3NPXA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
249
structure length
249
Chain Sequence
DLKASSLRALKLMHLATANGDDTDEKVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRIWTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADHIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPAGGVRTAEEAQKYLAIADELFGADWADARHYAFGASSLLASLLKALGYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords deoxyribose phosphate aldolase
total genus 98
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3npxA00
4GUGA 1JCXA 3B0UX 1HTIA 4AEOA 1ICQA 3TAKA 1FY6A 4N9EA 5EA9A 1DQWA 2B0MA 3N19B 3PUOA 3MP3A 2ABAA 2X1TA 5LNUA 2ZZ5A 2CLMA 3LX9A 4O54A 4O17A 4HNUA 5AB3A 1GTHA 3DKLA 1SZGA 1TYGA 2X30A 3G8EA 1MEIA 1YDOA 3G0XA 2FLIA 2Y85A 1WDWA 1OFBA 3GR8A 2EKCA 5D05A 3LI1A 2C16A 2JGQA 1TPUA 4QITA 3TAOA 1PCKA 2WSRA 1A5AA 3QMSA 2DP3A 3TQ0A 3TH6A 5I3HA 1SO5A 2ZRYA 1WV2A 1K8ZA 2VEMA 1R30A 3W2LA 2G97A 1UCWA 3S1WA 1TV5A 1A53A 1W56A 1W5NA 4CLMA 3ANYA 4PTNA 5HULA 5C54A 2YCEA 3VI2A 3DFNA 1GYLA 3W1MA 2V5LA 1VYSX 2ZCGA 4JD4A 5EPDA 3WJZA 1TCDA 2V82A 4NU7A 4ZQCA 2VFEA 4HT3A 2DJLA 2RDWA 2C14A 3R12A 5KMYA 3LCGA 4PEKA 4MY8A 4GXMA 3STGA 3QQ0A 3KRUA 4JDBA 4MUZA 1VYRA 4JIPA 4RZ5A 4OQVA 5DXYA 3TKFA 4EWND 4UTWA 2FQIA 1K7EA 4FHAA 3BG5A 3H53A 3RLVA 3LTPA 2OT0A 2I1OA 1G4TA 4NJIA 4JTIA 2A7PA 4JTUA 3ZWTA 5F1VA 2WSQA 1QPOA 4WY0F 2G96A 4RR4A 3WJSA 5HNRA 1OYCA 2CLEA 3OVRA 4FX7A 3FOKA 4UNLA 4O16A 1BWLA 4ZQNA 1Z41A 3E02A 3G0SA 1PV8A 4HN4A 2FDSA 3WK0A 3ABQA 3G3DA 3S1VA 4TIMA 4LUJA 2BXVA 3LCWA 3TSDA 1GOXA 3LLDA 3LV6A 3MYOA 3BARA 3P61A 3C6CA 2J24A 1VCVA 3NQ8A 4EVZA 2CLLA 3TJLA 3GXPA 2PRHA 2E6FA 4FO4A 4GFSA 4PL2A 4FB7A 4NQ1A 3CLMA 3Q37A 1DVJA 3W7JA 3HG5A 1ZENA 2ZRUA 5CPLA 5AHLA 4NZFA 2ATMA 3H55A 1AL8A 3IEBA 3W75A 3O1NA 1OX6A 3W1LA 5LHEA 3BG9A 4AWTA 3F03K 4YL2A 3QH2A 1VCGA 4K8HA 4BFAA 4KKXA 1YXCA 5AYZA 2I14A 3MI2A 3SZ8A 4FNTA 4JN6A 3P5ZA 2ZTKA 3LERA 4MPQA 3LLFA 5F2GA 2H3BA 4UTJA 5C6MA 5C2XA 1QMLA 3SECA 5F2LA 1LBFA 1RPXA 1YPIA 4IMEA 3PWAA 1FWTA 3DFQA 3TIMA 3OIXA 3ZR4A 2B7OA 3FA5A 1QAPA 4ZZ9A 3PG9A 3W7EA 3B0PA 4HPJA 4BF9A 1PS9A 1C9DA 3LRKA 1H5YA 3W7OA 5SWUA 4FNRA 3A22A 1LRQA 1DHPA 2V0TA 1QDSA 4GUJA 2PRMA 3NQ6A 3R13A 1Q6RA 3DXIA 2Y61A 1SW0A 4ONVA 2YXGA 3EEGA 4HIBA 2E6AA 1GTEA 1F73A 3QYQA 1YTEA 3GXTA 2ZQ0A 5CPNA 3IIOA 1F74A 3DZ1A 2Y7EA 3OBKA 1PCWA 3W7CA 2JKEA 4JX5A 1H63A 2O7SA 3DAQA 2ZA3A 4Z1AA 1VHCA 2WOQA 3SFKA 2VFDA 3TCEA 1JCYA 1UUOA 1TREA 3JR2A 2R8WA 5F2MA 2CLIA 4GRSA 1P1XA 4S2CA 4E0CA 5KZMA 4OU1A 3W7LA 3P5YA 3B4UA 5G1YA 2O7QA 3QPYA 3DI1A 3LV5A 3QQ1A 1HO4A 3R2GA 3CEPA 4UTMA 4B5NA 5FF0A 4UFHA 3QW4B 2NV2A 5J5RA 3GNNA 1AW2A 1ME7A 1PVNA 2FIQA 5D2XA 1ME9A 4WZHA 3BGGA 4WOQA 1LP6A 2WQPA 4JTSA 3W6YA 1I2NA 3MMTA 3M44A 4UTLA 3N2XA 1JVNA 2TMDA 1ME8A 5TQLA 4NZJA 1YTKA 2QCGA 3W22A 3HBLA 4TX9A 5LSMA 2A2IA 1XUUA 2Y7GA 4Y90A 5IBXA 3W1TA 1QR7A 2ZZ2A 1GQNA 4MJZA 5KSWA 4Z1BA 1KM0A 1V5XA 3QSRA 4IGHA 4ZQMA 3A9IA 4XKYB 1EP2A 3NQ7A 4CNOA 3G1YA 2A85A 1BWKA 3A24A 4MLRA 3LM7A 2P10A 3NM3A 4S1FA 3WJWA 2ZA2A 2GVLA 3A5FA 4K39A 3IV3A 4NNCA 3ABSA 1H1YA 2HS6A 5EMUA 3TMQA 2NUXA 1S5WA 4KWVA 3CM4A 3WJXA 4JTEA 2W79A 5I3KA 3GLCA 4R7JA 4N9DA 1FXQA 3T4CA 1XFBA 3S1UA 2WNZA 2AQWA 4UTHA 3CIXA 2E5CA 2V2DA 3E0IA 1K03A 1ZHAA 1FDZA 3LCIA 1IXQA 1I8JA 2B7QA 3L67A 4Z08A 4EIVA 2V5BA 2BTMA 4GWEA 4L4LA 4JNMA 4O1AA 5LGXA 2QCCA 3QSTA 2VELA 3WK1A 3TFCA 3NQAA 1D3GA 3AJXA 1LROA 4HPXA 4JYDA 1AW5A 1LCOA 5EL1A 2NUWA 3PM6A 5KZDA 5KTLA 3HGSA 1A5SA 3MUXA 2A6NA 4K6AA 5BNKA 5DY2A 3LXAA 1DBTA 5LGZA 4JTLA 4YXGA 1C8VA 5BMWA 3KOFA 5AYYA 4H3DA 4LTSA 4UFLA 4E2BA 1EPXA 1MEHA 4XKYA 1TPWA 5HJLA 3C8FA 2Z1BA 1JCMP 3HPZA 3STCA 3NQCA 4UFJA 3W71A 1QPRA 3MW7A 4NXSA 3TU9A 2Y7FA 1XI3A 7TIMA 5K3VA 2QAPA 1DJNA 3C56A 3DU0A 3VE9A 3KVKA 4OHQA 4POCA 4YWIA 1XKYA 3EXTA 1WBHA 4GUFA 1F05A 3NNTA 3S6DA 2BSLA 2CZFA 3SW6A 1LORA 4DELA 3FLUA 3T55A 1LBMA 2GJNA 1WX0A 3PF3A 1L6SA 1VLWA 4HNTA 5FF7A 3FYOA 4ADSA 3EWZA 1YXDA 3FJLA 1N7KA 4MLJA 1HL2A 2P0OA 4M7TA 3MYPA 5D37A 2C19A 1MXSA 2P1FA 1H1ZA 1WA3A 2G5WA 1R2RA 3THAA 5D32A 2E6DA 3GNDA 3W73A 4Z1CA 3BW2A 1FUYA 5K9DA 1KFEA 4MIMA 2C1HA 5CZJA 4LV4A 4CCCA 2E1DA 4CQ8A 4Z0JA 3NEVA 3UPBA 3E49A 1NSJA 3HG3A 1H7WA 3NL2A 4OE7A 5GVJA 1OFDA 2G95A 4JYEA 4MFDA 4BK9A 2X2GA 5CZ0A 4O14A 2HMCA 2ZZ4A 1EB3A 4O52A 3G3MA 2Z0IA 2OCZA 1KFCA 2VC6A 2QDHA 3SIZA 4D2JA 2YFOA 4QM1A 2QKFA 4O0ZA 4PA8A 4JICA 2NLIA 1U5JA 1W5QA 3MI3A 3PSVA 3NZRA 3E96A 2XN2A 5HR7A 4QQ3A 2QUTA 5CGQA 3PB0A 5G1TA 4OBTA 3R89A 2F7FA 2ZA1A 3HGOA 2BZNA 4R33A 5L6UA 4Y9AA 5HWMA 1HFBA 1SUXA 5G4WA 2GVJA 3GZ3A 4K36A 2QUUA 1KFBA 2GVGA 3B05A 2R14A 2QCDA 3G1VA 4RXGA 1QPQA 4LT9A 1JCNA 3I7SA 4O0KA 3IRDA 4JXCA 4O53A 3ATYA 1THFD 3IIXA 3PY2A 4WY0B 2DZWA 2QJIA 1ZAJA 3KAOA 2CFFA 1K7FA 4AMAA 3PG8A 3OA3A 1IXNA 4E38A 3G18A 1VPXA 2J9YA 5E1QA 3NQVA 3LCXA 3LOTA 4JDYA 2CLOA 2V9DA 3LBCA 3MWAA 4JIQA 3O06A 4O8RA 1CX9A 2QDGA 3NZ1A 4RK8A 1RV8A 3CTLA 3I7QA 4LU0A 1TPB1 2J27A 4JTFA 1EUAA 1KLYA 4IMGA 3W87A 3IVTA 1FWNA 4NJGA 1XC4A 1LTDA 2NWRA 3W70A 3AO0A 3NVTA 1H7OA 2QJHA 1Q6QA 5FF3A 4MZYA 2NX3A 1H50A 2PCQA 1TTPA 1FQ0A 1OFAA 4RX0A 4IMFA 3NG3A 2I9EA 5FESA 2WJZA 1AMKA 1P0KA 3KVMA 4M6QA 2B7NA 1KM3A 2V2HA 4AWUA 3P67A 4UMAA 1L6YA 1F6KA 2VFIA 1KM6A 4N6EA 1A5CA 5C55A 1W0MA 2OMAA 1WXJA 4MYXA 1XCFA 2QCLA 3N9RA 3PBVA 3K30A 3LHZA 3W1AA 3QMTA 1F76A 4AHOA 5DN1A 3M16A 3N3MA 5DBUA 3PBWA 2DZXA 1OYAA 3DENA 1Q45A 4JX6A 3T44A 1TMHA 4LVFA 5HR6A 1LDCA 1MSSA 2CW6A 2QR6A 2Q8ZA 3EWXA 3RU6A 3U8GA 3C3NA 4YCOA 1OFEA 3NYZA 2B7PA 2WNQA 3U6WA 5AHEA 1ZFJA 3QW3A 3P8IA 3BK0A 3M1ZA 1KV8A 1QWGA 2KZHA 2H90A 1GVQA 5HWJA 3W7NA 4Q32A 2XFWA 1K02A 4K37A 3HMJG 1DL3A 5I3JA 3TJXA 1B57A 4NJHA 2H6RA 4I7UA 2ZZ6A 1O5KA 3MHFA 2NWSA 2X16A 1Z48A 1GWJA 2VXNA 3OEXA 4IUOA 3A23A 1AL7A 2RH9A 4YMZA 2NUYA 3CB8A 4UMCA 3KHJA 1XL9A 1YADA 4OGZA 3PS7A 3TSMA 4YCPA 4DF0A 5FEXA 3M7WA 4LVBA 3L0NA 3W7DA 1GPWA 3INPA 4HNVA 3W7GA 1RQBA 4NJJA 3IGXA 3SSJA 4P2VA 4DBEA 5J5DA 5D09A 5LNVA 1JUKA 1JJKA 2EGZA 4UIOA 1I2QA 3TROA 4PL1A 4AF0B 4WXZA 3DKJA 1W3NA 1LLZA 5AYXA 1TRDA 4NUWA 3W84A 3KVJA 1EWEA 1I2PA 1OFPA 4RXFA 3QZEA 2RKXA 1Y0EA 3W9ZA 4JX4A 5AHFA 4HSOA 3HGJA 5I3GA 1ICSA 4XBSA 2ALDA 3SR7A 3A21A 4ZQRA 3C52A 5EKYA 4DF1A 3L5MA 4UFIA 4AF0A 3GDMA 4JEQA 3YPIA 1DV7A 3NQEA 2VFFA 1TPFA 2QCHA 3O6YX 1ADOA 3V75A 4O15A 1KW1A 3NL6A 3CPRA 2A0NA 2CWNA 2ZBTA 1SW3A 5CKSA 4NVTA 4Y6GA 4Y8FA 1GZGA 4UTTA 4TR9A 4N9BA 5FEZA 4BWLC 2YSWA 3BVJA 1TIMA 4ICNA 3DHDA 4FIRA 4TU1A 3S42A 3NQMA 2CLKA 1K3UA 3TE9A 4K7VA 3PBUA 4JYFA 5I3IA 3PUEA 1XM3A 3EWUA 3M5YA 3F4NA 4NNAA 3W83A 3DI0A 4JTHA 3RMJA 5KITA 3UWZA 1NF0A 3HOJA 2A7NA 3MHGA 1WOBA 3LBMA 4U28A 1T8XA 3W88A 1YDVA 3W72A 1W37A 5F4XA 1KM5A 1GJPA 3MI6A 4AB4A 3P81A 3GX9A 1R46A 4WJEA 4XTIA 3TQKA 1F2JA 1OYBA 3EB2A 4UTWC 5CPOA 3S8HA 3KRSA 2UV8G 5H91A 1Z44A 1G7VA 5H2ZA 2X1SA 3OG3A 2OT1A 4ORMA 3NQ2A 5CPMA 2GPTA 1SO4A 1XBZA 3BW4A 4HNNA 3NAVA 1YXYA 5HQEA 4ADTA 2DZPA 1XBXA 5LHFA 4YLWA 2ISVA 1SZFA 4QNWA 1M7PA 3QFEA 3G1SA 4MY1A 4Y96A 1AW1A 5HUPA 1TV7A 3TC6A 5HMSA 1TJPA 1TPVA 2J6XA 1SQ7A 1X8FA 2JKAA 3NQFA 2VKZG 3HG4A 4IXXA 3RFAA 2C0AA 3BLEA 1T96A 4PH6A 3UWVA 1W5MA 1G4PA 4MKNA 1P4CA 3G22A 2RDTA 5LZLA 2PC4A 5F4SA 2FB3A 2GJLA 3MBDA 4RLIA 3I65A 3C4UA 1EP1A 5K9CA 3GDKA 3VE7A 3TQVA 1KFJA 1EEPA 1OK4A 1SU5A 1FDJA 1Q6LA 2GQ9A 2JGYA 2IQTA 3PSWA 4LOCA 2YW3A 5D38A 4XBKA 1RQEA 1X1ZA 2V30A 2WPBA 4QIUA 5F1UA 5G2WA 3DFPA 3OVPA 3Q58A 5DXXA 3W2KA 4JY8A 5CZTA 2GOUA 2NX1A 5IM51 3IIVA 1O4UA 3G1FA 4GUIA 5U4NA 1TV8A 2TYSA 4LVGA 1YDNA 2E5BA 1B4KA 2CZDA 3L9CA 2W0UA 2XN0A 5K7JA 1JRBA 2NX9A 3O07A 1B3OA 1X6UA 2ZFAA 4FXRA 3PC0A 1F5ZA 2VEIA 1TJRA 1CW2A 4K8EA 5DBTA 3S9YA 3W1XA 4N4QA 1PE1A 2EPHA 4WX2A 3G1XA 3NQDA 3C2VA 2EF9A 3L5AA 1TO3A 3TXZA 2Y7DA 1QOQA 2GUUA 1KV5A 3G8RA 1KLZA 2V81A 1GEQA 1VJIA 3P7YA 5HUOA 2WV8A 4O10A 5LNWA 5CSSA 1TTQA 4ALDA 3HPSA 1G67A 4MOZA 4PCFA 1E51A 4QNEA 4CQ9A 1GVFA 2E6YA 4R53A 1JUEA 3TA6A 1T99A 3E12A 2ZZ1A 3LXCA 1F7BA 3TC7A 4UFKA 2Y88A 3STFA 5BOOA 3EKZA 1SR9A 4JS3A 3PUDA 3GAKA 3WK3A 4JTTA 4MZ1A 3HB9A 4LC8A 1RD5A 1KTCA 3N9SA 3QRHA 3MHUA 4LNYA 2QCEA 4DEFA 3PULA 4GBUA 4BI5A 4UUIA 3TW7A 1DKWA 3UD6A 3B06A 3WJYA 1YTDA 1O60A 1HO1A 4ZL1A 1OHLA 1DORA 3C2OA 6ALDA 3PR2A 1KM1A 3W23A 2ISWA 3CWNA 3GDLA 1A5BA 4MYAA 4IWWA 3PB2A 3I6RA 3EXRA 1QO2A 4ZMGA 4GJ1A 5EY5A 2PE4A 5KZEA 4UTUA 2E5DA 4KFNA 2CU0A 4N02A 4DF2A 2ZTJA 3W7IA 5FI8A 4GE8A 1AG1O 1OFRA 1M5WA 4JGDA 3SY5A 3FIGA 4CCDA 5LNRA 4Z0SA 4QSHA 1IIHA 4AH7A 5G5IA 5IBXC 3W76A 1Q6OA 4FX8A 3CWOX 5A8GA 3GIYA 1OK6A 1VGAA 3EX2A 3KX6A 4AAJA 3IVUA 3L2IA 1JQVA 5D02A 1T0OA 3NGJA 1G4SA 2FPTA 4LS2A 1H7RA 1W8SA 3MP4A 3R5EA 1EP3A 1QNVA 3TK7A 3CHVA 2YYTA 1ONRA 3BLFA 1LBLA 3M5VA 4MZ8A 1KM4A 2FB2A 3NPWA 1R2TA 3DFTA 3DH7A 3L0GA 3P82A 1KBIA 5DCBA 3CT7A 4OV9A 4KWWA 3STEA 4IMCA 2F84A 3QF0A 5AOUA 4KFPA 4QAIA 3HQ1A 1GVRA 4FF7A 4S2BA 1LOSA 2YW4A 1H62A 4PC8A 5EYWA 1VQTA 2ZYFA 4WXYA 1QCWA 1LOLA 1MEWA 1ZAHA 3THQA 1ML1A 3D0CA 4IX2A 4O4WA 3ZFHA 4A2SA 1UJPA 1L6WA 1QO5A 1GYNA 1NEYA 1WQ5A 4X2RA 4O13A 3F4WA 3NPXA 4AXKA 3W1UA 3LDVA 3NOEA 3GK0A 1ZCOA 3B0VC 1IXOA 4FNUA 2Y63A 5D30A 3W1NA 2A21A 1ZALA 4NX0A 5K2ZA 4AHPA 3TMLA 2YPIA 3EWYA 3BW3A 2Q3RA 3R8RA 1HG3A 5DCEA 1JUBA 5AHNA 4C1KA 1K7XA 1CI1A 3DFOA 4OWGA 2QEZA 3L66A 5FF2A 1OX5A 4KFOA 2Q8LA 1OX4B 3S1XA 4X3ZA 1MZHA 3NPVA 5D2VA 4RV8A 3BO9A 3EX1A 4WY0A 1F6PA 1VHNA 3C61A 1LOQA 1OF6A 1SW7A 3DBPA 4MVAA 1GG0A 1OX4A 1SFJA 3NM1A 3UZJA 4A29A 4CCEA 4LUIA 4JTJA 4TO8A 1ZJIA 3ELFA 4WOZA 5BW6A 1KTBA 3UY7A 2C18A 2TPSA 1DQXA 4MJMA 2ZDRA 4P61A 1VLIA 3G1DA 5G2IA 3LXBA 3A5VA 5D2WA 1FWRA 3TSBA 3UQNA 1D9EA 1KFLA 3NL3A 5AC8A 3FS2A 2CZ5A 2DORA 1QFEA 5E93A 1X1OA 1FXPA 4GNJA 3EKLA 5D2YA 1IXPA 1XDMA 2YZRA 4RCXA 4UC5A 2ZRVA 1G4EA 4LVAA 4O11A 4RKAA 1Q3NA 3GVGA 3OVQA 5D04C 3ZS4A 5KINA 1W1ZA 4K7YA 1EIXA 1JULA 4UTTC 3S5OA 1SO6A 4RZ4A 4H4IA 4N9CA 3W07A 1OJXA 3M9YA 1XUZA 2ZRZA 5HWNA 3GR7A 8TIMA 3JRKA 3LRLA 1P5BA 2FJKA 3BPWA 1LM1A 4L4MA 4NT0A 3CIWA 2YDAA 2X1UA 2H3DA 1W5PA 4DQWA 1ZY9A 4MY9A 5D33A 3LCLA 5F4WA 1G7UA 2A1YA 3WFAA 1TQXA 2QAFA 1H51A 2ZZ3A 1UB3A 1W31A 3EWBX 5G4EA 3O6CA 2BWGA 3M5ZA 3P62A 4WUIA 3MO7A 4IMDA 3IIZA 3FYPA 4UFMA 3W74A 3O8AA 1TSIA 3UWWA 2D73A 3U2OA 1H7NA 3B03A 4FNQA 4BI6A 3G24A 3LRMA 3LHUA 3BLIA 3C0JA 3Q94A 3GKFA 4JTKA 3O16A 2H8ZA 1KA9F 2QCDB 1FWSA 1RQHA 3G0UA 2Q3OA 2A6LA 1TPH1 1IF2A 4M5PA 4NJKA 3ABRA 4JY9A 1N55A 1GVOA 4CNPA 4W9TA 1K8XA 3KXQA 1QOPA 3C2RA 1H7XA 3W86A 1NF7A 2YX0A 4EOUA 2J88A 1EX5A 1W5OA 5AHMA 1JCLA 5MHBA 3SJ3A 4FXSA 3BGJA 1XBVA 3FEMA 4N4PA 3W7KA 4IPIA 1GG1A 3LTSA 2A7RA 1FCUA 3O63A 1FCQA 4FNPA 2W6RA 2DU2A 3TFXA 3V1PA 2C6QA 4FEZA 2HSAA 1FCVA 1YPFA 4C1LA 4A3UA 2CZEA 1PHWA 1ZNNA 4M6PA 4O50A 3LHYA 1VCFA 4IX0A 1J2WA 5DCDA 3ATZA 4O1BA 1JQXA 1WAUA 1ZAIA 3LTYA 1LLWA 4RJEA 5A5WA 3W1PA 1B9BA 3W2JA 3TR2A 2PRLA 2QJGA 3NXFA 3UZ5A 4BI7A 3H54A 3TNOA 2A5HA 4M7SA 2VFGA 1XBYA 3I68A 1C29A 3TUUA 2Y62A 1I2OA 3M41A 1TRIA 5AC7A 2E09A 3QEZA 2RHGA 3HJZA 2E68A 4O1CA 1KFKA 1SZEA 2FPYA 4K38A 4EF9A 4ML9A 3VKJA 1I4NA 4ORIA 1G69A 1M6JA 1VRDA 3L65A 3RLUA 1XDLA 4LWWA 4DPQA 4TMCA 2J9XA 3PBYA 1GVSA 3UWQA 3CEUA 5FEPA 3SI9A 4IXHA 3P60A 3QMRA 1WYIA 1A50A 3CQ0A 4X22A 2YFNA 3P74A 4O1DA 3LHTA 3N34A 1XXXA 3T78A 1SO3A 3RK8A 4IQLA 3GDTA 4FIQA 1ICPA 1WBJA 4NX5A 4O4VA 1SZNA 3O05A 1LYXA 2WKJA 4LRSA 5C5YA 2R94A 4XWUA 1DJQA 3KRZA 1KTNA 2C13A 1B4EA 2WSYA 3W2UA 1NAL1 1S5TA 1M7OA 4DO5A 3M5XA 1SFLA 4R34A 1TB3A 4JTGA 4O57A 3CC1A 4NXKA 3O6DA 1N8FA 4LY8A 4Q33A 5L9FA 4GUHA 1LZOA 4N6FA 3NO5A 1RZMA 3LCHA 5K9XA 2JKPA 2CLFA 2JBMA 1OG0A 2JK2A 4I7WA 3JS3A 2ZZ7A 4LS0A 4BWLA 2EHHA 1KM2A 3W7HA 2VEPA 5DELA 3M47A 4Q4KA 4HHPA 3N73A 4AVFA 2WO5A 4WQ6A 2LLEA 1PIIA 3L68A 1OVDA 3W7QA 1L9WA 3QM3A 4O28A 3HGRA 3LHWA 5TIMA 4UTIA 3W7RA 2YGYA 1S3HA 3GYEA 1EUNA 1IGSA 2PURA 2DZUA 5DLCA 3UY8A 3DGRA 3EXSA 3FKRA 2DZTA 3LB0A 1O5XA 3L21A 3S5YA 3UWUA 3C2FA 1SSGA 3MJYA 2QCFA 2QCNA 1NVMA 1J4EA 2VFHA 3DHFA 1H60A 4GC4A 4UTKA 5BMXA 3FFSA 1ALDA 5K4XA 4OV4A 3ABOA 2C15A 4I7VA 3L5LA 2AGKA 5TBOA 2Y89A 3GXNA 3GKAA 3IGUA 3O15A 5DY3A 4AWSA 1L2UA 3VCRA 4CQAA 5LKYA 2CLHA 5D2TA 4LS1A 4DBDA 2ZRXA 3W2MA 3BV4A 3IIPA 1VH7A 1VZWA 4PODA 4UR7A 3NDOA 1K8YA 2ATSA 4Z1DA 3TXVA 3USBA 3TW6A 2VOMA 1YLVA 4M19A 3RF9A 1GT8A 3PVFA 4UXDA 2FFCA 3UXDA 1RVGA 1LRTA 2HS8A 4O19A 3EWWA 1UUMA 3S0CA 3B8DA 5K4ZA 3PAJA 4DXVA 4RZ6A 3IVSA 4G1KA 3LGEA 3CU2A 3ZWSA 2E77A 1IIGA 3W7PA 2TRSA 4UMBA 3LCFA 2Z6IA 3M0ZA 4QISA 4XQ6A 2QF7A 5LNSA 1V7YA 4NNBA 4CNNA 3LI0A 3G1AA 3TV8A 4O18A 4XUGA 3L0KA 5HINA 2Z6JA 1BTMA 5G2HA 3F1QA 3NL5A 3UWYA 4A22A 3BG3A 3DFSA 4LW7A 1FBAA 3RNDA 2BX7A 4HKPA 4LV9A 3OHIA 3QC3A 3HF3A 2QCMA 4ZVJA 5AFDA 3EX3A 1EWDA 2YYUA 5EBUA 1I45A 1W3IA 3NA8A 4U4MA 2TSYA 4E2DA 1OF8A 1BKSA 1SSDA 2NZLA 5I3FA 1R2SA 3W1RA 1HUVA 5CSRA 4HSNA 1JR1A 1UBSA 3KVLA 3IGSA 1SPQA 5E0KA 3M6YA 3KFTA 2DZVA 2V8ZA 1NFBA 4WD0A 2C3ZA 2V2CA 2A4AA 1O94A 2EAWA 1G6CA 3VFLA 1RR2A 3MP5A 3S5ZA 3T40A 2ISSA 2B4GA 2DZSA 1UASA 5FF4A 2WNNA 4DO6A 4AHQA 3UNDA 4O12A 4A2RA 1PHQA 3WK2A 2J9ZA 4IPJA 3EX6A 1QPNA 4TMBA 2VEKA 2OX1A 4PFMA 4A21A 1FCBA 1MO0A 1TPEA 3P84A 1TPDA 3QJAA 4FX6M 6TIMA 1U83A 1Z42A 1VS1A 3NR0A 2BLEA 2NV1A 3MBFA 3HPXA 2RFGA 1YYAA 1FDYA 3W7MA 4ZQPA 4DO4A 4ZQOA 2YR1A 4I9AA 2RDUA 2X1RA 4EF8A 3W3OA 3HG2A 1OFOA 1TTIA 1P0NA 1KBJA 1O95A 2GQAA 5AN7A 5AHIA 2FPVA 2NXHA 3NQGA 1VR6A 3M43A 3W2NA 1H7PA 3UYCA 3Q2DA 4N2YA 3LHVA 3QPZA 3UPWA 3TX9A 3SGZA 2R91A 1S5VA 3E9AA 4OT7A 2OZ0A 1EA0A 4FNSA 4ADUA 1BEUA 1TPC1 3P8JA 3TDFA 2NXIA 1PL9A 4QJ1A 3GAYA 1TTJA 4X9SA 5U7SA 4DPPA 2QUVA 4XZ9A 1WOAA 1OFQA 2ABBA 4H6KA 2H8XA 2ZRWA 5T26A 1X7FA 1R47A 2FTPA 2NXGA 3C2EA 4LVDA 2VENA 5CZSA 3T7VA 1W3TA 3GB6A 2OJPA 2GQ8A 2AAMA 3FKKA 3GDRA 5AC6A 3VNDA 4JR5A 3S5NA 3FJ6A 5D03A 4XTDA 3W1QA 1FX6A 1VYPX 2Y70A 1TQJA 3NPUA 3N2MA 3HO8A 3HIJA 1J5TA 3B04A 4UR8A 3W85A 5BRBA 4M6VA 1VC4A 1FWWA 3EX4A 5F2IA 2DJXA 1D3HA 3P80A 1LRNA 4J9JA 1I2RA 2Z2UA 4MFEA 3SGUA 1OABA 5CG7A 3G1HA 2XN1A 3N14A 5ABTA 4BR1A 2HTMA 4UNKA 3UXAA 4IJBA 1H61A 4UCGA 4LC6A 4LRTA 3I7RA 1DOSA 5FEWA 1W54A 1AK5A 1JCJA 4IOTA 2Y6ZA 1JRCA
chains in the Genus database with same CATH superfamily
4H8VA 1MQPA 1SZRA 1HZYA 2CEQA 1IZKA 1FY6A 4BQ5A 4KEMA 3HFTA 5E70A 5EA9A 2OSXA 3GH5A 4C6EA 4BQ2A 2X1TA 2ZZ5A 4DJDC 1WUEA 3C3UA 4O54A 1E72M 1HN1A 4HNUA 3IJ7A 2J8FA 1H49A 2XVLA 3W81A 1S5NA 2DW6A 2Y85A 4GKTA 4LGXA 3GR8A 3ZZ1A 4IIDA 4EXAA 1A5AA 2DP3A 3UEQA 1HJWA 1KXTA 3B3DA 4G6CA 4L4OA 1YNQA 1EL3A 1R30A 2G97A 3GTNA 3DC0A 1E71M 2XDFA 1W56A 1VBRA 1GYLA 3WJZA 2V82A 2GJRA 4HT3A 2DJLA 2RDWA 3S1GA 4F9DA 6ENLA 2WB5A 5C9UA 1VFMA 4UR9A 4MY8A 1L8PA 3KEHA 4GXMA 1ZP3A 4JDBA 4IIEA 1VYRA 2XSAA 1RA5A 1T6MA 2VCBA 3TKFA 6PTDA 3WMSA 1K7EA 4L61A 4XD4A 2IW0A 3RLVA 2OT0A 5HJYA 3PPGA 3M7SA 3WMCA 1TJ0A 2A7PA 4JTUA 1QPOA 2G37A 2VJXA 2G96A 1KQZA 4RR4A 3TYAA 3WJSA 3AXHA 3OVRA 4FX7A 3D6NA 1BWLA 1PIFA 4H8UA 1VFTA 3WFZA 5CSYA 1QI3A 4F3HA 4C6BA 3ZT7A 1Z41A 4HN4A 1PKNA 4JTAA 2BXVA 1LQ0A 3TSDA 1GOXA 4RDYA 3W37A 3LLDA 3CV7A 1LUCB 1AJ2A 3BARA 1UPMB 4EVZA 3TJLA 2XSBA 1WZKA 1AJZA 2PP0A 4PL2A 1AH4A 4RE2A 1DVJA 1PX3A 4MHBA 4Y8EA 2OTDA 1AL8A 3W75A 1OCJA 3CZJA 2ZX8A 1XWYA 3FSUA 5LHEA 4YL2A 1VFOA 1DXIA 1US3A 3B97A 3PZNA 1XIDA 4BFAA 1GZ1A 2I14A 3EDDA 3MI2A 3WDRA 1US0A 4LAZA 3RPTA 2H3BA 3E3HA 4KETA 1QMLA 5CEWA 4G2DA 4IP4A 3WQ5A 3GR4A 3PWAA 1FWTA 4NZ3A 4WKHA 3OIXA 3ZR4A 3FEQA 2B7OA 3CMJA 4GBDA 1QAPA 3N29A 2CPUA 3B0PA 4NILA 4DWSD 1W1YA 1PS9A 5T9CE 5AKQA 1R87A 3AHVA 1V3MA 1QDSA 2X2YA 3NQ6A 4ZXLA 1JXKA 1S2AA 3DXIA 1BVZA 3THCA 4EPKA 1F73A 2DW7A 4ROQA 4YHEA 2ZQ0A 5GJPA 2FTYA 3EWCA 4MB5A 3S6TA 1EF2A 3OBKA 3NQBA 4ZEPA 1EH9A 3MCOA 4Q8WA 2QS8A 1KKOA 3DAQA 2ZA3A 3VIMA 2WOQA 4KBXA 1RSCA 1PBGA 5E0CA 2XHYA 1UD3A 2Y24A 2CLIA 5T8GA 1KXHA 3W7LA 3P5YA 3BSHA 3SY1A 4PN2A 1Q6FA 3MVIA 5AZ0A 1MNZA 3DBNA 5DRCA 3PWGA 3QPYA 3LV5A 3QQ1A 1GOWA 2A3CA 3R2GA 3THDA 2CBIA 1WDRA 3QW4B 2I17A 2NV2A 3B40A 4QAWA 3GNNA 2WHLA 5D2XA 4S3DA 1ME9A 3GH4A 3M64A 3EPNA 3RCNA 1LP6A 2CXGA 2WQPA 2FGZA 4B3ZA 3MMTA 1PWLA 2X05A 2D2JA 3LLXA 1Y5XA 2TMDA 1ME8A 3UA4A 4D8AA 3S5SA 4GYJA 1DWHM 3MSYA 3W22A 2R1LA 3BAYA 2WM1A 1XUUA 2Z00A 1JZ6A 3SCVA 2OU4A 2Y7GA 3BJSA 3H22A 3SCRA 3SADA 1V5XA 2HQAA 3QSRA 1GCYA 3A9IA 3NQ7A 2GJXB 2A85A 4YVVA 4JTQA 3LM7A 3NM3A 4NNCA 3IV3A 1H1YA 2HS6A 1JZ7A 1WZMA 5KETA 3QKZA 4RNHA 4OBSA 4GY7A 1AQHA 4YNGA 3CM4A 2W79A 1UMLA 5FA5A 4GJJA 4DWSA 3S1UA 1OD8A 1EOMA 1HJVA 1REQB 1JCTA 1ZHAA 3DFYA 2YZ5A 3UJRA 1RY0A 3T05A 2QMJA 3ZJ7A 2BTMA 4I5UA 4AY7A 1IHIA 4GIEA 3FXYA 1ZJBA 4WEVX 5LGXA 1BTCA 1ZZMA 4Q7NA 1LROA 4HPXA 1X6LA 4JYDA 1LCOA 2NUWA 1CXEA 1J8VA 3LBOA 4Q8MA 2A6NA 5CPSA 2HBXA 5BNKA 5DY2A 3BSGA 3GZAA 5LGZA 4GX9A 4RNFA 1XYZA 3KOFA 5BMWA 3NFUA 5AYYA 3OJGA 4CD6A 4LTSA 4UFLA 1XGZA 4H01A 4XKYA 4Q8NA 4WKAA 2VOTA 4MMWA 2G3NA 2C8NA 1WDDA 3Q67A 3RILA 4Q6XA 2Y7FA 3KTXA 4HCDA 7TIMA 2Y1HA 3C56A 3DU0A 4OHQA 4F66A 3R0KA 4EPDC 2PZNA 3EXTA 1NWTA 1WBHA 4EX4A 5A6TC 3SW6A 4DELA 3FLUA 3T55A 3VM7A 1JF5A 3VZXA 3CL6A 4M1RA 1R38A 3PJTA 5FF7A 4MM1A 3RU8X 3FJLA 1HL2A 2P0OA 3MWCA 2HBVA 4C6MA 4GI6A 2UY3A 4PUUA 1F8MA 1WA3A 3RRAA 1XLIA 3RUBL 3UNTA 4ACYA 2BS9A 5LIKX 3IJ8A 4MIMA 4PTMA 2WBGA 1H4PA 4IQJA 1MDRA 5CZJA 1B54A 2Z1KA 4CCCA 3CV6A 2HJPA 1PTDA 4HZ6A 4TTGA 3UCCA 1QI2A 1GEHA 3GW0A 1TFVA 1TE1A 1H1NA 3NSXA 4QLLA 4JYEA 2PDIA 1UR3M 5C7VA 1UC5A 3PNUA 2HMCA 4KERA 3BCFA 2AOSA 3ITYA 3LPPA 1XCWA 4RNIA 2PDPA 2OCZA 2UZ9A 4CEUC 1J2BA 4EACA 4CUCA 1JXJA 4QM1A 1DWIM 3K4AA 5IDZA 2OLHA 4YPJA 1UZ4A 3N3TA 1NDZA 3EKGA 4PUKA 4NY2A 2QUTA 1EJVC 3L2LA 5CGQA 1G1YA 1BRLB 5G1TA 5TAOA 3SY8A 4OBTA 3MPGA 4R33A 4V28A 3KP0A 5HWMA 3RCMA 3AS2A 4ZFCA 7CGTA 1MMFA 3BOFA 1R6WA 3D3AA 4C6LA 3AHYA 1K1DA 5LA0A 3WQCA 1JCNA 4I6KA 1I9CB 5A2AA 2QDDA 3GY1A 3KAOA 4LUTB 4AD3A 4WVXA 1W9DM 2ZADA 4CQDA 2V67A 2EPLX 3T81A 2ZX9A 3EOSA 1NM9A 3BLPX 3FY1A 2CETA 2OO0A 4KH2A 5DT7A 4JDYA 1AD1A 3LUTA 4N0RA 4O8RA 1V93A 2Q6ZA 9CGTA 2Q8XA 4LU0A 4JTFA 2E4TA 4XV0A 3SQMA 1LTDA 3W70A 3AO0A 1H7OA 2QJHA 2OZ3A 1KGUA 1Q6QA 4AZHA 3BL3A 3QGKC 4Q3MA 2YXOA 4JEJA 1TTPA 2O9RA 4DJDA 1O7AA 1OFAA 4TUFA 4IMFA 2EQDA 3ZOAA 2XVKA 2WJZA 3ZXWA 1AMKA 1GOKA 4LALA 1J18A 2V2HA 1X8CA 4IL2A 3VK5A 3P67A 2PPGA 3QTPA 1UG6A 1HQTA 3WFLA 4Z2HA 4BQ4A 1FHLA 2ESCA 3TP4A 4MYXA 3K30A 3W1AA 3WLJA 4MPKA 3DENA 1TMHA 1BHGA 3G6MA 4LVFA 4RDVA 1LDCA 4QLKA 2Q8ZA 3RU6A 3UJEA 2JEPA 2QPSA 3OZPA 3QPEA 2WNQA 2E9MA 5AHEA 1CB2A 2FZ8A 2QT3A 1QWGA 4C1NB 2AL2A 1PAMA 2Z7KA 3S2LA 1RD6A 1B57A 4LH8A 1ZJAA 4I7UA 2ZZ6A 5JBFA 1O5KA 3MHFA 1E4LA 4LFYA 1GWJA 3OEXA 4IUOA 3A23A 3VOJA 5D8WA 2VWTA 1AL7A 1LL6A 2VR2A 2PCEA 2Z26A 2NUYA 3CB8A 3KHJA 1XL9A 4KRZA 3TSMA 2QV4A 3PS7A 4YCPA 5FEXA 3M7WA 1S38A 2WMHA 4J3UA 1EXPA 5GNYA 3W7DA 3INPA 4HNVA 2BY1A 3WH6A 4J4KA 4GY1A 2I5QA 5D09A 1FP8A 3OGVA 4GIYA 4BEUA 4UIOA 1JYWA 4LAMA 1B3YA 4PL1A 3ZSTA 1ZS2A 1LLZA 3TTYA 2IKIA 3C0SA 3T9PA 4WR3A 2EEXA 4RXFA 2BHYA 4PB4A 1Y0EA 4KESA 4HSOA 1NWRA 2JALA 3HGJA 5I3GA 4HA4A 4H2CA 1G5AA 2I56A 2BB0A 1XIBA 4AF0A 5A6SA 5A6BA 3KTCA 1J6PA 3WBWA 3NQEA 2G3FA 2QCHA 4JQAA 2C91A 2QIWA 1KW1A 1QK0A 2PDCA 2ZBTA 4PULA 4XSLA 4NVTA 4Y8FA 3VIJA 2QVHA 4HVXA 3S2JA 4FS9A 2AKMA 4BWLC 1DIEA 1B1YA 1TIMA 2CKRA 1XG4A 5E9XA 4AX6A 3MSRA 3WBAA 1QXLA 3PBUA 5I3IA 5MF5A 1XM3A 4F0RA 1TR9A 3M5YA 1F8IA 3TNBA 4JTHA 5HOSA 3UWZA 4C6FA 2QPUA 2A7NA 1NU5A 2O9PA 3LBMA 1E1EA 1A5MC 3W72A 1W37A 3EB3A 5F4XA 4W87A 1MW1A 4NYUA 1XD1A 3WUEA 3GX9A 1F2JA 4OJYA 4UTWC 3FK4A 4NF7A 3QY6A 1EQCA 1YNPA 3GNXA 1SO4A 4ZSUA 1YXYA 4F79A 3WNPA 1SZFA 4QNWA 4Z2GA 1M7PA 3MMWA 3QFEA 3G1SA 4MY1A 2BDQA 1TZZA 3SM0A 3A3WA 1SQ7A 1X8FA 2VC5A 1UD5A 3HG4A 4RDWA 3RFAA 1T96A 4PUNA 1Q6CA 5FJPA 2RDTA 5LZLA 4J3SA 3CL8A 3A4WA 3MBDA 4D8LA 1WKYA 3C4UA 3I65A 3GDKA 3RO6A 3GIPA 3FAXA 1T8QA 2ZXQA 2JGYA 3QHMA 4LOCA 2CKSA 1X1ZA 4CD8A 1UR0A 2QJJA 3KBJA 3Q58A 3KOXA 5IM51 4Y7EA 4JBRA 4GUIA 5PTDA 1TV8A 4I8DA 2TYSA 1YDNA 1B4KA 2V68A 2Z27A 3ITVA 2I7GA 3WL0A 2PWGA 1H0IA 3HQNA 1JRBA 4JQ1A 3WQWA 1E56A 3V7PA 4TV6A 2VEIA 4EXBA 4K8EA 5DBTA 2HV5A 4QS5A 1CWYA 3HJEA 3G1XA 4DUOA 5EMLA 3GM8A 1HKIA 1OCQA 2X7VA 2GUUA 2CBUA 1KV5A 1VJIA 3P7YA 1AD4A 5IHSA 1M53A 4Q8VA 5HUOA 4O10A 2QGHA 4A8RA 3QY7A 3AAMA 1XP3A 5DRIA 4QNEA 2F2HA 2E6YA 4R53A 3T0CA 4GGHA 3KCLA 2ZZ1A 1ITUA 3LXCA 3MDWA 4DXXA 1MI3A 2XISA 1JFXA 2OZ8A 2QUNA 3EKZA 2ACSA 4ZENA 2VRQA 4NASA 1JI1A 2CBVA 2DUZA 2EPKX 3QRHA 1R7AA 5I3DA 3FSTA 1GOMA 1LWIA 1EX1A 5MKGB 3T8LA 3NOYA 1YTDA 3TVAA 3H7VA 4ZL1A 3CHEA 2OX4A 3C2OA 4DM2A 1V6VA 5DFAA 4E8DA 4ZMGA 1X97A 3H70A 2NQ5A 2PE4A 5KZEA 2E5DA 4KFNA 1QUMA 3SRDA 5FI8A 2C1GA 3SB0A 1AH0A 3E0FA 3VNLA 3RX2A 4M81A 2PBOA 5DMNA 3RPMA 2D3LA 4Z0SA 4QSHA 4BA0A 4S3KA 5IBXC 4Q4OA 4PSPA 8XIAA 3CWOX 1XH2A 1ECQA 2BNJA 5A8GA 1FVPA 1R3YA 2TODA 1W1A1 1UR1A 5D02A 3B8WA 5IXEA 1TWWA 1CXHA 1XLFA 1XQKA 4B16A 3CHVA 3VINA 4WDUA 2DIJA 1ONRA 3KBWA 2PTWA 1KM4A 2GDUA 5C9XA 8XIMA 3P82A 3AU2A 1CGTA 2PDHA 3QF0A 4QAIA 3HQ1A 4GPNA 4Q7IA 4E8GA 1LOSA 3CPUA 3WUBA 2DT2A 3AWOA 3CMFA 4IPPA 3ZFHA 2XFYA 3SFWA 3T08A 1L6WA 1QO5A 1NEYA 4V2XA 2NVAA 4X2RA 4O13A 1LJYA 3F4WA 3S3GA 3GK0A 3VCCA 4WDWA 1U1JA 1IXOA 3OGSA 2XIJA 3GO2A 2J75A 1S5MA 2A21A 1ZALA 4NX0A 5K2ZA 2QHAA 3ZLHA 3TMLA 2YPIA 3BWWA 3OPSA 2YJQA 5DCEA 2POZA 1JDAA 4C1KA 4MKSA 4XO6A 1NJJA 1CI1A 3DFOA 2QEZA 3ABZA 4HK5A 3SCWA 4NL1A 2WCAA 1BQGA 1Q13A 1P1MA 3EX1A 1BVNP 4WY0A 3BOLA 1XLAA 1VBHA 1KFWA 3DBPA 1GG0A 1IWAA 1ITQA 4GG9A 3SQLA 1K6WA 4A29A 3TYCA 4CCEA 2EPNA 4JTJA 3GHRA 4J1OA 5BW6A 3D3FA 1DQXA 3QR3A 5G2IA 2NQJA 2EBNA 5D2WA 3NL3A 3UXKA 2OLSA 2CZ5A 1XQLA 2EG6A 3EKLA 5FKYA 3GXFA 3SEPA 4UQCA 3RLHA 4AIEA 4JCLA 4FAMA 5EGRA 4HJFA 3S2CA 1BFNA 3NO1A 3DESA 3WD2A 3OA5A 1ZBWA 3GXIA 1W1ZA 4I6VA 1XYMA 1EIXA 2ZWYA 4PMXA 3IJLA 1E6QM 3TN6A 5IDIA 1P5BA 4NT0A 2ADAA 1UC4A 5CGTA 1XYBA 3VGBA 5ABHA 1QNOA 3BH4A 3OBEA 4AIBA 5IOBA 1DQUA 4X61A 1G7UA 4E2VA 3TLLA 3GG8A 1TVPA 1H51A 1U1HA 1W32A 1W31A 1MWOA 2BWGA 3ICJA 3OO2A 3MO7A 4M1BA 4JAWA 3IIZA 3ISIX 3U5YA 3W74A 3O8AA 2D73A 4ZOAA 3URBA 3U2OA 4H04A 3ZMRA 4BI6A 1UA7A 4GQGA 3Q94A 1BXCA 5ABGA 4HMNA 4JL2A 1FWSA 1RQHA 2Q3OA 2A6LA 3AIWA 4NJKA 3ABRA 4PMJA 3VMNA 4W9TA 3GUWA 1K8CA 4F9JA 4NAFB 3VZYA 3NJ3A 1NF7A 3RM8A 3KW3A 4YYCA 1VIWA 4XZIA 3P3BA 1XH1A 4TOQA 5MHBA 1EJWC 1R3RA 4FXSA 3TYUA 3QR1A 1PEZA 4IPIA 1IWBA 3F5KA 1BLIA 1JDCA 1MNSA 3NZGA 3VD7A 1PDZA 1VENA 3RRXA 4C1LA 2D23A 5F7UA 2CZEA 1PHWA 3UP8A 1TMQA 3UVAA 2ONEA 3SAZA 5DCDA 2P5NA 4S23A 4O1BA 1WAUA 4H7VA 3LTYA 4JKKA 5A5WA 3W1PA 3W2JA 3TR2A 3W38A 2VZUA 4ACZA 2OB3A 3H54A 3OYZA 2BVDA 3DHUA 2IS7A 2Y62A 3M41A 1TRIA 4PE8A 1AVAA 2E09A 3QEZA 2E68A 1KFKA 4XAPA 3IK2A 4ORIA 3P0WA 1ENUA 4Q8TA 4B15A 3V5CA 4D6EA 4NAEA 4HMDA 3RLUA 1XDLA 4DPQA 1SJDA 2PBGA 5FJUA 3MMUA 4URIA 3UWQA 1NDYA 3KOYA 4I9TA 3P93A 3CQ0A 4X22A 3IPWA 1TVNA 2D1ZA 3LHTA 3VC6A 4CNSA 1SO3A 2XZ7A 4GI9A 3QV6A 3URNA 4IQLA 1WBJA 4O4VA 1SZNA 4P5UA 3A6OA 5C70A 4IFOA 1SVDA 4Y9PA 1DJQA 3KRZA 1ESWA 2C13A 1DJXA 3SN0A 3RR1A 1S5TA 1UMYA 4A3QA 4JTGA 3QHNA 1Q8AA 4O57A 3CC1A 1FWJC 2DV0A 3DOPA 4QQUA 1O1HA 3IJ9A 5JUVA 4QDMA 4GUHA 1LZOA 5LXEA 4L1GA 1RZMA 4E8CA 2IPGA 2CZVA 2CLFA 2JBMA 1OG0A 4DB7A 1MRQA 3VNYA 3N73A 4WQ6A 2LLEA 3VKAA 3L68A 2X1IA 1K9EA 3VNKA 2YCLA 5BROA 2A3AA 1U2YA 2GFTA 4LAKA 1RP8A 2PURA 4WSJA 5DLCA 3DGRA 4HCHA 2GVYA 4M8UA 2AQOA 5D9NA 4IIGA 1JYNA 3AXIA 4XISA 5A8OA 4BY3A 1SMDA 2QCNA 5D4YA 3WF1A 3DHFA 2WK2A 3NVDA 1QBAA 4R7WA 1BYBA 4PUJA 2NQHA 1TCMA 3L5LA 3VKKA 2ACUA 2Y89A 3GKAA 3O15A 4EPBC 3ZT5A 4AWSA 3VCRA 3PTQA 3ECQA 4HZ7A 5LKYA 1UUQA 5FL1A 4TVUA 3NZQA 4UZUA 3USBA 3BDKA 1YLVA 1DIDA 1RVGA 3E2SA 6REQA 1E0VA 3AU6A 4DIAA 4IPLA 2AQVA 2RGMA 1P43A 4C5ZA 2PTXA 3N4FA 3QV8A 4G1KA 4QJ3B 3S47A 5JBDA 5M1TA 5CPTA 4XQ6A 2QF7A 5LNSA 3GBEA 5M03A 1M3UA 2CC0A 4RUBA 1BTMA 4NAFA 3BG3A 3U48A 3QOKA 4ZOEA 3S6OA 2GOKA 4LV9A 3OHIA 4YS1A 3SO7A 3SSZA 1W17A 2RUSA 1HKJA 4NZ5A 2QJNA 3HF3A 3ZLFA 1H0GA 4ZVJA 5AFDA 1EWDA 3CH0A 5EBUA 4U4MA 1QPKA 1M41A 3VZZA 3QXBA 4YVXA 1R2SA 1CENA 3D47A 2XGBA 3GFYA 2DSVA 5E0KA 1HKWA 3KFTA 2ASHA 2V8ZA 4YVPA 3CPGA 2C3ZA 2V2CA 1O94A 2EAWA 4CD5A 1RR2A 3S5ZA 1GZJA 2ISSA 3K8LA 2QQ6A 1AMYA 2WNNA 4AD0A 4CEXC 3D46A 3EX6A 1QPNA 3BTNA 2VEKA 4C91A 5ECUA 3BXWA 1TPEA 1CXLA 4MAZA 1S2WA 3W7MA 3DYOA 1KRAC 4DO4A 2F8QA 4Y9NA 3HG2A 4A8LA 4WRHA 1KBJA 1V4YA 5BYWA 1OCNA 1TG7A 4OT7A 2HDJA 2IXUA 3W4RA 1XYCA 2QF8A 1BEUA 3OZOA 3P8JA 1QNRA 2NXIA 3HA1A 4IHCA 1WXZA 4LYKA 3GAYA 1TTJA 4QJ1A 4RPPA 2BVYA 1AODA 2ZE0A 1OFQA 2AL1A 5A2BA 4H6KA 4PFHA 2FKPA 5GJNA 2ZRWA 1KGWA 2AMXA 5M3WA 2FTPA 4J3WA 5CZSA 1O1ZA 3T7VA 3VTRA 2GQ8A 1JNDA 4MF4A 5DT5A 3GDRA 1Q6GA 3S5NA 3B0YA 2DVTA 2XG9A 1IQ8A 3GDBA 4IT1A 3W1QA 3TQPA 4PR4A 1XDJA 1MDLA 5C0QA 3HO8A 4XZHA 1J5TA 3W85A 4UR8A 1OADA 5BRBA 4M6VA 1VC4A 4AY8A 1D3HA 4MFEA 3VGGA 1VFFA 1Z69A 3LN3A 1X38A 5CG7A 4IIFA 2IPJA 3N14A 3UXAA 3S4TA 4LRTA 1W54A 2J66A 2FGLA 4C7FA 3B0UX 1JCXA 2GK1B 3W82A 4AEOA 1JDEA 3TAKA 1FH9A 5DF0A 2W61A 1BYCA 4ZBCA 1H11A 4O17A 5AC4A 1GTHA 5CGMA 3DKLA 1SZGA 1TYGA 1YDOA 1OFBA 5EFFA 3VX0A 3LI1A 3BGAA 3TAOA 2H9AA 3OU8A 2WSRA 3QMSA 3TQ0A 1SO5A 2ZRYA 1DTNA 1WV2A 3CHDA 4I8YA 3M46A 1UCWA 1TV5A 2ZX6A 3CTTA 3GRIA 2YA0A 4L64A 3V0UA 1GOIA 4CLMA 3L4ZA 3B9NA 3ANYA 4PTNA 3TEVA 2FH8A 5HULA 3VI2A 1F3XA 2V5LA 3KE0A 4ZQCA 2VFEA 4PUEA 3R12A 4IICA 1XV8A 5A6MA 4PEKA 5C2GA 3A4AA 3STGA 1V0MA 4MUZA 4OQVA 4R3UA 1A0CA 4EWND 1KCXA 5HMFA 4UTWA 2WJDA 3MU7A 2FQIA 2PWUA 2EPMX 3BG5A 3H21A 5C9RA 4G56A 3LTPA 2I1OA 1W2PA 3M0XA 2WSQA 4WY0F 4A3RA 3OZMA 2QYGA 3WLHA 1OYCA 3BMWA 1V6XA 2FGBA 2VDIA 4PMDA 4UNLA 4O16A 1UP0A 2CCRA 2BBFA 1XRFA 4H00A 4ZQNA 4DJEC 4D71A 1PV8A 3WK0A 3ABQA 3S1VA 4TIMA 4LUJA 3LCWA 3NXLA 3AS1A 3FA3A 5BOFA 3MYOA 3K4WA 3C6CA 1R5YA 2J24A 5M2FX 3GXPA 4FO4A 4H41A 4JIEA 2CIPA 4MGGA 4NG3A 7A3HA 5LIYX 5MKGA 5BWFA 3HG5A 1ZENA 1E4IA 3H2MA 3BAKA 5AHLA 4NZFA 3WLTA 3QQWA 5M17A 3O1NA 2WZTA 1OX6A 4JPGA 4AWTA 3F03K 3BLKA 4K8HA 4ZE5A 5AYZA 1X6NA 4FNTA 4JN6A 2ZTKA 2OOGA 1Z8AA 3LERA 4MPQA 3E0VA 3LLFA 1GKPA 3H4XA 3SECA 4YTQA 1LBFA 1RPXA 1YPIA 3OIHA 2NT0A 4IMEA 4REQA 3DFQA 2R9RA 2PLJA 3PG9A 4HPJA 4YIWA 1JZ3A 5BXRA 3WG6A 1XIGA 5SWUA 5BXSA 3A22A 3SCSA 3N2BA 3R13A 4FR1A 4MAVA 1R3QA 4ATLA 2BP1A 1W9XA 1EJRC 2D20A 3EEGA 4LNCA 1EJ7L 3V16A 4HIBA 1GTEA 3ITCA 1MXGA 1OGBA 1SFSA 1F74A 4HTYA 2V3DA 3DZ1A 2ANUA 1ZGDA 3W7CA 3AIVA 2Z2AA 5B7ZA 4Z2IA 3SFKA 3TCEA 1KRBC 1LQAA 1UD2A 3ZJ6A 2R8WA 1LWHA 4D8ZA 4CGTA 1IT8A 3ARWA 5KZMA 4OU1A 5HK4A 4D6GA 9XIMA 1R0MA 1UR8A 1WUFA 1WKFA 2CERA 2D0HA 1KXVA 4P7RA 4UFHA 4GYFA 4DJFD 1DHKA 1BQCA 5DQPA 3AISA 1EO5A 4WZHA 4MWAE 3BGGA 3CZEA 4WDTA 1NOFA 4A35A 3W6YA 3M44A 2OWXA 3M0LA 1KBLA 5TQLA 2CWXA 4I90A 4MNMA 1UKPA 1V3JA 1XISA 4TX9A 2A2IA 1BRLA 1C7SA 3PPFA 2J7EA 2PDKA 4XKYB 1EP2A 3QFWA 2EO7A 5CBBA 1YEYA 4CNOA 4S1FA 1U22A 2XH7A 3GTIA 3K1GA 3H2CA 1E40A 4INFA 2ZA2A 2GVLA 2XIQA 3ABSA 4QE5A 4KRTA 5EMUA 3DG7A 4G7EB 1YMYA 1S5WA 4AYSA 3CLWA 4GY0A 1ADSA 4U3CA 4AC1X 2Y8UA 3GLCA 4R7JA 1MW0A 3KWSA 4AVOA 3T4CA 2WNZA 2AQWA 3OTRA 5CJMA 3CIXA 3EMZA 4IM4A 3E0IA 3N12A 3WD0A 2VRJA 1FDZA 2W67A 4EIVA 5IFTA 1H2JA 2X0SA 1PZ2A 4OOUA 5C7HA 3MCNA 2QCCA 2VELA 1ZBVA 3TFCA 4O1FA 1VEMA 2BFGA 2WSPA 3AIQA 4QFUA 2DQWA 3DCPA 3RGTA 1A5SA 2DSZA 2J74A 3B8TA 4KWUA 1Q2RA 4UTFA 3LXAA 3G77A 4YXGA 5A8QA 3FCPA 4XZBA 4H3DA 1R3VA 2CHRA 4C6OA 2Z4GA 3TJ4A 2WMKA 2Z1BA 3CQKA 3STCA 3NQCA 2XM1A 3W71A 3MW7A 4U5IA 3TU9A 1CPUA 1XI3A 5K3VA 2XSXA 3VE9A 4YWSA 3KVKA 1W91A 1F05A 3S6DA 1OC5A 4HHMA 4Z2KA 2XUCA 4DZHA 1LBMA 3MKVA 3WQFA 1GVEA 1VLWA 3EWZA 4MLJA 5AYBA 5FIPA 4B3LA 2D2HA 4UBPC 3EDEA 1L6FA 1R2RA 5D32A 3W73A 4Z1CA 3BW2A 1FUYA 5K9DA 1KFEA 2VZSA 4Q8OA 2ZX5A 4ENLA 4LV4A 2E1DA 1TA3B 3T0DA 3CZLA 4Z0JA 2RJHA 1RPKA 8RUCA 4QX4A 3NEVA 1ZU8A 3EA3A 2X41A 3TN3A 3HG3A 1H7WA 3NL2A 3ID7A 4W8AA 1OFDA 4MFDA 1XIJA 3PHAA 4O52A 2EKGA 3G3MA 4F48A 3ZO9A 1WP6A 3CYVA 2ZUSA 3C0LA 2NW0A 2QDHA 3K8KA 2YFOA 4REQB 2WVTA 2QKFA 2QULA 3H24A 3N13A 3L7RA 4UQAA 4IG2B 4JICA 2HE5A 2NLIA 3GBDA 5C71A 4W7UA 3NZRA 2BOGX 3KBMA 1UA3A 4JTCA 1QJWA 3HGOA 3HN3A 1HFBA 3TA9A 5KZ6A 1VD6A 3GZ3A 4CN4A 4A6GA 2GVGA 3B05A 2QCDA 1C90A 1IYXA 4AU0A 3I7SA 1B0IA 3IRDA 3BUVA 3ATYA 2E8ZA 3MVTA 2QIIA 3IIXA 2DZWA 2QJIA 3BQ6A 1BVWA 1MUMA 3GU1A 1K7FA 4PMRA 3SRFA 4P8VA 3PZQA 4GHRA 2I57A 5TNVA 4EE9A 3NQVA 3M0JA 3LCXA 5H1WA 5JIWA 2MNRA 2V9DA 3EA2A 1KQYA 2Z29A 4RK8A 5CAHA 1TPB1 2J27A 1ODZA 1EUAA 1KLYA 5C9WA 1VJZA 4L56A 4RW5A 3IVTA 1XC4A 3BSMA 1K4GA 3ARSA 1U5VA 4FLSA 4L9YA 5FF3A 3EOLA 1FQ0A 3VKCA 1Z32X 1FHVA 4UQ9A 3NG3A 5FESA 3VX1A 1P0KA 3KVMA 4FOJA 3ZIZA 7XIMA 4LYRA 1W9BM 1Q7ZA 1L6YA 1F6KA 3AHZA 2P50A 1V7AA 4N6EA 3GXDA 1TUFA 2QCLA 3N9RA 3PBVA 2VL4A 1F76A 5DN1A 3GIQA 3MQTA 1OYAA 3EYPA 1Q45A 5LIWX 2DIEA 4YCOA 2PFHA 4GVIA 4Q4SA 1PO9A 4GK8A 3GXMA 3U6WA 4LQ1A 4GD0A 4HZ8A 2W62A 1ZFJA 3UJFA 3LU2A 3SN4A 1PKYA 1XLMA 1S1PA 3CHFA 5EMJA 1MQRA 3FNDA 3N25A 2H90A 2ZWZA 2XM2A 5HWJA 1K02A 2BGSA 4Q4PA 3TJXA 4QXIA 4NJHA 4GGBA 3N04A 2NWSA 3AMGA 4W4QA 4B5VA 3AYVA 4ZCWA 2RH9A 4YMZA 1EXBA 5HATA 3UR8A 1FKXA 3UJ2A 3L0NA 1JFHA 3ZJKA 4US5D 1DJYA 5ABEA 4H9UA 5DMYA 3GC5A 1RQBA 3IGXA 5J5DA 4P2VA 4CU8A 3UR7A 3EZ4A 2J8GA 3ZYZA 2GWNA 1JJKA 5LYRA 3VGDA 2WZIA 4HA0A 3C8NA 1W3NA 1LT8A 4NHVA 4MNJA 3H2EA 4QEEA 1C8XA 4W84A 3R1ZA 4YTSA 4PMUA 1EWEA 1EZ2A 1OFPA 4JX4A 5CJ5A 1ICSA 4QP0A 2ALDA 3SR7A 2FHCA 3HPFA 3TTSA 3B9EA 3C52A 2WLYA 2PDFA 4DF1A 4UFIA 4HCLA 3GDMA 3PN8A 3YPIA 3W25A 4WCJA 1BGGA 1TPFA 3O6YX 3W27A 4O15A 2OOFA 1W9PA 3CPRA 1XLCA 4ZB5A 1A5NC 4Y6GA 5H8PA 2VEFA 3BCDA 4F8XA 4H8HA 2ZC1A 4PCSA 4ICNA 3PZOA 1ITXA 3GW3A 4DBWA 3FJ4A 4HB7A 2IQDA 3OLGA 3PUEA 4LX4A 1EJSC 3EWUA 3RMJA 3VOCA 2DEPA 3HOJA 4TVCA 1WOBA 2GL5A 3DX5A 4D9PA 3KOZA 1KM5A 3DG6A 1R46A 4H7ZA 2XZ9A 1Q4WA 4PTXA 1OYBA 3EB2A 2YDRA 1OZMA 1GNXA 2X1SA 3OG3A 2OT1A 1E9IA 3J7HA 4GYKA 4CCZA 1QHOA 1XBZA 4AW7A 2Z1SA 4HNNA 1M1BA 1QHZA 3NAVA 3CUXA 5HQEA 4ADTA 4CN6A 4C5YA 1XBXA 1UKOA 5LHFA 4PBEA 3VGEA 2YB1A 1OD0A 2GJPA 4Y96A 1TV7A 4JL1A 3VIGA 3TC6A 1ZRQA 1J0HA 1TJPA 2OWCA 4D6IA 1TPVA 1KCZA 2J6XA 2DT0A 3NQFA 4F0HA 4AXNA 3B9DA 4MKNA 5CC3A 1P4CA 4DY1A 4DXKA 1ISYA 3L4VA 2GGHA 4QJ4B 1V0NA 2PC4A 5F4SA 1NP2A 2WNWA 4RLIA 3VE7A 1KFJA 1XIIA 4PMQA 1OK4A 1FDJA 1DEDA 1UKSA 2ZICA 1Q6LA 4XVDA 4M82A 1J0ZA 3VC5A 1FWEC 1RQEA 5HANA 5F1UA 3U2ZA 1KR1A 1P7TB 1M7XA 5GJMA 4XZWA 3QTGA 3W2KA 5DXXA 3KL0A 6CGTA 3WO8A 4JY8A 2GOUA 5U4NA 2E5BA 4LBRA 2CZDA 2W0UA 1CGUA 1XCXA 1XJBA 3APYA 4ZXOA 1DJIA 4Q8QA 4LSBA 2YL9A 2G3JA 1UBPC 4J3VA 2WZHA 4MADA 2CESA 1TJRA 1CW2A 3EBVA 3S9YA 3ZQ9A 3W1XA 2YA2A 4AZ7A 3XIMA 3QVQA 3CUGA 3N17A 3C2VA 1PZ1A 4V15A 1TO3A 1OIMA 2QJMA 4P7OA 1ISXA 6REQB 2UBPC 2WV8A 4CQBA 5LNWA 3AS0A 1CGXA 1TTQA 4KRUA 1AFSA 2VX7A 1XPYA 1GVFA 3WLIA 4B4FA 1VFLA 3TA6A 3T42A 3E12A 1UR9A 4AZGA 4L7ZA 2Y88A 2Z1VA 3STFA 1BD0A 1QU4A 3PK7A 4DAIA 2GZXA 3PUDA 1QW8A 1RHCA 3GAKA 3WK3A 2BXZA 3AZTA 4LC8A 3IUDA 1A3HA 4LNYA 4DEFA 2WMIB 1K6AA 3PULA 3SCNA 3TW7A 3N6HA 1LL7A 3APTA 3B8UA 1HO1A 1C7TA 2QZRA 5BOEA 1UKQA 2PLCA 4CU7A 3MA8A 3PR2A 3W23A 2VGGA 3GDLA 3AALA 4M51A 3QOMA 4IWWA 1T40A 3PB2A 4L9ZA 2Y5SA 4NAEB 2PUZA 1QO2A 3VKBA 3R7MA 4DZAA 2J4GA 4C6PA 4Q4QA 3GHUA 4DF2A 1VPQA 3KLLA 3L4YA 3WEOA 4GQQA 3GQYA 1OFRA 1M5WA 4K8GA 3SY5A 3FIGA 1IIHA 5G5IA 5T9BG 5M5DA 3W76A 2NT1A 3SCPA 4B5XA 4LUSA 2EXOA 3GIYA 1OK6A 4NRRA 4ZA0A 4AAJA 5D9OA 5JH1A 1JQVA 3LS9A 3T2PA 4JFWA 3W00A 1M9HA 1E1CB 2FPTA 4PUWA 1H7RA 3IAPA 3B8VA 3UZZA 3R0DA 5BRQA 4HP5A 5J8LA 3GVVA 3IANA 1VIZA 2FB2A 4IJRA 3L0GA 4FA3A 4QG8A 3CT7A 3CASA 4JHZA 4KFPA 2WAGA 2Y4SA 3DERA 1GVRA 4S2BA 1XS2A 2YW4A 5EYWA 1YBQB 1BYDA 1VQTA 1QCWA 1LOLA 1MEWA 1V0KA 4IX2A 4O4WA 4A2SA 1QVBA 3E2VA 3WDPP 2OPJA 3M0HA 5JU6A 3NPXA 3W1UA 3NOEA 4HK7A 4AEEA 3NSNA 4FNUA 3W1NA 4L4PA 2YL6A 1OBAA 5ABFA 3VO0A 4AHPA 2QDEA 1GOOA 4XUYA 2VURA 1JUBA 1RXOB 3EA1A 1EC8A 5I7GA 4Y2WA 4C60A 4OWGA 1RLCL 1PDYA 1OX4B 1NY1A 3OHMB 3LZ3A 2P3EA 3AYSA 3NPVA 4RV8A 1Q8JA 1B3XA 1OF6A 4MVAA 3OLIA 4H9TA 2J7GA 2JEQA 3KHDA 1BG9A 3OG2A 3UZJA 1R9XA 1O66A 3I6TA 1KTBA 3UW6A 2TPSA 4MJMA 4P61A 1VLIA 3G1DA 4DNMA 4IIHA 2ZXBA 4UNIA 1D9EA 1KFLA 1X98A 3T1GA 5E93A 5AECA 1UD6A 3E5BA 1IXPA 1XDMA 2YZRA 2ZRVA 4LVAA 4O11A 4B2DA 1UH3A 4WK9A 2OSYA 2HPIA 4HHHA 4A3HA 1KD0A 4K3ZA 2HXUA 4ZB0A 1EEXA 4H4IA 2DH3A 3M9YA 2ZRZA 3WD4A 5HWNA 3GR7A 8TIMA 4NYYA 3BPWA 1W3LA 2VM8A 4UQDA 2BMBA 2H3DA 3EDKA 1JGMA 1DWGM 3LCLA 5F4WA 1OY0A 2A1YA 3WFAA 2J78A 4IFKB 4C6IA 1TQXA 2G3MA 4H6EA 3WEMA 1JEZA 3EWBX 1V02A 2V69A 3OBAA 3JZEA 3U5UA 1HNYA 3MMDA 6A3HA 2VQTA 3P62A 1UQZA 4UFMA 3FYPA 3ITLA 3CGTA 2WLZA 1QNSA 4GYPC 4AD2A 1BYAA 3NCOA 3C0JA 1XINA 3GKFA 1UP3A 3O16A 3IACA 1KA9F 2QCDB 3V36A 4M5PA 3E74A 4Q8PA 4CNPA 2PTYA 3QC0A 1MQQA 2WMJA 1H7XA 2YX0A 4GVGA 4EOUA 4IMAA 4DJEA 1TZ9A 2V3EA 1DXEA 1E3XA 3SJ3A 1QW7A 5FL0A 4AFYA 1L2QA 3M0VA 2E28A 3OOQA 3LTSA 2G4JA 2VR5A 2A7RA 5HBFA 3S83A 3TFXA 3HU7A 3W24A 3ORWA 4FEZA 2L5HA 1YPFA 1JPMA 1Q4NX 4EAMA 4A3UA 2WJFA 1Q7MA 4M6PA 4RV3A 4IX0A 4ZO7A 4QE4A 3WNLA 3ATZA 1JQXA 4R27A 1LLWA 1B9BA 2HCVA 2XWEA 3ITGA 1ZLPA 4LUYA 3RG6A 4XBJA 3S9IA 2VHLA 3VOIA 1AH3A 1V79A 1XX1A 1WB0A 3I68A 4DJDD 3EGJA 3EB4A 1YDYA 5AC7A 1K9TA 2FPYA 1TX0A 4ML9A 2Z28A 1I4NA 4BHYA 1M6JA 3WQDA 3L65A 5BXPA 3GHSA 2YA1A 1K9DA 2O92A 4HPHA 3TR9A 3RJXA 3U4AA 1POKA 3PBYA 4IFKA 3H8AA 3CEUA 1E15A 4JQ2A 3P60A 1WYIA 4ZTXA 2YFNA 3P74A 4J27A 1DE6A 1GVYA 2UY4A 3P14A 3T78A 4LPCA 3GD6A 2IKGA 3RK8A 3GDTA 4MWAD 3T07A 4L1XA 3L23A 3RDKA 3O05A 1LYXA 1NDVA 2R94A 4KCTA 1KTNA 1WDSA 1NAL1 3VMOA 2WVVA 5GNZA 2D22A 1E6SM 1E9YB 3LENA 4ICCX 4N6FA 4GNVA 2FMNA 2JKPA 4PMZA 2JK2A 3LY0A 3JS3A 4UCFA 2ZZ7A 4LS0A 3GVQA 2VVNA 3W7HA 1EYWA 3F5LA 4B9ZA 4HHPA 5CAKA 4AVFA 3WDJA 1PIIA 3K13A 1OVDA 1CBGA 3W7QA 1L9WA 3MCMA 5TIMA 3HQOA 1I0DA 4LXFA 1Z9AA 1EGZA 3UY8A 3L4XA 2J7DA 5I77A 3VD5A 3AXXA 2DZTA 4U33A 3LB0A 1DTUA 1O5XA 3L21A 4M29A 3TYEA 5FJIA 4Q4RA 3C2FA 2WW5A 3AFBA 4H19A 2QCFA 3V1HA 1UD8A 1NVMA 2VFHA 5CSUA 5BMXA 3XISA 4OV4A 2VGFA 4I7VA 2I9UA 3WY1A 3QGAC 3IGUA 5DY3A 1E0TA 1E5NA 2E0PA 1L2UA 4CQAA 2CLHA 4LS1A 3ZT6A 1W1B1 2GVEA 4DBDA 4BJHA 3WLOA 1VZWA 4UR7A 1Q5MA 3THUA 2E9BA 3NDOA 1JDDA 1K8YA 3TXVA 3N4AA 3IARA 3PPCA 1XH0A 4YTTA 2PB1A 4GMEA 5LIUX 1FFQA 4UXDA 3UXDA 3RXZA 5HMEA 1NWUA 1PKLA 1E1FA 2HS8A 3EWWA 4C6CA 3TYDA 1O68A 2GDVA 1UOZA 3TONA 4ERIA 4DXVA 4RZ6A 4IP7A 1XLJA 3LGEA 2E77A 2ISDA 3W7PA 1UW9A 2W3ZA 2FYMA 2Z6IA 5EBAA 4KIEA 1GHRA 4B5WA 3A47A 1OSEA 3LI0A 4AIUA 3G1AA 5A6KA 2ZXAA 1HIZA 3ALGA 4LW7A 1FBAA 3RNDA 3V3WA 3R43A 4HKPA 3RM9A 1CGYA 3EPMA 1UYQA 4EANA 3F7JA 4JOMA 2QCMA 2J7CA 4HK6A 1I45A 3NA8A 4E2DA 2ZUVA 1BKSA 2E1WA 1IEXA 2NZLA 4C90A 3W1RA 1HUVA 1GORA 1QOXA 3KUMA 4IP5A 3O0KA 1ELSA 4NZ4A 3IGSA 2VZTA 3OODA 4WD0A 1G6CA 5LA1A 3VFLA 1F3TA 1QT1A 1PX4A 3RN6A 3MP5A 1SJBA 1UR4A 3PBMA 2B4GA 4G7EA 2WVVB 1PIGA 2F6XA 1VAHA 4AHQA 4JIIX 1WKDA 4TMBA 4OIFA 4A21A 5H8UA 1FCBA 3QJAA 5HNNA 4X2PA 3A4JA 1VS1A 3NR0A 4QG6A 4JFTA 1R85A 2P76A 3FX4A 2RFGA 3HPXA 3DEQA 1XC6A 2YR1A 1QHPA 2RDUA 2YIHA 2X1RA 3L4UA 2VI0A 1P0NA 1TJ1A 3E38A 3EDFA 1Q85A 1D7FA 1VR6A 2WJEA 1P0DA 3LHVA 3QPZA 3EAUA 3UPWA 3Q4DA 3SGZA 1N8IA 1S5VA 3USZA 1GQJA 1EA0A 2DVXA 3AXMA 1C8YA 4P8XA 3M0KA 3TDFA 3GVRA 4Y9MA 4X9SA 5U7SA 4DPPA 4PMNA 1D8CA 4XZ9A 1HVQA 3HMCA 3MTWA 2WKLA 4HPNA 3O2LA 5T26A 4KIRA 1R47A 4QRNA 4AY1A 2XFRA 2VENA 1W3TA 3BLOA 4A05A 2OJPA 4XIAA 3FKKA 3MZNA 3W29A 4ROPA 5D03A 4QJ5B 3POHA 2ISFA 1VYPX 3FVMA 3VDBA 2IKHA 1TQJA 4H9VA 3LK6A 3N2MA 2XTKA 5I5RA 4HD5A 3HIJA 4S39A 4QCEA 4KGJA 1RK5A 4MKVA 1EZWA 3B8IA 1UWUA 2J62A 2ZUTA 3P80A 4J9JA 1I2RA 3SGUA 5CC5A 5AY7A 1WDPA 4S3BA 1KR0A 2HTMA 1SJAA 4LC6A 3CZ8A 4XKMA 3WENA 1E6NA 3SCTA 2Y6ZA 1JRCA 5A6AA 2WVUA 1QI5A 3HQPA 5DMLA 1DQWA 2B0MA 1VP5A 3ARXA 2CLMA 4LCSA 4U2YA 2B31A 2WCSA 5AB3A 3R8GA 3CH9A 1M04A 4CQCA 3G0XA 2FLIA 1WDWA 1GVIA 4B9YA 4LEQA 1HGYA 4ERAA 5D05A 2C16A 2JGQA 3ARTA 1CZ1A 1PCKA 2O9TA 2YCJA 5G1MA 2A3EA 2PDQA 3TH6A 2P0IA 5I3HA 1K8ZA 3W2LA 3PZ9A 3WLKX 1BF2A 2X7WA 4R88A 3M07A 4MUPA 2YCEA 3C2YA 3ALFA 1V3HA 1VYSX 2HNEA 5EPDA 2FZ9A 1V6TA 5KMYA 3WLNA 1ZBCA 3LCGA 4KEUA 2DZBA 3QQ0A 3KRUA 4JIPA 2PWFA 5DXYA 1IV8A 4JNYA 4IG2A 1RK6A 1NQ6A 4RPQA 3AHTA 2NQ9A 5DANA 1G4TA 2CNCA 4JTIA 3JUGA 3ZWTA 5F1VA 2GGGA 2BVTA 3PBGA 3PPHA 3F4VA 1NOUA 1C93A 5HNRA 2CLEA 3AUJA 3G2GA 3FOKA 3LD5A 4HOXA 4ATDA 2ODOA 2DUAA 2GDQA 2XVPA 5I09A 3E02A 2FDSA 3G3DA 5FJJA 3M0IA 5EMKA 3B4YA 2VDGA 4WJXA 1AJ0A 2BG5A 3P61A 3U7BA 3IK4A 3WSUA 2YL8A 1TV3A 2CLLA 2BGNE 4JZ5A 1FHDA 4FB7A 7REQB 1XLLA 4NQ1A 3CLMA 1OGSA 3Q37A 3W7JA 1YX1A 4L6HA 2ATMA 3H55A 1YQ2A 2WPGA 3BG9A 1JD9A 1EYEA 1VCGA 4GA8A 2VR4A 3FGCA 1ISZA 2W92A 3N11A 4KKXA 5EU9A 3MV01 3SZ8A 1Z3NA 3P5ZA 3ZVHA 2WXDM 2IKJA 1QATA 3FDKA 3UVIA 5F2GA 4UTJA 5C2XA 3GG0A 3CUHA 3F5JA 4F0LA 2FDMA 4GVHA 1EPVA 1TUXA 5I79A 3FA5A 2HK1A 3VYLA 4L1WA 4X0NA 1FFRA 3W7EA 3AS3A 2C0HA 3VDAA 4BF9A 2FFIA 3FHQA 1PZ3A 1C9DA 3VCNA 4ZGYA 2Q01A 1H5YA 4LJ3A 4FNRA 2F6UA 4IUGA 1LRQA 1IR2A 1DHPA 4BEQA 4AWEA 2V0TA 3NWRA 1Q6RA 2OLAA 1XIEA 5FAGA 4DN1A 1IEWA 2V5KA 2IXVA 1TMLA 3L2MA 4QDWA 4C6NA 2XU2A 3SCOA 2Y7EA 2PWEA 4M24A 4JX5A 2NQLA 1H63A 2O7SA 4D72A 4ZODA 1VHCA 2VFDA 1UUOA 4HHLA 1GK8A 3JR2A 3VOGA 3EPOA 5F2MA 4ZE4A 1VPYA 2OVLA 4J7RA 4ZOCA 4S2CA 5CC7A 4E0CA 1IEVA 2W4XA 5HPCA 4UOJA 2O7QA 3AIRA 1XYFA 4KMQA 3JZUA 4U31A 4GVFA 2EJAA 4B5NA 5FF0A 1PVNA 2FIQA 1DP0A 3UETA 4WOQA 2E40A 4JTSA 3UCQA 3SUVA 1NOWA 1I2NA 2NV9A 3URQA 4UTLA 3NYDA 4FPSA 1B9ZA 3C5QA 1JVNA 1ZP4A 3AWNA 1YTKA 2D24A 1MZRA 2PDWA 3UG4A 5IBXA 3W1TA 3G6LA 2ZZ2A 4MJZA 5JH2A 4F2TA 5KSWA 4Q8UA 4Z1BA 1KM0A 2IUZA 3R11A 4IGHA 2XPKA 5XIAA 3KDOA 4FLRA 1BWKA 3A24A 4MLRA 5HPOA 5RUBA 4OECA 1UWIA 2QVNA 1XRTA 3WJWA 2JIEA 4K39A 4M80A 3WLPA 3TMQA 2NUXA 3B0XA 4C65A 1OQFA 3WJXA 4JHOA 3QZAA 4V1YA 1RBAA 4D6CA 4N9DA 4XD3A 4XZLX 4UTHA 3GE7A 2V6AA 1K03A 3VUPA 3L67A 3OZYA 2V5BA 2VX5A 3II1A 6XIMA 4GWEA 4JNMA 5FOOA 4JTRA 3VKDA 4O1AA 1WAWA 1A3WA 1HW6A 3QSTA 1UKTA 3WK1A 3W26A 3NQAA 1D3GA 3PM6A 5KZDA 2PDYA 2O55A 3CWHA 3HM7A 4HZMA 4AZ6A 1I6NA 1OM0A 2DGAA 1IGWA 1ZL1A 4JTLA 3PP7A 2NLYA 1G01A 1W6TA 4AZCA 1CLKA 1R9ZA 2C79A 3UZYA 5HAOA 2UWFA 5DO8A 1CYGA 4MWAB 4WJ8A 4E2BA 1EPXA 3O7UA 1J6OA 1MEHA 1MFVA 5XIMA 4X0VA 4UOZA 1JPKA 1TPWA 3C8FA 4JKLA 1JCMP 2E67A 3HV9A 4UFJA 1QPRA 2E9LA 1Y8BA 3RJYA 3SBFA 3PZMA 2QAPA 5REQA 3URAA 3ITTA 4AD4A 4YWIA 1ISWA 4GUFA 4KT2A 3LEPA 2VX4A 2CZFA 2VEGA 1P48A 2W91A 2GJNA 1A47A 1ZJHA 6XIAA 1MFUA 2FZDA 3PF3A 5HQMA 4RW3A 4HNTA 2WVSA 3FYOA 3LQLA 4QLJA 4M7TA 4MTVA 3MYPA 3C86A 2P1FA 1H1ZA 1DYSA 2J47A 2Q09A 3ARRA 3THAA 3A9BA 2OODA 3GNDA 4R5EA 4MDOA 4B5SA 3RYSA 1DPMA 1TA3A 3H7UA 4CQ8A 1TR1A 1CNVA 4Q22A 4D6FA 3IJDA 4PMYA 5EB8A 1V3KA 3AOFA 2G95A 3WZ0E 1F6YA 4BK9A 2X2GA 2G8ZA 1YE4A 1E43A 3Q65A 1RJRA 1EB3A 2YKKA 1UWQA 2Z0IA 3R10A 4W5UA 3MANA 3MS8A 1KFCA 3GUGA 2NSOA 3GHTA 1Z6KA 4D2JA 1BSIA 3KLKA 3U9IA 1CGVA 4FP1A 4O0ZA 4PA8A 2J6VA 3WUGA 1W5QA 4KW2A 5A6BD 3E96A 2XN2A 5HR7A 4QQ3A 1T41A 3PB0A 3GNOA 1US2A 3UERA 3U3HA 2F7FA 3PANA 2ZA1A 1XYLA 1J10A 5L6UA 3JU2A 3K1DA 1TV4A 2QUUA 1KFBA 2BY0A 2BGQA 5BCAA 4LT9A 3KM8A 3NDZA 1DJGA 1LLOA 5EMMA 4O0KA 1EF3A 4JXCA 1THFD 1NDWA 3OB8A 3PY2A 4WY0B 1H3GA 1LUCA 1ZAJA 2DFAA 4S3JA 1VKFA 3LPGA 5TD4A 3WDIA 2CFFA 5EMYA 3VPLA 1UWAA 2PU0A 3DFHA 3PG8A 4E3TA 3OA3A 3E0WA 4E38A 1QTWA 3QV7A 2VCCA 5G4HC 1J0KA 4GH3A 4LUTA 3LOTA 3OP2A 1F07A 2CLOA 3LBCA 3MWAA 4JIQA 1WZAA 3NZ1A 2R6OA 1RV8A 3CO4A 1E0UA 3CTLA 3I7QA 1RCQA 4H9XA 5JQ9A 1ZUAX 4OOZA 4IMGA 2OFJA 4XD6A 1I60A 1FWNA 4XVEA 3NVTA 4GI4A 2V5JA 1GW1A 2OXNA 1UP2A 4MZYA 1DWFM 1AZ1A 4UZSA 4RX0A 2W27A 4LY4A 1E9ZB 2G4FA 3U0HA 4M6QA 2B7NA 1KM3A 2XJ7A 4E4PA 2QLYA 4HTBA 1Q6EA 3BLDA 4UMAA 1L0PA 2RGLA 1KM6A 4I9MA 1PZ0A 2PP3A 4AZCB 2Q02A 3KDNA 3LHZA 1C91A 3QMTA 4XSMA 4OUIA 4L80A 4AHOA 3M16A 3N3MA 5DBUA 1Q6DA 3TWAA 1V8EA 4JX6A 1I0BA 3T44A 5HR6A 1MSSA 2QR6A 3EWXA 4PUDA 5I2UA 3C3NA 4X9YA 4IGSA 3UXLA 4WF7A 3WF3A 1OFEA 3NYZA 1CTNA 5D8ZA 3E2RA 1TV2A 3QW3A 3P8IA 4NKCA 2KZHA 3F2BA 3WF4A 4Q32A 4K37A 1DL3A 2VTFA 5A1AA 2H6RA 4C7DA 3Q45A 1UR2A 3UG3A 4MWAC 2X16A 3TC3A 1HL8A 3TN4A 2C71A 4DBSA 1Z48A 2VXNA 3PZIA 3F4DA 3BCJA 3A3XA 3CUJA 2YBVA 4JNZA 4DF0A 2XFFA 3HTWA 4LVBA 2FMOA 2X0HA 1D7KA 1GPWA 4BCEA 3W7GA 4NJJA 2PTZA 4TX6A 1VF8A 2PSNA 4ERGA 1JYVA 1JUKA 4TTUA 1PSCA 4HJWA 4K2SA 4PCNA 2EGZA 1I2QA 3TROA 1GKQA 4ZO9A 4WXZA 2X09A 1FWDC 2R1NA 2Y5EA 1TRDA 3W84A 2WWCA 4IQEA 3QZEA 2RKXA 3W9ZA 4HGXA 5AHFA 4JQ4A 4KWOA 1JZ5A 1V51A 5CLWA 3A21A 3AQUA 4ZQRA 5EKYA 4JEQA 1DV7A 2VFFA 1B31A 3H2FA 3UFYA 4RE3A 3GS6A 3V75A 4UQEA 1RP9A 3NL6A 1S46A 2CWNA 5CKSA 3GFZA 5I07A 4UTTA 4TR9A 4N9BA 2PODA 2I5IA 1FKWA 5CC6A 5FEZA 4H6RA 4I9JA 1DE5A 4FIRA 2VO5A 4TU1A 4DO7A 3S42A 3NQMA 1K3UA 3SURA 4H6QA 4K7VA 4JQ3A 4AX7A 4S3GA 3F4NA 4GFIA 4YHGA 3W83A 1UWTA 3MKCA 3LMZA 4DZ5A 1Q7QA 1I1XA 1NF0A 3R4IA 2E3ZA 4PRWA 4U28A 4DWSB 3V4BA 3AJ7A 1YNYA 3MI6A 2FTWA 2DQXA 4AB4A 4WJEA 4BS0A 5CPOA 3S8HA 3KRSA 5H91A 1Z44A 1G7VA 1WPCA 5H2ZA 1M03A 3VA8A 3MB9A 4PYSA 2ZUWA 3RX3A 2AAAA 4X63A 1JD7A 3UCDA 4YLWA 2ISVA 3AMLA 1V6UA 3H2NA 2GSHA 4CD7A 5HMSA 2VKZG 1A4MA 4IXXA 2C0AA 3BLEA 4AG0A 2PLMA 3N2OA 1T7LA 3DN5A 1JDFA 3G22A 3IWPA 2Y8KA 3KRBA 2FB3A 1PXGA 2GJLA 7ENLA 1EP1A 3A64A 1EEPA 1SU5A 1XLKA 4QTGA 2YW3A 4XBKA 1R7OA 2GQ3A 3LM3A 5G2WA 1CECA 3LQGA 1J12A 1VFHA 3EMCA 3CYJA 3OVPA 1EBGA 1GOQA 2NX1A 3LNPA