4I9JA

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to dic4pc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
302
structure length
302
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 122
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i9jA00
3RLHA 2FJUB 4QJ4B 5T9CE 2OOGA 4RV3A 3EA3A 1DJXA 1XX1A 2PZ0A 4RW3A 2OTDA 3V16A 4F2BA 4OECA 2ZKMX 4QJ5B 1V8EA 4I8YA 1DJYA 2O55A 3OHMB 5T9BG 6PTDA 4I9MA 1ZCCA 3QVQA 1T8QA 4F2TA 3H4XA 3PTDA 4S3GA 4F2UA 3CH0A 7PTDA 1QASA 1DJZA 3QR0A 4PTDA 3NO3A 4I9TA 3I10A 1DJWA 1DJGA 4I90A 1PTDA 1T6MA 4RW5A 3V18A 3KS6A 1AODA 1VD6A 1PTGA 3QR1A 2OR2A 3L12A 4I9JA 3MZ2A 4Q6XA 2P76A 1DJHA 3KS5A 3EA1A 4GNKB 1YDYA 2PLCA 4R7OA 1DJIA 1O1ZA 5PTDA 1GYMA 2F9RA 4QJ3B 2ISDA 2PTDA 3EA2A 3H4WA 3V1HA 3RLGA 5T91A 1QATA
chains in the Genus database with same CATH superfamily
5E6YA 3M0ZA 3NXFA 4LV9A 2V0TA 2WZHA 3I4KA 4RL3A 4DI8A 3IV3A 2BGQA 1SFJA 3SCSA 3KE0A 2E6YA 3HOJA 3M07A 1IEIA 2X8RA 3NVTA 2FLIA 4RE4A 1LZOA 2F2HA 2DSZA 2QXWA 1P0KA 1DKWA 4JIQA 3FY1A 3BAWA 3LB0A 3GXFA 3R13A 1H61A 3UR5A 2Z28A 1EQCA 5AHNA 3LGGA 4XSMA 2PF0A 4L1WA 5D2TA 3P93A 4DJFA 3MS8A 1ENUA 3H26A 1G94A 1E70M 1FHLA 4E3VA 1O1HA 1GVIA 4XAPA 2AMXA 3F5LA 4GUGA 3TXVA 1PV8A 1X6UA 1HG3A 4KF1A 4XBSA 5G1MA 1TRIA 1C90A 4L64A 1S46A 1O7AA 3RUBL 4HCHA 2OVLA 4TMBA 4XZBA 2AQOA 3BLIA 1AA1B 1EPXA 3GTXA 2OWXA 2YSWA 1DHKA 4OBTA 5HJLA 1YE6A 4ZOCA 3LCLA 4RDWA 2HMCA 2R1NA 1SJDA 4ZQMA 3TYDA 2XN2A 4K68A 3AZSA 3CGTA 3UEQA 2FMOA 3N14A 2RFGA 1RUSA 4TIMA 4OU1A 3TR9A 4QG6A 3KVLA 3LQGA 1VFTA 1ISYA 1KFLA 2WCSA 2HVNA 2MANA 2YPIA 4GINA 4XZLX 3DC8A 3QPZA 4PMXA 4QR6A 1J18A 4EPBC 1RH9A 4KIEA 4NSBA 4DXXA 1OFBA 3RN6A 2CETA 1DJYA 2WCAA 1S5WA 1DXEA 2V3FA 1VQTA 4PMNA 3CQ0A 3IJ7A 3QSTA 3KP1A 4LJ3A 4AX7A 3LY0A 3MKVA 4GI4A 1KGXA 2QEZA 3DGBA 3F7JA 3CUZA 3GNOA 4B92A 2AOSA 1U5HA 3CB3A 3OLDA 4ZE5A 3TW9A 5DY2A 3DFTA 1SMAA 4F0LA 1PIIA 4L7ZA 2WLYA 2YCJA 1PIGA 1CGYA 1PXGA 1ZHAA 1H7XA 3BGAA 4ACZA 1PTAA 1Z7AA 2E67A 1XLDA 3GB6A 4F0RA 3OW1A 3EEZA 1F4AA 1FDJA 1UZ4A 4CU8A 1IGWA 1ICQA 1XRVA 2FZBA 4PUMA 2I5GA 3G1FA 3L9CA 3H4GA 3POHA 1ITUA 1I60A 4HZ6A 3LTPA 4NUWA 4QG9A 2TYSA 1CLKA 5LZLA 5XIAA 4Q8PA 3NZRA 4YPJA 5LNWA 1K8YA 5U7SA 1WE5A 3EOOA 3WFZA 4F9DA 1S38A 1JNEA 4JY9A 2OO6A 4AMCA 4H83A 4EOUA 4Z08A 5CAKA 3WJZA 4H3DA 3URAA 2IMRA 4Z2IA 1R3WA 3EOEA 3RRAA 2GGIA 3VD3A 4W4QA 4GI8A 4LYRA 1QXLA 5C0QA 1JI1A 3ITLA 5BU9A 5FSDC 2YLAA 1F3XA 3WF0A 1YYAA 2XFYA 3MCMA 4NF7A 3TOPA 5C2XA 4G1KA 4RNIA 4A21A 1XSJA 1OWQA 3O1NA 2C16A 1EOMA 4HHHA 4PUDA 1QWKA 3CT7A 1O5RA 1N8WA 2DQXA 4LS1A 3HJZA 1DWAM 3GIYA 1DIKA 1WOBA 1GCYA 1RZMA 4IH3A 4IPNB 3QOMA 3F4NA 3I6EA 4KW2A 4OZOA 2C18A 4H9VA 4C6FA 3HF3A 5D30A 3QW3A 1K7FA 4GC4A 2ZA2A 4O52A 5E09A 1SJCA 3GK0A 5E6ZA 3STPA 3CC1A 1G7UA 5GNZA 3U48A 1LG2A 3DKJA 5FI8A 3PSVA 3SGZA 2EO7A 2J7GA 3VE9A 1J0KA 2JKAA 2ISWA 1AH3A 2ZC1A 4XZMX 3BAYA 1QI2A 8CGTA 1XG3A 3H2EA 1XS2A 5F4SA 4Z0JA 1GOIA 1KXQA 2V69A 2WC7A 3W02A 4TV5A 1J01A 3TWAA 4HT3A 2WZEA 3HGJA 1EP3A 1OD8A 3NG3A 2BDQA 3VNDA 4CQBA 3MSDA 4GD0A 3RR4A 3P80A 4XSLA 3WD3A 4DEFA 1OFRA 4RE2A 5IXEA 4KCWA 4GYKA 1FHDA 1KM5A 1WDWA 4M8UA 8XIAA 1JULA 3S2NA 3SCNA 3BURA 3ES7A 4IMCA 5DANA 3S3GA 4WVXA 3CH9A 4B16A 5EBUA 3UP8A 3W81A 4EP8C 1RP9A 2ZRWA 1TPUA 5IHRA 4AUBA 1OFAA 3FDKA 2HJPA 3CNYA 4NAFB 2XIIA 4KCVA 2XIQA 4HA1A 5CPMA 5M1TA 2HVMA 3BOLA 1HKJA 4UTJA 3LX9A 4LUIA 5DN1A 2DJLA 2DZSA 1D3CA 1EUAA 1ADSA 4MKNA 4Q8WA 4Q4KA 2FH8A 1V3HA 2R6OA 1M7PA 3KHJA 4QEEA 1BXNA 1KD0A 4GQ0A 3UPBA 3VNLA 3GQYA 3O06A 1ECEA 4I5XA 3LQLA 3IWPA 5JMUA 4DJFD 4LH8A 1OYCA 2NQ9A 1V3MA 1SZFA 4L6DA 1NOUA 4H9UA 4G6CA 1WZMA 2CLFA 3O15A 2JEPA 3FN9A 1H60A 4F48A 4IP4A 4UCGA 2PMQA 1TZZA 2DT0A 2FZNA 4NKCA 1YW1A 3E0VA 1JNDA 1J93A 1DWIM 3BAXA 3STGA 4X9YA 4Z1CA 1FWEC 2V68A 1EYWA 1LQ2A 3AXIA 4JYFA 3N15A 4CQ9A 2IPJA 2CXEA 1NP2A 4WJXA 1A0CA 5DF0A 4PMZA 3DECA 4XISA 3WK0A 1KR1A 1MI3A 3DU0A 4IMEA 1V77A 5KETA 3ZJ8A 1NWUA 1R2TA 3H2CA 4A6GA 4XKMA 1G9HA 1EC9A 1H1YA 2NQJA 3LZ3A 1XGDA 3PUEA 1I6NA 1ZBVA 2Z00A 3LGEA 3CV1A 1CTNA 4WK9A 2VGFA 3KX6A 2J7CA 4A8RA 4NNAA 1PHQA 9XIAA 4NXKA 3PZUA 3PF3A 2CLKA 3K30A 5I3JA 1OM0A 1U5VA 2ZUUA 3LV5A 3RF9A 1CGWA 3VZXA 4YTQA 5BU6A 2WSKA 3UXIA 1EIBA 3EOLA 1BD0A 5DELA 3B8TA 4WKFA 1B2YA 3TYZA 1LWJA 4YN5A 5DMNA 3W74A 4HHMA 3GE7A 2DT2A 3KOFA 4A8IA 3S2MA 4DYKA 2D22A 1TTIA 2R8WA 4V1YA 1E15A 4CD6A 2W91A 1K70A 2QNEA 1M68A 2ZZ3A 1HJQA 1EQPA 2INEA 2NV1A 1X6LA 2VEIA 5XINA 3Q67A 2PBOA 4XBKA 3WDHA 1F9CA 1NP0A 2WQDA 3FHQA 3IS4A 3JUGA 4R9OA 1GONA 5A6LA 1MQQA 1VP5A 3UJ2A 2WHKA 2OO0A 2PDXA 3PUGA 4O18A 4PTVA 2CXGA 4GY1A 1N8FA 4R7JA 1K7EA 1J0HA 5LA1A 4CGTA 5JIPA 2UY5A 5I23A 4I8DA 1XBZA 4OV9A 1XCWA 3WEMA 2DUAA 3CHCA 5EL1A 3QH2A 1UD4A 1HP4A 3G0XA 3NJ3A 3R8HA 4ZODA 4R33A 4O28A 1WX0A 4MPKA 4QE4A 1RV8A 3GXNA 1VIWA 4IFRA 4NAFA 3W27A 4TTGA 1AQMA 3S2LA 5LA2A 1BG4A 3IJDA 1J0IA 4QE5A 1LP6A 3MW7A 1BSIA 5C9ZA 4OFCA 3CHDA 1JRBA 3HPXA 3B8IA 1FH9A 2YFOA 5FKYA 3ZT6A 4WKHA 3IVSA 5BMXA 2PS2A 4UFLA 1UR9A 2J79A 4PCFA 4GUHA 5LXXA 1JR1A 3QSRA 1WAUA 2Y70A 2FZMA 1LJYA 1MEIA 2VMFA 3TJXA 1XJBA 3SUUA 4GJ1A 1V4YA 4NIRA 2XJ7A 1EP2A 4CNNA 3EPMA 1X96A 2EPMX 2YLLA 5FJJA 5FEWA 2DSUA 5FCZA 2QJIA 3HIJA 3C56A 3L2MA 2P0IA 3QMTA 4LYPA 4IM4A 1L6FA 5D2WA 3OIXA 5HMEA 3EXRA 1LYXA 3F2BA 3P8JA 1R30A 2PLCA 4KPLA 5EBAA 3AHVA 4HOXA 3AS1A 4TVCA 4O4WA 4ZBCA 4I7VA 4YTUA 2CBJA 1GTHA 5M3WA 3W1QA 2WNZA 2A6LA 1TR1A 3FOKA 5DY3A 2I56A 4BQ4A 1P6BA 4G2DA 3PZ9A 3EA3A 1L9WA 3ZJKA 2F6XA 4WJEA 1E0TA 1E6RA 3M5VA 3PAJA 4Q8QA 3B0UX 4GY0A 1A5KC 1GHSA 1UWIA 3TSMA 1ZJAA 1XLCA 2GSHA 3T42A 2BGNE 1UD8A 4DBEA 1W3LA 2QJGA 3ANUA 4HZ7A 4W85A 4Q4RA 4P8XA 2DJXA 4B2DD 2G96A 4DHGA 2Q71A 4L4OA 4IUOA 3IJ8A 3EDFA 3WFLA 1WBJA 3H2MA 3GFXA 1RSCA 1AUSL 4BR1A 2XG9A 4F79A 5D2VA 1ME9A 4HPNA 1PZ0A 3OG2A 5HMDA 4ZZ9A 2WKLA 3KRBA 2XZ7A 3IK4A 5EU9A 4Q8VA 1WKDA 4HJWA 3ARVA 1XD0A 2CLIA 3ITGA 1EP1A 4YNGA 3I3BA 2ATMA 3P0XA 1ZAJA 5KEZA 1OYBA 1V7AA 3UBPC 3VVGA 3SECA 3CL8A 3Q94A 2ZXDA 4N2YA 1Z3NA 3DFHA 1CWYA 1HXJA 5DQPA 4BHYA 3WNKA 1PKYA 3W76A 6XIAA 3EDDA 4IPIA 1FCUA 2Z2UA 3ABSA 3E5BA 4PUKA 1GVRA 2XIJA 3INPA 2PA6A 4YWSA 2CITA 3MV11 1Y8BA 4J4KA 3B9DA 3HQNA 3SM0A 1E40A 4S3JA 1TUFA 4DYEA 1W1ZA 1HP5A 4D1JA 3FYOA 2EG6A 2ZDSA 2NX3A 2E1DA 5HNTA 3VCNA 4OWGA 1B4KA 2HQAA 1NARA 3QY8A 3VX0A 1XLIA 1KFKA 4X60A 2WVTA 1EZWA 3GC4A 2ACRA 3JR2A 3RU6A 1ZBWA 3L2LA 4ORMA 3WK3A 2BP1A 4Q4SA 5H8PA 4WF7A 1X38A 1P7TB 4H6KA 4Q7IA 1E56A 4TMCA 4MWAC 1C9WA 2X05A 4GG9A 4DF1A 2VQTA 4FF7A 7ODCA 3N3TA 5J5DA 5AHEA 4HVXA 5TF0A 1GZGA 3USZA 3MQTA 3AIRA 1I75A 2EJAA 3C0QA 3HGRA 3S6DA 1Y7VA 4K6AA 1RLDA 3LN3A 2A3AA 2GJXB 3VC6A 1E0VA 1SZGA 3BK0A 1DJIA 5FF3A 4AQLA 1H50A 3OODA 1EEXA 4Z2JA 4E2DA 3TDFA 5A3HA 1PIFA 1EX5A 1FWFC 1MXGA 3GBEA 2QMJA 3FW6A 3UYIA 1L8PA 1QMLA 3EXSA 1UD5A 3QLDA 3WLSA 3WLQA 1TJ1A 4U2YA 4QJ4B 3O6CA 5BCAA 2DZVA 3WNPA 4ZB0A 1XLFA 5F2MA 1LRNA 5HNRA 4M0XA 3VIGA 1QBAA 1OCNA 3WQGA 3PWAA 3T09A 1E0UA 2A5HA 1XC6A 1RY8A 5HJXA 3S8HA 1JD7A 2Y2WA 4LTSA 1B3VA 1CLXA 1WXZA 3M6YA 4PCSA 1GQKA 4HOZA 4FNTA 4PE8A 4GO9A 3G1YA 2PC8A 3VMNA 3TAKA 3M7SA 4DJED 3SB0A 2NVCA 3Q58A 3O05A 1GVSA 4DXKA 3UNDA 1ZCOA 4GXMA 1H51A 5F2LA 1S2WA 1PCKA 3CAWA 2NQHA 3JVAA 3NQEA 4M56A 2GGJA 4CKQA 1UA7A 1EGZA 1FWAC 1J11A 1XUUA 4OT7A 3B03A 4HN8A 4ERIA 1D7FA 4NJKA 2GYIA 3O3RA 4FXFA 4PBFA 1EF2A 2AKMA 4XZWA 4TOQA 4CN6A 3VX1A 3SUWA 3WLHA 3AYVA 1EIXA 5J5RA 4C6PA 1Z41A 3OQ8A 3FDGA 3OBEA 3EDKA 3GUGA 1E6SM 3NYZA 2CW6A 4KIRA 1QATA 2XN0A 3THCA 1CI1A 1VC4A 1XISA 3MBDA 3VOCA 1XI3A 2QUMA 2QAPA 3EWYA 2V5KA 4LGXA 1L8NA 4MY1A 4K2SA 4OECA 1BKSA 4B5NA 1TV7A 2ZUNA 4B3KA 3M46A 4PUJA 2R82A 1F6KA 3SADA 4O1BA 1XIFA 3UQNA 1QPOA 4FXJA 1EO7A 1HVQA 1JZ2A 4JFVA 3A13A 1HTIA 4PH6A 4JAWA 1BVWA 4XZIA 3P5YA 4GFSA 4ECLA 3GUWA 5FEZA 3AXMA 3TW6A 3WDPP 2NXHA 2V63A 2PTZA 3QF0A 2O0TA 1TA3B 4NX5A 5LIYX 2V2CA 1M7OA 3GTFA 2ACSA 2ANUA 1E9IA 4M19A 4XUGA 3IGHX 4S3DA 2WC3A 1TKKA 4MG4A 3RO8A 1R3VA 3W6LA 3WLOA 3T44A 1P7TA 2FTWA 4GYPC 3R1ZA 3IVUA 3P82A 4PTWA 2QVNA 1TTJA 4S2CA 3C2VA 1VBJA 1H11A 1TWDA 1KM6A 4GHRA 4GE8A 1OCBA 5BOFA 3A47A 4P5UA 1EYEA 5C9XA 3L5AA 1NWRA 3I3EA 3LCFA 7REQB 3DHDA 1XXXA 1A4MA 1PZ3A 3VIIA 2OQHA 2GJXA 3GFZA 1ZQ5A 5EFDA 2B7NA 3KBMA 2QS8A 4M1RA 1O60A 1VS1A 1J6OA 2PCQA 3R10A 3DYMA 3FA3A 3LS9A 2IQ0A 6ALDA 4K37A 1E51A 4QTGA 4ICNA 2OZTA 3UZYA 3MYOA 3URNA 4KKXA 4DO7A 4MNKA 5GVJA 4J2MA 4PUUA 3A12A 3SN1A 5HWMA 4AH7A 3DCPA 4I6KA 3CHEA 2DVXA 1JDDA 3CV7A 4A29A 2ZOXA 2X2GA 3TONA 4H4IA 2HE8A 4BF5A 4MJ2A 3NR0A 3E38A 3T81A 3MKKA 3KBSA 2CHNA 3R25A 3DN5A 5KSWA 1BG9A 4US6A 3KL3A 4EWJA 3W7EA 1JYNA 3RG6A 3KBWA 4JS3A 4EXBA 1IWAA 4WZHA 1NOFA 1ADDA 1KFJA 4ZVJA 4XAZA 2WAGA 1YNQA 3WH9A 3U2EA 3ANVA 4WGHA 3TJIA 4C6MA 4JIHA 2E9LA 2VC9A 5D9MA 2DH3A 3ARSA 4IJCA 5DEZA 1GG0A 3H54A 4HMEA 4UTMA 3GLCA 2XSBA 3DFPA 1KRMA 1XX1A 3L4UA 1KO0A 3UJRA 4H8VA 1UC5A 3ORWA 4XQ6A 3SY5A 2O7SA 3L4VA 3TLLA 4Z1BA 3KOYA 3PULA 2QMKA 1FKXA 1K9FA 3UWVA 1UWTA 1TV4A 2PD9A 2ICSA 1C7SA 1Q66A 4FB7A 3TFXA 5SWUA 5G4EA 2XIBA 2HZGA 1JZ3A 4J28A 3WDQA 1W1VA 3N1AA 4UR7A 1B3WA 1FWWA 2E5CA 3LM7A 4HBKA 4Y9OA 2J9ZA 8RUCA 2ONEA 3IRDA 1XLJA 4H9YA 2E0PA 1M65A 4B5VA 2G8ZA 3T7VA 1OFDA 1T5AA 2GUBA 3ZO9A 4Z1AA 1HO4A 1GYMA 2WO5A 1W9BM 1KWGA 1R2SA 5BRQA 1XDLA 1W1TA 3PUOA 4HHPA 1DQXA 1TA3A 2VEPA 4AEFA 3W53A 3WX7A 4UUIA 3IK2A 1RPXA 3BTNA 1O6IA 4A3RA 3SSZA 4C6KA 4HCLA 1YADA 1LORA 1JVNA 2OYKA 4PC8A 1Q6RA 1PCWA 3STEA 3HPZA 4GVHA 3EWUA 1EJWC 4AX6A 2PDNA 1K8XA 5KITA 3VOFA 3WLPA 3V16A 3ZFHA 1PDZA 1D7KA 4JHMA 2ZQ0A 4AW7A 5EY5A 4HA3A 5DT7A 3SEPA 1B9BA 3W24A 1UD2A 3IIZA 3H2NA 3M41A 3NSXA 4HNVA 4AWEA 3PPCA 3RX2A 2X1UA 3UY7A 4CNUA 7REQA 1AMYA 3E1F1 3LOTA 4AD5A 1KBBA 1FVPA 3WMBA 3ITYA 2HVOA 4YVVA 4H00A 3TYUA 4MNLA 4JN7A 1NQKA 1PO9A 3LI0A 1VENA 4MZYA 3N25A 4DM2A 2J62A 3OU8A 4JHZA 3LK6A 4BQ3A 5AHFA 4NRRA 1X7IA 3W7HA 3RK8A 3KS5A 4AZ5A 1DVJA 4A22A 3BLEA 2XUCA 2VELA 4WEVX 3OBAA 4C7DA 5H1WA 1G7VA 3UXDA 1JDEA 3BJFA 4E6MA 4UMAA 4XB3A 2X1TA 1IZJA 1MW0A 1R7AA 1G4EA 3K13A 4YIWA 1F8MA 1FWBC 4DJDC 3DFNA 4LEQA 4AWSA 1XLMA 2VXNA 3I7QA 4GI9A 3N18A 5CG0A 1YQ2A 3NL5A 1WDSA 4KERA 1H41A 5DMMA 2OG9A 4GVGA 1ML1A 5HAOA 2VRKA 2V82A 2E6FA 2QLYA 2OTDA 1TPVA 4B5UA 1Q45A 3PPGA 2B7QA 2E09A 4GJJA 3E49A 3EMZA 4L80A 2XVKA 4Q8NA 3UZZA 6REQB 1SQ7A 1NVMA 2XVLA 1SFSA 3GM8A 4L1GA 4RUBA 4BI7A 3N6QA 4KEVA 6TAAA 4MDPA 1TZ7A 4UTUA 3QPYA 4NL1A 1A5BA 3W29A 2DZWA 1QNPA 4AXNA 5CZ0A 2QDDA 1OYAA 1VYRA 3VM7A 2I7GA 4FX7A 3CUJA 5HR7A 4LBRA 2OR2A 1MZHA 1L0PA 1W5PA 1QNOA 4UOZA 1EDGA 1RR2A 2V9DA 3PTMA 3N4FA 2DGAA 4KT2A 1XDMA 2PDMA 1DTNA 1KXHA 3CT2A 1E3XA 3D3FA 1EPVA 1SM9A 4AHQA 1LT8A 5DBTA 4MY8A 1BYAA 3RILA 3C6CA 2PTWA 3AS2A 3U2CA 3WNMA 3U8GA 4M7SA 2TAAA 4GOAA 4UIOA 4CN4A 3SJNA 3BMVA 2J7EA 3AXXA 4O1EA 3RFAA 3UR2A 4LC6A 1NJJA 2X0YA 3IJ6A 1OJXA 3U6WA 3VKDA 2WANA 2AMGA 1OHLA 3EPOA 4WRHA 3RNDA 2WSRA 1EXPA 2XIOA 1WDRA 1LL6A 2AKZA 2ZYFA 4JTSA 4F40A 3T6CA 4Q8OA 1YHTA 2BG5A 2XVNA 5HWJA 2RGMA 4PMQA 3SUTA 2X42A 1XDJA 1A4LA 4X61A 1FKWA 1GOOA 2P0OA 2OLSA 1E1EA 1NF7A 1TIMA 2ZRVA 2VZVA 2OKTA 5A6JA 5IHSA 3CZEA 1EJXC 3TC6A 3APTA 1U30A 2E3ZA 1JD9A 3W37A 4DX3A 4G9PA 2V38A 1GZ1A 2VGBA 2OKOA 3NQ8A 3UT0A 1TWZA 1REQB 4QDPA 1GOMA 3BG3A 3PBYA 1R2RA 4K7YA 5FJIA 2R9RA 2VOMA 3D3AA 3UCQA 3KP0A 4DO6A 1IE7C 3BLDA 3PG9A 4N02A 3H12A 2DW6A 2Z27A 3ITOA 4AC7C 3NZQA 2CLOA 5EFFA 5CGMA 4QX4A 3VAVA 5LGZA 3MDWA 4WDUA 1KC7A 5CPSA 1ONRA 1S39A 3TQVA 4LB4A 3GZAA 2VEMA 3CTTA 1EWEA 4QP0A 2YA0A 3CM4A 4AMAA 3WIJA 3AI0A 3W7DA 3AAMA 1GVOA 1EDTA 2R1LA 3PSWA 4C6IA 3AICA 2H8ZA 1B3ZA 5MHBA 2BOFX 1J96A 1OFPA 1Q13A 2YYUA 1V0MA 2I16A 1UUQA 4MDOA 2QV4A 4L6OA 4R5EA 5C5YA 2FTPA 5M5DA 3W01A 5CC6A 3ZJ7A 3KLLA 3AHZA 1VCFA 4QEHA 1XIGA 1RK6A 2QPSA 2WWCA 1TZ9A 3SRKA 1IT8A 4JFSA 4ZL1A 4IZGA 4M81A 5F1VA 4GLEA 2W79A 2DUXA 2PDGA 4JX5A 2ALRA 4PMYA 5I3DA 4UR9A 1CDGA 6REQA 3AO0A 1TREA 4AIBA 1J12A 3SY1A 3QXBA 1GQJA 1C91A 1SYTA 2GGGA 5BRPA 1I4NA 1YTDA 1Y5XA 4QJ3B 2JGYA 3ZWSA 3GXTA 2QT3A 2YL9A 1YDVA 4HTYA 3W71A 3BANA 4B90A 5D2XA 3LHWA 5CC5A 2WNQA 4H2CA 3ZT7A 3AXHA 1WB0A 4IIBA 2P8CA 1G4SA 5K4ZA 4GQQA 4AYGA 2F8QA 2IXUA 2F6KA 5CC7A 4LAMA 4YLWA 4H01A 1P43A 4PRTA 5FF0A 1OVDA 4G1NA 1YEYA 2GSEA 3L2IA 1HKIA 2QV5A 5I79A 1FDZA 4IPLA 4DWSC 3SRDA 3NOEA 4FNQA 3W7LA 3UPMA 5A6SA 1FX6A 3NDZA 1SW3A 2CIPA 5LIXX 5IM51 1DIDA 3R0KA 1UD6A 1IEVA 5ABHA 3SRHA 2A3LA 4PGLA 1XIIA 5A94A 1DJGA 1PB0A 1ZGDA 4ZO7A 2JEQA 4XTDA 4H6QA 1LF1A 3S5OA 3KBVA 4NJHA 4RW5A 3V18A 1CZ1A 3TCEA 4ZOEA 4LSBA 1QR7A 1TYGA 3RLVA 2V30A 3ITVA 2YB1A 6A3HA 3P67A 4JCMA 1H09A 7TAAA 2WQPA 1G01A 1QOQA 3HV8A 3HO8A 4AB4A 4LVAA 4WUIA 3WLRA 1YXYA 1O95A 2EPNA 3M0XA 4IIDA 3KOWA 3IUIA 1WKFA 3AYRA 1DQUA 3BCJA 2PTXA 4E5TA 3TOYA 1I0DA 4K36A 3SCVA 1B90A 2P88A 4YVPA 3PN8A 2X30A 4HU8A 1XSIA 4IHCA 4J35A 1REQA 3GNRA 2A3EA 1DOSA 1VH7A 3SN0A 1FHVA 3FA5A 2FVKA 2NT0A 3S2CA 4J3XA 5C9UA 3LV6A 4RW3A 2P1FA 4YHEA 5I5RA 1GJUA 4JX6A 3BSMA 1E0XA 2NUWA 1UOZA 4REQB 1XLAA 5BOEA 1ZCCA 4L4LA 4LXFA 1XH0A 1HW6A 2YOCA 3PANA 3QC0A 4G56A 4LYQA 5BXTA 1W3IA 3VZZA 4LVBA 4GGBA 5F4WA 2YCLB 4RX0A 4S3CA 5FF4A 2WPGA 1W3JA 2XFFA 1VHNA 1R9XA 2XH0A 7TIMA 1Q7QA 4U3AA 2V3EA 1HVXA 2FGBA 3ABZA 2J8FA 4FLQA 1UD3A 1GPFA 2D2GA 4S38A 1DBTA 4DZHA 3VNMA 1J9YA 1ZAHA 4D6JA 1DHPA 2YBTA 4AHOA 1M04A 3FK4A 1FUYA 2PP0A 1K4GA 3CU2A 4B3ZA 3K8MA 4DRSA 2CYGA 4IGNA 4NP7A 3G1SA 2ADAA 5AECA 5C55A 3VI2A 4MLRA 1V0NA 1NIUA 4QGCA 2OXNA 3CTLA 1LRTA 3DOPA 3RMJA 3T0TA 3VKBA 3B8VA 3DDMA 2VVSA 1LBLA 1A5MC 2OOGA 2CLEA 3CEPA 5JQ9A 3VPLA 5FAGA 3VD9A 3WYZA 1VGAA 3T8LA 3SFKA 2YA2A 1OFQA 5FOOA 3TZFA 4QLLA 1E43A 4JGDA 3QQ1A 1NDVA 3AMCA 4IQEA 2CZDA 1GK8A 4F9JA 2P5NA 3OHMB 2PLJA 1L2UA 1ZENA 1ZUAX 4ATWA 4IG2B 4ENLA 1RPKA 2HDJA 3OGVA 1C8YA 3FNDA 3OVGA 2VZUA 4QCFA 3KBJA 1ZS2A 2QCHA 3OG3A 5BYWA 2I57A 5AYZA 3OZPA 2YL8A 4IXHA 4TX9A 2Y5SA 3W82A 3GVQA 2FHCA 3V4BA 4E38A 1ESWA 3SQLA 2PI6A 1HL2A 4AG0A 3CL6A 4W8LA 2TRSA 2KZHA 4HIBA 3CB8A 2OZ8A 3FVMA 4NVTA 3K4AA 1DQWA 3EGJA 4JQ3A 1QPKA 1QK0A 1AJ2A 4N4QA 3AYTA 3I7RA 3STCA 4PR4A 1TFVA 4UXDA 1PX8A 3THUA 4FEZA 4BF9A 1RJQA 1WPCA 2PDWA 2FVLA 5LNSA 5A8PA 3NEHA 1TPH1 3PJUA 3OHIA 2CCRA 2C0AA 3DGRA 4U28A 1AG1O 1JF5A 1E0WA 3EZ4A 1VPXA 2CZEA 2A7NA 5ABGA 4C5YA 4X2RA 5I3KA 2UY4A 3S5NA 1TTQA 4BQ5A 2SFPA 4IOTA 4QAIA 3RHGA 4QNEA 3W4RA 3W1LA 1VYSX 1ZPTA 4XAGA 2CZVA 1IGSA 3UXKA 3QQWA 1AL8A 1IF2A 2QIIA 3VU2A 2HEJA 3DXIA 2FGLA 3UZJA 2A3HA 3K1GA 4RXGA 4JKMA 1VFHA 2Z2BA 2VCCA 4DIAA 1VBHA 5CZKA 1OT1A 4OKDA 3MVIA 3S1UA 2NLYA 2GDQA 1OGSA 1T8QA 1E3ZA 1VFLA 4AAJA 3RX4A 4XKYB 1JCMP 4DLFA 1XV8A 2WVUA 1K8ZA 5GJMA 2YCIX 5FF7A 3WEOA 2YXXA 3DKLA 5DCDA 3WQ6A 1QPQA 4JEQA 4OOZA 3KW3A 2C6QA 1MUCA 3F2DA 4MYAA 2ZA3A 1NFGA 3EX4A 1V02E 3G6LA 4Q8TA 3ABOA 1R7OA 2PDYA 2HISA 4ZFMA 3H7VA 3PFMA 3R11A 4DUXA 4REQA 3E5PA 3LLFA 4C7FA 3GG7A 1XKYA 3Q45A 3BCDA 3KCOA 3PPHA 2V67A 4D6CA 1HNYA 4JTIA 3LPPA 4HU0A 2E8ZA 5F7UA 2YCLA 4AD2A 4TO8A 2VCAA 3PZGA 5I3IA 3TVAA 1N2VA 2DDXA 1V3IA 3NNTA 2WV8A 3TSBA 3MJMA 2DP3A 4CQDA 4ICCX 3D0CA 1WO2A 4N0RA 4QDMA 1JDFA 1S3TC 4I6VA 5LHEA 3SAZA 5EMUA 3U7BA 1W31A 3FJLA 3DAQA 1D8WA 4K38A 1F3EA 1EC8A 4XTIA 4D2JA 1F76A 1VBGA 3A24A 3N2MA 2O9RA 1VLIA 4PTDA 5JBFA 3GC5A 4M1BA 1GT8A 1V08A 1QNRA 2Q3RA 1E55A 5BWFA 1ZJHA 1KGUA 1MMFA 4O0KA 5A6BA 4F0MA 1VFSA 1JZ8A 3DENA 1D3GA 3PG8A 2DZXA 4JNYA 2DV0A 2AAAA 2LLEA 1QUMA 1GORA 4IG2A 3N2OA 2B4GA 1K9DA 3A4XA 4LT9A 1DWJM 3BL3A 4Y90A 5BXPA 4KWWA 3LSCA 3LCIA 4GX8A 5CQ1A 3C2EA 2V3DA 1ALDA 1M5WA 4MM1A 3H53A 3VO0A 3NO5A 2FIQA 1RD5A 3BUVA 1TJ0A 4AY8A 2CFFA 4H8HA 4Y9MA 1H2JA 1Q6DA 4B5XA 3PY2A 1ME7A 4DI9A 1Q4WA 5HATA 3S0CA 2IKJA 4IMGA 2J75A 4F4RA 3CUHA 3E2RA 3G0UA 4BEQA 3GNNA 3ENLA 1ZALA 3MSGA 4LS2A 3T8QA 4BJHA 5FESA 2PDUA 1JDAA 2NLIA 4LUJA 1A3HA 3TR2A 3B4YA 3KLKA 3DYOA 1G5AA 5REQB 1XIDA 4IPPA 5H2ZA 1R3SA 4J3UA 3WUEA 3BVJA 1AJ0A 4PUEA 4GX9A 1C29A 4DPPA 1A5OC 3L67A 1Q6QA 1XYZA 2C1HA 2J8TA 3I65A 4A3QA 2DORA 1VBRA 4ROPA 1AZ2A 1DWHM 2Y7FA 1FWSA 4XD3A 1VHCA 1TPC1 4MMWA 5FJOA 3V5FA 4S3AA 1EGMA 3T2OA 1UJQA 4FR6A 3M64A 5CJ5A 3S42A 1TRDA 5FL1A 2GDUA 1C92A 4GABA 2R24A 3MCOA 1EEPA 2QZRA 4XKYA 4FLRA 5LNRA 4ZR8A 5E93A 4XX6A 3GNPA 1NAL1 4ERAA 3VZYA 2ATSA 3A6OA 2CHOA 3UG8A 3SQMA 3OZOA 4MKSA 1B5TA 2E8YA 1R85A 4HOWA 5D4YA 4D8ZA 2OYLA 3UGVA 2G0WA 3CQIA 4O16A 4N6EA 3IGUA 2AGKA 4MNJA 1XPGA 2XVGA 4UTIA 4S3BA 3GNDA 4MIMA 4DF0A 2PDQA 1PS9A 3GRIA 3ZXWA 2WM0A 4F8XA 3CWOX 1XW8A 5KMYA 4I8YA 2Z24A 1GOQA 5A1AA 4PTXA 2YGYA 3EX3A 1MVYA 3QM3A 5LNVA 3ZLFA 1BVZA 2OQYA 4FF5A 2PWDA 1VR6A 4Y7EA 1R3YA 2EEXA 4ZEPA 1ZRQA 5TNVA 3QN3A 3QR0A 1POJA 1XLGA 3I10A 3TTYA 1OT2A 5BWAA 4UOJA 3THQA 1FWRA 1LROA 3ABQA 3OA3A 3WH6A 3IJLA 1QW7A 3CK5A 4GACA 4HNCA 1T0OA 2I14A 3AYSA 4OBRA 4NXSA 3UWWA 2P8BA 5D37A 2WSPA 2RDTA 1E72M 5ECUA 2X1RA 3IJQA 3H7RA 3BGGA 3DZ1A 5BRBA 4PODA 1UZ1A 1BAGA 5HMFA 4LPCA 1TPDA 3GHTA 3QC3A 2ZWZA 3GO2A 3V1HA 2Y62A 4WHBA 1B9ZA 4S3KA 1F8IA 3W7CA 4ILSA 4CQCA 4AD0A 2QYGA 2PDBA 1PKLA 3AWOA 2IPGA 4NI3A 1KTNA 4ZO9A 4DY1A 1Q2SA 3LHTA 4CNOA 1HKMA 3KTCA 1GOXA 4GXPA 3FKKA 2J7DA 3GG1A 3GWQA 5DXYA 2UWFA 2BHYA 4POCA 3QEZA 5JBEA 3GX9A 3W1RA 3QGKC 4WQ6A 4RDVA 3WQVA 4IX2A 2H8XA 3TQ0A 1TVNA 1M6JA 3AJ7A 3GDRA 5D8ZA 5H8MA 1QI3A 1S3HA 2FJKA 2OWWA 1CENA 2D20A 1MYRA 1LWIA 3F03K 4RE0A 1I1WA 1TCDA 4AD4A 4Z2LA 1H7OA 1GOWA 1W32A 4LUYA 3W1TA 4IL2A 1YKWA 3V1PA 5REQA 2QUVA 3UG5A 2YKKA 3TCSA 3MZ2A 2GJNA 1GQLA 2O9OA 2FTYA 1FCQA 4S3FA 4DAIA 1Q63A 4UQ9A 2DZAA 1F6YA 2HS8A 3OYZA 4FS9A 1S1PA 2NWSA 3MWAA 3O6AA 2J9XA 4YJ5A 3C8NA 1TTPA 1C8XA 3VIHA 3U7VA 3QJAA 3VDBA 5ABEA 2WZMA 1TR9A 4U31A 2E68A 1EBHA 1L6YA 4W9TA 3TN3A 2RDWA 1R8LA 2E9MA 1MW3A 1BKHA 2CLHA 1JYWA 3MMUA 1XIEA 1W8GA 4UFKA 5A6BD 2WCGA 5I24A 3IV8A 3W2KA 2P3ZA 2QVHA 3M0JA 2QPUA 2ZX7A 4QROA 1FWTA 4GZ7A 4GIRA 2CPUA 1Y65A 3KRSA 2X0HA 1R46A 1QASA 4Q7NA 1JCJA 3B8UA 3TX9A 1KCLA 3LNMA 7XIMA 4FI4A 4D1IA 4C6LA 1BWLA 1HQTA 1R3QA 1W9XA 3H21A 2RDXA 5CKSA 2PGFA 2J7HA 2W5FA 1QI5A 1EZ2A 1PHWA 1F3WA 2I5QA 1OZMA 3A4JA 1Q6EA 5DX7A 5CPLA 2D24A 4GCXA 4K39A 3VGBA 3UWUA 1XGEA 3TP4A 1Q5MA 3TYEA 4EPKA 4FMVA 4JTRA 4NYYA 4P2VA 4XAYA 5EKYA 1GEHA 3NQ6A 5JXQA 4C90A 4Y6GA 2Q8ZA 3QY7A 1ICSA 2CEQA 2OYMA 4X22A 3W7PA 2VENA 3MMDA 1R6WA 2Y7GA 4A35A 1DIEA 3ABXA 4GBDA 3QYQA 1FWIC 4QNWA 4AEEA 7A3HA 4LX4A 4QSFA 3ZIZA 3GFYA 3OPSA 3GU1A 1P6WA 1WUEA 5EMYA 3TUUA 3D5HA 4QXIA 2PDCA 2XWEA 2Y85A 4PZVA 4A3UA 4AZIA 3CEUA 4N9EA 3VILA 2G95A 1OFOA 2PLMA 4D72A 4QJ5B 3M5XA 4PMDA 2E1WA 3B3DA 4D9PA 3HTWA 3RX3A 2ZUMA 5TAOA 2PRMA 1CCWB 1AFSA 4K7VA 4MNMA 4LB3A 3PWIA 4D6IA 1AH0A 1NFPA 3FSUA 3IJ9A 1WAWA 1ECQA 3UA4A 3OTRA 4NZ3A 4MB3A 3ITXA 3TJ4A 1EB3A 5FF2A 2VC6A 2QCFA 4JKKA 2NSOA 3LPOA 1VFFA 2WSQA 5K4XA 3W2UA 1ISZA 2VZTA 3BARA 3S46A 2OZ3A 5AY7A 4O53A 4CNTA 1RQHA 3W1NA 4U2ZA 3WUBA 4C6NA 2GDVA 4GRSA 4QBXA 4MZ1A 4CVWA 1W5NA 2E6DA 4QE1A 1XUZA 4TR9A 1JAKA 2YA1A 4IX0A 2AQVA 3IUHA 1XLBA 5HUPA 3EWBX 1Z44A 2QCLA 1RVKA 2GOUA 5I07A 3THAA 2Z6IA 1OB0A 1TV5A 3LTSA 3MKCA 4DUWA 1Z89A 2Z1SA 4PN2A 4JTTA 4MUPA 4CCDA 1CB2A 3ABRA 2GJRA 3L0KA 2OT1A 4XV0A 4Q8UA 1T99A 2ZX6A 2WMHA 2VD9A 3OLGA 3ZYZA 2ZVIA 1EL3A 3DFOA 4EANA 4RE3A 5BROA 3B8WA 3SDOA 2BVDA 2O7QA 4JTDA 1DIOA 3AFBA 4L6HA 2CNCA 2JGQA 2HXTA 3QVQA 1K02A 1K9TA 1IXQA 5I02A 1VEOA 1RBAA 2WVVB 4C5ZA 1GJWA 2O4QA 1VKFA 3GC2A 1VPYA 3R94A 3M0LA 2WW5A 3S5ZA 4GJIA 4U3CA 4LAZA 4QSHA 3BLOA 4W7WA 4OV4A 1A3WA 2YXGA 3NEVA 4URIA 4JNMA 1UKPA 2X7WA 4W86A 4YTSA 1HT6A 4MYXA 3T2PA 3CPGA 1DE6A 1SO6A 2W3ZA 2G3MA 2PC4A 2XWDA 3M4HA 3D6NA 1FHUA 1WBHA 1JYXA 1YBQB 3N2XA 1RLCL 4GZJA 1TX2A 1VFOA 3NCOA 2WLZA 4C60A 4JTQA 1RQBA 1YNPA 4HHLA 6XIMA 4FX6M 1XFBA 4D8LA 2R94A 3B0PA 1C93A 2Q01A 1VEMA 3BW4A 2A7RA 1BQCA 1MEWA 2VX7A 3OLEA 2DVTA 4HYRA 4GUIA 2OGJA 2OFJA 3WY1A 4FK9A 5CBIA 3LA4A 2Z4GA 4WY0F 5EMJA 4IMFA 3QHOA 1Q7ZA 3T1GA 3E0LA 4HSHA 1HKVA 4UNKA 1MEHA 3DX5A 4EXAA 1VF8A 3KTXA 3A3HA 4GIYA 1KXTA 4IGSA 4Q4OA 2XH2A 4PTNA 3RITA 1KFBA 1TVPA 2RJHA 1ITCA 1DJQA 1EF3A 1KV5A 3H4XA 3D46A 3DERA 5HMSA 1DV7A 4DO4A 1KM3A 4CN1A 1O4UA 3BAKA 1J79A 4I9TA 2Q6ZA 3W7QA 3WH8A 3LBOA 1LUCB 3BG9A 3RM8A 3W7OA 3V5CA 1LBMA 3AU6A 2EQDA 3PK7A 4D8AA 3LHYA 1HUVA 3KZSA 3FIGA 3WQ8A 3NVDA 3LRKA 3VNYA 5LGXA 2QF7A 4BFAA 2OB3A 3L5LA 5AYYA 5B80A 4W8BA 1K3UA 5CGTA 1FDYA 1ISVA 3MUIA 2WJEA 3OVRA 2OU4A 3FJNA 4RZ5A 3W7IA 1JZ5A 2WMFA 3RYSA 3OGRA 4DZIA 1YDYA 3LSBA 1R9ZA 1H3GA 4JFWA 2ZBTA 3MHUA 3G24A 3OO2A 3W7KA 4EWND 1E4NA 4MJ4A 4IJBA 4JPGA 4O1FA 5G2HA 4BK9A 1GQIA 3SJ3A 3E02A 4BWLC 4MY9A 4NT0A 1VRXA 3HG3A 4GZIA 1S2VA 2QCMA 1UWUA 4QIUA 1VJZA 1DTUA 3S9YA 4WLCA 4XG1A 3F4VA 4A05A 3RMEA 1U33A 3ELFA 4HMNA 1AJZA 2GVEA 3THDA 1O5KA 3OQEA 1H7RA 3G2GA 5T8GA 4QCEA 2PUZA 3QV8A 1YMYA 1K77A 2WHJA 5C8BB 4G8TA 5E9AA 4AVNA 5HUOA 5EMMA 4PCTA 1CXEA 3VGEA 1UIPA 1VZWA 3QFEA 2EKGA 3MY9A 1XRSA 4O15A 3PFRA 2DEPA 2WBGA 1UR3M 1JUBA 3TC7A 2ZRYA 3WH5A 3BAJA 3NURA 2OSYA 1AZ1A 1E9LA 1ZBCA 4BKNA 3N17A 4RZBA 1TG7A 2Y88A 2VEGA 3QV9A 1YTEA 2IQDA 3P81A 3CMFA 3WLLA 2OWCA 5G2IA 5HNUA 4AWTA 4DN1A 1FWNA 3PUDA 5A2AA 3ZT5A 3R12A 5E70A 2WVVA 5KZDA 3QMRA 2J27A 1QRQA 3COTA 2F84A 3QTPA 2Z29A 1XD1A 4AY1A 5D32A 4TU1A 1GVFA 4AIUA 1W3TA 3S6OA 5J8LA 2G3JA 4FAMA 4DNMA 5BMWA 4Z1DA 3ZR6A 4FIQA 1OFEA 2CC0A 2V5JA 1OX4B 3ID7A 1OBAA 3TA9A 3WLTA 2VURA 1YBQA 3QFWA 2VC7A 4KCTA 1XKJA 3GY1A 4CD7A 2QUUA 1EHAA 3MA8A 3SZ8A 3LMYA 3VIPA 1JL8A 2HTMA 4KFNA 1WZLA 2WYSA 2PODA 1FQ0A 4ZOBA 3UXAA 2XDFA 2ALDA 5GPRA 6CGTA 2JQXA 1W56A 4B2DA 1X6NA 4GY7A 4FLSA 3K4DA 2JIWA 2PDHA 1ZB5A 5IBXA 3TLQA 5FJPA 2J7FA 4JKLA 2DH2A 1BXBA 1XH1A 3ARXA 3B9AA 3LCWA 2ZVRA 2NQ5A 2I17A 2G41A 2BOGX 1HZYA 4EAYA 2FDSA 4ZO8A 4GO8A 2ZX5A 2OODA 1Q7MA 4BCEA 2XSAA 3VNZA 3O7UA 3LZ5A 4UQAA 5FEPA 5B7ZA 4P61A 4J3VA 3P8IA 5H8UA 1FCVA 2ZRXA 2C71A 3F4WA 4N4PA 2ISDA 4O14A 1LUCA 2QHAA 3IRSA 3SBFA 4J3SA 3TTOA 2EF9A 5G2WA 2QF8A 4JZ5A 3FCPA 2FZ9A 4RK8A 1BYCA 3P7YA 2GQAA 1H7WA 3VGHA 2ACUA 2NXIA 2IKHA 1V02A 2OEMA 1HJWA 1NWTA 3PBGA 4GGHA 1V93A 4KCUA 3R7MA 3AIEA 2VGIA 4XO6A 1E1FA 3GBDA 2Y61A 2J78A 5CJNA 2QGHA 1B4EA 4MWAD 2ZTKA 2ZUSA 3SN4A 4I3GA 2WMIB 2YXOA 2TMDA 1OADA 1WXYA 5I0DA 4DWDA 3U0HA 4IP5A 3BJSA 3NGFA 4HPJA 1KW1A 1HIZA 4ZFCA 1TB3A 2NX1A 4W8AA 1UWRA 4G5DA 1EOKA 3KDNA 1QVBA 3AALA 1C7TA 1GKRA 3VINA 3CAKA 2O9PA 2PSNA 5F4XA 4S1FA 4HPHA 3U57A 5JUVA 3S1WA 1V6YA 3K46A 3A3XA 1OC6A 1K8CA 3VTRA 1QHZA 2VYOA 2AGTA 4X2PA 3HQOA 4J7RA 5KINA 2WJZA 3T9PA 2J88A 3R8GA 4CCEA 4QM1A 3GVWA 4HNLA 1ITQA 4BY3A 1D8CA 4JCLA 3GHRA 4QG8A 3CUGA 1SO4A 2PTDA 5C70A 2PLKA 3SO7A 2IS7A 2ZX9A 4OGZA 1KWKA 2PZNA 2DT3A 1WV2A 2VNCA 1FFRA 4ADUA 5AVNA 3NYDA 3O0FA 4AZHA 1L6WA 3VC5A 4H9XA 5HQLA 2B81A 2CHRA 4O50A 3MBFA 2OOFA 5TQLA 3ARPA 4NJIA 1S2TA 4TQTA 3CIXA 3TSDA 4HN4A 1LQAA 1SFTA 3LRLA 3PR2A 3GDTA 4FNSA 3AHYA 2YBUA 3VGFA 1QCWA 1EKOA 3N73A 1TO3A 3PS7A 2EGZA 4A2SA 3G77A 4DJEA 1OX4A 3NZ1A 1TJPA 4LNCA 3RPMA 3CL7A 3NOYA 2Q3OA 2B0MA 1G1YA 1K4HA 1A47A 1C8QA 2GFTA 2Z1XA 3KEHA 1VRDA 1V7YA 3WD0A 3W7JA 3QR1A 3EOSA 1ICPA 3G18A 2CZ5A 3O8AA 5TBOA 2B7PA 4LRSA 1W0MA 4AY7A 2YR1A 5CXPA 3WEZA 4CNPA 1LLOA 4FZIA 1ELSA 1KGWA 2QR6A 4KRTA 4L5ZA 4Z2GA 4ROQA 9CGTA 4RZ4A 1LBFA 5A6TC 3WJWA 5EA9A 3RRXA 3E0IA 4LUSB 3PZNA 3DG6A 5U4NA 4E2OA 3B40A 1PKMA 4LCSA 3LNPA 3PB2A 4A3YA 3KCLA 3QPEA 2WMKA 3VCRA 4QJ1A 3WQ4A 3L4ZA 1BTCA 1E4IA 1LL4A 1D3HA 4JL2A 4KETA 4LCRA 5HQMA 4DJDA 3P5ZA 2EG7A 1MXSA 1B3YA 3KRZA 4IF2A 3BOXA 3IAPA 9XIMA 1X8CA 3NL6A 2CERA 3PBWA 5A8QA 4QQ3A 3RJYA 3MI3A 3SGUA 3KWSA 4YVXA 1OX6A 2VP8A 4W84A 5FSEC 2J6XA 4M3PA 1DXIA 3PTKA 4KFOA 2Y24A 5L6UA 3N11A 4H1ZA 4C1KA 2YDAA 3W1UA 2Z0IA 3Q4DA 3SIZA 1VCVA 4PSRA 3KBNA 5GQBA 4E4FA 2ISSA 4HMDA 4MSSA 4E2VA 4V15A 1JZ4A 1JCNA 4M6QA 4UZUA 4B9ZA 1THFD 4RNJA 3UZWA 2WMIA 2ZIDA 4W93A 3VFCA 3EA1A 4OIFA 1IEQA 3N4EA 5HPCA 3HJEA 2GQ9A 1XYBA 1KLZA 1SZNA 1KRAC 1KTBA 4XD4A 3MP5A 3ZLHA 2P53A 3E9AA 4HD5A 2Y7EA 2WB5A 3HZ3A 1GYLA 4IL0A 2KAUC 3PZIA 3GVGA 2I5IA 3G8EA 1KM2A 4GQGA 2ZC8A 1XLHA 2BBFA 5KZMA 3IIXA 4PMOA 1H62A 5HNNA 4EACA 3CS2A 1S2UA 3CJPA 1SJAA 2VX4A 2FPTA 2QPXA 1PUDA 3MSYA 3WQPA 5LXEA 2G3FA 3W88A 5FD0A 2Q09A 2Y63A 4UC5A 2KX9A 3SQSA 4GQRA 1QHOA 1D2KA 2FYMA 1W91A 1IEXA 3FGCB 5AZ1A 1SU5A 3E6EA 2YYTA 1GVYA 3GXDA 1ZU8A 4ZQPA 4H9ZA 3WLNA 1BYDA 4MZ8A 1W9UA 5C9WA 3EWCA 5IDZA 4NQ1A 3W6MA 1F2JA 1M01A 2DIKA 1N7KA 3W9ZA 1Z48A 1BEUA 1RALA 1J10A 2ZZ5A 4W89A 4Z42C 2FQIA 2QJMA 3TZNA 3CPUA 1CGUA 2E6AA 3KS6A 3HU7A 1I0BA 1B54A 1W2PA 3AS0A 2NUXA 3CASA 3GYEA 3ZWTA 4I9JA 3WBWA 4BQ2A 2FGZA 3OOQA 5IFPA 1AW1A 3LPGA 5M03A 4IP7A 4HKPA 3V7PA 3SCWA 5HXMA 2Y5JA 4UTKA 1DP0A 3QTGA 1IEWA 3P0WA 1E9YB 1FP9A 1DWFM 1XIJA 3FLUA 1JI2A 4ZB5A 1UKQA 3L4YA 4LUTB 1GWJA 1HGYA 3E12A 4TVUA 3EWZA 3AUOA 3O16A 5K9XA 1NELA 4Q4PA 4WX2A 1J8VA 3AIQA 4A8LA 5FACA 1H7PA 3VOIA 2OLHA 3TTEA 4PMVA 3ANYA 2D0GA 4YCOA 1OGBA 2W27A 4JNZA 2FKPA 3GIPA 1G6CA 5B7YA 5EYWA 3DH7A 3WF1A 2PDJA 4LUSA 5CZJA 4FO4A 1ME8A 3WNLA 2ZZ6A 4OQVA 1E5JA 1U1UA 2GWNA 1QNVA 4F2TA 4JQ4A 1BWVA 2GVLA 4GZEA 4UTTA 1KFWA 4N9DA 3UJEA 1SMDA 1IIGA 3M0VA 4O11A 2J4GA 3U9IA 2IPWA 1MFUA 3BO9A 3TH6A 2BXYA 4J1OA 1MO0A 4YYCA 1JYVA 3PNZA 3TMQA 3AXKA 2Y6ZA 4DBSA 1F61A 2PDFA 1HF6A 1YIXA 4G7EB 5E9XA 4HGXA 3HPSA 2HXUA 5I3GA 3SCPA 2VFFA 2NVAA 2OCZA 4LVDA 3FAXA 2BGSA 2ZICA 5AB3A 1FXQA 4F0KA 1ISWA 3KUMA 4YHGA 1M41A 4ZTXA 4S39A 4H7ZA 3II1A 3ISIX 1UZDA 3TYBA 4ZCWA 1UUOA 4IIEA 1Z8AA 4M24A 4Y8EA 3B9NA 4TX6A 3UWYA 3BPWA 5GNXA 3TNOA 3H6OA 3HQ1A 1TWIA 1MUWA 2CLPA 3ES8A 3L23A 2ON3A 2R14A 1AMKA 2Z26A 1KBKA 1UH4A 1PVNA 2YB4A 2XVPA 4JFUA 4MPQA 2Z1BA 2QJNA 2ZWYA 3B06A 4NZCA 3SSJA 2Y8VA 3OP2A 3M9YA 5CSRA 4MKVA 3LUTA 2GGEA 3VIMA 3MO7A 4KEUA 4JTFA 3SW6A 2WNWA 4R7WA 3USBA 3CMGA 3W38A 1KR0A 2J77A 3R79A 4L9YA 1Z42A 1Q6GA 3T2QA 2GUYA 4GA8A 3GVVA 4TV6A 4WOZA 3T0AA 1VD6A 4AXKA 1YRRA 4IMDA 2R1MA 2BVTA 2G3IA 4FSAA 3FGCA 3BCFA 4FNUA 2QGYA 3APGA 3L68A 2DSVA 1GYNA 1TMQA 2GSJA 3G8RA 4HP5A 3V5OA 4DJDD 2PD5A 4UTHA 3W7GA 1WUFA 5C71A 1KXVA 1OC5A 2A3CA 5CCZA 1JRCA 3J7HA 1SO3A 1S5NA 4HA0A 5LIUX 2ZUTA 3B0VC 1QBBA 4ZGYA 4CU7A 5A95A 1J2WA 1OINA 1R87A 2FH6A 3KFTA 5DT5A 4DB7A 4DBDA 4LVFA 1YDOA 4PMUA 4ADSA 2C7FA 3EWDA 2ZTJA 3SR7A 1GOKA 2DVUA 3ARRA 4O19A 1XG4A 4HPGA 4GK8A 3ONCA 3WL0A 4TX8A 4OTKA 3LD5A 2A2IA 1GG1A 4M6PA 4IMAA 1DE5A 4HMCA 4QRNA 1MW2A 2ESCA 2DZPA 4PYSA 2X16A 1V6XA 2G4FA 4LUTA 4L9ZA 4C6BA 5G4WA 3ATZA 3CWHA 3NQVA 4WKAA 3SUVA 3TNBA 3UPWA 4V1XA 1NY1A 1IR2A 1GW9A 2EG8A 4DF2A 3WF2A 4B4FA 5JIWA 4AYSA 1H49A 1Q4NX 3M0KA 1W3KA 1LOLA 3MO4A 3MB9A 5D38A 2PDKA 3WN6A 2FB2A 3BSGA 1KA9F 2W6RA 1H63A 1FWJC 3WD4A 3LEPA 1JPKA 2W0UA 3CQJA 3I6TA 2XZ9A 5AOUA 3LPFA 3IJIA 4Y2WA 1GUVA 3BZJA 2XPKA 3U5YA 1J0JA 3AWNA 2D3LA 5ABFB 2W62A 1N55A 1YPXA 4HNUA 2NSXA 4ZXLA 2BNJA 1XF0A 2BV9A 4TUFA 3XISA 2CWNA 2BXVA 2WSYA 3Q37A 4RCXA 3NDOA 3FJ4A 1H5VA 2EKCA 4TTUA 4G7EA 2FFIA 2QJJA 4M5PA 3LU2A 4AZ7A 1VIZA 1TPEA 8TIMA 4QLKA 1XYMA 2IQTA 1JCLA 2TODA 3G0SA 1KM1A 1BLIA 1G69A 1T7LA 3VUSA 1XQLA 1K1DA 5T9BG 4MAVA 2WHMA 5DBUA 4I9MA 4JTEA 4DVOA 2IUZA 1GKQA 2W92A 1LWHA 3OJGA 1UA3A 5CGQA 4FALA 1OY0A 2NQLA 3WQWA 1KV8A 1QPNA 4US5D 2PB1A 4KBXA 4XD5A 3DI0A 1W5OA 4ADTA 4MFDA 2V81A 3N13A 3WJYA 5D9NA 3UR8A 3CYVA 3RCYA 1PTDA 1E6PA 4PTMA 1VBUA 1JPIA 2C1GA 1DPMA 2EJ1A 2Z7GA 3M5YA 2BVYA 3ZOAA 3QYSA 4D6EA 4LNYA 4Q8MA 1XCXA 2CBUA 1M9HA 1XYCA 5DO8A 2ASHA 4CVUA 3GU2A 3EPNA 3MZNA 4GUJA 4BEUA 2C1IA 2D2JA 2F9RA 5JBDA 4PB4A 1LOSA 2J8GA 5CC3A 3DI1A 1Q6FA 4HZ8A 5ABTA 1C9DA 2VZSA 5D05A 4K8GA 1W17A 3EXTA 3HG2A 3CO8A 3QOKA 3F5JA 2D1ZA 3C5QA 1GW1A 3HG4A 4ZSUA 1A3XA 1F3TA 2BWGA 4ES4A 4Y9AA 4CNSA 4Q33A 4NG3A 2B7OA 5CBBA 1W3NA 4YWIA 1VCGA 4F2BA 4IIGA 2OZ0A 4R27A 4CUCA 1X39A 3OLIA 5DRIA 3TYCA 2EPHA 4GC3A 3ALFA 2VGGA 5A2CA 3W26A 4C1NB 1E71M 5AVHA 3W72A 4LOCA 3M0IA 3GDMA 3SY8A 1TPFA 3NPWA 3NM3A 3A5VA 4J40A 4XIMA 2PWGA 2VC5A 2WPBA 3LENA 5EPDA 1QO5A 3PZQA 5A8OA 3W87A 5D09A 2NV2A 2ODOA 4E4PA 4MVAA 1WKEA 5C7VA 3ZSSA 5LA0A 2P10A 1AW5A 4I7UA 5CPNA 3KCJA 3LCXA 3GR4A 1QPRA 2ISVA 4LRTA 1R3RA 2WOQA 2EBNA 1J5SA 2TSYA 2ZE3A 5FJUA 4M80A 4XAFA 4J5NA 5J04A 3W2MA 3FX4A 1YX1A 3R43A 2FHBA 3EBVA 2J66A 2BS9A 2FJUB 2BSLA 3G1HA 5MKGB 4NX0A 3AS3A 4NJGA 4I5RA 4DWSD 3B8SA 3NXLA 2C14A 4PULA 3H70A 5ABFA 1OCJA 1IXOA 1JQXA 2PAJA 2X1IA 3R2GA 1NQ6A 4U4MA 4DLMA 3OYXA 4MTVA 2ZRUA 4K3ZA 3L4WA 5EMLA 1Y5VA 5LIWX 1OIFA 1VJIA 1XHGA 3CIVA 4HNTA 3N12A 3CV6A 3LDVA 1NDYA 7PTDA 5I7GA 1RAKA 4C6CA 1O12A 4AIOA 4CEUC 1XYFA 3G3MA 3DG7A 1CXHA 1IYXA 2BXZA 4O10A 2Z1KA 3C4UA 5DCEA 5HULA 1IWBA 3N19B 4EVZA 1GKPA 3DYPA 3TIMA 3LHZA 5EGRA 2E28A 4A4AA 5G1TA 5ENLA 3IAQA 1AQFA 4UQCA 8A3HA 1DYSA 4P7OA 4V2XA 4NZ1A 2VFGA 5HDRA 4ONVA 5C9RA 3SCRA 3HGOA 2GPTA 2NX9A 4H9TA 1XICA 3WMSA 2X09A 4KWUA 3VABA 3W2NA 4AZCB 1F5ZA 1SSDA 4P7LA 2B31A 2PP1A 1SZEA 1HL9A 1A5SA 1IR1A 3VNIA 4Y9NA 4HNNA 4IFKB 3O63A 3M0MA 1QDSA 3RLHA 5D2YA 4K8HA 1GJPA 4JIRA 5AC5A 4H9MA 4LBSA 3F4DA 1E73M 3M7WA 3R4IA 3UNTA 1SW0A 2WMJA 4JQ1A 3PAOA 1CPUA 3U4FA 3T0BA 3PWGA 3MYPA 2NVDA 4L4PA 2D73A 5KZ6A 3BLFA 4DAFA 5G4HC 2OSXA 1EGVA 4HYWA 2X2YA 1TE6A 1S5VA 3WO8A 3WBAA 2CU0A 1QAPA 1W1YA 2JIEA 4DPQA 3EX1A 3VIFA 2PRHA 3N34A 3TC3A 3EKLA 3MI2A 3AMDA 1EO5A 2OLAA 3FYPA 3D47A 5FA5A 1OGGA 1M03A 4QS5A 3GDKA 2WVSA 2OEKA 4RDYA 4ALDA 3LRMA 4P7RA 1A5UA 4C1NA 1ZZMA 3B8DA 3QRHA 4NRSA 2GK1B 2BODX 1T8XA 1JFHA 1E4MM 2Y0FA 1U5JA 3UZXA 1JFXA 1BWKA 3KXQA 1XBYA 4E3TA 2OJPA 1GTEA 1YXCA 4Q4MA 2ZDRA 2BOEX 4INFA 1QW9A 1P4CA 4IXXA 1WDQA 1F07A 1UKOA 1XINA 5AZ0A 2DT1A 3WFAA 2XYLA 2W63A 1XP3A 3C2FA 2PZ0A 3H2FA 1P1MA 1HKKA 1CT5A 2JALA 3GSMA 3H22A 4Z0SA 5AFDA 4PMJA 1WDDA 2DPEA 1CXLA 1TX0A 1Z9AA 2Y8KA 3HG5A 1ZAIA 3A23A 3W83A 3S5YA 1C8VA 1US0A 5MKGA 3NM1A 3ITCA 3MMWA 4I90A 4IPJA 2YBVA 2INFA 2EAWA 2HNEA 4LCQA 4IGHA 2F7FA 4PCPA 1W2VA 2X7VA 1F05A 1JG9A 3TN5A 1V0LA 2BY3A 4Z2KA 2V5CA 4UTWA 3P60A 3GIQA 4IIFA 3UD6A 3W1AA 3OVPA 1V3KA 3BC9A 4V33A 1OZQA 1A5CA 5D02A 2A4AA 4YYFA 1EJVC 2F6UA 2VOTA 4L9XA 5CSSA 4UFIA 1J0ZA 4WY0B 4JR5A 3W23A 4W5ZA 1W5MA 2IKIA 5HR6A 2WK2A 4KH2A 3VKJA 4I9AA 4IICA 2OELA 2Y8UA 3GR7A 1LCOA 1TWSA 2F38A 4Z2HA 1RQEA 3IEBA 1HO1A 2XISA 2X41A 1G67A 4XK2A 1ZP3A 2ZZ2A 4XO7A 2G50A 3P2VA 4K1GA 2O4MA 4R53A 4I5UA 2CLMA 1E9ZB 4KGLA 4NZJA 1AVAA 2HS6A 1O94A 3WQDA 5BZAA 2QAFA 4AZCA 4HSNA 4ZE4A 4AISA 3FA4A 4JTLA 4OHQA 4GKTA 3KOXA 4R34A 4LAOA 4IFKA 2BFGA 3AMLA 3TJLA 1JUEA 2FPVA 3QHNA 3LGDA 4NNCA 1P5BA 1XWYA 1US2A 3QKZA 3BV4A 4RKAA 1KQZA 3BLPX 4H41A 1E5NA 3JRKA 1JPDX 3EX2A 4LF1A 3E0WA 1YTKA 1MXDA 3MHFA 1HJXA 3MJYA 3BSHA 2UY2A 3C0SA 3L7RA 5D03A 5F1UA 3S9ZA 2P76A 4LWWA 3PBVA 4KS0A 3SCUA 2FFCA 2QCDB 3DBPA 2QCEA 2VD8A 3Q2DA 4MWAE 3WK2A 2D0HA 4U5KA 4RJEA 1XBXA 3N04A 3OB8A 4I7WA 1UQZA 1TE1A 3NGJA 3PJWA 4V28A 2HPIA 3RLUA 3HFTA 3GXMA 1X97A 4C6DA 2PPGA 2XHYA 2V5LA 4MGGA 3MANA 4RV3A 4ML9A 3GNXA 2TPSA 2ZX8A 2OX4A 1W37A 2GK1A 4UMBA 3B97A 3TAOA 3NL3A 3OIHA 3N4AA 3ZM8A 3EDEA 4ZSTA 1A5NC 1XYAA 3H8AA 1W5QA 2RJGA 2XN1A 3LTYA 3PHAA 1FTXA 4ZQCA 3S5SA 4Y9PA 1PX3A 3FXGA 1QW8A 4YS1A 4GI6A 4Q22A 4WCJA 3GH4A 3Q65A 4IWWA 2GQ3A 5A8GA 1XBVA 5E0CA 5BW6A 1SW7A 2F2KA 3IVTA 3AISA 4PEKA 1UJPA 3BXWA 5I3HA 4IQDA 3YPIA 1UASA 4GBUA 2I9EA 4KFPA 5I6SA 2DZUA 1M3UA 1RCQA 2MUCA 3ERPA 2OT0A 3M0YA 1IV8A 5CLTA 1KB3A 1QHPA 4RR4A 4FOJA 3URBA 4C91A 3C2YA 4ICMA 4IJRA 1V6VA 1HL8A 3M0HA 1N8IA 4YCPA 4KWOA 1P0EA 4XVEA 4UFJA 3HN3A 2WZIA 2FZDA 1CECA 4DM1A 4LY4A 2O56A 3WDIA 1QI4A 1KTCA 4C65A 4BF7A 4MB5A 1JCYA 1H7NA 3WENA 4WXZA 4B5WA 4NHVA 3TA6A 1Q2RA 5K9DA 2VZOA 4R9XA 4UZSA 3BG5A 1EDQA 3VD7A 1BF6A 4H7CA 1E6QM 1UWQA 1EC7A 1NOWA 5AYIA 4WY0A 4DJFC 2J24A 1TMLA 2INZA 3MV01 3T4WA 2O92A 3SRFA 1WZAA 4YTRA 3VKKA 2BHZA 3RGTA 2EPKX 4H04A 3T40A 4AEOA 1MNZA 4X63A 1OF8A 3CH0A 2Y1HA 1I45A 1RBOB 1XR2A 1PDYA 3H23A 2QDEA 4QLJA 3TYAA 4XVDA 5BOOA 3DUGA 3NA8A 2OSWA 4EK7A 2XGBA 4IT1A 5C2CA 4FXSA 3WF3A 1Q8AA 3TTQA 5JH1A 1J6PA 1T6MA 1P48A 2PGEA 3KZPA 2GLKA 2REQB 2NW0A 1YNYA 1EHNA 3CPRA 1KKOA 3I68A 1FCBA 2PDPA 2RUSA 2AL2B 2XM2A 3WMCA 2HROA 2VT0A 4JTUA 1KBLA 3ZJ6A 3F2CA 3UETA 3CZKA 2C13A 3H55A 1DJNA 3G5EA 3ARUA 3GG0A 3ZZ1A 3H4WA 3DBNA 3FXYA 4IGMA 3SURA 4GIEA 4JQAA 5E5CA 3MVTA 1QTWA 3GR8A 1XC4A 3OZMA 3R5EA 2I1OA 3UGRA 1IHIA 5LSMA 2HCVA 3CYJA 1PAMA 2JK2A 1E1CB 4GKLA 3RXZA 4WSKA 1X7FA 1V0KA 1TV3A 2QCDA 1OABA 3JS3A 3TE9A 4WOQA 1AD4A 4F3HA 1KCZA 4FPSA 1F4HA 3FAWA 1PZ1A 2E25A 4JTAA 2YL6A 1KFEA 1LG1A 3P62A 4NNBA 3NAVA 2YDQA 1BPLB 1BVNP 4DBUA 3UFYA 3WD1A 1UR2A 1S5TA 1FP8A 5RUBA 1MW1A 3VNJA 1TSIA 4AF0B 3NSNA 3PBUA 3WMLA 2CLLA 3VA8A 5GNYA 1A0DA 1PTGA 4LFYA 3B4UA 3RIKA 4Q7BA 5HWNA 2ZFAA 4NI8A 3N2TA 3NFUA 4MAZA 4JEJA 2BZNA 3DFYA 3IACA 1ZLPA 3V0TA 2WBKA 3UERA 1I1XA 1P0BA 3R89A 4A8NA 5AHIA 1OSEA 1OQFA 2A79A 2H3BA 5CLWA 2BTMA 2G4JA 3B04A 2ISFA 3W1MA 2JE8A 1CB7B 3P61A 5A69A 4FNPA 4AZ6A 3VOGA 4UWMA 3QZAA 4R85A 3TFCA 2ZADA 5I06A 2YX0A 3MUZ1 4O1CA 3T08A 2GVYA 4E8CA 2E5DA 2EXOA 3LM3A 2DIJA 2WMGA 4LBUA 4RNFA 5FJRA 1JGIA 3AQUA 2NZLA 4N6FA 5CSYA 3MHGA 3AUJA 4ML4A 4N9CA 2NXGA 1RHCA 3W1PA 3S9IA 2XINA 4EX4A 1ZY9A 2YCEA 2CKSA 4LQ1A 2AL1A 1UHVA 3CV2A 3UCCA 2E40A 2PU1A 4C6OA 4QS6A 4F66A 4PMRA 4JYDA 1OCQA 1VB9A 2GJLA 1OIMA 4C7GA 2HK0A 4U5IA 1B0IA 3S1VA 3NQBA 3VMOA 4H8NA 4JTGA 3R6IA 4DUVA 2JFEX 3EAUA 2OEJA 1BRLB 4R7OA 2PP3A 5HANA 1ISXA 3VDHA 1PZ2A 2VFDA 2A1YA 4ZO6A 3A3WA 2GVJA 1DWGM 4HA4A 4MJZA 2HWGA 1Y5WA 3AIWA 4O0QA 1NU5A 4X9SA 2REQA 1UIOA 4HCDA 8XIMA 2QULA 1UKTA 1PJ9A 1R5YA 2G97A 2HNHA 5HA7A 2AL2A 2VDHA 4BWLA 2HE5A 2VWSA 2CBVA 1UP0A 1UMYA 4ZMGA 1T41A 1Q85A 3BW2A 5HPOA 3MUCA 3BQ6A 1TQJA 3FS2A 3HMJG 2JF7A 2DZTA 1X1ZA 3GDLA 1CX9A 3SCQA 3M5ZA 1S2CA 4J9JA 1VFMA 1QWGA 1QOPA 3PZVA 5CH9A 1NH6A 4E2BA 4CU6A 4JQ2A 1JIBA 3DHPA 3RO6A 2J9YA 1Q65A 1E1CA 1ZBKA 1LLZA 5LNUA 1ODUA 3B9OA 3U3HA 1QU4A 5IBXC 5I00A 3MTWA 1JCXA 1M53A 3GZ3A 4KRUA 1KKRA 3HA1A 3PZTA 1Q3NA 3ZS4A 2MNRA 5AN7A 1US3A 3WUGA 4TVDA 3ITTA 3VDGA 3TTSA 3NQCA 3K2GA 3K5XA 1JF6A 3WZ0E 3EEGA 4W5UA 4NY2A 3LG3A 4AF0A 2QKFA 4J27A 2HBVA 5XIMA 3ARWA 3GH5A 3ZMRA 3CHFA 3WF4A 3UJFA 4H19A 3MUXA 3RLGA 1CYGA 4E8DA 2BX7A 4DQWA 4GFIA 3TQKA 2FB3A 2A0NA 4W7VA 4HJFA 3CO4A 3W2JA 3FEQA 1Y0EA 2DQWA 1G4TA 1GZJA 1R0MA 2ZE0A 1W9PA 3PVFA 3MP4A 2FMNA 3WLIA 4PFHA 4PBEA 2A21A 2FZ8A 3NPXA 5KTLA 1JJKA 2CKRA 3MP3A 2CBIA 4UTFA 1KBJA 4MB1A 1JGMA 4JN6A 1UPMB 4HU4A 5HOSA 3PTDA 1EFZA 1WYIA 2QUNA 3FEMA 4MUZA 5CBJA 5I09A 2PFHA 3W0KA 3UJSA 4Z1YA 3K4WA 4FP1A 4YU1A 4RZ6A 3RU8X 3QR3A 4AZBA 6TIMA 3TK7A 4P8WA 2E7FA 2WJFA 4ZQRA 4EE9A 4B91A 9RUBA 1XL9A 3L21A 4CCCA 1RD6A 3W2LA 4XD6A 4PL1A 3DG3A 1PE1A 3HV9A 1WQ5A 1XFCA 4ZQOA 3NSMA 1XYLA 3AC0A 5GJPA 1P6CA 3F4CA 3KTSA 4GQBA 1SUXA 3EWXA 1RA5A 2GQ8A 2VM8A 4P8UA 1KRBC 2VRQA 1Z32X 1FWHC 3NQ7A 1QO2A 4M29A 2YDSA 5I78A 5CPQA 4NASA 1ZSXA 3UU0A 1FXPA 3BMXA 5G1YA 4EPDC 2W4XA 5KZEA 1KNWA 2YCKX 2VQUA 3XINA 4OE7A 2BB0A 3GHSA 4EIVA 1SZRA 1PYFA 3NUKA 2J25A 4U10A 1UB3A 1EUNA 2VFHA 1FBAA 1BRLA 1MUMA 4CD5A 4YTTA 3C86A 4AD3A 1MRQA 3KHDA 3QHMA 1AW2A 2L5HA 4AWUA 1O5XA 5E0KA 3QLLA 3STFA 2FHFA 1XCFA 3N2BA 3G1AA 2Q8XA 1IXPA 3HFYA 4IUGA 2VR2A 1J4EA 3P84A 4AD1A 2H3DA 2BASA 1TV8A 2E77A 2NUYA 4LW7A 5D9PA 2D2OA 4RV8A 3UWQA 1I2NA 3BE7A 3BQ5A 1OEPA 1HFBA 5G5IA 3LHUA 4CD4A 5K2ZA 4IIHA 4DELA 1JPHA 4DJEC 2OMAA 1XIHA 5M2FX 3A64A 1UR0A 3S47A 1LDCA 1MDRA 3L65A 3MSRA 3LBCA 5AYXA 2H90A 4GCAA 1RK5A 4F0HA 4XZNX 3REQB 1GEQA 1YDNA 4L65A 1CXIA 1OK4A 3FVDA 1M7XA 4OUIA 2POZA 3SGGA 3VD5A 3C8FA 1I2QA 3WELA 4EF8A 1TVLA 1A53A 3U2ZA 1Q6OA 3A9IA 1PSCA 4NZ4A 2D69A 4H2HA 4H6RA 1F6PA 4B4HA 1L6GA 3EDJA 4V27A 4J3ZA 3C52A 1I9CB 1L6SA 1LOQA 3BMWA 3DHFA 2V2DA 1V6UA 5AC6A 1JCTA 1MWOA 5CPOA 2PF8A 1QJWA 1BTMA 2J13A 3NPUA 1BSLA 1TWWA 4W7UA 1TV2A 2VUNA 1SR9A 1UPPA 3AIVA 1X1OA 1K7XA 3L4XA 3V36A 4O1AA 3W75A 3CZJA 3S4TA 1FFQA 4UCFA 3VCCA 3LCHA 1H0GA 2E9BA 4B15A 1JXJA 1K6AA 4HPXA 1XLLA 4JTKA 3VFLA 1UZHA 3VKAA 1HKWA 1V3JA 1UWSA 2R91A 4BS0A 4A3HA 2J6VA 5BNKA 4QHRA 1J5TA 4XUYA 3KAOA 3QV7A 3ECQA 3O9NA 5HINA 3UR7A 3UYCA 5TD4A 1UR1A 4MLJA 1D9EA 4BI6A 1QNQA 1KBIA 2HPMA 2C8NA 4RLIA 1SJBA 4JDBA 3WK1A 2PWUA 3CBWA 1UR8A 5H6HA 3B9EA 1RJRA 2YZ5A 5BXRA 5T26A 3LXCA 4GVIA 3P6LA 3E3HA 3T07A 4HQVA 3QMSA 3EOUA 1IXNA 4MWAB 2GZXA 3CAVA 4XWUA 2ZUVA 2BY0A 3CWNA 1BF2A 3RCNA 4A2RA 4AZGA 7ENLA 1TPB1 1POKA 3SFWA 3IUDA 3GDBA 3OGSA 4LANA 2NT1A 4FXRA 3SI9A 2DZBA 3MCNA 5AKQA 1MRAA 1Z69A 1R9YA 1CNVA 4EF9A 4D71A 3FSTA 1W1PA 3E0FA 4AU0A 2GUUA 3HPAA 3ZR4A 4GNVA 2DIEA 4D6GA 3UY8A 1WXJA 3OA5A 1ONXA 3V0UA 3U4AA 4GMEA 1UG6A 4BI5A 1UROA 1O5QA 2G5WA 3L0GA 3C61A 3TMLA 1AQ0A 2VVNA 5HK4A 1KCXA 3B0YA 3A9BA 2PWVA 2RAGA 3RR1A 3LXBA 1OC7A 4E0CA 3U5UA 1NSJA 3AIUA 1V79A 1ONWA 5I3FA 2C0HA 4FOKA 1DL3A 1U83A 3KL0A 4X0NA 3BWWA 3H7UA 2X1SA 4UQEA 4FA3A 1HJSA 3E2VA 2V5DA 3W25A 1H0IA 2W66A 4XZ9A 4JBRA 2XIMA 2Z2AA 3CHVA 3PB0A 2ZXBA 3W73A 4WXYA 3UG3A 4M7TA 2CESA 5A6KA 2OX1A 3MMTA 5CSUA 1QI0A 3K1DA 1BQGA 3EKZA 2O9TA 1W6TA 2QUTA 4KRZA 2VDIA 1JXKA 4JYEA 3RAOA 1ZL1A 4HK5A 3GG8A 4G7FA 1FWCC 3W84A 3RPTA 3TV8A 4H8UA 3SUSA 2GGHA 2PRLA 4MHBA 3N3MA 3REQA 4CQ8A 4LVGA 2AQWA 3AU2A 1DJXA 4UNLA 1I2RA 3L4TA 3ZVIA 2HK1A 1OF6A 5LYRA 3I3DA 5FJTA 1RCOB 5AYBA 3N9KA 4JD4A 4AHPA 4RXFA 4L4MA 3H2OA 5C7HA 4HK6A 1A0EA 4XZHA 1KLYA 1UMLA 2C19A 4OJYA 3W7MA 2ZZ4A 3W86A 1HGWA 1T96A 1W1IE 1DJWA 2NV9A 4UTTC 1E4LA 3RJXA 3P14A 3NL2A 4JICA 3GW0A 3F1QA 3L66A 1V3LA 4DZAA 3PM6A 4UQBA 1AQHA 4L56A 1H4PA 1P0NA 3CUIA 2VFEA 4ZOAA 2VJXA 1UC4A 3VUPA 4LC8A 1SSGA 2WNNA 4EAMA 1V5XA 3PNUA 3MWCA 1EJRC 1ZFJA 3R0UA 3ARYA 1H1ZA 3QZ6A 3SIMA 2EPLX 3UZ5A 5LKYA 3RM9A 5CJMA 1U2YA 1HJUA 1G0CA 5LIKX 3UW6A 1GNXA 4UR8A 3MU7A 4GYJA 1CEOA 4C6JA 4NJJA 4NYUA 1QT1A 4U33A 3ATYA 4NZ5A 1B30A 1UOKA 4QITA 3DEQA 4KEZA 4UB9A 2O55A 3RDKA 3AZTA 3T55A 4GPNA 3S1GA 4BZYA 1S5MA 1ADOA 4S3EA 4FOUA 4PL2A 3WLKX 2ABBA 3VE7A 3ONBA 2X40A 4MWAA 2J74A 2WKJA 2P50A 3GH7A 1UW9A 3M1ZA 1RY0A 3C0LA 5D9OA 3UG4A 2QCGA 4WSHA 3A22A 1HX0A 3QV6A 2FVMA 1XSKA 3CUFA 4JIPA 3L0NA 4KGJA 4C6QA 1EWDA 5D33A 1Q6CA 5FEXA 4DO5A 5JH2A 4LY8A 3VIKA 1EXBA 1RP8A 2RDUA 3H24A 5I2UA 4H6EA 3WQ5A 3BLLA 1W9VA 2VI0A 4OBSA 4LV4A 4WIWA 3CQHA 1O66A 4L1XA 2BY1A 1MDLA 4JTJA 3UWZA 3W70A 3JZEA 2QDGA 5A8NA 1LTDA 5DRCA 3W28A 1RJPA 1BYBA 2C15A 3P74A 2F61A 4ATDA 3BGJA 3TQPA 4HYVA 1WCGA 3B05A 1TMHA 3U2OA 2RHGA 1O68A 2RH9A 3BV7A 2R1PA 3V35A 3T0DA 2UV8G 2XH4A 3LXAA 1PL9A 2CWXA 3BICA 2ZXQA 4KWSA 3MPGA 4QQUA 2E4TA 1NFBA 2GVGA 3GTHA 1XIMA 3UA3A 4ERGA 1JUKA 1A50A 2BLEA 3MC5A 3MDUA 5LHFA 1EJSC 1GGOA 3GVRA 3IANA 4LEFA 1KM0A 1Q8JA 3S1XA 3A21A 1P0DA 2Z6JA 2RGLA 4Q32A 1XRFA 4M6VA 3LLXA 4C1LA 4O4VA 4PB3A 4R88A 3S2JA 2DU2A 3TROA 1AODA 1YXDA 3WLMA 1BGGA 1K9EA 5FL0A 4CCZA 3TWBA 2ZZ1A 1VJSA 4O0ZA 4GIAA 3M6DA 4Q4QA 4HNOA 3BOFA 4ZTYA 1PX4A 3WJXA 1DXFA 1EA9C 3V3WA 3UWEA 4WDTA 1PBGA 5CPTA 5PTDA 1W9DM 4DZ5A 2QQ6A 3QQ0A 3QY6A 1PEZA 2J47A 3EX6A 1IQ8A 4NILA 1XM3A 5EMKA 2Y89A 4WGXA 4FX8A 1ITXA 4UMCA 4HB7A 3DFSA 1Z6KA 3N9RA 4RPPA 1B3OA 4RNHA 5A6AA 4PCNA 2OQLA 2WC4A 5E0FA 4AIEA 1U1JA 3VK5A 5H91A 1S1RA 3N29A 2ACQA 2WM1A 1CGTA 2NWRA 4FNRA 2A6NA 5HQEA 1IT7A 3GU9A 3HGSA 2OPJA 3R58A 4P8VA 2VKZG 1JDCA 4P7QA 3M44A 2JF6A 3LHVA 1ZNNA 1VFUA 2RKXA 1X98A 1IT0A 1AL7A 3ME3A 5HBFA 5DMLA 1JZ6A 4WDWA 2C79A 1I2PA 3WBXA 4X0VA 3UESA 1SO5A 4Q3MA 3M43A 1GVEA 5A6MA 4ZXOA 3HBLA 2QJHA 3JU2A 2WWDA 3IIPA 3JZUA 3WNOA 5C54A 1MQPA 3AIBA 2IW0A 1LT7A 1XIBA 4M82A 2DY3A 1MSSA 3IIVA 4JY8A 3QGAC 1V6WA 3HURA 4H7VA 1E6ZA 1LM1A 2ZXAA 4P7NA 3NQ2A 5I03A 4GYPA 3WBYA 4UTLA 3AROA 4GNJA 1BFNA 1FH7A 3EMQA 4LALA 2PDLA 4S23A 2H9AB 3RM4A 1WZKA 3FYYA 1XGZA 3HPFA 6ENLA 5DMYA 1TCMA 5FIPA 4J3TA 3W85A 4OVXA 3CZ8A 5A2BA 1KFCA 4Q6JA 4DYJA 4XIAA 4N9BA 3H2AA 4O12A 2NQZA 2DSKA 3ARZA 3OVQA 5IRPA 2XTKA 2VO5A 1U1HA 3HM7A 1E6XM 4WDXA 3WH7A 3MUY1 5DXXA 4O1DA 2QCNA 4UNIA 1RA0A 3APYA 1CIUA 2EPOA 4KWVA 3S83A 1M7JA 3O07A 3EWWA 1FRBA 4PBGA 1FWDC 4QAWA 5AC7A 3CIWA 3T78A 1DEDA 4MJMA 3BJTA 2WXDM 2YL5A 3G22A 2D3NA 3ZVHB 1FH8A 3WQOA 3WQEA 1UH2A 2PURA 3LERA 1VYPX 1A80A 3T4CA 4EKJA 4CEXC 4GUFA 3GAKA 1BGAA 2Y4SA 3GTNA 3LI1A 4PRRA 2GJPA 3GD6A 4JL1A 5A8MA 3IGSA 3ICJA 4JTCA 1UQYA 5K7JA 4AFYA 4Z17A 3ZQ9A 3C2OA 3CZGA 3CUXA 2V5BA 5M17A 1MFVA 3UF9A 2XGZA 4FR1A 3KVJA 1VEPA 3BW3A 1DJHA 5BXSA 3VD4A 4GNKB 3VM5A 4UQDA 1CLVA 4ZENA 2XSXA 2QDHA 3VDCA 4GYFA 4NZFA 2V6AA 3GKAA 4AVFA 2BMBA 1EJ7L 2YW4A 2YDRA 4L61A 5GJNA 2VEFA 4JXCA 3G1XA 2E5BA 2A85A 3W07A 1SPQA 3HB9A 5T91A 2JBMA 3O2LA 3FJ6A 4FIRA 3NZGA 3KM8A 3AMGA 3PP7A 2QW5A 2GWGA 3FFSA 1W54A 4JTHA 1A5LC 2PU0A 2VRJA 1UKSA 1LQ0A 2W61A 4IQJA 5TIMA 3W7RA 1V8EA 3QZEA 3E2SA 3AHTA 2AAMA 1RVGA 1WOAA 3QBUA 6PTDA 3C3NA 3AHXA 3PZOA 1UWAA 3GAYA 3KRUA 3VKCA 2C91A 4F2UA 2IPFA 2W67A 2ZRZA 1Q6LA 1IZKA 1R38A 3MI6A 3PBMA 4DNHA 1EX1A 3RPDA 2PWHA 2QIWA 3OZYA 4QISA 4DUOA 3HMCA 2UZ9A 2PGWA 3AJXA 4KEMA 5K3VA 4JIEA 4QDWA 2IXVA 4K1WA 2PTYA 3WDJA 1TQXA 2G37A 3N2CA 3MUAA 2DSWA 2PCEA 3VIJA 3TKFA 2VX6A 4LU0A 1XQKA 3BZGA 4IQLA 3WUFA 3WKZA 3NZPA 3WD2A 1F73A 3UXLA 3GHUA 2CZFA 2P3EA 2Y7DA 1OG6A 1FOBA 4NU7A 2PE4A 2WHLA 2VFIA 3WNNA 4JX4A 4UOQA 2WZTA 3W7NA 5L9FA 1UP2A 3IARA 3OBKA 3E96A 2VL4A 3NTYA 3PZMA 5C