1EP1A

Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
309
Chain Sequence
ENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAANVKAIELNISCPNVKHGGQAFGTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
total genus 99
structure length 309
sequence length 309
ec nomenclature ec 1.3.1.14: Dihydroorotate dehydrogenase (NAD(+)).
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ep1A00
1Q45A 3DAQA 3RLVA 1TIMA 2BTMA 4MZ8A 1ALDA 1H62A 1K7FA 2CW6A 3W2KA 3G18A 3LLFA 4UTKA 5E0KA 3ABOA 1OF6A 1BKSA 1LM1A 1PHWA 5KZMA 3DZ1A 3B04A 1NF0A 3QPYA 2E77A 3CQ0A 3M43A 2D73A 3PS7A 3W1RA 4GUHA 3W9ZA 2V5LA 4K6AA 3N73A 4QNEA 1HO4A 4UMAA 4IQLA 4RX0A 4O14A 7TIMA 3TKFA 4HSNA 3E49A 3VE7A 4S1FA 2A21A 4MUZA 1Q6RA 4N02A 4A22A 5K9DA 4CQ9A 2VEPA 4O10A 1XI3A 3A9IA 3ZWTA 3W7CA 4UR7A 3SFKA 3C52A 1P0KA 5AHEA 5FF4A 4IPJA 3TQ0A 2OJPA 4OT7A 1FWTA 4FF7A 2TRSA 3ATZA 2C19A 4JY8A 1GVFA 1ZAJA 2A85A 1DJQA 3OVQA 2I1OA 3CLMA 4HKPA 4M6QA 3WJXA 5CZSA 2XN2A 4I7VA 3LCHA 2NV1A 2CWNA 2DZWA 4YL2A 1M7PA 1BEUA 1KV8A 1SSGA 3EX4A 5FF2A 1KTBA 2H3DA 4KFPA 5G4EA 2VKZG 3BW2A 4O50A 1R2TA 4LY8A 3L0NA 3W7JA 1TSIA 1HTIA 4JTHA 3TK7A 1GOXA 3DFSA 4KWVA 4Z1BA 3ZR4A 3LERA 3SJ3A 3TAOA 2CU0A 1TPVA 3LHWA 4XZ9A 2VFFA 2QDGA 3DHDA 1IIHA 3OEXA 1IXOA 5AB3A 5C55A 3CM4A 3GR8A 1G4PA 4O18A 4OV4A 4ZQPA 4M7TA 3GDLA 4AVFA 5F1VA 2Y7DA 2QCDA 2Y7EA 1JULA 3QMTA 4GNJA 3NR0A 5TIMA 4Z1CA 1A5AA 5I3HA 1SPQA 2ISWA 4CQAA 1GTHA 2A6NA 3CEUA 2DU2A 1ZAHA 3EWXA 3G24A 3LCLA 1UJPA 1DVJA 2ZA1A 4UTMA 5C2XA 4DBDA 1T0OA 4LVBA 2ZA3A 5FF7A 1H61A 4H4IA 3JRKA 5BOOA 2G97A 4OE7A 4ADUA 4UFMA 3GVGA 3D0CA 4CCCA 3LBMA 3W1PA 2TMDA 2WOQA 4DEFA 2QKFA 3W75A 5HUPA 1J4EA 1KTCA 2J9ZA 1FXQA 1LROA 1QNVA 3UWUA 1EUAA 1H7RA 2XN0A 4GFSA 1Q6LA 1KA9F 3G8RA 4GC4A 4ZVJA 5AC6A 1XXXA 4KFNA 1K8YA 4O57A 4AWSA 1Z41A 3PB2A 3T44A 1XC4A 1KTNA 1UB3A 4N4PA 5LNWA 3TV8A 3G3DA 5D2YA 2QUUA 2Y6ZA 3USBA 2ATSA 1BWKA 4OBTA 1WA3A 1F73A 3CPRA 3OVPA 1OX6A 4JXCA 2JK2A 1GVSA 5AYXA 1P1XA 3EKLA 4K39A 1THFD 2YW3A 5KMYA 3B0UX 2QAPA 4JX6A 1RQHA 5AHIA 4KKXA 2QJIA 3FS2A 2QCLA 1J5TA 4UTIA 1K3UA 3KVMA 3C56A 3L0KA 4A2RA 1FWWA 3TROA 2Y88A 1NSJA 3TW6A 5BRBA 1AG1O 5FI8A 3GXTA 3I7QA 5J5DA 1G7VA 1OFEA 1GYNA 3CU2A 3M5XA 2NUXA 1A50A 3LRMA 2FDSA 2QCNA 2YYTA 1PV8A 1S3HA 1QDSA 4NXSA 4DO5A 4NX0A 1VHNA 4JDYA 3W2NA 2ALDA 3N2XA 1X6UA 3HG2A 1A53A 2R91A 4E38A 1UCWA 1W31A 2WQPA 2VELA 2FPVA 3F03K 4Y8FA 1OVDA 2CZ5A 3IGUA 3LRLA 4UFLA 1PCWA 3NQGA 5LHFA 1KBJA 2QCEA 3W7RA 2BSLA 2PC4A 2V5BA 2V2HA 3UY7A 4AF0B 5TQLA 4NNCA 4WOQA 1Y0EA 1VYPX 3N19B 3TC6A 4GWEA 1A5BA 1TQXA 1TPH1 3OA3A 3FYPA 4OHQA 4Q4KA 2YFOA 3P62A 3EXTA 2J88A 1JCMP 1EP2A 2OT1A 3EX6A 4JTIA 1LDCA 1SZNA 1AL8A 1IXNA 1QWGA 4ZZ9A 4QISA 3LV5A 2Q3RA 3G1AA 1TJRA 1TRIA 1SW0A 1I2OA 1VQTA 3WK1A 1JUKA 3L5AA 4Z08A 1U83A 3MHGA 1YDNA 4BF9A 4O53A 5D03A 4N9EA 4GJ1A 3P74A 3NL2A 1W3IA 2VFDA 1OG0A 1XBYA 3P80A 3W3OA 1I2PA 1W1ZA 3I6RA 3TJLA 1KLZA 1XBZA 2NV2A 1GVOA 5HR6A 1EA0A 1RZMA 4ZQRA 2YYUA 5G2IA 4CQ8A 3W6YA 3P81A 3LCFA 4ORIA 1O4UA 3NL5A 1TPWA 3FJLA 3NO5A 3NM1A 4HPXA 3YPIA 3TU9A 1KFKA 3UWVA 3N14A 3T40A 1EWDA 4XBSA 1VCFA 2XFWA 4Q32A 4P2VA 4FX7A 5F4XA 1V7YA 4MYAA 4J9JA 1EPXA 3SW6A 1TTQA 2H3BA 2HMCA 4XTIA 4O15A 4EVZA 2ZZ3A 2CLEA 3BG9A 1QO2A 4GE8A 4Y9AA 1DV7A 1TMHA 2C13A 4AH7A 4LT9A 1KFLA 4ML9A 4O1BA 5HWNA 1EX5A 5E1QA 3TNOA 1VPXA 2YXGA 3C0JA 3C2OA 5DCEA 3IVSA 4IX0A 1LP6A 1TV7A 1SU5A 5DXXA 1OX5A 5HMSA 5IM51 2FLIA 4Z1DA 1MEWA 2C0AA 3KRZA 2C6QA 3W88A 4UTWA 4ICNA 4LV9A 3QMRA 3KX6A 4OWGA 2V81A 5HWMA 2FPTA 5DBTA 3C4UA 1PHQA 1OFOA 3W7QA 1QCWA 3QW4B 2BXVA 4L4MA 2Y62A 3KOFA 3R89A 3QQ1A 1UUMA 4TMCA 4M6VA 3V1PA 2QCFA 3MJYA 3GZ3A 3CIWA 3MO7A 1FXPA 1QPQA 2YDAA 2GOUA 4OV9A 1ONRA 3B8DA 1OFQA 3ATYA 1VZWA 3L0GA 3CTLA 2FFCA 1E51A 3CWNA 1YTDA 3E96A 3G1HA 3DU0A 3UXDA 5AC7A 2JGQA 3W2JA 4I9AA 3QPZA 3C2VA 5LNSA 4W9TA 1LYXA 2QCMA 4ORMA 5F2IA 3C6CA 3M1ZA 1ZHAA 5D2VA 4AXKA 1KM3A 3C8FA 3QJAA 2PCQA 3T4CA 4N6EA 1XDMA 4FO4A 4Z0JA 1OYBA 2A5HA 2WJZA 4JIPA 3LCXA 4NT0A 5G1YA 4EOUA 2ZTJA 3W73A 1DKWA 2CLHA 1KFCA 3W1UA 1KW1A 3A21A 3GXNA 3QFEA 4HPJA 5L9FA 2GQ9A 4NX5A 4JX5A 3G1VA 4AHOA 2G5WA 3F4NA 4O19A 1KM6A 2E6YA 4O0KA 5CG7A 4IGHA 1S5WA 4QM1A 3P5YA 3RLUA 5K4ZA 3GB6A 3HGSA 3LXBA 3G0UA 4CNOA 2GVLA 4LS1A 4FNTA 3W74A 4RK8A 4DF2A 1OYCA 1W3NA 5D05A 4RXGA 4YWIA 5LNRA 3OHIA 3I68A 3KFTA 4LWWA 2TPSA 3TUUA 1LBLA 1GEQA 2B7OA 2W0UA 4GUJA 1H1YA 4LS0A 1JR1A 2AAMA 3GDKA 2E1DA 1LZOA 1WBJA 2GVJA 4DO6A 3MYOA 3UYCA 5U4NA 3V75A 4PEKA 4JYFA 2OZ0A 5KZEA 2ZZ5A 2C3ZA 3TCEA 3WJSA 4ADSA 3E9AA 4FIRA 1PVNA 3SR7A 2ISVA 3M7WA 5BMWA 3A5FA 3E0IA 2LLEA 1MEIA 3W70A 3P8IA 4MZ1A 1RVGA 3EX3A 3P82A 4L4LA 3S5OA 5LGZA 3P61A 4FX6M 3STFA 1WAUA 4LW7A 2QEZA 3IIOA 4ZQMA 5G4WA 4OGZA 1FUYA 2Q3OA 4UFHA 1FCUA 3SZ8A 1L6SA 2RDTA 1ICPA 1FCVA 5G2WA 2HTMA 3FEMA 1JVNA 2H6RA 4KWWA 1WQ5A 4A29A 4LOCA 3BVJA 3MWAA 1QO5A 4MFEA 3TW7A 1JQXA 3L67A 1JRBA 2QCCA 2V8ZA 3WJYA 3C2EA 5K9XA 4NJHA 3NQ2A 1EB3A 1JCJA 5H2ZA 3C3NA 3LCGA 4JTSA 2VFHA 1W5NA 1QOQA 2R8WA 1SZEA 1SW3A 4UUIA 4FHAA 4MJMA 1KM1A 2V2DA 4JTKA 3F1QA 1NF7A 4QAIA 3EWYA 4POCA 3CHVA 3IV3A 4I7WA 5A5WA 4AB4A 3LRKA 5IBXC 1ZJIA 3KVJA 4QIUA 1OJXA 3W7MA 2C1HA 1F7BA 3LCWA 2B0MA 2CZFA 1AW1A 2YCEA 2ZRWA 1SZFA 2ZZ6A 4Y6GA 4TO8A 1D3GA 3DFQA 3HG3A 4O4VA 1Q3NA 5LKYA 3QW3A 1W5OA 5HNRA 4WUIA 4PL2A 3W7KA 1FY6A 1O60A 4GRSA 2X16A 2BLEA 4XKYB 3GK0A 4BWLA 4N9BA 5FEWA 2A0NA 1XFBA 4QITA 1LCOA 2EGZA 1MSSA 4ADTA 2WO5A 1JCXA 4Z0SA 1UASA 3A23A 1OYAA 1YPIA 1L2UA 2DJLA 1GVRA 5CPOA 3O8AA 3W7GA 3NNTA 2ZQ0A 4WY0B 1GTEA 3S42A 4NJGA 3S1XA 3N3MA 1OFDA 4JS3A 1PE1A 5KTLA 3NDOA 3PBVA 2DORA 3S5YA 5H91A 3G3MA 3PWAA 5LSMA 4UTHA 3IRDA 4YXGA 2X1RA 4O17A 5KSWA 1SO6A 4OQVA 4WOZA 2ZZ4A 3P67A 1JJKA 2FPYA 3LBCA 4YLWA 4BR1A 5CZTA 1AW5A 4HNTA 5I3FA 1PIIA 3NEVA 3S5NA 3HG4A 4LRTA 6ALDA 1WX0A 3UXAA 1MXSA 5BMXA 4FNQA 1KLYA 2WNZA 3PC0A 5G1TA 3VFLA 2H90A 3IIZA 2QJHA 1DOSA 4RXFA 1RQEA 2CZDA 4IMFA 3FKRA 4LUIA 4HIBA 5HWJA 3LHTA 2QJGA 3L66A 4EWND 2VEIA 4UTTA 2AGKA 3LXAA 1KM4A 3MP5A 3MMTA 3W22A 4R33A 4ZMGA 3HJZA 2VFEA 4WY0A 4LVDA 1TB3A 1VH7A 2ZBTA 2J24A 5CGQA 3HPZA 2RH9A 1XUZA 4UTLA 3EXSA 4A21A 4EIVA 1JCNA 1W5QA 2A7RA 2ZZ7A 3AO0A 5TBOA 2E6DA 5EPDA 3UWQA 3UQNA 3NQ8A 2FJKA 3W1MA 3IIVA 4UC5A 1GWJA 5F4SA 3W1NA 3GDRA 3S1VA 2HS6A 3NQEA 3C2RA 4LVGA 4CLMA 1KM5A 5HINA 3W1XA 1H7PA 3NAVA 3NPXA 5CSRA 5DELA 1U5JA 4UFJA 1OX4B 3B05A 2A2IA 1DORA 1YXCA 5CZJA 3TXVA 2R94A 2TSYA 4LC8A 3WFAA 1JQVA 5AN7A 4LVFA 3BV4A 5EKYA 1FX6A 4XBKA 4RLIA 3IEBA 1OFPA 3DFTA 1LOLA 2EPHA 4BWLC 5BW6A 2P1FA 4JGDA 2A6LA 3IIPA 2VXNA 3W2MA 1ZNNA 3HF3A 3QMSA 1QFEA 1J2WA 1W8SA 3HIJA 3PSWA 4TR9A 4AAJA 3L68A 4NNAA 3DI1A 5K7JA 2JKEA 2B7QA 5HUOA 3GNDA 2NXIA 1FDZA 1LBFA 5G5IA 1YYAA 4RJEA 2YPIA 4M5PA 3SY5A 1DL3A 5EY5A 3G1DA 5A8GA 4WJEA 2RDUA 3E02A 3W83A 4DXVA 1ME9A 4Q33A 1C29A 4DBEA 3NL6A 1JUEA 3BG3A 5G2HA 5FEXA 1WOAA 3N9RA 1TJPA 4BFAA 2GQ8A 3QM3A 3SSJA 3NZ1A 2PURA 4QSHA 4UTUA 1VJIA 2X1SA 1L6YA 2E5CA 1VCGA 3PULA 1EUNA 1YDVA 2VC6A 3BO9A 4K7VA 1EIXA 1H63A 3EX1A 3UWWA 3T55A 2DZUA 3W85A 1OK6A 1W3TA 3TR2A 1KFEA 2WSYA 1O5XA 3A22A 2E5BA 1TPC1 3O16A 1VS1A 3EX2A 2ATMA 3W87A 3W7NA 3HQ1A 5HQEA 1G69A 2EF9A 2O7SA 1TV8A 4E2BA 4JNMA 3FLUA 1D3HA 1F05A 2E6FA 3O6DA 5CPMA 1G4EA 2P0OA 3S8HA 3EXRA 3IIXA 3NM3A 1ME7A 3FJ6A 3LX9A 1V5XA 2WSQA 4K36A 1SFJA 3TIMA 4DPQA 3NQ7A 3B0VC 3PVFA 3DGRA 3M6YA 1VYRA 4QQ3A 5FF0A 6TIMA 1LOQA 3NA8A 2H8ZA 2YFNA 3BGJA 5F1UA 4FNSA 3M41A 4JICA 2UV8G 3MI6A 2GJLA 1FWRA 2FB3A 3STGA 1QAPA 5FEPA 4UMCA 4UTWC 1TPB1 3M5ZA 3G22A 3PBWA 5AFDA 1SFLA 4C1KA 1LOSA 5K9CA 3PUEA 4WY0F 3L21A 4O28A 3LLDA 3MHFA 1BTMA 1R2SA 4UFIA 1SO3A 4IMCA 3B03A 1W56A 2Q8LA 5AC8A 4ONVA 2FQIA 4CNPA 1TYGA 3G8EA 2EKCA 4YCOA 4WD0A 2WNQA 1ICQA 3EWWA 2VENA 4G1KA 1QMLA 3SECA 1T99A 3PY2A 3O06A 3LCIA 3LDVA 1SW7A 4JEQA 1KFBA 2CLOA 3IGSA 1G7UA 3TJXA 1G4TA 5AHNA 4NJKA 3IGXA 4AWUA 1VC4A 4CCDA 2W6RA 1DBTA 3M9YA 1KM0A 2CLKA 1T96A 4MY9A 1HL2A 2A7PA 5I3KA 3W7DA 5EL1A 3ZS4A 1VLWA 3GKFA 1F76A 3ABRA 2G95A 3S1WA 4JTEA 3U2OA 3U6WA 1QR7A 1ZALA 2J9YA 2VOMA 3MYPA 4RZ6A 5CSSA 3TE9A 3TQVA 1TO3A 2ZDRA 5D09A 1BWLA 2E5DA 4NU7A 4O1DA 3TSBA 3QZEA 2WPBA 3DBPA 4EF8A 2C18A 2CLLA 3EKZA 5LNUA 4FXRA 1KV5A 4ZQCA 3H53A 1XBVA 4O0ZA 1W37A 2GPTA 3UZJA 1NVMA 1ZENA 3NOEA 3UD6A 1SO5A 4K8EA 1EEPA 2YSWA 3SGUA 4LS2A 4GBUA 1PL9A 4NVTA 2ZRYA 4K38A 3W2LA 4P61A 1I2NA 3NQFA 3BLEA 3FOKA 4U4MA 4PCFA 4JR5A 2QCGA 1CX9A 4UNLA 2NWSA 3L9CA 1GJPA 3DENA 4A3UA 3GKAA 1I8JA 3EWBX 4H3DA 2EAWA 4LV4A 5DLCA 3WJWA 5AYZA 2ZRXA 4JYEA 4PFMA 4JTFA 1ADOA 3NPVA 4K8HA 2NUYA 1H60A 3KRSA 2KZHA 3W7EA 3R12A 3CC1A 1SO4A 1Z48A 3FKKA 3QEZA 1IF2A 1B9BA 1OX4A 4JIQA 1DQWA 3KRUA 4JD4A 1FBAA 4IPIA 2J9XA 3T78A 1IGSA 1SZGA 1L6WA 4D2JA 5BNKA 4MVAA 3A24A 4AF0A 1LBMA 1F6PA 1FDJA 1LRNA 1QPRA 5FEZA 1HFBA 4GUIA 3WK0A 2WKJA 2AQWA 1WYIA 3FIGA 4HNUA 1O94A 1N8FA 2NXGA 1AMKA 3PBYA 2VFGA 3C2FA 1SR9A 3GDMA 4MY8A 1JRCA 4O16A 3GDTA 1JUBA 1LLWA 3O6YX 3HOJA 3M5VA 1F5ZA 3BW3A 3FA5A 2WSRA 3LXCA 1YADA 4XKYA 1OHLA 4N9DA 1W5MA 4N9CA 2NUWA 3RF9A 5K4XA 3P8JA 1K03A 1TCDA 3QSTA 2X2GA 3S0CA 3EEGA 3UWZA 2Y61A 1T8XA 1S5VA 1CW2A 1JCLA 3LTSA 3M47A 5EA9A 4LC6A 3MP4A 3H55A 1P0NA 4MPQA 4S2CA 5HR7A 3P7YA 4MIMA 3NQDA 2GUUA 4JDBA 4KFOA 3DFPA 3MBDA 4NJJA 4TU1A 3TMQA 5EBUA 3TDFA 3G0SA 1L9WA 2Y85A 4MLJA 5C6MA 3JR2A 3O15A 5LGXA 3T7VA 3VCRA 4NZJA 1Q6QA 3UNDA 4TMBA 3W7OA 1TPEA 2Z1BA 1YXDA 1W5PA 1M5WA 2ZA2A 1B3OA 4LRSA 3TX9A 1VCVA 4O52A 1OK4A 3WK2A 4IOTA 4GXMA 3L5MA 2HS8A 4NQ1A 2F7FA 2CLIA 1UUOA 1VHCA 4ALDA 5D30A 1KBIA 2WNNA 1DQXA 4C1LA 2RDWA 1P5BA 4MY1A 1YTKA 1G67A 3DH7A 4HSOA 3M0ZA 1LRTA 3STEA 1GZGA 2NLIA 1O95A 3G1FA 1LRQA 3S5ZA 3ABSA 3Q2DA 1TRDA 5HULA 2QUVA 1LORA 1M7OA 3Q37A 3NL3A 2WV8A 4IXHA 3NZRA 1AL7A 3PUDA 1R46A 3RNDA 4UTJA 1B4EA 4GUGA 4UXDA 2QUTA 1LTDA 3MUXA 3NXFA 2B7NA 1FWSA 5DY2A 1VRDA 5EMUA 2JBMA 3L5LA 4IMEA 3SIZA 5DBUA 5D38A 3VE9A 3W1TA 4LUJA 4M6PA 4O13A 1I2QA 3UPWA 3EWUA 1NAL1 1M6JA 2NX3A 3W72A 1DJNA 4H6KA 4JYDA 3DKLA 4N6FA 1WBHA 3QC3A 1TQJA 5D04C 4BI5A 5D33A 1ZFJA 1TTIA 1K7EA 2GVGA 4JTGA 4O12A 3R2GA 1RPXA 3W84A 4UNKA 1TTPA 1X1ZA 2ZFAA 2NXHA 2DZPA 3NQAA 2B7PA 1R30A 3TFXA 4Y90A 1XM3A 5CKSA 3PR2A 4CNNA 5CZ0A 1W54A 3LM7A 1ICSA 3GNNA 3TA6A 1CI1A 2B4GA 3VKJA 4X22A 4AWTA 4R53A 2YGYA 4WXYA 1FCBA 1Z44A 4MJZA 1K02A 1WOBA 4RZ5A 2IQTA 2YW4A 1AK5A 3MI3A 3NPUA 3BGGA 5E93A 2Z2UA 2QAFA 4O54A 4ZQOA 1VR6A 3G1SA 1NEYA 3MHUA 4E0CA 3M5YA 3LI1A 2GQAA 4PTNA 3ANYA 4MYXA 3QYQA 1GG1A 4A2SA 5D2TA 3U8GA 5KITA 1MZHA 1GT8A 3N9SA 4EF9A 1RV8A 3DKJA 3JS3A 1QPOA 3SGZA 1KM2A 2Y63A 1HG3A 3LHVA 2V0TA 1NFBA 3ELFA 1YTEA 2YZRA 4WZHA 4ZL1A 3DFOA 2JGYA 5F4WA 3W7LA 4RV8A 4AEOA 3IVUA 2CZEA 1C9DA 3CIXA 3DFNA 3CEPA 3I7SA 1XUUA 1PS9A 3LHZA 5AOUA 1VLIA 4K37A 3BPWA 2BZNA 4GUFA 3PAJA 4LU0A 1XL9A 1B57A 3PG8A 3UY8A 2VFIA 2NZLA 3LV6A 4O1AA 1VYSX 4NUWA 1G4SA 4R34A 4LVAA 3P60A 3W76A 3PF3A 1K7XA 2X30A 2CLMA 2Y7GA 2GJNA 3NQMA 4ZQNA 2A1YA 4PA8A 4QJ1A 1TV5A 3R5EA 2X1UA 3W07A 5C54A 4YCPA 1KFJA 2HSAA 4BI6A 1RR2A 2FB2A 2ISSA 1F74A 5I3IA 1SSDA 3C61A 3OG3A 3OBKA 3TH6A 1A5SA 2VEKA 3QSRA 3ABQA 5AHLA 1Z42A 3PSVA 5MHBA 3L2IA 3B4UA 5DXYA 3W7HA 3P84A 1FQ0A 2C16A 3HGRA 3KAOA 2ZZ2A 3PBUA 1SQ7A 2YX0A 1C8VA 4RCXA 3FYOA 4BI7A 3OVRA 3HMJG 3DI0A 3MP3A 5HJLA 2DZXA 3QF0A 1AW2A 4NNBA 4FNPA 2OCZA 3O6CA 4PODA 1H7OA 4HN4A 2DJXA 4XWUA 2Z6IA 1OF8A 2OX1A 2QCDB 3W71A 3CWOX 3I65A 5K2ZA 4X2RA 4IUOA 3N34A 1YLVA 3UPBA 1F6KA 4O1CA 3GLCA 3KHJA 1ME8A 3LI0A 4MLRA 4B5NA 2XN1A 3KXQA 1H7NA 4FXSA 3TMLA 1OABA 3W7PA 1ZY9A 2X1TA 4Y96A 1YPFA 1XBXA 2ZCGA 1TPUA 1IXPA 4K7YA 5D02A 3S9YA 3THAA 2OMAA 4BK9A 3E12A 1DHPA 3RFAA 2W79A 4DF0A 1H5YA 3LHUA 3PB0A 2F84A 2FTPA 1GG0A 3WK3A 2A7NA 3QQ0A 1RQBA 3NGJA 1H1ZA 4UMBA 2DZSA 3W23A 3IVTA 4AHPA 2ZZ1A 4HNNA 4FB7A 4UFKA 3G1YA 3PUOA 3AJXA 3TSMA 5LZLA 2Y89A 1PCKA 3WJZA 2ABAA 5DN1A 1FDYA 3BG5A 3O1NA 3EB2A 3F4WA 1HUVA 4DF1A 1TPFA 4N2YA 3S6DA 4MOZA 3INPA 4O8RA 3HGOA 3W1AA 4NJIA 2CLFA 4YMZA 4PL1A 2RHGA 4JTLA 4JN6A 3G1XA 3KVKA 4JY9A 1GVQA 3LGEA 3BLIA 4M7SA 4AMAA 3PG9A 1I2RA 3SI9A 3ZWSA 1N7KA 4I7UA 3VNDA 3CT7A 3MBFA 1O5KA 1VGAA 4CCEA 1JCYA 4IXXA 1UBSA 5AHMA 2QR6A 5DCBA 2Z6JA 8TIMA 3GX9A 3NVTA 5D2XA 4UIOA 3B06A 1EWEA 3GR7A 2OT0A 3QRHA 5U7SA 4PH6A 1HO1A 3EWZA 3LOTA 4WXZA 5D32A 4DELA 3TXZA 3STCA 4XTDA 3RK8A 3RU6A 3W86A 4FIQA 4FX8A 4HT3A 2V9DA 1YDOA 2PRHA 4XQ6A 1B4KA 2DZVA 3MI2A 3N2MA 4Z1AA 5J5RA 3TSDA 5D2WA 2I9EA 3R8RA 4FNUA 3NG3A 1W0MA 3Q58A 1EP3A 5DCDA 2G96A 4FNRA 4LNYA 3Q94A 3I7RA 2ZTKA 1TREA 2EHHA 2PRMA 3S1UA 1WXJA 4AHQA 3UZ5A 2BWGA 3P5ZA 1QOPA 3HGJA 4IMDA 3W7IA 1X7FA 4IMGA 3TAKA 1R47A 5D37A 1G6CA 2Y70A 2BX7A 1I4NA 3CB8A 1WDWA 3G0XA 3NPWA 3TC7A 5AYYA 2QF7A 4FEZA 5I3GA 2E09A 3TQKA 1H50A 5K3VA 1GYLA 4HHPA 2NX1A 5DY3A 2C14A 4O4WA 1RD5A 1XCFA 1K8XA 3NYZA 4QNWA 2E6AA 3GYEA 4RZ4A 1ZCOA 4IWWA 4X9SA 3QH2A 5FF3A 3BLFA 1H7WA 1OFRA 1MEHA 1EP1A 1F2JA 2R14A 1XKYA 3W1LA 5F2LA 3HBLA 3GAKA 4UCGA 1GPWA 2DP3A 3W2UA 1R2RA 1H51A 2P10A 1X8FA 2V82A 4WX2A 1K8ZA 3NQVA 5L6UA 3ZFHA 4MFDA 2NX9A 1WV2A 3LHYA 3GIYA 4WQ6A 2PRLA 1SUXA 3BARA 5I3JA 2ZRUA 3H54A 2CFFA 3GAYA 4R7JA 3LTYA 2ZRVA 2TYSA 1OFBA 3M16A 2FIQA 4PC8A 4IX2A 2QDHA 3HO8A 4RR4A 4DPPA 1TTJA 4DQWA 2Y7FA 3O05A 4IJBA 4JTJA 3DXIA 4NZFA 5CPNA 4XUGA 5KZDA 2ZYFA 1Q6OA 3R13A 5GVJA 3K30A 4MKNA 1N55A 1XDLA 2DZTA 1IXQA 3DHFA 5EYWA 5CPLA 3O07A 2E68A 1S5TA 2I14A 3THQA 3VI2A 3HB9A 4UR8A 2JKPA 4U28A 2JKAA 3LTPA 1ZAIA 4UTTC 4MZYA 4NXKA 3L65A 1IIGA 1OFAA 3KVLA 4JTTA 4M19A 4E2DA 3NQCA 5IBXA 3B0PA 4JTUA 2A4AA 1LLZA 3BW4A 1YXYA 3PM6A 2Z0IA 5SWUA 4HNVA 1I45A 2V2CA 2Q8ZA 5T26A 3BK0A 4TIMA 4LTSA 5C5YA 1X1OA 3GXPA 2NWRA 3FFSA 2ABBA 2YR1A 2J27A 5LNVA 4JX4A 5F2GA 2V30A 1ML1A 3A5VA 5KINA 4O11A 5ABTA 1P4CA 2PE4A 2RFGA 2QCHA 5LHEA 2C15A 2H8XA 4RKAA 2O7QA 2J6XA 5AHFA 3MW7A 1A5CA 4S2BA 1D9EA 3RMJA 2RKXA 1FWNA 1GQNA 3TFCA 3HPSA 1QPNA 3NQ6A 3UWYA 3O63A 3HG5A 3M44A 1MO0A 1TPDA 3HPXA 4TX9A 5FESA 4OU1A 2VEMA 4DO4A 1H7XA 3LB0A 5F2MA 1FCQA 3W1QA 2ZRZA 4X3ZA 3OIXA 4N4QA
chains in the Genus database with same CATH superfamily
1Q45A 3DX5A 1E4IA 4IUGA 1K7FA 4IP5A 3W2KA 4UTKA 4RE0A 1P0BA 1EXBA 2VZUA 1OF6A 1BKSA 1NF0A 4UQBA 2E77A 3CQ0A 2VQUA 2D73A 3E0WA 4Y9MA 4GUHA 3NOYA 3CTTA 3W9ZA 1MDLA 4IMAA 7XIMA 4QNEA 3OLGA 5CGTA 4O14A 5DX7A 2VVNA 3BDKA 3GNRA 4MUZA 4A22A 1JI2A 3O7UA 3ZWTA 3IJ9A 1JZ3A 1XRVA 4UR7A 1XF0A 3SFKA 1P0KA 3P93A 4IPJA 2HXTA 3KBVA 5JU6A 4FF7A 4XBJA 3IANA 1REQB 5HJXA 1TA3B 1YRRA 2Q8XA 4GXWA 3SRKA 1JGMA 3CLMA 4HKPA 2NV1A 3H70A 2BGQA 1M7PA 3EX4A 1KTBA 2H3DA 2VKZG 3BW2A 2EO7A 4HSHA 2QF8A 3UVIA 1V7AA 3EOUA 4Z1BA 3SJ3A 3TCSA 3TC3A 4JCLA 3AICA 4M80A 1TPVA 3LHWA 2VGBA 3ITVA 2VFFA 2QDGA 4JFWA 3OEXA 3PZOA 5A6TC 4AUBA 5AB3A 1TV3A 3WFZA 1E6XM 4W84A 1G4PA 2E8ZA 3IAQA 3T08A 4M7TA 4C7DA 1VFOA 4W8LA 3THCA 2XU2A 4YHEA 1JULA 4GNJA 3NR0A 3TLQA 1LG2A 1SPQA 4CQAA 2DU2A 1DVJA 2ZA1A 3QN3A 2YBVA 1EYEA 2BY0A 1JDEA 1HJQA 3H4XA 2NQJA 4D9PA 1DTNA 1Y65A 4Y7EA 3WQWA 6REQB 3M0LA 5FF7A 4EACA 1PDZA 2H9AB 4REQA 2CXGA 3LN3A 3RX4A 3OQEA 5BOOA 2WZMA 2G97A 1H1NA 1PZ3A 1MQRA 4HQVA 4CCCA 5CC7A 4MNKA 4GCAA 2WOQA 3OPSA 1PWLA 5G4HC 2J9ZA 3ECQA 3UWUA 3VOGA 2PWVA 3G8RA 3OU8A 4TTUA 1IEXA 4O57A 1Z41A 1XC4A 2JIWA 4JFUA 2J79A 5EMJA 1NP0A 2BVDA 3G3DA 4RDVA 4N7QA 1BWKA 1IWBA 1UMYA 4OBTA 1XP3A 5JBFA 4HK7A 1Q8JA 1F73A 3CPRA 2ZICA 3MANA 1OX6A 3E2RA 2JK2A 2A3HA 1ZJBA 1QW9A 3WCZA 1KQYA 2I9UA 2YW3A 3EA3A 4L80A 2QAPA 5A2CA 4KKXA 1S2TA 5BWAA 1MUCA 3VIHA 4UTIA 1K3UA 3E2SA 3KVMA 3L0KA 3TROA 2Y88A 1OFEA 2VX5A 3VDGA 1NDWA 3OZPA 3LRMA 2FDSA 2QCNA 3ARZA 1PV8A 1QDSA 3W2NA 3GG8A 3N2XA 3AFBA 3HG2A 4E38A 1CLKA 1K4GA 1UCWA 1W31A 4E6MA 1EZWA 1OVDA 2XVNA 3VM5A 2O55A 1XYZA 3NQGA 4PEEA 4HU3A 5I2UA 2QCEA 3A4JA 3GU9A 3W7RA 2V2HA 1UP0A 5TQLA 2FKPA 4NNCA 4OOUA 1Y0EA 3N19B 1E1EA 1A5BA 3OA3A 3FYPA 2YFOA 3P62A 1HP5A 1QI0A 2FGBA 3C0SA 2GFTA 3UU0A 1IXNA 1DIKA 1RA5A 1W1B1 1XHGA 1I1WA 4AU0A 1UKPA 2XIOA 2R9RA 1P7TB 4RZBA 3TONA 2WMFA 3QYSA 3MHGA 1YDNA 4OUEA 3CLWA 2VFDA 4HK5A 2FVMA 3I6RA 4XD6A 1XBZA 2W91A 1Z8AA 1YMYA 3G6LA 1J79A 1OCBA 1EHNA 4P7RA 1LG1A 3AU6A 4LBSA 3LCFA 1GHRA 2X7WA 3S83A 2D24A 3PK7A 2WVTA 1KFKA 3UWVA 3KLKA 3N14A 4XBSA 3L4YA 4DJDA 4P7QA 3K5XA 3SW6A 3OVGA 4P8UA 4IM4A 4RNHA 3XINA 1QO2A 3D3AA 4JFTA 3QVQA 2POZA 5FD0A 3A12A 4PCTA 2C13A 4LT9A 1KFLA 4ML9A 3J7HA 5HWNA 1V79A 5E1QA 2YXGA 2E7FA 3MCOA 2E9BA 5DCEA 3IVSA 4HA0A 3VIMA 1OX5A 5IM51 3VMNA 3KRZA 2C6QA 1GVIA 4ICNA 4S3JA 1W9XA 3C86A 2WZTA 1UOKA 3II1A 1ECEA 2V81A 3AALA 3ZIZA 3DOPA 3W7QA 2Z2AA 1UWTA 2Y62A 1N8WA 3QQ1A 4HHHA 3TYDA 3MT1A 4DJFD 1FXPA 2OYLA 1QPQA 2O92A 3WN6A 3ATYA 3RYSA 1KQZA 1JCTA 1E51A 2FFCA 1YTDA 3CIVA 1GQKA 3DU0A 3DIPA 3UXDA 5AC7A 4I9AA 3QPZA 3NWRA 4L4PA 4MJ4A 2GGEA 4HD5A 1CGYA 1CNVA 2VRJA 1GZJA 5D2VA 1YE4A 1KM3A 4AIUA 3E74A 2PCQA 3H4GA 2P76A 3LPOA 3T2OA 2Z1KA 4B4HA 4AWEA 1OYBA 1LQ0A 1KGUA 4TQTA 4JIPA 5C2CA 4EOUA 5M3WA 2CLHA 1KFCA 4JKKA 1KW1A 3QFEA 4HPJA 5L9FA 4XX6A 3PBGA 1IEWA 3WQPA 1Q6FA 1HN1A 3B8VA 2BV9A 2A3BA 1H3GA 1PBGA 3F4NA 2WHKA 3NDYA 1BVNP 1KCKA 4O19A 1KC7A 2BY1A 2ZWYA 1S5WA 4DAIA 1KXHA 4LEFA 4V27A 1J10A 1T7LA 4G7FA 4RK8A 4RE4A 2VHLA 3I3DA 1FHDA 3NO1A 3N15A 5D05A 4RXGA 4ICCX 5DEZA 4LWWA 3C8NA 1DEDA 3WD1A 3ZT5A 1LBLA 1JNDA 2W0UA 4GUJA 3DFYA 4PMDA 3H8AA 2AAMA 2E1DA 2W63A 3SM0A 3MYOA 3V75A 3GTHA 2OPJA 4PUEA 1EXPA 4JYFA 2ZZ5A 3U5YA 4ADSA 1EC8A 4JL2A 3SR7A 1BKHA 3WH5A 2TAAA 3DN5A 3PFMA 3R0DA 4ZXOA 4L61A 1TFVA 4UQCA 4MZ1A 1RVGA 3EX3A 3P82A 4L4LA 1J6OA 3P61A 4FX6M 3SCNA 4ZQMA 4UFHA 1FCUA 3SZ8A 2GZXA 4IL2A 1PX8A 4DWDA 1JZ6A 1KRMA 2CKSA 4NRRA 5A69A 4HU0A 3MWAA 2IXUA 3GBDA 1QO5A 2VEGA 3TW7A 4TVUA 1JQXA 1JRBA 3WJYA 4MMWA 4FOKA 2RJGA 2MUCA 3R0UA 5H2ZA 3LCGA 1OCJA 1W5NA 5FJRA 4ASTA 1SZEA 3N18A 4JHZA 4GI6A 2HBXA 2D0FA 4GINA 1XRTA 2HRWA 4HJFA 2DSVA 2WMHA 3WSUA 4QAIA 3RJYA 4POCA 2YIHA 4I7WA 2CESA 3FA3A 2VCAA 4HYRA 4PMNA 4S3EA 1H5VA 1V02E 4TO8A 1D3GA 2NVDA 1Q3NA 5LKYA 1MNSA 1W5OA 4QJ4B 3WUBA 4MTVA 4PL2A 1YBQB 4CVWA 1O60A 2XM1A 4GRSA 4P8XA 1D7KA 4S39A 2ZUUA 1QHPA 5FEWA 1E0UA 1JF6A 3VNJA 2Z24A 4QITA 4P7OA 2F6UA 4UQDA 1XYAA 1L2UA 4ACYA 3LGGA 3GH7A 3NNTA 4WY0B 3S1XA 3SN4A 4LALA 1IV8A 4D72A 1TKKA 1Z9AA 1HJWA 4JS3A 4XD4A 3SADA 3FHQA 3SCOA 2FZ8A 5E5CA 2DORA 2XZ7A 4E8CA 3G3MA 4MSSA 1W2VA 3VZZA 3BH4A 7TAAA 2HISA 1RJRA 1SFTA 1JJKA 2FPYA 3LBCA 4YIWA 1AW5A 4HNTA 3ZSSA 5I3FA 3S5NA 3GTXA 5JUVA 3UXAA 2WNZA 1PAMA 3VFLA 1X38A 2H90A 3ARRA 2QJHA 2IKGA 1DOSA 2XSAA 4WRHA 4PRWA 1JD9A 1RQEA 2CETA 4GOAA 4X2PA 3L66A 3WBYA 3KCOA 3H4WA 1CDGA 2Y8UA 3MP5A 3MMDA 3W22A 2FTYA 4ZMGA 2XWDA 4KS0A 1VH7A 4KETA 4AG0A 2ZBTA 3ZJ6A 3HPZA 8A3HA 2RH9A 5M03A 2J74A 1XUZA 3PPHA 1ZS2A 1KXQA 1JCNA 2ZE3A 5CAKA 5I23A 2W62A 2ZZ7A 3SCWA 1DJIA 3UQNA 2FJKA 3UESA 5D9NA 2ZKMX 1E15A 3PWIA 5F4SA 3W1NA 3RPDA 3NQEA 4U5IA 1JDAA 2P8BA 4IJCA 4AVNA 1WZAA 1H7PA 2I17A 2EEXA 1G0CA 2VX4A 5EU9A 1OX4B 3QTPA 3B05A 4GQ0A 7ENLA 5JH2A 5HBFA 2X05A 1MRQA 3U0HA 5BU9A 2GUBA 3DYOA 2ZOXA 4EPBC 3BV4A 4RLIA 3IEBA 3DFTA 2EG6A 1RK6A 1OC5A 2OFJA 2WHJA 1V4YA 2VXNA 3W2MA 1QFEA 1J2WA 2UY5A 3L68A 4NNAA 3DI1A 3M0HA 1J6PA 3VKAA 3M0XA 3NIYA 4E4PA 4Q7BA 1FDZA 8XIMA 2AQVA 3SY5A 1B90A 3WQFA 1DL3A 1G5AA 2V3FA 5EY5A 1XFCA 2ZUTA 3BMVA 4YYFA 2G3MA 3E02A 4DXVA 1S5MA 1C93A 1C29A 1TUXA 3EDJA 5G2HA 2DSKA 1TE6A 4BFAA 1XGZA 3SSJA 2PURA 3NJ3A 4IIHA 1UOZA 3PULA 1EUNA 1YDVA 3IGHX 4L9YA 1ISWA 2F6XA 3AMKA 1EIXA 1H63A 1W3TA 3TR2A 1KFEA 5H8MA 3P0WA 2WJEA 1VS1A 1ECQA 2FVKA 3IJ8A 2ATMA 2INEA 1QHOA 1PKLA 2EF9A 4JNMA 3DBNA 1D7FA 3VXGA 3W4RA 1W91A 1XLDA 2JFEX 2P0OA 4RPPA 2HK0A 3EXRA 2X1IA 1ME7A 1QWKA 1V5XA 4UR9A 2WSQA 4DPQA 2C0HA 7PTDA 3PVFA 5FF0A 1EH9A 3NDZA 4L1XA 4FNSA 1KO0A 3KBSA 4PUMA 2VRQA 4RUBA 4NASA 2GJLA 1BD0A 5JIPA 1ENUA 1XLHA 4J27A 2FB3A 4A8RA 1TZZA 5FEPA 2E9MA 4AZ5A 4UMCA 4HNCA 3OG2A 5TF0A 4UQAA 2OEKA 5CAHA 3M07A 5FL0A 1LOSA 5K9CA 3P2VA 3L21A 3M0MA 2VX7A 1RCQA 3WQCA 4IMCA 2HXUA 5AKQA 4L65A 5BXTA 1NDZA 1R6WA 1VFTA 4CQCA 1VJZA 4HA3A 5AC8A 1KB3A 5C7VA 4XUYA 1TYGA 4H9YA 1UR3M 2WNQA 3VNKA 4G1KA 1C92A 3SECA 3A3XA 5RUBA 3LCIA 3LDVA 1R3QA 3IGSA 4H04A 3RCNA 1KGWA 4MAZA 1A47A 2YL8A 5IFTA 3VOCA 1XGDA 2CLKA 1IT7A 1T96A 6XIAA 4CD8A 4GGHA 4PUUA 3W7DA 4B16A 1M41A 3CQHA 4W8BA 3GKFA 4XZNX 4LYRA 4US6A 3CZLA 2WSPA 1QR7A 4J28A 2VOMA 4Y9OA 3EKGA 2ZDRA 4QDWA 1PXGA 4H83A 4H7CA 5FCZA 3KLLA 1Z89A 3U7BA 3TSBA 1GVYA 2WPBA 3SQMA 2PDFA 2CLLA 5LNUA 4BQ2A 4FXRA 3KTSA 4C6FA 3QHMA 3H7UA 3H53A 3M0VA 1W3JA 3KDOA 1SO5A 4K8EA 3DECA 1DJGA 2YSWA 3V35A 1NFPA 4QAWA 4KWSA 3HPFA 1VFFA 4DWSA 3E1F1 4JEJA 4U4MA 4JR5A 5JXQA 4J3WA 2DVXA 4ZOEA 1JYVA 3DENA 4A3UA 3GKAA 3AQUA 2JEPA 3WJWA 2AMGA 4JTFA 1HKIA 2KZHA 4BZYA 4ZSUA 3B3DA 1JL8A 1IF2A 1B9BA 3KRUA 2PBGA 3QGAC 3AHXA 1RPKA 2WHLA 3GVVA 3R0KA 4FR1A 5XIAA 1SZGA 2UY3A 1QUMA 1RA0A 4WSKA 1TR1A 1F6PA 1VFHA 1QPRA 5FEZA 1SMAA 2AQWA 1E9LA 1WYIA 1O94A 3R7MA 1AMKA 1QPKA 3PBYA 2CBUA 4GZEA 4DJFC 2PTZA 2YCJA 1JUBA 2QYGA 3M5VA 3AS2A 2E9LA 3FA5A 3LXCA 1XC6A 1E4NA 1YADA 2DW7A 2EJ1A 2ACRA 1R3WA 1W5MA 3RF9A 3P8JA 4G8TA 2Y61A 1MW0A 4LNCA 1S5VA 1CW2A 3EMCA 1EJTC 1BG4A 5EA9A 1DTUA 3W82A 4JHMA 3JUGA 2WBGA 1K9FA 1U1HA 4MPQA 5HR7A 4M0XA 3NQDA 3URAA 3W81A 4DM2A 3G0SA 4M24A 3CPGA 3JR2A 3ARYA 3T7VA 2CHRA 2Q6ZA 4HHMA 3UNDA 2DIEA 2I56A 5CBJA 5FAGA 1IZJA 3W7OA 1W5PA 2OTDA 1F8MA 2F2HA 2ZA2A 1B3OA 1B0IA 4GYPA 4J3UA 1A5UA 4GXMA 4ERGA 4GJIA 4IHCA 4CVUA 1WKFA 1KBIA 2WNNA 2BHZA 1WE5A 1A3HA 3UJEA 3H2NA 1EC9A 3THDA 1CT5A 2INFA 4HU8A 4GIRA 1J0HA 1LRTA 1GZGA 3R79A 5XINA 3G1FA 5HULA 4L6HA 2QUVA 1B3YA 2PB1A 3B9NA 1QNOA 2XINA 3PUDA 1ZZMA 1B4EA 4C6EA 3EA1A 4UXDA 3H12A 4F0MA 3BC9A 5CXPA 2IQDA 1VBGA 3FDKA 3EA2A 3GH5A 3ZO9A 4F3HA 4PTXA 3WNNA 4M6PA 4M1RA 1TUFA 4O13A 3UPWA 3CK5A 1M6JA 2NX3A 5T9BG 4DUWA 3W72A 2B81A 3MUY1 1QT1A 3URQA 4B92A 1MQPA 1T8QA 1WBHA 1YNQA 5A8PA 3S2NA 1NDVA 4I6VA 4BI5A 1TTIA 1K7EA 2GVGA 3IJIA 3PJUA 3W84A 1TTPA 3CB3A 3UR5A 2ZFAA 2NXHA 4NYYA 2DZPA 2PTDA 2B7PA 2BXYA 4B5SA 3EBVA 4B9YA 3TFXA 2Q71A 2FHBA 4P8VA 1ONWA 3GNNA 3TA6A 1WO2A 3ARQA 2YGYA 3L4UA 1Z44A 2YW4A 1AK5A 4OBRA 4NZ3A 2YXXA 5E93A 2XGIA 3SSZA 2XIMA 4E2VA 1VR6A 2ZUNA 4GVIA 3M5YA 4PTNA 3QYQA 2O4MA 2OSWA 4A2SA 3U8GA 1MZHA 3N9SA 4A8NA 1H09A 3A64A 1Q6DA 1QPOA 2VX6A 2PDWA 3AROA 1KM2A 4PMZA 3T42A 3CWHA 1HG3A 2V0TA 3NUKA 3TWAA 3E2VA 4FK9A 1JXKA 4WZHA 2IPWA 3N4AA 2QJNA 5BRPA 3I7SA 4QG9A 4HOZA 4EPKA 2J75A 1ZQ5A 3M7SA 1XIBA 1R3SA 2WLZA 4WR3A 3BPWA 2YKKA 5HPOA 2BZNA 4LU0A 3PAJA 1DPMA 4XAPA 2BVWA 2VFIA 1VYSX 4NUWA 2BBFA 3WMLA 3P14A 1J0KA 1K7XA 2X30A 3PF3A 3VO0A 1GJWA 4C7GA 2OEJA 2XUCA 3CUHA 4U10A 1XLAA 1TV5A 2R1MA 2X1UA 5C54A 3IACA 4C6IA 2FB2A 2ISSA 2XJ7A 5I3IA 3C61A 4PRTA 3M0KA 3OBKA 3TH6A 5A6JA 2VEKA 3QSRA 4H8VA 2OGYA 3OQ8A 3N1AA 1RBOB 5DXYA 1A0CA 3HGRA 3KAOA 2BFGA 2ZZ2A 3UWEA 1SQ7A 3AXIA 1VAHA 3UR8A 5FJPA 3T8LA 4BI7A 3OVRA 2F61A 1IQ8A 3DI0A 1AW2A 4NNBA 4FNPA 3O6CA 3FHAA 1NWSA 4HN4A 2DJXA 4XWUA 2AKZA 1O66A 2FMOA 2INZA 5K2ZA 5I6SA 1LL6A 5FACA 3TJIA 1EA9C 4O1CA 3LMZA 1LWHA 1DJHA 3GLCA 2I57A 4IP4A 1DJZA 3LI0A 2PGWA 1BXNA 3A3WA 3KXQA 1P7TA 4GO9A 3KBMA 2ZCGA 1TPUA 1IXPA 5B7YA 4CD6A 3ARXA 2VMFA 4W7UA 1TWWA 4ZB5A 1XLIA 1UJQA 3ICJA 2OMAA 3B8UA 1SGJA 3RFAA 3LPFA 4PUDA 1H5YA 1BVZA 1P6BA 4R9OA 2FTPA 4AY8A 4DZIA 1IHIA 1XJBA 2GVEA 2VI0A 4XSLA 3QQ0A 3VINA 8CGTA 4IFKB 1H1ZA 3AS3A 3G1YA 2VEFA 3AJXA 2Y89A 1WDSA 3WJZA 3O1NA 6XIMA 3F4WA 4JQ3A 3PUGA 2ZVIA 1TPFA 1RHCA 4DF1A 4MOZA 4WKHA 2PGFA 3K13A 3HGOA 4D1IA 5M1TA 5CC5A 2D2GA 1E5JA 2OODA 1GVQA 1CECA 4AMAA 4R7WA 2CBJA 1UKQA 2ZE0A 4OKDA 3USZA 3K2GA 1N7KA 2Z4GA 4I7UA 4J2PA 3TN3A 3CT7A 1XSJA 4IIEA 4W5ZA 1C7TA 2JF7A 1JF5A 1RLCL 5AHMA 4GYKA 4LYQA 4PB4A 5DCBA 3WD4A 2XH7A 2Z6JA 8TIMA 4DYKA 3NVTA 3OHMB 4Q8QA 3PZUA 2OT0A 1Q6EA 3QRHA 5U7SA 2ICSA 4DELA 1E9YB 4XTDA 1MW2A 3RU6A 3W86A 3GFZA 1UIPA 3RUBL 2V9DA 4XAZA 1YDOA 3PJXA 3UJRA 1HVXA 4KWOA 1B4KA 2DZVA 2OWWA 3N2MA 5J5RA 1KR1A 3B8TA 2I9EA 3N4FA 1EP3A 4XO7A 4GIEA 2G3FA 3LUTA 5MKGB 4BF7A 1HVQA 4J1OA 3VD9A 1FHVA 3S1UA 2G0WA 4AHQA 3UZ5A 2Y8VA 3OGSA 4HCDA 4E8DA 3TAKA 2BMBA 4WKFA 2J4GA 2Y70A 2BX7A 3TC7A 1WDWA 5EMLA 2D22A 3AZSA 3P3BA 1H50A 4HHPA 2NX1A 3RO6A 4BEUA 3H2CA 1K8XA 3NYZA 4RZ4A 1UA7A 1E3ZA 4AYGA 3ITXA 4X9SA 1QASA 4MDPA 3H2AA 2X0HA 3UCDA 1MEHA 3HBLA 5HDRA 3TA9A 3KHDA 4E4FA 1NM9A 3Q67A 2DP3A 1H51A 2JALA 2P10A 4WX2A 1DWIM 3E2QA 3MCMA 3N04A 3ZFHA 2X42A 1B3VA 1IT0A 1SUXA 3BARA 2ZRUA 3L2MA 3V7PA 3AXXA 4YWSA 3GAYA 4YVXA 1W1YA 5BWFA 4H8HA 1UH4A 1OFBA 5A8OA 4QEEA 4DQWA 4RR4A 1CWYA 3O05A 3MVTA 3PHAA 4JTJA 4XAFA 4NZFA 4QRNA 1UR0A 2PWFA 3WLRA 3K30A 2A3AA 1N55A 3MQTA 1XDLA 1XIIA 2YJQA 1PWMA 3O07A 1DWGM 1S5TA 3QKEA 3HMCA 2FZBA 3VI2A 2BODX 3TEVA 4UCFA 4PBGA 3GFYA 4UTTC 5BXPA 1OFAA 1V3JA 4KIEA 4MHBA 1FKWA 4QJ5B 3W02A 5SWUA 3RPMA 4FMVA 2XVPA 5C5YA 4KCVA 3GXPA 3K1DA 2NQ9A 2EXOA 1E71M 2YR1A 4B9ZA 2VO5A 1K6WA 3KZSA 4LH8A 3WLLA 3A4WA 1YE6A 2QCHA 5LHEA 1A3WA 2C15A 5HMEA 2VWSA 1AQHA 2EPLX 3HFTA 2YDQA 2D1ZA 3MW7A 4GCXA 2CHNA 1A5CA 3RILA 2FHCA 1HL9A 2Z00A 3RMJA 3WNMA 3PTQA 3TFCA 1OADA 4Q4QA 3HPSA 2HV5A 3NQ6A 2NSOA 3WLPA 3MY9A 2G3JA 2XIQA 5FESA 3QTGA 4MNMA 1H7XA 3LB0A 3W1QA 4PUWA 2ZRZA 2XISA 1WDQA 2GUYA 4N4QA 3CHDA 4AIBA 3DAQA 4QDMA 1TIMA 2CW6A 3G2GA 3LLFA 3WFLA 4JFSA 2PLCA 1X39A 2R6OA 5KZMA 1I6NA 4GY0A 1Y5XA 3WQEA 1KBKA 3W1RA 3DERA 2PZ0A 4K6AA 2X0SA 1F3WA 3N73A 4IGMA 1X6NA 5H8UA 4IQLA 1CXKA 6A3HA 4HSNA 1V0MA 4DUVA 4BKNA 4C6OA 4N02A 1D8CA 1XH0A 1EJWC 2OR2A 1RAKA 2ZWZA 1SJCA 1M04A 3JZEA 1FWJC 2J47A 4GABA 3ATZA 4JY8A 2DIKA 3LMYA 1DJQA 4D8LA 3WJXA 3L23A 1C9WA 1V02A 1EOMA 4HB7A 4I7VA 2CWNA 1FWHC 4H7ZA 3F4CA 3MCNA 1NH6A 2TODA 1HTIA 5IXEA 3WD3A 3G1RA 2WB5A 1MW3A 3RMEA 3TAOA 2CU0A 4HK6A 4F0SA 1IIHA 4RPQA 1B54A 4KH2A 5C55A 1C90A 4O18A 5HXMA 2NQ5A 2Z7KA 5CJMA 2Y5JA 1Y7VA 1XIJA 4Z1CA 1K4HA 2PDMA 1SFSA 3UGRA 4PFHA 1GTHA 3CEUA 3LCLA 4GI4A 4J3ZA 3SB0A 3JW7A 2PP1A 4DBDA 4LVBA 1MW1A 5A6MA 4F2UA 4H4IA 1HJUA 4UQ9A 3QHNA 3EPMA 4UFMA 3NZPA 3LPPA 3CL7A 2GLKA 2OO0A 3LNMA 4M29A 4H2CA 4DEFA 5HUPA 1BF2A 1FXQA 3WUGA 1LROA 5A95A 1EUAA 2XN0A 4GFSA 2Z1VA 2QLYA 3PZGA 5D4YA 3B9OA 4KFNA 1K8YA 4HPGA 4YPJA 3CZGA 3PB2A 3T44A 1KTNA 3PWGA 2J77A 5CPSA 3GSMA 4ZOBA 4ZSTA 4N4PA 3ONCA 3IV8A 1YNPA 5D2YA 2Y6ZA 3USBA 3MKCA 4QCFA 4ZE5A 3EEZA 2V68A 4K39A 1UH3A 4JN7A 1PZ0A 3BXWA 4Q7IA 1PJ9A 4JX6A 1RQHA 4XD3A 3FS2A 1XLKA 2NV9A 3V5CA 4QE4A 4M1BA 1JPMA 2JE8A 3WQ8A 1PZ2A 3VOFA 5BRBA 1AG1O 4RL3A 4KGJA 3GXTA 1AA1B 1UWUA 1X96A 2GJXA 1GYNA 1HW6A 3CU2A 2W61A 1J0IA 1GONA 2QV4A 1A50A 2YYTA 4KEVA 3ZJ7A 1S3HA 4NXSA 4DO5A 4NX0A 1VHNA 2QIWA 4ZEPA 2XTKA 1GGOA 4B3KA 1A53A 2R91A 1W3LA 2FFIA 3SUWA 1K9DA 3ITYA 2GWNA 2WQPA 4LUTB 2VELA 3ZM8A 3CZJA 1Q66A 3QXBA 1Y5VA 4UFLA 1PCWA 1KBJA 4DZ5A 4QG6A 2HPIA 5E0CA 4KT2A 1CLVA 1IZCA 3UEQA 3GNXA 4AF0B 4W87A 5CLWA 3TC6A 4GWEA 5BU6A 1TQXA 1JPIA 1TPH1 5E0FA 4OHQA 4L6DA 2J88A 2FGZA 1E9IA 1HKKA 2AAAA 4JTIA 2AL2A 3T09A 5LA0A 1LDCA 1AL8A 1FKXA 4ZZ9A 2Q3RA 1XQKA 3OZMA 4GIAA 1I2OA 2OQHA 1L6GA 3L5AA 4GNKB 3QR3A 4Z08A 1U83A 4LF1A 2CXEA 3GNOA 4BF9A 4N9EA 4GJ1A 1MXGA 4A3HA 3R58A 1XBYA 3P80A 1I2PA 1W1ZA 3TJLA 1CB7B 2NV2A 1GVOA 3GU2A 3VIIA 4F9JA 4ZQRA 2YCIX 5JVLA 3P81A 3GE7A 1M03A 2FYMA 3S2CA 1XLLA 1MMFA 1Q7MA 3T40A 1VCFA 1LF1A 1NQKA 2VGIA 1V7YA 4MYAA 4UB9A 4J9JA 1DJYA 1EPXA 2QQ6A 1EJVC 4J7RA 1Q8AA 1NP2A 1J12A 3RCYA 4EVZA 3BG9A 3GC4A 4GVHA 4Y9AA 3E38A 4GVFA 4Q22A 1TMHA 4AH7A 1OT2A 3LU2A 3RJXA 2ZX8A 4O1BA 3ZR6A 4JIHA 2WC3A 5DXXA 1UMLA 5GPRA 3R8GA 2C0AA 4GX9A 4IGNA 3WMCA 4LV9A 1DXIA 3KX6A 4OWGA 5DBTA 1Z3NA 1PIFA 3VMPA 1OFOA 3VC5A 1QCWA 1XWYA 3DFHA 1UUMA 5LIKX 3URBA 2CBVA 3V1PA 3MJYA 1L0PA 2GDUA 3CIWA 3FSTA 1R85A 2XVLA 1M7XA 4LAZA 1F4HA 2GOUA 1F4AA 1ITXA 1ONRA 1KWGA 3N6HA 3T05A 4OECA 3B8DA 5DANA 4UOZA 4DB7A 5DT5A 1GCYA 1Q5MA 3E0VA 3A47A 4YNGA 4W9TA 5LNSA 2VWTA 1BXCA 3C6CA 3IUDA 3BJFA 4AXKA 5LIWX 4GX8A 1L6FA 3ES8A 2YLLA 2D23A 1XS2A 2WJZA 4LB4A 1EOKA 2W9MA 4RW5A 3W1UA 3ISIX 1FP8A 4NX5A 3G1VA 4AHOA 2O0TA 3RCMA 5CG7A 1J11A 1OG6A 4GZIA 2GVYA 1V6WA 2Z1WA 3RLUA 5K4ZA 3HGSA 3LXBA 1FWGC 1VJSA 2GVLA 1GOKA 3W74A 3CQJA 1Q13A 4YWIA 3OHIA 4JFVA 3KFTA 2QDDA 2DQXA 4HVXA 4F2BA 3AIEA 4ZENA 1LZOA 4DO6A 3MB9A 5U4NA 3QZAA 1BRLA 3LS9A 4JZ5A 1QNPA 2OZ0A 3WLHA 3EOOA 3WJSA 2ESCA 4B15A 3WQDA 2FTWA 4C60A 4D1JA 4NG3A 1R3RA 3PAOA 1PX3A 3E0IA 3LBOA 2WYSA 2V3DA 3S5OA 2HROA 2WM1A 2QEZA 2WK2A 1NFGA 5T91A 4F4RA 4Q4RA 3SCQA 3Q65A 4JNZA 1FCVA 3W28A 4C1NA 2CYGA 4LOCA 3BVJA 3L67A 2YA0A 1NIUA 3WL0A 4XG1A 2PF8A 2PDCA 4NJHA 3NQ2A 4GACA 3W29A 1VIZA 4RW3A 4C91A 1L8NA 1MNZA 3EDKA 4NRSA 3OZYA 3ZT6A 4WGHA 3VNMA 3WF0A 4MJMA 3APGA 2ZXDA 1NF7A 1DWJM 1GHSA 1XLGA 4O1EA 5A5WA 4AB4A 1HGYA 3KVJA 4QIUA 2C1HA 1VBRA 3H26A 2DUXA 1R9ZA 5H1WA 4DN1A 1PO9A 2QVNA 2J7FA 2ZRWA 4JPGA 4QE1A 5LXEA 3EYPA 3DFQA 1MDRA 3H7VA 5IRPA 4YTRA 4WUIA 3W7KA 2NVAA 1FY6A 4MADA 2X16A 3GK0A 4FPSA 4BWLA 4TX8A 3ZVHB 3KZPA 2J7HA 4NF7A 2W27A 2EGZA 1MSSA 4Z0SA 1YPIA 5CPOA 4NKCA 3O8AA 1GTEA 3S42A 1E56A 2ACSA 2J7DA 1S2CA 4U2YA 3NDOA 3PBVA 3TOPA 4B2DA 5H91A 2XGBA 3MSGA 4J3VA 3I4KA 3I6EA 2WC4A 3GS6A 4O17A 5DMNA 1SO6A 5C9XA 1JGIA 4WOZA 3P67A 3UR2A 1U2YA 3NEVA 3BANA 3HG4A 4QTGA 6ALDA 3VGGA 2QDEA 1MXSA 1EHAA 3F5JA 5D9OA 1WDRA 2GWGA 3IIZA 4W4QA 2Y5EA 4RXFA 3KBWA 2F6KA 4KCWA 3LHTA 2QJGA 3BTNA 3LXAA 1KM4A 5HNTA 2HJPA 1MFUA 1EO5A 3U9IA 4DUOA 4Q8PA 4LVDA 4DBWA 1EDQA 3UNTA 3APTA 5F7UA 5JBDA 1B1YA 1W1TA 2CEQA 3EXSA 4RDYA 3RAOA 3WDRA 2VR4A 1W5QA 2A7RA 1FWFC 1DXFA 4TOQA 1BGGA 2PI6A 1OQFA 3OLDA 8XIAA 4KQNA 1PIGA 2HWGA 3FVMA 3AJ7A 5CEWA 3GVQA 2J8FA 2HS6A 3SCUA 4CQDA 2PWDA 2GOKA 4D6FA 3EDFA 5HATA 6ENLA 4H9UA 2WCGA 5DELA 4H00A 2PU0A 3V18A 1DORA 1BG9A 4HN8A 4TTGA 5CZJA 4PZVA 4M82A 4DHGA 5AVHA 1ZGDA 3UG3A 2O9OA 3NSNA 2BVTA 4QLLA 3H21A 3AS0A 5EKYA 1FX6A 4XBKA 5T8GA 4FI4A 1OFPA 2VDGA 3OGRA 2ACQA 2A6LA 2EPOA 3IIPA 1BRLB 3WO8A 1RP9A 3O6AA 2J8GA 1RALA 3PSWA 1OSEA 4QP0A 2ISDA 3VPLA 3NO3A 2JKEA 2NXIA 3FXGA 5G5IA 5A6BA 1YYAA 5EMMA 4EWJA 2FZ9A 1D3CA 5EBAA 5A8GA 2PUZA 2FDMA 3PJTA 5M5DA 4Q33A 4G9PA 3FEQA 4GPNA 5FEXA 2CIPA 1TJPA 2FHFA 3ARWA 1E6QM 3UG5A 1UZHA 2AGTA 2O56A 1QU4A 1VCGA 2VC6A 2IKHA 1PKMA 2BG5A 3N2TA 1PTDA 2QPSA 3UWWA 1W8GA 1H0IA 4NI8A 3A22A 4C5ZA 2VVSA 3O16A 4L7ZA 2VD9A 4YHGA 1GK8A 3HM7A 1XYBA 3W87A 3W7NA 3BMXA 1UP2A 5HQEA 4FS9A 2OZTA 4DZHA 4E2BA 3GTFA 1V93A 3FLUA 4U2ZA 4YYCA 4IG2A 3P6LA 1HKVA 5CPMA 4FLSA 3S8HA 7CGTA 1OZQA 3FJ6A 3LX9A 1MZRA 4K36A 1SFJA 2UY2A 3B0VC 4L9ZA 5FJIA 5IHRA 3DGRA 2Z27A 4XVEA 2SFPA 3M41A 4LUTA 3NVDA 3MI6A 2X40A 3PTDA 5I07A 1FWRA 3STGA 1B3WA 3GQYA 3KCLA 3O9NA 2DH2A 3RN6A 1R0MA 4HPNA 2UBPC 3SAZA 2IPFA 1H4PA 2P3EA 2ZUMA 1NWRA 2PC8A 4WHBA 1UD3A 2Q8LA 1XLMA 1UD8A 1SJBA 1T6MA 3OBEA 1TMQA 4YCOA 1SZRA 4WD0A 4CKQA 4LCQA 3M4HA 3O0KA 3O06A 4QLJA 4M6UA 3URNA 1E0WA 4JEQA 1Q2RA 2VURA 5AHNA 2V3EA 4TXEA 1WKEA 3IGXA 1AQMA 1JPHA 3IWPA 4CCDA 4WDUA 2VP8A 3MDUA 1DBTA 4MY9A 4QCEA 2BHYA 3OBAA 2HE8A 2VR5A 5I3KA 5A94A 3ZS4A 1VLWA 2PZNA 3ABRA 3KL0A 4IIDA 1GNXA 2X41A 2J9YA 4RZ6A 1XD0A 4J35A 3TQVA 2WC7A 1AJ2A 2QPXA 1HT6A 2PDIA 3AIQA 3B9EA 1NELA 4NU7A 4O1DA 2CLPA 3QZEA 3DBPA 2C18A 4ZQCA 4GA8A 3T81A 2GPTA 1NVMA 3FJ4A 4GBUA 3TZFA 3FXYA 3DDMA 4P61A 2BXZA 1ZSXA 2QCGA 4CGTA 1UZ1A 4GZJA 4UNLA 4LAKA 1GJPA 4AD4A 1I8JA 1PDYA 4MNLA 4H3DA 2EAWA 4LV4A 3O2LA 2IXVA 3NZGA 3WF4A 4IICA 3SDOA 1A4MA 5MKGA 2OB3A 5EB8A 4H2HA 3KRSA 5I09A 5C9RA 1Z48A 3QEZA 2FH8A 3EPNA 4YVPA 4JIQA 2PDLA 1FBAA 2CITA 1IGSA 3ORWA 1L6WA 3FCPA 4D2JA 5BNKA 4Z2IA 1UW9A 3VNZA 4AF0A 1LRNA 2QGHA 4GUIA 4W88A 3WK0A 2WKJA 3ABXA 4HNUA 1E43A 5ABGA 2VFGA 3S9IA 1UR9A 3S46A 2WWDA 1JRCA 3GDTA 4JIRA 1K70A 5MF5A 3VDHA 3VGDA 4N9DA 4XVDA 4Z2GA 1SVDA 1E4LA 4HTBA 1C3FA 1M9HA 3VUPA 3AMGA 3CGTA 3QSTA 4ZO6A 1ISXA 3MZ2A 3L4XA 4BY3A 3SCTA 3RDKA 4L6OA 1U5HA 3LTSA 4XZLX 4DRSA 4ZGYA 3AYRA 1P0NA 2PTXA 2UZ9A 1AD1A 4FXFA 1XICA 4WDWA 4W5UA 2YCLA 5HANA 4KPLA 2GUUA 3FW6A 4TU1A 3GG0A 1R9XA 1UWIA 3TDFA 1LJYA 1L9WA 1IE7C 2Y85A 5LGXA 1P0DA 3BWWA 4NZJA 3VC6A 1TWDA 1XG4A 1HKWA 4TMBA 1MQQA 1DE6A 1UZDA 1M5WA 1W1IE 3SCVA 4S3BA 1VCVA 1QJWA 4RDZA 3UJFA 2IKJA 4J2MA 4IOTA 2YCLB 4V15A 4Z2KA 5A2BA 1FOBA 1UP3A 2CLIA 2XSXA 4PTWA 4AVOA 1VPQA 4JNYA 5CC3A 3M0YA 4ALDA 4J40A 2VDHA 1DQXA 4C1LA 2RDWA 2GYIA 4PRRA 3DH7A 3CMJA 3HPAA 3TN5A 4HSOA 4DVOA 3S1GA 3ARVA 3ZZ1A 3VYLA 1O95A 3WEOA 3VNYA 3D46A 1M7OA 3Q37A 2BOFX 3H7RA 4JQAA 4H7VA 5E9XA 1R46A 5HMFA 3UZZA 1LTDA 3ITGA 4B5XA 4EAYA 3MUXA 3SUUA 2A3LA 4U3AA 2B7NA 1VRDA 1XYMA 4IMEA 2QZRA 5DBUA 4BA0A 4LUJA 1I2QA 3QY7A 3EWUA 3ANUA 1PSCA 4G7EA 4DLFA 1VP5A 2IPGA 3HV8A 3CQKA 4H6KA 1E9ZB 4GYPC 1XRFA 2YBUA 3QC3A 4K8GA 2QJMA 1P48A 1TQJA 3EMQA 5HNNA 3VIJA 3VMOA 3RX2A 4JTGA 4JIEA 4DYJA 1JDDA 2WVSA 2XVKA 3A6OA 3VKKA 4UNKA 3ZVHA 4O0QA 4KEUA 5HPCA 2OGJA 2OLAA 1R30A 1UWRA 2XSBA 3NGFA 3PR2A 3CO8A 1GVEA 3A9BA 1W1VA 2C79A 2FZDA 3VKJA 4R53A 4WXYA 3BICA 4JKMA 4MJZA 1WOBA 4B3ZA 4RZ5A 4P8WA 2P5NA 3VZXA 2Z2UA 4O54A 2QNEA 3G1SA 3MHUA 4X63A 4FOJA 2GQAA 1EGVA 3ITOA 5A3HA 3R1ZA 5A6BD 2G4FA 3DKJA 3G5EA 1NARA 1S2VA 4JAWA 2C71A 1RD6A 3ELFA 1PKNA 4M81A 4PMYA 3ARTA 4KRUA 2JGYA 2V6AA 3W7LA 3HFYA 4RV8A 3IVUA 5A6AA 3DFNA 4GYFA 4JHOA 4PMVA 3S2LA 1RXOB 3KL3A 3VGBA 1EX1A 1QATA 2FZNA 1U30A 5AOUA 1VLIA 4CD4A 3BOLA 1ITUA 4JTDA 1XL9A 3AUJA 4D71A 3LV6A 5G1MA 2E28A 5A8QA 2W92A 2BY3A 3QY6A 2Z7GA 4AZCB 2GJNA 2V63A 4DNHA 1OZMA 3R5EA 3W07A 1KFJA 2HSAA 4BI6A 1RR2A 1XIMA 2DZBA 4MKSA 3LNPA 1A5OC 1E72M 1XLEA 4HU4A 2PD9A 3UETA 3PSVA 5MHBA 4HCHA 3B4UA 3P84A 1FQ0A 2D3LA 4G1NA 2YX0A 3A13A 4V33A 3AU2A 1G1YA 3AYSA 5GNZA 2XH4A 3MP3A 5HJLA 1EJRC 3PZTA 2QCDB 1BYAA 4RNJA 1HJVA 3BSGA 3I65A 3WMSA 2HNHA 1UHVA 4CD7A 3N34A 1YLVA 3UPBA 2KX9A 4PR4A 4DJDC 1PKYA 3S9ZA 3CO4A 4B5NA 2OOFA 4FXSA 3C2YA 3TMLA 1E4MM 4QHRA 3COTA 3ZJ8A 2X1TA 3BL3A 1UD4A 5C9WA 1HX0A 2GGHA 2QJJA 4LQ1A 4Y96A 1S2AA 3DYMA 1F6YA 4JCMA 1BSIA 3SJNA 2J6VA 3BGAA 3S9YA 2XM2A 3D5HA 2Q02A 4A8LA 3VKCA 1GG0A 2XIIA 3NGJA 2D20A 3MKVA 3W23A 3IVTA 1DJWA 2G3NA 3PUOA 5LZLA 2ABAA 3EB2A 2ZXBA 3PZ9A 4PGLA 4D6GA 3S6DA 1ZJHA 4WCJA 5DF0A 4DLMA 4O8RA 3IUHA 3W1AA 1KD0A 3ZOAA 4FR6A 4YMZA 3TJ4A 3EWDA 2RHGA 4JTLA 1UWQA 1CGXA 2DZAA 5DO8A 1U33A 3KVKA 2PPGA 4KCTA 2QW5A 4M7SA 3NXLA 3L2LA 3T2PA 3PG9A 3K8LA 2DPEA 4FSAA 4UZUA 3WDIA 1JCYA 3D6NA 1A49A 3IS4A 4O1FA 2QR6A 2AL2B 4YTTA 1S2WA 4US5D 5BROA 1EWEA 3GR7A 4CEXC 4GFIA 5D32A 3DC8A 1FFRA 1NOWA 3MSDA 1JZ5A 4DIAA 2EPMX 3IK4A 3FSUA 2NQZA 4XQ6A 2PA6A 5I06A 1HXJA 4LPCA 1XDJA 3NG3A 1W0MA 3STPA 1UR8A 2G96A 1VKFA 3UCQA 4FAMA 3Q94A 3R4IA 4EXQA 3GW0A 4B5WA 3VIKA 3PNZA 4D6CA 4IMDA 3HGJA 4TUFA 5DT7A 3WY1A 2J78A 1I4NA 1TX2A 3CB8A 4FEZA 3N6QA 5BXSA 5K3VA 1GYLA 1WDDA 4LB3A 4PMXA 1GYMA 1LT7A 4IWWA 2L5HA 3UGVA 5FJUA 3QH2A 4HHLA 1F3EA 1F2JA 3I3BA 3W1LA 1B5TA 3EB4A 4IFRA 4UCGA 1GPWA 3VA8A 2CC0A 1UYQA 2WVVB 1X8FA 4H9VA 2PTYA 4W89A 1K8ZA 3TW9A 3GC5A 4JKLA 1WV2A 1KRAC 3LHYA 3LLXA 2PRLA 2PEVA 1WXYA 3H54A 2CFFA 3KTCA 3KW3A 3KP0A 3KOWA 2VZOA 2FIQA 3U4AA 2QDHA 2Y7FA 1Q6CA 3DG6A 2DT3A 4XUGA 1Q6OA 5GVJA 4MKNA 4LF2A 4LAOA 2DZTA 2P88A 3PZVA 2V5KA 2E68A 2OOGA 2V5CA 4DBUA 2PDPA 1ZP4A 3PN8A 3LTPA 3Q4DA 1MWOA 4NXKA 1IIGA 2WW5A 4XK2A 3RO8A 3B0PA 4FLRA 1AJZA 5ECUA 1ISVA 1JAKA 2A4AA 5DMYA 1CGUA 1LLZA 3MSRA 1YXYA 3PM6A 2V2CA 2Q8ZA 3GIPA 4PUNA 4LTSA 2YDSA 2ADAA 1X1OA 3WELA 1I60A 3E5BA 1BFNA 2ABBA 4GMEA 3M46A 4F0KA 1A3XA 4JX4A 2B31A 1ML1A 3DCPA 2YZ5A 1P4CA 2PE4A 2RFGA 4EANA 3U2EA 5REQA 4Z17A 3SQSA 3CZEA 1I0DA 5AHFA 3SEPA 1V0NA 1KRCC 1V0KA 2OSXA 5A2AA 4F79A 2C8NA 3HPXA 5D8ZA 1C8XA 1EEXA 2A3CA 4PULA 1X7IA 5F2MA 3WLQA 3OIXA 4PMUA 4DX3A 3XIMA 2BTMA 1OD8A 4MZ8A 1XINA 3G18A 4FF5A 3CPUA 3ABOA 5JIWA 1LM1A 5HA7A 1MRAA 1PHWA 3DZ1A 3UW6A 3B04A 2G8ZA 3QPYA 3U4FA 3PS7A 3UR7A 1TWSA 1OGSA 2V5LA 3WZ0E 1NQ6A 4UMAA 4RX0A 3TKFA 4C6CA 4S1FA 4LBRA 5K9DA 3IUIA 3U3HA 1JEZA 1TJ0A 4HZ8A 4O10A 1XI3A 3LZ3A 5I5RA 3I6TA 1O7AA 3VOHA 3W7CA 1JZ2A 3CV2A 3P0XA 5AHEA 1UKOA 3TQ0A 3CMGA 2OJPA 4FXJA 4H19A 4C6DA 2YCKX 3BLOA 4XO6A 2C19A 2VT0A 1M65A 3I3EA 1ZAJA 2A85A 1M53A 4Q8WA 3OVQA 3RXZA 4H8NA 1KWKA 5CZSA 3LCHA 2DZWA 4YL2A 1BEUA 5FF2A 1M68A 2OVLA 3PBMA 4CNTA 1DIEA 3AMLA 4LY8A 3W7JA 1TSIA 1YNYA 3GUGA 3AUOA 3H2FA 4PMQA 1NWUA 3DFSA 4KWVA 1U1JA 2G50A 1K6AA 3ZR4A 3LERA 4TV6A 5D8WA 3AZTA 5IFPA 1LL7A 3WD2A 3VIGA 2AKMA 1NTHA 4IL0A 4AZ7A 4OV4A 3T8QA 1P0EA 2KAUC 3GDLA 5F1VA 3MZNA 4MKVA 2ZUVA 3WQOA 3QMTA 5E9AA 2YBTA 1UIOA 4H8UA 4Y9NA 5I3HA 1VFSA 2ISWA 3KDNA 7REQA 2A6NA 5CLTA 3EWXA 1UJPA 3CV7A 5IDIA 3U5UA 3A4AA 4CU7A 2X7VA 3H22A 4PCPA 4I5RA 1T0OA 4LAUA 4LEQA 3AXKA 3T0TA 5EMKA 5CJNA 2XWEA 5A6SA 3AZRA 1K8CA 1LLOA 4M3PA 1EQPA 3W1PA 5FIPA 2QV5A 2TMDA 1CGTA 3HURA 1JZ4A 3TZNA 4L1GA 3G77A 1XIFA 1QNVA 3T6CA 1OIMA 1Q6LA 1KA9F 7ODCA 4ZVJA 1EPVA 5AY7A 4MWAB 5TNVA 4AWSA 1TWZA 4Q7NA 2WMIB 5LNWA 3D3FA 3TV8A 1W1PA 3V0UA 2ATSA 3L4WA 1VFMA 1WA3A 3OVPA 2GJRA 2HPMA 3LD5A 4LCSA 1P1XA 3QGKC 1M1BA 3EKLA 5KMYA 3B0UX 4PE8A 2GDVA 2OZ3A 5T9CE 2QJIA 3NTYA 4ROQA 1J5TA 1PTAA 1Z69A 3TW6A 4Q8VA 5FI8A 5J5DA 1G7VA 3SUTA 3M5XA 2NUXA 5GJMA 4GC3A 1AH0A 2RJHA 4JDYA 3BZJA 4HZ7A 3CL8A 4I9TA 2AL1A 1KGXA 4GG9A 1GJUA 3UJ2A 3F03K 5DRIA 4U5KA 3KBNA 1BYCA 3UPMA 2J7BA 1W17A 3PZNA 3PZQA 2PC4A 2V5BA 5CBBA 3LZ5A 3TLLA 3UY7A 1VYPX 3E6EA 3IRSA 2Y1HA 5A6LA 2DUAA 3OOQA 4Q4KA 4N42A 4ILSA 1XIHA 1K77A 1YHTA 3BAXA 5FL1A 1SZNA 4GNVA 4QISA 3G1AA 4E2OA 2ZXAA 4AX7A 3GU1A 1TJRA 3RHGA 1TRIA 4MWAE 1SW0A 3MO4A 1VQTA 3WK1A 4PB3A 1MUMA 3AHZA 1G94A 1OD0A 4O53A 2BASA 5GQBA 3EOEA 3NL2A 3CYVA 4QSFA 3TYBA 2G37A 4H9MA 3W3OA 1KLZA 3ITLA 3VDAA 1UA3A 5HR6A 1QNQA 1GOWA 1RZMA 2PDQA 4Q4MA 5G2IA 2YYUA 4YTUA 4CQ8A 3W6YA 1AQFA 4DJFA 1O4UA 3U57A 4D6HA 3FJLA 3NO5A 3NM1A 3T07A 3TU9A 1EWDA 2ONEA 1TIWA 5F4XA 1EO7A 2DT0A 1TTQA 2H3BA 2HMCA 4ZE4A 1UROA 1W3KA 4O15A 1GEHA 1V08A 1EL3A 1DV7A 4NILA 1E6NA 1H0GA 2BVYA 2OG9A 2DV0A 4W85A 1XLJA 4ACZB 4GI8A 4S3DA 3TNOA 1VPXA 3C0JA 1YW1A 1TX0A 4IX0A 5HQLA 2Z28A 1TV7A 1SU5A 2XFYA 5EMYA 1WXZA 2FLIA 4MWAA 1MEWA 4MB4A 4Q4SA 4UTWA 5CPQA 4ES4A 3GXMA 1DWAM 3QMRA 1UR4A 4LAMA 2BS9A 1CGVA 3C4UA 1GQIA 1PHQA 4L4MA 3KOFA 2RGLA 4MAVA 3R89A 3HA1A 3GZ3A 4J5NA 3K8KA 3PPCA 1KCXA 1SJDA 2DY3A 2XZ9A 3MO7A 4C6MA 4E3TA 2YDAA 4OV9A 4KF1A 4AXNA 4GKLA 1GORA 3E96A 3G1HA 1EBHA 3THUA 3W2JA 1XQLA 4Y9PA 3C2VA 3DHPA 2QCMA 1JD7A 3EZ4A 3LM3A 3QR0A 1ZHAA 3AIRA 4C6LA 2Q01A 3B0YA 3T4CA 3TN6A 4HBKA 1QW8A 3UZWA 1XDMA 4V1YA 2PSNA 5LA1A 4NT0A 3LCXA 3NZQA 1NOFA 1QTWA 1HJXA 3SN1A 2WQDA 3A21A 3WDPP 2GQ9A 2O9TA 3QV6A 1DJXA 1J9YA 3MV11 1KM6A 1XH1A 4IGHA 3P5YA 3VFCA 3GB6A 1GPFA 4CU8A 1V03A 3G0UA 3DUGA 3KL5A 2FVLA 4LS1A 4NAEA 5H8PA 3RRXA 1KNWA 4US5A 1NJJA 2TPSA 3TUUA 3RLGA 1ZBKA 4PSPA 2B7OA 1JYWA 2VZSA 1H1YA 1JR1A 3GDKA 1ITCA 1N2VA 3SQLA 1U1UA 1WBJA 2GVJA 3UYCA 5B7ZA 3LA4A 2YL6A 5KZEA 1R3YA 1TJ1A 1R8LA 3E9AA 4FIRA 1PVNA 3M7WA 3CUZA 3F2BA 2LLEA 3TVAA 3W70A 3P8IA 5LGZA 1O12A 1XD1A 1WAUA 2FZMA 1V6XA 5G4WA 4OGZA 1EJXC 1FUYA 1L6SA 4QBXA 2REQA 4AFYA 3FEMA 1JVNA 4KWWA 4ZXLA 1WQ5A 1NOUA 3VZYA 2YB1A 4R5EA 4GBDA 4MFEA 5I24A 4TVDA 2QCCA 2V8ZA 1ITQA 4R7OA 3VILA 1ZTVA 1EB3A 1JCJA 1WP6A 3GVWA 1HZYA 2DQWA 4QFUA 1SW3A 4RNIA 4UUIA 4FHAA 3VNIA 1EJUC 1KM1A 4E5TA 1JYNA 1QW7A 2D2OA 3S47A 3CHVA 3IV3A 3AYVA 3CYJA 4ICMA 3LRKA 3GG7A 1ZJIA 4Q4PA 3WBWA 4B90A 4F0LA 1XW8A 4AY1A 5IBXC 1OJXA 3HQPA 3BCJA 1F7BA 3LCWA 1VBHA 4MUPA 4BJHA 1GOQA 2B0MA 1EJSC 1AW1A 4NAFB 2YCEA 1SZFA 2ZZ6A 4Y6GA 5I77A 3HG3A 1BQGA 3LG3A 3EMZA 4PUJA 1UC5A 5JQ9A 4IQDA 4LFYA 4P5UA 4F0HA 2V38A 2NVCA 2BLEA 1HNYA 3V16A 3FGCA 1ISZA 4XKYB 2WANA 1XFBA 3GG1A 4ZTXA 3WNOA 5C9ZA 3UZXA 4ADTA 3ABZA 2WO5A 1REQA 1JCXA 1UASA 2DDXA 3A23A 3ITCA 2OWCA 3BE7A 1E55A 5FKYA 1M7JA 1MXDA 3W7GA 4NJGA 4PB5A 3GRIA 4AD0A 3N3MA 5LIUX 5FJOA 1FA2A 1EJ7L 2PDUA 4LANA 4ZO8A 3MWCA 3LENA 4IF2A 5LSMA 4UTHA 1OC6A 2Z29A 4YXGA 2X1RA 3M64A 3WQ4A 1J01A 4G5DA 2ZZ4A 4YLWA 4BR1A 5CZTA 1A5MC 1WX0A 4FNQA 1KLYA 3PC0A 5G1TA 5LYRA 6CGTA 5AVNA 3RM9A 3AIUA 1QNRA 3FKRA 5HWJA 3ALGA 3KE0A 3MUAA 3W37A 2NT0A 1M01A 1R7AA 2P53A 1H2JA 3ZJKA 1V0LA 4WY0A 1TB3A 3FJNA 1CLXA 3VVGA 4UTLA 1A0EA 4A21A 3WLTA 2VJXA 4EIVA 4WVXA 2E6DA 5EPDA 5TBOA 3UWQA 2HVNA 3W1MA 4HOWA 3IIVA 1PZ1A 5CQ1A 4ROPA 3ZSTA 4UC5A 1POKA 1GWJA 3L4TA 2GL5A 3R10A 3S1VA 4DO7A 3T2QA 4TVCA 4LVGA 5HINA 3V1HA 1RVKA 3W1XA 2OXNA 2R1PA 3NAVA 3NPXA 3R94A 2RUSA 4QLKA 3BJTA 4UFJA 3B97A 4P7NA 3RM4A 3S2MA 4D8AA 3RITA 4URIA 4JN8A 3WLNA 1W9DM 2EG8A 3TXVA 3S2JA 2I5IA 3PFRA 4LC8A 3EGJA 3WFAA 1JQVA 3VDBA 3OO2A 5AN7A 4LVFA 1XPYA 4BWLC 5BW6A 3ES7A 3SUSA 2QUNA 2H9AA 3V5FA 3QQWA 2C91A 2ZX7A 1W8SA 3HIJA 2NT1A 2CKRA 4HGXA 4PMOA 3WDHA 1LBFA 1XSIA 4K2SA 2DVUA 5H6HA 2YPIA 4M5PA 3VU2A 3R43A 3G1DA 1TE1A 4Q8TA 3GYCA 4WJEA 2RDUA 3W83A 1A5KC 4QEHA 2QULA 2R1LA 4FALA 5ENLA 1JUEA 1WPCA 5FJJA 1WOAA 3EPOA 4I3GA 3NZ1A 3TYZA 1HGWA 1VJIA 4UTUA 1L6YA 1E5NA 2E5CA 2E0PA 3DESA 1J93A 4UZSA 3EX1A 4K3ZA 1UQZA 2PBOA 1YDYA 1ZBCA 1O5XA 2HQAA 4DJEA 3N29A 3TQPA 4GQRA 1WB0A 3EX2A 2RAGA 3L4ZA 3N4EA 2V5DA 3HQ1A 4LUYA 2Y0FA 5FJTA 3TN4A 1G69A 2YOCA 3CHEA 2PD5A 1D3HA 1F05A 1B9ZA 4GY7A 3WLMA 2OX4A 3O6DA 4FP1A 3IIXA 3NM3A 1O1ZA 5BZAA 2WNWA 4S23A 3TIMA 1VYRA 4QQ3A 2XFRA 6TIMA 3CJPA 2WM0A 3NA8A 4GXPA 2H8ZA 5F1UA 3ZT7A 3SCSA 3AMCA 1L2QA 3QV7A 3GXIA