1KFJA

Crystal structure of wild-type tryptophan synthase complexed with l-serine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
267
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title On the role of alphaThr183 in the allosteric regulation and catalytic mechanism of tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 98
structure length 253
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1kfjA00
4XUGA 3NO5A 2RHGA 3T44A 5D37A 5I3IA 4Q32A 4Z0JA 4OQVA 4K38A 3LHYA 1ADOA 1OJXA 3TAOA 2VFFA 2QF7A 2WV8A 4PCFA 1WOAA 1RVGA 4S2BA 3NPWA 1I45A 2CLFA 4JYFA 2ISWA 2Y88A 3CWOX 2ZRWA 1WA3A 4CLMA 4JDYA 1JRCA 3IEBA 3W2NA 2X1TA 4JX6A 1VGAA 3CHVA 4NX5A 1XBZA 3G1YA 1PL9A 4M6VA 1YXYA 5LNSA 3QPYA 4IPIA 1GYNA 3MJYA 2Y89A 4LVAA 1UBSA 3LI1A 2DZSA 1NSJA 1TMHA 4NJIA 3HO8A 3WJSA 3GNNA 5LSMA 2TMDA 4E0CA 2FPVA 3TA6A 4JDBA 5EA9A 1FWWA 2B4GA 2TRSA 4TX9A 4O12A 1O5XA 2NUWA 1LOSA 4RR4A 3FKKA 1KM0A 4I9AA 3B03A 4UMBA 4JEQA 1T0OA 5J5RA 2YGYA 3LTPA 3BLEA 3EXRA 3TH6A 1KTBA 5FF4A 2PE4A 3LXAA 4UFMA 3P61A 1R2TA 4MY9A 2YPIA 2DZVA 4HSOA 3QRHA 1O95A 1SZNA 3O16A 4OWGA 3KFTA 1ZAIA 2FLIA 4M7TA 2VFEA 3C6CA 3PY2A 3UWYA 1MZHA 3BK0A 2EHHA 1ONRA 1KM5A 3PF3A 3S5OA 1SZFA 4IWWA 3MP4A 4IQLA 3NQ8A 3TU9A 3PUOA 5K4XA 3TXZA 4AWTA 1GVSA 4YLWA 3G1FA 3LTYA 3OIXA 4JIQA 2VFDA 4ADSA 2QCDA 3O15A 1WBJA 4OV9A 1W5NA 4JTFA 2ZQ0A 1QR7A 1G4PA 2V2CA 1JUEA 1FDJA 3TSDA 5C55A 3DGRA 4PH6A 5LGZA 4R53A 3S5YA 2JGYA 3H53A 1AG1O 4Q4KA 1UUOA 5T26A 3G1SA 3KXQA 2R8WA 1EP1A 4M7SA 5L9FA 3KOFA 4XKYB 2RH9A 3QW4B 3S8HA 2OCZA 5MHBA 4MZ1A 3ZWSA 3UXDA 1OX5A 4AHPA 4IXXA 2Q3RA 4RZ6A 2GQAA 4CQ8A 5IBXC 4AVFA 4K36A 3ATYA 4LRTA 1ZFJA 2WQPA 1KLZA 3O07A 4NJJA 5HULA 3W2KA 1QWGA 3U2OA 3EWXA 1OX6A 1FWRA 2QJGA 5FF2A 4HPXA 4MLRA 4BK9A 4CCEA 3I65A 3BLFA 3IIZA 3T7VA 1T99A 3GVGA 3F4NA 1LOQA 2NV2A 3W7PA 3WK1A 5AYZA 3HF3A 3U6WA 3CIXA 4MLJA 1GVOA 5KZDA 2J6XA 1T8XA 5I3GA 1H7XA 1Y0EA 3LHVA 3GR7A 3QYQA 4UFHA 1JCMP 1G4EA 1VQTA 1FWSA 3TNOA 1WV2A 1O60A 3NL2A 4WY0B 4GE8A 4NX0A 4K8HA 3UNDA 1P0NA 5HNRA 5BMWA 3CB8A 1VZWA 1W56A 1UASA 4MKNA 3W6YA 5CKSA 4IMGA 3NL5A 4ZQNA 3IVSA 2BXVA 1VHCA 4EF9A 3Q58A 3QJAA 4YL2A 5C6MA 3FS2A 4P61A 3NQMA 3D0CA 1DBTA 4UR8A 3W1XA 1D3GA 4ZQPA 1XM3A 4XBKA 2ZRUA 1SO4A 3W7KA 5SWUA 3P74A 1E51A 1LRQA 4ORIA 2ISSA 4YCOA 1UB3A 1YDOA 4UTWC 1GWJA 2DORA 1LBFA 4MUZA 4MZYA 4H4IA 4LVFA 4N9BA 3E12A 1CX9A 4N6EA 1V7YA 1KA9F 1NEYA 1OF8A 1VC4A 5F1UA 2DJXA 2WOQA 3HQ1A 1R46A 3P84A 3GDLA 2E6YA 1W5MA 4IMFA 1W5QA 4NNAA 5ABTA 3UPWA 2WNZA 2RDTA 3E9AA 3L0GA 1L6WA 2I14A 2XN1A 3PWAA 4RK8A 3HMJG 4XKYA 1JUKA 2ZZ2A 3G1HA 2Y85A 5KITA 1FDZA 2TPSA 2GOUA 2C1HA 1AW1A 1ICPA 5DBUA 2NWRA 1DVJA 1WOBA 4DPQA 2B7PA 3UWWA 2BTMA 3KVKA 4NUWA 4O17A 4I7WA 5HR7A 5FI8A 3GLCA 2A4AA 3PG8A 5AN7A 4LOCA 2HS6A 2X1UA 3LRLA 3QSTA 3P80A 4K8EA 1GVFA 2X30A 3W7LA 4JYDA 1M7PA 1QOQA 5D2XA 4UC5A 2NUXA 5DXXA 3MHUA 1HTIA 1ZAHA 4N9CA 3WJWA 4MYAA 2EPHA 4N9DA 1IGSA 1X8FA 3THAA 4WY0A 4HSNA 3M43A 3R2GA 4MPQA 1YTKA 1W5OA 2IQTA 3UYCA 2YFOA 3LM7A 3W07A 2EGZA 3QQ1A 1AL8A 3WK2A 4ZQRA 4ZL1A 3W7GA 2NWSA 2X1RA 1J4EA 4GJ1A 1C29A 3N2MA 3HPZA 1DL3A 4KKXA 4A22A 3NOEA 4PL2A 3GXTA 4NZJA 1HL2A 4WJEA 1X1ZA 3RK8A 5K3VA 4FHAA 4O4WA 1LORA 3OVRA 3S6DA 4EIVA 2VEKA 4N4QA 3OBKA 1C9DA 4JTEA 2NX9A 5F2MA 4FNPA 1B4EA 3DFTA 1VJIA 1ZNNA 1N7KA 4NNBA 4Y8FA 2FIQA 1NF0A 3N9SA 1LLWA 4ICNA 4NJHA 1BKSA 3LBCA 3S1XA 4YMZA 3I7QA 4LWWA 2ZBTA 1YADA 2DP3A 3C2OA 4MJMA 3C8FA 1XL9A 1TPWA 4XQ6A 3ABOA 5AHMA 3ABSA 1DJNA 3MBDA 3R12A 1H62A 3G3MA 5G2HA 4UTUA 3M1ZA 4UTTA 3W72A 3L21A 3W1QA 3RNDA 1FUYA 2BSLA 2V82A 3TW7A 1AW2A 3IIXA 4BI7A 2FPYA 2FPTA 1KTCA 3W2JA 3DFPA 1GTEA 5TBOA 4UFLA 5EY5A 2ZTJA 3DFSA 1XDLA 3BPWA 1C8VA 1L9WA 3GKFA 1XI3A 1FDYA 4DO5A 4POCA 3GDTA 1V5XA 5DBTA 5K7JA 4FNUA 1KFKA 1OFAA 2CW6A 3KHJA 2FDSA 4JTJA 4O1BA 1K02A 3STCA 2LLEA 4JD4A 2Z0IA 3QZEA 1XC4A 1K7XA 1EB3A 2V8ZA 1CW2A 1F76A 3IGUA 2Y61A 3B0VC 3LDVA 2VENA 5G2WA 1IXQA 1EP3A 1ZJIA 3W22A 3QPZA 4UTHA 1K7FA 2Z6IA 4AWSA 4JY8A 2F84A 3N73A 3G18A 5D2YA 4JTKA 1KM6A 1O94A 4I7VA 4WX2A 2NV1A 1P0KA 1OK6A 3M5XA 5CZ0A 2I9EA 1H1ZA 2J88A 2A7PA 2E5DA 3M9YA 1QOPA 4LS2A 4LT9A 3IIOA 2H90A 3G0SA 2E1DA 1F7BA 3QEZA 4DXVA 3JR2A 3W85A 4O52A 1QCWA 4WQ6A 5TIMA 1B3OA 1HO4A 4FX7A 4BWLA 1Q3NA 4UTJA 5I3FA 4Q33A 3A23A 3NYZA 2DZPA 4AB4A 4LVDA 2ABAA 3DENA 2JBMA 1BEUA 2VOMA 5C2XA 3A5FA 4LV4A 4OGZA 1OFDA 3G3DA 3S1UA 4UTLA 4FX8A 4O0KA 1VLIA 1TTQA 3EWUA 2I1OA 3HGSA 4NXSA 4DBDA 2ZTKA 4J9JA 4JR5A 1K8ZA 1X7FA 1Z48A 2QCCA 4Y96A 1KFLA 1OFRA 3LLFA 1HG3A 3NQCA 1AMKA 4O53A 4OHQA 4K39A 5EBUA 1TRDA 3M41A 4CQAA 4ZVJA 1XBVA 2QCFA 1XBXA 1F6KA 2JK2A 5D2TA 1JCYA 5D32A 5KSWA 2AQWA 3G1XA 4LUJA 1P1XA 4DEFA 1VR6A 3MP5A 3G1AA 5FF3A 5BRBA 1LTDA 3L0NA 2YR1A 3LCFA 3NXFA 2GPTA 3FIGA 4N6FA 1F2JA 3RLUA 3W88A 4UR7A 3W7OA 2WSYA 5D38A 4FIQA 1Z44A 3DZ1A 3LCHA 2W6RA 3OG3A 2RKXA 1B4KA 3ZS4A 1YLVA 1JCLA 3ZWTA 5K4ZA 3HG3A 3LX9A 3LV5A 3DKLA 4AHOA 1GZGA 3PC0A 1LBLA 1G4TA 1TV8A 4GUIA 1TPVA 1LDCA 3CWNA 1TYGA 1ICSA 4RX0A 2YFNA 2DJLA 2P1FA 4GUGA 4I7UA 3C2FA 4CNNA 1ML1A 1PE1A 2OMAA 1T96A 3GXNA 1I2NA 5FF7A 2V5BA 1ZALA 3W84A 2QUTA 4X9SA 2RDWA 4GUJA 1Q45A 4TO8A 3UWVA 4N4PA 1KLYA 2ALDA 2UV8G 1NFBA 3IGXA 1WX0A 3TC7A 1TREA 2QJHA 3EWZA 3W7QA 1KFJA 1LRNA 3S0CA 1SFJA 1F73A 1VS1A 4NQ1A 1W8SA 3IIVA 2V0TA 2XN2A 1DQXA 2J24A 1PHQA 1SPQA 4FNRA 2A1YA 1H60A 4DBEA 4ORMA 3GDKA 5G4WA 1FQ0A 1DV7A 3TAKA 2HMCA 4DF2A 3T4CA 2E6FA 4IGHA 5LNRA 1KM3A 1JVNA 3W2LA 3DI0A 3LLDA 2WSQA 1PS9A 3M5ZA 4RJEA 5LGXA 4WD0A 4AWUA 1K8XA 3TROA 4EF8A 3TSMA 4MY1A 4AEOA 3EKZA 5KZMA 3TK7A 3LHZA 5FESA 3BARA 3INPA 4O13A 1RR2A 4IMEA 5F2LA 4UIOA 1R2SA 1R30A 4M5PA 1SFLA 3PB0A 5AFDA 2VC6A 5F2IA 2QEZA 1B9BA 3W7RA 2PRMA 3ZFHA 2VXNA 4O8RA 4TMBA 1WXJA 1J2WA 1H61A 4UFIA 2HTMA 4JXCA 1MSSA 3JRKA 1UUMA 5CG7A 4MOZA 1BTMA 2FB2A 5D30A 1Z42A 3LI0A 3FJLA 3FA5A 4Z0SA 4DO6A 5CPLA 1TPUA 3EXSA 4TIMA 1X6UA 4MJZA 2DZWA 3NQAA 5HR6A 3KVJA 4HNTA 3PR2A 4MYXA 2YW3A 4ZQOA 3P67A 4JTGA 4RZ4A 6TIMA 3M6YA 2J9XA 1DOSA 1LM1A 4A29A 1P5BA 3SY5A 3BW3A 3DH7A 1I8JA 3EX1A 1ME7A 3HG5A 2JKAA 2QR6A 1W1ZA 3TQ0A 4M19A 3BV4A 4YXGA 4Y6GA 3EX6A 3B06A 2E5BA 5BMXA 3G8EA 5L6UA 1XUUA 4MFDA 1OYAA 5E0KA 4AXKA 3P5YA 3EWWA 1OX4B 2WJZA 3IV3A 3IRDA 3TE9A 4OU1A 4AF0B 1EWDA 3RFAA 4BF9A 3VKJA 4JNMA 3CEUA 3M16A 1RV8A 3BVJA 4DQWA 2FQIA 1QPNA 2E6DA 3MHGA 4Z1CA 1EA0A 5K9DA 3PBYA 2NUYA 4X22A 3NQDA 3G0UA 1JULA 1H7PA 1WQ5A 2P10A 3UQNA 3B0UX 1QDSA 3CQ0A 1Q6OA 1I2OA 3T55A 1TPH1 3M44A 3VE9A 2VKZG 4O15A 2CLLA 4A3UA 1JCXA 3NQFA 5CZSA 2FTPA 1L2UA 2NXHA 1A5BA 3MI2A 4KFOA 1SW3A 1QO5A 1UCWA 3ABRA 5K9XA 4AH7A 4XWUA 2ATSA 5DY2A 4Z1DA 4QM1A 1JUBA 1M5WA 4DF0A 3OVPA 3W70A 4GC4A 3HPXA 4JX4A 4UTIA 3IVUA 2A0NA 3N3MA 1SSDA 1XDMA 4FIRA 4UTKA 5G1TA 3TC6A 3NAVA 1TTJA 3W1PA 1EIXA 4OV4A 3USBA 2ZRVA 1OHLA 3PVFA 5D09A 4TU1A 3NVTA 1VCFA 3FEMA 5HJLA 2R14A 2V2HA 1OFQA 1WDWA 2TYSA 2QCLA 3M47A 5G1YA 1YTDA 4QIUA 3C2EA 3FYOA 1PCKA 1VYSX 4JICA 3VI2A 2R94A 5G4EA 4L4MA 3NQVA 3W7EA 2A21A 5K9CA 1EP2A 5AHFA 4JTIA 3UXAA 1K03A 4FNTA 1ME8A 2CZEA 3HIJA 3EX3A 1IXNA 1RZMA 3JS3A 1TPFA 2C19A 4CQ9A 3SW6A 3A5VA 4LTSA 3QSRA 2E5CA 1RQHA 3O6YX 1ICQA 3QMRA 3N9RA 2YZRA 1K8YA 1RQEA 4K6AA 4E2DA 1W54A 3F4WA 1OX4A 4RLIA 2QKFA 4ALDA 3W7DA 3P81A 1VYPX 4FX6M 2H3BA 3GAKA 2YDAA 4LVBA 4AF0A 2W79A 5I3HA 1F05A 3SFKA 3PBUA 3NM3A 2Y70A 3ANYA 3M7WA 3W1NA 4LV9A 4GUFA 3LBMA 1SW7A 3A22A 1GG0A 1TJRA 1OFEA 4A2SA 1ZAJA 3P82A 1DORA 3LTSA 1LZOA 4PFMA 3W7MA 1EUNA 5FEXA 5CZTA 1WYIA 2YYUA 3NPXA 3WJYA 1G69A 3BLIA 3SR7A 4PODA 3W7HA 1TPB1 3T40A 4HN4A 4O14A 1I2RA 1W3NA 4BFAA 2F7FA 3SZ8A 3PBVA 3NQ6A 4PL1A 1TJPA 4PTNA 1G67A 3UPBA 2YYTA 2H3DA 1F5ZA 3UY8A 1KM2A 2BWGA 3NQ2A 3TJXA 4DO4A 2VELA 1S5VA 4Y9AA 2ZZ3A 1OG0A 3NZ1A 1R47A 4O18A 1TTIA 1ALDA 3HPSA 2DZUA 3TIMA 4XTDA 4IXHA 2EAWA 4O54A 5A8GA 2C13A 2ZA1A 4EVZA 7TIMA 1EEPA 2J9YA 1JR1A 2ISVA 2PRHA 2E68A 5G2IA 1KBJA 3W9ZA 3RU6A 1NVMA 4M6PA 2C18A 1IXOA 2A7RA 1TQJA 2NX1A 1TPC1 3PG9A 3K30A 2Q3OA 2QDHA 4BI6A 1DHPA 4QNEA 5AHLA 1SZGA 5A5WA 1H7OA 1TV7A 2V30A 4QJ1A 4DELA 5D02A 1OK4A 1GG1A 4QISA 4A2RA 1YYAA 1LLZA 2Z1BA 5G5IA 5F4SA 3L2IA 3HBLA 4CNPA 1F6PA 1I2PA 3STEA 3CEPA 1JQXA 1OVDA 2D73A 4KFPA 1TPEA 2RDUA 2O7SA 3ABQA 1KBIA 3HG4A 4JS3A 1OFOA 3UY7A 4R7JA 4O50A 2QDGA 3FKRA 3KRSA 1Q6LA 3BG9A 2HSAA 5AHIA 1GVQA 2AGKA 4O1CA 3A21A 4M6QA 3KRUA 1GOXA 3V75A 3VNDA 3NGJA 3SGZA 3E0IA 3SI9A 2NXGA 1EX5A 1F74A 3GR8A 2GQ9A 2VEIA 2H6RA 3I7RA 2OX1A 1H51A 3H54A 3RLVA 3VFLA 2OT0A 4ZQMA 1TV5A 2FJKA 3NM1A 3LCGA 1I4NA 1BWLA 4FF7A 1YXCA 4KFNA 1KW1A 3B0PA 2VFGA 3I7SA 4HNVA 1S5TA 3KVLA 4UNLA 3DAQA 3LHTA 3KVMA 2V81A 3LCWA 3MW7A 4K7YA 5AOUA 4GFSA 3TMLA 3GYEA 1VLWA 2ZYFA 3PULA 3TJLA 1AL7A 2QCHA 3OEXA 3TMQA 2XFWA 3LXBA 4LS0A 3MP3A 3P8IA 1XBYA 1SO6A 2ZZ7A 4NJGA 2YCEA 4O11A 2NXIA 3SJ3A 3BG5A 1D9EA 3P5ZA 1NAL1 1GVRA 4Z1BA 1G7VA 3THQA 3EX4A 1GQNA 3LRMA 2A85A 2H8ZA 4O0ZA 4BR1A 5KINA 2WO5A 1LBMA 4PC8A 2PC4A 4GUHA 2QUVA 4PEKA 5HMSA 5J5DA 3BO9A 2YXGA 3O6CA 3S5NA 1O5KA 5E1QA 3WK3A 3LOTA 2ZZ1A 1HFBA 3W23A 1KM1A 4O57A 2JKPA 5C54A 3W83A 3SGUA 1FX6A 5EKYA 4UTTC 4XZ9A 5EYWA 2PCQA 5HUOA 4MVAA 1L6YA 4JN6A 5LHEA 2WNQA 4H6KA 2Y6ZA 1FXPA 3R5EA 3CPRA 3KX6A 3QMTA 1AK5A 2X16A 3W76A 2C3ZA 3Q37A 3C52A 2GQ8A 1P4CA 3L9CA 2QUUA 3HG2A 2WPBA 1SSGA 3F1QA 3MI3A 3MWAA 3C2RA 3WJXA 1XUZA 2C0AA 4LNYA 5HWMA 5KZEA 3LHUA 3G1VA 2E09A 2CLHA 3CT7A 3NG3A 3W87A 1SQ7A 2HS8A 2OJPA 4UNKA 3TFXA 3CM4A 4X2RA 1MEHA 4GRSA 5F2GA 3LRKA 5AC7A 4RXFA 2A7NA 3W1MA 5AB3A 4O1DA 2CLIA 5AHNA 2JGQA 2FFCA 1TB3A 1WAUA 1UJPA 3S1VA 1FCVA 2GVJA 2J27A 4IPJA 3W1RA 1L6SA 3OHIA 2OT1A 1JCNA 5D03A 3A9IA 2OZ0A 3OA3A 3TUUA 1ZENA 3PM6A 4ADTA 2ZZ5A 1H5YA 1KFCA 1FWTA 4S1FA 3FYPA 4HNNA 1Q6QA 3RMJA 2X1SA 4YWIA 1FY6A 1O4UA 3W71A 2CLKA 5EPDA 3PS7A 1DJQA 2YSWA 3M0ZA 1TCDA 4BWLC 3TXVA 2ZZ6A 1VCVA 2C16A 3PB2A 4NU7A 1H63A 1S3HA 3LB0A 5F4XA 3CTLA 3QW3A 3EWYA 2ZRZA 4JY9A 5EL1A 2ZRYA 1QPRA 3VE7A 4FEZA 3C0JA 1PVNA 3L67A 2QCEA 1GYLA 4K7VA 4HPJA 1GTHA 3L5LA 5C5YA 1EPXA 2BZNA 3EEGA 3E02A 2QCMA 1U5JA 2CLEA 1GPWA 2CLOA 4ZZ9A 1Q6RA 4RCXA 3O05A 2B0MA 1RQBA 4Z08A 3SECA 1YDVA 2Y62A 4HIBA 5TQLA 3NDOA 2RFGA 3FFSA 3GAYA 1A50A 5AHEA 3STGA 4G1KA 5AC6A 1A5CA 4IX0A 4E2BA 1QPQA 1K7EA 2R91A 3IVTA 2W0UA 4HHPA 4CCDA 4HNUA 3GDMA 4JYEA 1LYXA 4OBTA 3UD6A 1KV8A 1ZHAA 5IBXA 2DU2A 3TKFA 5LNWA 4UMAA 5CZJA 3QFEA 3VCRA 2EKCA 2P0OA 2Y7GA 2DZTA 1H7NA 3LCIA 3LCLA 1U83A 3C61A 4ML9A 1ME9A 3Q94A 4MFEA 3UWZA 4MY8A 3G8RA 4ADUA 2CWNA 1GT8A 5D05A 4CNOA 4UFKA 3HGOA 3DHDA 5AC8A 4JTLA 3GNDA 3W2UA 1H1YA 3AO0A 4IUOA 4JIPA 2NX3A 4NJKA 4EOUA 1W37A 3GDRA 4N02A 2WSRA 1WBHA 3GZ3A 3R89A 5DCDA 4ZMGA 4U4MA 1SW0A 1JRBA 3EXTA 2FB3A 4N9EA 1VRDA 4LRSA 2V2DA 3BGJA 1QNVA 3TSBA 3Q2DA 1TTPA 1FXQA 3GB6A 1X1OA 3L66A 1OFPA 4IMCA 2Z6JA 8TIMA 1PIIA 4UTWA 1MEIA 4CCCA 1QPOA 2A5HA 3TQKA 2DZXA 1HO1A 2G97A 4W9TA 3B04A 3RF9A 3P60A 5CPOA 5CSRA 4IJBA 3NQGA 3C2VA 4WOQA 1XXXA 1LROA 5D33A 1QO2A 1G7UA 1W3TA 2CU0A 3NQ7A 4RV8A 3BW2A 3LGEA 4WOZA 1YPFA 3IGSA 3QF0A 3QQ0A 1SU5A 2QJIA 1Z41A 1XKYA 3SSJA 1PCWA 2EF9A 1EWEA 1IIHA 1GJPA 3UWQA 4NZFA 1W3IA 2JKEA 4TMCA 4AAJA 4GNJA 4WXYA 3TDFA 3W7CA 2XN0A 5U4NA 4QNWA 1J5TA 3S5ZA 5DLCA 5DY3A 3UZ5A 3GIYA 4LUIA 3WFAA 4MZ8A 3GXPA 2NZLA 2GVLA 3N14A 1FCQA 3QH2A 3A24A 3L5MA 1OYBA 3L0KA 4NNCA 4DF1A 4LS1A 1YPIA 2E6AA 3HB9A 5HQEA 4YCPA 3DXIA 3NZRA 1FBAA 1HUVA 3TW6A 2GVGA 1SR9A 4LC6A 3PBWA 3LERA 3TR2A 3UWUA 3QC3A 1VPXA 5KMYA 2QCNA 2A6LA 1BWKA 2VFHA 2QCGA 5CSSA 4B5NA 4NVTA 3ATZA 3I68A 1AW5A 3HGJA 4GBUA 5EMUA 2QAPA 3CU2A 2ATMA 3NR0A 4QQ3A 3NEVA 4FNQA 4LW7A 5GVJA 4DPPA 1NF7A 1LCOA 1TQXA 1H50A 4R33A 2TSYA 2H8XA 3PSWA 1VCGA 3T78A 5D2VA 3NPUA 5DN1A 5E93A 1LRTA 3G0XA 4QITA 4S2CA 3MBFA 1OF6A 4KWVA 1K3UA 2Y63A 3W74A 6ALDA 4RZ5A 1ZY9A 3PUDA 4NXKA 1YXDA 3C3NA 3EB2A 3NPVA 1RD5A 3R13A 1KV5A 1SZEA 4GWEA 3GKAA 3QM3A 5HWJA 2CZDA 3MMTA 3HGRA 3QMSA 5K2ZA 3LCXA 3C56A 5HUPA 2BLEA 4A21A 1SO3A 3W75A 4JTTA 1N8FA 3P7YA 5I3KA 2ZA3A 2KZHA 4IX2A 2E77A 4TR9A 4LY8A 1KTNA 3NNTA 4IMDA 4C1LA 3MYPA 1JJKA 3W1AA 3L65A 2QAFA 1A5AA 1W0MA 1ZCOA 3LXCA 5LKYA 3M5YA 2Q8LA 4LU0A 2C15A 1VYRA 2CZFA 3DHFA 3OVQA 3B4UA 5LNVA 3B05A 5D2WA 4FNSA 3P62A 3DFNA 4X3ZA 4UUIA 3S9YA 2Y7EA 5CPNA 4NT0A 5F4WA 2B7NA 3B8DA 2ABBA 2A2IA 2PURA 4RKAA 4FB7A 2B7QA 1FCUA 4UXDA 1RPXA 1LP6A 4O10A 5AYYA 2V5LA 3L68A 1XFBA 1JQVA 1PHWA 3S42A 2ZCGA 2C6QA 3MHFA 2WKJA 1TRIA 4AMAA 4OE7A 2YW4A 5CGQA 4EWND 3W7NA 5BOOA 3KAOA 2CZ5A 1XCFA 2C14A 4XBSA 3F03K 4Y90A 3HJZA 1TSIA 3MYOA 1G4SA 2GJLA 1YDNA 1FWNA 3FOKA 3TX9A 3U8GA 1TPDA 3KRZA 3V1PA 4IOTA 5IM51 3IIPA 3P8JA 4FXRA 5U7SA 3UZJA 4AHQA 1OYCA 2Y7DA 1KFBA 1KFEA 3W1TA 4Z1AA 3CLMA 4UFJA 4C1KA 3R8RA 4WXZA 1IXPA 3CC1A 1MEWA 4ZQCA 4LVGA 3EX2A 2CFFA 2B7OA 2Y7FA 4LC8A 2CLMA 4E38A 1JCJA 1H7RA 1VH7A 1QMLA 3BW4A 3N34A 5KTLA 4BI5A 3TV8A 1H7WA 2G95A 4QAIA 3W1UA 3O6DA 4N2YA 3G22A 1TO3A 1G6CA 2ZRXA 3MI6A 3H55A 1KM4A 2G96A 3O8AA 1W31A 1VHNA 1M6JA 4U28A 3O06A 1A5SA 3L5AA 5FF0A 3MO7A 1S5WA 5LHFA 1N55A 5HWNA 1CI1A 3N2XA 4K37A 3G1DA 3DU0A 3ZR4A 5DELA 5DCEA 2X2GA 2YX0A 1IIGA 4FO4A 3MUXA 5BNKA 1D3HA 2BX7A 2GJNA 3C4UA 2ZDRA 2PRLA 1MXSA 3ELFA 5FEZA 2ZFAA 3M5VA 1PV8A 3WK0A 3E49A 4ONVA 5HINA 4D2JA 2WNNA 1I2QA 3YPIA 4O16A 4L4LA 3GK0A 4UCGA 4JX5A 1OFBA 3TFCA 3PUEA 3W7IA 5LNUA 3NL6A 5LZLA 3W86A 3W2MA 3WJZA 3EWBX 4O1AA 3O63A 5F1VA 4JTSA 4UTMA 3SIZA 5BW6A 3BG3A 3EKLA 3W3OA 4FXSA 3W1LA 4PA8A 3NL3A 1SO5A 2O7QA 4JGDA 2VEMA 3DKJA 5FEWA 1OABA 1R2RA 3DBPA 3I6RA 5DCBA 4OT7A 3W73A 2AAMA 3NQEA 3AJXA 3LV6A 2Q8ZA 3FJ6A 4JTHA 1DKWA 2ZA2A 3S1WA 3DI1A 4UMCA 5AYXA 3O1NA 4HT3A 2NLIA 3E96A 1QFEA 1FCBA 5FEPA 1W5PA 3PSVA 3N19B 2VFIA 4XTIA 5CPMA 3GX9A 1LOLA 3G24A 3CIWA 4WZHA 4QSHA 5H91A 3TCEA 1IF2A 3HOJA 4R34A 2ZZ4A 3NA8A 1A53A 3STFA 2A6NA 3BGGA 4KWWA 4HKPA 1EUAA 1YTEA 4WUIA 3LHWA 1M7OA 2G5WA 1GEQA 4H3DA 4MIMA 4JTUA 1TIMA 3TQVA 1SUXA 4O19A 2J9ZA 3FLUA 2V9DA 3DFQA 4P2VA 4WY0F 1THFD 3W7JA 5H2ZA 3PAJA 1B57A 2Z2UA 5DXYA 4RXGA 2GUUA 5I3JA 4O28A 1MO0A 4GXMA 4O4VA 3DFOA 1DQWA 1QAPA 2VEPA 5D04C 2QCDB
chains in the Genus database with same CATH superfamily
1DJHA 3WYZA 5CC3A 1S5NA 3NEHA 1IEVA 3KTSA 4NAEA 5A3HA 3DX5A 2GSEA 5ABFB 4J4KA 4EXQA 1WOAA 1RVGA 5G4HC 4S2BA 3I10A 4I9MA 1NH6A 1U1JA 1DWGM 2PGWA 2ISWA 4RV3A 1RXOB 1EDTA 1EEXA 2ZRWA 1UW9A 4CLMA 2IKJA 4WF7A 3H8AA 3BAXA 4CNSA 1VGAA 3CHVA 1XBZA 3QHOA 9RUBA 5EGRA 3LPGA 1GYNA 4LVAA 3EBVA 1UBSA 1JNEA 1TMHA 2BDQA 4NJIA 4NG3A 4AXNA 4CD5A 1BLIA 3AXMA 1FOBA 4KPLA 1TWWA 1JDCA 1TVPA 4O12A 4B5XA 1O5XA 1R3VA 2CBJA 4RR4A 4JFSA 4DLMA 3VDAA 1NOFA 3DUGA 4IPNB 5J5RA 4PB3A 3VKBA 1KTBA 1XLIA 5FF4A 3VIFA 4D6CA 4W8LA 3UZZA 3QPEA 4HD5A 2YPIA 2CBVA 2GGHA 3GNRA 1O95A 1SZNA 3O16A 4I8YA 4YVVA 2WMFA 1YIXA 4M7TA 2VFEA 1TZ9A 4OECA 3FN9A 3UWYA 4HK7A 5HMEA 2NQ5A 4WR3A 1J18A 2V5KA 1KM5A 4PMXA 1JXJA 4I5XA 3TU9A 3NQ8A 3PUOA 1POKA 5REQB 4ERAA 2VZUA 1NOUA 4YLWA 2R1MA 3OIXA 4JIQA 2QCDA 3O15A 4GMEA 3T2OA 1TKKA 1WBJA 2OODA 1G4PA 2Y8KA 1JUEA 4IIBA 4TVDA 3DGRA 4PH6A 5LGZA 3S5YA 3FK4A 3H53A 4B2DA 3QV6A 1XCXA 1NFPA 3KM8A 1GYMA 3WD2A 3QVQA 3H7UA 3KOFA 3P2VA 2ZX5A 3AYRA 3S8HA 3FGCB 1UUQA 4IXXA 2Q3RA 2ZXDA 3GBEA 4ERGA 4K3ZA 4K36A 2WQPA 1XYAA 1FWRA 2XINA 4MLRA 3SADA 1YHTA 1NU5A 3T7VA 4Q8UA 4HN8A 1LOQA 1S46A 5AYZA 3HF3A 2OXNA 3ONCA 4QE4A 2HXUA 1Q6CA 2X09A 4UFHA 1VQTA 2VCAA 1O60A 1PIFA 1M7XA 3QOKA 3UNDA 4LB4A 1P0NA 3BSMA 1VZWA 3V16A 5CKSA 1CT5A 3GG1A 3AICA 3IVSA 1XPGA 3FNDA 3PZGA 3FS2A 3NQMA 1DBTA 4L6OA 3IANA 4H83A 3W7KA 1HKIA 3CL7A 5SWUA 3P74A 4GHRA 3FVMA 1IZKA 4LBSA 4YCOA 1QNRA 1YDOA 4UTWC 3FDGA 4MUZA 4MZYA 1V0MA 1Q7ZA 2VGIA 4Y9OA 3CJPA 4CKQA 4ICMA 4N6EA 3SB0A 1I9CB 1V7YA 5FD0A 2DJXA 4Y9PA 4REQB 2WOQA 1C90A 1Q2SA 3HQ1A 4M0XA 3GDLA 1A5KC 3USZA 4QXIA 3DFHA 3RLGA 1BHGA 2VGFA 4H2HA 3QV9A 3O6AA 5CC6A 1KCLA 2VRKA 4GKTA 3U48A 3VM7A 1XINA 1KBBA 3HMJG 2PF8A 3N4AA 1E3XA 1FDZA 2NWRA 5MF5A 4NAFB 2B7PA 4DJEA 2BTMA 1FWAC 2CHRA 2V6AA 4R88A 2NV9A 5A6AA 2A4AA 3PG8A 3NO1A 3SUSA 4PRRA 2X1UA 4LAOA 3QSTA 3KS5A 5CSUA 2GK1A 3P80A 3VC6A 4ZB5A 3AUOA 2ZIDA 3MS8A 5A8QA 4HZ7A 3T2PA 2Y5EA 3MHUA 1HTIA 1WB0A 3WJWA 4MYAA 6XIMA 2CERA 5CPSA 2ZXBA 4HSNA 3R2GA 1B9ZA 4LGXA 1GPFA 1R3WA 9CGTA 2EGZA 2ZXAA 1QNQA 4ZQRA 3OIHA 4H9ZA 2PF0A 2Y0FA 1VENA 4GJ1A 3HPZA 1F61A 5HPOA 2TODA 4PL2A 4GFIA 4EP8C 3W6MA 5K3VA 4MF4A 5C9UA 2VTFA 4O4WA 1JF6A 4E8DA 4EIVA 3BE7A 3OBKA 3I3BA 4XSLA 1C9DA 3F4VA 1RJPA 4GINA 4FNPA 4INFA 4DZAA 3O0FA 1K9DA 4TUFA 3UJSA 2BVTA 1ZNNA 3MZ2A 3A3HA 3WBAA 4M24A 1CZ1A 4NNBA 1OQFA 1JF5A 3VOFA 1I60A 2INZA 1IEIA 2YZ5A 1BKSA 3LBCA 5C2GA 3S1XA 3D3FA 2ZBTA 1YADA 3H2FA 4LAZA 4U2YA 1IEWA 4XQ6A 3ABOA 3SUVA 2OZ3A 3N2CA 2OEMA 2XFFA 5G2HA 1IWBA 4LYRA 3SBFA 4UTTA 4NY2A 3ZLHA 1FWGC 3VOIA 4PBEA 3LG3A 3B8VA 3RNDA 4Z42C 2V82A 3TW7A 3IIXA 1NP2A 5TBOA 1GTEA 4UFLA 5EY5A 1ONXA 1XDLA 3BPWA 2C0HA 4ZA0A 3HTWA 1FDYA 4DO5A 3R79A 5BCAA 1C92A 4MB1A 1UR1A 2CW6A 3KHJA 4Q8NA 1IZJA 2NLYA 4JTJA 4O1BA 4KRTA 1K02A 1U2YA 2LLEA 4KEZA 2WZHA 3JUGA 3QZEA 4KCVA 3W02A 1QI0A 3QTPA 5BYWA 2V8ZA 1CW2A 3URNA 1J0IA 2WZMA 2AOSA 1YNPA 2Y61A 4DJFA 1E4LA 1KQZA 1UMYA 1EP3A 1ZJIA 3VD5A 3W22A 2YOCA 3VIJA 3GVRA 4AZCB 4UTHA 1FHLA 2HISA 3S2MA 1XYCA 4PB5A 2F84A 1M7JA 3ARTA 3TYBA 4JN8A 3FAXA 1AH4A 5FL1A 1O94A 4WX2A 5D4YA 1W3LA 2DY3A 4HOWA 2I9EA 3IJ9A 2VEGA 2DIKA 4FXFA 3JVAA 2P53A 3SURA 1B54A 4HA3A 2HBVA 2UBPC 2CESA 2D20A 4AG0A 5TIMA 2PWGA 1D2KA 4FX7A 4BWLA 1Q3NA 4UTJA 4CD8A 4F66A 4JKKA 4LNCA 3A5FA 4OGZA 1OFDA 2AQVA 3G3DA 3S1UA 4O0KA 3SCRA 2I1OA 4KIRA 1X7FA 1OFRA 3XISA 3CUFA 1AMKA 4OHQA 4XD4A 3R0KA 4LUSB 3RPTA 2JF7A 4AMCA 3K8MA 1YE6A 1XBXA 2OZTA 2JK2A 1JCYA 5KSWA 2E1WA 4OTKA 2AQWA 1KWKA 1KCKA 1KRBC 3MP5A 3G1AA 5BRBA 5AC4A 1LTDA 1UD4A 3FW6A 3FXGA 2EG6A 8XIMA 1E55A 4TX8A 3W88A 5D38A 4IG2A 1E15A 1Z44A 3DZ1A 3LCHA 4WGXA 3W24A 2FVMA 3ZS4A 1YLVA 1O1HA 4IP5A 3LQGA 4AHOA 2WVVB 1LBLA 1G4TA 1TV8A 4LY4A 1TYGA 3KWXA 1BXCA 2YFNA 1UD6A 3QGAC 4LBUA 3GXNA 5FF7A 1XLEA 8A3HA 3CYJA 3WQ6A 3W84A 2RDWA 3VDGA 4TO8A 3I4KA 4GX9A 2VC5A 3W7QA 1SFJA 1F73A 1VS1A 4IHCA 4NQ1A 3IIVA 2V0TA 2XN2A 4PSRA 3CHFA 1XIHA 1DQXA 2A1YA 3AXKA 1DV7A 3TAKA 2HMCA 2D3LA 3AALA 4IGHA 1R0MA 1XG4A 4YVPA 1KM3A 4AEEA 2DSWA 2GFTA 4A05A 1GOMA 4IT1A 4RJEA 4WD0A 4AWUA 3TROA 4EF8A 2TAAA 5KZMA 3EDFA 1AMYA 1R9XA 1JNDA 2J7FA 4C6MA 3INPA 4O13A 3EMZA 3PUGA 1R30A 1HX0A 5F2IA 1B9BA 5IFTA 2CLPA 4PULA 3W7RA 3ZFHA 4TMBA 1J2WA 1H61A 5HANA 2GWGA 1MSSA 3M0XA 2HPMA 3JRKA 4G7FA 3V36A 1JI1A 3LI0A 1UWQA 5M5DA 4Z0SA 5CPLA 5A2BA 2RJHA 1AUSL 3EXSA 4TIMA 3ARUA 5A6KA 1UKPA 3OZMA 4ZQOA 3P67A 3TWAA 3AS1A 2FYMA 1DXFA 3IUHA 1DOSA 3RR1A 1P5BA 5LIWX 3DH7A 4NZCA 3EX1A 1ME7A 3HG5A 5IDIA 5GNYA 2XISA 4KS0A 4Y6GA 1DYSA 5BMXA 3G8EA 1XUUA 3OQ8A 3UFYA 4PBGA 2PDUA 1KBLA 4HHHA 4DUXA 1VFTA 4OU1A 3HV8A 4AD2A 3DYOA 1MDLA 2FQIA 3MHGA 3S5SA 2HE5A 5FJIA 1V4YA 3NQDA 3MV11 2V3GA 3ABZA 4IH3A 2ODOA 1KO0A 3DYPA 1PDZA 3N04A 4EKJA 3T55A 5A6BA 4M1RA 3AIRA 1S2TA 1K8CA 3RCNA 3AI0A 5IOBA 4DBUA 2Y5JA 4Q6JA 5K9XA 4XIAA 4E6MA 4YTQA 1X6NA 5HDRA 1M5WA 3HPXA 4UTIA 2A0NA 1SSDA 1UMLA 4LAKA 2XGBA 3NAVA 3ARWA 3W1PA 3E0FA 2ZRVA 1OHLA 3PVFA 1ECEA 1HQTA 3VGEA 5ABEA 1R7OA 4JQ3A 3A4AA 4M6UA 1XLLA 1WDWA 1XSKA 2NQ9A 2PDQA 3FX4A 2Y8UA 2YBTA 3QY7A 4MKSA 2EPOA 1PPIA 4D6EA 4FA3A 4HYVA 4B3KA 2NQJA 2A21A 2BHYA 2RAGA 3WD0A 2WWDA 5AHFA 4A35A 3HIJA 4DBSA 3ONBA 3F5KA 2I57A 1Q6GA 3CUZA 1DWJM 3O6YX 3QMRA 2P76A 1RQEA 1W54A 2YCLA 3F4WA 4RLIA 3R43A 2RUSA 2YKKA 1VYPX 2XM2A 4AF0A 1ZTVA 1XIDA 4C5ZA 3SFKA 2SFPA 4X60A 1TMLA 1X96A 4LV9A 2FGZA 4GUFA 3ES7A 1UIOA 3AWOA 3LBMA 4IMAA 3A22A 3ANVA 3WDJA 2Y5SA 3P82A 5JMUA 4PFMA 1XD0A 1DXIA 3T8LA 1WYIA 1JIBA 1SR0A 1REQA 3SR7A 1TPB1 3TN3A 4O14A 1W3NA 1R9ZA 3SZ8A 3DC8A 4C6NA 3UPBA 1N82A 4HA4A 3CAWA 3OGVA 2XIQA 5I7GA 1KM2A 5DMYA 4P7LA 4JHMA 2ZZ3A 2YA1A 1R47A 3SCWA 1ALDA 1I0DA 3HPSA 2DZUA 2NQHA 3TIMA 2W66A 4XTDA 4J27A 3VZXA 4IXHA 4CNTA 4A3QA 4F4RA 4YN5A 3PFMA 2OEKA 2J9YA 3I6TA 3BAJA 2E68A 1V0LA 5G2IA 3KEHA 2C18A 4DNMA 2DVUA 3SRFA 3PG9A 2Q3OA 2PTXA 3HU7A 4QNEA 1BAGA 5AHLA 1EF3A 1H3GA 5A5WA 1OIMA 1QWKA 3FDKA 3CZJA 4DELA 5D02A 2VNCA 3AJ7A 1WP6A 4Q4QA 4UWMA 1YYAA 2Z1BA 5G5IA 4WLCA 1I2PA 1CGUA 1HKJA 1DE6A 3ABQA 1KBIA 2XIMA 5IDZA 2HCVA 1PTGA 1DIKA 1AH0A 1EQCA 2J25A 3L4ZA 3P0WA 4GQQA 3FKRA 3WH8A 4XAGA 3AIEA 2HSAA 1JGIA 4FAMA 1GOXA 3NGJA 2PGRA 1X1NA 4ML4A 1N2VA 1EX5A 2ZVIA 3GR8A 4CNUA 3I7RA 2OT0A 4Y2WA 3WKZA 1TV5A 2YB4A 2WZEA 1BWLA 4BZYA 3FJNA 3FYYA 2QDEA 2VFGA 2J79A 1S5TA 3KVLA 4DXXA 2VCBA 3RPMA 2DT0A 2V81A 3GXFA 3MW7A 1CXIA 4K7YA 4GFSA 3OU8A 2QUNA 5FJRA 1Q6EA 3OEXA 3TMQA 3LXBA 4DUVA 4GOAA 4Y9MA 1X38A 1O66A 1RUSA 3BCJA 3SJ3A 3N6HA 1VIWA 4DWDA 4QP0A 3THQA 3WENA 1T41A 3IACA 3AC0A 4D6IA 2H8ZA 3AMGA 4NI8A 2J75A 4PC8A 4GUHA 3PPFA 5HMSA 5J5DA 3BO9A 1O5KA 4AZBA 3POCA 5E1QA 3WK3A 4Q7BA 3LOTA 1HFBA 4O57A 3BXWA 3W83A 4PTDA 1B31A 3SGUA 4XZ9A 5EYWA 1O12A 4JN6A 3QTGA 5JBFA 2Y8VA 3N25A 1UZ4A 5DO8A 3CPRA 5A8MA 1JPKA 1AK5A 4NL1A 2X16A 2XVNA 3W76A 4D71A 1BG9A 3TVAA 2GQ8A 3CXOA 3HG2A 1WKYA 3E6EA 3TOPA 2PTYA 3MWAA 2WHMA 4S3CA 2OWXA 5KZEA 2ANUA 3GFXA 1SQ7A 2HS8A 4AISA 1MRQA 2VQTA 3KBWA 4F0HA 2WMJA 3VUSA 4X2RA 2DSKA 3N4FA 1MEHA 1OG6A 3K4WA 2WHJA 4HSHA 2WLYA 5AB3A 4O1DA 3N3TA 2BGSA 3PZMA 5AHNA 3WLOA 1UJPA 1FCVA 2GVJA 3CHEA 4IPJA 1E72M 3OHIA 1Q5MA 3CIVA 3T08A 3RCMA 2FZNA 2F61A 2ZX7A 2VZOA 4H9VA 2HZGA 1H5YA 2JIEA 3NTYA 1FWTA 4S1FA 2E3ZA 4BQ4A 1FY6A 3W71A 4DZ5A 1US3A 1V93A 1JXKA 2YBUA 1WDPA 1CPUA 4ZO9A 4U3CA 4TV5A 4AD0A 3GVQA 3N15A 1S3HA 3ITYA 3UGVA 2VP8A 4IQJA 1EL3A 1FP9A 4B5TA 4E2VA 2X41A 3R0DA 4V28A 4QG9A 2VR2A 3SGGA 1W32A 4L1XA 2QDDA 3TA9A 3VE7A 3C0JA 5CPTA 3MV01 2J47A 4HPJA 3SY1A 2GVYA 3H70A 4LAMA 3AFBA 3PPHA 3PAOA 3UPMA 5C5YA 5C7VA 1EPXA 1YPXA 2OPJA 2QCMA 2IPFA 1GPWA 5A8NA 2CLOA 1RCQA 1F8MA 3F5JA 1RQBA 4B3LA 3SECA 1YDVA 2V69A 5DT5A 3CL8A 5FCZA 3TP4A 3NDOA 3STGA 2JALA 3CQIA 1A5CA 4IX0A 1AA1B 4YTRA 1QPQA 2R91A 3IVTA 2W0UA 3BTNA 1PZ2A 4DUOA 3AMKA 1KV8A 4C7DA 4IIEA 3TKFA 3QFEA 2P0OA 3VYLA 3TWBA 2XVLA 3EPMA 3R1ZA 1KKOA 2UWFA 2ZX9A 3Q94A 4ZOAA 2QJJA 4MY8A 3G8RA 1CXFA 1YEYA 3MVTA 1QI2A 1J0ZA 1TZZA 4J3TA 3W2UA 1OSEA 3AHYA 5JQ9A 2NX3A 3WLQA 3QV7A 1W9PA 3HA1A 4N02A 3URAA 1EJXC 1LL4A 5A6JA 3QFWA 2HVOA 1JRBA 2FB3A 2W3ZA 2Z7KA 3JU2A 1CGXA 2GGJA 2CBIA 4HZ8A 4BHYA 5FJPA 2YXOA 5CJ5A 4F48A 3T0TA 4B92A 4DZHA 1VPQA 1TR9A 4B2DD 1DP0A 2Z6JA 4UTWA 4WSJA 1ITUA 2DZXA 4FLSA 1XDJA 2X7WA 3B04A 1Q6DA 3EA2A 2NSOA 5CPOA 1WKEA 2FGBA 4HA0A 1VEOA 1ZB5A 2PLKA 3J7HA 4WOQA 1XXXA 4JIRA 3G1RA 1Q4WA 1CXEA 4AZ5A 3NQ7A 3DECA 4WOZA 1YPFA 3IGSA 3Q65A 4BY3A 2FFIA 4ZO8A 1Z41A 4WSHA 1W2VA 1XKYA 3SSJA 1EWEA 3OPSA 1GJPA 1GZ1A 4UQEA 4AAJA 3TDFA 2IQDA 3AMDA 4QNWA 3G5EA 4LUIA 2OO0A 4X61A 4MZ8A 1V6VA 3C0LA 3FY1A 1Y65A 4NIRA 3A24A 3L5MA 3WMLA 4YCPA 2E9LA 3NZRA 3E38A 1FBAA 4Q4PA 3H4WA 1M65A 3NO3A 3DG3A 2GVGA 1OGGA 3GHRA 4RW3A 4H7ZA 2VQUA 1BWKA 1BXNA 2OEJA 5ENLA 4DLFA 2X05A 1JDFA 1C91A 5EMUA 3K4DA 1XRTA 2X0HA 3NR0A 3NEVA 1JFHA 5REQA 4US5A 1LCOA 3KCOA 2JEPA 1ADSA 1GHSA 4AY7A 2H8XA 3NPUA 1PX3A 4BCEA 3G0XA 3MB9A 4QITA 1BYAA 1TA3B 1K3UA 1YE4A 1XYBA 3IJDA 2WCAA 3GG7A 2D22A 3PUDA 4BQ2A 6REQB 1YXDA 2CEQA 2NSXA 3NPVA 3ITOA 1KV5A 4GWEA 3QMSA 4CUCA 5JBDA 1KXQA 1PB0A 4MG4A 1NM9A 2X40A 2OOFA 5HUPA 4L7ZA 4A21A 4U2ZA 5D8ZA 1N8FA 3ITLA 3E2QA 1CENA 1DWAM 2KZHA 1MW2A 1BD0A 1KTNA 4ROPA 3G6LA 1B3ZA 1JJKA 3C3UA 2QAFA 2VVNA 1VPYA 1A5AA 1W0MA 4C6PA 3LXCA 3Q45A 3H2CA 1CIUA 3EPNA 4M81A 1QI4A 2W62A 2Q8LA 4B16A 1WCGA 4OUEA 4QJ5B 1VYRA 3B4UA 5LNVA 3RX2A 1BRLA 5D2WA 4FNSA 2DT3A 5CCZA 4H19A 3PJXA 3TTSA 3P62A 1DE5A 1OT1A 3S9YA 1RALA 2B7NA 4AIBA 2A2IA 3TYCA 4FB7A 2JQXA 1NDYA 3PZ9A 3ARSA 4D6GA 4O10A 1XG3A 5E9XA 3LZ5A 4K1GA 1EFZA 3W25A 1XFBA 1JQVA 2XH0A 2ZCGA 2C6QA 1CB2A 2FTYA 1E4NA 2H9AA 3BAWA 4AMAA 2YW4A 5CGQA 3PTDA 3RAOA 3H7VA 1NIUA 4KGJA 3OB8A 4EXBA 3HJZA 3FHAA 1J2BA 1YDNA 1UYQA 2I9UA 3WMBA 3U8GA 2J4GA 2J77A 4D6HA 4KEVA 1XWYA 4FXRA 5U7SA 4DHGA 3UZJA 1MNZA 2J74A 1SFSA 2UY2A 1ZGDA 3W1TA 4W84A 4U31A 1PKNA 3R8RA 4WXZA 3NSXA 1A0CA 3MY9A 4OIFA 1AD1A 1K1DA 2JFEX 3I3EA 3EX2A 2B7OA 2Y7FA 3PN8A 1GQKA 4DAIA 4JTDA 1W1B1 2ZUUA 3QKZA 1JD7A 5J8LA 3BW4A 3N34A 5KTLA 4BI5A 3M07A 4B90A 1BVNP 2X2YA 1B90A 2MUCA 3MCNA 3O6DA 2OQLA 1TO3A 3IV8A 3MI6A 4IPPA 1J0JA 3H4XA 3H55A 1GGOA 2G96A 1BGGA 1VHNA 4JTAA 4U28A 4LF1A 3CHCA 4GZ7A 4EX4A 5LHFA 3MKCA 3G1DA 3ZR4A 1ZBKA 4ATDA 1L8PA 4NAEB 2ALRA 1D3HA 2Z24A 4GXWA 3WLTA 1I1XA 4ONVA 2AL2B 3W4RA 4D2JA 1XISA 4HTBA 2PWFA 1TMQA 2Z1WA 5BOEA 3HV9A 2PWHA 4JX5A 2DQXA 3GD6A 2PDNA 4GZIA 1M3UA 3PUEA 3W7IA 3NL6A 3W86A 2E8YA 3IJLA 4HP5A 3EWBX 4QDMA 4DM2A 4ASTA 4O1AA 4JL1A 2VGBA 4JTSA 4WDUA 4XVDA 3EDEA 4UQCA 3BG3A 5A6LA 1F4HA 4PA8A 4F0SA 3ZJ7A 3BL3A 2G4JA 7XIMA 1OABA 3I6RA 2ZX8A 4E4PA 3AJXA 3BAYA 2Q8ZA 5ABGA 4QRNA 2E9MA 1XLCA 2YXXA 1EJWC 3L2LA 1PKMA 3VGBA 2NLIA 1SVDA 1CGVA 1FCBA 1PDYA 3O0KA 2VFIA 2B31A 3S2NA 3UG8A 1XSIA 2HK0A 3CIWA 2OLHA 4QSHA 2PPGA 5H91A 3TCEA 3GVVA 2ZZ4A 1RH9A 2JIWA 4Z2LA 3BGGA 4HKPA 1EUAA 3UETA 3LHWA 4AZ6A 3R0UA 1DIEA 1GEQA 3TQVA 5FJOA 1E71M 4MWAE 5C7HA 1OBAA 4P2VA 1THFD 1E0VA 2ZADA 3GC5A 5H2ZA 1JDEA 4X2PA 1CGWA 1B57A 2A3CA 1WKFA 1F3EA 3CWHA 5I3JA 4O28A 2CXGA 3RHGA 2VEPA 2QCDB 3R94A 1DWHM 2YB1A 4K1WA 2RHGA 3T44A 5D37A 2O56A 1CB7B 4Z0JA 4OQVA 5HNTA 1OJXA 2BOEX 2VFFA 4EAMA 2QF7A 3WQCA 1DTUA 1EX1A 1I45A 1E0WA 1V3KA 4GVGA 4IZGA 2Y88A 4ZTXA 3CWOX 3RXZA 2VL4A 1WA3A 3HPFA 1KXHA 3IEBA 3W2NA 2X1TA 3SRHA 3G1YA 1PL9A 1B3WA 1YXYA 5LNSA 3QPYA 4C5YA 4HB7A 4IPIA 3MVIA 2PP0A 4CQBA 2GYIA 3LI1A 1AQFA 1UWIA 2DZSA 1NSJA 4ZB2A 3WJSA 1L8NA 1JPDX 5LSMA 2TMDA 3ARXA 2O92A 4B5UA 2ZICA 1GQJA 2OSXA 3TJIA 2B4GA 3M0VA 2F8QA 4IP7A 3QGVA 2TRSA 4GI6A 4IIDA 2Z28A 3WDHA 2WANA 1LOSA 3OP2A 3PZUA 3B03A 4FALA 4JEQA 2BP1A 3CK5A 2PZ0A 2V3DA 4MY9A 2EEXA 4V33A 3O2LA 1JZ3A 4HSOA 3VNZA 2PGFA 2VX6A 3W26A 3KBMA 4FPSA 1JPMA 4KERA 3WUEA 1ZAIA 1CLVA 4DBWA 2GVEA 3C6CA 4Q8PA 5TNVA 1RJRA 2ZC8A 4FR6A 3PF3A 3UESA 4XZHA 2P3EA 1RBOB 4L6DA 3S5OA 4LCQA 1SZFA 3NUKA 2GSJA 3MP4A 4JAWA 2F2HA 3M6DA 2WVSA 1VFOA 4BF5A 4EPBC 4J3VA 2PBGA 1Q7MA 4B3ZA 3B9NA 4IP4A 3MTWA 2E67A 3PP7A 2OWWA 4ADSA 3QR1A 3GTFA 4OV9A 4YIWA 4QCFA 1UKQA 3TSDA 4DWSC 4AIEA 4XX6A 1AG1O 3H2OA 4Q4KA 4GGBA 3OA5A 2CETA 2GDQA 4DN1A 4PCNA 4M7SA 5I0DA 1E56A 3SQMA 2W9MA 4NHVA 4HPGA 2PDJA 3UR7A 3WX7A 1UR8A 2OYKA 1J11A 3SO7A 3QW4B 1ITQA 2OZ8A 3ZWSA 1SJCA 3UXDA 3LS9A 3SIMA 4IQDA 5EFDA 4HMCA 1JPHA 1DJXA 2GQAA 4PRTA 1T40A 4AVFA 3RN6A 3U2CA 4GYPC 3M7SA 2ZUSA 3W2KA 3EWXA 3AXIA 2J78A 2QJGA 3UXKA 3VZZA 2ADAA 3TR9A 3C5QA 1OY0A 1N8WA 5A6BD 2NV2A 1I75A 1GVOA 3GG8A 2J6XA 1T8XA 4NRRA 5KZDA 3VIOA 1VRXA 1FWSA 4GE8A 2E9BA 4K8HA 1V0NA 2C71A 2QYGA 5BMWA 4H9YA 5HNRA 1UASA 3NVDA 3NL5A 4GX8A 3PZVA 2BXVA 5TD4A 4EF9A 2EJ1A 1V3LA 4YL2A 3K13A 4JNYA 3D0CA 1QPKA 4UR8A 4K8GA 3W1XA 4QROA 1ONEA 4Y7EA 1O7AA 1UWTA 1UB3A 3R8HA 1GWJA 3LUTA 4MWAC 4S3KA 1LBFA 4C6OA 2XJ7A 3WQGA 1HVXA 5PTDA 3EA3A 2PODA 2P8CA 2DVTA 1OF8A 5F1UA 1Q63A 3EGJA 1LG1A 4D6DA 1I0BA 4LX4A 1FH7A 2RDXA 3P84A 4PUJA 1AQ0A 3C0SA 2V5JA 3VD7A 4U5IA 5LXXA 3VCNA 2Z7GA 3N29A 1JPIA 2PDGA 3E9AA 1L6WA 4GYKA 4DX3A 3VD4A 1W9UA 4RK8A 4UQDA 5BWFA 2Y85A 5C9XA 5KITA 3N13A 1AW1A 1DVJA 3KL0A 4O1FA 2Z00A 3UT0A 3KVKA 4I7WA 5AN7A 2FZBA 1CYGA 1E3ZA 1Y7VA 2ZUNA 2NW0A 1S3TC 1BF2A 1JCTA 3W7LA 4LBRA 3NCOA 5EMKA 4JYDA 1FVPA 1GJWA 5D2XA 4UC5A 3NIYA 3LENA 3WQ5A 2UY4A 5A6TC 1BKHA 2EPHA 1Q8JA 1X8FA 1VFLA 3DEQA 3THAA 2Z1SA 1BG4A 4WY0A 3MUIA 2DUZA 3M43A 2DDXA 3LU2A 3UYCA 5XINA 4R7OA 2QJMA 3O3RA 3BC9A 2NWSA 2X1RA 1J4EA 1C29A 4HVXA 2PDXA 1DL3A 3CNYA 4I8DA 3NOEA 4A22A 4KBXA 3GXTA 4NZJA 1HL2A 4GNKB 1EO7A 1XGZA 3PJWA 4HYWA 4N4QA 1LQAA 4RNHA 3VPLA 5M3WA 3AAMA 3DFTA 5CSYA 1VJIA 2Z2AA 2FTWA 2PDYA 1N7KA 4J5NA 4Y8FA 1LWJA 1NF0A 1Z7AA 1ZBCA 4JN7A 4NJHA 2BODX 4PEEA 1R87A 3I7QA 3NJ3A 4MJMA 1UR3M 3UZWA 3ZJ8A 3GW3A 1XL9A 4L5ZA 3GZAA 2Y4SA 1BFNA 1J93A 1VIZA 3VMPA 3PZOA 4CN4A 3RJXA 1KWGA 2VT0A 1YKWA 3ZVIA 4TTUA 4C6KA 3L21A 4C91A 1QOXA 3WBXA 3N12A 3W1QA 2WYSA 1U33A 1NOWA 1HZYA 2CXEA 3NQBA 2FPYA 2FPTA 3W2JA 1UJQA 3DFPA 2VX4A 1C8VA 4HU4A 1L9WA 1XI3A 1YDYA 3AIWA 3GDTA 4FNUA 1KFKA 3H26A 1AH3A 4GG9A 1FHUA 4HMEA 4JD4A 2R1LA 2Z0IA 1K7XA 2XYLA 4HCDA 2QXWA 3IGUA 3RIKA 1E1EA 4MB3A 2PDHA 5G2WA 2PTZA 1JYWA 3NFUA 3FXYA 1VF8A 4QQUA 1GOKA 1SMAA 4IIFA 2ZOXA 1EJRC 3G18A 5JIWA 1KM6A 1KB3A 4XAPA 4MDPA 2GGEA 2OQHA 1QOPA 4LS2A 3CL6A 4LT9A 1K9FA 3G0SA 4J3SA 2E1DA 3QEZA 2AMGA 2J8TA 4DYJA 1B3OA 4AYGA 1G0CA 3A47A 3VCCA 2DZPA 2WSPA 4AB4A 2ABAA 1C3FA 2JBMA 2WMGA 5D9MA 2VOMA 1E5NA 2HQAA 5C2XA 1HGWA 1VLIA 1TTQA 3P0XA 4WKFA 3DBNA 4NXSA 4DBDA 1UC5A 1FH9A 2OO6A 1HG3A 3NQCA 2WVTA 5CLWA 4K39A 3CO4A 3GR4A 5EBUA 3M41A 3AYTA 2WM0A 2QCFA 4WIWA 5LA0A 3NURA 1W3KA 5D2TA 1XFCA 3GDBA 4W5ZA 1P1XA 1VR6A 5D8WA 2YR1A 3FIGA 5HQMA 6CGTA 4UR7A 4FIQA 2ZKMX 3CHDA 2WC4A 2RKXA 1G94A 1JCLA 3ZWTA 2VDHA 3TYAA 2EPNA 4W8BA 3LX9A 1GZGA 3PC0A 5IXEA 4GUIA 1TPVA 4LPCA 3GC4A 3LSBA 4I7UA 3CT2A 4CNNA 2OMAA 2IKHA 4O8AA 2VURA 1ZALA 4X9SA 1Q45A 4L4OA 4ACZA 4OOZA 5DRCA 3UJFA 1KLYA 1PBGA 4N42A 1XQKA 3IGXA 3TC7A 1TREA 3FEQA 2QJHA 3S2JA 1KFJA 3W00A 1EH9A 1PHQA 1SPQA 3QHNA 4DBEA 4ORMA 1Q65A 4LH8A 3GH4A 4PR4A 2E6FA 3AZSA 3LLXA 5LNRA 3DI0A 3M0LA 3LLDA 1Q4NX 4Q8OA 2DPEA 1PS9A 5LGXA 4Q4OA 2WKGA 3TK7A 1AFSA 5FESA 2V38A 2WKLA 3A64A 3BARA 4F2TA 4TX6A 4JEJA 4M5PA 3PB0A 4KIEA 1DXEA 2D0FA 4P7QA 1VFUA 3G6MA 2VXNA 3VKKA 3AOFA 1PTDA 4J3WA 4F40A 2HTMA 1OZQA 5CGTA 3IRSA 1QHPA 4I6VA 1NWRA 1BTMA 2FB2A 5D30A 4R9XA 3LGGA 1TPUA 2YL9A 1X6UA 4P8UA 5HR6A 3KVJA 1PUDA 5JVLA 4UNIA 2DV0A 3M6YA 3GHTA 2WB5A 1NJJA 4Q8MA 1D7FA 2DT2A 1J0HA 4A29A 3A9BA 3GU9A 1I8JA 1GNXA 2QS8A 3CTTA 1WUFA 2BVYA 3GRIA 5BXTA 3VMNA 5E0KA 1LL6A 2YCLB 1LF1A 4I5UA 1V0KA 1QHZA 4C1NA 1F3XA 2WJZA 4ICCX 3IRDA 3TE9A 2FJUB 4AF0B 1EWDA 3RFAA 4BF9A 4Q22A 3VU2A 3VKJA 4Q7IA 1UIPA 4JNMA 4MJ4A 1RV8A 4AWEA 4DQWA 1QPNA 1EA0A 5K9DA 5DX7A 2WC7A 3MUZ1 3AS0A 2NUYA 2YL5A 3G0UA 1JULA 1WQ5A 3UQNA 3GYCA 1K6AA 3B0UX 2PUZA 2A3LA 3B0YA 3B9EA 3CASA 1P6BA 1REQB 3M44A 2WBGA 5C9ZA 4C7GA 3GQYA 2PDLA 4GI9A 3GSMA 3SUTA 3NQFA 2BV9A 2BGNE 2FTPA 2C1GA 2Z1KA 2Q6ZA 1A5BA 1CXKA 1GKQA 2ON3A 2ASHA 3ABRA 5T9CE 1MFVA 4AH7A 3LSCA 2ATSA 2I7GA 4Z1DA 1TZ7A 4H7CA 3A13A 1TWIA 4C6LA 1XDMA 3UR5A 1EHAA 1AZ2A 4FIRA 2Y1HA 3I6EA 3S9ZA 4PUNA 5D09A 5AECA 3FEMA 4L9XA 2V2HA 1SM9A 1D8WA 1OFQA 2TYSA 5H8UA 2QCLA 3M47A 2A79A 4JCMA 1KGWA 4QIUA 2D2OA 4E5TA 3FYOA 4JICA 5M17A 3VD3A 1UKOA 8RUCA 4AIOA 1EP2A 4MAZA 4XAYA 3WY1A 3UXAA 3PWGA 4ZSTA 2GQ3A 1ME8A 2PDKA 5BRQA 3PJTA 1TPFA 4F0MA 1UWSA 3U4FA 2OG9A 3SW6A 1GJUA 3WLKX 2E5CA 2AL1A 4US5D 1RQHA 3N9RA 5HJYA 2YZRA 1IGWA 2PU0A 2CHNA 4BEUA 4FI4A 4G1NA 3GAKA 5I3HA 3GXIA 2PP1A 4IF2A 4EACA 4H8NA 1QHOA 3NM3A 3AROA 1CLXA 3M7WA 2J7EA 3IARA 1DPMA 4I3GA 1GG0A 3ZVHA 4C6IA 1TJRA 3N4EA 1OFEA 3S9IA 1W3JA 1ZAJA 2QPSA 3UG3A 2B81A 2AQOA 5FEXA 1KQYA 2PWEA 2DSUA 3WJYA 5A94A 3W7HA 2QGHA 3T40A 1I2RA 4QFUA 3TYDA 3PBVA 1EJ7L 3NQ6A 5T91A 3SJNA 1G67A 3UP8A 2J7BA 2H3DA 3BCDA 2QF8A 4J2MA 4J35A 1UD5A 3TJXA 4DO4A 5LXEA 4L9YA 1OG0A 3W53A 4O18A 3R10A 2DSZA 1TTIA 3GU1A 3H4GA 4RE4A 2Q8XA 3M0HA 2EAWA 4O54A 1DJGA 5A8GA 3A3WA 4EVZA 3RCYA 3W9ZA 5CBIA 4E8GA 1UH3A 4H8VA 1J9YA 4TXEA 1TQJA 3GIPA 1I6NA 1VBGA 1TPC1 2XH7A 4PSPA 3WNLA 4BI6A 1JYXA 1SZGA 1BYDA 3OOQA 3D46A 4QJ1A 1UKSA 1NQKA 3L4WA 4QISA 4A2RA 4YPJA 5FACA 4ROQA 5HAOA 4CNPA 1NELA 1JQXA 2ICSA 3ZM8A 2D73A 3N1AA 2R24A 3UZYA 3RYSA 2VVSA 1W1YA 3HG4A 2XTKA 1XIFA 4JS3A 5G1MA 3WFLA 5AY7A 4S3BA 4MKVA 2QDGA 3MDUA 3H2AA 4I9JA 3KRSA 3KDOA 3WCZA 1VEMA 3KE0A 5CJMA 5AHIA 4MPKA 2AGKA 4AQLA 3BV7A 5ABHA 3EOEA 2BGQA 5CQ1A 1OCJA 4S3GA 2DZBA 4JZ5A 3E0IA 2GOKA 5JH1A 1AVAA 1F74A 1KC7A 2GQ9A 2VEIA 3AYVA 4LXFA 3H54A 3RLVA 3VFLA 1HIZA 2Z26A 3SCQA 3AZTA 2CKRA 4GQBA 1C8QA 3NM1A 4IIHA 3LCGA 1TUFA 1YXCA 1GHRA 4P7RA 3I7SA 4UNLA 3HJEA 2GL5A 1XPYA 1Y5XA 4QEHA 3TYZA 2ZYFA 1HW6A 1RLDA 4WKAA 1VJZA 3PULA 3TJLA 1IWAA 3MP3A 3P8IA 3T2QA 4NJGA 2ZZ7A 1XLDA 1VP5A 4KMQA 4IGMA 2XPKA 2NXIA 1TE6A 1A3HA 2EQDA 1NAL1 4G5DA 3UA3A 2A85A 4O0ZA 4EPKA 5KINA 1NY1A 1E70M 3WLLA 3LMYA 2ZZ1A 1GONA 3W23A 1WDRA 3VNIA 4JOMA 1YMYA 2JKPA 5EKYA 5C70A 1VJSA 2PCQA 1L6YA 2PC8A 5M1TA 5LHEA 3VNLA 4H6KA 1H11A 2Y6ZA 2PEVA 3QMTA 3WNOA 3C52A 4IFRA 1P4CA 4IL0A 2WPBA 2VJXA 4GJIA 3RDKA 3MI3A 1RHCA 1Q2RA 4WJXA 1WPCA 2GDVA 2C0AA 1P43A 3IUDA 2CWXA 4W4QA 1IYXA 4MTVA 3NG3A 1XLHA 4BJHA 1T7LA 5CBJA 3TFXA 3CM4A 2WHLA 5HBFA 1Z32X 1A3WA 4PN2A 4CN6A 1RCOB 4RXFA 1UPPA 1MQPA 2A7NA 4ZOBA 3QBUA 2FFCA 3CUIA 5FA5A 3IUIA 3V5OA 4AZGA 1L6SA 2OT1A 5BXSA 4ZENA 1JCNA 4FLRA 5D03A 5B7ZA 3OZOA 3M0MA 1XLFA 1ZENA 4B9YA 4ADTA 2BOGX 2ZE0A 3RMJA 1Q6QA 2BVWA 1M1BA 2R9RA 3BJFA 2CLKA 1A80A 2RJGA 4H9XA 3W29A 5EPDA 1R85A 4P8XA 4BS0A 2NQZA 4J2PA 4H6RA 5A6MA 5AYBA 3TXVA 2ZZ6A 2C16A 3VGFA 4NU7A 1GVEA 3ZZ1A 3TN6A 3CTLA 3QW3A 3AMLA 1WDQA 4C90A 2Q71A 3UJ2A 5EL1A 4OOUA 2AL2A 3CUGA 4UBPC 4S3AA 2QCEA 4K7VA 5FJUA 5I5RA 3BGAA 3VD9A 3B9OA 1GTHA 5LA2A 2BZNA 3TN5A 3EEGA 1E4MM 1U5JA 3DDMA 3VGGA 3WLRA 2X7VA 1U5HA 1Q6RA 3S3GA 4DWSA 5DQPA 4OZOA 4YYFA 2XWEA 2VR4A 2G0WA 1J01A 1VAHA 5TQLA 3CV2A 5AVHA 4GXPA 4E2BA 3IJ7A 1E9ZB 5DANA 3U2ZA 4U3AA 4HHPA 4CCDA 3NGFA 1KRAC 4HNUA 3GDMA 5HNNA 1PAMA 2PDWA 3BOLA 1W1A1 4GYPA 2Y7GA 2VYOA 1RAKA 1XLMA 1H7NA 1HXJA 2DZTA 3BAKA 1J12A 1ZP4A 1VBJA 3ITXA 1U83A 3C61A 2UY3A 3UWZA 2IW0A 3BICA 1XW8A 4JTRA 2W91A 1GT8A 1RLCL 4X0NA 3GNDA 3CH9A 4Z2KA 1GVIA 5HK4A 3GDRA 4PMNA 1PEZA 4UOJA 2WSRA 1XKJA 2VR5A 1J8VA 5A2AA 3OLDA 4U4MA 3EXTA 4N9EA 3H21A 1E6XM 1VRDA 4LRSA 3TTQA 3VMOA 4QEEA 3BGJA 4HZ6A 1JGMA 2C8NA 2FHCA 1UOKA 3VX1A 1VBUA 1DJWA 4HU8A 1X1OA 4GD0A 4YNGA 1FWJC 5I02A 4IMCA 8TIMA 2FMOA 4EE9A 3UJEA 4MWAA 1TV2A 1HO1A 2G97A 4NF7A 2OELA 2PD9A 1JZ6A 3FJ4A 3OYZA 3WIJA 9XIAA 4IJBA 3PBMA 3RRAA 3BWWA 4WKHA 1KRMA 4ZFCA 4Z2IA 4MNLA 3WQDA 4WK9A 2D0HA 3UZXA 2AGTA 2OB3A 3F4CA 3PFRA 3QF0A 4E2OA 1XSJA 2XSBA 1SU5A 4NZ4A 3VDBA 1P1MA 4E4FA 1VBHA 4XKMA 1WZMA 3UWQA 4JHZA 4GNJA 4QGCA 1HKKA 2XN0A 1J5TA 3S5ZA 4HMDA 5DY3A 1E6RA 1BRLB 3EDJA 3VOHA 3GIYA 1ITXA 2BASA 4X9YA 4GC3A 3VIPA 3WN6A 3QH2A 3L0KA 4L1WA 3HB9A 3DXIA 2F6XA 3VNMA 2X42A 4G6CA 3TW6A 3GM8A 3GNXA 3AYSA 2X0YA 4LC6A 3PBWA 1H0GA 3QC3A 1VPXA 5KMYA 2H9AB 1PYFA 2QIWA 2WM1A 4LEQA 1P0EA 5LIXX 1VKFA 4GVHA 4NVTA 1VFSA 3I68A 4GBUA 4KT2A 1G1YA 2QAPA 3CU2A 4QQ3A 3VFCA 3E0LA 1NF7A 3LMZA 4QCEA 2TSYA 1T5AA 1PKYA 1VCGA 2IXVA 3B97A 3T78A 1MQQA 5D2VA 4CCZA 5DN1A 4IM4A 4ERIA 5I2UA 1TJ0A 3MBFA 1OF6A 1R3YA 1Y5VA 4RZ5A 2INFA 4LQ1A 5BU6A 2EG7A 3GKAA 5HWJA 3MMTA 3HGRA 1V6WA 1KBKA 3ZO9A 2BLEA 3LY0A 4NI3A 1B1YA 4DUWA 4LUTA 2UY5A 1PWMA 1W6TA 4GA8A 1J6PA 3W75A 2AMXA 4OBRA 3HFTA 2P0IA 4IMDA 1E6ZA 3T05A 3W1AA 1EGVA 4ACYA 3TTYA 4XZWA 3L65A 5GJNA 3DG7A 1NWUA 5LKYA 1K77A 3CUJA 3L4VA 2YA0A 3RMEA 2IUZA 1W1IE 4TOQA 2CZFA 4JHOA 3DHFA 4IIGA 3B05A 4HYRA 1EBGA 3DFNA 4ZO6A 4R7WA 4NT0A 1DWIM 3B8DA 2XU2A 1X7IA 4H7VA 4RKAA 2PURA 3SUWA 1LP6A 2YLLA 3D6NA 5AYYA 4MNMA 4WRHA 3T09A 3S42A 4M51A 4DJEC 3AIVA 4EWND 1S2UA 4NILA 2CZ5A 4N7QA 1CGYA 4LSBA 2C14A 4Y90A 4GCXA 1K9TA 1Z89A 2GJLA 4YTSA 1QNSA 3FOKA 5E0FA 3TX9A 3R6IA 3TTEA 4OFCA 1TPDA 1DEDA 3IIPA 1WO2A 3E0WA 1M01A 4AHQA 1FKXA 1KFBA 3WO8A 4URIA 2QJNA 4C1KA 1RJQA 1CTNA 1ISZA 3CC1A 1MEWA 1M41A 4M3PA 1A5OC 2CFFA 3WQEA 2PDBA 2CLMA 2FHFA 4E38A 1H7RA 1JZ4A 3RJYA 1UR0A 3WQWA 1TV3A 4ECLA 1H7WA 2PLJA 4XZLX 2C79A 2DW7A 3N2BA 4XBJA 2QT3A 4N2YA 4HU0A 1KM4A 4H9MA 2VC9A 2G3JA 3P3BA 1W31A 1M6JA 2J13A 3T81A 1A5SA 3L5AA 4A3RA 1MI3A 1XQLA 1S5WA 5HWNA 2DQWA 4WJ8A 5DELA 2PS2A 1RK6A 3AXHA 3GHSA 5DCEA 4J3UA 5C9RA 1MMFA 5BWAA 3W6LA 2YX0A 3MUXA 3M0JA 5EU9A 2BX7A 4D6FA 2BY0A 2PRLA 2XFRA 3ZQ9A 1MXSA 4QLJA 3K5XA 1FWCC 1PV8A 4A4AA 2G3IA 1W9BM 4XZNX 2QW5A 4GQRA 3VA8A 3YPIA 4O16A 4V15A 3APGA 4L4LA 4UCGA 3TOYA 4WGHA 1RBAA 1J0KA 3C86A 2CNCA 3FVDA 3WSUA 3W2MA 3WJZA 4PMRA 4L80A 2E4TA 3OQEA 1TV4A 5F1VA 1YNQA 1UR4A 1UZDA 2IS7A 2YJQA 1SO5A 3L23A 3V0TA 1YBQA 3GC2A 2EPKX 2WC3A 4CEUC 2AAMA 3NQEA 3SM0A 4JTHA 3GY1A 2ZA2A 3KZPA 1R38A 3WDPP 4QR6A 4UMCA 4FOKA 1XIGA 3WELA 2PDCA 2VO5A 1QFEA 4QX4A 4UZSA 4KRZA 1DQUA 3DFYA 3L4UA 3MSRA 2PMQA 3PJUA 1IF2A 4KGLA 4R34A 3MSDA 1UPMB 1NQ6A 2CZVA 1A53A 3QC0A 4LYQA 1YTEA 4KWOA 5XIMA 1M7OA 2G5WA 4XZBA 3IK4A 3AIQA 1SUXA 3FLUA 2XDFA 4MJ2A 3W7JA 2G3FA 2Z2UA 4RXGA 2GUUA 1XYZA 1M9HA 3VKCA 4KWSA 1MO0A 1GKRA 4GXMA 1A49A 1TVLA 3DFOA 1QAPA 5DMLA 4RZBA 2V3FA 1P7TA 2D2HA 2WSKA 4XUGA 3NO5A 5CG0A 3UBPC 3BMXA 3HZ3A 1QNPA 1FWHC 1ADOA 3TAOA 2PZNA 2OGYA 3OJGA 1SJAA 4PCFA 2Q09A 3NPWA 3WEOA 1W9XA 4JYFA 3CYVA 1UR2A 3S2CA 2QVHA 4BQ5A 2OYMA 4NX5A 2ZE3A 4EPDC 1FA2A 4LJ3A 1ZSXA 1ZJBA 2Y89A 3ZJKA 1J0YA 3R8GA 2E0PA 2HK1A 4Z2HA 2O55A 1EIBA 3GNNA 4RE3A 3M0IA 4WHBA 4E0CA 2FPVA 4JDBA 2BXYA 4MNJA 1Q85A 4G7EA 4TX9A 1OEPA 1TFVA 3PK7A 3WLIA 2GLKA 4DVOA 4UMBA 1FH8A 2YGYA 3BLEA 3EXRA 3TH6A 2EG8A 1BWVA 5GJMA 5GQBA 1IHIA 3P61A 1R2TA 2IKGA 2A3BA 1JAKA 4M82A 3KRBA 3KFTA 1V8EA 1V6TA 4NZ1A 4W5UA 3E5BA 2GUYA 4YHEA 4XSMA 1GQIA 1TVNA 3OLIA 4IWWA 1BPLB 4IQLA 2OR2A 3TZFA 5K4XA 3TXZA 3G1FA 3LTYA 5AYIA 1XRSA 2ZQ0A 3VXGA 2PD5A 3R58A 4YHGA 7A3HA 4R53A 3KOXA 1UUOA 5T26A 1HP4A 1UA3A 2GJRA 3UVAA 3KXQA 1E5JA 4B5WA 4ZGYA 3AISA 3VK5A 5T8GA 2OCZA 1TWDA 1OX5A 2BNJA 4PMOA 4W7WA 2ZUTA 5B80A 4P7NA 2Z1VA 2F2KA 3CZ8A 4RZ6A 4CQ8A 1KRCC 3WZ0E 4LRTA 2OYLA 4J3XA 3O07A 4HU3A 4NJJA 4C6JA 4QE5A 1QWGA 4HPXA 4BK9A 3I65A 3IIZA 3GTXA 1TJ1A 4D72A 3W81A 3W7PA 4C6FA 3V0UA 1QUMA 1BSLA 1IT8A 4F3HA 4MLJA 3LHVA 3QYQA 1JCMP 3BH4A 3TNOA 1WV2A 2VHLA 3NL2A 4WY0B 3U7BA 4NX0A 5HQLA 3CB8A 1B3XA 3W6YA 4MKNA 3D5HA 4IMGA 4ZQNA 3PBGA 4KF1A 2P50A 3T0CA 3WH6A 4ZO7A 3B9AA 3B3DA 3QJAA 5E0CA 2L5HA 3COTA 1D3GA 1QW8A 3ZLFA 3CPGA 1XM3A 4XBKA 1KGUA 2ZRUA 1SO4A 4CQCA 1LRQA 1F6YA 1WZLA 3SCOA 1JEZA 2BS9A 2I56A 4LVFA 1RBLA 4G2DA 3TLLA 3MT1A 1Z9AA 1EKOA 4N9BA 3E12A 1CX9A 3N6QA 4MMWA 1OC5A 3CZKA 3WEZA 1FWBC 1BGAA 1BVZA 1R46A 2FZMA 1XYLA 1D3CA 1I1WA 2ACUA 7TAAA 5H1WA 3WEMA 4NNAA 5ABTA 3CUHA 3UPWA 3TLQA 4H01A 2E40A 3L0GA 3T07A 2XN1A 3PWAA 3EMQA 4DAFA 1UOZA 5BROA 4F79A 2OGJA 3AZRA 4XKYA 1JUKA 2ZZ2A 3PTQA 3WF2A 3WMSA 1GCYA 2GOUA 2C1HA 4XV0A 4DPQA 1PX4A 3WLSA 4NUWA 5HR7A 5I07A 5FI8A 2QMJA 3GLCA 4XISA 1OCBA 2HS6A 2OFJA 4B9ZA 3HN3A 5HXMA 1V02E 3LRLA 3UERA 3AMCA 3MSYA 3VILA 2X30A 2GZXA 1ZL1A 4B5SA 4S3JA 1QVBA 2HROA 1ECQA 1GEHA 2YDQA 2ZUWA 3WF1A 1QOQA 2NUXA 3S83A 1HL8A 1UROA 3R25A 4HBKA 4N9DA 1OM0A 3UF9A 2R1PA 1MRAA 1CGTA 3CZEA 2YFOA 3LM7A 3W07A 3SDOA 3QQ1A 1AL8A 2D23A 3W7GA 3CAKA 3GTIA 1B2YA 1MUCA 4DJDC 4XB3A 4D8AA 4WJEA 1X1ZA 3RK8A 4FHAA 4LFYA 4B4FA 4D6JA 2VDIA 3OVRA 3S6DA 1U1HA 4JTEA 5F2MA 2PBOA 4M56A 3SCUA 1RCXB 3APTA 4Q3MA 3LPFA 3VDCA 1GQLA 3N9SA 4ICNA 1LL7A 4LWWA 3C2OA 2MNRA 2REQA 2XIBA 3RLHA 1E73M 4B4HA 4GACA 1HJUA 3HM7A 1U1UA 3SRDA 3VM5A 1DJNA 3MBDA 3SN4A 3DHPA 3EWCA 1H62A 4UTUA 3BLKA 1ESWA 4LYKA 1S2VA 3ITVA 2OWCA 4HGXA 2BSLA 3KTXA 1AW2A 4A8IA 1LWHA 3ZT6A 4BI7A 2DZAA 1KTCA 3DFSA 3GKFA 3CMFA 3U0HA 4A8NA 1V5XA 2FGLA 2OKOA 2O4QA 1OFAA 2FDSA 3BLDA 4LEFA 1NP0A 1MXGA 1XC4A 4B5VA 3E5PA 4KESA 3BOXA 3VKDA 1GOOA 2FVKA 2VENA 3LDVA 1QATA 8CGTA 1XD1A 3QPZA 3VGHA 1RPKA 4Q8QA 1K7FA 1XLJA 4ACZB 4HA1A 3KCLA 3RU8X 1X98A 3N73A 3WQ4A 3BLPX 1JG9A 4DRSA 5E70A 4I7VA 2NV1A 1P0KA 1A5NC 3A3XA 3U3HA 3M5XA 5CZ0A 3WD1A 2NVAA 2XH4A 5HMFA 3IIOA 3A12A 4DXVA 3W85A 2BXZA 2CPUA 4O52A 1A3XA 3LZ3A 3K1DA 2HRWA 2QIIA 4ENLA 3A23A 2XFYA 2WMKA 1WZAA 1MYRA 4QLKA 3ITCA 4H8HA 1BEUA 5M03A 4LV4A 3FA4A 5CEWA 1WE5A 2F38A 4UTLA 4FX8A 3EWUA 3HGSA 1R5YA 4JR5A 2QCCA 1KFLA 1WXZA 2AKMA 4P5UA 3ARZA 1R9YA 5H6HA 4O53A 1TRDA 4CQAA 2BY1A 4ZVJA 1XBVA 2VD9A 5D32A 3G1XA 4LUJA 3QHMA 1IQ8A 1CXLA 1MQRA 3LGDA 5FF3A 3L0NA 3NZQA 4C65A 2WSYA 5CAHA 2WVUA 5K4ZA 1TELA 1LDCA 4AIUA 5D9OA 2GJXA 2DJLA 1RP8A 1WAWA 4RNFA 1PE1A 4C1NB 3GNPA 2V5BA 4AFYA 3BURA 2QUTA 3N17A 1A5LC 1CEOA 3UA4A 4N4PA 1YW1A 1PZ1A 2UV8G 4QG8A 1WX0A 3EWZA 2AKZA 3S0CA 5HATA 5FSEC 1BYCA 3TJ4A 1W8SA 5I77A 3KL3A 3QLDA 4XG1A 3H2MA 3RO8A 3H2EA 3GDKA 5G4WA 2I5GA 4OBSA 4H41A 4DF2A 3T4CA 4HOXA 2WSQA 4MY1A 4AEOA 1XJBA 3EKZA 2FDMA 4DWSD 3UWEA 2O0TA 2OSYA 3EEZA 4IPLA 4RUBA 4GQGA 3AIUA 3EKGA 5CH9A 1HVQA 1IEQA 3DHUA 3DESA 4IMEA 3WL0A 3Q4DA 3BANA 4UIOA 1R2SA 5EMJA 3AQUA 1SFLA 3OBEA 7ODCA 1WXJA 4M1BA 2D2GA 2YA2A 4UFIA 3CUXA 4MOZA 1XH0A 1UD2A 4BKNA 3FJLA 1HJVA 2FMNA 3FA5A 3SQLA 2XSXA 2XVPA 3VGDA 2BG5A 4C60A 4MYXA 1Q8AA 4QTGA 4JTGA 4RZ4A 1GKPA 1S38A 1IT7A 1EC8A 3IAQA 1SGJA 1SMDA 2JKAA 2QR6A 3NWRA 3TQ0A 5EMLA 4M19A 4AD5A 3BV4A 3EX6A 2E5BA 3B8IA 3ZYZA 1KR0A 1OYAA 3P5YA 4MNKA 3EWWA 2YDSA 3CO8A 3WNPA 1MXDA 3N2OA 4W87A 4Q4SA 3CEUA 3M16A 1Q66A 3BVJA 2DT1A 3GTNA 4MWAD 4HK5A 4EXAA 3PBYA 5AZ1A 4PCTA 3ZVHB 4KWUA 1H7PA 1WNOA 1E40A 2WMIB 2BHUA 1QDSA 2PI6A 1E9YB 1E1CB 4WDWA 1Q6OA 4I6KA 2X0SA 4NYUA 1BSIA 2VI0A 4O15A 2CLLA 1JCXA 3U4AA 2VZVA 5CZSA 4LAUA 5DEZA 1L2UA 1EQPA 1WZKA 1SW3A 1QO5A 3LEPA 1B0IA 3S1GA 4Q4MA 4PMZA 1PZ3A 4QM1A 3ORWA 1JUBA 2YDRA 4DF0A 3W70A 4GC4A 1G9HA 4JX4A 3BSHA 3IVUA 4GLEA 4IISA 1OD8A 4UTKA 3ME3A 4W7VA 4OV4A 1TWSA 3NVTA 3BUVA 1VCFA 3MMUA 5HJLA 2R14A 3ENLA 1F3WA 5G1YA 1YTDA 4JQAA 1ONWA 3MQTA 1XCWA 1VYSX 4L4MA 4ZOEA 3W7EA 5K9CA 3QV8A 5JH2A 4R3UA 1E6SM 3WD3A 4JTIA 4DNHA 3WUBA 1E6QM