4I9JA

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to dic4pc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
302
structure length
302
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 122
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i9jA00
4I9TA 1DJHA 3CH0A 5T9BG 5T9CE 2PZ0A 2ZKMX 3I10A 4I9JA 5PTDA 3QR1A 1DJWA 3RLHA 1GYMA 4PTDA 2FJUB 4F2BA 4RW5A 3EA1A 3V18A 3QVQA 3RLGA 6PTDA 3KS5A 1DJXA 1DJIA 1QATA 1YDYA 4GNKB 4S3GA 4RW3A 3V16A 2ISDA 2O55A 4RV3A 4F2TA 4I8YA 1ZCCA 1PTGA 2PLCA 2OTDA 3EA2A 3MZ2A 3H4WA 4QJ5B 1VD6A 4I9MA 1QASA 1DJZA 7PTDA 3OHMB 3L12A 5T91A 1O1ZA 1PTDA 2P76A 1DJYA 4I90A 4Q6XA 2F9RA 4R7OA 1XX1A 1DJGA 1V8EA 3H4XA 1AODA 3V1HA 3QR0A 4QJ4B 3KS6A 4F2UA 2OR2A 2PTDA 3EA3A 1T8QA 3PTDA 1T6MA 4QJ3B 2OOGA 4OECA 3NO3A
chains in the Genus database with same CATH superfamily
4R88A 3CH0A 1NJJA 4AIUA 1EC8A 1MXGA 2H6RA 1WDSA 3EX2A 3ARSA 4M1RA 4PL2A 4AWTA 1JDAA 3H2NA 1DHPA 2XN0A 3OGRA 1E55A 3KBNA 3U4FA 3H7RA 4RK8A 3A3WA 1XG3A 6XIAA 5K9XA 3GG1A 4DJED 3G1SA 2WSPA 2CHNA 3OW1A 4O17A 3S8HA 4IOTA 1VYPX 4ZFMA 2EEXA 2YB1A 3FGCB 3H8AA 1RY8A 4FA3A 3W71A 2XN1A 3T8QA 2JIEA 4AIBA 3ZJKA 3GS6A 3HQ1A 4UTIA 1O4UA 3MKCA 1QNPA 2PDLA 2ZUWA 1JZ2A 2B7OA 1OVDA 4H4IA 3WBYA 4H7ZA 3TNOA 3NOYA 3G6LA 3EB4A 1FDYA 3W1MA 1FFQA 2QYGA 2IQTA 2ZFAA 4AF0B 5LIYX 3TROA 1M3UA 1GEHA 1OC5A 3MZNA 5LNSA 2ZC8A 5CG7A 4YMZA 3LERA 2WWCA 3IUDA 4I9TA 4WXYA 1OYCA 5T9BG 2F6XA 4X2RA 4GQ0A 1E51A 1EOKA 3L4UA 4IT1A 1MUWA 3DKJA 4MNKA 3LHUA 2NX1A 2W5FA 3CIXA 3S2MA 2WVSA 5G1MA 3WNNA 4UXDA 1RP9A 3QFEA 2FDMA 1US0A 3ABXA 1ONRA 1DKWA 2W61A 4WUIA 1P6CA 4W7VA 4MNLA 2B7PA 1VB9A 2NQ5A 3SCTA 1P0EA 2VMFA 2DSZA 1BHGA 2HSAA 4BWLC 3TXZA 4IWWA 4MF4A 5EBAA 1NDYA 4JQ1A 2NV1A 1NELA 2Z6IA 3TWAA 4G2DA 2VZTA 4GX9A 3UWYA 4FX7A 1Z9AA 3KVLA 5CH9A 3KDOA 1GWJA 3MY9A 4E38A 5JH1A 1W1IE 2PDGA 1KC7A 5GVJA 3F4VA 3GHUA 3SRHA 3S0CA 1XG4A 3A12A 3ZZ1A 3F4WA 2X8RA 5LNRA 3TTYA 1UA3A 3SUSA 5D02A 1R85A 1MQPA 1VBHA 4YTQA 2EXOA 3TOPA 2WLYA 1FWDC 1HVQA 4PR4A 4XD4A 4MPKA 4NJJA 3SUWA 1JGMA 3EDKA 1F8IA 4TX9A 1DIOA 3URBA 2YLLA 4MG4A 4A8RA 2W66A 3KLKA 2VR4A 3QHMA 3I6RA 4PBEA 3DGRA 4K7YA 1GONA 3PK7A 4M7TA 3AU2A 4MDPA 1EDGA 1WZAA 4I7VA 2WMIB 1G01A 1CGYA 1GJPA 3MYOA 5E5CA 1H7NA 1ZGDA 4L64A 1IEVA 2WM1A 2CPUA 5LXXA 4IPNB 3TFCA 4O1EA 4UTLA 2BFGA 1XIFA 1QNQA 2XSBA 4PEKA 4UTMA 3R79A 2QKFA 4XZMX 4XB3A 1UOZA 1OX5A 1AZ1A 2E25A 2Y85A 1SUXA 1XV8A 5LHEA 2YBVA 1QRQA 4QJ5B 5FCZA 2OEJA 3LLXA 1YBQB 4RUBA 1VRDA 4C7GA 1DJQA 1CGWA 4JTAA 4C6CA 4FOKA 1CYGA 2NXHA 5JBDA 3JW7A 2E6AA 2CXEA 3KBSA 2PMQA 4RDWA 1S5VA 3IARA 3R7MA 5DELA 1WNOA 1RALA 2JQXA 1E3ZA 1UCWA 2WO5A 1AK5A 1O1ZA 2F9RA 5BNKA 3TW6A 5IDZA 3TN3A 2XIOA 3SN0A 2WJEA 2V5LA 2WJFA 4U4MA 3DAQA 3TK7A 4LUJA 3O63A 2DZBA 3GG8A 3T78A 5RUBA 4ES4A 4IGHA 3RU8X 3WZ0E 4P7LA 3POHA 4Q33A 1F3EA 3VOFA 4F0HA 3VFCA 1KRBC 1XKJA 4M7SA 1DL3A 4LC8A 2CBIA 3VINA 1H2JA 4URIA 2FLIA 3MQTA 1I0BA 2H90A 4KFNA 1HVXA 3SGZA 4HNUA 5C71A 4UQCA 4JFSA 1CNVA 3EGJA 4I9AA 3WQVA 3WLTA 1CENA 1JZ5A 3EA3A 4NI3A 1E9YB 2OZ0A 3MMWA 4JTLA 1HKKA 1JCYA 2Y5JA 1TJPA 3HGJA 3PP7A 2IXVA 1JNEA 4PTXA 4GIEA 1VLWA 1E6NA 1OGGA 4OKDA 4QM1A 1QHZA 5HINA 1TPUA 3C56A 2ACQA 5AFDA 3BK0A 5DT5A 3EOUA 2VFDA 3VO0A 2CZVA 4MADA 3KTCA 1YXYA 3C2FA 5E6YA 4A05A 1TPWA 3SJ3A 4EPDC 3UBPC 5HR6A 3EKLA 1P0DA 5JMUA 1VFSA 1W9VA 1W3NA 4JIEA 2AGKA 3VD4A 4RZBA 4A3YA 4J3VA 2EJAA 2ZA1A 4G7EA 2RDTA 1J18A 3WJXA 1FHUA 1U33A 1HJWA 4PCTA 4Z1AA 1QWGA 4Q3MA 4XUGA 1GW1A 1KXQA 3CUZA 1ONWA 1EF3A 3MV11 3AIEA 3WMBA 1JDFA 3FJNA 1KRMA 1UASA 3WH7A 1IWPA 7REQB 3UXAA 1KR1A 4E2DA 4U33A 3WD4A 3L21A 2ACSA 4UCGA 3GXMA 4K6AA 3DERA 4H7CA 2NWRA 1UZHA 3R89A 2PC4A 3DBPA 1XDLA 1M7XA 4FK9A 2ADAA 4MZYA 3LOTA 4NXSA 3H6OA 4UOQA 3C3NA 4L61A 2D69A 4GA8A 5B80A 1TKKA 4E4UA 5T91A 3LMZA 5I3IA 1UKQA 3ARPA 3SGGA 2EG6A 3GQYA 4QXIA 1WKFA 2E0PA 1GVQA 1KD0A 3RLGA 4X9YA 4PUUA 2O9TA 3NEVA 2PWEA 4LAZA 1K9EA 3I3EA 1ZBVA 4NILA 2FMOA 3IJIA 3PBYA 4JGDA 4AZ5A 3B3DA 4H8UA 3GH7A 3OB8A 1FCQA 3ZIZA 2X7VA 1N8IA 4XUYA 3SQLA 4PMXA 4KWSA 4MZ8A 3FLUA 4DBDA 1HX0A 2BVYA 1YPXA 3WDJA 2QCEA 1KXTA 1G5AA 5CPOA 1KTNA 3IGUA 2E09A 2P50A 3DFQA 3QF0A 2PEVA 4A3QA 4L9XA 3KP1A 5A3HA 4O8AA 3ELFA 4IL2A 5LYRA 1WP6A 3KM8A 4LT9A 5A6BD 4M19A 3V3WA 2OQLA 3VNMA 2V6AA 4O1FA 4FHAA 3GTFA 3W01A 4E5TA 1E6ZA 4S3DA 3ARVA 1REQA 4QCFA 4XAYA 1LCOA 1ZU8A 3EOLA 1GYLA 1JCJA 4DBEA 2POTA 3GO2A 3FYPA 3VGFA 3E0FA 3I3BA 5HQMA 2X09A 1GUVA 3RPTA 1VFTA 2E77A 1R3RA 4GCXA 4JFVA 3GXDA 4M56A 2Y62A 1LJYA 3ZFHA 2ZRUA 1M04A 4YXGA 4HU3A 1V7YA 3R0DA 4JL2A 3W2UA 5JUVA 2CWNA 4R33A 3EOOA 3NQMA 2RAGA 4UTJA 4BS0A 3AOFA 3NYDA 3WF1A 3M0ZA 4QNWA 1RPXA 4H01A 5A8PA 2J47A 5IBXA 2J77A 3QYQA 2KAUC 3QOMA 2GJXA 3EAUA 4P8VA 3PBWA 1AW2A 1KRAC 4JYFA 1LM1A 2HV5A 1RCOB 4JY9A 1QPQA 2GPTA 2FGBA 3CAVA 3CAKA 4UMBA 2YYTA 4LEFA 6CGTA 2QIIA 4US6A 4YPJA 4XZNX 3FDKA 4PBGA 4H2HA 1RJPA 2I57A 3YPIA 3SO7A 1MNSA 1T6MA 3GXPA 1MI3A 3KVJA 1VJZA 1DIKA 1XIHA 4A3RA 3UZWA 1TRDA 2JIWA 4CN1A 2CBJA 3A64A 3ZO9A 3FEQA 3ANYA 3LRLA 1WE5A 1IGSA 2C16A 3QRHA 2ZYFA 1JFXA 1QPNA 3KFTA 1MW3A 4HSOA 2VXNA 3U3HA 2PP0A 4MB4A 2FJUB 3PJWA 4OQVA 3NWRA 1ODZA 1XSKA 4ZXOA 1ODUA 1JCNA 1EKOA 1FXQA 1R9YA 4G1NA 3UYIA 2P3ZA 5IM51 4LCSA 2ZUNA 3E2QA 4LOCA 3L66A 3UT0A 5C2CA 1RVGA 4QLJA 4KWUA 4XWUA 3D3AA 3FXGA 3PZGA 4A2SA 4Z2GA 1QI5A 1M01A 3B4UA 1SM9A 1H5VA 3S6OA 4PB4A 5JBEA 5G4EA 4DQWA 3G1DA 2YL8A 4Q4KA 1XIGA 4Y9PA 1TRIA 3FYOA 1C8QA 4IXXA 2XYLA 3LNMA 4L1XA 2PWVA 4N9EA 2BGSA 4JYDA 4NG3A 4QAWA 2YDAA 1XYAA 2PURA 1LQ2A 4IMFA 2VM8A 3ABQA 4E8DA 5D03A 2OKTA 4PYSA 5LIXX 4HNLA 5A8NA 4ICMA 1TR1A 2ISWA 4LBRA 5A69A 3OQEA 4EXAA 1X98A 2DEPA 3VU2A 2V2CA 3W23A 2CESA 3IV8A 4W5UA 5AHNA 2YCIX 5D2TA 4TTUA 3ONBA 2V3EA 4JEQA 5ENLA 3TIMA 3W76A 3SECA 1AJZA 3GKFA 4DWSC 2WWDA 4H3DA 4KH2A 4IUGA 5HULA 2WMHA 3LY0A 3KS5A 3PSWA 4JTEA 2WYSA 3Q4DA 1MMFA 3G24A 3MUCA 1V7AA 4H00A 4DI9A 3VDBA 2G4FA 2P8CA 1C3FA 3QPZA 3LYEA 2XFFA 4HMNA 3E0WA 2GVEA 1JZ3A 2Q71A 2CZEA 3S2NA 3TA6A 4J3WA 1XH0A 3GVQA 3WLHA 2JGQA 3UR8A 3TTOA 3W7PA 3OYXA 4NT0A 3GNRA 1IT7A 2ANUA 5KINA 5A8OA 1TA3B 5F2IA 2AAMA 3WQ6A 1TIWA 1NF0A 3TLQA 4J35A 3O1NA 2PWFA 2X40A 3VABA 2PDPA 4GRSA 1MXDA 4B2DD 1X38A 2GJNA 3TSBA 2G0WA 1GHRA 3LPGA 1OX4A 1HL8A 1DXFA 1RY0A 2GDUA 5C8BB 4IQJA 4A2RA 4MLRA 2QCDA 3WUBA 2Z27A 3EMCA 5DN1A 4D8AA 1G7UA 1XUZA 1HTIA 2O4QA 4EF9A 2F2KA 4K2SA 2CZ5A 3CZGA 3LLDA 1W9PA 3OA5A 3TN5A 2E9LA 2FHCA 3UPWA 1AQHA 2P10A 1L6GA 3QXBA 5KEZA 4FNPA 3E12A 4KERA 2D20A 3U5UA 1PO9A 1UMYA 1BTCA 6PTDA 3W81A 1E6SM 3OVGA 3IEBA 4IP4A 1PTGA 3N15A 3L68A 5J8LA 4MAVA 2BY2A 4X2PA 9XIMA 4JNZA 2A0NA 4IF2A 4A22A 4JTFA 4MAZA 4AWEA 2V81A 3DENA 3ZR5A 1YBQA 1UWUA 3ZXWA 4HOZA 2JK2A 3I65A 1WBHA 2FZ8A 1VFMA 2ZX8A 1I8JA 3P5ZA 4BI7A 1KBIA 1XYBA 3AFBA 4CNOA 4I7UA 3MW7A 3SQSA 1OIMA 1X8FA 1LLWA 4UCFA 5BRBA 5H91A 2PDMA 2E9BA 1YEYA 1EO5A 5BRPA 1W6TA 3MWCA 1IF2A 1I0DA 5JH2A 4I8YA 1KXVA 4UZSA 1Y8BA 5I79A 2XGIA 2VGBA 3PPGA 3FJ4A 4AY7A 4S3AA 1ITCA 3ARWA 1UP3A 3CMJA 5D9OA 3WD2A 4Q8TA 3W26A 3UCCA 1CBGA 1KM4A 4M5PA 1B0IA 4F9JA 1UD6A 2XSXA 1K7EA 3HG3A 3W7CA 3ZVIA 1CW2A 1SSDA 2PDIA 1RA0A 1NP2A 2GWNA 2BHUA 3GNPA 4KBXA 3M43A 1ISVA 3W0KA 2PDFA 2ZTJA 1I2OA 1GZGA 1PWMA 3WG6A 2JKEA 4I7WA 4UMAA 3B8UA 1FVPA 3IIPA 4FR1A 5DEZA 2HJPA 3TJLA 1XH1A 4QNEA 4CNNA 1GQJA 4E2OA 1JYXA 3OU8A 5D2WA 3VM5A 2GVLA 3M0XA 1A3HA 1KBBA 4EPEC 4LNYA 2HBXA 4N9DA 3U2OA 2CETA 4MJ2A 3VIIA 4ZA0A 3STPA 2DY3A 3T0DA 1MZHA 4KWVA 1MFUA 1SVDA 4J1OA 2Y7FA 4WGXA 2VZVA 5CSRA 3EB3A 1JAEA 2NUXA 1WXJA 2Q02A 3CAQA 2HZGA 3W29A 3FV9A 1TPH1 3NL6A 1DPMA 4CU8A 3A4AA 4WDTA 4AIOA 5EMUA 3CQKA 5KETA 3NPUA 5JXQA 2P0OA 5M1TA 3KRSA 5I03A 4IMAA 1E73M 3RO6A 1W2VA 3CK5A 1P1XA 1XCFA 4CD7A 2WHLA 2ZX7A 3HJEA 2W63A 3QQWA 1W32A 8XIAA 4XVEA 4MWAB 1B5TA 4DVOA 3NPVA 4DLMA 2PDQA 3SCNA 5E93A 2OGYA 2VFEA 2PRLA 2Y2WA 4B91A 4TX8A 4EXQA 3STFA 1GYMA 2G95A 3N13A 4GD0A 3AIQA 1ELSA 3H24A 5A94A 2V8ZA 1UZ4A 4NAEB 4DXXA 3GTHA 1POJA 2HNHA 5IHSA 4FF5A 5I23A 4OUIA 3PPCA 4UZUA 1TREA 2PUZA 3WF3A 2ALDA 2VL4A 1Q2RA 2W9MA 2X16A 1UUOA 1EJ7L 1W9UA 3BW4A 1H1YA 1W3HA 3M07A 5HNTA 1A50A 2QJJA 2UV8G 1FWEC 3MP4A 2GJXB 3GDRA 4NZ3A 4QQUA 2ATMA 2YL9A 1UZ1A 2WBKA 5ABGA 4QJ4B 2Z7KA 4B5SA 3LEPA 3F5LA 3M1ZA 4Q8WA 4P5UA 1EUNA 2O4MA 2C19A 1IGWA 4AZCB 3VDCA 5I77A 5D4YA 1ZS2A 3OLEA 1JI1A 3DZ1A 2VD9A 3HV9A 4EWJA 4O14A 2OWWA 1EBHA 3KOZA 1BPLB 1XD0A 1DOSA 4GXMA 1TWSA 3KBJA 2FPTA 3P14A 3A9BA 3B0VC 6XIMA 4TIMA 3GB6A 3ZQ9A 4Z17A 1VBGA 2R6OA 2WVVA 1GG0A 5AHFA 4CQAA 1YX1A 2TRSA 5AHLA 5E0CA 3U2CA 1UOKA 4O54A 1K8YA 1UWIA 4NXKA 3WK1A 1RP8A 4OUEA 1V3LA 2JFEX 2WB5A 1FY6A 1WKYA 1XR2A 3GAYA 1ME7A 1IEQA 2EKCA 4GX8A 2W0UA 1JR1A 4GUHA 2WK2A 3CV1A 1OIFA 3BPWA 3IANA 3GC4A 4P7NA 3HM7A 4MKSA 1UD4A 3LQGA 3PTDA 1Z42A 1SZFA 2Y6ZA 1HO4A 1WUFA 5GPRA 3L0KA 5BOEA 4GUJA 3IUIA 2QCLA 4GUGA 5CPSA 4DUOA 1EIBA 2J6VA 2ZRXA 3LSCA 3WH5A 1EDTA 2XINA 2PWHA 3W7JA 4K1GA 3LTSA 1NDZA 3PZUA 2F61A 4MWAC 1YHTA 4LX4A 4AUBA 4R9OA 5EFDA 1AD4A 3P6LA 5CCZA 5B7ZA 1VPXA 2J79A 5C9RA 3P74A 2G3NA 2QJMA 3MWAA 4CUCA 3M5ZA 1Z41A 1P7TA 1V93A 1QNVA 2YCEA 4HPXA 3UP8A 3TQ0A 1LORA 3VIOA 2WHJA 2CWXA 4MWAD 2ZZ1A 3WMSA 3SB0A 3R2GA 1C8VA 3WBWA 1ZAJA 3ABZA 3C6CA 4WJ8A 4CQ9A 3C5QA 4DNMA 3BARA 4ZTXA 5IFPA 4J7RA 3VC6A 3SUTA 1P7TB 2PBOA 4HYVA 4AH7A 3W7DA 5GNXA 2FZDA 4W7UA 2BVDA 2EF9A 3OLDA 1XYFA 3QV6A 2X05A 3KRZA 1PXGA 1AVAA 1AFSA 1KQYA 4AZ6A 3AMDA 1O12A 4YN5A 1J93A 5GNZA 3TTSA 3WJYA 5LSMA 3P5YA 4CD5A 3IJ8A 1HKJA 1R2RA 1EH9A 3E2RA 3H2CA 5ABHA 1KBJA 4HCLA 5E70A 2XIMA 3MSYA 2GWGA 2AL1A 2UBPC 1SQ7A 2F6UA 3AQUA 4QP0A 1HKMA 4HHMA 1K9TA 2PTXA 1P43A 4NZ1A 1PAMA 3LI1A 2H8ZA 5FEZA 2AAAA 1FP8A 5I3HA 4ORMA 4ZB2A 3NIYA 3NAVA 1FH9A 4F2BA 1KM1A 2PC8A 4QS6A 1B2YA 1J0ZA 5AHIA 2UY5A 3WLMA 1W1YA 1N8WA 3ZWTA 1WPCA 3RK8A 3MVTA 4B5NA 4UQ9A 5BCAA 3GVVA 4JTGA 4MTVA 4O52A 3L5AA 3RILA 3LBOA 1LWHA 2I7GA 4JZ5A 4H7VA 2D24A 1ZQ5A 2H9AB 1VEMA 4GNKB 3EDDA 1CIUA 4US5A 3LTPA 3DC0A 3Q65A 2INZA 4G7FA 1FWRA 5FF4A 2YOCA 3T0AA 3WYZA 3GSMA 3B9AA 3M16A 4LUSA 5HDRA 4HMCA 3W7MA 5LXEA 1QPOA 2DSKA 1R47A 2DVXA 1OF8A 1B3WA 3S47A 5H1WA 5FESA 5CZJA 3GBEA 4B4FA 1E0TA 3ECQA 3CL6A 4F0KA 5BW6A 4F79A 5HBFA 1TVPA 2IW0A 5HUPA 4IISA 3VMOA 4MB1A 1QCWA 1S5TA 2HISA 3AMKA 4RW5A 1QOPA 5D2VA 1CDGA 4DO5A 4L5ZA 3CTLA 1H51A 1AMYA 1MQRA 4Q6XA 4RZ6A 1SR9A 3KHDA 4W93A 1FWFC 3W73A 1F61A 1SO5A 1SFSA 4N0RA 2C8NA 3CO8A 3RCNA 3WUFA 3QKZA 2OWXA 3EX1A 4MJ4A 4GFSA 1FWWA 4QEEA 3ZM8A 4WLCA 5DLCA 2FPYA 4RNJA 1XLEA 1TV2A 4K8HA 2H3BA 1WOAA 5JVLA 3U2EA 3INPA 3ZJ6A 5F4XA 4JN7A 2VWTA 1V02A 1JUBA 2Y5EA 1EQPA 5A6JA 4DAFA 3RM9A 3UCDA 4PMRA 3I3DA 3GBDA 1LTDA 3TC6A 3NQFA 4YVXA 2WSQA 3ABOA 2YDRA 2DIEA 1ZCCA 3NVDA 1J4EA 4DI8A 4GBDA 4JAWA 5REQB 5AVNA 3TNBA 3PHAA 5FIPA 1XUUA 1CGVA 3W9ZA 2A7NA 2WSRA 1WBJA 2OSYA 4E4FA 1U1HA 1SW3A 2GOKA 2OFJA 3WD3A 1PVNA 3AUOA 2G3JA 4S3GA 4HVXA 3LGGA 1XRVA 5C54A 2E3ZA 2GLKA 4CEUC 1CXKA 2IS7A 5G1TA 1XCXA 3RX2A 1XGEA 2C3ZA 5E9XA 8TIMA 1V3IA 3AU6A 4S3KA 2PTWA 1LOLA 4OE7A 4MDOA 4DM1A 2A7RA 3BLFA 3E49A 3HFYA 1I75A 4W8LA 2XUCA 3SURA 1IE7C 1V6WA 4GIAA 5DMLA 3N18A 4AVFA 2J62A 2GJRA 1VYSX 2VO5A 2FZ9A 1PKMA 4AFYA 2AKMA 1VHCA 4A8LA 5GQBA 4CD6A 4WK9A 4ACYA 3MI3A 2NLYA 3UFYA 1SGJA 3GWQA 3VIKA 2IUZA 2PDWA 2J9YA 1YMYA 1XIBA 3MT1A 5A8QA 1DJNA 4ZE4A 1F07A 2PA6A 4HU8A 1UPPA 4DIAA 5ECUA 3T07A 3VD3A 4H9VA 4IGSA 1XRTA 4JNYA 3RITA 3W86A 1M41A 2FHBA 1S3TC 1VCGA 4WVXA 3PTQA 1WDQA 4W7WA 4KRTA 4LS0A 4NJKA 3M47A 3TAKA 4N9CA 1DE6A 3P93A 4UQAA 4UTHA 5FJUA 3GFZA 3M5XA 3OPSA 3W1AA 4GYFA 1MEIA 3KZPA 4PL1A 5EPDA 3PG9A 2BY3A 1Q65A 2J75A 4PMDA 4ZCWA 3VIPA 3MPGA 3C86A 2BDQA 3H2AA 5HJYA 1F76A 3N4EA 4GH3A 2XH2A 2ZX9A 4JIPA 4I9JA 1W91A 5G4HC 5DXXA 4O4WA 2CLKA 3M41A 4F9DA 4AIEA 1SJBA 3D0CA 1ADSA 1CZ1A 3QV7A 1PX4A 2IPWA 1EA9C 1FWBC 1T96A 3G77A 2Q01A 5FD0A 2Y7GA 1V0LA 2ZZ4A 4PFMA 1OGBA 3NL3A 1YNPA 2OLSA 2XVLA 2PTZA 1PTDA 1T41A 4O0ZA 6TIMA 3IACA 1TMQA 3WQ8A 1R87A 1E6QM 2ZZ7A 2X0YA 2D23A 3ERPA 1KA9F 3ABSA 3HG5A 5CXPA 1XLGA 1M1BA 4AB4A 4D6FA 1BYCA 1X1NA 5C7HA 4S3JA 4ZSTA 1NDWA 4GKTA 1LDCA 2DUXA 3MI6A 3T09A 4ZQCA 1LF1A 3VOCA 3FNDA 3BW3A 4PGLA 3HPZA 2ZVRA 4JTTA 3UY8A 1CEOA 1I1WA 1AD1A 3G3MA 4K7VA 5LA2A 3HPSA 1BYDA 1B57A 1HKWA 3OVQA 5J5RA 1GJUA 1OADA 3THAA 5CC7A 3PNZA 5K4XA 1YDNA 5FSDC 3B0XA 2OOGA 2KX9A 1W2PA 2W4XA 3M0MA 4W8BA 3R58A 4QR6A 2OVLA 3W2LA 2Z26A 1QPKA 4MM1A 1VQTA 4LSBA 3IRDA 4L6OA 4H9MA 3GR4A 4DJEC 5EL1A 4IP5A 1TR9A 3E74A 3SY1A 4MB3A 5SWUA 1VC4A 1QBBA 3EXRA 3RDKA 2VVNA 2PGFA 3DC8A 2XFRA 3W2NA 1Z8AA 3QN3A 4ADSA 1B1YA 3THUA 2YCJA 4FI4A 1UWSA 3IRSA 1OHLA 1I6NA 4HOXA 3F7JA 1TTPA 2VEGA 1AQ0A 3VIFA 1F3WA 2INFA 2V68A 3NM3A 3MMUA 3N6HA 3PAJA 3VK5A 3A9IA 1DQXA 4ML4A 1OFQA 1EXPA 1Z7AA 1OCNA 2QUNA 1J11A 1NF7A 3H23A 4BWLA 1SZEA 2BHZA 1W0MA 3NQEA 4NF7A 3BWWA 4PB3A 1KXHA 2IPJA 1TA3A 2XFYA 4OOUA 4ROPA 1LG1A 4Y96A 1RAKA 3F1QA 1FWJC 4ZQNA 1RQBA 1E71M 3W24A 1VEPA 4HPJA 2G50A 3A22A 1R3YA 1MW2A 3CZEA 3N19B 2JKAA 4U5IA 3LI0A 5AYYA 1KLYA 4IGNA 3RJXA 4H41A 1VR6A 5D30A 3LCHA 4V27A 3WJSA 5BMWA 2DH2A 1H1NA 1GVOA 1Y5XA 4ERGA 3RLVA 4F0LA 1QTWA 4ZO6A 2VZUA 2PDYA 1XSIA 3O9NA 1J79A 2WVUA 3OVPA 4IIHA 1VCFA 4IPPA 1PX8A 3KTSA 2PDNA 3C0JA 4IIBA 5LZLA 4OFCA 3NQBA 3TU9A 3CB3A 1T8QA 4RV8A 3TJ4A 1NU5A 1W5MA 1ZL1A 4O1BA 2DP3A 4EANA 5ABFB 4GABA 3VOGA 3VD9A 4NHVA 3U4AA 2CHOA 2CKSA 2Z29A 1YLVA 3EX4A 3PB2A 3W7EA 4L80A 5MKGA 3HPFA 5TD4A 3O0FA 4J2PA 4QX4A 3KE0A 1Q4NX 3E0VA 3FKKA 3QR0A 2AMGA 4J3SA 4LS1A 1MRQA 1I2PA 4YTTA 1VH7A 2J88A 1AW1A 5D33A 2ZRVA 3OZMA 3QGKC 3V5FA 4U5KA 3GZAA 2OCZA 3DFPA 4B16A 2QV4A 1GNXA 2R1LA 4YVVA 1EDQA 4RE2A 1K6WA 1GW9A 4H1ZA 4L1WA 4V1XA 3WLQA 3L5MA 3C4UA 1A3XA 2FQIA 3BSMA 1WCGA 3RM8A 2OTDA 2I16A 2VYOA 1NVMA 4Q7BA 3REQB 1VJSA 3SEPA 2NX9A 2D0HA 1K4GA 3H26A 1TV7A 3KWXA 1QW8A 3LG3A 3TX9A 4PUNA 1UD5A 4AD0A 2G8ZA 5CBIA 2ZXDA 4JYEA 1F6YA 4TX6A 4JFWA 3LQLA 1D8CA 1QR7A 4X0VA 3TH6A 4GY7A 2JEPA 2Q3RA 2QQ6A 4WIWA 2YB4A 4XO7A 1IT0A 1YQ2A 5D09A 1X6LA 3PZQA 2E67A 1L8NA 1BXBA 4HMEA 3IUHA 1FCVA 1KM6A 1W1A1 2HRWA 1G69A 1OC6A 4P8WA 4AISA 4DPQA 1R86A 1EWDA 3LSBA 4RR4A 3UERA 4YU1A 3G0UA 2UWFA 2F2HA 4MMWA 2R82A 5A95A 2VVSA 4FIRA 3W53A 4ZEPA 3U9IA 5BYWA 5D8ZA 3SI9A 1OQFA 2YXGA 5C9UA 1E5JA 4LVBA 2VDIA 3MHUA 2G3IA 3SCUA 4UOZA 1JVNA 4REQB 3NGJA 3QQ1A 5HAOA 1W56A 2WMGA 2EPHA 2C7FA 3D47A 3RHGA 1J2WA 3G18A 4DUVA 3EX3A 3SUUA 1OK6A 3GUWA 2A6NA 2F84A 3GTXA 5I78A 4Y2WA 3S2LA 1HGWA 1KM0A 5K3VA 3TR2A 2XJ7A 2KZHA 3W82A 5AOUA 3FX4A 3TUUA 1DJIA 2C6QA 3AIWA 1ZBCA 4RDYA 1TELA 1UKSA 1VIZA 4RDVA 2EPMX 5LIKX 3DOPA 4Z2LA 1F6PA 3TQKA 3WNLA 4QAIA 2ZUUA 4YJ5A 2EJ1A 3UJRA 3B8VA 5DF0A 3SBFA 2D2OA 1IR2A 5AC4A 3PBMA 1YE6A 3GDLA 3R8GA 3HQNA 3DECA 5CAHA 3BGJA 1MSSA 3MVIA 4ZVJA 2NQLA 3V75A 4CN6A 1MEHA 2JEQA 1FUYA 1I2NA 4YIWA 1GT8A 3W7HA 4P7RA 4GIRA 4LUYA 5K2ZA 2NT0A 3NR0A 3VGDA 3B8DA 1AZ2A 3P62A 1O94A 3BOLA 2WZIA 3CWHA 3LBCA 5CPNA 1MFVA 1EA0A 1VRXA 1XHGA 3TFXA 1GORA 3HU7A 1Q6LA 2XH0A 2C79A 3AIUA 3N2OA 1CXHA 2QAFA 4WEVX 2WNNA 1N55A 1V6YA 3S2CA 4WOZA 1ADOA 2VRJA 3R12A 2NLIA 2VEPA 5AN7A 4AD2A 2J7GA 1SJDA 1E0UA 3GW3A 1EP3A 3CPUA 2ZCGA 4WJEA 3FA4A 4FNQA 3WJZA 4RE0A 3CNYA 1DTNA 4X3ZA 2WZMA 1EP1A 3GVRA 3SRFA 5LA1A 4BF9A 1A53A 3A23A 4IJCA 2WCGA 2YZRA 4UNLA 2GK1B 1FXPA 3UGVA 3LGEA 4FALA 4MWAE 1TX2A 5AHEA 4V1YA 5D05A 3B4YA 3VNLA 3W7RA 1CXLA 4YCOA 3M0LA 2DT1A 4S38A 3BGAA 4O28A 2PS2A 4V15A 1IEIA 4GQQA 5BOFA 3CU2A 3TR9A 2GSHA 1TPC1 2H9AA 1GTHA 1YDOA 1CT5A 3R11A 4FXSA 2VKZG 4DWSA 1GQNA 3S4TA 1HJQA 4ZE5A 3EDEA 3E02A 2BY1A 1XKYA 3G1VA 3TJXA 2WCSA 4OBRA 2ACUA 5D9PA 1C7TA 1UW9A 4IJRA 4E8CA 3LN3A 4PSRA 3CQIA 1AJ2A 3JVAA 1NWRA 4KQNA 1HKIA 1Z32X 1AL8A 1SMDA 2JBMA 4AZGA 3WK3A 2O92A 3BZJA 1J8VA 3VNKA 3DFYA 4ADTA 3A24A 1Q3NA 1JPMA 3CGTA 3S42A 1R7OA 4GBUA 5HWNA 2J13A 5A2AA 4GE8A 1W5OA 4ASTA 3UWZA 4YYFA 3WQWA 4IXHA 4LY8A 3GHRA 5EMYA 1PJ9A 1XINA 2HEJA 3LK6A 2VR2A 1FKXA 4GG9A 1V6XA 3LNPA 4OVXA 3PN8A 5BWFA 1EJSC 3ZOAA 1NWSA 2ZKMX 4F0RA 2JKPA 5CSSA 1O1HA 2POZA 1YTEA 3CEUA 4O10A 2UY4A 1A0EA 3MDUA 4DNHA 1CCWB 5CJNA 2CFFA 2J8TA 5I09A 1OF6A 3B8IA 5EA9A 2FJKA 4HJFA 3GC2A 4W8AA 1FQ0A 1Z44A 4UTKA 1JFHA 4Q7IA 3HB9A 4DB7A 3MUZ1 1NFBA 3O06A 2QUUA 1CGTA 3GKAA 3I7QA 1ZUAX 1UR9A 2ISVA 1NIUA 1MEWA 1ZENA 3TC7A 1BQGA 4HHHA 4M82A 4GYKA 3WLLA 1P0NA 4EKJA 2YW4A 2GQ8A 4H6RA 1S2UA 3WDIA 2V5JA 3BMXA 4IMEA 3W70A 1EO7A 3UR2A 3VNYA 5BROA 1VZWA 3DXIA 4M0XA 1RR2A 2RDUA 4Z2IA 4DJDD 3WD0A 3TMLA 4C6MA 1UMLA 3WJWA 3GM8A 4QE4A 1CGUA 3WLNA 3P2VA 3BJFA 3RCYA 5KZEA 4DZAA 3C2EA 3P3BA 2QPXA 1JZ6A 2J27A 2O7QA 4MY9A 4RZ4A 1R9ZA 1DJGA 2D3LA 3KRBA 4JX5A 1GVFA 2A1YA 4ZQMA 5ABFA 2UY3A 2W91A 1EJVC 2VQUA 3KL0A 3N11A 3TN6A 2FZBA 3N73A 1ME9A 4C6JA 4QS5A 2DV0A 4GGHA 4XIMA 6ENLA 4S39A 1EJRC 3PUOA 1W54A 4A3HA 1ZP3A 4FR6A 5H8UA 1KWGA 5XIAA 3DBNA 3USBA 4YTRA 3PFMA 1FDZA 4O19A 3CAWA 3PJTA 4O0KA 2HROA 3WDRA 2PDKA 4XO6A 2PP1A 4U28A 4JN8A 3L12A 3AXXA 4W87A 4TMBA 3THCA 4ZGYA 3HFTA 4GYJA 3W1RA 4AHPA 1MUCA 4LEQA 4GIYA 4XSMA 3WENA 2BVWA 3H22A 1A80A 3STCA 4TXEA 5HMFA 1FWNA 1C29A 3AZSA 4W5ZA 3H21A 3UJEA 3H2EA 4AY8A 3W2JA 3SADA 4OOZA 3IJ7A 3WN6A 6TAAA 1X39A 2WM0A 3CHDA 1EIXA 1G67A 3Q67A 2G3FA 3BAJA 1H62A 2E68A 3MCMA 2Y7EA 2FZNA 5HJLA 4LAMA 1R3QA 4XZWA 3SIMA 1PIGA 3UJFA 1Q6FA 1AH3A 3TSMA 5FAJA 3DX5A 4DUWA 3N2MA 5DANA 2B7QA 3NQ8A 1NTHA 4GC4A 3A5FA 3TTEA 3ZLGA 4L9YA 4HP5A 3L4ZA 3NZGA 4YWIA 1U30A 1JJKA 2FFCA 2BGNE 5G5IA 1W3JA 3TTQA 3LTYA 4H9YA 1F3XA 2WHMA 2ZVIA 3L23A 5D2XA 5I2UA 5H6HA 1VKFA 4XG1A 3B9OA 1RSCA 1JL8A 3NCOA 3ARRA 2A7PA 4PMUA 3CIVA 3KAOA 2QUTA 5LHFA 2DDXA 3ID7A 4P2VA 1KNWA 2QNEA 3W74A 8RUCA 1BGGA 1XDJA 4GNJA 1VFHA 4JL1A 3GY1A 3CH9A 4KGLA 1B3YA 3URAA 2E5DA 1OFDA 1H7XA 3PWAA 3P7YA 4LS2A 2D1ZA 3DN5A 1H7RA 1HL2A 4NJIA 2OT0A 3MB9A 1LYXA 3MHGA 1VFFA 3ATYA 5BU6A 1BAGA 1E6RA 4HA4A 2WLZA 2AQOA 4MJMA 2I5QA 3PPFA 3WF4A 1GOIA 1KTCA 3AYTA 3T05A 1PCWA 5LKYA 5K9DA 3UPMA 1HKVA 1HG3A 1S5NA 1DWFM 4GPNA 3BO9A 4MLJA 1WV2A 3EX6A 3WQOA 5C9ZA 3FA3A 3T6CA 1O5QA 5CJ5A 3I6TA 4C60A 3K46A 2Y8VA 3BSGA 4X9SA 3KXQA 5I6SA 1QVBA 4QTGA 5AYXA 3FCPA 1S2AA 5FAGA 4UFIA 1J9YA 1TJ0A 4PUKA 4P61A 4HQVA 2P5NA 1S5WA 3FN9A 3QLLA 1M6JA 2AQVA 3DIPA 1TE6A 1R3WA 4RPPA 3GU9A 4Z1DA 2ISDA 4CQBA 1ISYA 5LA0A 3BICA 4O57A 4YL2A 4AG0A 4V33A 3KBMA 3HO8A 3P60A 1LL7A 5CG0A 4QJ3B 1BVNP 2TPSA 3K8MA 1SZGA 2RGMA 1Q85A 5U7SA 4GISA 4GZEA 1A49A 2X0SA 4C6LA 2RKXA 2VCBA 1JI2A 1NARA 1EOMA 4N4PA 1L8PA 2BVTA 2ATSA 3BURA 4JIIX 4R53A 1XLIA 4PCNA 4WHBA 4QLKA 4BCEA 3OODA 3USZA 5GJMA 4HK5A 2HVNA 1MDLA 1ZAIA 2ZA3A 3W72A 4WY0B 4OHQA 3C8FA 3EEGA 3VOHA 3U0HA 3E96A 4IP7A 1R2SA 4DYEA 4JDYA 5CBJA 1HXJA 3T42A 3GR8A 4C65A 1HJVA 4D8ZA 4BHYA 4Q8PA 3W7QA 5AY7A 2WC3A 4S23A 2I5IA 3N9RA 3S1WA 4MVAA 1IIGA 1UH4A 1WKEA 1DJXA 3OEXA 2PGEA 3ABRA 4XBKA 4PTWA 2QCGA 1GOQA 1WAWA 3VXGA 3R94A 4PUMA 2DW7A 4OT7A 1OJXA 1TG7A 3B9DA 3CYJA 1EF2A 1LWJA 1O5RA 1XBXA 4NQ1A 4GZ7A 2PCEA 3OZPA 1PIFA 3B0YA 1UWAA 4CQDA 4C6OA 3W83A 1JZ4A 2VP8A 2OYMA 1YW1A 1OSEA 1GG1A 4B9YA 1PHQA 2CZDA 1RHCA 2QMKA 2FGLA 3CT7A 1XYZA 3SIZA 2R8WA 3IJQA 4IUOA 3BJTA 3W00A 3KLLA 3KX6A 4HCDA 3NSMA 4JTUA 3UG5A 4R7OA 2G4JA 2WJDA 4ERIA 2OO6A 3NG3A 3G1HA 2WOQA 3CPRA 1XLLA 3UPBA 3ITYA 4LPCA 1OZMA 1TUFA 3NQCA 3K1DA 4ZZ9A 1OY0A 3VNIA 2VOMA 3KTXA 5TBOA 2ZOXA 3G0SA 1X1OA 1A4LA 4C6QA 2P76A 3AIBA 5AZ1A 1UH3A 3QSRA 4CU7A 2OEMA 4DM2A 1EYWA 4OIFA 4D6IA 2J7DA 3IVSA 4Q32A 1E9IA 4XKYB 4GQGA 5CZKA 4C6EA 4AZBA 4D71A 5HPOA 2ZTKA 3ALGA 5A6MA 3H7UA 1XX1A 3KZSA 2FB2A 4N4QA 2PTYA 4H8NA 4UIOA 1HN1A 4ZODA 2BOEX 1QO2A 2V0TA 3TONA 1ESWA 3QVQA 1N7KA 2DSWA 3WBXA 2QLYA 5TF0A 1K8ZA 1A5NC 4O4VA 2O0TA 3RLUA 4KCUA 2VDHA 2J78A 4DJFA 2XVKA 3WQCA 5KZ6A 4HNCA 4GYPC 1NFPA 3FGCA 2G3MA 3L0GA 5EMKA 1PZ0A 1A5LC 4REQA 1GVEA 2GFTA 3OQ8A 2YA1A 4QRNA 1XFBA 3MMDA 3NJ3A 4H6KA 3VNDA 4QDPA 1P6WA 1C8XA 1WB0A 4PBFA 4AAJA 4LVGA 4DO4A 1DIEA 2F6KA 5PTDA 2FB3A 3S1GA 3S5OA 3FK4A 5BMXA 3GZ3A 2WAGA 4AX6A 3P0WA 4QLLA 1VPQA 3R0UA 3ITLA 1F73A 4X63A 1LWIA 2QUMA 1OFAA 4MUPA 3PJUA 1GKPA 3WH6A 2PPGA 2BBFA 3BLEA 4ORIA 1CECA 1H49A 3T4WA 1XIJA 2Y0FA 3V0TA 1TPFA 1UG6A 3LZ3A 4MUZA 2NT1A 4PUEA 3GU2A 1HP4A 2AKZA 3GNOA 2OB3A 3SCRA 2Z0IA 3AS3A 2NZLA 3RNDA 3VFLA 1GQIA 1H50A 2V63A 2IKJA 1IT8A 3FVDA 2QW5A 4OV4A 1JDEA 3K5XA 1GVIA 1NEYA 1R2TA 4WKHA 1B4KA 1TTJA 5IDIA 2ZA2A 4HBKA 1D7FA 3SY5A 4AYGA 1BEUA 4LUIA 4HNVA 1WDWA 3ARXA 1YDVA 3S9ZA 5FACA 3QV9A 4F48A 4IMCA 3RJYA 3UWEA 3F2BA 2H8XA 3NZ1A 4DZ5A 4O50A 4GUIA 4JTDA 2FDSA 2RJGA 4Z2JA 1ENUA 3W7NA 1F2JA 2DFAA 1JPHA 2ZQ0A 4PMZA 2ZWYA 3QM3A 5U4NA 1B9ZA 4D6EA 3OA3A 3VMNA 2P1FA 3S9IA 3URQA 4L4PA 3W28A 4D6JA 5I0DA 3S83A 4IG2A 3MO4A 4DPPA 1K03A 5E0FA 5FJJA 4WJXA 1OINA 2NVDA 3TDFA 3VCNA 4LUSB 4JD4A 3RR1A 4NSBA 1JUEA 3ES7A 2L5HA 1A0CA 2CEQA 2Y8KA 1NSJA 1PCKA 3K13A 3RLHA 3NGFA 2Y7DA 1KKOA 4ATDA 1GQLA 4ICCX 1PZ3A 5CZ0A 2OMAA 7TIMA 1UH2A 3NURA 3MZ2A 3WK0A 1SU5A 5FJIA 4ZOCA 4M8UA 2VELA 3W6MA 1PYMA 2A3CA 4RE4A 4WSHA 3TYCA 3UETA 5A8MA 4JX4A 3AHVA 1RUSA 5A2BA 2XDFA 4NRRA 3AIRA 3CT2A 4QITA 4GI4A 2C15A 2CHRA 2R14A 4QSHA 5TQLA 3SY8A 5JU6A 2YA0A 1Q66A 3DYMA 3SW6A 4ZTYA 4UFLA 3GD6A 3KHJA 1SJCA 1H09A 3SRKA 3E1F1 5G4WA 6REQA 3IAQA 3LM7A 3ZS4A 5HMSA 1XLMA 5HPCA 4DLFA 1PZ2A 1KFWA 2NWSA 3APYA 5CPMA 4CN4A 1TWZA 1RBOB 5AYIA 4AW7A 4LJ3A 4J3ZA 2RHGA 4JTJA 4MZ1A 4A8NA 2I14A 4PTNA 2X1IA 5LNWA 3TV8A 1ZAHA 1VYRA 1ICQA 1IXOA 1UBSA 1KCLA 2XWDA 1E3XA 1S39A 4QEHA 1VS1A 5I00A 4CEXC 4UNIA 3CUJA 3K30A 3STGA 1UP2A 1M03A 5I5RA 5JIPA 5G2HA 4NJHA 5KSWA 3DHPA 4O8RA 3PUEA 2CLPA 3T9PA 3UEQA 4US5D 4UR9A 3QSTA 2IKHA 1F4HA 3HGOA 1EQCA 2XVNA 2YKKA 3M0JA 2OSWA 2AMXA 4MFDA 1TIMA 4JFTA 1A47A 3GG7A 5DCBA 1TCDA 3CUHA 1L2UA 4WRHA 4PTDA 2WNWA 4GMEA 4GO9A 4N02A 2HVOA 1UA7A 3AMGA 2CLLA 4KIEA 2P53A 4KETA 2E6YA 3VGGA 3E0IA 2QCDB 3CMFA 5AB3A 3IK2A 1KFCA 3UR7A 2VEIA 1LLZA 5C2XA 4WZHA 1FWIC 1CTNA 2J8FA 1MNZA 1JQXA 2BXYA 1EPVA 1TVNA 6A3HA 1H61A 1KR0A 3GYCA 1B3ZA 1VFLA 3K1GA 2I5GA 4AC1X 1G1YA 3BAWA 1Q6EA 4GY0A 4LAOA 1T8XA 4PA8A 2REQA 1DTUA 3AC0A 1KFLA 4PEEA 1R6WA 3PAOA 4DJEA 4D6DA 3GDTA 3D5HA 3IJ6A 1GVYA 3U48A 1WX0A 2ZUMA 4JTHA 3VZXA 5H2ZA 2DUZA 1J12A 2J74A 4Z1YA 4RX0A 3CTTA 3EDFA 1T99A 2DZTA 3PWIA 2A3AA 4J2MA 4MWAA 2W92A 2ZE0A 4TV5A 4NUWA 5EMMA 2REQB 4LB4A 3AMLA 1FWTA 3BCFA 3DCPA 3NEHA 5DXYA 4S3EA 2PCQA 3CS2A 3SCWA 4LNCA 2HBVA 4A3UA 2Z1WA 1OCQA 1UZDA 1F5ZA 1HF6A 2PODA 4XZHA 3TP4A 1KV8A 4JHMA 3CASA 4XTDA 3N2BA 1UR2A 1TV3A 2X1RA 3QTPA 1GKRA 3UW6A 3HGRA 1B30A 1EFZA 3E5BA 3VYLA 3AMCA 3MUAA 3WQDA 3PZVA 1UBPC 1JIBA 1J96A 3N3MA 3V5OA 1V3KA 1F4AA 3LCXA 5F1VA 5BU9A 3CQJA 2Z25A 4NY2A 1QT1A 3UESA 4GNVA 2G41A 2X2GA 3T55A 1DJHA 3E5PA 2NVAA 4HPNA 4IX2A 4I3GA 2IPFA 1OYAA 5HQLA 2BXVA 4GVFA 3T0TA 4B3LA 4IPIA 2GQAA 3SCPA 3AYSA 1A5BA 2ZZ3A 1CXEA 1S2CA 2ICSA 4GVIA 4AYSA 3S6TA 3E9AA 5FEWA 1XH2A 3QPEA 2VNCA 3H2MA 1W17A 1LRTA 2INEA 3N2TA 4J27A 1SW0A 1EP2A 2BY0A 1RVKA 3GU1A 1AMKA 1M7OA 3V5CA 2FVLA 3WEOA 2QT3A 2P3EA 1SW7A 3WNPA 1XYMA 1M7PA 4LAUA 1E43A 2RFGA 1X1ZA 2PWDA 1K77A 2TODA 3W84A 3F03K 1V3HA 2ZUTA 1X97A 2VD8A 3B8SA 1PB0A 3KOYA 1Q6CA 2ZDSA 3LHZA 4OGZA 1Y5WA 4GFIA 2E5CA 2Q6ZA 1AODA 1JGIA 2WSYA 3UU0A 4HTYA 4NX5A 3GRIA 3W7KA 1V0KA 9RUBA 2V5DA 3IGXA 3UWVA 3LBMA 3A3XA 1F3TA 2PWUA 2X0HA 4GXWA 3KL5A 3C2VA 3MS8A 4B5UA 3GIQA 3WUEA 4EX4A 1XBZA 2EPOA 3B9NA 1TZ7A 4FXJA 4QGCA 1YADA 1RV8A 3I7RA 5HOSA 4HZ7A 4JKMA 4JCLA 5CBBA 3NL2A 3FHAA 3VKAA 4KEVA 1OBAA 2UY2A 1FHVA 4CQ8A 3DESA 3UGRA 1FWSA 3VE9A 1B3VA 5CQ1A 2ZX6A 4HT3A 3TZFA 5FL0A 3EKGA 4FNUA 3DDMA 2QMJA 5CPLA 2V3DA 3V16A 3AYVA 4BKNA 1W3KA 4L65A 1JEZA 2CU0A 3O6DA 3ZR4A 1Q6OA 2IKIA 5F2GA 3QW3A 4AF0A 3MC5A 3QZAA 3KOXA 3DFNA 3WF0A 2OPJA 3V0SA 4KWWA 4LYRA 1E9LA 3BOFA 1OGSA 1S1PA 1T40A 3M0KA 5CC5A 1SZNA 1H5YA 2NW0A 1FKWA 4UR8A 3ARTA 5C9WA 1E4LA 4MKVA 9CGTA 4ICNA 2XVGA 3MV01 4Q6JA 4A4AA 3F4CA 3ZJ8A 2X2YA 3G5EA 3U7BA 4POCA 3W27A 1V6VA 1P0KA 2OODA 1O66A 1W3TA 3QR1A 3KVMA 4DBUA 3MTWA 4BQ3A 2FH8A 4LU0A 4RJEA 4NZCA 2GVGA 1JRBA 4L4LA 2Z1XA 2Y24A 3E2SA 3RGTA 3RM4A 3NSXA 3NVTA 1N8FA 1WYIA 4A29A 5HWJA 3I10A 4LGXA 4P7QA 4G8TA 2Y61A 4ZQOA 1HL9A 2X30A 5D2YA 3WF2A 1T7LA 4J9JA 5FF7A 4HGXA 1WZKA 5LNVA 3TQPA 5CC6A 3S5YA 3WFAA 1WZMA 3WMLA 3ITTA 2TSYA 2FFIA 4KGJA 3CV7A 5DBUA 4NRSA 2F7FA 3KUMA 3CHFA 1ITUA 2VFHA 1C9WA 1K4HA 4GY1A 4KW2A 5I3FA 3UYCA 3ITOA 2RJHA 1US2A 3RFAA 3CHCA 2VGIA 2FVKA 2YLAA 2VURA 3PUDA 5AC7A 2MUCA 5KTLA 5HANA 4CD4A 1ISXA 3WFZA 1KFKA 2PBGA 3QMRA 2HXUA 1I2RA 2MNRA 3D6NA 3AO0A 4AXKA 1SSGA 1QU4A 1H4PA 4A6GA 5CAKA 3N14A 1UIOA 1QDSA 5A6KA 1XQKA 2VC9A 3DFOA 3IGSA 3PANA 1OWQA 1BTMA 3KBWA 4WDUA 4HA3A 4TVCA 4Z0JA 4HJWA 8A3HA 5DRCA 2GGEA 2PU1A 1XP3A 3W85A 2WZHA 3ZVHB 1VJIA 4U31A 4ROQA 4HPHA 2CXGA 3WQ4A 1F05A 4IPJA 4GACA 3GH4A 5HXMA 3G8RA 2PF8A 1THFD 3BW2A 1UWQA 1J0HA 3DG6A 4B3ZA 1TQJA 1WOBA 4DYJA 3B03A 1V6UA 3PTKA 3N6JA 1N2VA 4UFHA 4KCTA 4ZQRA 4FIQA 3MKVA 1DWJM 1L6FA 4BR1A 3NQGA 4XISA 3VX0A 1K7XA 4R85A 4C5ZA 1BKSA 4W88A 4WSKA 4N7QA 4FEZA 1JF6A 1VBRA 3ARZA 5I3KA 2E8ZA 1Y0EA 3LV5A 3UZYA 4B92A 1JCXA 3ANVA 3RRXA 2BZNA 1UJPA 2VFGA 1XIMA 1TWIA 3ARQA 3OZYA 4JX6A 3CC1A 5I3JA 2WHKA 4WSJA 1ICSA 3N1AA 2GGJA 1M5WA 1I45A 5I7GA 1S2VA 4W89A 3P8IA 2XSAA 1ZFJA 1TO3A 2CLOA 3MKKA 3RRAA 1RBAA 1QK2A 5DY2A 1SFJA 5T9CE 5CEWA 1RJQA 2IMRA 1IWBA 2DJXA 4WF7A 3BDKA 4FAMA 3GFXA 4XSLA 2DZXA 3W7LA 3WDPP 4GVGA 2VT0A 1B9BA 3WEMA 4B5TA 4UUIA 5AHMA 4DAIA 2HTMA 1NP0A 2ZC1A 3CWNA 4RNIA 4CCEA 2C1HA 4JCMA 3OHIA 4DJDA 3C2YA 4ZOAA 2VWSA 3OGSA 2YIHA 1KBKA 2OLHA 4O53A 3QJAA 3WO8A 1D7KA 1FWGC 4AQLA 3CMGA 1ZP4A 3OP2A 3V4BA 4KMQA 4LUTA 1GOKA 2W3ZA 2ZRWA 2GSEA 1IYXA 1QO5A 3PNUA 3S5SA 4O18A 7CGTA 3H2FA 5D37A 3T1GA 3MSGA 3ITCA 4MKNA 4NZFA 2VC7A 3ISIX 3BANA 3PTMA 3SRDA 3AHXA 4EIVA 3T8LA 2ZE3A 4Q4OA 2VX5A 3ES8A 4MNJA 1G7VA 1L0PA 3KW3A 3BCDA 3C0SA 4M6VA 3UWWA 1M7JA 1TSIA 4XTIA 1FBAA 1OT2A 4WY0F 3LPPA 3IIZA 4HHLA 1GYNA 3MSDA 3CHEA 2W79A 3CUXA 3PC0A 4C1NB 3RX3A 4AZIA 2BLEA 4GVHA 3FEMA 1TUXA 2I56A 4XX6A 1B4EA 4HNNA 4DEFA 5D04C 2Z1VA 4RPQA 3AIVA 2ZXAA 3E6EA 1PKNA 3GXFA 1K7FA 4LRTA 1CLXA 3U7VA 3ORWA 4EE9A 3B8WA 1TJRA 1XFCA 1H0GA 3K8LA 4FS9A 3UG8A 2XWEA 4GO8A 3ZLFA 1GK8A 1PZ1A 1FCUA 5DO8A 1AUSL 3OIHA 3BLLA 4Q7NA 1VFUA 4GQBA 3WIJA 1W9DM 2D73A 5F4SA 3EA2A 3L4TA 3N12A 1XRFA 1JPDX 3N9SA 3WKZA 3F5JA 2DGAA 1QOQA 3CZKA 2CIPA 1ML1A 1BD0A 3WQPA 1U5VA 2DZWA 2YPIA 3GC5A 2QUVA 1FWCC 4NYUA 3O8AA 2W6RA 2A2IA 5C9XA 3HTWA 4Z42C 3UY7A 3CZJA 1A5AA 1TTQA 2AOSA 3KS6A 1JAKA 3WQGA 2DZVA 1P0BA 3Q58A 1VENA 3VE7A 1PHWA 4NL1A 1UR0A 3WY1A 4BK9A 4TUFA 4PMQA 3SCOA 1AA1B 2PB1A 3MSRA 3LB0A 1R7AA 1QUMA 1BVZA 2C1GA 1SMAA 4JN6A 3TYBA 1XPYA 4EK7A 4PSPA 3QHOA 1LBLA 4JPGA 2WXDM 3UD6A 1EHAA 5F4WA 3XISA 2YBTA 3VCRA 1GQKA 3ZSTA 5FOOA 2DT0A 2BMBA 2Z28A 1R3SA 1KWKA 2YDQA 4DWSB 3CLMA 4HNTA 1IV8A 5TAOA 4R3UA 3LPFA 3VKDA 1ZTVA 1DQUA 4LF1A 3TQVA 2O9PA 3R4IA 3UNDA 2VENA 3M46A 1TX0A 3T2PA 1IEXA 1KGXA 3DFHA 3W6LA 1V08A 3RG6A 4DJFC 2NSOA 2I9EA 4F2UA 1X6UA 2J6XA 4MY8A 5B7YA 2HE8A 3TW9A 5REQA 2JE8A 5HQEA 3ENLA 2HNEA 1ZCOA 3PF3A 3SZ8A 2EPLX 1SJAA 2PGRA 4XKMA 4JHZA 3TCSA 1Q6QA 2HXTA 3M7WA 2V9DA 4IIFA 3WH9A 2QDHA 1DP0A 1JXKA 2UZ9A 1RZMA 2DW6A 4L4MA 2FZMA 3B8TA 1NM9A 4CKQA 4XZBA 4KFOA 3VKJA 2QCHA 5FSEC 1PEZA 4EAMA 4V28A 4WY0A 2C71A 3T7VA 4IGMA 4B2DA 1O5KA 3XINA 1VFOA 2HQAA 4DN1A 3N29A 1TWDA 2Y8UA 3SCSA 1HP5A 3GNXA 1JRCA 4UQDA 1MZRA 2R1MA 2FTWA 3N6QA 3RX4A 3TLLA 2W62A 5AC5A 1Q6DA 1MUMA 3NZPA 3GXNA 4IIGA 3KCOA 2DZAA 4OV9A 3A4XA 1OX4B 1ZB5A 3I68A 3EPNA 1A5OC 1WXYA 4Y6GA 3UA3A 3BSHA 8CGTA 4XZLX 1K8CA 1DJZA 3TAOA 1KM2A 4AVNA 1XYLA 2HS6A 1IEWA 2XVPA 1HZYA 3BLKA 3M5VA 3MUIA 2D22A 4GGBA 5F1UA 2A3BA 3FJLA 4NVTA 1OT1A 2HDJA 1EZ2A 1QATA 4M6QA 2XG9A 4O13A 4WQ6A 3LPOA 4Y9AA 3VAVA 3UWQA 4Y8FA 1OM0A 4H2CA 1QI0A 2OYLA 5BXPA 2ZZ2A 3OG2A 1MQQA 2BGQA 1EL3A 1LOQA 3OTRA 5F2LA 3RXZA 2X1SA 2OT1A 3AS2A 2AL2A 4BEUA 2VGGA 3R25A 4U2YA 2Z2UA 4GJJA 1F7BA 3S1XA 1JG9A 1GOXA 3ARYA 4BF5A 2F8QA 5DBTA 1YNYA 1QW9A 3H70A 3K8KA 3SCVA 3PJXA 2X41A 2HWGA 1H7OA 1VIWA 1XIIA 1OG0A 4YLWA 2XISA 3S5NA 1MDRA 2XU2A 2YA2A 3BQ5A 1BLIA 1W5QA 3VGHA 3LS9A 3L7RA 3QW4B 2DJLA 1OYBA 3NFUA 4W4QA 1KQZA 2V67A 3UVAA 3WH8A 1WAUA 4C1NA 1BKHA 2J9ZA 1XL9A 2YXXA 3BZGA 4TVDA 4FF7A 1S1RA 5EFFA 5E6ZA 3H4XA 3CZLA 3VUPA 4D2JA 1QWKA 4UR7A 5K4ZA 3T2QA 3G1AA 3NO3A 1EGZA 1H7WA 1DORA 4L6HA 3UJ2A 2P0IA 4PMOA 5KZDA 3M7SA 4Y90A 3AHYA 4CQCA 3E2VA 1EB3A 1F6KA 3TN4A 1P4CA 2PD9A 4LVFA 3G2GA 1EPXA 4H8VA 4U3CA 1H63A 4XAZA 1GZJA 1UJQA 1XC4A 3ZSSA 3V35A 4JOMA 4HTBA 3W75A 4LC6A 1NWTA 4XAGA 3DFSA 2ISFA 3V36A 4GUFA 4DXVA 4JFUA 4TOQA 1E15A 2OZ8A 4B5XA 3B9EA 1EYEA 3L5LA 3SFKA 4DF2A 3UNTA 4F4RA 3VOIA 1M65A 1XGZA 3VUSA 1E9ZB 2O7SA 4ZO9A 1JZ7A 4FPSA 2XH7A 4K8EA 3EWUA 1Q7MA 2DT2A 4JQ4A 4ZENA 3GDBA 3M0IA 3C52A 4Q4SA 4K1WA 4UFKA 5C55A 2Z2BA 4IFKA 1OABA 1U5HA 2Y63A 4Q22A 4HK6A 2PI6A 1DWAM 1RJRA 1P6BA 3ZLHA 1UC5A 3P84A 2CLMA 2QVNA 2CYGA 4EXBA 3AROA 3UVIA 3FJ6A 1YKWA 3EBVA 1OD0A 1KBLA 4O1AA 5JBFA 3HZ3A 1HJUA 4L1GA 4C90A 2BXZA 1BG4A 4HK7A 2V5CA 4JY8A 3IAPA 3WMCA 4O1CA 4J3TA 1XCWA 3EWBX 3ZT6A 3KOFA 5HA7A 3WK2A 2HPMA 3FW6A 2GL5A 4EOUA 3EXTA 2Y88A 2QXWA 4FNSA 2QJHA 1K6AA 2GQ9A 2R1PA 2X1UA 5MF5A 1CXFA 3PVFA 3IIVA 5LNUA 3IPWA 1UROA 3SAZA 2QDDA 1SFLA 1RLCL 1WDRA 1QI3A 3BCJA 3WLKX 4AMCA 3LXBA 1V03A 3IJ9A 2DIKA 1CPUA 3C2OA 3G8EA 3R43A 1P48A 1E1CA 4NASA 4GZIA 4IMGA 2XZ7A 2PAJA 5E0KA 1VHNA 3GLCA 1KTBA 3SN1A 4E4PA 4R7JA 1N82A 2VCAA 4AU0A 3O6YX 1EHNA 2D0FA 1QHOA 4J4KA 5CZTA 4D6CA 2ONEA 1PUDA 4Z1BA 4N6FA 1QAPA 1VCVA 4NNBA 3EWXA 2DVUA 3T44A 3JU2A 4KEZA 1PL9A 1R3TA 3O7UA 2ODOA 3RYSA 3CO4A 3H53A 2W27A 5CSUA 4FX6M 3K4DA 1LBFA 2NQHA 4JTRA 4PUDA 3W1TA 7TAAA 2X1TA 1YE4A 3U6WA 1H11A 4IIDA 4MOZA 1GVSA 2OR2A 2YJQA 3BG9A 4JNMA 1D2KA 3O6CA 4EF8A 1R9XA 4RE3A 1QPRA 4PUWA 2B7NA 4H6EA 2WZTA 4C6DA 3LA4A 3TXVA 3VGBA 2FH6A 2VTFA 4AZCA 2EO7A 4AEOA 7XIMA 3KRUA 3WQ5A 2GJLA 4YTUA 3S5ZA 3MBFA 1LT7A 1JUKA 1CB2A 1LROA 1QHPA 4LWWA 4C6PA 3M6YA 2EPNA 2A3LA 3BQ6A 3GE7A 3AJXA 3ZT7A 3OYZA 3WLJA 3FA5A 4KRUA 5CLWA 1XXXA 3URNA 1V77A 4UTTA 3K2GA 2QCCA 3G6MA 3NQ7A 4TO8A 1GJWA 4AD5A 3GTNA 3BVJA 2PLKA 2R1KA 4PN2A 4C6FA 2YFOA 4JQ3A 3EZ4A 3CYVA 5DMMA 3M5YA 2J24A 4JIQA 4RCXA 2VX4A 3IS4A 3TYEA 2QULA 1PKLA 1XLFA 4B3KA 4F3HA 4Q8OA 2V3GA 2WMFA 4UMCA 2P8BA 3E0LA 5HR7A 3W2MA 3UQNA 4M1BA 2MANA 1KB3A 3F2CA 2OKOA 1DV7A 3VOJA 1PX3A 5LGZA 3T0CA 1UR3M 3WNKA 2OO0A 3GHTA 2NSXA 5A8GA 3AZTA 4QQ3A 3PZOA 4YWSA 2V2HA 1GPWA 1JXJA 1CX9A 4K68A 2BWGA 4OECA 1JD7A 3D46A 2GK1A 4PRWA 4GINA 5HNUA 1C7SA 2PE4A 1M9HA 5AVHA 5FF0A 1EX1A 3W22A 3AICA 2EAWA 1IR1A 3DUGA 3EWZA 3CXOA 4S3CA 3UWUA 4D6GA 1I60A 2R1NA 1Z48A 1TPVA 2ZZ6A 4DF0A 4HA1A 1XICA 2WVTA 3GYEA 1FP9A 1W3LA 5DY3A 1R30A 1VEOA 2ISSA 3H12A 4PTVA 1Q63A 4RXFA 1PS9A 4IQDA 3OLIA 2V30A 3I7SA 2RDWA 1PE1A 4OBTA 3RIKA 3H4GA 4XAFA 2VDGA 4KESA 3VKKA 5C6MA 1K02A 1OG6A 2GDQA 1I1XA 4Q4RA 1UIPA 1AH0A 1VAHA 5AECA 2WPBA 1TYGA 1EJWC 1VLIA 4ZB0A 2Z24A 1G4SA 2DQWA 1I2QA 3PFRA 4QJ1A 4FNRA 4JDBA 4Q4QA 1UR1A 1WDDA 2OXNA 3BV4A 3M4HA 2PWGA 1E0VA 4F0MA 2J9XA 5AC6A 2FVMA 2EHHA 3OIXA 4K39A 1J01A 4R5EA 1E0XA 4IFOA 2XM1A 4JTQA 5ECVA 4GH1A 2PGWA 2VR5A 4YHGA 4N9BA 3FSTA 1RK6A 3HA1A 3O0KA 5FEPA 4PZVA 5DX7A 3QY7A 2R9RA 1JCLA 3WFLA 3AWNA 2FHFA 2XPKA 3AISA 1LT8A 3CEPA 3DFTA 4XZIA 1UUMA 1WKDA 3TWBA 4QG9A 3EWWA 5C2GA 2CLIA 4TVUA 3P81A 2ESCA 4Z1CA 5GJNA 3HIJA 1LL4A 2G37A 4FLRA 1OK4A 1B3XA 4HIBA 1V51A 1E4IA 4HZ6A 1Q8JA 4HCHA 2OQHA 1WO2A 5IBXC 3EWDA 3N4FA 2OEKA 1E1EA 3OBAA 4PODA 5CLTA 3BLOA 1U22A 3O6AA 4HYRA 1IZKA 2Q8ZA 5M3WA 3WDHA 1FX6A 3G0XA 1KFEA 1Y5VA 4F8XA 5BXRA 5LIUX 3BGGA 3TVAA 1FHLA 3OZOA 1YPFA 1VBJA 2AQWA 5J04A 2Y1HA 3VIGA 2I1OA 1BSLA 2BSLA 1U1JA 1OFBA 4RW3A 1US3A 2DSVA 4Q4PA 4JQAA 2Q09A 4PCFA 2IKGA 4XD6A 4CVWA 3BMWA 3BAKA 3Q37A 4FMVA 1SFTA 4MSSA 4PRTA 1X6NA 4GZJA 1GOWA 3XIMA 4LF2A 4PMNA 1FFRA 3OLGA 1UD3A 1U5JA 3MHFA 3VDHA 1GCYA 4PULA 3W2KA 3CUFA 5MKGB 5H8MA 4MYAA 4G6CA 3ATZA 3FHQA 5A6BA 3H4WA 3HG4A 5D9MA 3GUGA 1JCMP 3DI1A 3W1QA 4C1KA 2DPEA 1U83A 1V8EA 1ADDA 1XIDA 2WC4A 3PSVA 4YNGA 4RV3A 1IXQA 4D6HA 3L4WA 3MCOA 2RGLA 2Q3OA 3TCEA 3NPXA 4G5DA 1A3WA 1NOWA 1L6WA 2VHLA 3NUKA 2QJIA 2CBVA 2G5WA 4DF1A 4AD4A 4I9MA 3TYUA 3PZMA 5G1YA 3WSUA 1AL7A 1SPQA 3S2JA 3SJNA 2G97A 4ZB5A 3KCJA 5E09A 4K38A 4AWUA 2VC6A 5CJMA 1YXCA 3W1NA 3NZQA 2RDXA 2C0HA 2VRKA 2PDHA 2C14A 3PBUA 4UC5A 1XDMA 1WA3A 3B05A 1XSJA 1W1ZA 3OVRA 2HE5A 4KEMA 1UKOA 4WGHA 1A5CA 2ZICA 2ZXBA 5C7VA 1TV4A 2NXIA 4MNMA 2Z6JA 4M80A 5LGXA 1HJXA 3QGVA 2FPVA 2OELA 5HNRA 4QROA 3FXYA 4I5UA 4AZHA 5BWAA 2QDEA 5A1AA 2OJPA 1WQ5A 1AW5A 1UWRA 1P1MA 4K3ZA 1J6PA 1A5UA 3AXMA 4HMDA 1XJBA 3MDWA 4UBPC 2OX1A 4ATLA 3LRKA 3ALFA 2VZSA 2IPGA 2ZZ5A 1XLCA 1P5BA 1R0MA 7ODCA 3RR4A 3T2OA 3QMTA 4L9ZA 3TEVA 3IK4A 5EGRA 4QDMA 2ALRA 4GKLA 4FLOA 2E5BA 1S5MA 2NQZA 1E1CB 4FP1A 1QK0A 3O3RA 3L67A 1RH9A 4GQRA 1O7AA 1OFEA 3LXCA 3SM0A 1XC6A 3G1XA 3TSDA 2WJZA 1YYAA 4ENLA 2W67A 2ZDRA 2C91A 4QISA 2NV9A 5HWMA 2XIBA 2QVHA 4DHGA 3LCIA 1XLDA 4DYKA 1V5XA 3RF9A 3A5VA 5EMJA 3B97A 2OWCA 3DHFA 3L4VA 3TMQA 4IM4A 4I6KA 1LQAA 1PPIA 1A0DA 1JCTA 4DZHA 3G3DA 4OTKA 2WQPA 1IHIA 4KRZA 3BH4A 5BZAA 4ZO7A 1VD6A 1A5SA 3TZNA 1HJSA 2ABAA 3P80A 3LHYA 3EOEA 3C61A 3QV8A 2QCMA 3M44A 3UG3A 2PZ0A 3P8JA 2ZX5A 3BE7A 4LVAA 2E8YA 1L6YA 4KCWA 5BXTA 1PYFA 1W9BM 4YS1A 3CPGA 2PLCA 4J3UA 3PBVA 4ACZB 2WZEA 1IXNA 3UZ5A 1B31A 3MP3A 3IJLA 3BAIA 2BG5A 4LBSA 1YIXA 2OOFA 2QCNA 1FDJA 3AHTA 4HPGA 1XYCA 3DI0A 3VVGA 4C1LA 4Y9NA 3GH5A 3NDZA 2CCRA 2BOGX 4DBWA 1HO1A 1ECEA 3B40A 1FA2A 3C0LA 3LDVA 4YVPA 2XTKA 2GVYA 1TE1A 5HUOA 3C3UA 3R0KA 4PC8A 1M53A 1XS2A 3IVUA 2BHYA 3N3TA 4BZYA 2GQ3A 1E6PA 1R46A 3QH2A 3BXWA 2PU0A 4LV4A 4JTSA 4NZJA 1Y65A 1E6XM 2YDSA 2QCFA 1O60A 4M29A 4NZ5A 1WUEA 4EAYA 4RNHA 3M0YA 1D8WA 1W37A 2EG8A 4U10A 3VGEA 3M0VA 2BODX 1JDDA 2XZ9A 4BQ2A 7ENLA 3FIGA 3AWOA 1J0KA 4G7EB 3WL1A 3PG8A 4JBRA 4Q8UA 1HFBA 2PDXA 3F5KA 4JXCA 4ZXLA 1YNQA 3T08A 3STEA 4LRSA 4AWSA 5DMNA 3QYSA 4B90A 3BC9A 3UG4A 4FLQA 3GIPA 1H41A 3QR3A 5A6SA 1HGYA 1TJ2A 2DU2A 3RMJA 7REQA 4QBXA 1OZQA 3PZ9A 3LZ5A 1EBGA 2GGGA 2C1IA 3CUIA 4K36A 4O11A 1RXOB 3S1UA 1KKRA 2PP3A 1K8XA 3OG3A 4QDWA 4XZ9A 4NX0A 5L9FA 1NQKA 4U2ZA 4OZOA 3DG3A 1Q8AA 3PULA 3CJPA 3VA8A 1QI4A 3W38A 3V1HA 5BXSA 3FVMA 4X60A 5BRQA 3N2CA 1E4MM 1EC7A 2ZRYA 4IICA 2A79A 2I17A 2PFHA 4DWSD 1TV8A 3AAMA 3QPYA 3A3HA 4KWOA 3RU6A 3K4AA 3ME3A 3KCLA 2AL2B 3LHWA 1LUCA 3NXFA 2O55A 2EKGA 4O16A 1KV5A 2VFIA 1ONEA 3WNMA 1B54A 3BG5A 4N42A 3H7VA 3LV6A 1GGOA 7A3HA 2WKJA 3RUBL 1NFGA 1O6IA 1R38A 1TVLA 5IRPA 2VC5A 5HMDA 2E1DA 1PKYA 4WDXA 1ECQA 1WXZA 4HYWA 3U57A 1UKPA 4NAFB 1VF8A 1CLVA 2C0AA 2HK1A 5L6UA 1V3JA 3BLIA 4AZ7A 4QHRA 2X7WA 2WNZA 3HF3A 5FJRA 4ZMGA 1H0IA 4R27A 1ITQA 1BF2A 3MJYA 3G22A 3W3OA 4Q8VA 4O1DA 1EUAA 3MUY1 2R94A 1C8YA 4UQBA 4MYXA 1LRNA 4HZMA 2VGFA 1NOFA 3PS7A 4INFA 1FTXA 2AGTA 2GYIA 4K8GA 4LXFA 1B3OA 2XN2A 3V1PA 1GTEA 2PDUA 5A2CA 1MWOA 3L65A 1KLZA 4B5WA 6ALDA 4H6QA 2HK0A 3ZMRA 5FI8A 3W88A 4HZ8A 1PSCA 4JR5A 2PZNA 2YGYA 1W3IA 5EY5A 3EEZA 4Y9MA 4XBSA 4XK2A 2GUUA 3PUGA 2YXOA 4HN8A 4L4OA 3VPLA 2E6DA 2QIWA 4RLIA 1O5XA 1M68A 1R8LA 2X42A 4UFJA 4C7FA 2NUYA 1IZJA 4TV6A 2OGJA 3HV8A 1J6OA 4ACZA 5TNVA 1HW6A 4PE8A 4GWEA 4M6UA 1A5KC 1J0YA 3SFWA 3ICJA 1EEPA 4Y8EA 4GJIA 2ZIDA 4Q8NA 3W02A 1ZLPA 2E1WA 1Q7ZA 4NP7A 1UD8A 1J2BA 3V7PA 3V0UA 3RCMA 3MJMA 3JR2A 3MU7A 2Y89A 3PY2A 3EPOA 3W37A 4ZOBA 2JGYA 3U8GA 2Z2AA 1B90A 3VDGA 4PUJA 1KCZA 4QIUA 1K9FA 1G4TA 2JALA 3LCLA 3MP5A 4LYKA 4W85A 2QF7A 2QJGA 3AZRA 4DJFD 1PDYA 3GXIA 1X8CA 4TTGA 3VC5A 1K70A 2GSJA 2WKLA 4HU0A 2D2JA 3PB0A 2YBUA 2ZUVA 1CB7B 3EA1A 3APTA 5HMEA 2DVTA 5FJPA 1WDPA 1HIZA 1HNYA 3H2OA 4IH3A 1PWLA 2NV2A 3VDAA 3G1FA 2VZOA 1G4EA 1BRLA 4JTCA 3WLSA 2WBGA 3V18A 2Z4GA 2QHAA 3DHUA 4HSHA 4G9PA 3W87A 3GDMA 4JICA 3APGA 1G94A 2WNQA 1BWVA 3FOKA 3TYDA 4H9UA 1E40A 3W1UA 1YXDA 1DJYA 2PDCA 3HPXA 4M24A 3CUGA 3EWYA 3VTRA 4IIEA 3NYZA 2ZBTA 1RBLA 1LP6A 3O2LA 3KOWA 4UWMA 4LTSA 3PZTA 3GIYA 2DQXA 2HPIA 3VX1A 2BTMA 3IVTA 1POKA 4CCDA 3PR2A 1FWHC 4RNFA 1XLAA 2DUAA 3UZZA 3AJ7A 1REQB 3H54A 3IGHX 3D3FA 2WVVB 3S9YA 2QGYA 1JZ8A 1LBMA 3A6OA 3GAKA 4TQTA 5FEXA 2XIIA 4RZ5A 4N6EA 1GVRA 2VRQA 1H7PA 1AH4A 4OJYA 3E3HA 3TC3A 4NNAA 3AYRA 3H55A 5AYBA 5C0QA 1E72M 1MYRA 3UXIA 3HN3A 2O9RA 5HNNA 3OJGA 3KEHA 2QS8A 1RA5A 4XQ6A 2Y5SA 3FYYA 4AD3A 4MY1A 4GI9A 4DZIA 5BOOA 2A3HA 1V02E 1BWKA 1QNOA 4NAEA 1UB3A 4JIRA 2DH3A 4FSAA 3N4AA 3J7HA 5CGMA 3G1YA 3IIOA 2OZ3A 1Q45A 3QHNA 3T81A 4PTMA 1ISWA 3BAXA 4UTTC 1TCMA 3DHDA 2GOUA 4H9XA 4LV9A 2A6LA 3GK0A 2Z1KA 1RCXB 4HSNA 5ABTA 4LALA 3NPWA 1RQHA 4GCAA 3VKBA 3QFWA 2H3DA 1QI2A 3P67A 5A6LA 3LCGA 3TA9A 4E3VA 4DX3A 1U2YA 2D2HA 2IQ0A 2XGBA 3DKLA 1JF5A 1T5AA 3VILA 2VEFA 1LLOA 1CWYA 2PSNA 2O9OA 2RUSA 3CBWA 1HUVA 4FX8A 5AKQA 4C6IA 4HU4A 2Z1SA 3R10A 4HNOA 4AY1A 1ONXA 4XD3A 1D3CA 3WCZA 5HK4A 3CWOX 4BI5A 2YCLB 2J7BA 1T0OA 2A4AA 3HMCA 2RH9A 4NYYA 4LH8A 5DRIA 4I5RA 3LRMA 4WD0A 2BP1A 3S3GA 4XD5A 1XI3A 3O05A 2B4GA 1BRLB 5FA5A 3E38A 3FSUA 1GOMA 3R5EA 1F9CA 1JD9A 4EVZA 4FZIA 1V79A 1OCJA 4CLMA 1UQYA 2GGHA 3WQEA 1XGDA 4JS3A 1TPEA 2NQJA 4NAFA 3WL0A 1I4NA 3OOQA 3EYPA 3A21A 1DHKA 1PV8A 1QBAA 2I9UA 3HG2A 2V5KA 4D1JA 2PTDA 3MUXA 3VIJA 4I8DA 4DO6A 3T40A 3ANUA 1TPB1 4JTIA 3QZEA 1X7IA 4FB7A 1A4MA 2J7EA 2J7HA 4IJBA 3TE9A 2FGZA 1JDCA 4F0SA 3R13A 1PBGA 1RCQA 1VBUA 2A85A 4Q8MA 4EPBC 4CU6A 3C0QA 1BG9A 1KW1A 1EX5A 4DO7A 2ACRA 1GOOA 3A13A 2YSWA 1ZPTA 3CQHA 4WXZA 4IFKB 5H8PA 1SO3A 2DSUA 5CSYA 1Q4WA 1W8SA 3NTYA 1H3GA 1AQMA 4PFHA 1EJTC 3F4DA 1AG1O 3R1ZA 1Y7VA 4KIRA 1RLDA 2WKGA 3NM1A 3UZXA 2TAAA 2YFNA 1UKTA 3CB8A 2D0GA 2FTPA 5M2FX 4RL3A 1JNDA 2IQDA 1JYWA 2XFWA 4IX0A 3CHVA 4PMJA 4HA0A 3AI0A 3AXHA 4W86A 1LG2A 2YCLA 4K37A 1DBTA 2Y4SA 1BF6A 1KFBA 3JZUA 5M5DA 1FH8A 4UTWC 1BXNA 4AX7A 4D8LA 1TZZA 2WW5A 4BQ4A 1MXSA 4AHQA 2HCVA 5G2IA 3W07A 1J0IA 1UC4A 5ABEA 5DCEA 1ME8A 2CW6A 5I02A 4Z08A 4QSFA 4F40A 1NY1A 4PCPA 2E7FA 2D2GA 4RDZA 3UXLA 3ZJ7A 5M03A 3VIMA 3JUGA 3QZ6A 3SUVA 3HQPA 4C6BA 4YTSA 1E0WA 5EKYA 4BF7A 3WELA 4ERAA 1KM5A 3O16A 2HMCA 2YYUA 4MFEA 4JKLA 1RPKA 2E6FA 1BWLA 4ZO8A 1VPYA 3MCNA 2BB0A 1X7FA 1ZJIA 3OBKA 1FOBA 1DXIA 3QC3A 3N9KA 3PZNA 4HN4A 3BV7A 5EMLA 3LHVA 1GEQA 3K4WA 1ZRQA 3IJDA 4JTKA 4UTWA 3NQ2A 4N2YA 1QW7A 3N17A 5CC3A 4LCRA 1PTAA 4ONVA 3VNZA 1R5YA 3W7GA 2PRHA 3TYZA 3MBDA 3OBEA 4H19A 4BY3A 4V2XA 3GNDA 4FO4A 2QR6A 1BXCA 1NWUA 1J0JA 2XGZA 1S2TA 4R9XA 4Q8QA 4C6KA 4D72A 3P0XA 4FXRA 3BTNA 4X0NA 3BAYA 3I6EA 2WMIA 3AALA 4IQLA 5I24A 1XM3A 3W6YA 3ITVA 1QFEA 3JS3A 3NL5A 5M17A 3HOJA 3RPDA 1FWAC 2NXGA 2CERA 4Z0SA 3MANA 3VCCA 3PPHA 1V6TA 3HGSA 4ECLA 1C92A 2YX0A 5CGQA 2O56A 2VEMA 2HS8A 2PRMA 1G9HA 4BJHA 1TB3A 1S2WA 4U3AA 4DY1A 1QNRA 3Q2DA 1KCXA 2QPSA 2NVCA 2OQYA 1DIDA 3QTGA 4EP8C 1Z3NA 3AXKA 5GNYA 3RPMA 3VD7A 4NIRA 5F2MA 1UR8A 3WQFA 4BQ5A 3ARUA 3NDYA 4XV0A 3CL8A 3OHMB 4IL0A 2JF6A 3NQVA 1W1TA 3LMYA 3WNOA 1TWWA 1MW1A 1EXBA 4ALDA 4MIMA 1SZRA 3FY1A 1DE5A 3ZVHA 3GNNA 4QCEA 1FH7A 3UA4A 2VUYA 1GKQA 4H8HA 5AC8A 3B04A 3NO1A 1J5SA 1NAL1 1DVJA 1U1UA 1UQZA 4AD1A 4S2BA 4AVOA 2BASA 4XKYA 2CLFA 3REQA 2OZTA 4E8GA 1OFPA 4GK8A 3G1RA 4DJDC 1ITXA 3PZIA 4B9ZA 3GDKA 2EGZA 4NJGA 5FF3A 1TZ9A 1V0MA 5A6TC 5I06A 3FDGA 3ZR6A 3EB2A 3JRKA 1XBYA 2E28A 1X96A 3QOKA 1SYTA 4OWGA 1F74A 1L6SA 4ZOEA 1XIEA 3DH7A 5G2WA 1TTIA 5D38A 4GOAA 1Q13A 2DZPA 1VGAA 4B5VA 4BI6A 5IXEA 1TV5A 2DZUA 1DJWA 4CD8A 2A21A 2BX7A 3NQAA 4ZL1A 1CLKA 3HQOA 4UQEA 1Q6RA 3MI2A 3PBGA 4EWND 4CCCA 4RKAA 2VX7A 4JQ2A 4HB7A 1KM3A 3CV6A 1FCBA 4HOWA 2NUWA 4C7DA 1GHSA 4FOJA 5A6AA 5J5DA 4GYPA 1DEDA 1KGUA 2ABBA 1MW0A 3L9CA 5CPQA 1H60A 4JEJA 4C91A 1XWYA 2QAPA 4ZFCA 2F38A 3GTIA 7PTDA 3O15A 3OO2A 2V2DA 4MJZA 5EYWA 4FOUA 3VD5A 3N2XA 4PMYA 1OC7A 1DWGM 3IV3A 4GHRA 1SO6A 2Y70A 4XBJA 4A21A 2ASHA 4QE5A 4R34A 1W1VA 1VP5A 2XHYA 4WCJA 1Q6GA 1PIIA 4IZGA 2BV9A 2C13A 3NQ6A 1NDVA 1TMHA 2OSXA 2CNCA 1Z69A 3LCFA 3MA8A 3PWGA 1LQ0A 1EGVA 2EBNA 2VX6A 5MHBA 2YL5A 1BFNA 5K9CA 4P7OA 5T26A 4BA0A 3C8NA 1W31A 3C2RA 3MO7A 3SGUA 4AEEA 2J8GA 4FXFA 4WOQA 4UTUA 3RO8A 1L9WA 2PLJA 3GX9A 1ALDA 3GFYA 2NQ9A 1CI1A 2P88A 3M64A 3LLFA 3NOEA 4M51A 3TYAA 4CNUA 4DWDA 1IIHA 2V3FA 4YCPA 1KO0A 2QDGA 1EWEA 4DUXA 3NA8A 1D3HA 2ZXQA 3BMVA 2GUYA 3WX7A 1XLHA 5DCDA 4ZQPA 1W1PA 2A3EA 2XH4A 4G56A 2R24A 4MB5A 3EKZA 3CIWA 3WBEA 3BLDA 3BL3A 2Z00A 3TKFA 1SO4A 4WR3A 1ZJHA 3ZT5A 4WKAA 1Z6KA 2OLAA 3POCA 3GVGA 1Q7QA 3L2LA 4AXNA 1S46A 3UF9A 1FHDA 2E40A 3I4KA 3O07A 4PRRA 4XIAA 4KCVA 4S3BA 3R6IA 5FL1A 3PM6A 1EEXA 1EZWA 1QNSA 3ONCA 3SSJA 1FRBA 2VFFA 5EB8A 1E1FA 3DEQA 4AHOA 3P61A 3LHTA 5FJTA 4C6NA 1OB0A 1YTDA 3KBVA 1K3UA 3QGAC 1TFVA 1A5MC 3L0NA 2J4GA 3T0BA 5C70A 3UXKA 2QF8A 3AHZA 2GUBA 5KITA 4DELA 3GG0A 2GDVA 2CBUA 5FKYA 5A5WA 3SR7A 1XD1A 4G1KA 4QG8A 1DWHM 3NQDA 4NKCA 1XLJA 3F4NA 4QFUA 1TJ1A 1PDZA 5DQPA 3B0PA 2EG7A 2WPGA 5FF2A 3GW0A 2WQDA 2GVJA 5E9AA 1EJUC 2WV8A 3BOXA 1J5TA 2B0MA 3NDOA 3TW7A 4J5NA 2VOTA 3CLWA 1JPKA 3UCQA 1BSIA 1UWTA 4KF1A 1BYAA 3KWSA 1UP0A 3WLRA 1Z89A 3DGBA 2EQDA 3BJSA 4UOJA 3Q45A 1ZSXA 3MYPA 4IQEA 4ZR8A 1Q5MA