4I9JA

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to dic4pc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
302
structure length
302
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 122
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i9jA00
2ZKMX 1PTGA 4I8YA 1QATA 3KS5A 3L12A 3I10A 3NO3A 1DJGA 2OOGA 1DJWA 1AODA 2PTDA 4I9MA 4QJ4B 2O55A 5PTDA 3EA2A 3OHMB 1DJZA 4QJ3B 3EA1A 3PTDA 7PTDA 1DJXA 3RLGA 3V18A 3V1HA 4RW5A 1DJYA 3MZ2A 5T91A 4QJ5B 1T6MA 3QVQA 3QR0A 1VD6A 4Q6XA 4R7OA 4RV3A 1V8EA 2OTDA 4PTDA 4S3GA 3QR1A 5T9BG 1DJHA 1DJIA 4F2BA 3H4XA 1O1ZA 4GNKB 1T8QA 2PLCA 2PZ0A 1XX1A 2F9RA 3CH0A 4I9TA 4I9JA 5T9CE 4RW3A 3RLHA 1PTDA 4F2TA 3H4WA 4I90A 3EA3A 4F2UA 4OECA 1QASA 1YDYA 2FJUB 2OR2A 3V16A 3KS6A 6PTDA 1ZCCA 1GYMA 2ISDA 2P76A
chains in the Genus database with same CATH superfamily
4ZOCA 4JQ3A 4FNSA 3N2XA 4RJEA 3DG7A 1MUCA 2J78A 3ABSA 3WNNA 4G56A 4W89A 3LRMA 1E1CB 1W1A1 4DM1A 3S5OA 3L4UA 4GKLA 3QW3A 3IVSA 1PX4A 4D1JA 1GYLA 4M1RA 1IEWA 4LB4A 1JD9A 3K4AA 1S5MA 3MMUA 1E9YB 2YFOA 4URIA 1CGUA 4U3CA 1QNSA 2DIKA 3KHJA 1W6TA 2DT0A 1GJUA 1TJPA 1FY6A 2A4AA 3T0TA 2EHHA 1CLVA 3T05A 1JDAA 2PEVA 3P84A 1HJWA 1QW7A 3LCHA 4BK9A 5A2CA 3MBFA 2CZEA 4JCMA 5MKGB 1Y7VA 3CM4A 4AZCB 4FXSA 4DAIA 4J40A 1PZ0A 3HZ3A 3W37A 4US5D 3ARYA 1UKTA 2D73A 4HMEA 3PBGA 4MNKA 3O07A 5E09A 3VNYA 5C2CA 2R1LA 1DJYA 1O12A 4UCFA 5DY2A 2OYLA 5AHEA 2B31A 3UG4A 2HVMA 3R0UA 1IYXA 3IJDA 3CTLA 2J7HA 1JUBA 1NFGA 4IXXA 3ELFA 1TG7A 4X9YA 4HN4A 1KGWA 2ATMA 3FAXA 1IIGA 4JIPA 4PRWA 1XPYA 4AC7C 4H9VA 1ODZA 3ITGA 4GQQA 1CXKA 1R86A 2C15A 7CGTA 2QEZA 4HN8A 3T0CA 3AZRA 3CV1A 3LS9A 4HA0A 3LPGA 1JRBA 4WKFA 1X8CA 2HISA 4Y9MA 1XLMA 3FLUA 4N42A 1JF5A 1TV8A 2V67A 2PLKA 4M80A 1UC5A 4M82A 5EMLA 2ALRA 2IKGA 1BRLB 5CGTA 3VMOA 4GIYA 3VXGA 4D6GA 1XBYA 2DY3A 2BVDA 2XM1A 5CH9A 3WEMA 4N9DA 1KRMA 3UCDA 1H4PA 3SSJA 3AS2A 4FF5A 1XHGA 3C0SA 1U22A 4I3GA 1NSJA 4FXRA 5I77A 4MY9A 4PRTA 3BVJA 4MLJA 1YDOA 3DHFA 4MFDA 1DKWA 1YYAA 2DP3A 2FYMA 2FMNA 2E0PA 3SO7A 2HZGA 3NR0A 3F7JA 4Q4PA 4AY7A 4EPKA 1HTIA 1ZBKA 1XV8A 2O55A 2Y8UA 2WKGA 3KRZA 2VFFA 4IFKB 1NTHA 3GAYA 2YL6A 2HNEA 1EOKA 1SO3A 1S2VA 3DDMA 3KCOA 3KAOA 3GU9A 1R46A 5ECUA 3PBUA 4GI9A 5DMNA 4MJ4A 1BFNA 1C3FA 3K4DA 2DVXA 3M5YA 1F74A 4Z42C 1W1YA 2BGSA 1OIFA 3LV5A 3KL3A 5EU9A 3MI6A 2X05A 1OT1A 3CPRA 4W84A 5BW6A 4H8UA 2OQLA 3H4XA 2DVUA 3EX1A 1V3IA 1WV2A 2WNNA 2OEMA 3CU2A 3CT2A 4PFMA 3O15A 4XZNX 5BU9A 3TCEA 1UMYA 2WVVB 1A5OC 3LQGA 3VC5A 3OHMB 4KIRA 1FOBA 4XSMA 4REQB 4G7FA 5DO8A 1DWIM 2F61A 1UP0A 4PCSA 2Z2BA 1WXYA 2X42A 4AYSA 3T2PA 2ZUNA 2VGBA 1KM1A 1QBBA 2PDXA 1X8FA 4E38A 2DFAA 4Z08A 5MF5A 3TQPA 1EF2A 1UJPA 1UHVA 1MDRA 2DSVA 3CUGA 2Z6IA 3HGJA 1BWKA 2VC5A 1TJRA 3MO7A 3EYPA 3GHTA 3PAJA 1B9BA 4B16A 4B9YA 1KGXA 1JL8A 1R7OA 2HROA 3F5LA 4ZB0A 1OCJA 3NOYA 2D2JA 1XQLA 3CUFA 4FX7A 3GAKA 4W93A 4MWAB 1ECEA 4LVBA 3G22A 1O94A 3SY5A 1B3YA 4ZQRA 3QEZA 1QOPA 3BPWA 3L0GA 3ZJ6A 2WMGA 1RUSA 3XISA 3K30A 1MMFA 2BY0A 1NFBA 3SCWA 4WDXA 4A8RA 2ODOA 5LIYX 1S46A 3M41A 3QSRA 4KS0A 1EYWA 1O6IA 4NAEA 2J9ZA 3NQ2A 1R3VA 2C13A 3TOYA 4PEKA 3ARQA 4I5XA 4KEMA 2KAUC 1C29A 2OT1A 4J3UA 4QSHA 3WBYA 2V2CA 3THUA 1ZSXA 3AXKA 4KRTA 4F48A 1BYCA 6XIAA 3WDQA 5EPDA 4S2BA 3M47A 4MMWA 1KRCC 1DJGA 1EQCA 2FVMA 4Z1BA 4JL2A 8CGTA 4Q4OA 3VKKA 4AW7A 3ZJKA 6A3HA 4MB4A 5IM51 2ACRA 1AL7A 1XUUA 4RV8A 4U28A 2DQWA 4DWSA 3C2YA 2XM2A 4I90A 3KM8A 4LAZA 4UR8A 4US5A 1L2UA 2WJFA 1BLIA 1B0IA 1J2BA 3U7BA 4B90A 5F1VA 4UFJA 1LBMA 2UV8G 3TIMA 4ZSTA 2NVAA 3SDOA 3NQBA 3C3UA 4W5UA 4V27A 4GA8A 2E9BA 4Q8TA 5E0CA 1FWIC 1YDYA 4IIDA 1J0JA 2QJMA 2TODA 4GY0A 1OZMA 3SRDA 1LZOA 1AW5A 3P81A 4DPPA 1HNYA 6CGTA 3VGGA 3U4FA 2ZE0A 4I7VA 5LIXX 2ZTKA 1EGVA 3U0HA 2NX3A 1OFQA 1XLAA 3HO8A 1YIXA 4GX9A 4IPIA 2BZNA 3GLCA 5I02A 2WHMA 1KM4A 1FWDC 4IH3A 3URNA 3O9NA 2ZC1A 4GZJA 1W32A 1E0UA 3PZUA 3EDFA 3JZEA 1MZRA 1JPDX 4GO9A 4MY1A 1US0A 2PDYA 3TQ0A 1K03A 4DJFA 5D30A 4AHOA 4PUWA 3GW3A 3IJ6A 1MVYA 4GG9A 4WZHA 1T6MA 1HKIA 3PZIA 4G7EA 5DCBA 4PRRA 5AYIA 1ZY9A 5HWNA 1CBGA 3T09A 3LENA 3T8LA 4O53A 2Q6ZA 3KZPA 4RNHA 3K2GA 3ISIX 4Y6GA 2WSQA 4CD7A 3B9NA 3B8DA 3M0LA 4MVAA 3GHSA 2X2YA 4GABA 2QULA 5BXPA 3VGBA 4HNUA 1W3LA 3RLUA 1GGOA 4JTHA 3C2VA 1F3EA 3CB8A 1LLZA 1R9XA 5I09A 2PGWA 1QO5A 4Z1CA 4M8UA 4MM1A 1B3XA 2XJ7A 3UR7A 3UJRA 4EPDC 3WK1A 3IV8A 1FHUA 1GG0A 4QM1A 2IKHA 2ZRZA 1K02A 3U9IA 3TEVA 2QUNA 3IJ9A 2QDHA 5CGQA 2YDAA 3ABZA 1H0GA 2J62A 3W74A 3T08A 4B4FA 1B54A 3SUTA 3NQEA 4O11A 4GUHA 4O10A 1WKFA 4UZUA 1OJXA 2DVTA 5E6YA 2PTYA 4TX6A 3KLLA 1DBTA 1F2JA 4LAMA 3DC0A 3UZ5A 4DIAA 1RH9A 3W85A 2E67A 4JTLA 2EF9A 4G1NA 1S2WA 2CEQA 2GK1A 2FTPA 1PO9A 3NVTA 2OO6A 3MI3A 5LNWA 3C8FA 4V2XA 2VP8A 4C6JA 4NIRA 1JQVA 3SY8A 1ONWA 1SSGA 1XGZA 3QOMA 1GZ1A 2B7OA 4AH7A 3A24A 4QNEA 2J7FA 2PD5A 4R7OA 2DZAA 5T9BG 5IFPA 1TA3A 3LPPA 1JCXA 1S2TA 2OJPA 3ALFA 3N4FA 3N19B 1XLFA 4A6GA 2P76A 5JH1A 1MW1A 3MSRA 4L9YA 4C5YA 4C90A 3QFWA 1GOWA 1J10A 2WV8A 4O1CA 2PTXA 5A6SA 2REQB 4LYPA 3I4KA 4Q4RA 4CNOA 1IIHA 4GXWA 4EAMA 2ZXAA 2OODA 2PLMA 4GLEA 2GQ3A 3SR7A 1I6NA 4BI5A 1FVPA 1LP6A 4ZTXA 4GCAA 1VJIA 2GGGA 3LX9A 1OHLA 2DW7A 1W3NA 4KF1A 3WFZA 1TVLA 2IMRA 3TYUA 1YBQB 3AIQA 4WOQA 1GVOA 4IPJA 2HS6A 2IQDA 4MSSA 1QASA 1RLCL 2WW5A 3GU2A 1UWQA 3SCTA 2XGIA 4LUTB 4J3SA 3IACA 2Q09A 4IFKA 4O18A 4N6EA 4LU0A 2Q71A 4BR1A 1UD3A 1HQTA 5L6UA 4BCEA 2VR5A 3AJ7A 2VZOA 5A8MA 1TV2A 2PU0A 2WCSA 2J79A 3PSWA 3G77A 4CU6A 3RDKA 3XIMA 4YWSA 1JG9A 4TR9A 3CZGA 4A8LA 2F6XA 6PTDA 1Y5WA 1PTGA 1O60A 4W5ZA 3OTRA 5D03A 1JPIA 2CLIA 3ZT6A 4DWSC 1GQIA 3EX4A 4NU7A 5IRPA 5HOSA 1L8PA 4G5DA 4EVZA 3HJEA 1ISWA 3POHA 3NQDA 3VZXA 1JCNA 2PD9A 1W8SA 3DAQA 2ISFA 1PX8A 1EJWC 5CJNA 3GTHA 1R2RA 3UWZA 1CXLA 3FX4A 3USZA 2DORA 5J04A 1TUFA 2CIPA 1K77A 3OEXA 1S1RA 1GVIA 1H0IA 4JFSA 3WLTA 3F5JA 1KXVA 4D1IA 5H8MA 1Q3NA 3P14A 2VEFA 3BLDA 2PZNA 3DCPA 3WLQA 3WBEA 2RGLA 3TJLA 3C2OA 3UR5A 1CW2A 2BX7A 1HKMA 1SSDA 1E40A 3W1RA 2CU0A 1VBRA 1DTUA 1KBJA 4JS3A 3VD4A 4UNKA 2E40A 3ZJ8A 4LALA 4GWEA 3UXKA 4US6A 3WQCA 4LUIA 4JGDA 4JTTA 4FLQA 1XXXA 3BJTA 4JQ2A 1RHCA 1E4LA 2WPBA 4EP8C 4L6OA 2VT0A 1OINA 2CPUA 3GDTA 5C7VA 2XVKA 3PY2A 5D4YA 3LGGA 2RGMA 1VJZA 3W22A 3WLRA 1QVBA 1MEWA 2Z1SA 2PDPA 4HPXA 3U4AA 2VJXA 2VC9A 3LI0A 4XAPA 4GVGA 4ZFCA 5I3KA 1Q63A 1XRVA 1F4AA 1WPCA 5HWMA 1HFBA 3MV01 4JX5A 3SCNA 3UWUA 3W2UA 3A4XA 1YDVA 3QC3A 1NQKA 5DFAA 2CERA 3QTGA 3C0QA 1OVDA 3I7RA 5HR7A 3L66A 3W0KA 1K7EA 1H7NA 1E72M 3TMLA 3W7DA 3FSTA 4HPJA 1DVJA 3H12A 4FXJA 1MYRA 2YCJA 4Z2HA 3CHDA 5HXMA 2NQJA 1AZ2A 3RM4A 2EPNA 4JQ1A 3AMKA 4JFWA 1OGBA 3U2ZA 1UD8A 2PWGA 1LF1A 2QS8A 3T2QA 4KH2A 1ZLPA 3CNYA 3QY6A 4PUUA 5KINA 3IV3A 2VDHA 2J47A 3EWXA 3DBNA 5HNTA 4OIFA 4AXKA 3LMZA 1IWPA 3BK0A 4LVAA 1ZJAA 1LOLA 3S1VA 4K3ZA 4S3BA 2VGFA 5EBUA 1C9WA 4C6CA 2B81A 2Z26A 2ZUWA 1OX5A 1FWWA 1DWAM 1H61A 1KXTA 4IIFA 2WWCA 2WVTA 4TXEA 3NO5A 5HAOA 1SJCA 3FYPA 1YNPA 3WMBA 4F2BA 3PTKA 1CLXA 3G1XA 3TONA 4GKTA 2QF7A 5D02A 3MW7A 1NFPA 1DV7A 4DYKA 1SFJA 5CPQA 2G5WA 3KE0A 2WXDM 4F4RA 3BSMA 2EKCA 4RR4A 1LG2A 1K6AA 1U30A 3EEZA 3UA4A 4GC4A 1FXQA 4Q4MA 3DBPA 2QHAA 2V5KA 4UTUA 4ORIA 4N9EA 4NZ1A 1YE4A 4TMCA 4GBDA 4ZQPA 3KOFA 4FALA 4FOJA 3UZZA 4LYRA 1R3TA 1VYPX 3TW9A 2RDXA 4RK8A 1FBAA 2PA6A 5EFFA 4Z1DA 5A69A 2P50A 5KMYA 3AALA 1ADSA 4IT1A 2YCLB 4M6QA 4WKHA 4MGGA 4GMEA 4OJYA 1M9HA 1ZPTA 3GC4A 5C55A 1KM6A 3NUKA 2EBNA 5JQ9A 3TC6A 5BXTA 2NXGA 3I3DA 1GVQA 3I4EA 2PAJA 2W0UA 3WLIA 4EX4A 2WC4A 3VZYA 5KZDA 2BXVA 3NNTA 5XINA 5LSMA 4GY7A 4CNTA 1E5JA 1OGGA 6REQA 3PVFA 4QLKA 4F2TA 3YPIA 1JGIA 2JF6A 3B0XA 2V5DA 1TKKA 3QF0A 5A6BD 2HMCA 4MUPA 4WIWA 1VFFA 1QNPA 2FHBA 1I2RA 4J28A 2W62A 1J0IA 3A13A 1JULA 1Q45A 4H9YA 1V3KA 4W86A 4UTHA 2OLHA 4P2VA 3GH4A 4GZIA 4XUGA 2OX4A 1Q66A 2YPIA 2QDGA 3SGZA 1W37A 1Z44A 2A1YA 2BOEX 4MOZA 1PJ9A 2I14A 1RY0A 3GNPA 3P8IA 1UZHA 4XKYA 3FW6A 4FLOA 3GYCA 4HYRA 4Q8WA 2R94A 1V93A 4XZ9A 4YU1A 4A4AA 3MMTA 4L1GA 4JIQA 4HNOA 1X98A 2WHLA 4QS5A 1I45A 3SUSA 4LV4A 4HNNA 1I2OA 3GW0A 3WJYA 1AJ0A 1DQWA 1I0BA 4RNJA 3EWUA 3DERA 8TIMA 1LBLA 1UROA 4V33A 3WNPA 4XX6A 1WDQA 1V0NA 3JUGA 1CXEA 2NLIA 2PWHA 4Q7NA 2Y7EA 4UQAA 3WLOA 1TQJA 1TA3B 3UZXA 4H6EA 1BF2A 2QJIA 3NQ7A 1OK6A 1DJXA 3VKCA 1POKA 4CNNA 3LEPA 3WLNA 1LRNA 4AF0B 2GYIA 1XKJA 3THAA 3FXGA 5C2XA 4O8AA 4DJEA 4PTMA 3FEMA 1A5LC 4U4MA 5EB8A 1JCTA 1JDEA 3LV6A 5D2XA 3DG6A 2XH0A 2FTWA 1RXOB 1H7RA 1LT8A 3AO0A 5FIPA 1MRAA 2WKLA 2PBOA 3LTSA 2VEKA 5HJLA 3QPEA 4IL2A 2DZSA 2Z00A 1M6JA 1BRLA 5M3WA 2X2GA 2BGNE 1TE6A 5I23A 4FZIA 2EEXA 4JDBA 4HTBA 3WLKX 1GONA 4EF9A 2EJAA 1TPEA 1Y65A 4I7WA 4OE7A 1NM9A 3VOFA 2DZTA 3VM5A 4Q3MA 1BVZA 1RD6A 3GWQA 1LRTA 1JZ3A 1TIWA 4DWDA 3PZVA 3H7VA 3D47A 1FH8A 2QAFA 2FH8A 4C1NA 4GE8A 3QHMA 2YB4A 4BF7A 1U5JA 2YA1A 3GTFA 4XZWA 9CGTA 5A6KA 1A5NC 2OPJA 3APTA 3SUWA 3PB0A 4GI8A 2NUYA 4W88A 4PUEA 4QP0A 3N2TA 3EXTA 3MBDA 1RPKA 3MANA 1YHTA 3CS2A 3UWWA 3WF1A 3NYZA 4DJFD 1TQXA 1J5SA 3W82A 4B5WA 3O2LA 3BTNA 1ZAHA 3Q2DA 2WSYA 3EOEA 1DJZA 4MAVA 5CC7A 4L7ZA 5FF2A 3E3HA 4MZYA 1DIOA 5FJIA 3W29A 3AUOA 4UFHA 1V6XA 2F9RA 1E51A 3XINA 4P7QA 1W2PA 4PEEA 2E6YA 3E2SA 1PDYA 1RQEA 4JCLA 4MF4A 3MUY1 2Y2WA 1E0TA 3CYVA 3TFXA 1NH6A 4QJ4B 3GDRA 4WUIA 3AI0A 1CGWA 3GBDA 1W9UA 1N7KA 2FFIA 4WY0F 2QXWA 1KTCA 3CAVA 3EOLA 3F2CA 5F4WA 4RE4A 1VS1A 2QIIA 4HNCA 3WLJA 4MZ8A 4PTXA 3FV9A 3ZVIA 3CQHA 1QFEA 3M0ZA 1EJXC 1WX0A 3R0KA 3CMFA 3S5NA 1QI3A 1CLKA 2ZICA 3RYSA 3TVAA 2UBPC 1CGYA 3AXHA 4DRSA 2CLKA 4NKCA 2PDHA 3GVVA 2BOFX 1OCQA 5C71A 4ZOBA 3N9KA 3GH7A 2IPFA 3DFOA 1W1PA 5I07A 1D7FA 3OLGA 3A4WA 3VDGA 3GVGA 1W2VA 1MW2A 4XBSA 2G37A 4KERA 4AB4A 4CVWA 3LERA 2A3BA 1DIEA 3NXFA 2ZZ3A 4D6DA 4PMDA 1XH1A 3AWOA 4DVOA 3MWAA 1RA0A 1W91A 4IPNB 3WKZA 4XTIA 4KRUA 3F03K 1V6WA 3CQIA 5FACA 3WJZA 1DJNA 3UWVA 5TNVA 1MSSA 3STCA 5BU6A 3PR2A 3N3MA 3BW3A 1GCYA 2FPVA 2XDFA 2C0HA 2CLEA 3MKKA 3IPWA 1VFLA 2YCIX 3DUGA 3OGRA 3B4YA 4E3TA 1E15A 2P88A 5BWAA 4R53A 4ICCX 2G3NA 2QCEA 2GPTA 3HGSA 5AHMA 3SQLA 5H91A 1E1FA 3N2OA 4HOXA 2DZUA 2CLFA 3EB4A 3CZLA 2ZZ6A 3C6CA 5CLTA 4ATWA 3T07A 3B8IA 2Z0IA 3MDUA 1QPRA 1Z7AA 1VYSX 1XIJA 5F2IA 2CBJA 2Y0FA 3V1PA 5H8UA 3MA8A 3AICA 4GVFA 4G6CA 1SR0A 2E1DA 4Q7IA 6ENLA 3E2QA 2J6XA 4HPGA 4A2RA 4PUKA 1JUEA 2JKEA 3NEVA 1OEPA 3QY8A 1TMLA 3GNNA 1OFPA 5GVJA 1DEDA 3E5BA 3V7PA 5CQ1A 3ZWSA 1TX2A 1DP0A 2FB2A 3S83A 3W7OA 3NM3A 3ARPA 4EE9A 2GJLA 4JZ5A 2G4FA 3TR9A 3ZR5A 2EPKX 1P48A 5D37A 5I3GA 4K1WA 4GC3A 1Q6LA 4WXYA 5A8GA 3ABRA 1UWAA 3NOEA 3RUBL 3IJ7A 3U5UA 4RE0A 4DUVA 1IT7A 1XYCA 3FVDA 3UR8A 1KV8A 3KOWA 1C8VA 3R89A 1X97A 1X6LA 1HP4A 5AECA 3QGKC 5DANA 3OYZA 3WLSA 4DUWA 2Z29A 5AHFA 4B2DA 2V3EA 1KBLA 1D3GA 3GS6A 4G7EB 3NZ1A 4TQTA 1WB0A 1HKKA 1UH4A 3EMZA 2J77A 3GZ3A 4BKNA 1SO5A 2FPYA 1BHGA 4O4WA 2VI0A 2OQYA 4E2OA 2TMDA 5DBUA 2FZMA 3USBA 3VTRA 4TTUA 4ERIA 1EO7A 2VDIA 1QU4A 4J1OA 3V35A 2VFGA 7REQB 2P5NA 3KBVA 1G7UA 1OYAA 3S2MA 1OD0A 1G7VA 3M7WA 4YTUA 3PN8A 3ZJ7A 3KDNA 4K37A 2ZX5A 5BWFA 5RUBA 3MTWA 2PLJA 1F6PA 4QDPA 1KFEA 5M17A 4MNMA 2VX5A 4Q8MA 1IF2A 1ZS2A 2YDSA 5IHRA 3CHCA 2P0IA 4BQ4A 2ZWYA 1C91A 3FHQA 2WMIB 1R38A 5G1YA 4A22A 2D20A 2XYLA 3UEQA 2C8NA 3VNIA 3FHAA 3MB9A 3H2FA 4HSHA 3R0DA 3OZYA 4UBPC 4GYJA 1QMLA 1C90A 4GYKA 4HOZA 1WQ5A 3H8AA 3TDFA 5DRIA 4NNCA 2DSKA 1GORA 4GFSA 1OG0A 2I1OA 1TV4A 2PRLA 1UQYA 2BMBA 5DY3A 1LT7A 4GIAA 1X6UA 3S1GA 5GJMA 4XWUA 2RHGA 2WYSA 2AMXA 4NZFA 4HTYA 2C7FA 3RPMA 1EJUC 1GYMA 4K6AA 2HE5A 3AYSA 3WLPA 3F4VA 3K5XA 5I00A 1TX0A 5U7SA 1PWMA 1G5AA 3GB6A 4ZODA 1EA0A 1Q7ZA 1ZENA 1ICSA 3HTWA 1UG6A 4HK6A 5A3HA 4O1DA 3QZAA 3BV4A 1KKRA 3BZJA 4U2YA 1DPMA 5IDZA 1R87A 2WLYA 5GJPA 1QPKA 3L4VA 1IXOA 2J13A 1QRQA 2IQ0A 4LTSA 3MZNA 4F3HA 3KFTA 4N9BA 4L6HA 4DELA 1AODA 5BNKA 4DPQA 3QFEA 4GVIA 2QCLA 4DBUA 3B8VA 1HVXA 4UTFA 4E2DA 1WUEA 3H7UA 3VAVA 4H4IA 4O4VA 1TWSA 2BWGA 3AFBA 4JPGA 1ESWA 1KM3A 1FWFC 4FIRA 1HJXA 2VFEA 5CBBA 1XR2A 3VINA 3NPXA 4DZHA 2O7QA 3FGCB 1G4TA 1A3XA 1OQFA 4ROPA 4DLFA 1J01A 2YR1A 2V8ZA 4UTTC 4IMEA 2ISDA 5GNZA 2BY3A 1EIXA 4P7LA 3O0FA 1QDSA 3RU6A 3K46A 3TTQA 2XH2A 2YX0A 1X39A 4NI8A 1S2AA 1RK5A 3UESA 5H1WA 3NPUA 3SN1A 1D7KA 1PSCA 4GY1A 2Z1XA 2V30A 4QLLA 1OFDA 1TZZA 3W7EA 3EPOA 3MCMA 1M7XA 4A8IA 3HGOA 4CCDA 2GL5A 3GX9A 2CZ5A 1H50A 5G2IA 4X9SA 3T0DA 2J74A 4JQAA 3V5OA 5B7YA 2PDLA 3ZO9A 1EBHA 4FNQA 3NZRA 3GXPA 2Y8VA 1I4NA 3UF9A 4MDPA 3NZQA 4GK8A 2ZZ5A 1PYFA 1EGMA 4NJGA 2X1RA 4MFEA 2EAWA 3SN4A 1QI4A 2PFHA 3VIHA 4IP4A 2WKJA 1XBXA 2O4QA 5E9XA 5U4NA 3SFKA 2DSWA 4F0MA 1YKWA 4O1EA 3LLXA 1M1BA 2CESA 1HO4A 5DMMA 5EMYA 2R1PA 4IX2A 4IQLA 2YOCA 3BMXA 4QG6A 3ZT7A 3DEQA 3W1MA 4LSBA 3AMLA 5E0FA 2IS7A 3UZJA 5HA7A 1E3ZA 2QAPA 5FF4A 3LCFA 5E0KA 5C6MA 3C3NA 4GH1A 4XIAA 1IEXA 1JPKA 1EX5A 4ZR8A 3N29A 4GUIA 1JI2A 4DO7A 1E6SM 1B9ZA 1SYTA 1UR9A 2GJXB 5K9XA 4PCPA 3AZSA 4WY0A 1LG1A 4RZ6A 4GNJA 4O0QA 3L9CA 2WJDA 1F5ZA 1JXKA 3RLHA 4YTRA 2MNRA 2DV0A 4DJDA 3PTMA 1PL9A 4L1WA 4A3HA 1JYWA 2OZ0A 5FF3A 2PRHA 4ES4A 1OFEA 1LWHA 4LYKA 4YTSA 3S5YA 3H70A 1S5VA 4WEVX 1SR9A 1ITQA 3NPVA 4KRZA 3B8TA 1H7XA 3OBKA 3ERPA 4YPJA 3KS6A 4MNLA 4KMQA 4WK9A 2D22A 3W3OA 4UTWA 1MNZA 1YADA 3LHUA 3ICJA 1E6PA 4BI7A 3HQNA 4DQWA 4K7YA 3PFMA 2BGQA 2UY3A 2WO5A 3SCSA 1GG1A 4RZ5A 1JZ4A 2XISA 4MPQA 2Z6JA 4XAFA 5I7GA 3VKJA 3W28A 2CHNA 1GVFA 2DGAA 3OOQA 4FPSA 4DF2A 4TVCA 2E7FA 1JQXA 4GO8A 3ABXA 4RLIA 3S8HA 1WDSA 1US3A 2WLZA 2XTKA 1Q6FA 3TWBA 3TCSA 1XIIA 3OA3A 3KBNA 3VX1A 4I8DA 1A4LA 3MUAA 1H5VA 1NU5A 3GXIA 3FK4A 2EKGA 4GOAA 3HMJG 4CLMA 1FWAC 3EA1A 4F79A 3RCNA 3WUFA 3B8UA 4AD0A 5DEZA 2UY2A 1R5YA 5I3JA 3W7NA 5C9RA 3I3EA 2RDUA 3QKZA 1OT2A 1ONEA 3MUCA 2NX1A 4W9TA 2GSEA 2CLHA 1RPXA 3KL5A 1UIOA 1ZJHA 2VX7A 1JAEA 8XIAA 3N9SA 3CZJA 3GE7A 3SUUA 4XZLX 1U1HA 1VB9A 1W5OA 1CENA 4H9ZA 2EPLX 2ZXDA 3MSYA 1W1ZA 2QJNA 4C60A 4YIWA 1ITCA 5DXYA 3DZ1A 3S6OA 4A3RA 2J24A 4GXPA 3GUWA 4GD0A 1BD0A 1ZALA 3II1A 4NHVA 1ZU8A 4Z0SA 1Q6QA 1K9DA 3RM9A 5T9CE 3GDLA 2WCGA 3BLFA 2V3DA 2ICSA 5GNYA 2PC8A 3U3HA 4JTFA 4ADUA 4AZ5A 1KTNA 1UR8A 2WHJA 4TUFA 3Q58A 4FK9A 4IJBA 4C7GA 2I5IA 1L2QA 4AD2A 3WDIA 3WH6A 3PBVA 4OECA 3RX3A 1VP5A 3WQVA 4FNRA 3WO8A 4DBDA 1EXPA 2YL5A 3R4IA 3QJAA 3APGA 3N6JA 3MPGA 1K4GA 2DJLA 1L6GA 4C7DA 3NEHA 1J12A 5FEPA 5GQBA 4JIHA 2XGZA 3HQOA 4QR6A 5HNRA 3EDDA 3CZKA 4QEEA 1OC5A 4O50A 2QDEA 1EJTC 3CL8A 1PKYA 4M81A 2Z1VA 5FESA 4BY3A 5I6SA 4AD1A 2E6DA 1BGAA 1RCQA 1RBAA 1OK4A 1XYBA 4IMCA 1UYQA 2UY5A 5FEZA 3P80A 5D38A 3L5MA 2DUXA 3R5EA 2VUNA 2OWWA 3VCCA 5AZ1A 3HFYA 3OHIA 3RRAA 1TPB1 1JGMA 1XIGA 2YXXA 4NZ4A 3NO1A 1W1B1 1TTPA 3O16A 3PZQA 4HZ7A 3W7QA 1CXHA 4Q6XA 1OABA 2JALA 3KEHA 3EKLA 2ISSA 2C18A 5M1TA 1OGSA 1CB7B 1N82A 4R33A 1E4IA 1SUXA 3CXOA 1V0LA 1N2VA 4H3DA 4BEQA 3ALGA 3AU6A 2DH2A 3L2LA 3FAWA 3LHVA 5H2ZA 1DJIA 2TYSA 1NARA 2ACQA 4A29A 1CGTA 3CWNA 1KV5A 3WF0A 1C8QA 4IGMA 4IMAA 1VIZA 1FQ0A 4L56A 3GSMA 3GK0A 4Q7BA 3ZSSA 4JKKA 4PE8A 1J5TA 2WSKA 4PTWA 1VFHA 4MLRA 2X7WA 3GXMA 3KTSA 3DECA 1KM2A 3MU7A 3KS5A 2XWDA 5K7JA 2W61A 4JOMA 4H6QA 4TV6A 3ARRA 2NV9A 4KPLA 2Q02A 2YXOA 4EKJA 1Q8AA 5FJPA 2CLMA 1F76A 3MP5A 3UP8A 1GEQA 1VFOA 2XGBA 3E0FA 1BPLB 3B0YA 1K3UA 1OWQA 3T81A 3PPGA 4OBSA 3NQFA 3OODA 1Q7QA 4NT0A 1OBAA 4R9XA 3S9YA 1AQ0A 1AH4A 2PDBA 2RJHA 4RCXA 1GZGA 1EL3A 3DFQA 4QBXA 1QXLA 2P3ZA 2VEGA 2JKPA 3BARA 5LXXA 5EY5A 3UJEA 3UD6A 1JYVA 1B3WA 4QJ1A 1XIEA 3JVAA 2E6FA 7REQA 1F6KA 3VNLA 2E25A 2PMQA 4S1FA 4ZO7A 2FH6A 1BF6A 1KD0A 1VH7A 4UWMA 4V28A 5LA2A 5E93A 3OB8A 3ZT5A 1LQ0A 2G3FA 4JY8A 3TWAA 3SQMA 1R30A 4C1LA 1R9ZA 2QQ6A 3HOJA 3PTQA 3V5CA 4ZO9A 5I2UA 1KCKA 1NDVA 1VZWA 4UFMA 2L5HA 5EGRA 1TMHA 1IQ8A 4J3VA 1RBOB 2EG8A 2ZOXA 4O1FA 4L5ZA 5F1UA 4RNIA 4ZO8A 4S3AA 5L9FA 2CHOA 1HX0A 5TAOA 3TK7A 3WL0A 4QE1A 1P0EA 2W63A 3W1PA 3P93A 4H2HA 3SCRA 1DJWA 2VM8A 1FWGC 3LZ5A 1JZ7A 2YGYA 2WB5A 1F9CA 1PWLA 3HG5A 2IXVA 1BXCA 1L0PA 5REQA 3TYCA 1E55A 2HS8A 2YBVA 5FEWA 3K8KA 4YYCA 2FZNA 3BANA 5HUOA 5CSRA 1Z89A 1RLDA 3FEQA 2A3LA 4O19A 1HIZA 1M5WA 2A21A 3NURA 1E4MM 3U8GA 3G3MA 4ZENA 3J7HA 5DBTA 4IG2B 2BBFA 4MNJA 2NQHA 1KLYA 1XIBA 1DL3A 2YSWA 4HMDA 5F2LA 5HUPA 4IICA 5AKQA 2J9YA 3U5YA 1UR1A 5EKYA 3WD4A 1HJUA 3GY1A 1E9ZB 4GYPC 4RZ4A 3EPNA 1VYRA 3R6IA 2PBGA 4FXFA 4NJHA 1IXNA 4QEHA 3NCOA 5C9WA 3P67A 2OYMA 3ARSA 4BJHA 4GVHA 4PCTA 3A47A 1J0KA 4C5ZA 2VFIA 3GVWA 4XV0A 4KCTA 1PHWA 1FWCC 4LS0A 2J27A 3S2LA 5G2WA 4AVNA 4XD5A 3C86A 2XHYA 1XDJA 3AOFA 4AZGA 5AVHA 3ZSTA 4MTVA 1UKOA 4N0RA 3BCDA 3OVGA 3ITYA 4FNPA 4GQBA 4ZBCA 3KBSA 3TN4A 1I2NA 4CN4A 3H7RA 1M3UA 3LHZA 4MDOA 1DXFA 4L4OA 1K4HA 5D8ZA 3WUEA 4AZ7A 3VCNA 1E43A 3LHWA 4UFLA 2E3ZA 1H7PA 5AZ0A 4JBRA 1VC4A 1DQUA 1OB0A 5EMKA 3TXZA 4C6LA 4WHBA 1PZ2A 1C92A 4N9CA 3CO4A 4X22A 4LYQA 5CPLA 5LNSA 2HK1A 1GHSA 2ZE3A 1TCDA 3W7IA 3MMDA 4HPHA 4IISA 1H1NA 1TWIA 1XLJA 3EKGA 3HMCA 1PAMA 3UXLA 3CO8A 1XD1A 3T0AA 1B2YA 3F4NA 1V02A 4HK5A 1JDCA 5TD4A 3NO3A 5I3FA 1AK5A 2E9MA 2X1TA 5AC4A 5DLCA 5LHFA 3W7MA 2Y5SA 4WDTA 5D8WA 3B9DA 4BF9A 1RALA 2QCMA 2DIEA 4MKVA 1AMKA 3QGAC 1WKYA 1HKVA 2W66A 3C56A 2D69A 1FWRA 5ABEA 3SCQA 3PPFA 5TBOA 3QXBA 5EMUA 3FOKA 4LJ3A 3AHYA 3BAWA 3O7UA 4JNMA 3DESA 1QPQA 4I6VA 3W27A 3A3WA 4C6NA 4IIGA 3W87A 3LOTA 2Y63A 1MWOA 1Q65A 2ISVA 1V79A 3RR4A 2OT0A 1FRBA 1J11A 2V5CA 3MUIA 5HMDA 4R3UA 4PMUA 3P5YA 1NWUA 1X1OA 3K8MA 5FF0A 3SCUA 4MG4A 2Y7DA 5A8OA 1YNQA 1TMQA 2YDQA 2QCFA 3BXWA 3G1YA 2P3EA 1V3MA 2G97A 1YE6A 1H63A 3M5VA 1F61A 4ZE5A 2QGHA 3OLIA 4XG1A 2QPXA 2XIMA 2WNZA 2NUXA 4KFNA 4C1NB 2DDXA 7XIMA 3MCOA 3OQ8A 2YLLA 4Q22A 4S3DA 2VZUA 4XAYA 1H1ZA 1X7FA 5LIUX 1QI0A 5DF0A 3B03A 4XUYA 1LQAA 3W7KA 1LM1A 3O6YX 1E5NA 3GNRA 4KT2A 1WKDA 4LBRA 4IGSA 1XP3A 3CV7A 2AAAA 3GG7A 3NDYA 3IANA 3VO0A 4PMOA 1KCLA 1YDNA 1B3VA 2E68A 4WXZA 4LW7A 1P1MA 1W1VA 4WR3A 2V0TA 3PUOA 4H8VA 4IJCA 4CCZA 1ZHAA 1B4KA 3A22A 1BYAA 3P7YA 2PURA 2Q3RA 3W53A 1ZBWA 3WDJA 4AF0A 3NZGA 3LRLA 3W84A 3FYOA 3PJUA 1PTDA 3BG3A 3N11A 3TOPA 3FA5A 3W1LA 4H7CA 4F0KA 3SSZA 1Q4WA 3L4YA 5K4ZA 2A2IA 4HB7A 3EWBX 3REQA 2HBVA 2G4JA 4XO7A 4C6BA 2CXGA 1RCXB 1D3CA 1KFCA 6TIMA 4NAEB 4I9JA 4B91A 3CB3A 4UOZA 1OF6A 3GC5A 4V1YA 3MDWA 1YX1A 2CZFA 3VNDA 3CGTA 3C2RA 3CHVA 3JRKA 3FKKA 3PTDA 7PTDA 4EK7A 1VPYA 3WF2A 1F4HA 4BQ3A 3W73A 2BVTA 3DH7A 3A5FA 2J8FA 4XIMA 4LAKA 1XIDA 4E8CA 1R3WA 1WDRA 1BQGA 4LVFA 4ZB5A 3GDBA 3VVGA 3CUIA 1H09A 3ZLFA 2PS2A 1ME9A 1XM3A 3DKJA 3CC1A 5DRCA 4LUJA 4JX4A 1UR4A 4KCVA 3QGVA 5I78A 2C1IA 3PM6A 4TO8A 4U10A 2WJZA 1R47A 3TMQA 4BZYA 5D9PA 4GBUA 1DWGM 4R88A 3DXIA 1X1ZA 2BFGA 5HINA 2QCHA 4ZCWA 2VRKA 3O06A 2O9PA 1KB3A 2QUTA 3EDJA 1ITUA 3WK3A 1EJ7L 3HGRA 1JZ2A 2C1HA 2YZRA 2I9EA 4OQVA 1EC9A 4P5UA 3RJYA 1BKSA 3C2FA 5A8NA 4B3ZA 2C19A 1UWSA 4UOQA 1UBSA 1WZKA 2PTDA 1G94A 3B3DA 4AVOA 3LK6A 5CJMA 3B9AA 1G4PA 3N1AA 3AYTA 4NXKA 4ZOEA 4LEQA 2D1ZA 5F2GA 3W9ZA 4E4UA 2PDGA 4HHHA 2VO5A 3PNUA 1EP1A 1O1HA 1Q6GA 4XK2A 1REQB 2XIIA 5HMEA 3VE7A 4HT3A 2POZA 3I65A 2O56A 1O1ZA 2Z27A 3STEA 1TZ7A 2GJPA 1E6QM 2D2OA 4JD4A 1G4SA 1KFJA 3P61A 5D2YA 3PZNA 3LZ3A 3QQ0A 4JTQA 3GTNA 4WKAA 3GFYA 1IEVA 3CIXA 2XSXA 1PCWA 1D2KA 2J7GA 4BS0A 5KZEA 4Q8VA 2Z24A 4IXHA 3DYMA 3UW6A 4FMVA 4Z2JA 3NVDA 3O6DA 3WK2A 5A6TC 1QAPA 5FJJA 5KEZA 1W9XA 3TN3A 1MZHA 1JFHA 4J5NA 2ALDA 2ZKMX 1MUWA 1WAUA 4AD4A 2GVGA 4M6UA 4B3LA 5GPRA 3H26A 4NRRA 1POJA 5D05A 4WX2A 3KBJA 2FVKA 3RO8A 4Y9PA 3SBFA 4IP5A 3CT7A 4DN1A 2GJXA 4ECLA 3S3GA 1NQ6A 1PKLA 4Y9OA 1RJQA 2G50A 3P62A 4KGJA 1VRXA 4RV3A 2V81A 3ZIZA 1OSEA 1XUZA 3BOLA 3SUVA 1CEOA 3NQ8A 2B7QA 3IGUA 3AMDA 2INEA 4C6OA 1GOIA 2WVUA 2W67A 2CLOA 3L12A 3BO9A 1T5AA 2PDWA 2J7DA 1QPNA 3M5XA 4QS6A 3TZNA 3NGJA 4W7VA 3E96A 2OX1A 3CUZA 1OYBA 3LA4A 4ENLA 2FPTA 3WFAA 2PWFA 3IIOA 4HD5A 2V5JA 3VK5A 3OIXA 4OHQA 5KZMA 2WMIA 2C71A 2Z2UA 2RDWA 3S4TA 1XLCA 3B40A 2NQLA 3WMSA 1GNXA 1QUMA 3AIRA 3UPWA 3UXDA 4L64A 1IR1A 2D3NA 3W2LA 4UMAA 3N18A 2FHCA 1W9PA 4AX7A 3U2EA 1BKHA 3IWPA 2A7NA 4H9MA 2VVSA 2A3EA 3IGXA 3F5KA 1IEIA 2PDNA 3MP3A 5G4WA 5T8GA 1EC7A 4NNAA 3TLLA 4INFA 4KIEA 4YL2A 3URQA 5I3HA 4UQCA 4ZFMA 3M0VA 3WG6A 2JFEX 5A95A 3H4GA 3IS4A 3CZ8A 3BAKA 4C6QA 1QOXA 4CQAA 4JTJA 5EYWA 3DHUA 3R58A 1Q85A 1T8XA 4LY4A 2HCVA 3TC7A 4FR6A 3GIQA 4KCUA 3LTPA 3VNMA 3W70A 3PBYA 3S6TA 4PMVA 3LCXA 4K8EA 3K4WA 3UYIA 1T40A 2WZHA 5LYRA 1W31A 4NJJA 4D71A 2O9OA 3O63A 2YB1A 9RUBA 2D3LA 4B4HA 4JFVA 1KBKA 4PUMA 3KHDA 4LT9A 1TFVA 1TSIA 2GGHA 3H22A 3IGHX 1E6ZA 4DXVA 1M03A 4ACZB 1E1EA 2EGZA 1QBAA 3W6LA 4QJ3B 3RPTA 1LL7A 2BODX 3ZMRA 3M43A 4ZXLA 2OLAA 2FFCA 1XQKA 2PF8A 3DN5A 3POCA 3HFTA 5AC5A 1JZ6A 3A3XA 4EF8A 1XCXA 4RDZA 3WQ5A 1MQPA 4XSLA 2Z1BA 1GWJA 3THQA 1ZP4A 1T7LA 3VGFA 1L6WA 3Q65A 1AH3A 1VFUA 3R7MA 4QITA 3VOGA 2D0GA 3CK5A 4DBSA 2ZUTA 1I8JA 4PMQA 2AQOA 3Q45A 3WL1A 5AYBA 3R94A 4AEEA 3R8RA 3VFCA 5KZ6A 2JIEA 2YYTA 3B06A 1XYLA 4B2DD 1F07A 3GDMA 3TP4A 2TSYA 2Y88A 4KESA 3HV9A 1ZGDA 5ABFA 3IGSA 1Z32X 2FKPA 3RG6A 3TJIA 5BMXA 4H00A 2H8ZA 3QPYA 3KVKA 4NY2A 1QO2A 4CUCA 1UP3A 4GIRA 2RUSA 3CASA 3AYRA 1BSLA 2Q3OA 2F6UA 2BDQA 4PZVA 3MUZ1 4L4MA 4A8NA 2RKXA 3UNTA 3LCWA 4B92A 1XIHA 4CNSA 1FWEC 3CLMA 4DX3A 1K9FA 1KFKA 2BVYA 1FWJC 3VOCA 2ZX7A 2FDMA 2ZXBA 4EXBA 2ISWA 4R5EA 1G6CA 3NTYA 2HSAA 3QV7A 5A6JA 4FLSA 3GRIA 3GD6A 1Z48A 3MC5A 5HPCA 2WMKA 4LH8A 4MY8A 3EPMA 4M29A 2YA2A 4JN8A 2XFYA 3IIXA 5G1TA 2Y70A 5F7UA 1XLGA 2PE4A 1FWSA 3L4ZA 4D72A 1NP0A 2TRSA 4EACA 4MPKA 4MUZA 1W54A 2ATSA 2ZZ7A 4YVXA 2PF0A 1JI1A 2PZ0A 4S38A 4HNLA 1D8CA 4KFPA 1VBUA 3WYZA 1SW0A 4H8HA 2WQPA 1ICQA 3N17A 3QN3A 3S46A 3KBMA 3GFXA 5G4HC 1FFRA 1MFVA 3VKDA 4X0NA 4PB5A 1J18A 1TPC1 1GHRA 2WM1A 4YTQA 4H6RA 1XPGA 3RGTA 4TX9A 4NJKA 2YBTA 1DWHM 3T42A 3ZLGA 2BTMA 4AZCA 1P1XA 2P1FA 1V3HA 9XIMA 3TTYA 1HUVA 4GHRA 4HOWA 4IGNA 2DT2A 3THCA 3F4DA 1CCWB 1V7YA 2WMHA 2A7RA 1BVWA 1RVKA 3I6TA 3BH4A 1K9EA 1YRRA 1RA5A 3AHXA 3BW4A 1M65A 4LVDA 1RV8A 3MP4A 1WP6A 3L68A 3HM7A 2GVJA 4L1XA 4W8AA 3V18A 1Q2RA 4GJIA 4AEOA 1JUKA 2EPHA 3ARZA 1PVNA 1SFSA 2GDQA 4B5VA 1Z9AA 3OGVA 2QUUA 2JE8A 2W79A 2YFNA 3STPA 4EAYA 4OFCA 1EJSC 4F0HA 1J9YA 3UBPC 1CPUA 5TF0A 1QNVA 4F0RA 4CCEA 2VZSA 3W83A 3VIOA 3OLEA 4Q4SA 1TJ2A 4JYDA 4Q8OA 4HZ6A 2ONEA 4U2ZA 3QQ1A 5CEWA 1W1TA 5IDIA 2CZDA 5LHEA 3SEPA 1MNSA 4N4QA 2H3DA 3HG3A 1EUAA 1E9LA 2ZQ0A 3D3AA 3BMWA 2Y1HA 3W81A 3QBUA 2JKAA 4LEFA 4JTUA 5CZ0A 2VGGA 2R82A 4XZMX 4NL1A 1R0MA 3SIZA 4QDWA 4WD0A 4IQDA 3LSCA 2POTA 4HU4A 3Q37A 5C7HA 4HJFA 1QATA 4ZQOA 3VYLA 3OLDA 3IUIA 1GOMA 1F8IA 3CQ0A 4ZZ9A 3F1QA 3BURA 1QWGA 1CXFA 2ZRWA 4WCJA 4GINA 4D6FA 2H9AB 4PMZA 2ZZ2A 1JPHA 4RKAA 4M56A 3G8EA 3HPFA 4TIMA 5BRBA 2VURA 1A5KC 1UOKA 3KRUA 4A2SA 2PU1A 3MZ2A 3GUGA 1FHVA 5FCZA 5C70A 4Y9NA 2CFFA 3GXFA 4TVDA 4D6CA 2DUAA 2G95A 4DEFA 3IRSA 2X7VA 7TIMA 1EBGA 3CBWA 1V0MA 1UPMB 5LIKX 1I2PA 3P60A 3QV8A 3PHAA 2QJHA 2EG7A 2PODA 4WY0B 3TAKA 3P3BA 1O66A 3HQPA 1DHPA 2GOUA 4S3EA 4H41A 1J4EA 1UUMA 2Q8ZA 4MWAE 3MSGA 4TX8A 3EAUA 1IHIA 3U2CA 1RCOB 3M5ZA 4W87A 1IXQA 1OM0A 1S5NA 2Y5JA 4WJXA 1QI2A 3MMWA 2QJJA 5D9NA 2WCAA 3VUSA 3DENA 1E3XA 2XPKA 1L6FA 4C6IA 4JYEA 4XD3A 3TSMA 2WZIA 1RP9A 3CAWA 1MDLA 2PDMA 3H53A 1NJJA 3QR3A 2VD9A 1XBVA 2CITA 2IPWA 2INZA 1W5NA 3PBWA 4OKDA 4U5IA 1AQFA 1KQZA 5K4XA 4HHPA 1DJHA 1I60A 3QLLA 1W3IA 2V2DA 2PDQA 3GR4A 2YDRA 4IFRA 4DM2A 3E49A 1U33A 1A5AA 1N8WA 4ZQMA 5D32A 2AL2A 3L0KA 1E6RA 1GPFA 3HV8A 4O1AA 3VA8A 1VR6A 2BHZA 1EX1A 3GH5A 3B8WA 4H01A 3SM0A 3WEZA 2V6AA 3WNLA 4M7SA 4PCNA 3M44A 4BEUA 4R85A 2AQVA 4HNVA 1Q6RA 2ACSA 2VHLA 2VCBA 4M6VA 5J5RA 2PWUA 3RCYA 1SO6A 4LBUA 3M0KA 3VM7A 2VD8A 3CL6A 4MKNA 4HVXA 1TZ9A 3V75A 3WLLA 5EMJA 3WQ6A 4JXCA 3W01A 4YJ5A 2C3ZA 2CKSA 3HPZA 3DHDA 2EJ1A 2VX4A 1IZJA 5I0DA 4ERGA 1Y5VA 3PUDA 2PPGA 4RPQA 3A64A 1XKYA 2VMFA 3AIWA 2PTZA 3G5EA 3S9ZA 3F4WA 3VDCA 1O4UA 4LUTA 1EKOA 4JNYA 1JPMA 5ABGA 1TREA 4LWWA 4XBJA 5EBAA 3HA1A 3WELA 1O5XA 1J6PA 4L61A 1XS2A 1S5TA 3EBVA 2FDSA 3V5FA 1Q13A 2JEQA 2ZUUA 3GXNA 1S3HA 4LX4A 3AIBA 3L7RA 4A3YA 4ZE4A 4ADTA 1NWTA 1SQ7A 4J3WA 2EPMX 3VKBA 3H54A 4QIUA 4Z2LA 3LPFA 1JCJA 3NQCA 4Z1AA 2IQTA 3IVUA 1S38A 2XIJA 3UG5A 1VLWA 3QW4B 5LXEA 2PGFA 1YW1A 4LF1A 1UWIA 1C93A 3PWAA 4QHRA 3SJ3A 1ZBVA 2Y62A 2VOTA 3OQEA 2Y8KA 3RMEA 4J3TA 1XRTA 1YXDA 1BG4A 1E6XM 3SRFA 3NA8A 3TE9A 4AZHA 3WH8A 3UPBA 1JD7A 1K8YA 3E74A 3EMQA 3WMLA 1KO0A 3OVRA 1FCUA 3P5ZA 1Q6CA 1HXJA 1YPFA 2HXTA 3PG9A 3MVIA 4M5PA 4O0ZA 3QPZA 4HJWA 4C6DA 4AMCA 2DSUA 3M46A 1WA3A 1D9EA 1KR0A 1UW9A 3S0CA 3SECA 2DZBA 1WE5A 3N73A 4QDMA 3QMRA 3WEOA 2J7EA 3PZ9A 1GYNA 4PBEA 3WQEA 3S1XA 3S2CA 4AWTA 3BOFA 2J88A 1PHQA 3MHUA 5AN7A 4GACA 2CXEA 3V0TA 4AD3A 3CJPA 1WZAA 2VUYA 3WK0A 3B4UA 3CL7A 5AC8A 1P6WA 2R14A 3SAZA 3SB0A 3MSDA 1SJDA 5JH2A 1H7OA 5FL0A 2ZZ1A 5IXEA 1EP3A 2E9LA 3E0VA 2X40A 2W3ZA 4CQBA 1M01A 5DT5A 4LFYA 5BZAA 1XF0A 2QPUA 2OLSA 3SGUA 1XW8A 4JY9A 1F6YA 1WCGA 3LBCA 4RUBA 2ZRVA 1Q6OA 1FWBC 3KVMA 1A5CA 3WDRA 1A4MA 1SMAA 4DBWA 3KCJA 3B0PA 4LC8A 1FH9A 1EEXA 1PZ3A 2WSPA 1DJQA 2QCGA 4HYWA 1S2CA 4S3CA 3UVAA 5IBXC 2CWNA 4TV5A 1ZZMA 2WZTA 4PSPA 2PWEA 3GNXA 3P82A 1XLHA 1BTCA 3LG3A 5LA0A 1LOSA 1UR3M 3JZUA 1Q2SA 3KRBA 2AMGA 1C7SA 2XZ7A 4R9OA 3ZXWA 1YXYA 3VPLA 4B5UA 3THDA 5B80A 3RPDA 3BMVA 1Z3NA 1TYGA 3W07A 3EKZA 5CXPA 3T6CA 4JFTA 2OEJA 3EDEA 4D2JA 3L4WA 5C5YA 4ERAA 4UCGA 1H2JA 5EMMA 3L5AA 4H1ZA 3VOHA 1UWTA 3QSTA 1XFBA 2A0NA 3W24A 1YNYA 1V7AA 4V15A 4WSKA 3BG9A 4S3FA 1EQPA 8RUCA 4XAGA 4M51A 4UFIA 1XL9A 3AS0A 2G8ZA 3QKEA 4RDVA 4M24A 3T55A 3DKLA 3WUBA 5EA9A 2VDGA 3EWCA 4UQBA 5C9ZA 4HPNA 1CT5A 3N34A 4QE5A 4WJ8A 4O57A 1WBJA 1K7FA 4KGLA 2BHUA 2I9UA 3UJSA 5DN1A 4AG0A 3IIVA 2FIQA 3HF3A 1F7BA 4GZ7A 4HZMA 4MIMA 4WF7A 1X38A 4C65A 1TVNA 3ECQA 4Y9AA 5BXRA 4L80A 4FB7A 1EWDA 4CQ8A 5E5CA 3W2JA 2XN2A 2RDTA 3UVIA 3DFHA 5A2BA 4OUIA 1GVEA 3I68A 1YMYA 4FR1A 3MCNA 3M9YA 1A5BA 3OG3A 4IM4A 2OOFA 3I3BA 3DOPA 4HCLA 4HMCA 4IG2A 3HB9A 4V1XA 1KGUA 2B4GA 1VENA 3G24A 1S1PA 3BSGA 4MB1A 3SCPA 3NIYA 1FH7A 3K1DA 4CQCA 4P7OA 4D6JA 5XIAA 3OVQA 3OZMA 1P4CA 5DELA 3N9RA 3WD1A 2X09A 1BSIA 3CH0A 1YTDA 3RM8A 3L0NA 3ANUA 2AGKA 1JF6A 2ESCA 4UNLA 4DXKA 1DE5A 3W2MA 3UWYA 5AB3A 1LBFA 2CCRA 4P7RA 5E70A 3T78A 4LS2A 5CBJA 4NSBA 5CZJA 4M0XA 4AHPA 3ITLA 1UZ4A 4AU0A 2AQWA 5CPSA 4LUSA 4WGXA 3S2NA 1AQHA 1OY0A 4H19A 4PC8A 4PMXA 4NZCA 2VC6A 3OP2A 1CNVA 4H9XA 3NQVA 4A3UA 1Q5MA 1HJSA 3LB0A 3TYDA 5CZTA 1A5UA 5CLWA 1FDJA 1M04A 1XRFA 1B4EA 4QCEA 4XKYB 5DXXA 4GRSA 3QV6A 3G3DA 2DUZA 3N04A 4AWUA 2BXYA 2E28A 4E2BA 1KBIA 2CLPA 2PDKA 2VXNA 1LCOA 5BOOA 4UQ9A 3U2OA 1TWZA 4FX6M 1HT6A 1EO5A 4AD5A 1DOSA 5FI8A 1V6YA 3ONBA 3AHTA 1GKRA 1Q6EA 1FWHC 3ZQ9A 1QK2A 1E0VA 4DHGA 1EPXA 3RFAA 1UZDA 3LM7A 1YPIA 5CGMA 5G2HA 1UZ1A 1W5PA 4G8TA 4OUEA 2EG6A 4P8WA 1WZLA 5SWUA 2V38A 4DNHA 2GWNA 3GQYA 3ZFHA 3EX2A 3CH9A 5CPNA 3UY7A 1CXIA 3ANVA 4UB9A 3EOUA 4TVUA 3W25A 3T1GA 5LGXA 4FI4A 1H1YA 3RIKA 5CC3A 1HZYA 2DJXA 1Z8AA 2ZRXA 4XQ6A 1UQZA 3HPAA 4D9PA 3W02A 5FJRA 1UCWA 1HGWA 4I9TA 1XISA 4ZGYA 4H7VA 4GCXA 3PS7A 2A3CA 4DZ5A 1EF3A 3ZZ1A 1V6VA 4A35A 5BRPA 4JTRA 4E5TA 2PDUA 3JU2A 2PDJA 1XCWA 2GQAA 3LY0A 4UTTA 4E2VA 4U33A 3UA3A 5HNUA 1NP2A 2PSNA 2C1GA 3NSXA 2PP0A 5HQEA 1JCMP 1AD4A 1C9DA 2X16A 1FWTA 3ME3A 3NQGA 2A79A 1CB2A 3BCJA 3HPXA 4HHMA 1AG1O 1U83A 5CAHA 1XSKA 1NOWA 4J7RA 2NSOA 1XX1A 4AC1X 4XBKA 4F8XA 3SADA 4KEVA 2PDFA 3UGVA 4ZTYA 3IK2A 1KTBA 5HULA 3VNJA 1NF0A 3LMYA 4FHAA 3E2VA 3G1HA 3AIEA 1XD0A 4AEFA 3I7SA 2FJKA 1TJ0A 2QNEA 3M64A 2BV9A 2FGBA 2FZBA 1ZB5A 3BAJA 1MEHA 4PBFA 1UKQA 1WKEA 4AIBA 1ALDA 3MS8A 3LI1A 3CV2A 2F2HA 4M6PA 3G1SA 3UGRA 1V8EA 2OSYA 4YCPA 2B7PA 1LJYA 1O5RA 3IJ8A 3V16A 1XRSA 2UY4A 2E5DA 3WY1A 5IBXA 1QTWA 4PCFA 1FFQA 1XJBA 4HBKA 1OFAA 1LRQA 4JL1A 4ZOAA 3T40A 4EWJA 4UQEA 3RCMA 4O1BA 5D9MA 2PUZA 1MI3A 2JBMA 4L9ZA 3RLVA 1LDCA 5JU6A 2NV1A 1OADA 1V5XA 3VDHA 3CYJA 3HN3A 4O8RA 1A0EA 3OZOA 2BASA 1BEUA 1G4EA 1W17A 2O4MA 1GEHA 1XDMA 2A5HA 3UWEA 5JBDA 3DX5A 3CEUA 3GTXA 5FSDC 3DGRA 4IFOA 4CN6A 3BC9A 3UU0A 3UZWA 2PCQA 1M7JA 3GYEA 2Q01A 3BLLA 3H2CA 1ZJIA 4PL2A 1GJWA 2QUVA 3IAQA 3C52A 3G1AA 4ACYA 1TV5A 3AUJA 3DYOA 1F3TA 4NZJA 5CG7A 1P43A 4JYFA 3OIHA 3UERA 1L6SA 1Z6KA 3WF3A 4BHYA 4IPPA 3FKRA 2X41A 3F2DA 2B7NA 2V63A 3PK7A 3CIVA 3A9BA 2ASHA 3KP0A 3TSDA 2YW4A 3REQB 4GYPA 2MUCA 3TFCA 1YXCA 3VZZA 3NAVA 1CWYA 3WLMA 4JTEA 3W1NA 3G1RA 3FSUA 3KOZA 5A6AA 4J9JA 3JW7A 4ZB2A 1XYAA 3KDOA 3BOXA 4EXQA 5LGZA 4WLCA 1OCBA 3HJZA 3DI1A 4UNIA 5AYZA 4XO6A 1P5BA 4KETA 3ITVA 1DTNA 4L6DA 3DFYA 1KCZA 2J8GA 3EXRA 2XIBA 2HVNA 3TKFA 1WOAA 4PB3A 3TUUA 4GIEA 2Z1WA 1ZFJA 6TAAA 4D8LA 5J8LA 4X63A 1A53A 3UR2A 5J5DA 2DQXA 4YYFA 1AL8A 1LWJA 2BSLA 3WQGA 3Q4DA 1XSJA 3VX0A 1JDDA 3N2MA 4AWSA 4DYEA 4OOUA 1LL6A 3E1F1 2HRWA 1THFD 4W85A 3ITTA 2W91A 3AMGA 2NVDA 4OV9A 2HPMA 4UOJA 2CBVA 1DE6A 5KETA 5JXQA 1QNQA 1CDGA 1XBZA 5TIMA 2Z25A 1D8WA 1AMYA 3IK4A 4NP7A 3PWIA 2GQ9A 1UOZA 4PULA 4MYXA 3TR2A 1V02E 2OB3A 3AZTA 4JTDA 3AIVA 3OO2A 4GUFA 3TW7A 3TYAA 3VIMA 3H55A 4UUIA 3W1AA 2D2HA 3A3HA 3MV11 4MAZA 4F40A 4L4PA 5HR6A 2A6LA 1C8YA 3NSMA 5FA5A 3W2KA 4ONVA 1R3QA 1GUVA 3HBLA 2QPSA 1OIMA 3BLPX 5FL1A 3VIIA 1REQA 2WNQA 4YCOA 3L67A 1VCGA 2PWVA 4WOZA 1LOQA 2OZTA 1JNDA 3PWGA 3GDKA 3NYDA 4WSJA 3WQ8A 1NOUA 3W6MA 1HW6A 4UR9A 1QOQA 4C6KA 3UG8A 1QT1A 4OOZA 4JR5A 3RO6A 1GKPA 2AGTA 3G6LA 4FOKA 1TRDA 3L65A 4B9ZA 3QVQA 5JIPA 1UMLA 3W76A 3GHUA 2NLYA 1TE1A 2ZADA 3VFLA 1FWNA 2YYUA 3UNDA 2VRJA 1A50A 1NWSA 2DU2A 3PJXA 1XICA 2D23A 1ZQ5A 1XC6A 2QMJA 5HK4A 1RSCA 3WD2A 2QDDA 3B04A 3SURA 2GOKA 3QY7A 3UCCA 3GFZA 3GTIA 1ODUA 1BWLA 1E1CA 2VNCA 4HA4A 2Y61A 1MUMA 1KRAC 3LGEA 1Z69A 1JZ8A 3M0HA 3N6QA 3G0XA 4DY1A 3G2GA 2HDJA 3FFSA 4UZSA 3UJFA 4IUGA 5H6HA 3NQ6A 1NF7A 1MQQA 1LQ2A 2Z2AA 2V3FA 3FJ4A 3FDKA 4ROQA 3FS2A 3KVLA 4AAJA 4NUWA 1T99A 1EFZA 1SU5A 4M3PA 1ECQA 1B3ZA 2F8QA 5FF7A 1TPVA 3QZEA 3PSVA 4HK7A 5JUVA 3TYZA 3FJ6A 1EIBA 4M7TA 3A9IA 3WBWA 2GLKA 4HSOA 3W7GA 5KTLA 2WSRA 5AHIA 1W9VA 2ZX9A 1KA9F 1OFBA 3ITCA 3AYVA 3A5VA 3CQKA 1A0CA 4J2MA 1Y5XA 1NAL1 3S6DA 4AIUA 1IGWA 1AA1B 1OX4B 1PXGA 1XLKA 2GGIA 3AROA 2PWDA 3CZEA 2QCCA 3KTCA 4NJIA 4X60A 1GOXA 4FIQA 3VD9A 2UZ9A 1OFOA 2WQDA 5C9XA 1EC8A 1VFSA 2Z4GA 2A7PA 3MHGA 3ARUA 1XSIA 1TRIA 4NAFB 2NVCA 3IJLA 1W3TA 5IHSA 4PA8A 3TNOA 1I9CB 3WJWA 4HU8A 3FYYA 5C2GA 2W92A 5CC6A 1WXJA 3N6HA 4OU1A 5I5RA 3RK8A 3MKVA 2E8ZA 1EB3A 3KOYA 1VPQA 3AS1A 5BMWA 1X1NA 1KR1A 1JDFA 4IHCA 1TPUA 2W9MA 2ZA2A 1F8MA 3B05A 3FJNA 3R10A 2KX9A 3N13A 1AJZA 3TXVA 2A6NA 3FIGA 1JVNA 2ZVIA 2FVLA 4KQNA 4ZQCA 2VEMA 3A23A 3L2MA 4RXGA 2FGZA 5D04C 1K8CA 3EOOA 4ZVJA 1TTJA 1GVYA 2V82A 1WXZA 4YTTA 1GOKA 4O12A 4JTAA 2RAGA 4ZQNA 3HURA 1U1JA 4R34A 4K68A 3AISA 2J8TA 3BICA 3G8RA 1FP9A 3ZWTA 2ACUA 4FLRA 4JIRA 1XGEA 5AC7A 1GKQA 1FXPA 3CTTA 4GX8A 4NZ5A 4J35A 4I6KA 4NXSA 3T9PA 1TWDA 1GQJA 3C4UA 3CAKA 1JXJA 4PMRA 1PTAA 4EPEC 3TTOA 3IUDA 2VZTA 1PX3A 4MKSA 4IOTA 4FP1A 4GXMA 3M4HA 3W00A 3R11A 1R3RA 1HN1A 3NFUA 2R1MA 4LUSB 3WQDA 2TAAA 3LGDA 2JQXA 1G9HA 1KC7A 4GISA 4W7UA 4NRSA 1M7OA 4UR7A 2HEJA 2ZDRA 1KLZA 5I06A 3LD5A 3A6OA 3KZSA 1HKWA 3K1GA 1N8IA 2I7GA 1ONXA 3VUPA 2ZUVA 2P0OA 4NG3A 5HJYA 3T44A 3I6EA 1KM0A 2WBKA 1SVDA 4ORMA 1X7IA 3W7RA 4DO5A 2OOGA 2V5BA 4D6EA 2QW5A 3EEGA 4JTIA 4H04A 2OWCA 2WC3A 1VCFA 1YEYA 2E6AA 3ZM8A 4CNUA 3M0JA 1XCFA 2R91A 2XVGA 1FKWA 2OSWA 5LZLA 2QVHA 4QX4A 4NNBA 4CEUC 2ZRUA 4ML4A 4Y2WA 1SZFA 5A8PA 3VOJA 3BL3A 3O0KA 3GNDA 5AY7A 1DORA 4JIEA 1TUXA 2ADAA 1FHDA 3SY1A 2FHFA 4ASTA 3W1TA 1PIFA 1BXNA 3DHPA 4LOCA 2GUUA 4NF7A 3D5HA 1B30A 1Y0EA 5FJTA 2E5BA 3V0SA 3MUXA 5DCDA 1HG3A 6XIMA 3W23A 1HP5A 2OTDA 4Q8PA 3QOKA 2OZ3A 1O68A 1VBJA 4WVXA 1S5WA 4A3QA 1VHCA 3HIJA 1W9DM 4GGBA 3DFSA 1LWIA 2GDUA 1NEYA 1ZL1A 2ZA1A 4ATDA 1XIMA 4IIBA 1XLIA 1TCMA 3V1HA 4O16A 1UKPA 4I5RA 4MB5A 1RVGA 2ZVRA 2CBIA 2J75A 4KCWA 2C6QA 4GNVA 2JK2A 3W4RA 2G3JA 2NZLA 3ZLHA 2CW6A 2I16A 2ZTJA 4GQ0A 3LBOA 3OBEA 1GZJA 3U7VA 1KQYA 5ABTA 1DHKA 3U6WA 1U1UA 3WD3A 2NW0A 2VWTA 3M1ZA 3W7HA 3PZMA 4JN6A 3DFTA 1H41A 1LROA 3LXBA 2R1NA 2FZ8A 4AWEA 1EXBA 1MXSA 4ICNA 3LM3A 4EOUA 4RW3A 1C8XA 3GC2A 4UMCA 3NQAA 1YPXA 2I56A 3W75A 2VKZG 5G5IA 3SFWA 1WUFA 4DUOA 3L23A 4FNTA 5LNRA 1TPWA 1ISZA 3MKCA 4FA3A 1GVRA 4PMYA 3KP1A 3CPUA 4JTGA 2G0WA 2ABBA 3AU2A 3VDAA 3JS3A 1KXHA 2E09A 1SW7A 3IIZA 2YZ5A 1P0BA 2E5CA 1FCQA 4H83A 1GW1A 5IOBA 3PPCA 4X0VA 4JTKA 1F3XA 2GVYA 1AUSL 3D3FA 2O9TA 1XYFA 4WRHA 1SO4A 1VPXA 4AIEA 1OFRA 4C7FA 1V4YA 1EEPA 2FZ9A 1J0YA 2PI6A 2HV5A 3ZVHA 3ARXA 4U31A 4RXFA 4QISA 3IEBA 1W9BM 1K6WA 2PGRA 3T7VA 1V08A 3O1NA 1ZTVA 4AISA 1DXIA 3EOSA 4FF7A 1TPDA 1DQXA 1KM5A 2ZIDA 1E56A 3OYXA 2QF8A 2Z7GA 3BG5A 3WDHA 3LPOA 1QPOA 4IP7A 2GSJA 2H3BA 2Y7FA 3BGGA 4Q33A 1HJQA 1J0ZA 4C6MA 1ZCCA 5FJUA 5AYXA 3RAOA 4ACZA 3AHZA 1QHOA 3VGEA 1XH2A 1V51A 4MJZA 5FAJA 5ABHA 2XSAA 1LORA 3S42A 2ZBTA 3ENLA 1NELA 2DT1A 2MANA 3R25A 1HVQA 4YHEA 3HQ1A 3W38A 1AH0A 3KW3A 2QVNA 3OBAA 1ICPA 5PTDA 1A49A 2FB3A 4LCRA 5F2MA 2VX6A 4Y90A 1RAKA 3S5SA 3URAA 4KKXA 3LCIA 5HWJA 4KWWA 3H4WA 4IMFA 5K3VA 3OGSA 4IX0A 3SCVA 7ENLA 1EPVA 1GOQA 4OBRA 3CLWA 1P7TA 1G1YA 3WH7A 2WNWA 2JGYA 1QI5A 2GVEA 3PUGA 4I5UA 5CZSA 1EHAA 4X3ZA 4G2DA 3TX9A 1JCYA 3CUXA 4HSNA 3GR7A 3TTSA 4HGXA 4Z17A 1OC7A 3QR1A 1IGSA 1SMDA 4LAUA 3OJGA 5REQB 4POCA 1NY1A 2VCAA 4KWVA 3FN9A 3PBMA 4M1BA 3WX7A 4QSFA 3D46A 3BQ5A 4N7QA 4C6PA 4C91A 4ZSUA 1ENUA 3KXQA 2X1IA 3C0LA 3FJLA 3EWYA 1E0WA 1W3JA 4NAFA 1KNWA 1ML1A 1U5VA 1ZBCA 1KFLA 1BYDA 1NDZA 5LNVA 1MRQA 1FX6A 1Z42A 4XD4A 1OG6A 3KOXA 3VIFA 4OTKA 1GQNA 3OU8A 5HQLA 1EHNA 1UBPC 1UPPA 1M68A 3ES8A 4OWGA 4BI6A 2XH4A 2V2HA 5T26A 2GUBA 7TAAA 2P8BA 2ZXQA 2VQTA 1CECA 3CQJA 2IUZA 1IZCA 1QHZA 1KBBA 3TA6A 4PTNA 4LAOA 3AMCA 1PB0A 2NT0A 1KKOA 4MB3A 4ML9A 2NQZA 2Y4SA 1AZ1A 1P0KA 4WQ6A 2OMAA 4LANA 4FNUA 1IT0A 1S3TC 1CGXA 2OYKA 4W8LA 3ZS4A 1SJBA 3Q94A 4DO6A 1PDZA 3STGA 5BROA 1S2UA 1RJPA 5G4EA 2OKTA 1BAGA 4DB7A 1ZP3A 4DI8A 1XLDA 1OCNA 3GR8A 5MHBA 5A94A 3D0CA 4UTKA 1XWYA 3BLIA 3PAOA 2H6RA 2BP1A 3PUEA 1JRCA 4JDYA 3GZAA 5A2AA 3R2GA 1CX9A 4LB3A 4REQA 3QR0A 4ZO6A 1ELSA 3N4EA 1FHLA 6REQB 4Q4QA 1KCXA 4CNPA 3DYPA 3R1ZA 3INPA 3P0WA 4W4QA 3R13A 3SQSA 5DT7A 1JNEA 3M0IA 1JYXA 2WM0A 4QG9A 3VOIA 4LV9A 1GT8A 4XAZA 3WH9A 1PIGA 4O15A 2FTYA 3GXDA 3TYEA 1LLWA 1E9IA 4QE4A 1BGGA 1K8XA 1H49A 1J93A 2CLLA 2NV2A 2Z28A 3GG8A 2CZVA 3FA3A 3PANA 2E77A 2X8RA 2W6RA 3HU7A 2XFWA 1T0OA 3IJQA 3GIYA 2V68A 3M7SA 1WDPA 1XLLA 4K7VA 4PUDA 4RW5A 3BAIA 2OG9A 1A5SA 1VJSA 2QV5A 4GI6A 2GGJA 4RPPA 2XSBA 4LUYA 4E4FA 2OKOA 4UTWC 3KRSA 4DBEA 1QNRA 4F9JA 3QYQA 4HYVA 3SI9A 1UWUA 5XIMA 1AFSA 4XTDA 5E9AA 1QNOA 5DX7A 3TN5A 3GHRA 3VDBA 2BY2A 3AIUA 4GFIA 4CQ9A 3NL2A 1OX6A 1PZ1A 2C79A 4LBSA 3EDKA 1D3HA 3SN0A 3TROA 3CPGA 4DF1A 4EIVA 1A5MC 1JIBA 4H7ZA 5M2FX 1V3LA 2J9XA 2PC4A 2Y89A 1H60A 5D09A 1GK8A 4HKPA 2BNJA 2OR2A 3N15A 3V0UA 3TJ4A 3AXXA 5CSUA 3WZ0E 3NPWA 4I9AA 5AVNA 3EB2A 3DC8A 3M16A 4K8GA 3BGAA 4UTLA 1IWBA 4HZ8A 2CKRA 5BOFA 1H11A 2XIQA 4YN5A 4GGHA 2WOQA 4RE2A 5MKGA 4GUGA 4W8BA 1GQKA 3B9OA 1J6OA 1LUCA 3IIPA 3W2NA 4QRNA 4IMGA 2WC7A 2XWEA 1GQLA 2DH3A 4AY1A 1P6CA 4AFYA 1AVAA 3DFPA 1JEZA 3V3WA 1QW8A 4DJFC 3BJSA 3ONCA 2HJPA 1PUDA 2PLCA 3WQPA 3CIWA 4D8ZA 1B31A 4PR4A 2WMFA 1UKSA 1V03A 3O8AA 2C0AA 2F38A 2HTMA 2AAMA 1B1YA 1BQCA 1CIUA 3BGJA 4LRSA 1I2QA 2PP3A 3UQNA 4WDWA 4C1KA 3MO4A 4MHBA 2X0SA 1NIUA 1K8ZA 1VGAA 3KWXA 1VAHA 5I3DA 1JYNA 1XLBA 4NASA 3WUGA 1SW3A 1WO2A 4IZGA 4JNZA 2DPEA 3CWOX 5T91A 4E6MA 4N2YA 4XVEA 3N12A 5FJOA 5CSYA 2V3GA 1WNOA 4OT7A 5A5WA 5HNNA 2YJQA 1T96A 1R85A 3AC0A 2QCDA 3W1UA 3NDZA 3VMNA 2R8WA 2E4TA 4PYSA 2SFPA 5CPMA 1TV7A 3UYCA 3EA2A 1C7TA 1BWVA 4BQ5A 4KBXA 3UPMA 5M5DA 4XKMA 4N4PA 2FQIA 2D0FA 4O14A 1W5QA 3C5QA 1K9TA 1RK6A 3NGFA 1TV3A 3CHEA 2DEPA 3P0XA 1SM9A 3PP7A 2H9AA 1O95A 2DZWA 3H23A 3QHOA 3DGBA 4EWND 3C2EA 1MFUA 4C6EA 3ARWA 3RXZA 1UD4A 1KXQA 3G0SA 1UA7A 3ATYA 2Z1KA 2C14A 2J6VA 2OO0A 3T4CA 4JHZA 2A3AA 3M07A 2GWGA 3MHFA 5BRQA 3O05A 5M03A 1W0MA 4K39A 2JEPA 2VGIA 4Z2GA 5D2VA 3C61A 5DQPA 2HNHA 3TC3A 3G1FA 1UJQA 1PS9A 2FGLA 3TJXA 1FCVA 4OBTA 2BHYA 2WVVA 1B5TA 1XLEA 4RX0A 1TO3A 3WDPP 1XINA 4QFUA 2VQUA 4MJ2A 2VVNA 3WJSA 3ANYA 1QW9A 3BDKA 2OZ8A 3BCFA 4PFHA 4UC5A 2XVPA 3RRXA 1KFBA 3EZ4A 3RILA 3W7PA 4KWUA 1WYIA 5JVLA 3WSUA 3WF4A 2WMJA 1HO1A 4IF2A 5E6ZA 1LYXA 4QLJA 3MQTA 4IIEA 3OPSA 2FLIA 2RJGA 3L2IA 1MQRA 3EWWA 8A3HA 3IUHA 3O6AA 3L5LA 1EA9C 4AZ6A 4I8YA 2VC7A 2OSXA 4Z2KA 3ARVA 3CMJA 5CZKA 3VIJA 2NQ5A 1FUYA 1SFTA 3L4TA 4QXIA 2NT1A 2XUCA 4JN7A 3O6CA 3E0IA 4P8XA 1U5HA 2XG9A 4MWAA 5D33A 1VEPA 1NOFA 4FAMA 5ENLA 5JBFA 2YCEA 3OVPA 3LN3A 1ZAIA 3FA4A 3VABA 4A05A 1F3WA 3RLGA 4O52A 2XVNA 3QH2A 3JR2A 2VFHA 5BYWA 5AC6A 3LLDA 5C8BB 5AOUA 1L6YA 3WBXA 1W56A 4PSRA 5HQMA 5DMLA 1ZJBA 1A3HA 2VFDA 4J3ZA 4Z0JA 2X30A 4K1GA 2P10A 2OWXA 1R3SA 1I1WA 1E0XA 2WWDA 2QCDB 1UD2A 4QAWA 1RBLA 3FXYA 1Q6DA 1T8QA 3N2CA 4PUJA 2QLYA 2PTWA 4YWIA 7A3HA 4ZEPA 3CUJA 4OVXA 3RJXA 1ZCOA 2D2GA 1ISXA 1V6TA 4JEQA 4PUNA 3ZYZA 4BWLA 2DZXA 3E0LA 4QAIA 7ODCA 3LCGA 1GW9A 1VKFA 1VIWA 5GJNA 5LA1A 2OEKA 1PYMA 5HATA 2X1SA 1ME8A 2G3IA 5A1AA 2I5QA 1TTQA 1AJ2A 2J66A 4RE3A 3TLQA 1PIIA 2AOSA 4R7JA 4WDUA 3EXSA 4KFOA 3HPSA 3VU2A 3OZPA 4P61A 4NILA 3S1UA 1J0HA 4JFUA 3BAXA 1TR1A 1FTXA 1GJPA 5LIWX 5IFTA 3BLOA 1R8LA 2VR2A 2WPGA 2OGYA 3CAQA 4IJRA 4LCSA 3IAPA 3VKAA 5EFDA 1XGDA 4PH6A 4X2RA 3SJNA 4CN1A 3RITA 3UCQA 8XIMA 5CJ5A 1CZ1A 4J3XA 4FS9A 4YVPA 1UC4A 3R79A 2IKJA 4RL3A 1IV8A 3I6RA 3NQMA 2ANUA 2D0HA 3BV7A 5HJXA 3LHTA 3M0YA 1OZQA 1TELA 4DJDD 1K70A 2WK2A 4R27A 1EP2A 5F4SA 1PCKA 2WZEA 4XZHA 3VNKA 4DNMA 3APYA 2WVSA 4AZIA 4F2UA 4CD8A 4F9DA 2FMOA 5BXSA 4B5SA 2VELA 2WZMA 3A4AA 4IPLA 4BWLC 1SZGA 4AMAA 3CEPA 3H24A 3BLKA 4GJ1A 1DWJM 1T41A 2OCZA 4EPBC 2X1UA 1MW3A 2EO7A 1JAKA 5LNUA 4AXNA 1TPFA 1V0KA 2GFTA 3WFLA 3RU8X 1M7PA 1XDLA 2XU2A 4DO4A 1XYMA 2X0HA 4FOUA 1SZNA 4UTIA 3S2JA 2OQHA 1QWKA 4UMBA 3VGHA 5FD0A 2R1KA 2QCNA 2GVLA 3ABQA 3MY9A 5CC5A 2I57A 3KCLA 4Q32A 4BQ2A 4R7WA 4G1KA 3E6EA 4WJEA 1PE1A 5K9DA 5D2WA 3R12A 4WSHA 4LY8A 1JFXA 4MWAC 4DWSD 1HKJA 5DCEA 3QYSA 2Y6ZA 3BZGA 3FDGA 3G0UA 2G41A 2ZA3A 2CC0A 3M0XA 4S39A 5JMUA 1ONRA 4CD4A 2XFRA 1L9WA 1RQBA 4YVVA 4GPNA 1NWRA 1YTKA 4J27A 1I1XA 3WBAA 3NM1A 2FJUB 3CHFA 2NXIA 2GGEA 4IUOA 3NSNA 1VLIA 1ADDA 1W3KA 2QGYA 1RR2A 2PCEA 4UFKA 4S3JA 2W5FA 3PJTA 2HQAA 4ZMGA 1AW2A 1UR2A 3PC0A 3F4CA 2ZDSA 1TJ1A 2VL4A 3MT1A 3FGCA 4CEXC 3GNOA 4YHGA 2AKZA 3LTYA 3IRDA 1UH2A 2YCKX 3E12A 4MJMA 1RP8A 4FEZA 4O0KA 3NZPA 4Y8FA 3LQLA 3W1XA 2GJNA 5FSEC 2HE8A 3PF3A 4AYGA 4UXDA 1UH3A 4WGHA 2J7BA 4P8VA 4IGHA 1HL2A 3VD3A 5B7ZA 4EXAA 3E02A 1XIFA 1KRBC 1UWRA 3NL6A 2O7SA 4RDYA 3U48A 3WMCA 1R9YA 3LBMA 3UY8A 2REQA 3WD0A 4DZAA 2EQDA 3H2OA 4XD6A 3SW6A 4AY8A 4FX8A 4ATLA 1B90A 2FZDA 1FA2A 4HCHA 3PB2A 3LCLA 3B9EA 2TPSA 2QYGA 3L4XA 4LS1A 3AQUA 5C9UA 5CSSA 3N2BA 2BB0A 5KITA 2XN0A 3DU0A 3TAOA 3VGDA 5CPOA 2IPGA 4P7NA 3GU1A 1AW1A 3P6LA 4YMZA 1UD5A 1H3GA 1EOMA 4O28A 3NJ3A 2HBXA 3V36A 2J4GA 3E0WA 2YCLA 2HVOA 4DF0A 3UJ2A 2O0TA 2VWSA 3ZR4A 4RZBA 5JBEA 3E9AA 1M53A 1XYZA 3EA3A 1MEIA 1K7XA 4AHQA 3ZR6A 3S47A 1CTNA 9XIAA 1LL4A 2YW3A 5GNXA 3I10A 1DIDA 3ZVHB 3AS3A 4LQ1A 1ZNNA 2ZRYA 2OGJA 1V77A 4H9TA 4PTDA 2CNCA 3WQWA 4D6IA 4D8AA 5BOEA 4K36A 1HJVA 3TSBA 3WNMA 4MYAA 2VR4A 1VEMA 4KEUA 4QQ3A 1IZKA 1UB3A 4TU1A 4H8NA 4XB3A 2G3MA 3VNZA 1E4NA 1IR2A 3AWNA 3UT0A 2Y7GA 1S39A 3LXCA 2I5GA 4NX5A 3SCOA 1I0DA 3MJMA 3G1VA 1O5QA 4Z1YA 4AQLA 3PZTA 4JKLA 4GI4A 4DJEC 3SGGA 1RZMA 1ME7A 1SZRA 2A85A 4E3VA 2VRQA 2BLEA 3RMJA 5ABFB 5D2TA 4JHMA 3QV9A 4QROA 2LLEA 1IEQA 4JKMA 4ZA0A 2Y85A 3COTA 3HG2A 3IVTA 1EYEA 1Q8JA 1NDYA 2ZYFA 3PULA 3AHVA 2GK1B 1SFLA 2RFGA 1LUCB 4PODA 4XZIA 1MXGA 3TTEA 4LGXA 4UQDA 4JICA 3ID7A 4LF2A 3CUHA 2F7FA 3RR1A 3W7JA 3RX2A 1ZUAX 3PG8A 5CG0A 1W1IE 3BW2A 1NDWA 1GTHA 3BAYA 3B0VC 2YKKA 2QIWA 3MJYA 4OGZA 1U2YA 2XIOA 1PEZA 1JCLA 2C91A 4CD5A 2VCCA 4GUJA 3W7LA 3FNDA 1F73A 2CHRA 3GG0A 1UP2A 3TQVA 3TH6A 2O92A 1IT8A 3PZGA 1WDDA 4K38A 1A80A 1BG9A 4KW2A 2OFJA 1SZEA 4Y8EA 3F2BA 1X96A 3LLFA 2QV4A 4PMJA 3UFYA 1BVNP 2NWRA 4XVDA 5CAKA 3AJXA 5CBIA 3QLDA 3QC0A 1TTIA 3BLEA 3QZ6A 3WQFA 2DW6A 1QK0A 1ISVA 4HU3A 2ZUMA 4K2SA 2ZFAA 1E73M 4GH3A 2YA0A 1PBGA 1QJWA 3G1DA 4KEZA 3R8HA 3TV8A 2NWSA 1SGJA 4NZ3A 1MXDA 1EDTA 1EZ2A 1HL8A 2HPIA 1EDQA 4E8DA 1HF6A 4HNTA 4Q8QA 4ADSA 1HGYA 3AAMA 3ABOA 4ZXOA 5I3IA 3W7CA 3QQWA 1ZAJA 1UIPA 2EPOA 2EXOA 4JHOA 3NL3A 4AX6A 4GQRA 5HDRA 2GQ8A 2ABAA 1WBHA 4DWSB 1Q4NX 3EX3A 4LVGA 1WDWA 4YS1A 2F6KA 4HHLA 4QGCA 4MWAD 3VIPA 1EH9A 4IWWA 4J2PA 1B3OA 3W86A 2KZHA 4B5NA 4GJJA 1G01A 3S9IA 4B15A 2BOGX 2CYGA 1FKXA 2F2KA 2XN1A 1VBHA 4NYUA 1LTDA 2E1WA 5TQLA 3LNPA 1VF8A 2IPJA 4XZBA 4Q8NA 1R7AA 2YBUA 4J4KA 4E4PA 3KWSA 4L9XA 3VC6A 3DI0A 1XC4A 3E5PA 2D24A 3I7QA 4W7WA 2HXUA 5G1MA 3QHNA 2ON3A 1PPIA 3MWCA 4HA3A 2IKIA 2YL9A 4O17A 1HL9A 1VRDA 4HQVA 3KX6A 2QUMA 3W26A 4CVUA 3VMPA 3GKAA 2QT3A 3HG4A 1VFTA 3WNOA 5BCAA 1BXBA 4I9MA 2DSZA 4H2CA 2HWGA 2Y24A 4QJ5B 2WJEA 3ITOA 1JR1A 3TU9A 2INFA 1Y8BA 3MYOA 3P2VA 2P8CA 3QMTA 4U5KA 2YXGA 2WANA 2XH7A 1P0DA 4CU8A 1TR9A 2VOMA 4DZIA 3EGJA 2ZC8A 2NUWA 1I75A 3ES7A 3N3TA 3UXIA 1X6NA 3WN6A 5CCZA 1ZRQA 3BSHA 3RX4A 2C16A 3B8SA 3IJIA 3P8JA 1CGVA 1VFMA 2JF7A 4E8GA 3CMGA 3GG1A 2Q8XA 2DZPA