4OQVA

High resolution crystal structure of human dihydroorotate dehydrogenase bound with dsm338 (n-[3,5-difluoro-4-(trifluoromethyl)phenyl]-5-methyl-2-(trifluoromethyl)[1,2,4]triazolo[1,5-a]pyrimidin-7-amine)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
353
Chain Sequence
b'DERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Fluorine Modulates Species Selectivity in the Triazolopyrimidine Class of Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 139
structure length 353
sequence length 362
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4oqvA00
1QPOA 3SW6A 3EX2A 1VS1A 1UUOA 5AHMA 5HR7A 1K8YA 2DZTA 3MHGA 3TE9A 3M5YA 2JKEA 4O15A 4JTHA 4DO4A 1SSGA 3JRKA 3GR8A 4UCGA 4FX7A 1EB3A 4Z1BA 3HOJA 3BLFA 3IVSA 3PR2A 3DENA 1GVSA 2ZFAA 4LS0A 3WK3A 1K8XA 2WNNA 5EMUA 1TTIA 1MO0A 1UASA 1V5XA 3L67A 3NZRA 3L68A 3E96A 1Q6RA 3PVFA 1J2WA 3LCHA 3OA3A 5I3FA 4ORMA 4WXYA 1PVNA 1VCFA 3LCLA 2CLLA 2Y85A 3ANYA 1TCDA 3KRSA 1SUXA 3MBDA 1KLZA 2RDTA 4O28A 2OT0A 1LORA 3NM3A 1SZEA 5LGXA 1B57A 2Z0IA 4AAJA 2Y88A 3ZWSA 1PIIA 5DXYA 1ML1A 1LROA 1W5PA 1JCLA 3PS7A 2YFNA 4O16A 2J27A 3DAQA 3T7VA 4HIBA 2CFFA 3PUDA 4ALDA 3RFAA 4UIOA 1P0KA 3GDMA 4MLRA 5AFDA 2B7QA 2E09A 3PBYA 3GK0A 3W7MA 4O52A 2VFHA 3S8HA 3P5ZA 4K8HA 2FLIA 3Q2DA 3QSTA 3PSVA 4XBSA 4HKPA 1YXDA 3M1ZA 1DHPA 2FFCA 3SGZA 3THQA 3TU9A 1MEWA 2C0AA 4D2JA 3C2FA 4IMEA 2F7FA 3ZS4A 1RVGA 3NQ8A 1GVFA 1RV8A 1N55A 4PODA 4CQ9A 2Y7DA 2QUTA 2QCNA 4JTJA 3CWOX 1KBJA 5AYZA 4UFMA 1LBMA 1RZMA 1W54A 3W73A 1AW2A 4HT3A 1ZAIA 4QNEA 4O12A 3BW3A 5G4WA 3UWWA 2ZTKA 4NXSA 4HN4A 4FF7A 1YTDA 1OK6A 1CW2A 1R2RA 4O11A 2QJGA 5G4EA 2QF7A 4B5NA 4IOTA 5EPDA 5DCDA 4IXHA 2Y7EA 3IIXA 3G1SA 2QDGA 2C18A 5LSMA 1W5OA 3N2MA 3S42A 4ZZ9A 3TDFA 1MZHA 1WBJA 2B0MA 3FA5A 3TR2A 3GAKA 3RMJA 2J9XA 2Y89A 1W3IA 3DZ1A 1JCNA 4JTSA 4GC4A 2VELA 3OVPA 3M43A 2YXGA 4N6EA 1XUZA 1OYAA 1G6CA 1GYLA 3O05A 1OX6A 2G5WA 2O7QA 4RCXA 4O1AA 4LT9A 3W88A 4PTNA 2ZZ6A 4CNOA 2VFGA 2Y7FA 1WOBA 4O17A 2VEIA 3O6YX 5FF4A 2ZTJA 5H91A 3PY2A 5BMXA 2BX7A 5HR6A 4DEFA 3VI2A 2V2CA 1OX4B 2PC4A 2ZZ2A 5EA9A 3O06A 4GNJA 3UPBA 3LI1A 5IM51 3LX9A 4LTSA 1TJRA 4NNBA 4YCOA 2ZBTA 3R8RA 1OX4A 3EXTA 4GUGA 4E38A 3NL6A 3ZR4A 2VEKA 3MI6A 3S0CA 1AK5A 3EWUA 3LCXA 4WY0F 3HG3A 5T26A 3QEZA 4JN6A 4E0CA 1SO4A 3W7RA 3TV8A 4MY9A 3LLFA 4Q4KA 2WSQA 4BI6A 1TTQA 1QMLA 4JY9A 4BI5A 3OVQA 1PV8A 2HS6A 1VLIA 4HSNA 3L2IA 5I3HA 1TRIA 3M41A 1FY6A 4CQ8A 4N4PA 4RZ5A 3M6YA 5LHFA 3MP4A 1PL9A 1SW3A 1GYNA 1BWKA 4EF9A 2WJZA 5FESA 5KZMA 4LRSA 3S5OA 3TFCA 2BSLA 1L2UA 1W5QA 1TV8A 4A3UA 3MO7A 4TO8A 4FIQA 1LTDA 1QFEA 1F6PA 1TPB1 4Y96A 2YYUA 1W8SA 3L9CA 1W56A 3SJ3A 1ME8A 3DHFA 3EWYA 3BVJA 3W1RA 2NZLA 3LV6A 3PWAA 1R47A 2HTMA 4GXMA 1MSSA 4Z1DA 4IPJA 1ZJIA 3PB0A 3LRLA 5EKYA 5AN7A 3QQ0A 1ZNNA 2Y63A 3TA6A 3GVGA 4JTGA 3S5YA 1Q6QA 3EX6A 3IVUA 3I65A 1SZNA 4JGDA 5KITA 1KM1A 1FCQA 1Z42A 4ZQNA 4BF9A 1T0OA 3TNOA 3M5XA 1H62A 4QITA 3N3MA 3LBMA 1ZFJA 3QC3A 3S9YA 1G67A 5K4XA 5AC7A 1OX5A 4QNWA 2H8ZA 3BV4A 4R7JA 4CNNA 3NXFA 1FX6A 2NXHA 3NQEA 4AHOA 1LOLA 1Q6LA 5C54A 1I2RA 3E12A 4NZJA 1LM1A 1JJKA 3C0JA 1OFBA 3R5EA 4XTIA 1X8FA 2Y70A 3LM7A 1NF7A 2YW4A 3B03A 3STCA 4XUGA 4LS2A 1ICQA 2E5BA 3D0CA 1LDCA 3FKRA 1KFKA 1KTBA 1YDOA 1F73A 2X1RA 3CM4A 2FJKA 1R2TA 1FWTA 4O54A 1SW7A 4AB4A 3F4WA 1QWGA 1G4SA 1WDWA 2AQWA 3LB0A 3BK0A 1VJIA 1TRDA 2XFWA 3P82A 3NQFA 4MYAA 5FF3A 1G7UA 3BGGA 2A6LA 1VC4A 4ZQCA 1ADOA 2E77A 3ELFA 1H7RA 4K37A 5TIMA 5TBOA 3M9YA 1YTKA 5D33A 3ABSA 2EPHA 3LRKA 4MY8A 1JUKA 4HNNA 3S6DA 2PRLA 3O07A 1UJPA 5U4NA 2DJXA 2GQ8A 3W07A 2VOMA 3W22A 3VE9A 3U2OA 3JR2A 3G1XA 4OU1A 2NWRA 4XWUA 2NWSA 1JCJA 3IIZA 4HPJA 4JYEA 2I1OA 1F74A 3TAOA 4NJHA 5BOOA 2A7PA 1EA0A 2GJNA 2Q3RA 3C4UA 4FHAA 3C6CA 1ZALA 4WJEA 3DGRA 1VH7A 5G2WA 1BKSA 5AHEA 3U6WA 4M5PA 1CI1A 1GZGA 2CLHA 1U5JA 1UCWA 3IIPA 5HWNA 1KM5A 4Y8FA 4KKXA 1FCVA 3MUXA 1L6YA 1H7NA 3IVTA 2ZCGA 2V0TA 4ORIA 1JCMP 4GFSA 4RZ4A 4NT0A 3QSRA 1KA9F 4IXXA 2G95A 3S1UA 1FDZA 4EVZA 3TW6A 4K7YA 3OVRA 1OFAA 4ADTA 3V1PA 2LLEA 2X2GA 1BTMA 2JGQA 2QCDB 1B3OA 3NQAA 1SFLA 1RQHA 4ZMGA 4DPQA 1YDNA 2H3BA 2V30A 4TIMA 1VGAA 2AAMA 1RD5A 4QQ3A 3GXPA 2QCDA 3FLUA 3W1LA 1DKWA 3E02A 3RLUA 3UY8A 4H4IA 2ZZ7A 4OWGA 1TPWA 5KZEA 3M44A 3O15A 3F4NA 5DBTA 3ZFHA 1OFRA 2C15A 1K03A 1ME7A 1I45A 3A23A 2RDWA 4ADUA 4OT7A 1BWLA 1TQJA 4K38A 4O1BA 3HG2A 1F7BA 1IXPA 2V5BA 4O1DA 1HO4A 4NXKA 1JCYA 3P8JA 4OV9A 1XUUA 2EHHA 4UTJA 5BW6A 1XC4A 3TAKA 5CPLA 2CWNA 4O18A 4AXKA 3NM1A 4MPQA 5E0KA 5AC6A 3W7HA 3DBPA 4ZQOA 3NG3A 2P1FA 3UWQA 5DELA 4A29A 1SFJA 4UMBA 1UB3A 4O0KA 1KFEA 1EUNA 4HNVA 1H61A 2YZRA 4AHQA 2Y61A 2NUYA 2NV1A 4LVAA 3NDOA 4YL2A 1OF8A 1GOXA 3HJZA 2E5CA 3FKKA 4R53A 3QJAA 4N9BA 3B06A 1JVNA 2TMDA 1SO5A 5HMSA 2QJIA 1SU5A 2ZZ1A 4P2VA 1OVDA 3TKFA 1I8JA 2E6YA 2J9ZA 3LI0A 1EP1A 4O8RA 3TFXA 2Y6ZA 3MYPA 4IX2A 3L5AA 2NUWA 4I7UA 4EOUA 4S2BA 4RLIA 2Y62A 3FJLA 4BK9A 4UFKA 5K2ZA 4LY8A 1QPNA 2V9DA 3W9ZA 5G2HA 5F4SA 2ISSA 4JTIA 3W7KA 1JQVA 2TRSA 3W72A 3WFAA 1K7FA 2E68A 2H8XA 4Z0JA 3HF3A 1XFBA 4NQ1A 4JTFA 5FEZA 1X1OA 1B9BA 3NPWA 3G0UA 4QJ1A 5CZTA 3SY5A 3P67A 3DI1A 3FIGA 2IQTA 3QZEA 3NOEA 1OK4A 3SIZA 1ZY9A 5I3JA 2I9EA 3E49A 2YGYA 3L5LA 5D05A 2QR6A 1PS9A 4XBKA 1DVJA 2CZDA 3P5YA 1W31A 3LBCA 3STFA 3QMRA 3EB2A 1XDMA 5AOUA 3EKZA 2CU0A 3A24A 1IF2A 3WK2A 2J88A 4K6AA 3HMJG 1OFPA 5AYYA 1TO3A 1A5CA 3EWWA 2PRHA 3G1YA 1ICSA 1S5TA 3DFTA 3GLCA 3M5VA 1H63A 3CWNA 1NSJA 3EXRA 1G7VA 3P7YA 1I4NA 2FPTA 3W7NA 4M6PA 5F2IA 3WJSA 4E2DA 3O6CA 5K3VA 1O5XA 3W1MA 5IBXA 5FF0A 4Z1AA 2JBMA 2O7SA 2NX3A 3AO0A 3Q37A 3L5MA 3LHWA 4LV9A 2GQ9A 3PB2A 4PL2A 1FWRA 2WKJA 4IMGA 3HPXA 2EKCA 4ADSA 3P81A 1XCFA 4QM1A 4DO6A 2QJHA 2Z6JA 3W1XA 3GAYA 1ICPA 1W37A 4UTTA 5FI8A 3H55A 3W7CA 2VC6A 3W7OA 3RNDA 5DCBA 1GVRA 4EWND 1TSIA 3NPXA 8TIMA 4RR4A 2R91A 3IGUA 3LXAA 1OFEA 2Z6IA 3RK8A 3FS2A 1I2PA 4O4VA 1H7OA 4X3ZA 3THAA 3TMQA 3FOKA 1Q45A 4UFIA 3NGJA 3QW3A 3SR7A 2J6XA 5CSSA 3GDRA 5EYWA 3TXZA 4FIRA 3O63A 4UTHA 1NF0A 5A8GA 1SZFA 4LUJA 1TPVA 1QPQA 4CNPA 5EY5A 2R94A 4UNKA 1AW1A 2OMAA 4PFMA 2BWGA 2CLMA 4TU1A 2RKXA 4NVTA 3TSMA 4R33A 4DBEA 3E9AA 4QISA 5KZDA 1G4PA 4KWVA 3W70A 1OYCA 5EBUA 1F5ZA 4QAIA 3A22A 1LP6A 2GQAA 3LRMA 4NU7A 5K9DA 4WY0B 2VEMA 3TXVA 4AHPA 4OHQA 2GVJA 1QCWA 3BLEA 1FXPA 1M6JA 2FB2A 2YPIA 4IGHA 3GNDA 3G0XA 1ONRA 3PAJA 4UNLA 3G1FA 4WY0A 3EXSA 2VFFA 3PG9A 4MY1A 2X30A 3IGXA 1XBYA 3SGUA 5E1QA 2YX0A 4NZFA 2A6NA 2H90A 4MJMA 5K7JA 3W7DA 2QCEA 2BLEA 2QCGA 1SR9A 2XN2A 4G1KA 2FTPA 1YPFA 1YYAA 1WAUA 1I2OA 3G1DA 1S5WA 1R46A 1YADA 2TSYA 3TMLA 1XDLA 3MBFA 4UFJA 2CLFA 3O6DA 2OT1A 1JCXA 3L66A 4LWWA 3P62A 1QPRA 1A5BA 4MZ8A 1GG1A 2DZWA 4KFPA 1WXJA 4U4MA 3QQ1A 2ALDA 4K8EA 1WQ5A 1KFLA 3W1AA 3CB8A 3IEBA 1KV8A 1D9EA 1TB3A 3MYOA 4DELA 1W3TA 3VNDA 1AG1O 3H54A 5K4ZA 5C2XA 1FUYA 4GE8A 4CQAA 1TPC1 3F1QA 4PA8A 1QDSA 3G0SA 4NNCA 1C9DA 4M6QA 3N19B 4I7WA 4KFOA 2RH9A 4KWWA 2V2HA 3LXCA 1GT8A 1X1ZA 3TIMA 1KFJA 1DL3A 2FB3A 3LCWA 3HG5A 1TREA 2YR1A 1DJQA 3W75A 5C55A 4I9AA 4N4QA 5I3GA 1B4KA 1THFD 4WD0A 5F1UA 4UFLA 4O0ZA 4RV8A 2DZXA 3NQMA 3W83A 4PL1A 1LCOA 4JX4A 4DF0A 4UR8A 1WOAA 1K7XA 1EP2A 2VFDA 3NYZA 1VCVA 5MHBA 1QO5A 4JDBA 3N9SA 1Y0EA 3CLMA 3LTYA 4NUWA 1NAL1 4UTKA 5J5DA 3SECA 1PHWA 3GZ3A 1Z41A 2ABBA 5IBXC 1SSDA 3I68A 3PC0A 1DOSA 3GDLA 3Q94A 3GXNA 1O5KA 3GYEA 4N6FA 1JR1A 1HFBA 1UBSA 3W7LA 3KHJA 1W1ZA 4FNUA 1C29A 3ZWTA 3NO5A 1K8ZA 1TTPA 2NX1A 4RZ6A 4N2YA 2JKAA 3HGJA 4UTTC 4LW7A 4ZL1A 1A50A 3LCFA 4AWSA 2P0OA 4KFNA 4X9SA 1FXQA 1SO6A 2X1SA 2C13A 3ABOA 1N8FA 3TJXA 1FDYA 1P1XA 3IGSA 2DZPA 4A2SA 2ZRXA 4MFDA 1IXNA 5LZLA 4ZQRA 4LUIA 3VFLA 2E5DA 4DPPA 4O57A 3HQ1A 4CCEA 4HNUA 1H60A 3FYOA 2C14A 4N9EA 4YXGA 2GJLA 1TPEA 2JGYA 3TROA 3UXAA 1ME9A 2QAPA 3UZJA 5D04C 3WJWA 1KTNA 1H1ZA 7TIMA 3C2VA 4MOZA 3W1QA 4WXZA 3HPZA 4AWTA 4NJJA 5F2GA 1XI3A 1AW5A 2QKFA 1W5MA 3WJXA 4LU0A 5DCEA 4L4LA 3LDVA 1O60A 3T78A 1VQTA 1TV5A 4HPXA 3C56A 3GDTA 5E93A 2BTMA 5F2MA 1GQNA 3I7QA 1QOQA 4HHPA 1YPIA 5GVJA 4BWLA 1KM2A 1LLZA 1LRNA 4K36A 3G18A 1D3GA 3SSJA 1EIXA 4MYXA 1P5BA 1G4TA 3TX9A 5AHLA 5FEPA 2A21A 5FEXA 3UPWA 4FNSA 5D30A 1KLYA 4ONVA 5I3IA 1A5AA 3P84A 1LBFA 4N02A 5SWUA 2XN1A 1R2SA 5BRBA 3CC1A 3W86A 4R34A 4ZQPA 3QM3A 2B7NA 5CZSA 1J4EA 4IPIA 3B05A 1N7KA 3ABRA 3W7JA 3LTSA 1VYSX 5CPNA 3GB6A 3CT7A 4O19A 5KTLA 1ZHAA 2DZUA 4XQ6A 4E2BA 4MUZA 1B4EA 4DF2A 4IUOA 1GWJA 2A1YA 5C6MA 3W7EA 4FXRA 3DFNA 3VKJA 1LYXA 3NPUA 3OBKA 2QAFA 4O1CA 3UZ5A 1FQ0A 2WPBA 3USBA 2J9YA 1OG0A 1TIMA 3G3MA 4FB7A 3R13A 4C1KA 2YCEA 3PG8A 1H7PA 4O14A 2PE4A 3QF0A 1L9WA 4BI7A 3W6YA 3W23A 4LC6A 4JD4A 4AH7A 3W1PA 1GJPA 4L4MA 3I7SA 2OJPA 3AJXA 3KAOA 3PM6A 4UTMA 3O1NA 3FYPA 3MI2A 4HNTA 1RQEA 5LNSA 5DLCA 1PCKA 1XBXA 3NL3A 2TYSA 3MMTA 5LNRA 4UUIA 2Q8LA 2E1DA 2ZYFA 4ICNA 3P80A 2W0UA 2CZFA 2KZHA 1IGSA 4O4WA 2C1HA 5AB3A 3PSWA 3EWZA 1TV7A 4YLWA 4AWUA 3W2MA 5G2IA 4PC8A 5EL1A 3BG5A 4GUHA 5HQEA 5D32A 1GVOA 4S1FA 4TX9A 1VCGA 4XKYB 1L6SA 4JYDA 2BZNA 1DORA 3QYQA 3GXTA 4J9JA 2Q3OA 1WBHA 4QSHA 2ZZ3A 2RDUA 4LVDA 3L65A 4XKYA 1VHCA 3G3DA 4JXCA 2DJLA 1VYRA 3PBWA 1SQ7A 3PBUA 2ISWA 1M7PA 2A4AA 3PULA 1KW1A 3STEA 3GDKA 2WV8A 3TK7A 3HBLA 4OGZA 4H6KA 4LV4A 4TMBA 1TPDA 3TUUA 4FNPA 3DI0A 3ABQA 3IV3A 4OV4A 2ZA1A 1FWNA 5KMYA 1IIHA 3HB9A 3U8GA 1EP3A 4NJKA 5LNWA 3I6RA 4UTUA 1F76A 3NQ7A 1SPQA 1M5WA 5A5WA 3TQVA 5DXXA 2AGKA 1FCUA 1OFDA 3HO8A 5DY2A 1K3UA 1IIGA 3LCGA 4UMCA 3W1NA 2QCFA 4UTLA 2B7PA 3W7GA 4JICA 3UWYA 4MKNA 4RK8A 4DXVA 4DQWA 2B7OA 3LOTA 4GBUA 2Z2UA 4W9TA 3NVTA 4WUIA 1GEQA 1VRDA 3NR0A 1GTEA 4WOQA 3HIJA 3TW7A 2WNQA 3H53A 3P61A 2V82A 1MXSA 1OFQA 3MWAA 3KFTA 2R14A 1U83A 4UTIA 3EX1A 4M6VA 1ZAHA 2FDSA 1LOSA 1K7EA 3CIWA 2FIQA 2DZSA 2F84A 4N9DA 1L6WA 3R89A 4TR9A 4DO5A 3G24A 4BFAA 2QUUA 1WYIA 4LRTA 1CX9A 1X6UA 3QH2A 3GKAA 4IMFA 3KVJA 3BO9A 1XXXA 1KM3A 5FF7A 4JTTA 2HSAA 1KTCA 2G97A 1OHLA 3M16A 3TSBA 4DBDA 1Z44A 4OE7A 2ATMA 5G1TA 5AHFA 5BNKA 3MP3A 1XBVA 3OEXA 5BMWA 3LCIA 2DP3A 2PURA 1YDVA 1P0NA 4LC8A 3MHUA 5HULA 1TJPA 2UV8G 2D73A 2V81A 1TMHA 2V8ZA 3TQ0A 3M7WA 3L0KA 5U7SA 1RR2A 4AVFA 4Q32A 1EEPA 2HMCA 4EIVA 3ATZA 5H2ZA 3NQGA 3HGSA 5AHIA 3P60A 3T44A 1VHNA 1TPFA 1VR6A 3W87A 4MFEA 5D03A 2QCMA 3SI9A 2WSYA 1SO3A 2ZRWA 3C8FA 2WSRA 2FPYA 2Z1BA 3UWZA 5C5YA 2QUVA 3P8IA 3UNDA 1EUAA 4LNYA 2NV2A 3CU2A 3NNTA 1TPUA 2WNZA 4GUIA 3W2NA 4O10A 1HG3A 4WQ6A 3DH7A 3W2JA 1X7FA 3IRDA 2CZ5A 2OZ0A 1JRBA 4JIPA 3DFOA 4LVFA 3BW2A 3IIVA 5HUOA 3S1VA 2YFOA 3MHFA 1AL7A 2GUUA 4AF0B 2A0NA 1KM4A 3B8DA 3E0IA 1FDJA 5K9CA 1DV7A 5FF2A 4JNMA 2GVLA 3CPRA 1QO2A 1OF6A 4AF0A 3CHVA 3WJZA 3L0GA 3S1XA 3W7PA 5CPMA 3KVMA 2ZRVA 4UTWA 3NZ1A 3DU0A 3VCRA 2ISVA 3KOFA 1YXYA 1DJNA 4GRSA 3DFSA 3G1AA 2V2DA 3GKFA 4UMAA 4IJBA 3BG9A 4Y6GA 3UXDA 4BR1A 3NQ2A 3KX6A 2ZRUA 1QAPA 2EAWA 4AEOA 1AMKA 4C1LA 3CQ0A 4O13A 3W2UA 3TC6A 1T8XA 1XM3A 5LGZA 4LOCA 1HTIA 3NA8A 5LKYA 2ABAA 2WOQA 5F4WA 3QPZA 1PE1A 2YYTA 3RLVA 1DBTA 4JTLA 1I2NA 4NJIA 1D3HA 4OBTA 3L0NA 2J24A 4JY8A 4XZ9A 1KFBA 3M5ZA 3C2EA 5DY3A 4MLJA 1XBZA 3N34A 1EPXA 1UUMA 4MJZA 1V7YA 5DBUA 4GWEA 3KVKA 4H3DA 3NQ6A 2P10A 4CLMA 3LHYA 2GVGA 3GX9A 3S5ZA 2W6RA 5G1YA 1H1YA 5D2XA 5D02A 4LS1A 3G1VA 1YTEA 1VLWA 1LRQA 5K9XA 3W3OA 2ATSA 1F05A 2NLIA 2ZRZA 3R12A 1EWDA 3LGEA 4PEKA 4A22A 3CTLA 1KFCA 1TQXA 3BLIA 1S3HA 3QPYA 1EX5A 3EWXA 4JTEA 1HO1A 3MI3A 5J5RA 1QR7A 3TH6A 1JUEA 4GUFA 1LOQA 3DHDA 1EWEA 3T4CA 1ZCOA 2QCCA 3T55A 5AHNA 4HSOA 2FPVA 2CZEA 4JR5A 5HWJA 2VEPA 4Z0SA 3G8RA 1TPH1 1BEUA 3W74A 2E6AA 2QCLA 2Q8ZA 3NL2A 4JEQA 3EX4A 3N2XA 6TIMA 3NEVA 2G96A 1WA3A 5F2LA 2PCQA 1TYGA 4IMCA 4YCPA 3HGRA 1F6KA 5LNUA 3EKLA 3QFEA 3S5NA 1G69A 5KSWA 1Q3NA 4NX5A 3R2GA 5HJLA 4WOZA 3C2OA 3NQVA 5HINA 2GOUA 1DQWA 1VZWA 2QEZA 4FO4A 1XL9A 2E6FA 3SZ8A 4CCCA 3LHZA 3W85A 1WV2A 1RPXA 5AYXA 5CG7A 3SFKA 2FQIA 4Z08A 3TC7A 3Q58A 3W76A 2DZVA 2VXNA 2VKZG 4GUJA 2W79A 2OCZA 3HGOA 1FWSA 1FWWA 1FBAA 2CLKA 2QDHA 1H50A 3WJYA 2RHGA 4MVAA 3YPIA 1JQXA 2A2IA 1NVMA 3M47A 3INPA 1LLWA 4N9CA 5HNRA 4LVGA 3QMTA 1MEHA 5F1VA 4ZQMA 3UYCA 3LHTA 3EEGA 3S1WA 3W71A 1K02A 4FX6M 3PUOA 3LXBA 1FCBA 3F03K 2QCHA 2A85A 4YWIA 4S2CA 1OABA 4FXSA 1JUBA 3KXQA 4GJ1A 5KINA 1PCWA 3PBVA 4M19A 3EWBX 4IX0A 1I2QA 4M7SA 5D37A 4Z1CA 2ZA2A 3UWVA 4TMCA 2CLOA 3A21A 3KRZA 1KM6A 4MZ1A 3B04A 3MW7A 3G22A 1O95A 2GPTA 3OG3A 3C2RA 1VYPX 4MZYA 4O53A 1LZOA 2H6RA 3KRUA 2JK2A 4P61A 4UTWC 2JKPA 5D2TA 4EF8A 1LBLA 1KV5A 3LERA 1P4CA 1M7OA 1DQXA 3W1UA 3QRHA 2RFGA 5L6UA 3N14A 4Q33A 1HUVA 2NXIA 3IIOA 5CPOA 5D09A 2ZRYA 5AC8A 4OQVA 3DKLA 6ALDA 3OHIA 1SZGA 1W5NA 1ZENA 4WZHA 4XTDA 4JYFA 4NNAA 5FEWA 3NAVA 1GVQA 3TJLA 2EF9A 2C16A 2WQPA 3LV5A 1H7XA 3HG4A 2R8WA 3FEMA 2EGZA 2NX9A 5DN1A 4JTKA 3V75A 4DF1A 1ALDA 5CZ0A 3WK1A 3PF3A 2C19A 3OIXA 3JS3A 4UXDA 4FNTA 3TCEA 4M7TA 3RF9A 3W1TA 4K7VA 3M0ZA 3O8AA 3PUEA 2CLIA 3C3NA 4YMZA 1NEYA 3L21A 4X22A 2HS8A 3ATYA 1A5SA 4PCFA 4UR7A 2I14A 2BXVA 2XN0A 3DFQA 4QIUA 5G5IA 3MP5A 2Y7GA 5CGQA 1C8VA 3O16A 3UQNA 3BG3A 1GTHA 4WX2A 2X1TA 2YW3A 2A5HA 2V5LA 4JIQA 4NX0A 1KM0A 3NL5A 4FNQA 2X1UA 1XKYA 2CW6A 4NJGA 2OX1A 3CIXA 4JTUA 5CSRA 4FNRA 5TQLA 5L9FA 2VENA 4Y90A 3B0PA 5D2YA 1H7WA 3QMSA 4RXGA 4CCDA 1J5TA 3NPVA 2PRMA 1W0MA 3W2LA 2E6DA 4UFHA 4FX8A 3P74A 1G4EA 4I7VA 5I3KA 3A9IA 1F2JA 3C52A 2B4GA 1IXQA 3GNNA 1MEIA 3HPSA 4JX5A 4A2RA 1H51A 1JULA 3FFSA 3DFPA 4RKAA 3LHUA 3N73A 2C6QA 3N9RA 1YLVA 1AL8A 1HL2A 3BARA 3W7QA 3CEPA 1R30A 1O94A 4POCA 3GIYA 3I7RA 1A53A 1O4UA 3DKJA 4IMDA 1VPXA 1E51A 1KBIA 5F4XA 3W7IA 1OFOA 3UWUA 5ABTA 3A5FA 1H5YA 2A7NA 2X16A 1Q6OA 3MJYA 1IXOA 1ZAJA 2NUXA 2VFEA 1W3NA 3G1HA 3KVLA 1OYBA 5CZJA 3CEUA 4A21A 5LNVA 1WX0A 1T96A 2TPSA 1RQBA 5D38A 4U28A 4K39A 4FEZA 3LLDA 4RX0A 4RXFA 3BGJA 5LHEA 1GG0A 2NXGA 4IQLA 3G8EA 3LHVA 5HUPA 4RJEA 3EX3A 2ZZ5A 2ZA3A 2DU2A 2ZQ0A 3W84A 4O50A 1JRCA 1PHQA 1SW0A 2DORA 3TSDA 3WK0A 3RU6A 4AMAA 4JDYA 4X2RA 3T40A 3B0UX 3B4UA 3W2KA 1GPWA 4Y9AA 1TTJA 2WO5A 5D2WA 3BW4A 1Z48A 3QW4B 4ML9A 2H3DA 3STGA 4JX6A 4ZVJA 3C61A 1T99A 2YDAA 1OJXA 1YXCA 5CKSA 1S5VA 3NQDA 2A7RA 1QNVA 2YSWA 3B0VC 2ZZ4A 2VFIA 3TQKA 2ZDRA 3NQCA 3A5VA 5HWMA 1QOPA 3VE7A 4LVBA 3UY7A 4IWWA 4MIMA 4BWLC 3GR7A 3FJ6A 3LTPA 1NFBA 4JS3A 2C3ZA 5D2VA 2CLEA 3DXIA 1LRTA 4UC5A 3UD6A 3BPWA 4PH6A 3K30A
chains in the Genus database with same CATH superfamily
3D3FA 3SW6A 3EX2A 1UUOA 1RY8A 5FJIA 4JTHA 4DO4A 1SSGA 4LAUA 4AQLA 2UY4A 1NQ6A 1E56A 5C9ZA 3NYDA 4B5UA 1GVSA 2ZFAA 3WNPA 3A64A 5HPOA 4KWSA 4OJYA 4A8NA 3GE7A 2XGIA 1V5XA 3ONCA 2WBKA 3E96A 3PVFA 4IFKB 4RDVA 1ZBCA 1VEMA 4IH3A 4HSHA 2GSEA 4HK7A 1G5AA 2UY3A 1PVNA 1VFFA 3LCLA 2X41A 2YCLA 1KLZA 1IR1A 2QYGA 1B57A 3AAMA 3BMXA 2EPLX 3II1A 2Y88A 3ALGA 1FRBA 3LBOA 1GEHA 1PIIA 1NFGA 3IRSA 3WLLA 5TAOA 4PUKA 5CH9A 2AQVA 2ZXDA 1OSEA 5A6JA 1ODZA 4YJ5A 3WUEA 4S3EA 3DAQA 4HIBA 4GQBA 4YTQA 3HTWA 4ALDA 2BOEX 3IUIA 1R85A 5TD4A 5HJXA 2W4XA 2GJRA 1P0KA 3GDMA 4LNCA 2E09A 1GVIA 3AIWA 4ATWA 3W7MA 2VFHA 3I4KA 1GUVA 3QSTA 4XBSA 3M1ZA 2OR2A 1MEWA 2C0AA 1ZGDA 1DE6A 3N29A 1RV8A 2XFYA 1N55A 4CQ9A 5KZ6A 1GW9A 2HBXA 3CUXA 4DJEC 4Z2LA 3CWOX 4ES4A 1JZ7A 1XYCA 3M07A 3RAOA 5CBJA 1AW2A 4HT3A 3SCNA 1ZAIA 3U4AA 3BW3A 3UWWA 4NXSA 4HN4A 4HVXA 3L2MA 2Z2BA 1CW2A 1R2RA 4O11A 2ZWZA 5FAGA 2QPXA 1K4HA 3U9IA 4Z2JA 5EPDA 1MWOA 1EQPA 2Y7EA 1OWQA 2QDGA 2V67A 4L6DA 3TR2A 1F3XA 5EMYA 3RMJA 3MO4A 2J9XA 2Y89A 3AHZA 5IHRA 1JCNA 5AVNA 4GC4A 3SSZA 3N04A 3FYYA 2O9TA 1BQGA 1KXTA 3WDHA 3UZYA 1QI5A 5DEZA 2O7QA 2VRKA 1EJXC 6REQB 4QG9A 2AKZA 1LLOA 4ZBCA 4C91A 4CEUC 5H91A 1CEOA 1PPIA 3RDKA 3PY2A 2CNCA 2FTYA 5HR6A 2PCEA 4FR1A 3GC5A 1OX4B 1Z3NA 1IWPA 2ZZ2A 5EA9A 3FXYA 3LI1A 2I57A 4H7VA 3SCUA 4W8BA 2BP1A 3KM8A 2VD8A 2VHLA 4BQ4A 3TW9A 4GUGA 4MB5A 4UQBA 3VINA 4UQDA 1RHCA 2R1LA 2EBNA 3EWUA 2DW6A 4MGGA 4H00A 4LUYA 5T26A 3V18A 4X0NA 1DE5A 3DIPA 2EG7A 1SO4A 4E0CA 1WCGA 4W4QA 5HQLA 2Z1VA 2PBGA 4BI5A 3OVQA 1HN1A 1FHDA 2PZ0A 3WQVA 1TRIA 1QXLA 3M7SA 4CQ8A 4D8AA 1PL9A 3BCJA 3IS4A 2WJZA 4F0HA 1BYAA 3IJIA 5FESA 2OEKA 1W5QA 2YL5A 4A3UA 3MO7A 2RAGA 1QFEA 3BMWA 1E6QM 3KTXA 1OG6A 4DYKA 3DHFA 3BVJA 2NZLA 2HTMA 4GXMA 1MSSA 4IPJA 2J4GA 4TOQA 5EKYA 5AN7A 3FCPA 1TWZA 3I3BA 3TA6A 3GVGA 4HK5A 4JTGA 1EXBA 3CWHA 3N15A 2GUBA 3W6MA 3I65A 4JGDA 5KITA 1U22A 3K4AA 3GFYA 4ZQNA 1MUMA 4QITA 3ZLHA 2E4TA 2ZOXA 3QC3A 1S1PA 3SUSA 5K4XA 1KFWA 2C0HA 2BGQA 1R8LA 1IT0A 3CGTA 1FX6A 4XZLX 5C54A 3E12A 2OVLA 3ONBA 1DJZA 1ODUA 4XTIA 1X8FA 1TV2A 1S2WA 2Y70A 3LM7A 1NF7A 3B03A 4XUGA 3AS3A 4J3XA 1CXHA 1OY0A 1QI3A 1KTBA 4DJDC 1F73A 2VGIA 5LIWX 3CM4A 4XK2A 1R2TA 3QHNA 5FJRA 4AB4A 3NUKA 3F4WA 1QWGA 2RDXA 3BK0A 4AIUA 1VJIA 3CV6A 1TRDA 3NQFA 4NP7A 1TJ1A 3BOLA 4DWSA 2E77A 4AZCB 2PMQA 4YYCA 1F61A 5TBOA 3M9YA 1YTKA 4DVOA 5D33A 1JPHA 4GIEA 1JUKA 4HNNA 3B9NA 4A05A 3S6DA 3O07A 3B40A 5U4NA 3U2OA 3TONA 7TAAA 3HPFA 4CUCA 3JR2A 2GGHA 3G1XA 3GTIA 3LK6A 4OU1A 3A4XA 1RH9A 2NWSA 2YBVA 2I1OA 3TAOA 2GJNA 4GD0A 1GW1A 3EWCA 1GK8A 3UYIA 3OLDA 1BKSA 3T08A 2VWTA 1GZGA 1UCWA 5HWNA 1J6OA 1KM5A 1XLFA 1JIBA 1FCVA 4JQ3A 2O0TA 2J66A 3LNMA 3MUXA 1L6YA 2PDCA 1H7NA 1MYRA 2ZCGA 2PF8A 3TQPA 4ZODA 4JQAA 4GFSA 1CLXA 4C65A 3E0WA 2X05A 1HVXA 3DESA 3R58A 4US6A 5EMKA 5XINA 3OVRA 3QZ6A 3QQWA 5CAHA 3V1PA 1H5VA 2F8QA 2X2GA 1KBBA 4JTCA 1GJUA 1RQHA 4DPQA 3ANUA 1FWAC 2I56A 2I5QA 1KWKA 2VJXA 1RK5A 1HKJA 4PUJA 2HWGA 5A2BA 1A3XA 3OU8A 4AEEA 1SGJA 3RLUA 3UY8A 3KEHA 3VGFA 1XCXA 1QW7A 2R1NA 5KZEA 3O15A 3CQJA 3BCFA 1OFRA 1UZ4A 2WB5A 4BF5A 4NILA 3V4BA 1IXPA 1A4MA 1UPMB 5LXEA 1WZAA 2PGRA 4PN2A 4RDWA 3TTOA 3UWEA 1HO4A 4HYWA 4ATDA 4JCLA 1S1RA 2Y5JA 3WF2A 3A13A 3P8JA 4UTJA 1OGSA 1KCLA 4O18A 4AXKA 5E0KA 3TR9A 3N11A 3DBPA 5E0FA 4F2UA 4A3YA 3O7UA 1QASA 4GI9A 3WX7A 1C9WA 3BICA 2ZKMX 1UD5A 1KWGA 1PZ3A 1QRQA 3IAPA 3VIGA 3WKZA 4E5TA 4ILSA 1EUNA 3VD4A 4AHQA 3ZSTA 1UJQA 2NUYA 4LVAA 4A8LA 2IXUA 4I5XA 2G3NA 1GOXA 2E5CA 1FWFC 3VDCA 3FSTA 4WSKA 1JVNA 3O0FA 3C0LA 1AD1A 2QJIA 1SU5A 2ZZ1A 4GI8A 2XUCA 2QVHA 2NVAA 4QJ4B 4H7ZA 1QT1A 4LF2A 1PAMA 2IQDA 3KP0A 3TFXA 4H1ZA 1CXLA 1ITQA 4GH1A 5K2ZA 3U3HA 2V9DA 3SCRA 3OVGA 3GTFA 3ZR6A 4JTRA 2E68A 5JUVA 3D46A 4JTFA 3VGBA 2INFA 4QJ1A 1XRTA 3QZEA 5JXQA 2YDSA 3SIZA 1ZY9A 5E0CA 1PX8A 3KLLA 4S39A 3L5LA 2QR6A 4XBKA 3P5YA 3LBCA 4DIAA 3EB2A 5AOUA 5A6BA 4IGNA 2CU0A 1CZ1A 3VTRA 4O1EA 1OFPA 4IFKA 1HGYA 5BCAA 3G1YA 4PTVA 1JNEA 3ARRA 1NSJA 1G7VA 5J8LA 2DT0A 1LF1A 4GGHA 5F2IA 4E2DA 5K3VA 1AJ2A 1XLBA 3CYVA 2QMKA 5IBXA 1UPPA 3ORWA 2NX3A 3PB2A 3OGVA 2GOKA 3IJLA 1SFSA 1EF2A 3P81A 3SQLA 3O3RA 2QW5A 3W7CA 1Q7ZA 3GIPA 2VC6A 3RNDA 5DCBA 4K1WA 1XSJA 1TSIA 3NPXA 3IJ7A 3LXAA 4NAEA 1H7OA 3THAA 3FOKA 2GZXA 3S5SA 1BGGA 4J5NA 3GDRA 4FS9A 3EOSA 1KRMA 3ZT7A 1W3HA 4HBKA 2VO5A 4DY1A 1I0DA 4UNKA 2VR4A 2XU2A 2RKXA 3WSUA 3GXMA 4M82A 4Q8MA 4DBEA 2QF8A 5KZDA 4HZMA 3EDFA 2BHZA 1LL7A 5EBUA 5EGRA 4R3UA 1DIEA 3A22A 4DWSD 3LRMA 2ZXQA 1E40A 4LAZA 4WY0B 3W82A 3AMLA 3TXVA 4AHPA 4W5UA 1QCWA 3OOQA 2DEPA 2FB2A 4QLKA 3LYEA 3G0XA 1RAKA 3AI0A 1RCXB 1XJBA 3G1FA 2VFFA 5F7UA 3IGXA 3WCZA 4PSPA 2NQZA 1XBYA 3F4DA 1UD6A 2YX0A 2H90A 2VEFA 4HNOA 3W7DA 1FWBC 2CBIA 1EC9A 3VCNA 4LBRA 2XN2A 4CN4A 3HU7A 1W8GA 4AYGA 2DSWA 1R46A 3SN1A 5A8MA 4YN5A 4UFJA 6REQA 3P62A 2JIEA 1QPRA 1A5BA 4D1JA 4PBFA 2Z26A 4KFPA 2PDNA 3GU1A 4GVIA 2PODA 3ZVIA 2GJPA 2ALDA 5IFPA 4YWSA 3CB8A 1ECQA 1KV8A 3KOYA 3MYOA 3VNDA 1O1ZA 5C2XA 3UR2A 4MTVA 1TPC1 3F1QA 4PA8A 2P8CA 2G50A 4DX3A 3VMPA 1V0LA 3LXCA 2G4FA 1GT8A 3V7PA 3PZTA 1XIFA 1P0EA 2D69A 2KX9A 5C55A 4I9AA 2AQOA 3RUBL 5HA7A 3R0DA 4PL1A 1LCOA 1FH8A 3FX4A 4G6CA 2WZEA 5MHBA 1QO5A 1Y0EA 1NP2A 4FF5A 3LTYA 4GXPA 1NAL1 4NUWA 4DUOA 4LAMA 3NZPA 1PHWA 3GZ3A 2A79A 1HP4A 3R6IA 1SSDA 1K9TA 3E6EA 3ZXWA 2C1IA 1JR1A 1OINA 1HFBA 1E0UA 3PZQA 4LUTB 4FNUA 1C29A 1TWSA 1K8ZA 5CEWA 4RZ6A 4N2YA 5ENLA 3AXIA 1A50A 1M41A 1FXQA 1TA3A 4C7FA 1TZZA 1PX4A 3CAQA 3LSBA 1FDYA 1P1XA 2DZPA 1GKPA 1UC5A 1WPCA 1E4IA 3PJTA 1PBGA 4G7EB 4HNUA 2C79A 2C14A 3WEZA 1R9YA 3E2SA 1J0ZA 3UXAA 3AZSA 3UZJA 1XCWA 3CBWA 4D8LA 3R8GA 3GTNA 1H1ZA 1R86A 3FJNA 7TIMA 3WQPA 3P0WA 3C2VA 4MOZA 4WXZA 4AWTA 5F2GA 4E2VA 2QKFA 3DYMA 2V5KA 4L4LA 5FL0A 3CV7A 3S2CA 3T78A 3T0DA 1VQTA 1TV5A 1UR3M 1CGXA 5E93A 2BTMA 5ECVA 4MNLA 4JEJA 1GQNA 4BWLA 1LRNA 1A5MC 2MUCA 1P5BA 5FEXA 4FNSA 5M2FX 2PTDA 5I3IA 4PB4A 3P84A 3U5YA 2OKTA 1R2SA 1KO0A 3RX3A 4CD7A 5A6BD 4R9XA 2B7NA 4WDTA 3B05A 1VYSX 3CT7A 3PPFA 4HHHA 4Q8PA 4HOZA 1D7KA 2DZUA 5CPTA 4MUZA 5MF5A 3MMUA 1RJQA 5FJUA 4H6EA 4KWUA 1A4LA 2WPBA 4JQ1A 3WQCA 4JOMA 3G3MA 4C1KA 3GTXA 4O14A 3W23A 4FAMA 4K2SA 3W1PA 1GJPA 2BGSA 3KAOA 6PTDA 3O1NA 3MI2A 4NZ3A 2HVMA 5LNSA 3DUGA 4YYFA 4X9YA 1XBXA 4ZTYA 1EC8A 2E9LA 4RNHA 1UH3A 3MMTA 3MZNA 5LNRA 3SRKA 5A3HA 2DSZA 1IZJA 2KZHA 1IGSA 4J3SA 1R6WA 2PI6A 4IP7A 3ARWA 2VCAA 2VCCA 4IGSA 3C0QA 4QDPA 5HQEA 1SYTA 3DC8A 1GVOA 4S1FA 4TX9A 4XKYB 2BGNE 3ABXA 2BZNA 4EE9A 5IDIA 2QVNA 3GXTA 1JPMA 2ZICA 4J4KA 2DQXA 1T40A 1WAWA 1ONXA 3PBWA 3W25A 3PBMA 4GZIA 1M7PA 2A4AA 1KXQA 2H9AB 1YNYA 3CAKA 4TMBA 2GQ3A 3UJSA 3ABQA 3IV3A 4F0KA 3AHTA 5KMYA 1ZBKA 1UD2A 1ZB5A 5LNWA 3UERA 4UTUA 4X0VA 2Y8UA 5FSDC 3NQ7A 3RN6A 1M5WA 5CC3A 1R3YA 2CLPA 1DIKA 2Y2WA 3LCGA 1W91A 3MC5A 4Q4QA 1ZJAA 3UCDA 1KC7A 1Q7MA 3BURA 1VBUA 3PTKA 4RZBA 3WQGA 4C6FA 4RK8A 4CN1A 4DXVA 3TTYA 2AAAA 6ENLA 1ENUA 3A3HA 4MNJA 3H4WA 1VRDA 2HQAA 3QXBA 4WOQA 2X0YA 2PGWA 4GX9A 1YDYA 3DFYA 3TW7A 4G8TA 4E4UA 1ZSXA 4L1WA 3H53A 1OFQA 2I9UA 3RCNA 2J75A 4J7RA 3ITLA 2FZMA 1LOSA 4X61A 1DYSA 3ZMRA 4YTTA 4AVNA 4ZSTA 1XISA 4TR9A 3G24A 2QUUA 5AZ0A 4R88A 3D6NA 3H26A 1XINA 3GKAA 3KVJA 1Q6EA 5DRCA 1MDRA 3CMGA 2O9RA 3IUDA 1KTCA 1W9PA 1Z44A 3SURA 4C5ZA 4DXXA 1KQZA 1XBVA 3V0TA 3M0YA 3OEXA 3OG2A 5BMWA 2XVLA 1YDVA 1P0NA 1QNOA 4C7GA 4S23A 3SO7A 2D73A 3ZO9A 1MMFA 1N2VA 1TMHA 2V81A 2V8ZA 1VFMA 1EQCA 4QE5A 3SCSA 4IIHA 3NQGA 1US2A 3W87A 3VKBA 2HNHA 5D03A 3F2DA 2Z1BA 4Y2WA 5C5YA 2QUVA 3CU2A 1H11A 2WPGA 4GUIA 5CBBA 1C91A 4O10A 4L9XA 1X7FA 2CZ5A 4JIPA 3DFOA 4DJFA 1V08A 1Z32X 2EEXA 5HUOA 7ODCA 3MHFA 4Q7IA 4L6HA 3FNDA 4R7WA 2HDJA 4AF0B 2D0GA 1S5NA 3B8DA 1CENA 1K77A 4JNMA 3CPRA 1QK0A 3WJZA 2YLLA 3KVMA 4XD4A 3VCRA 4PMXA 3MSYA 3MWCA 2V2DA 4I9TA 3HFTA 4UOZA 1GQKA 3BAWA 3KX6A 4GK8A 2IS7A 5A6MA 3IJ9A 3MTWA 2EAWA 1EHAA 1ONEA 4O13A 3W2UA 3GIQA 3LA4A 5A94A 2PFHA 1U33A 2BXYA 3AMCA 3SUWA 2HVNA 2XM2A 1U2YA 2XSAA 1RK6A 3LMZA 2BY1A 4NIRA 2AL2A 3WNLA 4E4PA 3GW3A 1PE1A 4MB1A 3RLVA 3H7RA 1I2NA 3B0XA 3GRIA 5TNVA 1L6FA 3L0NA 4JY8A 2BG5A 1US3A 4MWAC 1Q8JA 4MDOA 1UWSA 5BRPA 1ZBWA 3N34A 1EPXA 4FLSA 1G94A 3QYSA 5CLWA 4GWEA 4H3DA 3L4ZA 3WQOA 3CUHA 3S5ZA 4DWDA 2W6RA 1C8QA 2XTKA 3VIMA 4HA1A 1H1YA 5D2XA 4OUEA 4LS1A 4MKSA 3G1VA 3WDJA 1LRQA 5K9XA 4KQNA 2V3DA 9XIMA 1EWDA 1XIBA 6XIMA 3CK5A 3QHMA 3SN4A 2CEQA 1S2CA 3CTLA 4F0MA 3QPYA 5HNUA 3OGSA 4QAWA 4WJ8A 2E3ZA 2CXEA 1Q6FA 4EK7A 5J5RA 2CHOA 1QR7A 2ZX9A 5LIYX 5BOFA 2V38A 3W0KA 2QCCA 6CGTA 5HMFA 1PKYA 5AHNA 4H9UA 4HSOA 5C9UA 2CZEA 4GC3A 3CHEA 2VEPA 1L2QA 2Z00A 1TPH1 2VC9A 1CT5A 2QCLA 2XYLA 3N2CA 3NL2A 4JEQA 8XIMA 3EX4A 3N2XA 1A80A 3FK4A 3NEVA 1WA3A 4XKMA 4DLFA 1TYGA 4L65A 4IMCA 4Y9NA 4AD3A 3WLKX 4YCPA 3HGRA 2FVKA 5I00A 3GDBA 1F6KA 3EKLA 4GVFA 3S5NA 4EWJA 3AXMA 3R2GA 1DIOA 4ML4A 3C2OA 1CWYA 5HINA 1Q7QA 4UQAA 2QEZA 1XL9A 2IW0A 1KCKA 4ZR8A 2XIOA 4S3GA 1HIZA 3JZEA 1I75A 4XG1A 3LHZA 5AYXA 4Z08A 4V1XA 3TC7A 5ABFA 3W76A 2JFEX 4PMVA 4TV5A 2XIJA 2OCZA 3H2CA 4WSHA 1EDQA 2CLKA 2RHGA 4MVAA 1Z8AA 2W62A 4PMRA 1MEHA 4J3WA 5F1VA 1NOWA 1SFTA 3W71A 4FX6M 4GY0A 3GC2A 3LXBA 2Y1HA 3EOEA 4JIIX 1KRBC 2HPMA 1ISWA 1TZ9A 4GJ1A 3IK4A 3SIMA 5KINA 4M19A 3HV9A 2OLHA 4M7SA 2ZA2A 4YTSA 3QTGA 2CLOA 3A21A 4G56A 1KM6A 4NKCA 4I3GA 1DJWA 1OZMA 1VYPX 1C7TA 3DC0A 2JK2A 2W5FA 2JKPA 1LBLA 2G3JA 3TYBA 4V2XA 5L6UA 3WBAA 1GOWA 4AD4A 2VX6A 3N14A 3PJWA 4GYPC 1HUVA 4DXKA 3IIOA 5D09A 1QBBA 4NHVA 4HCLA 1W5NA 4HU8A 4NNAA 2WKGA 3TJLA 4LGXA 3GSMA 1H7XA 4QJ5B 4JTKA 1J2BA 1VPYA 2XSXA 4P7RA 1ALDA 1EYWA 3OIXA 4S3KA 3PJUA 4PCNA 3QY7A 4WGHA 3OP2A 1K70A 3OYZA 3M0ZA 4Y7EA 4S3AA 1RBLA 4F3HA 3ATYA 3E38A 1AQHA 4LH8A 2QXWA 1V0NA 4Q4RA 1AQFA 5JBDA 1BVNP 2XN0A 4BF7A 4KRUA 3PZMA 5CGQA 1B9ZA 2J8TA 2NVCA 1EHNA 1R3QA 2X1TA 1HX0A 1QPKA 1OD0A 4NX0A 3V3WA 2WCSA 3NL5A 1XKYA 1WP6A 2CW6A 2O9OA 5L9FA 4DM1A 4Y90A 1YW1A 7REQB 3F5KA 1J5TA 3NPVA 4QFUA 3W2LA 1R0MA 4UFHA 4HZ7A 3AMKA 3P74A 2D2OA 3MANA 1B3VA 4DJFD 2A3LA 4F0RA 2OSWA 3NO3A 1JGIA 1TJ0A 3HM7A 4MHBA 4QLJA 2VI0A 4RKAA 2F38A 2XIMA 2C6QA 2I16A 1QOXA 2C7FA 3W24A 3EPNA 4HN8A 4POCA 1CXEA 3ZLGA 3I7RA 4NASA 1W9DM 1E51A 5F4XA 3ANVA 1EKOA 3W7IA 3AFBA 2GGJA 3GG7A 2PDFA 1RUSA 3A5FA 1AH0A 1H5YA 2A7NA 2X16A 3VNLA 4H7CA 4DAIA 1IXOA 1EC7A 1OIMA 1ZAJA 3H23A 3DBNA 2WVTA 2NUXA 1W3NA 3G1HA 3KVLA 4H41A 4MKVA 1WX0A 4J2MA 4R5EA 3IPWA 4TTGA 4U28A 3VO0A 4K39A 2H9AA 5E9AA 3QKZA 2NSXA 3WLJA 2GSHA 1P1MA 3G8EA 3LHVA 3A4WA 3MV11 2ZA3A 3AYVA 2DU2A 3CAWA 3EB3A 3VIIA 4RPQA 1JRCA 1X8CA 1TMLA 5DF0A 2Q01A 1SW0A 2Z24A 2DORA 3RU6A 1IEXA 4HU0A 3UA3A 5I24A 1VPQA 1JYNA 3VD5A 2WO5A 4JHOA 1CCWB 1VP5A 3QW4B 3STGA 4JX6A 5H8MA 4AZIA 4ZVJA 2WHKA 4PSRA 1T99A 1GGOA 2BVDA 4YVXA 4JTAA 4CD4A 2ZZ4A 1B30A 4REQA 3WMCA 4GJIA 2ALRA 3KL5A 2WQDA 1RSCA 4MIMA 4BWLC 3GR7A 1UR4A 3AS1A 4JS3A 4EAYA 4UZSA 2C3ZA 5D2VA 2GGIA 1LRTA 2JE8A 3EA1A 3M0JA 3TYUA 3BPWA 2QUNA 1QPOA 4XO7A 5BWAA 1VS1A 3H8AA 3UNTA 3VOFA 4O15A 1JI2A 3H2MA 5HPCA 3JRKA 2YLAA 1M04A 1UC4A 4Z1BA 3BLFA 3BAJA 3IVSA 4LS0A 5IXEA 4ZB2A 1KBKA 1R9XA 4M80A 1AZ2A 1K8XA 1V93A 3N2TA 3CMFA 5GQBA 1MO0A 5D4YA 2V5CA 4AMCA 1Q6RA 4R7OA 2GVYA 4E8CA 5IOBA 4DRSA 3LCHA 4UCFA 4WXYA 3O2LA 3WN6A 3O0KA 3ALFA 4W8AA 2XVKA 4GYKA 4IQDA 4O28A 2ZVIA 5JIWA 1LORA 3REQB 4EACA 2AGTA 1DJHA 1ML1A 3GO2A 3WQ4A 3LPPA 3V5CA 3XIMA 1W5PA 4JKMA 1GOOA 1HJVA 1R3VA 2YFNA 4IUGA 4MPKA 1A3WA 2J27A 4ZOEA 4C6CA 2VC5A 4PTMA 4Z1YA 3PUDA 3RFAA 1OB0A 3BOFA 2EQDA 1M9HA 3LS9A 4LB3A 3TC3A 3NURA 4MLRA 3QOMA 2QZRA 4RDZA 4K68A 4O52A 1FWEC 3ERPA 3TYEA 1R7OA 1D8CA 1GQLA 1VKFA 3TU9A 3V1HA 3V16A 4D2JA 3ZS4A 2DT1A 1KGWA 1TIWA 2Z4GA 5FA5A 4KBXA 3VA8A 3LGGA 2QCNA 1AQ0A 1KBJA 5AYZA 1LBMA 2PDXA 5M3WA 2B31A 4D6FA 3R1ZA 1JZ6A 4QNEA 4UNIA 4O12A 4ZXLA 3UFYA 1AFSA 4LYQA 4FF7A 4L1XA 2QJGA 4TUFA 2BV9A 2P0IA 2BMBA 5DCDA 3R11A 2DUAA 4DZ5A 3CQIA 1RLCL 2C18A 3NO1A 3N2MA 3CZLA 4JCMA 1MZHA 5LXXA 5C0QA 2WWCA 2B0MA 1XYZA 4GI4A 3GAKA 1R3TA 5CLTA 3DZ1A 4IJRA 2ZC1A 3VZYA 2VELA 3CS2A 3B8IA 3C2YA 3OVPA 2YXGA 4N6EA 2WZHA 3RLGA 1SMAA 3O05A 4E8GA 2DZAA 4AIEA 2V63A 4RCXA 4LT9A 3W88A 3T2QA 1Z9AA 1PUDA 5FF4A 2ZTJA 4XAFA 3WFLA 4UZUA 2XVNA 3CZJA 4DEFA 3O06A 4GNJA 3CL7A 5IM51 4LTSA 4NNBA 4YCOA 2ZBTA 1UWUA 4E38A 3ZR4A 5C8BB 2VEKA 3S0CA 1MW2A 1SM9A 1PDYA 4KW2A 1VEPA 1RCOB 3W6LA 2WNWA 3KL3A 3TV8A 1E3XA 4MY9A 3K8KA 1HF6A 4Q4KA 4QDMA 1TTQA 5CPSA 2HS6A 4GZEA 1VLIA 5CQ1A 4JKLA 5I3HA 1NDWA 4N4PA 1X7IA 4RZ5A 5LHFA 1FWDC 1Q4NX 1BRLB 1GYNA 3TJIA 1L2UA 1IZKA 2UY2A 4C5YA 5CG0A 1TX2A 2FMOA 4RV3A 2YYUA 4ZE5A 3L9CA 3QLDA 2WHLA 4CVUA 2YCKX 4F0SA 1KQYA 4AY8A 1TG7A 1WZLA 4WKAA 5JH1A 4IZGA 3RLHA 4AD0A 3JUGA 3BLLA 2OB3A 3ZZ1A 3ZVHA 2P88A 1FCQA 1Z42A 3TNOA 3M5XA 1UQZA 3LBMA 1W1PA 3S9YA 1XLHA 1JDDA 1H3GA 4J3UA 2WK2A 2WLYA 1EGMA 1B90A 2H8ZA 2BB0A 3BV4A 1HZYA 4R7JA 2PSNA 1W9VA 3HA1A 5CGTA 2NXHA 4MAZA 4LUSB 4H2CA 3N2OA 1LM1A 2VGBA 2UZ9A 1J10A 3ARPA 1RALA 2AKMA 1B2YA 4LS2A 1ICQA 5A95A 4JIRA 4PMJA 1PDZA 2E5BA 2QHAA 4EPBC 1LDCA 3FKRA 1ADDA 1XP3A 1UA3A 5LA2A 1S39A 2Y24A 3FA3A 1PEZA 1WO2A 1G4SA 3LB0A 4PBEA 1E9YB 2OTDA 3JU2A 2YA2A 3P82A 4GYJA 1S3TC 2O4MA 1G7UA 5A1AA 2PWEA 4ZQCA 1J0KA 1ADOA 1XLEA 1H7RA 1FWIC 4K37A 4KRTA 1DEDA 1AJ0A 3GH4A 4GOAA 2PRLA 3B4YA 4LB4A 1D7FA 1DJGA 3V0SA 3W07A 2VOMA 2OKOA 1A0CA 2WJFA 3KDNA 4KMQA 4MNKA 4Z2HA 3VDHA 5XIAA 4AC1X 1EX1A 2ZWYA 2GDUA 1MUCA 4XWUA 2IKJA 1CPUA 3IIZA 1L8PA 1UOKA 1D2KA 1GYMA 5BOOA 2V69A 4FHAA 3C6CA 4LEQA 3R25A 3GHUA 5AHEA 4I9JA 4D1IA 3J7HA 1H0IA 2PDGA 3IIPA 2PDHA 3SN0A 1FFRA 2V0TA 7ENLA 2ON3A 5I06A 1JCMP 4IISA 4QX4A 4NT0A 3VKCA 1XIEA 4XBJA 3S1UA 4LQ1A 4EVZA 3TW6A 4K7YA 2WZTA 4DNMA 1OFAA 4ADTA 2DH2A 2LLEA 2QIWA 5H8PA 2NT0A 4XSMA 2WZMA 1R87A 2QCDB 5CZKA 4A3RA 4Q4PA 2PC8A 1DIDA 4GVHA 4ZMGA 1BWVA 2UY5A 3GVVA 4BQ5A 1ITXA 4TIMA 2OFJA 1GOKA 2AAMA 1RD5A 4JNYA 4NRRA 3E02A 3HJEA 2MANA 2X0SA 2ZZ7A 4OWGA 3M44A 3F4NA 5DBTA 3ARQA 1AJZA 2C15A 1ME7A 4HGXA 1I45A 3A23A 1R38A 1BWLA 2PA6A 4K38A 4O1BA 1F7BA 1MNZA 2CCRA 3H2OA 2V5BA 1FH7A 3BLPX 3URNA 1KCZA 1XG3A 2EXOA 3LM3A 5JH2A 3UR5A 4MSSA 2QJJA 2VZOA 3MCOA 1XUUA 2DV0A 1XC4A 1XFCA 5CPLA 1T8QA 3NM1A 5AC6A 2W27A 3B8SA 4J2PA 5DELA 4A29A 5C71A 3CQKA 2NV9A 1H61A 2HISA 2Y61A 2QV5A 3VGHA 3HJZA 2Z7KA 2CPUA 4C6KA 3OLIA 3N4AA 3AYTA 2TMDA 3NZGA 3FHQA 1OZQA 2BHUA 4B9ZA 3MDWA 5D9NA 3CQHA 1E1FA 2PTXA 2VGGA 3PZGA 4IIDA 4KEMA 5DANA 1OVDA 3CAVA 5I77A 4MJ4A 2E6YA 4GABA 2CZVA 3S1GA 4GQQA 4U10A 4O8RA 4AUBA 5GJNA 3MYPA 2DVUA 2XFRA 1H4PA 2WMFA 4RLIA 2PB1A 3BAKA 2Y62A 3FJLA 1LL6A 5BXSA 1PB0A 3W9ZA 5G2HA 1JNDA 3WNOA 1JQVA 3W72A 1ITCA 2J78A 4QXIA 2ZX5A 3NPWA 4F9JA 3G0UA 5CZTA 3SY5A 4GQ0A 3DI1A 4B91A 3FIGA 1OK4A 1NDVA 1Q2RA 3W00A 3E49A 5M03A 3G1RA 1UP3A 1QJWA 3EDKA 1PS9A 1DVJA 1W31A 4D6HA 4MNMA 4ZOCA 1XLMA 3ARTA 4P8WA 3WUFA 3SEPA 3HMJG 1E4MM 1UWAA 1TO3A 3AU2A 1UZ1A 3W4RA 1ICSA 1S5TA 2XIIA 3APGA 3GR4A 2P53A 3DFTA 4C6EA 3GLCA 3EXRA 7PTDA 2ASHA 1I4NA 3W7NA 4M6PA 4AG0A 3W1MA 5C7HA 4U3CA 4D6GA 1E0XA 3Q65A 5B7YA 3L5MA 3E0FA 1UBPC 3WQ5A 2QJMA 3U4FA 2EKCA 4ADSA 4L64A 3EGJA 4DO6A 3W1XA 3T05A 1ICPA 2WKLA 3E2QA 2PDKA 5AY7A 1KNWA 4W7UA 2ZUUA 3BAYA 4EWND 1YEYA 4O8AA 4RE2A 3RK8A 3FS2A 1I2PA 3R8HA 1MQPA 1UKQA 1Q45A 3BQ6A 3MSGA 3NGJA 3QW3A 2J6XA 1MFUA 1RP8A 5CSSA 5EYWA 5I0DA 4FIRA 4UTHA 2TODA 1NF0A 2OO0A 3CLWA 1TVPA 2R94A 2OMAA 2BWGA 4NVTA 2HE5A 2XSBA 3KBJA 1KKRA 3E9AA 2FZDA 4PMQA 2Z28A 1G4PA 2R6OA 1OYCA 2WBGA 3RO6A 1AZ1A 1F5ZA 3KBWA 4QAIA 4IPPA 1POJA 4B4HA 4C6JA 1F07A 3N4EA 3UXKA 1EH9A 3BLEA 1FXPA 4W84A 4AD1A 2YPIA 5HNTA 1IWAA 1ELSA 3RILA 1W2VA 2EPMX 2Z25A 4XD6A 4AZ6A 3PAJA 4CU6A 3PG9A 4MY1A 2OXNA 1XSKA 4B3LA 2ZXBA 4NZFA 2XHYA 4B2DA 3GXIA 2QCEA 2ONEA 1EO5A 2BLEA 4Q3MA 1YE4A 3GHRA 4NI3A 1WAUA 2GUYA 4CGTA 3ISIX 3RYSA 1Y5WA 1F9CA 1JZ4A 1XDLA 3MBFA 4XZWA 1E6XM 1UKTA 3O6DA 2OT1A 3LNPA 1N8WA 2ANUA 1CLVA 1GG1A 3ZJ7A 3IV8A 5A8OA 4EANA 4DHGA 1WXJA 2IMRA 1GHSA 1B0IA 1FOBA 3W1AA 1TUFA 1GHRA 1TB3A 4DELA 1MW3A 1W3TA 2QPUA 3W26A 5K4ZA 4LCSA 3WBWA 1GVEA 4DUXA 3ABZA 3T1GA 4FOKA 1JZ5A 2BODX 3DG3A 5E6YA 1GOQA 4M6QA 2NQ5A 1M01A 4I7WA 1OEPA 4GVGA 2RH9A 3R4IA 3VIFA 2E8ZA 4KCTA 1RBAA 1BGAA 1KFJA 3T0TA 4UQEA 2MNRA 3RGTA 1BF6A 1B4KA 4AZGA 1IT8A 1EJ7L 5DRIA 3TOYA 4GJJA 1K9EA 4K3ZA 4YHEA 4UFLA 3E2RA 5F1UA 4O0ZA 1A3HA 2OZ3A 1O5QA 4HYVA 3AMGA 4UR8A 2VC7A 2VFDA 3GWQA 3NYZA 1I0BA 4JDBA 5D9PA 3CLMA 4NL1A 4DBUA 3B9EA 2VD9A 2ABBA 4XIAA 3I68A 1DOSA 3I3DA 3LD5A 1GOMA 3GDLA 2VUYA 3H7UA 3PN8A 4ZFCA 1O5KA 4N6FA 1BFNA 1MVYA 1UBSA 1W3KA 1MQRA 5C70A 3BJTA 3KHJA 4YIWA 5CAKA 1W1ZA 3ZWTA 3NO5A 1F8MA 1MW1A 3AMDA 2HROA 2DQWA 4YU1A 1P6WA 2NLYA 4UTTC 2XGZA 2POZA 4WVXA 4BZYA 3AIEA 2P0OA 2E9BA 4P5UA 3VGGA 2C13A 3ABOA 1N8FA 3TJXA 3EPOA 1HXJA 3IGSA 4KGLA 4A2SA 2ZRXA 4ZQRA 4Z2KA 3ZM8A 3VFLA 4GIYA 1IV8A 2J47A 3HQ1A 4GFIA 4CCEA 2WC3A 3BAIA 3I3EA 3FYOA 3OQ8A 3GFZA 2JGYA 1ME9A 1E9IA 4IIEA 1XDJA 3B8TA 1KTNA 4C7DA 4PE8A 4PUWA 3AIUA 2WLZA 1ZLPA 1J5SA 3K13A 2ZUMA 1F6YA 2WVSA 1EOMA 1TR9A 2PDUA 3E0VA 3GDTA 3HPAA 5F2MA 1PO9A 3CO8A 1B1YA 1QOQA 3VMOA 5GVJA 3AICA 1KM2A 3S6TA 3G18A 2HVOA 4Q8VA 1D3GA 3SSJA 4MYXA 4NAFA 5MKGA 1UP2A 1NDZA 5AHLA 4I5UA 3UPWA 4OZOA 2J7HA 2D0FA 5SWUA 3CC1A 4R34A 1FH9A 3QM3A 5GPRA 5CZSA 1J4EA 1N7KA 5HANA 4O19A 2GDVA 1R5YA 1MXDA 2YXXA 2PLKA 4XQ6A 1B4EA 4DF2A 5A8PA 2A1YA 3W7EA 4DI8A 1M68A 3VKJA 3NPUA 4O1CA 3UZ5A 2VNCA 2Y8VA 2E8YA 4FB7A 2X2YA 2YCEA 4J27A 3WF1A 4LC6A 3WNMA 5HJYA 5C2CA 4L4MA 3I7SA 4WIWA 1RQEA 1PCKA 3W01A 4JFSA 9XIAA 4F8XA 3RM8A 3NL3A 2TYSA 4JTQA 4UUIA 3DGBA 4D6DA 4C6OA 5T8GA 1OCQA 3SFWA 1RP9A 4URIA 2I5GA 3TZNA 1VBRA 3QTPA 4AWUA 4PC8A 4H8NA 2CXGA 4GUHA 4ZA0A 1ISYA 3LY0A 5D32A 4P7QA 1E6ZA 3QYQA 1OIFA 5REQB 3CMJA 4LBUA 4ZFMA 4ACZB 2ZZ3A 3L65A 4U33A 3UR8A 2BHYA 4JXCA 1UKPA 1VYRA 4OIFA 4H9ZA 2WCAA 3PBUA 3ARUA 3APYA 1J11A 3GDKA 1A5LC 3TK7A 1NJJA 4H6KA 3P14A 4FNPA 5AYIA 4OV4A 1FWNA 5BRQA 1H49A 1EP3A 1Q63A 4M6UA 2R82A 4FOUA 4XZHA 3WMBA 5GNZA 1JPDX 1HKVA 1YBQB 5DXXA 7A3HA 4LCRA 3DHPA 4B2DD 3VM5A 3W1NA 4UTLA 1O7AA 4J3VA 5EBAA 4HD5A 2E7FA 4PBGA 3L4TA 4LJ3A 4DQWA 1S2VA 3LOTA 4GBUA 2Z2UA 4W9TA 2BBFA 1EL3A 3LU2A 3NVTA 1W3LA 4GIRA 1GTEA 1NWRA 3IUHA 2WNQA 1V6WA 3OGRA 2EKGA 1MXSA 3MWAA 3KFTA 2HK1A 1X6NA 1U83A 2DH3A 4UTIA 4XD3A 1EOKA 1DWGM 4M6VA 4DUVA 1ZAHA 2FDSA 3JVAA 1UWRA 3UXLA 3OYXA 1CXIA 1DQUA 3VZXA 2FIQA 2DZSA 4HPNA 2F84A 2JEPA 4N9DA 3TYDA 4Q8TA 5KEZA 4DO5A 4GQRA 1HKMA 4BFAA 1WYIA 4BA0A 3VYLA 7CGTA 4IL2A 4WHBA 2FZ9A 2FH6A 4LRTA 1OT1A 1X98A 3H4GA 3MB9A 3SY8A 3W29A 4XZBA 4JTTA 3LENA 1UWQA 1JAEA 3AROA 2G97A 1OHLA 4D6JA 3M16A 3PNZA 4Q4SA 1HNYA 3TSBA 1UMYA 5G1TA 5AHFA 3MP3A 4J3ZA 1KRAC 3LCIA 1J0YA 4FA3A 2PURA 3RX2A 3MHUA 1TJPA 1LWIA 4NF7A 3LQLA 3M7WA 2ACQA 3ZT5A 4HNCA 3UVAA 5D8ZA 2HPIA 4GO8A 5H2ZA 3HGSA 1XGZA 1VR6A 3B8VA 2HXUA 1DXEA 1SO3A 2FPYA 3UWZA 3HN3A 3NXLA 4NZCA 4BS0A 1Q13A 2ODOA 3PANA 4W85A 2CKRA 1HG3A 3HQOA 4WQ6A 3DH7A 2VUNA 3W2JA 1BLIA 2OWWA 4C6IA 4D6CA 4V15A 3WO8A 2OZ0A 1JRBA 2JQXA 1H0GA 1GORA 4W87A 3NIYA 4ERIA 2GUUA 1XICA 1OADA 2F6UA 1KM4A 4RPPA 4X63A 1FDJA 1T7LA 2YXOA 3VOGA 5FF2A 1OC6A 1OF6A 3U57A 4Y9OA 1PZ2A 3W27A 4ICMA 2HCVA 1Y7VA 3PBGA 3W7PA 5CPMA 2ZRVA 4U5IA 3NZ1A 2A3AA 3DU0A 3SCWA 4IIGA 2PU1A 3AHVA 3GKFA 4UMAA 1XR2A 4Y6GA 2R1MA 1NQKA 2HK0A 3A9BA 4XUYA 1LG1A 3ITOA 3PZUA 4B5XA 3NQ2A 3KTSA 3OA5A 2ZRUA 1QAPA 3GBDA 1XS2A 4C1LA 1W1YA 4QCEA 3CQ0A 2Z7GA 3F2CA 4P7LA 4G5DA 3TC6A 5CGMA 4K1GA 5LGZA 3W38A 4LOCA 1EJRC 3NA8A 5LKYA 1A49A 5EMMA 5GJPA 3H6OA 1B5TA 2J24A 3M5ZA 4ZOBA 4LF1A 1V02A 4MLJA 1SJCA 1V0MA 4MJZA 4WKFA 1V7YA 3NEHA 3NQ6A 3WDRA 2XH7A 4CLMA 4UWMA 4LFYA 4V33A 3GYCA 3N12A 5D02A 3GD6A 1F05A 2ZRZA 2WM0A 5PTDA 1DPMA 1CXFA 3N3TA 4PEKA 2AL1A 1EIBA 1QTWA 5HNNA 3BLIA 2GJXA 2YL6A 3SY1A 2L5HA 3KW3A 4BEQA 2FZBA 1CYGA 2GK1A 1PSCA 1JUEA 4GUFA 3B3DA 3DHDA 1ZCOA 1M1BA 4I8YA 3TA9A 2EG6A 3WEMA 3UW6A 5AKQA 4DZIA 1FWJC 3W74A 2QUMA 1E4LA 4PRRA 4XAGA 3CH9A 4I5RA 3PUGA 2IPWA 2PCQA 1J0JA 3S6OA 4ASTA 1E6NA 1XC6A 1DWFM 1Q85A 1G69A 4KCUA 4WOZA 3BLDA 4FPSA 5I2UA 2GOUA 1DQWA 1VZWA 4FO4A 3OODA 4LYPA 3MT1A 4S38A 3SZ8A 3W85A 1RPXA 5CG7A 1F3EA 3Q58A 1S5MA 2DZVA 2VXNA 1FBAA 4IHCA 3FVDA 4GI6A 1CNVA 1NVMA 3INPA 3TYAA 5HNRA 4LVGA 3UYCA 3THDA 2F9RA 4MADA 1NWTA 3BLKA 1FCBA 3F03K 2QCHA 1XIMA 1VAHA 3E3HA 1JUBA 1XLCA 3VGEA 3PTQA 3KXQA 4ZE4A 1A47A 1NELA 3OJGA 3VIKA 4NZ5A 2INEA 4WSJA 1NWSA 4IX0A 3STPA 1I2QA 4Z1CA 3U2ZA 4TMCA 3EKGA 4JFWA 4AWEA 3B04A 3G22A 1EZWA 2PGFA 1O95A 3OG3A 4HA3A 3SGGA 1DJIA 4MZYA 4UTWC 3KRUA 2PP0A 5D2TA 3KE0A 3VC6A 4MDPA 4HTYA 4H9MA 3LERA 1M7OA 1DQXA 4IP4A 4PB3A 3W1UA 2RFGA 2X0HA 4HMNA 4Q33A 2G37A 2ZRYA 4ENLA 4OQVA 3VIPA 4C6BA 4CQDA 2PLCA 3OHIA 1SZGA 1BKHA 1F4AA 4AD5A 1ZENA 4XTDA 2WMIB 4JYFA 4Q4OA 1E6PA 3VMNA 4E3TA 3K5XA 2C16A 3CV1A 3UEQA 3WK1A 3JS3A 1JZ3A 4I6VA 1JDCA 7XIMA 2QPSA 1RVKA 2G3IA 1PKLA 1QNRA 3W1TA 3IARA 3O8AA 3PUEA 3C3NA 4AIBA 3QGAC 4BY3A 3H2AA 4YMZA 1VFLA 4X22A 2Q8XA 3WF0A 1A5SA 2XDFA 4PCFA 3ZT6A 1UD4A 4F48A 3EDEA 3WLSA 4FK9A 3MP5A 2Y7GA 4QRNA 1KRCC 1C8VA 1Q8AA 3SAZA 3UQNA 2IUZA 2YW3A 1KM0A 2X1UA 1BHGA 3FGCA 4NJGA 2OX1A 1UMLA 4JTUA 5CSRA 4FNRA 2VENA 1ESWA 1H41A 3AWNA 1MDLA 5D2YA 1H7WA 4CCDA 4H19A 2CITA 4FLQA 4MAVA 2PRMA 4NI8A 4F40A 1IEQA 4FX8A 4IPNB 4DYEA 1VF8A 3SDOA 3L4VA 5I3KA 4XB3A 3C52A 1F2JA 3GNNA 2CBUA 2WZIA 2HE8A 4Z42C 1H51A 5DMYA 3N9RA 1ZQ5A 1YLVA 1E0VA 2VX5A 2YOCA 3V35A 3VNJA 3QFWA 4HHLA 3W7QA 1O94A 4HJFA 1CTNA 2XVPA 1O4UA 3DKJA 1KBIA 3CHFA 3C86A 3UWUA 5ABTA 4JPGA 4J35A 2VFEA 4TTUA 1X1NA 2JF6A 5CZJA 2WMGA 4A21A 5LNVA 2PS2A 1XIDA 3KBMA 3UXIA 4MJ2A 1XKJA 4FEZA 3LLDA 4Q22A 2Z1KA 3TYCA 1GG0A 2C1GA 3HQPA 5HUPA 4RJEA 2ZZ5A 2BS9A 3U7VA 3PAOA 3W84A 1FWCC 1FP9A 3RIKA 1PYFA 1N82A 1YBQA 4AY7A 1W6TA 3I6EA 3TSDA 2ZX8A 1A5UA 5HK4A 3T40A 3B0UX 3W2KA 1GPWA 2GL5A 5D2WA 1Z48A 1KR0A 1NFPA 1XF0A 5I7GA 3RG6A 3ZJKA 2VZSA 2YDAA 1S5VA 3S4TA 5HAOA 2DW7A 2VFIA 4HOXA 2AMXA 2D1ZA 1V3MA 1W32A 4PMDA 4IWWA 2D22A 1NDYA 1M7XA 3L4XA 4DZHA 4UC5A 3UD6A 4HPGA 3K30A 2VX4A 3AISA 1Q65A 4P7NA 1K8YA 3TE9A 4Y9MA 1XPGA 4XO6A 3BZJA 1POKA 3GR8A 4FX7A 2IPFA 2YCIX 1AD4A 2VM8A 3DENA 4S3BA 1E71M 3H22A 3WLTA 1JI1A 5JVLA 2PDWA 5EMUA 1TTIA 1HKIA 1UASA 2BY2A 3L67A 3L68A 4MUPA 1OBAA 4MM1A 1J2WA 3WH5A 8A3HA 2OU4A 4DI9A 5I3FA 1YMYA 3VDAA 1VCFA 1TCDA 3KRSA 1SUXA 2RDTA 2OT0A 4XAYA 1KCXA 4AZ5A 1CGTA 1P48A 1QU4A 5BOEA 3CH0A 2PLMA 4B16A 2VRQA 5DXYA 3AHXA 1LROA 1JCLA 1O66A 2F61A 1SMDA 4O16A 2DSVA 2CFFA 2Z29A 4DB7A 1WNOA 1A5NC 2VYOA 4UIOA 2Z1SA 3MUCA 5AFDA 4PB5A 3GK0A 1US0A 3LEPA 3S8HA 1E6RA 2XZ9A 3Q2DA 4JZ5A 4WLCA 3AIBA 3PSVA 4HKPA 1YXDA 1QHZA 1XGDA 4KIEA 2Z1WA 2FFCA 3SGZA 1W1A1 1WUFA 3THQA 1UZDA 1QHOA 4IMEA 3W81A 3NQ8A 4PODA 4JTDA 2QUTA 5BROA 1NH6A 4JTJA 1RZMA 1YIXA 3W73A 1M65A 1UOZA 2PTZA 3FHAA 4UB9A 5G4WA 2ZTKA 1YTDA 4DJDA 3H2NA 4IT1A 4CNUA 5G4EA 4A6GA 2P50A 3CL6A 1ZBVA 2DFAA 1CGUA 4HU4A 4IXHA 4MG4A 3IIXA 2J7BA 1IE7C 5LSMA 3KLKA 4CU7A 1W5OA 3BJFA 4YVVA 3S42A 4ZZ9A 3TDFA 1EDGA 1WBJA 2PWUA 1TFVA 3T6CA 1Y8BA 3UETA 2OEMA 2DVTA 1W3IA 4JTSA 1VFUA 3M43A 2WMJA 1OYAA 1G6CA 2J7EA 1GYLA 4A8RA 3AXXA 1OX6A 3QR0A 2REQB 4EXQA 5EB8A 1O68A 4H9YA 1HW6A 2G5WA 3G6LA 1TWDA 2YL8A 1RPKA 4PTNA 2ZZ6A 4QROA 4V28A 4CNOA 3BWWA 3DG7A 2HNEA 4O17A 3EDJA 2VDHA 3NSMA 2YZ5A 3OBEA 3JW7A 2J79A 2BX7A 3VI2A 4MWAE 4JIEA 2V3EA 3OZPA 2C8NA 3R43A 1JPIA 3UPBA 2QV4A 4D6IA 3GM8A 3PTMA 3LX9A 1GCYA 3DOPA 1ZPTA 2YL9A 1GQIA 3UCCA 3R8RA 1SZRA 1OX4A 3EXTA 3NL6A 2A3EA 2WSPA 3C0SA 1AK5A 1CXKA 3VZZA 4D8ZA 3LCXA 1YQ2A 5BU9A 3VD7A 1RY0A 3ICJA 2W9MA 1SJBA 4AZBA 3UJEA 3RJYA 1QMLA 2WVVB 4JY9A 5AECA 4HSNA 4CKQA 3IACA 4JN8A 3M6YA 5KETA 4HA4A 4RW3A 1Z69A 2NW0A 4TQTA 1SW3A 1BWKA 4H9VA 2J7CA 4EF9A 3GH5A 1XGEA 4LRSA 1ZU8A 1AH4A 2W61A 4BQ2A 2PU0A 2BSLA 1TV8A 1UWIA 4FIQA 1C93A 1ISZA 4Y96A 3CV2A 1W8SA 1BG4A 1HT6A 3KOXA 1W56A 3SJ3A 2OQLA 4GX8A 6XIAA 3WLRA 3W1RA 3DFHA 1MRAA 3PWAA 4E3VA 3ES7A 5A69A 1PYMA 2ZUTA 4HMCA 4NZ4A 4PCTA 1ZJIA 1YE6A 3LRLA 5CC5A 3QQ0A 4L4PA 1ZNNA 2Y63A 1VFSA 4GHRA 3EX6A 3IK2A 5JU6A 5H6HA 4JFUA 3IVUA 4XZIA 3V5FA 4XIMA 1XYLA 1KM1A 4HB7A 1AA1B 1BVWA 2HJPA 3ITTA 1OGBA 4YHGA 3TN5A 1H62A 1LG2A 2ZX7A 1ZFJA 3TWBA 2DSUA 4MF4A 5AC7A 3WDQA 4QNWA 4DUWA 3CYJA 4CNNA 2PDQA 3OBAA 3NXFA 5CC6A 3NQEA 4AHOA 2WHJA 3JZUA 3C0JA 4R85A 1WKEA 2YW4A 2PDJA 3D0CA 1KFKA 1LT7A 2FJKA 1FWTA 2TAAA 1WDWA 4PMYA 1DXIA 1JPKA 3GHTA 2XFWA 4JHZA 4MYAA 3MSRA 5FF3A 1D8WA 3BGGA 2A6LA 1VC4A 3L4WA 3ELFA 3PWIA 5TIMA 3N17A 2XIBA 3LRKA 2YJQA 3MZ2A 3K8MA 4AZCA 2V5DA 2GQ8A 1NOFA 3W22A 2ZC8A 3VE9A 4RE4A 2QLYA 1YPXA 3S2NA 2FDMA 3TOPA 4CEXC 1P7TB 1IWBA 3LLXA 2DPEA 3PPHA 4FP1A 1SJAA 1JCJA 4HPJA 1F74A 1XH1A 1J8VA 4NJHA 2A7PA 1EA0A 2Q3RA 1QW8A 3C4UA 1ZALA 4TVCA 4WJEA 3DGRA 5G2WA 4H8HA 2VCBA 3EDDA 5LYRA 3TLQA 4DAFA 1HP5A 1VFOA 1G0CA 4Y8FA 4KKXA 5CPQA 2WVUA 3CO4A 3S9ZA 3CUIA 1QI0A 1EZ2A 4Q8QA 3AIQA 3WMSA 3BV7A 4IGMA 4AEFA 3GC4A 2G95A 3T2OA 2R1KA 4Q8NA 5HQMA 1O5RA 2D0HA 2PEVA 1P6BA 3WUGA 3NQAA 4GQGA 1SFLA 3AQUA 2ISFA 1VGAA 4Q8UA 4UQ9A 3WQWA 4QQ3A 2XGBA 3FLUA 3RU8X 3RM9A 1KBLA 4B5TA 3VKAA 4I6KA 1TPWA 5I03A 1E0WA 3ZFHA 1ECEA 5FIPA 4DJDD 3DHUA 5FAJA 4ADUA 5DO8A 4OT7A 1TQJA 4ZENA 3N2BA 3USZA 4EAMA 1E9LA 3WQFA 1P6CA 1MW0A 3K4DA 3H24A 4Q4MA 4JNZA 4O1DA 1JCYA 3ZR5A 2ZADA 4OV9A 2EHHA 5BW6A 1TR1A 2WMHA 4XD5A 3W7HA 4ZQOA 3NG3A 4PTXA 2P1FA 3RPDA 2PTWA 4UMBA 5J04A 1UB3A 1LJYA 3OQEA 1GZ1A 4MWAB 4PTDA 2J25A 4CD6A 1KFEA 4HNVA 2YZRA 1EGVA 2DZBA 4YL2A 4LCQA 1EYEA 3FKKA 3LPOA 4G9PA 4R53A 3B06A 4HCHA 4W86A 2WANA 2ZUNA 1XYBA 1SO5A 5HMSA 4QGCA 2WYSA 3P0XA 2V68A 5EFDA 1WKYA 4QE1A 2J9ZA 3THCA 3LI0A 3C5QA 4PGLA 4PULA 1EP1A 3L5AA 4I7UA 1RJRA 3BSMA 4F9DA 1E55A 4LY4A 5F4SA 2ISSA 3W7KA 4Z0JA 3HF3A 3TN3A 4NQ1A 4DWSC 4B5WA 1X1OA 1B9BA 2IQTA 3NOEA 1P43A 5I3JA 5D05A 1RXOB 2PLJA 5D8WA 1LQ2A 1XDMA 4BKNA 3A24A 1IF2A 3VAVA 3H7VA 3VKDA 2J88A 3F2BA 3WD0A 3OO2A 1ISXA 1A5CA 3EWWA 3N13A 2PRHA 5E9XA 3QV6A 5CSUA 3UA4A 4QS6A 3B97A 3CWNA 3BCDA 1K8CA 3OW1A 3WBEA 3QY8A 4HU3A 4NSBA 2GSJA 3WJSA 2PWHA 3N6QA 1VJSA 1OD8A 1O5XA 2ZUSA 4FXJA 3XINA 4CN6A 5FF0A 4C6QA 2I5IA 1Q4WA 2JBMA 3AO0A 3LHWA 3QZAA 5T9BG 4LV9A 1GONA 1XD0A 2GQ9A 1WB0A 1WDQA 1FWRA 4IMGA 3UZXA 3HPXA 2P5NA 1U1JA 1XCFA 3WBXA 2XWEA 1W37A 3GAYA 4NAEB 4OOZA 3H55A 1ISVA 3W7OA 2VZUA 5EMLA 5FJTA 1GVRA 4DZAA 4FSAA 8TIMA 2R91A 2D2JA 1TKKA 3VDGA 4D6EA 1NARA 1QI4A 3T09A 1QWKA 4QP0A 3EYPA 2X8RA 2WMKA 4UFIA 5I6SA 1UKSA 4WK9A 4A35A 4AVOA 4U31A 4BHYA 3BSHA 5CJNA 1SZFA 4LUJA 1QPQA 1UP0A 4CNPA 4PYSA 5EY5A 3KZSA 1AW1A 4JN7A 1O12A 4PFMA 1DWAM 4NG3A 4TU1A 1JYWA 3TSMA 3H4XA 4W7VA 5HMDA 4IICA 3GXFA 3WH8A 4N42A 4H9XA 2PWFA 4FMVA 2Z1XA 1DP0A 1LP6A 2RGMA 2VVSA 3KS6A 3NSXA 2VEMA 4OHQA 2GVJA 1UUQA 1M6JA 4HNLA 2CESA 3EA3A 3VIOA 3GNDA 4DM2A 4G2DA 3BH4A 1H09A 4WY0A 5RUBA 4HYRA 3GFXA 4HZ8A 3SGUA 5E1QA 4HZ6A 2A6NA 4MJMA 5K7JA 4LANA 3HURA 4ZO7A 5C7VA 4G1KA 1BF2A 2FTPA 4JKKA 4KF1A 1YPFA 3KTCA 3L4UA 3ME3A 1CIUA 2REQA 3G1DA 1HJWA 1S5WA 4HMDA 5HXMA 1BXNA 2TSYA 2CLFA 3EOUA 1J9YA 1JCXA 4MZ8A 1ADSA 1WDPA 2ZE0A 2DZWA 3SUUA 4PEEA 4U2ZA 4H6RA 4H01A 2OPJA 4K8EA 1WQ5A 2D20A 1M7JA 1XRFA 4Q6JA 3VK5A </