQFA 1WV2A 2PC4A 2FH6A 2YL8A 2Z2AA 1XYCA 5DCBA 2QDGA 4NG3A 4D6JA 1OADA 1EGMA 3UZXA 1TVLA 1PE1A 2YDQA 2Z1BA 1XC4A 4HYVA 4JIIX 1WOAA 1UJQA 3BLLA 1IQ8A 4YTTA 3TXVA 4HSNA 4YPJA 3IK2A 2WSQA 2A85A 1RBAA 3UCCA 3GVQA 4XZLX 3RM9A 3WD4A 4NX0A 4UTTA 2QDHA 3TKFA 4HNUA 3PB2A 3OG2A 1FWHC 1G5AA 3M5VA 4AHOA 3XISA 4MTVA 2E9BA 1L6FA 2EPHA 1A5OC 3O0FA 4NVTA 1M5WA 4GY0A 3CAWA 1GORA 3N2XA 3QR3A 4UMBA 1SSDA 4GYJA 1KV8A 3F1QA 4IF2A 4DM1A 1K4GA 1W37A 1GKRA 3VGBA 5M03A 2F84A 4JNZA 3MUY1 4HA1A 5AHIA 2QYGA 1OK4A 2YX0A 3K30A 2FB2A 3HQ1A 4GX9A 3PTDA 3S2JA 3OIXA 3GXTA 3DCPA 2DZUA 4ENLA 3B9AA 3HV8A 1A4MA 4AWUA 2R1MA 5E6YA 1X7FA 1HKMA 4DO6A 3GTNA 4DUVA 2CLKA 5I3DA 3GHUA 2OX1A 3T7VA 3NJ3A 1A5SA 1UIOA 3LS9A 2AL2B 4AZBA 4D6DA 3BLDA 2PLKA 2ZCGA 3CZLA 4TVDA 4IIHA 2RDXA 3ID7A 3SSZA 2DZPA 4LY8A 4OECA 5G5IA 5AYZA 2WJFA 4PTMA 3GC4A 2A3BA 1JI1A 2FHBA 4WDXA 3PZIA 5H8MA 5HOSA 2JIEA 3PB0A 1AD4A 2OODA 4LAUA 1DORA 4K1GA 3N73A 2WJZA 3B40A 3GYEA 3B8DA 3P5YA 4DZHA 4TTGA 3QXBA 4W86A 5TQLA 4RX0A 3L4TA 4B5SA 1KTNA 4AQLA 3VKDA 3NVTA 4MKVA 3KHJA 3QF0A 2OYMA 2P88A 3AXHA 2VM8A 3PVFA 3WH9A 2QCDB 2V3DA 2ZVIA 4TX8A 5H2ZA 1VBGA 3M43A 5G4WA 4N02A 3RN6A 1XH1A 4CQAA 4R27A 3CIWA 3H2NA 5HMSA 1BTMA 1YNPA 2XZ9A 4FEZA 2J27A 4S3JA 2WAGA 4PMXA 1B57A 4QRNA 4C60A 2VUYA 5AC5A 4MADA 3BSGA 1A5UA 1GW9A 3N2BA 1JDDA 5FJRA 5I6SA 4KKXA 3NPVA 1JAEA 2X2GA 3A6OA 2C16A 1TKKA 1JD7A 4HIBA 1JUKA 4TIMA 1HL2A 1K8ZA 3S47A 3ERPA 4PUEA 1MDRA 3K13A 1DIEA 1KA9F 3N6JA 2AKZA 1IHIA 4NJJA 3FJ6A 1E43A 4IFKA 4HBKA 4M5PA 4XZIA 1MNSA 3OHMB 3S0CA 1QCWA 1JZ6A 4NYUA 1H5YA 3SQLA 3WD2A 4QSFA 1LCOA 1FWNA 1QPRA 3TONA 3WYZA 2FIQA 2VOTA 4PCTA 4RE0A 5HBFA 3QYQA 3CHFA 4IMFA 1UG6A 3SZ8A 4EPBC 4JBRA 4WOQA 1IZJA 4OV4A 5GNXA 5CG0A 1WAWA 3VNDA 3W2KA 1I45A 4PUNA 5D9MA 2WM1A 3HG3A 2FPVA 1VGAA 1E4MM 1TA3B 3AOFA 1EEPA 3EWWA 4R88A 2WCAA 1NM9A 3NSXA 1D8WA 4MB3A 2G95A 3JW7A 1BYCA 3ZFHA 3LHTA 4GYPC 2X16A 1QNVA 3AXXA 3IJ6A 2WNNA 4ZTXA 2NV2A 1PWMA 2GSHA 3C2OA 3H4XA 3CUGA 1UD8A 2QCGA 2E67A 1U30A 4ZE4A 1XCXA 1VBJA 1N8WA 4B5TA 4NP7A 3DBPA 4PB4A 4B5UA 1VIZA 1XUZA 3NQ6A 2RJHA 1K6AA 1A5KC 2ATSA 3KVJA 3O15A 5E09A 4BQ3A 1DE5A 3TQVA 1XFBA 3KCLA 3UZ5A 4C91A 4BKNA 1JCJA 3STGA 1BAGA 3NO3A 1TPB1 1VH7A 3AYSA 5FJIA 2CPUA 1L9WA 3F4WA 4GFSA 4YHEA 3GSMA 4GX8A 2PSNA 1TCMA 2V68A 3R0UA 4EK7A 3GDTA 2Q09A 3NZGA 2F61A 2OZ0A 3ABSA 4DN1A 3VK5A 3BUVA 1M7PA 4GKLA 1HQTA 3WNOA 2PWDA 1TMLA 4IFOA 2FMNA 1KXVA 1PX3A 4FF5A 1O5RA 3ABQA 2BFGA 4ZL1A 4E38A 3STFA 4S3DA 4LTSA 3RLVA 3LGDA 1ITCA 3WFZA 3DH7A 5C7VA 1IZKA 3DFYA 3N15A 1X8FA 1G1YA 2EPLX 3RDKA 3G1FA 3NL3A 1F5ZA 8RUCA 1JCLA 1MO0A 3NZRA 3E38A 1Y7VA 4QQ3A 1IR1A 3F03K 2Z0IA 3RX2A 5H8PA 2O56A 3QSTA 1EH9A 4R33A 3VKKA 1YTKA 1NIUA 2FHFA 1MQPA 4XVDA 2IUZA 4D71A 3LM7A 2ZC8A 3WLJA 3WDIA 4O0KA 3W37A 3TIMA 3TFXA 3FEQA 2I17A 3WBEA 6PTDA 3R0KA 1XH0A 1TR1A 5CZKA 3W76A 4AAJA 4J3TA 4UTIA 3MA8A 4WY0B 2Y85A 4AHPA 3EA3A 3SCOA 2EPKX 1X38A 1ZY9A 4M0XA 3ES7A 3TZNA 3MJMA 5HK4A 2E6DA 3W24A 4PB5A 1L2UA 3IVSA 2V30A 3GFZA 5CLWA 1Z8AA 3HN3A 1DTUA 2XINA 3KDNA 3BOLA 2D2OA 1Y0EA 3JU2A 1TE1A 1T41A 4IIBA 4WDWA 4Y90A 3AZTA 4YTUA 4XD4A 2ZC1A 3VMPA 1C90A 2A21A 1RSCA 2KX9A 2VRQA 4IG2A 3NG3A 5KEZA 4E2OA 3SIMA 2PAJA 1OT1A 5HR6A 3SECA 4LFYA 1EUNA 1OZMA 3G2GA 3WL0A 3PJUA 4XAFA 8TIMA 4GUGA 2OX4A 2EQDA 2XSAA 6A3HA 5LA2A 4BI7A 3C3UA 4WF7A 4CQ8A 3P80A 4QM1A 3LPPA 1FCQA 2OQHA 3T1GA 3EPOA 5I06A 3BAWA 2Y1HA 3GK0A 3WH7A 1SJDA 3RPDA 1FDJA 4Q33A 1VFTA 3OQEA 1GOIA 1JIBA 2IMRA 3OBAA 3KP1A 5K9DA 2J78A 1S2VA 3RLUA 5F2LA 4UTTC 2GOUA 2H9AA 4HU8A 2WLZA 3WJYA 3Q2DA 1VEMA 1ZTVA 3FHAA 4G5DA 4J5NA 1WAUA 1F4HA 4CLMA 3OVPA 1CLVA 1I8JA 2BX7A 3PPCA 4HTBA 2A7PA 3AAMA 3TNOA 3IV8A 4PE8A 4J4KA 4J2PA 2YLLA 3BW4A 1OG0A 2I1OA 4S3EA 4H04A 3W71A 3LMYA 2PDJA 3VFCA 4V28A 2IQ0A 2X0HA 2Z24A 2NVCA 1KRAC 3H2FA 2Z27A 4JIHA 5AC7A 5JBFA 5E70A 1Q8JA 4IUOA 5CPNA 2WPBA 1BYAA 2QPUA 4WVXA 1BHGA 3WMSA 4EE9A 1W91A 4NZ1A 3KRUA 1ME8A 2FDMA 2ISSA 4Z1CA 2QJMA 2XFYA 3AMDA 3BLKA 4FS9A 1XUUA 9RUBA 4O4VA 4O17A 3ZIZA 1Q45A 3QMTA 1MW0A 1ZAHA 3VD7A 4XZNX 1J0IA 3WLNA 1YE4A 4O11A 4DAFA 3N2MA 1JZ4A 3N34A 1H7NA 1KBIA 3L0GA 1LWIA 2BP1A 3IAQA 2Q8ZA 4RXFA 2WCSA 3O6YX 2CLLA 4LB4A 2QVNA 2X0SA 1B90A 2XG9A 1GG1A 2GDQA 4TQTA 2VRJA 5G2IA 1A5LC 1RBLA 3G3DA 1XL9A 1F61A 2P76A 1GTHA 3CASA 3SY5A 5I5RA 3NQ2A 1JYXA 2PP0A 4D6HA 2J7GA 3EWYA 2J9XA 3V75A 2EJAA 4PCPA 2NXGA 3KDOA 3AS0A 4K7VA 2WWCA 3QBUA 3SSJA 3NPUA 3SDOA 4ZB5A 4MY9A 1W5QA 3S1GA 3UFYA 1B5TA 2PDMA 1IWPA 2BVTA 4EXAA 3MHGA 4GIAA 2OGJA 2HWGA 4FNQA 3S5OA 3M64A 1OINA 2XVLA 3LA4A 4W8BA 3S42A 4WKAA 4A3HA 2ZZ2A 1S5VA 4I3GA 1TV3A 2YSWA 3EA1A 4B9ZA 3MC5A 3T44A 4PMQA 1OYBA 4ZO7A 3F2CA 2VEIA 3LPFA 3VGEA 1EYWA 4A05A 4XZHA 6ENLA 2XH7A 1HP4A 4I7UA 3W72A 1XD0A 3CQ0A 3UCQA 1W1IE 3IIVA 4QCEA 2HVMA 2WSPA 2PWEA 1H63A 3IJIA 2FFCA 5IFTA 4NI8A 4DO4A 3WEZA 4WY0F 1U5HA 3PK7A 1PX4A 3B0PA 4ASTA 4JAWA 1SFJA 1MFVA 3AXMA 1MRQA 2QCNA 3UR5A 4JYDA 3A4AA 2J8FA 2HS8A 4H9ZA 2YBTA 1KFEA 1XIDA 4H41A 4P7NA 1VFSA 3FLUA 3RITA 2WK2A 3EMCA 3GR8A 2D73A 4RLIA 3GH7A 5MHBA 2V81A 2NQZA 7REQA 3DC8A 4M3PA 4XZWA 4J3UA 4ZOCA 4CQBA 3SRFA 4B9YA 4UNIA 1IGWA 3EX1A 2TSYA 4UOJA 4CQ9A 1ISXA 3BDKA 4XB3A 2O4MA 3D3AA 1EB3A 3N6HA 4Q8MA 3LZ3A 3MKKA 5JIPA 1NARA 1ZAJA 1BWKA 2RGMA 3WL1A 1YQ2A 5DBUA 3UP8A 5T9BG 1JD9A 2P3EA 1CGVA 2KAUC 3Q4DA 1NP0A 4H7CA 4AD5A 2JK2A 4WJ8A 2OOFA 4H1ZA 3TDFA 1Q6DA 3LZ5A 3O63A 5A6KA 3B05A 5FF3A 3UWVA 3LG3A 4GY1A 4LCRA 3ZO9A 1KLZA 2ZTJA 5C55A 2C15A 2GZXA 5C9RA 1ZQ5A 5D03A 2W5FA 3WJXA 5CH9A 1XDMA 1V0NA 4YJ5A 1OSEA 1MRAA 4P2VA 3BTNA 1T8XA 4IT1A 2PTDA 3KBVA 1TRDA 2ZWYA 6XIMA 3G1DA 4V15A 2CHNA 4LALA 3I7QA 3HBLA 1QI2A 4RW5A 3DAQA 2Z6JA 3AXIA 5DY2A 2OWWA 4FOJA 2DW6A 1JPIA 1H41A 2IPFA 3PBUA 2E9MA 4A3QA 1W1YA 1FH7A 1HX0A 1V0KA 3HU7A 3QC3A 5A8OA 1A49A 3WENA 5FAJA 2GFTA 1EYEA 3WLQA 4DBWA 3STCA 4Q3MA 1H11A 3BOFA 1O95A 2P0IA 4DO7A 1FCUA 1O5QA 3WK3A 3LXAA 1OGBA 2FPTA 1VBRA 3GTXA 1RR2A 1HVQA 4NZ5A 1KM1A 1MXSA 4L9XA 4WSJA 1VJSA 3TC7A 3UG8A 4DIAA 4M82A 3GQYA 4IMDA 4DX3A 2PURA 4JIQA 3EWZA 1FBAA 4INFA 3ITCA 3LCLA 1V5XA 3S83A 3W7OA 3H70A 4AVOA 2AMGA 3QHNA 4AWEA 3VKJA 8CGTA 4LOCA 3B8UA 1UA7A 3M41A 2ZZ3A 3SR7A 4HCLA 2BOGX 5FEXA 3MSGA 3KOYA 1J5SA 3IJ9A 3BMXA 3I6RA 1XIGA 1EWEA 4EAMA 3KWSA 4KIRA 2PU1A 4H00A 4TR9A 4A2RA 1WZLA 4L6DA 1OFPA 3S5SA 3BJTA 4QAWA 3FYYA 4PMZA 2X1IA 2FZBA 4C6JA 8XIAA 4XSMA 4DF0A 3SFWA 3IVUA 4IJBA 2AGTA 3WMLA 2FZDA 2FJUB 4RCXA 4DJFA 1J6PA 4O1EA 4GUHA 2PWFA 3OVRA 2UV8G 2ALRA 2D20A 3T40A 2JALA 2DU2A 3SCQA 1R30A 3ITYA 4L4LA 1Z41A 2VZVA 1PSCA 2NV9A 4U2YA 5D02A 3FV9A 3ALGA 1CWYA 1XH2A 4V2XA 1EZWA 2GVEA 1FXQA 3M5YA 5REQA 3RPMA 1FOBA 2CC0A 4P5UA 3E2RA 3F4VA 3GXPA 2XWEA 4IQEA 4JKKA 4W89A 1HJWA 3B03A 3FN9A 3I3EA 4A8LA 5A6SA 4JFVA 1Q6FA 3PJTA 5K7JA 4C6IA 5FCZA 3N29A 2G50A 1B3XA 4J35A 3U8GA 3W6LA 1NFPA 1UJPA 4GCAA 5AYIA 1KKRA 4O13A 4XTDA 2VZOA 5C9ZA 3SCWA 4CQCA 1SZFA 1GVEA 5F4SA 2A6LA 3JZEA 3FA5A 3C86A 3K4DA 3UJSA 4XQ6A 1A4LA 5FA5A 3ZVHA 4N42A 5E6ZA 4Q4RA 3RX4A 4U28A 3CH9A 2KZHA 4HN8A 4EACA 3LHYA 1EJUC 4YCPA 2AQOA 5CLTA 4R85A 2V5KA 1YDYA 1TPH1 1VRDA 4GUJA 3GC5A 4LXFA 2CBVA 5U4NA 4FF7A 4DO5A 3N1AA 3T4WA 4NRRA 1UWAA 1OFEA 4TX6A 4S23A 3IIZA 4ZB0A 4MZ1A 4AFYA 3WDPP 2ZICA 4XD5A 5GPRA 2C6QA 4G7EB 1A5BA 2DT3A 3O06A 4PFHA 3B9OA 3CMJA 4C7DA 1ADOA 3BV4A 3GX9A 3UR2A 4AC7C 3T42A 1ECQA 1EJWC 3TWBA 4FSAA 1EXPA 1GHSA 3NDYA 3PZGA 4PUDA 2J7CA 1REQA 2R82A 1GOXA 1PIIA 1LG1A 1XRFA 1RJRA 1JGIA 3O6AA 3CPUA 2B0MA 5J8LA 4CNSA 3MCMA 1O5KA 2FH8A 4K2SA 4C6KA 2RFGA 4UBPC 4CEUC 3LERA 2ACSA 2RAGA 2BY3A 3URQA 3NDZA 4C7FA 4OT7A 4EAYA 4L1WA 3GHTA 1NWSA 3TJIA 1B1YA 1E51A 4BEQA 2NW0A 3BW3A 4Z42C 5AHMA 4C5YA 3BLPX 3T8LA 1FH8A 1RCOB 3VNJA 4XAPA 2BGNE 4KS0A 3SRDA 4Y2WA 3QOMA 4HTYA 2P3ZA 4RXGA 3PFRA 5BRQA 4YTRA 3LBCA 1JZ2A 2GK1A 4JL1A 1OGGA 4ZE5A 2DSKA 3CGTA 3N4AA 3W7HA 4AIOA 3V3WA 2ZX8A 5XIAA 2WMJA 1HTIA 4H6RA 3R12A 3QV9A 2V6AA 3RO8A 3FHQA 1S1RA 4Y6GA 2WOQA 3MYOA 5AHLA 3M46A 3W1QA 1R5YA 4AMCA 3W29A 3VD9A 1XF0A 4Q4SA 4DUWA 4KBXA 5C2CA 3BARA 2NSXA 3G1AA 2J7HA 3AHVA 1CCWB 4L56A 3G77A 5CSSA 3Q37A 4GGHA 4ACZB 3GG7A 1I2OA 4FAMA 4O0ZA 2BHYA 4N9BA 2ISFA 5LIKX 1T0OA 4LC8A 1FFQA 4U33A 3W86A 2YFNA 1J01A 2DDXA 1UP2A 2YCEA 4MMWA 4UTKA 3VE7A 2GVGA 5HJYA 1MNZA 1AA1B 1HO4A 5HWJA 1T40A 2WYSA 2E8YA 1CXFA 4XWUA 1UMYA 3W1AA 1ZNNA 7A3HA 2QV5A 2WMIA 1IEQA 3MVIA 4E3VA 3DEQA 1BYDA 2UY2A 1LQAA 1THFD 2XH0A 1Y5VA 1CGUA 1PBGA 4IGSA 3CO8A 1CX9A 3LTPA 3ARVA 1TE6A 1ZBCA 2X2YA 3D5HA 4B91A 4O10A 1OD8A 2PCEA 5AHNA 4LV4A 2NWSA 1A3HA 4DYKA 1SM9A 5B80A 5D38A 2WANA 4QQUA 3ITTA 5BWFA 1E6RA 1MUWA 3MHFA 4WXYA 2E7FA 2YDAA 3WF1A 3E2SA 1XI3A 1ZUAX 3MV01 1CXEA 3NWRA 3V1PA 2C13A 5A6JA 3UWZA 5I00A 1L6GA 2GJPA 2CHRA 1VEOA 3UG3A 3W85A 3EYPA 4ICNA 1VCVA 3W7MA 4F4RA 1VS1A 3D46A 3DIPA 1M6JA 5AKQA 1I4NA 4NQ1A 5CAKA 1TQJA 2QPXA 3A24A 5DMYA 1RZMA 2Y8KA 5FJJA 3SY1A 4PMRA 3ISIX 1E5JA 2PZ0A 3TFCA 3MDWA 3E96A 1KCKA 1GJPA 3BZGA 4C1NA 2J66A 2PI6A 5C9XA 2Q3OA 3G1VA 2XU2A 1EQPA 4DQWA 3UY7A 3UBPC 5I02A 4D6CA 1QO5A 3LQGA 1AW2A 2X09A 3WNNA 4WZHA 1VJZA 3GTHA 4LRTA 1O6IA 4IPLA 3VIKA 2WCGA 4H9UA 5FSDC 1K8XA 2DY3A 3ATZA 3VX0A 4UTFA 3AIBA 2BBFA 1M65A 1H0IA 3G1SA 3O16A 4DPQA 1VFHA 1GVYA 2ZUSA 4EKJA 1FWAC 2OB3A 4LUSB 3N9SA 1TZ9A 1WBJA 3ICJA 2C7FA 1QAPA 3L0KA 4O53A 7TIMA 4N2YA 1T8QA 4XKMA 3SADA 2DZSA 4JD4A 4DWDA 1US0A 4UQDA 3CEUA 1U33A 2GUUA 1RY8A 3GE7A 1UWIA 4CN1A 3IJ8A 5DRIA 4OTKA 4O1CA 3WY1A 1ZBWA 5D2XA 3TQKA 5IHRA 1EGZA 1QHZA 3IWPA 1IE7C 4MY8A 3B8SA 1F4AA 1QI0A 1IT7A 4JTTA 3QGVA 3VPLA 1WBHA 2VGBA 3KRBA 1DKWA 1OCJA 2NQLA 2NX9A 2VQTA 1EKOA 1XV8A 3BLFA 4PH6A 2XIIA 1B3VA 2V8ZA 1VENA 5CC3A 3MJYA 2R1LA 2OSXA 2JGYA 2INEA 2UY3A 4HCHA 1CTNA 1PTGA 3W1TA 5D30A 4DJFC 3AMKA 4PCFA 3TLLA 4NT0A 2QJIA 1JCTA 5BNKA 3ITOA 2ALDA 3GDRA 5DELA 5DXYA 4WJXA 4XX6A 4HPGA 1B2YA 2NT1A 3O1NA 1JDFA 3N25A 1GOOA 4AVFA 5D9PA 4MWAE 3BGGA 3UYCA 3UVIA 1RAKA 4JX4A 1BVNP 3CEPA 1GKPA 1K9TA 1R9YA 4FB7A 1E6NA 1R7OA 7ENLA 3WQ4A 1F2JA 2FHCA 4IGMA 3MTWA 1PIGA 2WMGA 5KZDA 1GJUA 1G4EA 1RJPA 2WMHA 4OHQA 3H55A 4C6MA 1NU5A 3V5OA 1ODUA 3SJ3A 4W7UA 4O0QA 1W54A 4LB3A 3NQCA 1AH4A 3AXKA 1TV8A 1LDCA 2FDSA 3B04A 3M7SA 5D37A 1HGYA 1LOQA 1UYQA 4I8YA 3URBA 2A0NA 3M0HA 3DENA 4GHRA 2P8CA 3PJXA 3PFMA 1WXZA 4DBDA 3N13A 2PS2A 2HE5A 1XQKA 3BOXA 1AH3A 3NQDA 3HQPA 2PD5A 2WKJA 3EX4A 3B3DA 1HJQA 2PGWA 4YN5A 3RUBL 1WQ5A 3EWUA 2QCMA 4TUFA 3DX5A 3VKCA 2G96A 2EGZA 1EUAA 1V51A 3CS2A 1NF0A 3UF9A 4PTWA 4UNLA 5KINA 3ZZ1A 3QFWA 5JBDA 3NSNA 2PWHA 2W0UA 3GRIA 1RVGA 1I2NA 4KF1A 4B4HA 2ZZ7A 4NAEA 3BV7A 1O12A 2EPMX 3AQUA 3CV7A 3VIPA 2FVLA 4IFRA 3UYIA 1CW2A 4N9EA 3G24A 3VCRA 4DPPA 4QLLA 1BQGA 2GQ8A 3PHAA 3C0SA 3GTIA 4D2JA 3HQOA 4IHCA 1Q66A 1HNYA 4RZ5A 2PDGA 4HVXA 1GYNA 2VQUA 2PDHA 3NL6A 4ZCWA 2EAWA 4E8DA 4NAFB 5I77A 2ZTKA 3MT1A 4CCEA 2E68A 4MJZA 2CEQA 3A5VA 3U57A 3V7PA 2V5BA 3WH5A 2XGBA 1BF6A 4REQA 1H60A 1OF6A 3NQ8A 3M0LA 1LBMA 1HXJA 4HU4A 4GO8A 1FKWA 3N2TA 3M5XA 5A8PA 4IMEA 1WZKA 3EWDA 1KM0A 3INPA 2OWXA 1U2YA 3KAOA 3LI0A 4CNUA 3WUBA 1ZU8A 3G1YA 2RDUA 2AAMA 3VZYA 4J7RA 1GZ1A 2DGAA 8A3HA 4HPXA 1C8VA 2H8XA 1A0EA 3KS5A 1TX0A 4DWSA 5XINA 4CU6A 4OWGA 4KPLA 3AICA 4GC3A 2QNEA 4UTJA 3IK4A 3UG5A 3TN4A 3RGTA 3KOXA 2V3EA 3WQ5A 2GLKA 2ZUMA 3GNPA 3TK7A 3ZR6A 1JZ7A 1RQEA 5I23A 1OFAA 3PWIA 3SJNA 1GQLA 1AZ1A 1YTDA 1P1MA 3BJSA 4US5A 1E6PA 2OEJA 5E0CA 2O9OA 1W1TA 3UNDA 2GSJA 3B8VA 4MLRA 1W8SA 2DQWA 2TAAA 4BY3A 1H09A 2A6NA 1RJQA 3PBVA 2BXZA 1V0LA 3M07A 1EOMA 2PA6A 3U2CA 4CEXC 2HXUA 3P0WA 3E1F1 3L4VA 3QY6A 2TRSA 4JYEA 3NQMA 3E0LA 1GCYA 1FWGC 3M44A 4MVAA 2D22A 1PEZA 1MQRA 4AXNA 3GR4A 3L0NA 1P0DA 2WSYA 3CZKA 1SZEA 3V0TA 2IPGA 1FX6A 2DQXA 2IKJA 1IXQA 4IQJA 4YVXA 3MUIA 3CHEA 3VMNA 4I6VA 2DORA 3F7JA 4Z17A 2ISVA 4MKNA 2DIEA 1DWFM 4PCSA 1F6PA 2F6KA 5JU6A 4ZR8A 1J0ZA 2QCCA 1L6YA 3F2BA 3W1UA 3OZYA 4C65A 1R2SA 4FNTA 3TMQA 1CXKA 1O66A 2GGJA 2J62A 3TSMA 1GOQA 1TZZA 1JCYA 1Z48A 1KFCA 3VOHA 4MJMA 3LBMA 1FHDA 2VCCA 4JKLA 3WDQA 2YCLB 5DT7A 3WD3A 1SO5A 4ROPA 2VGFA 5F4WA 2QJHA 1DV7A 1J4EA 1DOSA 3N12A 4MM1A 1XSIA 1OX4B 5I3JA 2R94A 3K8LA 3AS3A 3H2EA 1BQCA 2J7DA 4HU3A 1ZENA 1QO2A 2E09A 4IUGA 3NTYA 1TREA 5A94A 1UR2A 1E6QM 2INZA 1V6WA 2VR2A 4ICCX 1UD4A 4QEHA 5TNVA 1UMLA 1HJXA 1MUCA 2C0AA 4FHAA 5CPSA 3QQ0A 4M80A 1MYRA 3VNMA 1BD0A 1XWYA 5EPDA 4H83A 1HJUA 2ZOXA 4WD0A 1IXOA 4WQ6A 4ZO6A 4OBSA 1UQZA 3T2PA 3TYBA 2Z1XA 4Q7BA 4UB9A 3UXDA 5HQMA 3C4UA 1XRVA 4L80A 2E77A 2BB0A 5FIPA 3PWGA 1PDZA 2XPKA 2QAPA 4H9TA 3SCUA 1WZMA 3TYUA 2DSWA 1SW3A 4LS2A 3ZJ7A 1BEUA 4GVFA 4I9TA 3B9NA 3RM8A 1H0GA 3MZNA 3VXGA 1AW1A 3EX6A 3VGFA 1SO4A 4IPPA 5C5YA 3W87A 4AVNA 2D69A 4CNTA 1V02E 1LROA 4FNSA 2GDUA 3W7DA 3AHZA 3LSCA 3LRLA 2D2JA 4MB1A 1G4TA 1MEIA 2J8GA 2WJDA 5JIWA 3T9PA 4OIFA 6REQA 2PDBA 3ZXWA 2HNEA 4C6QA 2PGRA 3PZVA 3TR2A 2G5WA 1SQ7A 3E5PA 2ZRZA 2VXNA 4GKTA 3PJWA 1YBQA 2TYSA 1NWRA 4L9YA 4IPNB 4O8RA 2WB5A 4LANA 1BKSA 5LXEA 4HHHA 3SN0A 1EBGA 1X98A 1O60A 4P8UA 2V2DA 2GUBA 3YPIA 2J13A 3QGAC 3CHCA 4PEKA 2PDWA 1NDWA 3IGXA 1NWUA 2EKCA 3OB8A 5CC7A 4RR4A 4NJGA 3DYMA 2CWNA 1NEYA 4QS5A 2PDKA 1I2PA 2D24A 4B2DA 3NZ1A 3KBSA 5I2UA 3HJZA 1QR7A 3EWXA 2E6YA 2P1FA 3BC9A 3CK5A 4DBEA 1YIXA 4GOAA 1RLCL 4TTUA 4CU7A 3GYCA 1K9EA 3W7GA 3OVGA 2NXHA 1JUEA 2OGYA 6TIMA 3QY7A 4MAZA 4XIAA 1OB0A 5A6BA 2YDSA 2YZ5A 3N3MA 4OZOA 1WKEA 3S3GA 4UMAA 1H1ZA 4RK8A 2G41A 4ICMA 1AJ0A 1BSIA 5FOOA 2FQIA 4U5KA 3RJYA 4H2CA 3VD5A 3WDHA 2FVMA 4I6KA 3F4DA 1JYNA 4PYSA 3R0DA 2PP1A 1TJ1A 1ZHAA 3EWCA 3ZT6A 1G6CA 2AAAA 2ZUTA 4O28A 4GFIA 4D72A 1KD0A 2OXNA 4ES4A 2OKOA 2EG6A 1V0MA 5EMMA 4O1BA 3MWCA 4M7SA 1RK5A 1OFDA 4AMAA 1QUMA 4A6GA 3W2MA 3DYOA 3VDGA 4P7OA 2YCIX 3H24A 2AQVA 4DJDA 3AYRA 3MKCA 5A2CA 2J6XA 3WSUA 1KM6A 3THCA 2FMOA 3OEXA 5SWUA 3OYZA 1W9PA 3RRXA 4OE7A 3WCZA 3KBMA 3MCOA 2D0HA 1B3ZA 1YW1A 3S2MA 4H7ZA 3SCNA 2OZ3A 2BASA 4JR5A 3C2RA 1OFBA 1ME9A 4DVOA 1I1WA 3GU2A 3GHSA 1WKFA 3W7JA 2BS9A 5EKYA 3GIPA 1CGYA 5FF2A 2HPIA 2Y4SA 1K9FA 4DZ5A 5G4EA 3ZWSA 3UZWA 4YLWA 1Y65A 4ZZ9A 2E9LA 1WDQA 3CV2A 3G1RA 4DWSC 2Z00A 1CLXA 1F8MA 3DFQA 3NYDA 4GZJA 4QROA 4ADUA 4DXXA 4KWUA 1T99A 3SQMA 3DFPA 3M5ZA 4US5D 2JKEA 3ZT5A 2PWVA 2Y24A 3W73A 3CUZA 3LMZA 4F0SA 1NDVA 1DXIA 3W88A 2OWCA 2W66A 2ZX5A 3KCOA 1E3XA 3GBEA 2ZIDA 3U5YA 2WZIA 1MSSA 1GEQA 4B3LA 1R47A 2H90A 2R1NA 1VAHA 2Y7GA 4WGHA 1BXNA 1UR9A 1LLWA 4NIRA 1GOWA 4GWEA 3A9IA 2PTYA 4IISA 1AVAA 2WSKA 5A6MA 1A3WA 3C3NA 1XGZA 1YPFA 2F9RA 1TPWA 1AUSL 1X6LA 2AOSA 4YNGA 2NXIA 4KFPA 1BSLA 1FY6A 4ZXLA 1R2TA 3W6YA 3GUGA 1YADA 3CL7A 3KTSA 2HDJA 2X1RA 1IEVA 4B90A 5FAGA 2E28A 3BZJA 1NDZA 3VIIA 4NNAA 3M0YA 1UZHA 2XZ7A 1MXDA 2X05A 1DJGA 4H9VA 1EO5A 3CUJA 4KW2A 1KXQA 3HMJG 3E0VA 4UFHA 3U2OA 3RCYA 4AXKA 1G0CA 3PUDA 2ZDSA 3QKZA 4FX6M 1VB9A 3NXLA 5AYXA 1OCQA 3VYLA 1UB3A 1I6NA 3DKLA 3GG8A 5D32A 2NUXA 4FNUA 3FA4A 4QBXA 4A8IA 3BJFA 2FZ8A 4MB4A 4ZSTA 3VIJA 3GS6A 3H22A 1KFJA 1WA3A 3TTSA 1FWCC 4AF0B 2VFFA 2I5QA 3SURA 1I9CB 4AC1X 1PPIA 4LYRA 4D6FA 4A29A 1GVSA 1S2TA 3MYPA 3K46A 1NP2A 4NRSA 4NXKA 1IR2A 1GHRA 2BSLA 4XK2A 1E6ZA 1XHGA 1TUXA 5I03A 3MSRA 4TXEA 2DVXA 1E6SM 1HIZA 5LA1A 3CAVA 3BMWA 3BICA 2G4FA 3BAXA 1JPKA 4ATLA 3TC3A 3H2CA 4J28A 1X1ZA 1SW7A 3RILA 3VC5A 3RO6A 4ZSUA 2A79A 2X7WA 2B7NA 3BG9A 4QCFA 1BWVA 3K8KA 2XN0A 2BY1A 3QW3A 1DWGM 4FK9A 4Q6XA 2DSUA 3Q94A 4GISA 2D23A 3KX6A 2P53A 3GDMA 2ZRUA 3AIUA 4EPKA 4KETA 1S1PA 3UGVA 3GUWA 4XISA 1KQZA 2BDQA 1CPUA 1I0BA 4L9ZA 1VP5A 4UFIA 2ZXDA 4GGBA 3TMLA 4MYXA 3AMLA 4EX4A 5JXQA 3ZLFA 1AODA 4LVFA 4CD5A 3M0JA 4JTGA 1OG6A 5D9OA 3IJDA 1GONA 3AIEA 2PODA 4QDMA 5KMYA 2C3ZA 3KLLA 4X9YA 2OPJA 4NUWA 4C6BA 3T0TA 2PDCA 2ZX9A 5LNVA 3NQ7A 3W2UA 3WF0A 3CIVA 5CJ5A 2V82A 1B30A 4AW7A 3ZR4A 2V0TA 1S5NA 5AHFA 1V77A 4JYFA 4DJED 2XYLA 4O19A 3TA6A 2XGZA 1JZ8A 1EDTA 3C6CA 3WJZA 2VEKA 2PDPA 2PWGA 4PB3A 3W07A 4QSHA 1CI1A 1LUCA 3U9IA 3M0ZA 3TWAA 3TX9A 4D9PA 2GGIA 3RMEA 3DYPA 3ZMRA 4H8UA 1GOKA 1PZ1A 3PAOA 4Q4MA 1XYBA 2WHLA 3PPHA 3E5BA 1K3UA 3NEHA 1REQB 2DZTA 5CJMA 2YW4A 1ITQA 3THQA 3QTPA 4KRZA 3LCHA 4GY7A 3MCNA 3VNIA 5A6BD 3R89A 2R24A 3W82A 3BH4A 3CQKA 4N7QA 1CECA 4L6OA 2QUTA 2OEKA 3A3XA 1G9HA 3MUXA 4W5ZA 3UXKA 1QT1A 4ZB2A 3LXBA 4DM2A 3VMOA 1LRNA 3UR8A 3TN5A 4Q32A 3CYVA 4MFEA 2J75A 1Q4NX 4QDPA 5JQ9A 3P5ZA 1XM3A 3IGHX 1CEOA 2V5LA 3TN3A 1ZZMA 4GNVA 1CB2A 1RBOB 4JTJA 3FXGA 4FX7A 5J5RA 2CCRA 2CLIA 4S2CA 5ECUA 2GK1B 2BHUA 2RJGA 5CEWA 3R2GA 1POJA 4HPHA 2UY5A 1EDGA 1UBSA 1EC9A 2XM1A 3ABZA 2DUXA 3W4RA 2GYIA 2O0TA 4HMDA 4LVBA 3W7RA 3F5JA 4JY8A 3VAVA 4XKYA 3GXMA 1KTCA 3TXZA 2HPMA 5DF0A 2IS7A 3PG8A 1TVNA 3TN6A 2OO0A 1V3IA 3W53A 5K9XA 4C7GA 2J88A 2PRLA 3GKAA 3PAJA 5CGMA 2NUWA 2EPNA 2C1IA 1EF3A 1YX1A 4I90A 3SBFA 3OLDA 1FHVA 2FYMA 3UEQA 3C5QA 1JF6A 4O14A 3OZPA 2F7FA 1VPYA 3L2IA 2OTDA 1E3ZA 3LQLA 1PCWA 3AI0A 1U22A 3DECA 1W9XA 2ZZ5A 3T05A 2WMIB 1C7SA 3O8AA 2OT1A 2REQA 6ALDA 1W1VA 3LOTA 3WFLA 4LQ1A 1ODZA 3VVGA 4ML4A 4DUXA 4IGNA 3BWWA 1G4SA 2NZLA 5LIYX 3PC0A 1WPCA 5LSMA 4PRTA 2BVDA 3UETA 3GW3A 1YMYA 4IH3A 4G1KA 1ZAIA 1VBUA 4G8TA 3QV8A 1LZOA 4LVDA 3IUDA 3FJ4A 1ZB5A 4JQ3A 1TZ7A 5FACA 5I3HA 3GDBA 3QLLA 4W5UA 2YFOA 3DBNA 5LKYA 5KZMA 3VUPA 4TVCA 3D3FA 1PO9A 2PLMA 3VGDA 1TR9A 2J4GA 3U6WA 1O1ZA 3P84A 1NQ6A 3KOFA 4QAIA 2NLYA 4IIEA 1KGUA 1XFCA 3S5YA 4KRTA 3OLGA 4JTLA 1LWHA 5HA7A 4O52A 5EGRA 1HGWA 4Q8UA 1WKDA 1OFQA 3QPEA 2R14A 1BYBA 4F0LA 1OEPA 1TMQA 1Q6RA 4FIQA 5EU9A 5G2HA 2QQ6A 3SQSA 5IRPA 1XYAA 4LBRA 2OLAA 3L2MA 3THAA 3TTOA 4W9TA 3CB8A 4DF2A 4GO9A 1EHAA 4GD0A 3QFEA 4JTRA 2BOFX 4IXXA 3PY2A 3V36A 3COTA 3HG5A 2OYKA 1SYTA 1A53A 1W32A 1XX1A 2WSRA 1XYZA 4W87A 1HN1A 1MDLA 4WIWA 1E55A 4KIEA 2Z1WA 4JDYA 1J6OA 1JEZA 5JUVA 1ICQA 1XPGA 3CWOX 2VYOA 2DH2A 1AL8A 1DWAM 3H2OA 4JOMA 3EOLA 1LLOA 1XSJA 1W17A 4GQGA 1Z7AA 4A3UA 4F3HA 5HQEA 3A4JA 3PSWA 2Z2UA 1I75A 3BCDA 5AC6A 4Q4OA 3DC0A 5I79A 3TYAA 4L1GA 4MGGA 1N8FA 2WVSA 3FAWA 3W70A 4L5ZA 1M3UA 4ATDA 4JCLA 2PBGA 2VD8A 4OGZA 4HSHA 1MEHA 4XO7A 3GXIA 3RAOA 3ZQ9A 2YIHA 4MWAD 4PSPA 3VNZA 2QHAA 1TTQA 3KEHA 1JGMA 4Z2LA 2J8TA 5HMFA 4AD3A 4Y96A 1VCFA 1TA3A 2EPOA 3SGZA 4AZIA 1W6TA 2X30A 3SY8A 1XS2A 1V3JA 1W56A 3NEVA 1TTJA 4AY7A 3EDFA 4IPIA 2P0OA 1KBJA 3AZRA 4MOZA 5HNUA 1JJKA 2QZRA 3N19B 1UKPA 4GVGA 4D8ZA 1J10A 3APGA 1GT8A 3LSBA 3OGVA 1EHNA 2E40A 5XIMA 4DHGA 1GQKA 4LUYA 2QV4A 2VZTA 4PMJA 1LRQA 4WJEA 4C6LA 3LPOA 1X7IA 1QNSA 3VDHA 3S6OA 3I4KA 1PB0A 1WXYA 3QEZA 5DY3A 2YXOA 3W6MA 3CQJA 5CC5A 2PWUA 2ZXQA 3AS1A 1MWOA 3PZQA 3JUGA 1VEPA 1XW8A 1K70A 3S9ZA 1E1EA 2BXYA 1FDZA 4PUUA 1XLKA 4MUZA 4RZ4A 4XD6A 1O1HA 1VIWA 1US2A 1B3OA 3VNLA 1WX0A 3PZMA 1B3YA 1FTXA 4EP8C 3E3HA 4WLCA 4YTSA 4RL3A 3TTYA 4IZGA 3UD6A 4CVUA 4U2ZA 2ZXAA 1P1XA 5K2ZA 1OHLA 3FKRA 1IT8A 3S1VA 2XFRA 4GI8A 1KRMA 3IUHA 3UWEA 1MFUA 1FWRA 3FJNA 4MNJA 3FSTA 2PUZA 5DMLA 4DB7A 1R8LA 3GW0A 3QY8A 3NM3A 1ADSA 1JNDA 3UJFA 4HQVA 3IAPA 1EDQA 2VD9A 3NQBA 1IF2A 1PDYA 3HA1A 1US3A 2I16A 1W3HA 1S3TC 3KOZA 1J0HA 3LLDA 1UASA 4Q8QA 4X63A 2HV5A 4RV3A 1W3KA 3VOFA 1SSGA 4OU1A 3EWBX 1HKKA 2VFHA 4Q4QA 1EPVA 2IPWA 2V69A 4LEQA 3VD3A 3E6EA 3TW9A 4F0MA 1H7PA 1F05A 3LHZA 4LV9A 3PS7A 2BGQA 4HNVA 3VKAA 3T0BA 4I9MA 4K37A 5JVLA 1C9DA 4WY0A 5KZ6A 3SW6A 1X6NA 4Z1AA 2JKPA 3QM3A 2VVNA 5BU9A 1CLKA 5HNNA 5AC4A 1V8EA 1KRBC 1NOFA 1UD5A 5CGQA 1TVPA 4M1RA 3UJRA 3TJLA 4GQ0A 1L8PA 4W8AA 4ZVJA 4RNHA 4GZEA 2XISA 3NUKA 1ECEA 3A3HA 1VJIA 3SCTA 3WEMA 4EF8A 1QPNA 4J9JA 1IYXA 5DMMA 4NAEB 1GPFA 1J18A 3FVMA 4LAZA 3IIOA 3L21A 3ITXA 3C0LA 2F2HA 3U0HA 4JEQA 4A21A 3F2DA 5LYRA 3CBWA 4LUTA 1F76A 3SCVA 4LNYA 4FX8A 4XAYA 2J7BA 3QRHA 1H5VA 1PYMA 3EAUA 1TJRA 4EPEC 2WVVA 3I6TA 2A3HA 2VC9A 1DP0A 3RYSA 4AZ5A 1HKJA 1B0IA 1OC6A 1P6BA 4YHGA 1J12A 4KWSA 3I10A 1SR0A 1K77A 3LHVA 3W23A 3EMQA 2VRKA 5GNYA 1Z9AA 4JTUA 3O2LA 3FGCB 3FDKA 3VUSA 4P7QA 3U5UA 4LWWA 3LCWA 4HKPA 3OLIA 4NY2A 2DV0A 3AROA 3WLLA 1E72M 5D2VA 3WJSA 1E1CA 3TCEA 1VFLA 5I09A 3CYJA 1BGAA 1SU5A 1WYIA 1YDVA 1S38A 3AISA 3ZS4A 1G67A 3QZEA 3SIZA 3JVAA 4TMBA 3EOSA 1Q63A 1DQUA 3KRZA 3KL3A 1QJWA 1TUFA 1EXBA 3U2ZA 4OJYA 4RZBA 4WDTA 3L68A 4ZQCA 2FZ9A 3OA5A 1DXEA 1SMDA 1SFLA 3LCFA 2CYGA 5ABGA 5MKGB 1XDLA 3KBWA 1A5CA 1A5NC 1W8GA 3LK6A 5F2IA 4BEUA 1O5XA 3C0QA 2HJPA 4UIOA 2BXVA 3CUFA 3CQIA 1D3HA 2P50A 3KM8A 2EF9A 3N18A 1PAMA 4A22A 2IXVA 3GU1A 3EXRA 2GJLA 1GW1A 3WUGA 4V27A 1POKA 2QPSA 3NZPA 5E93A 5JH1A 2H3BA 4C1KA 3SUVA 3VDCA 2WKGA 2Y5EA 4BZYA 1S39A 1XPYA 1QU4A 3LPGA 3HZ3A 2PD9A 4FA3A 4L6HA 1UZ1A 4AIEA 1RCXB 4XZBA 4ADSA 5BXTA 1GQIA 3SGGA 1JDEA 1WP6A 2R1PA 1W1ZA 3WQ8A 1OZQA 1F7BA 3EEZA 4Q4KA 4LAKA 2Y70A 1JXJA 4HMNA 5HPCA 1DIOA 4FMVA 3MP4A 2QF7A 4JQAA 5DXXA 1EF2A 1JL8A 2AQWA 4BFAA 3NXFA 4GJ1A 4QGCA 1FHLA 3TR9A 4X2PA 4X9SA 1E40A 3S2CA 2PGFA 3G22A 1QFEA 3WG6A 5H1WA 2G3MA 4UXDA 2QIWA 1A5AA 4LU0A 4BQ5A 2BVYA 4E4FA 5JBEA 1WKYA 5D9NA 3MMUA 2IW0A 2W92A 4MNMA 4R3UA 5BOEA 1QK2A 5CZ0A 3LM3A 4Y8EA 3L2LA 4F0HA 3ZWTA 2P5NA 2W63A 4J3ZA 3LHWA 3GLCA 2GQ3A 5LGZA 3DGRA 3AHTA 1XXXA 3CTLA 4X60A 1W3IA 1RLDA 2QJGA 5D2TA 3CXOA 1OJXA 4Z0JA 3RNDA 1XISA 5BOOA 1EIBA 1UUQA 1WDPA 1SJCA 1TELA 5I0DA 4MHBA 3T8QA 2PRHA 1DWJM 1F8IA 1R3SA 4TX9A 2RUSA 4X0VA 1IXPA 3ZVIA 1XJBA 3MZ2A 4F79A 4TV5A 3THUA 3W7IA 4Z1BA 1Y5XA 3PBYA 3FKKA 2EKGA 1BRLB 3FSUA 1EJRC 5EYWA 3VX1A 2ACQA 3GG1A 2NWRA 1P48A 4X22A 1AG1O 3WK2A 2VJXA 3P0XA 5HQLA 5FKYA 3MW7A 2Q8XA 3WDJA 1NF7A 1XC6A 3M7WA 4KEZA 1C9WA 3R8RA 3AJXA 2J74A 1SR9A 4ILSA 2VFEA 4F0RA 2WJEA 3WLHA 4GI9A 1S2AA 3NIYA 4W7WA 1HVXA 3FW6A 2Y0FA 4UTMA 3R8GA 3HGRA 3L4ZA 4TV6A 1VFMA 5FL0A 3LTYA 3CT2A 4E2DA 4FZIA 5CSRA 1A5MC 3BAJA 4FLRA 3DFTA 4MAVA 4R53A 1V3MA 4FO4A 4GBDA 3PZUA 4MIMA 5DX7A 5I07A 4LBSA 1D2KA 5KITA 1XKJA 3GWQA 4K8GA 2FFIA 5EFFA 3DGBA 2X1UA 2PDLA 1BTCA 1F6YA 1W5MA 3DZ1A 3A4WA 3L66A 1CYGA 2YZRA 3B8TA 2XSBA 2YL6A 1W2PA 5AZ0A 3KZSA 2YGYA 4MFDA 3FDGA 3HOJA 1LORA 4HOXA 1ONXA 3AS2A 4BF7A 2DH3A 3TVAA 5K3VA 1QI5A 2CLMA 3UT0A 3WQCA 1LP6A 1V03A 2TODA 6REQB 4JEJA 3G6MA 4M6UA 1IZCA 1V7YA 5LHEA 3P62A 1DEDA 1X1OA 3SN4A 3UW6A 4IL0A 3WLKX 1GPWA 1YBQB 3W2JA 1EJ7L 1Z42A 4GLEA 4E8GA 1P5BA 4R7JA 5E1QA 5LNUA 4W7VA 1J11A 1EA9C 3IRSA 3QHOA 3UPWA 2QLYA 4Z2HA 7XIMA 4JHZA 1PS9A 4I5UA 2WM0A 1ONWA 4W8LA 3OA3A 3MKVA 1GKQA 5G1YA 1LT7A 3OBKA 3IACA 3VTRA 4KGJA 1FCVA 1IIGA 1XLAA 1OD0A 3SN1A 5CQ1A 1C8YA 4R5EA 3AJ7A 2UY4A 2HTMA 2OQYA 3CLWA 3QMRA 3NGJA 4PTVA 4LH8A 5DMNA 1IWBA 3P2VA 2Q02A 3MUAA 2EO7A 1KFLA 4LGXA 4IQDA 2INFA 5IXEA 4QJ1A 3T09A 4WK9A 3CMFA 4GNJA 4ZOAA 4B5WA 2CWXA 5HXMA 4F48A 3SEPA 1NSJA 2H6RA 1E70M 4HU0A 3M16A 4JY9A 1J8VA 2WVTA 1EX1A 1E9IA 4O50A 5J04A 4FI4A 4O16A 4UTUA 1UOKA 1QNOA 4Y9AA 2C1HA 3B9DA 5ENLA 5CGTA 2YJQA 2VGIA 3OBEA 1FDYA 4DELA 1LF1A 3TW7A 3LCGA 1B3WA 1F3WA 1J5TA 2XGIA 4KCTA 3OODA 4AX7A 2O9PA 3CUHA 3ARQA 5AC8A 3QSRA 3T2QA 2FTYA 3MMDA 2VZUA 1B9BA 2PGEA 2ON3A 4CNOA 3T81A