3NPXA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
249
structure length
249
Chain Sequence
DLKASSLRALKLMHLATANGDDTDEKVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRIWTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADHIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPAGGVRTAEEAQKYLAIADELFGADWADARHYAFGASSLLASLLKALGYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 98
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3npxA00
4KFNA 3NL2A 3S5YA 5AHLA 3I7QA 2FPYA 2ZZ6A 2OT1A 3PBYA 3UZJA 1W3NA 4XKYA 1NVMA 3KFTA 1P1XA 5K9CA 3A5VA 1YTEA 1Q6RA 4UFKA 3SSJA 2EHHA 3C4UA 3DU0A 4JX6A 1GYNA 2G97A 3W7KA 3TFCA 2E6YA 1OHLA 3F03K 1ZENA 3E12A 2VKZG 5TIMA 1LRNA 2A85A 5KTLA 1TTPA 1X1ZA 2NXHA 3IVUA 1V7YA 2A7RA 2LLEA 1JCNA 2YFNA 4PTNA 3W7PA 4DXVA 3UXDA 3N14A 3HJZA 4EOUA 5D2TA 2XN0A 3G1YA 1VC4A 3BO9A 1K7XA 2J88A 2YFOA 1IXNA 3NL5A 3LLFA 3TCEA 3VKJA 3G3DA 3HG4A 5LNSA 5D05A 2BXVA 1GVOA 1GVSA 2NXGA 2Z0IA 4XBSA 3GZ3A 3KVLA 1SO3A 2E68A 1ICSA 2AAMA 1DJQA 2BWGA 1W8SA 2V82A 2WNQA 4UTKA 5CZ0A 3OIXA 1N7KA 3MP3A 4NUWA 3U6WA 1SW3A 2QEZA 1R2TA 4CLMA 1ZCOA 4RXGA 5IM51 1W5MA 2CZDA 3DHFA 1DVJA 3R12A 5AC7A 1LOSA 4FHAA 1W5QA 4BI7A 1THFD 3HGOA 2J27A 3ABOA 1R2RA 4LC6A 1AMKA 4QITA 4DO6A 3TAKA 1KV8A 1WYIA 3CHVA 4XWUA 3W2KA 4Y90A 5F4SA 4FO4A 1R46A 4MVAA 1DQXA 1AK5A 4OE7A 3QM3A 1IIGA 1XDLA 3W7GA 3N3MA 4JX4A 4IQLA 1A5SA 1L9WA 3BK0A 3LCWA 1A53A 1ZHAA 2PC4A 4IUOA 3WJZA 2Z1BA 4IMEA 1Z48A 4JTKA 1YTKA 3OA3A 3O63A 1PCWA 3WK3A 2ALDA 5CPMA 5EL1A 4NJJA 3CWNA 3GDMA 2ZZ2A 2C16A 1AL8A 3LTYA 1UJPA 3L66A 3BGGA 1L6SA 1KFKA 2V2CA 3BPWA 1FWNA 3FIGA 3W22A 1JRBA 5F2MA 1JJKA 3N2XA 1KFEA 1WAUA 4GUGA 4UIOA 1XDMA 4RLIA 4JR5A 2RDWA 2HTMA 4ZQMA 2OCZA 4HSOA 1MZHA 2A7PA 5AYZA 3HIJA 2CWNA 1K7EA 2VENA 2WOQA 4IWWA 3GNDA 5KINA 3OHIA 4U28A 2ISVA 3IIOA 3PR2A 3PY2A 5K7JA 1QFEA 3EKLA 3FLUA 3NNTA 1VPXA 2R94A 3CIXA 5H91A 3NQ2A 2G96A 3FYOA 3PAJA 1ZAHA 3FOKA 4HPXA 2CLFA 4JX5A 4FF7A 5AYXA 1UUMA 2Z6JA 3Q37A 2J6XA 1H7XA 3HQ1A 2J9XA 2VFDA 1LOLA 2VC6A 2NLIA 1ICQA 2HS8A 3EXSA 3N34A 3TNOA 3TSMA 2JKEA 2B7QA 3LX9A 5KITA 1P0NA 3LBMA 1P0KA 2PRLA 2QAFA 1FCBA 1G4TA 4NNBA 2B7NA 4H6KA 2H8XA 2CLHA 4JY8A 2WSQA 5D09A 1OFPA 3KVMA 1YADA 5CKSA 1OX6A 2FB2A 2X30A 4ADUA 3W3OA 3L0GA 2PCQA 3G22A 2A1YA 2ZA2A 1HUVA 3B8DA 3P82A 3TW6A 3EWZA 4N4QA 5DY2A 2E1DA 3DFOA 1OFRA 4HN4A 4I7VA 4TMCA 1ONRA 4A3UA 1KLYA 1QPRA 1W5NA 2A6NA 3WJYA 5E1QA 1DHPA 3U8GA 4N6FA 3GDLA 3N9SA 3P5ZA 4MPQA 1JCXA 2DZVA 4GFSA 1ZJIA 2NWSA 3W88A 5CZJA 4OV4A 3LI1A 2QCHA 1FWWA 4JYDA 1M6JA 1OYCA 3TROA 3NQFA 3QPZA 3TUUA 5G4WA 1TPUA 4WOQA 1TMHA 2A0NA 2NV2A 1EIXA 3NPVA 3P62A 4LWWA 3LB0A 1O4UA 1BWKA 2X16A 4Y96A 3HGJA 1MEHA 1EP2A 4IPJA 2YSWA 4AB4A 4DELA 1JUKA 2ZA1A 3W1UA 4RV8A 3NL3A 3LXAA 5DXXA 3GDTA 3M6YA 3TR2A 1X7FA 2G5WA 4XUGA 2CLMA 1OG0A 4JYEA 3W72A 2JKPA 4FNRA 5TQLA 4AWSA 1K8XA 3LLDA 1KM4A 4B5NA 3W1LA 2VFEA 3PM6A 3O15A 1XBZA 2C3ZA 3JRKA 4O1DA 5CG7A 3EWXA 3O05A 2ZBTA 4H3DA 3GNNA 3IIZA 4K37A 3PUEA 4AEOA 3LHZA 3G1FA 4MLJA 4RZ6A 3C52A 1KV5A 2TYSA 2R14A 5MHBA 5LZLA 4UTIA 2QCLA 3BARA 1TV7A 2YZRA 4Y8FA 4UUIA 4O1BA 2VXNA 3OBKA 1AG1O 4GWEA 1TPC1 4K36A 1FWTA 2X2GA 3V1PA 2ZRWA 1KA9F 3PG9A 4IMGA 1ICPA 4LRSA 3UWQA 1F6KA 3KRUA 3O07A 2XFWA 1Z44A 2H8ZA 3G8EA 5D2WA 1WBJA 5U7SA 1K02A 2RDUA 4JTFA 2ZZ1A 3NEVA 2WSRA 3NQ7A 1IXOA 1GG1A 4JTGA 4UFHA 1NEYA 1HO4A 3KHJA 5FEPA 2B4GA 2OT0A 4WD0A 2ATMA 3EXTA 4NZFA 2YCEA 5HWNA 4O54A 4CNOA 1JR1A 1JCYA 3RMJA 2DJLA 2Y6ZA 1SZFA 5CZTA 2J9ZA 1L6YA 4UTJA 4IMFA 1EWEA 1XXXA 1HFBA 3HB9A 4RZ4A 4JGDA 4WJEA 1O5XA 3EB2A 2Y89A 3W86A 3IIXA 2YW3A 1I8JA 4LVAA 1DOSA 4MFEA 1SUXA 2C0AA 3PULA 5F2GA 2TRSA 4LTSA 4BI5A 2DORA 4XTDA 5KSWA 2RKXA 1WOBA 3BV4A 3NO5A 1YXDA 4X9SA 1XCFA 3B03A 2V2HA 3I6RA 2VELA 4AWUA 4XKYB 3GVGA 3WK0A 1Y0EA 3DKLA 1TTQA 4FB7A 2YX0A 4WXZA 3QQ0A 3BW3A 5FEWA 4OBTA 1XBXA 4Z0SA 2A6LA 2JGQA 3TC7A 1XFBA 4IXXA 3MJYA 3STEA 1ME7A 3NOEA 4FEZA 2HS6A 3MUXA 4O16A 3RLUA 1H60A 3E02A 3QW3A 2CFFA 3EXRA 3NZRA 3CM4A 3GR8A 3NR0A 3N9RA 3KAOA 3CWOX 3EWBX 1J5TA 3DBPA 2CZFA 3C0JA 1TIMA 3HPZA 3SECA 3QZEA 5EBUA 1OABA 2QKFA 3DKJA 4HIBA 3W87A 1OYAA 1QAPA 4M5PA 4UR7A 3ZR4A 1I2OA 4EF8A 1TPWA 4DEFA 3G0SA 1ZAJA 5D30A 1QDSA 3ELFA 1EP3A 2C19A 3MYOA 3I68A 1J2WA 1AW5A 1NFBA 4UMCA 4FX8A 3QMRA 4YLWA 4I9AA 4NQ1A 5AYYA 1S5WA 1W54A 1PCKA 5TBOA 2QJHA 2DJXA 3EX2A 4AVFA 1LRTA 3H53A 1QPQA 4N6EA 1JCMP 1SW7A 2ZTKA 3TW7A 4YCOA 3DFNA 1M7PA 4QM1A 1K3UA 4IMDA 3LCLA 4LRTA 1TREA 4HT3A 4RZ5A 2G95A 1SW0A 4TIMA 2FPTA 3LHUA 1D3GA 2QDHA 2QDGA 1VCVA 2YYUA 4O50A 1QNVA 1GTHA 1Q45A 3O6DA 3P8JA 3FKRA 3M44A 2ZRXA 4M7SA 4WQ6A 2YPIA 2CU0A 1GQNA 3LCIA 2V81A 1DKWA 1WDWA 3MW7A 1ME8A 4E38A 1EEPA 3QYQA 4N2YA 1C9DA 1YDNA 1PHQA 1P5BA 5HWJA 2VEIA 1I2NA 3S1WA 3IV3A 1QR7A 2ZDRA 1XL9A 1IF2A 3C8FA 4NXKA 3SW6A 3QMTA 3TA6A 3OVQA 1GG0A 4Z08A 1I2PA 1K8ZA 1KW1A 3MI2A 1I2QA 1GEQA 1X6UA 2E5BA 5HJLA 4ZQCA 1OVDA 5LGZA 1KM0A 1LLZA 5F2IA 1LP6A 3W85A 1YPFA 3L67A 1GVRA 1OFBA 4I7UA 1F5ZA 5EA9A 2R8WA 4PFMA 5KZMA 1GJPA 3GDRA 4JTLA 1YTDA 1UUOA 1RQBA 2Y85A 4M6PA 3NQGA 3BG3A 1G7VA 5F4XA 3NQCA 4PH6A 4UMAA 1B4KA 3ZS4A 4JXCA 3STGA 1G7UA 4DPQA 1YPIA 3I65A 3T40A 5G2IA 4ZL1A 1TV8A 4XQ6A 1SO6A 4HNTA 2YGYA 5LSMA 2X1RA 2NV1A 5A8GA 3UPWA 1H7OA 1EPXA 1T8XA 3G1DA 5CPOA 4JN6A 1Z42A 4Q33A 1WOAA 4HNVA 3GKAA 4QJ1A 4PA8A 5D2XA 1MEWA 2QF7A 4PCFA 4WUIA 3NM3A 3W75A 3M5VA 4MZ8A 4NJHA 2QCGA 3DFTA 5EPDA 5AHFA 1TCDA 3S0CA 1TRIA 2GJLA 3W7NA 4MYAA 3INPA 3PF3A 4RR4A 1VR6A 2WNZA 4X2RA 3TQKA 4EWND 5FF2A 1GTEA 3GDKA 4UNKA 3WK1A 2E6FA 2XN2A 2VOMA 4MZYA 3W7DA 3DGRA 2Y7GA 3L5AA 1VGAA 4O1CA 1RV8A 2Y63A 5E93A 2DZTA 1IGSA 3TJXA 3TKFA 4HSNA 5IBXA 1B57A 4ZMGA 4WX2A 1ZFJA 4K8HA 4POCA 1A5AA 1OFEA 2KZHA 1TQXA 4OT7A 5D33A 4NZJA 3G1HA 3DAQA 2F7FA 1SO5A 1TPVA 1OX5A 3G1SA 5FI8A 2ZQ0A 3CQ0A 4RK8A 3FYPA 4WXYA 5AHMA 4CQ9A 3L0KA 1OX4B 3LHVA 3D0CA 3HF3A 3E0IA 2ZFAA 1W5PA 2OX1A 4AAJA 3H54A 3LXBA 4ORMA 1ZY9A 4O12A 1L2UA 3MMTA 4OU1A 3BW4A 3PC0A 1G67A 4MIMA 3DFSA 1IXPA 1KBIA 3LCGA 4NJGA 4WY0B 5HWMA 1JULA 3S5NA 4N02A 1XUZA 4TX9A 5HULA 1PS9A 4AF0A 4MY8A 4ZQNA 4ONVA 4O15A 1EB3A 5EY5A 1JQXA 2QCDB 3O16A 1GVQA 4S2BA 1TO3A 2J24A 1YDVA 4OGZA 2GQ9A 4YWIA 1VYPX 5DN1A 2Y7DA 4QNWA 3L65A 1KTCA 3W23A 2CLIA 3LI0A 1A50A 2VEKA 1JCLA 4JDYA 5F1VA 4LV4A 3T44A 1HTIA 1BTMA 3Q2DA 3CT7A 4YCPA 5EKYA 1EUNA 3QW4B 4LVBA 1QPNA 3MHFA 4IMCA 1H7WA 1XBYA 3A23A 1EP1A 4LW7A 4IGHA 2QCMA 3P81A 4JS3A 4MZ1A 2AQWA 5C54A 3IGUA 4JTTA 4TU1A 1VJIA 4JIPA 2BLEA 3RLVA 1NAL1 3PBWA 3PSVA 1GZGA 2GQAA 4RJEA 2QUUA 1K8YA 1YLVA 1GPWA 1UB3A 4L4MA 4O17A 3M7WA 1FXQA 3NQ6A 2V5LA 3TXZA 1FWRA 3RFAA 3C2FA 3BLFA 3LHYA 4CCCA 4R33A 3C2VA 2D73A 4UFIA 3GX9A 5HMSA 5G1TA 4UTHA 3G18A 4UTWA 4R53A 3KXQA 1KFBA 5FF4A 2R91A 4EVZA 3NVTA 3LTPA 3SIZA 1I2RA 2OJPA 4KFPA 4PC8A 3MYPA 4CCEA 5I3GA 3R5EA 1RQEA 3G1AA 1W37A 3CLMA 3BGJA 1GT8A 1DL3A 2NZLA 5SWUA 1PV8A 3LXCA 4Q32A 5GVJA 2PE4A 2X1SA 4UNLA 3DI0A 3NPXA 3HPSA 4NX0A 2Q8ZA 1FCQA 3GYEA 5BRBA 4OQVA 1JUEA 2QCFA 1PL9A 3C6CA 5DY3A 1X1OA 1W1ZA 1IXQA 2X1TA 3YPIA 1OFDA 2H3DA 3B4UA 5HR7A 3STCA 1MXSA 1LROA 4A21A 1TYGA 1EX5A 1GWJA 3TV8A 1HO1A 2W79A 2A5HA 4JTJA 3QPYA 2HSAA 3LERA 4N9DA 2BTMA 3KVJA 4K8EA 3OVRA 5I3JA 3HBLA 1O94A 4GRSA 5F4WA 4QSHA 1LTDA 1PIIA 3LCXA 1KM2A 3TSBA 5U4NA 3W7RA 5FEZA 1CI1A 1R47A 5CSSA 4CQ8A 4AWTA 3W84A 1SFLA 5T26A 1RR2A 4M19A 1YYAA 3G8RA 3P8IA 3THAA 1JQVA 1EWDA 1FWSA 2GVJA 3CU2A 4C1LA 3W7MA 1TB3A 4AHOA 3IRDA 1F7BA 3TE9A 5D04C 4Q4KA 1LBFA 3LBCA 3M47A 4ZQOA 2NX9A 4K39A 3NA8A 2JGYA 4BR1A 6TIMA 4TO8A 4LVDA 1TSIA 4BK9A 3HOJA 3B0UX 3H55A 2B7PA 2C1HA 5K3VA 1W3TA 1F73A 3O6CA 4NX5A 2VFFA 1OK4A 3NQMA 5J5RA 2A7NA 3EKZA 1XBVA 4UTUA 5G2HA 1B3OA 2WQPA 5CPNA 2Y70A 4MY1A 2E5DA 4D2JA 1PVNA 3DXIA 1RD5A 5LKYA 1H7NA 4RCXA 1G4SA 3WK2A 5K2ZA 4OHQA 2V0TA 1N8FA 1VQTA 1VCGA 5AC6A 2PRHA 5CZSA 3W6YA 5AHIA 3L0NA 1OFAA 5D02A 1P4CA 3S6DA 3NL6A 3BVJA 3IIVA 4Y9AA 3A5FA 4LUJA 1RQHA 3M16A 4NNAA 2ZRYA 1OYBA 2QJIA 2RDTA 2A4AA 3R89A 3VFLA 3MO7A 4GNJA 2Y88A 3ZWSA 1LYXA 3TSDA 4UR8A 3PBUA 3QC3A 4G1KA 4O1AA 4DO5A 1LBLA 3W83A 1A5BA 3IVSA 3BLEA 1FDJA 1B9BA 5AN7A 3LRMA 3TH6A 1GYLA 2CZ5A 4ZZ9A 1H62A 4MY9A 1WV2A 2QUVA 4N9EA 3GR7A 4GUJA 3VI2A 1FXPA 3C56A 4O14A 4Z1DA 3IGSA 4JDBA 5KZDA 3EX1A 4IX0A 3WJSA 3THQA 2DZXA 1D3HA 2B7OA 4NU7A 5I3HA 3BLIA 4FNUA 3S5ZA 4CCDA 4GXMA 1EA0A 1OJXA 3OVPA 4X3ZA 3R2GA 1SPQA 3W2JA 8TIMA 3FA5A 2ZTJA 3DFQA 5FF7A 5IBXC 5I3KA 4FXRA 3MP4A 3Q58A 2NX3A 1U83A 3N73A 3W7QA 5DBUA 3C3NA 3HPXA 2RH9A 3QSRA 3NQVA 2CLOA 2GQ8A 3MHGA 3TU9A 3CTLA 5D2YA 4NNCA 3TQVA 4MOZA 1S5VA 4HPJA 2BZNA 3G1VA 3LGEA 5AHNA 1SQ7A 1UASA 4M6QA 3MBFA 4NVTA 3F4WA 4CNNA 5F1UA 1T96A 1AL7A 2Q8LA 1OFOA 1VZWA 1FBAA 3MBDA 3L2IA 1D9EA 5L9FA 2W6RA 1CW2A 3SJ3A 3UWZA 1YDOA 2H3BA 3W1NA 3CIWA 1SSGA 5CGQA 3O06A 4O19A 3FJ6A 1SZEA 5FESA 3UY8A 1KM3A 1FUYA 2GUUA 3O6YX 4JTSA 1KTBA 3V75A 3LHTA 3TFXA 4A29A 4FNSA 2NXIA 1RPXA 2YW4A 4IX2A 3T78A 3T55A 1QMLA 3EWUA 3ANYA 2C6QA 4ALDA 4O0ZA 3C2OA 4DO4A 1F05A 4E2DA 1TPDA 2NX1A 5D03A 5HNRA 4DBDA 1XC4A 3F1QA 4O13A 3W7HA 5F2LA 5L6UA 3B0VC 3LCFA 5D32A 4O57A 5D38A 4FX6M 1VS1A 1WA3A 2ZA3A 3UWWA 3W2NA 3EWWA 5J5DA 4A2RA 3GKFA 1PHWA 4N9BA 2BX7A 3O8AA 1LLWA 5DCBA 3LHWA 2NUYA 4AHQA 1R2SA 4K7YA 1KLZA 4RX0A 2WNNA 3R8RA 4DQWA 4H4IA 3P80A 3GXPA 2I1OA 5EYWA 4NXSA 3HG2A 3N2MA 1DORA 3PB2A 3RK8A 3NG3A 3LRKA 3TAOA 2EGZA 3KVKA 3S42A 3NQEA 4R7JA 1UCWA 4Z1BA 4KWWA 5FF0A 3U2OA 2A21A 3EX6A 3RF9A 3QF0A 5C55A 4AHPA 3ATZA 5HQEA 5AOUA 3OEXA 4K38A 2GVLA 5E0KA 3W1AA 3P74A 4AMAA 4ZVJA 3PBVA 2YR1A 3ABQA 4O4VA 3HG3A 4UTWC 1A5CA 2FFCA 2ZZ3A 2FJKA 3NM1A 4FX7A 4JTIA 4WOZA 3W1XA 4JIQA 1SR9A 2ZZ4A 3W73A 4DF0A 3DZ1A 1C8VA 3LM7A 5K9XA 5EMUA 5LNUA 1K03A 1W5OA 2VFGA 1LDCA 2C13A 3JR2A 3B05A 1FY6A 1F76A 2ZRVA 4GUIA 3TIMA 4HNUA 2RFGA 3UD6A 4KWVA 1LM1A 1XKYA 3T7VA 1O60A 2TMDA 2Y7FA 2H6RA 3ATYA 5BNKA 5K9DA 3R13A 4WZHA 1LORA 2V2DA 4ADSA 4O8RA 1IIHA 3I7RA 3C2EA 3NQ8A 4EF9A 2ABAA 3BG9A 3CC1A 1K7FA 1XM3A 3SGZA 3UPBA 2DZPA 4A22A 3A24A 2CZEA 1E51A 2VEMA 3W76A 1ME9A 4MJZA 4FNQA 3AJXA 1FDYA 4O4WA 3USBA 1DQWA 3MP5A 3QRHA 4FIQA 4LS0A 1W31A 4U4MA 2CLLA 2V8ZA 2V5BA 4XTIA 4JEQA 1SZGA 3RNDA 3TX9A 5CPLA 3QMSA 4A2SA 3P84A 4IOTA 1KBJA 1H51A 3VE9A 2YXGA 5DELA 2C15A 5C6MA 4E0CA 2P10A 2Y61A 1X8FA 3W7LA 1WBHA 4UFLA 1KFCA 3S1UA 1H50A 2H90A 2E09A 3A21A 3BW2A 2GJNA 3OG3A 2OZ0A 4DF1A 1ZAIA 1KM5A 5DXYA 1M5WA 5CSRA 1VYSX 3S1VA 1R30A 1TV5A 4I7WA 1UBSA 2O7SA 4M7TA 3GXTA 4JTHA 1TQJA 3KOFA 3UWUA 2HMCA 3IGXA 2E6AA 3QSTA 4MKNA 1T0OA 2ABBA 4CNPA 3PUDA 2QCEA 4UTTA 3UWVA 1DJNA 1KTNA 1TPB1 3CPRA 1OK6A 2VEPA 2Q3RA 5HUPA 2ZRUA 5FEXA 4YXGA 3GAYA 1WQ5A 1TJPA 3RU6A 3L21A 4KKXA 4XBKA 3IVTA 3W2MA 4ADTA 4LVFA 5BMWA 5HR6A 2X1UA 4FNPA 2ZZ5A 3DENA 4JNMA 3SFKA 3SR7A 4IPIA 2FTPA 3NQAA 1MO0A 4GUHA 1G4EA 2CLEA 4P2VA 3W7CA 1H7PA 3F4NA 3W1RA 1G69A 4BI6A 2ATSA 4GUFA 3QJAA 1C29A 3PUOA 4LY8A 4P61A 2V9DA 1H1YA 1QWGA 4PL1A 3B04A 3BG5A 3SZ8A 1I4NA 2EAWA 4UFMA 3L9CA 4LVGA 4S2CA 3M41A 3P7YA 5H2ZA 4YMZA 4LUIA 3W2UA 1XI3A 2E77A 1KFJA 3M43A 5ABTA 3SGUA 3W1MA 3NDOA 4S1FA 4E2BA 1F6PA 5K4XA 1KM1A 3TJLA 1TJRA 3W74A 1SSDA 3S5OA 4LS1A 1SO4A 4X22A 1OF8A 3GK0A 3KRSA 1W3IA 3B06A 4HKPA 4TR9A 1F74A 4GJ1A 4Z1CA 1TPH1 2BSLA 4MJMA 1H7RA 3L5LA 4PL2A 2PURA 1JVNA 2FDSA 4BWLC 3EX4A 2AGKA 1QOQA 4HNNA 4DBEA 5LNRA 2CW6A 3SY5A 5A5WA 1KFLA 1YXCA 3UQNA 3FFSA 2VFIA 2TPSA 3PS7A 4FIRA 2Q3OA 1H1ZA 1H61A 1U5JA 3QQ1A 3WJXA 1O95A 3TQ0A 1ZNNA 3P60A 3UXAA 3WJWA 3G24A 4GBUA 4LU0A 1FQ0A 3A22A 3K30A 4PEKA 3TMLA 3NPUA 4BF9A 3HGSA 3NXFA 1VHCA 3G0UA 1FCUA 4UXDA 5D2VA 2FB3A 1QO2A 3NZ1A 3E9AA 5BOOA 1HL2A 5G2WA 4MFDA 3LOTA 3NGJA 5D37A 1LOQA 2DZWA 4YL2A 1CX9A 5DBTA 1QCWA 4N9CA 2WO5A 1WX0A 4IXHA 1SFJA 5DLCA 1OX4A 1V5XA 3W1QA 2JBMA 3EWYA 3W7EA 3EEGA 3LV6A 5K4ZA 1B4EA 3VE7A 2I14A 1HG3A 4K6AA 2DU2A 2EKCA 2P0OA 3A9IA 1VH7A 4O52A 2I9EA 3M5YA 1N55A 4WY0A 3W1TA 2DZUA 3E49A 1QPOA 3HG5A 4FXSA 1ZALA 3ZFHA 4ZQPA 3UYCA 2IQTA 4AXKA 3GXNA 5KMYA 1BKSA 3IEBA 4UFJA 3W7IA 2VFHA 2YDAA 2QCDA 1QOPA 3LDVA 2JK2A 3L5MA 1BWLA 3M1ZA 3PVFA 3W1PA 3O1NA 4DF2A 4N4PA 1ADOA 1O5KA 3GLCA 3SI9A 1AW2A 1VHNA 3C61A 3ZWTA 3G3MA 3QH2A 4J9JA 2EPHA 4O0KA 5I3FA 5AC8A 3NQDA 1EUAA 4NJIA 3PWAA 4ML9A 3W7OA 4QQ3A 1MEIA 3DI1A 4CQAA 1YXYA 1H5YA 1Q3NA 5I3IA 1QO5A 1SU5A 3S8HA 5LHEA 4MUZA 1LRQA 5BMXA 1PE1A 3E96A 1J4EA 4M6VA 3S9YA 1T99A 3G1XA 6ALDA 1MSSA 5C5YA 3I7SA 5BW6A 3VNDA 2GPTA 3AO0A 2DP3A 4LS2A 2WJZA 4O28A 1H63A 3W71A 1ALDA 3IIPA 5LNVA 3VCRA 4EIVA 3DFPA 4LNYA 1TRDA 4O11A 2C14A 4LOCA 2ZRZA 1VLIA 3GAKA 5AFDA 2QJGA 2P1FA 5DCDA 1FCVA 2V30A 3UZ5A 2CLKA 4ICNA 4O10A 1DV7A 1TPEA 1TTIA 1FDZA 2B0MA 3FJLA 2C18A 2J9YA 2GOUA 5LHFA 5LNWA 1NF0A 3WFAA 4BWLA 3LTSA 4KFOA 1RZMA 4JYFA 3L68A 3W9ZA 2RHGA 4ORIA 3ABSA 4JY9A 1WXJA 4Z1AA 7TIMA 5LGXA 1VLWA 2ISWA 5G5IA 4MLRA 3TC6A 4QISA 2OMAA 1JRCA 2NUXA 1VYRA 4Z0JA 3ABRA 1LZOA 2F84A 3HMJG 4JTEA 1Q6LA 2ZCGA 4IJBA 4O18A 3DH7A 1W0MA 5DCEA 1NSJA 2UV8G 2JKAA 4LV9A 4NJKA 4UC5A 3EX3A 2WSYA 1F2JA 4JICA 2FQIA 4OV9A 4L4LA 3GIYA 1JCJA 4RKAA 4UCGA 3QEZA 4NT0A 3CEUA 1LBMA 2E5CA 2GVGA 4RXFA 3S1XA 2WKJA 1VCFA 2ISSA 3LV5A 3M5ZA 3M9YA 4JTUA 2WV8A 4MYXA 1SZNA 4QAIA 4PODA 1Q6QA 4FNTA 1G4PA 5HINA 1LCOA 2Z2UA 4OWGA 2O7QA 4UMBA 3G0XA 1Z41A 3MWAA 4C1KA 1KM6A 3TXVA 2XN1A 4DPPA 3W70A 3CEPA 3LCHA 1OFQA 3JS3A 4O53A 1GVFA 4JD4A 5G1YA 3FEMA 1ML1A 3P67A 4R34A 2DZSA 2FLIA 1OF6A 5C2XA 1XUUA 3P61A 5KZEA 2QUTA 4K7VA 3TK7A 5AHEA 4AF0B 3M5XA 1GOXA 4GC4A 3KRZA 2FIQA 3NPWA 4HHPA 2QAPA 3TDFA 3P5YA 1BEUA 3GB6A 2TSYA 3MHUA 3NAVA 3FKKA 3Q94A 1DBTA 4UTTC 3M0ZA 2QCNA 4LC8A 2Y7EA 4UTLA 1NF7A 3PSWA 2QR6A 5HUOA 2NUWA 1I45A 3T4CA 4QIUA 2QCCA 3FS2A 3HO8A 3MI3A 1Q6OA 3HGRA 1FX6A 1TPFA 2YYTA 3CB8A 1RVGA 1VRDA 4TMBA 5G4EA 2E6DA 2A2IA 2Y62A 3PG8A 1M7OA 3W2LA 4Y6GA 1S5TA 4W9TA 4AH7A 3B0PA 3PB0A 3NYZA 4XZ9A 1AW1A 3TMQA 3KX6A 2WPBA 4QNEA 1TTJA 4WY0F 4LT9A 2ZZ7A 1S3HA 4UTMA 2FPVA 3DHDA 3UWYA 3QFEA 4ZQRA 3MI6A 2PRMA 3UNDA 2Z6IA 3W7JA 1JUBA 3LRLA 1L6WA 5FF3A 2W0UA 3C2RA 3UY7A 3W07A 5AB3A 3STFA 3N19B 2ZYFA 2EF9A 1W56A 2NWRA 1G6CA 4BFAA 4GE8A
chains in the Genus database with same CATH superfamily
3KOWA 3M0MA 4DI8A 3I7QA 2EXOA 3KBWA 3GWQA 1FWJC 3ZLHA 2OT1A 3PBYA 3EA3A 2ZWYA 5K9CA 2VX6A 3A5VA 5E6ZA 4V33A 2EHHA 3TEVA 1HKMA 1TV4A 3UCCA 3OW1A 1KR1A 4Y2WA 1DJHA 5TIMA 3MPGA 3VOIA 5KTLA 2J7DA 4UWMA 1X1ZA 3E0VA 1V7YA 1OY0A 3ITTA 4PTNA 4KCTA 4ZTYA 3KM8A 3G1YA 3PWIA 1VC4A 4JIEA 1XLDA 3BO9A 5I2UA 2J88A 2OWWA 1IXNA 2C0HA 2BXVA 2OELA 4H8NA 4Q8UA 1GVOA 1GHRA 3GZ3A 3KVLA 4DNHA 1NDVA 2BWGA 3MP3A 4NUWA 5M3WA 1JZ3A 3OHMB 2O0TA 2CZDA 3RM4A 2PDNA 5GNZA 1LOSA 2VNCA 1TR1A 4AD1A 1THFD 2J27A 1QW7A 1P0BA 1KV8A 1V0MA 1J96A 4I6KA 4FO4A 1XDLA 2AL2B 3N3MA 4AMCA 4JX4A 1LT7A 1A4MA 3U48A 4AY7A 4IUOA 1J8VA 1C9WA 4YYCA 1HF6A 3T2PA 5C2CA 5ECUA 1EF3A 2YLAA 4F2UA 1B0IA 2BV9A 4PTDA 1TV2A 2ZZ2A 4IUGA 2C16A 1AL8A 1K77A 2CXEA 1UJPA 1XSKA 1L6SA 3L4YA 1FWNA 4HU4A 4NI3A 2PWEA 1KFEA 3VO0A 4GUGA 3W6LA 2RDWA 2HTMA 4ZQMA 4ICMA 1MZHA 3OG2A 4CEUC 4NYUA 2O9TA 2QMKA 4IWWA 4YTUA 2WOQA 4JTDA 3RXZA 2ISVA 3VCCA 5K7JA 4ERIA 2WPGA 3EKLA 2E7FA 4QEHA 4FPSA 3FX4A 4IFOA 3CIXA 2G96A 1ZAHA 2CLFA 4JX5A 4LAMA 4RNJA 3HQ1A 2J9XA 3WQVA 1WXZA 3EOOA 2HS8A 2FVMA 4BZYA 4B5WA 2C8NA 5KITA 2BHZA 1P0KA 1QBAA 1O12A 4NNBA 4P8WA 1IYXA 4JY8A 3TTEA 1SJCA 3MWCA 2OQLA 5BWAA 5CKSA 2MANA 1NWRA 4NASA 7A3HA 1XHGA 1HUVA 1UH3A 4EXQA 2WMFA 3H21A 3MCNA 1TJ1A 5DY2A 3PANA 1OFRA 1RY0A 3UEQA 1C7SA 1EZWA 2VTFA 4S39A 1YE6A 3W02A 4A3UA 1W1TA 3WJYA 5E1QA 2R1KA 3OZMA 1XIJA 2POZA 2PDMA 2QJJA 1ZJIA 2NWSA 3C2YA 3RUBL 2XGIA 3ZMRA 1AZ2A 1LL7A 3LI1A 3AALA 1FWWA 1KQYA 1VAHA 1RVKA 2PTWA 4J7RA 4DZHA 4WCJA 1X7IA 1EOKA 1KGWA 2A0NA 2QV5A 3GG7A 3CZJA 3HGJA 2BVYA 1MEHA 2YSWA 4LF2A 3B9EA 2PDCA 3WQWA 4JFUA 4RV8A 3NL3A 1KFWA 3GDTA 3TR2A 4MWAC 1X7FA 4S3CA 4UOJA 3RJYA 2DT2A 4JYEA 3GH7A 4FNRA 5AYIA 1Q2SA 1VFLA 1KM4A 3MANA 3PM6A 3O15A 1R3VA 3WQPA 3CV7A 2Z1WA 1QOXA 2INFA 3GNNA 4K37A 4AEOA 3GNOA 4XD4A 1AH3A 5H8UA 4MLJA 4RZ6A 2EQDA 3GS6A 2TYSA 4LUTA 1V3IA 5MHBA 5LZLA 3QY7A 5EMLA 2QCLA 3AHZA 1TV7A 4RV3A 3BANA 2WJDA 1AG1O 4GWEA 4K36A 1TCMA 2ZRWA 1ICPA 3ZLFA 1X6NA 4C6DA 2VRKA 1F6KA 3WQOA 3O07A 4W88A 1DEDA 4IG2B 1BRLA 1YKWA 1Z44A 3V36A 5D2WA 3I3EA 3U7VA 1GNXA 1PIGA 2FVLA 5LYRA 3B9OA 3NQ7A 1EJUC 4JTGA 1OGSA 4H2HA 1GOMA 5FKYA 3OGRA 1NEYA 4NIRA 4G7EA 5E9AA 1CENA 1KQZA 2B4GA 2PDKA 4P7QA 1FH8A 1Z8AA 3DX5A 5HWNA 3WUGA 4O54A 1JR1A 5DT7A 3RMJA 4EACA 1KXVA 2J9ZA 1L6YA 4RZBA 5GJPA 3JUGA 1UWAA 4UTFA 1TWSA 1ZSXA 4WJEA 1O5XA 4J28A 1CGTA 2Y89A 1AQFA 5DMMA 2YDSA 4LVAA 4ZO7A 5I5RA 2BY1A 2C0AA 1A5MC 4LTSA 3VOGA 2G4JA 1CNVA 1WOBA 1QI5A 1DQUA 1UMLA 3GVGA 1REQA 3DECA 1Y0EA 3G77A 1TTQA 4AY1A 1N8WA 4WXZA 4DX3A 3QQ0A 4Z0SA 3GDBA 4FR1A 3FEQA 4LGXA 3VC6A 3R1ZA 3RLGA 3STEA 1H60A 3QW3A 2WZIA 5RUBA 3AMGA 3NZRA 2Q09A 3CWOX 5A6MA 2V3DA 3TVAA 2CZFA 2X7WA 3SECA 3CZLA 3DKJA 3W87A 1ZRQA 1QAPA 3CXOA 1EL3A 1UWRA 3B9NA 4DEFA 3BJFA 3I68A 1AW5A 1NFBA 4AEFA 1SFSA 3SQMA 2VGGA 4H8VA 4GABA 1OINA 3QMRA 1UA7A 2GDQA 4IIGA 4I9AA 4NQ1A 5A6SA 1XDJA 1S5WA 3PPFA 2DJXA 3H53A 3VOCA 2DW7A 4L1GA 1ZU8A 2X05A 3TW7A 4GKTA 3T2OA 1M7PA 2VWTA 1BVZA 4H7ZA 4LRTA 5J04A 4QSFA 4HT3A 3W82A 1C8QA 2FPTA 1OM0A 2QDGA 1VCVA 2YYUA 3RX4A 4R9XA 3EA2A 3A3XA 1OCNA 3D47A 2PZNA 5BZAA 1GQNA 1R3RA 2OQYA 3OBEA 2EBNA 1EEPA 3QYQA 4N2YA 3UYIA 1YDNA 2ODOA 3PZMA 1PHQA 3OJGA 1QR7A 2ZDRA 3KTSA 1IF2A 4I90A 1UBPC 3S2NA 3SCVA 1XYBA 2PU0A 4Z08A 1QI3A 1UYQA 2D3NA 3APGA 2ZX5A 1JPMA 2QXWA 1A3XA 2E5BA 3LQLA 1OVDA 1JYWA 2CCRA 3PJTA 1Q7ZA 2QJMA 2DEPA 4LB4A 3ARUA 4I3GA 1A3HA 1OFBA 1C8XA 3T8QA 1XLMA 4I7UA 3DG7A 2FHFA 1UC4A 3DIPA 3T0TA 4LF1A 1F5ZA 5CLWA 1UR0A 3CMFA 3BV7A 1UPMB 1YX1A 1MRQA 3LSCA 2Y85A 3K4WA 2ZXAA 4PH6A 2D24A 2INZA 4OVXA 4JXCA 2XSBA 1G7UA 4DPQA 4ZL1A 2XYLA 3WF4A 2YGYA 4HNTA 3BDKA 3UPWA 5A8GA 1P6CA 2XVGA 4R27A 1TV3A 4Q33A 1UP2A 1UR9A 4HNVA 3GKAA 4QJ1A 3CGTA 3DHUA 1E1EA 3NZQA 5EB8A 4TVDA 4KWUA 1MEWA 2QF7A 2OYLA 3WH9A 1FWHC 3VKAA 2E40A 1RBAA 2GDUA 4L6DA 1GKQA 4J3XA 3DFTA 4FS9A 5EPDA 1TCDA 2AQOA 1TRIA 3W7NA 4Z2LA 2HE8A 5A2CA 2QDEA 4D6HA 1VR6A 2YIHA 2CITA 4AY8A 1S3TC 4X2RA 1U1JA 4K3ZA 3H2NA 5FF2A 3IJIA 2EPMX 2FZ9A 2Y5JA 3WDPP 4MZYA 3S2CA 2OFJA 1VGAA 2Y63A 2NVDA 3FVMA 3E5PA 1B57A 3SADA 4ZMGA 1E56A 4XG1A 2VDIA 4DXXA 1EEXA 2XIQA 1RAKA 4PCTA 4KW2A 2V5JA 3KL0A 1OX5A 3G1SA 4L7ZA 4RK8A 5AZ1A 4PTVA 3LHVA 2ONEA 5FAJA 1W5PA 2OX1A 1U5VA 1HP4A 3RIKA 4O12A 1YPXA 1PAMA 2VOTA 3U4AA 4MF4A 3BW4A 3GVRA 1B5TA 4LAKA 4Y9MA 4MIMA 7TAAA 4TX9A 4DZ5A 1RBOB 4BF7A 4NL1A 4AF0A 5DF0A 1W9UA 2VCAA 4ZQNA 1KNWA 1QNSA 1EB3A 1UROA 3QKZA 4D8LA 4LPCA 3K4DA 4NAFB 2O4QA 1MUCA 2YKKA 2ZX9A 1FWDC 1YDVA 3O6AA 1VYPX 3VGEA 1FH9A 2QZRA 4HYVA 3K8LA 2GL5A 4JDYA 4WRHA 4LV4A 3T44A 4XAPA 2ZE0A 1JF6A 1K4GA 4QDPA 4IMCA 2XISA 4HVXA 2AGTA 1XBYA 1EP1A 1OT1A 4RPQA 3UESA 2ACRA 3AOFA 4JTTA 5BOEA 4JIPA 2BLEA 2Z1VA 5I79A 3RLVA 3PSVA 1S2UA 4GYKA 1PTAA 4GG9A 2L5HA 2QUUA 3QV6A 2QVNA 5CC3A 2I7GA 3ARWA 5AY7A 2BOFX 3QV9A 3TXZA 1QNQA 1FWRA 4TV5A 5A6LA 5C70A 3LMYA 3WL0A 3APYA 3SSZA 1RA5A 4QG9A 2X2YA 5G1TA 5HMSA 3VNMA 3UFYA 3I4EA 1HKVA 2PDLA 4EVZA 3WENA 3LTPA 5BYWA 4RDZA 4M24A 3MYPA 5A6JA 3R5EA 2PI6A 4ZO8A 3UG3A 2ACQA 2CIPA 4REQA 1XRSA 1DL3A 3DESA 1PV8A 2IQ0A 3FYYA 1V79A 4C7FA 4YPJA 1AODA 3NPXA 4PUNA 4ZTXA 2XVPA 3WQCA 3GYEA 5BRBA 1E9LA 1HKIA 1W17A 2QCFA 3B8UA 1PL9A 4AWEA 2W3ZA 3K8MA 1DWFM 5DY3A 4Q8TA 2DFAA 4JTCA 1IXQA 1OSEA 1OFDA 3MMDA 4MWAB 4G8TA 1LROA 4A21A 4W5UA 1EX5A 4XAYA 1H4PA 3PTDA 2DSUA 3WKZA 4Q8PA 1Q63A 3LERA 2DGAA 4N9DA 1RJQA 3DC0A 1QK2A 3HBLA 4GRSA 3UERA 1EC9A 1LTDA 2FZMA 1QWKA 3GYCA 5D9NA 2OLSA 3PZIA 3UZYA 5U4NA 3W7RA 2G3IA 5FEZA 1CI1A 3QGVA 1R47A 4CQ8A 1XCXA 4ZXOA 3CUZA 1WDRA 5FACA 2PC8A 1XP3A 5T26A 4M19A 1D8WA 3P8IA 2GVJA 3W7MA 2ZUMA 2JF7A 1F7BA 4QQUA 5D04C 4K39A 3NA8A 4BR1A 4XD5A 3QOKA 1WAWA 6TIMA 4GGHA 4TO8A 3CHCA 4F0HA 3FN9A 7ODCA 2VJXA 3UVAA 3WF3A 4IF2A 4BK9A 4EE9A 3H55A 2R1NA 2WVTA 1JPDX 4L1XA 3OPSA 1ZJHA 5K3VA 4DI9A 3O6CA 4HHLA 3UZXA 4JQ2A 2XUCA 3NWRA 1XBVA 4DWSD 4UTUA 1B3OA 2J8TA 4PUEA 1LJYA 4UNIA 3SCQA 3CO4A 4BQ3A 1EZ2A 4C60A 4XAGA 4D2JA 1JAEA 5K2ZA 1XKJA 1GW1A 5AECA 3B9AA 2X1IA 3MVTA 5D02A 1OIMA 1P4CA 1C8YA 3NURA 2NQ5A 3GHUA 5AC4A 4GHRA 1RQHA 1E6SM 3M16A 3VDAA 2ZRYA 1P7TB 1MQQA 3UA4A 3ZWSA 2GYIA 3TSDA 3PBUA 1V6UA 4YVPA 2OOFA 3W83A 2VWSA 4KS0A 5HDRA 3H6OA 4W4QA 2CLPA 3LRMA 1K1DA 3TH6A 1GYLA 5I02A 1BD0A 3GFYA 3SUSA 3ABXA 1Q7QA 4GUJA 4GH3A 2XVNA 4KRZA 4JDBA 5KZDA 4PB5A 1BVWA 4C1NA 1ONXA 3ZR5A 2B7OA 1S1PA 2DVTA 1DXFA 1E4MM 3L2MA 4NU7A 4C65A 3CUFA 4QS6A 4CCDA 4GXMA 1RSCA 3RM8A 2O9RA 4QEEA 1VIZA 8TIMA 5FOOA 1NH6A 3DFQA 1W3JA 4RDVA 3MQTA 4LB3A 4W93A 4IHCA 2NX3A 2YZ5A 3W7QA 2ZUUA 3F5KA 3NQVA 3MHGA 1EXPA 4Q6JA 2OEMA 4U3CA 3TQPA 3DGBA 1KGXA 1DPMA 1SQ7A 1UASA 2VO5A 4XBJA 2OYKA 5CC5A 1T5AA 3WLIA 1H1NA 4NVTA 2J7CA 3AWNA 1XPGA 3JW7A 2Z1XA 2RUSA 1BSLA 4PFHA 4AFYA 4XAFA 1CW2A 3SJ3A 4AG0A 4MTVA 1SSGA 5CGQA 2F6UA 3IUDA 1R9XA 3SM0A 3O6YX 1KTBA 3LHTA 3CQIA 3BSMA 3QV8A 1QMLA 2A3EA 3EWUA 1Q66A 4P8XA 4D6DA 4O0ZA 3MKVA 3CWHA 1F05A 4PUMA 1KB3A 2NX1A 3O2LA 4QGCA 4O13A 5L6UA 1X98A 1XJBA 4HYWA 1NWSA 4O57A 4WDWA 5D38A 2VCCA 3T0BA 2ZA3A 3VNKA 1TKKA 5J5DA 4A2RA 1PHWA 4N9BA 3R8HA 3O8AA 4QE5A 1UKOA 4P7LA 4AHQA 3LHWA 2NUYA 1R2SA 6TAAA 1XLBA 4H4IA 1UWTA 2D0GA 3WH5A 3GXPA 3ES7A 2I1OA 3S9IA 2BVWA 1BSIA 4ZR8A 5JBDA 2DT3A 4ZOCA 1YBQA 3SCUA 1RCXB 3GRIA 4Z1BA 4KWWA 4DWSA 2HCVA 4JN7A 1EJRC 3ALGA 1VF8A 3R58A 1XIBA 4JZ5A 3ZLGA 4K38A 1KXQA 4W89A 1NOFA 3ABQA 3WQDA 3QFWA 4UTWC 1M7JA 3KHDA 2JIEA 1TFVA 2FJKA 5KEZA 4WOZA 4EWJA 2GWGA 2OGJA 3VGHA 3DZ1A 3II1A 1C8VA 2BGQA 4HB7A 3LM7A 3WQ4A 5LNUA 1K03A 2VFGA 4IPPA 3U3HA 1LDCA 2VQUA 2C13A 2DZBA 3CYVA 3UF9A 1E43A 4H6QA 3VNYA 3JR2A 3FJNA 3THUA 2UBPC 2PWVA 1XIDA 4HNUA 3UD6A 5HPCA 5TF0A 1XKYA 3L4WA 3RLHA 3QTGA 2WHLA 4PEEA 5BNKA 4WZHA 1V3JA 4XD3A 1LORA 4L4PA 2V2DA 4ADSA 2D0FA 4GCXA 1EBHA 3CC1A 5MKGA 4C6PA 2CZEA 1E51A 1RY8A 3QR1A 4RPPA 3BMVA 1BYAA 3EZ4A 3AJXA 4O4WA 3QRHA 4LS0A 1HJQA 1PTDA 2V5BA 3VKCA 3RNDA 3PTQA 3SUTA 4Y8EA 5EFFA 4C5YA 3UZZA 3P84A 4IOTA 4BS0A 3AQUA 1KBJA 1H51A 3VE9A 4GVIA 1WPCA 3REQA 3BJSA 4XZIA 3BZGA 4DZAA 3QBUA 4UFLA 2IKJA 1MW1A 2H90A 3A21A 2OZ0A 4DF1A 1ZAIA 5DXYA 3S46A 1XLLA 3N25A 3SN1A 4MAZA 3GXTA 3TYEA 2J7GA 4JTHA 1TQJA 1ZCCA 4AC1X 3MCOA 3VNZA 4LUSB 2ABBA 2PD5A 4ILSA 2YB1A 3UWVA 1SJAA 3CPRA 3GHSA 2ZRUA 6REQB 3GFXA 3GAYA 1JCTA 1JZ4A 3T42A 3RU6A 2D20A 4UB9A 5KETA 1BTCA 5BMWA 2X1UA 1FWFC 1DIKA 2FTPA 1MO0A 2EPLX 1H7PA 1VFUA 3ZSSA 3W1RA 4R9OA 4H9UA 2PA6A 5M03A 1UWUA 4D6JA 4PL1A 2BG5A 3U0HA 1NOWA 3B04A 2EJ1A 3BG5A 3HPAA 3L9CA 4GYFA 1BWVA 1VBUA 3GVVA 2YCLA 2J7EA 4YMZA 2V3EA 4LUIA 3V0TA 4C7DA 4J2MA 3T0DA 1KFJA 2V69A 5ABTA 3BAIA 4GI8A 2PUZA 1DJWA 4PMDA 3APTA 1ZB5A 1R9ZA 4PMXA 1TJRA 4X0NA 4PE8A 2ZWZA 1SSDA 3S5OA 2NT1A 3IGHX 1ITXA 4AZ7A 2PTDA 1EYEA 1GORA 1H7RA 2Q02A 2P8BA 4WVXA 4DBUA 1W9DM 2I5IA 4BWLC 3T1GA 1ZP4A 1EDGA 4HNNA 4DBEA 1R86A 4IJCA 5LNRA 3SY5A 5A5WA 4RE3A 4IFKB 3G6MA 5LIWX 3PS7A 4FIRA 3KOZA 2Q3OA 1ESWA 3I6EA 5CPSA 1E9YB 3N6QA 4RDYA 2WC7A 3WJXA 1O95A 3E6EA 3AIQA 3RILA 3WMCA 3AXXA 3WJWA 1DE6A 4MNJA 2XIIA 2BBFA 1I0DA 4HMEA 3NPUA 3FGCA 4BF9A 4DIAA 1T40A 4OOUA 4GVHA 4AZHA 2PS2A 3H70A 2HZGA 6A3HA 4S3KA 1QO2A 1HQTA 3MMUA 2FMOA 1OC5A 3B8WA 5BU9A 1LOQA 2DZWA 2Q71A 5DBTA 2QIIA 3BQ5A 1JNEA 4IXHA 4DJDA 2PF8A 3S1GA 1UWIA 1V5XA 5B80A 5A69A 2AL2A 5C7VA 3W7EA 3SUVA 2EKCA 3WIJA 1N55A 2FYMA 4KEVA 3W1TA 1Q6EA 1OCBA 1SR0A 1QNRA 3AIWA 3E49A 3HG5A 1ZALA 4C6CA 3ZFHA 1TJ2A 2IQTA 2G41A 3GXNA 1WB0A 1P6BA 1MI3A 2JK2A 1BWLA 1UG6A 2G3JA 3W1PA 3O1NA 4ZEPA 4DF2A 4N4PA 1UPPA 2PTZA 5BXTA 4XZHA 3GLCA 1AW2A 3BWWA 4QCFA 3G3MA 1JNDA 1G5AA 5I3FA 5AC8A 3S2LA 4NJIA 3CASA 3W7OA 4FLOA 5FA5A 1PZ0A 2BOEX 3DI1A 4QR6A 1H5YA 3P2VA 1RCQA 1RK5A 1G94A 4M6VA 3G1XA 2IKGA 3WQ6A 3ZJ6A 3ZVHA 2Q6ZA 1QW8A 3QY6A 3W71A 1OB0A 3MSRA 1ALDA 2E9MA 5DRIA 5A1AA 4LNYA 1TRDA 2PB1A 4LOCA 2ZRZA 1VLIA 3GAKA 3ITLA 2P1FA 4HNOA 5DCDA 1FCVA 3DYPA 2WHKA 1VKFA 2IKIA 4ICNA 4O10A 2GVYA 2FFIA 3FJLA 2C18A 2AKZA 2YBVA 2GOUA 3P93A 5LNWA 1RZMA 1WDSA 4ZO6A 2RHGA 3CZGA 4ORIA 1E6QM 5PTDA 4Q4SA 7TIMA 4IQEA 4PRRA 2NVAA 1VLWA 4M56A 4MLRA 1DJZA 3TC6A 4P8VA 4H83A 4Z0JA 4RE2A 1Q6LA 3WNNA 2OO0A 5CSUA 2OX4A 1EQCA 5DCEA 3F7JA 5D9MA 3BE7A 4UC5A 3C5QA 1PPIA 4OV9A 3WDJA 2HXTA 4NT0A 2XZ9A 3CEUA 1EO5A 1LBMA 2E5CA 1V8EA 1CPUA 4HTBA 3W0KA 3M9YA 1O66A 4PODA 4FNTA 3NCOA 2O7QA 1GOOA 3WZ0E 1O5QA 4X60A 2X41A 4C1KA 3VIIA 4BQ2A 2XN1A 2WM1A 3SCNA 3JS3A 1JL8A 3WNPA 1GVFA 2EPNA 4OTKA 1U2YA 5C2XA 2PWHA 3VIOA 2QUTA 4K7VA 3M5XA 3UJ2A 1SMAA 3HQNA 2QAPA 3GXIA 3TDFA 1HGYA 2ZC1A 3MHUA 3D3FA 4LH8A 1NELA 3NDYA 3Q94A 3SEPA 4UTTC 2ZOXA 3AYTA 2Y7EA 4UTLA 1U33A 5EFDA 3K4AA 4RNHA 3MI3A 1Q6OA 4O1FA 1NOUA 2VZVA 5J8LA 5G4EA 2V67A 3PG8A 5HA7A 2FGBA 4W9TA 4AH7A 3NO1A 3TMQA 4B9YA 3UJEA 1EGZA 1TTJA 3GXFA 3W6MA 3WD3A 4LT9A 4CD7A 2IPFA 4D1JA 1EC7A 4ZQRA 2PBOA 4EAMA 1W2VA 2Z6IA 2VC5A 2W0UA 3UY7A 4Y7EA 4HZMA 2XM2A 4BFAA 3NL2A 1UOZA 4JIHA 3WLSA 2WW5A 3EMCA 5D8WA 2G50A 2FGZA 2C1GA 3NTYA 4YVXA 3SSJA 3C4UA 4DVOA 2EO7A 1GYNA 2G97A 4JX6A 3W7KA 3TFCA 1T7LA 1ZENA 2VKZG 3QR3A 2BMBA 4H8UA 1TMLA 4XSLA 2A85A 4KGJA 4WJ8A 3BOFA 3WLQA 1FWIC 4A05A 4K1GA 3L4VA 3UCDA 2VUYA 2A7RA 1Q7MA 1E72M 1XV8A 4DXVA 4XIAA 3HJZA 2VM8A 3D3AA 1GPFA 1K7XA 2YFOA 5DEZA 3TCEA 3HG4A 5LNSA 2E67A 3ZQ9A 4CQCA 1GVSA 3CTTA 2Z0IA 2OXNA 3OZPA 4DLFA 3TZFA 4Q4PA 1BXNA 2AAMA 1DJQA 1W8SA 4UTKA 5CZ0A 2J47A 1SW3A 3M0KA 1H0IA 4CLMA 1A0CA 5LIXX 5IM51 1W5MA 1JGMA 1DVJA 4IQDA 5A6AA 3CYJA 1W5QA 2V5CA 4B5SA 3HGOA 4LC6A 4ROPA 4CVUA 1AMKA 1TWDA 3CHVA 4XWUA 1SVDA 4Y90A 1GVEA 1R46A 4MVAA 1DQXA 3KZPA 3QM3A 3IARA 1A5SA 1L9WA 2VR2A 3BK0A 1ZHAA 3NOYA 3WLJA 1EGMA 3WJZA 2Z1BA 4IMEA 1BG4A 3FJ4A 3GU2A 3GTIA 2P53A 2GUYA 4Z2JA 1XGEA 3N4FA 3BSGA 3OA3A 5EL1A 2YDRA 5HJYA 3KS5A 1W1IE 3IJLA 5JXQA 3LTYA 4AXNA 1UIOA 3UJSA 3EBVA 3L66A 3BGGA 2ZC8A 2XWDA 2V2CA 1NARA 3W22A 1JRBA 1ONWA 4P7OA 3WLRA 3N2XA 4XVEA 4MUPA 4RLIA 4JR5A 3ZO9A 3MSYA 4M51A 2CWNA 1K7EA 2VENA 2W91A 1NFGA 3EPMA 4M29A 5KINA 4U28A 4INFA 3KCJA 3VDGA 3IIOA 3PR2A 4IPLA 5GNXA 3NNTA 4JNYA 1VPXA 3OLEA 2R94A 4IQJA 3WDRA 3IK2A 3FOKA 3IK4A 4FF7A 2Z6JA 2J6XA 3FY1A 2VFDA 3T0AA 3TSMA 3P3BA 2B7QA 4JKLA 2PWUA 2XH7A 3ES8A 1FCBA 7REQA 3ID7A 2H8XA 2CLHA 2DSWA 3BTNA 1W3HA 2WKGA 5D09A 3KVMA 2YLLA 2FB2A 4ADUA 5H8PA 2QUMA 3G22A 4Z2KA 3EWZA 1UH4A 3ZIZA 1TE6A 3CZKA 2E1DA 4HN4A 1MW2A 4I7VA 1KLYA 1QPRA 1W5NA 4CEXC 2A6NA 3RPTA 4LQ1A 1DHPA 1JF5A 4N6FA 4U33A 3U8GA 1O5RA 4LXFA 2BXYA 5DMNA 4MWAD 1V3LA 4GFSA 1VFMA 2W4XA 4TVUA 4OV4A 4IGMA 2QCHA 4F79A 4QJ4B 2QDDA 5IHRA 3QLLA 4JYDA 1OYCA 3TROA 2D2OA 3QPZA 3VC5A 3ARPA 1DXIA 3QXBA 1UP0A 3KBMA 4WOQA 2WWCA 1TMHA 3CHFA 3M7SA 4LWWA 1BWKA 2FHBA 4Y96A 1EP2A 4IPJA 1EFZA 1NWUA 4AB4A 5C8BB 1Q5MA 2ZA1A 4GYPC 2H9AB 2CLMA 3KCOA 1OG6A 2A3BA 2W66A 4XAZA 1R85A 3LLDA 4TX6A 1R3WA 1IQ8A 2VFEA 1QATA 4Q22A 1XBZA 1LF1A 2C3ZA 2HE5A 5CG7A 3EWXA 3O05A 2PDIA 2ZBTA 3IIZA 3AFBA 3SY1A 3G1FA 3NO3A 1UA3A 1Q4NX 3WF0A 2R14A 3H22A 1AMYA 1P1MA 2PDFA 2TAAA 4UUIA 5TNVA 4X0VA 4M82A 3PZNA 5A8PA 3OBKA 1WKEA 4IICA 1FWTA 4B5VA 1KA9F 1TG7A 2WB5A 4JN8A 3RN6A 1CDGA 2QJNA 3ARVA 1LL6A 1WBJA 1K02A 8A3HA 2RDUA 2CBVA 3PZVA 2WSRA 2OODA 4OZOA 1GG1A 2J74A 5IRPA 4UFHA 2WCSA 3KHJA 2ACUA 3UU0A 2GSEA 2G0WA 4C6IA 3GTHA 1PZ2A 2FVKA 1E3ZA 2DJLA 3UBPC 1SZFA 5CZTA 1GHSA 3IPWA 3TN6A 1JG9A 3W86A 2YW3A 3I6TA 3UXLA 4BF5A 2XJ7A 4MFEA 4B5TA 3WH7A 5DRCA 5F2GA 2TRSA 3LPPA 2DORA 2RKXA 3BV4A 4AZCA 3B03A 3KP1A 2VELA 2XG9A 4G7FA 3EGJA 3CPGA 4HJWA 3NQBA 2BGSA 2WCAA 3TYBA 2ZXQA 1XFCA 3FSUA 2A6LA 2V5KA 2VZUA 3AWOA 2F38A 4MHBA 3S4TA 4AIOA 5HXMA 1B3YA 3NOEA 1H2JA 3MUXA 4GXWA 3VDBA 1ZL1A 1C7TA 3UETA 4ECLA 3NR0A 4W8LA 4HBKA 3N9RA 3U57A 3EWBX 5A2BA 4Y9PA 3HPZA 3VIHA 1S39A 2GOKA 5EBUA 4HU8A 1OABA 3H7VA 4HIBA 5BXPA 4M5PA 4IGSA 4UR7A 4HHHA 4B3LA 1G9HA 3AICA 1V3HA 1FHDA 4HA0A 5D30A 3TP4A 3MYOA 1BF6A 4YN5A 2I5GA 5BXSA 5AVHA 2V5DA 3POCA 3C0LA 2J79A 3M0LA 5CBBA 5DMYA 4MWAA 1W54A 5TBOA 2J77A 3EX2A 3ZXWA 1SW7A 1POJA 2EJAA 4YCOA 4QM1A 1K3UA 3BLPX 1R3SA 3SUUA 2G95A 3PZGA 1SW0A 2QHAA 2FTYA 3LHUA 3PPCA 2WNWA 4A8RA 4IL0A 1AA1B 1GTHA 3O6DA 1FWGC 3CV2A 2PZ0A 2CU0A 3CL7A 3MW7A 3WLTA 3CS2A 1XGZA 2E9BA 5A8OA 2DIKA 1LLOA 8CGTA 3S1WA 1QPKA 5CEWA 1XL9A 2WM0A 4AISA 1UZHA 4FP1A 4NXKA 4KRUA 4DHGA 2POTA 1DJIA 1S2WA 4A8LA 1XISA 3V0SA 2NSOA 3MI2A 4Z42C 1YMYA 4HK5A 1GEQA 1LWIA 4XZMX 1GK8A 4ZQCA 5LA0A 4AX7A 5LGZA 3LS9A 3UXIA 1F8MA 1H09A 1IT8A 3TYAA 1W1A1 5F2IA 1LP6A 2DQXA 1B3XA 4HOXA 2F2HA 1L0PA 3AHTA 4KCVA 2A3AA 2UY5A 2WZEA 3DN5A 3EEZA 4NYYA 3MO4A 2R8WA 1E6NA 2O9OA 3TNBA 3RMEA 3GDRA 1UUOA 4WKHA 2WMKA 3OLIA 4C6KA 1A5LC 3SN4A 1B4KA 3LPOA 4OJYA 1YPIA 3ABZA 1PIFA 2CETA 3IJ9A 1TV8A 1P7TA 2HJPA 1H7OA 1RD6A 5CPOA 3RITA 1WOAA 4D6IA 3COTA 1FHLA 4PA8A 1Q4WA 5D2XA 2OWXA 1TZ9A 2D2HA 2WLZA 3VPLA 1RP9A 4FSAA 1M41A 3S9ZA 1QJWA 4XO7A 3H12A 3CUXA 2VR5A 1BYCA 1GTEA 3GDKA 2J7HA 4U3AA 3AIUA 3M07A 2FMNA 3DGRA 5D4YA 4M3PA 2GSJA 2Y7GA 4KIRA 5HAOA 5E93A 4F0RA 1IGSA 3OLDA 2I57A 4HSNA 5IBXA 1KKRA 4K8HA 2YL9A 1ZBKA 2GJXB 1VEMA 5A6BA 3AS1A 1J0YA 4AX6A 5CLTA 3OTRA 5JVLA 4E6MA 1DJYA 4AW7A 2REQB 4CQ9A 3L0KA 1OX4B 3D0CA 3HF3A 3E0IA 3LYEA 1V4YA 3LXBA 1L2UA 3WD1A 2D69A 5C2GA 3MMTA 3HN3A 4I9MA 4C6LA 3PC0A 1G67A 4NJGA 1IXPA 1KBIA 1KBLA 5HWMA 1HKJA 1JULA 1XUZA 5I78A 3DYMA 3TA9A 3N17A 4BEQA 1M01A 3UZWA 4ONVA 2XWEA 1MNZA 2QCDB 3O16A 4S2BA 1JZ5A 1ECQA 3AI0A 1ZJAA 1YEYA 2PLJA 2OWCA 3W23A 1A50A 4NILA 5FJUA 4F2TA 2YCJA 2XGBA 1HTIA 2VEGA 3Q2DA 4HU0A 4AZ5A 4YCPA 2ZX8A 4LVBA 1FHUA 1WZKA 3N13A 5HQMA 2GGGA 1POKA 5IFPA 3NDZA 4M1RA 4IGHA 2AL1A 3EYPA 4MNMA 5LA2A 2FKPA 2X42A 4UR9A 3IGUA 4TU1A 1VJIA 4IIHA 3EB4A 3MKCA 4RJEA 1K8YA 1YLVA 1GPWA 3STPA 4QDWA 3M7WA 3NQ6A 3RFAA 3LHYA 1UKQA 2Z2BA 4JCLA 1XYMA 2WKLA 4CD6A 4IZGA 4LBSA 1IT7A 3KXQA 2R91A 1VBGA 2O55A 2GJPA 1FH7A 2Z4GA 4GQRA 1I2RA 2OJPA 4PC8A 2C7FA 4XIMA 2DZAA 1RQEA 1W37A 2NZLA 5SWUA 1JDAA 3LXCA 4NSBA 2C91A 3O7UA 3O0FA 2PE4A 2X1SA 4UNLA 1HN1A 3DI0A 4DAFA 2Q8ZA 4JEJA 2WWDA 4PMUA 4OQVA 3C6CA 2UY2A 2VCBA 1B1YA 1H11A 2CPUA 3NYDA 2X1TA 4L1WA 5HQLA 3B4UA 3STCA 1MXSA 1TYGA 2DT0A 5C9XA 4JTJA 2OOGA 3GW3A 3HFTA 3WLOA 3QOMA 4TTGA 3KVJA 4K8EA 4IMAA 2WJFA 5F4WA 3V1HA 3KDOA 1WP6A 3TSBA 1VBJA 3N2BA 1PYFA 3NUKA 2J25A 1OIFA 3NIYA 3W84A 1IZJA 5JBFA 1SFLA 1RJPA 3G8RA 1JQVA 2OR2A 4GPNA 1DJGA 4AHOA 3HMCA 1V3KA 3TE9A 3AZSA 4MKSA 4LUSA 2Z29A 4LVDA 3HOJA 1XCWA 2VDGA 2B7PA 4BHYA 3VOHA 1V6TA 4GI6A 2C1HA 5IFTA 1FVPA 1W3TA 1F73A 4XK2A 5CXPA 1PEZA 4NX5A 1XD0A 4Q8OA 2A7NA 3EKZA 3WBXA 5JIPA 4EKJA 4YJ5A 4C90A 2DVUA 5AVNA 3LZ3A 4QP0A 5T91A 3W26A 4C5ZA 2Y70A 3NZPA 3XINA 2B81A 3DXIA 4GIEA 3EKGA 4OHQA 5CG0A 1LG2A 4JIIX 1OFAA 1UD2A 3U2CA 5AYBA 1LUCB 1VPQA 3S6DA 4H19A 3NL6A 3S47A 1A0EA 1OCJA 4Y9AA 3CHDA 1NJJA 3TJIA 1V6XA 3PZQA 2QJIA 2A4AA 2CZVA 3R89A 3VFLA 3MO7A 4PUJA 3TTOA 5IXEA 4H1ZA 3AYSA 2OPJA 3AHXA 3A47A 4O1AA 4RNIA 1A5BA 4BJHA 3BLEA 4OUIA 4L6OA 1FDJA 1B9BA 5CAHA 3VYLA 3L4TA 1X6LA 3AUJA 1C90A 2CZ5A 4ZZ9A 1H62A 1JIBA 2V63A 3IJ6A 2VYOA 2VZSA 3GR7A 1EH9A 3AS3A 2GGEA 3N2CA 4GO8A 4O14A 3IGSA 1XLGA 3DDMA 3AYRA 2PBGA 4IX0A 3EOUA 3WJSA 1D3HA 2E4TA 2OSWA 3RG6A 4JCMA 3BLIA 4C6BA 3S5ZA 4A3YA 4PUUA 2R9RA 1HVQA 3LBOA 1UR1A 2EEXA 5FF7A 2O56A 4FXRA 2VC7A 1ADDA 3TTQA 4WF7A 1U83A 3SRDA 4ZFMA 4L9XA 5DBUA 3C3NA 3N11A 3VGFA 2GQ8A 4HTYA 3H2MA 3TU9A 4GVGA 3WF1A 3TQVA 4MOZA 4HPJA 2BZNA 3LGEA 5AHNA 1HJSA 4JKMA 3RPDA 4PYSA 3F4WA 1QW9A 1OGGA 1AL7A 1OFOA 5E0FA 3MBDA 3XISA 4ACZA 2W6RA 3U2EA 5FJOA 2H3BA 3W1NA 3RDKA 1N82A 3O06A 4LAUA 4NG3A 3FJ6A 1V51A 3VX0A 5FESA 3UY8A 2W67A 3JZEA 4BA0A 3VIPA 4FNSA 2NXIA 3NSNA 3ARYA 1FWAC 4IX2A 3T78A 3ANYA 3UNTA 2QULA 1IWAA 3C2OA 4L6HA 4DO4A 1ODUA 4L4OA 3UCQA 1V93A 2CNCA 3RYSA 2E8ZA 4WSJA 3W7HA 1QHZA 5F2LA 3LCFA 5D32A 5BRQA 4FX6M 1U22A 2PTXA 4AZIA 1WA3A 3ARRA 1A5KC 1FHVA 3GR4A 4GINA 1XR2A 1EJVC 1OWQA 3T09A 3C0QA 5EMJA 5DCBA 3OODA 4K7YA 4ZA0A 4JFSA 5HNTA 5CH9A 4DQWA 5EYWA 1W1B1 2XPKA 5HOSA 3N2MA 3IANA 5H1WA 1HXJA 3WF2A 5HPOA 3LRKA 3OZYA 3KVKA 1HL9A 3ALFA 1A5UA 5M5DA 1EDTA 3EX6A 2Y4SA 5IDIA 3RF9A 2OSXA 1TVPA 3EA1A 5HQEA 2GVLA 5E0KA 3W37A 3P74A 3H4WA 3PBVA 3S2JA 4KT2A 1VEPA 3HG3A 1A5CA 6CGTA 1MUWA 4O1EA 4FX7A 4NHVA 3Q65A 1YW1A 3WUBA 2ZZ4A 2A3CA 4DF0A 4W7WA 1IWBA 3UGVA 5EMUA 1DIOA 5ABFA 3KW3A 1F76A 2QT3A 4GUIA 1KBBA 2HNHA 4PB4A 4KWVA 1LM1A 3R0UA 1K9FA 4ZENA 3S6TA 4HCHA 3N15A 3N9KA 3ANUA 4YTQA 3K1GA 1W3KA 4GCAA 2Y7FA 2H6RA 4WIWA 1TJ0A 3J7HA 1IIHA 3I7RA 3GVWA 4EF9A 1XM3A 5BOFA 4KF1A 4C6EA 3PHAA 1BYDA 2IW0A 1NM9A 4FNQA 1PWLA 1GQLA 1FDYA 3QY8A 5LIYX 4FIQA 1W31A 4U4MA 3N3TA 1ISWA 3BCDA 5CPLA 3QMSA 3O0KA 1UD6A 1TX2A 3EMQA 2YXGA 5DELA 2JALA 3UR8A 5I23A 4X9YA 1FWBC 5CSRA 1VYSX 4J3TA 1TV5A 2GFTA 4I7WA 2YB4A 4DB7A 5ABGA 4IM4A 1XG3A 2W92A 1ZPTA 3KOFA 3IGXA 1BRLB 3BLKA 4GY0A 2E6AA 3ORWA 1DIEA 2QPSA 4CNPA 2BY3A 1KTNA 2Y5EA 1KCLA 2Q3RA 4YXGA 4JFTA 1TJPA 1UR2A 5I24A 1OBAA 4KKXA 4C6FA 1S38A 4XBKA 3LNMA 5CQ1A 3GD6A 4JTRA 1TR9A 4LVFA 3CIVA 3DENA 4EXBA 4IPIA 1KXHA 1RLCL 4GUHA 4IIBA 5GNYA 3ZR6A 5FIPA 1EJ7L 2ALRA 1V0KA 3QJAA 3MY9A 3PUOA 4LY8A 1ECEA 5DANA 2V9DA 1H1YA 3H4XA 3SZ8A 3LPGA 2EAWA 1QI4A 1A49A 4E2VA 1OC6A 3BC9A 3T6CA 1XI3A 3IJ8A 3SGUA 2WQDA 2QGYA 1REQB 2VUNA 5HMFA 3GIPA 3P0WA 4FLSA 3AC0A 5K4XA 3TJLA 4OECA 5E09A 3HV8A 1BHGA 1KRCC 1OADA 4GVFA 4X22A 3FHAA 2WVVA 3GK0A 4GJ1A 5REQB 4Z1CA 4HK6A 4PL2A 3BLLA 4AYSA 1Y65A 2D22A 1AVAA 4A3QA 2FDSA 2AGKA 2CW6A 2J7FA 4LAOA 3UQNA 3FFSA 1VFSA 2TPSA 2R1MA 4FLQA 2G3NA 1QHOA 1CCWB 4US5D 4UQDA 4F0MA 3P60A 3LNPA 1JAKA 1FQ0A 1W91A 1XSJA 3TMLA 1X96A 5CC7A 4D6CA 3AS2A 2ZE3A 2ASHA 4HHMA 1AQ0A 3LN3A 3G0UA 1FCUA 2PDWA 5D2VA 2FB3A 3CL6A 4A35A 4FXJA 1O1ZA 2DUXA 4GI4A 2DVXA 3AZRA 4YL2A 1KGUA 1XW8A 2OYMA 1SFJA 2Z00A 2PCEA 1EKOA 3SFWA 2QIWA 2V3FA 2BOGX 5C9WA 3LV6A 1XLIA 1FKWA 4DJFD 4K6AA 2P0OA 3SCWA 1YRRA 2ICSA 1R9YA 4WY0A 1CIUA 1H5VA 2DZUA 3M0IA 4AD5A 4HPHA 4JAWA 2OB3A 4YWSA 3RX2A 2EPOA 4NAEB 3VZZA 3NGFA 2PDYA 2PLKA 3IAPA 4KRTA 2YDAA 5B7YA 2RGLA 3ZSTA 1JGIA 3L5MA 1XH2A 5XINA 1XYAA 4YS1A 2J8GA 1ADOA 2G3MA 1O5KA 1VHNA 1VP5A 4PCPA 1X39A 5GJNA 4H9ZA 4YTRA 3NQDA 1EUAA 3KS6A 4ML9A 3CMJA 2UWFA 1MEIA 4CU8A 1TWIA 3ONCA 1LRQA 4JFWA 2G3FA 5I7GA 1PE1A 2QS8A 5GPRA 6ALDA 1MSSA 5C5YA 4U5IA 2XGZA 5HATA 5BW6A 3FA3A 4CQBA 3VNDA 2GPTA 3AO0A 4GQGA 1LQ0A 2DP3A 3WLPA 3EDFA 3VFCA 1CZ1A 4O11A 3SY8A 2X09A 1W3LA 4GNVA 2QJGA 4IJRA 4Z2GA 1TPEA 1TTIA 1FDZA 2B0MA 3TLLA 1KC7A 5D9OA 3VABA 3LEPA 5ENLA 4MWAE 4BWLA 3LTSA 3QLDA 4UCFA 3GU1A 4Z1AA 3FA4A 2ISWA 1B3VA 5G5IA 4QISA 2OMAA 1IEXA 3ITGA 1VYRA 4J3UA 4A4AA 2F84A 3WSUA 1XS2A 1E0VA 4JTAA 4M1BA 1NSJA 2JKAA 4HOZA 3PBMA 3KLLA 1A80A 2WSYA 2FQIA 3MJMA 4MB4A 4B3ZA 4L4LA 3FW6A 1TUFA 4RKAA 4UCGA 3SB0A 3QEZA 3PZTA 4MADA 5T8GA 4S3JA 1VCFA 2OKOA 2ISSA 3LV5A 3M5ZA 2ON3A 4HA4A 5M1TA 1SZNA 1Q6QA 3V18A 1MRAA 3SRKA 1BG9A 4LYRA 3G0XA 4WGHA 4Q4MA 1XLJA 3MWAA 4US5A 5BU6A 5BRPA 5JU6A 1OFQA 2QYGA 3V7PA 3WX7A 4JD4A 5G1YA 2DZSA 4B3KA 3TK7A 5AHEA 4AF0B 1GOXA 3BZJA 3KRZA 3L4ZA 2FIQA 3VMOA 1A4LA 2FZBA 1X38A 2VP8A 4FZIA 3FKKA 1DBTA 2NQJA 3M0ZA 5CJNA 3OQ8A 1NF7A 3PSWA 4E5TA 1I45A 3T4CA 4ENLA 4QIUA 3FS2A 3HO8A 4DJFA 1TPFA 2IXVA 4TMBA 2FJUB 4C91A 2PDHA 4ML4A 4DYJA 1V6YA 3B0PA 1VJZA 3VNLA 3KX6A 2WPBA 2XH4A 4A8IA 3UG8A 2DQWA 3VD9A 1KWKA 4QBXA 5D8ZA 3UJFA 1JDDA 3W29A 3DBNA 1DIDA 4Q8WA 3AS0A 1Y5WA 3MI6A 3UNDA 1L6WA 2A3LA 4C6OA 3C2RA 1WKYA 3W07A 3WNMA 3STFA 1Q8AA 1RXOB 2EF9A 1QASA 4PULA 3NZGA 1M7XA 4GE8A 1E4LA 4KFNA 4L56A 5AHLA 2ZICA 3KBVA 2PD9A 2FPYA 2J8FA 2ZZ6A 3QYSA 4PCNA 1W3NA 1TA3A 1NVMA 2WC3A 1P1XA 1YTEA 3VU2A 4A3HA 4MAVA 3EOEA 2E6YA 3WH8A 4XUYA 4V28A 3TYCA 1E5NA 3FDGA 3EDEA 4REQB 2LLEA 3W7PA 4D8ZA 3RGTA 1TWZA 4EOUA 5D2TA 4M6UA 3GZAA 2JF6A 4BKNA 7XIMA 4KETA 3NL5A 3LLFA 3WMLA 3UT0A 3VKJA 2A79A 2CERA 1QU4A 3BLDA 1PDZA 1VBRA 1MUMA 3BSHA 1MZRA 1SO3A 3IUIA 3TN4A 3BMXA 1CLVA 3DC8A 2OSYA 4JFVA 2WNQA 1CB7B 1PXGA 3CAVA 3OIXA 3ITVA 1DHKA 3D5HA 3FSTA 3U6WA 4RXGA 3DHFA 1HJWA 3R12A 5AC7A 4FHAA 4BEUA 2E0PA 1J11A 4MNKA 1XPYA 4DJDC 1KR0A 1GJUA 3OGSA 4NZCA 4QITA 3TAKA 1KBKA 1PX8A 3WBAA 2FZ8A 1WYIA 1F3EA 2VDHA 3W2KA 3OIHA 3IACA 4OE7A 1IIGA 4PSRA 4LNCA 4S23A 3DFHA 4IQLA 4RNFA 1QXLA 1WZLA 2PDXA 4JTKA 1BXBA 4KCWA 1YTKA 4PMNA 3O63A 3WK3A 3WH6A 3GDMA 3ITXA 2Q8XA 5FJPA 1R87A 4QG6A 1PKYA 2OKTA 3VD3A 2ZKMX 1UZDA 1KFKA 3URBA 1JZ8A 1XLCA 2XHYA 5F2MA 3CB3A 1US3A 1VFFA 2HNEA 2OCZA 4HN8A 4HSOA 5I77A 3THDA 3G6LA 3HIJA 2Q01A 4B5UA 3EAUA 3K1DA 5CC6A 3CLWA 3PY2A 2DDXA 1W9BM 4ZCWA 1J2BA 3SBFA 3TC3A 5DMLA 1HJXA 5H91A 1GJWA 3FYOA 1ZBCA 4HPXA 4GX8A 4GIRA 1N8IA 3Q37A 1R3YA 3C8NA 4MDOA 4NZ3A 4GFIA 2I5QA 2NLIA 5EU9A 3TNOA 2JKEA 3LX9A 2PLMA 3LBMA 2C1IA 2PRLA 2BFGA 2QAFA 1G4TA 4PMOA 1U1UA 4W8AA 4ZFCA 1B9ZA 1E6ZA 3KBJA 2WANA 1Q6DA 1UJQA 1WE5A 1OX6A 2X30A 2BVTA 3W3OA 3L0GA 2PCQA 4S3EA 4YYFA 4PBFA 1S5MA 3P82A 3H2AA 4MG4A 1ONRA 5AZ0A 1ZJBA 1X8CA 2ZX7A 3N9SA 4GZJA 1HL8A 4MPQA 3PNZA 1SFTA 2DZVA 1Y5XA 1BQGA 2YL6A 1XX1A 1BLIA 3CJPA 3NQFA 3QGAC 4D6EA 3RO6A 2PGWA 3V4BA 5EMYA 3NPVA 4ES4A 1E6RA 4D9PA 3DFYA 2NQLA 2IQDA 1JUKA 3W1UA 1AJ2A 4V1XA 4U10A 1DP0A 3LXAA 2PDJA 3UVIA 2PODA 4J3SA 1DXEA 2VZTA 1OG0A 4JQAA 1D3CA 3W72A 1BGGA 4AWSA 3B8TA 1K8XA 4B5NA 4ZSTA 3W1LA 1JDFA 2DV0A 5I06A 2J66A 2REQA 4ROQA 5BXRA 3GSMA 4AVOA 3IUHA 4E4UA 3LUTA 3WMBA 4H3DA 1GVYA 1TE1A 2G37A 3MVIA 5EBAA 2FHCA 1S2AA 5CCZA 1XYLA 4F9DA 2YA2A 2RDXA 1CGYA 1Y8BA 4UBPC 4YHEA 2ZX6A 2PP0A 3QTPA 4Q6XA 1TPC1 3L4XA 5C7HA 1I75A 2X2GA 3V1PA 3PG9A 3GC5A 4OBRA 4LRSA 3RRAA 3UWQA 2BODX 3KRUA 1GOKA 4QX4A 1J12A 2H8ZA 3G8EA 1UR8A 4JTFA 4JIRA 1XLHA 4TX8A 3L7RA 2XVKA 3M0JA 5CSYA 1D8CA 3KRBA 3WQGA 2PWGA 5FEPA 3KBNA 2OT0A 3EDJA 4WD0A 2ATMA 3EXTA 4NZFA 2DUAA 4H2CA 1R7AA 1TUXA 4CNOA 4MSSA 1JCYA 1E1CB 3CAQA 4KGLA 3WN6A 1NTHA 4UTJA 1JPHA 1CLKA 4J3ZA 4IMFA 3T81A 1QI2A 2NLYA 1XXXA 1CGWA 1HFBA 3HB9A 4F9JA 4JGDA 3MDUA 4XX6A 3VILA 1SUXA 1M04A 2Z2AA 1SYTA 4BI5A 3SDOA 4IH3A 4XTDA 3E0LA 5KSWA 1PO9A 3R11A 5DT5A 3NO5A 1YXDA 3I6RA 3N04A 4XKYB 3WK0A 2SFPA 4FB7A 4V15A 3BW3A 4OBTA 1XBXA 4Q8VA 1XFBA 3R6IA 3UG5A 3E74A 1Q13A 3WLKX 1ME7A 1NY1A 4FEZA 1S1RA 3WQFA 4FALA 1UR3M 3KTCA 3EXRA 3CM4A 3GR8A 3QC0A 4EANA 3KAOA 2BP1A 1J5TA 2XH0A 4AIEA 1MFUA 1TIMA 3N29A 3QZEA 2QKFA 3EOSA 1OYAA 4UOQA 1IEVA 3ZR4A 1I2OA 4EF8A 5D9PA 3AYVA 2UY3A 1ZAJA 2ZIDA 1XLAA 1QDSA 3ELFA 1EP3A 3VMPA 3ZT5A 5MKGB 2FH6A 4I8YA 4UMCA 7ENLA 4FX8A 2WVSA 4RE0A 4YLWA 4ZOEA 2GWNA 3SJNA 2QJHA 4AVFA 4XVDA 1QPQA 4N6EA 1DE5A 2DPEA 5LXXA 4IMDA 3AZTA 3SGGA 2X0YA 5I6SA 1TREA 4RZ5A 3B8IA 3QVQA 1NQ6A 3REQB 2JQXA 2HPMA 3VKKA 3GHTA 1ZS2A 1M53A 3OVGA 3FKRA 4M7SA 3LCIA 2V81A 1DKWA 1WDWA 3N2TA 4E38A 8RUCA 5CGMA 3IJDA 4HU3A 4LJ3A 2VEIA 1I2NA 4CU7A 3IV3A 1K9TA 3C8FA 1ISYA 7CGTA 4BQ5A 2ZUTA 1HKKA 2YJQA 3SW6A 1R8LA 3QMTA 4DO7A 2RAGA 4DJEC 2CBUA 4B16A 3B8VA 3N1AA 4KIEA 2GGIA 4LSBA 4W5ZA 2O9PA 5EMKA 1IV8A 1KM0A 1LLZA 4X2PA 4PTMA 4XISA 2VEFA 3S3GA 4CUCA 4DZIA 4KEUA 2J78A 4L61A 4A3RA 1YPFA 1MYRA 2WMIB 3O3RA 1M03A 2HDJA 3L67A 1GVRA 3F4DA 3PPHA 1ZZMA 3ITOA 1VRXA 5A2AA 4W7VA 2X8RA 1W6TA 2CYGA 2YBUA 4PB3A 2XIMA 3EB3A 4PFMA 3W38A 2VD8A 2VMFA 3MC5A 3LM3A 3OO2A 1F3TA 1YTDA 1RQBA 4M6PA 5F4XA 3NQCA 4UMAA 4PUWA 1AD4A 3MV01 4OOZA 1UKSA 3I65A 1UUQA 3M0HA 5G2IA 4XQ6A 1SO6A 3W28A 2X1RA 2NV1A 5LA1A 1Q6GA 1T8XA 3G1DA 1JD9A 2DW6A 1Z42A 4JN6A 3WLNA 1KWGA 1NWTA 2CESA 2QVHA 3QQWA 2QMJA 4WUIA 3NM3A 3W75A 1HNYA 1KRAC 2QCGA 4WK9A 2GJLA 2R6OA 1R3TA 3INPA 5HK4A 3PF3A 3LU2A 4RR4A 2WNZA 5T9CE 4LALA 3TQKA 2DT1A 1LQ2A 4LAZA 3KDNA 1M68A 3ERPA 3ISIX 4UNKA 2XU2A 2AQVA 3WK1A 1UC5A 4JKKA 1TVLA 2XN2A 4LCSA 3M64A 4GQBA 3W7DA 4Y9NA 4UQAA 2OLAA 5I03A 1RV8A 3PN8A 3HU7A 3TJXA 4WEVX 2I17A 4UQBA 3TYZA 3FGCB 4A8NA 3UR7A 2WBKA 1XYFA 1NFPA 3OQEA 3AJ7A 1A3WA 1OFEA 1MDRA 1XIEA 1E0XA 1XIGA 1TQXA 2OEKA 3MKKA 3DAQA 4QTGA 2F7FA 2GQ3A 1SO5A 1EQPA 3GU9A 2ZQ0A 4F66A 1E71M 3QGKC 4WXYA 4ZOBA 1DWAM 2ZFAA 4AAJA 3VM5A 2NQZA 3UPMA 1PKMA 4OU1A 3RCMA 2W61A 1R6WA 1F3WA 2PSNA 2JE8A 4GYJA 3S5NA 4AZ6A 9CGTA 3BQ6A 1PWMA 1LT8A 5HULA 1PS9A 4H7CA 4MY8A 3WLMA 4GH1A 2HRWA 4O15A 4IIFA 2R1LA 5EY5A 5ECVA 1JQXA 3LSBA 1GVQA 4ASTA 3CUIA 5G4HC 2J24A 4ZB5A 2GQ9A 4YWIA 5CJMA 2Y7DA 4QNWA 4N7QA 1EJSC 3L65A 3LI0A 3M4HA 1JCLA 2Z28A 1HZYA 1E9IA 1RA0A 3KWXA 2IMRA 1E0WA 1EUNA 3ZZ1A 1B30A 3QW4B 1ZBWA 2GK1B 2DUZA 3MHFA 3GUGA 3WFZA 1ZTVA 1H7WA 3ZJ8A 3L23A 1GZ1A 4LW7A 5FJIA 2QCMA 3P81A 4Q3MA 4JS3A 5ABHA 5C54A 2CC0A 4DUOA 4AD0A 1EHAA 1NAL1 3PBWA 3MUCA 3ZVHB 1GZGA 1O68A 3T9PA 1UB3A 4L4MA 4O17A 2D2GA 2ESCA 1FXQA 3PWGA 1AQHA 3BGAA 1US2A 4AD4A 4NF7A 4RDWA 3BLFA 5BCAA 4CCCA 4K8GA 2PGFA 2PDGA 1HJVA 3BLOA 4J35A 3AROA 4GC3A 4UFIA 4FOUA 4XV0A 2R24A 3TN5A 4J5NA 5FF4A 3B9DA 1RUSA 5E0CA 3SIZA 1CXHA 3EPNA 3HA1A 4KFPA 5I3GA 4CCEA 3AIVA 4Q8MA 3B40A 2QV4A 3G1AA 3VAVA 3BH4A 1GT8A 3ARXA 3U2ZA 4E2OA 4Q32A 3N4AA 2FZNA 3BL3A 3ZT7A 4DY1A 2E9LA 4PRWA 3VINA 5KZ6A 4Q7BA 1AJ0A 1J0HA 4L9ZA 2H3DA 5HR7A 4V27A 2YL8A 2J6VA 3VCNA 1V02A 1HO1A 2W79A 4DRSA 2FDMA 1E5JA 3QPYA 3ME3A 1GQIA 3LZ5A 3OOQA 5I3JA 5CPQA 4KEMA 3UXKA 2QF8A 5A8NA 1PIIA 3B3DA 3LCXA 1J6OA 1KM2A 5M17A 2PWDA 5CSSA 4AWTA 3THAA 4H9TA 3CV1A 4H04A 3CU2A 5FSDC 2ZXBA 4Q8QA 3IRDA 4TOQA