1EP1A

Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
309
Chain Sequence
ENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAANVKAIELNISCPNVKHGGQAFGTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
pubmed doi rcsb
molecule keywords DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
molecule tags Oxidoreductase
source organism Lactococcus lactis
total genus 99
structure length 309
sequence length 309
ec nomenclature ec 1.3.1.14: Dihydroorotate dehydrogenase (NAD(+)).
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ep1A00
5EY5A 5HWNA 1MZHA 5DELA 5BNKA 2FPTA 4MZ1A 1OG0A 1UB3A 4FX8A 4GFSA 2PURA 2JGYA 4NJKA 1ZHAA 5H91A 2XN2A 3R2GA 4Q32A 3LRMA 3LDVA 3TFCA 2V5LA 3UYCA 4RKAA 4TR9A 4ZQRA 3W7DA 1TMHA 4TO8A 1UCWA 1I8JA 2B0MA 1Q3NA 2YW3A 1KM1A 3O07A 3LBMA 3SJ3A 3W7IA 1S5VA 5CPLA 3UY7A 3PC0A 3GDRA 4AHQA 5KMYA 1O5XA 2E68A 2VFFA 1OFPA 1X6UA 3W1LA 2FFCA 3TJLA 4Y8FA 3UWWA 3HMJG 4OBTA 3C3NA 4L4LA 1O60A 2Y70A 1YDVA 2RDUA 4O19A 1SO4A 4UXDA 2CLEA 3SECA 4BK9A 2QUTA 3QJAA 4HT3A 4UTJA 1G69A 1Y0EA 4FNRA 4O50A 3L0KA 1B4EA 2YPIA 1LLWA 3W7QA 1LBLA 4ZL1A 1FWNA 1TPB1 4BI7A 2ZZ5A 1QCWA 3GAYA 4N6EA 3NM1A 1AW5A 5H2ZA 2CLLA 4JD4A 4AAJA 5DBUA 1T99A 4PEKA 2NX3A 1K7FA 1VHNA 4AF0A 3SGUA 3QMRA 2E1DA 4Z0JA 3U2OA 1DJQA 1GYLA 2GVLA 3UPWA 1W31A 3BK0A 1BWKA 1WDWA 3LTPA 2NWRA 2Y61A 1CX9A 5G2IA 3GAKA 5I3FA 4HPJA 3TC7A 3S1VA 1OABA 3GNNA 3L66A 5AYZA 1SO6A 3OVPA 5AFDA 3TUUA 2QUVA 5FEXA 3N14A 2ALDA 3PSWA 3WFAA 3DHFA 4UTTA 1DBTA 1JCMP 1YXYA 1LLZA 3T55A 1FBAA 5HULA 3E49A 3QW3A 5D2WA 2QF7A 1OFEA 2H90A 1X7FA 3PG9A 4ORMA 3E9AA 4O18A 5F1UA 1TQJA 3BVJA 4I7UA 3R5EA 1I2PA 3N73A 3CT7A 3NQ6A 2H3BA 3STCA 3IIVA 3P81A 3G1FA 1ZNNA 3W2UA 3PUDA 3M5ZA 5K4XA 1TPH1 1DORA 4LUIA 4R34A 5G4WA 4ALDA 3W74A 3FYPA 3LCHA 5LNVA 1X1ZA 5AC7A 3GXNA 3QQ0A 2QCDB 3VNDA 1F76A 5AHIA 3PBWA 2W0UA 2A0NA 3GLCA 1VPXA 2X1RA 3MUXA 1P5BA 3O8AA 1QDSA 5CG7A 2V82A 2A21A 2VFDA 1H62A 2PE4A 1NVMA 3HBLA 5J5RA 1TPFA 4UTTC 1WYIA 3SIZA 1H1YA 2GVJA 4O54A 3LCXA 2TPSA 1RQHA 1WBJA 1FXPA 1LP6A 1AK5A 2JGQA 3STGA 4OV4A 1W3TA 5HQEA 5K9XA 1QO2A 5HNRA 3HPSA 2CZDA 3EB2A 4J9JA 3W1XA 3W7PA 5E1QA 1KW1A 5LHEA 3VFLA 3GVGA 3W2NA 4BI5A 3QYQA 5FEWA 2NV2A 3BLEA 2YR1A 4JDYA 5KINA 5D02A 2D73A 2NUYA 3VI2A 1FCQA 1EX5A 1HFBA 4JTLA 3PBYA 3LI1A 1WAUA 3NQFA 4L4MA 1G4TA 1QR7A 1OYBA 2LLEA 2ZRWA 4NNAA 1A5BA 2F84A 4MUZA 2ZRXA 2Z0IA 4N9CA 4CQAA 2ZRVA 1TV5A 1H7RA 3LXBA 1G7UA 4MY1A 5DBTA 4A3UA 2J24A 5I3JA 3I68A 3NL3A 3KVKA 1QO5A 2FQIA 1XBYA 4Z08A 2QEZA 4JY9A 3W3OA 4RZ5A 3BW3A 3O16A 2Q8LA 4GUJA 4MYAA 5KSWA 1KM6A 2W79A 3O6DA 1OX6A 3PAJA 3KFTA 1ICPA 3LHWA 2Y7EA 4H4IA 3NQGA 2YYTA 3OBKA 1NSJA 2FIQA 5U7SA 1V5XA 2C15A 4RR4A 4AHPA 3L65A 3R13A 1H60A 3RU6A 2QCCA 4WD0A 3I6RA 5AB3A 4NJJA 2R94A 4JGDA 2E77A 1L9WA 1VYRA 3A21A 5K3VA 4XBSA 3ZR4A 2X30A 3DAQA 5D32A 3TFXA 1EIXA 4OT7A 4K36A 3PS7A 3MYPA 1KM4A 1QWGA 1GJPA 4YXGA 1Q6QA 5CKSA 5HINA 1W8SA 4CQ9A 2A6NA 2P0OA 1L2UA 2X1UA 4NQ1A 1VS1A 4DO6A 1F73A 3CHVA 3FJLA 2YFNA 3U8GA 4X22A 1TTPA 3PM6A 4O1BA 2UV8G 3QSTA 1WA3A 3P84A 1THFD 2RKXA 1KTNA 3FEMA 4HNNA 4TMCA 1QPOA 1DOSA 3QH2A 3DI1A 2RFGA 3M43A 3CIWA 3NL2A 3TX9A 3PVFA 3IIPA 1W5QA 4RXFA 4DO4A 1HUVA 3GDKA 1I4NA 4RK8A 4S2CA 4LY8A 5D37A 1FXQA 4ADSA 5F2GA 2XN0A 4M7SA 3A9IA 1FX6A 4IQLA 1B57A 3EXSA 3PY2A 3B0VC 2X16A 1OK4A 4ONVA 1UBSA 1PS9A 2V81A 4FX7A 2NXGA 2TMDA 4X3ZA 1NF7A 4AF0B 1KFBA 4OHQA 2E09A 4NJGA 1ZJIA 4XZ9A 3L67A 4NX0A 2O7QA 3WK0A 2I1OA 3BGGA 3NYZA 4IPJA 3SZ8A 4UR8A 2ZCGA 1H7NA 2VFEA 4KWVA 1CW2A 1W5OA 4MIMA 4LV4A 3W7OA 4O4VA 5G1TA 4ZQMA 4AWTA 2B7OA 4MJMA 1TB3A 3C2EA 3BLFA 3DFQA 4HNUA 3OEXA 4Z1BA 5AHMA 3QMTA 3LV5A 1OX4A 3RFAA 4WY0A 2WKJA 2CLMA 3VE9A 5GVJA 4DBDA 1Q6OA 4CNOA 4IPIA 4WY0F 2NV1A 4K39A 1SFLA 4GUHA 1SUXA 3KVJA 1W3NA 4HN4A 4HNVA 2ZZ1A 3H53A 1IXQA 5AC6A 1GT8A 1GEQA 3MMTA 5BW6A 3B0UX 2Y85A 1Z44A 2WSQA 3MHGA 4FNUA 2C14A 3HGOA 2JKAA 2J6XA 1SSDA 1QMLA 2YCEA 4GXMA 4I9AA 1I2RA 1SPQA 1VC4A 1ZAJA 3LXCA 4XTDA 1TPVA 4MOZA 5LHFA 5SWUA 1XUUA 2PRHA 4E0CA 4AVFA 4KFNA 4LVAA 3NPWA 3DFTA 2B7QA 4ZMGA 1PHWA 3N34A 1R2TA 1LRNA 1LRTA 2QCHA 4NZFA 2DZPA 2WNNA 3DZ1A 1EA0A 4O11A 4JTKA 5CZSA 1LRQA 1TPUA 1WBHA 3LTYA 1P1XA 4MPQA 5LNSA 5C5YA 1FWWA 4ZQNA 1ZAHA 3G18A 3OVQA 1J5TA 1F6PA 2VENA 4NNBA 4MYXA 5F2LA 4WQ6A 4IWWA 3M44A 2ISVA 1H1ZA 2EKCA 3QW4B 2QKFA 3W83A 4CCEA 5C55A 1WQ5A 3W2JA 3P80A 1JVNA 3KVMA 2DORA 4GE8A 3GYEA 4JYFA 1XXXA 4TX9A 4FIRA 3CWOX 4FX6M 3G1YA 4E38A 3O6YX 4G1KA 2G97A 3P8JA 3LCWA 3M16A 3NDOA 2PCQA 2VXNA 1JUKA 3HGJA 4Q4KA 4GUIA 5EMUA 1Q6RA 2GOUA 4UTIA 5CSRA 1XM3A 1VCVA 1NAL1 3S1UA 2Z2UA 2X1TA 5LNRA 1H7WA 3E12A 3E96A 1TO3A 2ZZ3A 1P0NA 1SW3A 4O12A 3F1QA 5D2VA 3NNTA 2B7NA 3L0NA 4WXZA 3L9CA 4UFHA 1G7VA 3DFOA 2BZNA 3N9RA 2H3DA 1XFBA 2ZRYA 3FLUA 3TQ0A 1RVGA 3UWUA 3F4NA 3LV6A 1JRCA 1PIIA 3W7MA 3EEGA 4YCPA 2ZTKA 4O16A 4NX5A 1DQWA 4LS0A 1ALDA 3G3DA 2NX9A 1A50A 3P5YA 5F4XA 2V2DA 3DBPA 5F1VA 2VC6A 3TKFA 3FKKA 1PVNA 2QUUA 2Y7DA 4UCGA 4YWIA 3CU2A 4KKXA 3PULA 4ZZ9A 3EWBX 5DY2A 1C29A 5C54A 3TK7A 4JTJA 2QCFA 2GQ9A 2VEPA 1VHCA 3LCFA 4I7VA 2DZWA 5U4NA 1TV8A 4M6QA 1S5TA 1JR1A 2DZXA 2Y63A 3IGUA 2V30A 3LCGA 3G1HA 3TSDA 1BKSA 1LOQA 3EKLA 1O95A 5FF7A 4XKYA 1YTEA 3N3MA 3M5VA 4N4QA 4JX6A 1B4KA 2ZA3A 1VJIA 3LI0A 1XCFA 2V8ZA 3PB2A 4NNCA 4BF9A 3NQMA 4O1DA 3NPVA 2YX0A 3PUOA 5AOUA 2OT1A 1XDLA 4OE7A 1DL3A 1F7BA 1ZCOA 1OJXA 3ZWSA 3BV4A 3R89A 1H5YA 2NZLA 4NXKA 3W7LA 1KM3A 4AWUA 3NO5A 2Y62A 3USBA 3HF3A 1RR2A 3CEUA 4FNQA 3G1AA 1AL7A 4AXKA 3RLUA 3TIMA 1LYXA 5BMWA 2WO5A 3WJYA 3P5ZA 3FA5A 2TYSA 4I7WA 3R8RA 3DU0A 1SZEA 3SGZA 3PSVA 2C16A 3FOKA 4LVFA 1SZFA 3W1PA 3MP4A 4GUGA 3MI6A 2A7PA 2A7NA 1VR6A 3HOJA 2BSLA 2ATMA 1FQ0A 3EWUA 3GDLA 2RDTA 1T0OA 2ISSA 4KWWA 1J2WA 2NXIA 3EWWA 3S0CA 2QJIA 4R53A 1YXDA 2G95A 3ZWTA 1EPXA 5CSSA 5DCDA 3QZEA 3MHFA 4M6PA 5EPDA 3W7JA 3GNDA 1TREA 4BFAA 1OF8A 1UJPA 2BTMA 4UTUA 3SW6A 1S3HA 4ZQPA 4PFMA 1JCYA 4GJ1A 5D2YA 2YXGA 1OX4B 5F4SA 2DZUA 4K6AA 4WY0B 5LGXA 3LLDA 2GPTA 4JNMA 4JEQA 4IJBA 3TSMA 2ZZ7A 3B03A 3HIJA 4ZQOA 1JQXA 1JUEA 3EKZA 5AN7A 2EF9A 1JUBA 2QCGA 3C2RA 1XBVA 3AJXA 1G4PA 3MI2A 3W71A 1XDMA 5A5WA 3P60A 1YLVA 1YADA 3W1QA 1VZWA 4S1FA 4AEOA 2QDGA 5DLCA 3NAVA 1KM2A 2XN1A 4GWEA 5D05A 3L0GA 1KV5A 3TQKA 2ZRUA 3GKAA 4N02A 2IQTA 4DF1A 4OWGA 3P67A 2RHGA 3IVTA 4JTFA 2ZA2A 2Z6JA 1QNVA 1F5ZA 1NF0A 3LM7A 1FCVA 4DF2A 1M5WA 1AL8A 1OFBA 4DO5A 4JS3A 2VKZG 3W22A 3F03K 4PTNA 4UR7A 1L6WA 6ALDA 5DXYA 3B05A 3C52A 1NEYA 4K7VA 5E0KA 1OX5A 3O05A 3L21A 4RZ6A 3I7RA 1KTBA 3QSRA 3LGEA 4MFEA 1MO0A 2VFGA 3A5FA 4LW7A 1GQNA 3QMSA 3W7RA 1H7XA 3GR8A 3TAOA 2H8ZA 3TR2A 5A8GA 3TC6A 2ATSA 2CU0A 1KTCA 3IIXA 1RQBA 1R2SA 3W88A 3ABRA 5FF0A 3UXAA 3I7SA 4IUOA 3UY8A 4NJIA 1DQXA 3M41A 1OF6A 2JK2A 2FDSA 2CWNA 3IGSA 1PE1A 3WJSA 1PL9A 3W7KA 4FIQA 5CPNA 2CZ5A 5D04C 2WPBA 1L6YA 1W0MA 2A6LA 4RV8A 5FF3A 3T78A 1KM0A 2WOQA 4JTUA 1AW2A 1ZALA 2WNZA 2R8WA 3HGRA 2JBMA 4GRSA 3IV3A 3LCLA 4UFMA 2Y7FA 3A23A 5C6MA 1FCBA 2B7PA 3W7HA 1HO4A 1P0KA 1F6KA 2KZHA 3NA8A 1KLYA 2Q3OA 1I2NA 3Q94A 1VCFA 4UTWC 4FXRA 4LOCA 2Z6IA 2NX1A 1DVJA 3CIXA 4FNTA 2X1SA 3ANYA 3P62A 3O63A 3JS3A 1A5CA 3IVUA 2ZZ4A 3S1XA 3W1RA 1N8FA 4JYDA 3C56A 4TIMA 2HSAA 4AH7A 3TXZA 5TQLA 3INPA 5HUOA 2ZZ6A 4Q33A 3EX2A 1YPIA 3EWXA 1ICQA 3ABOA 5DCBA 3TH6A 3C2OA 3W84A 3M0ZA 5D2TA 3UWVA 1N7KA 3N2XA 1OFAA 4QNEA 3NQ2A 4M19A 3G0XA 4WXYA 5L6UA 1EP3A 1ZENA 4DBEA 4FO4A 4LNYA 1PV8A 4XKYB 4UNLA 4YLWA 4O1CA 4JX5A 4NUWA 1A5AA 2Y89A 1TCDA 4U4MA 4JTSA 3LRKA 1VLIA 2ZBTA 3PB0A 1VH7A 3FKRA 5DCEA 4LC6A 3G1SA 1K03A 5I3GA 3HO8A 4DEFA 4LVBA 2A2IA 4U28A 3NGJA 3HJZA 5HWJA 1H7OA 1DKWA 3TW6A 4O10A 5FEZA 1PCWA 3B0PA 4RXGA 2J27A 2C13A 1KFJA 3GK0A 1RV8A 1EWEA 3NQVA 2OCZA 3UXDA 1UUMA 4PCFA 4O28A 3OVRA 2VOMA 3NZ1A 4R7JA 4RX0A 4P61A 3TXVA 2Q3RA 2Z1BA 3MYOA 1QAPA 3P82A 4Z1DA 4IOTA 3H54A 1QPNA 3NR0A 3G8EA 1QPRA 4JDBA 4RLIA 5LZLA 4D2JA 4JX4A 3T7VA 2C0AA 3MWAA 5K9CA 4N6FA 1LDCA 5D30A 3RNDA 3N9SA 5KZDA 3GIYA 1XKYA 4LV9A 2AQWA 2RH9A 5HMSA 4A29A 1R47A 1GTEA 2CLFA 3LHVA 3O06A 2WSRA 5BRBA 1EEPA 1ONRA 1TTJA 5K2ZA 1KBIA 4JYEA 1ME7A 2WSYA 3DENA 2FLIA 4GC4A 5D2XA 4MKNA 3B4UA 2I9EA 4IMGA 3G3MA 3CEPA 3EXRA 2C3ZA 2C1HA 1HL2A 5HUPA 4MVAA 1SO3A 3I65A 1FY6A 1W5NA 2PRMA 2WJZA 3NXFA 4IMFA 3QPZA 2CZFA 3NL6A 1ME8A 2YZRA 1K8XA 2E5CA 4DF0A 3VE7A 3GKFA 2FB2A 4BI6A 3AO0A 3STFA 1WOAA 3CM4A 5CPOA 4XTIA 1TSIA 4FF7A 5TIMA 2ABBA 3DXIA 3M1ZA 1FCUA 3BG3A 1VCGA 1GPWA 5F4WA 4LUJA 3LXAA 4A22A 2PRLA 4QITA 3NQ8A 3DH7A 2HS8A 1IXPA 4YL2A 3MI3A 1K02A 3W7GA 3PBVA 4PL1A 5I3HA 1FWRA 1KFEA 2VELA 3S5NA 2E6DA 3NM3A 1YXCA 5F2IA 3QFEA 2VFIA 2CFFA 1K8YA 1FWSA 3LCIA 2FB3A 1AG1O 3OG3A 3W2MA 4MY9A 2P1FA 5DN1A 3PWAA 1ADOA 5LNWA 4H6KA 3N19B 1GYNA 2FTPA 1BWLA 4WOZA 5KZMA 1MEIA 4ICNA 4IXHA 3Q2DA 4LVGA 6TIMA 4IGHA 1Z48A 5LSMA 3HQ1A 1GVOA 4O4WA 5LGZA 1X1OA 2C18A 4EWND 3Q37A 4LRTA 5CZJA 2H6RA 5FF2A 4MZYA 4IMCA 3T40A 4W9TA 4M6VA 4UTHA 1OFDA 1JCJA 1GVFA 3W1UA 1K3UA 2QCMA 1GZGA 1WXJA 3Q58A 4HHPA 3TROA 3G22A 3TA6A 2CZEA 2V2CA 3TJXA 1GOXA 4LTSA 4MY8A 1TRDA 3QF0A 1G4SA 4IMEA 1Q6LA 4JIPA 1XBXA 2QR6A 1VLWA 2DZVA 4ADUA 5KITA 3LLFA 3PG8A 2P10A 1GVQA 3CLMA 1OYCA 1KFLA 1FDZA 1W37A 2FPYA 3BPWA 1J4EA 4FNSA 4BR1A 3QM3A 2BX7A 3M9YA 1YPFA 3W9ZA 3WK1A 3EX4A 1KM5A 1X8FA 1Z42A 2NLIA 4DELA 1KBJA 1XI3A 2OT0A 3H55A 5DXXA 4OU1A 2A4AA 1YTKA 1LOSA 1EP1A 4X9SA 1JJKA 3MJYA 4XUGA 3M47A 3DI0A 3NPUA 2NUWA 1TTQA 4NJHA 3O1NA 1R46A 2GUUA 4IMDA 3UWYA 5LNUA 2X2GA 1H7PA 1IXNA 4FXSA 5CZ0A 3LHTA 4LS1A 4MZ8A 1EUNA 2ZTJA 3S5OA 2A1YA 1EB3A 1OFRA 2H8XA 1U5JA 5TBOA 3ATZA 3NQCA 2E5BA 3NQDA 4PA8A 4CNPA 2EAWA 2WV8A 3A5VA 4IX2A 1F05A 1A53A 2VEMA 1LROA 2ISWA 5D38A 5K9DA 1SZGA 4QJ1A 2ZDRA 1G4EA 4PC8A 5KTLA 1XC4A 4UTKA 3DFSA 1U83A 3IIOA 3W1NA 1SR9A 3FIGA 1OK6A 1YTDA 2Y88A 1OHLA 3ABQA 1TPDA 3B04A 3C6CA 3LX9A 3STEA 2OMAA 3QQ1A 4WZHA 2XFWA 3W7NA 3W70A 2J9XA 3BLIA 4IX0A 4GBUA 3W73A 2ZFAA 2E6FA 1IXOA 2VEKA 5D03A 5FEPA 3HB9A 4AB4A 3RLVA 1K8ZA 1WV2A 4UNKA 5HR6A 2CLHA 2YYUA 4ZVJA 3KOFA 3V75A 3W85A 1XL9A 3CWNA 4M5PA 1GG1A 4R33A 2E5DA 3S6DA 1C9DA 3G1XA 3G1DA 5D33A 1OFOA 3PBUA 4HKPA 4KFOA 1W56A 1HTIA 3G0SA 1W1ZA 4NXSA 4LS2A 3V1PA 2WQPA 1S5WA 1SO5A 2CLOA 5I3KA 1TRIA 5G1YA 2YSWA 3WK2A 5KZEA 3QRHA 3ZFHA 4LWWA 3SI9A 2C19A 3QEZA 3TAKA 2ZQ0A 3VCRA 1Z41A 3S5ZA 2DZTA 1TQXA 3IRDA 3S8HA 2AAMA 3L68A 3E02A 3NPXA 4O0ZA 3C4UA 4FNPA 1F74A 3EWZA 5G2WA 3WK3A 1O5KA 2GQAA 3R12A 2DU2A 3P61A 2TRSA 4N2YA 3EX3A 1D3GA 4O13A 4AWSA 5HWMA 2V5BA 4XBKA 1W3IA 3SFKA 3O15A 2NWSA 4HSOA 3GDMA 3UWQA 1JQVA 4C1LA 3CC1A 3TE9A 4EF8A 3F4WA 4HIBA 3DKLA 2QAPA 1B9BA 2V0TA 4E2DA 1LBFA 4ORIA 2EPHA 3S42A 1KFCA 3CQ0A 1EWDA 3G0UA 1SW7A 2Y7GA 5I3IA 5AHNA 4CLMA 3NL5A 5BMXA 4MFDA 4PL2A 1RZMA 1K7EA 2PC4A 2G5WA 4CNNA 2ZYFA 3TQVA 1MXSA 3BG9A 2GJLA 1EUAA 4GUFA 4NU7A 4PH6A 1PHQA 5AYYA 3IGXA 3THQA 3BGJA 4LVDA 2I14A 4UTWA 3L5LA 2A5HA 2DJXA 3TV8A 4HNTA 5AHLA 1DJNA 3LOTA 1OVDA 4OV9A 1PCKA 3C2VA 4JN6A 1DHPA 1FDJA 3NOEA 2CLKA 2J88A 1TJPA 1LOLA 2R14A 4O0KA 4Y90A 1VRDA 3P74A 1SFJA 4UUIA 3L2IA 4X2RA 2V2HA 2WNQA 2ABAA 4Y9AA 2R91A 3TDFA 2J9ZA 3D0CA 2QCLA 2DJLA 4NVTA 5G2HA 3MO7A 1GVSA 3PF3A 1TJRA 3UPBA 3FJ6A 1IIGA 2ZRZA 4O15A 4CCDA 3PR2A 1IIHA 3TW7A 1QOPA 3P7YA 4UC5A 1RD5A 1JULA 4K7YA 4CQ8A 1M7PA 4O17A 4EIVA 3W6YA 3GDTA 4AMAA 1OYAA 1AW1A 1GG0A 1LORA 1LZOA 1T8XA 3IEBA 3W75A 7TIMA 1YYAA 3OIXA 1A5SA 1K7XA 4PODA 3W76A 4UTLA 1SW0A 4RZ4A 4JR5A 2F7FA 1O4UA 3HG2A 3TU9A 4Y6GA 2JKPA 3UQNA 1C8VA 1ZY9A 2FJKA 4O8RA 2W6RA 5CZTA 2QDHA 1N55A 5BOOA 1UASA 3EX6A 4FEZA 4WJEA 4MJZA 1H61A 3NQ7A 3A24A 3GR7A 1H51A 3KVLA 1GWJA 1G6CA 4TU1A 3DGRA 3S5YA 4UTMA 4K37A 3W2KA 1IF2A 4TMBA 3LHYA 4NT0A 1GTHA 1TIMA 4BWLA 3SSJA 3CPRA 3JRKA 4WX2A 3MBFA 1MEWA 5CGQA 1HG3A 3W87A 4DXVA 1BEUA 3LB0A 1VQTA 4UMAA 1NFBA 4JY8A 5CPMA 5AC8A 4O52A 3LBCA 3JR2A 2A85A 3BW2A 4UFKA 4XQ6A 3W07A 3EXTA 3HPZA 3EX1A 1ICSA 3M5YA 1EP2A 2BXVA 1JRBA 4LRSA 4OGZA 4RJEA 5J5DA 1TPWA 3IIZA 5EKYA 1D3HA 2VFHA 2HMCA 2YGYA 3C61A 5C2XA 3DKJA 5ABTA 2CLIA 1WOBA 5IBXA 1TTIA 3WJWA 3OA3A 3PUEA 4HPXA 1KFKA 5EL1A 5EA9A 3NQAA 4WOQA 3GB6A 3GXTA 5G5IA 3VKJA 3FFSA 3HG5A 3BG5A 3M5XA 1ME9A 3HGSA 4E2BA 3BW4A 1JCLA 3MP5A 4Z0SA 3W2LA 4BWLC 3MBDA 3NZRA 4QNWA 4QSHA 4QAIA 3C0JA 2V9DA 3DFNA 4UFJA 2GQ8A 1QFEA 2YDAA 4A2RA 4QIUA 4ADTA 4UMBA 4UMCA 3W1TA 3KRSA 3TMQA 4N9BA 3NVTA 5AHFA 3W1AA 3EWYA 4S2BA 3DFPA 1SU5A 4AHOA 1OFQA 2J9YA 3UZJA 3MP3A 2G96A 4Z1AA 3TNOA 1ZAIA 4Y96A 4K8EA 4ZQCA 3UWZA 3GX9A 3RMJA 1D9EA 1WX0A 3TSBA 5DY3A 1H63A 3ABSA 4JTGA 4UIOA 3QC3A 2O7SA 3W1MA 5IBXC 2RDWA 3GZ3A 4DPPA 1TPEA 1ML1A 5EBUA 1LBMA 2QCEA 1FUYA 3HPXA 1CI1A 3S9YA 1JCNA 2FPVA 3W7CA 4EF9A 1SZNA 5FESA 3M6YA 2BLEA 1DV7A 1QOQA 3U6WA 3C8FA 3RK8A 3W72A 2QAFA 5MHBA 1O94A 1QPQA 3UNDA 4JICA 1XUZA 4N9EA 4JTTA 4QQ3A 1I45A 4FHAA 4O57A 3L5AA 3LHZA 1TYGA 1RQEA 4UFIA 1M7OA 3G8RA 3LRLA 4UFLA 4JTIA 4GNJA 5G4EA 3KAOA 5LKYA 5AYXA 1F2JA 1MSSA 3HG4A 1KV8A 3HG3A 5F2MA 3I7QA 3NG3A 4MLJA 3B8DA 1YDOA 5HJLA 3G1VA 3WJZA 4MLRA 5E93A 2EHHA 2YFOA 3OHIA 1I2QA 2HS6A 2OZ0A 5T26A 2BWGA 2HTMA 4EOUA 8TIMA 3B06A 4C1KA 1W54A 3RF9A 1IGSA 3LHUA 4M7TA 4A21A 3NEVA 1UUOA 4ML9A 1LM1A 5L9FA 3LTSA 4NZJA 3TCEA 1VYPX 3SY5A 3C2FA 1KLZA 4JXCA 3GXPA 4POCA 4YCOA 1L6SA 1M6JA 3M7WA 3T4CA 4H3DA 1T96A 3S1WA 4K38A 2DP3A 1P4CA 2A7RA 4LC8A 5HR7A 2OX1A 4CCCA 2NUXA 2QCDA 3YPIA 5IM51 3KXQA 1R30A 3KRZA 1R2RA 5FI8A 2Q8ZA 2EGZA 2AGKA 4JIQA 1JCXA 4O1AA 1SQ7A 1VGAA 2JKEA 2VEIA 4N9DA 3TMLA 4IXXA 1YDNA 1BTMA 1FWTA 4EVZA 3BO9A 1VYSX 3FYOA 1ZFJA 3WJXA 3QPYA 3E0IA 2QJGA 4RCXA 2E6YA 2QCNA 4A2SA 3NQEA 5D09A 3CTLA 5AHEA 3KX6A 2OJPA 3N2MA 2ZZ2A 2YW4A 3G24A 3MW7A 4YMZA 2TSYA 4FB7A 3SR7A 3UZ5A 1TV7A 4QISA 3LERA 2NXHA 1V7YA 2B4GA 1H50A 1RPXA 3ATYA 1TPC1 3CB8A 3A22A 4K8HA 3W86A 3T44A 3L5MA 3ELFA 1SSGA 3KRUA 2C6QA 3BARA 4LT9A 3UD6A 4WUIA 2QJHA 2Y6ZA 1W5PA 5EYWA 3ZS4A 1E51A 1GVRA 3MHUA 1FDYA 1Q45A 1XBZA 3W7EA 2CW6A 4DPQA 1KA9F 3P8IA 2ZA1A 3O6CA 2E6AA 1B3OA 3IVSA 2DZSA 4KFPA 3THAA 5FF4A 4XWUA 4LU0A 4B5NA 4Z1CA 4DQWA 1W5MA 1LTDA 3KHJA 1HO1A 4HSNA 5K7JA 1MEHA 1LCOA 4N4PA 4O14A 4JTHA 2GVGA 4OQVA 1G67A 5K4ZA 2GJNA 4P2VA 3FS2A 3W23A 3K30A 1I2OA 4QM1A 1AMKA 4JTEA 3DHDA 4O53A
chains in the Genus database with same CATH superfamily
4M29A 3PJWA 5HWNA 1XLCA 3N18A 2G3NA 2HNHA 1IWAA 2R82A 4KCTA 1OG0A 3JUGA 4CN6A 3ZLGA 2Y8KA 3UG5A 4GC3A 2CHRA 1CIUA 4NY2A 1V6YA 3HV8A 1DXIA 5C7HA 2O55A 1IR2A 3GHUA 1KXVA 2V5KA 2WMKA 1TMHA 3EOEA 3SUWA 1I8JA 1KM1A 3W7IA 4JOMA 4B5WA 1S5VA 1U5HA 5CPLA 4KF1A 3PC0A 4AHQA 3T0DA 1POJA 1X6UA 4XBJA 1BVNP 3PANA 4W84A 3VD5A 3W02A 4UR9A 3B8VA 4O19A 3MS8A 3VNJA 2CLEA 3OO2A 4IJRA 3SECA 3BANA 3AXMA 2YJQA 5KEZA 2WJEA 2J25A 1HZYA 2QDDA 1X96A 2ZXQA 4PRTA 1NP0A 1LLWA 5AKQA 3T4WA 4CN1A 2DUZA 3E0LA 3SCSA 4DJED 1EDGA 2CLLA 3E2QA 1UR3M 1T99A 3ABXA 1K7FA 3VXGA 4DNMA 4QQUA 4Z0JA 3U2OA 1GYLA 2GVLA 4UQCA 1W31A 2XFYA 3BK0A 1BWKA 2FH6A 2HE5A 1WDWA 1HX0A 2GSEA 3TC7A 1B3VA 5AYZA 3NSMA 4G8TA 1RCOB 4C6FA 5FEXA 4I5UA 2ALDA 1XYCA 4IIDA 3E2SA 2W67A 3G6LA 3BCFA 4HU4A 1YXYA 4QGCA 4CD5A 1PB0A 3PG9A 2OSWA 3KBMA 4O18A 1US3A 1TQJA 2WMHA 2I5QA 4I7UA 4B91A 1I2PA 5IFPA 4WKHA 3GRIA 2WLYA 4D6HA 1FH7A 3P81A 2GYIA 1ZNNA 2WWDA 3PUDA 1TPH1 1F4HA 1DORA 5G4WA 4R34A 2NQ9A 4IIFA 2F9RA 3VNDA 3QV7A 3E0FA 2Z7KA 1R85A 2W0UA 2A0NA 2P88A 4B4FA 2X1RA 3S46A 1P5BA 5CG7A 3OHMB 3H21A 3N6JA 3DN5A 1H62A 3MT1A 1E9YB 3IJDA 2XH4A 5D9PA 1MRAA 3F7JA 1NWRA 1RQHA 1LP6A 1AK5A 2JGQA 3ABZA 3UW6A 1HKJA 1QO2A 4AZBA 1J12A 1ISVA 1DQUA 3LZ5A 4J9JA 5I02A 4L61A 3W7PA 4ATDA 5JUVA 3IK2A 4BA0A 4ZODA 5FEWA 2YR1A 2CLPA 2D73A 2AOSA 5DO8A 3EOOA 4D71A 3O9NA 4PCPA 2IPWA 3BZJA 3LI1A 2EXOA 4L4MA 3RR4A 1G4TA 1QR7A 1OYBA 2LLEA 4FK9A 1G01A 1V02A 3SUTA 1A5BA 3M0MA 3MCMA 4GY7A 3L2MA 2OEMA 3L4TA 4MUZA 2ZRXA 4N9CA 5FAGA 3A47A 2I5IA 3BCJA 3LXBA 1FWFC 1G7UA 4AW7A 4E5TA 5DBTA 3WD4A 4A3UA 4KT2A 2WC4A 5CBBA 3SQLA 2FVLA 1XBYA 3MANA 3W3OA 2PLKA 2VZSA 4JY9A 1XR2A 2R6OA 3H2EA 6XIMA 2W79A 3PAJA 4ATLA 1OCJA 3PTDA 3LHWA 1Y5VA 2Q02A 3CT2A 2R1NA 3WMSA 3ZZ1A 2P0IA 4IT1A 1KRAC 3R13A 4L6DA 1RJQA 4WD0A 5AB3A 2DH3A 3E5PA 1ISZA 1L9WA 2BODX 1VYRA 3A21A 4XBSA 4RE0A 4ICCX 3VDAA 3EA2A 1ITUA 1Q6GA 2BY1A 2Y5JA 4YXGA 1Q6QA 4UOZA 5HINA 1Q8JA 1L2UA 4NQ1A 5E0CA 3GG1A 2PTWA 2PODA 2YFNA 3U8GA 2XVPA 1TTPA 3NJ3A 3H7RA 2UV8G 3L4YA 1WA3A 3P84A 3UESA 1IT8A 1ODZA 5REQB 1QPOA 4HU0A 3NL2A 1ZL1A 4DO4A 3H2AA 3AIWA 3VZZA 1KXHA 2XZ7A 2BB0A 3EMZA 4YHGA 3AHXA 1FXQA 4ADSA 5F2GA 2HXTA 3KDOA 4IQLA 4JCMA 3AYTA 4CU7A 1OK4A 1IWPA 2V81A 4X3ZA 1GQIA 2WXDM 4J7RA 2BHUA 3L67A 1S1RA 1U2YA 2CKSA 3BGGA 3NOYA 1YEYA 2VFEA 4KWVA 3CWHA 3UR8A 3ZSSA 3ID7A 4O4VA 4ZQMA 4AWTA 2B7OA 4GYKA 3BLFA 2DDXA 4CVUA 3LV5A 3AMDA 4QE5A 2XDFA 4KWOA 3N4AA 1L6GA 1UD2A 5E9XA 1ISYA 3CTTA 1VJZA 2CCRA 4K39A 1M41A 4FR1A 3BOXA 1ECQA 2F61A 1R6WA 1M53A 3UEQA 5AC6A 1ZBVA 3SEPA 3MHGA 2P76A 4W85A 3HGOA 3HN3A 2JKAA 2P8BA 1SPQA 3LXCA 4XTDA 1UH4A 1DWAM 4L64A 4GISA 5LA1A 3NPWA 1S2WA 1F4AA 1UZ4A 4K1GA 1R2TA 1LRTA 2QCHA 4NZFA 3DZ1A 4O11A 5CZSA 1TPUA 5LNSA 4DWDA 1E5NA 5C5YA 1HJVA 5FSEC 3VDCA 4S3EA 1FH8A 2HNEA 4AYGA 4NYUA 4J3WA 4ZQNA 1UH3A 3OVQA 1F6PA 1DPMA 4WQ6A 1KB3A 3GNXA 4UZUA 1VB9A 4CCEA 5AC4A 2WW5A 3EEZA 3KL0A 4RE3A 2WHMA 4C91A 2X40A 2ZX7A 4RUBA 2CERA 1ZJHA 3CZ8A 2WAGA 4NAEB 4FIRA 2XSBA 5D9MA 3EA1A 4E38A 5CZKA 3EMQA 3KTXA 3LCWA 4IH3A 3NDOA 2VXNA 2VUNA 1WZKA 1BYAA 2XH0A 2P8CA 3KTCA 3APTA 3CQHA 2PP1A 5I2UA 2WANA 4I9TA 3TTEA 2XH7A 1NAL1 2AL2B 3PNUA 1H7WA 3E96A 4O12A 3F1QA 5D2VA 3GFZA 4LCSA 3K8MA 2HZGA 4UFHA 5A6MA 3N9RA 3B4YA 1XFBA 3R4IA 2IKIA 3FLUA 1LL7A 3QC0A 1RVGA 3UWUA 3F4NA 3LV6A 4WDWA 1PIIA 1EKOA 4BJHA 4CD4A 4TVCA 1ALDA 3OLIA 4TVUA 1JZ6A 3OODA 2YZ5A 1HF6A 2UY2A 4XAPA 2QUUA 4UCGA 1DJZA 2SFPA 4DZ5A 3VIJA 2YL9A 1EX1A 4JTJA 4N42A 2VEPA 3VNIA 3IJQA 5AVNA 2DZWA 3DECA 4M6QA 1S5TA 2Y63A 2I7GA 4EX4A 1L0PA 1E43A 2L5HA 3G1HA 3MMUA 3ARZA 1Q2RA 3DHUA 4BEQA 1O95A 1PWMA 1UWUA 3N3MA 4DUOA 4C5YA 4N4QA 2QJMA 4C5ZA 2PTYA 3H2CA 4NNCA 4FAMA 4O1DA 2OLAA 2G3MA 2BVWA 2VCBA 2GGIA 2VGFA 1DL3A 2OZTA 3EDDA 1ZCOA 2Y8UA 1RP9A 3CH0A 3ZWSA 3OW1A 1FKWA 1H5YA 3WDRA 1LT8A 2OU4A 1KM3A 3NO5A 2XG9A 4PUEA 1RR2A 4FNQA 3P5ZA 4OKDA 4PMUA 1REQB 2AAAA 3DU0A 5ECUA 4Q7BA 3E0VA 1XSJA 4PMOA 1HGWA 1FQ0A 4WDTA 2RDTA 1PO9A 2ISSA 1VENA 3F5KA 4CVWA 4C6IA 4FR6A 3RRAA 3S0CA 4R53A 2OGYA 7PTDA 4MDPA 4Q6JA 5EPDA 1BYCA 4FSAA 4FXJA 1A5NC 3BAJA 3H2OA 3I4KA 4PFMA 1SMAA 1HKWA 1JYVA 2OSXA 2YXGA 2GWNA 2F2KA 4MTVA 4R5EA 2XSXA 1EYWA 3ITOA 4ZQOA 3BMWA 2DQWA 5AN7A 1JUBA 5DANA 1RK5A 5CCZA 3AJXA 1FTXA 1G4PA 2FMOA 3W71A 2ZIDA 1XDMA 5A5WA 1FHVA 1YLVA 3ARPA 2OWXA 3GVWA 3IGHX 1V77A 4B9ZA 5DLCA 1UMLA 1KM2A 2XN1A 4GWEA 1W3HA 1KV5A 4N02A 4EAMA 3S5SA 4HZ8A 2FZNA 1IT0A 3MVIA 1XIIA 4A6GA 3LGGA 3LNPA 1CGXA 4JTFA 3T09A 1QNQA 2J7DA 2BFGA 2J4GA 1FCVA 3ES7A 4DI8A 2YL8A 4DO5A 3CO8A 1OCNA 4PTNA 4UR7A 4YN5A 3TNBA 1NEYA 4K7VA 5E0KA 4EACA 4RZ6A 2VDIA 3BH4A 2VFGA 3QGVA 1GQNA 2E8ZA 4J40A 1QASA 3V5FA 2WMIB 1H7XA 1D7KA 2H8ZA 3TAOA 5A8GA 2CU0A 3QHOA 2ZUTA 3AHTA 3LQLA 3E0WA 1FKXA 3W88A 4HGXA 5FF0A 3M64A 3UXAA 3WEMA 4IUOA 1WPCA 1WDPA 1OM0A 2FDSA 3BSMA 2DPEA 2BGNE 5CSYA 3HTWA 1GOQA 4JEJA 5CPNA 2WPBA 2VO5A 1KM0A 3ZSTA 4ZTXA 1ZALA 1TFVA 4GQGA 2JBMA 2GOKA 4GRSA 5BRQA 4JTCA 2B7PA 1G5AA 1P0KA 1JZ8A 2KZHA 4Q22A 5E09A 4XD6A 4Q8NA 4LJ3A 3CIXA 4FNTA 3IJIA 5LA2A 3O63A 3H26A 1KXTA 1VPYA 2WNWA 3IVUA 2ZZ4A 1RSCA 7REQA 1O66A 4TIMA 2HSAA 3PJTA 3TXZA 5TQLA 3BLKA 3INPA 2NW0A 4Q33A 4AX6A 4AG0A 4TVDA 3B8SA 1YPIA 3TH6A 4Q4MA 1QRQA 3M0ZA 1MXDA 5D2TA 1N7KA 5H8MA 1Y8BA 3N2XA 1HNYA 1Q6DA 5IRPA 4TXEA 4DBEA 2HJPA 3M0IA 4PMYA 1UKSA 4XKYB 3HJEA 2QLYA 1A5AA 1TCDA 3IUDA 3KWSA 3PB0A 2ZBTA 3ES8A 1WXZA 5DCEA 3WLMA 3PZOA 3APGA 3K8LA 1K6WA 1SZRA 3NGFA 5A6TC 5A95A 1AQFA 2ZUMA 3NIYA 1OB0A 2YKKA 4CQDA 3MUZ1 2ZUWA 4LAOA 4O10A 1PCWA 4GBDA 4I8DA 1YBQA 3TTQA 2C13A 1KR0A 2QJNA 3NQVA 1ONXA 2OCZA 3OPSA 1RBLA 4NZ1A 1TMLA 3SFWA 1J0ZA 2XIMA 3AXKA 4KS0A 2VZUA 3NZ1A 4R7WA 4RX0A 1WKDA 2Q3RA 4O1FA 1S5NA 1QAPA 1QHPA 3ITGA 2PD5A 4AIOA 1QI0A 1QPNA 2QGYA 1QPRA 2X8RA 1B0IA 2J66A 2XSAA 4QG9A 3H2MA 1LDCA 5KZDA 2WHLA 2RH9A 2XVKA 4ZOCA 2DIJA 4A29A 2YL6A 5BRBA 3T08A 3WQGA 1TTJA 3WFZA 2OOGA 2NSOA 3VIFA 3DENA 2FLIA 1TG7A 1C7TA 3B4UA 2I9EA 3FAWA 1J01A 1R7AA 3ZMRA 3U5YA 1W5NA 2PRMA 2WJZA 4N7QA 4LEFA 1QUMA 1ME8A 1K8XA 4DF0A 1A5MC 2FB2A 4FP1A 2J6VA 3W0KA 1HIZA 1WOAA 3CM4A 5CPOA 1RBAA 3O0KA 4HOWA 3ZT7A 2WVUA 4S3CA 1GPWA 1SJBA 4GZEA 3M0XA 9RUBA 4B5TA 4C6LA 4QXIA 2PRLA 2XHYA 1UYQA 2PP3A 3VDHA 2VYOA 1IXPA 2PTXA 1KRMA 1WO2A 1K02A 5A69A 4PL1A 2EQDA 1CTNA 2XGIA 5A2CA 3S5NA 5A2BA 1J0KA 3NM3A 2GK1A 4IP4A 5F2IA 3MVTA 4G1NA 3W2MA 3CL7A 3QY8A 3T1GA 3N19B 2FTPA 1BWLA 5KZMA 3Q2DA 4LVGA 1QPKA 5A8MA 2HBVA 4S23A 3HQ1A 1X1OA 2BVYA 2H6RA 5FF2A 1QWKA 4IMCA 3P2VA 4MZYA 4W9TA 4UTHA 3W1UA 1AJZA 2VR5A 5C2GA 4Q6XA 1NOWA 3DYPA 4FLRA 1OG6A 1GVYA 2V2CA 1GOXA 1X8CA 4LSBA 3G1RA 3QF0A 4PCNA 4H8UA 3W24A 1Q6LA 3WUFA 4JIPA 1XBXA 1EXPA 1VLWA 1R3VA 3LLFA 3PG8A 3V0SA 3M0LA 5T8GA 4KGJA 1FDZA 3H2FA 3BPWA 3AFBA 3QM3A 2INEA 3ZOAA 3Q45A 3WQDA 1KM5A 4PSRA 4ZFMA 1M01A 1SR0A 3RLGA 2OT0A 3H55A 3DOPA 2EPOA 4YTTA 3DCPA 1AQ0A 1XF0A 1HKIA 4HU8A 4X9SA 3ARVA 4P7LA 3KP1A 1L8NA 3DI0A 2NUWA 1TTQA 4NJHA 1XLIA 4EPEC 4F40A 3UWYA 2WYSA 4FXSA 1GW9A 5B80A 2ZTJA 2PDKA 2PDIA 1OFRA 4PMRA 1FWCC 2H8XA 1U5JA 3ATZA 1YMYA 3V5CA 5CQ1A 2ICSA 3NQCA 1KBKA 4PA8A 3T6CA 2BGQA 4QG8A 2EAWA 4D6JA 1A53A 4JZ5A 3GW3A 1LROA 2ISWA 2P5NA 1MQPA 4Q7IA 2ZDRA 1W2PA 4GIRA 2XIJA 3RG6A 4UTKA 2VZTA 4HK7A 4JNZA 1U83A 3FIGA 1OK6A 1XGEA 1YTDA 2OYKA 1JD9A 3B04A 4FMVA 2EKGA 3T2OA 4Y9MA 5I24A 2QXWA 2VHLA 3W7NA 2WSKA 2J9XA 3W73A 3GM8A 3ITTA 1IXOA 2VEKA 4AB4A 5H6HA 1JZ5A 2CLHA 2YYUA 4REQA 3FK4A 4R33A 3WF1A 5HNNA 3G1DA 4ZSUA 5D33A 2XIIA 1ZSXA 3SBFA 1W56A 1HTIA 4BF5A 4M51A 1CGTA 3V1PA 2WHKA 2I5GA 5G1YA 4B5XA 1UWAA 2PF0A 3PBGA 3D3FA 6PTDA 4AD3A 1C8QA 3VCRA 5IFTA 4ZO6A 1Z41A 1OWQA 2GZXA 1SJCA 5XINA 2HISA 4HYWA 2PLMA 4MJ2A 2QPUA 4LF2A 2Z1VA 2DU2A 3P61A 2TRSA 3AYVA 3QKEA 1A5LC 1POKA 4AWSA 1FVPA 3O15A 1PTAA 4HSOA 3RRXA 3CZLA 1MFVA 3TE9A 1TWZA 3DKLA 2W3ZA 3MMWA 4P8XA 3BSGA 3EOSA 4HZ7A 1GKRA 3TOPA 4V28A 1KKOA 4ORIA 2EPHA 2VI0A 3CQ0A 4DXXA 3OTRA 4JTRA 5HJXA 3G0UA 2WCGA 2DSZA 5ABFA 2BS9A 5I3IA 5AHNA 1ZGDA 4CLMA 4PL2A 4I9JA 3VDBA 1Q8AA 2HVOA 1K7EA 4CNNA 3TQVA 2GJLA 3VOJA 4PH6A 1PHQA 2AGTA 1H4PA 3TN6A 5CLWA 4UTWA 3L5LA 5AHLA 3LOTA 2Y5SA 3WD2A 4O0KA 3FA3A 5AZ1A 3P74A 3PWGA 1UOZA 4Z42C 1PBGA 2A3EA 3PZNA 4XZBA 4PTXA 4HYVA 2J9ZA 2QCLA 1P43A 5G2HA 3MO7A 1GVSA 3PF3A 2UY3A 3VABA 5HA7A 5AECA 3FJ6A 4IG2B 4XZLX 3LMYA 3BE7A 1BHGA 4M56A 4K7YA 1M7PA 4EIVA 4AVOA 4GQRA 3MQTA 4AMAA 1AW1A 1GG0A 2RAGA 5HAOA 1JXKA 1A5SA 3W76A 3TYDA 3SCQA 3CUFA 3QXBA 3KZSA 4G2DA 4QJ3B 1XD0A 3HG2A 3GC4A 5BOOA 4LUYA 2GVEA 1YDYA 1H61A 2J7BA 1GWJA 4EXBA 4HBKA 4TU1A 3CQIA 3S5YA 4UTMA 1S2VA 2UWFA 3W2KA 4GHRA 4Y9OA 4IQJA 3LHYA 3PZGA 4BS0A 1EQCA 3SSJA 5GNXA 1MEWA 5CGQA 4LFYA 1DE6A 1W91A 1R9ZA 9CGTA 5A8PA 5FL0A 5CPMA 1F3TA 3OB8A 3GE7A 3KUMA 4HNLA 4DBSA 2CZVA 3JR2A 1E6QM 2PGRA 3W07A 4WF7A 3EX1A 2POZA 2VJXA 4NKCA 1EP2A 3GNRA 1MFUA 1D3HA 2VFHA 5C2XA 3DKJA 4IQEA 2WK2A 4HPXA 5EL1A 2D20A 1EJXC 5EA9A 4RL3A 1EOKA 1JAKA 1Y65A 3HG5A 3BG5A 2FZ9A 1TJ0A 3LLXA 4F79A 3RYSA 4IFKB 4I6VA 4QNWA 4QSHA 2ZUUA 1DIDA 2QUMA 4GZJA 3B97A 4N9BA 5E6ZA 4JHZA 3H4WA 5AHFA 3W1AA 3EWYA 3CQJA 4S2BA 1OFQA 2VX6A 1BGAA 3KHDA 3UWZA 3FX4A 3GX9A 1QI2A 3ABSA 2QUNA 2IXUA 2RDWA 3GZ3A 1GKPA 5EBUA 3V3WA 1DWFM 4D1JA 3BSHA 3EYPA 2GUYA 2FPVA 4EF9A 3VIPA 3U6WA 1E56A 2WJFA 5G4HC 5MHBA 4BQ5A 1GCYA 3UNDA 1M1BA 1EF3A 4QLKA 4JICA 4N9EA 1TZ7A 4KW2A 5A94A 3AUJA 2GJPA 4QQ3A 4XKMA 3RM4A 3LHZA 3W28A 2E4TA 4GQBA 1RQEA 4UFIA 3LRLA 4MB4A 2W66A 3VNYA 3FY1A 5G4EA 3KAOA 3WLRA 1F2JA 1MSSA 1EHAA 4HMNA 4AIBA 4A35A 4MLJA 5HJLA 3K5XA 3G1VA 2PBGA 5FIPA 2BWGA 8TIMA 4MWAC 4JN8A 5CAKA 4C1KA 3LSBA 4CUCA 3HFYA 3VNKA 4M7TA 4A21A 2WVSA 3WH7A 3RN6A 2PWVA 4H9YA 2XVNA 1P0DA 5ABHA 4GJIA 1XRVA 1KRCC 1LQAA 1P1MA 1QBBA 4ASTA 1V3LA 4WDUA 1IV8A 3T4CA 3S2NA 2G0WA 4R7OA 4K38A 2DP3A 3F2BA 4CCCA 1V6WA 1TR9A 1L2QA 3ZT6A 3U57A 1R30A 1WDRA 3RILA 2EGZA 4F66A 2ACUA 5C70A 2PDNA 4KIEA 3KWXA 3UJ2A 1BYBA 1Z89A 2CBIA 3VKAA 3FVDA 1BTMA 1FWTA 1VYSX 3TWBA 1NARA 3RGTA 4GVHA 4AD2A 1FWGC 2DQXA 3WN6A 4OJYA 1E9LA 4YJ5A 4Q8TA 2ZZ2A 1XWYA 1UR2A 5M17A 2WWCA 4FB7A 4ACZB 2WKGA 2OYMA 4J28A 1RJPA 1RLCL 3R8GA 4JQ2A 2Y4SA 4QISA 3ME3A 2NXHA 1TUFA 5I03A 1V7YA 2CIPA 4WJXA 1TPC1 1XIGA 3CB8A 1XISA 4RDYA 1WP6A 1KKRA 3ELFA 1A3XA 1XIMA 3BARA 4XO6A 2EPMX 4H9ZA 2FHCA 3UPMA 3WMCA 3I3BA 1U33A 2XVGA 2ZA1A 3MA8A 3IVSA 3OLEA 3THAA 5FF4A 3XIMA 4XWUA 4LU0A 3WY1A 3IS4A 1D8WA 4Z1CA 3LPFA 3KHJA 3SRFA 4HSNA 2XM2A 2V5JA 1Y5WA 4PMDA 4OQVA 1G67A 4L5ZA 1HN1A 2GJNA 2D2GA 2CWXA 3FS2A 4PBEA 1KBJA 1WKFA 5EY5A 1MZHA 3CUHA 1JPHA 3QN3A 2GGJA 3MCOA 3S83A 1UB3A 4GFSA 3A4AA 2ZX6A 2JGYA 4NJKA 2P3ZA 4IICA 4JNYA 3VU2A 3R2GA 3BQ5A 2NVDA 1J5SA 1GKQA 3S4TA 4S3DA 3UYCA 3BC9A 4ZQRA 2YCLA 3W7DA 4NAFA 1DEDA 4TO8A 5CLTA 2REQB 4H8NA 3ISIX 3O07A 4JQ1A 3T0AA 2PWHA 3S9ZA 4XB3A 3AZTA 3GBDA 3N2OA 5I79A 1N8IA 2E68A 4A3RA 1OFPA 3W1LA 4BQ3A 3K4AA 3UWWA 1BAGA 1XRSA 4H8VA 3B9AA 3EPMA 1BXBA 1YDVA 4X60A 1ZU8A 1W8GA 4UXDA 2QUTA 1A5KC 1WAWA 1FWJC 3A9BA 2XGBA 1BKHA 4F9JA 3C86A 3SCNA 1S1PA 2IXVA 4AX7A 3CJPA 3W7QA 2R24A 1FWNA 1TPB1 4GI9A 1QCWA 1E0WA 3QQWA 3QR0A 1RY0A 4JD4A 2PA6A 1G94A 1MRQA 1VHNA 4B16A 3VD9A 3SGUA 4PMXA 1DJQA 3UPWA 3PNZA 4MNLA 2NWRA 1CX9A 5G2IA 5I3FA 4HPJA 1RY8A 1RPKA 1OABA 4HNOA 3Q65A 2ZXBA 3C0SA 1SO6A 3TUUA 2NQHA 3N14A 1RA0A 1NIUA 3WFAA 1W6TA 1MWOA 3T55A 2IPFA 5BXRA 3QW3A 2JFEX 3RIKA 3BVJA 1HL8A 4AZCA 1VD6A 2WVVB 3G2GA 3N73A 1V0NA 1JIBA 1XIBA 3CZGA 2X41A 3G1FA 3LPPA 1MUMA 2J13A 4KRZA 1SMDA 3M5ZA 1K9DA 4ALDA 3LCHA 1QT1A 1NFPA 4UOJA 4D8ZA 3QQ0A 1F76A 1UMYA 3PBWA 4GZIA 3GLCA 4TX8A 3MUXA 3O8AA 2A21A 3T2PA 3WD3A 3OYXA 5DQPA 2QQ6A 5J5RA 1E5JA 3OQEA 3PK7A 2XFFA 4DYJA 2W92A 1WBJA 2VWSA 4KWUA 1MI3A 1PIFA 4OV4A 2D2JA 5HNRA 1C7SA 4MJ4A 1OD8A 3W1XA 3U9IA 3VFLA 3GVGA 4BI5A 3GXIA 3QYQA 3LEPA 3N29A 1W3LA 1U5VA 5C0QA 3N3TA 4PCSA 1FCQA 4JTLA 4AIEA 1WAUA 2NSXA 4NNAA 1XRFA 2NV9A 2PDHA 4W4QA 1E4MM 4C6BA 1CXKA 3XINA 3VNZA 2ZRVA 1TV5A 2BOFX 4MY1A 3IK4A 4RW5A 3GTIA 4BHYA 4KGLA 1KO0A 2OVLA 3KVKA 3E38A 1QO5A 4F4RA 1LF1A 4QLLA 2IPGA 3LY0A 4HOXA 3MPGA 4YVPA 2Q8LA 4MUPA 2HVNA 1BPLB 1NOUA 3GO2A 3SURA 4H4IA 4QHRA 1NSJA 5U7SA 2JEQA 4HPNA 3TYCA 1DIKA 6TAAA 2PLCA 4AHPA 1XLDA 3L65A 2ZC8A 3PAOA 1PSCA 4H19A 2IMRA 2QCCA 3R58A 1EL3A 1UWSA 3VCCA 3WLNA 4AWEA 4JGDA 2E77A 4EPKA 2WM0A 5IHRA 3DAQA 3TFXA 2WMFA 5D32A 1EIXA 3PS7A 1Q4WA 3MYPA 2YCIX 3RJYA 1KM4A 4I5RA 4C65A 4QG6A 4YPJA 3T9PA 3FA4A 2XJ7A 4IPNB 4K68A 5CKSA 1W8SA 1M7XA 4FLOA 3H2NA 4CQ9A 1RA5A 4JIIX 2NT1A 2VZVA 1VS1A 3AIRA 1F73A 3CHVA 4LGXA 3BAIA 4X22A 1BG9A 1ZCCA 3PM6A 5KZ6A 3FV9A 2Z1WA 2OKOA 3URNA 1VFMA 2RKXA 1KTNA 1XLFA 1W32A 3QH2A 3DI1A 3M43A 3TX9A 4EPBC 1BWVA 3PVFA 4RXFA 4QE4A 3R43A 1I4NA 4S2CA 4LY8A 4J2MA 4PUKA 3EDFA 4LBUA 3L2LA 4M1RA 4R9XA 1R0MA 1VFOA 5C9UA 1PS9A 1J2BA 2NXGA 5HDRA 4XZ9A 5GNZA 4K3ZA 4LAMA 3WNOA 4LBSA 3WSUA 4P8VA 3UZWA 2ON3A 3PWIA 4IPJA 3SZ8A 4MKVA 3VOGA 3PZMA 1B2YA 1H7NA 3QGAC 4LV4A 3W7OA 2R1MA 3A4XA 1TB3A 5CC7A 4QDPA 1XLBA 5AYBA 1XH0A 1O7AA 1ITQA 2QMKA 5T91A 4WY0A 2CLMA 3VE9A 4DBDA 1Q6OA 3AWOA 4GZ7A 4IPIA 2NV1A 4MKSA 3O3RA 3FAXA 4GUHA 3UBPC 4GG9A 1W3NA 4HN4A 3PZIA 3WMLA 1C92A 3I10A 1C91A 4P5UA 3MMTA 4F0SA 1J0JA 1UR0A 2QULA 3CV7A 1PEZA 1Z6KA 4K2SA 1EJWC 1FWDC 4FNUA 4XSMA 2C14A 5D9OA 2J6XA 4AZIA 1QMLA 2ZE3A 3HQNA 4I9AA 1RXOB 4H6EA 4H9MA 5SWUA 1XUUA 2PRHA 2QZRA 4B9YA 4E0CA 4XZMX 4AVFA 1AH3A 3VOFA 4E4PA 4ZMGA 1PHWA 1LRNA 2DZPA 2WNNA 1EA0A 3WIJA 4JTKA 4ZOEA 1WBHA 1VKFA 4MPQA 3SADA 3BWWA 1KR1A 1JFXA 5LIWX 2YA2A 3RCNA 1J5TA 2VENA 1OQFA 4J3UA 1K9FA 1TV3A 2NVAA 2PDCA 2EKCA 3QW4B 2QKFA 4E3TA 5C55A 3U2EA 2DV0A 4HPHA 1QNRA 1VRXA 3AMCA 2RDXA 1X38A 3KVMA 2DORA 3VGGA 1GQJA 1CXEA 4JYFA 1XXXA 4TX9A 2V5DA 2VGBA 3II1A 3HGJA 1Q6FA 4GNVA 4NRRA 1W1PA 1AZ2A 4YTRA 4FALA 1XM3A 2JF6A 1E0XA 1UZDA 3S1UA 2PDMA 3TTYA 3ZR5A 2PMQA 1GK8A 5LNRA 2RJGA 1E0VA 1TO3A 2ZZ3A 5BWAA 4GH1A 2PDFA 3RM8A 2B7NA 1W9UA 3TQ0A 1XCWA 3DFOA 5ECVA 1LT7A 4YCPA 2PGEA 1KGWA 4NX5A 1TZ9A 4LS0A 4WRHA 1FWAC 4IIGA 5HQMA 1JF5A 3M0VA 1R3SA 3P5YA 2V2DA 1EJVC 2Z2BA 2VC6A 3AMKA 3TKFA 1UD8A 1G0CA 3CMGA 3FKKA 1PVNA 2Y7DA 2Y8VA 3WBAA 4DUWA 1OZMA 3ZXWA 3UP8A 1C29A 5EFFA 5C54A 3TK7A 1IZCA 3WF0A 4DYEA 1VHCA 3LM3A 5BU9A 3E3HA 4MGGA 1TV8A 4Q3MA 3RJXA 3IGUA 3PZVA 3TSDA 4HJFA 3EKLA 2OEKA 3QR3A 5FF7A 1YTEA 3M5VA 3VM5A 1UHVA 2ZA3A 1WCGA 4Q8VA 1UZ1A 4P7OA 3NQMA 1CGYA 5M5DA 2DUXA 4PUUA 2YX0A 5A6LA 4MSSA 2OT1A 5BCAA 1F8IA 4MAZA 4PEEA 2HDJA 4MDOA 1QU4A 4NXKA 5JXQA 4AWUA 2R1PA 4C7DA 1CZ1A 3HF3A 4J27A 3G1AA 3RLUA 1WE5A 4E3VA 5BMWA 4KPLA 2HRWA 1DYSA 2HXUA 2ZX5A 2TYSA 4I7WA 1SZEA 3SGZA 1S39A 3DFYA 3C0LA 3FOKA 3W1PA 4GYFA 2A7PA 4QROA 1KWKA 3HOJA 2BSLA 1VFLA 2ATMA 1S3TC 3QV8A 4AIUA 1T0OA 2Q01A 2OWWA 1YKWA 3MV11 1J2WA 2NXIA 1YXDA 1RLDA 5CSSA 3W01A 5DCDA 5AVHA 1BG4A 2R1KA 4M6PA 4OTKA 4W8AA 4IFRA 4Q4QA 3W7JA 1TREA 3N2CA 4MWAE 1OF8A 3TA9A 4F0RA 4ZQPA 4PGLA 1JCYA 4C90A 4KWSA 3T0TA 2OO0A 1WZMA 4ZB5A 1MUCA 4JEQA 3TSMA 2PEVA 3HIJA 4B90A 3EKZA 3URBA 4MG4A 2EF9A 1W9XA 2OZ8A 3C2RA 4D72A 3MI2A 3P60A 3N04A 2V3EA 3RX3A 1CGUA 4S1FA 4AEOA 2QDGA 1DTUA 5B7ZA 4WKFA 3L0GA 2YLAA 1VP5A 3LG3A 2ZRUA 4NL1A 2IQTA 4DF1A 4OWGA 2J7CA 1V6XA 5CXPA 3WELA 3IVTA 1CENA 3LN3A 2ZA2A 2D23A 1MDLA 4GY1A 3RPDA 3LM7A 1NF0A 2QPSA 3LSCA 1TZZA 1AL8A 1XCXA 9XIMA 4JS3A 2VKZG 3W22A 4YU1A 4H00A 1P0EA 1MNSA 6ALDA 2WCAA 1I1WA 1WUEA 1HKKA 3L21A 2OEJA 3CAWA 4HA4A 1KTBA 4W86A 3LGEA 3N1AA 1LUCA 3VD3A 3A5FA 2PZ0A 4LW7A 3USZA 3BXWA 4TX6A 4RNHA 3AS3A 1RQBA 1R2SA 1HJWA 1XLJA 1IEVA 2DSUA 3EDKA 3I7SA 4KRTA 3UY8A 1DJWA 2QPXA 2JK2A 3LNMA 1A47A 3IGSA 1PL9A 4JFWA 4FIQA 5CJNA 1XP3A 5I78A 4ILSA 5D04C 3CUXA 1L6YA 3GWQA 2A6LA 4GKTA 4RV8A 4S3JA 5FF3A 4XD3A 3PPHA 4PMZA 3IV3A 3UG8A 1BYDA 2Y7FA 3A23A 3AHZA 2ZX9A 3WLHA 3NURA 5HXMA 6ENLA 2CXGA 4W7UA 1I2NA 4ACZA 1VCFA 4UTWC 4FXRA 4LOCA 1J96A 1IYXA 1O1ZA 4HK6A 2P53A 4JIEA 4CNSA 3MUCA 1A80A 1N8FA 3BAWA 3QHMA 4H7VA 1XLGA 1CXIA 2FVKA 5DCBA 1ICQA 3ABOA 3C2OA 3LYEA 3EPNA 3WDHA 4ZTYA 3W4RA 3FDKA 1OFAA 4QNEA 4M19A 1ZENA 4G6CA 1SJAA 1Q13A 1PV8A 4O1CA 4JX5A 4NUWA 4PR4A 2Y89A 1JI2A 1TE6A 4ZO7A 1QW9A 5D4YA 1AUSL 8XIMA 4J1OA 4H8HA 4LC6A 1N2VA 1JD7A 3G1SA 5I3GA 2V69A 2Y24A 4JFSA 3GY1A 4S3BA 3L7RA 1S5MA 4DLFA 1QHZA 1DKWA 1UG6A 1EH9A 5FEZA 3B0PA 2J27A 1Q7MA 3FGCA 3GH4A 3M07A 3OU8A 3OJGA 4DWSC 2POTA 2ZWYA 5JU6A 5XIAA 4JHOA 5I6SA 3KOWA 3VUPA 2VOMA 3CAVA 4R7JA 3TXVA 5IDIA 2VRJA 3SSZA 3GIQA 1QXLA 3WBEA 3DDMA 3P82A 4Z1DA 1IEQA 4IOTA 3M4HA 4DO7A 3GU2A 1PTGA 3G8EA 4B4HA 5MKGA 4QBXA 1X6NA 3QHNA 4RLIA 5LZLA 1NOFA 2DEPA 4HYRA 4JX4A 1E55A 2A3BA 4KCVA 1OSEA 3T7VA 4RPPA 1T8QA 2DSVA 2FZDA 3GTNA 4N6FA 3KZPA 1GOIA 5D30A 5DF0A 2HEJA 3N9SA 1JYXA 5BWFA 1ONWA 1XKYA 3WLJA 5BYWA 5HMSA 2VNCA 1RHCA 3TJIA 1YW1A 1UP2A 2CLFA 3LHVA 1E9ZB 5M3WA 2WSRA 1EEPA 2TODA 1V3IA 4I8YA 1BRLA 3ZVHA 4NI3A 2H9AA 4NI8A 2NVCA 2G37A 4GC4A 2VL4A 4IMGA 3CEPA 5E9AA 1CYGA 2ACQA 2C1HA 5A6BA 2UY4A 3NL6A 2E40A 3MUAA 2E5CA 2HE8A 3VE7A 3GKFA 4GINA 1UIPA 3ITCA 4BI6A 4PUJA 4GX8A 3UXIA 1TSIA 4FF7A 3QZAA 3ZLHA 3KEHA 1ZBCA 4ZB0A 1FWEC 4HD5A 1LJYA 4HB7A 3LXAA 4A22A 3W27A 2DH2A 4QITA 1YPXA 1AD4A 2WVVA 3W7GA 3CL6A 3PBVA 3T05A 3J7HA 5I3HA 1FWRA 3URQA 3VGDA 2E6DA 2VFIA 1GW1A 1FWSA 3LCIA 2FB3A 4EKJA 3TZNA 2PWEA 2DIKA 1AFSA 1JPKA 2PD9A 4GIEA 3QLLA 4ICNA 3UCDA 4IXHA 3VK5A 1RH9A 4MNKA 6TIMA 3LMZA 1Z48A 2O9OA 5LSMA 1I9CB 5LGZA 4J35A 2C18A 3OOQA 4M6VA 3RMEA 4PRRA 1XLKA 1TMQA 1TA3A 4HHPA 1NDZA 3G22A 2DUAA 2BVTA 2ZX8A 1X39A 3NO1A 2E0PA 3FXYA 4Q8PA 3VTRA 1TRDA 4EXQA 4IMEA 3T8LA 2CPUA 2QJJA 3U4AA 2PDXA 2DZVA 2RJHA 2P10A 3TP4A 1OYCA 7REQB 4OBSA 3WQ5A 1UZHA 3DG3A 4FNSA 1TWDA 2BX7A 1A4MA 3M9YA 5EMYA 3W9ZA 3R7MA 3WK1A 3W26A 4A3YA 5C7VA 1X8FA 4DELA 2Q8XA 4G5DA 4LBRA 1W3KA 1XS2A 4WIWA 3HQOA 3HMCA 1TVPA 4OU1A 2O4QA 1A49A 3RITA 2PI6A 4QCEA 4CCZA 2FFIA 1EP1A 2EPNA 3M47A 2Y0FA 3NPUA 3SCPA 2GUUA 3VAVA 2X2GA 3VKDA 1IXNA 1K9EA 3WQ8A 4LS1A 3UJEA 4KERA 4MZ8A 2XM1A 3S5OA 1EB3A 4IP7A 4NZ5A 5JVLA 5TBOA 3GIPA 3K8KA 3O6AA 3NUKA 1JNEA 2E5BA 2WSPA 1B3YA 3A5VA 1HT6A 1F05A 1WUFA 1JZ4A 3JZEA 5K9DA 1SZGA 4AXNA 1S2AA 1YBQB 4XVEA 1XC4A 3DFSA 3GNPA 1UC5A 3GU9A 4C6NA 3PZ9A 1TPDA 4F48A 1EO7A 2OMAA 3QQ1A 3TC3A 4WZHA 4F9DA 5GJPA 2FHFA 3W70A 5HPOA 3HQPA 4FA3A 1E40A 3ANUA 4PUNA 3HB9A 2G4JA 1GOMA 1K8ZA 4OFCA 1A4LA 3VGFA 1S2TA 4ZVJA 3W85A 3A4JA 3CWNA 4HZMA 5I5RA 4LF1A 2OG9A 3G1XA 4GKLA 4Y9PA 4L6HA 1NDVA 4RE2A 3UA3A 4HKPA 4KFOA 3PP7A 4QFUA 3WMBA 4LS2A 2WQPA 1S5WA 3AIQA 5I3KA 4IHCA 1KNWA 4LWWA 7ODCA 3SCTA 1KQZA 3QEZA 3FEQA 3EKGA 5CPTA 2ZQ0A 2DZTA 3VMPA 3IRDA 2AAMA 3E02A 3C4UA 5G2WA 5CPSA 2VGIA 2GQAA 3SN4A 3R12A 3AMLA 4UNIA 3GH5A 5A6BD 4O13A 4M3PA 4AEFA 2HPMA 3EOLA 2V5BA 3SFKA 4NZ3A 3GDMA 2I57A 1TELA 3UWQA 1JQVA 4C1LA 3CC1A 3TYAA 4BQ4A 2XPKA 5C9RA 4EF8A 1ZTVA 2QAPA 2VEFA 1WKYA 5I7GA 3HZ3A 2V0TA 4WR3A 2NQLA 1EQPA 3TVAA 4B15A 4GOAA 1UR1A 4HA3A 1XYFA 1XPYA 1VIZA 2WJDA 1CECA 1XFCA 3AIUA 3ZJ6A 2GUBA 2GSHA 1AH0A 2GK1B 3ALFA 4XZIA 4QDWA 1MXSA 4GVGA 5AYYA 4U3AA 1W9VA 3IGXA 3O0FA 2QS8A 3CYJA 4EWJA 3KCJA 3BGJA 4LVDA 1GOOA 2I14A 2IKHA 2DJXA 3KLLA 1UKOA 1FDJA 2J88A 3OBAA 3LENA 2PWGA 4Y90A 2HV5A 4GI6A 4X2RA 1V3JA 3W37A 2ABAA 3R11A 2R91A 3TDFA 3D0CA 1XG3A 1NQKA 3MJMA 5FJJA 3BJFA 2A3LA 5DMLA 3ECQA 4AD0A 1VF8A 1US2A 1TJRA 1E1CA 1Z3NA 3POCA 4HZ6A 1KFWA 4AVNA 2I16A 3TW7A 1OT1A 1QOPA 3P7YA 6CGTA 1Y7VA 1RD5A 3DIPA 4HK5A 3KBNA 3L23A 1GGOA 3AZSA 2D1ZA 1LZOA 5H8UA 3OIXA 1K7XA 1SW0A 4RZ4A 4JR5A 1O4UA 3UJFA 4Y6GA 3CXOA 4PYSA 4AZHA 2JKPA 3AIEA 1XRTA 1C8VA 5C9XA 4O8RA 2W6RA 2J62A 2FYMA 4WJEA 3KL5A 4MJZA 3NQ7A 3MU7A 2QIWA 3RCMA 1H51A 3N4FA 3TYUA 1G6CA 3ICJA 3T42A 1UC4A 4K37A 4HVXA 4IJCA 4JKLA 2A79A 4TMBA 4Z17A 1UKPA 4TV6A 1TIMA 2OPJA 3CPRA 3VNMA 4WX2A 3WFLA 1OGBA 3W87A 1IWBA 1K77A 1VQTA 4EANA 2QHAA 4C6QA 5HOSA 4UFKA 3HM7A 3N12A 1ICSA 1C8XA 3W00A 4OGZA 5J5DA 3IIZA 1C90A 2BY3A 4IQDA 2YGYA 1PTDA 2FGBA 3OIHA 4EPDC 3LPOA 4C6MA 3FHAA 1NY1A 3GXTA 3VKJA 5AC5A 4HP5A 1VPQA 4YTQA 3AICA 4H01A 5A6AA 3BW4A 3MBDA 3BL3A 3W53A 3RAOA 3AROA 1QW8A 2AQOA 4REQB 2YDAA 4A2RA 4ADTA 2DT3A 2NQJA 1C9WA 2Z29A 3KRSA 1R3TA 3EB4A 5HMFA 3HPFA 7TAAA 3GDBA 2J9YA 3MP3A 2G96A 4Z1AA 1ZAIA 3AMGA 1D9EA 1WZAA 4Q4PA 3TSBA 1H63A 3WF3A 3QC3A 1W1IE 4MWAA 3ARTA 3W1MA 2HWGA 1TPEA 1ML1A 1NWUA 4DHGA 1Y5XA 4W7VA 2QCEA 1EOMA 3OYZA 4CN4A 2HROA 4WSKA 4HCDA 4Q8UA 3S1GA 1CI1A 3S9YA 6REQA 4A8IA 1DV7A 1Q63A 4ZBCA 3W72A 4L9XA 4LAUA 3SY1A 1E70M 1XUZA 4BEUA 1I45A 4FHAA 4O57A 1JPDX 1ZBWA 4H6QA 4JFUA 3TLLA 4JTIA 5LKYA 3HG4A 1CXFA 1BQGA 5JH1A 1YDOA 2QVNA 4MLRA 5E93A 1B3ZA 3R6IA 1XGDA 3N2TA 4JCLA 4EOUA 3V4BA 5B7YA 3B06A 3TTSA 4ZO8A 5ABFB 3RF9A 3LHUA 5A6KA 3CUGA 4J4KA 3CO4A 1UUOA 4WKAA 4S39A 4B92A 3CLWA 1TVNA 5L9FA 3LTSA 4MM1A 2PF8A 3PBMA 1A5UA 4DY1A 2Q09A 3KM8A 1KLZA 2NT0A 4POCA 1EC8A 2WC7A 1M6JA 6A3HA 4H3DA 4XV0A 3NEHA 3MDWA 2A7RA 4LC8A 5HR7A 3QOMA 3CNYA 2OX1A 1RCQA 2NUXA 2QCDA 3KXQA 3VGHA 4IP5A 3KRZA 4A05A 1R2RA 3S47A 3ARUA 4O1AA 4QS5A 2E9MA 1VGAA 2VEIA 1V08A 1YDNA 4J3SA 3KW3A 2Z1KA 3CHFA 5A3HA 3E0IA 2QJGA 4A2SA 4JKKA 3V0UA 3RU8X 4PE8A 5AHEA 2OJPA 3N2MA 1SYTA 2AMXA 3EDJA 2C7FA 3MW7A 3WLSA 4YMZA 3S6TA 2PU1A 3CIVA 2E67A 4KIRA 4ICMA 3GR4A 1H50A 3MV01 1TKKA 2GDQA 5FAJA 4K8HA 1E15A 4IPPA 2OTDA 4U31A 2F38A 3OZOA 4AYSA 2OOFA 5D8ZA 4GX9A 1SSGA 3CMFA 1HVQA 2EJAA 3BLOA 4XK2A 3S2LA 4LT9A 3REQA 2X2YA 3IUHA 1GVRA 2VD8A 3MHUA 2CETA 1FDYA 4MNJA 3W7EA 3O6CA 3NZPA 1B3OA 4KFPA 3WEZA 3T2QA 1FHLA 2D0GA 3BICA 1HO1A 2OR2A 5K7JA 1IZJA 4AY7A 4N4PA 1EDQA 4JTHA 2ESCA 1GEHA 1I2OA 5EB8A 4JTEA 3DHDA 3IARA 4ES4A 2FPTA 3UJSA 4Z2IA 1IEWA 2VGGA 1UP3A 4CQCA 4L65A 5FJRA 2PURA 5H8PA 2ISDA 1ZHAA 4M80A 4OBRA 2PLJA 3LRMA 3LDVA 3TFCA 1CB7B 4W93A 2QVHA 4TR9A 1Q7ZA 3DC8A 2B0MA 2YW3A 4G7EA 3SJ3A 5CPQA 2XINA 3UY7A 3AXXA 2EPKX 4OVXA 3GDRA 5LA0A 5KMYA 2CHNA 2DY3A 4Y8FA 1QW7A 3HMJG 3C3NA 4AD1A 4GD0A 4RE4A 1N8WA 4ZFCA 1E71M 2BGSA 1PZ3A 3QJAA 1EJTC 1WXYA 1PX3A 4V1XA 4HT3A 1G69A 4FNRA 4MWAD 4HA0A 2PBOA 2VOTA 3L0KA 4FPSA 3PN8A 3GXDA 1QK0A 4ZL1A 4BI7A 2FH8A 2ZZ5A 3GAYA 3AS2A 4N6EA 4UQAA 1OGSA 5H2ZA 5JIPA 4AAJA 3WL1A 4PEKA 4LAKA 4L9ZA 4AF0A 3QMRA 4Z2JA 2E1DA 4GYPA 4JL2A 1Q7QA 1I60A 3VM7A 2GSJA 4Q4OA 2PDGA 3KS5A 4IPLA 4GCXA 4MMWA 3GAKA 4IGMA 3S1VA 4ZB2A 2X1IA 2VX5A 3L66A 5AFDA 3RCYA 1FP8A 2I17A 3SIMA 2VQTA 2EG6A 2OWCA 1QI4A 1LQ2A 2AKMA 1BVWA 3TN5A 4DX3A 3BLLA 1M7JA 4LCQA 1XLLA 5HULA 1AQHA 1VFSA 2QF7A 1OFEA 1X7FA 3E9AA 4HTBA 3H24A 1MXGA 3GFXA 3CT7A 1JNDA 2C8NA 3N9KA 2WCSA 3STCA 3V1HA 1AODA 3S2MA 4B3ZA 2DGAA 3CYVA 4IIEA 2CNCA 4LUIA 3W74A 4U2ZA 4UWMA 1X1ZA 3VILA 1QJWA 5AC7A 5EU9A 3LK6A 1HXJA 4W8LA 2DT2A 2CITA 2OX4A 1QDSA 3M6DA 2V82A 3TJ4A 4KETA 2PE4A 1NVMA 3MB9A 4JAWA 3HBLA 2C1IA 3LQGA 1TPFA 3GHSA 4UTTC 3SIZA 1BSLA 2GVJA 1NWTA 4J3VA 4S38A 1PYFA 4O54A 3LCXA 2PC8A 3AYSA 4HHLA 3STGA 2J8FA 2GWGA 3R8HA 1W3TA 5HQEA 5K9XA 3VC6A 3HPSA 2CZDA 1PKYA 1RVKA 1ITXA 1DWHM 1KW1A 3A3HA 3DESA 3W2NA 2C71A 5IOBA 4JDYA 4GIYA 1J9YA 5KINA 5D02A 2NUYA 2WZMA 2YCJA 1EX5A 1LQ0A 3PBYA 1JGIA 4ZE4A 3KRBA 2F84A 3ARXA 1PKLA 5CC6A 4CQAA 2Z0IA 1JCTA 4GO8A 2OGJA 1H7RA 3A64A 3ARRA 3PHAA 2O0TA 3UVAA 3H70A 4OZOA 2J24A 1JDCA 2TAAA 4IL0A 3WNMA 3NL3A 4L1WA 1U22A 2FQIA 5FJPA 1T41A 2VC7A 1UQYA 2BV9A 5KSWA 4QS6A 3AXHA 3C3UA 1ICPA 1TUXA 2E7FA 4B3KA 5DMYA 3OBKA 3SUUA 1V5XA 2GJRA 4E8GA 3WUEA 4RR4A 1CLVA 3GVQA 3OA5A 3RU6A 4XZWA 4O0QA 3I6RA 3FCPA 2Z1SA 5LIXX 3IJ9A 3WQFA 3PTKA 5GJNA 4K36A 1QWGA 3GC2A 4PSPA 2YCLB 1TWSA 1YE6A 4NAFB 4LEQA 2A6NA 2X1UA 3VNLA 2PDUA 1VBGA 4IL2A 3LPGA 4DVOA 3EWCA 5A2AA 4IFOA 3T0BA 3QTPA 3CUIA 3PTMA 1F8MA 4QJ5B 1YX1A 4KEZA 3CIWA 2GDVA 1W5QA 1HUVA 4RK8A 2NQ5A 4NYYA 4HJWA 2OFJA 4L7ZA 5A8NA 4M7SA 4WDXA 3WNPA 1V03A 3ERPA 3EXSA 2XH2A 1UBSA 3SO7A 4FX7A 1M04A 1NF7A 4MAVA 4RDZA 1SFSA 1KFBA 2E09A 4EXAA 3BMVA 1D2KA 3ITYA 4NX0A 4E6MA 4US5A 1W17A 3WK0A 2I1OA 1FHDA 5DMNA 2FGZA 1JI1A 3NYZA 1PDYA 4UR8A 5E0FA 2ZCGA 1W5OA 4MIMA 2GJXA 2VWTA 4AEEA 5G1TA 5RUBA 3GQYA 4MJMA 3C2EA 4HCLA 1OZQA 4HNUA 3DFQA 2J78A 3OEXA 1XG4A 5AHMA 1T7LA 4CD8A 1OX4A 2WKJA 5GVJA 1V4YA 3NYDA 3WQOA 1SFLA 3UVIA 1VEOA 3GVRA 4AZCB 5DRIA 1SUXA 3KVJA 4HNVA 2ZZ1A 1D7FA 3A6OA 5FOOA 4S3AA 3GG7A 1M3UA 6XIAA 4TOQA 1Z44A 1ZZMA 2WSQA 3KE0A 3G5EA 4RNFA 8CGTA 3ZJ7A 4XISA 1AH4A 4D1IA 5A6SA 3RPMA 1M68A 5M1TA 2D3LA 3DFTA 2YL5A 1GZ1A 3WDIA 1HVXA 3WBYA 3PTQA 4YYFA 3LTYA 2XIOA 4PCTA 2G41A 1ZAHA 4GVFA 3G18A 1U1HA 1ADDA 4NNBA 1ODUA 5F2LA 3VOHA 2VR2A 3AQUA 3M44A 2ISVA 3THDA 1H1ZA 4MPKA 3ZJKA 1Q4NX 1WQ5A 3W2JA 3MWCA 1PZ1A 3P80A 3R79A 4GY0A 4GE8A 1D3CA 3GYEA 1B5TA 3AZRA 3CWOX 3GG0A 2CC0A 1XQLA 1H1NA 1PJ9A 4G1KA 2G97A 1K4HA 3N25A 4HPGA 2PCQA 2DVUA 4Q4KA 4GUIA 1GJWA 4DJFA 2HQAA 1K8CA 4XZNX 1AD1A 4X2PA 2GL5A 3UYIA 2XGZA 2YCKX 3E12A 3B9DA 3TLQA 4H04A 3IUIA 1P0NA 1SW3A 3W6LA 4L1GA 3NNTA 2WBGA 3L9CA 1G7VA 4YHEA 2BZNA 2ZRYA 4Q8MA 2ZVIA 3W7MA 3EEGA 4JFTA 3NCOA 4B5UA 1K6AA 3L4UA 4JIRA 4XSLA 1VBHA 1J6PA 4YYCA 1PX4A 1DJGA 3S6OA 1UQZA 3EB3A 1CLKA 3AS1A 1XYMA 2NX9A 1VFUA 3EDEA 3ZJ8A 2QIIA 1P0BA 1PYMA 5F1VA 3QTGA 4D6IA 1H2JA 4GJJA 2JEPA 4KKXA 4ZZ9A 3EWBX 5DY2A 3LA4A 3HFTA 5TD4A 2QCFA 1GYMA 3LCFA 4I7VA 3RO6A 1PIGA 4YWSA 2E1WA 2V30A 3CQKA 3LCGA 1XYAA 1KGXA 1ZP4A 4UQBA 3QY6A 1LOQA 3M0YA 1WNOA 3VD7A 4OIFA 3WDJA 3AS0A 1B4KA 2Z1XA 3LI0A 1ECEA 4BF9A 2CKRA 1SJDA 3B9NA 3NPVA 2VCCA 4FI4A 3KP0A 1ZLPA 3RO8A 2G50A 1XDLA 4QTGA 1F07A 2XVLA 2CXEA 1OJXA 4AZ5A 3R89A 2BVDA 5BXPA 3I3DA 2NZLA 1XH1A 3W7LA 5C8BB 4AISA 3USBA 4C6PA 3CEUA 4AXKA 2ADAA 2J74A 1LYXA 2WO5A 5BROA 3B8IA 3FA5A 3R8RA 1ZQ5A 4J5NA 5I00A 2C16A 3CASA 4LVFA 1SZFA 2HVMA 1R86A 1EJUC 3MP4A 4H9XA 4CNTA 4GUGA 4INFA 1VR6A 1VIWA 3EWUA 2NLYA 1R3QA 3GDLA 3UG3A 4US5D 5HNTA 1FP9A 2QJIA 2G95A 3ZWTA 4ERAA 1EPXA 1RP8A 4LUTA 3QZEA 4C6KA 3V16A 3WUBA 4PFHA 4UTUA 4DUVA 3RR1A 1S3HA 4JTQA 3NZQA 3OVGA 3F2DA 4LPCA 1ELSA 3IJ6A 5D2YA 4G9PA 5BU6A 5F4SA 4G56A 5LGXA 4WY0B 3TQPA 3VIHA 4JNMA 1ZJAA 2ZZ7A 3B03A 3U7BA 3RX4A 3EMCA 3U3HA 1EO5A 2QCGA 1XBVA 1B90A 4TV5A 2YA0A 3QKZA 4IMAA 3GH7A 2PWUA 4DUXA 1Q6CA 4WLCA 4GGHA 1AJ2A 1U1JA 2PDLA 1LWJA 1UWTA 3U4FA 3PZUA 4QSFA 2OSYA 4KEMA 4WSHA 1L8PA 2C91A 1IE7C 1QK2A 3NAVA 4TUFA 1H3GA 4V15A 1F9CA 2HPIA 5D05A 4LUSA 3TQKA 3GKAA 3GNOA 3CHDA 3P67A 2RHGA 1QTWA 3GFYA 2Z6JA 1QNVA 3ZQ9A 2V68A 3D46A 1M5WA 3WH5A 3F03K 4M82A 1E9IA 1L6WA 4D8AA 1XH2A 4F2UA 3UR5A 1PKMA 3QBUA 1V0LA 2OZ3A 3VGBA 1RCXB 2UY5A 4PTWA 3QSRA 1KBBA 4MFEA 3B0YA 3MCNA 1MO0A 3BQ6A 3WF4A 2KX9A 2ZDSA 1W9BM 2Z4GA 4PZVA 3W7RA 1BGGA 3PJUA 1DJHA 3GR8A 1IHIA 3TR2A 1UR8A 5HNUA 3TC6A 2ATSA 2INZA 3C0QA 3IIXA 4X9YA 3ABRA 1MW1A 3QLDA 4Q7NA 4NJIA 4DZIA 3DFHA 3M41A 4AC7C 3F4VA 3FJNA 3RLHA 4DJFD 1PE1A 2W63A 1JYNA 2Z27A 3SJNA 3OP2A 5CC3A 2CZ5A 1W0MA 1ADSA 1GHRA 2YB1A 3GSMA 4OUIA 2WNZA 2GFTA 3LCLA 4UFMA 1O1HA 1GOWA 1XYLA 4MF4A 3DG6A 1HO4A 1F6KA 4A8RA 3NA8A 2WZHA 4W88A 1UD6A 2Q3OA 1CCWB 3Q94A 2Z6IA 1DJYA 3ANYA 3P62A 4RW3A 3UJRA 1JZ7A 3JS3A 4U33A 3BUVA 4NIRA 5GPRA 4XAZA 4XD5A 3W1RA 3SGGA 1H5VA 4AH7A 4NASA 4ZSTA 3VYLA 3IPWA 5HUOA 2ZZ6A 4CU6A 3EX2A 3MSYA 4DWSA 1O68A 2IKJA 2R9RA 1VEPA 3E74A 4V2XA 2XFRA 3UWVA 1DTNA