1KFJA

Crystal structure of wild-type tryptophan synthase complexed with l-serine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
267
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the role of alphaThr183 in the allosteric regulation and catalytic mechanism of tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 98
structure length 253
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfjA00
2DJLA 3GAKA 4LT9A 4AEOA 4AAJA 2Y7DA 2QCNA 1H7WA 3HB9A 1O60A 3LXAA 4X2RA 1THFD 3I7RA 1OG0A 1OFPA 3DFTA 3P8JA 4HHPA 4QAIA 4O17A 1RD5A 5CSSA 1OF6A 3OG3A 1WBHA 2Y7GA 3QZEA 4UFLA 4DPQA 3QPYA 1RQBA 3LM7A 2WOQA 5U7SA 3R89A 1N55A 3BW3A 3P8IA 1JVNA 1AMKA 3QSRA 4K8HA 3NL2A 4H4IA 4O8RA 1QMLA 2QUTA 4JTGA 1XKYA 4DPPA 1B57A 1OK6A 1PCKA 2RKXA 1KTBA 4IUOA 1NF0A 3PB2A 5G2WA 2FLIA 3NA8A 1DL3A 2C19A 1LM1A 3S0CA 4O15A 5AC6A 3QPZA 1XBYA 3GLCA 4O1CA 3M5VA 4NZJA 4FNTA 5K7JA 3PSVA 2Z6JA 5CZSA 1XUZA 1FWWA 3HOJA 5G1YA 3W7MA 3UYCA 5HUPA 3I7SA 2XN1A 4GUJA 1VPXA 4UTLA 5E93A 1RR2A 3GKAA 3QEZA 3CB8A 2CLEA 3P67A 3MP5A 4MLRA 4IGHA 2ZYFA 1I4NA 2Y88A 1D9EA 3W7PA 2H90A 5D04C 3B0VC 2C0AA 4BFAA 1M6JA 3LRLA 4CCEA 2R94A 2V5BA 2WNZA 5LNRA 5FF2A 2DZVA 1YDVA 4S2CA 1F5ZA 5D37A 4FIQA 2B7PA 4N4QA 2A1YA 1IXQA 4FF7A 1K8ZA 1LOSA 4UFKA 2WO5A 1ADOA 1XC4A 4E0CA 1OFAA 5H91A 2JBMA 1MZHA 2RDUA 3NPVA 1RVGA 1XDMA 2Y89A 4WY0B 2ZZ6A 4O52A 5FEXA 4CNPA 2R14A 1V5XA 3EWBX 2W79A 4LUIA 1Q45A 1RQEA 1P4CA 3BG5A 4JTIA 5KSWA 3SR7A 3KVJA 2ZRWA 4FXSA 3KAOA 3MHUA 3S1VA 3PBWA 3TJXA 4JIQA 4LVDA 4MYAA 3UXAA 5D32A 3EWXA 3QYQA 2Q8LA 1VH7A 4AB4A 4UFMA 3USBA 1W3TA 3ABOA 4B5NA 1W1ZA 4K36A 3SW6A 4C1KA 4UFJA 4HSOA 2LLEA 1WQ5A 1R47A 4NZFA 3H54A 4DEFA 3O6CA 3DH7A 1U83A 4Z1DA 1KM2A 2ABBA 3M5YA 1FY6A 3LCHA 2A4AA 2DZSA 2GPTA 1BEUA 3W7JA 3UWWA 3AJXA 1TTIA 2CLOA 2QDHA 1OX4A 2ALDA 3UPWA 3PR2A 4K39A 1GVOA 2V2DA 3R5EA 1A50A 1YPIA 4LS0A 4NVTA 2ZQ0A 4ZQPA 3T7VA 2J24A 4NJGA 1X1OA 1ZNNA 3M7WA 4UTWA 1UBSA 4AF0A 3LOTA 2TRSA 4RJEA 5HWJA 3NQ8A 4KWVA 4UTKA 4BI7A 1G7UA 1GT8A 4DO6A 1ME9A 2GJLA 3LHUA 4MOZA 3O06A 5ABTA 1UUOA 3W3OA 3C0JA 4WUIA 3VNDA 4CCDA 4MY9A 3LCFA 1G6CA 4DF2A 5BOOA 1EIXA 3MBDA 4JDYA 2YCEA 4DO4A 4EOUA 3BO9A 3D0CA 3GNNA 2CLFA 1F7BA 2QKFA 4CNNA 4YCPA 2DZPA 1H1YA 5U4NA 4GJ1A 3TC7A 1YTEA 3QQ0A 3W86A 3VE7A 3G3MA 5DCEA 5J5RA 3WK3A 3RK8A 5HUOA 5EY5A 3DFNA 2Y62A 2ZZ3A 2QJIA 3QSTA 2TYSA 1LROA 2HS6A 2WSQA 2ZCGA 4N9DA 2JKPA 5TIMA 4RXFA 4E2DA 1RZMA 2QDGA 1SUXA 1LBMA 4MYXA 1U5JA 1UJPA 2PRHA 1G4EA 3V75A 2DZTA 3NXFA 3HG3A 1QOQA 1LDCA 5AHNA 3EXRA 4MZYA 4XTIA 3VCRA 2J9ZA 3G18A 1FUYA 4JD4A 4NX5A 4UTHA 3MI3A 4UTUA 3HF3A 1X8FA 1XM3A 2FJKA 3RLUA 1R2TA 3NG3A 5MHBA 3QMSA 1O94A 4XWUA 3HGOA 4BI6A 5AHIA 4PL2A 4HNUA 1V7YA 3SI9A 3VI2A 2BZNA 3IIPA 3GKFA 4IPIA 3C2FA 2PE4A 3N34A 4FNPA 3MUXA 6ALDA 3HPZA 1NSJA 3GDLA 2C3ZA 4ORMA 1W56A 2BTMA 1H50A 1P5BA 1TMHA 2OT0A 2DZXA 1JQXA 2J27A 2X30A 4EF9A 5LNUA 3CQ0A 2Z2UA 4NX0A 5IM51 1LYXA 3A21A 4PA8A 1O5KA 3WK1A 2X16A 2WSYA 3HBLA 5J5DA 2ABAA 3EX6A 3TAOA 1TPVA 2CU0A 3LV6A 4IQLA 2CLKA 3FYPA 1LRTA 4MVAA 4G1KA 4O4VA 4UTTA 1MXSA 4MJMA 1EWEA 3L5MA 5HULA 3QJAA 1H5YA 3TQKA 1XDLA 3G1YA 3LHVA 4YXGA 1YDOA 3WK2A 3CEPA 4BI5A 1KM1A 4AMAA 3PF3A 4N9CA 2Y85A 1ML1A 1PL9A 5HINA 3DXIA 3P82A 4E38A 2QEZA 3N2MA 1QOPA 4JX4A 3O16A 2W0UA 1F05A 1YXCA 1GVFA 1JR1A 2A0NA 3HPSA 4JTUA 5CPNA 2ZZ4A 3L0NA 3FEMA 3TK7A 5DY2A 1QO2A 4MY8A 1YDNA 5A5WA 3P5ZA 2YSWA 1ICSA 1TPWA 5HQEA 1LORA 2DORA 1TIMA 4XBSA 1SW3A 1TPFA 7TIMA 3A9IA 4GXMA 4TMCA 1OFEA 4FIRA 3LRMA 2X1TA 2TSYA 3UZ5A 5FF4A 4UNLA 3LI1A 2H3BA 3S9YA 4A29A 1EP3A 5LHEA 3GVGA 2NWSA 1GTEA 5FEPA 4NQ1A 3S1XA 1ICPA 2FB3A 2I9EA 4OV9A 4UMAA 1ZFJA 2BWGA 1LBFA 2QF7A 3G1FA 1TPC1 5LGZA 1X6UA 2ZRUA 3W85A 3W1UA 3P7YA 4ORIA 4ZMGA 3C6CA 3TSMA 4PCFA 3I65A 3W2JA 1KM0A 4ZZ9A 2A85A 1W5MA 5HWNA 4NNBA 1SZFA 2TMDA 3EWUA 5K4XA 1LOLA 4R7JA 1D3HA 3OEXA 2QUVA 3STFA 1VGAA 1ME8A 4QSHA 5FEZA 4DF0A 3PBYA 3GAYA 1Z42A 4PL1A 1OF8A 1K8YA 4M7TA 1PHQA 3GXNA 5AN7A 2Q8ZA 3LHYA 1KBIA 5D2VA 2PRLA 3DFSA 1Z48A 4TIMA 1IIHA 3DHFA 2R8WA 3KHJA 4YCOA 1TQJA 4JTTA 3RNDA 3IVTA 2A7NA 3IGUA 2Q3OA 1D3GA 2YX0A 1OFBA 1PIIA 2EPHA 2PURA 1JUKA 2RH9A 1F74A 3FS2A 3M47A 3M41A 5BMWA 3W2MA 3W2NA 3LRKA 3UPBA 4OHQA 4GUIA 1XXXA 4IMGA 5EA9A 2ZRXA 4XBKA 3AO0A 2C18A 2Z1BA 5AHLA 1W8SA 1ZHAA 4S1FA 4O0KA 5AYXA 4O12A 4IX2A 3M5ZA 3TKFA 3GDTA 3Q2DA 4NJKA 1DOSA 3C2OA 1ZAIA 3DI1A 4YMZA 4PEKA 1KFLA 4HSNA 3W23A 3S5OA 1GYNA 3CWOX 1R46A 4I7VA 3UY7A 4EVZA 1IGSA 2DP3A 4FXRA 4JTKA 3W74A 1B9BA 1QO5A 3OVQA 2CW6A 5AYYA 1HO1A 5I3GA 4MJZA 1G67A 3G1HA 3MBFA 1SO3A 3UY8A 3I7QA 1UB3A 5KZEA 2P10A 1QPOA 2Z0IA 3PUOA 1H7RA 3GYEA 1OJXA 1OFDA 3R13A 3MP4A 4HN4A 3WFAA 2E5BA 3W7LA 4WZHA 3B06A 3G1AA 3C52A 3EX3A 4O57A 1G4PA 4DXVA 5D03A 3IGXA 5LNSA 3WJXA 1KFBA 1M7OA 4RV8A 1TTQA 2ATMA 1KM4A 3PG8A 4ZQRA 4GBUA 4K6AA 1P0NA 4Q33A 4LWWA 3M43A 4UC5A 4LOCA 5AB3A 4JYDA 2E6FA 2J88A 3NQVA 1FCUA 4Q4KA 1A5AA 2ZTKA 2ISSA 3LDVA 4LC8A 3EKZA 2H3DA 1X1ZA 3IVUA 2UV8G 1GVQA 1Q6LA 3O6DA 3MYPA 1H1ZA 2XFWA 1Q6RA 1Q3NA 3DFQA 2F84A 3CM4A 1S3HA 4N6FA 2XN2A 3W84A 5D09A 3W83A 3LXBA 3NAVA 4RZ5A 3SECA 5DCDA 1OVDA 1DJQA 1JCXA 2OMAA 4HPXA 3PY2A 4M19A 1W3IA 1VHNA 3NQEA 2DU2A 3NOEA 2ZZ2A 4CQ8A 2V2HA 3LI0A 1A53A 3YPIA 1ZALA 1OX4B 4O10A 2H8XA 3UWVA 4Z1BA 5F1UA 4QITA 1HFBA 3G8EA 1VYRA 4I7UA 4FNQA 4ZQNA 1I8JA 3NL5A 3TROA 4DQWA 4FNSA 3A22A 3IGSA 3TR2A 1AG1O 1A5SA 1JQVA 4ZL1A 4AHOA 1W5PA 1TQXA 3E9AA 1VCFA 1WA3A 4BK9A 4AF0B 1UUMA 2YFOA 4A2SA 2WPBA 4UXDA 1EP1A 3BK0A 1T8XA 1K7EA 2A6NA 1EA0A 3ATYA 1SSGA 4DF1A 1I2QA 5AC8A 1NAL1 3ZWTA 4RR4A 1PS9A 5L9FA 5HMSA 3JR2A 2NX3A 2B0MA 2YW3A 4JGDA 1TO3A 3W1AA 2B4GA 4AWUA 4IX0A 1EUNA 2G95A 3RFAA 1F73A 3I6RA 2QCGA 3C61A 1KTCA 5F2MA 3T78A 1E51A 4JY8A 1H61A 2WNQA 2CLHA 3OBKA 4DBDA 4LU0A 5DBUA 3T4CA 2HMCA 1X7FA 3QQ1A 3W7KA 3M6YA 3DI0A 4K7YA 3P60A 1GZGA 3U2OA 3CTLA 4KFPA 3F4NA 1HTIA 3INPA 8TIMA 1I45A 3BLIA 2VC6A 4YL2A 3BPWA 1MEHA 1WDWA 2B7NA 2YGYA 3MJYA 4LC6A 4AWSA 2E5CA 3DENA 2B7OA 3SGZA 4IXHA 3NQGA 3LXCA 4NU7A 4P61A 2Z6IA 1H7OA 1BKSA 3S1WA 1SZGA 1KV5A 3M44A 4DELA 4FX6M 4R34A 3G0SA 3BLEA 4HKPA 3THQA 1OX5A 4LUJA 4PFMA 1A5CA 3EWWA 3PB0A 1ZENA 3T40A 3TFCA 3PAJA 1L6YA 3LCIA 3C8FA 1TJRA 1AW1A 3VE9A 4OWGA 4NJIA 5FF0A 3CC1A 3RLVA 2V0TA 3LX9A 5G2IA 3W6YA 2VFDA 4JS3A 4RZ6A 3EWZA 2ZZ1A 4HIBA 2WKJA 3P74A 4ML9A 3FIGA 3KRSA 3S1UA 2NX1A 2CZ5A 1TV5A 3LHTA 1OK4A 1TPDA 1FDZA 1QAPA 4QNEA 4Z1AA 5IBXC 4JNMA 3B0UX 1I2PA 1W5QA 3M9YA 4M6PA 4AWTA 4FHAA 4Y96A 5CZ0A 4O1DA 3G0UA 5C5YA 1XL9A 4RLIA 3LV5A 1O4UA 1KLZA 3ZWSA 3NYZA 4LVAA 2GQAA 2HSAA 3RMJA 2ZRYA 4IMFA 2ISWA 4AHPA 1B4EA 4O54A 4Z1CA 3BGGA 1G7VA 1DJNA 4O18A 1SZEA 3W7EA 1DVJA 4R33A 1S5TA 4IPJA 4PODA 3SIZA 5KTLA 3NQFA 1FQ0A 1GWJA 1K7XA 4NNAA 2E09A 4WXYA 3NQ7A 1FCBA 5BMXA 3IEBA 2FFCA 3G24A 3DKLA 1AW2A 1VYPX 3PBUA 4Y8FA 5GVJA 3W1NA 1JJKA 1TREA 1M7PA 1R30A 3LERA 5FI8A 5G1TA 1GVRA 3CIXA 3BV4A 3BG9A 3W7HA 2YYTA 1YXDA 3C4UA 3SSJA 4O4WA 1W5NA 3HO8A 2CZEA 2NXGA 1K03A 1H7NA 3O63A 3W1QA 3W7CA 4POCA 3JS3A 4TO8A 4QJ1A 3STCA 3QH2A 1SO4A 5DLCA 5F4XA 5DXYA 2CZFA 3NGJA 5F1VA 1TJPA 3WJWA 4MKNA 3UZJA 3OVRA 4WQ6A 2JKAA 1M5WA 4GRSA 1N8FA 5G4EA 2J6XA 2NXHA 2VEIA 2B7QA 2ZA2A 2WSRA 4NT0A 1XBXA 4UTIA 4RX0A 3SZ8A 4I7WA 1VHCA 4FEZA 3PM6A 1OYBA 1RV8A 3MWAA 1LP6A 5FF3A 3KVKA 3NQDA 3SY5A 1GG0A 3W73A 1WOAA 3DFOA 3H53A 4GFSA 1GG1A 3CT7A 4IWWA 2QAFA 1TPB1 3LLFA 3CPRA 4AXKA 1OFQA 3OVPA 5LKYA 1F2JA 2ZA1A 3N19B 4J9JA 2GVJA 5KZMA 3NR0A 2Y7FA 1QPQA 4O0ZA 1NF7A 1VCGA 1YYAA 3T55A 4MFEA 5C2XA 3W7IA 2ATSA 4YWIA 3W75A 3W7NA 2J9YA 4H3DA 4JTEA 3MP3A 4NXSA 3VFLA 2Y61A 1YTKA 3W2LA 4N4PA 2E6DA 1SW0A 3QW3A 4K7VA 3LGEA 3Q37A 2NX9A 2FDSA 1OABA 1PV8A 1TRDA 2YZRA 4GUHA 4LW7A 1I2OA 3LCLA 3TX9A 3TUUA 2JKEA 5K9XA 5EL1A 5K4ZA 1EX5A 3KOFA 4HNVA 3U8GA 4IXXA 2V30A 1IF2A 5EYWA 1XUUA 3N9SA 4TR9A 4WXZA 5EBUA 2VFFA 4JICA 3O8AA 2C13A 2PC4A 4E2BA 4GWEA 1NVMA 4TU1A 3PULA 3BW2A 2OZ0A 1F6PA 4O14A 4IJBA 1LCOA 2PCQA 1W3NA 2YXGA 3U6WA 2GVGA 3PG9A 4MUZA 1F76A 2QCDA 4O1AA 1XI3A 4HT3A 1PE1A 2A6LA 5HNRA 3W1LA 3IVSA 3NL6A 1JCYA 3BVJA 3E02A 3L21A 4MLJA 4RXGA 3S5YA 3RU6A 1MEWA 3C2VA 4LS1A 1K7FA 1Z44A 4Q32A 4O19A 4O53A 4C1LA 2PRMA 3N14A 5KITA 1EWDA 1YTDA 1QWGA 1OYAA 4A22A 1HUVA 5BRBA 3IIZA 1XCFA 5F4SA 5G5IA 1S5VA 3HMJG 3CU2A 3UWZA 2CLIA 1TV7A 5I3FA 5G2HA 5K9DA 1W37A 2CWNA 3ELFA 5LHFA 4GE8A 5I3KA 5AFDA 2A5HA 5D2TA 3EXSA 3GXPA 3FJLA 5D30A 3GIYA 3S5NA 5I3JA 3QF0A 1AL8A 1QR7A 1L6SA 3KX6A 3KRZA 1G4TA 1W31A 4JYEA 1GJPA 3MMTA 1K3UA 1SSDA 4O50A 3M16A 1Z41A 4M6VA 2W6RA 1SZNA 3DZ1A 3EKLA 3GZ3A 5D2YA 4K8EA 3ABSA 1NFBA 3CLMA 2BXVA 4LVFA 2NUXA 3NQAA 4GC4A 1XFBA 3I68A 3P61A 3QFEA 1FDYA 2G5WA 1JCNA 3F4WA 3EX2A 3O1NA 2TPSA 3S42A 2YW4A 3G0XA 3B05A 3BLFA 1W5OA 3G1SA 3HPXA 3R12A 5D33A 5TBOA 2FIQA 2VFGA 5F2LA 4NJHA 3FKRA 3QRHA 4WOQA 4M5PA 2VELA 4ADUA 4ONVA 1TV8A 3G1XA 1TB3A 3SJ3A 4UMCA 3GDKA 1WBJA 4ZVJA 2R91A 1KTNA 4QIUA 3KRUA 4I9AA 3W87A 5CPOA 4RZ4A 4N9EA 4LRTA 2ZZ5A 1VR6A 5AC7A 2V5LA 2VKZG 1PVNA 2QCFA 3MI2A 5EKYA 2VENA 2NUWA 2EGZA 2RDWA 3L67A 2Y70A 1J2WA 4L4LA 4O13A 3LTSA 3UNDA 3PVFA 1KW1A 3UWQA 1LLWA 3TQ0A 1BTMA 3UWUA 4UR8A 4K37A 4NNCA 3JRKA 3FYOA 2DZWA 5F2IA 3LCGA 3Q94A 3TDFA 3B04A 1KV8A 4ZQOA 2E6AA 2X1SA 1WX0A 4JX5A 5CG7A 4TX9A 2QCMA 1LBLA 3W9ZA 1YPFA 1UASA 2BX7A 3E12A 3TW6A 4NUWA 1AL7A 1LLZA 4UR7A 1KM5A 4NXKA 3LBMA 3NM1A 4Y9AA 3TXVA 1FXPA 3NL3A 4MZ1A 4UCGA 1IIGA 1KFCA 1T0OA 1VLWA 2FPYA 3A24A 4HPJA 1SR9A 4W9TA 3IIVA 3TSDA 3PC0A 2C14A 3QW4B 3E49A 4P2VA 3TE9A 3GR7A 1ZCOA 3TMLA 4MPQA 5LGXA 1EPXA 2ZBTA 1DQXA 4KKXA 4EIVA 1FWNA 1Q6OA 3LTYA 3FJ6A 4XKYA 3O07A 4AHQA 5I3IA 3NPXA 4QQ3A 1AW5A 1GTHA 1B3OA 2Y7EA 5CSRA 3EWYA 5SWUA 3EB2A 3W1XA 2J9XA 1HL2A 1N7KA 3W72A 4JTJA 4X3ZA 4EF8A 3P81A 1GOXA 2V9DA 4MFDA 3GB6A 3KVMA 4IMCA 3QC3A 1FX6A 4PH6A 5D2XA 1ALDA 1CI1A 4UTWC 1TYGA 4KFOA 2A7PA 4N2YA 1YLVA 5I3HA 3HQ1A 4LS2A 2CLMA 3N73A 3KVLA 1ZAJA 3MHGA 4JEQA 3UXDA 2FB2A 1MEIA 3NEVA 2V82A 3TFXA 1TSIA 1NEYA 5D38A 4NJJA 2VXNA 3G3DA 2JK2A 2CLLA 1DORA 3FKKA 4N9BA 1L9WA 3TNOA 3FOKA 1TCDA 3DBPA 3ZFHA 1C9DA 3TW7A 3B4UA 1FDJA 3GXTA 5LNVA 4BF9A 3NO5A 4OQVA 2WQPA 4JTFA 2RDTA 2V2CA 3NQ2A 1P1XA 4R53A 4RK8A 3MW7A 3P84A 1OYCA 4JY9A 2QAPA 3SGUA 2C16A 5AHFA 4OU1A 2A21A 2X1RA 4LV4A 2FPVA 4BWLA 4IMDA 3OHIA 1QPRA 5KMYA 2ZZ7A 3M1ZA 2NXIA 4CQ9A 5DCBA 1B4KA 3MO7A 3DGRA 3W2KA 2QUUA 4M6QA 2A7RA 5CPLA 4ICNA 2NUYA 3BARA 1DHPA 3DAQA 3BW4A 5C54A 1VYSX 2C6QA 5FF7A 4YLWA 1T96A 3MHFA 1J4EA 3TA6A 2NV2A 3HG2A 4HNTA 2V8ZA 2GOUA 1QDSA 3NVTA 3OA3A 3ATZA 3L0GA 3LBCA 3UQNA 1KFKA 1KBJA 1JRBA 1TTPA 3GDRA 3THAA 5HWMA 1FWSA 2QCEA 3L65A 4UIOA 2F7FA 3NDOA 4GUFA 4CNOA 3FFSA 2H6RA 1I2RA 4IMEA 5LZLA 3O05A 2QJGA 3LHWA 4GNJA 3IV3A 4FB7A 4ZQMA 1PHWA 4K38A 5CGQA 5AOUA 2G97A 2CFFA 1IXPA 3B03A 4JXCA 2VFEA 3L0KA 3RF9A 3W07A 3ZS4A 2ISVA 2GVLA 1FCQA 1ONRA 3NQCA 3HGRA 1S5WA 3LLDA 4UTTC 2QCLA 5LSMA 3Q58A 2FPTA 1VLIA 1QCWA 1VC4A 4D2JA 2RHGA 3TCEA 4ADSA 5F2GA 3NPWA 5E1QA 5HR6A 1DV7A 1I2NA 1KM3A 2ZTJA 1DKWA 3EEGA 4AVFA 4DBEA 5BW6A 1C8VA 2BLEA 3CEUA 4WOZA 4WX2A 4X9SA 4CLMA 3L5LA 4MY1A 3W7DA 2VEKA 3E96A 3PWAA 3S6DA 4JX6A 3CHVA 4QNWA 1VJIA 2BSLA 4WJEA 4QISA 1R2RA 1SQ7A 1OHLA 4Y6GA 3A5FA 5K2ZA 4LVGA 2OJPA 4WD0A 5KZDA 4M7SA 1QNVA 4JN6A 4O1BA 2NLIA 1A5BA 2NZLA 1VRDA 1OX6A 3W76A 4UFIA 1KFJA 4UNKA 4JTHA 1VS1A 1SW7A 3GDMA 4ZQCA 4AH7A 5DXXA 1L6WA 5DELA 1WV2A 2RFGA 3CWNA 4RCXA 2GUUA 5D2WA 3PS7A 1T99A 2FTPA 3LHZA 1TPEA 1H7XA 1H62A 1H51A 3GK0A 1GPWA 3HG5A 3ZR4A 1OFRA 3A23A 3TSBA 2E5DA 3NQ6A 3C3NA 3P5YA 2H8ZA 1ME7A 3TMQA 1GQNA 3QMTA 2I14A 4CQAA 3V1PA 2O7QA 2GQ9A 3KFTA 3NZRA 2QCDB 4WY0F 1G69A 1H7PA 2E1DA 3HGSA 1BWLA 5EPDA 4WY0A 5D05A 4Z0JA 1KA9F 3NQMA 4UTJA 3TIMA 3NZ1A 3W1TA 1H60A 4JYFA 3WJYA 5TQLA 3P62A 3DKJA 3GR8A 2Y6ZA 3N9RA 3W2UA 5FEWA 2KZHA 3W70A 1HO4A 5AHMA 1FBAA 3O15A 5HJLA 2HTMA 2X1UA 2ZRZA 3EX4A 1F6KA 2OX1A 3HJZA 4LVBA 3HIJA 3FLUA 1SU5A 2QJHA 1LOQA 4EWND 1FWRA 2OT1A 4QM1A 3TU9A 3UWYA 4ALDA 1EUAA 4O28A 5AYZA 1LRNA 3UD6A 1JUEA 3TQVA 4U4MA 3MI6A 1JRCA 1XBZA 2ZRVA 4XUGA 3E0IA 1O95A 1R2SA 4O11A 1IXOA 2VOMA 1ICQA 4A2RA 5A8GA 2C1HA 2D73A 5CKSA 5EMUA 3TAKA 1GYLA 1JCJA 3ABQA 3M5XA 4OBTA 3W1RA 1YXYA 2E77A 2QR6A 1VCVA 5L6UA 3CIWA 2YDAA 4RKAA 5DY3A 4TMBA 1GVSA 2YR1A 5KINA 2Y63A 4XZ9A 3W7QA 4U28A 3F1QA 2A2IA 3HG4A 3ABRA 4ADTA 4L4MA 2VEMA 2XN0A 3R8RA 3L5AA 5AHEA 3IIOA 5G4WA 2JGYA 4FNUA 1SO6A 1WXJA 3KXQA 1WOBA 4PTNA 2GJNA 3A5VA 4HNNA 3W7OA 1OFOA 4Z08A 3TC6A 4N6EA 1K02A 2ZA3A 1SPQA 1TPH1 2VFHA 2ZDRA 3PUDA 5K9CA 4OE7A 4UUIA 4UTMA 1P0KA 1Y0EA 3NNTA 3DHDA 3L9CA 3P80A 4JTSA 5BNKA 3H55A 3QM3A 3EXTA 3BGJA 2WJZA 1KM6A 5IBXA 2Q3RA 3W7RA 4LRSA 5T26A 6TIMA 1TRIA 2AQWA 2OCZA 5FESA 3S8HA 2P1FA 3N3MA 3L66A 3TXZA 2I1OA 4A21A 3OIXA 3EX1A 3WJZA 4IOTA 3M0ZA 3R2GA 3W1MA 4BR1A 1GEQA 1QPNA 4H6KA 3G8RA 3DFPA 1WAUA 1QFEA 5H2ZA 2EHHA 4FO4A 4FNRA 3ANYA 4JIPA 3G1VA 1DQWA 4JR5A 3STGA 1FWTA 2GQ8A 4Z0SA 3C2EA 1EP2A 3HGJA 1FCVA 2VFIA 2G96A 3W7GA 2AAMA 4KFNA 1UCWA 5LNWA 1G4SA 4PC8A 3IRDA 1W54A 2NV1A 3NM3A 1XBVA 4XKYB 4S2BA 2EF9A 1BWKA 4LTSA 1JULA 2CZDA 1C29A 3W22A 1SFJA 1HG3A 2DJXA 2VEPA 3N2XA 3F03K 5D02A 3C56A 3STEA 1LZOA 1L2UA 2FQIA 5CZTA 3T44A 4DO5A 2EKCA 1MSSA 1DBTA 3TV8A 4BWLC 3VKJA 1RQHA 2X2GA 4OT7A 4FX7A 3TH6A 4O16A 1H63A 3PBVA 5CPMA 1K8XA 1ZJIA 5C6MA 4LV9A 3O6YX 4OV4A 4UFHA 2YPIA 3G22A 1PCWA 4JTLA 1KLYA 1MO0A 5CZJA 1WYIA 4FX8A 1SO5A 2V81A 3WJSA 1JCLA 1RPXA 5DN1A 5F4WA 3NPUA 4GUGA 5K3VA 1VZWA 1VQTA 3K30A 4LNYA 3W71A 4KWWA 2C15A 1TPUA 3BG3A 2YYUA 3WK0A 1Q6QA 1SFLA 4XQ6A 1LRQA 3LCXA 1EB3A 4MIMA 3PUEA 3GNDA 1ZAHA 3TJLA 3G1DA 2EAWA 2ZFAA 1AK5A 2E6YA 2YFNA 5E0KA 3S5ZA 1IXNA 4CCCA 1JUBA 4N02A 1W0MA 2QCCA 2WNNA 3B8DA 3LCWA 4OGZA 4UMBA 3C2RA 1CW2A 4Y90A 2O7SA 3SFKA 3L68A 3LB0A 3QMRA 4A3UA 5HR7A 2QCHA 4JDBA 3DU0A 3FA5A 4X22A 2E68A 5C55A 1CX9A 3MYOA 3IIXA 1TTJA 4XTDA 5DBTA 1FXQA 1LTDA 2HS8A 1YADA 2AGKA 1KFEA 3PSWA 4LY8A 3L2IA 1ZY9A 2WV8A 1O5XA 2JGQA 3B0PA 2IQTA 2DZUA 3GX9A 3W88A 1J5TA 1EEPA 1JCMP 4MZ8A 2P0OA 3W1PA 2NWRA 3LTPA
chains in the Genus database with same CATH superfamily
1ZL1A 3CS2A 4AEOA 2G8ZA 1NOFA 2Y7DA 1XF0A 1H7WA 3I7RA 1OG0A 5FJPA 3IAQA 5EMMA 4B5VA 3WELA 4R7OA 2HK0A 2Y5SA 4QAIA 1RD5A 2CYGA 2HVOA 3MSRA 3BOFA 1OF6A 3MUZ1 3OG3A 2BVTA 2YCLB 3DUGA 3QZEA 1CEOA 3LM7A 3SRDA 2V5JA 3A4AA 1EDQA 4J4KA 3ARRA 4GKLA 4U3AA 2RJHA 3BW3A 2QF8A 1AMKA 3NL2A 3K8MA 4H4IA 4S39A 1QMLA 4JTGA 4JKLA 4DPPA 2Z1WA 2VX5A 3T1GA 1OK6A 3D47A 2OYMA 2RKXA 1KTBA 3OQ8A 3RHGA 3PB2A 5G2WA 3NA8A 2C19A 2YCJA 4O15A 1A4LA 3GLCA 5I79A 4NZJA 4FNTA 1TA3A 3PSVA 2OG9A 1OB0A 1TV3A 4PMVA 1FWWA 4BY3A 5HUPA 3I7SA 5HANA 1TUFA 3GKAA 2CLEA 3IJLA 3P67A 3BAXA 3MP5A 4MLRA 4QE5A 1PZ2A 2OELA 4Y9PA 3W7PA 4MNMA 3PTDA 5D04C 1OIMA 3B0VC 4BFAA 2XHYA 1M6JA 3KCJA 4CCEA 2XTKA 1KRBC 2V5BA 3VD7A 3L4VA 4YHEA 4GIRA 1PTGA 4DIAA 2PTZA 1NARA 5TNVA 2A1YA 3GW0A 1XC4A 1KGWA 4E0CA 1DJZA 3ITOA 1MZHA 3R25A 3H21A 5FEXA 1ODZA 1UZHA 1RQEA 4UWMA 3PUGA 4JTIA 3WLLA 3SR7A 1DWHM 2POZA 3UXIA 4RDYA 2UY4A 3QYQA 4DJDD 2VRJA 1NWSA 3R79A 4AB4A 1Z7AA 2WK2A 2W9MA 4ERIA 4K36A 4C1KA 2XH4A 1TVPA 3LUTA 5HXMA 4DEFA 3O6CA 3TTOA 3DH7A 1KM2A 2A4AA 4G7EA 1BEUA 4U2YA 3TA9A 5JIPA 2PDNA 2ALDA 4JTRA 5HJYA 2WKLA 3UPWA 3AQUA 3PR2A 4IICA 4LS0A 2ZQ0A 3LQLA 4H83A 2Y8UA 3TN5A 3BAIA 2PU0A 3LOTA 4ZBCA 3I3EA 2GGGA 5HWJA 3W29A 4UTKA 1REQB 4Z42C 4F2TA 4L4OA 2RDXA 5FAJA 2FZDA 4MOZA 3VNDA 3GC5A 2X0YA 3LQGA 3SGGA 2XIQA 3OU8A 1LUCA 5BOOA 1V6WA 4JDYA 2QIIA 2YCEA 2QIWA 3CV2A 5AYIA 4EOUA 3D0CA 2CLFA 2CC0A 1F7BA 3VDHA 5CAHA 2QKFA 4CNNA 2EEXA 4GJ1A 3CPUA 4HMNA 4IL0A 3G3MA 5J5RA 4ROPA 3LA4A 2HBVA 3QHMA 5EY5A 2D0HA 3KM8A 1HT6A 3F5KA 2ZDSA 2ESCA 3DFNA 2Y62A 2QJIA 3RCYA 4LY4A 2EPKX 1D2KA 2W66A 4YTSA 2HROA 4W7VA 1LROA 4TX8A 2OQYA 5DMYA 4QJ5B 3TLLA 4J5NA 3AYVA 1B90A 1ONEA 4MGGA 4RXFA 2JIWA 2Y8KA 5FJRA 1UJPA 2PRHA 3V75A 2JQXA 3NXFA 1QOQA 3UGRA 1LDCA 3WMLA 4H9MA 3EXRA 4GYJA 2J9ZA 2W91A 4DUXA 4NX5A 1XYCA 1KNWA 4R85A 2ODOA 3NG3A 3QMSA 2PDHA 3HGOA 3RLHA 4NI8A 3SSZA 4JL1A 1BVWA 3SI9A 2WKGA 4I9MA 3VI2A 5I77A 3C2FA 2PE4A 3N34A 4HA3A 3HPZA 1NSJA 2H9AB 1VBJA 2O4MA 4ORMA 3VTRA 1W56A 3R8GA 4QX4A 3IANA 3N17A 3KL0A 3Q45A 3K4DA 3CUZA 1LYXA 1HP5A 1V4YA 4HPNA 1TZ9A 2ABAA 2QYGA 3ITLA 4JTCA 1TPVA 4J3XA 2CLKA 3FYPA 1HNYA 4G1KA 4O4VA 2Y4SA 1EH9A 1Q6CA 4C1NB 4C5ZA 2DQXA 4ZO6A 3L5MA 3NSMA 4A35A 3A4JA 3LHVA 2PWVA 1YDOA 3WK2A 4BI5A 2UY2A 2WVVB 1XIFA 3FJ4A 3PF3A 3AS1A 1BGGA 5HINA 1GOWA 5TAOA 1W9DM 2A3CA 1GVFA 1S1PA 4IFKA 1KRCC 1GGOA 3TK7A 5DY2A 1EJWC 5EFFA 3DBNA 5E0CA 5HQEA 3VC6A 1HKIA 7TIMA 2Z1VA 4IG2B 4CEUC 1JF6A 3CNYA 3ITCA 4LJ3A 5AECA 3GVGA 4MSSA 1GTEA 5FEPA 3VMNA 4NQ1A 4ERAA 1OADA 1MXDA 2I9EA 3GXIA 3B8SA 1RA5A 2BWGA 2W3ZA 2ZX8A 2QF7A 1VIZA 5LGZA 4J28A 2ZRUA 5A6MA 3VIKA 5FJTA 4Q8UA 1QNOA 1RJRA 4GD0A 4ZMGA 3C6CA 1EPVA 1BXCA 4PCFA 3I65A 1KM0A 4ZZ9A 2A85A 4RL3A 4PTXA 5HWNA 4NNBA 1SZFA 4XX6A 3T07A 3OEXA 2QUVA 3OG2A 3KEHA 4J3TA 4Q8QA 5FEZA 1TIWA 4AD4A 3GAYA 2W27A 2D0GA 4PL1A 1OF8A 2Z24A 4M7TA 1PHQA 4UZSA 2INZA 1EBHA 3SY1A 1EEXA 2EPNA 1FWFC 3EB4A 3IVTA 1AJZA 3WQDA 2DIJA 3I3DA 3IGUA 2ALRA 3DYOA 2PDYA 1OFBA 2OFJA 1KCKA 1UR4A 3FS2A 4PFHA 2XWEA 3KDOA 3LRKA 5CJMA 4J1OA 5HOSA 5HDRA 2ZE0A 2Z1BA 4B91A 5HMDA 4O0KA 1N8IA 4ZSUA 1JZ4A 2O4QA 4AC7C 3Q2DA 4JEJA 1UD6A 3GTIA 2PF0A 4DYJA 5BZAA 3C2OA 3DI1A 3GU1A 5LIXX 4CU8A 1P0DA 3Q4DA 3TOPA 1MRQA 3CZKA 1TZ7A 6REQB 4HOXA 1IGSA 4JTKA 1B9BA 5A2BA 2CW6A 5AYYA 1HO1A 2CZVA 4MJZA 1VAHA 5AVHA 3AUOA 3PZUA 3I7QA 1R7OA 1ISXA 3EBVA 3V0UA 5CLWA 4IIHA 1H7RA 3QV9A 4EP8C 3CTTA 4GO8A 1ISVA 2I5QA 5BRPA 2OQLA 1AH0A 1N2VA 1J93A 3W7LA 3B06A 3C52A 1P7TB 4XZBA 3MZ2A 1VFMA 4D6DA 1EOMA 2UWFA 1IT7A 2J6VA 4F9JA 2OYKA 3AU2A 4Q4QA 1Q6DA 5HJXA 1RCQA 4MWAA 3GTNA 5AB3A 3WLNA 3T4WA 4R7WA 2E6FA 4GJJA 1FCUA 3VIMA 2BMBA 4ENLA 1OY0A 1X1ZA 2UV8G 4IGNA 1RXOB 1H1ZA 5CPSA 2F84A 3CV6A 3GU2A 3W6MA 3UCQA 4H7CA 5D09A 5DRIA 3W83A 2E9BA 1H2JA 2VX6A 1JCXA 2VT0A 3PY2A 4D8LA 3ALGA 1VHNA 2DU2A 2ZZ2A 1RAKA 3S83A 2H8XA 3VIIA 4Z1BA 4QITA 2BDQA 4QS5A 2ZE3A 4FLQA 4ZQNA 1I8JA 1Z9AA 3IGSA 4IMAA 4UR9A 1A5SA 4ZL1A 4AHOA 1W5PA 3E9AA 3QY7A 1O5QA 1V3IA 2YA0A 1HP4A 4BJHA 1UUMA 2YFOA 4A2SA 4UXDA 1IE7C 3H2NA 3E1F1 1EA0A 1WDQA 1C8QA 4LQ1A 5CSYA 2VURA 5BCAA 1I2QA 5F7UA 5AC8A 1NAL1 2V3FA 2YW3A 4AZ7A 2Y24A 5FSDC 1TO3A 3LMYA 3W1AA 4AWUA 4QFUA 1E9YB 2IQDA 3WF2A 4IIFA 1TMLA 5A8MA 3T78A 1E51A 4ZGYA 4D6HA 1WO2A 4RDZA 2HMCA 1O68A 3QQ1A 3CQJA 3W7KA 3CWHA 1DYSA 3FVDA 3CTLA 4QXIA 1W1YA 4P7OA 1RK5A 4NG3A 1EDTA 5CEWA 1M01A 3BLIA 3PP7A 4YL2A 4KERA 2ZWYA 4LC6A 1WDWA 4AWSA 2YGYA 1BG9A 1J11A 1GVEA 1XC6A 3RRXA 1UH3A 4INFA 1E4IA 8XIAA 4NU7A 4P61A 8XIMA 3S1WA 4IP7A 1KV5A 3G0SA 1NIUA 4L65A 2WWCA 4JIRA 1QXLA 4HKPA 2QVHA 4XD3A 5D9OA 1CDGA 2CKRA 3WEOA 4HPHA 3VE9A 1ONWA 2FKPA 4OWGA 1UR2A 4NJIA 5FF0A 1XCWA 4US5A 2L5HA 2QPUA 3CH0A 2V0TA 4H7VA 4HIBA 2ZZ1A 2AL2B 3CMGA 3RG6A 2WKJA 4C6FA 4GA8A 2X05A 4R88A 3TWAA 3KBJA 1QK0A 1VPYA 1TPDA 3IUDA 3KZPA 1UKPA 1QAPA 4QNEA 3SN4A 3IUIA 4XKMA 3GFZA 2OEKA 4Y96A 2X8RA 3DCPA 3CO8A 1Q4WA 3T8LA 2DGAA 2FZ8A 1O4UA 2WCGA 3STPA 2ISWA 3MV01 3VX0A 3WBXA 3FA3A 4GGBA 1B4EA 4O54A 4Z1CA 3BGGA 4TXEA 1MWOA 1SZEA 1DVJA 1QVBA 1M9HA 1I75A 5FL0A 3SIZA 1C92A 4NNAA 4HB7A 4XG1A 1FCBA 5BMXA 3G24A 2DPEA 1VYPX 3PBUA 3BSHA 3LERA 1BXNA 1CENA 1V0KA 1AODA 3W7HA 4JQ1A 1YXDA 3C4UA 4GACA 3T2PA 1UP0A 2OOFA 3HO8A 2CZEA 1KQZA 1QI2A 4B90A 4DWSA 1K03A 1H7NA 2DQWA 3V0SA 3GVRA 1GQIA 2OO0A 4POCA 3APYA 3DYMA 4XZNX 1SO4A 1S2CA 3AU6A 1Q2RA 3NGJA 1Q6GA 4MKNA 4Q4OA 3OVRA 4WQ6A 2JKAA 1QNQA 4NAFB 2VEIA 2B7QA 1UPPA 4MWAD 1XBXA 1VHCA 3KHDA 3PM6A 3WD0A 1EJSC 1DIEA 3BOLA 3W73A 3DFOA 1Z89A 4GLEA 1CXEA 2XSXA 4IWWA 4RE4A 4S3FA 4KPLA 4AXKA 1OFQA 3H70A 3CUJA 3AIBA 4LGXA 3WBYA 5KZMA 4K1WA 1NF7A 5LA1A 1GZ1A 4GH1A 2EBNA 3W7IA 1YMYA 3N29A 2J9YA 1Z3NA 3UG4A 2X1IA 2PWDA 4R3UA 2QGHA 4G2DA 4P8WA 4I5RA 3TYCA 4PRRA 3ZO9A 1TWDA 1PV8A 1J0IA 6CGTA 3W82A 2JKEA 5K9XA 3LU2A 3CMJA 4UNIA 3W26A 4X2PA 4IXXA 2EKGA 4Q8VA 2V30A 1IF2A 5EYWA 1PXGA 3GU9A 2CNCA 3KOWA 4JN7A 3AHZA 2C13A 3ANVA 4GWEA 2OZ0A 1F6PA 1E40A 2G3JA 3EYPA 4IJBA 2PCQA 3AXMA 1XI3A 3B9NA 2WXDM 5HNRA 1AA1B 7ODCA 2X41A 2ZWZA 4LUTA 3S5YA 4RXGA 3H7RA 1CGWA 3GD6A 1MEWA 3C2VA 1Z44A 4Q32A 4O19A 3SQLA 4HA1A 5KITA 3SADA 1YTDA 1S3TC 3RDKA 3IIZA 5F4SA 5G5IA 2OTDA 1S5VA 3BICA 5E6ZA 3CU2A 5CC7A 3AIEA 3UWZA 2R1MA 2CLIA 5I3FA 2Z2BA 3F4CA 5G2HA 5K9DA 1E5JA 3KDNA 1W37A 2CWNA 3I3BA 3CL7A 3ID7A 3FJLA 4YU1A 1PIFA 1L8PA 1L6SA 2NLYA 1GHRA 4K8GA 3C0QA 1G4TA 2FMNA 1CNVA 3MMTA 3ES7A 1K3UA 1SSDA 1PX4A 3U2CA 3OGSA 4ZODA 2W6RA 3HPAA 2J8GA 1ZSXA 3CLMA 2FFIA 2NUXA 3VUSA 4GABA 1XFBA 3P61A 3QFEA 1CXHA 3AS2A 3EX2A 1IYXA 1ZRQA 4RPPA 4QP0A 5D9PA 3KP0A 4P8XA 1GOQA 3B05A 2DT3A 5CAKA 3BLFA 1F07A 3C3UA 3CQHA 3B9AA 3FEQA 1UR1A 1V51A 3QRHA 3TP4A 1R3SA 3COTA 4H00A 5ABGA 4DJFA 4ONVA 1TV8A 1TV2A 3FXGA 3I6TA 3GDKA 5JBDA 2VMFA 3NZPA 3W87A 4RZ4A 1E56A 4G56A 2D69A 2FZMA 4H19A 4UQDA 1VR6A 4NIRA 1V0LA 2QCFA 4F79A 3ORWA 1PKLA 4O13A 2VC9A 4HZ6A 3TN6A 1X96A 4ZO9A 1KW1A 5EMLA 3CHCA 3TQ0A 2OSYA 3UWUA 2JF6A 4K37A 1RLCL 1OC5A 4PMRA 1VBHA 3B04A 1JPDX 4MNJA 3SCPA 1GONA 3GHSA 3W9ZA 2C1GA 1XYZA 5MKGB 1AUSL 2P3ZA 1E6RA 3W0KA 4NUWA 1AL7A 2D23A 4NXKA 3DG7A 3W28A 3N6JA 3NL3A 3WLPA 1IIGA 2P50A 4HPJA 1P43A 1E1FA 3IIVA 3PC0A 4IPLA 3E2VA 4WSKA 1S5MA 1E0UA 3GR7A 4DWSD 1SMDA 2ZBTA 1DQXA 4KKXA 3QOKA 3R6IA 3BSGA 1WNOA 3LTYA 3O07A 4QQ3A 1XLFA 2QV4A 3QKEA 3WY1A 1RK6A 2BXZA 1W2VA 4U33A 4EF8A 3M4HA 3FK4A 4JFUA 2V9DA 2VUNA 2GDUA 3URQA 3BWWA 4UTWC 1B5TA 2A7PA 3A4XA 1BPLB 4LS2A 1ZAJA 4JEQA 4KWUA 5A8OA 3L23A 3BLPX 4PTVA 4C6QA 3R10A 4NJJA 1FH9A 1PO9A 4JIHA 4GNVA 3WLTA 4E5TA 5I02A 1DJXA 2HZGA 2AL1A 3TNOA 3E5BA 3FOKA 3PHAA 4U5IA 1TCDA 2FGBA 3ZFHA 1C9DA 3B4UA 1FDJA 4GNKB 3UJFA 5JH1A 3RYSA 4OQVA 2WQPA 1XH1A 4PCPA 2V2CA 4ROQA 3ONCA 5DQPA 4IQJA 2IPGA 3NOYA 2QAPA 3SGUA 3IUHA 5AHFA 3FNDA 2X1RA 3URAA 3GNPA 4LXFA 1W1TA 5KMYA 3M1ZA 4CQ9A 2NXIA 2OB3A 2R82A 2J25A 3W2KA 2QUUA 2J77A 5C9XA 2G37A 3OOQA 4DZAA 2CITA 3V4BA 2C6QA 1E9IA 4D6IA 3SRHA 4WR3A 1F3EA 3QXBA 3OA3A 3WYZA 2QVNA 3UQNA 1BG4A 3OW1A 1MUCA 3UU0A 3RPTA 3N4FA 4Z2GA 4JFVA 3THAA 5HWMA 4WDXA 2F7FA 3NDOA 4XD4A 4ZOAA 4KRTA 3OGRA 2BASA 3O05A 1V3MA 2QJGA 3LHWA 1TX2A 4K38A 4S3AA 3FGCA 3AS0A 2P76A 1NDZA 2XIOA 3C0SA 1EQCA 3N25A 2CXGA 3P3BA 2WHJA 3BLOA 3L0KA 3OJGA 4HMDA 3ZS4A 1HKJA 4AUBA 3HGRA 3O0KA 2ZUWA 3B97A 3RMEA 2QCLA 5I09A 1IR1A 2FPTA 4CEXC 1QCWA 4H7ZA 2RHGA 3TCEA 3A64A 5F2GA 3SQSA 3NPWA 1I2NA 5ABFB 1KM3A 2ZVRA 1DKWA 3EEGA 3CAQA 4BKNA 4C6EA 5HMEA 2D24A 4MY1A 1CT5A 4Z2LA 2BOFX 4K1GA 4PZVA 2BSLA 3K4AA 4WJEA 4Q8NA 1SQ7A 4KMQA 4Y6GA 3DERA 3A5FA 4I3GA 5K2ZA 4LVGA 1M41A 4DJFD 5A6LA 3AXIA 4M7SA 4H04A 1HX0A 3N15A 2IS7A 2NLIA 3B4YA 1A5BA 4YTTA 3W76A 1B3ZA 3VDGA 2PP0A 1WUFA 5A8QA 4ZXLA 4UNKA 2D3LA 2TAAA 1VS1A 4Z17A 1SW7A 4W7WA 4Q7NA 1T99A 2FTPA 3EA2A 1H7XA 1E9LA 2XSBA 1GPWA 3HG5A 3ZR4A 3A23A 3NGFA 2MUCA 3EKGA 3VNLA 1OZQA 1NQ6A 3V1PA 2PDJA 4ZO7A 1G69A 2WHMA 2PDKA 3VKBA 5AC5A 1HGWA 4GG9A 4WY0A 3NQMA 4GCAA 5IHSA 1H60A 3WJYA 5TQLA 5M1TA 4MKSA 3GR8A 7XIMA 5DANA 1FWJC 1RH9A 4XZWA 5EGRA 3O15A 1TJ2A 1NJJA 3WD4A 1F6KA 4EPKA 1E9ZB 2QJHA 3R8HA 2OT1A 4QDPA 1XYBA 2IKJA 4HGXA 5I78A 2ON3A 2C71A 3UEQA 4HP5A 5AYZA 3UD6A 4H9ZA 2QQ6A 4HHMA 3WSUA 4U3CA 4XUGA 3GZAA 1G9HA 4HNCA 4PMXA 5DRCA 3VMPA 3F2DA 4IJRA 3E2SA 3TTYA 4CUCA 5D8ZA 1B30A 1EZ2A 2KAUC 3WD3A 5EMUA 3TAKA 3QC0A 3ABQA 1JYXA 2QR6A 2YLAA 4DO7A 3UZYA 5L6UA 3CIWA 4PRTA 1I0BA 1E72M 2FTYA 3VAVA 1F3TA 3BANA 1MQPA 1R8LA 1GVSA 3VGBA 2DSKA 3ABRA 1E0XA 4L4MA 1UHVA 2GVEA 1H5VA 1UWIA 2JGYA 1SO6A 3TYEA 2WLZA 1IR2A 4AW7A 3U7VA 3MT1A 3K4WA 1BVZA 1ELSA 4HNOA 2ZA3A 1SPQA 3QOMA 1W91A 4QG8A 5K9CA 9XIMA 4EAYA 1LLOA 1Y0EA 3L9CA 1FKWA 3QM3A 2Y2WA 3WF3A 3L12A 1XPGA 3EXTA 3BGJA 3ZR5A 1KM6A 2CKSA 1TRIA 4GIEA 2OCZA 4FALA 1FOBA 3VK5A 3L66A 1E1CB 3CHFA 3LGGA 1X8CA 3M0ZA 3R2GA 3W1MA 3VD4A 2PWGA 4J3ZA 2PDIA 3G8RA 1WZLA 4CU7A 3JZUA 4YS1A 4J3WA 2FH6A 1DQWA 1NP0A 1K1DA 1UWAA 4GZEA 3STGA 4RNJA 3C2EA 1EP2A 3HGJA 1VPQA 3ARYA 3OZYA 4DJEC 2VFIA 4QSFA 2Z29A 4KFNA 5LNWA 6TAAA 3IRDA 3VOGA 3N6HA 1W54A 2ZICA 1D7FA 1XBVA 4XKYB 2CZDA 3CV7A 2BY2A 2GSHA 1NTHA 3N6QA 1UKSA 1SFJA 1X97A 2VEPA 4XIAA 2FHBA 1EQPA 5CZTA 3T44A 2WC4A 1EJ7L 4RW3A 4FX7A 4PMYA 5CPMA 1ZJIA 2Q01A 1ZP3A 4NRRA 3WFZA 4AIEA 5CZJA 1R87A 4QE4A 3DYPA 2F6XA 3USZA 1UR3M 3LG3A 4AY1A 1JCLA 1Y65A 4GUGA 5BOEA 4O0QA 3K30A 1UIPA 3W71A 4F9DA 1TPUA 3WK0A 3H2CA 3M0KA 1VD6A 3GNDA 4GBDA 1JYWA 3P93A 4AWEA 2YIHA 5EFDA 5D9NA 1Y5XA 3G1DA 2Z28A 2W63A 1FWAC 4U2ZA 1AK5A 4YTQA 1JDCA 1IXNA 4ACZA 1JUBA 1V0MA 1W0MA 4L4PA 4OGZA 2ZADA 3LCWA 4UMBA 1DWAM 3C2RA 5HK4A 4I9TA 2DW7A 3M0XA 3L68A 5AVNA 1V3LA 3QMRA 2F6UA 3HQNA 4JDBA 3FA5A 2E68A 1TTJA 2OEJA 4HMCA 2WCAA 1JPIA 4GO9A 1ZY9A 4DYEA 2PDQA 3BAKA 3LSBA 2JGQA 5FKYA 1GKPA 2CHNA 2DZUA 1JCMP 4WDWA 2VGIA 4UB9A 4HK6A 3LTPA 3ME3A 2Z1SA 2DJLA 4Q3MA 3GAKA 4PMOA 1A5UA 3EDJA 3BCJA 2NV9A 1ITXA 2VC5A 4UQAA 4UTFA 2QULA 3WL1A 1OFPA 1S5NA 4C65A 2RAGA 4XAFA 3P8JA 4HHPA 4O17A 5CSSA 4DZ5A 2UY5A 5CZKA 4L6HA 1WBHA 4UFLA 1RQBA 2E3ZA 2ISDA 1JZ2A 1QK2A 2EJAA 4W7UA 5U7SA 1JL8A 4AD2A 2O0TA 1HJXA 3B0YA 1DJGA 1N55A 3KOYA 5C2CA 5A94A 5LIKX 1JVNA 3WH9A 4XAGA 3ZSTA 1KQYA 4XBJA 4O8RA 2QUTA 1XKYA 1PCKA 2W62A 2Z4GA 5REQB 5I2UA 2YXXA 7PTDA 3ES8A 1DL3A 1EO7A 4FOUA 3QN3A 4ICMA 3QV8A 4GOAA 4L5ZA 1EFZA 2RJGA 3T9PA 2WMJA 4O1CA 3M5VA 4F40A 1FKXA 5CZSA 3W7MA 1GUVA 5E93A 3UCCA 3V16A 2D20A 2PDGA 1XLMA 2AAAA 1GQKA 2BY0A 4IGMA 3BE7A 1U30A 5FF2A 4MB5A 2DZVA 3UPMA 5FJOA 3CZJA 4S3DA 4CVUA 4N4QA 3PZGA 4KWSA 1K8ZA 1LOSA 1OFAA 5H91A 2JBMA 4XZLX 1BD0A 2RDUA 1RVGA 2Y89A 3MSGA 2V68A 2ZZ6A 2XPKA 1V5XA 3EWBX 4AD1A 3HQPA 2W79A 1Q45A 1P4CA 1ZJBA 2ZRWA 4FXSA 3HZ3A 5DO8A 3S1VA 3UBPC 5IOBA 4JIQA 4LNCA 1V3JA 4LVDA 2CCRA 4MYAA 5D32A 3EWXA 4DX3A 4A8NA 2Z7KA 2Z1XA 2Q8LA 1R3WA 3O3RA 3USBA 2V6AA 1TG7A 1W3TA 4B5NA 3B8VA 4YN5A 3K1GA 1W1ZA 3GVWA 5E5CA 2YL6A 5DMLA 3R7MA 1M53A 1R47A 1Q7QA 1J18A 5DT5A 3J7HA 3SCUA 2PPGA 1U83A 1UIOA 3QHNA 1FWGC 3M5YA 1FY6A 3LCHA 2DZSA 2GK1A 3W7JA 2HE5A 1O7AA 4P8VA 4K39A 4JOMA 4AZCB 3E5PA 1BYBA 2PTXA 1A50A 1YPIA 4NVTA 4H9VA 4GFIA 5A6BD 3T7VA 3FVMA 4NJGA 4OVXA 4Z1YA 3M7WA 3S47A 1QUMA 3M0HA 1UBSA 2VM8A 4AF0A 2TRSA 1Y8BA 1OCJA 1A47A 4XIMA 1IZKA 2DV0A 4KS0A 1G7UA 1GT8A 3IPWA 1DWGM 2VHLA 4C90A 4DO6A 5E9XA 1ME9A 2GJLA 3O06A 1ZBWA 1UUOA 3W3OA 1UMLA 3BAYA 4XAZA 2XFRA 1CIUA 4RNHA 1K9TA 4LAMA 3R58A 1J0HA 3BO9A 4F0SA 1V0NA 1J79A 3TC7A 1BRLB 5DCEA 2PDWA 1DXEA 5HUOA 5JBFA 5EMYA 2JALA 2ZZ3A 4RV3A 3DFYA 4RW5A 4AZIA 2ZX5A 2WSQA 2ZCGA 3VD9A 1AQFA 4BZYA 3KCOA 1HKVA 3QZAA 3C5QA 4EX4A 1LBMA 1U5JA 4NASA 2DZTA 1EA9C 5LIYX 1JZ3A 5AZ1A 1GYMA 2CHRA 3G18A 1OGBA 1XSIA 4F4RA 4UTHA 4UTUA 4LFYA 5M2FX 1XM3A 1CXKA 3RLUA 4S38A 5MHBA 3BGAA 2HEJA 1PJ9A 1BF6A 1V7YA 3WNKA 1E6XM 1R3VA 4KT2A 1Z32X 1XQLA 4IPIA 3GKFA 4FNPA 2CWXA 4JIIX 2X40A 2C3ZA 5TD4A 2BTMA 1H50A 2XGIA 1XYMA 4KCTA 2NQ9A 1JQXA 3CQ0A 4OECA 4PA8A 3SEPA 1RY0A 3HBLA 2WSYA 4QHRA 3T0DA 3H24A 3TYUA 3F2BA 3TAOA 1EJUC 1XIJA 4XSLA 3WO8A 1MXSA 3BLDA 3ZJKA 4AZGA 4X0NA 3GH5A 1XGEA 3ZVHB 4YXGA 3K1DA 5A1AA 5FCZA 4N9CA 1V03A 1ML1A 3VPLA 1PL9A 4WIWA 4NZ4A 1QOPA 3QZ6A 3WLOA 4MJ2A 5H8PA 3KP1A 1JR1A 2A0NA 5CGMA 2MANA 4CNUA 2OO6A 1TVNA 1RCOB 1QO2A 4MY8A 4FLOA 2V5DA 1ICSA 2Y1HA 4ZCWA 3WKZA 1TPFA 4B4FA 2W67A 4FIRA 4YTRA 3LRMA 2JFEX 3UZ5A 1E0WA 4UNLA 4MUPA 1EP3A 3NYDA 2E9LA 2VEGA 4AIUA 3IJ7A 4HA0A 1EC9A 1ICPA 2FB3A 4UMAA 3CUXA 3AHXA 1C8XA 1LBFA 1PKYA 4PCSA 1OG6A 4GZJA 3NZGA 1XIDA 3D5HA 4ORIA 2EG8A 3HV8A 3TSMA 5JU6A 4DRSA 1QI4A 1W5MA 3AICA 2FH8A 2TMDA 3PBGA 4NL1A 4KETA 1D3HA 3EPOA 3SCQA 3W4RA 3REQA 1ME8A 4QSHA 4JTAA 3KRBA 4L1GA 3PANA 1Z42A 1I60A 1K8YA 3P0XA 3GXNA 3BJFA 2Q8ZA 1Z48A 1IIHA 3DHFA 4YCOA 1TQJA 4IPNB 4JTTA 1U1JA 1ITUA 1YIXA 1JF5A 1XV8A 2HCVA 2YX0A 4JNZA 1MXGA 4NAEA 1LWJA 5G4HC 2RH9A 5KETA 4ATLA 3N3TA 3M47A 4ZTXA 2DSUA 3CQKA 3W2NA 4PCTA 1JXJA 2WMGA 2ZC8A 3WUEA 2XGZA 6XIMA 2DH2A 2WLYA 3RPDA 3V3WA 2C18A 4Q8MA 3SCWA 1W8SA 1ZHAA 2VD8A 1FHVA 1NU5A 1ODUA 4IX2A 4AQLA 4XZIA 1FP9A 4WGXA 3B9OA 4G9PA 2WMIA 1JDDA 1TA3B 1FH7A 3S5OA 5GNXA 2RUSA 1GYNA 2QLYA 4EVZA 2DP3A 3GBEA 1HL9A 4A3HA 2C8NA 1AD4A 2FGLA 4EANA 1UB3A 4AY7A 4DNHA 1RD6A 2P10A 4LALA 1SJCA 2J7HA 1QPOA 1S2VA 3PUOA 3GYEA 2OZ3A 3E0FA 5KEZA 4E4FA 3LBOA 4W88A 2IPJA 5C9RA 5AY7A 4H8HA 2E5BA 4JCLA 3EX3A 4O57A 2CXEA 1J01A 4I6KA 1U2YA 5LNSA 3WJXA 4ZTYA 2ATMA 1KM4A 4W8LA 4ZQRA 4LH8A 1P0NA 4Q33A 1LQ2A 2VI0A 4PUNA 4UC5A 3CGTA 4LOCA 4XO6A 1CWYA 4Y9MA 2J88A 3W24A 4W86A 3G6MA 3GH7A 4GIYA 1XH0A 2PWFA 4FMVA 2H3DA 4U10A 4LCRA 1GVQA 3RPMA 2PGFA 4FK9A 1Q6LA 4GYPC 7REQA 1Q6RA 1Q3NA 3DFQA 2G3FA 3CH9A 1POKA 1Q6FA 6XIAA 1S3HA 1J96A 2XN2A 3R43A 3UW6A 5G1MA 3LXBA 1P48A 4L64A 4C6NA 4W5UA 3RU8X 1E71M 1DJQA 4W4QA 4HPXA 2BS9A 1W3IA 1ZBCA 1UBPC 3NOEA 3UR2A 4G7EB 2WZEA 1MRAA 3CL6A 1ZALA 2HDJA 1OQFA 1HFBA 4PUMA 4L6DA 4CCZA 3OBEA 1ECQA 3NL5A 3TROA 4FNSA 3TR2A 2W61A 1JQVA 3VNYA 4BK9A 1WPCA 4PBFA 3II1A 1U5VA 2WPBA 4GISA 5B7ZA 3BK0A 1T8XA 1R6WA 4Q4RA 3GXMA 4Y7EA 4AVOA 3D6NA 1WKDA 4GI6A 2DVUA 3SDOA 2VEFA 1EJRC 3ZWTA 4RR4A 5JUVA 5HMSA 3WCZA 3VKDA 1Q8AA 2B0MA 2PD5A 4DNMA 2IXUA 2B4GA 4IFRA 3CZEA 1EUNA 3CYVA 4HTBA 3RFAA 3I6RA 4MNLA 4GQRA 4LAUA 3OBKA 4GVIA 4DBDA 1XD1A 1J2BA 3VXGA 1X7FA 3M6YA 1S2AA 5FA5A 1A0EA 3BLKA 4NY2A 2BVDA 1TVLA 1J9YA 2P3EA 1I45A 1C7SA 1WKYA 1MEHA 3MJYA 3OBAA 2PF8A 4US6A 3ONBA 2YKKA 4M3PA 3ZT5A 2PAJA 1A5NC 1SZGA 1QHPA 2FDMA 8RUCA 1HJWA 4FX6M 3XISA 2F6KA 1UG6A 1RVKA 3THQA 3T0AA 1W9BM 2ACUA 3JUGA 3EWWA 3PB0A 1YDYA 1ZENA 1JPHA 3DDMA 1IZJA 1RY8A 3PZOA 2Q02A 1TJRA 2NVCA 3CC1A 4GHRA 1L2QA 3LX9A 3W6YA 2VFDA 4RZ6A 3EWZA 3U4AA 2YJQA 2G3IA 4ML9A 4RDWA 4CN1A 2YA2A 2CZ5A 3UR5A 1TV5A 3RX3A 1ITCA 1DE5A 4Z1AA 1NH6A 1OD8A 5IBXC 3R0UA 3ZR6A 4F48A 2DSVA 1W5QA 4AZ5A 1Q6EA 4AWTA 4FS9A 4GKTA 3SUTA 3G0UA 5C5YA 1J0ZA 1XW8A 2GL5A 4AG0A 4DXXA 3PFRA 3DG6A 4K3ZA 5GJNA 3ZWSA 3R0KA 4AC1X 2HSAA 1K4HA 3RMJA 4IMFA 3NCOA 4QS6A 4DBWA 1UD8A 1MUMA 4JFWA 1QW7A 3G5EA 1DJNA 2YL9A 4O18A 3KL3A 1RALA 3OA5A 3IACA 2O9OA 1EKOA 1L6GA 2XIMA 4IFKB 3WD1A 2E09A 1U33A 4PMNA 3OODA 2FFCA 1ZUAX 3VZXA 4Y8FA 5GVJA 5LYRA 1JJKA 4DJDC 1KCXA 3WNMA 1UZ4A 4LYKA 3BV4A 1XS2A 3BG9A 4M80A 2YYTA 2VNCA 3T2OA 3SSJA 4I8YA 3STCA 3QH2A 1NP2A 1AZ1A 2VDIA 5DLCA 5DXYA 3SRFA 4OUIA 2AKMA 3UG8A 1M5WA 4GRSA 1JZ5A 5G4EA 2NXHA 2ZA2A 4NT0A 1C3FA 4FEZA 1RV8A 1LP6A 3VCCA 3KVKA 1CPUA 3U5UA 4RZBA 2WANA 3NQBA 3PFMA 1T6MA 5IFPA 3LLFA 1XG3A 3OVPA 5LKYA 1F2JA 3N19B 2GVJA 1V3KA 4O0ZA 4GI4A 1YYAA 2ZX9A 5C2XA 3EDEA 4YWIA 3W7NA 4H3DA 3MP3A 3HPFA 1JIBA 1YTKA 1M65A 1LQAA 3W2LA 1FVPA 2E6DA 3QW3A 3Q37A 1I9CB 4PMQA 1OABA 1TRDA 4GUHA 3LCLA 4AU0A 4XZHA 3TUUA 2QGYA 1FRBA 1XJBA 2DEPA 5B80A 2GQ3A 3U8GA 1VJSA 3PWIA 1XUUA 4TR9A 2VFFA 2PU1A 3H2MA 3BW2A 4HD5A 4YPJA 1RP8A 3E2QA 2PZNA 1WXYA 3WQWA 3VNIA 4H1ZA 1E15A 2XGBA 4HYRA 1F76A 4O1AA 4R9OA 3PZTA 3WFLA 4HT3A 1H3GA 3W1LA 1YNYA 3E02A 2QNEA 1Z6KA 2E1WA 1E55A 1CLKA 4S23A 5AKQA 3BDKA 3AUJA 1SFTA 1QT1A 3SO7A 1QWGA 2HK1A 1HUVA 4B4HA 5BRBA 4WEVX 2GZXA 7TAAA 3NSNA 1W9UA 4L7ZA 1TV7A 3MDWA 2GWNA 1R86A 1CGYA 2DVTA 2VP8A 5LHFA 4GE8A 2A5HA 4H9XA 3AYRA 1YPXA 3PJXA 1CCWB 4JTQA 1VEMA 2NQZA 1Q66A 1Q8JA 1M68A 1NOUA 3OLDA 3KRZA 4JYEA 2VZTA 4M6VA 2PCEA 4LUSA 4PUKA 1SZNA 4IJCA 1K4GA 1NFBA 4MWAB 5CBJA 4IHCA 4QEEA 1FDYA 4FP1A 2PTDA 3F4WA 5IDZA 5M17A 2TPSA 4HJFA 3G0XA 3ZJ8A 1R3QA 3PZQA 4JKKA 1T5AA 1SVDA 3AAMA 4JQ2A 4K68A 3VGGA 2VYOA 4TQTA 1MI3A 2IXVA 3W00A 5D33A 5TBOA 2HNHA 2BVYA 2FIQA 3MS8A 5F2LA 4M5PA 2VELA 4X61A 1YRRA 2WMKA 3WH8A 1W9VA 5DF0A 3UG3A 1GVYA 3AALA 2R91A 1KTNA 4YYCA 3KRUA 4OUEA 4D8ZA 1UMYA 4LRTA 2ZZ5A 2AMXA 5AC7A 3SRKA 2V5LA 2OVLA 1X38A 2VENA 5EKYA 3P2VA 4HK5A 3UNDA 2PLMA 2VDGA 3UF9A 4PUUA 1LLWA 3LNPA 4NNCA 4M1RA 3APGA 4F0KA 5F2IA 3QTGA 3LCGA 1C8YA 2X1SA 1TJ1A 1SZRA 4TX9A 1UASA 1LF1A 1FP8A 4OBSA 4UCGA 2J62A 3T08A 4UZUA 1EYWA 3VINA 2OWCA 3TSDA 2F2HA 4BQ2A 2YL5A 3E49A 4P2VA 3TE9A 3R0DA 1AVAA 3WQ8A 3TMLA 3BC9A 1UWTA 1EPXA 2BV9A 4MPQA 5LGXA 3KWSA 4HA4A 5HQMA 3NWRA 3MANA 4JHZA 4HBKA 1HJSA 4F0MA 2F2KA 4L56A 5CC3A 3EB2A 4YWSA 1EOKA 3W1XA 1K9FA 4YVXA 1N7KA 4Q7BA 3D3AA 4KEMA 3TYDA 2BOEX 4PRWA 5D2XA 3RCNA 1MW1A 2IPWA 4V2XA 2WHLA 1IEQA 3N73A 3UXDA 3C8NA 2VGBA 1TSIA 2RGLA 2VXNA 2XG9A 2PB1A 4TVUA 1DORA 3EPMA 3FKKA 5M3WA 3L4XA 2HBXA 1UOZA 5LNVA 3L2MA 3MQTA 3CYJA 4J3SA 3KZSA 4R53A 3PPGA 3MW7A 3MZNA 4XV0A 3BJTA 4LV4A 3ITYA 2FPVA 3MSDA 1EHAA 1ISZA 4KEZA 4LBRA 1H41A 3E0VA 2WZMA 5DCBA 1B4KA 3MO7A 3DGRA 1R0MA 3UFYA 1JNDA 1DTNA 2NUYA 3PWGA 3BARA 4A8IA 2O9TA 3BW4A 4IFOA 4C6JA 2YCIX 4PUWA 1VYSX 2PDCA 5CLTA 5FF7A 2J7DA 5LXXA 4YLWA 1T96A 1UWQA 4E4UA 1J4EA 3OLGA 1P6WA 2NV2A 3B0XA 3SUVA 4PB3A 2V8ZA 1ESWA 1SJAA 4N7QA 2C0HA 3L0GA 2A79A 1KFKA 4ZFMA 3ECQA 3SB0A 4PTDA 2CERA 2QCEA 3L65A 4UIOA 2BHZA 4W93A 7A3HA 2DFAA 3MY9A 4CNOA 3FFSA 1YKWA 2R1KA 4OIFA 5LZLA 3IV3A 7ENLA 3H4GA 1PHWA 3RIKA 4AD3A 5AOUA 4DWSB 3VKCA 2G97A 2XVGA 4QE1A 2CFFA 3B03A 4CN4A 3HJEA 3AHVA 1VBUA 1IWPA 3RF9A 3WUFA 3OO2A 3VVGA 2XVPA 5IHRA 2ISVA 1TWZA 2D0FA 2PP3A 5CXPA 2QUNA 1BYAA 4Q22A 3Q58A 1N82A 1KRMA 1VC4A 4D2JA 4ADSA 3VZZA 1XDJA 5E1QA 4IIGA 4NZCA 1LL6A 4DBEA 4DBUA 3L5LA 3H2EA 3W7DA 1UC4A 1J5SA 2BFGA 3S6DA 4QNWA 3CHVA 4B9YA 1OHLA 1NFGA 2P8BA 3AIRA 4PBEA 5KZDA 2OXNA 1UD3A 4JN6A 2NZLA 1A3HA 4NHVA 3NO1A 3A3WA 1LL7A 1UZDA 3LMZA 5IDIA 3RO6A 1FWHC 1EBGA 3F7JA 1XFCA 3C2YA 5DXXA 3CWNA 2GUUA 5D2WA 1UD5A 3A4WA 4L9YA 4M6UA 3LHZA 4HYWA 1H51A 1KB3A 1OFRA 1D3CA 3AMKA 3CASA 3TSBA 3C3NA 1E1EA 1NWRA 3WBAA 1BTCA 1WE5A 3MUIA 1K9DA 1IEWA 1MFUA 2I14A 2FZNA 1KGUA 4CQAA 3AI0A 2E1DA 3HGSA 4LUTB 2F8QA 5EPDA 5D05A 3TIMA 3W1TA 3RM9A 2Y6ZA 1J10A 3N9RA 4NZ3A 3W2UA 5FEWA 4F8XA 3CMFA 4HZMA 1FBAA 5HJLA 5I06A 5JH2A 3HIJA 3TR9A 1GJUA 1SGJA 5AZ0A 5ABEA 1LOQA 3THUA 1FWRA 1JPMA 4WF7A 3TU9A 3H26A 2XISA 5M03A 5T8GA 1W3KA 5ABFA 3MI6A 2FHFA 4Q6XA 1UROA 3E0IA 1W1A1 4HHLA 4M1BA 1R2SA 4O11A 1IHIA 2VOMA 4A2RA 1JEZA 2WC7A 1F9CA 2PDFA 3EOSA 1AQ0A 4Z2IA 1XR2A 2VRQA 1GYLA 1UR8A 1EJXC 2X0SA 3M5XA 4OBTA 3W1RA 3UJ2A 2E77A 3HN3A 1VCVA 2PUZA 4FXJA 4KGJA 4DLFA 1VEOA 4D6EA 4A3RA 4S3JA 2ZUTA 2YR1A 2EPLX 5KINA 2Y63A 4V1YA 4U28A 3F1QA 3HG4A 3V5FA 3U7BA 4TVDA 4B5TA 3ITGA 4G5DA 2G4FA 4X9YA 5BROA 3L5AA 4LCQA 5AHEA 2QMKA 3THCA 3H23A 1XYLA 3WH6A 1WOBA 3VIGA 2BHYA 1UKTA 2OU4A 3A5VA 3GHTA 3W7OA 1ZGDA 3TC6A 4Z08A 1K02A 4DI9A 1ZJAA 3S46A 2QPSA 3UYIA 5FIPA 1TPH1 4ZB2A 3NNTA 3DHDA 4JTSA 1VRXA 2BXYA 3NUKA 4I9JA 3OYXA 4LRSA 4X60A 3OQEA 3LNMA 3S8HA 5HAOA 3LS9A 1CBGA 4MHBA 4E8GA 4MWAC 3TLQA 3BQ6A 1I6NA 3WJZA 4IOTA 1BKHA 1BSLA 1UD2A 3VOHA 3OP2A 4I8DA 1U22A 4C6OA 3QFWA 4BR1A 4HU3A 5D4YA 4H6KA 3DFPA 2J79A 2WBGA 1JDEA 3ANYA 1VIWA 4NYUA 3SCTA 4AYGA 2G3MA 2Y0FA 3B9EA 3UR8A 4B5SA 3E6EA 3UJEA 3H2FA 2QDEA 3C86A 4DUWA 1UCWA 1AZ2A 1BWKA 4PSPA 1XWYA 3POCA 2WHKA 1C29A 1X1NA 3ZXWA 2E9MA 3VDCA 3FCPA 1FA2A 1SFSA 5T9BG 2DJXA 1F4AA 3N2XA 2ISFA 3F03K 4AISA 1LZOA 3DGBA 1AQHA 2FQIA 1HL8A 4Y9OA 3VNZA 2EKCA 3N9KA 4Q8TA 3TV8A 3N1AA 1RQHA 5CJNA 1XQKA 4ZE4A 3TH6A 3PZ9A 4O16A 1H63A 3PBVA 4ZXOA 2WB5A 2CPUA 1WB0A 3WNLA 5A95A 3S5SA 5C6MA 3F4DA 3O6YX 4MADA 4GI9A 2YPIA 3UXLA 3G22A 1AH3A 2E4TA 1E43A 3VNMA 1SO5A 4H8UA 2V81A 2XFFA 3WJSA 4ZOEA 5DN1A 3NPUA 3PPHA 2X7VA 5K3VA 1VZWA 4LYRA 3R4IA 4IIDA 1H11A 4LNYA 4KWWA 1LQ0A 3BG3A 2YYUA 4GMEA 3FXYA 4LCSA 3AJ7A 1SFLA 4XQ6A 5I0DA 1LRQA 1EB3A 1E6NA 2ZX6A 2V63A 4D6FA 1BSIA 3W81A 4A6GA 1E0VA 2EAWA 2ZFAA 2GDVA 3V5CA 3WX7A 2E6YA 1Q63A 3H4XA 5BU6A 2VR2A 4PTWA 3EZ4A 2R1NA 4D6JA 1M7XA 3M0IA 3SFKA 3CL8A 2QCHA 3UT0A 1BHGA 3NEHA 4X22A 5C55A 3IIXA 2EXOA 1LTDA 1YADA 2E40A 2G41A 1D7KA 1D8CA 1DIOA 3L2IA 1O5XA 2XFYA 2OR2A 1X6NA 3CAKA 3B0PA 3UXKA 1AH4A 4NF7A 4DWDA 3W88A 1J5TA 3VABA 1G5AA 4F0RA 1LG2A 4H9TA 2XH0A 3W1PA 4AFYA 1EO5A 4AAJA 4M0XA 2QCNA 3HB9A 4X2RA 1THFD 4MG4A 4Q6JA 3W37A 1RCXB 5DT7A 3DFTA 5CH9A 3U48A 2HXUA 4EWJA 3PBMA 1UH4A 5IRPA 3WH7A 3AMLA 2NT1A 4FR6A 2Y7GA 4DPQA 3QPYA 2CESA 2WOQA 3CHDA 1FHDA 3R89A 1X6LA 3P8IA 3KBNA 3QSRA 4K8HA 1EGZA 3ZM8A 2EPOA 1B57A 3M64A 1OCQA 3IJ8A 4FF5A 1NF0A 2FLIA 4XVDA 2ACRA 3OLIA 1QASA 1XBYA 3QPZA 3M07A 2Z6JA 3W01A 3HOJA 1XISA 2ASHA 3UYCA 3GO2A 1US0A 4UTLA 1RR2A 4B3LA 1QI0A 1VBRA 3PJWA 3PJUA 4DWSC 3PZIA 1I4NA 2Y88A 2QS8A 3WLRA 2C0AA 3QGKC 3QTPA 4GXWA 1A3WA 4OBRA 2WC3A 3WIJA 2WNZA 5LNRA 1BLIA 7CGTA 3ARVA 3TONA 1F5ZA 4HJWA 3MPGA 4JCMA 3KOZA 5D37A 4FIQA 1YQ2A 3TQPA 4QCEA 1W1IE 1IXQA 4FF7A 1Y7VA 2IUZA 4UFKA 2WO5A 1ADOA 1PZ1A 2V69A 1FHLA 5H8UA 4B9ZA 4BQ5A 3NPVA 4YHGA 4F2BA 1W17A 4WY0B 4LB3A 3TNBA 4CNPA 1DTUA 1I0DA 4HU4A 2QZRA 2FGZA 1ZJHA 5KSWA 3AISA 2ANUA 3KVJA 1XLIA 2V3GA 3MHUA 1T8QA 4V27A 3PBWA 3TJXA 3NIYA 3MVTA 3UXAA 1VH7A 4UFMA 1S46A 4C6IA 4C7FA 1KWGA 1PEZA 3M0YA 3E74A 3OVGA 3SW6A 4UFJA 1GOKA 2LLEA 1SYTA 3Q67A 3WDJA 1B54A 3G6LA 1H4PA 1WQ5A 4LYPA 1D8WA 4Z1DA 2ABBA 1WZKA 1NQKA 2GPTA 2P8CA 3CBWA 3UWWA 4J2PA 5REQA 2CLOA 3GR4A 2QDHA 1OX4A 3SCSA 2POTA 4TOQA 3UA4A 3DECA 2GGJA 1GVOA 2V2DA 4R9XA 1MFVA 3R5EA 4M29A 3QV6A 2YXOA 4UCFA 4RJEA 1DJHA 4KWVA 3KBVA 4FPSA 5EMJA 3GG1A 3XINA 3JVAA 3NTYA 3A3HA 3S1GA 3WUBA 3LHUA 4HZ8A 3MCOA 3GTXA 3C0JA 4WUIA 2FYMA 4CCDA 3ENLA 1FWDC 1G6CA 3TEVA 4DO4A 3VM7A 3GSMA 3GNNA 1C90A 1OT2A 4H01A 4L80A 4WRHA 4PMJA 5U4NA 4P7QA 1ADDA 3QQ0A 1KWKA 3N2OA 2CBIA 5FACA 5ECVA 3B9DA 1IEXA 1PKNA 2ZUVA 3ZT7A 3S2LA 3QGAC 3T2QA 3OGVA 1Q13A 1T40A 4M82A 2JKPA 2CIPA 1QBAA 2HVMA 1RZMA 4MYXA 5PTDA 3VILA 3LSCA 4GQBA 3TN3A 4IF2A 1FFQA 3HG3A 3VOCA 5BWFA 4FA3A 1XH2A 5AHNA 4MZYA 3U0HA 2REQA 3VCRA 1MQRA 2PLJA 4JD4A 1X39A 3EPNA 5EB8A 3MI3A 1QU4A 1X8FA 2FJKA 1GOIA 1O94A 3W25A 3CHEA 4BI6A 5C9WA 3LK6A 4DJFC 5AHIA 3EEZA 4HNUA 3M6DA 1VEPA 3D46A 3MUXA 6ALDA 4JQ4A 3RR1A 3TCSA 4AX7A 3VZYA 1XIMA 1TMHA 3MDUA 3T0BA 2DZXA 1NWTA 4IPPA 2X30A 4S3BA 4EF9A 5LNUA 2J78A 4NX0A 5IM51 4P7NA 5JQ9A 1O5KA 3WK1A 1ZLPA 1XSKA 3EX6A 2CU0A 2F61A 1JFHA 4CD4A 2XJ7A 4UTTA 3QQWA 4MPKA 3R94A 5HULA 1H5YA 2Q6ZA 1E6SM 2PDUA 2XVKA 3TQKA 3GRIA 1IV8A 1XDLA 4XAYA 2DIKA 1H0IA 3CEPA 3AXXA 2QMJA 2A3LA 2Y85A 2NSOA 2BGQA 2GWGA 3P82A 2VQTA 4JHOA 1S2WA 4JX4A 3BCFA 3GE7A 5LXEA 3HPSA 3N13A 2XZ7A 4JTUA 5CPNA 2ZZ4A 3GDBA 2OGJA 4QR6A 4LAKA 1YDNA 3P5ZA 1TPWA 1LORA 2DORA 1XLGA 4XBSA 3T6CA 4GXMA 4TMCA 1OFEA 3NO3A 1DXIA 5FF4A 3LI1A 3N04A 4A4AA 3S9YA 4A29A 1XINA 1KRAC 2YCKX 3HA1A 1F3XA 2NWSA 3VIPA 2YBTA 2OPJA 3WH5A 3MCMA 1KXTA 4ACZB 4OV9A 3EWDA 4IZGA 4UOZA 2ZXBA 1ZFJA 3OIHA 2WQDA 1A5LC 4HHHA 1TR1A 4GXPA 2ZUUA 1NOWA 2OLSA 3W85A 4D8AA 3W1UA 5FAGA 3MC5A 3P7YA 2NVAA 1XKJA 5GNYA 4TV5A 2E8ZA 3DEQA 3K5XA 4ZOCA 4L1WA 2UZ9A 5K4XA 1LOLA 4QDMA 1P0EA 1VGAA 2EJ1A 1WDSA 3PBYA 3RILA 2WWDA 4HPGA 3VIHA 2J4GA 4RE2A 4FZIA 2C91A 3H4WA 1KBIA 1V6VA 4TIMA 2R8WA 1RBAA 2PS2A 3N2BA 3VCNA 4IT1A 2YBUA 2Q3OA 1D3GA 1Q7MA 4WKAA 3DESA 2EPHA 2A3AA 1JUKA 4US5D 1F74A 2PZ0A 3EA3A 3M41A 4LF2A 3ANUA 1TV4A 1YBQA 4OHQA 2WVTA 4CQCA 3U2ZA 5EA9A 2ZRXA 1XLHA 1KBLA 4XBKA 3AO0A 1RA0A 1Y5VA 5A8PA 2BP1A 3WDPP 4HU0A 1VFLA 3TKFA 3GDTA 3ISIX 1M03A 4PCNA 1ZAIA 4YMZA 1Q65A 4PEKA 1KFLA 4HSNA 4HYVA 1S38A 3GH4A 4FOKA 2E67A 1FWIC 2ZOXA 5I6SA 4P8UA 4I7VA 4FXRA 3W74A 5JMUA 1QO5A 4NZ1A 5I3GA 1G67A 3G1HA 1E3XA 1B9ZA 4TX6A 5IFTA 3UY8A 1UP2A 4C7GA 1A5OC 4QDWA 1ZCCA 2PGRA 4I90A 2C7FA 3WQEA 3GC4A 3R13A 1HW6A 2J66A 2HPIA 4GZ7A 3MP4A 3GTFA 1A3XA 1HVXA 2VX4A 3G1AA 3GUGA 4GX8A 1EGMA 4QTGA 1UYQA 5A6AA 4DXVA 2I7GA 3WDQA 1NDVA 4CD8A 1M7OA 1Z69A 4GC3A 1OCNA 1TTQA 3U9IA 1R7AA 1C9WA 3W02A 1V6UA 4K6AA 2BB0A 3ZVIA 1M04A 2PGWA 3MB9A 4HCHA 1E6QM 4JYDA 2VCCA 1WCGA 3VNKA 4XD5A 3NQVA 3V1HA 3SUWA 1A5AA 2ZTKA 2NW0A 3EKZA 1QHOA 3IVUA 1N8WA 1XG4A 3O6DA 8CGTA 1M3UA 4G7FA 4UQ9A 5BXPA 4RZ5A 4LEQA 2D2OA 3SECA 1OVDA 1JGMA 1ZZMA 1A0CA 3CZ8A 3LPFA 4KF1A 3GIQA 4GY0A 4WKHA 4IH3A 2YLLA 2GK1B 3RJYA 4L6OA 3UWVA 1LT8A 5F1UA 4LX4A 3G8EA 1L0PA 4L9ZA 1RPKA 3QR1A 3WNOA 4I7UA 4GVGA 1WKEA 1XLBA 1HJQA 1WXZA 1PWMA 3VOIA 1W8GA 1KKRA 1TQXA 4Q4PA 4IQEA 4AF0B 2V3DA 2WVSA 3CUIA 5CPTA 1A80A 1K7EA 1A5KC 4REQA 4ZSTA 1SSGA 1XX1A 2ZX7A 3AHYA 2A3EA 1C7TA 1PS9A 3FY1A 5L9FA 4YVVA 5E9AA 4OKDA 4L61A 4DAIA 3OTRA 1J0YA 1S39A 3C61A 1KTCA 5F2MA 3VUPA 4F3HA 4JY8A 1H61A 2CLHA 1XIGA 4LU0A 4AIBA 6ENLA 4MKVA 1GZGA 1Y5WA 4M81A 1WDRA 4Q8PA 1CGTA 2R24A 2VVNA 3UZZA 2OOGA 3KE0A 2P0IA 4ZOBA 2QJNA 3MUY1 4EAMA 2E5CA 3DENA 2B7OA 3SGZA 4H6QA 3NQGA 3FHQA 1AD1A 2VD9A 2Z6IA 1R3YA 1TFVA 3TZFA 3M44A 4DELA 1TWIA 4FR1A 1MQQA 1V6YA 5CBIA 1MZRA 4E2OA 4E3VA 1OX5A 4LUJA 1AJ0A 1QNSA 4PFMA 1A5CA 1WDDA 4BQ4A 3MKVA 1DJWA 3VYLA 3TFCA 1L6YA 3LCIA 5DX7A 1DIKA 3C8FA 3PZMA 1AW1A 4KRZA 1GK8A 2J74A 1KR0A 3TW9A 1XLJA 4QG9A 2XIBA 5G2IA 4JS3A 3QBUA 3FIGA 2YDSA 2IMRA 3CK5A 3KRSA 2NX1A 3DHUA 3BCDA 3BZGA 4FI4A 1OK4A 1FDZA 5LIUX 3NDYA 4JNMA 3B0UX 1I2PA 4ATWA 3KS6A 3M9YA 3O6AA 3VDBA 3IGHX 1WKFA 4C6DA 4FHAA 4O1DA 3IARA 1XL9A 4RLIA 3LV5A 1KLZA 2DDXA 1SR0A 2GQAA 4E6MA 2XUCA 2ZRYA 3RXZA 4GYKA 4AHPA 5IXEA 1M1BA 3GS6A 1G7VA 4E4PA 3DC0A 3GHRA 3W7EA 4R33A 4D9PA 2XZ9A 1OWQA 5KTLA 2NQLA 1FQ0A 5A6TC 3NVDA 1GWJA 1K7XA 2ZUMA 1JDFA 1ISWA 2W5FA 3NQ7A 3FV9A 4YTUA 3CAWA 6PTDA 2J75A 5XIMA 3DKLA 1AW2A 1XYFA 3MO4A 1MW0A 2D3NA 4YNGA 5G1TA 2OSWA 1PDYA