1G67A

Thiamin phosphate synthase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
GIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 82
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g67A00
2LLEA 3LHUA 4KFNA 2VEPA 1YPIA 1JCLA 4UNLA 4O16A 3W7HA 2CLKA 3N9RA 4LVAA 1W3IA 3A9IA 3W85A 4UTTC 1EA0A 1W5QA 4ADSA 1GG0A 4HN4A 3DGRA 3W2MA 2CLOA 4UTHA 4JTJA 3FJLA 1R47A 3C4UA 5F4SA 2Y62A 4JDBA 8TIMA 4O0KA 1FX6A 4K38A 3PC0A 3NQCA 1TPEA 4ONVA 3FKRA 3S9YA 4TR9A 3HPZA 2BX7A 5KINA 2DU2A 4O18A 1SFLA 3DFOA 4FNTA 2NUYA 3NVTA 3L21A 1Q3NA 2QKFA 4E2DA 1EUAA 5AHFA 3P8IA 3C52A 4EF8A 4UFMA 2B7PA 2FIQA 1TTQA 3G24A 3HIJA 2PRHA 1I45A 4O1BA 2QCFA 3TDFA 4DPPA 2JK2A 1BTMA 3STFA 1MO0A 1N55A 2Y70A 3TSBA 1YDNA 1XI3A 1MEWA 1V5XA 2QDGA 3FIGA 5C55A 3LCLA 3CM4A 1FCUA 2C14A 4XTDA 1OK6A 4EWND 3W7LA 1OYBA 3ELFA 3CQ0A 1C9DA 1TV5A 2H3BA 3LHVA 2RDTA 2HS6A 4JTIA 3LX9A 1YTEA 5KSWA 4A21A 1R30A 1XC4A 3M5ZA 4AAJA 1KTBA 1TRIA 4QSHA 3UY8A 4UFJA 2ATMA 4YLWA 3L2IA 1DQWA 1K7FA 3NR0A 3O6CA 3RK8A 4CNOA 2ABBA 4CNPA 2R91A 1RD5A 2YFOA 3M7WA 3SSJA 2TRSA 3T40A 2BZNA 1IIHA 3NQ2A 2Y89A 2VKZG 2UV8G 1W3TA 2RH9A 1G7VA 1TPDA 1NAL1 2J24A 3F4WA 1I4NA 3EX4A 1VLIA 3EKLA 3TFCA 3P84A 2V8ZA 1EIXA 4XUGA 5KITA 2PURA 1GTHA 4NNCA 4S1FA 1LZOA 4LT9A 1SR9A 3CIXA 4O10A 3G1DA 5H91A 2ZFAA 2QJHA 1H7XA 3P67A 3T78A 3SJ3A 3UZJA 4U4MA 3MHFA 3EWWA 3WK1A 2RKXA 3LERA 1YYAA 1YDOA 1ZAHA 1LOSA 1XM3A 4NX0A 5D38A 3JS3A 1F6PA 2NLIA 4NJKA 1FCQA 6ALDA 1PE1A 1QPRA 3GXPA 4NXSA 5EBUA 2ZQ0A 1SU5A 1XUZA 1YXYA 3BV4A 3V75A 4NNBA 1PIIA 4MKNA 1OX5A 3M9YA 1C8VA 4MJMA 4KWWA 4K8EA 3DKJA 2BTMA 1A53A 2O7SA 3WFAA 4X2RA 2A4AA 4IXXA 1YPFA 4FHAA 2VENA 3VE9A 5ABTA 1VH7A 3GKFA 3GDKA 3O06A 1G4PA 1VGAA 1TPVA 4MJZA 3C2EA 1QDSA 4K8HA 4Z1CA 1KTCA 5K4XA 2QUVA 1NVMA 4WXZA 4KKXA 1M7PA 4Z0JA 1A5SA 4JY9A 3ZWTA 2FB3A 3M44A 2VEIA 2PCQA 2YX0A 3MHGA 3HPSA 3CC1A 3F03K 5D37A 3LBMA 3BW3A 4NQ1A 1EWEA 4H4IA 1PCKA 4YXGA 3RMJA 3ZFHA 1F6KA 1C29A 5LNVA 4OE7A 5K2ZA 3TAOA 3LHYA 5F1VA 2X1UA 4LY8A 2QCEA 1TIMA 4UTUA 1SQ7A 1R2SA 3HGSA 1JUBA 4N9DA 1XBYA 4LUJA 1QFEA 3A5VA 3LB0A 4I7VA 4N9CA 2FQIA 4RLIA 4QQ3A 5G2IA 3TW7A 3W7CA 1GT8A 3TC7A 4PA8A 2ZBTA 4LW7A 5A5WA 5DCDA 1K03A 1PCWA 4QISA 3W7QA 3GYEA 5EMUA 3QMSA 3ANYA 2NZLA 4I9AA 4FXSA 1O5KA 5DBUA 1TQXA 2HTMA 4NJGA 3NO5A 4RZ5A 4GNJA 1QMLA 3G8EA 4PCFA 2H6RA 3GR8A 1KM4A 1ICSA 2WOQA 3DAQA 2YSWA 5D32A 3OA3A 1EP3A 4NX5A 1EEPA 2H8XA 3PG8A 1SZNA 3FOKA 2Q3RA 2DJLA 2X16A 3QYQA 2WSYA 4JR5A 1IIGA 1JVNA 4Y6GA 3PS7A 3MBFA 4HHPA 3EXSA 1OYCA 3CU2A 4JTKA 2FTPA 1KM2A 4EF9A 2GQ8A 2E68A 5AHLA 2CZEA 1WA3A 2ZTKA 3BLIA 4LC8A 4PL2A 3ATZA 5D02A 3HJZA 4UFKA 4K36A 2JBMA 1TJRA 4LS1A 3MP3A 4IMDA 5FI8A 3R89A 2V82A 3N2MA 2FPTA 5CSSA 1SO3A 3GXNA 4O15A 4CLMA 5EY5A 3LCIA 1TJPA 4CQ8A 4PC8A 1LCOA 2TSYA 3DH7A 3AO0A 5D2TA 1H7NA 1UJPA 1VYRA 3L67A 4WXYA 3A24A 2CLIA 4OBTA 3IRDA 1L6WA 4N9BA 5FF4A 4XWUA 4JY8A 4MY8A 1YTKA 4FIQA 1F7BA 4LV4A 3TXVA 3GVGA 3I7SA 1Z48A 1DL3A 3CTLA 2A5HA 3LXBA 2E77A 2V30A 4Z08A 5CZJA 4JYDA 4ML9A 1PS9A 3W7DA 2VXNA 4HSNA 1VQTA 3TAKA 2ZZ7A 1K02A 4RXGA 4DXVA 3LOTA 4OGZA 1GJPA 1N7KA 3C61A 1H7RA 1THFD 4BFAA 3W72A 4XQ6A 3P5ZA 1VR6A 4FNRA 1OVDA 2VFGA 3TE9A 1BKSA 3W1AA 2HS8A 4DBDA 4MZ8A 1W37A 1K7EA 4PL1A 5DCBA 1WXJA 2X2GA 1NEYA 3W86A 3SW6A 1OHLA 1VRDA 4LWWA 1TTJA 1UUMA 4MYXA 4JIPA 3NXFA 3W07A 2EKCA 6TIMA 4O1AA 5K9DA 4GJ1A 4TO8A 4IX0A 3HF3A 2A7RA 2B7OA 1VCFA 4ZQRA 4IX2A 3L9CA 2Q8LA 3DU0A 1I2NA 1UCWA 1KM3A 3ABOA 5AHNA 1I2RA 3DI1A 2TYSA 4MFDA 1W56A 2VEKA 3DFNA 1S5WA 4TIMA 5BW6A 4UNKA 4JTHA 1GZGA 2ISSA 1SO5A 2DORA 5K7JA 2VFFA 2ZZ2A 3W7IA 2V81A 2YGYA 3UWWA 5KMYA 3L65A 1CW2A 1KA9F 3TK7A 1J4EA 1IXOA 4D2JA 3UY7A 1AL8A 4MY1A 5HNRA 2BLEA 5D05A 3GX9A 3UPWA 3RLVA 4O53A 4NU7A 1TPFA 3BW2A 4K7YA 5LNWA 2IQTA 3DFSA 3G1FA 3TQ0A 1ONRA 2C0AA 4NJIA 3W2NA 3W1UA 5F2LA 2EF9A 3KFTA 1H5YA 5BRBA 1D3HA 5FF2A 4FNUA 5D30A 1WV2A 3WK0A 2E09A 1LRQA 2EPHA 3S8HA 1IF2A 3I6RA 3NQ7A 3HGJA 4UFIA 4Z1AA 3M5VA 4LC6A 3MUXA 1AW2A 4I7UA 1D9EA 3MYOA 3G1AA 4NJHA 2QCDA 1KBIA 1WOBA 2Y61A 2QCCA 3NG3A 4M6QA 1WBHA 2DZUA 1G69A 5IBXA 3QZEA 1TYGA 4M7SA 4JICA 3EX6A 4FB7A 5I3GA 3UWVA 4RK8A 3B4UA 3W2KA 4LUIA 3TUUA 5I3JA 2WKJA 1H1YA 2V5BA 3FEMA 4ADTA 3NQ6A 1S5TA 2ZRWA 1S5VA 2G5WA 4MLRA 2V2HA 1S3HA 3NQMA 3CWNA 1LBLA 2Y7GA 5I3HA 4ORIA 4NNAA 4CCEA 2F84A 4GUFA 4MIMA 1QR7A 2Y6ZA 4Q4KA 3PUOA 3W7NA 4WY0A 1SSDA 4JTGA 5AYXA 3UPBA 3W6YA 3MBDA 5DN1A 1KFJA 3NPVA 1T99A 1OFPA 4O57A 3PB2A 3G3DA 4DBEA 4O54A 3VCRA 2B0MA 1GQNA 4AWUA 3L68A 5HMSA 1CI1A 2V9DA 4JS3A 1YXCA 3T44A 2WPBA 4WOQA 3LGEA 1G4TA 1FDJA 3OVPA 2HSAA 1JCXA 4WY0B 2FDSA 1XBVA 2BWGA 4A3UA 1B57A 3LHZA 1LM1A 1DV7A 3O05A 3TR2A 1BEUA 3KVKA 1A5CA 3CLMA 3CWOX 4RR4A 3TQVA 5J5RA 4K37A 1H50A 2ZRXA 4GC4A 3B8DA 2JGYA 1Q6LA 3OEXA 4R7JA 5DBTA 4N6EA 3W3OA 3S1VA 3TV8A 2A7PA 2QCNA 4PFMA 2V2DA 1NF0A 4BI7A 2CFFA 5AOUA 2PE4A 4RX0A 3S5NA 1FWRA 2CU0A 5LNSA 2ZYFA 3C8FA 3B05A 4AB4A 1KBJA 1SZGA 3PWAA 3TMQA 3N3MA 4XKYA 1AK5A 2ZZ3A 3W7RA 3M1ZA 3PR2A 4OV4A 3O8AA 3G1HA 1LTDA 2WSRA 3W2UA 2Q3OA 1WBJA 2YYTA 4OQVA 2Q8ZA 2X30A 5HULA 4BK9A 2AQWA 2J9YA 3MJYA 3M47A 1Z42A 1P1XA 1G67A 1K8ZA 2P0OA 1EWDA 3GAKA 2G96A 1D3GA 2GQAA 1OFRA 2ZTJA 1TRDA 3HOJA 4IPIA 3NQAA 1I2PA 1O60A 1IXQA 3OIXA 5CKSA 4LRSA 1W5MA 4Y96A 4LU0A 4IJBA 3HG2A 3MW7A 3GB6A 4XKYB 1ADOA 4ZZ9A 1SW3A 2QCMA 1O95A 3MHUA 4UCGA 4LV9A 3B04A 3WK2A 3G0XA 5DY3A 2CWNA 3DBPA 3IIXA 1EP1A 3K30A 4HT3A 3EXTA 3UYCA 4H6KA 1FCBA 5LGZA 3NM3A 2ZRZA 3S0CA 5CPMA 2QJIA 5U7SA 3PBUA 3LV6A 3RNDA 1L2UA 4HIBA 2GJNA 1VJIA 1P4CA 3AJXA 5BMXA 2XN2A 2Y85A 1EUNA 3UZ5A 1ZNNA 1R2TA 1XDMA 4L4MA 4O0ZA 2ZRUA 2WNNA 1QNVA 3NOEA 3R13A 1WX0A 2Y7EA 3HG3A 1TO3A 2AAMA 3G1VA 3QQ1A 3LXCA 4QITA 5CZ0A 3T4CA 5KTLA 4PH6A 4RZ4A 4N02A 2C3ZA 3N14A 3UQNA 4JEQA 3WJZA 3EEGA 2OJPA 1VYSX 5BNKA 4LVFA 2CLHA 2CZ5A 1RQBA 4G1KA 1OG0A 3VKJA 1FCVA 3TJLA 2E5DA 2FFCA 3B0PA 1W5OA 2NWSA 2DP3A 2H90A 5MHBA 2CZFA 2VEMA 1LYXA 1SZFA 4OWGA 4M5PA 3LM7A 5G2HA 4EIVA 2ZZ5A 4RXFA 1OX4A 5BOOA 4Y90A 3W83A 3MP5A 3FA5A 3GNDA 1F05A 4IGHA 2V0TA 1T8XA 4WOZA 4FF7A 2GJLA 4BI5A 1UASA 4FXRA 1QO5A 3I7QA 5IBXC 4FNSA 3L5LA 1T0OA 1G4EA 3WJXA 3HBLA 5TIMA 2GVGA 3B06A 1B4EA 3WJYA 2VFDA 3QEZA 1ZENA 2CLLA 5HJLA 3DKLA 3P61A 3IIPA 4GRSA 4ADUA 3I68A 3R8RA 1KTNA 1OX4B 2CZDA 4YMZA 3IEBA 4HSOA 4UXDA 5T26A 4KWVA 4N9EA 1F2JA 3LHWA 1RZMA 4RV8A 3THQA 2FJKA 3D0CA 4ALDA 3E49A 2OX1A 5EKYA 2A7NA 3A5FA 4UC5A 1LDCA 1VCVA 5H2ZA 5AHIA 2F7FA 4QM1A 4JNMA 3W73A 1BWLA 1YLVA 3IVTA 3ZR4A 1PL9A 1MXSA 1QPOA 3JR2A 1Z41A 4JX4A 4HPJA 1J5TA 1Z44A 5K4ZA 3E12A 2ZRVA 5GVJA 4CQAA 1OX6A 3QPYA 4JYEA 4QNWA 1G6CA 1M6JA 2YZRA 1BWKA 3QSTA 3NGJA 1FXPA 1KLYA 4UFHA 3S5OA 1JQVA 1I8JA 4DQWA 1OFAA 4GFSA 5CPLA 1KLZA 3W23A 5F2GA 2ZZ4A 3I65A 1F74A 4EVZA 3G18A 3G0UA 5FEPA 3GDMA 3TX9A 3OVQA 3PUEA 4S2BA 4XTIA 1O4UA 4GUIA 3NPXA 2QCLA 1B4KA 4GWEA 4OV9A 3MP4A 5AN7A 1H62A 1ZJIA 1HUVA 4DELA 4ZMGA 1Q6OA 4O14A 4FX8A 1FXQA 1G4SA 2C15A 4ZL1A 4AEOA 1H7OA 3BG9A 3NEVA 1KV8A 1W54A 3IGXA 3NQ8A 3H53A 2QAPA 3TU9A 4EOUA 1A50A 3Q37A 5KZEA 2A6NA 3DFQA 2QUTA 1MEHA 3QPZA 1OJXA 3NPUA 3KHJA 3HB9A 3GDTA 1EB3A 2V2CA 3A22A 2QAFA 1L9WA 2Z0IA 5HWMA 1TPH1 4UTIA 1GYNA 4NJJA 1JUKA 3W1PA 1SFJA 2C19A 4RZ6A 2JKEA 3C2FA 2B7NA 5I3KA 4IMGA 5EL1A 4QJ1A 2NX3A 5CG7A 2NUWA 4AWSA 4WY0F 3S6DA 3P80A 2R14A 4ORMA 1KW1A 3TCEA 3HPXA 1FDYA 3B0UX 5LNUA 2X1RA 2RDUA 4N4PA 1K8YA 1W8SA 4Z0SA 3L66A 2GQ9A 2NV2A 3LI0A 1NF7A 4MZYA 3CIWA 5K9CA 4X3ZA 1KM5A 3NAVA 5BMWA 4KFOA 3YPIA 4ICNA 4JGDA 4JX5A 4JTUA 2C16A 5K3VA 4M7TA 1ZFJA 3EWXA 1OABA 3M6YA 1R2RA 4Q32A 4UR8A 5FEWA 5AYZA 4XBSA 4AWTA 2OZ0A 1JCJA 4IWWA 3DFPA 1QPQA 4J9JA 4YWIA 3P74A 4LS2A 3LRLA 3O63A 4K6AA 3PBWA 3E96A 4JTLA 3DFTA 1MZHA 1DOSA 2ATSA 4ZVJA 3IIZA 2VFEA 4LVDA 4NVTA 2WO5A 3W1XA 1LRTA 2ABAA 3GLCA 4N6FA 5AHMA 1TPC1 3C56A 5HQEA 3G8RA 3N73A 5D2WA 2DZVA 2RDWA 1DBTA 5DCEA 5HWNA 4ZQNA 2Y7DA 2FPVA 3ABQA 4AXKA 1XBZA 1I2QA 2DZXA 5AYYA 2YPIA 3LRMA 2E6DA 3THAA 5AC6A 4JTTA 5CZTA 4MPQA 3CPRA 3NQVA 1HFBA 2J88A 5EYWA 3W2LA 3NM1A 2OT0A 3QW4B 1GYLA 4MUZA 1XUUA 1NSJA 3C2VA 2TPSA 3P8JA 3LCHA 3ZS4A 3KXQA 1FWTA 1F5ZA 1K7XA 2ZCGA 3EWUA 3HO8A 4A2SA 3W7JA 3DZ1A 3MWAA 1ZAJA 2ZRYA 3S1UA 2G97A 5EA9A 1W0MA 3G1YA 1GVFA 2Y63A 3N9SA 3NDOA 3NQFA 1O5XA 1P0NA 3MI6A 5E0KA 3W7MA 4B5NA 5FF0A 4GXMA 2ZA3A 3SIZA 1X1ZA 3RLUA 1F76A 2W0UA 1QCWA 2NX9A 3S5ZA 4MLJA 3ABRA 3N34A 1J2WA 1QOQA 7TIMA 4ZQMA 1GVQA 4NZFA 4MOZA 4LVGA 2QEZA 5E93A 1H7WA 2NV1A 3BGJA 5G1TA 1OFOA 1JCMP 5FF7A 1IXNA 4X22A 4MVAA 5L9FA 1ICPA 1L6YA 2GVLA 2JGQA 1OFQA 1QOPA 3TQKA 5L6UA 1LORA 3W7KA 3FYOA 3LLDA 5AB3A 3LCWA 3HGOA 2VFIA 3GNNA 3W7GA 4L4LA 1OFDA 3S1XA 4UR7A 3W1TA 3W1QA 3B03A 1EP2A 4JX6A 4MY9A 3T55A 3GAYA 3RFAA 3M43A 2WSQA 5I3IA 4DPQA 1RPXA 2QCDB 1K3UA 2PRLA 2I14A 4DF0A 5D03A 1WOAA 1DQXA 2PRMA 1Q45A 3QFEA 4UMBA 5DXYA 3QW3A 2W6RA 4I7WA 4YCOA 1W31A 3PULA 4O19A 3W1RA 2P1FA 3W71A 2C6QA 3W74A 3ABSA 3BG5A 5C5YA 3LDVA 2QJGA 4TMBA 1GWJA 2JKAA 2J6XA 2EAWA 4GE8A 4FIRA 1Q6QA 1DJNA 4Z1DA 4N2YA 3PB0A 1KFLA 2NXIA 3PAJA 1VYPX 3W2JA 3P81A 1TB3A 1SW0A 1TPWA 2YCEA 3TXZA 1OK4A 1SO6A 4NUWA 2BXVA 3LCFA 3FJ6A 1U83A 4HNTA 1ZHAA 3NNTA 1YDVA 1VZWA 2VC6A 4HNNA 1ZAIA 5U4NA 3ZWSA 3UXAA 1TV8A 5AC7A 4PEKA 1HG3A 4UTLA 1KFEA 1KM0A 3KVJA 1P5BA 4NZJA 2G95A 4JXCA 3KVMA 3KVLA 2YW4A 2FB2A 1WAUA 3PG9A 1O94A 4BF9A 4LVBA 4P61A 3BK0A 4IQLA 3VE7A 1DJQA 5LSMA 3IVSA 4LOCA 4MYAA 5K9XA 1W3NA 1XCFA 3EWYA 1TCDA 4YCPA 3BGGA 4QNEA 3QC3A 2R94A 1EX5A 1FWNA 5CZSA 1VC4A 3TMLA 3STCA 4A22A 3BARA 1H7PA 3L5AA 3W70A 2XN0A 4O17A 2WJZA 4CQ9A 3W87A 1RVGA 4Q33A 4FX7A 1SW7A 3SECA 4O4WA 5CGQA 1NFBA 1ZCOA 1QPNA 1TPUA 4POCA 3UD6A 1OYAA 3G1SA 3SFKA 1H1ZA 1PV8A 2YW3A 3TNOA 4E38A 1JR1A 3B0VC 3E9AA 1OFBA 4ZQCA 3O6DA 3QQ0A 5AHEA 2OT1A 5FESA 3OBKA 4XBKA 5C6MA 1T96A 5HUOA 1ZY9A 4WUIA 3NL2A 4M19A 4MFEA 1H63A 4O4VA 3UWQA 3SZ8A 3NL6A 2XFWA 3EX3A 5A8GA 3LCGA 2VFHA 2FPYA 4IMEA 4M6VA 3M5YA 3IIOA 1CX9A 3P60A 1QO2A 5D04C 5SWUA 3TSMA 1DVJA 2HMCA 3HGRA 4O28A 3G0SA 1AL7A 1JUEA 2RFGA 3BLFA 4O1CA 4AF0A 2Z2UA 2DZWA 3CEPA 1H51A 2Z6JA 3G3MA 5G4WA 3W88A 3W1MA 1YTDA 3NPWA 3IGSA 5F2MA 1QWGA 4A2RA 1JQXA 4E2BA 3SY5A 1LROA 3P7YA 4OU1A 1XXXA 3C6CA 3PSVA 3BPWA 1A5BA 4HKPA 1LLWA 1KM6A 3SR7A 2DZPA 2VELA 1TPB1 1KV5A 2GPTA 3FLUA 5LGXA 4GUGA 3U6WA 2QF7A 3QM3A 3C2OA 2NUXA 2D73A 4CNNA 4AF0B 3NYZA 2CLMA 2CW6A 1LRNA 4UMCA 3H54A 3O1NA 1RQEA 2ZA1A 2J9XA 3EB2A 2JKPA 2CLEA 4WQ6A 3KAOA 1JJKA 1IGSA 1P0KA 4RKAA 3NL3A 3EX1A 5DELA 1V7YA 4WX2A 4R34A 3W7EA 2QDHA 3BW4A 3PUDA 4ZQOA 1N8FA 5HUPA 2ALDA 2E6FA 2V5LA 2ISVA 4IMCA 4R33A 1TSIA 4LS0A 3MI3A 1KFKA 4UMAA 4IOTA 1GOXA 5J5DA 3R2GA 1VLWA 4P2VA 3L0KA 1W5NA 4RCXA 4K39A 1MEIA 1TREA 2CLFA 3VFLA 3DXIA 4C1LA 3Q2DA 5LKYA 4LTSA 5AFDA 3W76A 1VCGA 2H8ZA 3NZRA 1RQHA 5F4XA 5D2YA 2DJXA 3S42A 4JYFA 3UNDA 4WZHA 1DKWA 4NXKA 3G22A 4JN6A 3SGZA 4AHOA 1MSSA 3CT7A 1SUXA 5LHFA 5FF3A 3QJAA 3DI0A 3LXAA 1ALDA 1UBSA 2AGKA 4FO4A 1M5WA 4A29A 1ZALA 1LOQA 1ML1A 5FEZA 3VI2A 3W7OA 4JTFA 1LP6A 3Q58A 2H3DA 2GOUA 4K7VA 5LNRA 2YFNA 3TC6A 4UUIA 2NWRA 2A0NA 4DF1A 1ICQA 1AG1O 4BWLA 1SZEA 3EXRA 1H60A 2C18A 3GDRA 3W22A 1L6SA 3PM6A 4FEZA 1HO1A 3DHDA 4OT7A 3A23A 2Y7FA 3R5EA 2P10A 4UTWA 5D09A 3TIMA 2E1DA 1FQ0A 3PSWA 3G1XA 3T7VA 4TMCA 2C13A 1EPXA 1LOLA 4C1KA 1Q6RA 3EX2A 3FYPA 2YDAA 2E6AA 1FY6A 2YYUA 3NQEA 3VNDA 3N2XA 5HR7A 5LZLA 5TBOA 1SO4A 2RHGA 2O7QA 3QMTA 1LBFA 1FWSA 3S5YA 5G2WA 4FX6M 4Y9AA 5LHEA 2X1TA 3O16A 3DHFA 2GVJA 3LTPA 3SI9A 3WJSA 4ZQPA 4HPXA 1WDWA 3EWZA 1F73A 1X6UA 4PODA 1Y0EA 3P62A 3INPA 3ATYA 3C2RA 4O8RA 2J9ZA 3Q94A 5EPDA 3IVUA 5E1QA 5CPOA 1X8FA 2J27A 2R8WA 4DEFA 3N19B 3KX6A 3QMRA 4AHQA 2TMDA 4O12A 3IGUA 4IMFA 2NXGA 3NZ1A 4AMAA 2A1YA 3BG3A 1R46A 4JTSA 1UB3A 3SGUA 2E5CA 1JULA 1VPXA 1OFEA 3KRSA 1XDLA 4FNPA 3C3NA 4O11A 1RR2A 2A6LA 4GBUA 1GEQA 1KM1A 3PBYA 3LBCA 3TJXA 1YXDA 3NL5A 3E0IA 3V1PA 1A5AA 3RU6A 5KZDA 1G7UA 4UTTA 2E6YA 4AHPA 3O6YX 2Z6IA 3TSDA 4U28A 1WQ5A 2I9EA 3JRKA 1VHCA 2WNQA 2WNZA 3IV3A 3M5XA 5AC8A 1W1ZA 2WV8A 2QR6A 2XN1A 3HMJG 2OMAA 3BO9A 5G1YA 2ZZ1A 3GKAA 3FS2A 2ZA2A 2B4GA 2QUUA 5G4EA 1GG1A 3M0ZA 2OCZA 4UFLA 5F4WA 1X1OA 4WD0A 5C54A 4QIUA 4IXHA 1DHPA 5HINA 1QAPA 3UWYA 5FEXA 2ZZ6A 2W79A 4JD4A 4BR1A 3OHIA 3WK3A 3L0GA 3LTYA 1FUYA 5F1UA 1GPWA 2QCHA 1LLZA 3LTSA 2PC4A 1X7FA 3PY2A 4GUJA 3DENA 1TMHA 3W1NA 3LI1A 3CB8A 5G5IA 1HTIA 1K8XA 3USBA 5D33A 3IIVA 3U8GA 4N4QA 4X9SA 2FLIA 4O50A 1U5JA 1H61A 3HG5A 2B7QA 3LRKA 3TH6A 3TROA 1XFBA 4LRTA 4BI6A 4MZ1A 4HNUA 4DO4A 2YR1A 2C1HA 3CEUA 2A21A 5C2XA 5HWJA 3HG4A 1GVOA 4M6PA 4XZ9A 1AMKA 3MYPA 5D2VA 4JDYA 4CCCA 4JTEA 5DXXA 5DLCA 4FNQA 5HR6A 2VOMA 2E5BA 1XKYA 5I3FA 3W84A 3GZ3A 4PTNA 2NXHA 3M16A 4H3DA 1M7OA 2X1SA 3FKKA 1VHNA 3FFSA 4O52A 3TW6A 4AVFA 1FWWA 3KOFA 4Z1BA 3TA6A 3BVJA 3GXTA 1SPQA 3P5YA 1OF8A 1PVNA 3LLFA 5CSRA 1SSGA 4WJEA 2ISWA 3PVFA 4S2CA 1TTPA 3C0JA 2WQPA 5D2XA 5CPNA 4DF2A 3F1QA 3GIYA 3UWUA 2Y88A 5TQLA 2ZDRA 3F4NA 3PBVA 3UXDA 1GVSA 1LBMA 4TX9A 1PHWA 3GDLA 4DO6A 3NA8A 4UTMA 3O15A 1PHQA 3QRHA 3H55A 3LV5A 4O13A 1RV8A 2QCGA 2Z1BA 3RF9A 1IXPA 3L0NA 2DZTA 1GTEA 3E02A 1AW5A 3U2OA 4QAIA 1XL9A 4JIQA 3W1LA 4UIOA 1TQJA 2A2IA 1I2OA 3R12A 4CCDA 2YXGA 3OG3A 5F2IA 2GUUA 1KFBA 3A21A 3STEA 1YADA 3LCXA 3WJWA 3KRUA 1DORA 3QH2A 2A85A 4BWLC 4UTKA 3MMTA 3MI2A 1TV7A 5KZMA 1W5PA 4AH7A 1JRBA 4HNVA 3TFXA 1ME8A 4OHQA 3PF3A 1E51A 1AW1A 2I1OA 4KFPA 3TKFA 4DO5A 3BLEA 4NT0A 2KZHA 3OVRA 4UTWC 4O1DA 3QSRA 5IM51 5DY2A 3I7RA 3STGA 3NQGA 1UUOA 4Y8FA 3M41A 4UTJA 1XBXA 1B3OA 2BSLA 2EGZA 3S1WA 3P82A 1JRCA 1HL2A 1TTIA 2EHHA 2DZSA 3W7PA 4RJEA 1JCYA 1WYIA 2NX1A 1VS1A 3UWZA 1GVRA 1ME7A 4YL2A 4TU1A 4IUOA 3GR7A 1B9BA 1HO4A 4GUHA 3NQDA 4R53A 3QF0A 3HQ1A 3O07A 3CHVA 3EWBX 3EKZA 3KRZA 3MO7A 3W75A 4W9TA 3W9ZA 1FBAA 1FDZA 1JCNA 3GK0A 3LHTA 4IPJA 1ME9A 1KFCA 3L5MA 1OF6A 4LNYA 4E0CA
chains in the Genus database with same CATH superfamily
3N4EA 1ZGDA 4KFNA 2GVYA 1JCLA 8CGTA 2SFPA 2ADAA 3BOFA 2ZE0A 3GG7A 4W86A 4UTTC 3W85A 1GCYA 2DSVA 1XINA 4GX9A 4O0QA 4HN4A 4ADSA 1GW9A 1UWQA 1FP8A 2VR5A 3FJLA 3AC0A 1K4GA 4HU4A 5A94A 3ZJ7A 3CUJA 1FX6A 4K38A 1XJBA 3NQCA 1QW7A 3S9YA 1MRAA 4ONVA 4DM2A 3HPZA 1ZSXA 2BX7A 2DU2A 4AWEA 3ZYZA 4L80A 1NWTA 1SFLA 3E2VA 2V5DA 1BXBA 1OC7A 3L21A 5E6YA 3CGTA 1HKIA 4UFMA 4GY1A 3HIJA 3LY0A 1I45A 1V3KA 2QCFA 3BAWA 3TDFA 4DAIA 3NOYA 4JN7A 1XH2A 2JK2A 1I60A 3WFZA 4C6BA 1E5NA 1F3XA 4MKSA 2EXOA 3SB0A 2E4TA 2Y70A 2DEPA 1JF6A 4CNSA 1YDNA 1XI3A 1ISZA 1NFGA 2OODA 1V5XA 4H19A 3NO3A 3K5XA 5C55A 1X8CA 3CNYA 3H23A 1OC6A 4DJEC 1OK6A 4MG4A 4W4QA 1QVBA 3MUY1 2ZXDA 3S2LA 1V6WA 3O9NA 4BJHA 2RDTA 1V6UA 1CBGA 4KRZA 1XLIA 3LX9A 1YTEA 1R30A 5FCZA 1XRTA 2I5GA 1ITUA 1NARA 1DQWA 3WQWA 4U5IA 4F0SA 2ABBA 3B9EA 2VWSA 3T40A 2BZNA 2NQZA 1IIHA 3VILA 2Y89A 2P3ZA 3UW6A 2CBUA 2RH9A 1N82A 2FDMA 2J24A 3EX4A 5E6ZA 1CTNA 3QY6A 3EKLA 1LUCA 3P84A 2V8ZA 1EIXA 4G9PA 2GDQA 1A5UA 2UY2A 4FR1A 4US5A 3JUGA 3CAWA 1DWHM 1YYAA 4QR6A 1MFVA 4CN4A 4HSHA 5D38A 1F6PA 2NLIA 4H9UA 3N2CA 3WLPA 6ALDA 2HXTA 1PE1A 3SEPA 3MQTA 1XFCA 3NYDA 1LUCB 3AFBA 3BV4A 1PIIA 1OX5A 4Q4OA 1C8VA 1TX0A 4LPCA 2FVLA 4ZB0A 3KHDA 3WBXA 2VCCA 4TVUA 1A53A 2VI0A 4X2RA 3QV7A 2DSWA 4NZ3A 2IUZA 2QNEA 3WUEA 2VENA 2VVSA 1AVAA 4AIBA 3O06A 4MJZA 2DQWA 4PMQA 4Q8WA 3VUSA 1V7AA 2AKMA 1NVMA 1QHOA 4Z0JA 3SCWA 1PZ2A 3FV9A 2BG5A 4XZBA 3FSUA 3O7UA 1XH1A 2X2YA 3E0WA 2WMKA 4L65A 4NQ1A 4YXGA 3ZFHA 2O0TA 5CPQA 4GQGA 2QCEA 1EL3A 1KNWA 1JXJA 1TIMA 4UTUA 2OR2A 1WUFA 1R2SA 3JZEA 3R25A 4FA3A 4F79A 1XBYA 4DI8A 4N9CA 2FQIA 4RLIA 3TW7A 4MB5A 3S1GA 3W7CA 1HIZA 3UJ2A 2OGYA 3RIKA 3T07A 4LW7A 2NSOA 4IL0A 4J40A 3VUPA 1Y5WA 3W7QA 2WVTA 4PCSA 2NZLA 3BMVA 1BVWA 4NJGA 3VPLA 1XSJA 4RZ5A 1GOMA 1UBPC 2GQ3A 3G8EA 4J27A 5A6LA 1IWAA 4FALA 3S2MA 3IGHX 1XIMA 4XAGA 1VB9A 3VKBA 2W66A 2WMFA 4JTCA 3KLLA 5I78A 1ZBVA 1EEPA 2FKPA 1GGOA 3QYQA 3PK7A 4JR5A 3A6OA 1IIGA 1JVNA 1MW1A 2VGGA 3T0BA 3OPSA 3EXSA 4BQ4A 1OYCA 5I03A 3WEZA 2E68A 3B0XA 2PTZA 5AHLA 2OYKA 5BYWA 2WZEA 1CCWB 1EDGA 2CESA 2EJ1A 4PL2A 1IWPA 3ATZA 4J4KA 4ZODA 5JBDA 3WLRA 3K1GA 4UFKA 4K36A 3CZLA 2JBMA 4PTMA 3WQFA 3MKKA 5AECA 1LL4A 1SO3A 5JIPA 3KBVA 1TVPA 3SADA 1E72M 5D2TA 1VYRA 2VL4A 4WXYA 5DF0A 5FJPA 3A24A 3CXOA 3OU8A 1R86A 3EOSA 4JIHA 1ZS2A 4XWUA 3TOYA 3CUZA 4BF7A 5I6SA 4KWSA 3TXVA 1MW2A 3DEQA 3FDGA 1F3TA 2P5NA 2A5HA 3VA8A 1Y65A 4Z08A 3O6AA 2XGBA 3LG3A 1V02A 1PS9A 4ML9A 2VXNA 2ZZ7A 2E40A 5HATA 1GJPA 3W4RA 2B81A 3PTKA 3ABXA 3P5ZA 1OVDA 2VFGA 2HS8A 4LX4A 3SQLA 4DYEA 3LZ5A 4DBDA 3CZJA 3B8VA 4EANA 1FWFC 3KDNA 1WXJA 1ISWA 3OODA 2WK2A 1NJJA 1VRDA 1TTJA 2QVNA 4DVOA 3GC2A 4YTRA 2A3HA 6TIMA 1EJVC 4O1AA 2A7RA 2B7OA 2PDIA 1G1YA 3FVDA 3K1DA 4ZQRA 4IX2A 3KCLA 5MKGA 2B31A 2YCLA 1NM9A 1VEMA 1DXEA 3ABOA 3WQ8A 3DI1A 2TYSA 2VEKA 3DFNA 4EACA 3ES8A 3UCQA 4JTHA 4DUVA 2ISSA 1QI4A 5K7JA 1G9HA 3W7IA 2YGYA 3UWWA 4QXIA 1JZ2A 4F3HA 3TK7A 1J4EA 3BQ6A 1U5HA 3EOLA 4MY1A 5HNRA 3DESA 2BLEA 3AHXA 2YLAA 3GX9A 3UPWA 4O53A 5MKGB 1KWGA 1TPFA 3BW2A 2YCLB 1EZWA 5F2LA 2EF9A 3KFTA 1BHGA 4XAZA 2ZX7A 1UKPA 4FNUA 2E09A 3AS3A 1LRQA 1IF2A 3UG4A 4UFIA 4LC6A 3WBYA 2ZX6A 4HA1A 3ZQ9A 1AW2A 4A05A 3FHQA 1UOZA 1D9EA 1O7AA 2QCDA 1V51A 3OLEA 3GE7A 4DJDA 4CVWA 4K1WA 3W29A 3QZEA 4GZ7A 5CJMA 5I23A 2IPFA 5CPTA 1R3TA 2PC8A 4RK8A 2PDBA 3CQHA 3UG8A 2WKJA 2V5BA 4WLCA 3IUHA 1S5TA 2ZUUA 2VT0A 4LBUA 1HKMA 2V2HA 1CEOA 4QX4A 1C8XA 3GNOA 4Y8EA 5I3HA 1HZYA 1I1XA 1L8PA 2F84A 4MIMA 4Q4KA 5GQBA 3TTOA 4QJ3B 3MBDA 4IIGA 1J2BA 2XIIA 1Y7VA 3TEVA 2B0MA 3B9OA 2FH8A 2QLYA 1GQNA 2AQVA 1KO0A 1CI1A 2Z25A 2PUZA 4JS3A 1UH2A 3T44A 3THUA 3AXMA 2WPBA 5BU6A 3LGEA 4HJWA 3WQGA 1G4TA 1BQCA 1TKKA 1E4LA 1VKFA 2DIEA 5LA1A 2FDSA 3H2AA 1LQ0A 3BMXA 1A80A 1B57A 3LHZA 1K70A 3MB9A 1BEUA 2DH2A 3CLMA 3FGCA 4OKDA 3CWOX 5GJMA 4B4HA 1JDAA 2OLAA 4LNCA 3OEXA 4HK5A 3S1VA 3TV8A 2A7PA 4PFMA 4HBKA 4RX0A 1FWRA 2UZ9A 3K4WA 3B05A 4AB4A 1E6QM 1XD1A 3DX5A 3PWAA 3TMQA 3N3MA 4L1WA 1AK5A 3FGCB 2ZZ3A 3CHEA 2OTDA 4PMDA 4IGSA 3M1ZA 3O8AA 4JEJA 2WSRA 5HQLA 1GJUA 1R9ZA 3BZJA 5D9PA 5FA5A 3HU7A 2YYTA 1EKOA 5E9XA 4OQVA 5HULA 4GH3A 2IPGA 1QJWA 2FYMA 3K4DA 2BGQA 4IFRA 4H1ZA 4C1NB 1EWDA 3BH4A 5C2CA 1D3GA 2GQAA 3HOJA 1I2PA 1O60A 2XZ9A 1W5MA 4C6FA 1EQPA 2NQJA 3ZVIA 3T09A 3MHUA 2XVGA 4LV9A 3B04A 4IG2A 5DY3A 2YIHA 1EP1A 3K30A 4HT3A 3EXTA 1FKXA 4DJED 2IQ0A 2VQUA 4PMNA 3LSBA 4HIBA 4TTUA 3RGTA 3FDKA 2GJNA 1GEHA 1K9TA 1P4CA 1VJIA 2Y85A 1ZNNA 2G4JA 1RHCA 4MB4A 4L4MA 4O0ZA 4S38A 1QNVA 5AY7A 4WHBA 3R13A 1WX0A 3TJIA 4LFYA 1U1HA 2FZ9A 3LXCA 3T4CA 4PH6A 4N02A 2PDLA 3N14A 4JEQA 3WJZA 4IG2B 2PDQA 2QT3A 5CXPA 1HJUA 1UQYA 3VKJA 3AUJA 3TJLA 2YJQA 5AVNA 1AQFA 2NWSA 2H90A 3R58A 2HJPA 2XG9A 5HANA 1BRLB 1SZFA 5J04A 4M5PA 4EWJA 5BOOA 3GTIA 4J7RA 1M7JA 1TV3A 4IGHA 4WOZA 3OYZA 1YNQA 3W27A 4JCLA 3WJXA 4H9XA 4CEXC 1FP9A 1WXZA 2F6UA 3WJYA 4PTDA 3WYZA 4NZ5A 3P61A 1E0VA 4XISA 5XINA 3R8RA 1M01A 2CZDA 4YMZA 3CYJA 3NDYA 2ANUA 2NQLA 1DWIM 1ZPTA 3VIIA 2V6AA 3EPOA 2FJKA 3MKCA 4D6FA 4DHGA 1M7XA 1H0GA 4HMDA 4UC5A 3V18A 2FH6A 3VMNA 4HOXA 3CV1A 2F7FA 1YLVA 1T6MA 1QPOA 1FHDA 2CBJA 1Z41A 2YDQA 1V6XA 2ZRVA 4WR3A 5MF5A 4CQCA 1JGIA 1OX6A 4GOAA 4KT2A 4QNWA 1M6JA 1BWKA 1DWAM 2YLLA 3C8NA 3NGJA 1A5OC 1KLYA 1XC6A 4AZIA 4MJ2A 4ZA0A 2C1IA 3COTA 3AI0A 2J79A 4LCQA 4FOKA 1KLZA 1KXTA 4P8XA 1QW8A 3V5CA 4M1BA 2W5FA 3G0UA 3VOIA 3PUEA 1DJXA 1O4UA 3NPXA 4HZ7A 2ZIDA 2TAAA 5B80A 1MYRA 3GNPA 4KCWA 4DRSA 4OV9A 3UJSA 4HHHA 3N18A 4H8HA 4UTFA 4DM1A 1Q6OA 4O14A 1FXQA 3IAPA 1KC7A 4AEOA 5JXQA 3BG9A 2CHOA 5J8LA 1S46A 3U2CA 4Q6JA 1KV8A 4UB9A 1C7TA 2PF8A 4R7WA 3TU9A 3VKCA 3Q37A 4B2DA 4G7FA 4F0RA 2WMIA 3DFQA 1CENA 3P0XA 4E2VA 5D9MA 1GVYA 4IPLA 3GDTA 2QAFA 1F4AA 1GYNA 3R4IA 3VMPA 1JUKA 1GPFA 3C86A 4REQA 2C19A 4F2UA 3WDRA 2E25A 4IMGA 4QJ1A 2NX3A 5CG7A 4AWSA 4WY0F 1KW1A 3TCEA 4NYUA 5CGMA 5I24A 3CS2A 4J5NA 3R43A 4R85A 3TN5A 4AY7A 4A3RA 1J12A 2RDUA 2BVWA 3VINA 2AKZA 4A3YA 3QV9A 3QHOA 3LI0A 3WMLA 2PI6A 1A49A 5K9CA 4KFOA 4JGDA 4REQB 4M7TA 3AYRA 1OABA 2H9AA 4Q32A 4UR8A 5FEWA 1G01A 2WBKA 4AWTA 5GNYA 5FJOA 5BXPA 3DFPA 7A3HA 4J9JA 3KCOA 3IJQA 5KETA 3LRLA 3EMQA 3WZ0E 1IQ8A 3AIBA 3F4VA 3PBWA 4MMWA 1DOSA 3ITYA 4W87A 3DYPA 3BL3A 3IIZA 2ABAA 3GLCA 4N6FA 2WC7A 4RZBA 3T0TA 4JQAA 2H9AB 3AYTA 5D2WA 2OKTA 3UU0A 5DCEA 1KKRA 5HWNA 2DGAA 4NF7A 2Y7DA 2FPVA 3RHGA 1XBZA 2QV5A 3AXKA 3PNUA 3UESA 4GA8A 3AQUA 2XH7A 3VVGA 2DZXA 2YPIA 4GACA 3WQ4A 3THAA 5DT7A 4JTTA 5CZTA 1E70M 1EEXA 2UY5A 3NQVA 2W92A 3AIRA 3ES7A 3QR0A 4FP1A 1XGDA 3C2VA 3EOUA 3P8JA 5TAOA 3ZS4A 3PP7A 2G50A 1FWTA 1F5ZA 9XIAA 1K7XA 1GNXA 1XV8A 3HO8A 3W7JA 1ZAJA 3TYDA 1OGSA 1PWLA 3HZ3A 2XM1A 4L4PA 1GVFA 4AUBA 2Z24A 3QYSA 1AA1B 3FAWA 3NQFA 2ON3A 3MI6A 2QHAA 3NCOA 3RLUA 2X7VA 4A6GA 5GPRA 3HPFA 3LLXA 2W0UA 4AD3A 3GWQA 1J2WA 1QOQA 3U4AA 1HX0A 4KGJA 1EIBA 1G94A 4D72A 4NZFA 2DUAA 3R11A 3SCPA 4OOUA 5E93A 4QS6A 2GOKA 1CYGA 1IXNA 4L7ZA 1RJRA 2J66A 1A5LC 2GVLA 2JGQA 1XLCA 4KWUA 4Y9MA 5D8WA 3OHMB 5L6UA 1M68A 5FKYA 3WNOA 5AB3A 3LCWA 4WSJA 3GNNA 1QPKA 4IIDA 3WELA 1EJWC 4UR7A 3GW0A 4G2DA 3MZNA 3B03A 3SUSA 4MY9A 3ANUA 1GZJA 1RPXA 2PRLA 2I14A 4HD5A 1WOAA 3S6OA 4UMBA 5DXYA 5C0QA 2W6RA 2DZAA 1W31A 2WWDA 4DIAA 1E6ZA 4XZHA 3WLSA 2Z1KA 4ZXLA 1O5QA 2G3IA 1GWJA 1UWAA 1XP3A 2RJHA 3TYCA 1Z6KA 4MAVA 5M03A 3BANA 4GE8A 4XZIA 1JZ3A 4Z1DA 4DO7A 1XF0A 4HNLA 3SCTA 3P81A 1SW0A 1TPWA 3RXZA 3OOQA 3QLDA 2AL1A 1SO6A 3RX3A 4NUWA 3LCFA 4LUSA 3E6EA 3UETA 1H2JA 3NNTA 2OG9A 4B2DD 3WF4A 5U4NA 2GYIA 1XS2A 3CAKA 4US6A 5E09A 3B4YA 1DHKA 4DJFA 3KE0A 1BGGA 1H1NA 1UA7A 2Z29A 4JZ5A 4RW5A 2YW4A 1WAUA 3T42A 4LVBA 1YDYA 2OEMA 3BK0A 4RE4A 5B7YA 4N42A 5LSMA 5K9XA 4W7UA 3BGGA 3OA5A 2OFJA 2OB3A 1H7PA 3L5AA 1UWRA 3WD1A 4Q33A 4FX7A 1NFBA 3O2LA 3WQPA 1WZAA 4C6LA 3G1SA 4ROPA 4X61A 1JR1A 3E9AA 3WNPA 1X7IA 3CT2A 3O6DA 2BVDA 4D1IA 4PZVA 2OWWA 5AHEA 2OT1A 3OBKA 3NL2A 4DZHA 1Z8AA 2DZBA 4E5TA 1M41A 3NL6A 3VAVA 5CBBA 1W3HA 2PDYA 3SUWA 1VF8A 2VFHA 4RV3A 2FGLA 1FH7A 3UR5A 5SWUA 1DVJA 3LPPA 1GOQA 5A6JA 4H2CA 4FZIA 1X1NA 2RFGA 2Z26A 3VOJA 3WD0A 3UVIA 4AF0A 2Z2UA 4GQBA 1XG4A 5E5CA 3W88A 1V08A 4A2RA 4BQ2A 4LUTB 4E2BA 1LROA 1CWYA 3UNTA 1XYAA 1RPKA 4CU6A 1XPYA 2VDIA 3IWPA 3SR7A 2VELA 3UEQA 1TPB1 2GPTA 4GUGA 3U6WA 5ABGA 2VMFA 3HV8A 4PGLA 3C2OA 1KR1A 2D73A 4AF0B 4XIMA 3KDOA 4PMOA 3PZOA 2HE5A 4UMCA 3W24A 4PTXA 1J10A 1E6NA 4DZAA 3DCPA 1C7SA 4WJ8A 1XIEA 3B8IA 3ZO9A 3DFYA 1P7TB 3KAOA 1VBRA 1IGSA 4UOQA 1P0KA 3UJEA 4BZYA 1HL9A 3EX1A 3NQBA 4WX2A 4F8XA 2FMOA 3BW4A 3PUDA 3NWRA 1N8FA 3GVVA 2P8CA 4YTQA 4HU3A 2V5LA 2NVCA 1WO2A 1CB7B 2PLMA 2WCGA 4LS0A 1S2TA 4IOTA 2QPSA 2Y8KA 4LAUA 5J5DA 1LL6A 1Q7ZA 1W5NA 1B31A 2Q6ZA 3DXIA 1TMQA 5LKYA 3WLOA 3APTA 1O1ZA 4UBPC 3VMOA 4BA0A 3M0VA 1DE5A 5DRCA 3T2QA 4JN6A 3CO4A 2ACQA 3CT7A 1O1HA 5LHFA 4C60A 3RITA 1WP6A 5HJYA 3VIFA 4EPEC 1ALDA 2OLHA 2JIEA 4FO4A 5DFAA 1JZ6A 1ML1A 2C8NA 3Q58A 3WH7A 1WDPA 2YFNA 2Z7KA 4DF1A 1SZEA 2I16A 1H60A 2JALA 1IT8A 4FEZA 2XZ7A 3T8QA 3VOCA 1PJ9A 1FWDC 4PRTA 1K9DA 3R5EA 1UC4A 2ZXAA 1IE7C 3TIMA 1FQ0A 4GG9A 3B8TA 3T7VA 4GIEA 3S6TA 1VFTA 3HTWA 1U22A 3MUAA 3A9BA 3E38A 3PZNA 1KD0A 3QVQA 3N2TA 3P2VA 1KXHA 2YDAA 3L4TA 1FY6A 2HNEA 4M3PA 3V0TA 3H70A 3QMTA 3WL0A 3PZGA 3VABA 2QQ6A 4HZ8A 3C0QA 4IQJA 1NFPA 3O16A 3SI9A 3WJSA 4ZQPA 3L4ZA 3WBEA 3F2BA 3ARQA 4PODA 2PS2A 1S2UA 4FOJA 3IVUA 1RCXB 4PUEA 1DP0A 5CPOA 1X8FA 1OZMA 1IHIA 4AHQA 5EFDA 1PZ1A 1B2YA 5A6MA 1W9PA 1KXQA 4WDWA 5M2FX 1P6BA 3GXIA 3SGUA 1JULA 1EJTC 1OFEA 1E4MM 1F61A 1RR2A 2A6LA 4GBUA 3TJXA 2J62A 3IUDA 1EO7A 4GI6A 4UQAA 5AKQA 3I3DA 5JBFA 3RU6A 5KZDA 4WSKA 3EA3A 1CGUA 1A4MA 4NRRA 4F2TA 1VHCA 2WNZA 4JN8A 2OMAA 3BO9A 1S1RA 3C2YA 2VC7A 3FNDA 5G4EA 4AEFA 2PDPA 4OBRA 4WD0A 1MVYA 1PTDA 2W63A 4JD4A 4BR1A 3OHIA 3WK3A 3VZXA 5F1UA 4DLMA 1LLZA 1PWMA 5IFPA 2QPXA 1X7FA 4ERAA 3RAOA 3O0FA 3GH4A 2PWUA 3LI1A 3VOHA 1CIUA 3U8GA 4N4QA 3WL1A 4X9SA 4GIYA 1CXEA 1H61A 1TV4A 3OZYA 3UXKA 3HG5A 1H5VA 4PBGA 3TH6A 3TCSA 3L4WA 4MZ1A 1WKYA 4GLEA 1UWSA 2C1HA 1VFSA 5C2XA 3N6HA 3HG4A 5FD0A 1AMKA 1SFTA 4J35A 4CCCA 4FNQA 1UR8A 1ESWA 1XKYA 3SUVA 4JQ4A 3WLLA 2NXHA 4DBSA 2D2OA 1EJRC 3W0KA 5HK4A 1M7OA 2X05A 2VQTA 1VHNA 4O52A 3GDBA 1BXCA 1FWWA 3VNLA 1S38A 3ANVA 4GYPC 5HMDA 4LYPA 3EB3A 3P5YA 1SSGA 4C7FA 4PR4A 1OCJA 4S2CA 4QFUA 3GIYA 3UWUA 2ZDRA 3PBVA 5CBJA 1R8LA 4HHLA 3CJPA 3S46A 3SY1A 4N7QA 3QOMA 4DO6A 2DY3A 3QRHA 9RUBA 3H55A 3CK5A 4C6CA 1KWKA 2Z1BA 1CXLA 1K8CA 3L0NA 2DZTA 1QRQA 1GTEA 3BJSA 2XJ7A 1QOXA 4LAMA 3W1LA 1I2OA 4CCDA 3WLMA 2YXGA 1QI5A 3OG3A 4R9XA 1KFBA 3LUTA 4R27A 3LCXA 3QH2A 5REQA 4BWLC 3MMTA 1KRCC 3MI2A 3TW9A 1CB2A 2FHBA 3FY1A 3TFXA 4OHQA 1TE6A 3PF3A 1VIWA 4XIAA 1E51A 4D6HA 3RN6A 2XGZA 4NT0A 4X0VA 2QVHA 3OVRA 4BEQA 4UTWC 4MPKA 1RVKA 1TELA 1HJVA 5C7HA 2YCIX 1JI2A 3MWCA 5M3WA 4UTJA 1B3OA 2BSLA 4C6MA 3S2CA 1A5NC 3VIHA 3QKZA 3CUIA 1XIHA 4W8BA 4EAYA 3IJ7A 5REQB 4RJEA 2OEKA 4EAMA 2NX1A 3QZ6A 3BLPX 3UWEA 4EXBA 5DMNA 4RNFA 2X8RA 1ZLPA 1B9BA 3QQWA 3NQDA 3QF0A 3EKZA 3MO7A 2PDNA 3REQB 4GNKB 1PIGA 1ISYA 1OWQA 3GK0A 1S2WA 3GG8A 3A64A 1SVDA 7PTDA 3L5MA 2GJRA 4LNYA 4E0CA 2OZTA 4GVGA 2LLEA 1YPIA 4ZFMA 1UC5A 4L6DA 4GGBA 3ZXWA 1EA0A 1NWSA 3BCJA 3SCUA 3DGRA 1KFWA 2CLOA 3HA1A 1R47A 3IJ6A 3AHTA 1V0NA 3RCMA 4PN2A 3K8KA 1MW0A 3FKRA 3MMUA 2R24A 2O4MA 2CCRA 3WQ5A 2W4XA 3MVIA 1VEOA 4DBWA 3U2EA 2QIIA 4E2DA 3VD5A 3WH9A 3EBVA 3ENLA 3N6JA 2FIQA 4MADA 3THDA 4O1BA 4WKHA 3KCJA 2XIOA 4AXNA 2OSWA 1JF5A 4C6PA 3STFA 1MO0A 2XIMA 1N55A 1S2AA 4U33A 1VFMA 2YBVA 4UQBA 5FOOA 4EK7A 4H9MA 4HU8A 1CXFA 3WDQA 3FIGA 4RDYA 3LCLA 3EYPA 1EQCA 2INFA 3CM4A 3E2SA 2HPMA 1FCUA 1NWRA 1PX8A 3B9NA 4EWND 1E73M 1F6YA 3W7LA 1RXOB 2H3BA 3ITCA 2FZMA 1GW1A 1TA3A 2ODOA 4JTIA 5KSWA 3S83A 4AAJA 2ICSA 5FAGA 4L1GA 1HN1A 2C91A 4UFJA 4YLWA 3L2IA 3CLWA 1KCZA 4QSFA 3RK8A 4CNPA 3IARA 2PODA 1GOIA 1RD5A 3A12A 2YFOA 3SSJA 1W1TA 2WYSA 2W3ZA 2VKZG 2HPIA 2UV8G 1HNYA 1TPDA 5LIUX 4IJCA 2ACRA 4P7NA 1I4NA 3DERA 4QCEA 5KITA 1TA3B 2PURA 1VFOA 2NT0A 4LT9A 3CIXA 4O10A 3G1DA 3H7VA 1MUCA 1KBBA 4W85A 4U4MA 3MHFA 5PTDA 3MMDA 2OOGA 1HP5A 4PRRA 3PPFA 3QV8A 4UZSA 3N12A 1XQKA 2GWNA 4ZO7A 4EKJA 4AX6A 3JW7A 5HAOA 4NXSA 1W2PA 2ZQ0A 1SU5A 1XUZA 2A3LA 1YXYA 1XLMA 4BHYA 1KRMA 5AYBA 2EPLX 3OO2A 3DECA 2EG8A 5T8GA 4S3GA 3RILA 4K8EA 3DKJA 1J0HA 2O7SA 4C7DA 1HGYA 2D1ZA 2FMNA 3VNMA 4D6GA 4B15A 4WGXA 1VAHA 3GDKA 1G4PA 1VGAA 4K8HA 1VENA 2GGEA 2J74A 5K4XA 2QUVA 4Q8MA 4X63A 4WXZA 4KKXA 1M7PA 4JY9A 1D8CA 3ZWTA 4PUJA 2PCQA 5HNNA 2NQHA 3HPSA 1JEZA 4OECA 3LBMA 5D37A 3BW3A 4DZ5A 1EWEA 4H4IA 5LNVA 1CT5A 3ZR5A 5F1VA 3GZAA 3K4AA 4XG1A 1SQ7A 1AZ1A 3HGSA 3EDEA 4N9DA 1JD9A 4LUJA 3A5VA 2EG6A 4JQ1A 5G2IA 1GT8A 3TC7A 4PA8A 2ZBTA 3GIQA 4WF7A 5F7UA 1K03A 4QISA 5EMUA 3QMSA 1UWIA 3AHZA 2HTMA 1Z3NA 4GNJA 4DWSC 2Z2BA 2VVNA 1BSLA 3GR8A 5HOSA 1KM4A 1ICSA 2POZA 3SCNA 3DAQA 2YSWA 4B5XA 5M5DA 2VZTA 3SY8A 4CU8A 3GUGA 4IPNB 2F2HA 1EP3A 4NX5A 4W84A 5EB8A 4LH8A 3RG6A 3FOKA 2Q3RA 3UG5A 2X16A 3W01A 1DXFA 1CGXA 1TJ2A 1NDVA 3SCVA 4HHPA 3NZQA 3T2PA 1KM2A 1ZBCA 2CZEA 1WA3A 4CUCA 5D02A 3CHDA 2BASA 2XIJA 4IP5A 2V67A 3MT1A 2V82A 3N2MA 5CC3A 5CSSA 4H6EA 2J7BA 1UWUA 5GJNA 4AYSA 3GXNA 3DIPA 2PP1A 2XTKA 4KF1A 3LCIA 3M0KA 4ZOEA 1EGMA 4Q8VA 4P7LA 3L67A 3OZPA 5JU6A 4QJ4B 4OBTA 1L6WA 5A8NA 1Q4NX 3VD9A 3ZLFA 3KTXA 3U48A 4JY8A 3HFTA 2QS8A 1F7BA 3SBFA 3I7SA 3GU9A 4JOMA 1Z32X 3SN1A 3W53A 4HK7A 1VFHA 2GK1A 2E77A 2XFYA 1YMYA 1R87A 1F3EA 3OLGA 1D3CA 3PTDA 1VQTA 3VU2A 4RXGA 4LB3A 1QT1A 2GSHA 3EPMA 3C61A 1H7RA 4KRTA 4BFAA 1NIUA 4FNRA 1FWIC 4QEHA 4H9YA 3TE9A 1ODUA 2Y1HA 4AZ5A 1F3WA 3BSHA 4C7GA 3ITVA 1J0IA 3H2MA 4ZO8A 1G0CA 2X2GA 1NEYA 2GK1B 4U2ZA 1OHLA 1PXGA 3BE7A 3MV11 4LWWA 1CXKA 4FXJA 1QNQA 4TX8A 1UUMA 4JIPA 3W07A 1V0LA 4FR6A 1ZZMA 4GD0A 3V7PA 4TO8A 3HF3A 3W02A 1PKNA 1PSCA 4JL2A 2F61A 2JIWA 3L9CA 1DWJM 3DU0A 1I2NA 1UCWA 1KM3A 1JPKA 5AHNA 3E74A 2QYGA 3QTPA 4UNKA 5HPOA 1GZGA 4L9ZA 4NZ1A 4L56A 1QXLA 2ZZ2A 2WHMA 4S3FA 3BAIA 3L65A 3VFCA 4HMCA 4HTBA 4PCNA 2FHFA 4D2JA 1AL8A 5I7GA 2P0IA 3T9PA 1U5VA 3AYSA 1CPUA 1OY0A 4B5VA 2W27A 2PPGA 5JH1A 4BEUA 4KCVA 1D3HA 2O9TA 3S8HA 3ID7A 4PUDA 3PZMA 3I6RA 3NQ7A 1RUSA 4DXXA 1P0EA 4XO6A 1JDCA 3VGEA 3MUXA 4YS1A 1XLAA 1U1JA 4MSSA 2Y61A 3FA4A 3NG3A 1US3A 5IBXA 1TYGA 4M7SA 4FB7A 5A6BA 5I3GA 4GC3A 2AMGA 4M51A 3W2KA 4LUIA 5A6SA 3FEMA 3W37A 4C6NA 1HVQA 3O0KA 2ZRWA 2YB1A 1UA3A 3UP8A 3OB8A 1UR9A 2NSXA 1LQAA 3EDFA 3NQMA 2J47A 2OQLA 2VC9A 3KP0A 3MCNA 1Q2SA 3UA4A 1Q2RA 1EZ2A 3QGAC 1PX4A 3KOWA 2BOEX 5DN1A 2XINA 3RMEA 3KL3A 1T99A 3NPVA 1W9XA 2FZNA 1OFPA 1V93A 3PB2A 4A3QA 4DBEA 4Z2IA 1B9ZA 4MWAA 3VCRA 2DUZA 3OZOA 1XKJA 4QGCA 4AWUA 4UQDA 1QBAA 3FVMA 3OYXA 3QGVA 3UZXA 4G8TA 1UROA 4DN1A 3P14A 3A13A 1JCXA 3H21A 4DWSA 1XBVA 2BWGA 3CYVA 2WNWA 4LJ3A 3KVKA 4MWAB 1QASA 1KGXA 3TQVA 4B9ZA 1J6PA 3CB3A 4MNKA 3QHNA 3AROA 1SJBA 3TJ4A 4QJ5B 2R1MA 2VUYA 3B8DA 2JGYA 5DBTA 4N6EA 3KLKA 2QJMA 3NJ3A 1ISVA 4HN8A 2V2DA 2CFFA 4QCFA 2C1GA 3KP1A 3S5NA 4DWSB 1SFSA 1RSCA 4OIFA 4XZLX 3ZT6A 1X38A 3T6CA 4XKYA 3RU8X 1UMYA 3KBNA 4GH1A 4OV4A 1VPYA 3VK5A 4E8GA 3PZIA 2YL8A 2Q3OA 1WBJA 4M80A 2X30A 4BK9A 1FWEC 1V3LA 5CC6A 1C3FA 1K8ZA 2P0OA 3WBWA 3SURA 5FIPA 4GYJA 2ZX5A 1OZQA 1ITXA 4PE8A 2J8FA 3ZJKA 3NQAA 1V6TA 2CERA 4LRSA 4Y96A 1NY1A 4XKYB 5BCAA 3GB6A 1MXGA 1ADOA 4ZZ9A 1MI3A 1XD0A 4LUYA 4UCGA 3R8GA 2HRWA 2Z27A 4V28A 3DBPA 3IIXA 2X7WA 3UYCA 4X60A 5LGZA 3LV6A 3RNDA 1UYQA 1JFHA 1YIXA 3AJXA 3CQKA 2Q71A 2Z1VA 1RK5A 3GVRA 1EUNA 4DUOA 1UZDA 1XDMA 3K2GA 3WQCA 4WK9A 3NOEA 1J0YA 1R9YA 4GXWA 3HG3A 3ZSSA 1TO3A 3POHA 3A4WA 4QITA 5CZ0A 3R0KA 3MC5A 1LT7A 3KUMA 2C3ZA 3UQNA 2OO6A 1ADSA 5BXRA 2OJPA 1VYSX 5BNKA 4LVFA 5EMKA 2CZ5A 3UJRA 1FFRA 3FJNA 1RQBA 4G1KA 1OG0A 3PNZA 3B0PA 4JNZA 3LPFA 3MSRA 1V79A 4TQTA 4UOZA 3M7SA 1P48A 1RALA 1V3MA 3LM7A 3F7JA 4RXFA 1OX4A 4H7VA 1UMLA 1DPMA 3W83A 4LYKA 4B16A 1F05A 2WWCA 5HNUA 2GJLA 4RE3A 4ZSUA 4FXRA 1UD2A 1ZJHA 3L5LA 4C91A 2Z00A 4K8GA 1PEZA 4WDXA 1Q63A 2PF0A 3UFYA 3CL8A 1YE6A 2GFTA 2VFDA 5HJLA 3FAXA 3IIPA 2YBUA 3NZGA 1LQ2A 4MNMA 4GRSA 4ADUA 3GW3A 1XHGA 1B54A 1KTNA 1OX4B 5EGRA 4HB7A 4UXDA 4CCZA 3VXGA 1JXKA 1MQRA 1F2JA 4BF5A 3T81A 4H7CA 3WLJA 4LYRA 1R6WA 3URQA 4W7WA 5EKYA 3AMLA 2A7NA 1LDCA 1R5YA 2FZDA 5IRPA 4QM1A 4JNMA 1BWLA 2VOTA 5EBAA 1AODA 1MNZA 2NLYA 4GO9A 5GVJA 1Q66A 2E8YA 3QPYA 4GZIA 1G6CA 2YZRA 1R7AA 4KPLA 1XLLA 1ZUAX 4M1RA 3SRKA 3MCMA 1ZBKA 1OFAA 5CPLA 4AC7C 5E9AA 1V4YA 3R94A 3S2JA 2Q02A 3CUXA 2BB0A 1EXPA 3TX9A 5KEZA 1GQKA 4A8NA 5DRIA 4GWEA 3ZSTA 4DWSD 1R3YA 1H62A 1ZJIA 4YVPA 1HUVA 2IKGA 3BMWA 4ZMGA 3VO0A 4HA4A 2BXYA 5FJIA 4FX8A 4QE4A 1H7OA 3ONBA 4AMCA 1LG2A 3TVAA 1GOWA 3AOFA 3H53A 1AD1A 1YE4A 4EOUA 2DSUA 1UG6A 3ERPA 3BGAA 3NPUA 3KHJA 1P0BA 1KQYA 1R9XA 3A22A 4CNTA 2FVKA 5A6AA 5JBEA 3OBEA 1QI2A 2ZKMX 2JKEA 1E6PA 1K6AA 3AXXA 4TVDA 4J3VA 2D24A 2ZICA 1UD3A 1FH9A 1GJWA 2PTYA 4JL1A 4N4PA 4LB4A 4ZFCA 1OGBA 8A3HA 3VX0A 5CC7A 1GQJA 3YPIA 4GHRA 4F9DA 4ICNA 3DDMA 2C16A 5FJTA 3N4FA 2R82A 5CEWA 3GIPA 4XBSA 3AZTA 4GQRA 2OZ0A 3CV6A 3QV6A 1JCJA 4IWWA 1GYMA 1DWGM 3P74A 3VOFA 3S9ZA 4YTSA 4LQ1A 2Q01A 2OQHA 3E96A 4JTLA 3DFTA 1OD8A 4ZVJA 3ARPA 2E9BA 2UWFA 3GNRA 3WDIA 1GQLA 4LVDA 1TWZA 1TPC1 4IIFA 1I6NA 3AIVA 3G8RA 3VDHA 3RUBL 2RDWA 1DBTA 1L8NA 4AXKA 3SCOA 1UWTA 3U5UA 4QBXA 5AYYA 2DT0A 3M0LA 2D2JA 3CPRA 4NYYA 2XIQA 2OT0A 3CV7A 4MUZA 1ZJBA 4ILSA 1PZ0A 2QDEA 1LLOA 3OQEA 2J8GA 3QZAA 3WLIA 3ITTA 3RX2A 1HQTA 4IH3A 2QJJA 4NRSA 2ACUA 3S1UA 2YXXA 5EA9A 1YX1A 3G1YA 3TR9A 2Y63A 3N9SA 4X9YA 1W3LA 4ERGA 2DUXA 3RM4A 5E0KA 1PB0A 4GXMA 2ZA3A 4BS0A 1UPPA 3IRSA 3LENA 1HXJA 5IDZA 3H6OA 4ZEPA 2Y5SA 1BWVA 1WB0A 4EPBC 3H4XA 1A5KC 3H4WA 3R10A 4CD8A 3WUBA 3CHFA 1XLJA 4L1XA 7TIMA 3B8WA 3LA4A 4LVGA 2QEZA 4U3CA 3BGJA 1XISA 1MWOA 4X22A 3F2CA 1L6YA 1RBLA 4RDZA 4TXEA 1OFQA 3AZSA 4L6HA 1CDGA 3H22A 3LLDA 4G6CA 1Y8BA 4L4LA 3VIMA 4GKTA 1BVNP 3W1TA 3QY7A 5G4HC 2QDDA 1VBUA 4JX6A 3T55A 1NTHA 9XIMA 3BAYA 4IZGA 3M43A 1HKKA 4DPQA 1K3UA 1E0XA 4DF0A 2P3EA 5D03A 2D0HA 3QW3A 2PB1A 2P1FA 3W71A 4CEUC 2C6QA 1YEYA 3W74A 1BAGA 5C5YA 5TNVA 5D8ZA 2ACSA 1RLDA 1SMDA 4LAOA 3PUGA 2FHCA 1GZ1A 1OM0A 1XLGA 4FIRA 4J2PA 1NWUA 3TLQA 1Q6QA 4FLRA 1BQGA 4INFA 3PB0A 3PAJA 1DJYA 3TYBA 2WANA 3BXWA 2BGNE 2P76A 3BJFA 1EYWA 3L23A 1YBQA 1VPQA 2VC6A 1IEWA 2EJAA 4J2MA 4J3UA 1TVLA 3W00A 3UXAA 1WDRA 1TV8A 2CYGA 2BGSA 4A8LA 3BICA 1XWYA 3PZVA 3KVJA 4NZJA 2VNCA 3EMCA 4JXCA 2JEPA 3MMWA 4NSBA 1O94A 3IJ8A 3ZZ1A 3RJYA 2QUNA 4IQLA 5C7VA 4RE0A 1DJQA 1MQPA 1AD4A 1XCFA 1DIOA 3QC3A 2V3GA 1FWNA 1W1VA 4PMXA 1VC4A 3TMLA 4PCTA 6PTDA 2OKOA 2C7FA 4I3GA 1YBQB 2WLZA 1SW7A 6XIMA 3S47A 3N2OA 4O4WA 1ZCOA 1E3XA 4ZOCA 3UD6A 1H1ZA 2OQYA 3LSCA 1OFBA 3A47A 2ZUWA 4I9JA 4HTYA 1T96A 3AICA 4PMJA 5HUOA 1ZY9A 3UGRA 1TZZA 4MFEA 3AXHA 2ZE3A 1Z7AA 1E56A 5A8GA 1OIMA 2FPYA 3MV01 5XIMA 3FHAA 4M6VA 2DT1A 5D04C 3VIOA 1KXVA 1RA0A 2UY4A 2HMCA 3HGRA 3FA3A 1JUEA 1Q6CA 4O1CA 1H51A 2J7CA 4F66A 5CBIA 1GKRA 3NPWA 3IGSA 4AD1A 4F2BA 3PANA 1QWGA 3AWOA 1JQXA 4H83A 1XXXA 3C6CA 3PSVA 4LSBA 4HQVA 3STPA 3M0JA 2WPGA 4AZCA 2GGHA 3L7RA 1A5BA 1LLWA 4S3BA 1M3UA 4ATLA 2VYOA 1KV5A 2VZSA 2QIWA 1KRBC 1GQIA 4YYFA 3SCRA 4CNNA 7REQA 5I02A 2CW6A 1LRNA 2J9XA 3RRAA 3D46A 2JKPA 4PULA 1CGTA 1A0DA 4WVXA 2ZVIA 3WKZA 2CLEA 2ZDSA 4XO7A 2GLKA 1K6WA 3FK4A 4AZCB 5AC4A 1JJKA 1ZBWA 5DELA 1V7YA 1D7KA 4R7OA 1H49A 3ICJA 2QDHA 1DJWA 1H0IA 4FPSA 1E4IA 4TVCA 2OXNA 7REQB 4IMCA 3G6LA 4R33A 2R9RA 1TSIA 4UMAA 4V1XA 4AD5A 1UR4A 3R2GA 1VLWA 3EA1A 3L0KA 3AU6A 1EJUC 3R0DA 1MEIA 1XIFA 2CLFA 4AZGA 1ONWA 1NELA 1E9IA 3NZRA 3AWNA 5F4XA 3I6TA 1JAEA 1SYTA 2YCJA 3UZWA 2VGFA 4WZHA 2O56A 4GBDA 3WN6A 2QGYA 2EPNA 1MSSA 2ISFA 1SUXA 2YKKA 3GO2A 2QW5A 3LQLA 5FF3A 4BKNA 1E1CB 1W9VA 3HN3A 3LXAA 5T9CE 3RDKA 3NEHA 4QP0A 4JTFA 1BGAA 1B5TA 2A0NA 1ICQA 3EXRA 5I5RA 1NOWA 2OYMA 3GDRA 2C18A 1L6SA 3PM6A 3QGKC 3KOZA 3WEMA 1U33A 3A23A 1JDEA 3DYOA 2R1NA 1UKTA 3G1XA 4TMCA 5JH2A 2C13A 2HROA 1W1A1 5BWAA 2VDHA 4ZOBA 1CGYA 2OLSA 1Q6RA 2NQ9A 3EX2A 2PGFA 2E6AA 1HKVA 4E8CA 3N2XA 2BXZA 2D69A 3Q67A 2RHGA 2VWTA 1FWSA 2OU4A 3S5YA 5G2WA 4FX6M 1B3VA 4XSMA 1IEIA 2CBVA 4S3JA 3VM7A 3DOPA 3DHFA 1RK6A 4RNHA 1WZLA 1WDWA 1ISXA 4DYJA 3INPA 3ATYA 3PPGA 4O8RA 1JD7A 2J9ZA 2WJFA 3Q94A 3VKDA 4ZO9A 4LALA 4DEFA 3N19B 4O12A 4IMFA 3NZ1A 1ZQ5A 2A1YA 3LPOA 1VPXA 1JZ4A 2W61A 1XDLA 3C3NA 3NUKA 4H6QA 4XD6A 2CITA 2VDGA 4MNLA 3B9DA 4ICMA 3CBWA 3E0IA 3V1PA 3HURA 1D2KA 4OVXA 1A5AA 1JDDA 4JTDA 1QBBA 2G0WA 4UTTA 4AHPA 1GHRA 4CN1A 1WKEA 1WQ5A 3KTSA 5D4YA 3JRKA 1W1ZA 2WV8A 4J3WA 1PZ3A 1E15A 3KL0A 1IYXA 1VBJA 5G1YA 3FW6A 1ZU8A 2B4GA 2QUUA 4O1FA 3VX1A 3WEOA 3WMBA 1X1OA 1E0TA 1XYMA 4IXHA 2ZZ6A 1QTWA 1W8GA 3L2LA 2R6OA 4TUFA 3LTSA 1EFZA 3PY2A 4GUJA 4Z17A 3W1NA 5BXTA 2PP3A 5D9OA 3ITLA 2PP0A 3CB8A 4ROQA 3B8UA 3OZMA 1Z89A 1NH6A 4O50A 3AMDA 1RLCL 3CWHA 2B7QA 3BOXA 3N11A 4LRTA 4LYQA 1W9DM 5DMLA 4HNUA 4DO4A 3CEUA 4DJEA 1XIJA 3WMSA 3D3FA 4M6PA 1GVOA 4LBSA 3ARSA 4JTEA 5DXXA 1JG9A 2PDFA 4PTNA 3NTYA 3M0XA 1BF6A 1WKFA 4AIEA 3FKKA 4HU0A 4S3AA 3FFSA 4G7EA 5M1TA 4AIOA 1E55A 1TUXA 3CHCA 1ITCA 1K77A 1AQHA 1SPQA 3AMKA 1OF8A 1PVNA 2Q8XA 3LLFA 1Y5VA 3I10A 1TTPA 1UZ1A 2WQPA 4DF2A 1QI0A 5TQLA 3F4NA 1LBMA 3PFMA 4XKMA 3R6IA 4TX9A 3LYEA 3NA8A 2VZVA 1PHQA 4RE2A 4O13A 4DNHA 3AIWA 2WZHA 8XIAA 2QCGA 4JTRA 1EOKA 1IXPA 3BJTA 4G7EB 3VGGA 2X40A 4QAIA 1XL9A 3ZJ8A 1TQJA 2JEQA 3FN9A 3XINA 5G1MA 3W28A 2R1LA 4R88A 2ZC8A 4CQDA 3CASA 3VCCA 3PPCA 1TZ9A 5BROA 4UTKA 4D8AA 1TV7A 1W5PA 5JQ9A 2PDXA 1JRBA 4LEFA 4HNVA 4PEEA 4UQ9A 4PUKA 4DO5A 1NQKA 1FWBC 5A2BA 1DJGA 2EO7A 2JF7A 3KL5A 3STGA 1EJXC 3E0LA 2EGZA 3S1WA 3MZ2A 1JRCA 2I5QA 2V5JA 1UQZA 3QOKA 1SMAA 3E5PA 4Q7BA 1H4PA 1JCYA 1VS1A 3UWZA 1GVRA 1A3HA 4YL2A 3BCDA 2W9MA 1EBGA 4GUHA 3HQ1A 3CHVA 1R85A 3KRZA 2D2GA 4LGXA 2GGGA 3MVTA 1X6LA 4GK8A 1UIOA 4D71A 3P0WA 1JZ7A 2CIPA 3FXYA 4LEQA 1UZ4A 3UJFA 4O16A 3N9RA 4LVAA 1W3IA 2NQ5A 3GVQA 3UCCA 3OGSA 2WAGA 2OX4A 1GKQA 1W5QA 3N1AA 4UTHA 1ONEA 3GHSA 7TAAA 3P6LA 3FYYA 3I3EA 1IWBA 3CV2A 4JDBA 5C2GA 3PC0A 1W1B1 1J0ZA 2Y0FA 3KS5A 3ZJ6A 4TR9A 1UZHA 4O18A 1OQFA 4C1NA 3TWBA 3DFOA 2NUYA 3HQNA 3W81A 1Q3NA 4C6KA 2QKFA 4MGGA 3P8IA 3GFZA 4KCTA 3G24A 2QXWA 2PRHA 4XK2A 4NIRA 3LM3A 4Q3MA 5AZ1A 2HXUA 2F8QA 3S2NA 4W89A 5BU9A 1AUSL 2VM8A 4AD0A 1BTMA 2EG7A 4AZHA 4JQ2A 1JDFA 1VIZA 2BHYA 2V3EA 4WRHA 1Q6GA 2QDGA 3ARUA 4XB3A 2Y4SA 1PKYA 1X97A 2PTDA 3TN3A 2C14A 1IR2A 5B7ZA 4JKLA 4RW3A 1KB3A 1TR1A 1TV5A 3LHVA 4YIWA 4FAMA 4A21A 3M5ZA 1IZJA 4DZIA 2REQA 1KTBA 1NDYA 3ARRA 4X2PA 1PYMA 4QSHA 3UY8A 2ATMA 1B3YA 1K7FA 3NR0A 3O6CA 4CNOA 3CQIA 1XIIA 2R91A 3M7WA 2TRSA 2HBVA 3NQ2A 4YVVA 1BRLA 1OB0A 1W3TA 3CH9A 1G7VA 1BG4A 4K1GA 4F0HA 3ARWA 3TFCA 1U30A 1GTHA 4NNCA 4S1FA 3EMZA 1SR9A 2REQB 4CD5A 5H91A 2ZFAA 1H7XA 4XSLA 2CC0A 3T78A 3W26A 3BC9A 3UZJA 3EWWA 3WK1A 2RKXA 4H8VA 1ZAHA 3QR3A 1XM3A 6ENLA 3JS3A 3IJDA 4NJKA 1FCQA 1PAMA 5T91A 4FF5A 3VYLA 4LF2A 4YPJA 4NNBA 4MKNA 2CZVA 3M9YA 1JL8A 4CD7A 2DIJA 3NVDA 4YU1A 4MJMA 4KWWA 2Z1SA 3TP4A 4W88A 3R79A 4IXXA 1YPFA 3VE9A 3TYZA 2ALRA 3TZFA 1EJ7L 1TIWA 4JHOA 3VNIA 4K68A 4Z1CA 1MDRA 1QDSA 3M07A 4HMEA 4GPNA 5A2CA 4Y9OA 1A5SA 4IIBA 4GVFA 2FB3A 3M44A 2VEIA 7CGTA 4U31A 3MHGA 3F03K 2O4QA 3ZR6A 3M0HA 1OT1A 5BRPA 1PCKA 4Y9NA 4OE7A 5K2ZA 3TAOA 3LHYA 2X1UA 4LY8A 4S23A 4CVUA 1JUBA 1WNOA 1QFEA 3AMCA 4O8AA 4QQ3A 2XISA 3MDUA 5A5WA 5DCDA 1PCWA 3UR8A 2CLPA 3GYEA 3LBOA 2QGHA 4QG8A 1WDQA 5I3DA 1O5KA 2G3JA 1TQXA 3NO5A 2FGZA 1S39A 1WKDA 3DBNA 3OW1A 4PCFA 3E5BA 4JTAA 2H6RA 1W9BM 3GH5A 4QLJA 3PAOA 3UBPC 4H04A 3PG8A 1MFUA 3V3WA 1SZNA 1ZP4A 3CZEA 2DJLA 4U10A 3HV9A 3TN4A 2WSYA 2J78A 4HMNA 3GFYA 1A0CA 1P6CA 4DXKA 3EAUA 3MCOA 4WJXA 3CU2A 4JTKA 1KR0A 3SN0A 4NILA 2GQ8A 3WQOA 1OSEA 3PBMA 3MSYA 1LG1A 2ZTKA 2ZX9A 3BLIA 1HKJA 1C8YA 2YA2A 5H6HA 4Z2JA 4B3ZA 4CD4A 5FI8A 3R89A 1PPIA 4HA0A 2WC3A 1XQLA 4OTKA 4CLMA 1W1PA 5EY5A 1TJPA 4GMEA 4U3AA 4CQ8A 1LCOA 2PZ0A 2TSYA 4FK9A 1BG9A 1SR0A 3DH7A 1VFLA 1H7NA 2PWHA 2XHYA 1SJDA 4EE9A 4N9BA 1PTAA 3MJMA 4PSRA 4S3DA 1RD6A 4B91A 4MY8A 1YTKA 3GVGA 4Q8UA 3EDKA 4HNOA 4CN6A 2E0PA 1Z48A 1DL3A 4PBFA 2GWGA 1XRSA 3E0FA 1HT6A 2P53A 2V30A 3VM5A 3N25A 4NHVA 2VD8A 2PLCA 4DI9A 3RX4A 5IHSA 1K02A 4DXVA 3LOTA 4OGZA 3APGA 4XV0A 2YL5A 4P8WA 1THFD 1QATA 3W72A 3BSMA 3SUUA 4P5UA 1BKSA 3W1AA 1A47A 3BCFA 1W37A 2PDUA 1K7EA 4PL1A 2YOCA 1V02E 3W86A 1R7OA 4QTGA 4HJFA 5EFFA 3XIMA 3NXFA 3GBEA 3OLIA 3QN3A 3CZKA 3SQMA 4RDVA 4YN5A 4WIWA 2PD9A 1FWHC 4YWSA 1I2RA 3PWGA 1W56A 1S5WA 2VZUA 3GTFA 1FWGC 2OVLA 4M24A 3TC3A 4D6CA 2DORA 2VFFA 5CLWA 4AU0A 4UWMA 5KMYA 2WHJA 4PCPA 5A3HA 1KA9F 1B3XA 4I8YA 4UQCA 5IFTA 1QI3A 4NU7A 4K7YA 4PRWA 3P93A 2IQTA 3DFSA 3G1FA 2O92A 1ONRA 2C0AA 3PWIA 3CAQA 4NJIA 3W1UA 1QK2A 1BYBA 1H5YA 5BRBA 2BOGX 1WV2A 4JFTA 5CQ1A 3ARVA 1YQ2A 3BZGA 2AL2B 4I7UA 3MYOA 3G1AA 4NJHA 1KBIA 1Q6EA 2QCCA 4M6QA 1OEPA 1WBHA 4K3ZA 3EX6A 3ZM8A 4DLFA 3UWVA 3B4UA 3TUUA 4F40A 3IV8A 5I3JA 3NQ6A 1JNDA 1KKOA 4MLRA 1S3HA 2PEVA 1DXIA 2Y7GA 4PUNA 3GVWA 3RYSA 3PN8A 4XAFA 4CCEA 3RRXA 2Y6ZA 4HPHA 2RAGA 5DMMA 4V15A 4WY0A 1SSDA 2DIKA 5AYXA 2PAJA 1US0A 3LK6A 4QS5A 1QHPA 1KFJA 1IGWA 3AIUA 3BOLA 4O57A 4GVHA 4RNIA 4O54A 1TWWA 3L68A 3SQSA 1P1MA 2INZA 1JZ8A 1E6XM 1FDJA 3OVPA 4KEVA 1K1DA 3CUHA 1EC8A 3TYEA 4WY0B 3TN6A 1UP3A 4A3UA 1A5MC 1YPXA 1LM1A 3O05A 3CPUA 1VBGA 1CZ1A 3TYAA 4RR4A 1UR0A 4GIRA 4K2SA 1H50A 4PMZA 1J6OA 1Q6LA 2OWCA 3W3OA 3PJWA 4OUEA 3A3XA 1NF0A 4NASA 4JCMA 5AOUA 2PE4A 1TE1A 5DX7A 4OFCA 1I1WA 4DUXA 5LNSA 2FZ8A 2QJNA 1SZGA 3KBJA 3URBA 1SGJA 4XD3A 3R1ZA 5AYIA 1ZJAA 3G5EA 3I4KA 3W7RA 1BFNA 3PR2A 4ICCX 1LTDA 3W2UA 3MPGA 2Q8ZA 2CPUA 3MJYA 1Z42A 4ZR8A 1P1XA 1G67A 1F8MA 1PKLA 3G6MA 4H01A 2G96A 3GTNA 3GSMA 1OFRA 4PMYA 4IPIA 4LUTA 3HG2A 3WLNA 4EP8C 2QCMA 1O95A 1E6RA 4NY2A 2XSAA 1W6TA 3G0XA 2CWNA 2YB4A 2WW5A 1FCBA 2ZRZA 3PBUA 1V77A 2CKSA 3HMCA 4HGXA 3DGBA 5BMXA 3IACA 2XN2A 1TVNA 3F5LA 3UZ5A 5H1WA 1QUMA 3H2OA 2D0GA 3GXFA 2ZRUA 2OOFA 3RR4A 1I9CB 1X98A 4JTQA 2Y7EA 4IT1A 2AAMA 3G1VA 4KS0A 3W25A 5I06A 3KW3A 1B1YA 4RZ4A 1P7TA 3EEGA 3E2QA 2PGWA 4DBUA 2CLHA 1RAKA 3EPNA 2FFCA 5CGTA 3USZA 3B9AA 3SCQA 1W5OA 1SJAA 2DP3A 2XSXA 1VFUA 1FKWA 2CZFA 2VEMA 1RP9A 4RPPA 4GO8A 1HL8A 3MUCA 5G2HA 2ZZ5A 5DEZA 4ZB5A 3FA5A 2CXGA 2CNCA 2Z1XA 2HVNA 2V0TA 1T8XA 4DJDC 4FF7A 1ENUA 3I7QA 5EMLA 3CMGA 4GJJA 1Q5MA 4Q4RA 3DUGA 1G4EA 5TIMA 2E9MA 2GVGA 3B06A 3QEZA 1ZENA 3GQYA 3IS4A 2CLLA 1T41A 2G3NA 3DKLA 2TODA 1FWCC 3A4JA 3I68A 3F5JA 3C5QA 2GGJA 3IEBA 3W82A 3M4HA 5T26A 5A69A 4B5UA 4NAFA 4JKMA 2INEA 2VO5A 2Y2WA 2BP1A 4N9EA 4QEEA 1RZMA 3D0CA 3CIVA 3E49A 2OX1A 3A5FA 5AHIA 3WLTA 4Q7NA 1UH4A 3WNKA 3IVTA 2MANA 4CD6A 2ZX8A 3K13A 1PL9A 3H12A 4JX4A 4HPJA 2DH3A 1J5TA 1Z44A 2IPWA 5K4ZA 3E12A 2JQXA 3DG7A 4JYEA 1ZB5A 2BY3A 1XR2A 4NAFB 4UR9A 3CMFA 1FXPA 4UFHA 4XVDA 1DJIA 1I8JA 2HV5A 3BTNA 3W23A 4GGHA 3SJNA 3I65A 3G18A 2DV0A 2PDJA 2WBGA 3GDMA 3WO8A 4ACZA 3VGHA 3F5KA 2QCLA 1B4KA 4GVIA 4RL3A 3MP4A 5AN7A 1S5NA 1J01A 4KMQA 4F0MA 4I5UA 1OD0A 5HMEA 1RY8A 3KWSA 1TMLA 1IR1A 2XUCA 3BURA 1G4SA 4ZL1A 3HQOA 2VD9A 1W54A 4PFHA 3OQ8A 2QAPA 4M6UA 2A6NA 4AEEA