1EP1A

Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
309
Chain Sequence
b'ENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAANVKAIELNISCPNVKHGGQAFGTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
publication title Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 99
structure length 309
sequence length 309
ec nomenclature ec 1.3.1.14: Dihydroorotate dehydrogenase (NAD(+)).
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ep1A00
1TRIA 3D0CA 5KZDA 1OFOA 3EX3A 4R7JA 1YXYA 3P84A 5G4WA 1FX6A 1FXQA 4Z0JA 1KFLA 1Z44A 4IWWA 1QR7A 4IMEA 2H90A 1PIIA 1G69A 4GUFA 3EX6A 1LYXA 1Z41A 1Q6QA 2YW4A 1KV8A 1VYPX 4LV4A 4O17A 4AF0B 4RKAA 3FS2A 2E1DA 2C6QA 2GVGA 1JJKA 3N9SA 1GJPA 3BO9A 2YYTA 2V81A 4IPIA 1QPQA 3W1LA 3W3OA 5K2ZA 4N9BA 1XFBA 4MUZA 3CM4A 1OYBA 3ATZA 1EIXA 3GKFA 5F4XA 4AXKA 1P0NA 3S1WA 1M7OA 3UZJA 1LOQA 5DCDA 1OFAA 4L4MA 4JS3A 4S2CA 2BZNA 4WX2A 4UTHA 3PG8A 3S6DA 3M5ZA 1M5WA 2E77A 2Q8LA 3ZR4A 1F5ZA 1S5WA 4A3UA 4DO4A 3PBYA 1SO4A 2B7PA 4Z1DA 3LCHA 1SFJA 1KM0A 2ATMA 3GDMA 3WK0A 3QW3A 4GXMA 4PTNA 5AN7A 3FYPA 3R2GA 4ZMGA 1Q6RA 1GVRA 5LZLA 3O63A 2XN0A 1LROA 4PODA 4C1KA 3IIPA 3NQAA 3INPA 2JKEA 3RFAA 1F05A 4M19A 3DAQA 4P61A 3IIZA 3C56A 4ZQOA 2E09A 3S42A 4RR4A 1QAPA 3LDVA 2A6NA 2A6LA 3PB0A 3C61A 1G4SA 2IQTA 3N9RA 4FF7A 1HL2A 4M7TA 3EEGA 1GTEA 1LOLA 1IGSA 5CSRA 3TUUA 1G7VA 4LVBA 3TQVA 2WQPA 3TMLA 2CZFA 2QUVA 3TC7A 2FDSA 1FWWA 1Z48A 4A2SA 3CIWA 4K8EA 4XBKA 2Y85A 4QIUA 3UQNA 1FDJA 2ISWA 3LRMA 5D37A 4UFHA 3QPZA 1TMHA 3SGUA 5DN1A 3EWWA 3MBFA 3L0NA 3GAYA 3R8RA 2EF9A 5TQLA 1J5TA 4PEKA 5CGQA 1VZWA 2A7PA 4JYFA 2CLFA 4LV9A 4CNPA 1R46A 1XBXA 1W56A 3TXVA 3TQ0A 2V2HA 4K38A 4PA8A 4O52A 3GAKA 3W2NA 2Z1BA 3IVSA 1VS1A 3G8EA 1D3GA 2NXIA 3O06A 4JR5A 4JTKA 4UMBA 1GVFA 3KRUA 3TAOA 3A21A 4LC8A 4ORIA 1JCYA 2PRHA 4LC6A 5HWNA 3S0CA 4O1AA 3LLFA 1T99A 3O16A 1IXPA 1FWSA 2ZZ5A 3G22A 4O10A 5C6MA 3E02A 3HOJA 1JUBA 1L2UA 4HHPA 5CZJA 1SSGA 1EUAA 2WSYA 3OVPA 1JUEA 3NVTA 3OHIA 3WJXA 1TSIA 4ALDA 4ZVJA 4M7SA 3ABRA 1PV8A 5CPOA 4RXFA 2HTMA 1RZMA 1PHWA 4MYXA 1OX5A 2A4AA 4MY9A 2BWGA 3KAOA 1PE1A 4YWIA 5HNRA 3ATYA 2WO5A 4H6KA 3QJAA 1K7XA 3P67A 1KLYA 3W1UA 3NEVA 4FNQA 3JS3A 2C3ZA 4NZFA 4N6EA 3TV8A 4O4VA 2DORA 1YPIA 1KBIA 1KFEA 3GDRA 3W74A 1DL3A 2C16A 3VE7A 2Y7GA 4JYEA 2X16A 5HJLA 2Q3RA 3HB9A 2YR1A 1W1ZA 3GXPA 4LRSA 4MJMA 2EAWA 3JR2A 3S5NA 5AFDA 1VHNA 2RDUA 3QPYA 3GYEA 5BRBA 2CZDA 1W54A 2I14A 1OABA 4CNNA 3EXTA 4WY0F 4A29A 1MO0A 4FNSA 4CCEA 5AC6A 2ATSA 3T44A 3R13A 5F2IA 1QMLA 2E6DA 4LT9A 4CNOA 1VLIA 1ZHAA 1ZAJA 1N8FA 4FNTA 2NLIA 1M6JA 4JD4A 3OA3A 1I2RA 2C18A 1LRTA 3GNDA 3TAKA 1T8XA 1FCVA 1BEUA 3S1XA 3LTSA 2YFNA 4CLMA 4XZ9A 4Y96A 1CX9A 3ZS4A 4LOCA 3EWUA 4ORMA 5D09A 5F1VA 2YW3A 3BLFA 4HN4A 1HG3A 2FLIA 2YDAA 4DPPA 3G1YA 1U5JA 2QUUA 3LHZA 3O1NA 3U6WA 3RLUA 3G24A 3EKLA 1KM1A 2V2DA 1VCFA 2ZA2A 4A22A 1YYAA 3LCWA 3KX6A 3IVUA 3N19B 4EIVA 4UFIA 3HG4A 3CEPA 2O7SA 4ZQMA 5CG7A 3TW7A 1TPWA 4N9EA 2FB3A 1K7EA 2QCDA 3W83A 2P0OA 2CLMA 3PF3A 1ADOA 5AHLA 1VH7A 3P5YA 3O15A 4LUJA 2FIQA 3STGA 1LORA 1DORA 5EKYA 2VENA 3NQFA 2NX3A 3GIYA 1WOBA 1DQWA 3W1TA 2X1UA 4RLIA 4WOQA 2A21A 3P62A 4W9TA 4NVTA 3BARA 5E93A 1H61A 2ZFAA 4WUIA 3VI2A 3EWZA 2C19A 6ALDA 4K8HA 2GQAA 4YCOA 1SO6A 1ML1A 4GWEA 1SO3A 1KTNA 1OVDA 1I2OA 1SZEA 3FJ6A 3WK1A 1W0MA 4M6VA 2QCNA 1R2SA 3L9CA 4OT7A 3FFSA 2NV2A 1XM3A 3NNTA 2ZZ2A 4LUIA 2B7NA 3DBPA 1G7UA 2X1SA 1TPFA 4M6PA 3LV5A 4UNKA 3T55A 2ZDRA 5A5WA 4JTLA 4KFOA 2F7FA 3B06A 2CLEA 3AJXA 1DV7A 2JKPA 3FIGA 3G1XA 1JQXA 2CZEA 3OEXA 1HO1A 3W9ZA 1W8SA 3W7GA 4N6FA 5AYXA 3P7YA 3Q58A 3WFAA 1KBJA 3SW6A 1S5VA 2V2CA 3B04A 5CPNA 2C1HA 4LVDA 3UYCA 4N9CA 4K39A 1SSDA 3KRSA 3DKLA 4GUGA 1KM6A 1SW0A 4Y8FA 4K7VA 3W7MA 1W5PA 3G18A 1O5KA 2V82A 4UTWA 5D05A 3TX9A 1GEQA 2AQWA 5T26A 3NL6A 2PE4A 5CSSA 5DCBA 1B4EA 1B4KA 3W6YA 1YXDA 3P5ZA 2ZZ7A 1PHQA 1JQVA 1OFRA 3C6CA 3L68A 3I68A 1XBVA 3W2JA 3O6CA 2Y7DA 2DZTA 3LB0A 1BTMA 5D38A 1H7NA 2Y70A 3HG2A 4K6AA 4EOUA 4ML9A 1OK6A 1TV8A 3QSRA 3PSVA 1ICPA 1GOXA 3NR0A 2WNNA 3W1AA 2RHGA 3C2RA 1NAL1 4AEOA 1TTJA 1EEPA 2GQ8A 1F7BA 3MYOA 3TROA 5HMSA 3M7WA 3TQKA 1TQXA 3IIVA 4FEZA 4Y90A 2W6RA 3HPSA 4OGZA 3S5YA 2J9XA 1WOAA 3W7HA 4HNUA 1YTEA 3EB2A 4FNPA 2GUUA 4FXRA 3IIOA 2WNQA 4N2YA 1KA9F 2PC4A 3TJLA 1JCNA 1OX4B 1O94A 1B9BA 1THFD 1VGAA 4MY8A 3LLDA 2PCQA 2CFFA 3LX9A 3QH2A 2E5DA 3C2FA 3W85A 2W0UA 2ZRUA 1XKYA 4DO5A 5K9XA 3NL5A 2C15A 3TKFA 3NG3A 5EL1A 1S3HA 4WXYA 3N14A 4NNBA 3C2VA 1AK5A 5F2LA 4WXZA 1IF2A 3T7VA 1WAUA 4KFNA 1YADA 1YDNA 3UXDA 3UWVA 3ABQA 1C9DA 4O19A 3RMJA 1ZALA 2G97A 1XDLA 4QM1A 5D2WA 5IM51 1OK4A 1N55A 5AOUA 4NNAA 1O5XA 3NDOA 2QCEA 2EGZA 5A8GA 4RXGA 2GOUA 4GNJA 5FF0A 2QCCA 2H8ZA 4JDYA 5C2XA 5FESA 1H1YA 4HNNA 3CWOX 1W3IA 5DELA 5D02A 1WA3A 1ALDA 4JTIA 4CCCA 4Z0SA 4QISA 4E38A 3NM3A 4ZQRA 2NX9A 3OIXA 3W84A 3PM6A 4FNUA 2OX1A 3A23A 1ZAIA 3NQCA 3C2EA 1F2JA 2QCDB 3PR2A 5AB3A 1W5NA 1HFBA 4LRTA 3DI0A 1PCKA 1OJXA 5CZTA 3NL3A 1GQNA 4BI5A 5HULA 1G4TA 2Z0IA 3VNDA 4X2RA 3SY5A 4YCPA 3IGSA 3DZ1A 3G1HA 3MMTA 1Q6OA 4BR1A 3GR8A 4TMBA 1P5BA 4BI7A 3C2OA 5EA9A 4ZZ9A 3EWXA 4WD0A 3MHGA 3SSJA 2TPSA 3LHUA 3PWAA 1LOSA 3EWYA 3QSTA 3RNDA 1KW1A 2A5HA 4DQWA 1DVJA 3GXNA 4DBEA 1L9WA 2V9DA 4TU1A 1Q3NA 5HR6A 1TJPA 1I4NA 2KZHA 3FYOA 4IX0A 5DLCA 2VEMA 3BGGA 3EXRA 4JTSA 5I3KA 4GE8A 1UUOA 2B4GA 5AC8A 3M43A 4GUHA 4HKPA 4OU1A 4HIBA 1G6CA 4EF8A 1RVGA 4DF0A 5D2XA 4WOZA 4WQ6A 3LHYA 1VYSX 3MP3A 3W1MA 2ISVA 1TPDA 2CWNA 4LTSA 3U8GA 3CLMA 3S1UA 3QC3A 1XL9A 3OG3A 5CKSA 1GZGA 5D03A 4FO4A 3UNDA 5LNSA 2A0NA 1W31A 4AWUA 5EMUA 3IEBA 2FPTA 3G1VA 3LV6A 4U28A 3W7JA 2VFIA 1BWLA 3L0KA 4OE7A 1TCDA 1GYLA 3IV3A 1TTPA 2WV8A 4JNMA 3HGOA 3STFA 3TW6A 3Q2DA 1WX0A 3P80A 3WJSA 1EX5A 2QCHA 3W70A 1LZOA 4UXDA 2QCFA 3W1NA 3MHFA 3MYPA 5D33A 2OJPA 3HIJA 4MIMA 4Z08A 3HMJG 5F4SA 2G5WA 3FEMA 2X2GA 1BKSA 3E49A 4FX7A 2A2IA 4UFLA 2NX1A 4JDBA 1VPXA 4UTTA 3C52A 3NPUA 2YSWA 2G96A 3W2KA 4LVAA 1KFJA 5TIMA 1UB3A 1OFEA 2XN1A 4JX5A 4YL2A 3EKZA 5G1YA 1EWDA 4JX4A 4ZQCA 2C0AA 1RPXA 4LS0A 3SZ8A 4GRSA 3W87A 1K7FA 2E68A 4NXKA 4JY8A 5LNWA 1R47A 1GG0A 2ABAA 1K03A 4UTWC 1TIMA 3A22A 4MFDA 3HPXA 1SFLA 4POCA 1E51A 4MZYA 4Z1CA 3GLCA 3QZEA 1LM1A 3QQ1A 3QYQA 1M7PA 3M5XA 4XKYA 3TR2A 1XBZA 5CPMA 4NXSA 3KOFA 4PH6A 4B5NA 3QMRA 2Y61A 5HWMA 1A5AA 3KVLA 4FNRA 1HO4A 4Q32A 1WBJA 3B0PA 2QCMA 3UWYA 4TO8A 4I7VA 3L5MA 5FF3A 3SR7A 1K8XA 3NYZA 4PC8A 1O4UA 4P2VA 1FWRA 4O53A 2VEIA 4O18A 4TX9A 1YPFA 8TIMA 3NQMA 3SJ3A 5LGZA 4Z1BA 2ZA1A 2GQ9A 3W7QA 1XUZA 3HPZA 4UNLA 2A7NA 1KFKA 1UUMA 4PL1A 1XC4A 3LHTA 4IMDA 3DGRA 4JEQA 2OCZA 1O95A 3UY8A 3CTLA 2ZRXA 3HG3A 5IBXC 4UTUA 1TV7A 2YZRA 3B05A 2Y62A 2CLIA 1DJQA 4O50A 5I3IA 1H7RA 3NZRA 4JTUA 4I7UA 2CU0A 3MI6A 5F4WA 3BG5A 1VHCA 5F1UA 3IGXA 4ADSA 4MYAA 1PCWA 4JTTA 3TJXA 2J27A 4O4WA 1EUNA 4LY8A 4NT0A 3HQ1A 2ZRZA 3NQEA 2DP3A 2Y88A 5ABTA 3W71A 2P10A 2FB2A 4N9DA 3L2IA 1SPQA 3PB2A 5FEZA 1AL7A 2ZZ4A 3N34A 3MBDA 1A5CA 4PFMA 4AWTA 2WJZA 1H62A 3W1XA 6TIMA 3PUEA 3S1VA 4MY1A 1VCVA 3VE9A 3LI0A 3FA5A 5FI8A 3GR7A 1ICQA 1WYIA 5G2HA 1GVQA 1GWJA 1QNVA 5GVJA 5K4XA 1SR9A 4BI6A 3CB8A 3UD6A 2ZQ0A 1TYGA 1LLWA 4LW7A 3I7QA 2BX7A 3NQ2A 1H7OA 1DHPA 3QW4B 1KV5A 5F2MA 3STEA 5I3GA 1QPNA 4BWLA 5D30A 1CI1A 2J24A 3PC0A 2EHHA 4RK8A 1B3OA 1NF7A 3TC6A 3B0VC 1GPWA 4BK9A 1UJPA 3AO0A 2JGYA 1R2TA 2R94A 1FQ0A 3CEUA 4GC4A 1NF0A 3S9YA 2B7QA 5FF7A 1VR6A 3BW2A 4QITA 3IGUA 3S8HA 3WJWA 2V0TA 3KFTA 1OFPA 3NOEA 1LRQA 2QR6A 3GNNA 4DF1A 3P60A 2H8XA 1SU5A 4NJKA 1Z42A 3PSWA 3W73A 2QAFA 4JTGA 1WV2A 1QCWA 1LBFA 2NUWA 3U2OA 2HMCA 4JTJA 3T78A 3N3MA 1ME7A 1L6YA 4Q4KA 2QJGA 2ZZ3A 3R12A 4JTFA 3V75A 1UBSA 5D2VA 1I8JA 1SO5A 2I9EA 1H63A 2V8ZA 5DY3A 1EP2A 1O60A 3QF0A 1KM4A 4FIRA 4I9AA 5KTLA 2RH9A 1LBLA 5G1TA 3NXFA 4XWUA 5EBUA 5LGXA 2HSAA 4DF2A 3GX9A 1S5TA 4IXHA 2ZZ1A 1FDZA 4TIMA 3L65A 4AMAA 3VCRA 4KKXA 3FOKA 3ZFHA 1GT8A 4KWWA 1OG0A 3PBVA 4O28A 2B0MA 4MFEA 4FIQA 3MP5A 1F6PA 3W7LA 4UTKA 2Z6JA 2CLOA 5HR7A 3W1RA 1WBHA 1WXJA 4UTTC 4UFKA 2BXVA 3W22A 3F1QA 4ADUA 2RFGA 3MWAA 1LLZA 3PAJA 1QFEA 3NPXA 2OMAA 2V5LA 1H7PA 1OYCA 3R89A 5CZSA 3UZ5A 1TB3A 2YXGA 4FX6M 3WJYA 4XBSA 3C3NA 2WSRA 3GXTA 3UWQA 1Q45A 5U7SA 3WK2A 1I2PA 4H3DA 2HS8A 2ABBA 3LCIA 3M44A 2VKZG 4JICA 2NZLA 3ABOA 1K3UA 1W5MA 2A1YA 4YLWA 3SFKA 1JRCA 4RV8A 3PUOA 1VC4A 3W75A 3A5FA 4R53A 2TRSA 1F6KA 1YTKA 4HPXA 3G0SA 5HQEA 3A24A 4JYDA 3GKAA 3NQVA 4NQ1A 1UCWA 4XTDA 2OT0A 2Y6ZA 3DFPA 4AH7A 4FB7A 3M6YA 1G4EA 1X6UA 2J88A 3NQ8A 1TPC1 1LTDA 3LXAA 4BF9A 3MW7A 3IVTA 5H2ZA 3Q37A 3LTPA 3RLVA 3THQA 4HSNA 5AHEA 3ZWSA 3NPVA 3TMQA 3HBLA 4KFPA 3MI3A 3LOTA 4R34A 4DEFA 4G1KA 2ALDA 4X3ZA 4WY0A 3T40A 1EP1A 1K8YA 2JKAA 3L66A 5LHEA 3O07A 2WPBA 1EP3A 3G3MA 4NUWA 1C8VA 2YYUA 2BLEA 4O1DA 2DJLA 1H5YA 3PVFA 3M16A 3I65A 1KTCA 4LS2A 4RZ5A 4WZHA 2Y63A 5AHFA 3YPIA 4LS1A 5D2YA 3M1ZA 4N02A 3EX2A 1OFDA 3G1SA 2TSYA 3TSMA 4LNYA 4AHQA 2E5CA 3N2XA 4MZ1A 1QO5A 3USBA 2H6RA 3NPWA 4UUIA 5BOOA 3DFSA 3JRKA 2W79A 2QF7A 1I2QA 3M41A 4UTLA 4O15A 2Q8ZA 4UTJA 1AW2A 3DU0A 1SZGA 3NQGA 3DXIA 3I7SA 4J9JA 1VRDA 2JK2A 3LHVA 4X22A 4UTMA 3M0ZA 1IXQA 1RV8A 1VQTA 2GVLA 3I7RA 4DO6A 1H7XA 3KRZA 3CU2A 1ZY9A 2JBMA 2NXHA 2GJLA 1P1XA 4M6QA 2E5BA 2NWRA 3MO7A 3QMSA 5MHBA 3UXAA 5BMWA 3TFXA 3W2MA 4IMCA 3LXCA 5D2TA 4MVAA 2ZYFA 3TK7A 2VXNA 4YMZA 5LKYA 4QJ1A 1ME9A 3PBUA 3PY2A 4LVGA 4DPQA 1C29A 3LXBA 4S2BA 3W7NA 4ZQPA 4MLJA 1OF8A 1L6WA 1QPOA 1DQXA 3A5VA 4N4QA 3I6RA 1JCLA 4GBUA 3GVGA 1FY6A 2X1TA 2R8WA 4O0KA 5CPLA 4XTIA 2X1RA 2AGKA 4K36A 5G2WA 3MI2A 4EVZA 2OZ0A 1KTBA 1QPRA 4FXSA 3UPWA 1I45A 4MPQA 3WK3A 3W7KA 3HGRA 2QKFA 1LP6A 1RD5A 4S1FA 4M5PA 2CLKA 1A53A 3M47A 5EPDA 4UFMA 1FWNA 5KMYA 1MEHA 3BLEA 2GJNA 5AYZA 2ZA3A 4AWSA 1X7FA 5C55A 5BMXA 3LBCA 3NQ6A 1W5OA 2H3DA 1K8ZA 4DBDA 2X30A 3B4UA 4ONVA 1IXNA 2CLHA 2RDTA 1ZAHA 4MJZA 3O6DA 2QDGA 4JXCA 2GPTA 2FJKA 5KZMA 2VELA 4QSHA 4E2DA 1V7YA 3W2UA 1QOQA 2BSLA 1W5QA 4OV4A 1RQBA 2D73A 4HPJA 4FHAA 5LSMA 2UV8G 3P74A 1OFQA 4O57A 4WJEA 1ICSA 4HT3A 3LCGA 1TPUA 3NQDA 4JGDA 5AHMA 4IOTA 3L5LA 3TCEA 1XCFA 3CQ0A 5G4EA 3CC1A 3BVJA 1NFBA 5FF2A 4AHPA 1FXPA 2VEPA 3DENA 4JX6A 4IMFA 5K9DA 3IRDA 1B57A 1TJRA 5BW6A 1V5XA 2FPVA 5LNUA 3W7OA 1ZJIA 3KVKA 1RR2A 4NX5A 2VFGA 3NL2A 2DZUA 1EA0A 2VC6A 3W1QA 1GTHA 4O11A 2F84A 5K7JA 2FFCA 1I2NA 3P8JA 4NNCA 5L9FA 3W86A 2Z2UA 3G0XA 5HINA 3A9IA 3SECA 1A5BA 2R14A 2P1FA 4O16A 4TR9A 2Y7EA 1HTIA 2ZRYA 5EY5A 1KM2A 4RX0A 3KHJA 5DXYA 5FEWA 2QEZA 3B03A 1SW7A 4IQLA 4JN6A 2C14A 5K9CA 2TMDA 4UMCA 3SIZA 5I3JA 2G95A 2C13A 5J5DA 2NV1A 5C5YA 5AHIA 4WY0B 1D9EA 1AMKA 1XUUA 2NWSA 1AW1A 1T96A 4UFJA 4GUIA 2ZRVA 3SGZA 1TPEA 1TTIA 1MSSA 3BG9A 1H7WA 3H53A 4QQ3A 3W23A 1N7KA 3BK0A 3UWUA 4CCDA 3E9AA 3TIMA 3N73A 3STCA 1PL9A 4EF9A 1YDOA 1TREA 1MEWA 5K4ZA 1JUKA 4JTHA 4JIQA 3TSDA 1MXSA 2B7OA 1SUXA 2FQIA 3FLUA 3ANYA 1A5SA 3DHFA 1TPH1 5HWJA 3DFQA 1JULA 1VLWA 1VYRA 2JGQA 2BTMA 4HSOA 3TE9A 4DELA 2FTPA 2NXGA 2RDWA 4UMAA 1DJNA 4NX0A 1YLVA 1F74A 1TPB1 3W2LA 3HJZA 1ZFJA 3P61A 1VJIA 2EPHA 1AW5A 1DKWA 2ZRWA 1ZNNA 2FPYA 2WSQA 1SQ7A 4U4MA 3O05A 1WDWA 3IIXA 2ZCGA 1EB3A 4OQVA 4L4LA 1W3NA 3LRLA 5I3FA 2E6FA 2RKXA 3GK0A 1RQEA 3W07A 4IPJA 1GG1A 1U83A 2ZTJA 1KLZA 3BGJA 5DCEA 3W1PA 3MP4A 3LCXA 4N4PA 1P0KA 1TRDA 1EWEA 2NUXA 3NO5A 2QDHA 5EYWA 1TQJA 3NZ1A 1MEIA 3L5AA 2WOQA 2E6YA 3RK8A 2DZWA 3S5OA 2J6XA 3BG3A 1KM3A 5D04C 4YXGA 1IIHA 3FKKA 3M5YA 1J4EA 2YX0A 4UR8A 4Q33A 1GVOA 4JTEA 2E6AA 1DBTA 3KVMA 2HS6A 3QMTA 3TXZA 3L21A 2ZZ6A 1W3TA 4JY9A 2ZBTA 1NSJA 3G1DA 2I1OA 4GFSA 5H91A 7TIMA 1JRBA 3W72A 2QJIA 1ONRA 3LCLA 2CZ5A 2VEKA 3C8FA 2YPIA 3MHUA 1ZCOA 1QDSA 2WNZA 3F03K 3QEZA 1TTQA 2ZTKA 1OX4A 3GB6A 1YTDA 5E0KA 3BPWA 3S5ZA 2YGYA 4QNWA 3UY7A 2Y7FA 1NVMA 3UWWA 5FF4A 1PVNA 4NJHA 1PS9A 1G67A 1JCXA 2QJHA 1QOPA 5FEPA 3TSBA 4H4IA 1OX6A 2PRMA 2QUTA 3TH6A 3GZ3A 3W7DA 1DOSA 1T0OA 3QQ0A 3VKJA 3M9YA 1MZHA 2YCEA 3W7RA 1XXXA 1H51A 3LGEA 4IGHA 2CW6A 2DU2A 5C54A 4PL2A 3CPRA 4JIPA 3LHWA 4OHQA 2EKCA 2DJXA 2J9YA 4TMCA 1FDYA 5KITA 2VFDA 3PUDA 1LDCA 4Z1AA 4NJGA 4O12A 4AVFA 5LNRA 5DY2A 3G1FA 1FCBA 3HGSA 3QFEA 3TDFA 3CIXA 3LI1A 4IXXA 1QWGA 2VFFA 1ME8A 3EX1A 5G5IA 2NUYA 3TNOA 1KM5A 4OBTA 2Y89A 3BLIA 1KFBA 1YXCA 4FX8A 1W37A 4GUJA 4XQ6A 4O54A 4EWND 1UASA 2QCGA 5CZ0A 5AYYA 3R5EA 4RJEA 4LU0A 2CLLA 3C4UA 3LTYA 3DFTA 2DZVA 4UCGA 4O1CA 1X8FA 3OVQA 4ZQNA 5KZEA 4NJJA 5DBTA 1SZNA 2DZPA 3LERA 3RF9A 3DFOA 2YFOA 2WKJA 1X1OA 2PURA 1Q6LA 1FBAA 5G2IA 3FJLA 4HNTA 1TV5A 4UTIA 2AAMA 1EPXA 3ELFA 5DXXA 3MUXA 3E12A 4E0CA 4AF0A 3GDLA 2OT1A 2V30A 4ICNA 1X1ZA 2H3BA 4O14A 4XKYB 4XUGA 3HO8A 1P4CA 3WJZA 4IUOA 4UIOA 4X9SA 3HG5A 5L6UA 1JVNA 3G3DA 4UR7A 2QAPA 2XFWA 1QO2A 1LRNA 1A50A 1NEYA 5HUOA 4R33A 1TO3A 3RU6A 5E1QA 3DKJA 4OWGA 2GVJA 1OF6A 4CQAA 1FCQA 4CQ8A 2TYSA 5J5RA 3NA8A 1K02A 3FKRA 5HUPA 3UWZA 3BV4A 3PBWA 1D3HA 3C0JA 2VFEA 1YDVA 3L0GA 3LBMA 4O0ZA 4BFAA 3BW4A 1IXOA 5KSWA 3DHDA 3W7CA 4K7YA 4C1LA 3OBKA 2V5BA 1IIGA 3W88A 2A85A 1XI3A 2ISSA 4PCFA 4K37A 4MOZA 2DZXA 2A7RA 3PG9A 4Y6GA 3EWBX 3HGJA 1F76A 3M5VA 3H55A 1LCOA 4O13A 2J9ZA 4NJIA 3KVJA 3NQ7A 5F2GA 3T4CA 1H1ZA 4AB4A 3ABSA 3NGJA 4AAJA 1L6SA 3VFLA 3W76A 4Y9AA 3DH7A 1LBMA 3MJYA 3PS7A 1R2RA 3P82A 3GDKA 4LWWA 3W7PA 4E2BA 1AG1O 1JCJA 4D2JA 4I7WA 5LNVA 1GYNA 3TU9A 3B8DA 4MZ8A 2O7QA 1TPVA 3EXSA 3E96A 4NU7A 4QAIA 3OVRA 3SI9A 5TBOA 3DFNA 4AHOA 4ZL1A 1OYAA 2LLEA 2XN2A 2VFHA 5FEXA 1F73A 3ZWTA 2PRLA 4O1BA 5D32A 4OV9A 4LVFA 4DXVA 1FCUA 1BWKA 1J2WA 3LCFA 2R91A 3H54A 1OHLA 3GDTA 5AC7A 2VOMA 3O8AA 4HNVA 1JCMP 3F4WA 1R30A 3KXQA 5LHFA 3F4NA 4IJBA 5U4NA 4RZ6A 5IBXA 1JR1A 3O6YX 4MKNA 3L67A 5I3HA 2QCLA 4QNEA 3G0UA 4GJ1A 3UPBA 5DBUA 3CHVA 1XBYA 3P81A 1HUVA 1WQ5A 3THAA 3CWNA 4RZ4A 4NZJA 3W7IA 3LM7A 3E0IA 4RCXA 5BNKA 1Y0EA 5AHNA 1ZENA 5SWUA 1SZFA 3QRHA 4A2RA 3G8RA 3HF3A 1CW2A 1KFCA 3K30A 3CT7A 4BWLC 3NAVA 1FUYA 1GVSA 4A21A 2Z6IA 1FWTA 1SW3A 3Q94A 3NM1A 4IX2A 1AL8A 1G4PA 1VCGA 4IMGA 4ADTA 1H60A 3G1AA 4MLRA 3W7EA 2DZSA 4UC5A 3TA6A 3N2MA 5K3VA 4CQ9A 3EX4A 1OFBA 3P8IA 3BW3A 3LRKA 4KWVA 3PULA 3B0UX 5KINA 1H50A 1XDMA 2Q3OA 4O8RA 3DI1A 3TFCA 3QM3A 1RQHA 3V1PA
chains in the Genus database with same CATH superfamily
4RDWA 4D8AA 2BVYA 1XRFA 1YXYA 3P84A 3VU2A 2PTXA 1FXQA 5CLWA 1KFLA 3MDWA 4XZLX 2H90A 2QW5A 3ARWA 1G69A 4L4OA 3IARA 2Z1SA 1VYPX 4H01A 3B9AA 3FS2A 4JFVA 5HA7A 1CXLA 3BO9A 3SN4A 1B54A 3WD4A 3W3OA 1V3MA 4LFYA 4N9BA 3PNUA 4NF7A 5B7YA 1NY1A 1DE6A 1P0NA 4ZB0A 4S2CA 2BZNA 4WX2A 1HJUA 3FA3A 5E6ZA 1UKTA 5FJTA 1M5WA 5LYRA 2Q8LA 2PGWA 4H6EA 3SEPA 4A3UA 3TYUA 4D6FA 3UJEA 3BH4A 4Z1DA 1KR0A 3LCHA 1SFJA 4Y7EA 2ATMA 1GOMA 1XYLA 3U4AA 3CUFA 4XSMA 2XFYA 1EO7A 4XZIA 3O63A 3N4EA 2XN0A 4C1KA 3NQAA 1CGUA 3EDJA 3RPDA 1W1A1 4GGBA 2JKEA 4MB5A 3DAQA 3GY1A 5LIKX 3IIZA 3WD0A 3REQA 3S42A 4UB9A 1DXEA 4M7TA 4X2PA 4TX6A 1S5MA 2XHYA 5CSRA 3RR1A 3TQVA 1VFLA 2FDSA 1YE6A 1XGEA 1ISVA 1S2CA 4A2SA 1RJRA 2Y85A 1CT5A 4QIUA 1M68A 4FP1A 4P7RA 2XM2A 1Z6KA 2ISWA 3LRMA 4BQ2A 3BV7A 1OGSA 5HNUA 1D2KA 4P7OA 1R9XA 2WZEA 3SGUA 1GCYA 1XV8A 6TAAA 2ACRA 1W2PA 2EF9A 5TQLA 1C8YA 5A6BD 1DJIA 4J3TA 4XSLA 4H9UA 3QV8A 4LPCA 1UPMB 3D46A 1C93A 2FMOA 3A3HA 3TQ0A 2R1LA 3ARUA 4LSBA 3IVSA 2D2JA 1VAHA 3EDEA 3GH4A 1D3GA 1KBBA 4JTKA 4K3ZA 3S2LA 4LC6A 5HWNA 2VWSA 1ZU8A 1OWQA 1IXPA 1ZBWA 3G22A 3WO8A 4RZBA 4DRSA 1F3WA 2W27A 3GNPA 3GH5A 3LK6A 2PP0A 4HK5A 4ZVJA 3QYSA 3GTNA 4H9XA 4H83A 1QT1A 1XW8A 1A5MC 4PBEA 1B1YA 2RJGA 1PHWA 2BWGA 4ACYA 2F9RA 4MG4A 5HNRA 3I4EA 1HKKA 4XZHA 3P67A 5HQMA 3V0TA 3F2CA 2JIWA 1X8CA 4UQAA 4O4VA 4RNFA 4Q4PA 4JCLA 1KFEA 3GDRA 1JZ7A 3VCNA 3DX5A 2WCAA 3HB9A 3PBMA 2WVVB 3FDGA 4MJMA 3IANA 3JR2A 4F79A 3S5NA 3U2CA 3AWNA 5BRBA 4L65A 4GKLA 4WY0F 1MO0A 4ICCX 5HPCA 3R13A 4CNOA 1WKFA 2O9RA 1W1PA 4ZENA 2NLIA 1M6JA 4LEFA 4DBSA 3GNDA 3GNOA 3TAKA 1GW9A 1T8XA 4F0MA 3FA4A 4Q22A 4YS1A 4XZ9A 1CX9A 3S2MA 4L9YA 4LOCA 4HN4A 2KX9A 4RW3A 3WH6A 5I24A 2E7FA 3O1NA 3RLUA 3G24A 5I2UA 3EKLA 1VCFA 4EWJA 5AY7A 1XYAA 5C7VA 4LJ3A 4DY1A 1J0HA 2HJPA 3PN8A 3URNA 2PAJA 3HG4A 3CEPA 1TPWA 4DYKA 4LUTA 1K7EA 3PZUA 3WF1A 1VPQA 2FFIA 3C0QA 3QZ6A 3N18A 2FIQA 3AXXA 3QPEA 1JL8A 4L1XA 2AMXA 3NQFA 4J3UA 4W5ZA 2NX3A 1A5OC 1DWAM 4C6BA 4GYKA 4WOQA 1CTNA 1QNQA 2XVKA 1MNSA 4GZ7A 4C7DA 3SN0A 1EF2A 1TWDA 1V6TA 4YCOA 3R8HA 1BF2A 1ML1A 4IP5A 5A8MA 3D5HA 1OVDA 1SZEA 1UD5A 4DX3A 4CCZA 3OHMB 1W0MA 3VM7A 4EXQA 3MMWA 2PZNA 2PP1A 3A6OA 5DO8A 1G7UA 3LENA 3L4WA 1B2YA 2YXXA 4AEFA 4UNKA 4I5XA 1XLLA 3CAQA 1WXYA 1REQB 1I0DA 2F7FA 3H24A 1B3WA 4IQDA 3F2BA 2OEKA 2W91A 3B06A 3BSHA 2CLEA 3AJXA 1DV7A 3FIGA 3G1XA 3TA9A 4IF2A 1EHNA 3Q58A 2ISFA 3WFAA 3SW6A 5HMFA 4DZIA 3PFMA 3LNPA 3LPPA 2DT3A 1R85A 1UW9A 4LVDA 3GW0A 1TFVA 5IHRA 4N9CA 4S3BA 3DKLA 3SCUA 1V0LA 4S23A 3LZ5A 4K7VA 3W7MA 1HX0A 1O5KA 2PS2A 1BYBA 2AQWA 2J13A 1Q7MA 3GFZA 5DCBA 2PBOA 1YXDA 3S3GA 1OFRA 1EJ7L 4Q8OA 4LBSA 3LEPA 1BTMA 1VFFA 2Y70A 1H1NA 4IFOA 3TWBA 4K6AA 2OKOA 4R27A 3RX2A 4NI8A 1TV8A 3QSRA 3GR4A 4JTQA 3W1AA 3U7BA 1BWVA 4AEOA 2AGTA 2QT3A 4V15A 3MYOA 1MI3A 5HMSA 5BU6A 1TQXA 4FR1A 2W6RA 3E2QA 4OGZA 3QVQA 4EANA 2J9XA 1V3JA 4HNUA 1YTEA 4ACZA 2XZ9A 4ECLA 2DQWA 4JEJA 4H8VA 4FXRA 4PZVA 3TTSA 3VNKA 4N2YA 3VINA 2XDFA 4RPPA 3V5FA 3OGVA 4O0QA 2HE5A 1UIOA 4MNJA 1OX4B 1XSKA 1QHZA 1B9BA 1RCQA 1VGAA 4MY8A 4E4FA 2VGIA 2CFFA 2E5DA 3TCSA 2W0UA 2ZRUA 4J27A 2IKGA 4KQNA 1K4HA 4PMDA 5K9XA 3F2DA 1CXEA 1UA7A 2PWVA 3QOKA 3NG3A 5EL1A 2DDXA 1S3HA 4H8NA 2VCAA 4WXYA 4WDXA 2XVLA 5C8BB 4WXZA 4QEEA 1JYVA 3THDA 3BOXA 4KFNA 4PCTA 3OODA 1YDNA 3CZ8A 2CIPA 5HMEA 3ABQA 1C9DA 3CNYA 3RMJA 2JFEX 4QR6A 1XDLA 4QM1A 1OK4A 1O5XA 3OJGA 4D72A 3BURA 4E3VA 4GNJA 1WA3A 1ALDA 1LQ0A 2PWHA 3UFYA 4E38A 3PM6A 2J7GA 4NZCA 2F6KA 3Q65A 2QCDB 2FYMA 1HQTA 5AB3A 1W5NA 1CGVA 1OJXA 3M46A 3VNDA 2PDQA 3SY5A 1CDGA 1FRBA 3IGSA 3DZ1A 3MMTA 1QXLA 2BFGA 4BR1A 3GR8A 4TMBA 3SY1A 1BFNA 5EA9A 4ZZ9A 1RP8A 2XG9A 1NIUA 4N7QA 3LHUA 2PDPA 1US2A 3S47A 1M7JA 4HU8A 3KCLA 1KW1A 1OCJA 4DQWA 1DVJA 3GXNA 3I3EA 2V9DA 4PTMA 1UOZA 3WQWA 1JFHA 2KZHA 3FYOA 4HCDA 4IX0A 2GUBA 5I3KA 1W3HA 3WQPA 4HMCA 2UY3A 5DFAA 1UUOA 1U5VA 2IXVA 2GSHA 1EZ2A 4GUHA 4HKPA 4OU1A 1G6CA 4DF0A 3EMCA 4NG3A 4H7CA 4WQ6A 2YCLA 1LG2A 5BXSA 5BRPA 4LTSA 4AZIA 5CKSA 4WEVX 3IJIA 3UNDA 1M7XA 2PLMA 5ECVA 4NKCA 3OGSA 4FLQA 3G1VA 1HL9A 2OG9A 3WDQA 5AC5A 2AL2B 4WLCA 4JNMA 5CPQA 3R0KA 1UKSA 3ARRA 2VVNA 1WX0A 2BOEX 3P80A 3IK4A 4BS0A 4ZCWA 4UXDA 1BQCA 1SVDA 3W1NA 5D33A 3ZIZA 2RUSA 5CGTA 1MQQA 2V3FA 4PSPA 1O7AA 1RSCA 4S3KA 5A6LA 2X2GA 3LMYA 3E49A 4LAOA 5AKQA 3DEQA 3C52A 3NPUA 2WPGA 2YSWA 1UB3A 3BZGA 2XN1A 4YL2A 2VCBA 1PZ0A 1EWDA 2DEPA 3MVTA 1TZ7A 1J5SA 3MSDA 1RPXA 3SZ8A 4NXKA 3MS8A 3PPGA 4Y8EA 1GG0A 3WLSA 2VC7A 2ABAA 1DTUA 4MFDA 2IXUA 3FHAA 3SQMA 2W67A 3WQ8A 1HZYA 1E51A 4MZYA 2IKIA 3S6TA 3M5XA 4B4HA 5TF0A 3VD3A 3BC9A 1ZRQA 2F61A 3H4GA 3VNJA 3QMRA 5HWMA 3U7VA 4YNGA 1JF6A 1HO4A 1WBJA 1KGWA 3GTFA 3B0PA 2DVTA 3JU2A 4TO8A 3N25A 4KEMA 3FVDA 3MO4A 4XUYA 3SR7A 5GNYA 3E0LA 1K8CA 5G4HC 4HA3A 1O4UA 1FWRA 3DGBA 4O53A 4FA3A 1J0ZA 2PDCA 4FLSA 1V93A 1YPFA 2YJQA 4UOQA 3SJ3A 1DWHM 3W7QA 1XUZA 3HPZA 2A7NA 2VEFA 4PL1A 1XC4A 3KBSA 5FJRA 4DUOA 4E3TA 2BXYA 1B30A 3DCPA 4JEQA 4LYPA 1RD6A 2DIEA 2OCZA 4PCSA 1E6SM 3VGDA 3TWAA 1HVXA 3L2MA 3UY8A 3CTLA 5IBXC 4UTUA 1TV7A 4CVWA 1OZMA 2DSUA 4MSSA 3H2AA 1ITQA 1XLAA 1XIGA 3T4WA 3MI6A 3BZJA 3AHXA 1VHCA 5F1UA 2WBKA 1XLMA 4F66A 4ADSA 1PCWA 2NQZA 4JTTA 4O4WA 1EUNA 4G5DA 3APYA 1OADA 4GVIA 2ALRA 1E0VA 1XIJA 2DP3A 2VR5A 4J3ZA 4M1RA 2FB2A 1FWIC 2PLKA 3SBFA 3PB2A 1AL7A 3N34A 3MBDA 4OBSA 3VGBA 4B2DA 3W1XA 1XYMA 5FI8A 1PEZA 3GR7A 3B8TA 1E0WA 4RNJA 1R87A 2GGJA 1YBQA 1GWJA 1R7OA 5I0DA 2R1MA 4LUYA 4BI6A 3AJ7A 3UD6A 3WMLA 1LLWA 5EMKA 2BOFX 4NI3A 4JBRA 3T9PA 1KV5A 3CQJA 5I3GA 4C6NA 2F38A 3GO2A 5D30A 2PWEA 1IEQA 4HOZA 2WC4A 3T0AA 1NF7A 3TC6A 3B0VC 3E0FA 1IGWA 4JIIX 1R2TA 1DXIA 4HQVA 3CEUA 3B8VA 3S9YA 5FF7A 5FAJA 1VR6A 5JH2A 2NSOA 3VIKA 1MFUA 1FFQA 3N3TA 1UG6A 5DMNA 4X0VA 3GNNA 1A80A 2H8XA 4JKKA 3N2TA 1Z42A 1BKHA 2GVEA 1HKVA 1QCWA 3ENLA 3M6DA 3WBAA 3WN6A 4JN7A 1JDCA 3KL5A 3T78A 2OGJA 1MRAA 3RX4A 3KP1A 4H9VA 4JIRA 1ME7A 1RA0A 3JW7A 3UZXA 2AOSA 4M1BA 3GTHA 2ZZ3A 4JTFA 5DY3A 1VFUA 1SJBA 3CV2A 2VRJA 1IEVA 4FIRA 4I9AA 4NZ3A 3NXFA 5EBUA 5C71A 2WHMA 3VIIA 4DF2A 4KESA 5C9ZA 4GI6A 4MKSA 5D9PA 3SURA 4G6CA 3DESA 4RE0A 2VC9A 3FOKA 3ZFHA 2GFTA 4KWWA 4CN6A 5DF0A 1F3XA 1XICA 3C5QA 3MP5A 1F6PA 1R9ZA 4P7NA 3GBDA 5HR7A 2F6UA 1KGXA 3W22A 1IE7C 4WDWA 5BCAA 1I75A 1QFEA 2WJEA 1O68A 2OMAA 1MVYA 3UZ5A 2DQXA 3SFWA 2C1GA 4G8TA 2BNJA 4E5TA 3CQKA 2DUAA 1HP5A 3GBEA 4QS5A 3WQCA 2PGEA 3WK2A 2HS8A 4GO8A 3M44A 2QMKA 2VKZG 4PTVA 5A6TC 4QLKA 3RUBL 3A5FA 4R53A 4EACA 5LA1A 1F6KA 3G0SA 4JYDA 3NQVA 4GIEA 2Y6ZA 4AH7A 4D8LA 2EXOA 4C6IA 3GG7A 1G4EA 4BF9A 3MW7A 2PTWA 1R3YA 2BGNE 1GKQA 3WD1A 3THQA 4UQBA 1A5KC 3TMQA 1K9EA 4G1KA 4HZ6A 4J3WA 1L2QA 1YX1A 4WY0A 3TN3A 1J0KA 1ZJHA 1EP1A 1DEDA 1K8YA 3L66A 5LHEA 2GGEA 4WKAA 2PD9A 4AY7A 3EA2A 4RE4A 1EP3A 3IGHX 3CT2A 4Q7BA 2BLEA 4O1DA 2I9UA 5FCZA 3I65A 4LS2A 1E6QM 2QV4A 4WZHA 5AHFA 3YPIA 1DWIM 1IR2A 3M1ZA 4N02A 3EX2A 3LM3A 3PPFA 1W32A 2ZUUA 3L23A 3NPWA 4UUIA 1X97A 3TONA 4BEUA 3DFSA 3JRKA 2W79A 3A4AA 3M41A 3M0MA 3PZ9A 4P7LA 3VOIA 3T8LA 1AW2A 3DU0A 4DWDA 1VRDA 1IXQA 1RV8A 4DO6A 1GKRA 1ZY9A 2JBMA 5I02A 2NXHA 5GJNA 4PUMA 1T40A 4IJCA 4K8GA 4M6QA 2YKKA 3TFXA 4B3LA 2WCGA 1TCMA 2XWEA 4MVAA 1MW2A 3TK7A 1P43A 3KL0A 1BF6A 1GVEA 4DPQA 3LXBA 4S2BA 1HT6A 1ADSA 3LBOA 3ZSTA 1QPOA 1DQXA 2FZBA 4N4QA 2OO0A 3B0XA 2DT1A 3GVGA 1FY6A 4U33A 1Y5WA 4O0KA 4GY1A 4L9XA 2VDGA 4EVZA 1KTBA 3SRFA 2BP1A 4CEUC 1Q8JA 2BASA 1X1NA 4BQ3A 1DYSA 2QXWA 3QQWA 1I45A 2YLLA 3I6TA 3V5OA 2I5IA 5I23A 2GJNA 5AYZA 5C55A 1GOQA 2H3DA 3WFZA 2V6AA 3ZVHA 4MNKA 1AUSL 3B0YA 5A3HA 4JXCA 5D8ZA 2FJKA 4QLJA 4QSHA 3R25A 3CMFA 1UD3A 3QZAA 4J3XA 3BJTA 1RQBA 2YXOA 3WY1A 3P74A 3THCA 1KBLA 4HA0A 4WJEA 2WSPA 3E74A 3M7SA 3NQDA 3T81A 2GDVA 2VJXA 5AHMA 3TCEA 5G4EA 5HK4A 1IZCA 5FF2A 1PTAA 4AHPA 2SFPA 2VEPA 3WLLA 1B57A 3W7OA 1ZJIA 3NL2A 1TMLA 3AAMA 1GTHA 3QKZA 3VOCA 1O1ZA 3SQLA 1Q66A 5HJXA 1I2NA 1QI3A 4NNCA 5L9FA 5XINA 2Z2UA 3G0XA 3U4FA 3UCCA 2R14A 2P1FA 4WGXA 4C6OA 4QG9A 3AHVA 3CQHA 4KBXA 5AZ1A 3BLLA 3KLLA 3P93A 4RX0A 5DXYA 1AVAA 2OB3A 3W29A 1SW7A 5LIXX 1KRBC 3FXYA 5HJYA 2WHKA 4DJDA 5J5DA 5C5YA 3PAOA 1KQYA 1R3VA 4R5EA 2NWSA 1V51A 1AW1A 3QHOA 1T96A 3RRXA 2ZDSA 4UFJA 1U1HA 2WZIA 4B5UA 2ZRVA 1TTIA 3DIPA 1H7WA 4LH8A 5HNNA 3W23A 3UWUA 3E9AA 3QN3A 3TIMA 1VEPA 3O0FA 1MUMA 3WCZA 5K4ZA 2Z1WA 2WW5A 1B0IA 3U57A 4PMVA 1UBPC 4JIHA 4ML4A 1TPH1 4HYVA 1G9HA 3Q4DA 2JGQA 5AC4A 1YNPA 2AQOA 4HSOA 3TE9A 2NXGA 2R82A 3KWXA 3PP7A 4NX0A 1WDDA 3OLGA 3PK7A 2NVDA 2FPYA 3AS2A 2VRQA 2DVUA 3ITTA 1WDWA 1B9ZA 2CBVA 2L5HA 4IP7A 4L4LA 3S5SA 5I3FA 2O9PA 1H49A 1GG1A 3WLHA 1LUCA 2ZTJA 1NOWA 3MP4A 2X8RA 4NSBA 4N4PA 2NUXA 3NO5A 2ZUWA 1MEIA 2JF6A 3MUCA 5KETA 1RALA 1KM3A 3FKKA 1J4EA 1NFGA 4UR8A 1WZMA 3MV11 1IT0A 4F0KA 2ZZ6A 1W3TA 2QHAA 4GFSA 5H91A 4GGHA 3VMNA 5CCZA 4GNVA 2R1KA 4Q7NA 1V3HA 2PSNA 3F03K 5ABGA 3UZZA 4OZOA 3BPWA 4DZ5A 1CEOA 1NVMA 3POCA 3C86A 4LYRA 1PS9A 1G67A 1JCXA 2QJHA 1QOPA 3TSBA 1J9YA 1OX6A 1JI1A 5E0CA 1XXXA 3TQPA 4IGHA 2DU2A 2NV9A 3CPRA 1RP9A 3W24A 2J9YA 2X40A 4TMCA 2ZUNA 5A6JA 1DIKA 3BAKA 3VUPA 3KZSA 3ONCA 1UP0A 3CMGA 3HGSA 3BMWA 1GZ1A 3CIXA 4IXXA 1M3UA 2Z7GA 1QWGA 5G5IA 1NU5A 2NUYA 4V1XA 2HWGA 3FY1A 4B3ZA 1YXCA 3E5BA 1TWZA 4D6GA 1W1B1 4O54A 4Z42C 2QCGA 2VI0A 1EBGA 4JCMA 4IT1A 2DZVA 3IK2A 5CH9A 1UR0A 5JVLA 4HGXA 1FWHC 5HATA 1X1OA 2PURA 2VX5A 1D8CA 4YJ5A 4OOUA 3FJLA 4G1NA 4PUUA 4PBGA 4D1IA 5I07A 4ZFCA 1EPXA 3E12A 4HTYA 4AF0A 2JIEA 2V30A 3VPLA 2PMQA 2E4TA 3AICA 4XUGA 3HO8A 4IUOA 5L6UA 3AU6A 2YL8A 1S2AA 3VVGA 4IGSA 3VXGA 7A3HA 1LG1A 3L4XA 3WH5A 1QO2A 4GOAA 1LRNA 4ES4A 1NEYA 5HUOA 4ATDA 1UHVA 2C8NA 4HU3A 2V3GA 1OF6A 1WE5A 2Y8KA 4A35A 5DMMA 2G3JA 2TYSA 2ACUA 3WMBA 3LBMA 3AC0A 4BFAA 2YA2A 1F07A 4Q8QA 3ID7A 1XCWA 5A8OA 1BXCA 3W88A 2R24A 2O0TA 1TUFA 2ISSA 2PF0A 1HW6A 4PCFA 4IFRA 1KGUA 4CNUA 3MV01 4S38A 1YW1A 2DZXA 2A7RA 1VFSA 3M5VA 1UR4A 1QU4A 4GY0A 4A8NA 4NHVA 1ISXA 1P48A 1KD0A 1H1ZA 3VFLA 2W63A 1LBMA 1S2VA 4NAEA 3GDKA 3W7PA 4E2BA 1JCJA 3T09A 4I7WA 5LNVA 1F8IA 4P5UA 3WNNA 3RMEA 2O7QA 2OWXA 2QPXA 4NU7A 4FZIA 1EJUC 3HV8A 1NJJA 2OLAA 3V36A 4ZL1A 2LLEA 2XN2A 1UR8A 3URBA 2OSYA 3KL3A 2BB0A 4OV9A 4LVFA 3UCDA 4FOUA 1MYRA 2DIJA 1YBQB 4A3RA 5ECUA 2VOMA 1WDSA 3LN3A 4JL2A 1KCZA 3CZGA 1JDAA 3C0SA 3TYZA 3PPHA 3IS4A 1W9DM 1JR1A 3O6YX 1A3XA 5GNXA 4MKNA 4L9ZA 4KT2A 3TLLA 3UT0A 2CBJA 1WO2A 3MMDA 3WUEA 1XBYA 3P81A 1WQ5A 2ZICA 4RZ4A 4NZJA 4CEXC 1H5VA 3E3HA 3V7PA 2OTDA 4ZSTA 3CASA 1VBHA 3QRHA 3CZJA 3WDHA 1CW2A 4BQ5A 5MKGA 5TAOA 3CT7A 3SQSA 3NAVA 4WHBA 4TTUA 4A21A 2X0YA 2Z6IA 1A5UA 1FWTA 4TX8A 3P3BA 3AOFA 4IX2A 4MPKA 1AL8A 2JF7A 4ADTA 3VKAA 1T7LA 4MLRA 1KRCC 3W7EA 2GGIA 2DIKA 3MWCA 4D6HA 1TJ1A 2ISDA 4K1WA 3DUGA 4QJ4B 5JBFA 5A6SA 4EPKA 4J1OA 4IPPA 4PUKA 3B0UX 1UJQA 1H50A 3VD5A 1BGGA 3DI1A 3GIQA 3QGKC 4WSJA 4KWOA 2E8YA 3D0CA 1HN1A 3EX3A 2QVNA 1QW8A 3PWIA 4PMNA 3H12A 2W66A 3LMZA 1BAGA 3ARSA 3M0YA 4IWWA 4L64A 3TN6A 2W3ZA 1PIIA 4GUFA 1E1CB 1KV8A 1PZ2A 2P0IA 4AQLA 2E1DA 2C6QA 3OBAA 3H2OA 4LAMA 3AHYA 3N9SA 1GJPA 1EJVC 2V81A 1TWIA 5EMYA 2D20A 6PTDA 1XFBA 4MUZA 1OYBA 3ATZA 5DMYA 3WDPP 2ZXBA 1ODZA 3ARXA 3GKFA 5F4XA 1YIXA 4R7WA 3DERA 4AX7A 4JS3A 3AIRA 3H26A 4L6OA 3GVWA 4UTHA 4ZGYA 3S6DA 4DJDD 1BG9A 5FSEC 3O3RA 4DO4A 3CLWA 1P0EA 1DWJM 3O2LA 1SO4A 2B7PA 3GHSA 3QW3A 4PTNA 4XX6A 3FYPA 3R2GA 5AN7A 1GVRA 3K5XA 2QMJA 4IIGA 1DJYA 3ZSSA 2BHZA 5JU6A 2CCRA 1GHRA 2VZOA 1EO5A 4M19A 4X61A 3TEVA 1OINA 3C56A 2VR2A 2E09A 2FHCA 1OCBA 2OYKA 3LDVA 2A6LA 4HCHA 1W9UA 3N9RA 4LYQA 1GTEA 2PWDA 1LOLA 2EPNA 4CD5A 4AVNA 1IGSA 3SUUA 3TC7A 2QUVA 2ZKMX 5M03A 2WANA 4DWSA 1Z48A 1PBGA 2QZRA 3UQNA 4FSAA 2E9MA 4KW2A 4YHGA 4UZSA 2VD8A 1ZZMA 2CITA 3DG7A 3FDKA 3EWWA 3MBFA 3R8RA 4Q4QA 2YCKX 4PEKA 5IDZA 2A7PA 2AAAA 2WB5A 1XBXA 3B8WA 3TXVA 2Z1KA 3QHNA 4K38A 4PA8A 2VP8A 3BUVA 2Z1BA 1A47A 4FAMA 1EXPA 2NXIA 3TYEA 3O06A 4JR5A 4M81A 4UMBA 1GVFA 3ZT5A 4LC8A 1PYMA 2J7FA 2PRHA 3SIMA 1ZJBA 3G6LA 3O16A 2YOCA 1W9XA 4KIRA 3QY8A 1PKLA 3HFTA 4NZ5A 1XCXA 1L2UA 1SSGA 4GH1A 1KBKA 1WDRA 4G56A 4RPQA 8XIAA 1PV8A 2X0HA 2WK2A 3ITOA 1XIMA 2IKHA 1L8NA 3PJUA 2CZVA 4MYXA 2P88A 3G1RA 2Y24A 1OX5A 2ZUMA 2Z24A 1SGJA 1EBHA 1XYCA 4XD4A 4LALA 3QJAA 5BWFA 1K7XA 4Z17A 3H70A 1KLYA 3W1UA 3A4JA 2XIOA 2IUZA 4Z2HA 2C3ZA 3TV8A 3S2CA 1TUXA 2DORA 1HKMA 3KWSA 3W74A 2QGYA 4C91A 2Y7GA 4GQGA 7REQA 1UWSA 3KCOA 1NDZA 4ZB5A 2YR1A 4HD5A 3T8QA 3DFYA 2QV5A 5AFDA 4JQ4A 4C5ZA 2EG8A 1VHNA 5FJOA 2GQ3A 3GYEA 1HP4A 1W54A 2I14A 1OABA 3N2OA 3T0TA 4A29A 3P0WA 3F4CA 4DUVA 5AC6A 1YE4A 2E6DA 2PWGA 4LT9A 2DW7A 1E6RA 1TE1A 1MNZA 1V3KA 1FWBC 2C18A 1LRTA 3KTXA 4RDVA 2WHJA 1AD4A 4Y96A 1M1BA 1A5LC 3THUA 3EWUA 4ORMA 5D09A 5F1VA 3BLFA 2G0WA 1CB2A 4UWMA 1P6CA 1U5JA 2QUUA 2PU0A 3LHZA 3GG0A 4JTRA 3U6WA 1ZSXA 3F4VA 2FKPA 2ZA2A 4B92A 4IG2A 1YYAA 3IVUA 2GWGA 4BF7A 4PUNA 6XIAA 1CLXA 5CG7A 2ODOA 3TW7A 4N9EA 2FB3A 4J2PA 3W83A 2P0OA 4NRSA 2CLMA 3PF3A 1ADOA 3U5UA 4PUDA 5AHLA 1Q63A 4FLRA 4GBDA 2WLZA 1S46A 3E0VA 1Y65A 3UCQA 3TN5A 3W0KA 3GIYA 3W1TA 2X1UA 4M29A 2A21A 3DC8A 1N8WA 3P62A 1D3CA 3OW1A 1A3HA 5E93A 1G94A 4CVUA 4WUIA 1XIDA 3LPOA 2Y2WA 3COTA 6ENLA 1PDZA 3AYTA 3K1GA 3UZWA 3JZUA 3FJ6A 3OQEA 2MANA 3GDBA 2NV2A 4DJEA 4HVXA 1XM3A 2DV0A 2ACSA 4DJDC 1E40A 3DBPA 3NSMA 3CWHA 4M6PA 4S3JA 5A5WA 4JTLA 2HISA 2A3CA 1RUSA 3GSMA 3WQEA 1BRLA 2J25A 1E9IA 2YDRA 3W9ZA 1QBBA 1DXFA 3W7GA 1KKOA 2Y5EA 4ROPA 3SCNA 1O66A 1F4HA 1S5VA 2V2CA 2CC0A 3T08A 5CPNA 4LY4A 4DNHA 3UYCA 3CHFA 4K39A 1ISYA 1SSDA 3KRSA 1FKWA 5CC3A 3W81A 3VIGA 1JXJA 1OC6A 7TAAA 5CSSA 3WQ6A 2OU4A 1C91A 1LUCB 3W6YA 3P5ZA 2F2KA 5IFPA 1XBVA 3W2JA 2Y7DA 1K9TA 3T1GA 4JQ1A 1UWQA 3MKVA 5D38A 4UQEA 5AVNA 1H7NA 9RUBA 3KTCA 2PGFA 1ZP4A 5EMMA 2CPUA 2GWNA 2DH2A 1Z7AA 3C2RA 3TTOA 2C71A 3QV7A 1TTJA 1ITXA 1NOUA 5JUVA 5D9NA 3M7WA 3IIVA 4FEZA 4Y90A 2P76A 4F4RA 3VKKA 3DC0A 3M4HA 4FNPA 2GUUA 3IIOA 4G9PA 1KA9F 2PC4A 3N29A 3TJLA 1O94A 1P0DA 1THFD 1I1WA 3DBNA 1B3ZA 3LX9A 4JZ5A 5GQBA 3RDKA 1BYCA 1YNQA 4CQCA 1XKYA 4PCPA 3NL5A 2XVPA 1W8GA 3JZEA 2VVSA 3QHMA 4F2TA 4PMYA 5FL1A 3N14A 3FV9A 1LL7A 4F0RA 1AK5A 1BYDA 3R58A 3NEHA 4GPNA 2Z2AA 1NQ6A 4L1WA 4O19A 4IFKB 1ZALA 4AC1X 4Q8PA 1OIMA 5IM51 1F6YA 5AOUA 3SY8A 2QCEA 1JZ2A 2EGZA 2GOUA 2ZOXA 5FF0A 1QBAA 2WZMA 5C2XA 4HNNA 4Q4OA 1W3IA 1KCXA 1HKIA 1ITCA 4JTIA 1SR0A 1BG4A 1Q6DA 2D2GA 4QISA 5CEWA 3W84A 4FALA 1V79A 3A23A 1MQPA 3AUOA 3NQCA 3C2EA 1F2JA 2PEVA 5HAOA 3PR2A 4U3CA 4LRTA 1UD4A 1MW3A 4BI5A 5DMLA 4N0RA 2Z0IA 1OT2A 2VZSA 1EF3A 4PRRA 1F3EA 3RILA 3CH0A 4CD7A 4BI7A 3C2OA 3BAIA 1TA3A 4WD0A 2VUNA 5J8LA 2TPSA 3QSTA 1KRAC 1GK8A 5AZ0A 3RNDA 1TG7A 1PDYA 1NWUA 3WNPA 5HR6A 1EXBA 3WUFA 3IUDA 3AWOA 5E6YA 4CQDA 3BGGA 3EXRA 4JTSA 4GE8A 4PRWA 1RK5A 3M43A 3K8LA 4EF8A 1RVGA 4S3GA 5D2XA 3OZYA 3VKDA 4Q6JA 1AJ2A 6REQA 4U31A 1VYSX 3S2NA 2CWNA 3MCOA 3KCJA 4C90A 2FPTA 3E0WA 4TVCA 3TW9A 3AMLA 3W7JA 1BD0A 2VFIA 1X96A 3ZLFA 3KBVA 3IV3A 1TTPA 8A3HA 2WV8A 3TFCA 1ZCCA 3STFA 3TW6A 3Q2DA 4DWSD 1ENUA 3EA1A 1EX5A 3W70A 3E6EA 4FF5A 1LZOA 5DQPA 3RCNA 2HE8A 3KZPA 1XYZA 4S39A 5H8PA 1W6TA 3VDBA 4MIMA 4Z08A 5F4SA 1BKSA 4FX7A 2A2IA 3FVMA 2NX1A 3VD4A 4LQ1A 3W2KA 3ALGA 1KFJA 1UR2A 5TIMA 4DXKA 2GJRA 3T0BA 4JX5A 4F8XA 2PDBA 5J04A 3RCMA 2Q09A 2C0AA 3ME3A 2E68A 3KOWA 3AYRA 3M0JA 4MMWA 4IIEA 1EQPA 4UTWC 3A22A 1XYFA 2QPUA 3HPXA 3M07A 1SFLA 5REQA 3QQ1A 2BBFA 3UP8A 3TR2A 4AD3A 4C6CA 1UH3A 2QJMA 3KOXA 4GACA 4B5NA 3V0UA 3SCVA 1A5AA 3KVLA 4FNRA 1E70M 4Q4MA 1YEYA 3MCNA 1H41A 3UWYA 1XLBA 3MKKA 1VBUA 4KIEA 5ENLA 4XAFA 1XLDA 2I7GA 1E9ZB 1D7KA 2ZA1A 1CXHA 4GG9A 2UY2A 4GQQA 3V4BA 3K8KA 1A3WA 5FKYA 2WMKA 4IMDA 4XD5A 3LD5A 4L5ZA 3DGRA 2QVHA 4W4QA 3ONBA 4V33A 2QDEA 3AXIA 2ZRXA 3HG3A 1BYAA 2OLSA 4QAWA 3CJPA 1QK2A 4GIRA 3T2OA 2INFA 5I3IA 1FOBA 3Q67A 1NDVA 1D8WA 4PTDA 2C91A 1HJQA 3VIMA 5C70A 1Z9AA 1PKNA 2EPKX 3TJXA 2J27A 3GWQA 3IJ6A 2ZRZA 3NQEA 4GI4A 4D6DA 2D23A 3A4WA 1VJZA 2WAGA 2Y88A 4TVDA 4AG0A 1ZP3A 4TXEA 4LUSB 4GVFA 4OUIA 2O4MA 3PUEA 3E5PA 1Q7ZA 2CESA 3ZR6A 4JN8A 1ICQA 4QDWA 4E8GA 1K1DA 5I79A 1K77A 3H2FA 5CC5A 3PZTA 1CECA 5K4XA 3OQ8A 5EGRA 1E4IA 1UZ4A 2BX7A 3B9DA 3NQ2A 1DE5A 1DHPA 3AROA 4QP0A 3STEA 2P8BA 2EHHA 3WDRA 3RRAA 3TYAA 1GPWA 4BK9A 1UJPA 4LGXA 1FQ0A 3MC5A 5H6HA 2B7QA 3GVVA 3BW2A 1AJZA 2OQYA 3AIEA 3XISA 1Q7QA 1K6AA 3BAXA 4GZIA 5M3WA 3KFTA 1EDGA 1X6LA 2EKGA 2ZUSA 3G6MA 3NOEA 1LRQA 3UR8A 2EO7A 2ONEA 1J2BA 1G5AA 1SYTA 3EAUA 1CGYA 2NUWA 2D1ZA 3U2OA 4KEVA 7CGTA 3N3MA 4HNLA 1OIFA 1L6YA 3VUSA 1E1EA 1XFCA 1CNVA 4HHLA 2OZTA 4Q4KA 4ZO9A 4UNIA 2HDJA 3WYZA 2Y1HA 1JGMA 1UBSA 2QQ6A 1I8JA 1RLCL 4TV5A 1H63A 4B4FA 3NFUA 1O60A 3KLKA 1KM4A 2RH9A 1LBLA 4H9TA 1RY8A 2HSAA 3GX9A 2YDQA 2XSAA 2YCJA 2ZZ1A 4TIMA 4AMAA 4DWSB 3ITXA 4HOXA 3DFHA 1Y5VA 3VDAA 1GT8A 1TIWA 2OX4A 3PBVA 1E6XM 1PZ1A 3W7LA 3AMKA 3BTNA 3OB8A 2CLOA 1GKPA 3K1DA 4UTTC 1YMYA 4C7GA 3U0HA 1HJXA 4GINA 3SJNA 4OFCA 3TLQA 4ADUA 3WG6A 1TVNA 4C7FA 3CUIA 5EB8A 4J28A 1ECQA 4DWSC 1TB3A 3WJYA 4PRTA 2FZ9A 4XBSA 5CJ5A 3C3NA 1TV3A 3PTDA 1I2PA 1CGXA 1E4MM 1L8PA 4JICA 4H9ZA 1K3UA 4YLWA 3SFKA 1MRQA 3L4YA 3PUOA 1VC4A 1TKKA 3SGGA 4EAYA 2GUYA 3NWRA 3A24A 4LANA 3L4TA 4NQ1A 4AWEA 1UCWA 4WJ8A 2OR2A 3T05A 3VOJA 3NQ8A 1V6YA 3WUBA 4F3HA 3GNXA 1LTDA 3KW3A 3LXAA 4QG6A 3LYEA 5H2ZA 3Q37A 1HJWA 3LTPA 3RLVA 3ZWSA 3HBLA 3WSUA 3MI3A 4JQ2A 3LOTA 2PDIA 4R34A 4DEFA 1TJ2A 1UC4A 3E38A 3T40A 2DT2A 4ZOBA 3LGGA 2JKAA 4UR9A 1C3FA 1R6WA 2WPBA 4PB4A 2YBVA 3H21A 3VZYA 3M16A 1JYNA 2KAUC 4ZFMA 4UZUA 4A3HA 4P8UA 3EPNA 2HROA 1DPMA 3TSMA 4GZJA 4XD3A 3F4DA 3AQUA 2ZADA 2ZUTA 2ZX9A 2E5CA 1RCOB 3N2XA 1QO5A 3HURA 4MZ1A 3USBA 1XLEA 4EXBA 2WMFA 4D6EA 4UTJA 1XF0A 3NQGA 1SZGA 3VOGA 3SRKA 1V7AA 1JZ5A 4UTMA 1H7XA 3CU2A 3TP4A 3EBVA 1P1XA 2FH8A 2VDIA 3I3DA 3QMSA 3UXAA 2YBUA 3W2MA 5C0QA 2XPKA 2J66A 3LXCA 5D2TA 1WZLA 4F9JA 5LKYA 4QJ1A 1XC6A 3WIJA 4G7EB 1QW9A 3W7NA 4ZQPA 3UJFA 2IKJA 2VGGA 4IG2B 5EU9A 4GBUA 2R8WA 5CPLA 2YZ5A 1A0CA 2DUZA 3MI2A 5G2WA 2OZ0A 1FHVA 1QPRA 3LQLA 1B3XA 3UPWA 1KWKA 1KKRA 1LP6A 1OBAA 2XIBA 3CUHA 3M47A 1DP0A 5EPDA 4UFMA 1FWNA 2BY2A 4JAWA 1C8XA 2E25A 3M0IA 2ZA3A 4WKFA 3LBCA 3UR7A 5CBBA 3GZAA 5A69A 2J75A 4QQUA 3NSNA 1A0DA 3W26A 4ONVA 1ZAHA 2E9LA 2GPTA 5KZMA 3W2UA 1QOQA 3ANUA 4TUFA 1W5QA 4HPJA 5I3DA 4AIEA 4Q7IA 3QC0A 4DI8A 3H4WA 4BZYA 3L12A 3LCGA 1TPUA 3VK5A 1IR1A 1V02A 3S9ZA 3L5LA 1X6NA 1DIDA 3VKBA 3UJ2A 4AU0A 3DENA 2OQLA 5K9DA 1TJRA 3AYVA 1GVYA 1PWMA 2FPVA 4WK9A 4PB3A 1DIOA 1EOMA 1RR2A 3KVKA 4PBFA 4NX5A 1PPIA 2V63A 3QKEA 4O11A 2YIHA 2VOTA 3EPMA 2BY0A 3OZOA 4H41A 1P1MA 4AIUA 3A9IA 1XLIA 1ZL1A 4O16A 1E5NA 4TR9A 4C1NA 2O9OA 4Z2IA 1VEMA 3KHJA 1GQLA 3B03A 1UIPA 2Z1XA 2TMDA 1ZBCA 3UYIA 3BWWA 4XIAA 1OD8A 1W1IE 3UR2A 4CGTA 1ZLPA 1XUUA 3KS6A 2YA0A 3BLDA 3K4AA 3SDOA 3BG9A 1KR1A 3BK0A 1WDPA 3STCA 1WAWA 2JEPA 1Q6GA 3BMVA 4GVGA 1YDOA 1JUKA 2H9AA 4JTHA 1OQFA 3ARYA 3TSDA 1MXSA 3IJLA 5I6SA 1VRXA 3ICJA 4LYKA 5C9XA 5JBDA 2FQIA 2I57A 4GK8A 4Z2LA 3ANYA 4O1EA 4AEEA 5HWJA 1M03A 3DFQA 3W4RA 4U5IA 1VLWA 3N15A 1Q65A 3RPMA 3FK4A 4IIDA 2IPJA 2ZX5A 2XH7A 1E6NA 2WWDA 3TVAA 2WLYA 4XKMA 3WL1A 1TPB1 5HOSA 4Q8NA 3P61A 2VR4A 1VJIA 3VC6A 4GYJA 1ISWA 2ZRWA 3UWEA 1ZNNA 5A8PA 4QTGA 3TZFA 1SQ7A 4U4MA 1V3IA 1EB3A 3MTWA 4OQVA 1W3NA 3LRLA 1HF6A 1IEWA 1RQEA 4HSHA 1U83A 1TV2A 2IQ0A 1KLZA 4B5SA 1YDYA 4AYGA 4ZOCA 1TRDA 5EYWA 3S83A 2QDHA 2GJPA 3NZ1A 3GVQA 2J6XA 3SN1A 4YXGA 5D04C 1IIHA 3M5YA 3CK5A 3PZVA 2XSXA 3E2SA 1DBTA 3WX7A 1EJWC 3KVMA 3U9IA 5JQ9A 4PB5A 2HS6A 3WQDA 4JTAA 4FS9A 3TXZA 4PMXA 4GC3A 4B15A 4DO7A 1TA3B 5F7UA 1E3ZA 2OZ8A 4H9YA 2CZ5A 4ZXLA 3C8FA 1ZCOA 2WNZA 1TTQA 3W02A 3QOMA 5ABFA 4YVPA 4B91A 2PDXA 3GS6A 2YGYA 4QNWA 3UY7A 1BVZA 3M0KA 2Y7FA 1PVNA 3B8UA 4YTQA 3N6QA 5FEPA 6REQB 4XVDA 4H4IA 2ZIDA 3R8GA 2PRMA 1EJTC 4XO6A 5BU9A 3W7DA 1T0OA 3QQ0A 1XD1A 4S3CA 3W7RA 3NYDA 3DDMA 2C0HA 3W27A 4AZ6A 2MNRA 4RUBA 4AD2A 4OHQA 3GHRA 1UYQA 4AZBA 3KBJA 1FDYA 5KITA 2WMGA 3D3AA 3V0SA 2Y8VA 4NJGA 4O12A 4E6MA 3G1FA 1NH6A 3QFEA 1FCBA 1UA3A 3ANVA 1Z32X 5AECA 4PMOA 1ME8A 3EX1A 3TNOA 1VD6A 3VIOA 1BQGA 2PDGA 4JKMA 1KFBA 4PEEA 4GUJA 1R7AA 4EWND 5IRPA 1UASA 2OYMA 5AYYA 3R5EA 4RJEA 4LU0A 3LTYA 3DFTA 1HKJA 1BHGA 1X8FA 3B9OA 2GDQA 3LU2A 1RAKA 1E4NA 2DZPA 3SAZA 4Q8UA 1CBGA 1KXQA 2WKJA 1H0GA 2VX4A 3FNDA 2ZE0A 3BAYA 1UMYA 1UKQA 4B90A 3MUXA 4E0CA 3CL6A 4ICNA 5C2GA 4GJIA 3ZO9A 2Z4GA 3R4IA 4Z2KA 4X9SA 1JVNA 3G3DA 4KS0A 3BLOA 3JUGA 3GH7A 2OKTA 5BXTA 2QAPA 4I8YA 3WLPA 3WKZA 4H8UA 2GJXB 2OOGA 3CIVA 3MVIA 1EJSC 1TO3A 1W1YA 2G4FA 4QXIA 4ZB2A 4IGNA 3DKJA 2ADAA 4CQ8A 3OIHA 1XD0A 5GNZA 5BROA 2WQDA 3EMQA 4KEUA 4QCFA 2VFEA 1YDVA 4O0ZA 3B4YA 1J96A 3DHDA 2W4XA 3KEHA 3W7CA 3UF9A 2CWXA 4C1LA 2V5BA 2G41A 2PDMA 5LA0A 2A85A 1XI3A 5E70A 2ZC8A 1CXKA 4ZO6A 2D69A 4GQ0A 4J3VA 4OOZA 4A05A 4Y6GA 1F76A 3DYOA 1GJWA 4I5UA 2CHRA 1QUMA 1XIEA 2R9RA 1H2JA 4W7WA 5F2GA 3T4CA 2J77A 3UA3A 3NGJA 4AAJA 2OXNA 2E8ZA 2ZXAA 1L6SA 3VNLA 1QI5A 3DH7A 3GU1A 3MJYA 3PS7A 1R2RA 3P82A 3UBPC 4J7RA 1UROA 4D2JA 3QY6A 5T9CE 4ILSA 1IHIA 1GYNA 1V02E 4WGHA 5GPRA 1MMFA 2P53A 3MT1A 3EXSA 8RUCA 3OLDA 4US6A 1UKOA 3UG5A 3OYZA 5TBOA 3MUAA 3UJRA 4XBJA 3GU9A 1BWKA 4XZMX 2TODA 1Z89A 3NDZA 2XZ7A 5AC7A 4LBRA 1BVNP 2DW6A 2DSKA 3F4WA 1R30A 4IGMA 5U4NA 4BA0A 4C6QA 3RN6A 4PMJA 1TZZA 2GK1A 3W28A 4OKDA 3L67A 2BGSA 2QCLA 3G0UA 3WLIA 4GJ1A 1X7IA 2VO5A 2PDWA 1O6IA 4UTFA 3THAA 3SB0A 3CWNA 4H6RA 4D6IA 4N42A 5BNKA 1Y0EA 2HK0A 5AHNA 1XLFA 1JZ3A 1SZFA 1ZUAX 1CGWA 1WKYA 1KFCA 3LSBA 2HQAA 4I6KA 1GVSA 2BVWA 3IUIA 2PFHA 2J74A 5D9OA 1SW3A 3NM1A 2OYLA 1G4PA 1ZBKA 3CZKA 2P50A 4MAVA 1PTGA 1H60A 4TOQA 2DZSA 3EX4A 3AALA 5DT5A 3LRKA 4KWVA 4O1FA 3UETA 2PDFA 1HJSA 3ITCA 2Q3OA 4BY3A 1EGVA 3QM3A 4IPLA 4PR4A 1TRIA 1OFOA 4R7JA 1H09A 5G4WA 1MQRA 3FAXA 3NOYA 4Z0JA 1Z44A 3AZRA 5AYIA 1QR7A 4IMEA 4H04A 1KC7A 3T2PA 3EX6A 1Z41A 3V3WA 3NIYA 3ZXWA 4WCJA 1XWYA 4LV4A 4O17A 4RKAA 3UPMA 2HBVA 2GVGA 1JJKA 2HPMA 4AW7A 2YYTA 2QIWA 4IPIA 5K2ZA 4HJFA 3W01A 3QXBA 1HVQA 2ZXQA 3MCMA 4IICA 4JIEA 2O92A 3S1WA 3UZJA 3FJNA 1LOQA 1OFAA 3EEZA 5JBEA 2W92A 4I5RA 4HTBA 3WQ4A 3R6IA 1C7SA 2HK1A 3M5ZA 2VEGA 1W17A 1KB3A 1QK0A 1S5WA 3NZPA 2AQVA 1XPGA 1WB0A 5A95A 1H0IA 3U3HA 1BTCA 4U10A 3W00A 3WK0A 3GDMA 4GXMA 1Q6RA 3PTQA 4Y2WA 4YTSA 1LROA 1XGDA 4JNZA 4L80A 4GI9A 4DYEA 3MB9A 1F05A 2X09A 4XIMA 1JDFA 3UR5A 1HGWA 4RR4A 1TV4A 1JXKA 2RGMA 3C61A 1G4SA 4FF7A 1HL2A 3RAOA 2FVLA 3EEGA 4F2UA 3TUUA 1KCLA 1G7VA 4AZGA 4LVBA 4NZ4A 2WQPA 4QJ5B 3TMLA 1RY0A 2CZFA 3EPOA 3K8MA 4J2MA 3CIWA 2ZWYA 3EOLA 1AH4A 1EOKA 1KXVA 2QS8A 5BZAA 3WMCA 5D37A 4KGJA 4UFHA 3LPGA 2PODA 5DN1A 1CPUA 4W84A 4HPNA 4M3PA 3GQYA 3WH8A 1VZWA 3VYLA 3BE7A 4JYFA 4LV9A 1FWFC 2DY3A 1W56A 5LA2A 4JPGA 1XDJA 3GAKA 3W2NA 5IOBA 1VS1A 3WNKA 3G8EA 3CAWA 4R9XA 1XQLA 3TAOA 3VO0A 4ORIA 2X05A 1JCYA 1ESWA 1F9CA 5CJMA 2ZZ5A 2IPWA 4GYPA 4WVXA 1WCGA 1EC7A 3E02A 3HOJA 3QV6A 1JUBA 3WLMA 4GCXA 1EUAA 3OVPA 3NVTA 5I06A 4ALDA 4M7SA 1XYBA 4RXFA 2OWCA 1RZMA 5I03A 4MY9A 3KAOA 1R3WA 4H6KA 3C2YA 3NEVA 4FNQA 1XLHA 2WKGA 3JS3A 4RNIA 1FHUA 4UBPC 1UQYA 3UVAA 3C3UA 4IUGA 4Q4SA 1DL3A 2C16A 4AD4A 1IYXA 2Q3RA 4LRSA 3L4VA 2EAWA 3VA8A 1DJZA 4FI4A 4H7VA 1EPVA 1TVLA 2RDUA 3QPYA 2OFJA 2NVAA 3WLKX 4DIAA 1N82A 4CNNA 3EXTA 3WQGA 3N4AA 1ISZA 2ATSA 5F2IA 1QMLA 4AD5A 4Y9NA 5ABEA 3VIFA 1VLIA 1ZHAA 1ZAJA 1N8FA 1JPKA 4FNTA 4I6VA 4JD4A 3UG4A 1FWAC 4F9DA 4G2DA 1MZRA 4TQTA 1FCVA 1BEUA 2YFNA 4CLMA 4D6CA 3RO6A 1UPPA 2YW3A 4J3SA 1PKYA 1NARA 2YDAA 3AS0A 1A5NC 1JG9A 3G1YA 1PX4A 2MUCA 4FPSA 1KWGA 2V2DA 1XSJA 4TVUA 4QSFA 3KX6A 3N19B 4EIVA 4UFIA 1TMQA 3M0XA 2POTA 5D8WA 2O7SA 2V67A 2NT1A 2AKMA 4EXAA 3N04A 2QCDA 3LZ3A 4QHRA 3P5YA 4LUJA 1LORA 2G3IA 4ENLA 3CYJA 1DORA 5EKYA 3PJWA 2R1PA 5CAKA 5PTDA 1WOBA 3HPAA 3REQB 4W9TA 3AS3A 4NVTA 1M9HA 1H61A 3P14A 5FJIA 5HPOA 3EWZA 4X0NA 3M0VA 2GQAA 4GFIA 2D0FA 1SO6A 4KF1A 1SO3A 3WH7A 4ZTYA 3R94A 4IQJA 1I2OA 1QHPA 3WK1A 2H9AB 1UR9A 1O1HA 4R3UA 4LUIA 4ZBCA 1TPFA 3LV5A 1ONEA 3WBEA 3N2BA 4AY1A 4KFOA 4H9MA 5H8UA 1UC5A 2PDJA 1J18A 3RHGA 3TJIA 3URAA 1FFRA 2CHOA 4FR6A 3OEXA 1JQXA 2CZEA 4H8HA 3SCPA 1K6WA 1HO1A 4GIYA 3R1ZA 4N6FA 3UESA 1UZDA 2AL2A 1KBJA 5B80A 4ERGA 1XR2A 3VDGA 3B04A 5XIMA 2C1HA 3F5LA 3R10A 1XG4A 1DHKA 3FW6A 4ZODA 3DG3A 4MADA 1K4GA 1KM6A 1SW0A 5C9WA 4Y8FA 1PUDA 4PN2A 2V82A 3D6NA 5D05A 1GEQA 5T26A 4NY2A 2PE4A 2ZZ7A 2QGHA 1Z8AA 2OEMA 4OECA 1GYMA 3OTRA 3ITGA 3LB0A 1GW1A 3VTRA 3XIMA 1E4LA 1ZS2A 3FYYA 3HG2A 3UXIA 4EOUA 3HQNA 4ML9A 1VBJA 1OK6A 6A3HA 1ICPA 2GOKA 1GOXA 2WNNA 3GFXA 4HOWA 3UJSA 2DSZA 1XKJA 2ZX7A 4GCAA 1W2VA 1EEPA 1F7BA 3LPFA 3TROA 2YLAA 3TQKA 2Y5SA 3QGVA 3HPSA 4EP8C 2BHUA 3W7HA 1WOAA 3VNYA 3OP2A 2X7WA 2Z27A 2IW0A 5HDRA 3ZZ1A 4EX4A 3LUTA 2J8TA 5M2FX 3MUIA 4ZOAA 1GOOA 2W62A 4W8AA 4DAFA 4KPLA 3LLDA 2PCQA 3QH2A 3H22A 3C2FA 3V35A 4X9YA 1QI4A 4H1ZA 3A3WA 2C15A 1XIFA 3TKFA 4W8LA 3IAPA 5F2LA 4KETA 4AX6A 3T7VA 1YADA 1ONXA 4IZGA 3CUZA 3H2NA 4GIAA 2G97A 3RGTA 3WMSA 1A0EA 4JQ3A 3NDOA 4P8WA 4Z2GA 5A8GA 4RXGA 1N8IA 2H8ZA 4JDYA 5FESA 3VILA 1H1YA 3CWOX 2FDMA 5DELA 2INZA 3K4DA 4HHHA 5D02A 4C65A 4CCCA 4Z0SA 1EL3A 4PUEA 4ZQRA 2NX9A 4P7QA 1IEXA 2I5QA 4FNUA 2OX1A 1AH0A 1O5RA 3V5CA 3B3DA 4LUTB 3PZQA 4E2OA 1I60A 3DOPA 4M0XA 5CZTA 3NL3A 1GQNA 3PJTA 1K70A 1TR1A 1G4TA 2XJ7A 4X2RA 3BAWA 5FJPA 1P5BA 4GNKB 1DTNA 1E9YB 3EWXA 1XLGA 3RLHA 6CGTA 3PWAA 1LOSA 1SJAA 3EWYA 1XLCA 2PTDA 2A5HA 3ABXA 3MSGA 4QJ3B 1S3TC 4DBEA 4TU1A 1E6ZA 1Q3NA 4W7VA 1IQ8A 1W1VA 4HMNA 1QNPA 5A2CA 5DLCA 3WDIA 1S1RA 4ZO8A 1E72M 1TX0A 1EYEA 1WPCA 4DYJA 3CHEA 4WOZA 2PDYA 4JKLA 3LHYA 2DZAA 3W1MA 3MP3A 4KERA 2ISVA 3U8GA 3CLMA 3S1UA 3QC3A 1XL9A 4X63A 1GZGA 1ZBVA 1CZ1A 2NQJA 3O0KA 3KBNA 2WJDA 1W31A 3IEBA 3LV6A 2XUCA 4U28A 3U48A 5T8GA 3L0KA 4OE7A 5H1WA 5A6AA 2QYGA 3HGOA 1CXFA 3Q45A 1MFVA 4KRUA 4W5UA 4R85A 4DI9A 2QCFA 1V6XA 2DFAA 1RH9A 3HIJA 4LAUA 5CBIA 3HMJG 1LT7A 2A79A 5C9UA 1JZ4A 3DHUA 5DRIA 3BGAA 1VPXA 2XGBA 1YNYA 2POZA 4GH3A 2G96A 4YTUA 2OZ3A 2WM0A 3UVIA 1EA9C 2GLKA 3RYSA 2J4GA 4M24A 1UD6A 3V16A 4NP7A 1CLKA 1C8QA 4ZQCA 4LS0A 4GRSA 3W87A 5JH1A 5CC6A 1JAKA 3ZJ6A 1M01A 1TIMA 3ZR5A 1E56A 4Z1CA 3QZEA 3VIPA 4IL0A 1M7PA 2BS9A 4XKYA 3W37A 3RIKA 5CPMA 4ACZB 4ICMA 1RJQA 3KOFA 3WQFA 4PH6A 3W38A 2GDUA 3WF0A 1NWSA 4NZ1A 3DYPA 4DB7A 2Y4SA 5CGMA 4MDOA 2PDNA 4A8IA 2DGAA 2QCMA 4AY8A 1LQAA 1J0JA 3L5MA 2GK1B 4NYUA 1K8XA 4ASTA 4PC8A 1EJXC 4P2VA 4QG8A 5C9RA 1OD0A 4O18A 5LGZA 2OO6A 3KTSA 4UNLA 1UUMA 3AU2A 4M56A 1TJ0A 2Q8XA 1AODA 4P8XA 1O95A 1V77A 2VM8A 1FKXA 1J01A 2XFFA 2YZRA 1VFMA 4B2DD 2Y62A 2CLIA 3KRBA 3NZRA 2XIQA 5F4WA 4Z2JA 3POHA 4B5XA 3DN5A 4D6JA 5I5RA 4LY8A 2J7EA 4UOZA 3HQ1A 3SCQA 1FWCC 1JZ8A 1W9BM 3NZQA 1AMYA 2PTZA 2A3EA 1SPQA 2VURA 5MF5A 2OLHA 1H62A 2WJZA 6TIMA 3S1VA 1VCVA 3ES7A 3VE9A 3LI0A 3FA5A 2XGZA 3WDJA 2ACQA 2ZXDA 1WYIA 4J35A 2J8GA 2HNEA 4JHZA 1GVQA 1QNVA 4K2SA 3CB8A 2ZQ0A 3K4WA 3SCOA 1H7OA 2Z29A 3QW4B 1ONWA 3FGCA 3GC4A 1AA1B 3ALFA 5F2MA 1QPNA 2F6XA 2JEQA 3ES8A 1XRTA 4Y9PA 3A4XA 1B3OA 3VOHA 3DECA 4GA8A 2YCLB 2JGYA 2R94A 3FCPA 5DANA 2BODX 2HBXA 4V1YA 3W82A 2PI6A 3RITA 3W25A 4YYCA 3IGUA 1KQZA 1R5YA 3RPTA 2BVDA 4ZEPA 1OGBA 1OFPA 4YWSA 2QR6A 4YTRA 1SMAA 4PMUA 4NJKA 1B90A