4I9JA

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to dic4pc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
302
structure length
302
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
total genus 122
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i9jA00
3H4WA 5T91A 2PTDA 3CH0A 7PTDA 2FJUB 3V18A 5T9CE 3KS6A 4S3GA 3QR1A 4RW3A 2P76A 1T8QA 3EA3A 4I8YA 1DJWA 1T6MA 4I9TA 3NO3A 5PTDA 2OOGA 4QJ5B 6PTDA 1DJGA 1QATA 4F2TA 2PZ0A 1QASA 3PTDA 4OECA 3EA2A 1VD6A 2O55A 1XX1A 1YDYA 3RLHA 4QJ3B 3QVQA 3V1HA 1GYMA 3QR0A 3OHMB 1O1ZA 4Q6XA 3H4XA 4PTDA 4RW5A 4R7OA 4F2UA 2F9RA 1PTDA 1AODA 4F2BA 4I9MA 3L12A 2OTDA 2PLCA 4I9JA 1DJHA 1DJIA 2ISDA 3V16A 4RV3A 4QJ4B 3RLGA 3I10A 3MZ2A 1DJXA 4I90A 1DJYA 1ZCCA 1DJZA 5T9BG 3EA1A 1V8EA 2ZKMX 3KS5A 2OR2A 4GNKB 1PTGA
chains in the Genus database with same CATH superfamily
5AVHA 4B91A 3FV9A 4IOTA 2QPUA 2A85A 1DWIM 1BWKA 3SY1A 2PWUA 5ABFB 4FNPA 4AHOA 2Y4SA 3ABZA 3NNTA 3QGKC 3XIMA 3ITOA 3GR4A 1K9DA 1I75A 2IUZA 3QKEA 3R8GA 4F9JA 1VKFA 4G5DA 1EP1A 4YTUA 2EBNA 1J5TA 4C6NA 3E6EA 4KRZA 2YDAA 4RDZA 4FPSA 3F4VA 2WJFA 3PNZA 4E3TA 3UG8A 3FCPA 5JIWA 1OSEA 3SQLA 3HFTA 3A4XA 4B3LA 1OCQA 4UCFA 4K36A 3FFSA 3RF9A 3L9CA 1R2SA 4K68A 3CV1A 4J3WA 4JFWA 4R85A 3GRIA 2B7OA 3W7JA 4NJIA 5J8LA 2UBPC 2CITA 1E6RA 1XQLA 2I57A 4GFSA 5HK4A 1H2JA 1JL8A 1XV8A 1W9UA 4YS1A 4DX3A 1RAKA 1ZJBA 1QJWA 3VIPA 2YPIA 1ADOA 5E0FA 3FA3A 2DH3A 4GQQA 1YXCA 4I90A 4AC7C 4JY8A 2YJQA 1XXXA 3WFAA 5LNWA 3NTYA 2HXTA 2PB1A 3VD9A 3VIKA 4KFOA 1XW8A 1QUMA 7TIMA 4FI4A 4QISA 4HK7A 1CCWB 2E1DA 2FTPA 3VK5A 1UIOA 4XISA 2BXVA 4B5TA 1OEPA 2NSOA 4E2OA 2CPUA 4U10A 4O1EA 3CHEA 4HNLA 3WL1A 1S2AA 4KCTA 4DWSA 3U57A 3NUKA 3TSMA 2ZC8A 2V2DA 3FGCB 4JYFA 2NVCA 1BVWA 1XH2A 2BG5A 4HCLA 4FLRA 3WMLA 4JHMA 4UFMA 1H62A 1J0ZA 3S2NA 4JN8A 1DHKA 3KTXA 3T0CA 1WBJA 1LT7A 2A7RA 3TN5A 1ZLPA 1GVFA 4CNTA 4PTVA 1US2A 2Z1BA 4X0VA 1XIIA 3HG2A 3GH5A 3RU8X 3UBPC 2BY2A 4EK7A 5CSSA 2V38A 3SGGA 3TW6A 2QMJA 1JZ5A 1QHOA 1DWGM 3GG7A 5CZKA 5B80A 3H2EA 3VKBA 1WZLA 3R10A 1K8YA 5EGRA 2OLHA 4AC1X 1EEPA 3WBAA 3TJLA 3LGGA 3QPEA 1E4MM 4DJFA 3OIXA 5EKYA 3BMVA 2ZVIA 2H90A 3AC0A 5CPTA 4ERAA 2QV5A 4QG9A 3S2JA 3ITLA 3S5NA 1DEDA 3CWOX 2QUTA 3VCCA 1SZFA 4YN5A 3W7OA 2VRKA 3W28A 1Q6EA 3CH0A 3G8EA 3K13A 4KF1A 1CENA 3S47A 1JRCA 3K2GA 4JN6A 4AXNA 1ZPTA 1HW6A 3EOSA 5D2XA 1H7NA 1VBGA 3I3EA 3S9IA 1VEMA 3M0VA 1EX1A 3TOYA 3UG5A 4ROPA 3R6IA 1V3KA 1M68A 1XISA 1DIDA 5EYWA 4E6MA 3SGUA 1WAUA 3SUUA 5I3JA 1R8LA 3W26A 1XLFA 1RJQA 1PBGA 1W37A 1OFRA 1IF2A 3DU0A 3PULA 2D22A 1SW3A 1KD0A 1TRIA 1OCNA 2VVNA 1VFMA 3PFRA 3OLIA 3ZSSA 2PD9A 4JQ2A 5K7JA 3SSZA 5LXEA 3NM3A 4N4QA 4NJGA 3IPWA 2ZUWA 1XCXA 3M44A 2Z24A 3NWRA 4MY9A 2J7BA 3L12A 3WD0A 2NV2A 3BOLA 3CUIA 3ITGA 4B4FA 1AK5A 2MNRA 2FTYA 6XIMA 3NZQA 1EXBA 3W6LA 1XRSA 1JZ2A 3VGGA 1DWHM 4GZ7A 1K6AA 2CLFA 1KCXA 4BS0A 4GXMA 3WO8A 2D3NA 1X38A 5I3IA 2ZRUA 4UNIA 2JGYA 5LNSA 3K4WA 3PAJA 4TO8A 3WNMA 1JDEA 1X97A 4DUXA 5AECA 4JPGA 1F6YA 4OKDA 4RE0A 1QOPA 1J11A 2CYGA 4AZCA 4QQUA 3Q45A 2G96A 4J3SA 3ELFA 2GQ9A 4U31A 1PZ3A 1TMLA 3P0XA 2R6OA 1J12A 1TV3A 3QJAA 4PC8A 3CUHA 2FVLA 1P6WA 2DSZA 1O1HA 3ARZA 1Z32X 4MJMA 3GXPA 2PGRA 3RMEA 2Z1SA 3FSUA 2VC5A 4L9ZA 4M80A 1FXPA 2XDFA 1PKNA 8XIAA 4IFKA 3VOHA 4QXIA 3L4TA 5MKGB 3DX5A 3HPXA 4DJFD 4C7FA 3PTKA 5H1WA 3GXTA 3EX4A 1KFLA 2E8YA 3M64A 2WV8A 1XFBA 4BI7A 4XAZA 3ZM8A 2VEIA 1LQ2A 4NP7A 4PBFA 1J2WA 4DLMA 5E93A 1B54A 3UVAA 3CLWA 2FGZA 3W2JA 3UJSA 3B9DA 3PNUA 5REQA 3IUIA 3OLEA 1E73M 5AB3A 3WQWA 2RUSA 3EOLA 3AHXA 3VX0A 2B31A 4KWWA 1S3HA 4QE4A 1WOAA 3ZVHA 3RGTA 3HGRA 1XYCA 1GQLA 3WLHA 1CB7B 1N55A 4QROA 5JVLA 3AMCA 1EFZA 4XZNX 5C9ZA 2HS8A 2TSYA 5HINA 3L0NA 4ZO7A 1YPXA 4WX2A 4LS1A 2G3MA 3N9KA 4OHQA 1A5LC 1WBHA 1XS2A 3GR7A 4Z2JA 4XZIA 4JDYA 1HJQA 1W8GA 3VUSA 3MB9A 3GS6A 4MNKA 3UJFA 5HOSA 2GGGA 3QMRA 3KM8A 1AVAA 1V02A 1UMLA 4F8XA 1XLAA 3ZS4A 2EKGA 4JDBA 1K9FA 3QYQA 5HBFA 1G4TA 4HZ8A 3HM7A 1J8VA 4EWJA 6CGTA 4GMEA 1KFCA 3CUJA 1V6YA 3V36A 1UWUA 1A47A 3OGRA 1W56A 1IZJA 3GO2A 2WKJA 1XM3A 3DERA 2VC7A 1EC7A 2PDKA 3URBA 3QY8A 5C6MA 1OT1A 3TU9A 3N19B 2YW4A 1EIBA 1MDLA 3WN6A 1DXEA 1R3VA 3AZRA 1D8CA 4LBRA 3W7LA 4ZOAA 4RZ6A 5A94A 1LF1A 3I6EA 1TYGA 4RE3A 3AO0A 3CAKA 1RP9A 2IKGA 3UZYA 1HJWA 1ITUA 5EFFA 2D20A 3BAYA 4AD2A 2F6XA 3MUXA 1WKEA 4PSPA 3NQMA 1ZUAX 5C2XA 2QPXA 2QW5A 2OOFA 1P1MA 2ZQ0A 3OZOA 4A8RA 1F8MA 3CZKA 4FF7A 3S1XA 3DKJA 4JTAA 4KPLA 4DAIA 2B4GA 3CH9A 4NAEB 4RZ4A 2FMOA 3DECA 1T41A 3H54A 2FJKA 1QI5A 4ZMGA 4D2JA 2GZXA 4J9JA 2EPKX 5A2BA 5G4EA 1D7FA 3NO5A 1XSKA 1BAGA 2OEKA 3P5ZA 1FWNA 2J47A 3IIPA 1V0NA 2J4GA 1XD0A 1B2YA 4P8UA 1XLEA 4DXKA 1KCLA 1A5AA 2VOMA 3E02A 4W8LA 2Q01A 3H2NA 2O9PA 4NNAA 5I06A 4WZHA 2CERA 1HIZA 3TVAA 3NOYA 4FO4A 3OZYA 1L2UA 3QMTA 2W5FA 3W88A 4ZVJA 1MZRA 2ZUSA 3UWWA 3G18A 4IGHA 5FF7A 1XSJA 1AUSL 2W4XA 4Z1DA 3MYPA 3R1ZA 1QPKA 3P67A 4S3CA 3KVLA 3ITCA 1UR1A 1SSDA 2G5WA 5GVJA 4MB5A 5HXMA 1HKIA 1JPHA 4OU1A 3W76A 2J9YA 1FXQA 5BYWA 4ZE5A 5C7VA 3AZTA 5D32A 4Q8MA 2CESA 3G77A 4A6GA 4ATWA 3CPRA 3UJ2A 1FHUA 3ERPA 1FWWA 2DVXA 4AYGA 1G0CA 5I3FA 3BLFA 1JYXA 3DFPA 3P8IA 4IH3A 1CEOA 2WSKA 2ZUUA 1PEZA 3WD3A 2Z4GA 2DIJA 2IKJA 4BF7A 1B3YA 3MA8A 4Z1YA 1AMKA 3DI0A 4HT3A 4CNUA 4Y2WA 3LCWA 3F4WA 4HNCA 2QZRA 3BMWA 3MUZ1 2ZX8A 4JFUA 3GBEA 1IZKA 5D30A 7REQB 4C1LA 4GIEA 3EWDA 3W85A 1A0DA 2QDDA 3EX3A 1XIFA 1S1RA 2ZZ1A 4OBSA 3E38A 3M0XA 2AL2A 4NAFA 3SQSA 1ZFJA 5HWMA 1LQ0A 4MKSA 4NVTA 4NXKA 3G1HA 5CSYA 5CPOA 1XX1A 3AIRA 3SI9A 3F03K 3P8JA 1GOQA 1PX3A 4UTIA 1J6OA 4Q4QA 5DEZA 3UGRA 4FNUA 2I17A 4X0NA 1SGJA 1TIMA 4CQBA 3AMKA 1SFLA 3PSWA 4Q7NA 1IWPA 1I2OA 3VNIA 2VX4A 2NVDA 3TFCA 2EPLX 1E0XA 1US0A 1C92A 4A29A 4I9MA 4DBWA 3AMGA 3YPIA 1G94A 3O0KA 1VGAA 2Y5JA 3CV6A 4GH3A 3N2BA 3F7JA 2ZICA 4OV4A 3DFOA 4JTUA 5H91A 3E0IA 4MWAB 3FW6A 3H4WA 2XZ7A 2YBVA 3LLDA 4KBXA 3T08A 4F0LA 1H51A 1M3UA 1IEIA 1ZB5A 4PUUA 4R9OA 3V0TA 1MDRA 2OKTA 5AC4A 2EXOA 2QDGA 2GL5A 3KTSA 4GVIA 3IV3A 1VFUA 4PRRA 3B9OA 1CGXA 4HNUA 4BFAA 3WELA 4W4QA 5GNXA 3K8KA 1ONRA 1FWTA 3KHDA 4GQGA 1TR9A 3N34A 1NU5A 2E68A 1BGGA 3PTDA 4GBUA 3CBWA 1R9ZA 3G0UA 3EDEA 9CGTA 3CAVA 3EX2A 3M0HA 4C1NA 1XC6A 1I45A 2PWGA 4S1FA 4J3UA 4LAZA 3W1NA 1EZ2A 1E1EA 3N73A 2PGEA 5RUBA 4C6LA 1SMAA 1ZRQA 1XRFA 4K7VA 1E4LA 3VNZA 4QG8A 3GFZA 1ZJAA 1QK0A 5CPQA 3M0YA 1PDZA 2G8ZA 3AZSA 2PWHA 2VZUA 3HQOA 1NDYA 3NQVA 3O9NA 4XVEA 4US6A 1TCDA 3HV9A 5FJIA 3MP4A 1XIJA 1V7YA 5HQLA 2NUXA 1ME7A 3RRXA 5AC6A 4FA3A 4E4PA 1PE1A 1TTPA 3OBKA 2E9LA 1KW1A 1W17A 2O0TA 2C16A 3Q37A 1XYAA 1KGXA 3WNKA 1E43A 5CSRA 2A7PA 1TE6A 4KEMA 2WSYA 4S2CA 4HJWA 3EWBX 2FDMA 3W37A 4JEJA 1D3CA 1OD8A 1VPXA 1F5ZA 3MKCA 2VXNA 1I6NA 4JOMA 1PIGA 3D6NA 3PZ9A 1H7XA 3P5YA 1GKRA 3V35A 3O6AA 2EG8A 1R6WA 1VHNA 2PDPA 2QS8A 5A95A 4FR6A 1OF8A 3NL3A 1P4CA 2CXEA 4KMQA 1D8WA 3GKAA 4M82A 5A2CA 1ONEA 3L2MA 4INFA 3A24A 3RLVA 4E0CA 4W5ZA 4XZHA 1W3NA 4CN6A 4LBUA 3SCRA 1KM4A 1O1ZA 4NQ1A 2YYUA 3KW3A 2WC3A 3VNKA 3EB4A 2YYTA 2XUCA 5FF0A 5EMUA 4UXDA 5KEZA 1F9CA 1TKKA 2WHMA 3UGVA 4GXWA 1X1NA 3FSTA 4FR1A 4CD8A 3PPFA 1YLVA 4WOQA 5TIMA 3BW2A 1Q85A 5FJPA 3CGTA 1RA0A 5DLCA 1MEHA 2ZC1A 5E0CA 5I7GA 3R2GA 4LH8A 4D8ZA 1XYLA 2FH6A 2C1HA 4HSOA 4QLLA 3GC4A 1YE6A 2CLLA 1E4IA 1HQTA 2CBIA 2VGGA 2OSYA 3VI2A 1FY6A 2TYSA 2C18A 3H2CA 3GHUA 1HVXA 5C2CA 4CNSA 1V77A 3IANA 1XUUA 3SB0A 1P6CA 1XIGA 3W3OA 4PRTA 3AIQA 3GHSA 2V69A 3SAZA 3KOYA 3K30A 1GEQA 3A4JA 3VOFA 4UQ9A 3WF3A 2FZDA 3VYLA 4LCSA 4AF0B 2GJPA 2XSXA 3GDMA 3K1GA 2QAFA 1ISWA 4MNMA 3WLLA 4Y90A 4ZQCA 2QIWA 3NQ7A 4C7DA 1LWIA 1FUYA 4NJKA 4IMDA 1FCQA 2WHLA 3URNA 2Y7GA 1TRDA 3GX9A 3MUY1 4QG6A 3OLGA 1PTDA 4RK8A 4AHQA 4BEUA 1E55A 5EMYA 1L8PA 1RV8A 2J8TA 4DPQA 2J9ZA 4C6QA 3B0XA 1Q8JA 2DV0A 3KDOA 4GE8A 4A3QA 3G6MA 4IISA 2HBVA 2PP0A 2JGQA 3FOKA 4EIVA 2WKLA 3N2MA 2E28A 2YA0A 1XCFA 1Q4WA 2WC4A 2BVYA 1E1CB 2RDXA 1PTGA 3GDRA 5I3KA 3AJXA 3C6CA 3OYZA 3DKLA 2F6KA 3VGHA 4BI6A 4KIRA 3DAQA 1TVPA 1ZENA 2G3IA 5A1AA 1XIBA 1HL9A 3TLLA 1FQ0A 2QXWA 4PMNA 2GQAA 1TJ1A 3O05A 4LQ1A 2HBXA 3NQAA 3JZEA 2VX6A 3A9BA 1SO4A 1J0HA 5CEWA 3P0WA 2VZVA 4GUHA 6TAAA 4POCA 3FYPA 4LC8A 3TN4A 3KBVA 5ABGA 1AQMA 3EDFA 3WD4A 1RJRA 3GZAA 1UW9A 2WM1A 1OFEA 3U3HA 3UXLA 2HCVA 3IJ9A 5HAOA 1QNPA 3UEQA 1BYBA 2XINA 1FWDC 1DYSA 2QV4A 1GW1A 5I3DA 1WPCA 4MDPA 2VRQA 5BXTA 2BWGA 4AWUA 1H1NA 4TTGA 1ZP4A 3KRBA 5FEXA 4Z2KA 3SUVA 4HA3A 3WLPA 3RO6A 3PPHA 4CNOA 3EWCA 5EY5A 3VIGA 1DJHA 1KO0A 3RX4A 4GUJA 1V03A 4L4LA 3OBEA 1JGIA 3LGEA 2V2CA 2PC4A 2WMKA 3KVJA 3W1PA 2BLEA 2BOFX 3QH2A 3WCZA 1MSSA 2VI0A 4Y9AA 3OVPA 3VMOA 3R8HA 3GR8A 3FJNA 5IBXC 3C0QA 4ICCX 3NEVA 3WX7A 4Q8UA 1KXTA 4UWMA 4DBEA 1OC6A 4AVFA 1GVOA 1V6XA 2WMFA 4I7VA 3HU7A 1DQUA 4K8HA 4XSMA 4PCSA 4PFMA 1W1PA 4L80A 3FLUA 4KW2A 1GVEA 3WDPP 2GGJA 4NKCA 4NI8A 2Y6ZA 1W2VA 4JXCA 4AD3A 2XWDA 1J2BA 1LUCA 2DP3A 1Q65A 3Q65A 4PUMA 3VO0A 3WDJA 4U5KA 2Q3OA 2W92A 4W5UA 3QEZA 4Z08A 2D24A 3GTIA 1Z7AA 3DI1A 3ABSA 3SIZA 3OVQA 1NQ6A 2REQB 4B9ZA 1MW1A 3EOOA 3MSYA 1VF8A 3BSMA 5ABEA 5BZAA 2BY0A 1IT0A 2DSUA 3R79A 3P61A 4Z17A 1XR2A 2IS7A 1EJRC 2TAAA 3E5PA 4EWND 3BMXA 1YMYA 3FVDA 3MV11 2J9XA 4QS5A 2Q09A 2WVTA 1VP5A 1VCFA 5HJLA 2EG7A 4QAIA 1R9YA 4MY1A 4IWWA 4HA1A 1GKPA 3W25A 3RHGA 1XGEA 4REQA 2GJXB 4QIUA 2OX4A 1WQ5A 1RCXB 2YCIX 4ERIA 4F3HA 5EU9A 3BCDA 4WDXA 3IIZA 3DGBA 4UNLA 2YCLB 2DZPA 3GG0A 3QSRA 1FWJC 3CYVA 2VT0A 4KH2A 2R1KA 4UTFA 3ONCA 4FALA 1WXJA 3GDLA 3NSXA 6REQA 2G4JA 3PF3A 3LBCA 4YHEA 4QITA 5JU6A 2VKZG 1AL7A 1OCBA 5F4XA 1J93A 3RILA 3CASA 3LHWA 4IL0A 3THCA 2C79A 3QHMA 5TNVA 3F2CA 5F7UA 4GVFA 4JGDA 5BRBA 1K8XA 4AX6A 2WBKA 5I02A 1ECEA 2OX1A 3PN8A 1FH7A 1L6GA 1QPQA 1JFXA 2GK1A 3WDHA 1OFQA 1OIMA 3W53A 1OZMA 1ZBKA 1XWYA 4A8LA 2Z00A 1QHPA 2VR4A 3THUA 2VC9A 3G3MA 3M0ZA 3PWIA 2XFWA 4CVUA 1XGZA 3GIQA 3AUOA 3RUBL 3AIVA 1OX6A 3WH7A 4OWGA 2W61A 2A5HA 2W9MA 1YTKA 5DN1A 4ORIA 2FFIA 2HPMA 1REQA 2XVLA 1CDGA 4F79A 4QNEA 1PXGA 2BVDA 3RPTA 3G1RA 1E9IA 1UIPA 1A0CA 1KM6A 3CAQA 4DQWA 4L1WA 1P7TA 4KWUA 1SJCA 3P14A 4FLSA 1OF6A 4JTTA 3HPZA 1EBHA 2QT3A 1E3ZA 3DFNA 3VVGA 4C6FA 3CHVA 3L0KA 4O4WA 3NQ2A 3C2YA 4DUWA 2PURA 3LPGA 5AZ0A 5IDIA 3CHFA 1RALA 2VZSA 4O1FA 3C5QA 3UPBA 5D4YA 3WENA 2Z6IA 4W87A 3MQTA 3W2UA 1QBAA 1S5WA 3PY2A 3WMBA 1HKVA 1Q63A 3WH9A 3PBYA 6ENLA 3NZ1A 1BXNA 1S2TA 1CLVA 1GQJA 1VEOA 4L1GA 3PUDA 1IIHA 3S1UA 3LEPA 4HU0A 1AQ0A 1EC9A 1K9TA 1NP0A 3CB8A 4B2DA 3MSGA 4NUWA 4O8AA 4E2DA 4CCZA 4CCEA 2P5NA 1MO0A 3WQEA 4EKJA 4J2PA 4QFUA 2A0NA 3BLIA 4IPNB 3A5FA 1XLDA 4ERGA 2P53A 1EEXA 1BWVA 2PBGA 4DF2A 1QW7A 3I4KA 3UG3A 2PRLA 3G1DA 2E67A 2FZMA 2UZ9A 2ON3A 1L2QA 3CZLA 3W7CA 1AJ2A 3KRZA 4MG4A 3GNXA 1HO1A 4YWIA 1YNYA 3PB2A 5BU6A 4C6BA 4FEZA 1JULA 3U2OA 1Z41A 3TV8A 3WEMA 3CPGA 1S5MA 1OGGA 2BBFA 1DJWA 3WF1A 3FAWA 2VFHA 2WVSA 4MMWA 4X3ZA 2O9RA 3WG6A 4AD1A 1S2CA 4JTRA 3OG2A 1KV5A 3DG7A 2PC8A 4BQ2A 1P5BA 4J1OA 1FTXA 4JIEA 4AY8A 3LRLA 2PDXA 1DPMA 2AGTA 1VC4A 4WQ6A 1XI3A 5KMYA 1KC7A 4CD5A 4IIHA 4QBXA 2GQ8A 3QR0A 1YQ2A 1RLDA 3GFYA 3N15A 5H2ZA 3K4DA 1MW3A 4GNVA 1C93A 1VR6A 1Z42A 4LUTA 4U4MA 3UETA 3WK2A 2PZNA 5AC5A 2XIOA 3QYSA 4MPKA 5LNRA 2HK0A 2Y1HA 1SFTA 1A4LA 1OX4A 7TAAA 4YCPA 2ZXAA 2HV5A 1JQVA 2H3DA 1QFEA 2HNEA 1JYNA 1WKFA 1TWDA 1M04A 3DFTA 3LQLA 4BI5A 3LMYA 2XN2A 3HJEA 2XH4A 3VTRA 2OG9A 2NT1A 3W27A 2VWSA 1XHGA 5I0DA 4B2DD 4AXKA 1PYFA 3H7VA 2DEPA 1SVDA 3WK1A 2CC0A 1FWEC 1PCWA 1JCNA 4FOKA 1VZWA 3KCLA 1I2NA 2X05A 2VEPA 4IMCA 4AVNA 3ZJ8A 5J5DA 1EKOA 2C71A 1B30A 1A5BA 2D2HA 3GK0A 1UWRA 5DCDA 3S5ZA 4GHRA 3TLQA 4X61A 3N3TA 4PMDA 4HPNA 4NJJA 3A5VA 1F8IA 5TBOA 3W87A 3LRMA 4RX0A 5D9OA 1FWIC 1AZ2A 2P88A 3VCRA 1UKOA 4Q4RA 4TOQA 5CBIA 2E1WA 4ACZB 3UW6A 3GNOA 4G9PA 2QMKA 4I6VA 1W6TA 4TX9A 3QTGA 4WRHA 2NUYA 6A3HA 3UPMA 1L8NA 4OBTA 3T8QA 4WD0A 2XIJA 2J75A 4JTQA 3PPCA 3HMCA 3M16A 3I65A 4GQBA 2PA6A 5DX7A 5DXXA 3WK0A 4DIAA 2E6FA 3EWZA 3THAA 1PTAA 4LAKA 1FWSA 2D0GA 4H2CA 3H7RA 3WF4A 1W3LA 5CLTA 3BG9A 4RV8A 5DMMA 2H9AB 4PMYA 4F0HA 3USZA 3ARTA 2JEQA 2CLHA 3VIIA 3O06A 1KNWA 2BMBA 1DTUA 1FWHC 3SCOA 1AQHA 1EA0A 4JX5A 1F3XA 4AISA 1V93A 3G0XA 1YRRA 1IV8A 3URAA 4AHPA 2ZTJA 3ABOA 1UKPA 3NZGA 4DXVA 4LFYA 4CU6A 3OTRA 5HQEA 2ZRYA 2MUCA 3T0TA 1EC8A 3DENA 3W07A 4DNHA 2YB4A 1EA9C 2E5DA 5FSDC 1XBVA 3SFKA 3TC6A 2GJRA 3LXAA 3S5SA 5D2VA 1ZALA 4UZSA 1AODA 2WJEA 1NWRA 1OGBA 1NDWA 1XBZA 1AW1A 3M46A 1QNOA 2J13A 3ZFHA 3L4ZA 3V0SA 3BL3A 3UNDA 4I7WA 2DUXA 4CQDA 4ML4A 9XIMA 3GLCA 3BK0A 4A05A 3IIXA 2VENA 5E1QA 5E9AA 1BSIA 1KTBA 2HS6A 1UD8A 1I8JA 2YLLA 3ZT5A 1CI1A 2PTWA 3N9RA 3B03A 1CTNA 2HXUA 3V18A 1J0IA 4GO8A 2A6LA 3ITTA 1Q6FA 2Z29A 1LL6A 2QF8A 4L4PA 1QW9A 4UMCA 1BFNA 4YU1A 4Y9OA 2Z0IA 1HGWA 4RNHA 4Z2HA 2DZAA 2Y5EA 2DQXA 3GU1A 3Q4DA 2W67A 5CSUA 2PD5A 4JQ1A 3GTHA 4GPNA 3R43A 5F1VA 1Q6OA 5D03A 2V2HA 5IBXA 4XO6A 4D6DA 4MLJA 1PIFA 5FESA 2OZ3A 3QQ0A 2YZ5A 5HATA 2YGYA 1W3TA 5CH9A 1QNQA 2C14A 4ZE4A 3TAKA 3F5KA 3UWQA 2P0OA 1IYXA 3EBVA 5A2AA 4NZ3A 4WKFA 1TWZA 3H26A 2CWXA 1CXHA 3W38A 4QJ4B 4H8VA 4P2VA 2YB1A 1IXNA 2D3LA 2VQTA 1JZ4A 1GONA 3W72A 5LXXA 4JTGA 2JEPA 3KS5A 5JBFA 1QI4A 1EH9A 1NWTA 4O14A 4J35A 3S6OA 1T40A 4JQ4A 4BEQA 3KS6A 4PUWA 2X40A 2YDQA 1WO2A 3AALA 3R12A 4J5NA 3QF0A 2BX7A 2VR2A 5XINA 4H8UA 3F5JA 1LROA 3CWNA 3TAOA 1OC5A 2DZSA 1TJ0A 5BROA 3RFAA 3SJNA 4IP7A 3NFUA 5LNVA 3KZSA 4Z0SA 3B3DA 1W5NA 5C8BB 3MI3A 5HUOA 2ODOA 1TZ7A 2WZTA 1ME9A 3MI2A 4DM1A 3U2EA 1I60A 3CMFA 3DBNA 1WZMA 4LANA 3W4RA 2WVVA 4NZ5A 3RCMA 1OK6A 1VJIA 4URIA 2BASA 1K8CA 3CQKA 3TN6A 3HGSA 1DWJM 4V33A 1W3KA 3E0FA 4MJZA 3VNYA 1F6KA 3OO2A 1QPOA 2W0UA 4L5ZA 2E6YA 4HN4A 1LRTA 1Y5XA 4F0RA 3F2DA 1DWFM 1SQ7A 3TQ0A 5GJPA 4DNMA 1DJXA 3COTA 4CQ9A 3M1ZA 2WKGA 4JCMA 2WO5A 4GJIA 1RQHA 3T1GA 3MZNA 4ILSA 3FHQA 3MMDA 2W91A 1VEPA 4C6JA 1KFEA 4Q8WA 1WX0A 4NU7A 2WMGA 4LVFA 3NVDA 1TMQA 2ACUA 4ADSA 3V3WA 2BVWA 1I9CB 3D3FA 3GW0A 1D3GA 2OPJA 3BW4A 4AD4A 3GDKA 1UR4A 1IZCA 1TPDA 1NY1A 4GX8A 1M5WA 2CBJA 2YCEA 3BV7A 2D73A 1L6WA 3TA9A 4XO7A 4P8WA 2R1MA 1KTNA 2P50A 3BARA 1Y65A 2XIQA 3EB3A 3WQ6A 5HA7A 5LA2A 4LNYA 4DYEA 1YIXA 1J10A 1Q7ZA 4P5UA 3GD6A 3QGVA 3BURA 5HWNA 4OGZA 1RCOB 1DTNA 2PDFA 1E0TA 4JTHA 2J7EA 1YHTA 5CGMA 4NX5A 3LXBA 2VEGA 4E5TA 3OEXA 5CBBA 1DXFA 3EMCA 4R7OA 5G4WA 2ISVA 4QP0A 2RHGA 1BF2A 1LLWA 4EF9A 2V3DA 5ABHA 3A23A 4MTVA 1JEZA 1GGOA 3IVTA 1YXYA 4MWAC 3UJEA 4IPLA 4MFEA 2QHAA 3P82A 1A3HA 3VE9A 2I16A 1TPC1 3CK5A 2CZ5A 5F4WA 1LTDA 3XINA 3E12A 3VKDA 1GEHA 2CLPA 4M7TA 4EACA 1HT6A 4AY1A 1NP2A 3ARXA 3A3WA 3SCNA 2YL6A 5M17A 1DL3A 1M7XA 2WOQA 1TWSA 3OZPA 3UR2A 4X2RA 1MRQA 2TODA 3EOUA 4H6EA 3VOIA 1ZL1A 1F2JA 4LJ3A 3WY1A 2V5JA 2A3AA 2WZMA 3N25A 3EYPA 1PZ2A 1KCZA 1IEVA 4KETA 5AC8A 4V28A 2WJZA 5DF0A 4GI9A 3VNJA 6PTDA 2DIEA 2DPEA 3UY7A 1UKQA 2ZX7A 3T07A 4AAJA 2P3EA 1SFJA 1U22A 2Y5SA 1TX0A 1EWDA 2J7DA 3UXDA 4NNBA 3IRSA 1EB3A 4KS0A 1YBQA 4FK9A 2OVLA 3PZMA 3FGCA 4QHRA 1TTIA 2QDEA 4WVXA 1A5OC 1E1FA 4GI6A 1GJPA 3B9NA 1MXDA 4XTDA 1PDYA 4IQLA 2YFNA 1S46A 3BZJA 4JTFA 3UA4A 1P0KA 2ATMA 5FEWA 2TPSA 1ONWA 3WUFA 4G8TA 4TR9A 5FL1A 4GX9A 4Q4SA 2V5KA 1DOSA 3GU9A 2ZX9A 4ATDA 2VDIA 4PCNA 4WIWA 9RUBA 1ZHAA 2A3EA 1B3OA 3EWYA 3VFLA 4WKAA 4S3BA 2E9BA 5HMEA 4JFTA 1OQFA 2PLJA 2QPSA 2GVYA 3NZPA 5I23A 2NQ5A 2GGHA 3EA3A 2CHRA 2YA2A 3H21A 3PJUA 1OC7A 2X16A 1DXIA 2H6RA 2HE5A 4WSKA 2EPNA 4A3HA 3PZVA 5LHEA 1MRAA 3WEOA 3WBYA 4IFKB 1H7PA 1PHWA 1C7TA 1H3GA 1UZ1A 2ZWZA 2V3GA 3DHUA 2QNEA 4CU8A 1P1XA 4AIEA 2C0AA 1V02E 1W1B1 4MJ4A 2J27A 2ZRZA 2NSXA 4CNNA 3KFTA 2W6RA 2TRSA 1JCTA 4HU4A 3P62A 4DHGA 4MNJA 4YVXA 4HNNA 2DFAA 2R91A 4AIOA 2NX9A 1MFVA 1H7OA 2IKHA 3QV6A 4DO7A 4C91A 4LT9A 2C6QA 3PZNA 1TV2A 5FACA 3UJRA 3CMJA 1L6YA 1WDPA 1NELA 4MZYA 3ZVHB 2VOTA 3GG8A 3LS9A 1ITCA 4HMCA 2V5CA 1RK6A 2NQLA 3BGJA 3UF9A 5CLWA 2XIMA 3M6YA 4MB3A 3TXZA 4W7WA 2FDSA 5CCZA 1RVGA 4UQAA 4IMEA 2XSBA 3FXGA 3R7MA 3WLJA 3BLLA 4Q4OA 4RW3A 2ZTKA 2PRMA 1Y0EA 4DWDA 2PDYA 4H9UA 2OFJA 4WSJA 1GJUA 1R86A 3WH5A 4AWTA 3CO4A 4LS2A 5JH2A 1XIHA 1M53A 1E70M 1M1BA 2L5HA 1J4EA 1UROA 3TN3A 1ENUA 5TAOA 4JIHA 3B0UX 1A5SA 1SJBA 2ALRA 5DY2A 1KKRA 4PA8A 2V30A 1BYDA 3BV4A 1YDNA 4B9YA 3ZQ9A 3QW3A 2WZEA 3AIBA 2FGLA 5I00A 3B8TA 1MUCA 2X0HA 4KEZA 2DUAA 2VFFA 5FIPA 3Q2DA 2PDMA 1UWQA 5A8NA 1MXSA 5D8ZA 3MI6A 1KV8A 3HG5A 3NGJA 4J2MA 3C3UA 3ANVA 1XGDA 5FJTA 4ZQOA 4AVOA 4XX6A 3LV6A 3LENA 2EKCA 3I10A 3VGBA 2Z28A 3CB3A 5CKSA 5LA0A 4D8LA 4HNOA 4QJ1A 2YDRA 4XKMA 1UBSA 1OB0A 2G3NA 4EPDC 3QY6A 3ZLGA 3FK4A 6TIMA 3QLLA 3R89A 3E2QA 4GVHA 3LU2A 4WKHA 3W86A 1SPQA 2X7WA 4P7LA 4AZIA 1UP0A 1G7VA 4LUIA 4DZ5A 3TTOA 1CECA 3ZYZA 2XFYA 4J7RA 3W83A 4RPPA 5ECVA 2ZIDA 1BXBA 3F4CA 4BWLC 4FX8A 3S1GA 4C6KA 2QLYA 2XG9A 3DYOA 1CPUA 4GYJA 4NZCA 5HMSA 4UR9A 1Q13A 4DAFA 4H3DA 2J7FA 1A49A 5E9XA 1OYAA 4L9YA 5HJYA 5M5DA 1GT8A 3MT1A 1D9EA 1I2PA 2CLIA 4PTDA 1V5XA 3L68A 1R3WA 3VPLA 1JXJA 3HQNA 4PGLA 2CU0A 1HJSA 3WSUA 4LAOA 4MLRA 2LLEA 3V5OA 2ICSA 3DHDA 1Q6RA 1FDJA 3GAKA 3GVQA 4ZQPA 1H5YA 1DIEA 4LWWA 2Y61A 1ALDA 2H3BA 2A3HA 1CBGA 1ICSA 1SR0A 5A8PA 3EPOA 5A8OA 4N02A 3UA3A 4B16A 2NT0A 2WMIA 3PVFA 3PBMA 3P60A 5CAKA 4LB4A 1YPIA 3SQMA 1VBHA 1B31A 4C60A 3SY5A 2Y0FA 2PDIA 3CIVA 4M1RA 1Q4NX 1FBAA 4Z2LA 3W7QA 1EDQA 1PPIA 2PDQA 4E4FA 2IXVA 3SDOA 1UZDA 5LGXA 1B9BA 1TSIA 1X8CA 1XLHA 1F4HA 4NRSA 4UTKA 3LHUA 4I5UA 4NAFB 4LV4A 4D6GA 4R3UA 4X60A 2NXGA 4NAEA 4F40A 3EOEA 1IR2A 1PKLA 5DMYA 2HEJA 3T44A 4O50A 4MUZA 5HPCA 5E70A 5LIKX 1QO2A 2Q02A 3AUJA 3WQGA 3TE9A 1FP8A 1KRMA 2D69A 1TO3A 4HOWA 4ATLA 3RXZA 1ADSA 3AJ7A 1N8WA 3T0BA 2X09A 3A3HA 4MADA 2NV1A 2W79A 4FAMA 4C1KA 5M3WA 4C7GA 5AHNA 4AMAA 3BCFA 4H9XA 1OADA 4XG1A 4R5EA 3GUGA 3PBWA 4A4AA 2GOUA 4PUNA 2XN0A 4NG3A 4O12A 2VCCA 3QC3A 3BW3A 3T78A 1MNZA 3FJ6A 3T2PA 2ESCA 1W1IE 4TVCA 3JU2A 3QM3A 3IAPA 3NGFA 4LU0A 8CGTA 4J4KA 4FMVA 2ANUA 3QZEA 3L5AA 3EGJA 4BA0A 5A6TC 1CIUA 3CZJA 3VILA 4J27A 4LF2A 3N13A 1XLBA 4IHCA 1DJGA 2VUNA 1RUSA 1O7AA 3WLRA 3LZ5A 4FOJA 1KXQA 4RPQA 1O66A 4X63A 3LX9A 5LKYA 4YMZA 3F2BA 3M0IA 3NXLA 4JCLA 1QWGA 1CGVA 1YEYA 2A21A 2G3FA 2D2GA 2DW6A 2IQ0A 1PZ1A 4NASA 1KRBC 2KX9A 1VBJA 1JNDA 4P7QA 3W73A 1W54A 3T40A 1Q2SA 5JH1A 3R0UA 3DHFA 1J0JA 3P80A 5DT7A 3RR4A 3DN5A 3N4FA 4MAVA 3WMSA 5DO8A 3DBPA 3OJGA 2R1PA 3LG3A 1KBBA 4IGMA 3CYJA 2VQUA 4YXGA 4JTCA 3TTSA 1G1YA 2YFOA 1RA5A 4LYRA 2CZEA 3W1AA 1CGUA 1K77A 3F4NA 1JPDX 2B7NA 3SCVA 1A0EA 1RPKA 1VFOA 1GQNA 1PL9A 2ZRVA 5AHLA 3VUPA 4GWEA 4OVXA 4G7EB 2VUYA 3NXFA 3II1A 5AYZA 2ABAA 2FZ8A 1GPFA 1VQTA 4M0XA 2Y7EA 1R85A 2OGJA 3OU8A 1ICQA 1O60A 2BHYA 1G01A 2BODX 1JUKA 3LCLA 2V9DA 5C2GA 3VIFA 3EPMA 4MWAA 3AIUA 5F4SA 4WDWA 3LLXA 1WDQA 3LSBA 2EAWA 3VGEA 3BGAA 1VS1A 1XINA 4O54A 5CPMA 4QLJA 3MSRA 1PZ0A 2HZGA 4HTYA 4W88A 1UWIA 2OCZA 3NQDA 4LW7A 4XQ6A 3H22A 4N9CA 3T05A 3BJFA 5EL1A 3ARUA 1QI2A 3GKFA 2UY5A 2CNCA 3NDZA 3WQPA 4YJ5A 4D9PA 1SM9A 1NFGA 3DOPA 4QAWA 4Q4MA 3HGJA 2QCDB 4JTDA 3L5LA 1HG3A 4B15A 3S9YA 2Z7GA 4L7ZA 4XV0A 1F07A 2AGKA 1NARA 2ZADA 3A47A 5CPSA 2WZHA 4KGLA 1HKJA 2ISFA 1H09A 1H50A 1MFUA 3U6WA 3L21A 2VEFA 1UC5A 3IS4A 3EA1A 3S6DA 3S2CA 1JI1A 3BVJA 1ZY9A 4PZVA 4M8UA 3WNPA 1GG0A 3ONBA 2G37A 3CM4A 1JD9A 4JIIX 3APYA 3PS7A 4O52A 1VLIA 5M03A 3L7RA 2F7FA 2PP1A 4B3ZA 4GACA 1GYLA 3PZUA 4A22A 1XPYA 1JZ3A 3AISA 1TWIA 1QATA 3WL0A 2VR5A 3SSJA 1SZNA 2WNNA 4HHPA 3OYXA 1YNQA 3UFYA 4G56A 3WJYA 4NYYA 1LWHA 1TG7A 1EGZA 4IP5A 4CD7A 2IQTA 3Q94A 3DYPA 1AD1A 3ARVA 5BMXA 3VD5A 3MCOA 3OHMB 4DBSA 2A4AA 3GH7A 4LUJA 3N6QA 5J5RA 3UNTA 4U33A 3N14A 3U4FA 1FH9A 4M56A 4B5WA 1A5CA 2ZXDA 1PVNA 2I5IA 3GG1A 1W3JA 2DZWA 1MUWA 1P0BA 3D5HA 1PS9A 1GYNA 5BCAA 4WY0B 2ZA3A 3WBEA 3ICJA 3LCHA 3OQ8A 5GJMA 2ISWA 1UC4A 3W29A 1Q6CA 4GI4A 2ZKMX 5AYYA 3W1MA 1SU5A 3W2NA 3UZWA 2XPKA 2G0WA 3VC5A 5EBUA 4HIBA 1TE1A 2XM1A 4HYWA 1WV2A 3GFXA 7PTDA 2VCBA 1E9YB 1XLMA 1U5HA 4MIMA 4YVVA 4FIRA 5LGZA 1ECQA 4EAMA 2P76A 3TK7A 2YCJA 4CQAA 2Q8XA 1O5QA 4HOXA 5IHRA 4H4IA 2J25A 3E1F1 4WGXA 3Q58A 1DIKA 3OVRA 3IJ7A 5D2WA 4S3JA 3PG9A 1T96A 3BC9A 1OK4A 5C9RA 4XAPA 1JF5A 1FVPA 4JX6A 1EJTC 4GXPA 1V0KA 3HGOA 3STPA 4BF5A 1JAKA 3OG3A 3PC0A 2HTMA 2GFTA 2FZ9A 4I9AA 5AY7A 1H0IA 5FD0A 1G6CA 1RPXA 2VD9A 1EJ7L 2YLAA 3EKLA 2Y70A 1XCWA 4KEVA 3GIYA 1CXLA 1CLXA 1QVBA 4LVDA 2YX0A 4LYKA 4AF0A 1QI3A 1H61A 4N9EA 1KWGA 4O10A 3W9ZA 4QE1A 3LNMA 1S2WA 2ZE3A 4K37A 4MDOA 3MZ2A 2A6NA 4FNTA 5AHIA 3ZVIA 5DT5A 1HL2A 3THQA 2VP8A 3M47A 3L4VA 1X6NA 3AHYA 3STFA 4JTJA 4I8DA 1UUOA 1NIUA 4AD0A 4IIFA 1HJVA 1HKMA 4YNGA 1GTHA 4GBDA 3OB8A 3C3NA 3O3RA 3ARRA 3BAWA 4IIDA 4IXXA 1YDOA 5U7SA 3IACA 4QS6A 4M6PA 1LG2A 3KXQA 2O7SA 3DCPA 1DWAM 1FDZA 5D2TA 3BQ6A 1TV5A 3I68A 2E7FA 2B81A 3KTCA 1C90A 4UFHA 4F66A 4DWSD 2DW7A 2NQ9A 1UBPC 4BZYA 4DJDA 1LUCB 3QN3A 5CC6A 3RMJA 3WKZA 3PBUA 1VCGA 2R1LA 3AYVA 2VNCA 1MEWA 3LUTA 2YIHA 3RK8A 1K7XA 3PZQA 1RY0A 5J04A 4ADTA 3N6JA 3GVGA 1XKYA 5JMUA 4BWLA 4FXRA 4DY1A 3G1FA 1J0KA 4FLQA 2R8WA 4H6KA 3AXIA 3V5FA 3LPPA 5C9UA 1G7UA 1VRDA 1POKA 3DC8A 3WQDA 3VOGA 1IGWA 1PWMA 1OYCA 2Z1XA 3QV8A 4Y8FA 4IPIA 3UWVA 5TQLA 2Z1VA 3WBWA 4WXZA 1Q8AA 4TMCA 3ATZA 1Q45A 3TYCA 2VTFA 2J24A 2Q6ZA 3KRUA 3VZYA 4D6EA 3CQJA 1JYVA 4LVGA 4Y9NA 4Y96A 3A4WA 3FA5A 2QJHA 6REQB 1N7KA 4I9TA 2WANA 4DI9A 3KOFA 5T8GA 4XBKA 5EMKA 3RN6A 2G3JA 2QQ6A 3D46A 1S2UA 4UMBA 4UNKA 4ICNA 1KA9F 4JNYA 2NV9A 3P74A 3TNBA 3WLSA 4I6KA 3AFBA 3EB2A 3O07A 4J3ZA 4M29A 3A4AA 1ZJHA 3TC7A 3S4TA 3HURA 1B4EA 2INEA 3EKZA 1TV7A 3N4EA 1VYRA 3W81A 3H4GA 3S9ZA 3SFWA 2XFRA 4ZO6A 2FZNA 1O12A 4ZXOA 3EAUA 1VH7A 2BOEX 3WUBA 1TV4A 1CXFA 3UY8A 4C6EA 1PWLA 4O19A 2GWGA 1XLJA 3T0AA 3TQVA 3BAXA 4M1BA 3OPSA 2ZZ4A 3CXOA 1NOFA 1PB0A 2ISDA 2OT0A 3LCFA 5HQMA 2HISA 1REQB 3MUIA 5CJMA 5I03A 2CLEA 3MWCA 4O0ZA 1F6PA 4HYRA 4DJDD 3B8WA 4F4RA 4GUGA 1W9PA 3FJLA 4GI8A 4UQEA 4W89A 5EFDA 1QOQA 4B5VA 1PX4A 3W7DA 2XVKA 3MANA 5H8MA 1H1YA 4KWOA 3RLUA 4O1CA 2I14A 5JUVA 3WDQA 1TVNA 5BOEA 3CV7A 2QJIA 4ZOBA 3CV2A 1QHZA 1GOOA 3TYZA 2QIIA 4X2PA 1W9BM 3T7VA 1VPQA 4MNLA 5DFAA 4WXYA 1B3ZA 4QJ5B 3EDDA 1LBLA 4LEFA 1W1A1 1X6UA 4TTUA 3V7PA 1KR0A 3WH6A 2W27A 5CXPA 3JRKA 5LIUX 4XIAA 1CXIA 2JK2A 1J01A 2G4FA 3EXTA 3W7GA 1O5RA 1EGVA 4FZIA 1GVRA 1YPFA 3USBA 3MW7A 3O0FA 1YX1A 3BTNA 4S38A 1KXHA 4QJ3B 1YW1A 3M0KA 4KKXA 1UASA 4N6FA 3KBMA 1O94A 2VCAA 2FPTA 3CTTA 5C9XA 1OIFA 1E9ZB 4K6AA 4TU1A 1EPVA 4QGCA 4WR3A 4H2HA 1RBAA 2OELA 5D9PA 4F2UA 3B06A 4IQJA 4N0RA 1C8XA 4W9TA 4N6EA 3C2OA 4Q8TA 2PLCA 4I9JA 4ICMA 4NF7A 2VGFA 2O7QA 3GHRA 1RBLA 3OA5A 1K70A 2RDTA 3RIKA 2JKPA 1DJZA 1OFDA 3SECA 3WUEA 3O1NA 1AW5A 4UTWA 1XDJA 1M7PA 4J3TA 3ZR6A 3LLFA 4JY9A 5FEZA 5DMNA 2XN1A 1F61A 1US3A 3S3GA 4DZHA 4I8YA 3JW7A 1O68A 2GJNA 2BS9A 1V0MA 2J7CA 3PTQA 1M9HA 2VHLA 4LSBA 1C29A 3NIYA 3IUHA 2Y88A 1LLOA 5H8PA 4CD6A 4EAYA 4IL2A 4FHAA 2DT2A 4MHBA 1EIXA 4E8CA 1E5NA 1VJSA 2CBVA 3EDKA 4XKYB 1YDYA 4NRRA 2ZYFA 1NF7A 4GA8A 1A3XA 2RH9A 4LVBA 2DZXA 4ZFCA 2MANA 4K3ZA 4HU3A 4HD5A 3U9IA 3ZZ1A 3H23A 3W7HA 4AX7A 1R46A 3QY7A 4EXBA 3G5EA 4LUTB 3WNOA 4UBPC 1UD5A 1TA3A 1X96A 2VC6A 3NA8A 4DM2A 1OX4B 4Y9PA 1JYWA 4CGTA 1AQFA 4DJFC 1XIEA 4IMFA 3NDOA 3EZ4A 4BR1A 4F0MA 1PSCA 4A2RA 1EQCA 3VE7A 5A6MA 1DJYA 3T55A 2WSQA 4C6DA 1XBYA 1DIOA 5G1TA 2OYKA 4GIRA 3AU6A 4X9SA 5KETA 2HE8A 1V08A 3TFXA 3NPVA 3JZUA 1D2KA 5EBAA 1OINA 3HMJG 4HCHA 4Q3MA 2YL5A 4I3GA 2WZIA 4FX7A 4KERA 3U2CA 3WF0A 2PDJA 1K3UA 3ZSTA 3HJZA 4L56A 2HQAA 3LOTA 3OODA 3I6RA 3JUGA 2JF6A 2QVHA 4RNFA 4KCWA 2ZA1A 2VDGA 4K8GA 3VOCA 1TREA 4RNIA 4HSNA 7ENLA 1SZRA 3MMUA 3DH7A 5AYIA 2NWSA 1E15A 2PCQA 3A6OA 2QEZA 3AXXA 4LCRA 3TWBA 5K4XA 2D0FA 5CPNA 3S83A 3M5ZA 1QNRA 1AMYA 4PMZA 2FMNA 4Q4KA 3GNRA 4TVDA 5B7YA 4AZ5A 4UFLA 3V0UA 3P6LA 4KRTA 1DORA 5XIMA 1EJUC 4HZ7A 3ZT6A 2A3BA 4H6QA 2ZWYA 3PBGA 4JNZA 1EXPA 2GUUA 2QJNA 4LS0A 4P7OA 1HZYA 1UQYA 4O57A 3N4AA 5FKYA 3PPGA 5AHMA 4RKAA 3LHTA 3T4CA 4PBGA 2JKAA 1UCWA 5FF4A 2PTDA 3NL5A 3LHZA 3WLNA 2GSJA 2IMRA 1ONXA 2E6DA 3GTNA 5MHBA 2INZA 3R5EA 2BY3A 5F2GA 5BWFA 3QV7A 2Y63A 4ENLA 4D72A 1FFQA 5A6LA 5HJXA 5U4NA 3MO7A 3UERA 1F3EA 3FYOA 4RE2A 2FYMA 1BPLB 1IWAA 1LL4A 4HPHA 1XRVA 2FQIA 3UP8A 4LXFA 1E6NA 4L1XA 3E5BA 1LQAA 1NDZA 4JEQA 4AEFA 4P8XA 1XLIA 4FOUA 3C4UA 2FKPA 2R1NA 5HULA 4CEXC 4YVPA 2OU4A 1K8ZA 2WVUA 1GNXA 1IT7A 2PSNA 2WM0A 2PUZA 4Q6XA 1OABA 5D05A 3K4AA 1E0UA 3TQKA 3EEGA 2CFFA 2ZZ3A 1RLCL 2C3ZA 5M2FX 4C65A 4WSHA 2ABBA 1KRAC 3WF2A 4LUSA 3AMDA 2QDHA 2DVUA 5HDRA 4K8EA 3K5XA 4ZBCA 4H9VA 3C8NA 3BUVA 4AU0A 1W0MA 2EG6A 5C5YA 1SJDA 3E74A 1WNOA 4DZAA 3TH6A 3DDMA 1HJUA 3OHIA 5FJJA 3GAYA 1V6UA 3FHAA 3PUOA 5HPOA 5JXQA 3CC1A 1DQXA 4R7WA 4YWSA 3EMZA 1A4MA 4ZODA 4CLMA 4O8RA 4KFPA 2GVGA 5FI8A 2PDNA 3NDYA 1J6PA 3G24A 5FF2A 5I78A 3GVVA 3M07A 4N2YA 4JTKA 3UWEA 2PRHA 1ITXA 4AD5A 1BXCA 2ZUVA 5BW6A 4A21A 2VM8A 2NZLA 2Q8ZA 3E3HA 2PF8A 3SW6A 2PTYA 2XVGA 2GGEA 2BB0A 3IJ6A 3LCIA 1LDCA 3V1PA 4X22A 1OY0A 3ZJ7A 3E0WA 2FHCA 5KINA 4N9BA 3N11A 3HN3A 3LCXA 3W74A 2BOGX 2ZRXA 3QPYA 4DF0A 3WDRA 3CIXA 2H8XA 3PUGA 1FA2A 1W1YA 2Q3RA 5CZTA 5E6ZA 1KFWA 2X7VA 2FVMA 1T99A 3FS2A 3G1YA 4LEQA 2G97A 3C2EA 3KP0A 3TYDA 4YPJA 1NVMA 2KZHA 4FXSA 3HPSA 1KR1A 3LXCA 4GYFA 1M7OA 5FJUA 5LHFA 2BY1A 1ISZA 4M6VA 3RRAA 5K9CA 2XIBA 3N1AA 4WHBA 3E9AA 5D38A 3M0JA 3QR3A 5K3VA 4NX0A 4US5A 4RZ5A 1B5TA 5HANA 3G1AA 4K2SA 4DVOA 3MPGA 5IHSA 1FFRA 1SYTA 4GY0A 2C1GA 1RBOB 4O1AA 2CZFA 4PODA 3SGZA 4PMRA 3AAMA 1KLYA 3U48A 1AG1O 1IXOA 1W5PA 4LRSA 5G2WA 2PLKA 3GNNA 2WVVB 3LMZA 3WQOA 1GOXA 3AXHA 3H6OA 5CQ1A 4K38A 4B4HA 1E9LA 5IDZA 2A2IA 2CXGA 2XM2A 1VFTA 5B7ZA 2QUVA 4H8HA 3M5XA 5K9DA 1GJWA 2QULA 4GRSA 3FEQA 3NPUA 5GJNA 3I3DA 4Z2GA 3W2KA 3PJWA 3KBSA 1EX5A 1P6BA 4E3VA 1NFBA 2JE8A 1LORA 4EXAA 5JIPA 4ZOCA 4BQ4A 1GPWA 2QUNA 4JTSA 3STCA 3G6LA 8RUCA 2E4TA 2OQHA 4LYQA 3TC3A 3HFYA 3R4IA 2PP3A 4LAUA 2QUUA 5HR6A 1TUXA 1JZ7A 1JCMP 1R7OA 1W3IA 3L2LA 1B9ZA 4PMQA 1UD2A 4PTXA 4MB1A 3PZGA 2VFDA 1PCKA 4DEFA 5T91A 1BRLA 1CNVA 2PU0A 2G50A 5L9FA 1M01A 3ECQA 1T5AA 1B3WA 2QCFA 2QF7A 1JDCA 1YDVA 1EYWA 4R27A 2EJ1A 3R13A 4CCCA 4DO5A 1OG0A 3UCDA 2CCRA 3DYMA 4M3PA 1R47A 5XIAA 2PWFA 1XG4A 3ARYA 3QFWA 2ISSA 1XLLA 4DLFA 1UR0A 2VD8A 4C5ZA 2HRWA 3ZMRA 2J8FA 1UZ4A 3AI0A 2VGIA 1FCUA 2XYLA 2GUBA 8XIMA 4C6PA 5KZDA 1ZP3A 5I3HA 1IEQA 4Q8NA 3H8AA 3BZGA 5CG7A 4KFNA 5G2IA 4IM4A 3QW4B 1P0NA 4MYAA 3EX1A 5D9MA 5C70A 1C8VA 1W5OA 4DBDA 4GIAA 1Y5WA 4US5D 3BLDA 3FNDA 1OD0A 2EPHA 2IPWA 3B9AA 1CT5A 5EPDA 1RR2A 3FKKA 4TX8A 1W1VA 1KXVA 4KESA 1NDVA 4WCJA 2OEMA 1F76A 4GKTA 3VINA 1TX2A 4IXHA 3BG5A 4W8AA 4AZ6A 3TR2A 1XJBA 2OZ8A 1QNVA 4DXXA 1L6FA 3KAOA 3QOKA 1S5NA 4JHZA 2Q71A 4UOQA 1XF0A 1UPMB 4NZFA 1FKXA 1XKJA 4W84A 1EJXC 4HHLA 3QRHA 2IXUA 4YIWA 3WH8A 2WLYA 3KVMA 4O0QA 1HKKA 4Z42C 3KDNA 3UWUA 1BYCA 3H70A 5D02A 1I1WA 4WEVX 1WCGA 5GNZA 2POTA 2P3ZA 3W7IA 2FPVA 2ATSA 3B8SA 3G1XA 4XD3A 3FN9A 4AZHA 2C19A 4PMVA 3U5YA 1PJ9A 1JGMA 1GCYA 2PBOA 2YDSA 1JD7A 2Y7DA 3VKJA 4IJBA 4GUFA 4PCFA 1H7RA 4MPQA 2DZUA 1TCMA 4NZ1A 3UD6A 1UYQA 2BHUA 1YBQB 1BVNP 4RDVA 1BQCA 4R88A 3HBLA 4DN1A 4GY7A 1CW2A 3CIWA 1YYAA 3DFQA 2EQDA 3PZOA 4LBSA 2XH7A 4Q8OA 2QUMA 3KWXA 1K03A 1JAEA 3ZT7A 2INFA 1W31A 5AYXA 3CT7A 1ZAJA 3CU2A 5KSWA 1K4HA 2Y7FA 3AYTA 3KHJA 5LSMA 4BCEA 3H2FA 2CWNA 2OTDA 4ZEPA 1LP6A 2YR1A 1VFSA 2EGZA 4ZQMA 1GUVA 3RM8A 4IIBA 2VYOA 4ZR8A 2WXDM 1VIZA 3GDBA 5E09A 1DV7A 1TPVA 1BSLA 4HVXA 1TVLA 1JVNA 3MY9A 1LOQA 4EPBC 2VDHA 3TR9A 2GYIA 3IVUA 2J8GA 3L66A 2W63A 3TTYA 4KCVA 2WWCA 1W9XA 3MDWA 4PUEA 4KWVA 2WMJA 2C15A 3BLPX 2YOCA 2XJ7A 1QAPA 3ZJKA 1R3TA 4Q8QA 1TR1A 1F74A 3AYSA 4MSSA 4LC6A 2A79A 3HPAA 1UPPA 4Z0JA 1GKQA 3LM3A 1W9VA 1B4KA 1XBXA 2PZ0A 1UR3M 1XDMA 3LM7A 1G69A 3UR5A 4G7FA 2AQWA 4O17A 2HVOA 3GC5A 4E4UA 4XZLX 3IARA 1GTEA 1CWYA 3DFSA 2QGHA 3A64A 2OSXA 4UTHA 4NHVA 1V4YA 3MKVA 1BEUA 1IQ8A 4TV6A 5L6UA 3UYIA 3MJMA 1VIWA 4XZBA 3CL6A 4TXEA 4A3UA 5LA1A 4GO9A 4L4MA 2F9RA 2D2OA 1FHLA 3WFLA 4DPPA 2PDCA 3GTFA 3GH4A 1KBLA 4FNRA 3PR2A 3AIEA 4G2DA 1UZHA 1DJIA 1HL8A 2WCAA 1H41A 2RJHA 4A8NA 3V16A 4QE5A 3R0KA 1RH9A 2J6XA 1KTCA 1HP5A 1AZ1A 2UY4A 3S8HA 4HGXA 4E2VA 3RM4A 3P93A 3DIPA 3VXGA 2VMFA 4LX4A 1ISXA 1N8FA 3AHVA 4MB4A 3CT2A 1T0OA 3RAOA 3CUFA 3QR1A 1VFLA 4FIQA 1MVYA 2PPGA 2QCCA 3PJXA 4XBJA 5EB8A 4J3VA 4D71A 4GLEA 1JDAA 1KFBA 4GOAA 3TQPA 3B05A 2OMAA 3TZFA 3VU2A 4GGBA 4C6OA 3JVAA 3KUMA 4HPGA 4PUDA 3BGGA 4EF8A 1KKOA 2E0PA 3UZ5A 1GVYA 4AIUA 5D2YA 3SRHA 4GZJA 1VD6A 1XPGA 4HMDA 2D1ZA 2ADAA 3SUSA 2V6AA 1EGMA 5IM51 3N2OA 3BJTA 4UR7A 1R30A 3T8LA 3TZNA 3FJ4A 1XLCA 3IJLA 3DESA 3LY0A 5HNTA 1ZBVA 4UIOA 4H19A 1FH8A 1QI0A 3C0JA 3MP3A 3FA4A 4IG2B 1GHRA 2X0SA 1B57A 2FB3A 2RJGA 3GXIA 1KQYA 4C90A 2ZZ5A 1VCVA 4FSAA 3REQA 5IXEA 3ZWSA 4JYDA 1RQEA 2DSWA 4TIMA 5I6SA 4QSFA 1E51A 4BY3A 4TV5A 4Q8VA 5GPRA 4L6OA 3IVSA 1I4NA 1QU4A 2XVNA 4HK6A 2OYMA 1UR8A 5HMFA 3N3MA 3DZ1A 1MZHA 1ZJIA 1RK5A 3ZR5A 1E6XM 1LBMA 3VZZA 5IFPA 1JCJA 2V5LA 1T7LA 2OO6A 1H49A 2ZXBA 4AZBA 1NFPA 3GC2A 1VPYA 1X7FA 1ZCOA 2QCLA 2AKZA 1MYRA 3T2OA 1X6LA 1IE7C 1OJXA 5C55A 4Z1AA 4FF5A 5CC7A 1Z69A 1TV8A 2NX1A 3F4DA 2V0TA 3TW9A 1LLZA 4P7RA 2OGYA 1V6VA 2FIQA 3NG3A 4NI3A 2J62A 2NUWA 4JD4A 1EZWA 3CL8A 3PG8A 1ZGDA 4PB5A 3DUGA 1OGSA 5CC3A 2UWFA 3AS3A 4V1XA 2JQXA 4MZ8A 4AYSA 5LYRA 2EO7A 5DXYA 3L23A 3LBMA 3CZGA 2ONEA 4JTIA 4UQCA 3IJ8A 3VA8A 5E5CA 4HOZA 4GJ1A 3PTMA 3W84A 2B7PA 3BOFA 3VKKA 2VWTA 1A53A 5SWUA 4U28A 1SMDA 2QJGA 1PYMA 3UWZA 2XH0A 2PE4A 3GVWA 4IFOA 4ZTXA 4D6IA 1UJPA 3W23A 1UR2A 3L67A 4D6HA 1BHGA 1UA7A 3TROA 4GQRA 2WMHA 4QSHA 5DRCA 2YBTA 2WMIB 1GOWA 3GNPA 4WJEA 3M4HA 3GB6A 5D09A 3FEMA 3CO8A 4CUCA 6ALDA 4B90A 3PM6A 5A6BA 1AFSA 1WZKA 1RZMA 4MF4A 1N2VA 1C9WA 4MKVA 1EO7A 1T8QA 3LERA 3NCOA 4IGSA 2BP1A 4HMNA 5E0KA 4GVGA 3L65A 3VD4A 4PN2A 3W2LA 1V7AA 3H7UA 1W5QA 1ZBCA 3LQGA 4AY7A 1XQKA 2RGLA 1LG1A 1S2VA 2J77A 1E56A 3LA4A 3E96A 2QGYA 3ABRA 2DUZA 3GHTA 5ENLA 3UCCA 4WUIA 3VDGA 4H9MA 1U1JA 2Y85A 2QKFA 2VURA 3RLHA 3I7QA 1VENA 3MJYA 4CD4A 4LY4A 4ZSTA 3WFZA 1G67A 2GQ3A 5A3HA 3FDGA 1N8IA 3PWGA 1OFAA 3RU6A 4RZBA 3IJIA 1RCQA 4QX4A 5HNNA 1DE6A 3R11A 2F38A 2OQYA 3CUZA 1MQRA 3RITA 3WJZA 1Y8BA 4HNTA 1JXKA 2HROA 1CZ1A 2CHOA 3LCGA 3KX6A 2NQHA 3DEQA 3WJSA 4KGJA 2ASHA 5BRQA 3EWWA 3HG4A 1W9DM 1POJA 4EOUA 1KM1A 4D1JA 3ABXA 3W1TA 1MWOA 1Z9AA 3FVMA 2Q8LA 3WQ8A 3U7BA 3BANA 3G3DA 2CKSA 2J6VA 3W6YA 1M65A 2DIKA 2VELA 2R9RA 1TPEA 4HMEA 2VX5A 3T6CA 4JYEA 3W1UA 1T6MA 1QRQA 3S1VA 5IOBA 2PTXA 4S23A 4TMBA 3GQYA 1XSIA 1UH2A 3C2VA 1B1YA 4J28A 4H1ZA 4M51A 4PTWA 1MXGA 3P81A 3KCJA 4JIPA 1ESWA 5F2IA 5BOFA 1EQPA 1K7FA 2WJDA 4CN1A 1VFHA 2GJLA 2VEKA 2X41A 3BWWA 3VNMA 1OBAA 2WHJA 2Z1WA 3T81A 3LYEA 2FZBA 1XH1A 1NTHA 4MWAE 4W7VA 5A6BD 4O15A 3C86A 1MI3A 3MKKA 3MHGA 4PE8A 3TJ4A 4L6DA 1L9WA 4IF2A 3S46A 2DORA 3DHPA 3CPUA 4M5PA 4UTLA 4QR6A 1ZU8A 4JS3A 4PCTA 3UESA 3W75A 3KZPA 1X1OA 3OA3A 3FXYA 4YYCA 1U1HA 3VCNA 3VZXA 3MCNA 1TPH1 3KE0A 3WYZA 2P10A 4DYJA 4FXFA 3PSVA 4MKNA 7ODCA 3A13A 3TP4A 2I56A 1AD4A 3IRDA 1M6JA 3GNDA 4GINA 4YYFA 2J66A 1UOZA 2WCGA 1GVSA 4C6MA 1S38A 2QCGA 1G4EA 1BLIA 4NZJA 3SM0A 1KM0A 4JNMA 2AMXA 1XD1A 4DYKA 3L5MA 2ZXQA 1XG3A 3W1QA 4W85A 4D6CA 1BTMA 3WQFA 4H01A 5BU9A 2QCEA 1CX9A 5DANA 3HV8A 2WB5A 2X0YA 2CEQA 1R2TA 2IPFA 4BJHA 4HNVA 3NOEA 1IT8A 5C54A 3N2XA 3LPFA 1UMYA 1TWWA 2IW0A 4DELA 4ZZ9A 3T9PA 3KWSA 3O8AA 3PANA 2NW0A 2QJJA 3SN4A 2UV8G 1OVDA 3NL2A 3C52A 3CMGA 1GW9A 2NLIA 5ABTA 5HNRA 1GZ1A 1YTEA 1TJ2A 1O5KA 4M81A 3RJYA 4NILA 1E40A 3C0SA 1EOKA 1TELA 3H53A 4NSBA 2X1TA 2RKXA 2WSRA 5KITA 3FY1A 1ZAHA 2D2JA 2QCHA 3WD2A 2WC7A 3ANYA 1H5VA 3I3BA 3SJ3A 1I1XA 1T8XA 5BXSA 3U0HA 4EE9A 2Y62A 2V3EA 4AEOA 1TPB1 3C2RA 2E9MA 1KM5A 2HJPA 4DBUA 5I07A 1N82A 4LALA 3B8UA 2I9UA 1NEYA 1W5MA 4PTNA 4UCGA 1KGUA 1BYAA 4LV9A 4UTTC 1JFHA 3CWHA 3KVKA 3WQVA 2PDHA 3SN0A 1XC4A 1XUZA 2I9EA 1PAMA 1U5JA 4YCOA 1YXDA 1YADA 3EDJA 3P7YA 1CLKA 1Z8AA 4GFIA 2FHFA 4G7EA 3VNLA 2BZNA 4IX2A 1RQBA 2X1SA 2YXOA 2TMDA 3E0LA 1F73A 1KM2A 3SCTA 1U30A 3WJWA 4JKMA 1LWJA 2GSEA 5CGQA 4ZENA 2PTZA 3BLOA 3HG3A 5CZJA 3A12A 5A6JA 3T42A 3WQ5A 1V79A 4M6UA 3TDFA 5M1TA 1E72M 1JCYA 2DT1A 3W1XA 1JCXA 3V4BA 5LIYX 3UU0A 2V81A 1FWAC 3LPOA 4QCEA 5CJNA 2ZZ6A 3SRKA 4PUJA 5DCBA 3RNDA 3U5UA 4GCAA 2IQDA 4RDYA 5KZMA 4HTBA 1XRTA 1MMFA 3TTEA 1VJZA 1JZ8A 1M7JA 2ZBTA 4KCUA 3CZ8A 2XGBA 3NQBA 4R33A 3CL7A 4GK8A 3ORWA 2QCDA 1MW0A 2AOSA 5DCEA 2ZOXA 3AROA 1D7KA 4DWSB 2PWVA 1F3TA 4UFJA 3IGUA 3C2FA 1FCVA 1EYEA 4XUYA 3SO7A 1F05A 1TZ9A 1QR7A 5I24A 4RUBA 5T9CE 5EMMA 3TSDA 5ABFA 1B90A 3ZR4A 3TYBA 2WCSA 3PAOA 1FHVA 3MSDA 3UXAA 3MUCA 4O53A 3B8IA 4O4VA 2QYGA 1AH4A 3I4EA 3IAQA 2G41A 5K2ZA 1DHPA 3MBFA 3VKCA 3ME3A 3FX4A 4L9XA 2GPTA 3DFHA 2OB3A 1UH4A 2Z26A 1GOMA 4UTUA 1GZJA 4L4OA 1JJKA 3WLQA 2FB2A 3RX3A 1IXQA 2WK2A 1UP2A 1TTQA 1X1ZA 4UC5A 1QPRA 1LJYA 3UYCA 2V5DA 2EF9A 3GM8A 2XIIA 3GE7A 3L0GA 1W1ZA 1WUEA 4J3XA 2OZ0A 2PDGA 1Q3NA 1AH0A 1OT2A 3LDVA 4ZL1A 4BKNA 4RDWA 4IQEA 4PB4A 3LHVA 1FCBA 4Z1BA 3PFMA 3G8RA 4XIMA 1O6IA 2AAAA 1VHCA 5I5RA 3LD5A 1E3XA 2CHNA 2ZUMA 3WQ4A 4MJ2A 1K9EA 4IZGA 1XDLA 4X9YA 1G9HA 1X98A 4ES4A 4GNJA 1F4AA 3TCSA 2CLMA 5KTLA 3ABQA 3KOZA 3Q67A 1V3MA 3MDUA 3IGXA 1SW0A 2Y89A 4OOUA 4RE4A 2GVJA 3W7PA 2JALA 3D3AA 2XFFA 3B97A 1PHQA 3ALGA 3SADA 2PFHA 1HJXA 2X1UA 4IPPA 4FNSA 4UR8A 2OYLA 4WY0A 1GORA 5D37A 4PMOA 2JIEA 3UPWA 2X1RA 3KL0A 3TYEA 5A6KA 1HUVA 1LYXA 1I0DA 2JIWA 4D6FA 4LB3A 1RVKA 1O95A 1QOXA 3B4YA 4AZ7A 4NNCA 3LNPA 2I1OA 4IMGA 3HPFA 2Y24A 3WIJA 3VIHA 2J74A 3BSGA 3BCJA 3VM5A 4ZSUA 1HP4A 3FAXA 3GYEA 5KZ6A 3KCOA 4AUBA 4QQ3A 4H6RA 4HHMA 1Y5VA 1NWUA 1PX8A 1WOBA 3BAJA 2BSLA 4ZA0A 1WXZA 4K1GA 1R3YA 4G1NA 5G4HC 3CNYA 3TXVA 1FWRA 4HN8A 3O16A 5FL0A 3AMLA 3BDKA 4RW5A 4IPJA 4XTIA 1YKWA 1FP9A 3GVRA 1AJ0A 1JF6A 3NURA 1LOSA 3TYUA 4D6JA 3MBDA 3GU2A 4AZCB 3GBDA 1NJJA 2CIPA 1WKYA 4LYPA 3VDHA 1R87A 5G5IA 3KEHA 3VMNA 3ZOAA 1QTWA 1W32A 2BGSA 3ITXA 1MQPA 1H0GA 3BH4A 5FF3A 1EJVC 4QLKA 1EF2A 2EPOA 3W02A 1G4PA 2ACSA 4BQ5A 4RXGA 4MFDA 1A50A 2PCEA 3U2ZA 1A80A 1L0PA 1UD4A 1SJAA 2SFPA 1CYGA 3ALFA 4XBSA 4UB9A 4WLCA 2QR6A 2WQPA 3RX2A 5BXPA 3CJPA 2JKEA 4F48A 2ZA2A 3W00A 2EPMX 4Q6JA 1YE4A 4LTSA 2YA1A 1TQXA 4S39A 3UG4A 1BG9A 5A6SA 1WB0A 1IWBA 4UQBA 4OFCA 4MUPA 5REQB 3P3BA 3S5OA 4S3AA 4HZMA 2Y8UA 1ODZA 4O13A 2NX3A 3HA1A 3W7MA 2B0MA 4YL2A 3SUWA 1EJWC 4OUEA 1V3IA 3UQNA 2HMCA 1Q6GA 5EMJA 3VGFA 1UQZA 4PR4A 3VX1A 1JI2A 3LI0A 2Z6JA 3TMLA 5AOUA 1H7WA 3LTYA 1TUFA 1SO6A 5GNYA 1U33A 3LB0A 4Q7BA 3G2GA 3ARPA 1V6WA 4LAMA 2VX7A 2OJPA 2OKOA 3DG3A 1ZSXA 1EUAA 4XSLA 1BVZA 3ARWA 4UTMA 3MHFA 3NPWA 3TCEA 3KOWA 4HJFA 1HF6A 4XAFA 1GZGA 3SCUA 1Z48A 2ALDA 3VD7A 1Q66A 4PL1A 3S2LA 3KBJA 2NXHA 3AYRA 2ZDSA 4IP4A 2FVKA 3M0MA 1HO4A 2YCKX 3PBVA 8A3HA 4JAWA 1PUDA 3BICA 2PDUA 5A69A 3E0VA 1XLKA 1I0BA 3WNNA 2R82A 4KIEA 3IIOA 4A3YA 3AHZA 4OIFA 5AN7A 4V15A 2BXZA 1WDDA 2J79A 2PWDA 4JQAA 5LIXX 3VD3A 4ZFMA 1QNSA 4HZ6A 3OQEA 3W24A 5MKGA 4AWSA 3CQIA 4M7SA 4IIEA 4F0KA 2QCNA 4HKPA 3RR1A 1SUXA 1K1DA 3RM9A 3GXFA 1J9YA 4DJEC 1EHAA 4W93A 4BF9A 1CGWA 3NQFA 5C71A 4GISA 3R58A 4ZCWA 3VKAA 1MUMA 1UHVA 1GQKA 1KBJA 2DGAA 1E0WA 3EKGA 3APGA 3APTA 1WA3A 3WLIA 1XLGA 1QK2A 4GUIA 3W7EA 8TIMA 4H7VA 1U1UA 3VC6A 3RCYA 1XYFA 1NSJA 4R34A 2RFGA 4PH6A 4Z2IA 1QPNA 3GIPA 3G1SA 4FP1A 2OWCA 1ZNNA 2WSPA 4E8GA 3HQ1A 4IMAA 2HVMA 1FWCC 2CKRA 4ACYA 2WNQA 3MUAA 3QFEA 4NJHA 1OHLA 4GG9A 2QAPA 1KCKA 1A5NC 2C7FA 1QWKA 5HWJA 2DH2A 1W8SA 2XU2A 4G6CA 3SCQA 4OE7A 4FB7A 4JBRA 5BMWA 1H63A 3RPMA 2FJUB 1ICPA 1BQGA 3N18A 2B7QA 1UD6A 4JIQA 3NJ3A 3QTPA 3MCMA 1J18A 3M7SA 4R9XA 1HVQA 3SR7A 4BQ3A 5HR7A 3E2VA 2NVAA 1ISYA 2V67A 4H41A 1R38A 2ZZ2A 4H04A 1DJNA 2F2KA 5FEPA 4EVZA 3WLMA 1B0IA 3MC5A 4ZQNA 4N7QA 3RG6A 3AICA 4GH1A 1LM1A 5FCZA 3LV5A 4QEHA 2DY3A 1S5VA 4XD5A 3AOFA 3AWNA 3MMTA 2O55A 4ZO8A 4LY8A 4L6HA 1JDDA 3G1VA 3VFCA 1Y7VA 3EEZA 3S42A 3ID7A 5K9XA 3WLOA 1GYMA 3SRFA 2Y8VA 3LTPA 3H2OA 3HQPA 3VAVA 4LVAA 3A3XA 1X39A 3CEPA 1OYBA 5LZLA 3MV01 2OSWA 3K8MA 4M19A 4B92A 1TA3B 2F6UA 2ZRWA 4PMJA 3VMPA 4E8DA 2ZUNA 3GXNA 4H9TA 3C0LA 3L2IA 3ISIX 1QT1A 2A3CA 2DT0A 1FHDA 2CZVA 3MWAA 1XYMA 3SEPA 1WDWA 1TPWA 3W82A 3GUWA 3DC0A 2GSHA 5T9BG 4XZMX 3SUTA 5CBJA 3TUUA 3STEA 4F9DA 3GXDA 5I77A 4EPEC 3OBAA 2GGIA 2NWRA 4QNWA 2AL2B 2Z2BA 1ELSA 4PYSA 3GSMA 3SRDA 3UR7A 3M5VA 2E6AA 1MEIA 4IFRA 3BLKA 4IT1A 1XICA 3NYZA 3S5YA 2WNZA 1M03A 4OBRA 5K4ZA 1WAWA 4DO6A 3IK4A 5A8GA 1PKMA 1XH0A 2ACRA 1SO5A 3NSMA 1LCOA 1JDFA 2V8ZA 1LOLA 1QO5A 3NO3A 2GWNA 5T26A 4WK9A 2OOGA 1S3TC 1FKWA 1OCJA 1A3WA 5FOOA 1NQKA 2FLIA 3SZ8A 2DSVA 4XD6A 3B0YA 5DBUA 3NPXA 4A35A 4GJJA 1A5UA 3UCQA 4ZTYA 2E5CA 4RJEA 5CJ5A 1UKTA 3EA2A 1DE5A 3QZAA 1VBUA 3BLEA 3JR2A 4RXFA 1EBGA 3E2RA 1LBFA 3MU7A 4UTTA 1DQWA 4ZB5A 4H83A 4NT0A 2Y8KA 4PL2A 2WW5A 1OX5A 3NEHA 3QHOA 1BTCA 1YNPA 4BK9A 2JF7A 3B40A 1K4GA 3H12A 4HHHA 3B9EA 4TQTA 1W3HA 4DB7A 1ML1A 1UA3A 4XKYA 1C9DA 4Q33A 1B3VA 3HF3A 4ADUA 1Q2RA 2YBUA 3TWAA 3KLLA 1KQZA 3VGDA 4CNPA 2DDXA 4K7YA 4L64A 5LIWX 2G95A 3O2LA 4PMXA 3WQCA 1UKSA 1RY8A 1RD5A 1QBBA 4S3DA 4E2BA 2X42A 3LK6A 5AFDA 5D9NA 3TTQA 1OWQA 1BKSA 4NIRA 4NY2A 3W7NA 1S1PA 7REQA 3WBXA 4XD4A 3WD1A 7A3HA 2KAUC 4CN4A 4LCQA 1DVJA 3DFYA 2PLMA 1H11A 4C1NB 1SR9A 3WK3A 5JBDA 1JRBA 4ML9A 3VDAA 4A2SA 3SN1A 1VFFA 3G22A 3LRKA 4L61A 2C8NA 5CPLA 4Y8EA 5FAJA 3E2SA 1R7AA 3NQEA 2XH2A 2Y2WA 3AQUA 4DF1A 4FX6M 3D47A 4H8NA 1E5JA 4U5IA 4MAZA 5C0QA 4PTMA 2PDBA 4FXJA 1AJZA 1IIGA 5G1YA 1SO3A 5A5WA 3E49A 3UVIA 3TNOA 2XHYA 4YTTA 4E38A 3O6YX 2NQZA 2OEJA 1SW7A 4DI8A 1JNEA 1S5TA 4HA0A 3WLKX 3IV8A 5IRPA 4JKKA 1F3WA 2WPBA 4GD0A 3LHYA 3N12A 4LUSB 4UTJA 1X7IA 3B8VA 6XIAA 1BWLA 3QSTA 4WGHA 4AB4A 4RV3A 1VYPX 1P0DA 1A5MC 1FDYA 2E25A 5G2HA 1LZOA 2BTMA 3PHAA 1KWKA 4GKLA 4HYVA 1E6ZA 4KT2A 4D1IA 3GWQA 2HWGA 4PBEA 3DG6A 4RR4A 2O4QA 1E6PA 3W7RA 1WP6A 4GYPC 2ZVRA 1XL9A 1VRXA 5BOOA 2ZUTA 2C0HA 5DY3A 2FHBA 1VB9A 2V5BA 1VYSX 3AU2A 1NH6A 3K1DA 1JCLA 3PJTA 2HK1A 1KM3A 1RP8A 5FJRA 2DT3A 3CUXA 3B04A 4N9DA 3S6TA 4HQVA 4XB3A 3F5LA 4TVUA 5CG0A 2OLSA 2BGQA 3H2MA 3SIMA 3ENLA 2J7HA 2JBMA 1NM9A 3N29A 2OWWA 2O56A 3ZLFA 3O6DA 2BHZA 1UH3A 4M6QA 4FNQA 3HTWA 1Q5MA 4YTSA 1Z6KA 4I5XA 2Z27A 1JPMA 4F0SA 1NOUA 4F2BA 1PKYA 1R3SA 2VFGA 3S2MA 4LNCA 1QDSA 2Z2AA 3W0KA 3ITYA 5F2MA 3AWOA 3W6MA 1ADDA 5GQBA 1QW8A 4Y7EA 1P48A 3UR8A 2P1FA 3JS3A 4UFKA 2WWDA 2F2HA 2POZA 4AFYA 4LPCA 1NWSA 2PWEA 3WNLA 4GC4A 4W86A 4CCDA 1PO9A 3WDIA 2Z25A 3BAIA 4XZ9A 4YTRA 2O9OA 4WJ8A 3U8GA 2PAJA 4O18A 5BXRA 3S1WA 1QMLA 3L4XA 4WY0F 3EMQA 1XFCA 5FSEC 4CQCA 4NYUA 2WLZA 3L4YA 4NZ4A 4ZXLA 4MOZA 2HNHA 3CQ0A 1SZGA 3ZXWA 4MWAD 2XGZA 3QC0A 4RNJA 3I7RA 2HDJA 3TIMA 1EP3A 1E6QM 1VBRA 3DXIA 4IGNA 2Z2UA 1CXEA 1SFSA 3NR0A 5D33A 4HBKA 2P8CA 4A3RA 3MS8A 4QEEA 2ZCGA 3GDTA 4YLWA 1EWEA 3VIJA 1OM0A 4GZEA 2VGBA 4BHYA 1BD0A 4CU7A 2O92A 2YL9A 3N9SA 4JTLA 1UWAA 3SCSA 4Z1CA 4EX4A 3GZ3A 4OJYA 3EWUA 3HIJA 5FA5A 5H6HA 4V1YA 4R7JA 1WZAA 3FIGA 1KLZA 1V8EA 3R0DA 3PZIA 5FJOA 4PEKA 2DJXA 3W22A 1R3RA 4IUOA 1BRLB 3THDA 4QM1A 1GOIA 1BGAA 1FWGC 4HK5A 1EJSC 3BQ5A 3LBOA 4LF1A 4UOZA 4Q8PA 3I7SA 1THFD 4DRSA 1F7BA 1OFOA 3N2CA 1R5YA 1IXPA 4B5XA 3ZLHA 3M7WA 5C9WA 2DZBA 4GIYA 1ZQ5A 4IUGA 2EHHA 2WNWA 4H9ZA 3TX9A 2I5GA 1E6SM 1FX6A 3W7KA 1JUEA 1KRCC 1IEXA 1RJPA 2AMGA 1V0LA 3AS1A 3BSHA 3AXKA 3NL6A 1Q7QA 5LNUA 3I6TA 3QVQA 3TKFA 4JIRA 2ZX6A 3J7HA 1FRBA 3OOQA 1BF6A 3B4UA 3WEZA 3VOJA 1O5XA 4J40A 4RCXA 2FPYA 2WAGA 1JG9A 5F1UA 1TFVA 3ZO9A 3W1LA 4EP8C 3ES7A 3NO1A 2PF0A 2V68A 2CLKA 4W7UA 4XWUA 2O4MA 4QDPA 4OTKA 4V2XA 1Q6LA 4DJEA 2QVNA 5CC5A 1GWJA 4DUVA 4HB7A 4ECLA 3GXMA 3SCWA 3AS2A 1E1CA 2IPJA 3MTWA 3QLDA 2IKIA 4XUGA 4XAYA 1A5KC 4B5UA 4IJCA 5G1MA 4PB3A 4OUIA 4GYKA 2WHKA 2C91A 4QTGA 2V63A 4XVDA 3HZ3A 1JR1A 4OT7A 5JBEA 1CB2A 4QCFA 3CHDA 5PTDA 3T0DA 2X2GA 5DQPA 2PI6A 1KBKA 1Z89A 4U3CA 3WMCA 3NVTA 1DP0A 4QDMA 2WQDA 1UOKA 2A7NA 4PFHA 1KB3A 3QHNA 2DJLA 4B5NA 3FYYA 4ZOEA 2EJAA 1GQIA 3N6HA 3QKZA 2DQWA 1RSCA 4QDWA 4P8VA 1TTJA 4GY1A 2BNJA 3TMQA 1XIMA 2XGIA 4A8IA 4HPJA 3N2TA 3KP1A 2I5QA 1IHIA 3CLMA 5I79A 2NQJA 3WJXA 1WUFA 1C3FA 2A1YA 4REQB 1WYIA 5BWAA 4HP5A 2VL4A 4Y9MA 2ZDRA 2YW3A 5AKQA 1HN1A 4XZWA 3K46A 2QCMA 4DZIA 4NXSA 3F1QA 3PUEA 1WE5A 1SZEA 4JHOA 2AL1A 3ITVA 1W91A 2DZVA 2XTKA 3PP7A 4QRNA 4H9YA 3VDBA 5BNKA 1TJRA 3NQGA 3RO8A 3LN3A 1OG6A 3K8LA 3KBNA 2UY3A 3HB9A 4HA4A 2GVEA 1WKDA 3D0CA 4ONVA 3ARQA 3VIMA 2VRJA 2DZTA 3POCA 2GK1B 3XISA 4UOJA 3CAWA 3QQWA 4AW7A 4DJED 4CKQA 3UZZA 2GDUA 2V82A 1PIIA 4MM1A 1H1ZA 1K02A 5A8MA 1QASA 3T4WA 1AH3A 1CGYA 1TZZA 1K7EA 1OZQA 4MVAA 3PB0A 3ATYA 3TSBA 4K39A 2X1IA 1GVIA 4ORMA 4WOZA 2OLAA 2OXNA 2GLKA 4GCXA 4H00A 3RJXA 1EOMA 3TEVA 1J79A 1ZBWA 2REQA 2PMQA 1GVQA 4B3KA 3A9IA 3MVTA 3KL5A 4RL3A 4GQ0A 3W01A 2F84A 1P7TB 1WDSA 3NQ8A 3U4AA 3OZMA 1PV8A 3IGHX 4JX4A 4U2ZA 1G4SA 4S2BA 1R0MA 3ARSA 5FAGA 1V3JA 4MY8A 3R25A 4C6CA 3RYSA 2GJXA 1JIBA 5HNUA 2VZOA 1R2RA 4GNKB 3R8RA 3TONA 2FH8A 3STGA 2CBUA 2YCLA 4RLIA 1HKWA 3NQ6A 3PZTA 5A6AA 1Q6DA 3M0LA 4IX0A 1RD6A 4ZB0A 4GABA 3ZWTA 3HO8A 2OO0A 1JPKA 3BPWA 3M5YA 5D8WA 3FDKA 4OOZA 3KLKA 4Q32A 2R24A 3MVIA 3SCPA 1V51A 3IUDA 3NQCA 1CGTA 2AQVA 1ITQA 1LRNA 3CUGA 4PSRA 1CXKA 1WXYA 3RPDA 4L65A 4MZ1A 3OP2A 1M41A 1I2RA 3H55A 4XK2A 2CLOA 2NLYA 4FS9A 2E77A 2FTWA 3QZ6A