1G67A

Thiamin phosphate synthase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
GIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 82
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g67A00
1KBIA 4K8EA 3W74A 2WPBA 1F76A 3N34A 2CLEA 1QPRA 3TA6A 1LP6A 2A2IA 4N9EA 2A7NA 1Q3NA 3GYEA 1B57A 3P62A 1YXCA 3TMQA 5LNSA 3LTPA 1J5TA 4O0ZA 1R2RA 1W5NA 2NUYA 3LCFA 4ADUA 4DPPA 1OFAA 3M5VA 4YCOA 2A1YA 2V9DA 2Y88A 3CIXA 4S2BA 5CPNA 5BNKA 2ALDA 1L6YA 5K4ZA 1AW1A 3PAJA 1VHCA 4HNTA 1TRIA 2FPVA 5IBXA 4AH7A 5CSSA 1OFDA 2VFDA 1NSJA 5TQLA 2ZDRA 4DEFA 1TSIA 4M6PA 4UTWA 4WXYA 3TNOA 5E93A 2ZBTA 3EX6A 3D0CA 1TJRA 4LVGA 1XUZA 3GXNA 4MZ1A 4MYAA 5G2HA 1PIIA 3S42A 3N2MA 1OFPA 2NUWA 2YW4A 1KV5A 1WV2A 4OU1A 4IMDA 1SW7A 4O10A 4DO5A 3LXBA 4CNPA 4GUHA 1SO6A 2WSRA 3LBMA 4K7YA 4MYXA 3W73A 3W7DA 1G69A 1L9WA 4CQ8A 3GX9A 4JNMA 1H5YA 1G4SA 2V5LA 3PG8A 1JCJA 4N4PA 4XBKA 1HTIA 4MVAA 3C8FA 2Z2UA 1KM2A 3HGRA 3L66A 3G24A 4RX0A 4R34A 5AN7A 3FYPA 3F03K 3DHFA 3KRZA 2J88A 1QO5A 4GWEA 3P7YA 1ONRA 4WJEA 3HPSA 2H3BA 3LHZA 3G1AA 3MHGA 1FDYA 4QISA 4CNOA 2OJPA 1VCGA 3L5MA 1LCOA 5FEPA 1VCFA 4H3DA 1GOXA 2V2CA 3GDRA 4X9SA 3GAKA 3B8DA 3FYOA 3RLUA 1Q6LA 3O05A 5DLCA 3S1WA 3USBA 1SPQA 5F4WA 2B4GA 3FKRA 1ME7A 3NL5A 1B9BA 2C15A 5CZSA 1OABA 3UNDA 1QFEA 2A5HA 4KWVA 1ICSA 2VFGA 1DHPA 1H51A 4X2RA 1YTDA 5EA9A 5IM51 3F4NA 1I2NA 4RKAA 3A21A 1GEQA 2E77A 3NL2A 1OX4A 1LOQA 3FKKA 3RNDA 4IXXA 2BSLA 2NUXA 1PCKA 5HNRA 1R46A 4GNJA 3NQVA 2B0MA 4DQWA 3HPZA 2EKCA 3HG2A 4RJEA 1OFBA 3EKZA 2ZTJA 1W3NA 3G1YA 4UR7A 1G4EA 3UY8A 3UY7A 3OBKA 1XCFA 4JICA 2E6YA 1C8VA 2WOQA 4JIQA 4NNCA 1JCLA 1WDWA 4TMBA 2VFHA 2R14A 1BEUA 3TAOA 2V8ZA 1F73A 4FO4A 5DBUA 2YW3A 4GUJA 1KM5A 3E9AA 3P60A 4HKPA 2Z6IA 1NF0A 3B03A 3B0PA 3GDMA 3NXFA 3W1MA 3KRSA 2GOUA 5FF4A 1F6PA 3L21A 2A4AA 1IF2A 2C0AA 1L6WA 1SZNA 3NAVA 2GJNA 3B04A 1FCUA 2PRHA 3NDOA 2W0UA 1RQEA 1KFBA 2CLLA 4AHPA 1W37A 5KZMA 3DHDA 3W1LA 1FCVA 1RD5A 1TIMA 4C1KA 3QSRA 1VH7A 3W7RA 3THAA 4QM1A 3VKJA 4UTUA 4LWWA 1KM1A 3RF9A 4AB4A 3CU2A 3QEZA 3QMTA 4JTLA 1WOAA 4K39A 5C54A 1S5TA 3LI1A 1ICQA 3UWYA 4EWND 3DKLA 3CLMA 3NR0A 2GJLA 4FHAA 1FWTA 2E5BA 2VEPA 2Y89A 1K02A 4FXSA 4JGDA 2ZZ2A 1M5WA 3ATZA 2DU2A 1A5CA 2VEKA 2ISWA 4FF7A 1ZALA 2F84A 3M0ZA 1UUMA 4LVFA 3W76A 2CZEA 5AHLA 4ZZ9A 2YR1A 3E02A 3LLDA 1KM0A 2DZUA 5D32A 4DO6A 3IIXA 1QWGA 1O5KA 3EXRA 5D33A 4JDBA 4QJ1A 1J2WA 1HFBA 1F2JA 1TPFA 2V0TA 3RLVA 1H7XA 4DBDA 4AXKA 3M5XA 3FS2A 3IVTA 1W5QA 1WBHA 3W1QA 4PA8A 3VI2A 1RPXA 4JIPA 3W9ZA 4JTIA 4OV4A 5HWNA 3QYQA 2YZRA 4JTHA 4KFPA 3G0XA 3TROA 1RQHA 4AWTA 5CZ0A 1K8YA 1KFKA 1T96A 1TYGA 4RK8A 3TC7A 4N9DA 3QM3A 1KA9F 3E96A 5F2MA 1X7FA 3M6YA 3NQFA 1SW3A 1Q6QA 2VFEA 5G4WA 3PSWA 3G0SA 3WFAA 3KHJA 3GR8A 4O18A 3W22A 3GIYA 4LS2A 2RDWA 4DF2A 1GYNA 3TE9A 4UFHA 2RDUA 4ICNA 4UIOA 4E38A 1IXOA 4MY1A 1P1XA 3G1VA 4P61A 3R5EA 1OFEA 4K6AA 5BMWA 1BWKA 3PSVA 1W5PA 3P8IA 4ALDA 1QO2A 3E12A 4M6QA 4A2SA 5AHIA 3I65A 3TH6A 3O6DA 4CCDA 3BG9A 2QDHA 3SSJA 2XN1A 5E1QA 3TW7A 4POCA 3STGA 3P5YA 1WBJA 3PY2A 1YPIA 5KSWA 3S5YA 1OFOA 4LVDA 1VYSX 2NZLA 1O4UA 3H55A 5TBOA 3C2RA 3GR7A 3OEXA 1W5MA 4Y90A 2XN2A 4WQ6A 1N7KA 4JN6A 3BLEA 1NAL1 3A5FA 4CCCA 1OX4B 3EWYA 2NXHA 1YYAA 4WOQA 1TTJA 2H3DA 1SZGA 1AW2A 3F1QA 4I7UA 4JYDA 3O6YX 5AHEA 1H7NA 3QH2A 1BKSA 5D2XA 3EX3A 1FQ0A 5I3FA 3TK7A 3HGSA 2VEIA 4WXZA 3W7KA 3W7MA 4JTTA 3W87A 1MXSA 3HGOA 1Q45A 1R2TA 3G1SA 3M9YA 4IMEA 4NJJA 4NVTA 1TPWA 2FPYA 1OK4A 2H6RA 3UD6A 1HL2A 5HR6A 4JEQA 3LM7A 2I9EA 3PBUA 5DY3A 2QCGA 3TAKA 3V1PA 3W7CA 3S5NA 3I7QA 1S3HA 1RVGA 1JJKA 1UUOA 1KM4A 2BWGA 1SZFA 5FESA 2NX9A 2R91A 2A85A 1FWWA 1TPDA 5AC8A 3NQ2A 5DCEA 1LLZA 3M5YA 2B7NA 4WY0A 1P4CA 1NF7A 2Z0IA 3R12A 2ZZ7A 3WK1A 1TV8A 3W2NA 1GVQA 3R2GA 2GVJA 3SR7A 2V2DA 3WJSA 4ORIA 5HULA 2EPHA 2YGYA 3ZS4A 5HUPA 4XUGA 1LORA 4IX2A 2RH9A 4I7WA 5FF0A 1TPH1 3S8HA 3LHVA 4EOUA 5CSRA 2GVGA 3PB2A 1H7WA 3PF3A 3UZJA 3GLCA 1TV7A 5LGZA 3C4UA 4PL1A 2V2HA 4HT3A 1RQBA 4A3UA 3G3MA 5D09A 3MP5A 4ONVA 1O94A 5T26A 2NX1A 4UMAA 5D2YA 4HNNA 4M19A 5FF3A 4UFLA 4N6FA 5CZJA 1SO5A 1G4PA 4UNKA 1FXQA 4WOZA 4AWUA 4YMZA 3C2EA 5FF7A 3W1TA 4GJ1A 1Z42A 3AJXA 3RU6A 4LNYA 3STEA 3EWBX 3LHTA 3LRMA 2ZZ5A 4AEOA 3PBYA 1H61A 2X1TA 3W7NA 1F7BA 4JX5A 3SZ8A 1TMHA 5G2WA 3TJXA 4W9TA 5C55A 4IOTA 1Z44A 4B5NA 4O1BA 4DXVA 3W3OA 3NL6A 4GFSA 3UXAA 1WQ5A 3W6YA 1EP2A 4RR4A 3KVJA 4ZQMA 1SU5A 1EEPA 4FNTA 4DF1A 1PL9A 3L5AA 3LRKA 1ZENA 3DBPA 3MHUA 3P74A 1TPC1 3EKLA 4NJGA 4A2RA 2PCQA 1KBJA 1PHWA 1GYLA 1I8JA 3L0GA 5CPOA 3MYPA 3OA3A 5HWJA 2TSYA 3W86A 3GK0A 1N55A 1LRQA 2C1HA 3ELFA 4UMCA 4WY0F 1T8XA 1D9EA 1XDMA 1ZCOA 3T44A 3NQMA 3LTSA 3W7LA 1VYPX 4JD4A 1XC4A 3W72A 1QPNA 3IV3A 4FIQA 1FCQA 4AMAA 3DI1A 4HNUA 1UASA 3IIPA 1TTPA 1UB3A 4HSOA 4U28A 3QW3A 5AHFA 4HIBA 4O4WA 4RZ4A 2GPTA 5FEXA 3I68A 3T78A 3GXTA 1KTCA 4JDYA 3UPBA 1GG0A 2GUUA 1ZAIA 2Y6ZA 4NUWA 2RKXA 3G0UA 3LCHA 1JQVA 1WX0A 3NGJA 1P0KA 1IXNA 1YLVA 2C18A 2DZSA 3PG9A 1V5XA 3DFQA 1LRNA 4OWGA 3F4WA 2O7QA 5DCBA 4XBSA 3CWOX 1XUUA 4NX5A 4ORMA 2XFWA 4JTSA 4HSNA 4NXKA 2JBMA 3EWXA 4UCGA 4XZ9A 3HPXA 2ZRXA 4UFMA 2ABBA 3BLFA 1U83A 3GVGA 1GT8A 3G3DA 3IGUA 1NVMA 3G1FA 1T0OA 3TQKA 1AW5A 3TXZA 2A0NA 3TMLA 4BI7A 1ML1A 2WV8A 3W1XA 3TC6A 1HG3A 3TX9A 1PV8A 2QCNA 3TSDA 1DJQA 3UZ5A 5ABTA 5KINA 3P8JA 1K7EA 4FX7A 5EYWA 1EA0A 2P0OA 1I2PA 4O50A 4AVFA 3W84A 1SSGA 2OZ0A 2WSQA 5HQEA 1WYIA 4WY0B 4MPQA 3QPYA 3TSBA 4N4QA 1AK5A 1KFLA 1KLYA 5DCDA 3EWZA 3NM3A 1HUVA 2H90A 2NXIA 1UCWA 1F05A 4R53A 5SWUA 1VHNA 1K03A 2F7FA 3FOKA 4BFAA 4YL2A 3VE7A 2J9YA 2J9ZA 4LTSA 1AL7A 3CHVA 2Y7DA 3H54A 1RV8A 1X8FA 3U6WA 4MY8A 1DBTA 4K7VA 2FB2A 2H8ZA 2HTMA 4ML9A 4UTJA 2QCFA 1P5BA 1CW2A 5F1VA 2HSAA 4LUJA 4EF9A 1OFRA 3M43A 5CPLA 5D03A 5DN1A 3M41A 4O13A 3PUEA 3C52A 2J24A 5J5RA 3MP4A 1FXPA 4Y9AA 2RDTA 1B3OA 4Z08A 4FNQA 4NJKA 2ZA2A 4LVBA 1QPOA 2YPIA 4A22A 2Y85A 2CU0A 2VOMA 2V82A 4ZQCA 5EL1A 1KLZA 2Y7EA 4RXGA 4JR5A 1ME8A 3NQAA 3DFNA 3IRDA 3W88A 3C2VA 1FDJA 4UXDA 2E5DA 3HG5A 3QC3A 4TR9A 4EF8A 3HQ1A 3P5ZA 1IXQA 1A53A 4UFJA 3KVMA 3CTLA 4QNEA 3N9RA 3SIZA 1QAPA 1ADOA 4IXHA 3NA8A 1PCWA 3UXDA 1XKYA 1XI3A 3H53A 1H62A 1VGAA 4OBTA 4Z1AA 2CZFA 2NWRA 3A23A 3LOTA 1LROA 1QOPA 2ISSA 5AYYA 1MO0A 3EXTA 1OF6A 4R33A 4BK9A 2GQAA 4FXRA 4FX8A 5D38A 6TIMA 5D2WA 4WD0A 2FJKA 1XM3A 1QCWA 1I2QA 4O15A 1YXDA 1PVNA 3IGXA 2DZVA 1W3IA 4M7SA 4IGHA 4ZMGA 2G5WA 3LCGA 5D04C 4O0KA 3TFXA 4MUZA 3I7RA 3TQ0A 1DVJA 1J4EA 2X2GA 1H7RA 4LW7A 1R30A 3BGJA 4MOZA 4LV4A 2C14A 5K3VA 1VJIA 3M1ZA 4TX9A 3W7OA 5C5YA 4M6VA 3UWQA 2V30A 4MLRA 4NX0A 2ZFAA 3N73A 5H2ZA 3MBFA 4OT7A 5DXYA 4FX6M 5A5WA 5F2GA 3ABQA 1S5VA 1OJXA 3ZWSA 1DL3A 1ZNNA 3L5LA 1EPXA 1W54A 2E6AA 3LHYA 3DI0A 3W85A 1OG0A 4AAJA 5I3KA 4YXGA 3JRKA 8TIMA 4IJBA 4IMGA 2CLKA 2O7SA 1GTHA 4UR8A 1KFJA 4GXMA 4MLJA 1W56A 4ZL1A 1GTEA 3DU0A 2YXGA 2ZQ0A 3NQ6A 4O12A 5DELA 3QSTA 1W0MA 3STCA 3MUXA 1YXYA 3L0NA 1THFD 5BOOA 4DO4A 3WK3A 3O8AA 5CG7A 3CM4A 4RLIA 6ALDA 1OVDA 4MY9A 1OK6A 4LRSA 4AHQA 4JTUA 3W71A 3TR2A 4O17A 1FBAA 2Y70A 1L6SA 4GRSA 2G96A 3HG4A 3B0VC 1YDNA 2OT0A 3JR2A 1TTQA 1JVNA 1D3GA 1YDOA 2BXVA 2QKFA 3EWWA 1ZAHA 4ADTA 1X1OA 1EP3A 2QUTA 3S6DA 2WSYA 1TPVA 1QMLA 3ABRA 5HMSA 4BR1A 1TV5A 2YFNA 4Y96A 3DFSA 3SJ3A 2EF9A 5G2IA 4GE8A 3P61A 1LRTA 3TSMA 2JKAA 1XBXA 2FFCA 3MMTA 4OQVA 3MJYA 2H8XA 3ABOA 1D3HA 4UNLA 2A7RA 1JRCA 2X1UA 3MI3A 3NOEA 4R7JA 4GUIA 3LCXA 5LNRA 3HMJG 1CX9A 4JTEA 2DJXA 2QR6A 3SECA 1P0NA 1QNVA 1FDZA 1KTNA 3G1DA 3NL3A 4LS0A 5EBUA 2BX7A 2TPSA 2ZYFA 1EUAA 2V5BA 1PS9A 4UTIA 3BK0A 3IGSA 4YWIA 1XBZA 4NXSA 3LHWA 5E0KA 1SUXA 3O06A 5G1TA 1DKWA 4IPIA 1RR2A 2LLEA 1IIGA 2FQIA 3HO8A 4NQ1A 2OT1A 3EX2A 4MFDA 5D37A 5DBTA 2BTMA 3VE9A 4O54A 4UFKA 3RK8A 1SFLA 2ZTKA 5AHNA 1U5JA 4NJHA 3A24A 1C9DA 2C3ZA 4PH6A 3E0IA 5F4XA 1XL9A 4OV9A 3S1VA 2CLHA 1W3TA 3BV4A 1TQJA 1UBSA 2Y7GA 3TIMA 1K8XA 2VELA 3INPA 5AC6A 2WNZA 2ZA3A 3JS3A 4RV8A 4NU7A 5GVJA 4AHOA 3S5OA 3DFOA 2AQWA 1ICPA 5LNVA 3LDVA 3W7EA 2EHHA 1SW0A 3TDFA 3GDKA 3W2LA 5F2IA 3W1NA 5EPDA 1K7XA 4NZFA 3A22A 5I3GA 2DZTA 1QR7A 1OF8A 3GDLA 5HWMA 1SO3A 2WO5A 4O57A 1WXJA 5F1UA 2Y7FA 2PE4A 2QCEA 4M7TA 4UTTA 3N2XA 1O60A 3SI9A 1ZAJA 4IUOA 5C6MA 1VZWA 4I7VA 3NQ7A 3W1PA 4BI6A 1ZY9A 1GVOA 3T7VA 2A21A 3QW4B 1Y0EA 1YPFA 4KWWA 1H7OA 3GDTA 1JRBA 1G4TA 5K2ZA 3SW6A 2YSWA 3RFAA 5H91A 3A5VA 3G22A 3LX9A 2YDAA 3NPWA 1TPB1 3T40A 1KFCA 2E6DA 4DF0A 1B4EA 3HBLA 4Z1DA 1O5XA 4U4MA 1VPXA 4KFOA 3S5ZA 2AGKA 1I45A 1K3UA 2E1DA 4K37A 2VENA 3NPVA 3NM1A 3WJXA 1BWLA 1UJPA 3PBWA 4QNWA 1JULA 1AMKA 3CPRA 3W2KA 4S1FA 3UQNA 1BTMA 3W1RA 3LRLA 1T99A 3W1UA 3GKAA 2OMAA 3HGJA 3TKFA 5EMUA 2YCEA 2ZCGA 5D30A 3DENA 4K36A 5HR7A 3Q37A 2WKJA 3LLFA 1JCYA 3M44A 3WJYA 1TTIA 3ATYA 5LKYA 5F2LA 2CWNA 2DP3A 4ZQRA 5D2VA 4DBEA 4GUGA 1GVSA 3LXCA 3G1XA 2P10A 2JGQA 2ZRWA 2RHGA 3MP3A 3BW2A 4WX2A 2VC6A 2Z1BA 2A6NA 3BG3A 1XXXA 5I3IA 2WJZA 3PBVA 2NV2A 3GXPA 1XBVA 1W8SA 2QJIA 4PODA 1A5BA 2VEMA 5KZDA 4CNNA 3UWVA 5I3HA 2PRMA 3VCRA 4OHQA 5G4EA 4O4VA 1V7YA 3OHIA 3NPUA 3IIZA 1VLWA 4FNPA 3P82A 5LNWA 2DZWA 1LBLA 4PFMA 3WJWA 2X1SA 2GVLA 1H50A 4MKNA 2W79A 4N6EA 4XTIA 3ZR4A 2QCMA 4MJZA 3TW6A 4IMFA 3STFA 3TXVA 1K7FA 2ZRYA 5U4NA 5CKSA 3G8EA 3R8RA 3NEVA 4KKXA 5HUOA 2CZDA 3IVSA 3TCEA 1YTEA 3N19B 1E51A 2QAFA 1EWEA 1JUEA 2HMCA 2JK2A 3CQ0A 3W7GA 1G7UA 1I2OA 3W83A 3IIOA 2QCCA 4LUIA 1ME9A 3E49A 3KXQA 5EKYA 1EIXA 3S0CA 2YFOA 1B4KA 3W2JA 3DFPA 3EB2A 4TO8A 2C16A 4UTMA 3O1NA 3ANYA 3PB0A 2VFIA 1DQWA 4BWLC 4E2BA 3LERA 5FEWA 3OIXA 3GNNA 4Z1BA 3TUUA 3DH7A 1JR1A 1IIHA 3BG5A 4Z0SA 1YADA 3C3NA 1JCMP 3BW3A 4JS3A 2NWSA 3B06A 4PEKA 3S1UA 4QITA 3LV5A 3VNDA 2JKEA 1HO4A 1IGSA 4GBUA 3W07A 3HIJA 4O16A 4JTFA 4ZVJA 4FNUA 1XBYA 5BRBA 1KTBA 3DAQA 3Q94A 3M16A 2NX3A 3TJLA 1Q6OA 5G5IA 4ZQOA 4H4IA 1SSDA 2Y61A 3NNTA 1KV8A 1RZMA 1LOLA 3IIVA 4NZJA 2NLIA 4UMBA 4UTTC 2I1OA 1I4NA 4Z0JA 3DZ1A 3MI2A 4Q32A 3FEMA 3N14A 4FNRA 3EX4A 2ZRVA 5AOUA 2WNQA 4LC8A 3UWWA 4AWSA 5U7SA 3G1HA 3PR2A 5HINA 2FTPA 2Q3RA 3DFTA 2ZRUA 4Z1CA 2B7OA 1M6JA 3OVQA 1SO4A 3EEGA 4O1CA 3QQ1A 1QPQA 5KMYA 2DORA 3IEBA 1ZFJA 4ZQPA 1G6CA 2PURA 3RMJA 5FEZA 5BW6A 2G95A 5DXXA 1XDLA 3LCLA 4DPQA 5C2XA 1W31A 3LCIA 4MIMA 3GKFA 5FF2A 3LGEA 3KFTA 3LTYA 4NNAA 2VXNA 4WZHA 1FY6A 1VYRA 2EAWA 1VR6A 3BW4A 3CEPA 1DORA 3KX6A 3NZ1A 3QRHA 1AG1O 4Y8FA 3NVTA 1VC4A 1VLIA 4MJMA 4N2YA 3CIWA 1LTDA 3SY5A 1OYCA 2ZZ4A 2QUVA 4UC5A 5AC7A 2A6LA 4N02A 4E0CA 1TCDA 4IPJA 1ZHAA 3UWUA 4UTKA 1MEHA 2FPTA 4JY8A 4QSHA 2B7QA 1LBFA 2E5CA 3BARA 3C6CA 3NYZA 2HS6A 3FJ6A 5TIMA 3W75A 2W6RA 4O14A 4Y6GA 3EXSA 1OFQA 3QQ0A 3BGGA 4A21A 2NXGA 3QMRA 1YTKA 3KRUA 2V81A 4LT9A 1SR9A 4PC8A 1TREA 4O11A 4JX6A 4H6KA 3IVUA 2JGYA 3C56A 3L9CA 1A50A 5KTLA 1TQXA 4LU0A 4LRTA 7TIMA 2X30A 4MZ8A 3QJAA 3Q58A 3N3MA 4TU1A 1WOBA 1KW1A 2CLIA 5HJLA 2JKPA 2QJGA 3ZFHA 1Z41A 3SFKA 4I9AA 3THQA 2J27A 2QCDA 3DKJA 3A9IA 2E68A 4XKYA 2ATSA 1LZOA 1C29A 3FA5A 5L6UA 5LNUA 1FUYA 4QAIA 3CT7A 2FB3A 4PCFA 3MHFA 4N9CA 3BLIA 3T4CA 1IXPA 4JTJA 3MBDA 3W70A 2QDGA 3W7JA 3HG3A 4HN4A 1M7PA 3PC0A 1OX5A 2Z6JA 3FFSA 3W7IA 4L4MA 3Q2DA 4LV9A 3L0KA 1H1ZA 4NT0A 3LXAA 4GC4A 3PUOA 4LY8A 4CQAA 3GB6A 1EUNA 3PUDA 1H63A 1LOSA 3EX1A 2TYSA 2XN0A 4D2JA 2TMDA 1ZJIA 1N8FA 1WA3A 3VFLA 5IBXC 1A5SA 4MFEA 2QEZA 2J9XA 5CPMA 3R13A 3W2UA 3CC1A 4X3ZA 3S1XA 1LDCA 4LC6A 3DXIA 4UTWC 1G7VA 1GQNA 1OHLA 3MO7A 4A29A 3OVPA 3QMSA 1R2SA 3WK2A 2NV1A 3QF0A 4EIVA 1L2UA 1YDVA 1VQTA 3OG3A 1SZEA 3CWNA 1JCNA 3G18A 4AF0A 4CCEA 5A8GA 1SFJA 2ZRZA 5D05A 4K8HA 1TRDA 1MEWA 3FLUA 4HPXA 1EP1A 1PHQA 3W7HA 1GZGA 3NG3A 3LCWA 4XWUA 1GVRA 1I2RA 1F5ZA 3HJZA 4UTHA 2CFFA 3NQGA 2R8WA 2CZ5A 3LHUA 4S2CA 4G1KA 1TJPA 1MEIA 4ZQNA 5AYZA 4QIUA 5K9XA 2FIQA 3W2MA 2PC4A 1SQ7A 1KM6A 5DY2A 2E09A 4L4LA 2YX0A 2ZZ3A 3W23A 4JTGA 2GQ9A 3W7QA 1GWJA 5KITA 4XQ6A 5K4XA 1JUBA 4Q33A 4O8RA 5L9FA 5K9CA 2A7PA 3KOFA 2C6QA 4UFIA 4TMCA 2GQ8A 2RFGA 3MWAA 2ABAA 3LB0A 1ALDA 3HF3A 3NPXA 3C2FA 4YCPA 4HNVA 2ISVA 3B0UX 4KFNA 5K7JA 1GG1A 2X16A 3M47A 4IMCA 4JY9A 5LHFA 3ABSA 3WJZA 3TU9A 5J5DA 4FIRA 4FEZA 2QF7A 4MZYA 3PS7A 2FLIA 4Q4KA 5BMXA 5I3JA 3M7WA 2P1FA 3KAOA 1FWSA 2DZXA 1HO1A 4K38A 1FWRA 3M5ZA 1QOQA 3BO9A 3UPWA 3NO5A 4GUFA 2ZZ6A 3NQCA 1LYXA 1VRDA 2QJHA 4HPJA 1K8ZA 3OVRA 3C0JA 1VCVA 1JCXA 3QPZA 1GPWA 4UTLA 1KFEA 3TQVA 3HOJA 3SGUA 2ATMA 3GZ3A 1X1ZA 1TO3A 4PL2A 1PE1A 1W1ZA 5LSMA 1LBMA 2Q3OA 2QCHA 4JTKA 3I7SA 1R47A 3O16A 1TPUA 4BF9A 1NEYA 5AHMA 3NQDA 4FNSA 1EWDA 2Q8LA 1TB3A 1MSSA 2QCDB 3W1AA 4BWLA 5LZLA 1GVFA 5KZEA 4CLMA 2C13A 1G67A 4P2VA 4XKYB 4M5PA 3O6CA 5F4SA 1FCBA 2Q8ZA 3MYOA 2ZZ1A 3C61A 4QQ3A 4O1DA 2YYTA 4RCXA 3K30A 1CI1A 1TPEA 1QDSA 4JYEA 3SGZA 1H1YA 2Y62A 1FWNA 2DJLA 4HHPA 1Q6RA 3P67A 1EB3A 4C1LA 1F74A 2QCLA 3HB9A 4JX4A 3L65A 4FB7A 4RZ6A 3MI6A 2VFFA 4O19A 3P84A 1DOSA 3QZEA 2VKZG 3L67A 2UV8G 1OYBA 3BPWA 1X6UA 1H7PA 1DJNA 1NFBA 3FJLA 3KVKA 3WK0A 5D02A 4JXCA 1FX6A 3O07A 3LI0A 4J9JA 3PWAA 5FI8A 3W7PA 2BLEA 3U2OA 3V75A 3PULA 2IQTA 4EVZA 1OX6A 3GNDA 3MW7A 3NQEA 3NQ8A 1S5WA 5CGQA 4PTNA 4O1AA 2HS8A 4AF0B 1F6KA 3L68A 3B05A 4OE7A 3EWUA 4N9BA 4UUIA 4LS1A 5LHEA 2E6FA 4OGZA 2YYUA 2CLFA 3C2OA 5CZTA 2I14A 3DGRA 3O63A 2DZPA 1A5AA 2C19A 5D2TA 5EY5A 3LV6A 3TFCA 2WNNA 4E2DA 3AO0A 4DELA 1DQXA 4IWWA 2KZHA 4O28A 2CW6A 3P81A 3FIGA 2ZA1A 4LVAA 3TV8A 3PVFA 2D73A 2R94A 4NJIA 2G97A 4RZ5A 5LGXA 2PRLA 2QUUA 4O53A 3T55A 3CEUA 3P80A 4XTDA 1VS1A 4YLWA 3UWZA 2X1RA 2AAMA 4IQLA 4IX0A 3B4UA 4JYFA 3N9SA 1O95A 1XFBA 4TIMA 1GJPA 3KVLA 3LBCA 1DV7A 3CB8A 1H60A 1AL8A 1EX5A 3UYCA 1OYAA 2OCZA 3S9YA 5AFDA 3PM6A 3YPIA 2FDSA 2QAPA 3ZWTA 5K9DA 3G8RA 1WAUA 4LOCA 2CLMA 4O52A 3NZRA 3BVJA 1LM1A 4X22A 2J6XA 2EGZA 5G1YA 3O15A 1JUKA 1MZHA 4CQ9A 4NNBA 3I6RA 2BZNA 2Y63A 3R89A 4RXFA 3GAYA 1LLWA 2WQPA 4ADSA 3L2IA 1W5OA 2TRSA 3QFEA 2CLOA 3U8GA 1JQXA 1Z48A 1KM3A 2OX1A 5MHBA 5AYXA 2B7PA 4WUIA 1M7OA 4BI5A 5AB3A
chains in the Genus database with same CATH superfamily
4CCZA 1YNQA 5H8UA 1E70M 2Y24A 2CLEA 1JD9A 1XIGA 2QV5A 2A2IA 3T08A 1BYDA 1B57A 5FKYA 3LTPA 2NUYA 3LCFA 4XKMA 3BSHA 1WXYA 2Y88A 2OPJA 4F79A 1WE5A 3COTA 4I8DA 1H3GA 4HNTA 1TRIA 2GVYA 3PZVA 5CSSA 2ZIDA 2VFDA 2XFFA 3OLGA 2XFRA 4B5WA 4WXYA 3TNOA 3VABA 5AECA 2OU4A 1PKYA 3GXNA 3AHXA 4K1GA 1PIIA 3OBAA 3S42A 1XIIA 1UC5A 4ZGYA 1WUEA 1IEWA 1KFWA 2Y8VA 3WLNA 1KV5A 1AZ1A 3S2LA 4IMDA 7A3HA 1SW7A 4O10A 3LXBA 2WLYA 3RR1A 4JFSA 3OQ8A 4ZE5A 3B40A 1NU5A 3W73A 1UA7A 4ZXLA 4CQ8A 4DB7A 4XBKA 1HTIA 2HDJA 3HGRA 3G24A 3FYPA 4PB3A 1QO5A 4GWEA 4AUBA 1HN1A 1ONRA 1MW3A 4UOZA 5CEWA 3QR0A 3LHZA 4L4OA 3MHGA 1GCYA 2OJPA 3GTNA 1LG2A 1VCFA 1WDDA 4H3DA 2V2CA 4P8XA 3NQBA 4IISA 3GAKA 2OYKA 3U57A 5C9RA 3O05A 3R8GA 5E9AA 1ZB5A 5J8LA 2PDLA 4HPNA 2C15A 1FWHC 3B9NA 1QFEA 2E28A 4UTFA 2A5HA 4KWVA 1ICSA 3KOXA 1Z32X 4FA3A 4MJ2A 3UESA 2E7FA 1CXHA 3SRKA 4D8LA 3K4WA 2WZTA 2PDCA 1GEQA 1UKTA 2E77A 1A49A 1OX4A 3FKKA 2AOSA 4B9ZA 1CZ1A 4DQWA 4GD0A 1XH1A 3HG2A 3M07A 4UR7A 1G4EA 1D8WA 1QI5A 2UY5A 3UY8A 1QI2A 3VIJA 2E6YA 2VX5A 2CXGA 1AJZA 4M56A 4IFKA 4S3BA 2V8ZA 4A8LA 3BQ5A 3GM8A 5DBUA 3SJNA 2Z6IA 3B03A 3CV7A 3GDMA 3W1MA 1F6PA 1IF2A 4E4PA 1SZNA 3NAVA 3CTTA 2OSWA 1QHPA 3B04A 3VD9A 3TYBA 2PRHA 3NDOA 1O1HA 3S2MA 4C6FA 1W37A 1FCVA 4F0MA 3QSRA 5A1AA 3W7RA 3THAA 3VKJA 2J7HA 4UTUA 4HN8A 3RF9A 4AB4A 3QEZA 4BA0A 1GONA 5DRCA 3GE7A 3UWYA 3OGVA 4AZBA 3KL0A 3NR0A 2E5BA 2Y89A 4JGDA 3EAUA 3ATZA 2UWFA 1HZYA 1VBJA 3SO7A 1UUMA 3P93A 4ZFCA 4D6CA 2YR1A 3SRDA 4C7GA 5D32A 4DO6A 2VL4A 5D33A 4YJ5A 4QJ1A 4MHBA 1J2WA 5HMFA 4IIEA 1E43A 3KLKA 1TPFA 2V0TA 1SFSA 1QATA 1LUCB 3FS2A 3IVTA 1W5QA 1WBHA 3W1QA 3PAOA 1RPXA 4JIPA 3S4TA 2G50A 2YZRA 4HOWA 3EDJA 3TN4A 3SY8A 4AWTA 4HK7A 4ATDA 3LY0A 1TYGA 4DIAA 3TZNA 3S9IA 2DZAA 5D9MA 5F2MA 3NQFA 1SW3A 3ONBA 1UQYA 2JE8A 1KQYA 4I6KA 2YA2A 1GYNA 3I10A 2BGQA 2VM8A 3QV9A 4WDXA 4UFHA 2ANUA 2D20A 3CIVA 4FP1A 4P61A 1OFEA 1R9ZA 5BMWA 1BWKA 2OEJA 5CPTA 3PSVA 3EYPA 4H6QA 5C9WA 3BSGA 3W01A 3E12A 4M6QA 2R1MA 1JDEA 5AHIA 3I65A 4WF7A 2WC4A 3AIWA 4POCA 1WBJA 2OGJA 3PY2A 3THUA 2X42A 3S5YA 2NV9A 4Q4MA 2NZLA 2NQ9A 3H55A 3C2RA 3GR7A 1JYVA 2ZE3A 1N7KA 4Q6XA 1B90A 4JKMA 4EXQA 3E6EA 2QPXA 4CN4A 2WCGA 1SR0A 4WOQA 5I0DA 5M1TA 4FR6A 4HA0A 5AHEA 1H7NA 1W3JA 4WGHA 1IWAA 1FQ0A 2D2HA 3HGSA 2VEIA 1E15A 5TD4A 3W7KA 3W7MA 4JTTA 3W87A 4ZOAA 2DY3A 2J4GA 4ZB2A 1Q45A 4V1YA 1R2TA 3GTXA 2E3ZA 3IUDA 3M9YA 1B1YA 4RPPA 4NJJA 3UCCA 4ZENA 2H6RA 1HL2A 1DWFM 1S5MA 1E1FA 3DEQA 3H22A 5DY3A 3WLIA 3V1PA 3W7CA 3S5NA 1V0MA 5BOEA 3W00A 1KM4A 2R91A 4TV5A 5DQPA 1IR2A 4ZFMA 3ZLHA 1TPDA 1AD4A 4WY0A 1C92A 1GHRA 3RX3A 4CEUC 4ERAA 1IE7C 2WKGA 3MUY1 2ADAA 2H9AA 5I78A 3CPUA 1P1MA 1KCXA 1OT1A 4OECA 5HULA 2YGYA 4MB1A 1LORA 3DESA 4E8CA 4I7WA 4G8TA 4EP8C 4J27A 2GVGA 3PB2A 1H7WA 1KBLA 1A47A 3UZJA 4YIWA 3UF9A 3C4UA 1LF1A 4PL1A 3UPMA 1RQBA 1XIBA 4A3UA 4B3LA 3MP5A 4ONVA 1X7IA 4QAWA 4UMAA 1KKOA 4UFLA 4N6FA 1SO5A 2IPJA 3PZUA 4AWUA 4YMZA 4J3UA 3GXMA 4E3VA 4GJ1A 2WYSA 4MNJA 3LRMA 1NIUA 4H41A 1X1NA 1S1RA 3SZ8A 3NIYA 4U3AA 4WVXA 4DVOA 1E40A 5C55A 2EG8A 4O1BA 1WZLA 3UXAA 1EP2A 4EWJA 3AMLA 4FNTA 3PZTA 2FGBA 4FOUA 3BAIA 2C7FA 2WVTA 1AQ0A 4GQGA 2D0HA 3MHUA 5HNNA 1IR1A 1O68A 4NJGA 6A3HA 3AI0A 4GIRA 4HZ7A 3VFCA 1GYLA 1V3JA 3L0GA 4XB3A 2YL6A 4L64A 3ITVA 3W86A 1REQA 4JL2A 3G6LA 1LRQA 4NASA 4WY0F 2WKLA 1XDMA 1ZCOA 3NQMA 2ZC8A 2AGTA 1XC4A 1K77A 2PU0A 4JNZA 4TVUA 3U7BA 3KCJA 1UASA 3IIPA 1SJCA 3QW3A 5CAHA 5AHFA 4O4WA 1UQZA 2YBVA 3T78A 3GXTA 3UPBA 3WF0A 2ZXBA 1ZAIA 5MF5A 1UH3A 2Y6ZA 1KRBC 1UH2A 1YEYA 3EA1A 1WX0A 1UJQA 3KL5A 4DI9A 2J8TA 5DMNA 2V3FA 2WAGA 4OWGA 3ZJ7A 3WQFA 5DCBA 3CWOX 4ORMA 1CLXA 2XFWA 4HSNA 4NXKA 2JBMA 4NIRA 4UCGA 2ZRXA 1U83A 2Q8XA 3IGUA 2WQDA 4KT2A 1NVMA 1TJ0A 1UD5A 2QGHA 4C5ZA 4GXPA 2WV8A 4ENLA 3W1XA 5I77A 3SIMA 3HQPA 1PV8A 2QCNA 1WKDA 4H8VA 5AZ1A 3TSDA 3P8JA 3H2OA 4E8DA 1K7EA 2VC7A 2GQ3A 2B81A 3GNRA 1IGWA 3AHZA 4FI4A 3MY9A 1GJUA 3W84A 1AD1A 3KZSA 1WYIA 3TYEA 4KCUA 3VOIA 1KFLA 1MNZA 3UERA 1S2AA 1TWDA 4I8YA 5DCDA 2VRQA 1L8NA 1LG1A 1UCWA 1Q4WA 1K03A 4C6OA 2F7FA 2VCAA 7CGTA 4DWSA 4KIRA 3A6OA 1QW9A 3CHVA 1RV8A 1X8FA 1LQ0A 3SUVA 1J6PA 2FB2A 1J0ZA 4MWAE 1ITXA 1OIMA 4W88A 2DQXA 4XO6A 1P5BA 1CW2A 3UW6A 2HSAA 3AALA 1B3WA 2ZUVA 4L9ZA 5DN1A 3F7JA 3M41A 2GJXB 2Q71A 5D8ZA 3AWOA 3MP4A 4JPGA 2RDTA 4Y9PA 3IWPA 3UZXA 2WZEA 3RM4A 2ZA2A 3WBYA 4LVBA 2YPIA 2OQLA 4A22A 2Y85A 3HPFA 1V6TA 1NELA 2V82A 1KLZA 1V7AA 4JR5A 4GYPA 3NQAA 4PUMA 1TELA 4UXDA 9XIAA 3QC3A 3HQ1A 1IXQA 3WLTA 4UFJA 3VU2A 3CTLA 1UKOA 3N9RA 2DSWA 3MZNA 1DHKA 1QBAA 1OD8A 1UUQA 7ODCA 1H62A 4JTCA 4YTUA 1HGYA 3IGHX 2NWRA 2FMNA 2EPOA 1NDVA 1QOPA 3CQKA 3BJSA 4W89A 3M0MA 1J11A 4TVDA 4BK9A 4XO7A 2E67A 1TX0A 6TIMA 1B31A 3O0FA 4O15A 4M7SA 4IGHA 3N04A 2VCBA 2AKMA 1C9WA 4R7OA 4KWUA 4UQ9A 2XIOA 3NUKA 3QC0A 1OADA 3I7RA 1BGGA 3TJIA 2A3AA 3S47A 1R30A 5XIMA 1KNWA 2C14A 3W02A 5K3VA 4TX9A 1CB7B 4NX0A 2P88A 2ACSA 2ZFAA 3J7HA 4NHVA 5F7UA 3MBFA 1ECQA 4HZMA 1JDDA 4OT7A 5A5WA 1YKWA 1OJXA 1D8CA 5B7ZA 1EPXA 1W54A 3LHYA 3A9BA 1JPHA 3TP4A 3DI0A 3W85A 4F2TA 5I3KA 1NY1A 4IJBA 3VILA 1GTHA 3PZNA 1AFSA 3R0KA 1GTEA 2YXGA 3NQ6A 4O12A 5AC5A 3VOGA 3STCA 1EKOA 4WGXA 4B4HA 3MDUA 2PBGA 3CM4A 4RLIA 1OVDA 1OK6A 3UJFA 2BMBA 2QJJA 5HBFA 2YJQA 1RP8A 2DIKA 2XHYA 3PTDA 3W24A 4GRSA 5HA7A 3HG4A 1TR9A 3E0FA 3W28A 4IP4A 1NDYA 1TTQA 2BXVA 1N2VA 3BH4A 4PSPA 4RPQA 3GHTA 2IUZA 3RU8X 1UR4A 3T0CA 2VEGA 1K9TA 2GSHA 1QMLA 2XDFA 3SQLA 4Q4RA 3MSRA 2DVUA 3VMNA 5G2IA 1LRTA 4C6JA 1PTAA 2FFCA 3AIUA 3SDOA 1CT5A 2H8XA 1M7JA 4JKLA 3C3UA 2PP1A 2P50A 2PWEA 1ONXA 4PE8A 3WELA 2EQDA 5LNRA 4JL1A 2WXDM 2DJXA 3ZOAA 4XAFA 3SECA 3VDCA 4AIUA 1MW0A 3G1DA 1DWHM 3NL3A 2Q02A 1XPYA 3D6NA 4B5UA 2W27A 1EUAA 3QTGA 6REQB 1Q6CA 4J3TA 1XBZA 2PP3A 4NXSA 1SUXA 3CB3A 1H2JA 1DKWA 4IPIA 4QDWA 2FQIA 4NQ1A 4EK7A 3EX2A 1ISYA 1IV8A 4BF7A 3RK8A 4C6EA 4YTSA 1MFUA 1TIWA 1EJ7L 1C9DA 5LYRA 2GUBA 4PH6A 2YLLA 4L9YA 1XIMA 2GGEA 4OV9A 3S1VA 3L4UA 1W3TA 5CH9A 3WNNA 2AMGA 2VELA 5AC6A 2I7GA 3A4XA 1TZ7A 3RN6A 2XIIA 1XCXA 4PGLA 3WG6A 3GDKA 1ODZA 1GKRA 2XWDA 3NSMA 3BCJA 5EPDA 2DZTA 5E6YA 5HWMA 2PCEA 1WXJA 3SN1A 3H21A 2IKHA 2PE4A 1BKHA 2GFTA 4M7TA 1JEZA 3EDDA 3N2XA 1VBUA 1O60A 3CH0A 3SI9A 5C6MA 4IH3A 4OOUA 3TA9A 3V0TA 3AHYA 3K2GA 1GVOA 4LUYA 1Y0EA 1XRSA 4KWWA 3BAKA 1JRBA 4XVEA 3ENLA 5H91A 2ZX5A 4XZIA 3LX9A 2OO6A 4R9XA 4WJXA 4U4MA 1VPXA 3S5ZA 4FSAA 5EMKA 3LSCA 3N1AA 3PZMA 1I45A 3FK4A 1K3UA 4TUFA 3ZVIA 1I6NA 2AAAA 4HPHA 1UJPA 5CPSA 4UCFA 1ZP4A 3CPRA 4UZSA 1BTMA 4G7EA 1T99A 2D3LA 3W1UA 1E4LA 3DECA 2YCEA 3AU2A 3KDNA 5D30A 4J7RA 1GNXA 4IJRA 5HR7A 3LLFA 1JCYA 3ATYA 3QN3A 5LKYA 4GVFA 2CWNA 4JHOA 5D2VA 1NOUA 3LXCA 2JGQA 5EBAA 3BW2A 1PIGA 4WX2A 3N17A 3SB0A 2EPKX 3KLLA 3D46A 5ABFA 2J78A 3BG3A 3CBWA 1W8SA 5I5RA 2V3GA 3DFYA 1PX4A 3FVMA 4PODA 1BXBA 2YDSA 3OGSA 3EOUA 3R11A 3UWVA 1F3WA 4I9JA 2FZBA 2I5QA 1XRVA 3IJ7A 1V7YA 2HPMA 3NPUA 1VLWA 3P82A 1LBLA 1EYWA 4PFMA 4UNIA 4GY1A 1H50A 2CEQA 3OQEA 2QULA 1POJA 3ZR4A 3H4WA 4MJZA 4IMFA 1MYRA 4A3YA 3WMBA 3STFA 4GH3A 4JQ4A 3UZYA 1K7FA 3T42A 3WLRA 1EBGA 3JU2A 4FOJA 3R8RA 4QTGA 4KKXA 4GO8A 4LALA 5DANA 4KRTA 1YTEA 2I5IA 3W7GA 2OQHA 4NZ1A 1I2OA 4J4KA 2AKZA 4LUIA 5EKYA 3KXQA 3S0CA 3FNDA 1UOZA 5FJUA 3ANYA 2PDYA 5BXPA 3A3HA 1TE6A 3LERA 3OIXA 4JEJA 1OSEA 3ORWA 4YTRA 2D23A 3IJDA 3BG5A 3C3NA 3BW3A 2NWSA 3AYVA 3GU1A 1VENA 4QITA 3LV5A 3VNDA 3PJXA 4XSMA 1IGSA 3CZ8A 3W07A 4FNUA 4PMZA 1XBYA 4HTYA 5BRBA 5AYIA 3G6MA 1DJZA 3M16A 3TJLA 1Q7ZA 3TWAA 5G5IA 1XW8A 3V5OA 3SRFA 2Z26A 1SSDA 3ZIZA 4ACZA 4KCTA 1ZCCA 4NZJA 4UMBA 5IDZA 4Z0JA 1TE1A 2CXEA 3FEMA 2WNQA 4GY7A 2DDXA 4AWSA 5U7SA 1KRAC 4QLJA 2IS7A 2ZRUA 3APYA 4Z1CA 5KMYA 5REQA 1ZTVA 1ZFJA 2PURA 4IIHA 4PSRA 4DPQA 3B9DA 5AC4A 1F8MA 2FJUB 4OBSA 1XIJA 3GKFA 3SURA 1FWGC 3LTYA 2VXNA 4P7QA 2EAWA 3NZ1A 3KX6A 1AG1O 2DV0A 1CWYA 4Y8FA 3KCLA 4MJMA 3R1ZA 3F2DA 4GVIA 2P8BA 2ZZ4A 1OGSA 4XK2A 1UG6A 4QRNA 2A6LA 1Q6DA 3ALFA 1Y8BA 2JIEA 1R87A 3ARWA 4IPJA 1MEHA 2FPTA 4JY8A 4DJFC 4F0KA 4GQRA 3HJEA 3VYLA 3BARA 2V3EA 2HS6A 3FJ6A 5A6SA 1DXIA 5HMDA 1UWUA 4PCNA 1J6OA 1O7AA 4DI8A 3BGGA 3QMRA 4JKKA 1GOIA 1YTKA 2CPUA 1UZHA 4GCAA 2YOCA 4NYUA 3LA4A 5B7YA 3IACA 4I3GA 4PCPA 4N42A 1A50A 3ID7A 5KTLA 4Z2HA 4LU0A 4GGHA 4MZ8A 4TU1A 2CLIA 1XLBA 1Z41A 3SFKA 4C65A 4L6HA 3L4WA 3A9IA 3AWNA 4ZOBA 2E68A 2ATSA 4PRRA 4G7FA 5LNUA 1C29A 4QAIA 1QNOA 2FB3A 3A47A 4UR9A 3GG8A 4WSHA 1IXPA 3TTOA 1Q2RA 1J0HA 4AU0A 3D3AA 3MBDA 4R9OA 4CU7A 2F6XA 3KUMA 3CHCA 3FFSA 1I9CB 2JEQA 1JYNA 4ES4A 2PWFA 4LV9A 3ZVHB 3C8NA 4NT0A 3LXAA 4GC4A 1JDCA 1GQKA 2WSPA 2PDIA 2QV4A 2O4QA 1PYFA 4NY2A 4NAEB 1H63A 1LOSA 5JBFA 1R0MA 3EX1A 4D2JA 1J0JA 1EPVA 1WA3A 3VFLA 3MMUA 1L0PA 4RZBA 4DY1A 3THCA 2PUZA 2VX7A 5LXXA 1LL6A 4X3ZA 3DXIA 1J2BA 1ZBWA 1G7VA 1GQNA 3TTYA 2BVYA 5JIPA 4U5IA 3E74A 3OVPA 3T0AA 1OCBA 1L8PA 1YDVA 3OG3A 5HQLA 3G18A 3VOHA 4AF0A 4D6HA 5A8GA 3CHDA 4A6GA 4JTDA 5D05A 1TRDA 3FLUA 1PHQA 3W7HA 1GZGA 4LUSA 4HYVA 1Y7VA 1F5ZA 3HJZA 3WUBA 2CZ5A 4S2CA 1ZPTA 1TJPA 1G5AA 4YNGA 1SQ7A 4WSJA 4WCJA 5DY2A 3SUTA 1HVQA 2ZZ3A 3O2LA 4JTGA 1GWJA 1GQJA 5KITA 5K4XA 2AQVA 4Q33A 4WKAA 3WEMA 5L9FA 3U0HA 3CQHA 2YA0A 3PBMA 3LPOA 2RFGA 2VD8A 3ABZA 1ALDA 3V1HA 4KGLA 3UJEA 3HF3A 3NPXA 3C2FA 5CPQA 4YCPA 3GXDA 1K8CA 1MUMA 3N6QA 2E0PA 4GLEA 2ISVA 2D3NA 8CGTA 3B0UX 2RGMA 3G1RA 1A5OC 3B8TA 3TNBA 5K7JA 1GG1A 3CHFA 1BVWA 2X16A 4AC7C 4JY9A 4H9UA 5A6LA 5CCZA 2O9RA 3U5UA 3PS7A 4GG9A 1QI0A 3VM5A 2NSXA 3VIHA 2DZXA 5BCAA 1FWRA 3M5ZA 1QOQA 3UPWA 4IFRA 3E38A 2ZZ6A 3NQCA 2DH3A 3BJFA 1VRDA 1VBGA 1P6CA 4LY4A 3V35A 2I56A 3C0JA 1S3TC 5I02A 3T6CA 1UP2A 2Y8UA 3KW3A 5CGMA 3BTNA 1AJ2A 3BGAA 1R47A 1PEZA 3W1AA 2E9BA 3S1GA 5LZLA 1GVFA 4XZLX 4P2VA 5GJNA 3R8HA 3V16A 2WANA 2Q8ZA 3MYOA 4O1DA 3DG3A 1W32A 4U2YA 5I03A 4PZVA 4U5KA 1TPEA 1WZAA 1VPQA 1BG9A 2V67A 3CWHA 4FMVA 4HHPA 4JZ5A 3GC4A 3GXFA 4GMEA 3SCWA 4RZ6A 2VD9A 1RLDA 4PMRA 2PC8A 4ROQA 4PRTA 2VFFA 4QJ5B 5I23A 4AEFA 4C6NA 4ZEPA 2VNCA 1SMDA 2VKZG 3L67A 5TNVA 2PBOA 4JIEA 1DIKA 3ZQ9A 2WZIA 2PDPA 3KVKA 3WK0A 4ZA0A 1RY0A 3TLLA 3VKAA 5FI8A 2BLEA 3A4WA 3UXLA 3WLMA 4AZ5A 2IQTA 3GNDA 4Q4QA 3BLDA 3PHAA 2G3JA 4O1AA 2HS8A 3MUIA 3QOMA 4OE7A 3B05A 3EWUA 4N9BA 4LS1A 1Q6FA 2VR5A 1R3SA 1EJUC 2AL2B 1IEVA 4J3WA 3C2OA 5FJIA 4KGJA 2REQA 2C19A 2WMFA 4DELA 4DYJA 3ITTA 3PVFA 2XISA 3VNYA 4XIAA 2G97A 5LGXA 1V6XA 3LNMA 4DAFA 3QR3A 2XH7A 4O53A 7TAAA 3CEUA 2HK0A 3MJMA 4XTDA 3V36A 1R3WA 5ABGA 1K4GA 3N9SA 1VFMA 2IXVA 2PD5A 3GQYA 2J13A 3MTWA 3LBCA 3WBWA 4GGBA 2X0HA 4HMNA 2OCZA 3WBEA 3T0DA 4Z2JA 3FXYA 3QHOA 4CN6A 1JGIA 3VOCA 3G8RA 2UZ9A 2BY2A 2CLMA 3VKKA 2VWSA 3BMVA 4O52A 3WL0A 5G1YA 5HQMA 4BEUA 2QYGA 2BZNA 3SCVA 3GAYA 1LLWA 3SCPA 1W2PA 2TRSA 2XGBA 1BF2A 1JQXA 1Z48A 3CZGA 2XFYA 5MHBA 4Q4PA 5AYXA 2VC9A 3E3HA 3KBVA 1PB0A 3WMSA 2OZ3A 4NYYA 4HTBA 1F76A 4GY0A 4US5D 3FHAA 3N25A 1QPRA 3TA6A 2V6AA 1SVDA 2A7NA 1Q3NA 3WFLA 2PDHA 3P62A 1YXCA 5LNSA 1EDGA 3ZMRA 3W0KA 3K1DA 4QS5A 4ADUA 1OFAA 5HPCA 1W9XA 4ASTA 5HJYA 4S2BA 1AW1A 2R82A 4MUPA 1JG9A 3VD5A 2FPVA 5IBXA 2HPIA 3OZMA 1GOOA 1NSJA 1XGZA 1ZP3A 3SCNA 4DM2A 3D47A 4KW2A 1TSIA 3OJGA 4UTWA 1WAWA 3VMOA 5E93A 2ZBTA 2G3IA 2ZADA 3D0CA 1E55A 3M64A 2PWGA 1VP5A 3EOEA 1XUZA 4MYAA 1SFTA 4GZIA 1YPXA 2XUCA 4P7LA 1OFPA 3M0JA 4ZXOA 3H4GA 4OU1A 3EPMA 3FA3A 4DO5A 1H0IA 4PBGA 1Z9AA 5JQ9A 2INEA 2WSRA 2DVXA 3HU7A 4K7YA 1QXLA 2YB1A 4PTMA 3OP2A 1M01A 3F2CA 2V5LA 3PG8A 4MVAA 1C91A 1KM2A 3F4CA 5AN7A 4A3QA 3F03K 2J88A 3ALGA 3NZGA 3P7YA 1FFQA 3QOKA 3RLGA 2GWGA 3HPSA 3QGVA 3BLPX 5KEZA 4WLCA 2H3BA 1JGMA 1ZBKA 3MA8A 3I6EA 2WWCA 2WJEA 4ZO6A 4E3TA 4ROPA 1Q8AA 4F2UA 3LGGA 3WZ0E 1EC7A 3QGAC 4X9SA 3KBMA 5CZKA 3QV6A 2PDNA 3S1WA 1UC4A 3FKRA 3NL5A 1A4MA 5CZSA 4ZTXA 1OABA 3W6MA 4ATWA 3VDHA 1DHPA 3WLOA 1YTDA 5EA9A 4GI4A 4NRSA 4W4QA 1EA9C 1UR0A 3APGA 1S46A 3A21A 2WSKA 1QHZA 2OELA 4IGMA 2C1GA 1PCKA 3OZYA 2OEMA 3VNIA 2EKCA 4RJEA 1OFBA 1W3NA 2GDVA 4HK5A 1XCFA 4JICA 5IDIA 2WOQA 3WD3A 1JCLA 4TMBA 1A5KC 2AMXA 3TAOA 2R1KA 2VR2A 4FO4A 2DT1A 3E9AA 4NKCA 1NF0A 2VDIA 3NXFA 5FF4A 3L21A 4AD4A 3H24A 1V79A 4AQLA 4M81A 5HXMA 4BQ5A 1KFBA 2CLLA 5KZMA 3DHDA 4C1KA 5A2AA 3XISA 4LAMA 4PTDA 3UR7A 4QM1A 1KM1A 1NP2A 4AZGA 1U22A 1R3YA 3CU2A 3DG6A 3QMTA 4Q7BA 1P7TB 1WOAA 2Y2WA 3T1GA 1HKMA 3LI1A 1V0KA 1RCQA 4L56A 5DMYA 4DXXA 2BGSA 3CLMA 3KTXA 2HK1A 2VEPA 4E4FA 1M5WA 1RLCL 2GOKA 1VFTA 4Q3MA 4S3CA 2VEKA 2DH2A 3K4AA 2XH4A 1K70A 4LVFA 5AHLA 4ZZ9A 1QBBA 3TR9A 3WL1A 5RUBA 1KM0A 2DFAA 1E6SM 3IIXA 1QWGA 2W3ZA 3B3DA 1O5KA 3GYCA 4I5RA 2PSNA 4LAUA 2Q09A 1POKA 3WQPA 3OA5A 1H7XA 3L4YA 4NL1A 2J7DA 4RNFA 1NJJA 3AS1A 4M29A 1XYLA 3QLDA 3WF3A 3EA2A 2I9UA 4LB3A 2XH2A 1EYEA 2J25A 2VJXA 1TWSA 2PDQA 5MKGA 4IL0A 3WLHA 2DT3A 1UKPA 4RK8A 1S5NA 3TC7A 3QM3A 1E4NA 1A0CA 1X7FA 1FH7A 4PUDA 3PSWA 3ZZ1A 3KHJA 1XS2A 1T40A 4LS2A 3S2NA 4BHYA 3CPGA 5IHRA 3JVAA 4N7QA 4PMDA 4MF4A 1H11A 1FWJC 1UHVA 4I9MA 1IXOA 3R5EA 3AZSA 2PWVA 4K6AA 1E0UA 1TX2A 2PF0A 4LCQA 4PMNA 3ITXA 4TX6A 3ANUA 3P8IA 2OWXA 4ALDA 1UBPC 4GIEA 4DZ5A 2Z28A 2XTKA 4RE4A 1XC6A 4K8GA 4GVHA 3SSJA 4ZODA 3STGA 3GUGA 3PTQA 4U31A 4BCEA 1M68A 1BRLB 2V5JA 3MSYA 3W82A 4F2BA 4JQ3A 3PJWA 4BJHA 3SCUA 1XH2A 1EIBA 4AMCA 4LVDA 3VDBA 1VYSX 1ITQA 4KPLA 4Y90A 2GJRA 4WQ6A 4IICA 1ZJBA 4HA3A 3EWYA 1JF5A 4C60A 4EPDC 1RP9A 1TTJA 1TA3B 1NWTA 1SZGA 1AW2A 4YWSA 4DRSA 2O92A 4PCTA 3QH2A 1UYQA 2EG6A 3CHEA 3EX3A 1V0LA 4D6IA 3WUGA 5I3FA 2WHJA 4JHZA 2CHRA 1MI3A 3V0UA 3NCOA 2OKTA 4CU6A 5E09A 3RIKA 3G1SA 5FACA 4WK9A 1CEOA 4JN8A 2Y8KA 3GNOA 5CAKA 3WFZA 4H04A 2WK2A 5CXPA 3RUBL 1OK4A 4XAZA 3UD6A 2GYIA 1HKIA 2VX4A 2Y5JA 2I9EA 4MAVA 1WDPA 3PZOA 1H49A 4F0HA 1ADDA 4FXJA 2A3HA 1S3HA 4OIFA 3RCNA 2FZ9A 5FESA 3MCOA 2W67A 2A85A 1FWWA 5AC8A 5DCEA 3M5YA 3TQPA 1E4IA 3MU7A 1P4CA 1NF7A 3SSZA 3R12A 3VGBA 2PLKA 2ISDA 3QPEA 3WLPA 3SR7A 3M0VA 2EPHA 3PPHA 3WDRA 4WDUA 7ENLA 1K9FA 2WVUA 4XUGA 4AD1A 4IX2A 4FXFA 1BG4A 2RH9A 1ESWA 3IARA 2HVNA 1HKJA 4EOUA 5H8MA 5CSRA 1X96A 5I00A 3R6IA 4HT3A 1QNPA 4QCFA 2PGEA 4HNNA 1KRCC 4M19A 1KXTA 1FXQA 1OB0A 4WOZA 3IJLA 1D3CA 2NVCA 1JL8A 4QG6A 3RU6A 2XSXA 3BCFA 3QZAA 1LWIA 1EQPA 1BYBA 2WMIB 3EWBX 3LHTA 3VCNA 4WHBA 1VFOA 1F7BA 1TMHA 5G2WA 3R58A 2J77A 4B5NA 4GFSA 4S3FA 1VFLA 2PAJA 3BL3A 4J35A 4Y9MA 4S39A 1SU5A 1R3TA 1EEPA 4GI8A 2WMJA 1US3A 2PMQA 1KRMA 3LRKA 4QJ4B 1E5JA 1PZ0A 5CC5A 3P74A 1B54A 1TPC1 4CQCA 2D1ZA 1KBJA 1PHWA 1E9IA 4KF1A 4YVXA 3MYPA 1QNSA 4QP0A 4XVDA 2IW0A 1TWZA 3GG0A 4HU4A 2C1HA 1YW1A 4NAFB 2OXNA 4CD7A 3ECQA 3LTSA 3W7LA 1XLFA 3W72A 3IV3A 3OIHA 3PJUA 3ITCA 4FIQA 4AMAA 1T41A 1HJQA 3DI1A 3UG3A 4Y8EA 1EC8A 1UB3A 4W8AA 3PK7A 4NZ5A 4RZ4A 4AZCA 4LAZA 3UR2A 1GG0A 1I0DA 1MRQA 2GUUA 2P76A 1E71M 1BYAA 2RKXA 3G0UA 3LCHA 4Q8WA 1JQVA 4PTWA 1P0KA 2D2GA 3GFYA 2C18A 3KBNA 3QBUA 5FIPA 1BTCA 1LRNA 3T2OA 1W3KA 4XBSA 1JXKA 4F8XA 1S2UA 4JTSA 1DE6A 3EWXA 1KD0A 1VF8A 5CSYA 3W29A 2ABBA 2HROA 3FAWA 4UZUA 3FYYA 3G3DA 3TQKA 1AW5A 3TMLA 1ML1A 1QTWA 4LANA 1UD8A 2VZTA 3KZPA 3TX9A 3A4JA 1DP0A 5FJJA 1PJ9A 4QG9A 1I2PA 1SGJA 1ZJHA 3DN5A 4AVFA 2FMOA 3PTKA 1SSGA 2WSQA 5JBEA 1JPMA 3LN3A 3M0YA 4X60A 3WH8A 1J18A 2J8GA 1E6PA 4A35A 2E9MA 1AK5A 1ISWA 3NSNA 3KCOA 2NVDA 3IK4A 2YBTA 2H90A 2BASA 4R53A 5SWUA 1L6FA 1Z69A 5A8MA 5FJRA 3VE7A 2J9YA 4LTSA 1WDSA 2Y7DA 3H2CA 1PKLA 1VFUA 1OQFA 4MY8A 3KTSA 2FTWA 4DM1A 4KESA 2HTMA 3EOLA 5LA0A 4ML9A 4UTJA 2PTZA 3BUVA 1XLAA 1GVYA 4EF9A 5D03A 2VDGA 3PUEA 4KIEA 2J24A 3UG8A 1TJ2A 2PLCA 4F0LA 1B3OA 3WQEA 1RBLA 1QPOA 1VFHA 4EKJA 3CL6A 1U2YA 4ZQCA 4RXGA 1ME8A 3R25A 4GZ7A 2X8RA 1U1HA 1V0NA 1NFGA 3W88A 3C2VA 2PWUA 1U30A 2YXOA 6ENLA 3KS5A 3E2VA 3WYZA 3ZXWA 1E0VA 3GVVA 4H9TA 3TLQA 2V63A 3NA8A 3P14A 1JD7A 4PN2A 1XKYA 1XI3A 1MXGA 1G01A 2HE8A 5B80A 2Z7KA 4OBTA 2OWCA 2QUMA 4C6CA 1LROA 5AYYA 1LL7A 3VDGA 2FVMA 1OF6A 4UQBA 4S23A 2GQAA 1UPPA 4MPKA 3NYDA 1RBAA 1QCWA 1YXDA 2EKGA 3KP1A 1W3IA 2BVDA 2YL8A 2PGFA 1IWBA 4XSLA 4MUZA 3TQ0A 2X2GA 3MQTA 3BGJA 5A95A 4LV4A 2XPKA 3OBEA 1VJIA 4C1NA 1XISA 4QXIA 4MLRA 4NSBA 4DBWA 3NFUA 3W25A 3QGKC 4L6OA 2QIIA 1N8WA 3NXLA 5F2GA 5A6TC 1DL3A 1ZNNA 1JDAA 1S1PA 5I7GA 2VP8A 3LLXA 3MSDA 4J3VA 3VVGA 4YXGA 2PP0A 4W85A 3VAVA 5FCZA 1ZQ5A 8TIMA 4HHLA 4YYCA 2CLKA 1YBQA 2O7SA 3MPGA 1CXLA 2VHLA 2Z27A 4DBUA 2CHOA 1HVXA 3VNKA 4K2SA 1XSJA 3OLDA 1THFD 2WVVB 4DO4A 1X8CA 3O8AA 6ALDA 1J0KA 1UWTA 4HYRA 1AVAA 1R38A 3A12A 4LXFA 4AHQA 1QW8A 3QHMA 4PMOA 2ACQA 2Y70A 1L6SA 3SCRA 1JZ6A 1EL3A 2G96A 3GD6A 1YDNA 3N15A 5DMMA 3AC0A 1YDOA 4W8LA 1JZ7A 3EWWA 2NW0A 1GQIA 4R85A 1X1OA 2PDJA 3EZ4A 4S3KA 4JFUA 3ABXA 3TTEA 4A8NA 1TPVA 1ZJAA 4Y96A 4REQA 4GE8A 5BOFA 1W9BM 1XBXA 5BU9A 3ARTA 3MMTA 4OQVA 4MMWA 4DUXA 4KMQA 3MJYA 2MANA 3ABOA 4UNLA 4PMUA 2A7RA 1JRCA 3MI3A 3NOEA 3HTWA 4R7JA 2PGWA 5C2CA 4LCSA 4QCEA 4JTEA 2XVPA 1QASA 2HWGA 1EJTC 2QR6A 1CGWA 1P0NA 1QNVA 2VZSA 2YCLA 2BX7A 2TPSA 1UD3A 3RILA 4B5VA 2ZYFA 1PO9A 4D6DA 2ZUSA 3BK0A 2OYLA 4YWIA 1UZ4A 2GLKA 5E0KA 3UR5A 5G1TA 3FV9A 2LLEA 2XIMA 1IIGA 5DBTA 1MMFA 3ARYA 1T6MA 3DYMA 2C1IA 5AHNA 4LAOA 3AXHA 4B92A 2C3ZA 4AY8A 3UJSA 1XL9A 4UB9A 1UMYA 2CLHA 2X0YA 4MG4A 1XLKA 3BV4A 4PTVA 1CGUA 1H41A 3INPA 4CQDA 3BZGA 4M0XA 2ZA3A 4O1EA 1IYXA 4RV8A 4H7ZA 1EFZA 4NU7A 3LUTA 4M24A 5LIKX 3S5OA 2YCKX 1ICPA 3WQOA 3W7EA 2EHHA 3B8VA 2ALRA 1MQPA 3BQ6A 3FXGA 5F2IA 3B8UA 4KS0A 3A22A 5I3GA 3GDLA 4O57A 2OX4A 4H9ZA 3ZSTA 3FGCB 4IUGA 3TONA 2QCEA 2FH6A 3NURA 1XLIA 3NQ7A 4Y9NA 2PDFA 2A21A 3QW4B 3T07A 3CLWA 3SN4A 2GDQA 3NOYA 5GJMA 2YSWA 4YN5A 1Q6GA 3ZJ6A 3G22A 3WD0A 1FRBA 2YDAA 2GGJA 3NPWA 3T40A 4KETA 1KFCA 2E6DA 3Q45A 4IFOA 2Z29A 4Z1DA 1O5XA 4J3ZA 4XX6A 2CETA 5EGRA 4NZ3A 3AIBA 2E1DA 3SUUA 3IAPA 3WJXA 1YX1A 2PWDA 3R4IA 3UZWA 4V1XA 4O0QA 4MWAA 5HOSA 3W2KA 1V08A 5I79A 2QDEA 4YTTA 1FP9A 2ZCGA 2OG9A 3M44A 4H7VA 4CU8A 5F2LA 3URBA 2DP3A 2P3ZA 3W37A 4LUTA 3GH4A 3G1XA 1WXZA 2O55A 2QQ6A 1UWQA 4ZBCA 3MP3A 2Z1BA 2XG9A 2ZWYA 1UR9A 5I3IA 3PBVA 5FA5A 2J66A 4KEZA 3FA4A 3H70A 3CV6A 2SFPA 5KZDA 4JCLA 4HPGA 3PTMA 2PRMA 3UGVA 4RNHA 1VEMA 2VX6A 1QW7A 2QS8A 5PTDA 1EZWA 3WJWA 1JZ3A 4L61A 2X1SA 2GVLA 4MKNA 2W79A 4XTIA 2IMRA 2VDHA 4HCLA 2ZRYA 5U4NA 4L4PA 3WQ5A 5XIAA 4AYSA 5HUOA 4H8NA 4B5TA 2CZDA 5C9UA 4W84A 5C7VA 3N19B 4HMEA 1FWAC 2HMCA 4JIRA 3W83A 3ARRA 1FHLA 4PB4A 1HW6A 3L7RA 2OEKA 1B4KA 3EB2A 4MWAD 2C16A 4UTMA 2OSXA 3F5JA 1DQWA 4BWLC 2PDWA 1E3ZA 4Z1BA 3TUUA 1C7SA 3URNA 1IIHA 4IPPA 3GFZA 1XSIA 4Z0SA 3RAOA 2YXXA 4B2DD 1EO5A 2CLPA 4R27A 5JH1A 1T8QA 3A13A 1B3ZA 1FHVA 4GBUA 4O16A 4JTFA 4ZVJA 1XIHA 2ZXAA 2WBGA 1KTBA 3DAQA 3L2LA 3Q94A 2NX3A 2WC7A 2WBKA 3NNTA 2DUAA 3HQNA 4HGXA 1RZMA 3KEHA 4S3JA 3THDA 3WSUA 3MI2A 1FTXA 4GNKB 4LC8A 3RCMA 3UWWA 1SJDA 3QZ6A 4F0RA 3MO4A 3PR2A 5HINA 2FTPA 3BOFA 1E5NA 2B7OA 2CCRA 4O1CA 3AYRA 2A3BA 3UVIA 2RGLA 8A3HA 3LD5A 1IZKA 1G6CA 5FEZA 4PBFA 5DXXA 3LCLA 2Z25A 1W31A 3ZJKA 1XYBA 2WHMA 2D22A 3CZKA 1M7XA 3O3RA 3UWEA 1J0IA 3KFTA 2D0GA 1VYRA 3BW4A 3CEPA 4MM1A 1DORA 3QRHA 2VTFA 1AZ2A 1AQMA 2G4FA 1VC4A 1VLIA 2V5DA 3KE0A 4JFTA 2YL9A 4N2YA 5IXEA 1XYFA 4PUJA 2CKSA 5AC7A 5CJNA 1DIOA 5A8QA 3WDHA 1TCDA 1HKVA 1RALA 2GGIA 4ILSA 2XYLA 4CNUA 2PI6A 1QT1A 2W66A 4JFVA 4PRWA 3SY1A 4C6PA 4WRHA 2FHCA 1UW9A 4Y6GA 3EB3A 1CCWB 3CK5A 4TOQA 1OFQA 1IT7A 3QQ0A 4U33A 3UBPC 2QUNA 3CAQA 1IEIA 4E2OA 4H6KA 3IVUA 4RV3A 5E0CA 3C56A 1SMAA 5E6ZA 5HJXA 3L9CA 3WD2A 1DJIA 3VZZA 5EB8A 1Q63A 3CUXA 2O56A 3Q58A 1WOBA 2PGRA 4AD3A 3RO8A 2QJGA 4DZAA 2GWNA 4FZIA 2QCDA 4CNTA 1BXCA 5DX7A 1TUFA 1QI4A 2VYOA 4XKYA 1LZOA 3FA5A 1BQCA 1FUYA 4PCFA 3MHFA 3LEPA 1RVKA 5FSEC 4LYQA 4HN4A 1M7PA 2RJHA 3WQVA 2VGIA 4GI9A 3Q2DA 4YPJA 3L0KA 1H1ZA 2QGYA 2EBNA 1GZ1A 3G77A 1RK6A 3TCSA 2TYSA 5JU6A 2TMDA 3VGEA 4N0RA 3W6LA 2OLSA 3HZ3A 5DF0A 1J8VA 3GNXA 3RPMA 1OBAA 3R13A 4J2PA 2ZC1A 4JAWA 5H6HA 3DUGA 3AJ7A 4IL2A 4X0NA 2NVAA 4A29A 4J3XA 1WZKA 1R2SA 2PLMA 3PWIA 4EIVA 3CWNA 4CCEA 1SFJA 3BV7A 2ZRZA 2QPSA 4J40A 4D72A 5LIXX 2PWHA 2C71A 1R7OA 4HPXA 3I4EA 4HMDA 4JTAA 3LCWA 3AUOA 1GVRA 1I2RA 3BMXA 1C8QA 4UTHA 3NQGA 3GUWA 3BLKA 5GQBA 3REQB 4OJYA 4A8RA 3CAWA 4QIUA 3OZOA 4PUNA 2QJNA 2BVTA 2PC4A 4DLFA 1E1CA 4WR3A 4HZ8A 5IRPA 3WQ6A 4HD5A 1JUBA 4ZO8A 4HNOA 2A7PA 5AVNA 1XF0A 4KRUA 4UFIA 4TMCA 1PUDA 2FFIA 1VJZA 2XGIA 1YE6A 5ENLA 1Y5XA 5I24A 4V15A 3AXKA 5LHFA 4HP5A 1F61A 4L1WA 3TWBA 4GX8A 3WJZA 5H8PA 3TU9A 5J5DA 3U2CA 1K6WA 4MZYA 4PYSA 4Z42C 4B3ZA 3KAOA 3DGBA 1MDRA 4GUFA 1LYXA 3GH5A 1C90A 4IG2B 2QJHA 4RNJA 4PTXA 3OVRA 1VCVA 5C8BB 4WKFA 4UTLA 1J12A 3HOJA 3SGUA 1PE1A 1QHOA 3EDKA 1XLDA 3I7SA 1TPUA 4HA4A 2YL5A 2ZDSA 2Q8LA 1TB3A 1MSSA 3PZ9A 3AS0A 4QR6A 3R7MA 3UVAA 2C13A 1G67A 4M5PA 3O6CA 1FCBA 1PZ2A 4D1IA 5BWFA 4MSSA 1JI2A 4QQ3A 4K68A 3SCOA 4URIA 1CI1A 2EO7A 4Y9OA 1XLLA 1ISVA 1MUCA 2DJLA 1OZQA 4AFYA 4C1LA 3HB9A 2ON3A 2V69A 4DJEA 1J96A 3C0SA 4GKLA 8RUCA 2E8ZA 2E9LA 4FB7A 2CERA 3MI6A 4JBRA 4QEEA 2FTYA 2F61A 4O19A 1NWSA 1F3TA 3P84A 3QZEA 1OYBA 1X6UA 2PDXA 1NWUA 4AYGA 4FK9A 3Q65A 1UR8A 3O0KA 3LI0A 4W7WA 3C86A 2INZA 3V75A 3VIKA 1I1XA 1OX6A 4Q8OA 4IP7A 3AICA 5GPRA 5G4HC 3W26A 3GG1A 3P0XA 1V03A 4WIWA 3KDOA 4TVCA 2CLFA 2IXUA 5CZTA 2I14A 2DZPA 4ECLA 3C0QA 3N29A 1ENUA 1A5AA 4BEQA 3ITLA 2WNNA 4E2DA 1WZMA 3AO0A 3I3EA 5HAOA 4O28A 2CW6A 3H4XA 1WKEA 4CEXC 1EJWC 1PX8A 1V3KA 3P81A 2ZA1A 4LVAA 2VWTA 4Q8MA 3B0YA 4NJIA 4LEQA 4RZ5A 3ITOA 2OOFA 3OB8A 1VS1A 4YLWA 1JF6A 1GKPA 4IQLA 2OTDA 1KGUA 4JYFA 3SCTA 4DJED 4B3KA 3V4BA 1ISXA 1GJPA 1QU4A 3KVLA 3CB8A 1EX5A 5C9ZA 1C7TA 4S3GA 4FF5A 4LAKA 3WMCA 3ZWTA 5K9DA 4EX4A 1DJXA 1X6LA 1CXIA 3WNMA 1F3EA 2Z1KA 1KBBA 4X22A 2EGZA 1MZHA 4CQ9A 4NNBA 3R89A 2Z2BA 1AH3A 4B15A 4HU3A 2Z1VA 4FS9A 3QFEA 1FWIC 2CLOA 2OX1A 1KM3A 5CGTA 1M7OA 4QSFA 4ZO7A 4K8EA 2WPBA 4C6BA 3N34A 4RDZA 2PU1A 3CUFA 2DIJA 1UD2A 4N9EA 5DT7A 2ZUTA 2CBIA 3HN3A 2D0FA 1J5TA 1IT8A 5ECUA 4WEVX 1OCJA 3M5VA 3BOXA 3CIXA 3VGGA 5BNKA 2ALDA 4ZOCA 3HPAA 5K4ZA 3PAJA 2QIWA 4L5ZA 1VHCA 4BQ3A 1PX3A 1OFDA 4INFA 3GHSA 5TQLA 2J74A 2ZDRA 2F8QA 3GW0A 4M6PA 1RJPA 2G0WA 1JPKA 2CHNA 3OODA 4CGTA 1F6YA 2O9PA 4GJJA 4CNSA 1TJRA 4MZ1A 1HXJA 3W38A 1LUCA 3JUGA 1KXHA 2WM1A 4DNMA 2YW4A 5ECVA 4HU8A 3SUSA 1BGAA 3GG7A 4GUHA 1SO6A 2X05A 4G1NA 3W7DA 1G69A 1L9WA 3PZIA 1WKYA 3GX9A 5DT5A 4TV6A 4JNMA 1N82A 3VIPA 4DO7A 1JCJA 1KCLA 3IJ6A 4HOXA 3C8FA 3L66A 4RX0A 4R34A 2ZKMX 5C71A 3EKGA 3KRZA 5IOBA 2V3DA 2VMFA 4GK8A 2WNWA 4RE3A 3AS3A 4WJEA 5LA2A 7REQB 1BFNA 1PZ3A 3CYVA 1W9DM 1UR2A 4PUKA 4C6QA 1HP5A 2VGGA 3G1AA 1FDYA 1UR3M 2VCCA 2W92A 4CNOA 2X41A 1TVNA 1R85A 3MSGA 4ZTYA 5FEPA 3MVIA 3CL8A 3PUGA 2WJFA 5AY7A 3FYOA 1AH0A 3RLUA 1Q6LA 3USBA 1SPQA 4KWSA 1ME7A 1XJBA 5I06A 3NSXA 3VTRA 3AIEA 1V6UA 4EPKA 3WEZA 1GZJA 2XIBA 5KETA 2X0SA 4PMYA 5FJTA 2VFGA 1H51A 4X2RA 1BAGA 4Z17A 1FKWA 1XCWA 1CGVA 2WHLA 1I2NA 1Z8AA 1CBGA 3NL2A 4IXXA 2BSLA 2NUXA 1YRRA 4GQBA 4RE0A 5HNRA 1R46A 4GNJA 3NQVA 2B0MA 4FPSA 1CLKA 3EKZA 3V18A 1J93A 4EPEC 3OBKA 4JIQA 9XIMA 1XYAA 4NNCA 4V2XA 3VC6A 1WDWA 2VFHA 2R14A 1NARA 3L4TA 1BEUA 1A80A 2WW5A 3RJXA 4KERA 4GUJA 1KM5A 1FA2A 3P60A 4A3RA 6XIMA 2R1LA 3KRSA 4NI3A 1V93A 2QMKA 2JF6A 1FCUA 2W0UA 1RQEA 4DWSD 4OVXA 3BAXA 4AHPA 4Q8VA 3MMWA 1C8YA 1RD5A 1TIMA 2IPFA 2PTXA 3K8KA 3MZ2A 4H9XA 1VEPA 5A3HA 1H4PA 4K39A 1RH9A 1RY8A 4DX3A 1ICQA 4EWND 1BSIA 1OD0A 3WLJA 3DKLA 4FHAA 1K02A 4FXSA 2PODA 2DU2A 1A5CA 2ISWA 3VOJA 4GYKA 1ZZMA 3M0ZA 1XD1A 3H2FA 2CZEA 2OOGA 3E02A 1CXKA 3O6AA 1BLIA 2DZUA 3S9ZA 1OY0A 4BQ4A 4Z2KA 5E5CA 1F4HA 2V68A 1GW9A 3RLVA 2BOEX 3E0LA 2EPNA 4DBDA 4AXKA 1HJSA 3M5XA 4R7WA 1UIOA 2CC0A 4ACYA 1W9PA 4JTIA 5HWNA 3QYQA 1PAMA 4KFPA 3G0XA 3SUWA 1RQHA 3VIIA 3IJ9A 1K8YA 5CZ0A 1KFKA 1OC6A 1ZLPA 2FZDA 1SJBA 3E96A 4AVOA 1XLGA 3M6YA 2I5GA 1W3HA 5D4YA 1Q6QA 2VFEA 3R10A 4GXWA 4XG1A 3N3TA 3GR8A 3W22A 1JXJA 3BZJA 3B9EA 2RDWA 1P6BA 6XIAA 4DF2A 3FEQA 1WO2A 3M46A 3TE9A 7XIMA 2RDUA 1R9XA 4UIOA 4E38A 2QPUA 4HVXA 4IF2A 2WMGA 1XH0A 5FL1A 2A79A 5DRIA 4GOAA 3HQOA 1QO2A 2QZRA 4LYKA 4A2SA 4QGCA 3O6DA 4CCDA 1EJSC 4D6GA 2XN1A 2J8FA 4YTQA 1US0A 1MW1A 3MV01 1K9DA 1RJRA 1YPIA 5KSWA 1OFOA 2J6VA 5TBOA 4IT1A 3OEXA 5A6AA 2XN2A 3ANVA 4PUWA 1NAL1 3A5FA 4CCCA 3M0LA 1OX4B 3ICJA 3RX2A 2WVSA 4ML4A 2NXHA 2YKKA 1EOKA 1XPGA 3TYZA 1YYAA 3AMKA 3CO8A 3USZA 4I7UA 2DSUA 4R5EA 5IFTA 2Z00A 1QUMA 4M1RA 3WO8A 2XWEA 5EMJA 3LK6A 4IFKB 4CD5A 4WXZA 3VD4A 3MKVA 1A3HA 5CC6A 1MXSA 3AMGA 3U4FA 3FY1A 3S46A 3ARUA 3WQ4A 2PS2A 4IMEA 4KCWA 4IM4A 2FVKA 3E0VA 2XM2A 1XIFA 2YCIX 3RJYA 4M51A 5HR6A 1LL4A 3QTPA 4DUVA 3LM7A 2QCGA 1IEQA 1I0BA 4AIBA 4AZHA 3BANA 1SZFA 3VOFA 4P7NA 1A4LA 1PSCA 1J10A 1V3HA 2Z0IA 4A8IA 5A94A 4I90A 4C6IA 4IGNA 3WK1A 3GW3A 3W2NA 2Q01A 1GVQA 1O1ZA 2HQAA 1AH4A 3ZS4A 1UZ1A 4XZHA 5D9OA 4H6EA 1NP0A 5C2GA 4F66A 3CMFA 3CUGA 1TPH1 1SZRA 3TOYA 3MKCA 1TVPA 5AKQA 3PF3A 3GLCA 2WC3A 4HB7A 4XAPA 1TWWA 1JI1A 5T26A 1O94A 2CYGA 3ES8A 4HOZA 2NX1A 5I07A 1RSCA 3GXIA 5FF3A 4Y2WA 2IPWA 2ICSA 4BZYA 1G4PA 2GJXA 2J75A 3SCSA 5FF7A 4ZB5A 3CMGA 5BZAA 3T4WA 3AJXA 1M03A 2Y5SA 4LNYA 4CD6A 4ZSTA 3UEQA 4LBUA 3BWWA 1E1EA 3IS4A 1OEPA 3PBYA 1E6NA 3W7NA 2CWXA 1S2CA 4W9TA 3QXBA 4IOTA 1WB0A 2GGGA 1DTUA 1WQ5A 3W6YA 3ZJ8A 2PDKA 4RR4A 3OW1A 3B0XA 3N4AA 3WNPA 3KVJA 2E1WA 4ZQMA 4XD5A 1WCGA 4JFWA 3OG2A 2BFGA 3GZAA 2YDRA 4GKTA 5IHSA 1A3XA 1ZENA 3PP7A 1B3XA 3DBPA 2WLZA 4JQAA 3CYJA 4A2RA 4UOJA 3MT1A 1I8JA 3RPDA 1G1YA 4OKDA 5CPOA 3OA3A 5HWJA 2TSYA 3ZT7A 2ZUMA 4LGXA 3GK0A 1N55A 4M82A 4UMCA 2BS9A 2ZE0A 1E0XA 3B8WA 2DPEA 3AUJA 1QPNA 1FCQA 5CBJA 1AA1B 3UP8A 3N4EA 4U28A 4KBXA 3RITA 1M41A 1BF6A 5IFPA 1XX1A 3FDGA 3DDMA 2PLJA 4JDYA 1GHSA 4Q8TA 4NUWA 1GQLA 3ZT6A 3PJTA 2I17A 3H7VA 1HX0A 4HJFA 3RDKA 1IXNA 3PG9A 1V5XA 1LWHA 5AVHA 3VK5A 3F4WA 2O7QA 2FVLA 1XUUA 1CNVA 3WBAA 4ZSUA 1ELSA 4UFMA 5HNUA 3BLFA 3GVGA 3HURA 1GT8A 3SN0A 4BKNA 3NWRA 4BI7A 2OZ8A 1EJRC 1DJQA 2GSEA 5ABTA 5KINA 1Y5VA 5EYWA 1EA0A 2P0OA 3AZTA 1XWYA 4O50A 4RUBA 2ZICA 3ERPA 3QYSA 5HQEA 4WY0B 1P48A 4MPQA 2H9AB 4N4QA 3U3HA 1Q4NX 3F5KA 3CAKA 3NM3A 1HUVA 3NO3A 2NXIA 3GR4A 4BF5A 1F05A 2Z1WA 3FOKA 4B16A 4GIAA 3WENA 4IMAA 3RX4A 4B5XA 2PDMA 4H9YA 1AL7A 3T9PA 4CKQA 4IIGA 4F4RA 3H54A 3KL3A 1O6IA 3L4VA 3U6WA 5HATA 1PWMA 4UQAA 4K7VA 1EBHA 1M65A 4H7CA 1XICA 4MB4A 1UD6A 4LUJA 1OFRA 3M43A 1EGZA 2WZMA 3QFWA 5J5RA 1FXPA 2WCSA 4NJKA 1U1UA 1CXFA 2HBXA 3RGTA 1RHCA 2VOMA 5EL1A 2Y7EA 6REQA 3DFNA 2DEPA 3DX5A 1FDJA 2E5DA 3HG5A 4OBRA 4EF8A 1KGXA 3N2BA 4RDYA 3P5ZA 1PPIA 1A53A 1CGXA 1M9HA 3KVMA 3RPTA 3AIQA 6TAAA 3E1F1 1ADOA 4IXHA 2PA6A 3UXDA 4P8UA 3PPGA 3A23A 4YU1A 2CESA 5A6MA 2ISSA 3EXTA 4A3HA 4R33A 1A0DA 3N18A 4FX8A 4GX9A 1MDLA 1REQB 5D2WA 4WD0A 4XISA 2FJKA 1YIXA 1ONWA 1XM3A 1I2QA 4G9PA 1PVNA 2DZVA 4TX8A 1EC9A 2G5WA 4NP7A 3LCGA 5D04C 4L1GA 3ITYA 4O0KA 2JF7A 1DXFA 3OOQA 2FZ8A 3EPNA 3FSTA 1DVJA 1J4EA 2DVTA 1H7RA 1FP8A 4LW7A 2OYMA 3UG4A 3M1ZA 3W7OA 3WNOA 2V30A 1RAKA 3V3WA 3AZRA 1MQQA 3MCMA 2BDQA 3GVWA 1OT2A 2EXOA 1E6ZA 5DXYA 1S5VA 4G5DA 4FOKA 4M1BA 3L5LA 3DYOA 2E6AA 1GGOA 5KZ6A 1W1VA 4GZEA 1OG0A 3BOLA 2HZGA 1A0EA 4GXMA 4MLJA 4PUEA 1W56A 2OB3A 1ODUA 2ZX8A 3DU0A 5DELA 3RO6A 3FJNA 3QSTA 2J79A 2JALA 3M6DA 1DIDA 3VKDA 5T9BG 4H2CA 4H9VA 1KR1A 2O9TA 3WK3A 5CG7A 2YA1A 1UWRA 4MY9A 2F6UA 4LRSA