3NPXA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
249
structure length
249
Chain Sequence
b'DLKASSLRALKLMHLATANGDDTDEKVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRIWTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADHIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPAGGVRTAEEAQKYLAIADELFGADWADARHYAFGASSLLASLLKALGYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 98
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3npxA00
4K38A 4X2RA 4JTKA 1MO0A 1N7KA 4MFEA 4MY9A 1DKWA 4JTIA 3WK1A 3QH2A 3O6DA 1Q6QA 4NJHA 2E5CA 4N9CA 1UUMA 4HSNA 4DELA 5HQEA 1SZFA 3G24A 3TW6A 4Z1BA 3BW3A 4O16A 2WSYA 4RX0A 2XFWA 5AHMA 1WBHA 3IGUA 2YYTA 1UUOA 2VEKA 3UPWA 1MEHA 3MWAA 4K37A 4LNYA 4PL1A 4K8EA 3O15A 3LCHA 1G4PA 3U6WA 2B7NA 5CZSA 4LUIA 1PHWA 1RQBA 1JRBA 3PG8A 3T40A 4Z0JA 4O10A 3FOKA 1OK6A 1W31A 3P84A 2Y7EA 3LCGA 3LCWA 1W5PA 1F5ZA 3L5AA 4PODA 3PUOA 1TTQA 4FNQA 4IPIA 2DJLA 1RD5A 3C61A 2NX9A 3H53A 2CLOA 3I6RA 1LCOA 5D30A 3TC6A 1WBJA 3DFSA 3PAJA 4JTEA 1XKYA 2YX0A 5AYZA 2ALDA 4FNTA 2V2DA 1ZAHA 1TPB1 3LB0A 2J9ZA 3W7CA 5HNRA 1L6SA 2ISSA 2GQ9A 3FYOA 5DBUA 4UTIA 4JY8A 1LTDA 3E12A 2XN2A 3HPXA 5KITA 1X1ZA 4K8HA 4CNNA 1QAPA 1YTEA 3GNNA 3W2KA 3SIZA 3KVJA 3EWBX 5U7SA 4Q32A 4UTTC 3CTLA 3DZ1A 3GDTA 4UTTA 2PC4A 3M5VA 1AK5A 2G5WA 3NPWA 4XKYB 1MZHA 5AC6A 2YW3A 3W07A 4E2BA 2PRHA 1VGAA 5AYXA 1KTNA 5LGXA 2BTMA 1VHNA 1SZGA 4DPPA 1TPWA 1J2WA 1FWTA 3ABRA 3TNOA 4WJEA 4WOQA 4FXRA 1KW1A 2DZXA 1H60A 4HNTA 4O1AA 3B0VC 3LCLA 1OFPA 3EWZA 1QO5A 4GUJA 4A2SA 1LBMA 4XQ6A 3W7PA 3N73A 1GVSA 4O17A 5H2ZA 3LCIA 2R14A 2F84A 3NYZA 4JTSA 2YZRA 1LOQA 4UFHA 1VJIA 2HS8A 4AH7A 3TK7A 3GR8A 4UTUA 1VS1A 4FEZA 3LHZA 3M44A 5FEPA 5D32A 5DN1A 5G1YA 1Q45A 4GWEA 3S8HA 3H54A 3SW6A 4D2JA 3WJXA 5I3KA 4RLIA 1FWRA 3DKLA 1JCNA 3PBVA 1FX6A 5E0KA 3QSTA 3G1VA 2Z1BA 2DZUA 1SW3A 2ZRYA 1JVNA 1L6WA 3BGJA 3BK0A 1ME8A 2EKCA 1FDYA 3W6YA 1HUVA 1FBAA 1I8JA 2QJIA 4QITA 5FESA 4MFDA 4JTJA 4C1LA 3N9SA 3IIXA 5DCDA 1KV5A 2GQAA 1JQXA 3GDKA 2H8XA 2E5DA 3R2GA 2NXGA 1IF2A 4O0KA 3NVTA 3TAKA 2ZZ2A 3S42A 2YR1A 4MKNA 1VCFA 4WUIA 4U28A 4I9AA 1TQJA 4MY8A 1GYNA 3QM3A 1OG0A 2CU0A 5K2ZA 4QNWA 5BMXA 3O8AA 1IIGA 1KFCA 1PL9A 5CPLA 2E09A 1DV7A 3QZEA 3WK3A 4XWUA 3W75A 1R46A 1LROA 3NQGA 4N2YA 5ABTA 2YYUA 1O60A 3W7DA 1VHCA 4JR5A 4RCXA 1EUAA 3LLFA 2GUUA 5D02A 3G8RA 4XKYA 3ABQA 2PURA 1P4CA 4H4IA 4O19A 3EX6A 5EPDA 1BWLA 1ZAIA 4Z1DA 4DPQA 1K8YA 2NLIA 5BW6A 1FDJA 1LRTA 2V8ZA 2J88A 3G3MA 4LOCA 3CQ0A 1Q6LA 4MLJA 4Z1AA 1WYIA 2CFFA 3FEMA 2FIQA 4N4PA 4KFNA 1VH7A 3NL2A 4NNAA 4U4MA 4DF2A 2C13A 3G1XA 1GVOA 4ORMA 2ZRXA 1QWGA 2PE4A 3DFOA 2ZA3A 4RZ5A 3BW4A 2OMAA 3KAOA 5C2XA 3G18A 3W3OA 1SZEA 4JIQA 1KM5A 4O0ZA 2QUVA 3VE9A 1XI3A 4O1BA 3DBPA 4X3ZA 2F7FA 2FFCA 3QRHA 4MYXA 3LLDA 1A5SA 1LP6A 2ZZ3A 4DBDA 4LC6A 1Z42A 3W1UA 1I45A 1OABA 3YPIA 1FCQA 1KFJA 1XFBA 3P82A 3GDRA 1I2OA 1I4NA 3W2JA 3QPYA 5CG7A 2CW6A 3Q58A 2RKXA 3NAVA 3W7KA 1CI1A 3LRLA 1O94A 1QFEA 5G4WA 3VCRA 5C6MA 2E1DA 1QR7A 1B4EA 2DZWA 3R5EA 4PFMA 5LNSA 1KV8A 2WNZA 4QQ3A 2NX3A 2A7NA 2OZ0A 4FO4A 1L2UA 2QCHA 2JBMA 5FF2A 1G7VA 3LOTA 3P5YA 2Y61A 1IIHA 1KLYA 4LS2A 1TPC1 3N9RA 1ZFJA 2WQPA 3H55A 2TPSA 3W1LA 4Y6GA 3WJSA 1KBIA 2EGZA 1K8ZA 3GZ3A 1FCVA 5HWJA 1GTEA 1DJQA 4IMCA 3W7HA 1YTKA 2OX1A 5D2VA 1QO2A 3VI2A 4UIOA 5F1UA 2ZTKA 3QEZA 2FB3A 1GEQA 2B0MA 3FA5A 2V5BA 4JTHA 1YPIA 3C52A 2V5LA 3HIJA 3QJAA 4B5NA 4FX6M 5DCBA 1EIXA 4JTGA 4LS0A 3RFAA 3W72A 1XXXA 3C2VA 3A21A 1TB3A 3CEUA 3B04A 2Y63A 2ABAA 3TSBA 3W7LA 2PRLA 3NQVA 3TX9A 4AEOA 3W70A 4AHOA 2ZQ0A 3HBLA 1GZGA 4ORIA 1RQEA 1EWEA 4BK9A 4HNNA 3LTPA 4LTSA 3UXDA 3EX2A 3Q37A 5D09A 2Z2UA 3NQFA 5GVJA 3O07A 3THAA 4DO6A 5HULA 4ADTA 1K7EA 2VELA 2QCCA 4WY0B 1OK4A 3C6CA 3UWYA 5EY5A 2DZVA 1YTDA 3C4UA 3M43A 2WNNA 1JCXA 4TU1A 5F1VA 5K9DA 2X16A 1LDCA 2YPIA 1FWNA 4E2DA 1A53A 2VEPA 2NUYA 2WPBA 4PEKA 2B4GA 3OBKA 4HPXA 2Y89A 1H7OA 4IJBA 3M47A 1M7PA 4A21A 3PB2A 4N9BA 1W3NA 1LOSA 3HGJA 3RF9A 3PR2A 1X7FA 5EA9A 3W7EA 5LNRA 1WV2A 5DXYA 3PC0A 3CWNA 1ZNNA 4K36A 2ZTJA 3O1NA 1KM4A 2HMCA 1QMLA 2QDGA 3GXNA 1HO4A 3KFTA 4NZFA 4QM1A 3NQCA 2H6RA 3SJ3A 3ABOA 4NX0A 4A29A 4XTDA 3B03A 5MHBA 1MEWA 3DI0A 3MI6A 4LW7A 4Z1CA 2A6LA 1XBXA 2ZZ6A 4UNKA 1L9WA 2YFNA 3NZ1A 4JN6A 3HOJA 3BG3A 3R13A 4M6PA 1H61A 3A24A 1BKSA 3NO5A 1WX0A 3QW3A 3S1XA 5I3GA 4MZ1A 4DF1A 2C6QA 2C16A 3TDFA 1F74A 5KZMA 4HSOA 4J9JA 1KM0A 2X1RA 4K7YA 1WOBA 1YXYA 2WSQA 1ADOA 3SR7A 3L9CA 1FCBA 2RHGA 3U2OA 2RH9A 3TU9A 4MIMA 1YXDA 1EP3A 5LNWA 2FJKA 1F2JA 1ICPA 1G69A 4CCDA 4WQ6A 3N14A 1X1OA 4Z08A 2QJGA 1VRDA 1VLWA 1FQ0A 4ZMGA 2FPVA 1H50A 3T78A 1UCWA 3W86A 1LOLA 1FWWA 1KM3A 3MHUA 3TE9A 3O16A 3CB8A 4MPQA 4WOZA 1XDMA 3CHVA 5KZEA 1OFAA 1YXCA 3NEVA 3EKZA 5LSMA 3S9YA 2Y7DA 4TMCA 3G1FA 3BLEA 5HJLA 1W5NA 4UFMA 4WY0A 3EB2A 3LI1A 4MOZA 2QF7A 4NJJA 1KM2A 4O50A 1EB3A 2A7RA 4CQAA 4ZQMA 5DCEA 1JJKA 3W1XA 3WFAA 4JD4A 3UY7A 3LBCA 4YXGA 3W1MA 4MUZA 4JXCA 1P0KA 5G5IA 3GKFA 4MVAA 5CZJA 3PY2A 4UMBA 1OX4B 2V2CA 3P80A 3BLIA 3OVQA 4TO8A 4RXFA 3WJZA 1MXSA 1AW2A 3S0CA 1C29A 1A5CA 2I9EA 4WY0F 4S1FA 4M5PA 1H7WA 1BWKA 1TMHA 1TPVA 3GDMA 1KBJA 3UZJA 4RV8A 4OE7A 1A5AA 3NL5A 2CLMA 3HQ1A 1F76A 4M6VA 3SGZA 3O6YX 4IX2A 2V81A 4K39A 1PHQA 2VOMA 4QIUA 1LBFA 3LERA 3G0XA 3EWXA 1NAL1 1ME9A 3HPZA 5DY2A 5HWMA 3MI2A 3DHFA 4ZQPA 1GPWA 4OQVA 4GJ1A 3IIZA 4NZJA 3PSVA 2RFGA 3LXCA 3GIYA 1D3GA 1H63A 3CIXA 2ZZ4A 3M5XA 5K4XA 4LVGA 1B4KA 3MW7A 3UYCA 3PULA 1Q3NA 1KLZA 5HUPA 4NVTA 1F6KA 3ZS4A 1S5VA 1SO6A 3DXIA 1W8SA 2QJHA 3HG5A 4UTWC 4UTWA 1R47A 4HHPA 1K8XA 2B7OA 3NNTA 3M16A 3MYPA 1JUBA 4GFSA 3F1QA 5AN7A 2E5BA 1LLWA 2CLEA 1QPNA 2WOQA 4HIBA 5TIMA 2JKAA 3KOFA 3OVPA 4EOUA 4OU1A 3S5ZA 3NZRA 3SECA 3M5ZA 3P62A 4GXMA 1EWDA 3A22A 4M6QA 4UUIA 1W3TA 4O4VA 5C54A 2ZZ5A 4MY1A 3RNDA 3MUXA 4IMGA 3ZWTA 1YDVA 2H3DA 4FXSA 3TW7A 1EP2A 4LVFA 1DQWA 1CX9A 5F2MA 4LU0A 3MHGA 1AW5A 3HG2A 3GYEA 3I7QA 1A50A 5D04C 4FIQA 4KFPA 1OX6A 3KHJA 4L4LA 4O18A 5K4ZA 1G67A 1OFQA 1QOPA 4I7VA 1X6UA 5KZDA 3R89A 2FDSA 3G1SA 1H7PA 4HN4A 3JR2A 1N8FA 5F4XA 3USBA 5FEXA 4H6KA 4N6FA 4ADSA 4O4WA 3TSMA 5E93A 5G4EA 5TBOA 1JCJA 4O8RA 4FNUA 5CSSA 3W85A 3KRSA 4QSHA 4UFLA 1OFEA 3QMSA 4QNEA 1PS9A 3KRZA 2ZBTA 1I2PA 1OYCA 3NPUA 4LWWA 3T55A 1R2RA 4H3DA 2W0UA 4IXXA 3U8GA 5AFDA 1RV8A 5K7JA 5CSRA 2ZZ1A 1TSIA 4RZ6A 1AG1O 1WOAA 4UNLA 2WV8A 1HFBA 1WXJA 3W7JA 2E77A 1SQ7A 1RR2A 3SSJA 3W22A 1OFDA 3IEBA 3MJYA 4EF9A 4GUFA 2R94A 1DL3A 1K7FA 2FPYA 2CZDA 3I7SA 2VEIA 4P2VA 4FX8A 3W23A 1TRDA 1TQXA 4GC4A 1TPDA 3W7IA 4GUIA 5CZTA 4ML9A 1FDZA 4NXKA 4O15A 3G22A 3OEXA 4BI5A 1ICQA 3G1AA 3PBUA 4R34A 5AC8A 3LHVA 2ZRZA 3TCEA 3MYOA 4YMZA 3IIOA 2VFHA 1VQTA 5F2LA 1T8XA 4ADUA 3BG9A 4YCOA 1EX5A 3VNDA 3LCXA 3TJXA 3W83A 4EIVA 1JCMP 5AC7A 1HO1A 4JS3A 3DFQA 1DHPA 4AWSA 2ZDRA 1M5WA 1RPXA 3C2FA 1TV7A 1BTMA 2A0NA 4EF8A 3THQA 3NM3A 2CLFA 1I2RA 1QNVA 4NJKA 2NX1A 5I3FA 4AWUA 2C15A 4FIRA 3W1AA 2ZA2A 1AMKA 1LORA 3EWUA 3FIGA 3S5OA 2J6XA 3EX4A 5T26A 5AHNA 1DORA 3W1TA 4X22A 2O7QA 3LDVA 3W74A 1JCLA 4HNVA 1OVDA 1VPXA 2OCZA 3LRKA 2OT0A 2Y7GA 4N9EA 1R2SA 3LV5A 5L6UA 2RDTA 3TR2A 1JQVA 2DZTA 3V75A 1QDSA 2FTPA 5BMWA 1O5KA 4KWVA 4L4MA 3W7RA 3UY8A 1SU5A 2Q8ZA 4I7UA 4WD0A 3ZWSA 5HR7A 3NG3A 4OWGA 3DAQA 2CZFA 5HR6A 4MJMA 1LZOA 2YDAA 2RDUA 1ME7A 5I3IA 1LLZA 3L5LA 2Y70A 1YDNA 3A9IA 3GDLA 4ONVA 2TMDA 5FF0A 1GWJA 3NQEA 1ZALA 1W5QA 4AMAA 2FLIA 1EA0A 2GJNA 1H62A 2ZRVA 5IBXC 4FF7A 1OHLA 3A5VA 4QJ1A 5IBXA 2VFEA 3NPXA 3S5YA 5CGQA 3NPVA 4JYFA 1D3HA 4ZQOA 3UWVA 4RKAA 1T96A 4AVFA 1SW7A 3ATZA 1NFBA 1G6CA 3P61A 5FF3A 1H1YA 1AL7A 3CLMA 2QAFA 3DHDA 3O6CA 3GNDA 1XDLA 3Q94A 3TKFA 3P8JA 5G2WA 3OA3A 4WXYA 3LXAA 8TIMA 5KTLA 1FXQA 3AJXA 1QOQA 4HT3A 1OYAA 2A4AA 3CM4A 1DQXA 4IMDA 4LRSA 3P60A 3W7OA 1ML1A 2E68A 3UXAA 2WKJA 5H91A 2DZPA 2Y88A 3CPRA 1U5JA 4FX7A 3DKJA 2C1HA 4IX0A 3P67A 3NQ6A 4AWTA 4YWIA 1EPXA 5DY3A 3TMLA 2J9YA 3FLUA 3N2XA 3TFCA 1DVJA 3F4NA 1TCDA 3UD6A 2QCDB 1FCUA 3PS7A 1IXQA 5D2TA 3EXSA 1THFD 3HF3A 2ZRWA 4OHQA 2VC6A 5DELA 5D33A 2Y7FA 1DBTA 3FJLA 3DGRA 1TPH1 3NQ2A 4FNPA 4LRTA 3LRMA 1J5TA 4JX5A 1SPQA 1QCWA 1PCWA 2TYSA 2NWSA 3P81A 3BV4A 2PRMA 1C8VA 3FKRA 5K9CA 5F2GA 1R2TA 2GVGA 5LNUA 3CEPA 3UWUA 3LTYA 5AHFA 3O05A 2Q3OA 3W71A 3N34A 1W37A 2CLKA 2QCGA 2AQWA 1Z41A 3MBDA 4A2RA 1JCYA 4NNBA 3IIPA 2YCEA 1QPRA 1O5XA 6ALDA 2TRSA 3SZ8A 2IQTA 3P7YA 2B7PA 1G4SA 3BO9A 4PH6A 5EKYA 1HG3A 5DLCA 4QISA 4LY8A 2FB2A 2BX7A 4TIMA 2A7PA 1A5BA 3QMTA 4QAIA 2YXGA 3MI3A 1K02A 4UMAA 3STFA 1KFEA 2UV8G 4FB7A 1GTHA 3WJWA 1S5WA 4LUJA 5C5YA 4N9DA 4NUWA 4RXGA 2KZHA 2E6YA 2E6AA 2B7QA 2DU2A 4A22A 3KVLA 4M7TA 1P5BA 2EPHA 2BWGA 1Y0EA 3HPSA 1SSGA 2V30A 1ALDA 3PUEA 3BGGA 3HO8A 1G7UA 5AHEA 4XUGA 3L2IA 4JEQA 1G4EA 1JULA 1YYAA 1Z48A 3G1HA 5D37A 4ZQNA 4XBSA 3TAOA 4HPJA 4K7VA 5D2WA 3D0CA 2G95A 4CQ8A 6TIMA 2CLLA 2ZYFA 2NV2A 5CZ0A 4Y96A 1ZJIA 3P8IA 1OFRA 5AHLA 3AO0A 5EYWA 2H3BA 2Z6IA 3T44A 4OGZA 2V2HA 3E96A 1OF8A 2ATMA 1X8FA 4S2CA 4Y9AA 1GJPA 3PSWA 5F4WA 1VC4A 4POCA 3CIWA 1KTCA 4IOTA 2QCDA 2X1UA 5FEWA 4JYEA 2P10A 4O1DA 4UFKA 3ZR4A 2GOUA 3O63A 4OV9A 4ALDA 1TTPA 3L65A 3DENA 3TA6A 3B0UX 1P1XA 3PBWA 5FI8A 3QF0A 1PIIA 3S1WA 4K6AA 1OJXA 3KRUA 2VFFA 2ZZ7A 4R53A 1SZNA 3W87A 1IGSA 3LCFA 4IMFA 2H90A 2A2IA 2A5HA 2FPTA 1JUEA 3LTSA 3S1UA 5LHEA 5FEZA 2WO5A 4MJZA 3JRKA 3FKKA 3IGSA 2QUTA 1NVMA 3F03K 2DORA 2GVJA 2C18A 2Y6ZA 5FF7A 4JGDA 2AAMA 2V9DA 1ZHAA 1IXNA 3TV8A 3M7WA 2D73A 3G0UA 2O7SA 1YADA 4XTIA 4WZHA 3ABSA 1GT8A 3GR7A 4BR1A 2DP3A 1XM3A 3OHIA 2V82A 4RJEA 3EXRA 2OT1A 1TO3A 4PCFA 5I3JA 3DU0A 3TQ0A 4CNPA 3TFXA 3IVTA 4CLMA 4MYAA 4JDBA 4NU7A 1VLIA 3BARA 4OBTA 3TQVA 3TJLA 5CPMA 5LGZA 3GAYA 1KA9F 1PVNA 3MP4A 1E51A 4O11A 3TXVA 2Q3RA 3N2MA 3EWWA 1QPQA 3DI1A 3CC1A 3N3MA 3NQ8A 4ZQRA 3G8EA 3B06A 4ZQCA 1FWSA 4AHQA 2WNQA 3GVGA 4WX2A 2QCMA 3K30A 4JNMA 5EL1A 2DZSA 1H7RA 5EBUA 1Q6OA 4JX4A 3RK8A 1KFBA 4DEFA 4O52A 2YSWA 1XL9A 3TC7A 2WJZA 1TPFA 2W79A 1I2NA 2NXHA 5EMUA 1O95A 4HKPA 1K3UA 2RDWA 3QFEA 3UZ5A 3LHTA 3MBFA 3DFPA 5FF4A 3PVFA 1XUZA 4FNSA 1G4TA 3TMQA 3W1QA 1K7XA 2Y62A 4S2BA 3G1DA 3KVMA 1W5OA 4OT7A 2CLHA 2EF9A 2ISVA 1W5MA 2VXNA 5E1QA 1V5XA 2EAWA 2ISWA 3W2LA 3ATYA 2DJXA 2W6RA 2NWRA 3GX9A 4TMBA 3QQ1A 1HTIA 4O1CA 3IV3A 3TH6A 4IUOA 2YFOA 2QCFA 2X1SA 1W3IA 2VENA 2ZA1A 4LVAA 3TSDA 4O53A 4YLWA 3TIMA 4YCPA 1AW1A 2JGYA 2ZFAA 1TRIA 3B4UA 2ATSA 3INPA 4O57A 5L9FA 2QEZA 1NEYA 3ELFA 5BNKA 2R8WA 4Y8FA 1OFBA 5KINA 1VR6A 5AYYA 3GKAA 2FQIA 3W1NA 3PB0A 3P5ZA 3EEGA 3NL3A 5BOOA 3STGA 3C3NA 3LI0A 3NR0A 1SFLA 1ZAJA 2ZRUA 1OYBA 1KM1A 4Q33A 3M41A 4JX6A 4WXZA 1OX4A 2JKEA 3S1VA 1YDOA 5AB3A 1SSDA 4UMCA 2GVLA 2VFIA 3JS3A 1XC4A 1ZY9A 3NQ7A 5DBTA 4KKXA 3EWYA 3T7VA 4UTMA 3W84A 2GPTA 3VKJA 3W7NA 3TXZA 1V7YA 3LHWA 2QCNA 3M9YA 4E38A 1H1ZA 2NUWA 3DH7A 3L68A 4AF0B 1SFJA 2HS6A 3I65A 3B05A 4LV9A 3L5MA 1VYPX 3EX3A 2VEMA 1LRQA 2QR6A 1ZCOA 2EHHA 2J24A 3BW2A 1IXPA 3E0IA 2Z0IA 3W9ZA 3UQNA 3M0ZA 1WAUA 5F2IA 1WDWA 3CWOX 4IMEA 5KSWA 5LZLA 1B3OA 4IWWA 4NNCA 4M19A 3SY5A 1W56A 5G2IA 3HGSA 1CW2A 1TV5A 3HGOA 3FFSA 4NQ1A 3WK0A 3G1YA 4EWND 3OIXA 3R8RA 3QSRA 2A85A 3R12A 4FNRA 2C3ZA 1GVRA 3M5YA 2LLEA 4NX5A 3KX6A 3RLVA 4JIPA 4TR9A 3PG9A 5G1TA 5K9XA 4DF0A 3I68A 4O13A 4CNOA 5HMSA 1P0NA 3MHFA 4PL2A 4RZ4A 4KWWA 2CZ5A 3GLCA 4W9TA 1OF6A 5AOUA 4DXVA 3GAKA 3MP5A 3NXFA 1VCVA 4UR8A 3E49A 4X9SA 3GXTA 3EXTA 3B8DA 1N55A 1S5TA 1EEPA 3TROA 3I7RA 2VFDA 1GG1A 4DQWA 3C8FA 4UC5A 2Q8LA 3LHYA 1EUNA 2BSLA 4UCGA 4JTUA 2A6NA 4ZL1A 3L21A 1OFOA 2VKZG 4GE8A 5DXXA 5LNVA 2G97A 3PF3A 2ABBA 2I1OA 3LHUA 3F4WA 1B9BA 1RZMA 1NSJA 3IVUA 1T99A 1ONRA 3BVJA 2JK2A 2CLIA 1SR9A 3G3DA 3IVSA 4G1KA 1GG0A 3SI9A 1NF0A 1YLVA 1M6JA 3OVRA 3NA8A 1AL8A 1MEIA 3A23A 3HB9A 4JDYA 5LKYA 2CWNA 5HINA 1F05A 1VYSX 1PCKA 4FHAA 4NJGA 2JGQA 3E9AA 3HG3A 4O14A 4R7JA 3UWWA 3W2NA 1XBVA 4AF0A 1FXPA 3UWZA 1TJPA 1H7XA 5K3VA 1W1ZA 1LM1A 4GUHA 2A21A 4A3UA 1W0MA 1RVGA 3C0JA 2G96A 4IPJA 4KFOA 2NV1A 4AHPA 4HNUA 4UR7A 3UPBA 3NGJA 3QPZA 3CU2A 3W2UA 4GBUA 1WA3A 1SO5A 1KTBA 1TYGA 3HG4A 1PE1A 3G0SA 4JYDA 1WQ5A 4MZYA 4N6EA 1SW0A 1BEUA 3TQKA 1I2QA 3NQDA 1FY6A 4IGHA 5HWNA 4JTLA 1H5YA 3PUDA 1W54A 1TV8A 3A5FA 1T0OA 1M7OA 5TQLA 1FUYA 1UJPA 4UFJA 5D38A 4P61A 2P1FA 2QUUA 3W2MA 4JICA 4NXSA 3W7QA 2JKPA 2YGYA 3OG3A 4Q4KA 4MLRA 3W7GA 1EP1A 3IRDA 3W88A 1F73A 1PV8A 1Z44A 4TX9A 1GVFA 3HGRA 1LBLA 4LC8A 4Y90A 3MP3A 3O06A 3MO7A 3N19B 1TPUA 4PC8A 2E6FA 4GRSA 2E6DA 3C2EA 4BWLC 5A8GA 4MZ8A 1R30A 1TPEA 4BWLA 3KXQA 2NXIA 1GOXA 5A5WA 3ANYA 1S3HA 3W1RA 3LV6A 3W7MA 4NJIA 1XBYA 1Q6RA 2QCLA 3LM7A 5IM51 2C19A 7TIMA 3NM1A 3HJZA 2PCQA 3EKLA 1MSSA 1XCFA 4UTHA 4BFAA 4LT9A 3GK0A 2BLEA 3C56A 5BRBA 3KVKA 4AB4A 3IGXA 3FS2A 4ICNA 4UTLA 5C55A 1IXOA 5AHIA 1D9EA 1UB3A 3S6DA 2A1YA 1VCGA 1DOSA 1JUKA 4BI7A 1VYRA 1VZWA 3QC3A 3RMJA 4OV4A 3L0KA 4O54A 5J5DA 4ZVJA 1SUXA 2HTMA 2AGKA 3V1PA 4CCEA 3C2RA 1KFKA 3QMRA 1DJNA 4BI6A 4CCCA 1GQNA 2HSAA 3L67A 4O12A 3W73A 4CQ9A 3S5NA 3WK2A 5I3HA 3STCA 3QW4B 2QKFA 2R91A 3NQMA 1B57A 4DO5A 1K03A 1TJRA 3L0NA 4XZ9A 3W1PA 1J4EA 3PM6A 1HL2A 3EX1A 3DFNA 3CT7A 4AXKA 1TTJA 3T4CA 3B0PA 3HMJG 5CPOA 3NDOA 1JRCA 5SWUA 4XBKA 2H8ZA 1U83A 5D03A 4JTFA 5LHFA 4UTKA 1SO3A 3DFTA 3P74A 2J27A 1JR1A 3LBMA 1GVQA 5D2YA 2ZCGA 1L6YA 5U4NA 4AAJA 5D05A 2TSYA 2XN1A 5KMYA 2OJPA 2X1TA 1XBZA 3SGUA 3M6YA 2I14A 1TTIA 3ZFHA 2J9XA 3SFKA 3RLUA 1QPOA 1ZENA 4LVDA 4R33A 4BF9A 3W76A 1F7BA 4E0CA 5CKSA 4GNJA 3BG5A 1OX5A 5HUOA 1F6PA 3GB6A 1YPFA 2WSRA 4C1KA 3PWAA 2C0AA 5J5RA 5G2HA 4UXDA 2GJLA 2Y85A 3FYPA 4UTJA 1LRNA 3MMTA 3L0GA 2GQ8A 3LX9A 3UNDA 3Q2DA 4ZZ9A 3QYQA 3VFLA 3WJYA 3BLFA 4JY9A 3PBYA 4DBEA 4M7SA 4PTNA 3GXPA 2C14A 4N02A 2NUXA 5F4SA 3TUUA 4DO4A 1O4UA 2X2GA 3L66A 4LS1A 2QCEA 4PA8A 1RQHA 2NZLA 2XN0A 2Z6JA 4LVBA 1KFLA 1UASA 3E02A 4Z0SA 3VE7A 3FJ6A 2QAPA 1H7NA 5D2XA 2CZEA 1XUUA 3NOEA 4YL2A 4N4QA 2QDHA 2V0TA 1KM6A 4JTTA 3IIVA 1TREA 3RU6A 2YW4A 1GYLA 3STEA 1UBSA 2BZNA 3LGEA 2VFGA 3LXBA 4O28A 3QQ0A 5CPNA 4NT0A 1LYXA 3NL6A 4LV4A 3M1ZA 4GUGA 4EVZA 4UFIA 1SO4A 3C2OA 1ICSA 2P0OA 3BPWA 3NQAA 4IXHA 4RR4A 2BXVA 3UWQA 1TIMA 4IQLA 1C9DA 1H51A 4I7WA 2X30A 4RK8A 1NF7A
chains in the Genus database with same CATH superfamily
4K38A 4X2RA 4JTKA 1MO0A 1N7KA 2GDQA 4JZ5A 4QLKA 4JTIA 4CEUC 3QH2A 4A3RA 4D6HA 4HTBA 1UUMA 1EGVA 1TR1A 5A2BA 3NQBA 1LG2A 1SZFA 3G24A 3TW6A 4HD5A 2ZXBA 4Z1BA 2WSYA 2XFWA 3V0SA 5AHMA 3R8HA 1MEHA 4K37A 4W7VA 4XG1A 3ZVIA 2E0PA 5CZSA 5C2GA 1TX0A 2OKOA 4LUIA 3PG8A 3L4ZA 1PKNA 3FOKA 1W31A 2AOSA 3WN6A 3A3WA 7TAAA 4R7OA 3UR8A 3LCWA 1BQCA 2CYGA 4UOJA 1W5PA 3L5AA 4PODA 3KBNA 3PUOA 1RPKA 1KWGA 3C61A 3A9BA 2IQ0A 1LCOA 1XDJA 3BE7A 3SUWA 3UXKA 2HCVA 2ALDA 2F2KA 5E9XA 5AY7A 1W1IE 1EF2A 5HMDA 4TQTA 1M68A 3FYOA 3OHMB 1LTDA 3OBAA 2E8YA 3W0KA 4CQCA 2FZ8A 3HPXA 2PMQA 5KITA 1X1ZA 4I6VA 4CUCA 1KWKA 4HCHA 5U7SA 3RLGA 4M1RA 3V5OA 1L8NA 5D9OA 4UTTC 2PC4A 4F4RA 3M5VA 3POCA 3NPWA 2OO0A 4XKYB 1MZHA 4OKDA 4ROQA 3RX3A 3VDCA 4WGHA 3M0LA 3VD3A 1VHNA 1SZGA 4DPPA 1TPWA 1J2WA 2BHYA 3IPWA 5E9AA 2O9TA 4FXRA 1B90A 2DZXA 4J3XA 2GSEA 3R4IA 3B0VC 4G7FA 1KBKA 2HRWA 2WVVB 3LCLA 1I1XA 1UZHA 1OFPA 1XRTA 2NSOA 4GUJA 4A2SA 4XQ6A 3CO4A 3WL0A 3KL5A 3N73A 4NI8A 3NUKA 5H2ZA 1QI4A 4JTSA 2XZ7A 2YZRA 1ZBVA 1Q6DA 3L2MA 4UTUA 3LHZA 3M44A 5FEPA 1GOMA 5G1YA 1R87A 5A6JA 3OLDA 3WJXA 4RLIA 1FWRA 4ICMA 3DKLA 5E0KA 3QSTA 3GNRA 1SW3A 2ZRYA 1JVNA 4QTGA 2YJQA 3HA1A 3H2NA 2Y8VA 3OYZA 4XUYA 3E6EA 2QJIA 3NO3A 1HGWA 5DCDA 4KWUA 5H8MA 2DW6A 4GCXA 5A8OA 4YVXA 4OECA 2NXGA 1JPIA 3NVTA 3RRXA 1XYZA 4QG8A 1NU5A 2ZZ2A 1O66A 2XUCA 2RDXA 1EO7A 4MY8A 1OBAA 3BCDA 3E5PA 5BMXA 1IIGA 1KFCA 4NRRA 1PL9A 1DV7A 3RJYA 1RUSA 1H4PA 3OO2A 4XWUA 4O1EA 5ABTA 4N2YA 1XLIA 3NVDA 2WJDA 4BJHA 1US0A 1VBRA 2ZKMX 4HA0A 3ABQA 2A3AA 3WUEA 4HPNA 2IPGA 1BWLA 4ZENA 3N12A 1UQZA 3A13A 1R5YA 3E2QA 2YDSA 1FDJA 2I57A 2PF8A 2V8ZA 2J88A 1J18A 4BQ3A 1TZ9A 4MLJA 2PU0A 1XYBA 4Z1AA 2CIPA 3GH7A 1VH7A 1WXZA 1PYFA 2QMJA 4DF2A 4U4MA 3NJ3A 1PTGA 1Q6FA 3KBMA 3N9KA 5HPOA 3MU7A 4GX9A 4C6MA 4MG4A 3G18A 1VFFA 1EEXA 4JEJA 3EDJA 1JZ4A 1UD3A 3MJMA 3EPOA 2FFCA 5HQLA 2EG6A 1UD4A 5CLTA 1LP6A 4DBDA 4Q7NA 3W1UA 1FCQA 1KFJA 1K70A 1FHUA 3U4AA 4NYYA 2POZA 4PTVA 1I4NA 4OZOA 1H1NA 1U5HA 1CI1A 4WGXA 1O94A 4QQUA 1QFEA 2OWXA 1QR7A 1B4EA 4LUSA 5I07A 3T08A 2F6XA 1KV8A 2WNZA 2NX3A 4HYWA 2A7NA 3AAMA 3BH4A 4FO4A 4LEQA 1M9HA 2QCHA 4KIRA 2CLPA 1WP6A 1JF6A 4LS2A 1TPC1 4KESA 3N9RA 1VF8A 1KBIA 4J28A 5REQB 2F38A 3RRAA 1GTEA 2YCIX 1ZJHA 3GYCA 1P6BA 3S1GA 1QO2A 1V3IA 3QV7A 3QEZA 1EBGA 1OINA 1YRRA 3ZSTA 2V5BA 4MB1A 5CQ1A 3N13A 5G4HC 1ZBWA 5DCBA 1EIXA 3RO6A 1XXXA 1TB3A 1XR2A 3CEUA 4W86A 2Y63A 3TSBA 3TX9A 1UZDA 2YCKX 2GWNA 3LU2A 4AHOA 2DSUA 3OOQA 2XH4A 4FOUA 1RQEA 4BK9A 1U1UA 1CTNA 3WLLA 2XWEA 4HNNA 1ODUA 3T0AA 4ZB5A 1XLMA 3LTPA 2ZOXA 4LTSA 3FXYA 3Q37A 1CLXA 4WSHA 1PX8A 1JZ8A 1CLKA 4N7QA 1Z32X 2PWEA 2DIEA 1J0YA 1K7EA 2VELA 2QCCA 4H01A 3WMLA 3UWYA 3C6CA 2P8CA 1OY0A 4F3HA 1CXFA 1JCXA 3W4RA 4DAIA 2VEPA 1OM0A 2NUYA 2WPBA 4PEKA 3ITCA 3OBKA 2XVLA 1ZBKA 3I4KA 1W3NA 1LOSA 2BOEX 3BGAA 3FAWA 4DZHA 4HZMA 3WLHA 3V36A 3VIHA 3W7EA 3KWSA 4GKLA 1V7AA 1GJWA 3CWNA 3VGGA 2QYGA 4FMVA 4K36A 4RDVA 3EWDA 2YLAA 5IXEA 3R0KA 3T05A 3S9ZA 4NX0A 1RA0A 3UVAA 3B03A 5MHBA 1MEWA 3DI0A 4N0RA 1NDYA 3HMCA 4F40A 1MQRA 4I5RA 3CMFA 4H04A 3DOPA 5JBDA 3N2BA 3BG3A 3R13A 4M6PA 3A24A 1BKSA 5PTDA 4AIOA 4Y9OA 4DF1A 3ONBA 1CB7B 5T9BG 4J9JA 1KM0A 5DMYA 4K7YA 3AZTA 1ADOA 3VXGA 2JE8A 2FHCA 1FCBA 2RHGA 4EPEC 3GO2A 2BGQA 3G6MA 5CAKA 1EP3A 4EE9A 5LNWA 1MFVA 5DQPA 3QYSA 1J12A 1ICPA 3WLPA 4XD3A 1QUMA 1GYMA 2QJGA 4UZSA 1FQ0A 1F6YA 2QVNA 3ANUA 3GHTA 4WOZA 1XDMA 3CHVA 5HMEA 1MW3A 4TMCA 3G1FA 3ARQA 5A1AA 3BLEA 2PEVA 3AUJA 5HJLA 2E67A 4WY0A 4ML4A 4HVXA 3H24A 3AMCA 3OGVA 3W82A 3SQLA 4IL2A 4RE0A 4X2PA 2J13A 2VVNA 1MRAA 3WFAA 2G8ZA 4KEMA 3LBCA 2E3ZA 4JXCA 1P0KA 1G0CA 4KRUA 4Q22A 3T2PA 1SJBA 2FVKA 4MNMA 4KGLA 4WJ8A 3TYZA 3MT1A 1WZAA 3WJZA 3S0CA 4XAYA 3QGVA 1L6FA 4RE3A 4IQEA 4PRTA 3GDMA 3UZJA 4ZO7A 4RV8A 4UNIA 1A5AA 3NL5A 3OLIA 3HQ1A 1R3WA 4UOQA 2V81A 3TWAA 4PUKA 4C7GA 1ISXA 1DIEA 2D2HA 2ODOA 3I6EA 4CD7A 4FLQA 1REQA 5DY2A 3GXMA 3DHFA 3WH9A 2BXZA 4ZQPA 2XWDA 3GIYA 4AD0A 2ZZ4A 3M5XA 5K4XA 4LVGA 3UYCA 5ECUA 3URAA 1KLZA 5HUPA 1B9ZA 2CBJA 4PBGA 1AMYA 1SO6A 2CKRA 1C8YA 1HZYA 3I3DA 3ES8A 4UTWC 1Q63A 4S23A 1JUBA 3F1QA 2VR4A 4OVXA 2CLEA 5TIMA 1QPNA 2EO7A 2VM8A 4GA8A 5TAOA 1CEOA 3OVPA 4IPNB 3S5ZA 3JZEA 3M5ZA 3P62A 2JQXA 4GXMA 4DM1A 3A22A 4AEFA 4OOZA 4M6QA 4UUIA 3WMSA 2ZZ5A 4NI3A 3P2VA 1E4MM 4DAFA 4QS6A 1DQWA 3SJNA 5F2MA 3UP8A 3MHGA 4EPBC 3EPMA 1NOWA 3GYEA 3I7QA 4L4LA 1OFQA 1QOPA 4I7VA 1X6UA 5KZDA 5M1TA 2YDQA 4UQCA 1DWFM 3JR2A 4LF2A 5F4XA 3VZZA 5ENLA 4H6KA 2FH6A 4N6FA 2ZDSA 2QQ6A 1GGOA 3OZYA 3FEQA 4DUXA 5G4EA 3LM3A 1OFEA 3QMSA 1PS9A 1OYCA 3WKZA 4AZCA 1R2RA 2W0UA 4IXXA 2VGBA 1RV8A 5K7JA 4GZJA 4PMJA 2PGRA 4GX8A 1XRVA 4MHBA 3ITYA 4XZHA 1XD0A 3W7JA 4B3KA 4IP7A 4C6IA 1SQ7A 2CBVA 1LQ0A 4LAOA 2Z1VA 3IEBA 3I7SA 4KCVA 4LH8A 4FX8A 1PKLA 3W23A 1P0EA 3TOYA 7REQA 1TQXA 3W7IA 1VFHA 1FDZA 3VNMA 4O15A 4NZ4A 3GW0A 3G1AA 3PBUA 5AC8A 1RY8A 4MTVA 3LHVA 2ZRZA 3MYOA 1P48A 2DW7A 4NIRA 3LCXA 3TJXA 4CD6A 1HO1A 1Q13A 3QN3A 5FL1A 2BGNE 3SCVA 5I3FA 4AWUA 4ERIA 3FVMA 3W1AA 4ZA0A 3AYVA 2KX9A 1LORA 2J6XA 1UKQA 3EX4A 2Y0FA 1KXVA 4HNVA 3KCJA 1VPXA 2Y7GA 1HNYA 1C8XA 4L65A 1R2SA 5M5DA 3VOCA 4GYJA 3TR2A 2RDTA 4MDPA 1KRCC 4HGXA 1BKHA 4GNVA 3WQCA 3V75A 4D1IA 2XSXA 2R6OA 3B40A 1O5KA 3Q4DA 3UY8A 3TEVA 4C6CA 3NG3A 4R5EA 4L80A 3PZIA 1BYBA 3DAQA 3WYZA 4MJ2A 3FAXA 2BVYA 4D6EA 3AQUA 1LLZA 2Y70A 5LXXA 1AQMA 2OSYA 4GY0A 3CYVA 2TMDA 4RNIA 2CITA 4TX8A 3NQEA 1W5QA 1QI3A 3S2MA 1EA0A 2Z1XA 3G77A 4M6UA 5JIPA 1WKYA 4JIHA 5IBXC 4P8UA 4QJ1A 2YLLA 2DQWA 2VFEA 5CGQA 3NPVA 4JYFA 3WQ4A 3M0YA 1FHVA 2BY2A 1XQLA 2BOFX 1E3XA 3H2OA 1JL8A 4WKAA 3O6CA 4HP5A 3SB0A 3BCFA 8TIMA 3GTNA 2YXOA 4J3ZA 3CM4A 4IMDA 4JQ3A 1WZMA 2RUSA 2E68A 3UXAA 2P50A 5CBJA 4GQGA 3OODA 5A6TC 2Z1KA 3II1A 4EKJA 2Y88A 1U5JA 3LYEA 4W5ZA 2X7VA 3P67A 4UBPC 3K8MA 3EA3A 5DY3A 5D9NA 2J9YA 3FLUA 5FJRA 1JEZA 4Q6XA 1FWJC 4XAPA 3UD6A 4MWAE 4PRRA 3UWEA 4GACA 3EXSA 3A4WA 1VBJA 3N3TA 3DHUA 1UZ4A 2RGMA 4ZOCA 4FNPA 1EYWA 4Q4SA 5A6BA 2J7DA 4AD1A 2I5GA 3BV4A 1P0BA 1OC6A 3FKRA 1RBOB 4GHRA 3AXKA 4GXWA 5F2GA 5LNUA 3CEPA 1E4LA 4F66A 3UEQA 5B7YA 1PAMA 1DXFA 1KRBC 4DXXA 4NNBA 1V03A 2YCEA 3BSGA 4CVUA 4RNFA 1QPRA 4H1ZA 3N17A 6ALDA 2WYSA 3ANVA 2OOGA 3S2CA 2QMKA 2IQTA 2B7PA 4G56A 1G4SA 1GKRA 4D1JA 1S2VA 1HG3A 1O68A 4P8XA 2FB2A 1EC7A 2BX7A 3CBWA 3ABXA 3TLQA 5DMMA 1BXBA 3VDBA 4QAIA 3MI3A 1IZKA 3EB4A 2DUXA 4FB7A 2EPNA 4X60A 2J4GA 4N9DA 2P3ZA 1K9FA 4C6KA 2B7QA 1P5BA 2BWGA 1Y0EA 2VEGA 1ALDA 3PUEA 3BGGA 4JEQA 1QNOA 2J7HA 3MPGA 4XBSA 3MUAA 4M24A 4AC7C 1GQJA 3S2LA 1CWYA 4CQ8A 3VNYA 1Q7ZA 5CZ0A 4HHLA 2VGGA 3QLDA 3P8IA 1QNSA 3EDDA 4H9MA 2XG9A 1E6NA 3B9OA 1PIFA 2V2HA 2Q09A 4Y9AA 4UTFA 1GJPA 1BG4A 3U7VA 4HPHA 3GH5A 3CIWA 2IPFA 2Q6ZA 4O1DA 2FZMA 1FRBA 1BXNA 4IFKB 2GOUA 1NOUA 3O63A 4GZIA 3S3GA 5JH1A 1TTPA 1E72M 1W91A 3TA6A 3VOGA 4Z1YA 1UH3A 2XFFA 3SCNA 3AZSA 3NZGA 1FWCC 2ZXDA 1DWGM 4XIMA 3WD4A 4IJCA 1SZNA 3W87A 1IGSA 3WLJA 2H90A 3R94A 3CPUA 3GC5A 1A5OC 3JRKA 2VEFA 1NVMA 3VC5A 1M65A 1E56A 4XAZA 1GKQA 1KR1A 2G41A 2NQLA 3G6LA 5AZ1A 2V9DA 4I90A 5LYRA 3TV8A 1C8QA 1T41A 3FJNA 1LWHA 1RLDA 2C1GA 2D73A 3WNOA 3BAIA 3ABSA 3GR7A 1TR9A 3WQ5A 2KAUC 4S38A 2BOGX 1M3UA 4W89A 4DUOA 1TO3A 4US5D 4B3ZA 2JALA 4FLRA 2D22A 1WO2A 3IVTA 3UNTA 4EANA 1FVPA 1CGXA 5C7VA 3MQTA 3SRFA 3BARA 1RCOB 5CPMA 2I5QA 1RK5A 3NZPA 2J77A 5FAGA 1XF0A 1KA9F 3MP4A 1E51A 1M7XA 3PPCA 3N2MA 1XS2A 4LPCA 3KDNA 4DWDA 3CC1A 2DT0A 3NQ8A 2AMGA 4KH2A 2GQ3A 1FWSA 2WNQA 2XIOA 2NQ5A 3K30A 2D3LA 3OTRA 3HFTA 4ES4A 1H7RA 1XPYA 1DIOA 2PWUA 3N04A 4HK5A 5AC4A 1HN1A 1K3UA 2RDWA 3QFEA 3LHTA 1FFRA 5FF4A 3H22A 1R86A 1K4GA 1HKMA 1JXKA 4WR3A 3O0KA 4LYKA 3BICA 3UJRA 1XYCA 5FJPA 1W5OA 2CLHA 2J7EA 1W5MA 1SR0A 2VXNA 1V5XA 2W6RA 1CXEA 3GIPA 4DZIA 3LSCA 4REQB 4O1CA 1W3IA 3MMDA 4LVAA 2WPGA 4H6QA 3TSDA 4YCPA 4BKNA 1HKIA 2QGHA 2UY4A 2YOCA 2X42A 5L9FA 1S2TA 3BC9A 3NSMA 3CNYA 1NEYA 1E9YB 2QPUA 5BNKA 5KINA 4HNOA 1BHGA 4FP1A 1VR6A 5AYYA 4NL1A 2OSWA 3W1NA 2E9BA 3CZEA 1J6PA 3PB0A 3P5ZA 4MWAA 4ATWA 2DPEA 1I1WA 1Y5XA 3C3NA 3LI0A 3VK5A 3AJ7A 3U5UA 2ZRUA 1CGTA 2C8NA 5I09A 5G1MA 3M41A 4JX6A 3UGVA 4Z17A 1OX4A 2VZTA 4M8UA 4ZODA 1L0PA 1PYMA 4WK9A 3U7BA 4UTMA 4KKXA 3EWYA 2GPTA 3DX5A 4J3TA 2PWGA 1MQPA 3M9YA 3OQEA 1EKOA 3L68A 2BB0A 1G9HA 3W29A 1QBAA 4QJ4B 3WLTA 2EHHA 3WDPP 4UCFA 2XJ7A 1XSIA 1DPMA 1TG7A 2Z0IA 2PP0A 2OU4A 5KSWA 6TAAA 1NWRA 1NOFA 2QULA 4NNCA 4M19A 3SY5A 1W56A 5G2IA 3HGSA 1TV5A 4J40A 3FFSA 3PBMA 1FWFC 3WK0A 2WM0A 2PDYA 2ZC8A 3R12A 2B81A 4GGHA 1MW0A 3M5YA 3KX6A 1E6QM 1E0UA 5CPSA 4K3ZA 4TR9A 3PG9A 5K9XA 4DF0A 4CNOA 3T0CA 3KHDA 5HMSA 3MHFA 4PL2A 1EZWA 4RZ4A 3AHVA 1RJRA 4W9TA 4C91A 5EFDA 4DXVA 2E7FA 4TVUA 3EB3A 1CGVA 3I4EA 4UR8A 3E49A 3GXTA 3EXTA 4HOWA 1S5TA 1J2BA 5ABEA 3FNDA 1UPPA 2VFDA 4LALA 3K2GA 4UCGA 2BSLA 3LBOA 6A3HA 2A6NA 4ZL1A 1TA3A 3DYOA 5I03A 4G7EA 1DJIA 3FA3A 4L9YA 4F48A 4G6CA 1RCXB 3M46A 3EA1A 4KCUA 2G97A 4ZXLA 3LHUA 3QGKC 3TYDA 1JYWA 3IVUA 2JK2A 3BOFA 3U4FA 1SR9A 1EHNA 2FHBA 3G3DA 4L4OA 3H7RA 2QV5A 4HZ8A 1NF0A 4J3VA 1YLVA 2J79A 3ITXA 4YTSA 1XIFA 3OVRA 3PZTA 1UKPA 4WJXA 4DJDC 2VWTA 3AWNA 4JDYA 4IJRA 3E9AA 2ZVIA 4GINA 3W28A 3HG3A 4B2DD 3UWWA 4AF0A 3M4HA 3UWZA 2OPJA 4YVVA 1W3LA 2O55A 2A21A 3CUIA 1RVGA 3C0JA 2G96A 2V5DA 4DJDD 3UPBA 3PJWA 3QPZA 4ZE4A 4GBUA 3EMQA 2WZIA 3B9NA 3DFYA 1EO5A 1RH9A 1WQ5A 1SW0A 2VDHA 3RO8A 3TQKA 2Z4GA 3U0HA 2GGJA 5FL0A 1JAEA 3NQDA 1FY6A 4IGHA 1IR2A 5HWNA 1H5YA 1MW2A 4F2TA 1EBHA 1FUYA 4PCNA 2HQAA 2P1FA 1HP4A 4E2OA 2CBUA 3KTSA 4JICA 3W7QA 5KEZA 1IQ8A 5CLWA 1EP1A 1LT8A 5IRPA 4TX9A 1KRAC 2O9PA 4Y90A 5J8LA 3O06A 3N19B 3WNPA 1Q2RA 1KD0A 4NHVA 3BOXA 4BWLC 5A8GA 4QG6A 3UERA 1A3HA 3KXQA 1J11A 1H11A 3W1RA 3LV6A 3HQNA 3F4CA 4OUIA 2CPUA 2VNCA 3W7MA 3OPSA 1XBYA 2C19A 2C91A 4XO6A 4B92A 1MSSA 4DJEA 3MTWA 4LT9A 1S38A 3GK0A 2BLEA 2WBKA 3E2VA 2ISFA 3AS2A 3IGXA 3GE7A 3LQLA 5C55A 3S6DA 4B15A 1TUXA 1RA5A 1EDQA 1DOSA 4X61A 2Z27A 1KXHA 4O54A 4ZVJA 3UG5A 4H7VA 4FPSA 4M0XA 3QMRA 4M82A 2P53A 1GQNA 3UYIA 3S5NA 3WK2A 1Y5WA 3NGFA 5I3HA 4FS9A 2AKZA 1B57A 4LEFA 2DT1A 3C8NA 1HL2A 3T4CA 1TTJA 4HCDA 3NDOA 3OGSA 2ZE3A 1XLCA 4XBKA 4QLLA 4MADA 4JTFA 5LHFA 5XINA 4QROA 4DUVA 1MUWA 1JR1A 5HXMA 1GVQA 2ZE0A 4AAJA 1J10A 5D05A 4B5SA 2V3EA 3B9DA 4C65A 1XBZA 3REQB 3S6TA 3SCSA 1EJXC 1ZENA 3RM4A 1E9IA 4BF9A 4FR1A 1REQB 4E3VA 1YPFA 2IUZA 3KS6A 1XLDA 2WSRA 3TTOA 4C1KA 5G2HA 1W1B1 4DI8A 4AXNA 2FGZA 4IM4A 1LRNA 4ZXOA 3MMTA 1NDVA 3L0GA 1FWEC 2GQ8A 1G94A 3UNDA 3GXFA 4YYFA 3K4AA 3QYQA 4DN1A 2UBPC 2WHJA 3MUIA 2FGLA 3BLFA 3HU7A 2Y4SA 4JY9A 5I79A 3BAYA 3E2SA 2NUXA 5F4SA 3TUUA 1O4UA 3BJFA 1IWAA 1ONXA 3ARVA 1IWPA 4PA8A 1RQHA 2I9UA 2Z6JA 1HP5A 1UASA 2F8QA 3SN4A 4J3WA 3KWXA 1H7NA 1XUUA 4N4QA 1EXBA 3UW6A 4K2SA 2BZNA 1MUMA 3KLKA 2HNEA 4NT0A 4ACZB 1WDQA 3NL6A 3H21A 3TN5A 4O8AA 1YKWA 1M1BA 4QJ5B 3IANA 4H7ZA 5GJPA 4Y9MA 3N1AA 1FFQA 1JFXA 2OVLA 1MYRA 2P0OA 3BPWA 3LZ3A 3UWQA 4R85A 1TIMA 4IQLA 1C9DA 1FP9A 2X30A 2OYKA 3GTHA 4M1BA 3GS6A 5KZ6A 3SBFA 2PDBA 4JAWA 1WBHA 3FDGA 1UUOA 4IF2A 2VEKA 3MWAA 1TZZA 3LCHA 4AYSA 1G4PA 3U6WA 2B7NA 2SFPA 3WFZA 1EGZA 2W66A 1UWTA 1JRBA 3T40A 4Z0JA 5C2CA 4O10A 1CGWA 5IDIA 1QI0A 1XIMA 2X05A 2ZADA 3M0JA 1WDRA 5C9UA 2BMBA 1F5ZA 5AZ0A 4AZ5A 1TTQA 4FNQA 4DVOA 3CUZA 4D8LA 3H53A 1PWLA 2ISDA 2YL6A 5D30A 5TD4A 1V6XA 3PAJA 2D1ZA 2GZXA 4IH3A 4GIYA 1ZAHA 3NOYA 2QJNA 3DG3A 1JPMA 2GQ9A 3NSNA 2Q8XA 1IEXA 2XISA 4CNNA 1BYCA 3EWBX 3D3FA 4LXFA 1EJWC 3W07A 4E2BA 1IR1A 3B9AA 2OYLA 1MNSA 4AUBA 2PRHA 3BANA 3QPEA 1VGAA 1KTNA 2BTMA 1HJXA 4FXFA 2I56A 3ARPA 1XWYA 3QY6A 3TNOA 5TNVA 3MB9A 4WOQA 3WQOA 1KW1A 3TZNA 1H60A 1LL6A 2YB4A 4HNTA 4UQDA 1TVNA 3NO1A 4XISA 3EWZA 3F5KA 1LBMA 4H6RA 4URIA 3GBEA 1KBLA 3LCIA 1ITQA 1TWDA 3CMGA 2OTDA 1L8PA 1H2JA 5A6MA 3UF9A 5DANA 4FEZA 3FHQA 1AQHA 3ZLHA 1NELA 2ZUWA 1U33A 4D2JA 3VPLA 1RBAA 1NARA 3WQPA 5I2UA 4XZNX 4BQ4A 2DZUA 4GOAA 2MANA 1L6WA 3BGJA 1GW9A 3EKGA 4LYPA 4GXPA 3W6YA 1HUVA 1E6SM 1I8JA 4QITA 4MFDA 3STPA 2DH3A 5HAOA 1HXJA 4F9DA 2H8XA 3R2GA 3R7MA 1EQCA 4UR9A 3VNKA 4D8ZA 3TAKA 3TTYA 5LIYX 3MV11 1E15A 2YR1A 4BS0A 3Q67A 2E1WA 2QV4A 2CU0A 1DE5A 3VYLA 5CPLA 3RPMA 4HNLA 3V18A 2ZXQA 1CYGA 3W75A 1YNPA 1XG4A 1O60A 2GUYA 4PUDA 4JR5A 3LLFA 5I24A 4XKYA 3V5FA 4DI9A 3GBDA 4H4IA 5EMLA 5EPDA 1UW9A 4WF7A 3NSXA 4Z1DA 4DPQA 3GNOA 1K8YA 5BW6A 2RGLA 4F0HA 3G3MA 3PPFA 3VTRA 1Q65A 4EX4A 1WYIA 3BL3A 2AKMA 4JFTA 2FIQA 3NL2A 2YKKA 2WVVA 4LGXA 5A3HA 4RDZA 3DFOA 2ZA3A 2CXEA 2BY1A 3KAOA 1FOBA 3CZJA 1YE6A 4W7WA 4EPKA 1HJQA 3EWCA 2NSXA 1CXIA 3QC0A 4MYXA 1A5SA 2BV9A 2ZZ3A 4LC6A 1OABA 1XFBA 3RILA 1I2OA 5HPCA 3TWBA 4DIAA 4CD8A 5CEWA 4Q7BA 3VKKA 3Q58A 2RKXA 3W7KA 2FH8A 1IT0A 5G4WA 3VCRA 5C6MA 3QTGA 1C91A 4OBRA 2VTFA 3R5EA 5LNSA 2EPMX 2ZUVA 2OZ0A 1W1VA 1L2UA 1UA7A 2WANA 1M41A 2GGEA 4XAFA 3GZAA 1KLYA 1ZFJA 2WQPA 3GHSA 3H55A 1V4YA 4QP0A 2OWCA 2AGTA 1GOWA 4Y6GA 2ANUA 4IQJA 1PWMA 3KL0A 1K8ZA 1FCVA 5HWJA 1CXKA 1ISYA 3CB3A 4HZ6A 2VI0A 1OEPA 3VI2A 4UIOA 1OT1A 2B0MA 5MKGB 4OJYA 4JL2A 3GVQA 4ILSA 3L4UA 3C52A 9CGTA 2IPWA 5D9MA 2V5LA 2VL4A 4R9XA 1NQ6A 4B5NA 4FX6M 1S2CA 2VRQA 3CUFA 3B04A 5BU6A 3TW9A 3W7LA 4W5UA 3AMDA 2ZQ0A 1GZGA 4ORIA 5HJYA 2O4QA 1WB0A 4CVWA 1HVQA 3UXDA 3C3UA 3WQFA 3DECA 4AVOA 3TCSA 4OTKA 4C6NA 4JIRA 3PFMA 4K8GA 4ADTA 1QNRA 4P5UA 2DZVA 1MDLA 3EDFA 3C4UA 4PUEA 5K9DA 3AXHA 3DYMA 4DZAA 3RJXA 4AY1A 1PBGA 3W6LA 4HPXA 3M47A 3PB2A 4BQ5A 3HGJA 3RF9A 3IJQA 2QVHA 3IGHX 1EPVA 1X7FA 5GNXA 5EA9A 2HVOA 5LNRA 1R85A 3ITTA 1EYEA 5BROA 2VQTA 1OG6A 1TZ7A 5CPQA 3V16A 4NSBA 1DJXA 3WNLA 2J75A 1HO4A 1V6TA 2JEPA 4AX7A 3ABOA 4XTDA 3WDHA 4DNHA 3BZJA 1US3A 3ARSA 1YBQB 1UWSA 2WVUA 4GG9A 4RE2A 3AZRA 4GQBA 3S1XA 1EL3A 3BMWA 2WBGA 5I3GA 3TR9A 5KZMA 1PSCA 5REQA 3MDUA 4I5XA 4GISA 3W81A 1VBGA 4J27A 3U2OA 2PWHA 2RH9A 4OOUA 3TU9A 1NWTA 5CAHA 4DYJA 1B5TA 1KQYA 1KXQA 4TV6A 3QHMA 2PB1A 3IJ8A 4UB9A 1X1OA 4Z08A 4FOJA 3MKKA 2GDUA 1VLWA 3QY7A 1FTXA 5JIWA 4DM2A 1XIBA 2FPVA 1H50A 5EU9A 3W86A 1LOLA 1D8CA 2WKGA 4JQAA 4TVCA 1BVWA 1WAWA 3TE9A 1W1TA 5I00A 3CB8A 2VC9A 3NEHA 4PMZA 1OFAA 1YXCA 4S3FA 3S9YA 3EKZA 2Y7DA 1KXTA 6REQB 1A47A 3EOEA 4NASA 4IG2B 1W5NA 4UFMA 1XLKA 1Q4WA 3S6OA 3UCQA 1Z6KA 1TIWA 2VCBA 3WQ6A 2Z7GA 1ZP3A 4MWAB 4O50A 1XJBA 4KETA 2A7RA 4BF5A 1JJKA 4FLOA 3IJLA 2VZUA 3VGEA 3OIHA 5G5IA 1OCJA 2Z26A 1EJRC 1RP9A 2OKTA 3SN0A 1OX4B 2V2CA 3HN3A 4W93A 4HJWA 2W5FA 2YA1A 2ZX6A 3E74A 1MXSA 1AW2A 4EP8C 2ZWZA 1C29A 4XAGA 3HPFA 3A12A 4WSKA 4S1FA 1E43A 4AD5A 3ZMRA 1MDRA 1HJVA 4XD4A 2ACUA 3SCOA 5BXRA 1KBJA 5H1WA 1A5KC 2CLMA 3G5EA 1F76A 3HV8A 4M6VA 3O6YX 4G1NA 4IX2A 7A3HA 1Z3NA 4QIUA 1UD5A 4HQVA 4MM1A 4ZOBA 3PP7A 5HWMA 2VC5A 3LPPA 1JPKA 1GOKA 1GPWA 3URQA 4OQVA 3IIZA 4NZJA 3ZT6A 3LXCA 3BWWA 4MGGA 3PULA 2VX5A 1V3KA 1F6KA 2ADAA 2VZOA 1S5VA 5EMMA 3DXIA 2GDVA 4ZTYA 3DC0A 3D6NA 3RAOA 4HHPA 1K8XA 5GJMA 2B7OA 3NNTA 4HA3A 4GFSA 2VC7A 4MNLA 1XH1A 3H7UA 3DGBA 2GSHA 4JN8A 2DSVA 2DVXA 3KOFA 3WEZA 2O0TA 1P6WA 4PGLA 4IT1A 4O4VA 3RNDA 1TMLA 3CAKA 3MUXA 1YDVA 3DYPA 4AU0A 4Y7EA 3VKDA 4FXSA 4J35A 3W02A 4C6BA 4CCZA 1T6MA 1AW5A 3HG2A 3ECQA 1OX6A 1E1CB 2BVDA 4GJIA 7PTDA 2VO5A 1FWIC 2EJAA 2FDSA 4HN4A 5AYIA 5FEXA 3NXLA 2PDMA 4CN4A 3AU6A 2PTXA 4QX4A 3CK5A 2XIBA 2NW0A 3WO8A 3F2BA 3KRSA 1RHCA 4GO9A 3RR4A 4QNEA 3KRZA 1HL8A 1UR4A 3NPUA 3VUPA 3UR5A 5ABFB 2ZX9A 3U8GA 2Y2WA 1RBLA 3VMNA 2C71A 3RX2A 1PO9A 1TE6A 4UNLA 2XH0A 3CQHA 3SSJA 1ISWA 2OFJA 3BURA 1GVYA 5HQMA 1OT2A 2XIMA 3O2LA 4EF9A 4HMNA 2R94A 5FIPA 2FPYA 4DYKA 4DYEA 4P2VA 2VEIA 3E2RA 3UZZA 2ZC1A 4I9JA 4XZBA 4GUIA 2ESCA 2BHUA 4IICA 3OEXA 1EOMA 1MXGA 1ICQA 4R34A 4S3CA 4GJJA 2DSZA 1J9YA 5BWAA 2VRKA 1J5SA 1VQTA 2ZIDA 5F2LA 4ADUA 3C2YA 3BG9A 4JCLA 1UP0A 4LB3A 4HK7A 3VNDA 4AD3A 5A6SA 1JCMP 4GYKA 2YBUA 4KRTA 3C2FA 1B3XA 1BTMA 2A3LA 4EF8A 3CWHA 1EC9A 3LGDA 2CLFA 3LG3A 4NJKA 2Y24A 1BGGA 1AMKA 3EWUA 5I77A 1JNDA 4JTRA 1DORA 1KCXA 5AHNA 3LDVA 5I0DA 4XD5A 3UG3A 3KRBA 2HXTA 3P3BA 3LV5A 4Q4MA 2GLKA 2HDJA 2OQHA 5BMWA 2BODX 3H7VA 4KWVA 3F5LA 3W7RA 1SU5A 2XSBA 3ITLA 1XLFA 1V6UA 5HR6A 1OGBA 1SFTA 4ATDA 1VEOA 2YDAA 2JIEA 2RDUA 1DJHA 1FHDA 1YDNA 4F2UA 4PRWA 2X41A 1MW1A 2HVMA 3N4EA 3ERPA 4ONVA 3WQVA 4MNJA 2PDHA 3KOWA 1GOIA 4Q3MA 2V6AA 4FF5A 2ZRVA 2QUMA 4AW7A 3A5VA 3XINA 5I02A 2VUNA 3S5YA 1B3ZA 1D3HA 5JBFA 3UWVA 2YCLA 4JQ1A 4KS0A 1UROA 1H1YA 1AL7A 3AYRA 1POKA 3GNDA 4B5XA 3TKFA 3I3BA 5G2WA 4HK6A 4J2PA 1VBHA 3S5SA 3WLOA 1QOQA 3K1DA 4Z2HA 3NCOA 1ML1A 2F2HA 4PR4A 3CL7A 3MS8A 2IXUA 2WQDA 4HU3A 1BD0A 1NH6A 3MUY1 2C1HA 1CGYA 5M2FX 4AWTA 4YWIA 3A4AA 3N2XA 4RW5A 2JFEX 1F3EA 2WKLA 2C1IA 3GDBA 1VFOA 3HF3A 2VC6A 3KBVA 1TPH1 1R3SA 3L4XA 1VPQA 3T4WA 3VKCA 1Z89A 1E5NA 1QCWA 1U2YA 3BQ5A 2NWSA 3P81A 3AHTA 1Q4NX 4PMUA 4W87A 3VA8A 2OSXA 3SUSA 1FWBC 2VJXA 2WJEA 3LTYA 4TXEA 2CHNA 2Q3OA 4PE8A 3BSMA 3W71A 3N34A 1W37A 2PDGA 2XVPA 1DE6A 3B8UA 4GI8A 1JZ3A 1JCYA 3IIPA 1O5XA 3PNUA 4B4HA 4I9TA 2EEXA 4BHYA 9XIAA 1H0IA 4G9PA 3UU0A 3T0DA 3TC3A 1GCYA 4JTCA 5EKYA 5DLCA 1XSKA 4JHMA 2VX7A 4TIMA 3LNMA 2YXGA 1F61A 3STFA 1KFEA 2UV8G 1GTHA 4KEZA 1S5WA 5C5YA 6PTDA 1UC4A 3KL3A 4RXGA 2DY3A 3JUGA 3LNPA 3UVIA 4P8VA 4AZIA 5BOEA 3KVLA 2QW5A 1G7UA 4XUGA 1G4EA 1F9CA 3NIYA 4ZQNA 3SCWA 4UOZA 4HOXA 1FWDC 5D2WA 3GUWA 3D0CA 5M03A 4H19A 2W4XA 1OFRA 5AHLA 2H3BA 2Z6IA 3T44A 2QPXA 2QNEA 3UXLA 3KTXA 4GMEA 3RUBL 5CBIA 1OF8A 2ATMA 3KCLA 1X8FA 4S2CA 2VOTA 1YW1A 2I17A 1G01A 1YMYA 2PTYA 3O9NA 4IOTA 2V3FA 4AZ6A 1S1RA 5FEWA 3TZFA 2I7GA 1RLCL 3DHPA 4UFKA 4PB3A 4OV9A 1ZPTA 3FDKA 3L65A 3DENA 2WNWA 3Q45A 1P1XA 3FGCB 4C60A 5A95A 5AVHA 1R0MA 1PIIA 3S1WA 1OJXA 3KRUA 4QS5A 2VFFA 4C6JA 4IMFA 4ZO9A 1JUEA 3LTSA 3S1UA 1GQKA 3IARA 1RVKA 4MJZA 2PWFA 2WCSA 1ZUAX 2CWXA 2QUTA 2HISA 1OIMA 3EDEA 2GVJA 2C18A 2OB3A 4A05A 1GZ1A 2VT0A 4HTYA 3FA4A 3UA4A 1ZHAA 4GI4A 1IXNA 1EJSC 4DJFA 3G0UA 2O7SA 4AC1X 1V6YA 2FTYA 4Q8UA 4XTIA 1GT8A 4BR1A 3E0FA 3EXRA 1EOKA 4C1NB 5I3JA 3CASA 3CHFA 1KR0A 2VWSA 4CNPA 3TFXA 4JDBA 4NU7A 1GPFA 3OW1A 2V69A 3TQVA 2QS8A 4HNCA 5LGZA 3CO8A 3B3DA 1UWQA 4A3YA 3CZ8A 4IIEA 2Q3RA 4ENLA 3TP4A 4A8NA 2YL5A 1B30A 3B06A 4WEVX 4IP4A 2ZWYA 2C7FA 4P7QA 3GVGA 4JOMA 4LANA 4JNMA 5EL1A 3GVWA 2WZTA 2W9MA 4V15A 1KFBA 2YSWA 1XL9A 3TC7A 1AJ0A 2W79A 2NXHA 1O95A 4GK8A 3RG6A 2IMRA 1UH2A 3DFPA 1XUZA 2GVEA 4FNSA 3TMQA 3M0IA 1K7XA 4IFKA 5HANA 3EDKA 4CD4A 3G1DA 4BF7A 2EAWA 2ISWA 3W2LA 1WKDA 3A4XA 4O0QA 3VDAA 3TYEA 4TMBA 3RIKA 4N42A 3IV3A 2PLJA 2PTWA 2VENA 4NZ1A 4B9YA 2AL2B 3A4JA 4O53A 2PUZA 1AW1A 2JGYA 3ITVA 4O57A 1LUCB 4EPDC 2R8WA 2WM1A 3QZ6A 4Y8FA 1OFBA 4FOKA 3ZO9A 1TWWA 5BXSA 3GKAA 2EKGA 1XV8A 3VIPA 3EEGA 3NL3A 2PDIA 1EDTA 3PTQA 1E4IA 1SFLA 1OYBA 1KM1A 4W8BA 4Q33A 2GVYA 1W8GA 5LIKX 4WXZA 2JKEA 2D23A 8CGTA 1VRXA 1O7AA 1SSDA 4UMCA 4WIWA 2VFIA 2VQUA 2PA6A 5HMFA 2YZ5A 3PBGA 4HYVA 4MMWA 3T7VA 3R11A 1A5MC 5FKYA 3W84A 2INZA 1QHPA 3TXZA 3L4VA 4WDXA 3AYSA 1M03A 1I9CB 4BCEA 1UD6A 1Z9AA 2PSNA 1SFJA 1WXYA 4LV9A 1KKRA 3L5MA 3EX3A 2WMIA 2PU1A 5LIUX 3K4WA 2GFTA 2QR6A 1ZCOA 2O56A 2D2GA 5A6LA 3AMGA 8A3HA 2E40A 1R38A 1WDWA 1OD0A 2G4JA 3CZKA 2VHLA 1WCGA 1NP0A 3U9IA 3DG6A 3WEOA 3RR1A 3W26A 3EYPA 3HGOA 1ZS2A 2OYMA 4NQ1A 3WUBA 2R24A 1UBPC 5CGTA 1GVRA 4HMCA 4DZ5A 5GNYA 4M56A 3T2OA 1DJWA 3VMPA 1ZQ5A 5GPRA 4C5YA 5G1TA 7CGTA 4O13A 5FJTA 1XQKA 1P0NA 4REQA 4KWWA 2CZ5A 4GYPA 1IHIA 2UY3A 1Q2SA 1XHGA 3C0LA 3COTA 1OF6A 3VIGA 2OO6A 3MP5A 1VCVA 4Q8PA 1DYSA 3SAZA 3T6CA 3B8DA 4WKHA 5CC5A 1N55A 2CHRA 1EEPA 4HU0A 5T8GA 2OGJA 1GG1A 4YYCA 4QRNA 3BAKA 2FJUB 1GZJA 4GD0A 2YDRA 3P14A 3AIEA 5LIWX 4GE8A 5DXXA 5LNVA 1E0TA 3VGDA 2ABBA 4ZFMA 3ARYA 1ONRA 3BVJA 4B5VA 2CLIA 1AJ2A 1DTUA 2OLHA 3CPGA 1HW6A 1XIJA 1M6JA 3NA8A 1MEIA 4XSLA 2CWNA 4PMYA 4W88A 1Y8BA 1Q6CA 1B1YA 4KWOA 2ACSA 2OODA 1XBVA 1W1ZA 1UMYA 2X0SA 4A3UA 2NV1A 4AHPA 4UR7A 3NGJA 3TOPA 1B54A 1MUCA 1WA3A 4Q8MA 1NWUA 4JYDA 3EBVA 4N6EA 4MZYA 4QDWA 3PUGA 1TV3A 2VMFA 3PUDA 1TV8A 3A5FA 4CN6A 1M7OA 1D2KA 2CKSA 2G3IA 2OG9A 3BCJA 3KZPA 1CB2A 2QUUA 4JHOA 2GK1B 1EC8A 4NXSA 3MSYA 3M0HA 3CUHA 1Z44A 3HGRA 2DIJA 3MSDA 3BZGA 1CGUA 1DJGA 1PKMA 3PZOA 2E9MA 3CGTA 3C2EA 1SMAA 4MZ8A 3XIMA 1TPEA 2PF0A 2NXIA 2VRJA 1GOXA 5A5WA 4JNZA 3LN3A 4NJIA 4QXIA 4F0LA 2PCQA 3EKLA 3EEZA 4YPJA 4Q4QA 3C56A 2FMOA 1GVIA 4AB4A 3PZNA 4GZEA 3VOHA 4GY1A 1NJJA 1KNWA 1IXOA 5AHIA 3PZVA 2A1YA 4BI7A 4B5UA 3WH7A 3RMJA 2YIHA 3L0KA 4LX4A 4KBXA 3THDA 3MDWA 4INFA 3SUUA 3U2ZA 5BRPA 4CCEA 3BUVA 1V6WA 3L4YA 3ZT5A 4LCSA 4BI6A 2Z24A 1D3CA 1TUFA 1FHLA 1UKSA 3STCA 4AZ7A 2V3DA 2ZX8A 4DO5A 1K03A 1TJRA 4B5WA 2G50A 3NZQA 2QXWA 3DFNA 1X6NA 4L6DA 4AXKA 2G37A 3T1GA 3HMJG 1JRCA 2W61A 2H8ZA 1C90A 4ZO8A 3A47A 1BRLB 4C6LA 3CV1A 1SO3A 3P74A 3IJDA 4V27A 5D2YA 2TSYA 2XN1A 5KMYA 2OJPA 3IUIA 3SGUA 2I14A 1TTIA 2J9XA 3TTQA 2W62A 3RLUA 2DSKA 1E1FA 4D9PA 4R33A 4L56A 3W76A 1F7BA 2HV5A 4E0CA 5CKSA 4GNJA 3VDHA 3BG5A 4LYQA 5HUOA 5I3DA 3KP1A 1Q66A 4JQ4A 1BQGA 1XYFA 2GJLA 2Y85A 2X0HA 1KRMA 3P0WA 1UUQA 1J96A 4PEEA 3ENLA 1AD4A 2IKIA 3LX9A 3VIJA 1UPMB 3SQSA 5C8BB 4ZZ9A 1VJZA 4GH3A 3WDRA 4YWSA 3H2EA 1OCQA 3KTCA 3IAQA 4J3UA 4DBEA 5CXPA 1UMLA 4PTNA 4N02A 3KOZA 1XLHA 2WC7A 3LA4A 4HZ7A 3IJ7A 3L66A 4A8RA 4LS1A 3ZJ7A 2QCEA 2PCEA 3LGGA 2NZLA 5TF0A 2XN0A 3WG6A 2ON3A 3FJ6A 4LFYA 2CZEA 4NYUA 4XB3A 1GQIA 4CEXC 1KM6A 1T5AA 4JTTA 3IIVA 2EPOA 4IGMA 3RCNA 3STEA 1UBSA 2P76A 4Q7IA 5CPNA 1LYXA 2JIWA 4MUPA 4GUGA 7ENLA 2AMXA 4EVZA 3GC2A 3E1F1 3WH8A 3IJIA 3S2NA 1ICSA 4IXHA 2REQB 4MB3A 5E70A 3DCPA 3J7HA 1H51A 1GJUA 2DZAA 3FVDA 2PGFA 1DKWA 2J25A 2W67A 1Q6QA 4NJHA 2V38A 3VINA 4DELA 4MSSA 4HYRA 5HQEA 1XISA 3FCPA 3D47A 4O16A 1EHAA 3REQA 1W9PA 1QHOA 3UPWA 2F6KA 3HPAA 4LNYA 3WD3A 4PL1A 2D2JA 3AS3A 2WB5A 3VM5A 5E0FA 1PHWA 1P7TA 5AYBA 4L1WA 4F0KA 1OK6A 3SFWA 4CNSA 3LCGA 4TTUA 1LQ2A 4S3KA 2C0HA 1K4HA 4H2CA 2X7WA 4XZWA 3ALGA 3N2TA 4IPIA 2DJLA 2NX9A 2ZVRA 2CLOA 3I6RA 4V1XA 1J0IA 4GABA 1QWKA 1DXEA 2YX0A 5AYZA 2HEJA 2EG7A 3BLOA 3W7CA 5HNRA 1C92A 4Q4RA 1CNVA 2ZUSA 4JY8A 4ACYA 3E12A 2W63A 3LMZA 4K8HA 3WBAA 1QAPA 4QCEA 3SIZA 3KVJA 4JFVA 3GFYA 1F3TA 4Q32A 1V93A 3CTLA 4JBRA 3GDTA 1KGUA 4UTTA 3UR7A 4ZBCA 2G5WA 4H8HA 5AC6A 2YW3A 1EJTC 1ADSA 3BXWA 1RK6A 2NVCA 4ACZA 1FWTA 3VOIA 3L12A 3ABRA 3A3XA 4WJEA 1T7LA 3VO0A 1A5UA 1V3JA 3PZMA 3AC0A 5BOFA 3TA9A 3RDKA 3QKEA 3W7PA 4H9TA 4LBSA 2F84A 2FTWA 3TJ4A 3E0VA 2Y8KA 4IFOA 1LOQA 4UFHA 4AH7A 1QJWA 1Y7VA 3TK7A 3WF2A 2RJGA 5BU9A 1VS1A 5D32A 5DN1A 4WHBA 1Q45A 1WUFA 3B8VA 4GWEA 5FD0A 3FW6A 4HN8A 3H54A 2YCLB 2FHFA 1JZ7A 1JCNA 2GUBA 3GHUA 3PBVA 1QW9A 3G1VA 3RPTA 1J0KA 2Z1BA 1W3KA 1ZLPA 3BK0A 4B3LA 1ME8A 3ISIX 1B3WA 1FDYA 3C86A 5A69A 3BDKA 1FBAA 4ZCWA 3GQYA 5FESA 4JTJA 5BZAA 3N9SA 2PS2A 3VD4A 3IIXA 2Z2BA 2GQAA 4TTGA 2E5DA 5HDRA 2PODA 3LQGA 3CHEA 4MKNA 1VCFA 4WUIA 4I9AA 1TQJA 1QVBA 1GYNA 3E0WA 3QM3A 3O8AA 5DFAA 2W92A 1E6RA 1SMDA 2XZ9A 3OGRA 5AKQA 3WK3A 2XYLA 3NQGA 2YYUA 3HURA 3W7DA 2NT1A 1EUAA 5IFPA 2GUUA 3JU2A 5D02A 2DH2A 2FZNA 5EMYA 1CPUA 1P4CA 1VFMA 2PDLA 2PURA 3EMZA 4O19A 5DRCA 3WD2A 1PTAA 2WSKA 2CC0A 6XIMA 2HK1A 4HPGA 1BLIA 1MNZA 3T9PA 3OQ8A 3LENA 4PTWA 3POHA 3WDQA 1H49A 2NLIA 2BHZA 4LF1A 4QEHA 2DDXA 4LOCA 1WDPA 3CQ0A 3BOLA 4WDTA 1QHZA 4KFNA 1KCZA 5C7HA 2PC8A 4NNAA 2C13A 4AVNA 4DWSC 5B80A 1GVOA 5HNNA 4GNKB 4ORMA 3S83A 3QVQA 4PBFA 1J8VA 5JBEA 1SZEA 4JIQA 1XLJA 4O0ZA 3PNZA 5HK4A 2QUVA 3VE9A 4C6PA 1XI3A 3B8SA 4X3ZA 2F7FA 2JF7A 3QRHA 4DWSD 1Z42A 1I45A 3YPIA 4X0VA 3P82A 1HJWA 3W2JA 3QPYA 5CG7A 2CW6A 1XLAA 3EPNA 1KGWA 3LRLA 5IOBA 1GVEA 3BAWA 4MAVA 4MJ4A 2E1DA 2YCJA 3GWQA 5KETA 1DEDA 3UJEA 1JDFA 2OQLA 2JBMA 5FF2A 1MQQA 1G7VA 2GGIA 3LOTA 4ZR8A 1XIEA 1Q6EA 4ZSUA 3ZT7A 3N6QA 4B4FA 1ZB5A 3W1LA 3WJSA 3MCOA 4P7NA 2EGZA 4RNHA 3C5QA 2D69A 1XFCA 1DJQA 4IMCA 3W7HA 1BF2A 1YTKA 2OX1A 1DHKA 5F1UA 2ZTKA 1W1YA 4PCSA 1GEQA 1P1MA 3AHYA 1VD6A 3FA5A 4MB4A 4JTHA 4P8WA 1S3TC 2VDIA 1OCNA 1DTNA 1XH0A 1V8EA 4GIEA 3HIJA 3SO7A 4JTGA 1KBBA 4LS0A 3RFAA 3W72A 3C2VA 3A21A 2ABAA 3NQVA 5JUVA 3W70A 4L6OA 2O92A 4AY7A 3TTSA 3KW3A 3MMWA 5D09A 3NQFA 4M3PA 3WBXA 1W9UA 3H23A 3THAA 1U22A 4JFSA 4Q8OA 3R25A 3UJ2A 1AZ1A 1OK4A 4H9VA 2FVMA 3KCOA 3M43A 4TU1A 5F1VA 1HQTA 3VX1A 2YPIA 4YIWA 4E2DA 1QNPA 1A53A 4PSPA 3BLPX 5D9PA 2Y89A 1A0CA 1ITUA 1M7PA 4A21A 4ZOEA 3PR2A 3ZM8A 2ACQA 4QJ3B 3PC0A 3SUVA 1ONWA 5F7UA 1ZRQA 1UP2A 3TLLA 3M64A 3O1NA 3CUJA 2XU2A 1V3HA 3QOMA 3GXNA 1LF1A 2Z2AA 3KFTA 4U33A 3OG2A 2O9RA 4QM1A 2H6RA 3SJ3A 3PFRA 1V51A 1U1HA 1DXIA 1DQUA 2PDXA 3MI6A 4IIDA 4LW7A 3GHRA 4Z1CA 2VYOA 2WCAA 4UNKA 2YFNA 3HOJA 3KS5A 2I5IA 3OBEA 1H61A 1S5MA 3NO5A 1NP2A 4QGCA 4FLSA 2C16A 1F74A 1VJSA 4XZLX 3DG7A 5RUBA 3LD5A 4HSOA 3AOFA 4O1FA 2X1RA 3V3WA 5JQ9A 1YXYA 3SR7A 5E6YA 4GGBA 2IKGA 4JTAA 4MIMA 1YXDA 5MKGA 2FJKA 1F2JA 4PTMA 1G69A 1K77A 4AQLA 4WQ6A 1UHVA 1OSEA 1XW8A 1VRDA 3S9IA 5A8MA 4EXAA 4PUNA 4F2BA 1O5QA 3WY1A 1E0VA 1ZP4A 1W32A 3AROA 3MHUA 3B4YA 3O16A 3WIJA 3SADA 4GQRA 5LSMA 2PDQA 3IUHA 4IIFA 3EB2A 3LI1A 4JQ2A 3FK4A 3B0YA 4NJJA 3WD0A 1YPXA 4CQAA 4ZQMA 4DO7A 5I78A 3UG8A 1XPGA 4ZEPA 3N25A 3UY7A 4YXGA 3W1MA 1RCQA 3URBA 3GKFA 4MVAA 1PDZA 3U3HA 4UMBA 4Q8TA 5FCZA 1ISVA 2XDFA 3MCNA 4QFUA 3F5JA 3P80A 5LIXX 3BLIA 5LXEA 4FR6A 5DT5A 4TO8A 4RXFA 2PLMA 1A5CA 5CJNA 4D72A 1DWIM 4WY0F 3B9EA 1BWKA 1TMHA 1S39A 1TPVA 3WLMA 3VKBA 2A79A 3M6DA 3ITOA 1GQLA 4JTQA 1WDDA 4K39A 1PHQA 4MB5A 2WMIB 1K9TA 5A2AA 3G0XA 3LERA 1ME9A 1YBQA 3MI2A 3H2FA 2PZNA 1W17A 3RM9A 3PSVA 4C90A 4B90A 1CT5A 1B4KA 3MW7A 4NVTA 1KC7A 1TCMA 3EMCA 3AS0A 1W8SA 3HG5A 1A5LC 3SY1A 4UTWA 5C9ZA 3MYPA 2PLCA 3E0LA 3H6OA 2E5BA 2WOQA 4QDMA 1OC7A 2QJMA 3BTNA 5DT7A 2QUNA 1EWDA 2O4MA 3PJUA 1UD2A 2BP1A 1HVXA 4KWSA 1W3TA 4PMDA 1JDEA 3ICJA 1PZ1A 4NP7A 3WF1A 1JYVA 3M0MA 4Z2IA 1EP2A 3KE0A 2WZEA 3L23A 4C7DA 1CX9A 1ECQA 4LU0A 6REQA 4IL0A 3D46A 3F2DA 1TWZA 1A50A 4IG2A 1XCXA 3RU8X 3VD7A 3SY8A 1AVAA 4O18A 3MSGA 1ZTVA 4D6FA 4XBJA 4H7CA 2WJFA 3G1SA 3VIFA 3V35A 1H7PA 3ZZ1A 1N8FA 3W01A 3TYAA 3ARRA 1E4NA 1MRQA 2UWFA 4ADSA 4O4WA 3TSMA 1TFVA 3N11A 5E93A 1A5NC 1IEIA 5CSSA 5GNZA 1MI3A 1W3HA 4QSHA 4GI9A 4ERAA 2IPJA 2ZBTA 1I2PA 1CXLA 1IGWA 2OLAA 5AFDA 1OQFA 4RE4A 1TSIA 1AG1O 1WOAA 3P93A 4AFYA 1YEYA 1RR2A 3W22A 3AMKA 3ARWA 3PK7A 4YHEA 1EDGA 2CZVA 2Y5SA 1XKJA 3MJYA 3QZAA 1K7FA 2CZDA 3CJPA 4NAEA 5BCAA 1EH9A 1EQPA 1D8WA 2ZUNA 3RGTA 1TRDA 3ZLFA 2VR5A 1TPDA 4U31A 5CZTA 3VIOA 2BXYA 3G22A 4HB7A 2ZX5A 4A6GA 3VABA 3I6TA 4YMZA 4YVPA 1T8XA 4YCOA 4UQ9A 1EX5A 3W37A 4EIVA 2VD8A 5AC7A 1E55A 4JS3A 4L7ZA 3DFQA 1XLLA 4AWSA 2ZDRA 3DESA 3QGAC 2XGBA 2A0NA 3HFYA 3THQA 3NM3A 1AD1A 1QNVA 2NX1A 3R6IA 5FACA 2C15A 4FIRA 2P8BA 3WQGA 2ZA2A 3GTIA 3FIGA 3WLRA 1NM9A 1R3TA 5T91A 1MMFA 1JZ2A 1JCLA 2OT0A 4H83A 4W85A 1F8IA 1JQVA 1FKWA 1Y5VA 1VENA 4H6EA 3WLKX 1E1CA 1OGSA 2FDMA 2G0WA 2Q8ZA 4WD0A 5HR7A 4L1XA 4OWGA 4X9YA 2RJHA 1W6TA 3BLKA 3KOYA 3QV8A 4MJMA 1LZOA 3GU1A 4PTXA 4ASTA 1A3WA 3UZXA 5I3IA 5CC6A 2WWDA 1UA3A 2J78A 3T8QA 2X8RA 3L5LA 4H9XA 1P6CA 3ZVHA 1XC6A 2HZGA 4DWSA 5C70A 3OYXA 4F0RA 3A9IA 1US2A 4M51A 3GDLA 1A3XA 3OLEA 2PD5A 2P88A 5ABFA 5FF0A 1GWJA 3MZNA 3F4VA 2FLIA 1TX2A 3SRHA 1NFGA 4QHRA 2WHKA 4FF7A 2NT0A 1OHLA 5IBXA 2ZUMA 5IDZA 2UZ9A 3B8TA 4DX3A 3WFLA 3NPXA 3H4WA 3QV6A 2PAJA 4ZQOA 1JPHA 1RALA 1T96