1EP1A

Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
309
Chain Sequence
ENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAANVKAIELNISCPNVKHGGQAFGTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
total genus 99
structure length 309
sequence length 309
ec nomenclature ec 1.3.1.14: Dihydroorotate dehydrogenase (NAD(+)).
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ep1A00
1TV8A 3TKFA 2V81A 3PVFA 3ZFHA 3M5VA 1RQHA 5IM51 1ZHAA 4NT0A 2EHHA 3STCA 2A5HA 4BFAA 2Z6JA 1OHLA 2QAPA 1P4CA 1JUEA 3OBKA 3M5XA 1UUOA 1NAL1 2QCDA 1MEIA 4AVFA 3NO5A 1ICQA 4OT7A 3LI1A 2J9YA 5HQEA 4UTTA 2A85A 1T0OA 1D3GA 1GWJA 3EWZA 3P60A 5L6UA 2CFFA 4Q32A 3TC6A 4YCOA 4W9TA 2QUTA 2ZA1A 3STFA 2Q8ZA 1LOLA 1Z41A 3G1XA 3FJLA 1Y0EA 4UFKA 1I2NA 3Q94A 4JNMA 2DORA 1XDLA 4LRTA 4NX0A 4LUIA 5ABTA 2A21A 3NA8A 4XBKA 2BSLA 4Y90A 1H1YA 4O16A 3TSMA 4JIQA 1SO4A 2VELA 3CTLA 4PEKA 5AYXA 1GVQA 3DBPA 4JTIA 3HGRA 2YCEA 3MHFA 2R8WA 4S2BA 3M5ZA 4IXHA 4PTNA 3WK1A 4TR9A 1M5WA 1IIHA 3BW4A 3QPZA 2V5LA 4UFJA 5DELA 5FEXA 2TYSA 5HMSA 4ZQOA 3UD6A 1DOSA 2NUXA 5F2GA 4O10A 1K7EA 3TA6A 3NM1A 4O12A 3N2XA 2BWGA 3S5YA 1LM1A 3DI1A 5AB3A 3O6CA 4K6AA 3TCEA 4GUJA 3EKLA 4LVGA 2WQPA 2IQTA 3GR7A 2FPTA 3LGEA 3TDFA 1R46A 1I2PA 2NXIA 2CLIA 3GDRA 1KFKA 3C2EA 1SZNA 4FB7A 4O19A 4O1AA 5DXYA 3W9ZA 2F84A 2WKJA 3BG9A 3HIJA 3NNTA 2XN2A 4AF0B 2I14A 4IX2A 3PB0A 2A7RA 1O94A 1H7OA 2ZQ0A 4NNAA 3I7RA 3M6YA 6ALDA 4N9DA 2E1DA 1JRCA 2YXGA 5I3HA 3WK2A 1KM2A 1PL9A 2ZYFA 3LTSA 3L5AA 3T7VA 3U2OA 4QM1A 4LWWA 2NXHA 1XDMA 4N02A 1QNVA 1OFBA 1A5BA 2GVJA 4AWUA 4JTGA 5EYWA 5F1UA 2NUYA 3QJAA 3E0IA 3NQ6A 3AO0A 3QYQA 3NEVA 4JY9A 2ZCGA 1MEHA 2DZTA 4BF9A 1LCOA 2QCFA 3BGGA 1ZAHA 4AH7A 1VPXA 3EEGA 3TX9A 3G1SA 3SI9A 2Y85A 3RU6A 4JTJA 3M1ZA 3W3OA 3EKZA 1T99A 1XBXA 3C2RA 3JRKA 4DXVA 3UZJA 1W0MA 2C14A 1EWDA 4MVAA 3HG2A 4LC8A 1JUBA 1RV8A 4UTHA 1GVFA 1W31A 2YR1A 4QSHA 2RKXA 3UY8A 3DGRA 1F6KA 2O7QA 3O06A 4N4QA 3B4UA 3CWNA 3HF3A 5CZ0A 1QPQA 1FCVA 3IV3A 1A53A 3P81A 1QMLA 3GAKA 3R89A 3W85A 5K9XA 1JCYA 5BNKA 4DQWA 2E09A 2B7OA 4JYFA 2Y70A 1UBSA 2VFFA 5FI8A 2ISSA 2V2DA 2CLOA 3PWAA 5CGQA 3EX2A 4I9AA 5D37A 1VCGA 3QSRA 4QIUA 4S1FA 3FA5A 3QF0A 3WK0A 3TJLA 3A24A 5DXXA 1FWNA 1BEUA 1SSDA 4PL1A 2BLEA 1KV8A 2GQ9A 5LGZA 5F2IA 3THAA 2E6FA 3W1MA 1WQ5A 1DQXA 1SO3A 5FEWA 3CPRA 3S1UA 1UB3A 4AHOA 3UZ5A 1B57A 4TO8A 2QR6A 1KLZA 1H60A 3N2MA 4JTTA 4IMCA 3F4WA 1BTMA 1F2JA 4O18A 2PCQA 3NQAA 4H6KA 1K3UA 2R91A 5AC6A 2AAMA 4GWEA 1DV7A 4QISA 1X8FA 4LVBA 4P2VA 4ADUA 3PM6A 5T26A 2CZFA 2XN1A 1X1ZA 2B4GA 1L2UA 2ZZ6A 4MOZA 5FEZA 2GVLA 5HUPA 3C4UA 4FNRA 1KA9F 3SGUA 1KW1A 5E1QA 7TIMA 3B0UX 2WO5A 1GZGA 1VCFA 2J88A 4RK8A 5IBXC 5AOUA 4UMAA 1SZEA 2X2GA 3SSJA 2H8ZA 1P1XA 1QR7A 3UNDA 1PS9A 1Q6LA 1J4EA 4WY0F 3RNDA 2C6QA 3GLCA 3LXCA 4J9JA 2JKAA 3TE9A 2DU2A 1HO1A 3MW7A 5BMXA 4XZ9A 4UR7A 1GT8A 4KFPA 1YDVA 2QCGA 3PG9A 3G1VA 4E2DA 4IUOA 2D73A 4X3ZA 2FPVA 4PFMA 3V75A 3ZWSA 1MEWA 2YSWA 4A3UA 3O15A 4X2RA 1RVGA 1AL7A 3QM3A 3C8FA 1TPUA 4R34A 5HNRA 1ZNNA 1B4EA 4GBUA 3ABRA 3W7PA 3TW6A 3MI3A 1LYXA 1SQ7A 2QCEA 3CQ0A 2FJKA 4BWLC 1QFEA 3LHWA 5EPDA 1F6PA 1H62A 3LRKA 3W71A 5LZLA 4DO5A 3IIZA 4FXRA 5C5YA 5KSWA 5CPMA 1TRDA 1TJPA 3IIPA 2X1SA 4I7VA 4XBSA 3TSBA 1GVRA 1MXSA 3HGOA 4NU7A 3W83A 1B4KA 2QUVA 4HNNA 1SFLA 4CLMA 3LX9A 1VLWA 3W7EA 2WSYA 3W23A 2QUUA 1VZWA 1Q6OA 2G97A 5FESA 1OF8A 3TU9A 4UTKA 2NX9A 3IVUA 4UTWA 4O4WA 5I3GA 3RMJA 1TQXA 1G7VA 1OFOA 3TUUA 3KOFA 3A23A 3WJXA 3MI6A 3QZEA 1FWTA 4FEZA 5I3JA 1SW3A 3W7GA 4O1CA 5HWMA 5FF7A 3A21A 4YLWA 5HWNA 2FB3A 3A5VA 1UASA 2Y88A 3OVPA 3W1RA 5EL1A 3N73A 4CNOA 1O4UA 3TXZA 5F2MA 2WV8A 3I7QA 4NX5A 3HG4A 1SSGA 1L6WA 1W1ZA 3W7RA 1LP6A 1H63A 1QPRA 2NX3A 1PIIA 3R5EA 1VLIA 1Z44A 3GIYA 1H7NA 2CLEA 2HSAA 1AL8A 2C1HA 1W5OA 4O0KA 3MUXA 4POCA 2OCZA 3W2KA 1EEPA 1P0NA 5DY2A 1KLYA 4HT3A 4N9CA 4A2RA 3DFPA 3GAYA 3NQFA 2BX7A 1Z48A 3RLVA 4Y8FA 2PC4A 3IIVA 4LVFA 2EAWA 4RXFA 1EWEA 3K30A 3GK0A 1RR2A 4R53A 3LCXA 1HO4A 1XM3A 4CNPA 4LC6A 3W74A 4TMCA 3FJ6A 3MP5A 4WUIA 5LNUA 2A1YA 5G4EA 3E02A 4WD0A 1XI3A 5BRBA 5D03A 1LRTA 2GQ8A 1XBYA 4RZ6A 5D38A 4UFHA 1KM4A 2ZZ5A 3W7OA 3NQ7A 4ZQMA 3DH7A 4JN6A 3SZ8A 5D02A 1MZHA 5G2WA 3GKAA 1A5CA 3PBYA 1YXYA 4JYEA 3IGUA 1TREA 3T40A 2ZZ1A 1YXDA 3BLEA 3GNDA 4MKNA 4HKPA 2LLEA 4I7WA 1F7BA 3B06A 3STEA 3LCHA 4UMCA 5AHFA 4N6FA 1I2RA 4K36A 2CWNA 3G0XA 2E6AA 2GJNA 2E68A 5BW6A 2H6RA 3U8GA 8TIMA 5AC7A 5K9CA 3F4NA 1K8YA 1EP2A 5G4WA 2DZSA 3T44A 4Y9AA 1W8SA 5AHIA 4UTUA 5I3KA 1W3TA 2V2CA 1WXJA 3M44A 3LTPA 5G5IA 4AWTA 1OK4A 1FWSA 2YZRA 3W6YA 3HGSA 3OVQA 3W1XA 1VQTA 5DLCA 3EB2A 4FHAA 3MYOA 4AMAA 4PCFA 1BWLA 1I4NA 3LHVA 3RK8A 1EX5A 3DFOA 2C19A 3N19B 4MUZA 3IEBA 4OWGA 4RJEA 2FPYA 4UUIA 4U4MA 1OFEA 3HPSA 3TSDA 3Q37A 2ZRYA 3GXTA 4NVTA 1R30A 1FCUA 3I6RA 4Y96A 1T8XA 2X16A 1O60A 4Z1CA 1W5NA 3MBDA 4M19A 2Y61A 4A2SA 3S42A 3G0SA 5D2VA 3TMLA 4AB4A 3PS7A 3LXBA 4TU1A 4CQ9A 5KZMA 1QO5A 3H53A 3S9YA 5C6MA 3EWYA 3W70A 4PH6A 2ZZ3A 4IOTA 5FEPA 2WSRA 4UNKA 5A8GA 1OABA 2E6DA 3LHTA 1DVJA 3LTYA 4Z1DA 3L0KA 4MFDA 1LBMA 3IGSA 3E96A 3NL6A 3B05A 4QQ3A 2V30A 1KBJA 1GPWA 1AW5A 3VCRA 3HOJA 2CLFA 4WXZA 3G1AA 3S8HA 4PA8A 3W7CA 1YDNA 3HB9A 1VCVA 3S6DA 2DZWA 1ZAIA 5K7JA 2V82A 1DJQA 2WNQA 1JCNA 2QCCA 3ELFA 3G1DA 4LY8A 4XUGA 5D2YA 3VE9A 3NQMA 2HS6A 4JTEA 3HPZA 2EGZA 1EA0A 1OFAA 1IXPA 1SR9A 4EF8A 4GE8A 4E38A 3NDOA 4O17A 2C18A 2Y7EA 4PODA 3NPXA 2FDSA 3P62A 3EXTA 3QPYA 4ICNA 2A6NA 4IMFA 2Q8LA 5D2TA 1HTIA 4Q4KA 4I7UA 4YCPA 1V5XA 5BOOA 4Z0SA 3NPUA 5LHEA 4YL2A 4GRSA 1YXCA 4JTHA 4MYAA 5BMWA 3WJSA 4Z0JA 3OIXA 4LOCA 4GNJA 3BGJA 2CZDA 3WK3A 1WA3A 2ALDA 4WOZA 1GYLA 1W5PA 3QC3A 4AEOA 1UCWA 3BARA 4MY9A 1TV7A 5CPOA 1NF0A 1SO5A 1P0KA 1I2OA 5L9FA 5HWJA 3TJXA 2P0OA 3SIZA 3MWAA 2WOQA 4FNSA 2W79A 1WOBA 1OG0A 2Q3RA 3L21A 1OFPA 4NNCA 3NQCA 2VOMA 3O8AA 5U4NA 1LOSA 1VYSX 3G8EA 3LERA 4NZFA 3RLUA 1OK6A 4A29A 1LRNA 2QJHA 1PCKA 1ME9A 4XTDA 2VEMA 4EF9A 4DBEA 1H61A 3UPBA 3W7HA 2Y89A 3FLUA 1VR6A 4WJEA 1OFQA 4YWIA 1QWGA 2GUUA 3T55A 2DJXA 3N3MA 4MLJA 1J5TA 4QNEA 4FX8A 2YW4A 4MPQA 3C2OA 3EWXA 4MYXA 1ADOA 4FIQA 3B0VC 3UWQA 1TSIA 3W2NA 4OHQA 2Z0IA 2Q3OA 4O15A 4OBTA 3MP4A 3INPA 4ADSA 1SO6A 2H90A 1IXOA 1WOAA 3JR2A 4PC8A 1B3OA 5EKYA 1IXQA 3MHUA 1S5WA 3BO9A 3VNDA 1KTCA 1KM3A 1A5SA 1VRDA 2R14A 2WSQA 2X1TA 4DO4A 3C0JA 2Y62A 4N6EA 3CIXA 4JDYA 5F4SA 4K39A 2ZRVA 3W7IA 1F76A 1TPEA 1WV2A 1U83A 1N7KA 3KVMA 1F5ZA 1PV8A 1PCWA 3BPWA 4ZQRA 5J5DA 1ONRA 1FXPA 1ZAJA 3W2UA 1OJXA 2ZTJA 1DKWA 2NX1A 3G3DA 2WNNA 3W87A 4JTFA 3L65A 1N8FA 3DU0A 3CEPA 4NJGA 2EPHA 3HQ1A 5DCBA 4ZVJA 2OJPA 1XC4A 1M7PA 3P61A 1KFEA 4Y6GA 1OVDA 3G18A 5DN1A 3ANYA 1GG0A 1SZFA 4WY0B 1KTBA 4O57A 5CZTA 2V0TA 1VH7A 2PRMA 3F1QA 4XTIA 1AW1A 3TXVA 5A5WA 4WQ6A 3C3NA 4MY8A 4EOUA 2W0UA 2ABAA 5FF4A 1K7FA 1ZY9A 2NWRA 1NVMA 3BW2A 4MLRA 1DJNA 3GYEA 3O63A 1F73A 3OEXA 3TK7A 3CU2A 4AAJA 4ZQCA 1SW7A 5AHEA 3W1AA 4JS3A 1OF6A 2A7NA 2NXGA 3NQGA 2CLHA 4MY1A 2WPBA 1VS1A 3UWUA 3M41A 4HHPA 3W1NA 3PC0A 4WXYA 5K2ZA 2J24A 3LCGA 3NL3A 5CSRA 1TTJA 4QAIA 1K8ZA 2JBMA 5HUOA 1SW0A 3PR2A 5K9DA 3TNOA 1LBFA 3NL5A 3HGJA 1OYAA 1LZOA 4O54A 4Z1AA 4IX0A 1TO3A 3DXIA 3TQKA 3GR8A 4HPXA 4IWWA 4GUGA 2QCLA 3M47A 1FDZA 4HSOA 1SPQA 4GJ1A 1D9EA 1VJIA 3DFQA 4LV4A 5KZDA 4K8HA 3PBWA 3P74A 4H3DA 3L67A 1CW2A 3NQDA 3BVJA 3TR2A 1YPIA 4O13A 1H7RA 3W1TA 4M5PA 1KTNA 5KINA 4RLIA 2A7PA 4O52A 3UPWA 1K7XA 2A6LA 3KX6A 2OZ0A 1Z42A 3M0ZA 3C56A 2UV8G 2JGQA 4IPIA 3JS3A 1QCWA 3C2FA 5IBXA 3TH6A 3FIGA 3HO8A 1KBIA 3IIXA 1RZMA 2R94A 3O6DA 2O7SA 4DF2A 2VKZG 1GYNA 2NV2A 4O1DA 5LNRA 4UTIA 3I68A 4JICA 1VGAA 1UJPA 3N9RA 1D3HA 3DFNA 3V1PA 4XKYB 5I3FA 3STGA 3L0NA 3U6WA 3L0GA 3F03K 1ZFJA 4ML9A 2GVGA 2E5DA 4C1KA 3HG5A 2YW3A 1H50A 2C3ZA 3P8JA 4O0ZA 2ZRZA 4K37A 4MIMA 1EPXA 2ZA3A 3Q58A 2CZEA 4CCCA 1I2QA 1BWKA 3P80A 3BW3A 2ZBTA 3KVJA 1HG3A 4R33A 4LVDA 3T4CA 3W84A 4ORIA 2GQAA 3S5ZA 1OYBA 5DBTA 4M6VA 5F4WA 1WBHA 1B9BA 3GB6A 4P61A 1LBLA 1G67A 4DF1A 2ATMA 3QW3A 4EIVA 3O16A 3SR7A 2NV1A 2HMCA 2Z2UA 3GDLA 1DBTA 3CLMA 3EWUA 3CM4A 3P7YA 3W1LA 4IXXA 3G1HA 3FKKA 3KFTA 4GUIA 1JCLA 4JTUA 5AHLA 3TAOA 2WJZA 3UXDA 1NEYA 3EX6A 2G96A 2YGYA 3W75A 5K3VA 3S0CA 2QDGA 3ATZA 3EX3A 2C0AA 2OT0A 3H54A 1WAUA 3PBVA 3VE7A 1W56A 3ZS4A 1Q6QA 1TRIA 4O4VA 3FYOA 1O95A 4HN4A 3R13A 1TIMA 5C55A 1WX0A 2A0NA 5D09A 4JYDA 4K8EA 4LNYA 2VEIA 3GKFA 5D2XA 4AHQA 3BK0A 3PBUA 4ADTA 1GQNA 3BG3A 1GTEA 4OQVA 4GUFA 4NXSA 3OG3A 1G7UA 3MP3A 4O28A 4A22A 5DCDA 3P5YA 2ABBA 3Q2DA 3VFLA 3TC7A 2BXVA 6TIMA 1K02A 1JULA 4IQLA 1KFBA 3CIWA 4LW7A 4ORMA 4KWVA 4JY8A 5AYZA 1TPC1 2BTMA 4LT9A 1QAPA 3LXAA 3A5FA 2DP3A 3EX1A 3KVLA 3W76A 2V8ZA 3PB2A 4O53A 1GJPA 2QKFA 2ZRWA 4E2BA 4GC4A 3DHFA 4KFOA 2RFGA 3GXPA 3PY2A 3W7QA 1FDYA 1FCBA 3PF3A 1L6YA 1K8XA 2QEZA 4FX6M 3WFAA 3NOEA 2Y63A 4OU1A 3G0UA 1CX9A 3NZ1A 3BLFA 2NUWA 1FCQA 2W6RA 4MFEA 1LDCA 5DCEA 5MHBA 3QEZA 5EBUA 3G3MA 3W88A 1TPDA 3TQVA 1JJKA 1OX5A 1YTDA 3C6CA 3TROA 4LUJA 1DORA 1AW2A 3W86A 3KRUA 1IF2A 3CT7A 2ZTKA 4IMDA 2ZZ4A 4HNUA 3LV5A 3W2LA 2CZ5A 3G22A 3GVGA 4K7YA 3W07A 2B0MA 1IIGA 5LGXA 1ZCOA 4OV4A 1A5AA 1FWWA 5AFDA 1W37A 3FKRA 3QW4B 1DQWA 1I8JA 1YADA 3HG3A 1WDWA 2DZUA 1EUNA 3HPXA 1ZJIA 4AXKA 3L5LA 2GJLA 3IVTA 1I45A 4E0CA 5TQLA 4CNNA 4UTMA 4DELA 1H1ZA 1EP1A 1JCMP 1W3IA 5SWUA 4UTWC 3NL2A 4MJZA 3LCWA 2BZNA 2NLIA 2Z1BA 1KFLA 1VHCA 1X7FA 3GDTA 1LRQA 3HMJG 2XN0A 3CEUA 1JUKA 2EKCA 3L2IA 1NSJA 3B0PA 1H7PA 2ZZ7A 4NQ1A 3C61A 3HBLA 5TBOA 3QMTA 1LOQA 2DZPA 2FB2A 2FLIA 3FEMA 4LS1A 3QRHA 4IMEA 4BR1A 1TMHA 2TPSA 3KAOA 4H4IA 2FTPA 3FFSA 3MO7A 4A21A 5AHNA 2PRLA 2FFCA 3EWBX 3SGZA 5D30A 3LDVA 1Q3NA 3P8IA 5CZJA 1G4EA 3C2VA 1XUZA 3RF9A 3PUDA 3D0CA 3NPWA 1TYGA 3E12A 1OFRA 3B8DA 3I7SA 5H91A 3KXQA 4N9EA 1THFD 1PHQA 1Q45A 4FXSA 1VHNA 5HR6A 3O05A 1UUMA 3LB0A 3BG5A 2QF7A 2GOUA 3DAQA 5CPNA 2E6YA 4K38A 4RZ5A 3TV8A 2ZZ2A 5D04C 4TMBA 3LV6A 3L66A 5DY3A 2QCDB 3O1NA 4TIMA 4DPQA 1GOXA 2B7NA 3LM7A 4GXMA 3DENA 4NZJA 3PG8A 3LLFA 3LHYA 1QO2A 1H7WA 3DFSA 4DBDA 2J9XA 1KFJA 3W1UA 1MSSA 4WOQA 1FUYA 3HJZA 3MMTA 4CCDA 1DHPA 3PUEA 3W7MA 1VYRA 2DJLA 2I1OA 5LSMA 2TRSA 4B5NA 2WNZA 2VXNA 3NZRA 1LTDA 1SFJA 2VFHA 2A4AA 4ONVA 2RDUA 5E93A 2DZVA 1H7XA 4M7SA 1C9DA 1X6UA 4NJKA 3GNNA 4Z08A 1ZALA 2ISVA 4CQAA 3N34A 5AN7A 3G8RA 3WJWA 5G1TA 3MJYA 3W7DA 3W1QA 4UMBA 4AHPA 4DF0A 3DZ1A 1V7YA 4UR8A 1ML1A 3LRLA 3KHJA 2J6XA 4X9SA 3GZ3A 1W3NA 5F2LA 3BV4A 2E5CA 1FXQA 3EXSA 1ME8A 2RH9A 4LV9A 3NAVA 3NGJA 1AK5A 4IJBA 2B7PA 2JGYA 5CZSA 1LLWA 2KZHA 4XQ6A 1GVSA 2ZRXA 4MZ8A 3USBA 1L6SA 1G4SA 1FBAA 1U5JA 1EIXA 1G69A 3DHDA 5KTLA 1G6CA 3DKJA 3ABSA 4UIOA 2VEKA 2DZXA 5LHFA 5D2WA 4RX0A 5CG7A 5LNWA 2H8XA 1KFCA 2CU0A 3MYPA 1MO0A 4HNVA 4O1BA 1XFBA 2ZFAA 4FF7A 4UC5A 3P67A 1TQJA 1R2SA 1EUAA 3E9AA 3NR0A 3W73A 5C2XA 4BI7A 4ZQNA 2NZLA 1RD5A 3CB8A 2AQWA 5HULA 1OFDA 4LS0A 3NQVA 3IGXA 4X22A 4ZL1A 1FY6A 3CC1A 4BK9A 1TPB1 3LCLA 3UWWA 4PL2A 3L9CA 4NJHA 4UCGA 3SY5A 4OE7A 4UTJA 2VFEA 3R2GA 1GEQA 2JKPA 4NJJA 3WJZA 1S5VA 2QJGA 3LOTA 3W2MA 1LLZA 3CWOX 2A2IA 5TIMA 1M7OA 1CI1A 1JVNA 1FDJA 2ISWA 3TIMA 3ABOA 4WY0A 2FQIA 3EXRA 2V2HA 3LBMA 4YMZA 2VFGA 1R2RA 4BI6A 1RPXA 4JX5A 3UY7A 1RQEA 4QNWA 4M6QA 1C29A 1NFBA 5K4ZA 1IXNA 1WBJA 2HS8A 1AMKA 4LRSA 1KM5A 2RDTA 2YX0A 3UXAA 4JGDA 3VI2A 2QDHA 4RV8A 4D2JA 3UWZA 3PULA 4EWND 2Y7DA 1JRBA 4NUWA 4UFMA 3QFEA 3EX4A 1W5QA 2CLKA 5KITA 1R47A 5KMYA 3W7LA 4IMGA 3TAKA 3G24A 2J9ZA 3SW6A 1ICSA 1OX4A 1SUXA 3GX9A 4CQ8A 1KM0A 4JEQA 2VEPA 5E0KA 4NXKA 4UFIA 5F1VA 3DFTA 3ZWTA 1PVNA 1FQ0A 3L68A 3M43A 4FX7A 2P1FA 2RHGA 4G1KA 3S5NA 3W1PA 3L5MA 3OVRA 5EA9A 3R12A 4RR4A 1M6JA 1X1OA 1ME7A 1S3HA 1IGSA 2B7QA 5U7SA 4MZ1A 2OMAA 2HTMA 3MHGA 3ABQA 3N14A 3QMRA 1JQVA 1YPFA 3W7JA 1DL3A 3H55A 2ZRUA 3QQ1A 2TMDA 1VYPX 3LBCA 1YYAA 2OX1A 1F05A 3ATYA 3W72A 2F7FA 1T96A 4FIRA 1RQBA 5CSSA 4FNPA 4UXDA 1SZGA 4N4PA 4JTLA 2G95A 5LNVA 2YYUA 1TB3A 2ZA2A 3NQ8A 4QITA 3PSVA 3FS2A 2Y7GA 3P82A 3SECA 2VENA 4RCXA 2YYTA 1BKSA 4RKAA 2QCNA 3LCFA 4L4LA 1QPNA 4XKYA 3CHVA 1EP3A 5K4XA 3PAJA 3M9YA 4GFSA 5GVJA 1TPFA 2YPIA 1HL2A 5AHMA 1KV5A 1SU5A 3NYZA 1TCDA 4JIPA 4FNTA 3YPIA 5G1YA 3MI2A 3N9SA 4K7VA 4HNTA 3NG3A 3O07A 4FNUA 4CCEA 4U28A 3NM3A 3NQEA 1G4TA 3S1WA 1LORA 4GUHA 1YTKA 3LCIA 3QSTA 4OV9A 4MZYA 2ZDRA 3KVKA 3SJ3A 1TTPA 1TTIA 2V9DA 3NQ2A 5LKYA 3S5OA 4KWWA 1H5YA 1OX4B 4KFNA 5I3IA 4ZQPA 5FF3A 5AYYA 1PHWA 2GPTA 4XWUA 1FX6A 3A22A 4UFLA 4Z1BA 3B03A 1PE1A 1O5XA 1JR1A 4AF0A 5KZEA 3GXNA 4JX4A 2H3DA 1E51A 3W2JA 1XXXA 2XFWA 4O8RA 4JTKA 5HINA 1C8VA 1ICPA 5AC8A 2C13A 3UWVA 4FO4A 3LHUA 5D32A 3LRMA 4QJ1A 2PRHA 3C52A 4HPJA 4Q33A 4JTSA 4MJMA 2PURA 1JCJA 5D33A 3A9IA 3TMQA 1XBVA 4KKXA 3MBFA 4L4MA 1OX6A 2CW6A 1S5TA 4UNLA 2VFDA 5LNSA 4JX6A 5HR7A 3ZR4A 4TX9A 5D05A 1TTQA 1XL9A 4O14A 1TPH1 4BWLA 2X30A 1A50A 4FNQA 1K03A 2Y7FA 5H2ZA 2QAFA 1TV5A 2FIQA 3AJXA 1NF7A 3NXFA 3OHIA 2E77A 3T78A 3TQ0A 2C15A 4OGZA 1R2TA 1YLVA 4YXGA 5DBUA 1FWRA 1L9WA 4DPPA 4UTLA 3M7WA 3KRSA 4JDBA 3TFCA 1F74A 4JD4A 4HIBA 5CKSA 1HUVA 2Z6IA 2YFOA 5EMUA 5CPLA 1AG1O 3M5YA 2AGKA 2E5BA 2V5BA 1XUUA 1TPWA 1KM1A 5J5RA 2CLMA 2YFNA 4HSNA 3S1XA 4DEFA 4S2CA 4LS2A 3IIOA 1QOQA 5G2IA 1QDSA 3FYPA 3NVTA 1KM6A 4LTSA 4ZZ9A 3FOKA 3W7KA 3RFAA 3UQNA 3VKJA 3PSWA 1GTHA 2X1RA 3GDKA 3IVSA 4IPJA 2NWSA 1O5KA 1H51A 2QCHA 2VC6A 4O50A 1G4PA 1YDOA 4AWSA 5G2HA 2EF9A 2X1UA 3SFKA 4JR5A 1WYIA 1EB3A 3IRDA 4JXCA 4M7TA 2TSYA 2ATSA 1QOPA 5F4XA 3QH2A 4UTTC 2P10A 4BI5A 3THQA 1ZENA 3KRZA 4DO6A 4M6PA 4RXGA 3LHZA 1J2WA 2JK2A 3EWWA 1GG1A 3G1YA 4ALDA 5EY5A 1HFBA 3TFXA 1QPOA 4IGHA 4NNBA 1P5BA 4LVAA 1XBZA 4RZ4A 1LROA 2QCMA 2RDWA 3R8RA 2Y6ZA 3LI0A 3TW7A 4C1LA 3WJYA 3QQ0A 3UYCA 3NPVA 2JKEA 3W22A 2OT1A 2C16A 4N9BA 1JQXA 3DKLA 3G1FA 1XCFA 4R7JA 3BLIA 3P5ZA 5FF0A 2J27A 2VFIA 1W54A 5FF2A 1TPVA 5HJLA 3M16A 1GVOA 1TJRA 2CLLA 4NJIA 3S1VA 2QJIA 2YDAA 3P84A 1W5MA 2G5WA 2H3BA 3LLDA 3B04A 1JCXA 1OYCA 3E49A 4O11A 2PE4A 3GDMA 2I9EA 3W7NA 3I65A 4WX2A 4EVZA 4ZMGA 4N2YA 3O6YX 1Q6RA 3PUOA 3QMSA 3DI0A 4WZHA 1XKYA 1VC4A 4LU0A 3UWYA 1YTEA 3OA3A 1N55A 5C54A 1ALDA
chains in the Genus database with same CATH superfamily
1GGOA 4CUCA 1UZHA 3WQFA 1OD0A 3URBA 3B40A 3NTYA 3L23A 1Q6GA 5IM51 4NT0A 3ZJ7A 2EHHA 2YA1A 4HYRA 5LIKX 1NAL1 3NO5A 4AZGA 1ICQA 1SJCA 2AKMA 2J9YA 3AMKA 3C5QA 4UTTA 3CPGA 1GWJA 1F61A 1IE7C 3EWZA 3OU8A 5L6UA 2R9RA 3GC4A 2CFFA 1TZZA 4HZMA 4GJJA 3W26A 4DZHA 4YCOA 3G1XA 1PKLA 3FJLA 1V3IA 1FWAC 2UZ9A 4JNMA 5H8PA 4LRTA 4CKQA 4TVCA 3B8IA 2BSLA 1E1CA 4DLMA 3TSMA 1LF1A 5I2UA 3ISIX 3HGRA 2YCEA 2R8WA 4K3ZA 3SN4A 3M5ZA 1E73M 4BF7A 4MSSA 2B31A 2VR5A 3K2GA 4TR9A 3QPZA 5CCZA 5AC4A 5FEXA 2TYSA 4MWAA 2NUXA 1V6YA 1PIFA 3N2XA 3QGAC 1XLDA 4US5D 2PP1A 2V3EA 3EKLA 2PI6A 1DP0A 2IQTA 3GR7A 2Z25A 4QRNA 7PTDA 1KFKA 3C2EA 1VBGA 4RNJA 2Z1VA 3EOSA 4O19A 1E55A 1KRCC 2ACUA 3TTOA 4PUWA 3KBWA 4H04A 3TYZA 3BG9A 1KWGA 8RUCA 4X2PA 3VKBA 4ZB5A 1LL7A 1V6VA 3L4VA 4WCJA 3CXOA 4IX2A 2G3JA 3D5HA 3NSNA 1H7OA 1UP3A 4C90A 4G2DA 3VVGA 1B54A 2ESCA 3M6YA 3VDBA 2YXGA 4QGCA 2FVKA 1K1DA 1PL9A 1GNXA 2PTWA 4QM1A 4LWWA 2NXHA 1QWKA 2WJEA 3AISA 1QNVA 1W1TA 1A5BA 4JTGA 1A0EA 5F1UA 3UGRA 3SCUA 5FJJA 3QJAA 4KF1A 4HVXA 2Z1WA 2ZX8A 3QYQA 3LNMA 4FZIA 5CGMA 2ZCGA 2DZTA 5E9AA 4GVHA 2X2YA 8CGTA 3EEGA 3SBFA 2I7GA 3MTWA 3UA4A 2I57A 3SI9A 4IISA 4JTJA 3M1ZA 2QQ6A 1PWMA 1T99A 2ZX6A 1DJHA 2WM0A 4C6IA 2C14A 4JFSA 4MVAA 1JUBA 3MANA 1GVFA 4X61A 2YR1A 3DGRA 1D8WA 3O06A 2ZUVA 1XLGA 3VDGA 1ONEA 1NARA 3R89A 3B9AA 2XDFA 2YA2A 3SJNA 3W85A 1JCYA 1GQIA 2B7OA 2C79A 4JYFA 1UBSA 4HU4A 1TZ9A 4J3VA 3EX2A 5CGQA 2NQJA 1VCGA 4UTFA 4QIUA 4S1FA 4AYGA 1BEUA 1PZ2A 5DMYA 3DFHA 4IUGA 1QNSA 3T0DA 2E6FA 3W1MA 1WQ5A 4EAMA 1DQXA 5AZ0A 4HOXA 3S1UA 1UB3A 1LT7A 2QR6A 2HE8A 2OOGA 4W7WA 3URAA 3UR8A 3VM7A 3T09A 3ARVA 4O18A 3H2NA 3MDWA 1VAHA 2HQAA 1IGWA 1P7TB 1E1EA 2PDLA 3W29A 4DJEA 4XVEA 2CKSA 2PU1A 3PM6A 2CZFA 2WK2A 1W8GA 1VB9A 3C3UA 1QATA 1RCQA 1WDRA 2ZXBA 3F2BA 5HUPA 4FNRA 1KA9F 1XX1A 4V15A 5E1QA 2WO5A 6CGTA 1VCFA 1JDEA 2DSKA 2KX9A 3H24A 1AQFA 5AOUA 3QKEA 2XIOA 1HVQA 2ZICA 3E3HA 1QR7A 3UNDA 1FP8A 4WY0F 4OUIA 4UQCA 2V6AA 3RCMA 3MW7A 3RCNA 2GOKA 3GIPA 4M6UA 3OVGA 1YDVA 3IACA 3PZNA 3WH5A 4XUYA 4E2DA 2D73A 3UXLA 4PFMA 5DT7A 5I7GA 4HZ7A 4A3UA 3WQEA 1XGDA 3AALA 1AL7A 3CZEA 1EC9A 4R34A 5HNRA 1ZNNA 5JXQA 3ABRA 3W7PA 1PDZA 2A3LA 3MI3A 5C2GA 2GJXB 1QHZA 1ITCA 2FJKA 1O1ZA 3UPMA 1QFEA 3GG1A 1F6PA 4DO5A 2AQVA 5C5YA 5CLWA 5I09A 1GONA 3HGOA 2XH4A 1SFLA 3LX9A 1KQYA 4LBSA 3CL7A 2OZ3A 2QUUA 1VZWA 1Q6OA 5CPSA 1OF8A 3AROA 3HQNA 4ZFCA 3RMJA 1S38A 1TQXA 3QC0A 3QV9A 1FWTA 1UA3A 4IIGA 4FEZA 4YYFA 5HJYA 3T6CA 1BG9A 4YLWA 4AD5A 2G37A 2ZUSA 1X97A 5CJ5A 3QGVA 3CGTA 3OVPA 5E9XA 1GZ1A 3ZT7A 5T9BG 1JGMA 1O4UA 2HK0A 1NFPA 3HG4A 1W1ZA 2Z00A 3UCQA 1EBGA 1H63A 3R5EA 1AODA 2BVWA 4CQDA 1VLIA 1Z44A 4TQTA 5ENLA 2CLEA 4DVOA 2QJJA 2C1HA 3SN0A 1XLMA 1P0NA 4TV5A 5DY2A 1TV4A 4DJFC 1KLYA 2J4GA 8XIAA 4HT3A 4A2RA 3NQFA 3RLVA 4Y8FA 4S3BA 3R8HA 1UKSA 1Z6KA 2PWGA 2BB0A 2IPFA 1UW9A 3LCXA 2DSUA 4UQDA 4GACA 1HO4A 1P6CA 4CNPA 4MG4A 4M1BA 4WUIA 4GGHA 3FGCA 3M7SA 4WD0A 1XI3A 3MMDA 4I9TA 4RZ6A 3WG6A 4UFHA 4XAPA 1KM4A 4A8LA 3PWIA 3U5UA 4JN6A 1FA2A 2CESA 4GYFA 1WKFA 1EC8A 3PBYA 1M41A 1V6XA 3T40A 3RX3A 3BLEA 4GH3A 5A6MA 2AKZA 1FH8A 4HKPA 5EFDA 2LLEA 4NAEB 1F7BA 5CLTA 1E4NA 2CWNA 2Z4GA 4GQQA 5CZKA 5BW6A 3AQUA 4L64A 4J3XA 2D2OA 1I1WA 1ODUA 4HPHA 1K8YA 5C70A 4Y2WA 3T44A 4MDOA 3E5PA 3M44A 4WDTA 4AWTA 5KETA 2EJ1A 3HGSA 3W1XA 1GOKA 3EB2A 4FHAA 4OOZA 3TYUA 1A3WA 3URQA 3EWDA 5AVHA 2BNJA 2D0FA 1HP4A 5GNXA 1W3JA 1BG4A 3N19B 3BLPX 3IEBA 2YCLB 3GHSA 4RJEA 2FPYA 1QNQA 1OFEA 1XP3A 5FA5A 1AH0A 2ZWZA 3MT1A 4NVTA 4IF2A 1UA7A 2EBNA 1FCUA 2F61A 2O9OA 4G6CA 4BQ4A 4IQDA 4MM1A 2QNEA 4GZEA 2GDVA 1IZCA 4D6GA 4AB4A 1P0BA 5CAHA 1Y5WA 5A1AA 3LXBA 4PSPA 4TU1A 5KZMA 1QI4A 3EWYA 3MSDA 3M0XA 4IOTA 4S38A 1EGMA 4L1XA 3CH0A 4A3YA 2PUZA 3LTYA 3LZ5A 4ILSA 4MFDA 3IGSA 3E96A 4KCWA 4CEXC 1XSJA 4QQ3A 1PZ1A 3AS2A 4O8AA 2P88A 1GPWA 1MFVA 3CJPA 3M0KA 3HOJA 3CTTA 4ERGA 3GO2A 4IM4A 1XIDA 3S8HA 1W9PA 3W7CA 1YDNA 4OECA 4ES4A 1U2YA 3S6DA 4GVIA 4Q8QA 3K1DA 2WNQA 3G1DA 4LXFA 2XIBA 5D2YA 3VE9A 3N29A 4C91A 3GBEA 3WQ4A 3BDKA 1IXPA 1IWAA 3C0SA 1TWSA 2FMOA 1XLHA 1WKEA 4GYKA 5D8WA 3TP4A 2WHLA 5LXXA 4I7UA 4IJRA 3POHA 2HRWA 1YXCA 5BCAA 3F4VA 1TX2A 1JFXA 3S2MA 3RPDA 4J7RA 4NKCA 4Z0JA 2J79A 3DN5A 4GNJA 3BGJA 2CZDA 4HNOA 1EYEA 1GYLA 4MADA 1QI3A 3PWGA 4WDUA 3UJ2A 2XFFA 4F9DA 3BLDA 4GHRA 4U10A 5HNTA 3CQIA 3DYPA 1TV7A 1SO5A 1I2OA 5LIUX 5HWJA 3UU0A 2P0OA 4HBKA 3QYSA 3SIZA 4FNSA 1EX1A 4R7OA 1KGUA 4EXAA 1WOBA 3ZLHA 3W0KA 2FZ9A 4DJED 4NNCA 1K9DA 2VOMA 6ENLA 5U4NA 2D23A 4G8TA 3SB0A 4P7QA 1BVZA 1PKNA 3WENA 3LERA 4NZFA 4A29A 1OK6A 1XIGA 6A3HA 1QK0A 2VEMA 1H61A 4INFA 2Y89A 2XINA 2GUUA 1V03A 1CXKA 3N3MA 3N6QA 1ZB5A 1J5TA 4DRSA 4MPQA 1UR9A 4AC7C 1GKQA 1ADOA 1QW7A 3N15A 3WLPA 1R5YA 1BWVA 3MQTA 1BXCA 1WOAA 3JR2A 3UEQA 1IWBA 1IXQA 1A5SA 1WZAA 4AIUA 4Q6JA 5FJTA 4H83A 2OYMA 3L4TA 1NQ6A 4N6EA 1OWQA 4JDYA 2IPJA 2ACRA 4K39A 2ZRVA 3PPCA 1E4MM 2YKKA 1F5ZA 1PV8A 3GE7A 1MNSA 1XSIA 2F8QA 2FHFA 4CEUC 2XIJA 4GY1A 4AMCA 1C93A 2WNNA 2NSOA 3CV6A 1N8FA 4AD0A 2EPHA 1OCBA 3A9BA 3KTCA 1H0IA 1YMYA 3G18A 3SQLA 1E1CB 3TJ4A 4WY0B 1KTBA 2OSYA 3AI0A 3B9EA 4ZGYA 2PRMA 3F1QA 3EDEA 1QNRA 3H6OA 4HMCA 2YL9A 1JCTA 3CMFA 1QHOA 2Z1SA 4MLRA 3T9PA 2PZNA 1I0DA 3OEXA 3VD7A 1ZQ5A 4H1ZA 3M0VA 4JS3A 4DJEC 4Q8MA 3H7VA 1OBAA 2CLHA 4MY1A 1HXJA 4CCZA 1CBGA 3UWUA 3M41A 4NI3A 4A05A 1UR2A 1WZLA 3CZGA 3PC0A 4WXYA 2WPGA 5K2ZA 3TN4A 3ZM8A 3N4AA 5B7YA 5CJMA 1TTJA 4QAIA 3PNZA 4LALA 5HUOA 3KE0A 1SW0A 4Z2KA 4UQBA 4L6HA 1E6QM 2ONEA 3EYPA 3AIEA 4V33A 5HPCA 1H5VA 1HKIA 1F3WA 2QJNA 3EA3A 4GUGA 1KCZA 3LPOA 1SPQA 2IKHA 4LV4A 3P74A 4JKLA 1CW2A 3BVJA 3MCMA 1H7RA 1A3HA 1VD6A 3N9KA 5KINA 1QUMA 1JDFA 4XIAA 1OQFA 3KX6A 2OZ0A 1Z42A 4IPIA 1QCWA 3FIGA 3LBOA 1KBIA 3IIXA 1RZMA 7ODCA 3AWOA 2R94A 3O6DA 2WHJA 1XLLA 4J28A 2FH8A 3W28A 4UTIA 3WD0A 4ZXOA 1D3HA 4JQAA 4ZB2A 1NU5A 4XKYB 5I3FA 3M46A 1XYLA 3L0NA 1TELA 3U6WA 2HE5A 3L0GA 3F03K 1YHTA 4XKMA 2ZIDA 1EHNA 1H50A 2PDQA 3NSMA 3P8JA 2FH6A 1R86A 3VO0A 2ZA3A 1I2QA 1BWKA 2ZUWA 3KVJA 4PMZA 4AZIA 1W2PA 3T4CA 1ZRQA 2GSHA 5CBIA 3VDAA 3CHFA 4ZFMA 3GB6A 3QW3A 2C1GA 2NV1A 3QY6A 1DBTA 1MXGA 3CQKA 2PA6A 3P7YA 4Q8OA 3G1HA 1TV3A 2DFAA 3FKKA 2PDFA 5EB8A 5AHLA 1AUSL 4RPQA 3EX6A 2YGYA 1L8PA 2RJHA 3ES8A 3VNKA 1LUCB 1MQQA 1RY8A 3EDFA 2XVPA 2C0AA 2OT0A 1WAUA 3WL1A 3ZS4A 1D2KA 1Q6QA 1TRIA 3I6EA 4JEJA 1DWAM 1O95A 1WO2A 5C55A 1WX0A 4LNYA 2QGHA 3GKFA 2PSNA 3U48A 4IZGA 3PBUA 3R8GA 4WK9A 4C6KA 4K8GA 3GTNA 3WQ5A 3LG3A 4NXSA 3OG3A 5CC5A 5I3DA 3GRIA 5A2CA 2GGEA 4DYKA 5DCDA 3GNRA 3FK4A 3TC7A 5FIPA 2XH2A 1JULA 4H9VA 1RA0A 4LW7A 3WNPA 4ORMA 1UKQA 3MCOA 3AMGA 4P7OA 1KCXA 3V5OA 3SCPA 4JKMA 4EXQA 3LXAA 2DP3A 3EX1A 4PR4A 2ZUUA 2PDHA 4GX8A 3RM9A 1GJPA 4ICCX 3GC5A 4KFOA 2RFGA 4KEZA 3PY2A 4I6VA 3W7QA 2QEZA 3WFAA 4S3EA 1XR2A 4I8DA 2OWXA 3BLFA 5HPOA 1UQYA 4HOWA 3WQDA 1FCQA 3VD3A 7TAAA 5DCEA 1LDCA 3R0DA 2OQLA 5EBUA 3WFZA 4BJHA 3TQPA 2OVLA 1YTDA 1V3MA 1ECQA 4L7ZA 4MNJA 1DORA 3SGGA 1QU4A 3S5SA 3UJRA 3CT7A 2R1NA 3IARA 3AYVA 1QASA 3GVGA 4K7YA 1E43A 3R11A 2B0MA 2ANUA 4OV4A 3PN8A 1DTNA 3FKRA 4E8CA 4GGBA 4GI8A 3EPNA 5G4HC 1B0IA 3S2JA 4ZOBA 3THUA 1ZJIA 3BWWA 2D0GA 1OZQA 4MWAE 1B3XA 3TYBA 1RP9A 4CNNA 1R3SA 1V6UA 2J78A 1W1YA 3WQVA 3TTQA 3CUFA 2NT0A 2GFTA 3LCWA 3KCOA 4X0NA 1VHCA 4C6EA 2OEKA 3CLWA 1J0YA 4CQBA 1WDQA 2XN0A 3CEUA 1QI2A 1ZP3A 3MV01 1EQPA 3L2IA 2YCJA 3LY0A 1FRBA 1NSJA 3B0PA 1UQZA 3UGVA 3TC3A 1HT6A 5TBOA 2R1LA 3LSCA 3QMTA 4W84A 2BXZA 1FH9A 3KOZA 3QRHA 4PMQA 3KAOA 1MW3A 4JTRA 4CN1A 1V51A 1KB3A 4HOZA 1Q3NA 2PDGA 7XIMA 3C2VA 3BOLA 1U33A 1TYGA 3E12A 5DRCA 1RHCA 2GVYA 4ZOAA 1NY1A 5HR6A 3H7RA 4L1GA 4XAYA 3BG5A 4LSBA 2GOUA 5CPNA 4MPKA 2E6YA 4FLOA 3RLHA 3RO8A 3FVMA 3TV8A 1Q4WA 4TMBA 2ZVRA 3VGBA 1HL9A 2XGIA 2WMIB 3J7HA 5DQPA 4Q4RA 1V6WA 4AZ5A 1IWPA 1QO2A 1ZCCA 3CV2A 4JZ5A 3NXLA 3RIKA 2XGBA 2OO0A 5JUVA 4WOQA 4JQ1A 1P6BA 2PDMA 3WDJA 4IIEA 3E0FA 2Y8KA 1W2VA 3S6TA 3W7MA 2QZRA 1VYRA 2DV0A 5LSMA 4MJ4A 1Z89A 3VZZA 1TZ7A 1SFJA 2A4AA 2RDUA 2OG9A 2VRKA 3WD3A 3ITYA 3SCSA 1H7XA 1C9DA 1X6UA 4NJKA 4LANA 4Z08A 2ISVA 2YBUA 4KBXA 5AN7A 4ZXLA 3W7DA 2O0TA 5AC5A 2EXOA 4TV6A 2GZXA 3DZ1A 4UR8A 1VPYA 1ML1A 1O66A 3KHJA 1HZYA 3KM8A 2J6XA 2E9LA 3GZ3A 1VFFA 1UOKA 1A4LA 1FXQA 7REQA 1E6RA 3HV9A 4IJBA 4IP7A 5CZSA 3XINA 2AMXA 2Y8UA 4XQ6A 3ITTA 4MZ8A 2AL2B 4GYPC 4IGNA 1G69A 3ENLA 4RX0A 5CG7A 4LUYA 3ZOAA 4W8LA 1XFBA 2PDIA 3NR0A 4BI7A 5EMKA 3E2VA 1RD5A 3AHZA 1OFDA 4JBRA 4YTSA 1W32A 4B3KA 4ZL1A 3HJEA 1TPB1 1NDWA 1C91A 4NJHA 4UCGA 3S2NA 2WVVB 2VFEA 1GEQA 1XPYA 4NJJA 3WJZA 4F2TA 4XISA 3W2MA 2C91A 1N8IA 1TCMA 5MF5A 3QY8A 1U30A 3ABOA 2QVNA 4WY0A 4LAUA 4LGXA 1F07A 3EXRA 1KBKA 1YE4A 4YMZA 3AIWA 3QLDA 4JFUA 1T8QA 2ZUNA 1NFBA 4W85A 1GJWA 3WBYA 1CECA 2DT3A 1IXNA 1AMKA 3MVTA 4PMRA 3AWNA 2YX0A 3UJSA 4IQJA 3VNMA 2ISFA 2QDHA 4RV8A 3MVIA 2VVNA 4D2JA 4GZJA 3T42A 4WGHA 4EWND 4AD4A 2C7FA 4UFMA 3EX4A 1M3UA 1W5QA 1Q5MA 3NWRA 3SY8A 1QW8A 4IMGA 3SW6A 4K2SA 3PZUA 4CQ8A 3BUVA 1KM0A 5A95A 3RUBL 3ITLA 5E0KA 2BVDA 3C8NA 4NXKA 3L4WA 3DFTA 1PVNA 2JQXA 3L68A 1EJSC 1I75A 3M43A 5FSDC 2RHGA 1BHGA 1OD8A 1O7AA 3OVRA 5EA9A 4PUMA 1M6JA 2VT0A 3I3BA 1ME7A 4MZ1A 2PZ0A 2BDQA 4PTWA 1IEWA 3WDHA 1XYZA 3BE7A 2ZRUA 1HJUA 3QQ1A 2TMDA 4AQLA 3U3HA 1TWIA 1E5NA 2JF6A 4AY8A 1H2JA 4MAVA 3T0CA 1JDDA 4JTLA 5LNVA 1MVYA 1WKDA 3PSVA 4NAEA 3PZTA 2YYTA 4JIEA 3ITVA 5I0DA 1BKSA 3IWPA 1DWIM 4XKYA 2PCEA 5GVJA 1SFSA 1VFSA 3SN1A 3NIYA 1HL2A 5AHMA 3PJTA 1HKMA 1XLAA 3KZPA 3APTA 4YTTA 1MW1A 3YPIA 3KEHA 2OKOA 4K7VA 2Z29A 3DESA 1ITQA 3O07A 2WC7A 4U28A 2GGIA 2J66A 1AA1B 3TYCA 2ODOA 1LORA 2AGTA 3QSTA 1A80A 1LLOA 3BMWA 3GR4A 1SR0A 3KVKA 4TX6A 4C6JA 3S5OA 4P7LA 2C8NA 4W93A 4EAYA 1GHRA 4B5VA 4AZ6A 3MUY1 5FF3A 1PHWA 1QPKA 2GPTA 4RV3A 2ZE3A 4Z1BA 1PE1A 4GI4A 3WMSA 1JIBA 1XXXA 2XFWA 2IKIA 4CD8A 1ICPA 1T40A 2C13A 5C9RA 3LHUA 2VRQA 3TLQA 1JNDA 1R87A 5D33A 3M0JA 3KBNA 3TMQA 3ZR6A 4GISA 3OB8A 1GVYA 3CUGA 5EGRA 5HR7A 3ZR4A 1HKKA 1CXEA 2QF8A 4LQ1A 1TPH1 1R3QA 4GPNA 4DZIA 1E5JA 3VOIA 2Y7FA 2VCBA 2FIQA 3SUTA 1Y5XA 4QG9A 2VMFA 2Y8VA 3AJXA 4ML4A 1PKYA 3KLLA 3ZIZA 5FCZA 8A3HA 3CAVA 3BGAA 4PUNA 1BAGA 1YLVA 1IT0A 4MNLA 4L6DA 3AS1A 3KDNA 4ZTXA 3QR3A 3O0KA 1XYAA 1AG1O 3AS0A 3RJXA 2V5BA 2IMRA 5J5RA 2CLMA 3DUGA 2YFNA 3WY1A 2YJQA 4J3UA 4DWSC 4ATLA 4E4FA 4GABA 3IJ9A 4LTSA 3F5JA 4ZZ9A 3W7KA 4YU1A 3PSWA 1GTHA 2ZXAA 5DO8A 1GQJA 4WF7A 3VIHA 5RUBA 1O5KA 1BYAA 1WAWA 1E4IA 3OODA 5IHRA 2XVKA 1BF6A 1EB3A 3IRDA 3RGTA 2ATSA 3QH2A 2V38A 2A3EA 1ZENA 1REQB 3ANUA 3EWCA 4E4PA 4M6PA 3B4YA 2DUXA 5BOEA 3R7MA 1HFBA 1C7SA 1QPOA 3WDPP 2DQXA 2DT2A 1DPMA 1OT2A 2QCMA 3ES7A 1N2VA 2Y6ZA 3LI0A 5J8LA 1W91A 2E67A 3FJNA 4LFYA 4LF2A 3NPVA 2OT1A 1J93A 3SUVA 3BLIA 2WW5A 1E0TA 1TPVA 1M7JA 3AUOA 1WDDA 1RY0A 1XCXA 3BLKA 5A6LA 1W5MA 2G5WA 3LLDA 3FYYA 1JCXA 1OYCA 3E49A 3PPGA 4O11A 3L4XA 2GJPA 3S1GA 1QRQA 5HXMA 1EQCA 1XKYA 4LU0A 3II1A 1S2TA 3UWYA 4I5XA 1EF2A 1V6TA 1UROA 1UKTA 3ZVIA 3KLKA 1UR8A 4DX3A 2E7FA 4P8VA 1A49A 2HBXA 3ZFHA 1RQHA 4GC3A 4KESA 1UWUA 3STCA 2A5HA 1EJUC 1OHLA 2QAPA 1P4CA 1XD0A 1JUEA 5BXPA 1UUOA 2NW0A 3PZIA 1MEIA 1ZU8A 4A3HA 1M1BA 4OT7A 1RPKA 2GUBA 5KZ6A 5A3HA 3P60A 3PBMA 3VC6A 4WDXA 1Q7QA 3SQMA 2XH7A 3Q67A 2Q8ZA 2B81A 4XO7A 3IAPA 1BTCA 1I2NA 3Q94A 3E1F1 1XDLA 1AFSA 2F6XA 4NX0A 3WF3A 1F8IA 3ZSSA 4JHZA 4Y90A 3E0WA 2FFIA 1GCYA 1R85A 1BGAA 2VELA 3CTLA 1GVQA 4LYRA 4Z2IA 4KT2A 4REQB 3MHFA 3B97A 2VD9A 4QEEA 1M5WA 3BW4A 4IFOA 2NQHA 2V5LA 4UFJA 4HK7A 1MUWA 2IW0A 1K7EA 4CNTA 3NM1A 4O12A 4CU7A 4CNSA 3EDKA 5AB3A 4EPEC 2JE8A 4HU8A 4K6AA 4GUJA 5AKQA 3V3WA 4D8AA 3H26A 2FPTA 2BGQA 1I2PA 2NXIA 3EPMA 2ZX9A 3TZNA 3GDRA 2R24A 1SZNA 4O1AA 3V5FA 4AXNA 3W9ZA 2F84A 2WKJA 4E5TA 1K70A 2W66A 1IT7A 3PUGA 1TUFA 5FJIA 4DLFA 4OFCA 2A7RA 1O94A 1RSCA 2ZQ0A 4FLSA 5M1TA 6ALDA 4N9DA 2GGGA 2UBPC 1KM2A 4LYKA 3I10A 4WKAA 4IGSA 4RNHA 4N02A 3WUBA 1OFBA 2FDMA 2XSAA 3AO0A 2Z1XA 5BXTA 3W01A 1OY0A 4H8VA 4AH7A 2J6VA 2JEPA 3N2TA 3W3OA 1XBXA 3C2RA 4DYJA 4LF1A 2PDPA 3JRKA 4DXVA 3UZJA 5DFAA 1EWDA 4P7RA 3WQPA 4LC8A 1PPIA 2BHZA 3OLGA 1RV8A 2VZUA 3AXMA 5JBDA 2G4JA 2RKXA 2F38A 1U22A 3UY8A 3AOFA 1F6KA 3ARPA 3HF3A 3SAZA 2W9MA 1UP0A 1TWWA 3M0LA 2PTYA 1BYDA 4PZVA 4DB7A 5K9XA 1L0PA 1RBLA 3VNZA 2QUNA 5BNKA 4DQWA 2Y5SA 1ZSXA 2E09A 3WUEA 1X1NA 4FOUA 5FAGA 2V2DA 2YCIX 1C8XA 5D37A 1UWRA 4AG0A 3KCJA 4IPPA 5IFPA 3QF0A 1UD3A 4IP4A 3WK0A 3TJLA 3BICA 4PL1A 3U4AA 4WVXA 2YL6A 5FJRA 2F6UA 2GQ9A 3W6MA 1S39A 2P53A 3WQ8A 3CQJA 1MZRA 3UZ5A 1B57A 2DQWA 1XGZA 3AIQA 4TO8A 4EX4A 4ZSTA 4JTTA 4HZ6A 4Q4QA 1ONWA 1F2JA 1A4MA 3IS4A 3NURA 5HQLA 2Z2AA 4H6KA 2R91A 2AAMA 4GWEA 4KWSA 3H4WA 4QR6A 1X8FA 1AMYA 4H7CA 1FWCC 5T26A 3QPEA 1X1ZA 2B4GA 4DI9A 1O12A 1L2UA 2ZUTA 2ZZ6A 3CV1A 2XVGA 2GVLA 2IPGA 2BHYA 3SGUA 1DEDA 7TIMA 2FZMA 1GZGA 3VMPA 5IBXC 1A0DA 3PZOA 3SSJA 4C6QA 5CJNA 1PS9A 4MB3A 1Q6LA 4KCUA 4J9JA 4NSBA 3H22A 3VOFA 3CUZA 3TE9A 6REQB 5HDRA 4XZ9A 3LM3A 4KRTA 4AZCB 2Z27A 3PG9A 3G1VA 4DBSA 2FPVA 1GJUA 4PMVA 3PK7A 2HPMA 3GM8A 2OGYA 4PMNA 4DZAA 2YSWA 5BWAA 2PLKA 3W82A 9CGTA 3F7JA 1RVGA 3PPHA 4I6KA 4Q4PA 4XZMX 4Y8EA 4LJ3A 4IGMA 1LYXA 3G77A 3N18A 2IXVA 1EDQA 3LHWA 5EPDA 2OB3A 3HA1A 3LRKA 3W71A 5LZLA 4XSMA 3SFWA 2OXNA 5KSWA 2YB4A 1GW1A 5CPMA 3VNIA 1PWLA 1TRDA 4I7VA 2X1SA 3TSBA 2VZOA 2XM2A 2QT3A 3OW1A 4XIMA 2QUVA 2WAGA 4M56A 2WSYA 1ZTVA 2DVUA 4W7UA 2G97A 1GOIA 1VIWA 1GORA 3U5YA 4UTWA 2VGBA 2ZXDA 4O4WA 2J8TA 1G7VA 3V7PA 1OFOA 3RPTA 5FL1A 2D2GA 3QZEA 1SW3A 3W7GA 1FFQA 4MTVA 2PC8A 3OOQA 5FF7A 5HWMA 4YTRA 1VP5A 4L80A 1JAKA 2FB3A 3IV8A 4FALA 1UASA 3RO6A 3GU9A 1RVKA 2PP0A 1CXIA 3PZ9A 2ZOXA 4CNOA 1JYXA 1PO9A 2GSJA 1LP6A 2ZE0A 1T6MA 1QK2A 3VKKA 5CC3A 4PCSA 2WBGA 4O0KA 2OCZA 4G56A 4DYEA 3LQGA 1DIKA 4PUJA 5AY7A 3R94A 3B8TA 1R8LA 1JEZA 3DFPA 1VKFA 1XFCA 2PC4A 4XZIA 3BLOA 3K30A 3GK0A 5REQA 4R53A 1XRSA 4LC6A 3W74A 3BXWA 4UQ9A 4Y9MA 2YL5A 6TAAA 1RJRA 3MP5A 1Q65A 4TTUA 3LNPA 4ATWA 2A1YA 3BAKA 3VIPA 5EMJA 1JYWA 2GQ8A 3MWCA 2CXGA 5I5RA 1JPDX 4AFYA 1JNEA 5G2WA 4L5ZA 2QW5A 4MMWA 3RPMA 1F3TA 4RE2A 4JYEA 3IGUA 4DUWA 4I9JA 3UCCA 2ZZ1A 4J5NA 3ZJ6A 3GNDA 3GIQA 3WSUA 4AIBA 2CIPA 3STEA 1W1B1 4UMCA 3SM0A 4N6FA 1I2RA 4JFVA 2GJNA 2E68A 4B15A 8TIMA 3MSYA 5K9CA 2CCRA 4U5KA 3FJ4A 3H12A 5DMLA 2DZSA 1DE6A 1W8SA 5BROA 3ANVA 1FWSA 2YZRA 3OVQA 1E0UA 5I02A 2D3NA 3BAIA 4F2BA 5M3WA 2XWDA 3DC0A 5DANA 2PFHA 1BWLA 1I4NA 3KL5A 4HN8A 1MYRA 4AIOA 1EX5A 9XIAA 3BAYA 1FWIC 4UUIA 2V68A 1E72M 3HPSA 3TSDA 2ZRYA 4QE1A 1R30A 3LQLA 3VILA 3I6RA 4Y96A 3CZLA 2XJ7A 3UWEA 2X16A 3GFXA 1Q63A 2Y61A 4YNGA 4FSAA 3WQ6A 3S42A 1DWFM 1GOQA 3AIVA 1PJ9A 4CQ9A 4P8WA 3MSGA 4W86A 1XIMA 2D1ZA 2VUYA 4QS5A 4XD3A 1K9EA 1R38A 5IDZA 4CD4A 4J2PA 1B9ZA 5TF0A 2GUYA 4LEQA 4W89A 3B05A 4B3ZA 3VCRA 1BXBA 2WBKA 3FHAA 2DZBA 3RAOA 2OTDA 1VCVA 4NRRA 1N82A 2Q01A 1ZAIA 5K7JA 1E3ZA 2PBOA 2V82A 4M3PA 1JCNA 3ELFA 3ABXA 4JTEA 2P8CA 1FH7A 2EGZA 1EA0A 4GI9A 4GE8A 4E38A 3ZLFA 3Q45A 4O17A 3F2CA 4YN5A 5CQ1A 2C18A 1VFOA 2Y7EA 4PODA 3QPYA 3AMCA 1HW6A 5D2TA 1HTIA 1K4GA 4Q4KA 1WUFA 4YL2A 4GRSA 3HQOA 4JTHA 5BMWA 3CT2A 3AHVA 1UJQA 3WJSA 1EIBA 3OIXA 2ALRA 4NZ4A 1WA3A 1ZL1A 1W5PA 1SMDA 4PCTA 1GOWA 1UCWA 1Z7AA 1HNYA 4W5UA 5M2FX 4LEFA 3G6LA 1P0KA 1EOKA 2X7WA 3BH4A 3RDKA 4Z2JA 3MWAA 1V93A 2OGJA 2WOQA 4H9ZA 3CNYA 1OG0A 4WKFA 3N2BA 3VKAA 4MWAC 3V0SA 2GK1B 3O8AA 3HV8A 3IRSA 2REQB 4R9OA 4H01A 1FHLA 2PDCA 1LJYA 4IIBA 2BOGX 3VKDA 1LQ0A 3MV11 1OFQA 4YWIA 4GYJA 3VNJA 2BOEX 1EJTC 3ZYZA 5JH2A 4S23A 1EDTA 3L2MA 3RJYA 3UXIA 3IPWA 4MYXA 3VIFA 2PLMA 3SY1A 3W2NA 1W9BM 3MP4A 2H90A 4FF5A 4PC8A 5HMFA 3ORWA 1S5WA 3FSUA 3OGRA 4IT1A 1KM3A 2X09A 2X1TA 2OYKA 4H8UA 1CGWA 4DO4A 3S9IA 3H23A 2Y62A 4AD1A 2PP3A 4QE5A 3CIXA 5HANA 5F4SA 1J0HA 3E74A 3W7IA 3IJIA 3OLEA 1WV2A 1S46A 1XRTA 4LUSB 2P3EA 1ONRA 1FXPA 1ZAJA 4DNHA 1OJXA 1FP9A 2NX1A 1UIPA 5A6TC 3AUJA 4CN6A 2OZ8A 2PEVA 3W87A 5H6HA 4RNIA 4U2YA 3V1HA 5FACA 3HFYA 1XC4A 1M7PA 3HFTA 3K4AA 2RGMA 1QJWA 1GZJA 3UXKA 4Q6XA 1IR2A 1E40A 2QMJA 4KPLA 1SZFA 4BA0A 3EOUA 5CZTA 1JI2A 1OCNA 1XH0A 3K13A 5HK4A 1VH7A 1BQGA 2W61A 1SGJA 2YL8A 3W27A 3TXVA 5A5WA 1F4AA 4WQ6A 4Q8VA 2W0UA 4NASA 4LCQA 3IAQA 5FF4A 1K7FA 2NWRA 4AYSA 1NVMA 3SADA 5I24A 3WNLA 1DJNA 3ECQA 1J12A 4F0MA 1F73A 2DIJA 3DOPA 1JAEA 3B8WA 1QI0A 1OF6A 4DN1A 2WPBA 3H2AA 2VTFA 3QV6A 1VS1A 1XS2A 3W1NA 3O9NA 3M0HA 1VBHA 3LCGA 3T81A 4Q8UA 3N1AA 4PN2A 5CSRA 3A3WA 2BMBA 2JBMA 3T8LA 5HOSA 1TR1A 1VPQA 1LBFA 2QPXA 3NL5A 3A4JA 3HGJA 3P0XA 4EACA 1XRVA 1LZOA 1RJQA 3S9ZA 1NJJA 3UBPC 3DXIA 3TQKA 3GR8A 3IGHX 2BOFX 3M47A 1FDZA 4I5UA 3FDGA 1VJIA 1WE5A 2DW6A 3DFQA 3E2RA 4K8HA 4H3DA 3L67A 1MXDA 3W1TA 1CGYA 3AXIA 1M7XA 2PGFA 1UOZA 2A6LA 3GXFA 5CPQA 3M0ZA 3CZ8A 2JGQA 1F9CA 3ARZA 3JS3A 3C2FA 3U9IA 1TV2A 3T08A 3HO8A 4ACYA 3IK2A 1X38A 2G41A 4Q3MA 3S47A 1ITXA 4L61A 2VKZG 2NV2A 5A6BD 5LNRA 4XZWA 2EPLX 1VGAA 4F9JA 4DAIA 3DFNA 3M4HA 3V1PA 3LMYA 1MFUA 1DIOA 3STGA 2AAAA 4IHCA 3STPA 1EZWA 3OQEA 3VNLA 1ZFJA 1QNOA 4ML9A 4C1KA 2C3ZA 2F2HA 4HA0A 3MUZ1 1EPXA 2VR4A 1NDZA 2CZEA 4JTQA 2WVSA 4Q8TA 2BVYA 4H6RA 4LVDA 2E25A 3MSRA 4ORIA 5J04A 3S5ZA 3WL0A 2XIQA 5F4WA 1B9BA 4MB4A 3A12A 2ATMA 3O16A 3SR7A 3GDLA 3CLMA 4CU6A 3EWUA 3W1LA 4IXXA 3KFTA 1FWFC 2R1PA 3TAOA 4JCMA 1UPPA 1NEYA 4R7WA 3THDA 1J0IA 5K3VA 4C65A 1MI3A 1JDCA 1I0BA 1FWDC 3PBVA 1W56A 4A8RA 5GQBA 3R13A 3P93A 5D09A 3ABZA 2W62A 3V35A 3ARWA 4J3TA 4J27A 4GUFA 1MRAA 5CC6A 2VO5A 1O6IA 3PPFA 5A2BA 3AIBA 3ONCA 4O28A 1J10A 4JTDA 5FJPA 3Q2DA 4A8IA 3VFLA 3GNXA 4H7ZA 6TIMA 1K02A 1W3HA 3CIWA 3BTNA 4O0QA 2YB1A 4JY8A 4Z2GA 2O4MA 1NM9A 1XHGA 1U5HA 2V8ZA 1HX0A 2QKFA 3MKCA 2ZRWA 1FWBC 3GXPA 3RM8A 1OCQA 2DVTA 3PF3A 4HK6A 4AUBA 2QPUA 3VYLA 4JTAA 3RR1A 3B8VA 3LGGA 3NOEA 4UZSA 3DX5A 3TTYA 4GLEA 3OG2A 3WBAA 1CX9A 3NZ1A 3OYXA 2CWXA 4ZO9A 4MFEA 3GTXA 2P76A 2WMIA 4HCHA 1KGXA 3W88A 1TPDA 2EPKX 3EZ4A 3TROA 4LUJA 1BF2A 3QOMA 4HA1A 1L6GA 4GD0A 1YKWA 3W86A 4L9YA 3KRUA 1JZ7A 4D6HA 2ZZ4A 4BQ3A 3W2LA 3W07A 4DY1A 1EF3A 4EPBC 1ZCOA 3AAMA 1A5AA 3TR9A 5AFDA 1W37A 3QW4B 4ATDA 1I8JA 4TVUA 3RX2A 3PAOA 4LBRA 3HG3A 3WEOA 2WLYA 2DZUA 3HPXA 4I9MA 2WMJA 3IVTA 1I45A 1UWTA 5TQLA 4UTMA 1JG9A 4Q22A 1H1ZA 1EP1A 2J7EA 1W3IA 1ADSA 5DX7A 4MJZA 4AW7A 1ENUA 2NLIA 2PDNA 4M81A 3MU7A 1KFLA 3ZLGA 3GDTA 5GNYA 1LRQA 1KFWA 1JUKA 2EKCA 2XVNA 5LIYX 3LZ3A 3C61A 1LOQA 2DZPA 2FLIA 4OBSA 4EXBA 4IMEA 3VU2A 4A6GA 4H4IA 3FFSA 3FNDA 3EMCA 3NDYA 3EWBX 3LDVA 5CZJA 5JIWA 2DEPA 2XIMA 1XUZA 3SCNA 3WDRA 1OFRA 1JFHA 3B8DA 3I7SA 4C60A 1PHQA 3Q65A 5HNNA 4F4RA 2CKRA 3O05A 1DXFA 4R5EA 1FWJC 4Q4SA 1NOUA 4HJWA 4QROA 2WKGA 4RZ5A 1YNYA 4YHEA 1GHSA 2PB1A 3N12A 3UZWA 3O0FA 3L66A 2W92A 2B7NA 3LM7A 5JBEA 4E2OA 2IPWA 3C0LA 3POCA 4NZJA 3LLFA 4MGGA 3LHYA 4PCNA 1H7WA 3DFSA 3QBUA 2J9XA 4LAZA 1XG3A 4KS0A 3ZQ9A 1FUYA 4J3SA 4B4FA 5B80A 2HROA 1KR1A 2P50A 3IJ7A 7CGTA 2VZSA 5H8MA 2DJLA 1ZLPA 2KAUC 4ERIA 2TRSA 4E4UA 4Q8NA 3URNA 2VXNA 1LTDA 2VFHA 1EJVC 2ZKMX 1YE6A 1Q2RA 1SM9A 1LWIA 4XG1A 4L1WA 4JQ2A 1ZALA 1LT8A 3VX0A 3BZJA 3T07A 3WJWA 2I17A 4YPJA 4LYQA 3R0KA 4HU3A 4WR3A 5IFTA 1NFGA 4DF0A 1V7YA 3GHRA 1C7TA 3NSXA 1V3HA 3CZJA 1NDVA 1W3NA 1AQMA 5F2LA 2QV4A 3GSMA 3BV4A 3GH7A 2X1IA 1B31A 3EXSA 4PBGA 2RH9A 4LV9A 3NAVA 1TX0A 2CNCA 4EKJA 1EO5A 1LLWA 2KZHA 3NEHA 1L6SA 5M17A 3VPLA 1XSKA 3FW6A 1U5JA 3HU7A 4BQ2A 2VUNA 2DZXA 3F4CA 3TYDA 1CENA 3UT0A 1E9IA 4B5WA 5LNWA 2H8XA 5BYWA 1B3WA 1MDRA 3QFWA 4GK8A 1AVAA 4O1BA 4FF7A 4UC5A 4WIWA 3M64A 4LUSA 5HULA 1NWSA 2WHKA 3NQVA 1O68A 2VQUA 4A3RA 1K77A 4X22A 3CC1A 4BK9A 3MDUA 3LCLA 3L9CA 3SY5A 5I23A 3DFYA 2PWVA 2OKTA 2WNWA 3R2GA 3N13A 2VEFA 2WMGA 1S5VA 1VF8A 4QJ3B 4JNZA 4HP5A 3H2EA 1QT1A 3UCDA 1CI1A 2VC7A 4XVDA 2FVMA 3VGEA 4MKSA 3SCOA 1AD4A 3WLRA 1EJRC 4H8HA 3WN6A 5E6ZA 4JX5A 3ZVHA 4JIIX 4RW3A 3TCSA 1C29A 1RALA 5K4ZA 4PBFA 4C6LA 1EH9A 4DWDA 1S3TC 1EO7A 4LRSA 3VABA 2J77A 3R6IA 3OA5A 4HMNA 3VGGA 2QDDA 2VGIA 3PULA 2Y7DA 1PX3A 4NUWA 3QFEA 1J11A 5HNUA 4DJFA 3V5CA 2J9ZA 2ACSA 3HZ3A 3AU2A 3BOFA 3L12A 3JZEA 1J01A 3WUGA 2VEPA 3UYIA 1E9LA 5FJOA 3O6AA 3VMOA 2VHLA 4A8NA 4LH8A 1DQUA 4HNCA 2OWCA 3ZWTA 2NQZA 3OGVA 4JN7A 1FQ0A 1KRMA 3HM7A 2WC4A 1PB0A 1ZUAX 3L5MA 3NVDA 1X1OA 2ZUMA 2GWGA 4NZ5A 5TNVA 1IGSA 2B7QA 3JZUA 3AMLA 1CT5A 4HMEA 2OMAA 1ZJAA 3ARXA 3ABQA 2UY4A 2GK1A 2WXDM 3WYZA 2REQA 3H55A 1VYPX 3LBCA 2OX1A 3MZ2A 3KRBA 3ATYA 1T96A 1RQBA 1E15A 3WH6A 2WMHA 2W27A 5LA2A 2G95A 2PDUA 1R3WA 2J7GA 5ABFB 4S3DA 1OG6A 2ZA2A 3NQ8A 3FS2A 3SECA 2FZBA 2V5CA 2VENA 4U31A 4O1FA 1Q66A 2UWFA 3M0IA 4TVDA 4RKAA 1JD7A 3SURA 4L4LA 1QPNA 1EP3A 3PAJA 1TPFA 1YBQA 1SU5A 3OLIA 4JIPA 2VQTA 4MNMA 1W1PA 3N9SA 1Q7MA 3N11A 4CCEA 1XISA 3KL3A 3QHOA 4TUFA 3MUIA 1JPIA 1G4TA 1OB0A 2WZTA 1CYGA 4OV9A 1IR1A 1DJWA 3PFMA 4MZYA 1XLFA 4UOQA 1TTPA 5LKYA 1M04A 4QSFA 4J4KA 1EL3A 1H5YA 1OX4B 3UR7A 3KW3A 4D6FA 1LL4A 4HPNA 2WVUA 4GKTA 4AF0A 1REQA 4JNYA 3EMZA 1JL8A 2GDQA 3GXNA 4IP5A 3H4GA 2D22A 5AC8A 2PD5A 1XPGA 4FO4A 2PRHA 3DYMA 3R10A 4HPJA 4JTSA 1KKRA 2PURA 1XBVA 3GVWA 4L4MA 2CW6A 4UNLA 4JX6A 1TA3B 1BLIA 5D05A 3WEMA 1A50A 1BPLB 4P5UA 2QAFA 2VCCA 2RAGA 1SMAA 4FS9A 1NF7A 3NXFA 4NG3A 2DW7A 3AMDA 3ICJA 4YXGA 3CL8A 3M7WA 4JDBA 4B91A 1HUVA 2YFOA 1FHDA 3GFYA 1KM1A 5I03A 4GIRA 1MMFA 4ZENA 4DEFA 3U7BA 3MKVA 5HJXA 1QDSA 3NVTA 5AECA 3VDCA 4J3WA 3FOKA 4IL2A 3V0UA 2ZC8A 3GDKA 3SQSA 4CU8A 2G8ZA 4IH3A 2NWSA 3OZOA 3UP8A 1UP2A 1YDOA 3VIJA 2X1UA 2WHMA 4W87A 4JXCA 1OIFA 2TSYA 4S3CA 2PU0A 4UTTC 2P10A 5GJNA 1YNQA 4BI5A 1Q2SA 3THQA 3GNPA 2PDKA 5HMDA 3NZQA 1E0VA 4CQCA 4RXGA 3TLLA 2WB5A 3TWBA 1DWHM 3EWWA 1XIFA 2NV9A 2WC3A 2GGHA 2VC9A 4RDVA 5JVLA 3WX7A 3ARSA 4FLRA 1TE1A 4R3UA 2VDGA 4AWEA 3HMCA 2OEMA 2DSVA 3UYCA 3KCLA 1J2BA 2JKEA 4GMEA 3G1FA 3P5ZA 1UC4A 2XZ9A 5FF0A 2E9MA 5FJUA 5HJLA 3M16A 1TJRA 1P1MA 1DXEA 3CUIA 4FP1A 3TTEA 1AQ0A 2FVLA 3S1VA 2QJIA 1WUEA 3MO4A 4TOQA 3TJIA 4E2VA 4XK2A 4RUBA 1B3VA 2ZC1A 4LUTB 4ZMGA 1VENA 3QMSA 3DI0A 3SRKA 1VC4A 4OJYA 6XIMA 4QAWA 3R1ZA 1XQKA 1EFZA 1T41A 4LB4A 3HTWA 4W4QA 4C6DA 3TKFA 3A4AA 1H11A 3M5VA 1XLBA 4IFRA 4CGTA 4UOZA 1ZHAA 3CO8A 4IJCA 4YVVA 3A47A 1P43A 3M5XA 3RITA 3LI1A 5HQEA 1TG7A 3WLQA 1T0OA 1M53A 1D3GA 1ZBCA 4IG2B 1E71M 1UKPA 2HWGA 1SJAA 3TC6A 4NY2A 2NT1A 2QUTA 2ZA1A 1J8VA 1Z41A 3SCWA 4AD3A 2QDEA 4CD5A 2J75A 3EGJA 3XIMA 2DORA 1ZBWA 4HMDA 5ABTA 3QGKC 4XBKA 1H1YA 2DPEA 2ICSA 3GTHA 4JIQA 4K1WA 4PEKA 1ZBVA 5AYXA 4JTIA 2E4TA 4US6A 4HGXA 4S2BA 2E9BA 4UQEA 3CMJA 4GQ0A 4ROQA 5C9UA 1PUDA 3N4EA 2VGFA 4F48A 4ASTA 4H7VA 3UD6A 1DOSA 5F2GA 1X6NA 2BWGA 4F66A 1HJQA 3DI1A 3K8KA 2OPJA 5LIXX 4LVGA 7REQB 1M68A 1RCXB 1SZRA 3RHGA 2MNRA 3TDFA 5C2CA 3N6HA 3B9OA 3VZYA 3CHEA 1FOBA 2QLYA 1EOMA 4DJFD 1KXTA 3PZMA 1AD1A 3UZZA 2PLJA 2GJRA 3HPFA 1UBPC 1JPHA 4AF0B 2I14A 4GX9A 3TNBA 5FKYA 1R3VA 5KEZA 1J0ZA 3FXYA 2WLZA 5ABHA 3I7RA 1GYMA 2BODX 5I3HA 4S3KA 1B5TA 2ZYFA 2EQDA 3U2OA 2DT0A 3ITXA 3OHMB 4AWUA 3T05A 5EYWA 4Q8WA 2NUYA 4WSKA 2PDYA 4HJFA 4WGXA 3NQ6A 3NEVA 3LEPA 1MEHA 2WKLA 4BF9A 1LCOA 2QCFA 4W5ZA 1ZAHA 1YPXA 3OBAA 2Y85A 2WVVA 3EKZA 3WMCA 1MNZA 5HA7A 1S2UA 3G5EA 5XIMA 1W0MA 2PBGA 3WMBA 1W31A 1V3JA 2O7QA 3B4UA 3CWNA 5CZ0A 1QPQA 3WLKX 3IV3A 3P81A 4XZBA 3W25A 5JBFA 3ZVHB 4ZE4A 2YLLA 1QMLA 1A5LC 2Q6ZA 1U5VA 1ADDA 2WMFA 3CAKA 5GJMA 1OGGA 2OO6A 1HKWA 3I6TA 2VFFA 2Q09A 5FI8A 2CLPA 1KQZA 5A8PA 3A24A 5DXXA 1FWNA 4DM2A 4I3GA 3OZMA 2BLEA 1IEQA 2PDBA 1KV8A 3THAA 3GU2A 3KL0A 3VIIA 1SO3A 5FEWA 3CPRA 1KO0A 3UJFA 4AHOA 1G0CA 1H60A 1ZBKA 1V7AA 3F4WA 1CLVA 2PCQA 2O9RA 3NQAA 4AU0A 4PEEA 1K3UA 3REQB 1DV7A 3L2LA 2PAJA 2F2KA 1CGXA 2W67A 1RK6A 4P2VA 4MB1A 4NI8A 4RE4A 2EPOA 3I4EA 3A4XA 4L9XA 3RMEA 4XB3A 3UESA 5FEZA 3C0QA 5BU6A 4YIWA 2V5KA 3C4UA 2WZHA 3B0UX 2J88A 4RK8A 4UMAA 5DMNA 2X2GA 2H8ZA 1P1XA 4AISA 3MMUA 2G3IA 2C6QA 3GLCA 2JKAA 1AJ0A 4LUTA 2DU2A 1HO1A 3TW9A 1GT8A 1EKOA 1HGYA 3U4FA 4Z2HA 3W53A 1VEMA 1YBQB 4X3ZA 4BY3A 4PTMA 1F4HA 1G01A 1B2YA 1MEWA 1J9YA 1TIWA 3O15A 4RE0A 3QM3A 3FX4A 5REQB 1TPUA 2QPSA 3VC5A 1B4EA 4GBUA 1VIZA 4MNKA 1ZGDA 3RCYA 2QCEA 1I60A 2J13A 2PTXA 2XG9A 4AVOA 2GQ3A 1PKMA 1NQKA 2BFGA 2I5GA 4UBPC 3RLGA 1H62A 3ITOA 3IIZA 4KIEA 1C3FA 1MUMA 2CHNA 4FXRA 2P5NA 3DC8A 2HZGA 1TJPA 3CL6A 3JU2A 1P0DA 3W83A 3GG7A 3JUGA 4HNNA 4CLMA 4F40A 1LWJA 2OFJA 2CYGA 3GDBA 2HDJA 3EDDA 3GD6A 2YLAA 2CBUA 5FESA 4GZIA 3TU9A 3DEQA 4UTKA 4D9PA 1HJWA 4UWMA 5I3GA 5ECVA 3D46A 3KOFA 2OQYA 4US5A 3A23A 3WJXA 5MKGB 2G3NA 2VDHA 1C9WA 4O1CA 2IQ0A 3A5VA 1GQLA 4X9YA 3QOKA 1P0EA 1Y7VA 1F3XA 2YIHA 3N73A 3TXZA 3QZAA 1BSIA 4PE8A 5F2MA 2WV8A 4GO9A 4NX5A 3QHMA 1L6WA 1NWTA 1QPRA 1PIIA 1R7OA 3GIYA 1AL8A 1W5OA 3DECA 2XVLA 4QLLA 4POCA 4Z17A 2OODA 4V1YA 3KOWA 4PULA 2BX7A 1Z48A 1WDSA 1S5NA 3IIVA 4LVFA 2EAWA 4JCLA 3WNMA 1EWEA 3T4WA 1RR2A 2J74A 1XM3A 5B7ZA 4TMCA 3WLIA 3FJ6A 1UYQA 5E70A 3IJ8A 4PMYA 3WO8A 5LNUA 3E02A 1J5SA 2A3HA 1LRTA 1XBYA 5D38A 3LPPA 2ZZ5A 4IMAA 3W7OA 3DH7A 5D02A 4G9PA 4ZO7A 5G1MA 3ZJKA 4G1NA 2XGZA 4FLQA 1GUVA 1YXDA 3TOPA 3SRFA 2AOSA 3B06A 1HIZA 3LCHA 2XSBA 4W8AA 2H6RA 4G7EA 3U8GA 4PMUA 5AC7A 5D9PA 2OWWA 3F4NA 1JZ8A 3TVAA 1TMQA 1XH2A 3RXZA 1OT1A 1EP2A 5G4WA 3GTFA 3U0HA 4Y9AA 5I3KA 2V2CA 4JIHA 3H8AA 2X05A 2Q71A 2PTDA 1QHPA 1CCWB 3WFLA 1M01A 4R85A 4UNIA 1G9HA 3MYOA 1VJSA 1Q6EA 3PZGA 3LHVA 3TWAA 3Q4DA 3RK8A 2GVEA 4P8UA 4ZOCA 3DFOA 1DIDA 4MUZA 4J2MA 4U4MA 5BRQA 3UR5A 3HQPA 4OTKA 3NO3A 3K8MA 1H4PA 1T8XA 4B2DA 4TTGA 1O60A 3DG6A 1TVPA 1W5NA 3MBDA 4M19A 3T1GA 4A2SA 3G0SA 4QS6A 3H53A 2HEJA 1EEXA 2FHCA 5C6MA 3REQA 2X8RA 4HCLA 1W9UA 3W70A 4PH6A 4WRHA 2ZZ3A 3EOLA 3QLLA 1BYCA 1RLCL 3CV7A 1UH2A 1OABA 1DVJA 1DTUA 1N8WA 3TEVA 5HQMA 3NL6A 1KBJA 2Q02A 1K6WA 4IICA 4RPPA 2CLFA 4WXZA 4KWOA 3RU8X 4JL2A 3G1AA 1FKXA 4NF7A 3ARQA 1UD8A 1XWYA 2H9AB 2VOTA 2YDQA 4QDPA 2DZWA 4B5SA 5A6AA 4H9XA 4N7QA 1DJQA 1XH1A 4REQA 2QCCA 3OIHA 3MUAA 3NQMA 2HS6A 3ITCA 3CMGA 4XAZA 3G6MA 4NYUA 1SYTA 1SR9A 1CLKA 1OFAA 1V08A 4EF8A 2VX4A 3NZPA 5A8MA 2SFPA 4H6QA 3A3XA 2FDSA 3P62A 3EXTA 2A6NA 3I3EA 4JQ4A 4IMFA 1ESWA 4GG9A 1X98A 1NTHA 1VRXA 3A3HA 4Z0SA 5LHEA 1DWGM 4MYAA 2YCLA 3CUXA 4GIYA 2WVTA 1BD0A 5CEWA 3PP7A 4LOCA 3QR1A 3AICA 3WK3A 4WOZA 4NIRA 1V4YA 2O9PA 4D8LA 3ZMRA 3WH7A 3BARA 4YYCA 3LPGA 1I9CB 3THCA 1NF0A 5L9FA 3VX1A 2XH0A 4B5XA 2DDXA 1K8CA 1VFUA 2W79A 3L21A 2Q3RA 4AIEA 1KR0A 1OFPA 1H09A 5E09A 3NQCA 3APYA 2HVOA 3WDIA 1Q13A 3WF1A 4EWJA 1LOSA 4LNCA 3HN3A 2FYMA 3G8EA 3R4IA 1IZJA 1LRNA 3PTMA 2QJHA 2NVCA 3KBSA 2PWDA 3CASA 5H1WA 4EF9A 4AZHA 5LYRA 3W7HA 1J6OA 2WWDA 1VR6A 4WJEA 5EMYA 2DJXA 4I5RA 2RJGA 1MUCA 1TWDA 2W3ZA 4QNEA 1W3LA 4OBRA 1DJGA 2YW4A 1KKOA 4KWUA 3B0VC 3QN3A 2DUAA 4OHQA 2Q3OA 4OBTA 2ASHA 4WSJA 4DJDA 1SO6A 3PJUA 4UZUA 3WCZA 1TMLA 4DWSB 1B3OA 4ZE5A 1RP8A 3AHYA 5CSUA 1E70M 3BO9A 3VNDA 1KTCA 3TN5A 1VRDA 2R14A 2WSQA 3GXIA 3WLSA 1HP5A 1L8NA 1R3TA 3UR2A 1F76A 1J96A 5JQ9A 1U83A 1RUSA 2VX5A 1EXBA 2PGRA 4JN8A 5J5DA 1WNOA 4ZQRA 5A8NA 5CSYA 3UZXA 4FA3A 3WNNA 4PRWA 4S3FA 3G3DA 3RX4A 1JPKA 4Q8PA 4A35A 4CVUA 2HVNA 3L65A 2POZA 4NJGA 3FN9A 3HQ1A 4CD6A 1KFEA 3ZXWA 5DT5A 4Y6GA 1OVDA 5DN1A 3ANYA 4QDWA 3P0WA 1H49A 1GG0A 3WEZA 3KTSA 4O57A 3F5LA 2V0TA 4G7EB 1M03A 4GA8A 4QJ5B 3AXXA 4XTIA 1AW1A 1LL6A 3AYRA 4XD6A 3VD5A 4XX6A 3C3NA