1KFJA

Crystal structure of wild-type tryptophan synthase complexed with l-serine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
267
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the role of alphaThr183 in the allosteric regulation and catalytic mechanism of tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 98
structure length 253
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfjA00
5LNSA 3ZS4A 2DZWA 3LCHA 3G24A 3GDTA 1IIHA 3DKJA 1M6JA 3VKJA 1M7OA 3THQA 1L6WA 5CPMA 3UWVA 1VCVA 4M7SA 2BLEA 4KFNA 1I8JA 3I65A 4I7WA 1BTMA 2F7FA 1UUMA 4UTTA 1JCNA 1GZGA 3OVRA 3A5FA 1RPXA 3L67A 3V1PA 3L66A 4MY8A 3THAA 3LXCA 6TIMA 1GQNA 5J5RA 5D09A 4IQLA 4UNLA 3CC1A 1FWNA 2NX9A 2D73A 2YDAA 1FX6A 1KBJA 1RD5A 4Z1DA 4LVBA 3FJLA 1KV8A 1GG1A 1LBLA 3TNOA 3KOFA 1GG0A 5IBXA 2ZYFA 4GWEA 3L5MA 3SZ8A 4TR9A 1TPB1 3D0CA 1R2RA 4H3DA 5CPOA 1XDMA 4IOTA 3PUDA 2X1RA 4DO6A 4TMBA 3W1AA 4HPJA 2DORA 4MFEA 4IUOA 3HMJG 1AL8A 1QPOA 3GXTA 4HT3A 4HHPA 4OWGA 2TPSA 3HG4A 1PHWA 2NUXA 5EA9A 2RDUA 3OVQA 3A24A 3ATZA 1B9BA 1X8FA 4OV4A 3STGA 3LGEA 4O18A 1LZOA 3PULA 5D32A 3TFCA 2LLEA 3PG9A 4K6AA 1MEIA 3TC6A 3ZWSA 5K9DA 1WX0A 1NEYA 2RKXA 1DJQA 4UC5A 1JR1A 2PCQA 5K7JA 2V2DA 5FEXA 3DFQA 2WSRA 2V2CA 3PBWA 3MP5A 3EXTA 2Y89A 3MUXA 3PBUA 3PUEA 2VXNA 3RF9A 4E2BA 5D03A 3CIWA 3SJ3A 1GOXA 1ZAIA 5AC7A 1I2OA 3GAKA 1SZFA 3GDMA 3W7CA 3GKAA 2VKZG 3PM6A 1WBHA 3W86A 3HQ1A 2RHGA 2Y70A 4LOCA 5J5DA 2NUWA 3KFTA 2A1YA 4KFOA 3P80A 1TV8A 3NL5A 1TTIA 4UR8A 5CZJA 4ZQOA 4LU0A 4O4VA 2FPYA 4IMEA 5AOUA 3C3NA 4UTTC 1GVRA 2WSYA 5CGQA 1ZALA 5G1YA 3B0PA 3GR7A 3GZ3A 1PCWA 3UYCA 1A5BA 1DORA 2HS6A 2VEKA 4JTUA 4WQ6A 2AQWA 3BPWA 4ZZ9A 1Q3NA 5HR7A 5IBXC 4I9AA 3GIYA 5HWMA 3T55A 5F1VA 2GPTA 1W0MA 3LM7A 4O1AA 4HN4A 5BW6A 1UUOA 2WPBA 4MFDA 4UTJA 4IXHA 3GK0A 2QJIA 5L9FA 4JIPA 4OBTA 3P67A 2QCMA 4O1CA 1SZEA 1MZHA 1OG0A 2GQAA 1GTHA 1EA0A 1UJPA 2TSYA 4ML9A 3P82A 4JEQA 4OHQA 1KA9F 1VLWA 3CEUA 5CZ0A 3EX6A 2I14A 5LNRA 2Z0IA 2YYTA 3DFOA 2TRSA 4RK8A 3W7MA 5CPNA 4FB7A 2J6XA 2E68A 4MY1A 5CPLA 5D38A 4ZVJA 3MP4A 1YADA 2WKJA 1X6UA 2OT0A 3L68A 1ZHAA 1PL9A 4ICNA 4A2RA 4FNRA 4RZ6A 4N2YA 3TV8A 1XBYA 1R47A 3NQ6A 3MYOA 5F4WA 5KSWA 4AH7A 3LHZA 5KINA 5TBOA 4JS3A 2BZNA 2V9DA 3EWZA 3PY2A 4NJGA 1WDWA 3PUOA 2R14A 2ZZ6A 2ZA2A 1W3NA 3SGUA 3O15A 1K7EA 3L0KA 1P4CA 1ICPA 3IRDA 3KXQA 4EOUA 4N02A 4BI6A 1KM3A 1LLWA 2VFHA 3TROA 3QEZA 5HUPA 5E93A 1VYPX 4O13A 4UXDA 1JCYA 1VR6A 2G96A 3G18A 4PH6A 1FY6A 1EP1A 1TQJA 1F74A 1F76A 2QR6A 3FEMA 3S0CA 1S5WA 3N73A 1MO0A 3C56A 3GR8A 2X30A 4DF2A 2JKEA 3P61A 3TX9A 2Z6JA 2V0TA 1DKWA 3LI1A 5EMUA 1TTJA 1G7VA 1OFDA 2GOUA 5G5IA 5H2ZA 3I6RA 1ZCOA 3W7KA 1H7XA 1NSJA 1FXPA 3BARA 3NXFA 3PAJA 4JXCA 4RXFA 3EX2A 3G1HA 4JYDA 3EX1A 4DELA 1JCXA 1SFLA 1HFBA 4GUGA 3QPZA 1WQ5A 3SECA 4FF7A 4PEKA 1PVNA 2A0NA 3P7YA 3TJXA 2H8XA 3TXVA 4K38A 3V75A 1QNVA 3R89A 3W1PA 5EKYA 1LCOA 2C6QA 1JCMP 2YGYA 4JTGA 4ZQNA 5I3JA 5A5WA 2JBMA 2JKPA 3GXNA 1RQHA 1P5BA 3TIMA 4EVZA 5AHEA 3WJXA 1F73A 2FJKA 4FIQA 3G0XA 4QM1A 1GYLA 3BW3A 5EYWA 3W3OA 3ABSA 3LXBA 2J27A 4Z08A 4DEFA 1LOSA 2XN2A 4WY0A 3W71A 4ADSA 1I4NA 4XKYA 4BI7A 2YPIA 3MJYA 1EUAA 1AW1A 1N7KA 1H7PA 5A8GA 1ZJIA 2QCEA 3S1XA 1H1YA 3W23A 3VCRA 3MYPA 3K30A 2RDWA 1P0KA 3PB2A 4MZ8A 2A21A 3KHJA 1UB3A 2VFDA 4O57A 2FQIA 3A5VA 1H60A 2ATSA 1FWTA 2JK2A 4N6FA 3U8GA 3I68A 4JX5A 4P2VA 2QKFA 4AWSA 5CSSA 3LCLA 4NUWA 1FCVA 1TPH1 3H54A 1ZAJA 4AHQA 2WOQA 3B05A 3W1QA 1KFBA 2CZFA 3R2GA 3ZR4A 3G1YA 3DGRA 1B4KA 1WAUA 3LBCA 3WFAA 3DZ1A 1OJXA 1VHNA 3CQ0A 1VRDA 4DBDA 3E02A 4O0ZA 5FF3A 3W7HA 5MHBA 3UPBA 1C8VA 1TPDA 3MI2A 3SW6A 3PSWA 4UTLA 3E96A 2F84A 4HPXA 3W83A 1VJIA 1WOBA 4GE8A 4PL2A 2E5CA 4Z0JA 2JGYA 3VNDA 3NQEA 2ZRVA 4RZ4A 1FBAA 4MJZA 4Q33A 2GJNA 1FCBA 3KVMA 3NGJA 2FB2A 2FB3A 3N14A 4C1KA 2DJLA 4O10A 3LHTA 2TMDA 3FFSA 3LLDA 1XC4A 2VENA 1B57A 2P0OA 4XBSA 1J5TA 4A29A 3M5XA 1VYSX 5AFDA 4Z1AA 1EPXA 5FF4A 3LX9A 3NZ1A 4Y96A 3IGSA 3ABQA 3W72A 2V8ZA 3N2XA 3T44A 4TO8A 3WJSA 3CWNA 1RVGA 1K8ZA 1LROA 1WYIA 1XUZA 3W1LA 3M5ZA 4Y9AA 3FLUA 4WOZA 4LRSA 4O28A 1OFEA 2CZEA 2QF7A 4O11A 1FDYA 1EP2A 1QCWA 3O06A 3UXAA 3LCGA 4N9EA 1ALDA 4S2BA 1W3TA 2J9YA 3UWUA 3G8EA 3O05A 1KBIA 3BG3A 5LZLA 2QDHA 1GJPA 2I9EA 3BW4A 2H3BA 1QDSA 2ZBTA 4U4MA 4FNPA 1G4TA 2QCHA 3OEXA 3R8RA 4WJEA 5FF2A 3NVTA 4QAIA 1W8SA 2VELA 3ELFA 3S9YA 5H91A 3L5LA 1SR9A 1JCJA 4LTSA 1W54A 1YDOA 4JTJA 3TQVA 4O12A 5DBTA 1NFBA 1SO5A 4WXZA 1OFAA 2H8ZA 1RZMA 3HGSA 5FF7A 5D2WA 2A5HA 3W1RA 3NQ7A 3C4UA 4MZYA 4O4WA 1AL7A 3NL3A 5F2MA 4AWUA 5CKSA 1X7FA 2GQ9A 4RCXA 5U7SA 1RR2A 4E0CA 3CWOX 3TA6A 1LRNA 3NQVA 4JTKA 4JIQA 1ME7A 4O54A 3RNDA 4HNVA 2TYSA 1ME9A 3TDFA 1IF2A 1SPQA 4NXKA 4LUIA 1QWGA 4TMCA 3W70A 4DO4A 3W07A 3HB9A 5HWJA 2RDTA 2ZRYA 2R91A 2A7RA 1D3GA 2GVJA 1HG3A 3EKZA 2IQTA 2B0MA 2EKCA 3MI6A 3L2IA 3SFKA 4JTHA 3NR0A 3DENA 1HO4A 1EEPA 4PCFA 1KM6A 2GJLA 3N34A 4UTUA 3W74A 1OX4A 3G1FA 2GQ8A 1VLIA 4XZ9A 4AHOA 1GVQA 4R7JA 3O63A 3I7SA 5D30A 2C18A 2Y63A 3E12A 4X3ZA 4S2CA 3U2OA 3S42A 1TO3A 3W2KA 4GFSA 3DH7A 2ZTKA 5C54A 2E6YA 3QJAA 2X1SA 4UTHA 2GVLA 3LV5A 1NAL1 1YDNA 2E5DA 1D9EA 3U6WA 3UY7A 4AHPA 2VFIA 3NG3A 1KTBA 2C14A 3CEPA 1OFRA 1F6KA 1RV8A 2PURA 2PRMA 2V30A 2NXGA 4OQVA 3EX4A 3NEVA 2FFCA 2ISVA 3NL6A 1F5ZA 4FO4A 3USBA 3TW6A 3NO5A 3R12A 5FEPA 1TJRA 2VOMA 1QR7A 3FIGA 3TR2A 2E09A 2X1TA 1XI3A 4FEZA 2Z1BA 5U4NA 2PC4A 1IXPA 2DZUA 3N9RA 4BWLA 3LI0A 2YR1A 3NAVA 4ORMA 1AW5A 2J9ZA 4A3UA 2R8WA 3L0GA 4GBUA 3NA8A 1K03A 8TIMA 1PIIA 2Y7GA 3M5VA 2ZA1A 3MMTA 3WK2A 3O6CA 4MJMA 5T26A 4WX2A 1TJPA 3HGRA 4JDBA 4K8EA 3M5YA 4WUIA 4RX0A 5KITA 4GJ1A 1TTPA 4LS2A 3G3DA 4G1KA 1TYGA 4ORIA 1KLZA 3C8FA 4A22A 3SIZA 4K39A 3KAOA 2CZ5A 3NM3A 4QIUA 3W7EA 1DOSA 1LRTA 4O8RA 3STFA 3GLCA 3TQKA 4FXRA 5FEWA 1RQBA 1U5JA 4FX6M 4NJKA 3OHIA 3W76A 1EUNA 1SO3A 5D33A 4M6VA 4OT7A 2ZCGA 1VPXA 1THFD 1VGAA 3CB8A 5LKYA 3B4UA 2ZRWA 2WSQA 5AC8A 4UFHA 3BGJA 3LB0A 1A50A 3OG3A 1OVDA 3DI0A 4QISA 3B8DA 3DAQA 1UBSA 4NNBA 1OYCA 2BXVA 1G67A 1BEUA 4UNKA 4N4QA 4O1DA 4WD0A 3T78A 3Q2DA 4JDYA 3RLUA 3IVSA 3HG2A 4W9TA 5AYYA 5L6UA 3B0VC 4N9DA 3TK7A 5EPDA 2Y88A 2A4AA 3S5YA 1F2JA 1KFJA 7TIMA 3TMLA 5EY5A 4RXGA 3UPWA 4Z1CA 2PE4A 5D37A 3UD6A 2V5BA 2PRHA 3STCA 4K7VA 3GDLA 1QMLA 3PSVA 1H63A 5G2HA 1EIXA 3C0JA 3T40A 4EWND 3TCEA 4E38A 3NDOA 3LHVA 5KTLA 1KFEA 3FKRA 5D2VA 4MPQA 1LDCA 4NX0A 5K9XA 1EP3A 1Q6LA 3NQ8A 4LVFA 3C52A 1F7BA 3W7GA 4BWLC 2CLIA 3CHVA 4K7YA 1FDJA 1WXJA 2ZA3A 2DZXA 4MKNA 1H50A 4L4LA 1YLVA 1QPRA 3LHWA 3HO8A 4UFIA 1YPIA 4XQ6A 4ZQMA 2WO5A 1OFQA 4HSOA 1LOLA 4CCCA 4DQWA 2G5WA 1XUUA 4NJIA 1BWLA 4UTWA 3EKLA 2KZHA 2XN1A 3R13A 3INPA 5LHEA 1IXOA 3HGOA 2NUYA 4IXXA 1TPVA 3S5ZA 3W7JA 4AMAA 3TAKA 4QNEA 2Z2UA 2DZVA 1H51A 3IV3A 3KRSA 1T96A 3MO7A 1DBTA 1K7FA 2BTMA 3UQNA 3ZFHA 1TPFA 1ZNNA 3H55A 1XXXA 5G4WA 2ZZ1A 1B3OA 5LHFA 1I2QA 1W5MA 1SZGA 1G69A 4MLRA 4NNAA 1ICSA 3QMRA 1AG1O 4GRSA 4TU1A 5C5YA 1W5OA 2O7SA 4CNOA 2AAMA 1EWEA 1FWRA 4IMDA 4J9JA 1H7OA 4FNTA 2JKAA 2DZTA 5KZDA 3LRMA 3P8IA 3OIXA 4A21A 2JGQA 3I7QA 3W1XA 3DHFA 2FDSA 4O50A 3L21A 3OVPA 5C55A 1ICQA 5HJLA 3BGGA 4U28A 4ADUA 1YDVA 1L2UA 3KRZA 1F05A 5AYXA 1YPFA 1KFKA 5I3HA 4Z0SA 3PC0A 3HF3A 5AHLA 4H6KA 5F4SA 1TMHA 2A6LA 4S1FA 3CIXA 5EBUA 1DQXA 2DP3A 4XBKA 3FA5A 4FIRA 3SR7A 3TW7A 1LTDA 3BG5A 3W9ZA 3EWYA 1M7PA 4CNNA 2ZDRA 3W85A 4YL2A 3UWZA 5HUOA 1WA3A 3O16A 3NQ2A 5BOOA 4I7VA 4JY9A 4LUJA 5HWNA 1OYAA 1N8FA 3MBFA 2VFGA 2CLLA 2B4GA 3LERA 5HINA 2E77A 4LC8A 4LWWA 2E6AA 5HULA 4O16A 2EPHA 3JRKA 3JS3A 4UTWC 1O60A 1TIMA 3GYEA 4CCDA 3QW3A 3T7VA 2NWRA 5BMWA 3HPXA 1TPUA 5DCDA 4CQ8A 1SO4A 2J88A 5K9CA 1A5CA 3W7LA 3GDRA 3TUUA 2ATMA 3AO0A 4FXSA 3UNDA 5K3VA 1CI1A 2E6FA 3IGXA 4KFPA 3LOTA 2BWGA 3IIXA 3QYQA 4Y8FA 1GVOA 3HOJA 3M7WA 3RMJA 4UTMA 3DXIA 2VEMA 1SU5A 2CFFA 3CLMA 3DKLA 3S5NA 2AGKA 4XUGA 5AN7A 4CLMA 4ZL1A 3FKKA 3KVKA 3M1ZA 4HNTA 3EWXA 1JUBA 2Y7EA 2A6NA 3C2OA 1DJNA 1SUXA 5DBUA 1SSGA 2Y7DA 1H7RA 1JRCA 3LRKA 1LBFA 2WV8A 3P74A 3W7DA 4GUIA 2EHHA 1R2SA 2VFFA 1XBVA 1ZAHA 1OX6A 3BG9A 4MLJA 1W31A 2Y62A 3GXPA 2NX1A 1GVFA 3F1QA 1G4PA 4JTIA 4JNMA 2C0AA 1GPWA 2EGZA 4EF8A 1OFPA 2QAFA 4PC8A 1PHQA 1VS1A 4XWUA 1OYBA 3S1VA 4NVTA 2V81A 3EWBX 3HJZA 3IVTA 2QCDB 3NQAA 4GUHA 4PFMA 1LYXA 3L9CA 1GWJA 3BK0A 2VC6A 3LTYA 1FCQA 1W5QA 4AF0B 3GVGA 3TKFA 4PODA 2ZZ4A 1PCKA 4M19A 3E49A 2H6RA 5D2TA 4X9SA 1L6SA 1I45A 2Y61A 3G8RA 1D3HA 3N9SA 1Z48A 5F2LA 1Q6OA 3C2FA 3DBPA 4UFJA 4UTIA 3M43A 2E5BA 3QSRA 1W5NA 5AC6A 4O1BA 1AW2A 5F2GA 2ZTJA 1JCLA 1GVSA 1SFJA 4JX6A 4LVDA 2ABAA 3W7OA 4UFLA 1T8XA 1KM1A 3UZ5A 3W7IA 3VE7A 2CWNA 1YYAA 2YZRA 2NXIA 4NNCA 3TU9A 3NZRA 5CZTA 3EX3A 3DFNA 1KV5A 5LNVA 3LV6A 2B7OA 1YXYA 4WXYA 3KRUA 3A22A 2VFEA 1H62A 2OZ0A 4MZ1A 2Y6ZA 4NQ1A 4P61A 4UTKA 2E6DA 2C1HA 1ZFJA 4NJHA 4YWIA 4AEOA 4HNUA 1IIGA 4RLIA 2WNNA 4ALDA 1PS9A 3L0NA 1F6PA 1JRBA 3LHYA 3UWWA 3VI2A 4KWVA 2C16A 3NM1A 3QPYA 2RFGA 1I2NA 3W1MA 1CW2A 4RJEA 3VFLA 2VEIA 3PBYA 4LRTA 4K37A 1HL2A 4QSHA 3W87A 1GTEA 2I1OA 1FUYA 4IGHA 3ATYA 5F4XA 1SQ7A 1O4UA 3KVJA 1W37A 1WOAA 1Q45A 3L5AA 6ALDA 4WOQA 3UZJA 4EIVA 4NX5A 1DL3A 1TRIA 5C6MA 1P0NA 1KTCA 3GDKA 3P5YA 2FPVA 5DCEA 2CLMA 1SW3A 3S6DA 3G0SA 2C19A 2OT1A 4CCEA 3LDVA 5AHMA 4LV4A 3W7QA 3MBDA 3W22A 4DBEA 4GXMA 1TCDA 1S5TA 1R30A 3F4NA 1TRDA 3LRLA 4OE7A 4FNUA 2CLHA 4R53A 1WBJA 1B4EA 2CZDA 1KM0A 4ZQRA 4AB4A 2V2HA 3C2EA 4MOZA 3QF0A 3G1VA 1HTIA 5DY2A 1I2PA 1TREA 5I3GA 4NU7A 1ZENA 4UCGA 1OF8A 4JTEA 3CTLA 3O8AA 2H90A 2YFNA 3S1UA 1A5SA 4RV8A 1Z42A 5IM51 3BVJA 5D05A 3IIVA 1FCUA 1R2TA 3GNDA 3IIPA 5F1UA 1OK4A 5D04C 4UIOA 2W0UA 4LW7A 4AWTA 4PA8A 5BNKA 1J2WA 1RQEA 2B7PA 1T99A 2ISWA 1NF0A 2YSWA 3HBLA 3QH2A 3W7RA 4AVFA 3MHFA 2EAWA 3DHDA 2R94A 2NLIA 1VZWA 2DJXA 4LS1A 1G4EA 5C2XA 2EF9A 2NXHA 2FIQA 4NXSA 1W3IA 3E9AA 4BK9A 5I3FA 5G2IA 3ZWTA 2QCFA 5HQEA 4O19A 3LLFA 2GVGA 3WJZA 5KMYA 2NX3A 1VCGA 3SY5A 4RKAA 4PTNA 3M9YA 2CLKA 2O7QA 4FX7A 2DU2A 2ZRXA 2ZZ7A 2YW4A 3P5ZA 3W2JA 3T4CA 4IJBA 4LS0A 3QMSA 4UUIA 5LGXA 1LBMA 5EL1A 1JUEA 1QAPA 2QJGA 3GX9A 4DXVA 1V5XA 1YXDA 1DHPA 4FNSA 2NWSA 2CU0A 4GUJA 3NPUA 5G4EA 1Q6RA 1EB3A 2WJZA 3EXSA 1AK5A 3QC3A 4FX8A 3S8HA 3EB2A 1SSDA 2WNZA 4MYXA 4QQ3A 3STEA 3EWUA 2V82A 3M41A 5DLCA 1BKSA 4QJ1A 4A2SA 1XL9A 4GC4A 4BI5A 4LC6A 2Y7FA 4CQAA 4O15A 1A5AA 3PBVA 1W56A 4ZQCA 1EWDA 1IXQA 2J9XA 1FXQA 4HIBA 5I3KA 4CNPA 3WK0A 4MY9A 2GUUA 2WQPA 4IMCA 5CSRA 3QFEA 3F4WA 4GNJA 4JTTA 2QJHA 1TPEA 3PG8A 4Q32A 1NF7A 2OX1A 1K8XA 3LCXA 3HPSA 3P62A 2CW6A 2OMAA 4X2RA 2VEPA 1G4SA 4MYAA 3IVUA 2YXGA 2A7NA 1SZNA 2HMCA 4B5NA 1MEHA 3W2MA 3VE9A 4JTLA 1GEQA 2QCCA 3P60A 3IGUA 4PL1A 4UMCA 1LRQA 2QCNA 3UY8A 3QQ1A 3C61A 1R46A 1I2RA 2ZZ5A 2YW3A 3NOEA 4HSNA 3NPWA 3UWQA 3G22A 2X1UA 1QFEA 3LTPA 2B7NA 1JULA 4FNQA 3EXRA 4TIMA 4R34A 4N9CA 3P84A 1YTKA 2QDGA 5DCBA 3W1TA 3CM4A 4DPPA 4MUZA 4O52A 3NQCA 3I7RA 2FPTA 4ZQPA 4BR1A 3WK3A 3FYPA 1ML1A 2P1FA 3MHGA 3LHUA 5LNUA 1FQ0A 4HKPA 3JR2A 4D2JA 1DQWA 3YPIA 4YCPA 5ABTA 4M6QA 3RU6A 3Q94A 3Q37A 4ADTA 4UR7A 4JR5A 2QEZA 4GUFA 4E2DA 5CG7A 2W79A 1VC4A 3RLVA 5E1QA 1KM5A 3LTSA 4BFAA 2C3ZA 3H53A 5LSMA 3C2RA 2NV2A 1XFBA 3G0UA 2C13A 1KLYA 3PF3A 4RR4A 4K36A 2A85A 3C2VA 4C1LA 1XBXA 1JJKA 1OF6A 3TSMA 3TSBA 1YTDA 1OFOA 4N4PA 3N3MA 5DELA 2ZZ3A 2Q3RA 3NQDA 2QUVA 1G7UA 3EEGA 3A21A 3OA3A 4JTSA 2YX0A 1N55A 4UMBA 3UXDA 1IXNA 4QNWA 2YYUA 2RH9A 1FWSA 5HNRA 1S3HA 2ZRUA 4DF1A 3NQFA 4JYEA 4R33A 2QAPA 2X2GA 2QUTA 3DFSA 3HPZA 3TJLA 5DXYA 4JGDA 3NNTA 3W88A 2OJPA 3QQ0A 1MEWA 3ABRA 3Q58A 3P8JA 3O6DA 4OV9A 1LLZA 3LBMA 2PRLA 1UASA 1VCFA 4NZFA 4Y90A 1ZY9A 4NT0A 2ABBA 5TIMA 5AB3A 2ZZ2A 1VHCA 1E51A 4JYFA 1GYNA 1VH7A 2Q3OA 3O6YX 3LCFA 3GB6A 4EF9A 2CLFA 4H4IA 3BLFA 2A2IA 1GT8A 2P10A 4O53A 3UWYA 4N9BA 1Q6QA 3B06A 4L4MA 2FLIA 2ISSA 3F03K 2J24A 1H5YA 3TH6A 4Q4KA 3PR2A 5LNWA 5K4ZA 3IEBA 1JVNA 5DN1A 3GNNA 4KWWA 3LXAA 1YXCA 3M47A 5BMXA 2ZFAA 2B7QA 1P1XA 3HGJA 1Z44A 1K7XA 1U83A 4Z1BA 5AHFA 1DVJA 1KM2A 4IX0A 3W84A 1W1ZA 3ANYA 3S1WA 3QW4B 1KM4A 4WY0B 4O0KA 4OU1A 4M7TA 3NYZA 1JQVA 3QM3A 4ONVA 1WV2A 2BSLA 4XKYB 4HNNA 1TV7A 1NVMA 3TSDA 3WK1A 5SWUA 3MI3A 2X16A 1X1OA 1Y0EA 1QO5A 1K02A 1XM3A 4JX4A 3PWAA 1QPNA 4Y6GA 2YCEA 3MWAA 4IMGA 3BW2A 4N6EA 3W2UA 2WNQA 2NV1A 4ZMGA 1H61A 3NL2A 3NPXA 5FI8A 1C9DA 3DI1A 2Q8ZA 3PVFA 3W73A 1XBZA 5LGZA 1MSSA 2Q8LA 5HR6A 1XKYA 2ZRZA 3R5EA 3G1XA 4NJJA 5D02A 3W2LA 1A53A 4K8HA 1OABA 1OK6A 3SGZA 4JICA 2XFWA 1SW0A 1LM1A 4IPIA 1QPQA 4FHAA 2UV8G 5BRBA 3B03A 3IIOA 1V7YA 4MIMA 1O5XA 4DPQA 1PV8A 2DZPA 3N2MA 3TE9A 3O1NA 4YMZA 4LY8A 5AHNA 3HIJA 3LCIA 1FDZA 5CZSA 3W7NA 1EX5A 3SI9A 1UCWA 2A7PA 3GKFA 3TXZA 4LVGA 3M6YA 5DXXA 3BLEA 1O94A 3QMTA 2DZSA 3MHUA 1VQTA 4IWWA 3PB0A 3TFXA 4POCA 3SSJA 3G1AA 3BV4A 4AXKA 4OGZA 5GVJA 5D2YA 1AMKA 4WY0F 4DF0A 4X22A 5AHIA 1OX5A 2G97A 4M5PA 1SW7A 2CLEA 3RK8A 3FYOA 4DO5A 2BX7A 1YTEA 2NZLA 3M0ZA 3W2NA 1TTQA 3WJWA 2H3DA 1XCFA 2Y85A 2QCGA 2HS8A 3NQGA 4LV9A 2XN0A 5HMSA 1K3UA 5K2ZA 1LORA 1O95A 1TQXA 1W5PA 3BLIA 2W6RA 4UFKA 1XDLA 4BF9A 3LCWA 3NPVA 4IX2A 3QSTA 1KFLA 1QOPA 3B04A 2QUUA 4AAJA 4NZJA 1BWKA 4MVAA 1QOQA 1LP6A 3S5OA 4JD4A 3O07A 2G95A 2C15A 1KTNA 4TX9A 1S5VA 2CLOA 4I7UA 3CT7A 3C6CA 4YXGA 2QCDA 3FS2A 3MP3A 3QRHA 5KZEA 1T0OA 5FEZA 4RZ5A 3DFTA 2ZQ0A 1ONRA 3A9IA 5DY3A 4AF0A 5AYZA 5TQLA 1TB3A 1G6CA 1X1ZA 4LVAA 1H7NA 5D2XA 5KZMA 4LNYA 3G3MA 4YLWA 1SO6A 3KX6A 1FWWA 3GAYA 3QZEA 3W1NA 4O17A 3M16A 3TQ0A 1TPC1 1L6YA 1HO1A 2V5LA 3DFPA 2Z6IA 1MXSA 1TPWA 5FESA 4QITA 4XTIA 2E1DA 1IGSA 1OHLA 3HG5A 1VYRA 3L65A 1Z41A 5E0KA 1HUVA 3BO9A 3G1SA 5G2WA 3N19B 3DU0A 3IIZA 2ALDA 5I3IA 1OFBA 2HSAA 5G1TA 5FF0A 1M5WA 1J4EA 1ME8A 2QCLA 1JQXA 3W7PA 2FTPA 4XTDA 1C29A 1PE1A 1TSIA 4M6PA 3KVLA 4O14A 1DV7A 3NQMA 4IPJA 1H7WA 3OBKA 1TV5A 1ADOA 3MW7A 3G1DA 1KW1A 3EWWA 3M44A 4KKXA 2OCZA 3W1UA 3FJ6A 1K8YA 3AJXA 4IMFA 3E0IA 3PS7A 1OX4B 4JTFA 1CX9A 4CQ9A 1L9WA 3TAOA 5K4XA 3W6YA 3B0UX 4WZHA 4UFMA 3WJYA 1JUKA 4LT9A 4JY8A 1LOQA 3FOKA 1QO2A 1KFCA 4JN6A 3P81A 3TC7A 1O5KA 2HTMA 3RFAA 3ABOA 3CU2A 1H1ZA 5F2IA 4UMAA 3A23A 3W75A 3CPRA 3TMQA 2YFOA 3HG3A 4YCOA
chains in the Genus database with same CATH superfamily
4B2DD 4GXPA 1U22A 4CU6A 2D2OA 3GDTA 1IIHA 2BGQA 3VKJA 3H26A 4JFUA 3THQA 3MKKA 1L6WA 1TZZA 3UWVA 1VCVA 1UBPC 3K46A 4M7SA 1X96A 4KEMA 3B9OA 4K3ZA 3EA3A 4I7WA 1BTMA 2F7FA 5HMFA 4UTTA 3EDEA 3EMCA 1TJ1A 4KMQA 4JTRA 3LXCA 4A8NA 4FXJA 4A3QA 3URAA 4P7NA 5HOSA 1GQNA 4IQLA 2D73A 3EAUA 1XIEA 2YDAA 1XH1A 2D1ZA 4C7DA 1RD5A 2GGJA 4AC1X 4QJ4B 3CT2A 3TNOA 1L8PA 2ZYFA 2ZICA 1GKPA 4GWEA 1E73M 3D0CA 1R2RA 4QDMA 5CPOA 1XDMA 4PEEA 4IOTA 3PUDA 4YVPA 5CC6A 3ARWA 3EB4A 4DO6A 4TMBA 4LAMA 3W1AA 4HPJA 1CYGA 4OWGA 2TPSA 3HG4A 1WDDA 5EA9A 3ATZA 1B9BA 4OV4A 3WH5A 5D32A 4CNUA 3P3BA 5A95A 4YYFA 2PSNA 5K9DA 4GJJA 3MKVA 2PLKA 2RKXA 1XG4A 3ZO9A 4UC5A 5K7JA 3DCPA 5FEXA 1W8GA 2Z27A 3MP5A 4DXXA 4IFKA 1AH3A 1GQLA 2Y89A 3PBUA 4C6JA 2VXNA 3ZSTA 1DE6A 3W6LA 1I0DA 1TCMA 3SBFA 2YJQA 3AWNA 3SJ3A 1GOXA 1KWKA 1ZAIA 3IAQA 5AC7A 1JF6A 1RSCA 2BOFX 2EO7A 3PM6A 4J3ZA 3SADA 4W88A 1NOUA 1LWJA 3W29A 4LOCA 3M0XA 2NUWA 2OFJA 3E5PA 3W37A 2PS2A 3P80A 1TV8A 1J12A 2UY3A 4L80A 1TTIA 2WYSA 4FOJA 4O4VA 2C91A 4HA0A 4D1IA 2W4XA 4Q8NA 3UNTA 5EMMA 2DIJA 5AOUA 2WSYA 1NWRA 1AZ1A 3WFLA 4IGMA 2VDGA 3U5UA 4E3VA 1D3CA 1VFHA 1A5BA 4IIBA 4DJEC 2HS6A 3XIMA 3H8AA 1B3YA 2Y5SA 4WQ6A 1BFNA 5C0QA 4WGHA 4UOQA 2J47A 3LM7A 4O1AA 5BW6A 2PTZA 2P76A 1RLDA 1OB0A 2OSWA 5L9FA 4JIPA 3KBNA 2WZEA 4OBTA 4EPKA 5C7HA 2D3NA 4TVDA 1UIOA 4RV3A 1QASA 1UJPA 4F9JA 4JEQA 5CZ0A 1KA9F 4PE8A 4L64A 2RJHA 2I14A 3ARPA 3AIUA 4XVDA 3DHUA 2TRSA 3SCUA 1BF2A 2INEA 3B9EA 3KHDA 1QOXA 2ZADA 2Z1XA 3MP4A 3WSUA 1ZHAA 4ICNA 4E2OA 4N2YA 2VX6A 1CCWB 1R47A 3NQ6A 1KRAC 3MYOA 3V0TA 2C7FA 4HZ6A 3U57A 3F4CA 5TBOA 4JS3A 1JD7A 2V9DA 1R8LA 4NJGA 2YCKX 3PUOA 1IHIA 6TAAA 2ZZ6A 3BWWA 3O15A 1K7EA 5CJ5A 3T05A 1UMYA 2CBVA 2PD9A 4G8TA 1W9BM 4B4FA 4BI6A 1LLWA 5HUPA 3XISA 1XR2A 4O13A 5A2AA 4XUYA 3G18A 4PH6A 1FY6A 1EP1A 3GBEA 3GTIA 1F76A 2QR6A 1C9WA 3S0CA 4H01A 2JKEA 1IYXA 3PANA 3TX9A 1BVZA 3CO8A 4CCZA 3NSNA 3WNMA 2GOUA 3I6RA 4G1NA 4FAMA 4AD4A 1JCXA 1SFLA 1CDGA 4GUGA 4XBJA 1JI1A 4UR9A 4PEKA 1PVNA 2A0NA 3QKZA 5H6HA 4K38A 1QNVA 1OEPA 3W1PA 5A94A 1C90A 2YGYA 2YCIX 3B97A 2JBMA 3FW6A 4AZ5A 1EQPA 3FEQA 4LF1A 3NUKA 3R0DA 2IW0A 5AHEA 5I09A 1O5RA 2O9PA 2FJKA 1ONWA 3B0YA 1GYLA 1YMYA 1NWSA 1UP2A 4YTSA 3UGVA 1NJJA 4Z2IA 2YPIA 5DFAA 3MJYA 2PC8A 3URNA 1EUAA 1TX0A 2R9RA 2PBOA 4AYGA 2D69A 1H7PA 4Q22A 4PCSA 5DEZA 1G5AA 2Y8KA 3VKKA 1AMYA 1PWLA 1P0KA 3PB2A 2A21A 3KS6A 1X7IA 2ACUA 2ATSA 1FWTA 2JK2A 3U8GA 2YDRA 4P2VA 2QKFA 4PBGA 4NUWA 1V02E 3FNDA 1P6CA 3H54A 4RNFA 3VX0A 3B05A 4H7VA 1JXKA 3W1QA 2PPGA 1BTCA 3WNPA 1CXLA 1LG1A 5I2UA 3DZ1A 1VHNA 4D8ZA 3E02A 4F48A 4O0ZA 1DWJM 1WZMA 1CB2A 3UPBA 4GISA 1TPDA 2OQYA 3MI2A 1DP0A 3VDAA 5ECVA 2A3CA 2F84A 4IIFA 4HPXA 3CUZA 4PL2A 3LN3A 3VZYA 4EANA 4OBRA 2OG9A 2GJNA 2POZA 2BDQA 3KVMA 4C65A 4B4HA 3THDA 3N14A 2DJLA 3AMGA 3NURA 4X2PA 1XC4A 6XIMA 4XBSA 1VYSX 3K8MA 2Z1SA 5AFDA 2R82A 3PZOA 4IT1A 1KCXA 3LX9A 2XIMA 1UQZA 3W72A 1TR1A 2V8ZA 3N2XA 4TO8A 2G37A 1R38A 4QS5A 1RVGA 1K8ZA 1B31A 1WYIA 3WLOA 3LA4A 3ARQA 2J7GA 1KBBA 1OFEA 4FLSA 4AIEA 3WO8A 3KRBA 1A0CA 3O06A 3UXAA 1SJAA 1ALDA 1W3TA 2J9YA 3G8EA 2GSJA 4WDUA 5A8MA 4D72A 4IL0A 1QW8A 4FA3A 2H3BA 2X09A 4RE2A 1BYAA 3HQNA 3DERA 5FF2A 4GPNA 3ELFA 3S9YA 4HK5A 3UA4A 1L8NA 1JCJA 4LTSA 1X97A 3UESA 3TQVA 2GVEA 3EPNA 3V0SA 4JIHA 1SO5A 5FF7A 3NQ7A 4HQVA 1V0MA 4WDTA 4AWUA 4PTMA 2GQ9A 3ITLA 4RCXA 3CL8A 1M68A 4E0CA 1E6XM 2V5JA 1LRNA 3NQVA 4QSFA 4W5ZA 2HV5A 3MSYA 3AS1A 4HNVA 2TYSA 4XZBA 2VUYA 1ME9A 1PJ9A 5AYBA 1GW9A 1QWGA 1M04A 1GYMA 3HB9A 1Z6KA 2ZRYA 3BQ6A 1XLKA 4U10A 3DYOA 3N34A 2E28A 4HMCA 4AY8A 2Q6ZA 5CZKA 4M0XA 2AL1A 1H0IA 3O63A 1ZJBA 1VF8A 2J7BA 2Y63A 3MMDA 9XIMA 4G7EA 4CGTA 1TO3A 3W2KA 3MSDA 4S3DA 2PDXA 1I6NA 2FZ9A 4UTHA 3LV5A 2OOFA 1NAL1 2YBTA 1XYFA 1YDNA 4AHPA 4WCJA 1F8MA 1GONA 4F8XA 1GOOA 1EF3A 3CEPA 2PF8A 1F6KA 2V30A 4QE1A 3EX4A 1OGGA 2EJ1A 2QNEA 3NEVA 2FFCA 1KNWA 4DY1A 2NT1A 3HFTA 5E6ZA 3WL0A 2VOMA 1QR7A 3CUHA 1ONEA 3IJ7A 3FIGA 3LUTA 3TR2A 4OBSA 1XI3A 3V35A 2DZUA 3N9RA 5A6BD 4BWLA 1C8XA 1JDFA 4C6CA 4B92A 3HU7A 1AW5A 4W7VA 2OU4A 1DJXA 2R8WA 3L0GA 4GBUA 3NA8A 4J1OA 4AD1A 3CL6A 5D8ZA 4DI9A 3WQ6A 4XSLA 5ABHA 3QOMA 1DJWA 4WX2A 3K4WA 4K8EA 4NRSA 5FJOA 1P0DA 1CEOA 3OZOA 4EPDC 5KITA 1MUMA 2OWXA 4H9ZA 4AD0A 3IV8A 3SCVA 1TYGA 2FZMA 1KLZA 1OT2A 1YNQA 3SIZA 3KAOA 4JN7A 3GG0A 3NM3A 4QIUA 1LRTA 5FEWA 1RQBA 1EUNA 1R3RA 1SMDA 3UJFA 1RK5A 3MSRA 1VPXA 2D2HA 1A49A 3VNIA 3B4UA 1NDVA 1HF6A 4E8CA 4WJXA 3KZPA 1A50A 1OVDA 3GVWA 3AAMA 4GIRA 3CV7A 4CU8A 1UBSA 3B3DA 1BEUA 4UNKA 4B91A 3Q2DA 4Q8OA 2VX5A 3RLUA 3EDKA 4MB4A 2WMGA 1UZDA 2VGFA 5I79A 4W9TA 1EGVA 3TK7A 3BLLA 3CTTA 2Y88A 4LCSA 2ZWYA 2BY3A 3UPWA 1HT6A 3H21A 3F5LA 5D37A 2PODA 3TTQA 3NWRA 3ITYA 3GDLA 1QMLA 5FSDC 2OXNA 3MDUA 4JCMA 3QTGA 4LUYA 3BANA 3NTYA 1BD0A 1OGBA 2WPGA 2YB1A 3AUOA 5K9XA 5I5RA 2FKPA 3NQ8A 4MM1A 3C52A 4ZO9A 3W00A 1QWKA 1F7BA 1ZRQA 2WM0A 2WLZA 3QHMA 4RNIA 1YIXA 2ZA3A 3WNNA 4C6QA 3K1GA 2V3GA 4UFIA 2I57A 3UVAA 4ZQMA 4F0HA 1LOLA 1XD1A 1TVNA 4DQWA 2G5WA 1J2BA 2WZIA 4AUBA 4LPCA 3EKLA 2DT2A 1VP5A 2KZHA 3INPA 2BASA 4V2XA 3WFZA 2QLYA 1C93A 3HV8A 3S5ZA 4L56A 1PTDA 2Z2UA 3KRSA 1W2PA 2PWDA 3WH6A 1DBTA 7CGTA 4UCFA 1TPFA 3Q65A 3BC9A 2W92A 3H55A 2VVNA 4NYYA 1W5MA 3QXBA 3WBEA 4NNAA 1ICSA 2DVTA 1DXIA 1AG1O 2NW0A 2VGBA 1QI2A 3QR1A 2VNCA 1ZJHA 1EC8A 4W85A 3D3AA 4IMDA 1Q6DA 5IXEA 1H7OA 4FNTA 3GVQA 3UG8A 1XCXA 5KZDA 3UG4A 3IANA 3P8IA 3C0LA 1WB0A 2VQUA 4OJYA 3L21A 2NQHA 5C55A 1ICQA 1RBAA 4NAFB 1XGDA 4KETA 4AX7A 3T07A 3P93A 2DUAA 1CXKA 1W2VA 4Z0SA 4S23A 4ZTXA 4Q8TA 1Q2SA 1Q6EA 3HM7A 3IRSA 4NZCA 5EBUA 1VJSA 2FTYA 1GZ1A 4MDOA 2A3LA 3E0VA 1W91A 3TW7A 5BZAA 1F3XA 3WEMA 4HHHA 2F9RA 2VO5A 3W85A 4YL2A 3CV6A 4AXNA 1E71M 5BOOA 3POCA 4I7VA 3LYEA 4EK7A 4RZBA 3A4WA 1N8FA 2JQXA 3VPLA 2CLLA 4B5WA 4KEVA 4LC8A 2E6AA 5HULA 1WDQA 4YJ5A 1KXHA 3JRKA 1XYCA 5LIUX 3ABZA 4H04A 2JEQA 3BAYA 1K8CA 4A8RA 3VUSA 3R0UA 3ITTA 3HPXA 1DWGM 5K9CA 3AXKA 3WF0A 2ATMA 2CBIA 3AO0A 4J3VA 1O1ZA 1AJ0A 3KM8A 1CI1A 1WKYA 3IGXA 2YA1A 3WY1A 3LOTA 1RUSA 1A3WA 1VENA 2I5QA 3HOJA 3RCYA 3QZ6A 1S5NA 4XUGA 4LYRA 1JUBA 3OA5A 3C2OA 1SUXA 4WK9A 2H9AA 5DBUA 1H7RA 1LBFA 3W7DA 4DUVA 4FLQA 2VFFA 2GGEA 1XBVA 1W31A 2ZUWA 1W9VA 2XHYA 2XISA 1HJUA 4R3UA 1QI0A 3ABXA 2QAFA 1UG6A 4PC8A 4HPHA 1OYBA 3FA3A 3IVTA 3NQAA 4PFMA 3WQGA 3LTYA 4GOAA 4Q4SA 4NF7A 4RW3A 1XISA 1VBUA 1VPYA 3TKFA 1XLDA 2PP0A 2ZXDA 2BOEX 5FAJA 3VIHA 1UD8A 3ARTA 2H6RA 4JQ1A 3ARUA 4X9SA 1ITXA 4I6VA 2MANA 2WBKA 2UY2A 2CETA 3GG7A 1Q6OA 5FACA 5BOFA 2W5FA 1ENUA 3G5EA 2F8QA 2ZTJA 4H9TA 1SFJA 1A5OC 2ABAA 1UPPA 4MTVA 3GU2A 2CWNA 4L5ZA 5EMLA 1A4LA 4KCVA 3NZRA 1AH0A 3EX3A 3PTQA 2J8FA 1A3XA 5CPTA 4L1XA 3E2RA 3AIVA 3O9NA 2Y6ZA 1HKIA 2E6DA 4L6DA 4YWIA 4HNUA 4D6GA 1OZQA 1X1NA 3LHYA 1JYXA 3M0KA 3NM1A 3QPYA 3RX3A 4D6DA 4B3LA 1CW2A 2VHLA 2XH4A 2VEIA 1E72M 2VZUA 3OB8A 4LRTA 4K37A 4GLEA 4HPGA 1E56A 4KS0A 1T7LA 3UZWA 4QSHA 5D9MA 3ATYA 5F4XA 3MVTA 3L5AA 2OZTA 3VOCA 2E9LA 3AS2A 4BS0A 4EIVA 4NX5A 4V33A 3GSMA 1TRIA 1C91A 2V38A 5DX7A 1JPKA 1KTCA 2CZVA 3P5YA 1UWUA 2E67A 3S6DA 2C19A 2OT1A 2W9MA 2HROA 1C7SA 6A3HA 1K1DA 1MYRA 2IMRA 1NQKA 5AHMA 1RA5A 1TV4A 3UR2A 2PDHA 1GQJA 2FGZA 3W22A 4OOZA 4GXMA 1TCDA 1R30A 1W32A 1Q85A 4US6A 3ME3A 4FLOA 3IUDA 4ZQRA 2HNEA 2V2HA 2I9UA 3QF0A 1FWBC 1HTIA 3NZPA 3OLGA 3LNPA 4YNGA 5I3GA 1S2AA 1ZENA 1OF8A 4J2PA 1N8IA 3WLIA 1HZYA 2YFNA 3S1UA 1A5SA 3OOQA 1FCUA 4D6CA 1JIBA 3UP8A 3SDOA 3OVGA 3BOXA 1KD0A 2YSWA 3VIMA 3W7RA 1P48A 3DHDA 2R94A 1UR8A 3H4WA 2RDXA 3U3HA 5C2XA 3HJEA 2YA0A 2NXHA 1UC5A 4HU3A 1BSLA 4MB3A 4HA1A 2EPOA 1IEWA 3ZJKA 3AI0A 1O5QA 1OG6A 5CC7A 4XZIA 5XINA 5DT5A 4ZGYA 2NX3A 3SY5A 3CV1A 2CLKA 3GS6A 3UCCA 3KBWA 2PA6A 2G41A 3BLOA 5DMMA 1X6LA 3GX9A 1V93A 1HKMA 2NWSA 3NPUA 2OEJA 4GCAA 4PUKA 3ZT7A 3N2CA 1LQ0A 2NVAA 1SSDA 4QJ3B 1QRQA 3EWUA 2V82A 4XIMA 4QJ1A 3UR7A 1AQFA 4BI5A 2Y7FA 2XVPA 1RHCA 1W56A 2J9XA 1FXQA 4HIBA 3RHGA 2KX9A 3WK0A 3BOFA 3VNLA 5F7UA 2GUUA 2WQPA 5E0FA 5HPOA 2VL4A 1BQCA 1XYBA 2DSVA 3K2GA 5IRPA 5H8UA 1JDDA 2O4MA 4FMVA 4Z2KA 3HPSA 1UP0A 3P62A 4C90A 3VGDA 2B81A 2OMAA 4GI8A 1G4SA 3OHMB 3VE9A 4PUWA 5IFPA 1E9YB 4QROA 5BRQA 4CD5A 3U0HA 1UR2A 4PL1A 1LRQA 1BHGA 1E4IA 3OGVA 2YW3A 8XIAA 4UQAA 3NPWA 2YZ5A 1FH8A 3KDNA 4ZE4A 3CH0A 2B7NA 4FNQA 3EXRA 1VFLA 4LGXA 4UB9A 4N9CA 3P84A 3R8HA 3PZVA 4RE4A 3ERPA 5JIPA 1L0PA 2QULA 4KW2A 1KFWA 3WNKA 4YVXA 3WK3A 3FYPA 3CJPA 5AVHA 1ML1A 1V0LA 4AZCB 3CLWA 4D2JA 1DQWA 3TTOA 4YCPA 4M6QA 3TONA 3RU6A 1EYEA 4IGNA 4ATWA 4UR7A 1OD0A 4E2DA 1VKFA 2WMFA 3PWIA 4ML4A 4C60A 4ECLA 4S3GA 1SR0A 5E1QA 1SJDA 4BFAA 4Y9NA 2PU1A 3H7RA 1E0TA 1MMFA 4H7ZA 4RNJA 1KLYA 2OVLA 4C1LA 3UCQA 4UOZA 3TSBA 1YTDA 3GVRA 2ZZ3A 4GIAA 3E2SA 2YX0A 1FP9A 1J8VA 2YYUA 1XLMA 2RH9A 3EDFA 4S3KA 2Y2WA 3BAKA 1VFOA 4JYEA 4R33A 4LALA 1HN1A 2X2GA 1E0VA 2QUTA 5E09A 2PDWA 1JGMA 3ABRA 2XM2A 3BAWA 3QLLA 4AIUA 1LT8A 3WQ4A 3AS0A 3MUIA 3GXDA 3JUGA 5TIMA 4C7GA 3WDRA 1XDJA 1VHCA 1VH7A 1TUXA 3O6YX 3BLFA 2FVKA 2VR4A 2GDVA 3RM8A 5H8PA 1Q6QA 3B06A 3T1GA 2XDFA 4KWUA 3AROA 4PRWA 5ABGA 1NDWA 1JVNA 2EEXA 2YKKA 3LXAA 1CIUA 1YXCA 4DYKA 3M47A 3H24A 2B7QA 1MQPA 1CTNA 1KXVA 3VIIA 1XSJA 4W93A 1U83A 3VCNA 1E1CB 1OBAA 4V15A 1EGZA 1KM2A 4DWSB 3W84A 2Z1KA 1XW8A 2EPNA 3QW4B 4N42A 4O0KA 1JQVA 4NAFA 1WV2A 3TYEA 3JVAA 4XB3A 4HNNA 2CWXA 3BMXA 4YYCA 4UQCA 3LD5A 3PZGA 3QOKA 1X1OA 1Y0EA 1A5UA 4WSHA 4QX4A 4JX4A 5LA1A 3QGKC 3VNKA 3H23A 4B9YA 2YCEA 3MWAA 2BHUA 3BW2A 3TVAA 3P14A 3W2UA 4B5VA 4ZMGA 3NPXA 2BY0A 3N2BA 1N8WA 3FDGA 2FHCA 3W73A 3U7BA 5LGZA 2ZRZA 4NJJA 3QZAA 5FCZA 1NOWA 3GW3A 5HMDA 2WHMA 4QLLA 2P5NA 1YBQB 4DAFA 4Z17A 4S38A 2UV8G 2FZ8A 2ZE3A 2PGWA 5AHNA 3HIJA 3KUMA 3W7NA 1PX4A 3U4FA 2QPXA 3GKFA 4LVGA 1O94A 2DUXA 4ATDA 1XD0A 3GFXA 2R1KA 3BV4A 3B40A 4OGZA 5ABFB 1Y7VA 3SCTA 1ISWA 4KT2A 5AHIA 3MZ2A 3EWCA 1PKMA 1SW7A 4QDPA 2J7FA 1V3IA 1PZ2A 1YTEA 4O1FA 3M0ZA 1XF0A 3WD0A 4MJ4A 3CL7A 1TTQA 3WJWA 2AKZA 2H3DA 2YDQA 3UFYA 3N12A 2XN0A 9RUBA 3HTWA 1PEZA 1TQXA 1W5PA 1BYDA 4UFKA 3QSTA 4L4OA 1BWKA 1BGAA 5CLTA 1QNRA 2AL2B 4MVAA 1LP6A 4Y7EA 4JD4A 3UXKA 2C15A 1KTNA 1S5VA 3CT7A 3C6CA 3UT0A 4HGXA 3CBWA 3HMCA 3SN4A 4W4QA 2D2GA 1MUCA 5CC5A 2WCAA 3RJXA 4X9YA 3TJ4A 2WVVB 1XX1A 2WJDA 5D9NA 5DY3A 5AYZA 2GVYA 4ENLA 3JU2A 1H7NA 5D2XA 1EX1A 4YLWA 5FL0A 1RCXB 1POKA 3M16A 3TQ0A 4F0MA 4HD5A 4YVVA 4J3UA 3DFPA 2Z6IA 3SO7A 3H2OA 2E1DA 9XIAA 1BVWA 1XC6A 1IEQA 2X7WA 3G6LA 1OHLA 3WLQA 1TUFA 1VYRA 2J7DA 1HUVA 3G1SA 2JALA 2I17A 5I3IA 2IUZA 1VBRA 5FF0A 2BMBA 2QCLA 3IJ8A 2J78A 3UG5A 2FTPA 1O6IA 1QHZA 1HNYA 1DEDA 3UR8A 4O14A 1I1XA 4IPJA 1H7WA 3ZT5A 4L4PA 1ADOA 1DHKA 3MW7A 3S46A 1M03A 1E6ZA 4ZSUA 3EWWA 3AIQA 4HMEA 2OCZA 4QGCA 3ICJA 3VVGA 3NSXA 3V4BA 1L9WA 1KKRA 4RDWA 5T8GA 3WLJA 5I7GA 3GVVA 4WZHA 5BU6A 4GD0A 3FOKA 1KFCA 3ARZA 1O5KA 4M29A 4W8BA 1QI4A 3NDYA 2WVUA 5F2IA 4UMAA 3W75A 1G1YA 2VRKA 3CPRA 4UQEA 3TMQA 3RGTA 3HG3A 4PTVA 4UTFA 1NH6A 3LCHA 4I6KA 4JFVA 3W24A 5A8NA 3GWQA 4TV5A 3DKJA 4PMVA 4P7OA 4M51A 1XIFA 4RE0A 3CAWA 2GOKA 4AEFA 4EXAA 4IHCA 1VJZA 3GXIA 2BY1A 2WBGA 2AOSA 1U1JA 1GUVA 4HZ7A 3I65A 5AECA 1UUMA 2CERA 1KXTA 1GZGA 1VEOA 4BEUA 3OVRA 3U2ZA 2VC9A 5JH1A 3A5FA 1RPXA 3MDWA 3EOUA 2VVSA 1HVXA 4E5TA 5D09A 3MCOA 3CC1A 1FWNA 2NX9A 4I5XA 4Y2WA 1H2JA 4W7WA 3VXGA 4DZHA 3DGBA 3IK4A 4PMDA 1WKDA 1IEXA 3QN3A 3RPDA 3T2PA 3KOFA 1GG0A 5IBXA 3USZA 3ZMRA 1XG3A 2QUNA 3B8VA 4MFEA 3HMJG 1PPIA 3EOLA 1Y65A 3LPOA 4HHPA 2HE8A 1XLFA 1PHWA 2NUXA 1CGTA 4DJDA 1B5TA 1IE7C 1AQMA 3LGEA 1LZOA 3TFCA 4F0LA 5BXSA 1DWAM 4H6RA 2J75A 3VKCA 3KWSA 4HHLA 2OLSA 4C91A 1DWIM 1DJQA 1JR1A 5HXMA 2V2DA 4IIGA 3WLSA 2J7EA 1QATA 5HQMA 1PUDA 4MMWA 1RPKA 4C6OA 3PUEA 5RUBA 4QG6A 4H6QA 5FL1A 1Z8AA 1I2OA 2ZX8A 3GAKA 1SZFA 2IKHA 2REQB 5EMJA 4DN1A 5DMNA 2YXXA 2D2JA 3W86A 1WNOA 1S3TC 5A3HA 3KFTA 3TN4A 1CXHA 3WELA 2BY2A 5TAOA 3OQEA 4KFOA 4HOXA 1FWIC 3NL5A 3C2YA 1EKOA 2YOCA 1TVLA 2W67A 3FHAA 2HE5A 4UTTC 3U48A 2PWVA 5CEWA 5CGQA 8CGTA 5I02A 4TXEA 4YHEA 1YDYA 2CYGA 5G1YA 3F4VA 4LQ1A 3LQGA 1C7TA 2XGBA 3GZ3A 2WVTA 3N18A 3DN5A 3CHDA 2VEKA 3FK4A 3BPWA 2WAGA 3OW1A 1B0IA 4AX6A 1CGWA 4I9AA 5HWMA 2V5KA 3T55A 1DWHM 5HMEA 2GWGA 3NEHA 2WPBA 4MFDA 4UTJA 4IXHA 1XIMA 2QCMA 2GLKA 1MQQA 1SM9A 4JEJA 3MPGA 1MZHA 1OG0A 2GQAA 3M0HA 2TSYA 4ML9A 1FWAC 1NFPA 2BVYA 3GIQA 4OHQA 1VLWA 3C86A 3EX6A 5LNRA 3K5XA 2E25A 2ASHA 4XD5A 3W0KA 2MNRA 1H5VA 5LXXA 2E68A 3QHNA 3QPEA 2WMIB 4OZOA 1PYMA 5CPLA 2J6VA 4WR3A 2XVGA 1X6UA 2OT0A 3L68A 1K77A 5FIPA 1BRLB 1PL9A 1WPCA 4GQGA 4A2RA 1DIKA 4A3HA 1XS2A 2P8CA 3TV8A 5A8PA 3I3BA 5D9PA 4S3FA 4S3AA 1DTUA 3CHEA 1Z69A 2YBUA 2J7CA 3H2AA 3EWZA 3PY2A 1JXJA 1WDWA 4U31A 4I9JA 2ZA2A 3L0KA 1P4CA 4KCUA 4MDPA 2VFHA 4J4KA 5CAHA 1VYPX 2PU0A 2HK0A 1JCYA 4QRNA 2ONEA 3FEMA 1BF6A 1S5WA 3E0WA 1YNPA 3N2TA 3N73A 4F3HA 3P61A 2UY5A 4Q6JA 3AZSA 1D7FA 3LI1A 1TTJA 4GKLA 4NL1A 5H2ZA 4GZIA 1ZCOA 4PB4A 1EHAA 2CKSA 2DQXA 3U5YA 3CUFA 3TZNA 1GEHA 4FPSA 1HFBA 2PDCA 3URQA 4QAWA 2ISDA 3BJSA 5D4YA 3P7YA 4JNYA 1JG9A 4NILA 3TQPA 3TXVA 3R89A 2P50A 3MC5A 1LCOA 2PP3A 5A5WA 3FA4A 3RMEA 1GORA 4KGJA 3GXNA 1P5BA 3CUXA 1E1CA 5LA2A 4DWSA 1W1VA 3W3OA 3ZOAA 1ZL1A 1A4MA 1EIBA 1I4NA 3T9PA 2CBUA 5AVNA 1W1A1 4BI7A 3APTA 1AW1A 2GSHA 2ZX9A 3T0AA 4G9PA 4GQBA 3L7RA 2QCEA 2XH2A 1H1YA 3W23A 3WD1A 3VCRA 4R5EA 2RDWA 2GJPA 3QQWA 4O57A 1UQYA 2FQIA 3A5VA 4AVNA 3VM5A 1CXIA 2WCSA 1H1NA 4JX5A 4YIWA 4AWSA 5CSSA 3LCLA 2XGZA 5CH9A 3TOPA 1YBQA 2CZFA 3ZR4A 3G1YA 1BXBA 3DGRA 3T0BA 4HZ8A 4TTUA 3WFAA 3BURA 2W91A 3ARSA 4LEQA 3A47A 5BWAA 1GW1A 3W7HA 4Z2LA 5MHBA 1ZQ5A 4HU4A 5D8WA 3SW6A 1GKQA 3PSWA 3WNLA 5AC5A 4DB7A 2F61A 4LANA 4UTLA 4EXQA 1WOBA 3HA1A 5ABFA 2E5CA 2JGYA 3VNDA 4AZ6A 3NQEA 4RZ4A 4MJZA 4Q33A 1XJBA 4O10A 2TMDA 2Q71A 3FFSA 4MNKA 3CIVA 4H7CA 4ZFCA 1J5TA 1FTXA 3MV11 3MA8A 3NZ1A 5FF4A 3EBVA 1GOKA 4D6FA 4PUDA 1J11A 5HJXA 2CKRA 1LROA 4PBEA 5M2FX 3VMNA 1DJGA 1UMLA 3S2JA 2QF7A 5IOBA 4GGHA 2PCEA 2HXTA 3BXWA 4S2BA 4PYSA 4ZSTA 3UWUA 2VP8A 3B8IA 3O05A 2NV9A 5LZLA 2QDHA 2OYMA 4ZOAA 2VZTA 1FHUA 3BW4A 2FH6A 4NIRA 3M0JA 4DNMA 1QDSA 2ZBTA 1J96A 1R3YA 2Q09A 3UWEA 2WVVA 3BQ5A 3AUJA 3R8RA 4CN6A 4KWOA 4QAIA 4PMNA 3VMOA 3Q45A 1GOIA 4M80A 1W8SA 2VELA 1PO9A 5H91A 4DBUA 4EPBC 1F6YA 3T8QA 4JTJA 1BYBA 5DBTA 1CWYA 1X8CA 3AMCA 4NYUA 3ZT6A 1F8IA 4LH8A 1Q6GA 1EJVC 1AJZA 2BB0A 3NL3A 1VBGA 2E9MA 4WKHA 1WZLA 1RR2A 3CWOX 3TA6A 1LT7A 4HMDA 4D6JA 1OGSA 4JIQA 1FP8A 1ME7A 4O54A 1VFFA 3RNDA 4DJED 2X05A 4IFOA 4GI6A 4AVOA 1SJCA 1Q5MA 3F7JA 1UA3A 3F4DA 4B5UA 4TMCA 1W1IE 5MKGB 5FKYA 3W07A 4Z42C 2VEFA 2C0HA 1D3GA 2Y8UA 2XJ7A 3VNJA 3L2IA 1F9CA 2WSKA 3NR0A 1ESWA 3KP1A 1EEPA 1S39A 1XKJA 1K9DA 2BFGA 3UJSA 3W74A 1Q8JA 3N4EA 3MO4A 4IQEA 1VLIA 7ENLA 4AHOA 1GVQA 3ARVA 2C18A 3E12A 3H7VA 5HNTA 4CQBA 2E6YA 3ID7A 2VZSA 3VFCA 3BUVA 1IZKA 2GVLA 4R27A 1E0XA 3NG3A 1RCOB 3VOGA 2C14A 5CCZA 1O68A 1WUFA 3LMZA 3D47A 3EDDA 2PRMA 4NZ3A 1XLJA 3VIPA 4OQVA 1R87A 4FS9A 3SM0A 1CGUA 4MUPA 3USBA 1S5MA 3L2LA 2VGGA 4W89A 1PZ3A 3UG3A 1X38A 1XRSA 2GDQA 4R9XA 2X1TA 2Z1BA 3UA3A 1W3HA 2PC4A 1IXPA 1ZCCA 2YR1A 3MY9A 1QVBA 3KL3A 1HGYA 1K03A 3KOWA 3DG3A 2Y7GA 2ICSA 4PMYA 4G56A 2CHRA 1TJPA 4JDBA 4FSAA 7A3HA 8A3HA 4GJ1A 2EBNA 4ATLA 3WMSA 4G1KA 4ORIA 3TLLA 3C8FA 4EAYA 4K39A 4PMUA 1UD4A 5CGMA 3GLCA 3O0FA 1UR4A 4FX6M 3ZQ9A 4XAPA 3OHIA 4IJCA 4OT7A 2RGLA 1THFD 1VGAA 2OSYA 2WSQA 5AC8A 3BGJA 3M07A 4AU0A 3MB9A 3B8DA 1IT7A 1OYCA 2BXVA 3CUGA 4AYSA 4O1DA 4WD0A 4AG0A 5EU9A 4DI8A 2WKLA 4JDYA 2PDQA 5IHSA 4UBPC 5DRIA 2OELA 1A0EA 5C8BB 5EPDA 1RXOB 2QGYA 1FRBA 3S5YA 1KFJA 7TIMA 3A4JA 4Q8MA 5EY5A 3DFYA 2NVCA 1QNQA 4RXGA 5HBFA 3RLHA 1QBAA 3UR5A 3M6DA 1LJYA 3PSVA 5G2HA 4GKTA 1TX2A 5GNZA 3PWGA 4LAOA 1LL6A 3GTHA 2REQA 3LHVA 5KTLA 3E6EA 1MXDA 2TAAA 4HN8A 3FCPA 3OTRA 1V0KA 3W7GA 1MZRA 4BWLC 1W17A 2CLIA 4K7YA 1FDJA 2DZXA 1EJUC 4L1GA 4LXFA 2RUSA 1QPRA 3HO8A 5DANA 1XFCA 2XSXA 1NQ6A 2WO5A 4HSOA 3NDZA 1MW2A 2CIPA 1TMQA 3IPWA 1XUUA 4ZOCA 1ZBKA 1VEPA 4UTWA 4ZFMA 1OIMA 3BCDA 3R13A 1J0IA 1IXOA 3HGOA 1B30A 4HNOA 2NUYA 3PAOA 4AMAA 4QNEA 2DZVA 3MSGA 2DGAA 1IWAA 5JVLA 1REQB 1DIEA 5LIXX 1Q65A 3MO7A 3T8LA 4K68A 4CN4A 5G4WA 1B3OA 2J8TA 2WC7A 4OFCA 3MUAA 4IP7A 3ZLHA 4GRSA 2D22A 1FA2A 3GHTA 1PBGA 2O7SA 3ECQA 3VAVA 4CD7A 4ERIA 1EWEA 1FWRA 4GQRA 3KL0A 2WMIA 5BOEA 1F3TA 2CCRA 2DW7A 2DZTA 1W3JA 6REQB 3LRMA 4K2SA 1BRLA 2JGQA 3VGBA 2O9OA 3DHFA 4O8AA 3ORWA 1PZ0A 1CPUA 3WMCA 3WUBA 4U28A 1L2UA 3KBMA 1F05A 1YPFA 1KFKA 3FGCB 3HF3A 5AHLA 3MANA 5F4SA 4S1FA 3CIXA 3LGDA 5JQ9A 4GXWA 1LTDA 3W9ZA 1YE4A 5HUOA 3NQ2A 1Q63A 2GZXA 4YS1A 3WNOA 1OYAA 3R8GA 3WYZA 3URBA 2QPSA 4F2TA 3SRFA 3I3DA 1V6YA 3E38A 3MU7A 4BQ2A 4HTYA 2O0TA 1KCLA 3JS3A 3N6QA 1VIWA 3V1HA 4GY0A 2ZUNA 2VMFA 3N25A 4HCHA 4DNHA 2DVUA 5BMWA 1CZ1A 2W3ZA 2OWCA 1SO4A 1PKYA 2J88A 2A3EA 3SY8A 5A6AA 1QHPA 3E3HA 2WW5A 7XIMA 1U5HA 5MF5A 5K3VA 4Y9PA 3RAOA 1EOKA 2BWGA 3J7HA 2P53A 2GL5A 3IIXA 3QYQA 4NRRA 3B8TA 3T2OA 2QVHA 3ZLGA 3M7WA 1JL8A 4UTMA 2PGFA 3DXIA 2VEMA 1SU5A 5LIKX 2PWGA 5BU9A 1UOKA 4XZWA 3RJYA 4HB7A 3M1ZA 4LAZA 4HNTA 1TE1A 1QW7A 1DJNA 3SUTA 7TAAA 3SRKA 2WV8A 4GUIA 2EHHA 1R2SA 4D8AA 1OX6A 4MLJA 2Y62A 3ONBA 3SSZA 2BP1A 2C0AA 2PDKA 3COTA 3TYZA 1PKNA 4ZR8A 2EGZA 3VO0A 4I8YA 1VS1A 4WKAA 4EXBA 3L4TA 3RPTA 4NVTA 3EWBX 1YEYA 2VZVA 3WUEA 4CEUC 4DBWA 1LYXA 3MQTA 2VC6A 2G4JA 4TVUA 1W5QA 4AF0B 1XH0A 3CO4A 4PODA 3ANUA 1PCKA 5DO8A 2WCGA 1AZ2A 5D2TA 2WKGA 1I45A 2Y61A 3QTPA 4AEEA 2ZUTA 3R4IA 3W26A 3G8RA 4MNLA 3C2FA 4UFJA 4UTIA 4DM1A 4LAKA 1FFRA 2GFTA 1W5NA 4QS6A 1AW2A 5F2GA 2EG7A 2OPJA 2FTWA 3W7OA 3TEVA 2VD9A 3SQSA 3WQWA 3DC8A 3UZ5A 1A5LC 3L4VA 4B3ZA 3TU9A 1X39A 5I0DA 3DFNA 3DUGA 1RA0A 3CPGA 3LV6A 2B7OA 1YXYA 2OKOA 2OZ0A 4UTKA 2C1HA 1ZFJA 5AY7A 4AEOA 1E6PA 1XV8A 4RLIA 3IWPA 3AZTA 1PS9A 1F6PA 3UWWA 2AAAA 4KWVA 3WN6A 3K8LA 3BL3A 4RJEA 4ZTYA 5HAOA 3VFLA 2B31A 3GZAA 1VEMA 3BDKA 1HL2A 1WZKA 4Q7NA 1WZAA 4L1WA 3APYA 4W5UA 2I1OA 1B3ZA 4IGHA 1CT5A 3H12A 3PTDA 1SQ7A 3KVJA 1PIGA 3RIKA 1HP5A 4BZYA 2QDEA 4AZ7A 6ALDA 1VFSA 3ZVHB 3AHXA 3UZJA 3CMGA 4C6KA 2HK1A 3GDKA 3PNUA 2FPVA 5DCEA 3UU0A 3PZMA 1AD4A 3VIKA 2CLMA 1OSEA 1SW3A 3OQ8A 5I00A 2V69A 4M8UA 1OC7A 3CHCA 4ZCWA 3MBDA 1RJQA 2BODX 4DBEA 1ZPTA 1S5TA 1MDLA 1TRDA 3LRLA 4OE7A 1UR3M 1FKWA 1WBJA 2W63A 3GBDA 2CZDA 1KM0A 4MOZA 4DJDD 3G1VA 3ES7A 5DY2A 3ALFA 3FY1A 3H7UA 3WZ0E 1TREA 2DT3A 1XLLA 1X6NA 2O55A 3N15A 2H90A 5MKGA 4D6HA 3KE0A 3BVJA 1YX1A 1EL3A 1R2TA 5F1UA 3QY6A 4J3SA 5D04C 4UIOA 1UOZA 4DVOA 3SB0A 1M7XA 1RQEA 4P5UA 2B7PA 1T99A 2PLMA 1NF0A 2CXEA 3MHFA 2EAWA 4MADA 4LS1A 4AFYA 3KCLA 2I16A 2V3FA 5LXEA 4JCLA 2FIQA 4BF5A 4ACYA 1W3IA 5CBBA 4HYWA 4RL3A 1E1FA 3PBMA 4WDWA 2IKIA 3WKZA 4PTDA 5I3FA 1G0CA 2VWTA 1JZ8A 3ZWTA 5HQEA 4XZLX 5C2GA 3HPAA 3WJZA 3QBUA 1NOFA 3N2OA 4RKAA 2RAGA 4KH2A 1F4AA 5DMLA 5A6LA 1QNPA 3ZLFA 1B3WA 3WH8A 3P5ZA 3W2JA 3T4CA 4LS0A 3QMSA 2ZVIA 2QJGA 1V6XA 1YXDA 1DHPA 3GFYA 4FNSA 4MB1A 2CU0A 3VDGA 4GUJA 1Q6RA 1J0JA 2WJZA 3EXSA 2VTFA 1AK5A 2NSOA 1EDQA 1J0KA 1Q4WA 2V5CA 5A6TC 3S8HA 2WNZA 4QQ3A 1DJHA 2EPKX 2QV5A 1IR2A 4ZQCA 5EFDA 2DZAA 4MY9A 1XIIA 3OBEA 1JCTA 1US3A 1NWTA 2ZKMX 3PZ9A 2QJHA 2VYOA 1NF7A 1K8XA 3LCXA 1HW6A 2NQJA 2A3AA 1KQYA 4JTQA 1WCGA 3KEHA 4X2RA 2VEPA 3UXIA 2PDPA 3T0TA 3IVUA 2E8ZA 2YXGA 1IT8A 3CZKA 3LENA 3QFWA 1KC7A 4B5NA 4JTLA 1EO5A 1GEQA 2WWDA 2X7VA 4JTCA 2JF6A 3V5FA 4Q7BA 2QMKA 3SUUA 3QQ1A 1I2RA 3NOEA 3UWQA 1MFUA 3QR0A 3LTPA 1JULA 4TIMA 4R34A 3LMYA 1J0HA 2E0PA 3CM4A 2Z1VA 5FJTA 2PDYA 2X1IA 2HBXA 4F2BA 4ZQPA 3B9AA 2XG9A 2R1LA 3R58A 3VX1A 4EE9A 1R3TA 4H8NA 3MHGA 3LHUA 3DEQA 4ASTA 1R3QA 5AYIA 3Q94A 3W01A 3H2FA 3UZXA 4ADTA 4JR5A 2QEZA 3TN6A 3EOSA 1IGWA 2VX7A 3T09A 3WDPP 1ZP3A 5CG7A 2XFRA 2BVWA 5A6SA 2OGJA 3C2RA 1XFBA 3G0UA 3ALGA 3PF3A 2A85A 1XBXA 1JJKA 2XH7A 3R10A 3FJ4A 3N3MA 2Q3RA 2QUVA 2OEKA 3EEGA 4JTSA 2P3EA 3UXDA 1N55A 8RUCA 1S2CA 2ZRUA 3ZIZA 3NQFA 1UJQA 4AQLA 4LFYA 2QAPA 1POJA 5LIYX 4JGDA 3NNTA 4GX8A 2OJPA 1O12A 3SUSA 3Q58A 4HSHA 2ACQA 4ZB2A 3LGGA 1OINA 2HRWA 4DWSD 3O6DA 3K13A 5DRCA 5T9BG 1KGXA 1UASA 1VCFA 4NZFA 1REQA 5A1AA 1TR9A 5AB3A 2ESCA 1E51A 3WD4A 1XLHA 1GYNA 1O7AA 4K8GA 1L6GA 5AC4A 4P8UA 1DQUA 1GT8A 4QJ5B 3UWYA 1E3ZA 3H2MA 4CD4A 4L4MA 5GJNA 5AKQA 3CMJA 3IEBA 1QI3A 3GNNA 3H22A 4PB3A 2VQTA 2XYLA 4R9OA 2ZXQA 5BMXA 1ZTVA 5I07A 1P1XA 1UZ4A 1UKSA 3WLTA 2BGSA 4B5SA 3VD3A 1K7XA 4NZ1A 3GNPA 3IARA 3PFMA 4XO6A 3K1DA 6REQA 3N6JA 3EEZA 3T4WA 1DVJA 3ANYA 3S1WA 1KM4A 3REQB 4NZ5A 3NSMA 4IFRA 1ZLPA 2BSLA 1JFHA 1RP8A 4W8LA 1NVMA 3TSDA 3A3XA 3WK1A 3FGCA 1NDYA 3WMBA 4V27A 2YB4A 3CYVA 1OY0A 3RRAA 3MI3A 2X16A 2WHKA 1QO5A 4RUBA 3V36A 1EZWA 1M41A 4IQDA 2GGGA 3WQEA 4IMGA 5C9RA 1PWMA 1DYSA 2NV1A 3NL2A 1NM9A 2FVMA 1SFSA 3DI1A 4Q8VA 1F3WA 3K4AA 3PVFA 4ZXOA 3GR4A 1WXZA 1CNVA 1RJRA 3G1RA 9CGTA 1MSSA 5GPRA 3G1XA 4QEHA 1A3HA 1GZJA 3S1GA 3L4ZA 2A3HA 4JICA 5EB8A 1SW0A 1LM1A 3T0DA 1O5XA 4DPQA 2DH3A 1PV8A 2DZPA 2H9AB 3N2MA 3O1NA 4LY8A 3GH5A 4IPNB 4XAFA 3SCQA 3WDHA 2QDDA 1UCWA 3TXZA 1QNOA 4HTBA 1EC9A 2WZTA 2XWDA 4JQAA 4H9YA 4IWWA 4BQ4A 4EPEC 4GZ7A 3ENLA 4AXKA 3LZ3A 3CZGA 1AMKA 3E74A 2NQ9A 3MCNA 3AZRA 4GH1A 1OX5A 2G97A 4M5PA 4R7WA 4B9ZA 3SURA 1NARA 1EQCA 1S2WA 1XYMA 2J13A 2DFAA 3I6TA 2HDJA 1VBJA 3AIRA 2F6XA 1XCFA 4GNVA 1Q7MA 2UBPC 3NQGA 2EQDA 1K3UA 5HMSA 4JPGA 2PI6A 4TVCA 1LORA 1O95A 1W1PA 1MDRA 4D6IA 1LL7A 4J2MA 4BF9A 4IX2A 3B04A 5KEZA 4NZJA 4YPJA 1QOQA 4IP4A 2WK2A 1TV2A 2G95A 5AZ0A 4DUWA 1FWHC 4XAYA 3IUIA 3FS2A 4ROQA 3MP3A 1M9HA 3FXGA 2WWCA 3AHTA 4MNJA 4JFTA 3AJ7A 2OEMA 1AUSL 1ONRA 1XGEA 3A9IA 4ROPA 4AF0A 4L9YA 1TB3A 3VIJA 2HPIA 4V1XA 3OODA 4L7ZA 3S47A 4LVAA 3OLDA 3OGSA 3RR4A 4GVHA 4LNYA 1W9UA 1SO6A 3KX6A 3W02A 1QU4A 5A6MA 2VM8A 4H9XA 4L9ZA 1L6YA 3R7MA 4QITA 1IGSA 3GFZA 5FJUA 4GC3A 4M81A 3KL5A 1Z41A 5E0KA 3LLXA 2GUBA 1DPMA 3N19B 4WKFA 1RBLA 5A6JA 3DU0A 3V0UA 4P7RA 2G50A 5G1TA 2XFYA 2W62A 3W7PA 3UW6A 3GIPA 1C29A 1TJ0A 3IJDA 4J27A 4M6PA 3CQJA 2XGIA 1KW1A 2NT0A 5CJMA 2HEJA 2FVLA 3W1UA 1EF2A 2HZGA 3AJXA 3BJFA 3TZFA 1TJ2A 5A2CA 3E0IA 1BXCA 4JTFA 4XD4A 2ZC8A 1WAWA 3B0UX 1LOQA 1QO2A 4AZGA 1G01A 2V68A 3AIEA 5HQLA 2XZ9A 3P81A 3MTWA 4HP5A 5H1WA 4KRUA 5JUVA 3ABOA 3ZVHA 3CU2A 1H1ZA 2QJMA 5PTDA 3LEPA 3D46A 4X63A 3ARYA 3VD7A 2OOGA 2YFOA 2VWSA 1UKTA 1ITUA 5BWFA 3ZS4A 5IHRA 2J77A 4FP1A 3TR9A 2ZDSA 3UJRA 3PFRA 1HX0A 3RYSA 1M7OA 3DBNA 3DOPA 2BLEA 3SCRA 5EBAA 5B7ZA 1I8JA 4MG4A 2Q01A 2R1PA 1V02A 2VR2A 3A3WA 3L66A 3THAA 3TOYA 2E1WA 4WSKA 5J5RA 1AA1B 3NQBA 1KBLA 1FX6A 3P0WA 2DVXA 4KIEA 4U3AA 4Z1DA 3FJLA 1LBLA 4B5TA 4DBSA 1V0NA 3N3TA 3D6NA 4U33A 1H3GA 1LQ2A 4Q4RA 2QVNA 3JZUA 1EJRC 3SZ8A 4TR9A 4H3DA 2X1RA 1GVYA 1HKKA 2CEQA 4LSBA 1KCKA 3E5BA 5C70A 2BBFA 4ZODA 3AICA 4IUOA 1AL8A 1QPOA 3GXTA 1H41A 2RDUA 1XLGA 5JIWA 4O18A 3L12A 2LLEA 3PG9A 4XIAA 1MEIA 3ZWSA 3A6OA 3NCOA 4H1ZA 1WX0A 2OO0A 1R3WA 1OC5A 3PZUA 3W38A 1J18A 2WSRA 4FI4A 2V2CA 4XISA 3PBWA 3O0KA 1SVDA 1UH2A 2ZVRA 1E43A 3FAWA 3RF9A 4E2BA 5D03A 4LYPA 3N11A 3GDMA 2Y1HA 3BSGA 3GKAA 1GNXA 2BOGX 3AS3A 3HQ1A 2QJJA 4I90A 2CXGA 2L5HA 2RHGA 3MVIA 4PUUA 1YW1A 5J5DA 4C5ZA 1FWJC 4DZIA 3I10A 4AMCA 4E4UA 3SAZA 3WF3A 5CZJA 2BNJA 4ZQOA 1FKXA 2V63A 3GHRA 3A13A 2FPYA 3KBJA 4TX6A 2PMQA 1EDGA 5M03A 4LEFA 3VA8A 3C3NA 1GVRA 3O2LA 1ZALA 1BVNP 3APGA 4DYJA 2XVLA 3B0PA 3GR7A 1PCWA 3AMKA 2ZUMA 3PPHA 5EGRA 1XIHA 1DORA 4KBXA 3WQPA 3FAXA 4JTUA 2AQWA 4UQBA 3UVIA 1UD6A 1Q3NA 4GYFA 4XVEA 5HR7A 5IBXC 1XGZA 4YHGA 3KOYA 4CNSA 5F1VA 2GPTA 4D1JA 1W0MA 4IPLA 4HN4A 2DUZA 1E5NA 2XIIA 1UYQA 2D23A 2QJIA 3P67A 4O1CA 1SZEA 1JZ3A 1IQ8A 2GGIA 4DJDC 1EA0A 4Z2JA 3P82A 4ES4A 2I5IA 1IWPA 3CEUA 1IV8A 2V3EA 3EPOA 3QLDA 2Z0IA 4GI4A 2YYTA 3DFOA 4RK8A 5CPNA 4FB7A 1OC6A 1FFQA 4MY1A 1UH3A 1M1BA 4DWDA 1XQKA 2WKJA 2OYKA 4RZ6A 3UJEA 2QZRA 1XBYA 2O9RA 3PTMA 1GHRA 5F4WA 5KSWA 3IACA 4G2DA 4AH7A 3LHZA 4H83A 1KQZA 2BZNA 3N4AA 3NO3A 1LF1A 1W3NA 3AYVA 3SGUA 2GJXB 2E9BA 1ICPA 3FN9A 3KXQA 4EOUA 1KM3A 3TROA 1M01A 3FV9A 1VR6A 5HJYA 3MJMA 4LAUA 4M6UA 3FX4A 1K4HA 3TTEA 2VD8A 1HJWA 3IJ9A 3DX5A 2Z6JA 2V0TA 5EMUA 1G7VA 4ZA0A 4Q8UA 1JAEA 1NSJA 3BARA 1EZ2A 3PAJA 1WDRA 3G1HA 3B8SA 2IXUA 4JYDA 4DELA 1EGMA 3QPZA 3STPA 1UROA 4PRRA 3S9ZA 4FF7A 4M56A 7ODCA 1I75A 3V75A 5EKYA 3SY1A 3SQLA 1JCMP 4JTGA 4ZQNA 1ISVA 5I03A 1XRTA 2Z7KA 3CS2A 2JKPA 3KDOA 4REQB 4HOZA 1GOMA 3WH9A 4QM1A 1NU5A 3BW3A 4A3RA 3IJLA 3ABSA 3LXBA 4Z08A 4DEFA 1LOSA 2XN2A 1UH4A 3REQA 4ADSA 3LU2A 4CUCA 4U5KA 2PWUA 4C5YA 3WBYA 1UZHA 2CESA 1XSIA 1EDTA 4IJRA 1N7KA 4F0SA 4UWMA 3N29A 5A8GA 1ZJIA 3S1XA 1RP9A 3SFWA 3HURA 2VCAA 4LNCA 4RPPA 4HZMA 4MZ8A 3KHJA 1UB3A 1OZMA 2C1GA 2XSBA 2RGMA 4GACA 1R9YA 1KB3A 3C0SA 4RPQA 1TPH1 1GK8A 4UNIA 1TVPA 4AHQA 2WOQA 3R2GA 1B4KA 2VUNA 4GINA 1WAUA 4U2ZA 3LBCA 1BQGA 4YN5A 1VRDA 4PN2A 4MB5A 1M7JA 3FSUA 2G3NA 4UZUA 3SCSA 2HCVA 1YKWA 3W83A 4NSBA 1HGWA 1HKVA 2PGRA 4Q8PA 2FFIA 3KCOA 3GTNA 4F9DA 1E40A 5HA7A 1NIUA 1N2VA 1FCBA 3NGJA 1C8YA 3GU9A 4GYPA 4JAWA 3LLDA 2VENA 4Q8WA 1DIOA 2P0OA 2X0SA 1BGGA 3PJTA 4Y96A 3ABQA 4CD8A 3T44A 2V3DA 1OCJA 3CWNA 4WSJA 3MKCA 2YDSA 3MT1A 2Q8XA 4Y9AA 3FLUA 4DWSC 1EC7A 4LRSA 4O28A 1GJWA 4O11A 4CKQA 1QCWA 3LCGA 1EJTC 1E55A 3P2VA 1KBIA 4C6BA 3VCCA 4MKSA 4U4MA 4FNPA 3SN0A 3OEXA 4F0KA 4MGGA 4KEZA 4WJEA 3NVTA 1PZ1A 2VRJA 1SR9A 1W54A 1YDOA 4O12A 1V79A 4GX9A 3C0QA 3RM4A 4HA3A 1NFBA 4RE3A 4QP0A 4W87A 1OFAA 2H8ZA 1XIJA 3HGSA 5BXTA 5D2WA 2XIOA 3C4UA 1C92A 4O4WA 4MZYA 5F2MA 5CKSA 3AIWA 4DJFA 4HK7A 4U5IA 1AQHA 1NTHA 3ONCA 3SJNA 1HJSA 2P0IA 5I3DA 4JTKA 3W53A 4W8AA 4RDYA 4WF7A 2PDJA 2Z29A 3AWOA 3TDFA 1IF2A 1SPQA 1UIPA 1ZJAA 4LUIA 3W70A 4DO4A 2PZ0A 5HWJA 2RDTA 4PB5A 3P6LA 2GVJA 1QK0A 2IQTA 1E6SM 2EKCA 5CPQA 3MI6A 3PBGA 2EG6A 1PYFA 1JNDA 3DENA 1HO4A 3H70A 4PCFA 2GJLA 3ZR5A 3S4TA 2PDBA 4HA4A 2YIHA 2ZIDA 4OOUA 3S9IA 3WEZA 3PJWA 4X3ZA 4S2CA 4GFSA 3DH7A 1SMAA 4JBRA 3QJAA 3UZZA 2X1SA 1E15A 4ZXLA 2Y5JA 2YLLA 3OGRA 1Y5WA 2E5DA 1D9EA 1RY0A 3UY7A 4PUNA 1TZ9A 1KTBA 1LQAA 1XYZA 1FHLA 3POHA 2FYMA 3TYCA 1U2YA 2NXGA 2XINA 2F6UA 3SQMA 1D8WA 2ISVA 3NL6A 1F5ZA 4FO4A 5DT7A 1DTNA 3MMUA 2Y0FA 1FH7A 2YCJA 1ZSXA 1CLVA 4FEZA 3EA1A 3FDKA 4ZEPA 4ORMA 1VFUA 1XSKA 2J9ZA 4R85A 4MWAB 1PIIA 3M5VA 4P8VA 4U3CA 4IG2B 3WK2A 4ACZB 3LY0A 4JIRA 4MJMA 3M5YA 4RX0A 1TTPA 3WG6A 3G3DA 4DHGA 4PCTA 5E9XA 2R24A 1NDZA 3N17A 4KWSA 2JF7A 1TWDA 3CB3A 5T9CE 3STFA 1DE5A 3BSMA 4FXRA 2XU2A 3S2NA 1WKFA 4NJKA 3W76A 5D33A 4M6VA 1M3UA 3CASA 1JZ7A 5C9UA 3DYMA 2ZRWA 4P8XA 3DI0A 3L4XA 5FJJA 3R25A 3IS4A 3GC4A 3UJ2A 4MSSA 3VABA 4QEEA 1E6NA 1FWGC 4EACA 1CGXA 1HJVA 4CD6A 3CZJA 4OECA 5AYYA 2WJEA 3B0VC 1RLCL 4N9DA 2DDXA 2A4AA 1F2JA 1MUWA 3TMLA 3AXMA 3L4UA 4KESA 2PE4A 3CPUA 2V5BA 2DPEA 2OKTA 2PRHA 3WBXA 3WUFA 1H63A 5M5DA 1EIXA 1ZGDA 2J62A 3W6MA 2CHOA 3ISIX 1YPXA 4D6EA 3CZEA 3C0JA 1KR0A 4E38A 3NDOA 5D2VA 4MPQA 1LDCA 3PN8A 1Y5XA 2IPGA 3CUIA 2Q02A 1V3HA 1TWZA 4PCPA 2FMNA 4LVFA 4GVIA 1MNZA 1XQLA 4HU0A 2W66A 1U33A 3BH4A 3WLHA 4GQQA 3CHVA 1HL9A 3N6HA 1H50A 3EZ4A 3WLRA 1YLVA 1KO0A 3TYAA 1J10A 5A8OA 4XQ6A 1OFQA 1S1PA 1JYNA 1BPLB 2DSWA 1RY8A 4MAZA 2P8BA 4DUXA 2OLHA 5ABEA 1PTGA 2XN1A 5LHEA 3WLNA 2QQ6A 1H51A 1V6VA 2OODA 2ADAA 5XIMA 3ZFHA 1XXXA 3AMDA 1V77A 5LHFA 5HATA