1EP1A

Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
309
Chain Sequence
ENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAANVKAIELNISCPNVKHGGQAFGTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
publication title Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 99
structure length 309
sequence length 309
ec nomenclature ec 1.3.1.14: Dihydroorotate dehydrogenase (NAD(+)).
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ep1A00
3QSTA 3W7IA 4PL1A 3UWUA 2ZRYA 4GNJA 4BF9A 4KWVA 4L4LA 2NXIA 4XUGA 1I2NA 3GKAA 3C3NA 1QOPA 4BWLC 1L6WA 3OVQA 3DAQA 1AW2A 4O15A 1VHNA 3G1VA 3WJXA 1YLVA 5G4WA 2QUTA 1GPWA 5CZTA 3W2UA 4R53A 3LCGA 2E1DA 3O15A 1WBHA 3SI9A 4FIQA 4XKYA 3N9SA 3W2NA 1XCFA 4XQ6A 4NX0A 1ME9A 4GBUA 3TQVA 5F4SA 1N55A 4NNBA 5E1QA 1TRIA 5I3JA 1DHPA 1KTBA 2WOQA 3SGZA 3L5AA 1OX4B 5D03A 4O19A 3W83A 4JTJA 4WOZA 2ZRZA 3LCIA 4LS0A 2WSRA 4GUIA 1DOSA 3RF9A 3NZ1A 3MUXA 4L4MA 4TX9A 3BG3A 2B0MA 2NX9A 1CI1A 1DBTA 2QUUA 1XUUA 3UXAA 5IBXC 1YTEA 3IIPA 4ZVJA 5C2XA 3S6DA 3BG9A 2EKCA 5BNKA 4P61A 3MHFA 3Q94A 3LHVA 3OA3A 4LV9A 2DZTA 3S42A 2TSYA 4XTDA 1SO3A 1H7NA 3QH2A 2HS6A 3PBWA 2CLIA 3SGUA 5H91A 4YXGA 4FX7A 1Q6OA 1BWKA 1LLWA 2CU0A 1AL7A 1WYIA 2ZDRA 1QPQA 3N9RA 1PV8A 1Z48A 3G22A 2E6FA 1GTEA 3M5ZA 3W2KA 1JCXA 5DBUA 1FWTA 2QCGA 1GEQA 1TO3A 2I9EA 2OMAA 2Y88A 2J6XA 1I2RA 4QSHA 5J5DA 2FQIA 2VFIA 4I7VA 1F05A 3B03A 3VNDA 1FCQA 2ZRXA 4MFDA 1GOXA 1YXCA 2YX0A 1LRNA 1W54A 3P8JA 4DF2A 4LV4A 1NF7A 1OFBA 3UY8A 5BRBA 3GX9A 2D73A 2ATMA 1J2WA 3KFTA 4JYEA 4NNCA 5K9CA 3S1VA 5DCDA 1VH7A 2RKXA 3NO5A 3KVJA 4FNPA 2YXGA 1FBAA 2X1UA 2NX1A 2R91A 1ICSA 3M6YA 1Q6QA 1S5TA 3TXZA 4CCCA 3NQ6A 4WXZA 3N2MA 4BWLA 3L65A 1U5JA 5DELA 3L5LA 4MYXA 4ONVA 4JDBA 2C18A 4RZ5A 2FJKA 5A8GA 3I6RA 4DF1A 1OK6A 3CIXA 4NXSA 1VLIA 2NXHA 4AWTA 1UASA 2DJLA 3ATZA 2FFCA 2DORA 1SUXA 3NR0A 1G4SA 3RNDA 1G69A 3LRLA 1LRTA 2WNQA 5K9XA 1L9WA 3PUOA 4CNPA 1UBSA 3SR7A 3IIZA 3I7SA 4NXKA 3ABQA 1P5BA 5FI8A 3W7CA 2YZRA 5BW6A 3PB0A 2DZWA 1KLYA 3LLFA 2A7PA 3LTSA 5AHEA 3S9YA 3O6CA 3PF3A 4WY0F 2ZRUA 4LVDA 1CX9A 3WJZA 4Z0JA 1ZY9A 3DFNA 3UWWA 5IBXA 1L6SA 2YFOA 2BLEA 2RDWA 1W5QA 1SZEA 3LHYA 4KWWA 5TQLA 1P0KA 3QZEA 3N3MA 1H1ZA 2OT0A 3UWVA 1SSGA 2VKZG 3ZWSA 1GG0A 4WJEA 3E12A 2VEMA 3A23A 2V81A 3IVTA 3GR8A 2X16A 3VFLA 1TB3A 1PE1A 4IWWA 1J4EA 1PS9A 2JK2A 1XXXA 2CW6A 3PAJA 3I68A 3ABRA 4S2BA 2V0TA 1IIHA 3UZJA 1JCJA 1S5VA 3TV8A 2E6YA 2RHGA 3LM7A 1ICPA 3P61A 1TSIA 3P5ZA 2W0UA 1Q3NA 1H62A 1VLWA 2B7QA 3JRKA 4MYAA 3DFSA 4JR5A 3UQNA 1BKSA 1UJPA 2ZYFA 1VHCA 1D3HA 4N6FA 1X1ZA 3G1YA 1K03A 3NDOA 3LDVA 3B05A 3W7KA 3STEA 3C6CA 4O52A 4LT9A 2TYSA 4OV4A 4LC6A 1VS1A 4MZ8A 3W7EA 5CPNA 4E2BA 3UPBA 1DQXA 1H51A 1JUKA 1R47A 4UTHA 1WV2A 3INPA 4BFAA 1ZAHA 2VFFA 1MO0A 1XC4A 5FF4A 5HJLA 3W74A 1FWRA 5HR6A 5AYZA 4UFMA 5HNRA 3RFAA 4A2SA 1XBZA 2C13A 3S1XA 5KSWA 4CCDA 2Q3RA 1XBXA 3MO7A 3W7NA 3W7JA 4Z1DA 2B7OA 5KMYA 3SJ3A 1O5KA 4M5PA 4NNAA 3OHIA 1GWJA 4JTIA 3GVGA 4RV8A 1W1ZA 2VENA 3NQGA 3N19B 3FEMA 1T0OA 4IMCA 3KRUA 2ISSA 4AXKA 1G67A 3HPSA 3MW7A 3W2MA 3L9CA 3R12A 3E9AA 2JBMA 4TMBA 5AHFA 4HNNA 5HWJA 1R46A 3NL6A 1SU5A 1TRDA 4MLRA 3WFAA 1H7XA 3EWWA 3EKZA 3ZFHA 2JKAA 1TYGA 4O1AA 1ZJIA 1P0NA 4PEKA 3LTPA 1B3OA 2BX7A 3W1PA 4W9TA 3NGJA 5EMUA 4Y9AA 3EX6A 2G96A 4GUHA 4MY8A 1GT8A 1VCFA 1FCUA 3VE7A 4KKXA 3L21A 4RZ4A 3QEZA 1QR7A 3LBMA 1LROA 5K4ZA 4ADTA 3MP5A 1EP3A 4N4PA 4TIMA 4QNEA 3TXVA 4KFPA 3SSJA 3TA6A 4CQAA 3LLDA 4NZJA 2NUWA 3FFSA 3O1NA 1I2QA 1Z44A 1IXNA 1JRCA 4N2YA 4M7TA 3DHDA 4FX8A 1G4PA 2QCNA 1BWLA 4JX5A 3S1UA 3W75A 4LOCA 2NWSA 4IMFA 2A85A 1QNVA 2Y61A 1G7UA 3RLVA 3HB9A 4X9SA 5D32A 3VKJA 1XKYA 2NZLA 3G1XA 2O7QA 3O06A 1KFCA 3QMRA 1JCNA 3RU6A 3M1ZA 2EHHA 4YL2A 1TV7A 3P7YA 5FEXA 2NLIA 1QDSA 4MLJA 5D2WA 1K8ZA 1LOSA 1KFEA 1SZNA 1KV5A 1FCVA 3EB2A 2V30A 4IX2A 2YYUA 2E77A 2YW3A 3O16A 1XBYA 6ALDA 1JVNA 1SW3A 3G0SA 4DPQA 4Z08A 3W07A 4MPQA 1QMLA 5TIMA 3FKRA 1OFOA 4JGDA 2QCLA 4NJJA 3PVFA 2GVLA 3UPWA 1EWEA 4GUFA 4XWUA 1ZHAA 4EVZA 3WK2A 5DLCA 3R89A 3NL2A 1IGSA 3SIZA 4U4MA 3W6YA 1WX0A 3L5MA 1VYSX 5EYWA 1YADA 5HWNA 2XN1A 4UTLA 2QCHA 5AFDA 3C2EA 3T55A 4ZQPA 3P82A 4LRSA 4DPPA 1YDOA 2VEPA 3G1AA 5D2TA 2A21A 2DP3A 4LW7A 4RKAA 4HSNA 1FWWA 3KHJA 2PURA 1K7XA 1TMHA 3DFPA 3C2FA 2J9YA 1I4NA 3UD6A 4N9EA 1W56A 1B4EA 4C1LA 5I3KA 1TPB1 2RFGA 3B04A 3FA5A 1GVSA 5EA9A 1W0MA 1FWNA 3W73A 3G1HA 5IM51 5DXXA 1KFJA 2ZCGA 4FNTA 3ZWTA 3BO9A 1AG1O 1W3IA 3L0KA 4O57A 5AOUA 3PUEA 4BK9A 3MHUA 4RK8A 5LSMA 3HOJA 4KFOA 3GB6A 2CLKA 4X22A 4LWWA 4DQWA 2QR6A 3W23A 2QJHA 3LRMA 3TDFA 1MEHA 1MEIA 1XBVA 3UNDA 4AVFA 3F03K 3BVJA 3LOTA 4TU1A 5LNWA 4LVFA 2AGKA 4JDYA 2A0NA 1XI3A 1XM3A 3E0IA 3N34A 3PS7A 3DZ1A 3M41A 1JUEA 1F73A 3C2RA 3DI0A 5EL1A 4XBSA 2HS8A 2RDTA 3S5YA 2WNZA 3CB8A 4UTJA 2R8WA 1QO2A 1OFAA 3GNDA 3QFEA 1H7OA 3NPXA 3PBUA 1FCBA 4JYDA 3WJWA 1QOQA 1KFBA 4MJMA 4N9DA 3BARA 1KM4A 4K6AA 2F7FA 4UTUA 1JCYA 3HG5A 3VCRA 1EWDA 4LTSA 2ZZ4A 4ZQNA 1FDZA 3G0UA 4GXMA 4FNQA 2QUVA 1WOBA 2VC6A 3NQDA 4IX0A 5HWMA 2ABBA 2PRHA 3F4NA 3CPRA 3WJYA 3NQ8A 3NVTA 2EF9A 1OG0A 4IXXA 1TPC1 4JTGA 4AAJA 3FIGA 3JR2A 3FJ6A 1SO4A 2XN2A 4OU1A 5LNVA 2VEKA 2ZRVA 4MZ1A 4X3ZA 1GYLA 1LM1A 2GQ8A 1OFEA 1TQJA 3STGA 4K39A 5D37A 2EGZA 1ZCOA 3C2OA 4YCPA 4OE7A 3GDKA 1HTIA 4K7YA 3G24A 3P60A 1KM5A 5CSSA 3W70A 5KZMA 1AL8A 1DORA 3LX9A 3PY2A 1EPXA 3A9IA 3P84A 3YPIA 2ZZ5A 3W7LA 3ANYA 1TJPA 3PSWA 3FKKA 3WK0A 1YTDA 3FYPA 1GZGA 5HUPA 3HO8A 1QWGA 3TC6A 2FB3A 2QCDB 4PL2A 4DBEA 3LV5A 5LKYA 5HMSA 4ADUA 2R14A 4HIBA 3AJXA 1RZMA 3EKLA 1HO4A 5D30A 4DF0A 2NXGA 3LI0A 3B0PA 1OX4A 3QC3A 2CLHA 2GUUA 5FEWA 3O8AA 2DZUA 2E6DA 3N73A 5FF3A 3W7PA 1YXYA 1IIGA 5CPMA 1MXSA 5L9FA 4JNMA 4NT0A 5F2LA 3ELFA 1I2OA 1G4TA 1R2SA 1TPWA 1YPIA 1M5WA 1OK4A 3W1QA 3HGOA 3TAOA 3BLFA 4CQ8A 5DN1A 4R7JA 4QIUA 1K8XA 3NQVA 2C0AA 3S5NA 2J9XA 4N4QA 3KRZA 3DXIA 1NF0A 3DBPA 3I7RA 1SSDA 2QEZA 3HIJA 3MYPA 4POCA 1ALDA 4LVBA 4FX6M 3W7DA 3S0CA 1JUBA 4NZFA 3T44A 1T99A 4NQ1A 3W1LA 3OBKA 2ZZ6A 3P8IA 3W7MA 3W7QA 2C19A 2GOUA 1EIXA 3LHZA 2W79A 3W1MA 5CKSA 1JCLA 1K02A 2VELA 2ZZ3A 5LNUA 2ZRWA 3KAOA 1OYCA 3TUUA 5CZSA 4CNNA 2WV8A 4FEZA 1F6PA 1VZWA 2QJGA 2VOMA 1U83A 5DXYA 4IPIA 3TKFA 3HGRA 4IGHA 3LCWA 3LXAA 4CQ9A 4O8RA 3W7HA 4JY8A 2A6LA 2ZZ2A 3MHGA 4K8EA 1GYNA 3MI3A 5G5IA 1OFPA 4MOZA 2QAFA 1S3HA 3O63A 3W22A 2C15A 3P80A 5H2ZA 4M7SA 1P1XA 3PM6A 1M6JA 2P1FA 1QPRA 4NJHA 5G2IA 3K30A 5EKYA 4EF8A 3SY5A 1L2UA 2FDSA 4ZQOA 1DQWA 2V8ZA 3W71A 3PSVA 3STFA 2TRSA 1YXDA 1G7VA 2C14A 3LCLA 1WXJA 4M6PA 5CGQA 4DO4A 4XBKA 3CM4A 3HBLA 4JX6A 4LRTA 1QPOA 3TSDA 2TMDA 3BGJA 5U4NA 1V5XA 4R33A 1R2RA 4RCXA 2V5LA 4O1BA 1PCKA 4Y96A 1B57A 5F2MA 1I8JA 4YWIA 4ML9A 4O4WA 1F74A 4Z1BA 1NAL1 2ZA1A 5FEZA 4AEOA 3GR7A 4IJBA 3TJXA 1GVOA 2DZVA 1LTDA 4UFJA 5FEPA 2OT1A 4Y90A 5BOOA 1KM1A 5D05A 1ZENA 2F84A 1GG1A 3DENA 3KOFA 1PCWA 1OFRA 4J9JA 1OVDA 5L6UA 2GJLA 1G4EA 1A53A 3E02A 1EEPA 2WNNA 1FXQA 2PE4A 4AF0B 1UUMA 3TK7A 3LHWA 4ORMA 4O10A 2ISWA 4ZQCA 3H53A 4UTIA 3ABSA 4LU0A 1ICQA 5EPDA 1K8YA 4H4IA 3IEBA 3C61A 3NQCA 3TW7A 3NQFA 5BMXA 5C6MA 1EB3A 3B0UX 1JULA 3UZ5A 3NL3A 1OFDA 5A5WA 3USBA 4AH7A 4I7WA 3LV6A 4GJ1A 1F6KA 1D9EA 1LBLA 3GIYA 4MJZA 4UFKA 4DEFA 5F4WA 4O54A 3CU2A 2G95A 5I3IA 2DZPA 4ZQMA 3EWUA 3W3OA 3BG5A 2X1SA 4QQ3A 4NJGA 3G18A 6TIMA 3W72A 3BGGA 4UTWC 1VJIA 3PUDA 1MZHA 3GXNA 4FO4A 4ICNA 3IGSA 4TO8A 1X7FA 2CLOA 2NV1A 1QCWA 1LP6A 3HG4A 1I2PA 1R2TA 1KTCA 7TIMA 3W1TA 2ZA2A 1Q6RA 4OWGA 3IV3A 4WQ6A 3HG2A 3LGEA 2A7NA 3M43A 1EP2A 2QAPA 1DVJA 1H60A 4JS3A 1PHWA 3ZS4A 3BW4A 4GE8A 4O16A 3VE9A 2H90A 1Y0EA 5CSRA 3QYQA 1QFEA 1TCDA 2ZZ1A 3IIVA 2BXVA 3UWZA 4HNUA 4NJKA 1TV5A 3NQ7A 1H50A 1JRBA 4K7VA 4LUIA 4BR1A 2ATSA 3G1FA 1VQTA 1WBJA 3TR2A 1PHQA 1GVFA 2QKFA 3EWZA 4RXGA 5TBOA 1TIMA 1ZNNA 5LHEA 4JY9A 8TIMA 3P74A 2Z2UA 3TFCA 5CPLA 4AWSA 3OVRA 4Z1AA 1W3NA 3TX9A 4AWUA 4Q4KA 1ZFJA 4N6EA 3TFXA 5LHFA 4MVAA 3W7GA 3M5YA 2WQPA 5F1UA 2ZFAA 1TPVA 1KFLA 3HF3A 2FPVA 5KZDA 2CLFA 4JTKA 2ZBTA 2PRLA 3MYOA 3PB2A 3KXQA 3W85A 1H61A 2R94A 4MY9A 4WD0A 5AHIA 2YPIA 5DBTA 3LXBA 3L2IA 3EXRA 3TROA 1XL9A 3FJLA 3HG3A 2CLEA 4H6KA 5FESA 4JTSA 3LBCA 2CFFA 3IVUA 1LOLA 3FLUA 4JIPA 1ZAIA 3TAKA 3HPXA 4FB7A 3QRHA 2Q8ZA 5AC7A 3M44A 2Y7EA 3RLUA 3D0CA 2Y7GA 3UY7A 2CZEA 4FIRA 2H3DA 3S5ZA 4GC4A 4Y6GA 2J9ZA 1IXOA 5HR7A 1W5OA 2VFEA 3C8FA 3GLCA 2NV2A 4UTWA 1X1OA 5AC8A 2A5HA 1ADOA 1TPEA 5G4EA 3OG3A 1WAUA 1FUYA 3TH6A 3QJAA 3LCHA 2ZA3A 2BTMA 5HQEA 1KA9F 3W87A 4FNUA 3AO0A 4JTHA 3WK1A 3NQEA 4C1KA 4Q32A 3W9ZA 2B4GA 1VGAA 3M9YA 3OVPA 1A5SA 1RQHA 4UTTC 3LHUA 1GJPA 3N14A 1M7OA 3DHFA 4JTEA 1HFBA 4EOUA 3M47A 5LGZA 2CWNA 2X1TA 5AHLA 3KVLA 3TJLA 5DY2A 3GNNA 4QAIA 2CZ5A 2QCCA 3L66A 4YMZA 5E0KA 1SPQA 4QNWA 1PL9A 2OJPA 3DI1A 3KVKA 4ADSA 1PIIA 4LS1A 3G8RA 3P67A 3N2XA 4JD4A 5LGXA 5G1TA 3LHTA 5DCEA 1VRDA 1W5MA 3EXTA 1A50A 3NOEA 3PWAA 4H3DA 2AAMA 3TE9A 3TW6A 3SFKA 3NPWA 4UFLA 3G0XA 5CG7A 4AB4A 3LTYA 3NYZA 1DKWA 1SW0A 5EBUA 3QM3A 1O60A 1TTQA 1HO1A 2Y85A 3LERA 4WXYA 3A22A 4NVTA 3EWBX 4I9AA 2Y7DA 4JX4A 1SFJA 2YW4A 3C52A 3TIMA 5KZEA 1UUOA 2FPTA 3NAVA 4FHAA 3SECA 3TSBA 1V7YA 2A1YA 5C54A 3R8RA 2P10A 1O5XA 4A2RA 4HNTA 2FPYA 3NM3A 4JN6A 5LNSA 1DJQA 1SQ7A 3FOKA 4PODA 2Y63A 4O1CA 1A5CA 1W3TA 3PBVA 5K2ZA 5G1YA 2WJZA 5K9DA 2DJXA 5DCBA 2ABAA 2JKEA 1RV8A 4K38A 1TQXA 3GAKA 3HGSA 2WSQA 1M7PA 2QDGA 3W7RA 5F1VA 1LLZA 4O0ZA 2J24A 2ISVA 1K7FA 4IMDA 2LLEA 4UR8A 2QF7A 3WK3A 1KM6A 2QDHA 2OCZA 2CZDA 4GUGA 5I3HA 5D2XA 2OX1A 1VPXA 3G3DA 3M0ZA 5I3FA 2HSAA 5CPOA 4MZYA 1EUNA 4WY0B 3G1DA 3RK8A 1EX5A 2Q8LA 4WX2A 5LZLA 4UTTA 4O12A 4UMBA 3NEVA 4OHQA 2Y6ZA 1XDMA 4LC8A 5C5YA 1H7WA 1HUVA 1LORA 2H6RA 1YTKA 2V2HA 3TC7A 2C6QA 1O94A 3IRDA 1P4CA 1TTJA 1FDYA 4Z1CA 4FNSA 4E0CA 2Y7FA 4XKYB 4XZ9A 1RVGA 3DKJA 4WZHA 3EXSA 5KITA 4A22A 4NX5A 5HUOA 4UXDA 2G97A 5EY5A 3BK0A 1MSSA 2J88A 2NUYA 2FB2A 2JGQA 3FS2A 1YYAA 4GUJA 4UUIA 1OX6A 4JICA 2VXNA 3HJZA 2V82A 1UB3A 3A5VA 3HPZA 5CZ0A 5AN7A 4Y8FA 2PRMA 2CLLA 3JS3A 1RD5A 5D33A 1YDNA 2BZNA 4JXCA 4HPJA 5K7JA 3UXDA 2FIQA 5DY3A 4QISA 1F5ZA 4YCOA 1RQBA 1LCOA 4HPXA 3P62A 4UR7A 4O28A 4AHQA 2PC4A 3B06A 3S5OA 4UTMA 3DU0A 2Y89A 2RH9A 3STCA 4A21A 3LRKA 1LBMA 1JQXA 3ABOA 4G1KA 4ZZ9A 2QCDA 1LOQA 1OYAA 3TCEA 3IIOA 4DXVA 1SO6A 2HTMA 4Z0SA 5AYYA 3W76A 4M6VA 3TU9A 3LXCA 5D2YA 3M7WA 3G1SA 5FF0A 1ME8A 2X2GA 1FDJA 1OHLA 5AHNA 4A29A 4LY8A 2GQ9A 3C0JA 1WQ5A 1S5WA 4OT7A 4LNYA 3IVSA 4UTKA 1A5AA 3QF0A 3KVMA 3HGJA 4O13A 4PC8A 2YGYA 3W1RA 2I1OA 2Z1BA 4N9CA 2ALDA 1FY6A 3TQ0A 1OYBA 2GVJA 3BW2A 5AHMA 5LNRA 4UIOA 3L68A 1H5YA 1LRQA 1RPXA 3CTLA 2H8ZA 5AB3A 2C3ZA 4DO5A 4E2DA 1NVMA 3THQA 4UMCA 2X1RA 2QCEA 1JJKA 3W1XA 3O07A 3PG8A 3C2VA 1BTMA 1VR6A 1EUAA 4QITA 4JTUA 1SFLA 1WOAA 5ABTA 1LBFA 2QJIA 1TPH1 3NNTA 3U6WA 4UNLA 1BEUA 3LB0A 4O53A 1C9DA 1KM0A 3T40A 2V2DA 4PA8A 5MHBA 3HMJG 4NJIA 3V1PA 4JIQA 3BV4A 4GWEA 4FXRA 4JTFA 2QCFA 3EX1A 1KBIA 4RJEA 3NM1A 4MKNA 1W8SA 2WKJA 1Z42A 4RX0A 1TTPA 3GXPA 5J5RA 2AQWA 5BMWA 3CIWA 5AYXA 3IGXA 3L0GA 1AW1A 1I45A 4WUIA 3UWYA 2YR1A 5FF7A 5I3GA 3LCFA 3PULA 4TMCA 1UCWA 1TJRA 1H7PA 2BSLA 1THFD 4HHPA 4K37A 1MEWA 3EX3A 4BI6A 2CLMA 2YYTA 4OGZA 3CEPA 3CLMA 2FTPA 1PVNA 5G2HA 4O50A 2Z6IA 2HMCA 4ZL1A 2NUXA 4EWND 3O6YX 2KZHA 1B9BA 4HN4A 2H3BA 3V75A 2P0OA 3QQ1A 2B7PA 3S1WA 3T7VA 1XUZA 1KFKA 3A5FA 4QJ1A 2E09A 3BW3A 4JEQA 5D02A 3MBDA 4YLWA 3CHVA 4ORIA 3EWYA 1LDCA 2A2IA 3C4UA 2ZTKA 1VCGA 1TV8A 2A7RA 3WJSA 2C16A 3I7QA 3R2GA 3OIXA 4HT3A 4I7UA 4FF7A 3GDMA 4AF0A 1HG3A 3S8HA 3MJYA 3E96A 3SW6A 4O11A 1R30A 3GDRA 2B7NA 3DGRA 3G3MA 4JYFA 5K3VA 5KTLA 2ZTJA 3GAYA 3QW4B 3MI2A 2VEIA 4HKPA 4BI5A 3NQAA 4KFNA 1H63A 3RMJA 3W2LA 3M5XA 4UNKA 2NWRA 3GYEA 1DJNA 3LCXA 3SZ8A 4HSOA 4O4VA 2EPHA 1QO5A 3EX2A 3TSMA 4WOQA 5F4XA 1TPDA 1Q45A 1HL2A 3W1AA 1KM2A 3IIXA 1FX6A 2X30A 2DZXA 1H1YA 5GVJA 3T4CA 3B0VC 4GFSA 3H54A 3Q2DA 4LUJA 3NPUA 1JCMP 3GXTA 3KRSA 3W1NA 1VYRA 1IXQA 2NX3A 3ZR4A 1WA3A 4UFIA 5SWUA 5HULA 4NUWA 3MP3A 1LYXA 5CZJA 2E6AA 3BLEA 2UV8G 1W37A 4PCFA 4X2RA 3EEGA 2GVGA 3MI6A 4IMEA 1OF6A 4LS2A 4CLMA 2PCQA 3NQMA 2RDUA 3W88A 3PBYA 3VI2A 4PFMA 4TR9A 3M16A 4ZQRA 4S2CA 4FXSA 2WSYA 3O05A 2GQAA 3CC1A 3UWQA 1E51A 2C1HA 1YPFA 3R5EA 3F1QA 4O1DA 1W31A 3A21A 1DV7A 1N8FA 2J27A 5F2GA 2XN0A 4JTLA 3P5YA 4DBDA 5D04C 1KV8A 4P2VA 1L6YA 1VCVA 1VC4A 1G6CA 5F2IA 3W1UA 1NEYA 5FF2A 1C8VA 2YCEA 4U28A 4RLIA 3DFOA 2V5BA 2VFHA 3R13A 3NA8A 3PG9A 3NL5A 2E68A 1OFQA 2ZZ7A 3CEUA 3U8GA 4LVAA 4N9BA 1TREA 3TQKA 1W5PA 1F2JA 1OX5A 5E93A 5HINA 5K4XA 1B4KA 1F7BA 3C56A 3B8DA 1XDLA 3KX6A 1T96A 4O14A 4BI7A 3NQ2A 3L67A 3GK0A 4FNRA 1GQNA 5G2WA 1XFBA 4IQLA 1SR9A 3NPVA 2VFGA 1NFBA 3F4WA 1D3GA 4AHOA 1IF2A 4GRSA 3GDTA 3QPYA 2WPBA 3E49A 3PR2A 1SZFA 2IQTA 2Z0IA 4OQVA 1RQEA 2E5DA 4QM1A 3TMLA 3W84A 1AMKA 2Z6JA 2JKPA 3DH7A 2JGYA 4D2JA 4IUOA 5D2VA 3UYCA 3NG3A 4UMAA 2DU2A 2GJNA 2Q3OA 5AC6A 1T8XA 3Q37A 1ZALA 1C29A 1Z41A 4ZMGA 3MBFA 4S1FA 3H55A 4IPJA 1KLZA 2QCMA 1EA0A 4UFHA 1IXPA 1JQVA 2WO5A 2E5BA 3M5VA 1LZOA 1SW7A 1AK5A 5T26A 4HNVA 4LVGA 1K3UA 2YSWA 3GZ3A 1A5BA 1KW1A 2YDAA 3CT7A 2ZQ0A 3ATYA 3T78A 3OEXA 2O7SA 3DFTA 3CWOX 3Q58A 1QAPA 4UC5A 3W2JA 4DO6A 4EIVA 5D38A 1N7KA 1FQ0A 4PH6A 1TPFA 3GDLA 4OBTA 3U2OA 3EX4A 4JTTA 2XFWA 4IMGA 4O0KA 3L0NA 3BLIA 1F76A 4IOTA 3QQ0A 4RZ6A 1KBJA 3FYOA 4OV9A 2V2CA 2GPTA 2W6RA 3QW3A 4MY1A 3THAA 4UCGA 1ML1A 4K36A 3CWNA 1FXPA 2E5CA 4Q33A 1RR2A 3W7OA 4B5NA 3B4UA 2G5WA 1GVQA 2OZ0A 1X6UA 4O17A 1EP1A 1GTHA 4MIMA 2A4AA 2Y62A 3P81A 1TTIA 4NU7A 1ZAJA 1SZGA 4AMAA 1KM3A 3GKFA 2H8XA 4E38A 4M19A 4N02A 4A3UA 4K8HA 1SO5A 1W5NA 4RXFA 3IGUA 5KINA 4IXHA 1WDWA 4MUZA 4EF9A 1Q6LA 3LI1A 3HQ1A 4MFEA 2FLIA 1X8FA 3MP4A 3NXFA 3W86A 3MWAA 5U7SA 1H7RA 2CZFA 5D09A 3MMTA 4R34A 2A6NA 3I65A 1GVRA 4XTIA 3DKLA 1AW5A 4CNOA 3CQ0A 3TMQA 3EWXA 3QSRA 1ONRA 3TNOA 1TPUA 4CCEA 3A24A 2I14A 1J5TA 4M6QA 1VYPX 1NSJA 3NZRA 3QPZA 1OF8A 4AHPA 1ME7A 1FWSA 4ALDA 4RR4A 4O18A 1OJXA 3O6DA 4PTNA 1OABA 3DFQA 3G8EA 1QPNA 1JR1A 2V9DA 2Y70A 5C55A 2YFNA 4DELA 3PC0A 2EAWA 1CW2A 2DZSA 1DL3A 1KTNA 1K7EA 1O4UA 1YDVA 3QMTA 3BPWA 2VFDA 2TPSA 4WY0A 1O95A 2BWGA 3QMSA
chains in the Genus database with same CATH superfamily
4GZ7A 4LXFA 2V6AA 3R8HA 3W7IA 4PL1A 3UWUA 1ZQ5A 2HPIA 3N6HA 4A8RA 2VMFA 4L4LA 2NXIA 1I2NA 3GKAA 1QOPA 1L6WA 2QDDA 3G1VA 1YLVA 2PI6A 3ZVHB 1QWKA 5FAGA 3WDQA 2QJJA 4C6LA 1XCFA 2QV4A 1HP5A 1V6TA 4NX0A 1XWYA 4JL1A 1US2A 5E1QA 1DHPA 1KTBA 5D03A 3RM9A 2PU1A 1I1XA 3LCIA 3TW9A 7TAAA 4GUIA 3K13A 1NJJA 1R6WA 1XYBA 3RF9A 4P8WA 1YQ2A 1LQ0A 4TX9A 1KQZA 3PPFA 1XUUA 5C2XA 2OR2A 4PMVA 1HKVA 4Q4MA 4AY7A 2FZ8A 3LHVA 3OA3A 1OCNA 3S42A 4EWJA 1F9CA 3QH2A 3RR4A 3KOZA 2HS6A 1GOOA 3SGUA 4FX7A 3B3DA 3GTNA 1EXPA 4DJFD 1ODUA 1TJ2A 5FA5A 2ZDRA 5LIXX 1Z48A 1W1PA 1JZ8A 5DBUA 2QMKA 2QCGA 3UZYA 4CN6A 1GEQA 1TO3A 2OMAA 1I2RA 4G1NA 4MFDA 1GOXA 4Y7EA 1LRNA 2DVTA 4DF2A 3UJRA 1UA7A 2VDIA 3GIQA 1R3SA 4D8LA 3GX9A 1KB3A 1PEZA 3L4WA 1J2WA 1XGDA 2VD9A 2AQVA 5CBJA 2NVAA 1JF6A 2R91A 1NM9A 3GVQA 4LAKA 3QV8A 3KBNA 2IW0A 4CCCA 2VO5A 2O9RA 3BAYA 3L5LA 4JDBA 3H12A 4I6KA 4RZ5A 3I6RA 5H6HA 1OK6A 4GY1A 1W3LA 4D71A 1DWGM 5JBDA 3LRLA 2XU2A 2WSKA 2A3EA 1L9WA 1UBSA 5CLTA 4JHZA 5GQBA 1GOWA 3I7SA 5FI8A 3W7CA 2A3AA 5BW6A 4PUMA 3WUGA 1IEQA 4YPJA 1W2PA 3LTSA 4Q3MA 2CERA 1ZPTA 3KM8A 1QHPA 1GKPA 1PTDA 3QY8A 4CKQA 5IBXA 1ELSA 1WZMA 1W5QA 4KWWA 1BSIA 3NOYA 5TQLA 1P0KA 4PGLA 5E6YA 1H1ZA 3WNOA 1GG0A 1R0MA 3E2SA 4E4PA 2CKSA 2JE8A 3EBVA 4KCTA 2X16A 3VFLA 2G3JA 1BHGA 1QT1A 1UWRA 3BAWA 3S5SA 1CGUA 3VIHA 1XXXA 2XTKA 4S2BA 1KQYA 1VJZA 4A4AA 5LA0A 3K8KA 1UWAA 1SVDA 1Q3NA 4WCJA 1VLWA 4R85A 4BF7A 3UQNA 4QLLA 1FH9A 4HOZA 3GZAA 1XLCA 1UJPA 3FHQA 3MVTA 1F07A 4N6FA 1S5MA 3G1YA 3B05A 2GL5A 3W7KA 1W9DM 2OPJA 4O52A 2GLKA 3NURA 4OV4A 4LC6A 1JZ4A 1C93A 1VS1A 4BQ2A 2EQDA 1EDQA 1WV2A 3LPFA 1YE6A 4C6FA 3S9ZA 3TOPA 3KCJA 2VFFA 1XC4A 5HJLA 4WF7A 1FWRA 5HR6A 3PFRA 4UFMA 2QPXA 3KBSA 3OP2A 1XLLA 3WLOA 4CCDA 1MW3A 3MO7A 4XZBA 3AS3A 4GI6A 3GY1A 1AZ1A 4MJ4A 4NNAA 1GEHA 1HQTA 1GWJA 1W1YA 3LUTA 2IXUA 3UJEA 3FEMA 1T0OA 4XIAA 3GQYA 4IMCA 1KD0A 3KRUA 4D1IA 3MDUA 1HF6A 1U1HA 2ZC1A 3HPSA 3UJFA 3W2MA 4KH2A 2PWGA 4DI9A 4YJ5A 3R12A 3MY9A 5HANA 2WMIA 2JKAA 1TYGA 2DVUA 1GW9A 4GO9A 5EBAA 4W9TA 4NAEA 1EC8A 3FEQA 3EX6A 4ROPA 2XIBA 3T08A 4GUHA 1YEYA 1DJYA 4MY8A 3VOGA 3L21A 2ZKMX 4F3HA 1WUEA 3RCYA 3CUFA 3FY1A 3WF0A 4N4PA 4TIMA 5H8PA 1VFOA 3MUAA 4W88A 3W27A 4D6CA 1Q2RA 4ZSUA 1JPKA 1G4PA 4D9PA 3CPGA 3S1UA 1EL3A 1ZP4A 4IMFA 2OZTA 1Q6DA 2Y61A 1A49A 1G7UA 1V93A 3JZUA 4X9SA 3VKJA 4Q4SA 3QBUA 1J96A 3CQJA 4F9DA 1Z3NA 3O06A 1YE4A 1HL8A 1E4NA 2OLSA 3GG7A 1TWDA 4MLJA 2VGGA 1FVPA 1K8ZA 1LOSA 2GUYA 1SZNA 4MB1A 1KV5A 3EB2A 2V30A 3SO7A 3A13A 5CXPA 3O16A 3ITGA 3B8VA 2XGIA 1B1YA 1CGYA 4Z08A 1FOBA 4C6QA 6A3HA 3MCOA 1CLKA 3FKRA 1FH7A 4JGDA 2QCLA 4JQ1A 1SZRA 2D23A 2PZ0A 1A47A 5DLCA 1IGSA 3DN5A 3ALGA 4E8GA 5EYWA 1K8CA 4J3WA 4UTLA 3C2EA 5EGRA 3T55A 3WD2A 4FLOA 4AX6A 1R85A 1NWSA 3GXIA 1YDOA 3BUVA 1TIWA 5D2TA 1GQIA 1JG9A 4LW7A 2PURA 1K7XA 1TG7A 1KXTA 1YNQA 5ABEA 1B4EA 4C1LA 4Q8NA 2DW7A 2RFGA 2GVEA 3CV2A 3MU7A 2R1NA 2X7WA 4V33A 2GSEA 1LF1A 1QI0A 3OBEA 2VR5A 5IM51 3HTWA 1C3FA 2PWEA 1KFJA 2ZCGA 3BO9A 4O57A 3WZ0E 4BK9A 5LSMA 3N04A 1UWIA 2X8RA 3NO1A 4DQWA 4CVUA 1MEIA 4C1NB 3F2BA 1V0LA 1XBVA 1F3EA 1E0VA 1E71M 3F03K 4FLRA 3EWDA 3I4EA 3NZQA 2A0NA 1M03A 1XM3A 1V6YA 2OLAA 2RGMA 2D0GA 1H41A 4XZWA 4XBSA 2HS8A 3IJ7A 1RA5A 3S5YA 3N2CA 2WJEA 3WLQA 1Y8BA 4UTJA 2VCCA 1DWFM 1Q6EA 1JZ3A 3GG1A 1HJXA 1H7OA 1W1VA 2PMQA 1VENA 6PTDA 4JYDA 1E15A 1QOQA 4GX9A 4CQCA 4K6AA 3HG5A 5E5CA 2ZZ4A 4ZQNA 1FDZA 1KKOA 3CAVA 2QUVA 1WOBA 4M81A 1XQLA 3WDRA 7A3HA 3CHFA 2ABBA 4JNZA 5EFDA 4QCEA 3NVTA 4IXXA 1UW9A 1EF2A 1JZ6A 3FIGA 3FJ6A 4MNMA 5AYBA 3VAVA 3DCPA 5LNVA 1PZ3A 2ZRVA 3CL7A 1K6AA 3TR9A 2GDUA 1XIDA 2GQ8A 4PCTA 1AD1A 2EGZA 3WL0A 3GNXA 3GDKA 3UXKA 4NHVA 5CSSA 1UOKA 3UFYA 1AL8A 3LX9A 3SY8A 4H8VA 2GDVA 3W7LA 1YBQA 1TJPA 3H2CA 3MUY1 3PSWA 3WK0A 4QE5A 1GOMA 4IZGA 4UCFA 1NFGA 5HAOA 1R3VA 2PLCA 2FB3A 2QCDB 1I1WA 4AW7A 3BAXA 2CHNA 5LKYA 4MWAC 2VC7A 3QXBA 2Z29A 3O2LA 4US6A 1EGVA 4GXPA 2CLHA 2GUUA 3T0CA 1B9ZA 3S4TA 3NZGA 1MVYA 4Q4RA 1PX3A 1MRQA 2I16A 3UR8A 2BOFX 1IIGA 5CPMA 1MXSA 4KERA 3ELFA 1UP3A 4WLCA 5AVNA 3H2FA 2Z1WA 5ENLA 1C7TA 3L4YA 3WY1A 3BLFA 4I9TA 4CQ8A 5DN1A 1K8XA 3EWCA 1NF0A 3PZOA 3WMSA 3BOXA 3VMNA 4RNFA 1HZYA 4POCA 3VYLA 2F6KA 3WD3A 3W7DA 1EYEA 3S0CA 5C9ZA 3ISIX 1ENUA 1T99A 4NQ1A 2QF8A 4IIDA 2ZZ6A 2C19A 2GOUA 2REQB 1RJPA 5BRQA 4F0RA 2X09A 5CKSA 3CJPA 4GQBA 3KS6A 5BROA 3NQBA 4LAOA 4GA8A 3THDA 3TUUA 4FI4A 1XLKA 4CNNA 3SJNA 1Y65A 2WV8A 4DWDA 1F6PA 3BJSA 2WHLA 4EPBC 2VOMA 1MXGA 3R10A 4IPIA 1RCQA 4P8XA 2VJXA 3S3GA 4O8RA 3BJFA 4QR6A 2OKTA 2A6LA 1GKQA 3WSUA 1S3HA 4K2SA 3I6TA 3B9DA 1OT1A 1OSEA 4NJHA 3OGSA 1I0BA 3GW0A 3M0XA 1L2UA 2ZE3A 3VD5A 5IRPA 1DQWA 1YKWA 2Y8UA 3SCVA 4UBPC 1Y7VA 1G7VA 3LGGA 2C14A 1VEOA 4M6PA 4DO4A 3N4AA 4JX6A 2P76A 3VNLA 3ZO9A 4QDWA 4QS6A 4LRTA 5C8BB 4NZ5A 3O0FA 4GVHA 4R33A 1R2RA 4RCXA 1PCKA 4A8NA 1NOUA 1S2CA 4O4WA 4H9YA 1KCKA 1J0YA 1DE6A 4PRTA 3AYRA 2ZA1A 4IJBA 4PRRA 2ZVRA 1HGWA 4IGMA 2PDGA 4UQDA 4EPKA 4Y90A 1ZENA 2F84A 1WDPA 4RE2A 4EX4A 3WG6A 3DENA 1M9HA 4PFHA 1GORA 2OGJA 3LHWA 4LGXA 4ORMA 3ME3A 4IHCA 1H3GA 3H53A 4Z2IA 4RDVA 1W9UA 4MAVA 3ABSA 1ICQA 5EPDA 4HMCA 3M0KA 1QW8A 4H4IA 3IEBA 2DZBA 4HNOA 4CD4A 4DZ5A 4MWAE 2VRQA 1MFUA 3WBWA 4KW2A 2ISFA 3VDHA 2BS9A 3USBA 4AH7A 3HU7A 1W9XA 3LV6A 1F6KA 2I56A 2P8CA 3GIYA 4MJZA 4UFKA 1VBGA 2W27A 3I3BA 3WNPA 3T09A 2DZPA 4YHGA 3BCDA 1JYVA 3DYOA 1NOFA 5A95A 4H19A 2X1SA 3AROA 1HJVA 4NJGA 3T0TA 1JYNA 3ARSA 1BYCA 1VJIA 4CQDA 3GXNA 4ICNA 5HNNA 2GZXA 1PB0A 4MNLA 3UT0A 1QCWA 4JBRA 4C7GA 4GYPA 3UR5A 1I2PA 3CUIA 1KTCA 1RBAA 7TIMA 2YB4A 3CUHA 2W9MA 4OWGA 2JF7A 3OU8A 4WQ6A 3IJIA 4MNKA 1EP2A 3ITTA 2G50A 4NZ4A 1W1A1 2D1ZA 3EB3A 3AXXA 1HJWA 4GIYA 1X98A 5CJNA 4O16A 4EKJA 1Y0EA 5HXMA 1QFEA 4QJ5B 3UWZA 2WKLA 1XFCA 4NJKA 4O0QA 4Q8PA 2MUCA 2JIWA 3VIOA 2QNEA 1LT7A 4C6PA 2GK1A 3WMBA 3K4DA 4DYEA 3WQFA 4KEVA 2PGRA 5D9OA 1WBJA 1ISWA 1BVZA 3VZXA 1TIMA 1ZNNA 5LHEA 4JY9A 1Z9AA 8TIMA 3QC0A 2Z2UA 5CPLA 4AWSA 1M7JA 3CL8A 1ZFJA 4N6EA 1ZLPA 3GTIA 3CBWA 1F61A 5I00A 5F1UA 2ZFAA 2E9LA 4DXKA 2FPVA 5KZDA 4AIBA 4JTKA 2R24A 2ZBTA 2PRLA 1WO2A 2YPIA 1M04A 3B9OA 5DBTA 3LXBA 3L2IA 3HFYA 3EXRA 3TROA 3HG3A 3FA4A 3ZT5A 1XLMA 3UETA 3VMPA 2CFFA 1LOLA 1OCJA 3PZUA 3HPXA 4ACYA 4FB7A 2Q8ZA 4CEUC 3M44A 3ZOAA 1UD8A 3UY7A 4FIRA 2CITA 3C8FA 3GLCA 4L9YA 2GGEA 2A5HA 1ADOA 4QSFA 1E3ZA 3UW6A 1YNYA 2D2JA 3E2VA 3QYSA 4U31A 1RH9A 1Z89A 1C90A 3TOYA 3W87A 2BTMA 4J35A 3OODA 2DQXA 3W9ZA 2B4GA 1JZ5A 2Z2AA 3M9YA 2SFPA 1RQHA 4UTTC 3LHUA 1HFBA 4AUBA 3P6LA 2DSZA 1JDDA 3O9NA 3VZYA 5ABHA 1W32A 3IJ6A 5DY2A 3ENLA 4MWAD 4WIWA 3PZTA 2I17A 1SPQA 4QNWA 2ISDA 3P67A 1FWAC 5LGXA 5G1TA 2E9BA 4DLMA 1U1UA 4H3DA 1D2KA 2FGLA 3TW6A 1DJWA 3SFKA 4UFLA 3VTRA 4TTUA 1RPKA 7PTDA 1YRRA 3OQEA 1DKWA 1P1MA 5GJMA 4E2OA 1BVWA 1ZBKA 1O60A 4UOQA 5EBUA 1NWRA 3B97A 4L6DA 1TTQA 3MCMA 1HO1A 4U5IA 2VYOA 1CXFA 4NVTA 4XAPA 3RPTA 2Y7DA 2OZ3A 1EBHA 4DY1A 4JX4A 3C52A 3TIMA 1E56A 1GOQA 3NAVA 2J7EA 3XIMA 2ZDSA 3TSBA 4UOZA 1V7YA 4D1JA 5C54A 1ITCA 3R8RA 4A2RA 2PWDA 1ZZMA 4M3PA 3ZJKA 3VMOA 2Y63A 3GUGA 1W3TA 2PDNA 3PBVA 2PEVA 4HPGA 1HKIA 4DWSC 2OX4A 1WKDA 4MGGA 4GD0A 4NAFA 1TQXA 3GAKA 3VGFA 1M7PA 3ERPA 3AMDA 3KDNA 4QGCA 1EJ7L 4OUEA 2PF8A 1EOKA 1NDWA 1KM6A 1R7AA 1V77A 5D2XA 1VPXA 3CGTA 5I3FA 4B15A 1YHTA 5CPOA 2W61A 3M0JA 1EX5A 2Q8LA 4WX2A 2V3FA 4UMBA 3NEVA 1OB0A 2Y6ZA 1XDMA 4LC8A 1UKQA 1H09A 2WANA 3ARWA 1VFSA 2V2HA 3TC7A 3VUPA 2C6QA 1O94A 3H23A 3IRDA 2RJHA 3RJXA 4XZ9A 2V67A 4L61A 1TMQA 1K9TA 4WZHA 5KITA 6ENLA 1OZMA 2J88A 3MKVA 4ATDA 1UD3A 1YYAA 4UUIA 1F4AA 1UC4A 1X6NA 3TCSA 4JICA 3WDIA 4YS1A 1XRFA 1UB3A 3A5VA 3OG2A 2NQZA 1BAGA 5AN7A 1RCOB 4Y8FA 1RD5A 4JZ5A 4YYFA 2BZNA 2FIQA 4U33A 3CHCA 1US3A 1ESWA 1UPPA 4GX8A 3CQHA 4AHQA 1ZBWA 4EAMA 3N29A 3SCOA 3CWHA 3BQ6A 3STCA 4EAYA 3WDPP 3COTA 1FWCC 4L1WA 5BXPA 4ZZ9A 3UA3A 3TN3A 1WXYA 1TV4A 3IIOA 3B0YA 1WCGA 4FXFA 2F2KA 2OVLA 4M6VA 3G1SA 5AHNA 1WPCA 4K8GA 2HNHA 4QG9A 1WNOA 2PDPA 5HJYA 1EEXA 3C0JA 4OT7A 2Q8XA 3KZPA 1T6MA 2XVLA 4REQA 4JCMA 3RPMA 2FJUB 2J75A 2VURA 3BQ5A 2YBVA 2I1OA 2Z1BA 4N9CA 3BW2A 2GJPA 1D8CA 1MRAA 1RPXA 3L68A 2H8ZA 4DO5A 3JUGA 3THQA 4UMCA 3LMZA 1HKMA 2X1RA 3W1XA 4DYKA 4LYPA 3PUGA 4DUXA 3UG4A 3AFBA 1AJZA 1VBJA 3STPA 1SFLA 2ODOA 5CSUA 4GH3A 1XRTA 9CGTA 1F8MA 3AZSA 1O68A 1T8QA 2VT0A 3R8GA 2QMJA 4O53A 1C9DA 2P5NA 2I9UA 3O3RA 4QP0A 2ADAA 3AXHA 5MHBA 4QRNA 5FAJA 4AXNA 1X6LA 3ZVIA 1UR1A 5E9XA 4FXRA 1NDYA 3TN5A 2QCFA 5AYIA 3CO4A 4A3RA 1V7AA 4RX0A 1TTPA 1TZZA 3GXPA 1RSCA 3CIWA 3NGFA 1E55A 3L0GA 4ZOAA 4OTKA 3UWYA 2HNEA 5FF7A 5I3GA 4ZB5A 4K37A 2BSLA 1FWEC 2PDYA 3Q67A 4Q8OA 4OGZA 3CEPA 3CLMA 1G9HA 3MSDA 1LQAA 4WVXA 2HMCA 5CQ1A 1MDRA 4GIAA 1E70M 3PBMA 2UY4A 2H3BA 1EO5A 4UNIA 4TVDA 1S3TC 2NQ5A 1SGJA 1CB7B 3QQ1A 2YBUA 1XUZA 3A5FA 1VD6A 3UZXA 3RN6A 1VEPA 3MBDA 4CD5A 3CS2A 2VCBA 3EWYA 2A2IA 3HV9A 2VVNA 1V6UA 3AIEA 3AU6A 4QDMA 4UTFA 3WJSA 3I7QA 1B5TA 2IQDA 1HG3A 1O1ZA 1XJBA 4KS0A 3AUOA 3PJWA 2B7NA 1MXDA 4RE0A 3QW4B 1MQRA 2J7CA 1XQKA 2R6OA 4HKPA 4GQGA 3NQAA 3RMJA 4UNKA 3ARRA 3LCXA 3SZ8A 4HSOA 4QS5A 4W86A 4WOQA 2J79A 1Q45A 3ZLHA 1BYBA 1KM2A 1FX6A 2BY1A 4ZFCA 4IPPA 4BY3A 2VX7A 2CIPA 4WDWA 2DZXA 1H1YA 4GFSA 3Q65A 3H54A 4J28A 3Q2DA 1PYFA 1JCMP 3W1NA 1J6OA 4J3ZA 3S2MA 3IK4A 1R7OA 5HULA 5CZJA 3BLEA 4DM1A 4DHGA 4MB5A 4C91A 1U1JA 4ECLA 2QJMA 3GO2A 4FF5A 4B5TA 1XHGA 2RDUA 3W88A 5C71A 3M64A 3M16A 1BVNP 3O05A 3T8QA 1P7TA 4DX3A 1E51A 1GCYA 4H9XA 4PSPA 5I77A 1YPFA 1IT0A 2YA1A 2O55A 3SDOA 4HNLA 3A21A 4Z2JA 3CK5A 1CPUA 4P2VA 1QBAA 1L6YA 4DWSD 3KBWA 4OBRA 3VD3A 3VGGA 5B7YA 3N18A 3SAZA 3PJTA 4ROQA 2NV9A 1L0PA 4ATWA 1OIMA 3NL5A 4W8LA 1Z8AA 1XGEA 3CEUA 2ZXQA 2PDJA 1TREA 2NQ9A 3TQKA 1QI2A 5T9BG 3VCNA 5HINA 1UZDA 1XDLA 4PMUA 1SJAA 2ACSA 3B9EA 3GK0A 4FNRA 2OWWA 1GQNA 4IT1A 1O5RA 3NPVA 5LXEA 1NFBA 4NIRA 2XISA 5HJXA 3GDTA 1XLFA 1UWQA 2WPBA 4B3ZA 2PWHA 1SZFA 2WMHA 2IQTA 2Z0IA 1RQEA 1AMKA 4AD3A 2Z6JA 4IUOA 5D2VA 3RO8A 4DLFA 1JXJA 5AC6A 3QY6A 2BB0A 3F5LA 1C29A 1VRXA 4IPJA 1W1IE 1HW6A 1A5LC 1J79A 4UFHA 2YB1A 4D72A 3APTA 4C60A 2E5BA 3M5VA 4PUJA 1MMFA 3O6AA 3E0VA 2PP3A 3VFCA 3GZ3A 3KOWA 3KBVA 1A5BA 5J8LA 1KW1A 3T1GA 2YDAA 4D6FA 2ZQ0A 2PDUA 3AYSA 3T78A 3OEXA 1XF0A 5IHRA 1QAPA 3VIIA 2ACUA 3JVAA 5LA2A 5CPSA 1FQ0A 2PDQA 2PAJA 5MKGA 4RE4A 3DFYA 3GC4A 3VKKA 4OV9A 4IL0A 1SM9A 2GPTA 3T81A 3QW3A 2QW5A 1B31A 1ML1A 1V08A 3GH7A 4V2XA 1JNDA 1KCZA 4B5SA 2G5WA 3EDKA 4ERAA 1EP1A 1FH8A 2Y62A 1TTIA 4NU7A 3OZPA 2BV9A 3TN4A 3AC0A 2H8XA 1BQCA 1FP8A 4M19A 4N02A 1SO5A 2X2YA 3IGUA 3HA1A 2FZDA 3MO4A 1GKRA 1BF6A 5D9PA 4MUZA 5H1WA 4EF9A 2OZ8A 1RCXB 4ZENA 3MS8A 4MFEA 1Z32X 5AC4A 3BLOA 4XD5A 1OBAA 3MWAA 5BCAA 2CZFA 4BEUA 4JTDA 3DBNA 1EJTC 3VDGA 2Y2WA 1HJQA 1XLEA 1AW5A 3II1A 4CNOA 3TMQA 2XFFA 1ONRA 3TNOA 4CCEA 4B9YA 3UU0A 2WWCA 3FW6A 5HPCA 4Q8UA 1J5TA 4M6QA 1VYPX 3UZWA 3NZRA 3EOSA 5EMYA 3W25A 1H11A 4YN5A 3QPZA 1C92A 4AHPA 4H6RA 2J6VA 1ME7A 1R9ZA 3QGAC 4RR4A 3CXOA 3WQDA 5A6AA 3H4WA 4O18A 1CECA 1OJXA 3O6DA 4PTNA 3G8EA 3D46A 3SN0A 4JN7A 5HNUA 4AG0A 5C55A 3BAIA 2EAWA 3L4ZA 1RA0A 2GQ3A 1DL3A 3DFHA 4H7ZA 4PSRA 2ZWZA 1KTNA 1K7EA 1O4UA 3AIQA 4QE4A 1WDQA 3BPWA 3ZMRA 2E25A 3U4FA 2BWGA 2DUAA 1QBBA 3QSTA 4IGSA 1ITQA 4PCPA 4GNJA 1DIDA 1GW1A 2P88A 5FL0A 4DJED 4BWLC 3SRDA 3ZM8A 5D9MA 1RLCL 4O15A 2WVTA 3FJNA 1XRSA 5G4WA 4YTRA 3W2UA 2H9AA 4FIQA 4XKYA 4D6GA 2VR4A 1FWIC 1RVKA 4XQ6A 5C9RA 1ME9A 2BY2A 3B9NA 4GBUA 3TQVA 5F4SA 4JOMA 4NNBA 4GBDA 1OX4B 4O19A 5IDIA 3W83A 3W00A 4JTJA 3PHAA 4L4MA 3ARYA 2A3LA 4LH8A 2NX9A 1UIOA 1UD6A 4FOJA 3H4GA 2WZEA 2V38A 1YTEA 1EHNA 3SUTA 3ABZA 3ARPA 2ZUTA 3S6DA 3WBAA 3BG9A 5BU6A 1V0NA 1K9FA 2V3GA 4XAFA 3MHFA 1AQFA 4L64A 2WC4A 4LV9A 3FXYA 4MM1A 3M46A 3DYMA 2CLIA 1M7XA 4BA0A 1BWKA 1RK5A 1LLWA 3CAWA 2CU0A 1AL7A 1DP0A 3N9RA 4ES4A 4LUSA 4HZ7A 3KTCA 5AC5A 5AZ1A 5C9WA 1FWTA 5TAOA 2OWXA 3WQCA 2IMRA 1LLOA 2FQIA 4I7VA 1F05A 2FZBA 2XSXA 3DEQA 3UY8A 3WQ6A 2CBVA 2OSXA 5BRBA 1UBPC 4I5RA 3URQA 4JYEA 4NNCA 5K9CA 2EXOA 4I8YA 3NO5A 3R25A 4MB4A 2HEJA 3WQWA 2DSUA 4J2PA 1PJ9A 1ICSA 2JIEA 4W89A 4WGHA 3M6YA 1YMYA 1RJQA 3C0LA 3TXZA 1Q8JA 4GYKA 3P93A 3O7UA 3AS0A 5DELA 4MYXA 4IQJA 4G7EA 4NKCA 6XIMA 1FHLA 2FJKA 2WQDA 2YIHA 4AD5A 3UR2A 1UASA 2FFCA 2MANA 5XINA 3KTXA 3EDEA 1G69A 4MWAB 2BBFA 1LJYA 3KOYA 4QQUA 1OADA 1SJBA 1X8CA 2VGIA 1DPMA 1AODA 1RJRA 3PUOA 3VXGA 3IIZA 2PTXA 3WD0A 1P5BA 2YZRA 1VEMA 3TQPA 2DPEA 1HT6A 4XO7A 1UC5A 3PF3A 4WY0F 4LVDA 3FN9A 3DERA 1CX9A 4Z0JA 1PZ0A 4F0KA 3RX4A 2VGBA 3H2EA 1LG2A 2BLEA 3LHYA 1XD0A 1IZKA 1B3VA 5A6JA 3ZYZA 3N3MA 2VKZG 4PCNA 3E12A 3A23A 3IARA 3ANUA 1OC5A 1EGMA 1JXKA 1ADSA 4JKKA 2GGGA 2Y24A 3TTEA 3UR7A 2CETA 3ABRA 2V0TA 3UZJA 2RHGA 1ICPA 3P5ZA 2PDHA 4XZIA 3D3AA 2B7QA 3FX4A 5CJMA 4GI8A 3UVIA 4HA0A 1BKSA 4TUFA 1VHCA 1RBOB 1X1ZA 2IXVA 3STEA 2I57A 3GD6A 1EH9A 2QDEA 3U5UA 3W7EA 5CPNA 4Z2KA 1JUKA 1R47A 1ZAHA 3WLTA 3OLGA 1MO0A 3ARXA 1H1NA 2J47A 5AYZA 1R5YA 4LAZA 3S1XA 5ABFB 2PD9A 3OGVA 2G3NA 3W7NA 1AZ2A 1UYQA 3R0KA 4RUBA 2NVDA 4M5PA 1WDDA 2QQ6A 2XIMA 4RV8A 2HV5A 1W1ZA 2YXXA 1UR3M 4UQAA 3RLGA 1XGZA 2NVCA 1UP0A 3QKZA 4IQDA 1XSIA 4W84A 2JBMA 4TMBA 5AHFA 5HWJA 2CBUA 2WHKA 1SU5A 3NL6A 3EWWA 3ZFHA 1EGZA 1ZJIA 1P0NA 4AWEA 4PEKA 4WDXA 3LTPA 3W1PA 4OOUA 2HRWA 5EMUA 3QV6A 3AJ7A 1X96A 5FACA 1FCUA 3VE7A 4F2TA 3W24A 1QR7A 5ECVA 1CEOA 1GGOA 1JIBA 1EP3A 3PTDA 4N42A 2PTYA 2FTYA 4KFPA 3TA6A 4CQAA 3LLDA 3O1NA 1JFHA 1I2QA 4G2DA 1JRCA 2PGFA 4N2YA 1CZ1A 4KESA 2VWTA 3DHDA 2QCNA 4LALA 3W75A 4LOCA 2NWSA 2A85A 3A4WA 3HJEA 1WUFA 2ZX8A 1OWQA 3HB9A 4B4HA 4I9MA 1DJHA 3TWAA 1TWWA 4B5VA 2NZLA 4ZCWA 1JCNA 3CV6A 3M1ZA 3RU6A 3W38A 4YL2A 3P7YA 3E3HA 1TMLA 4H9UA 1QDSA 4PBEA 5D2WA 5CGTA 1G5AA 1KFEA 3Q4DA 2GDQA 5I5RA 2E77A 3SUVA 5GNZA 1AH0A 1E9IA 4PRWA 3G0SA 4DPQA 2Z1VA 5TIMA 3F7JA 2GWNA 4IJRA 4WKFA 1DWIM 1QNOA 4EVZA 3MQTA 4LCRA 3WK2A 3R89A 3NL2A 2YCLA 3D3FA 4GI4A 4U4MA 3W6YA 1WX0A 3L5MA 3VM7A 5MKGB 5FSEC 4ZQPA 1E4IA 1IWBA 4IPNB 4B2DD 3LS9A 4HB7A 5C2GA 4RKAA 1QUMA 4HSNA 4F8XA 3VNYA 3OO2A 3DFPA 1I60A 3KCLA 2E8YA 1W56A 4LCQA 5I3KA 1JYXA 3AXIA 3F5KA 3RM4A 4Q7IA 3PAOA 3A6OA 1R38A 4GACA 5M2FX 6CGTA 2EJ1A 2PWVA 2BFGA 4G5DA 1G01A 3GC5A 2VHLA 3PZGA 4S3JA 4H00A 3L0KA 5AOUA 3MHUA 1PTAA 2D22A 4AYGA 4AZ6A 1QU4A 4KFOA 4X22A 4LWWA 2F8QA 5JBFA 4DVOA 1SFTA 2HROA 3W23A 4JFUA 2QJHA 1MEHA 1UZ1A 4GFIA 1UUQA 4XZHA 1OZQA 4AVFA 4P7RA 4LVFA 2AGKA 4JDYA 1SJCA 1V3IA 4U2YA 3BANA 3DZ1A 1XV8A 3WNLA 3M41A 1JUEA 2GJXA 2A3CA 1F73A 3DI0A 3ES8A 2PB1A 2DUZA 4LEQA 3R11A 1RY0A 1VBUA 3UBPC 4Q4OA 1XLGA 3AU2A 1OFAA 4G9PA 3QFEA 1CNVA 1V03A 4LF1A 1PZ1A 2HXTA 3R43A 4B5XA 5ECUA 1KFBA 4N9DA 4TVUA 4E8CA 3BARA 1Q63A 1KM4A 2WM0A 2BVWA 1EWDA 3B8IA 3KL5A 4FNQA 3NWRA 3CQKA 3NQDA 5HWMA 5A8PA 2DIEA 3VOCA 3F4NA 1ZCCA 1EJUC 5A6MA 2EF9A 4DJDC 4XO6A 1TPC1 4I8DA 4JTGA 4AAJA 4EANA 2I7GA 3JR2A 1SO4A 1XINA 3QGVA 2AAAA 2BVYA 1JCTA 2VEKA 3N17A 3HZ3A 2H9AB 1FWGC 1AFSA 3QFWA 4H7VA 4ICMA 1OFEA 2YCJA 2XVPA 2E67A 4YCPA 4M29A 4L65A 3HPFA 4XIMA 1ZUAX 3TZFA 2DZAA 1UPMB 4CNUA 3U4AA 1KM5A 2BY3A 4GKTA 1NDVA 2Z24A 3T6CA 1BG4A 3C2YA 1EPXA 3P84A 1MW1A 3FKKA 3ZVHA 3GFZA 4ICCX 3WD4A 3HO8A 2Q01A 5G4HC 3V36A 3LV5A 5HMSA 2OWCA 9XIMA 2R14A 4P7OA 3AJXA 1RZMA 3EKLA 2W62A 2NXGA 4E2VA 3B0PA 3EA2A 4DWSB 4GK8A 2E6DA 5FJOA 1V3MA 1V0KA 4JNMA 4NT0A 3EA3A 1K4HA 1OK4A 2HZGA 4C6DA 4A3YA 4LUSB 4AD2A 3NQVA 3S5NA 2J9XA 1TE1A 1SSDA 3SGGA 4JIRA 5DT5A 3QTGA 4FX6M 3DDMA 2DT0A 1L6FA 3W1LA 1M41A 4W7WA 1R3QA 4HYWA 2CKRA 1D7FA 4CVWA 3LHZA 2W79A 3SQSA 2W63A 3TJ4A 2Z7KA 2GVYA 2X05A 3THCA 1CBGA 1GHRA 2WK2A 4FEZA 2E40A 1U83A 4JY8A 3WEMA 4OJYA 3V0SA 4Y8EA 4K8EA 4LEFA 5HBFA 1GYNA 5G5IA 4WSHA 4Y9MA 3CV7A 5HQLA 2ZX7A 1BRLA 1VIWA 3P80A 4G7EB 1MDLA 4M7SA 5A6KA 5H2ZA 1AVAA 2IKJA 4HU0A 4H9MA 1F4HA 2YCKX 3K30A 2OG9A 3STFA 4WDTA 1UKTA 1TFVA 3WUBA 3G1RA 5CJ5A 4GQRA 3EEZA 2R1PA 5CGQA 3CM4A 2D20A 3THUA 1BF2A 1QPOA 1E0TA 4O1BA 4Y96A 1XH0A 4PR4A 4Z1BA 2IQ0A 3TJXA 2VRKA 1LTDA 5BXRA 4UFJA 4GY0A 3AMLA 1ISXA 2PLKA 1GK8A 3AIUA 4KGJA 3RAOA 4C6KA 3BDKA 3KOFA 1PCWA 1MNSA 4J9JA 1OVDA 2AKMA 2GJLA 1A53A 1EEPA 2WNNA 1FXQA 2VQUA 1Y5XA 3W26A 2ISWA 4WRHA 4UTIA 3GHSA 4JFSA 3AZRA 4LU0A 5KEZA 2Q6ZA 5C7HA 3UXIA 1LWHA 4MADA 3C61A 1UR2A 5BMXA 1EB3A 5BXTA 3B0UX 4GZIA 2WCGA 4AD1A 2C0HA 5A5WA 1LBLA 4S3DA 1EPVA 5GNYA 5F4WA 2POZA 4L9XA 2FDMA 4AY8A 2XSAA 4ZQMA 1LWJA 3QKEA 2DUXA 2Y5SA 3GVWA 4HOXA 1DIKA 4Q8QA 6TIMA 1Q7MA 1N8WA 3G18A 3BGGA 1W3JA 4EXBA 1XD1A 3PUDA 1MZHA 3IGSA 3IAQA 3QQWA 4TO8A 2NV1A 2X41A 5DF0A 1T7LA 5RUBA 1Q6RA 3IV3A 4IPLA 3QHMA 4DJFC 3VX1A 5HATA 3HG2A 1TR1A 3LGEA 3M43A 3ONCA 5DMNA 3SEPA 3KWSA 1H60A 1Y5VA 4JS3A 3QTPA 1PHWA 3ZS4A 2OOGA 3N4FA 1DJGA 5CSRA 2D69A 2ZZ1A 4XB3A 2BXVA 4QHRA 2HVMA 3RLHA 1Q85A 1OINA 4K7VA 4BR1A 2ATSA 3S46A 5M5DA 1E6PA 4ML4A 4ENLA 3KW3A 3E0WA 3P74A 2PDXA 3WQ5A 4Z1AA 4OOZA 2PGEA 4AWUA 4S39A 2PBGA 1ZBVA 4JIHA 1G94A 3HPAA 5LHFA 4MVAA 5D4YA 3W7GA 3FCPA 4GIRA 3M5YA 2DV0A 3HF3A 1C7SA 4NZ1A 2CXEA 3MYOA 3KXQA 4MY9A 1UOZA 4F48A 1ONWA 1PO9A 3WLSA 3IRSA 3L2LA 3H21A 4H6KA 1E1FA 4JTSA 3LBCA 3U48A 3IVUA 3FLUA 4JIPA 4AMCA 2QYGA 1X39A 4OBSA 1H4PA 3QRHA 5AC7A 2Y7EA 3RLUA 4HSHA 1E6ZA 1XDJA 2CZEA 2H3DA 3FSUA 1RP9A 3S5ZA 3CO8A 4KGLA 4XISA 4FOKA 4DJDD 3ITCA 4GC4A 4WKHA 4JHOA 3H2OA 2VFEA 4P7LA 1Q7ZA 1TA3A 2XH2A 2D0HA 4UTWA 3M0IA 3E0LA 5AC8A 3OG3A 1WDSA 1WAUA 3AUJA 5HQEA 1KA9F 5BWFA 2PDCA 2WJDA 3WK1A 4C1KA 3BC9A 4Q32A 2QUNA 4LF2A 5FCZA 1VGAA 2XM2A 2Y5EA 1A5SA 1I9CB 1A4MA 3BXWA 4JTEA 3M47A 3AAMA 3WF1A 1XH2A 3TJLA 2FGZA 4Z42C 4QCFA 4QAIA 5D8WA 2QCCA 3F5JA 2J7HA 1GQKA 1PL9A 2OJPA 4XSMA 3KVKA 4ADSA 3N2XA 3LHTA 5E09A 2FHCA 1VRDA 3EXTA 3NOEA 3PWAA 7XIMA 2AAMA 1QW9A 3ITYA 1DEDA 1UKSA 5CG7A 4AB4A 1NQ6A 1XW8A 2EPOA 3MZ2A 4ZTXA 4LY4A 4ZXLA 5HQMA 1SW0A 2JALA 3ZSTA 4L5ZA 3DC0A 3WUEA 3CZLA 3WMLA 4WXYA 2NSXA 3T0BA 5KZEA 3R0DA 3LPOA 1V3HA 3VO0A 2PTWA 1UUOA 1PIGA 5A1AA 1VAHA 1XLJA 4QG8A 2PU0A 1A5UA 1ZRQA 3RX2A 1IR1A 4AIEA 4HNTA 2PFHA 5LNSA 3CH9A 4AZGA 5I79A 1SQ7A 4MPKA 3FOKA 4PODA 3CQIA 3H2MA 4O1CA 1A5CA 2GJXB 1YNPA 1E4LA 1H49A 3AXKA 2O9OA 3ITXA 1XIBA 2V5JA 2PLMA 2AL2B 3VD9A 1V6VA 4C1NA 4K38A 4L7ZA 4FOUA 3R7MA 4O0ZA 2J24A 5XIMA 4S3AA 3KHDA 1XSKA 2YBTA 4HPNA 1AQHA 4GHRA 1P6BA 4ACZB 4GUGA 2CXGA 2IS7A 4QBXA 4WY0B 1TUFA 3E5PA 2OOFA 5CH9A 3WENA 3PZ9A 3DHPA 2J8GA 4O12A 2ON3A 1FWDC 1TR9A 1H7WA 1HUVA 2BG5A 3GHUA 1TTJA 1FDYA 4FNSA 5D9NA 2Y7FA 4BQ3A 3DHUA 5LIWX 2VTFA 1CT5A 1W3KA 1BXBA 4UXDA 3BK0A 1MSSA 5DANA 2NUYA 2B31A 3SUSA 1UR8A 1OX6A 2XGZA 1LL7A 1B2YA 2VXNA 3PZQA 4LYQA 2PRMA 1IWAA 5D33A 1E1CA 3S2LA 1YDNA 4HU4A 4HPJA 1A5NC 4MSSA 1RQBA 1LCOA 3N13A 2FGBA 3P62A 4UR7A 4O28A 3VK5A 1US0A 3VIJA 1PZ2A 4U3CA 4UTMA 5BRPA 3TN6A 4QX4A 2G37A 2PTDA 3MKCA 4ILSA 3IAPA 3LA4A 1LBMA 1R3YA 1JQXA 1X97A 1J11A 2WVSA 4G1KA 2QCDA 3N6JA 4JFWA 1OYAA 5CBBA 1VP5A 3HMCA 3GWQA 3CLWA 4Z0SA 2QLYA 3LXCA 5FF0A 4M1RA 2X2GA 1UMYA 4ERGA 1CYGA 1UP2A 1BXNA 1JZ7A 4XD4A 1S5WA 2QVNA 2JFEX 1V0MA 4PUDA 1QNRA 1OCQA 4IIHA 4DUOA 3QF0A 4IJCA 2BXZA 4YYCA 3S83A 4AZIA 1B90A 3L23A 1QNPA 4TV5A 2QULA 4E6MA 3TLLA 5AHMA 4C6MA 2WBKA 4H8UA 3S6OA 1H5YA 3CTLA 3M4HA 4F0LA 4E2DA 1OY0A 2REQA 1BRLB 4NSBA 4CD7A 2RDXA 4RNJA 1VR6A 5JH2A 2OEJA 4JTUA 3BV7A 1G0CA 1WOAA 5ABTA 1LBFA 3E2RA 4L1GA 4UNLA 4WDUA 2GJRA 2WPGA 1NARA 4NF7A 1MW2A 4E4FA 3MMDA 2BHZA 4HCHA 5FJPA 1MUCA 4M80A 3PZVA 2A3BA 2Y1HA 2QIIA 1KBIA 3NM1A 5HMEA 1W8SA 2WKJA 4MDOA 1K6WA 2Y8KA 2AQWA 1R86A 3CHEA 3IGXA 1B54A 1A5KC 3V35A 1AW1A 4WUIA 3LCFA 4TMCA 2DW6A 1TJRA 1H7PA 1THFD 1DWHM 1EDTA 2CLMA 2YYTA 1UIPA 4PMNA 1ZJAA 4ZL1A 2NUXA 3I6EA 4RDYA 1B9BA 2BOEX 2NQHA 4QXIA 1V02E 3P0XA 3KL0A 1XYCA 4M56A 2B7PA 3T05A 3S1WA 4QJ1A 3NYDA 1HVQA 4JEQA 5D02A 3OA5A 4YLWA 2J7FA 1H2JA 1LDCA 3URNA 3S2CA 1TV8A 3RIKA 2UY2A 4J5NA 4G56A 4I7UA 3GDMA 4QEHA 3S8HA 3SW6A 1R30A 2VOTA 3DGRA 1LL6A 1KRCC 1TX2A 3N25A 3GAYA 3A3WA 4PMQA 1LT8A 4BI5A 1EOMA 1TWSA 2VUNA 7ODCA 2NWRA 2PF0A 3TSMA 1E1EA 1B3XA 4A8IA 5GVJA 2PGWA 5CAHA 4HGXA 4C6EA 4J40A 1FHUA 2XH4A 4H6QA 4LUJA 5A8QA 5FL1A 2OSWA 1VYRA 2NX3A 1WA3A 4J3UA 1EIBA 5C9XA 4CQBA 1B3ZA 2ZUMA 2UV8G 4NILA 2PDBA 2GVGA 4J27A 3QLLA 4LS2A 4CLMA 1ZJHA 4PCSA 2NT0A 1WDRA 3VC6A 3IJLA 5I06A 3WL1A 1VFHA 3UWQA 4DO7A 2GYIA 2C1HA 3POHA 3F1QA 4YVXA 1XISA 1DV7A 3VNZA 5F2GA 2XN0A 2EBNA 4LAUA 1GOIA 4ZOCA 1BYAA 1P0BA 4LNCA 4S38A 1G6CA 4GC3A 2EG6A 3U5YA 1MYRA 2ZVIA 3VGBA 4CNSA 2V5BA 4GABA 3TYZA 3ZLFA 4Q4QA 1TV2A 4PTXA 4PE8A 2VNCA 3WFZA 1W5PA 1F2JA 3LYEA 1OX5A 3KBMA 5E93A 1NTHA 4Z1YA 5A2CA 3CNYA 4KCWA 3VOJA 3NQ2A 3L67A 3A47A 3WLJA 4IQLA 7ENLA 3W37A 4GRSA 3QPYA 1QHZA 2YA0A 4I5UA 1E6SM 3E0FA 3E49A 3PR2A 5H8MA 1FWHC 4L1XA 1CTNA 1TA3B 4EPEC 2E5DA 3TMLA 3SY1A 4DN1A 1WP6A 4GY7A 2JGYA 1AH4A 1XP3A 3UYCA 2DU2A 1TJ1A 5GPRA 3GHTA 3PJXA 1NWTA 1ZALA 4X9YA 3LQGA 4GO8A 4ZMGA 3WNNA 4B4FA 4S3GA 1XR2A 5KETA 1PYMA 4WJ8A 3H55A 3N3TA 4DJFA 1A0EA 3TWBA 5EMMA 3ZIZA 3AICA 4AEEA 4ZXOA 1AK5A 5T26A 3KCOA 2YSWA 2J25A 4XAZA 2WNWA 4HPHA 1AA1B 1K77A 3UA4A 4HU8A 3Q58A 4UC5A 3CWOX 4RE3A 3W2JA 2QVHA 2VZOA 3M07A 5I07A 5I02A 3EX4A 4TX6A 4JTTA 2XFWA 4GI9A 4F0MA 4Z17A 2J74A 3ZQ9A 4HVXA 3QQ0A 4RZ6A 3ECQA 4U2ZA 1KBJA 4BZYA 3FYOA 3CMFA 3BOLA 1J0JA 5LIKX 2W6RA 4J7RA 5A6BD 3U2ZA 3PZNA 5BWAA 3FXGA 4K36A 3CWNA 2WWDA 3LEPA 1FXPA 2QGHA 4GGHA 3GTHA 4Q33A 1ZTVA 3R1ZA 4O17A 4GQ0A 2OTDA 1GTHA 3W4RA 1CXEA 2XVKA 1ZAJA 1BFNA 3GKFA 2YL8A 3MDWA 3I3EA 4H2HA 1BD0A 3QOMA 1DWJM 3N2BA 3VVGA 1HX0A 3V16A 4QAWA 1EJXC 1VPQA 1X8FA 3WLPA 1JEZA 3A3HA 3NXFA 3W86A 3TJIA 3R0UA 5U7SA 1H0GA 3C86A 1H7RA 5D09A 4ZO8A 4YTQA 4ASTA 1CGTA 1FWJC 3AHTA 1DWAM 4XTIA 3FJ4A 2XFYA 5E6ZA 3B40A 3CQ0A 1QHOA 2TODA 4RW5A 1REQB 3EWXA 3GG0A 1DIEA 1KR1A 1UQZA 3A24A 3SRKA 4KQNA 1NSJA 1R87A 2FZMA 1RP8A 3WYZA 4W5ZA 1EX1A 3KP1A 1PDZA 2C71A 2ZADA 3PK7A 4WJXA 1OABA 1QPNA 3XISA 1JR1A 2V9DA 2YFNA 3WKZA 3PC0A 1CW2A 3ZSSA 1VIZA 1YDVA 3QZ6A 1T41A 3N1AA 4QJ3B 4C6CA 1WXZA 3QMTA 3QMSA 4F9JA 3EB4A 4ZA0A 2ZRYA 3WBYA 4BF9A 4GXWA 1MZRA 1S46A 1P0DA 3C3NA 3TONA 2HK1A 3TLQA 3FDGA 1AW2A 1VHNA 5CZTA 5BZAA 4JHMA 2E1DA 3SI9A 3N9SA 3NUKA 1V79A 1W3HA 1E1CB 1EJWC 2FH6A 1KWKA 2G3IA 4GJIA 2CZVA 3U3HA 1N55A 4HMDA 5EMJA 3L5AA 3W0KA 4LUYA 3WCZA 2BVTA 4WOZA 4R3UA 2ZRZA 5T91A 1DOSA 5C70A 4LQ1A 3AI0A 4Y2WA 2B0MA 2J62A 3M0LA 3URAA 3UXAA 5IBXC 1HP4A 4HJWA 2EKCA 3OBAA 4P61A 1HJUA 3Q94A 1E72M 3NO3A 2TSYA 4XTDA 2DIJA 1SO3A 1H7NA 1SJDA 5A6SA 5H91A 4YXGA 1C91A 3CUJA 2Y4SA 4AVNA 3OLEA 4GLEA 2O4QA 1HL9A 1WYIA 1QPQA 2BVDA 1PV8A 4B9ZA 2YDSA 3G22A 3EDJA 4KEUA 4LB4A 1IE7C 1UWTA 3GXMA 3W2KA 1JCXA 1RD6A 1RY8A 5DMYA 2I9EA 1R3WA 2J6XA 1GHSA 1POKA 2VFIA 3B03A 4NI8A 3VNDA 2QT3A 1EXBA 2W67A 5HA7A 3SURA 2YX0A 1FA2A 2CYGA 1W54A 4LV4A 4KMQA 1NF7A 1OFBA 2D73A 3WF4A 2ATMA 2X1IA 3S1VA 5DCDA 1VH7A 2G0WA 2RKXA 4G7FA 3KVJA 2YXGA 1FBAA 1BWVA 2X1UA 7CGTA 1NDZA 1QK2A 3FVMA 5I09A 1S5TA 2BXYA 3EPMA 5HNTA 3OYXA 3VIMA 3EAUA 3NQ6A 4WXZA 4X2PA 3L65A 4ONVA 3FA3A 1V02A 3KLLA 3L12A 3GG8A 2XM1A 5A8GA 4DF1A 2OODA 1U33A 5MF5A 1VLIA 4AWTA 2I5GA 3ARTA 2DJLA 3ATZA 3UCDA 1G4SA 2PCEA 3RNDA 2QPSA 4YTSA 1LRTA 3FDKA 2WNQA 1UA3A 5K9XA 4US5D 3DG3A 5I78A 4NXKA 3ABQA 4GYFA 4KCUA 3PB0A 1VFFA 3SQLA 2DZWA 1KLYA 5AHEA 2A7PA 2CHOA 4ZR8A 2V3DA 4Q22A 1QK0A 5A94A 3T07A 3WH5A 3W6LA 3WJZA 3IACA 2G41A 3DFNA 3UWWA 2YFOA 1S39A 3QR0A 3AS2A 2EPLX 1U22A 3GU9A 4HCLA 2OT0A 3UWVA 3ZWSA 4WJEA 1RHCA 5J04A 2VEMA 1EJVC 4W8AA 1NY1A 4GJJA 1TB3A 4MKVA 3W28A 4RZBA 4F40A 2R1KA 1S2AA 1UZ4A 4QLJA 1KRMA 2WHMA 3PAJA 3S2NA 3I68A 4ATLA 4M51A 4DAIA 1S5VA 3TV8A 3G6MA 4H9ZA 2IPWA 2KAUC 3P61A 2W0UA 2QIWA 4MYAA 3JRKA 4BF5A 3DFSA 1E5JA 2O9PA 2AGTA 4JR5A 4H2CA 3CASA 1K03A 1W2VA 3LDVA 3NDOA 1QXLA 2AOSA 2R1LA 4FAMA 2O9TA 4LT9A 1UKPA 4MZ8A 4BKNA 4E2BA 3INPA 4BFAA 2D24A 2XH7A 3APYA 1DJIA 3W74A 3URBA 3M7SA 4KF1A 5HNRA 1X7IA 3WLNA 3N2OA 5KSWA 3N6QA 2YDRA 2D3LA 1XBXA 3EGJA 3JW7A 1XYLA 3IUDA 5E0FA 2B7OA 5KMYA 3IWPA 1O5KA 4J3XA 1XKJA 3GVGA 1F3WA 1RBLA 3EOUA 4AXKA 1G67A 3MW7A 4H6EA 4C7DA 3NSXA 4HCDA 4B16A 4XX6A 5FD0A 2VWSA 2J4GA 1TRDA 4MLRA 4P5UA 2CBJA 3EKZA 1SYTA 4HTBA 2HK0A 1GQLA 1Q6CA 2BX7A 4Y9AA 2WMGA 2G96A 5A3HA 1IR2A 5DRIA 1GT8A 1VCFA 5LYRA 4KKXA 4PMXA 3CT2A 3I3DA 3LBMA 1LROA 1KCLA 1VJSA 2OYMA 3BH4A 4ADTA 3IPWA 1UWSA 3AHVA 1CDGA 4ZOEA 2IPFA 1WKYA 3TXVA 2PD5A 3SSJA 3R58A 1S2WA 4HK7A 3GNRA 1JI1A 3FFSA 2WVVA 1UD2A 4D8ZA 5IFPA 5C9UA 5HMFA 3TC3A 4PMJA 3DG6A 1BWLA 1W1TA 3ABXA 3RLVA 1M68A 5A6LA 2BHYA 2WMFA 1CENA 2PLJA 3HURA 1JPHA 2ASHA 3G1XA 2O7QA 1KFCA 3G6LA 3DGBA 1TV7A 5FEXA 2Z25A 1DQUA 3BLPX 3ICJA 4FSAA 1FCVA 1EF3A 5JU6A 2YW3A 1XBYA 6ALDA 1JF5A 2YA2A 1JVNA 3T8LA 3CMJA 3MMUA 3F4CA 2I5QA 2CEQA 1OFOA 1E6NA 3VIFA 4NJJA 3PVFA 2GVLA 1EWEA 4JQAA 4JTCA 3SIZA 2NQLA 1VYSX 2VZSA 4AISA 2QCHA 4DPPA 1DTNA 1XIHA 2VEPA 3MV01 2A21A 3GU2A 3GSMA 3QN3A 3GUWA 1I6NA 1FWWA 1VBHA 4LPCA 3SIMA 1R3RA 1TMHA 3C2FA 2J9YA 1I4NA 5I2UA 4N9EA 3WH6A 2CESA 4U10A 3H7UA 1TPB1 3QGKC 1J0HA 4AD4A 3RHGA 4W5UA 5EA9A 5IHSA 1W0MA 3P0WA 1FWNA 1M65A 3H26A 3W73A 2R82A 3G1HA 3NDZA 4L6HA 5JBEA 1UWUA 1W9BM 4ZB0A 1W3IA 1TZ9A 3PUEA 2Y5JA 1J5SA 4Y9NA 2A79A 1E9YB 1PPIA 3WDHA 3V1HA 5E9AA 1Z7AA 2OQLA 3LRMA 3HV8A 3LOTA 5LNWA 4UB9A 3PS7A 5TD4A 3N34A 1S2TA 1AH3A 2FMOA 5FJTA 3C2RA 2V69A 3GH4A 5EL1A 2Z26A 2WNZA 4KWOA 2R8WA 3GNDA 2PDMA 3USZA 3NPXA 4MTVA 3PBUA 1ISVA 2ZUVA 2Y8VA 3LLXA 3WJWA 2RUSA 1Q2SA 4MJMA 2O56A 2F7FA 4UTUA 3OIHA 3VCRA 4B5UA 2RGLA 3B9AA 5GJNA 4GXMA 1IEWA 3H4XA 1WAWA 5IOBA 5JQ9A 3H24A 2OU4A 4CU6A 2PRHA 3T0DA 3H22A 1CXKA 1FFRA 3CPRA 4XAYA 3NQ8A 3QZAA 1XLIA 2F2HA 2XG9A 2VL4A 4PYSA 4PZVA 1FKWA 4GIEA 4MZ1A 1GYLA 2HQAA 1TQJA 1HVXA 1JGIA 5I6SA 1E0WA 2IKIA 4IG2B 4WGXA 4HN8A 4K7YA 3G24A 2F6UA 4KRZA 4JTQA 3W70A 5KZMA 2BGNE 1TE6A 4AX7A 3A9IA 3YPIA 2BP1A 2ZZ5A 4TX8A 4AYSA 2WM1A 4IUGA 3TTSA 1YTDA 4MB3A 1U2YA 1GZGA 3SRHA 1J0ZA 3VDCA 2KX9A 3T0AA 4PL2A 3BL3A 4ADUA 4HIBA 1FKXA 3TNBA 5CC5A 4DF0A 1OX4A 3QC3A 5REQB 4E5TA 1R8LA 5FEWA 3K1DA 2J13A 3N73A 5FF3A 3FK4A 4S3KA 4DZIA 2HISA 3RX3A 1I2OA 1L8NA 1R2SA 3TZNA 4I5XA 4Y9PA 3UERA 1EC7A 2ZUUA 3ZT6A 4JL2A 2C0AA 4N4QA 4F0SA 1LL4A 3KRZA 3DXIA 3CAQA 2DVXA 4PTMA 3BMVA 3MANA 3ID7A 1GVEA 1CGWA 1PTGA 3LPGA 3PFMA 2DY3A 2QEZA 3HIJA 1ALDA 4LVBA 4PUUA 1GJUA 3T9PA 1JUBA 1CB2A 3T44A 4QTGA 2WZIA 1TZ7A 1UR4A 1TWIA 3A3XA 2QJNA 3OBKA 3W7MA 4FS9A 3W7QA 2OSYA 1EIXA 5FJUA 4F4RA 1JCLA 2VELA 3V5CA 5LNUA 2ZRWA 2WJFA 2ZIDA 3PTMA 1J10A 4PEEA 5CZSA 1VZWA 2F6XA 3C5QA 5DXYA 2Z1SA 3R4IA 3TKFA 4IGHA 3GH5A 3F2CA 4QROA 3LXAA 4CQ9A 2ZZ2A 4DBUA 4GYPC 1OFPA 4MOZA 2QAFA 2X7VA 2XWDA 1L6GA 3CMGA 4WSKA 4GNKB 3PM6A 3PZMA 4A3QA 3KUMA 1XLBA 1MUWA 1Q8AA 1V51A 1XX1A 3W71A 4JCLA 2VX5A 2ZUWA 3IV8A 4LSBA 1XH1A 5AZ0A 4XBKA 3HBLA 2QXWA 4Q4PA 3TSDA 2TMDA 4IFKB 3BGJA 5U4NA 3TP4A 2V5LA 2ZX9A 1F74A 3BURA 5HMDA 2JEPA 3AIWA 4MWAA 5JIWA 2VD8A 3GR7A 4PMYA 3AMKA 4X61A 1GVOA 2G8ZA 3GXDA 4LUTB 5FEPA 2OT1A 2JQXA 1KM1A 2ZXBA 4YVPA 3BSMA 1GG1A 2INFA 4DJEC 1JD7A 4OVXA 4TQTA 3A64A 3MUIA 3E02A 1VFLA 5M17A 4AEFA 4JFVA 4DYJA 4CN1A 1GZJA 2PE4A 4AF0B 3QPEA 3TK7A 4O10A 4ZQCA 3V5OA 1I75A 1HXJA 1K8YA 3NQCA 3NQFA 5C6MA 1K9DA 3WQVA 1NP0A 3UZ5A 3NL3A 4GJ1A 3BLLA 4O54A