4GYFA

Crystal structure of histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. lactis il1403 complexed with zn, l-histidinol and phosphate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
263
structure length
263
Chain Sequence
SLKKLDYHFHSHFSADSEELPRKHVTEAIAHGLEEICFTEHRDFYFPGMDFSLNLPEYFQEINQLQAEFKDKIKIKIGLEMGIDLRFKSEINQFIDSAPFDFVIASVHEIGDIEVYDGTEFYLQKTKEEAQREYLLACLDVVQNFENYNSFGHLDYVARYGPYTDKSIKFAENREILFEILRALASKEKALEINTRLFDDPKTEQFYSDLLINFKRLGGKFITLGTDSHIAKRDWLSIHKARTLIKKAGFHELATFSGMKIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol-phosphatase
publication title Crystal structure of histidinol phosphate phosphatase (HISK) from Lactococcus lactis subsp. lactis Il1403 complexed with ZN, L-histidinol and phosphate
rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
total genus 112
structure length 263
sequence length 263
ec nomenclature ec 3.1.3.15: Histidinol-phosphatase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02811 PHP PHP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gyfA00
2GOKA 3SFWA 4ZSUA 4H9YA 1P6CA 3MKVA 1RK5A 4LCRA 3LA4A 3PAOA 3O0FA 2EG8A 4C6BA 2WJEA 3IJ6A 2Y1HA 4ERGA 1KCXA 3BE7A 1FWHC 4H01A 3NURA 3S4TA 4IG2A 3TN5A 3OQEA 1A5MC 4RZBA 3IARA 3PNZA 4LCSA 4C5ZA 1P6BA 1ONWA 2GWGA 4EPDC 1UBPC 3CJPA 1K1DA 2OQLA 2FVMA 2VR2A 4LAOA 3K2GA 3TN3A 1FWEC 3LNPA 4G7EA 3A4JA 4DYKA 1FWIC 4RE0A 2O4MA 1EZ2A 1UIOA 3GU2A 4KIRA 2DVTA 3G77A 2BGNE 2O4QA 3WZ0E 5AKQA 3EWDA 4KEVA 1QW7A 3LSBA 4RDWA 4C65A 2HQAA 3N2CA 4H9TA 4GZ7A 3UBPC 4BY3A 2HPIA 2F6KA 4GOAA 3F4DA 3GU1A 1KRAC 3LY0A 3GRIA 4J2MA 2Z7GA 2R1PA 3NEHA 1PSCA 1W1IE 4DNMA 4GYFA 1ITUA 3NQBA 1UMLA 4F0SA 4OFCA 2GZXA 2E25A 4PCPA 3GTIA 3RYSA 1NDVA 1RJPA 1J6PA 3O7UA 2QT3A 2Z27A 4C6MA 4XD6A 4DLMA 4GX8A 3KM8A 4HK6A 4L9XA 2VUNA 4QS5A 4LAMA 2WM1A 4LANA 3IPWA 3V7PA 4C6QA 3URQA 3F2BA 2UBPC 4KESA 1GKQA 4V1YA 3OOQA 1R9YA 3URBA 2VHLA 1J6OA 4M51A 2PLMA 3FDGA 4WGXA 4CQBA 1XRTA 3OU8A 1NDZA 4KEUA 3GTHA 4R7WA 4Z42C 5FSDC 2Z26A 4GC3A 4CNSA 2OODA 2OGJA 1YBQB 1BF6A 4J5NA 1EJUC 2Z24A 1FWFC 4TQTA 4H9MA 3GTFA 5FSEC 2VM8A 4DZHA 1RK6A 1EJRC 4XAYA 1I0BA 2PGFA 2YZ5A 4XD4A 4L6DA 4C6LA 1M7JA 4H9ZA 2YB1A 2A3LA 2R1LA 1PO9A 2RAGA 3ORWA 1ONXA 3S2LA 3PBMA 4DI8A 1PB0A 4CNTA 1NDWA 4BKNA 2ICSA 3JZEA 4UB9A 3QGKC 4ERAA 3RN6A 1FWAC 5LXXA 1FWBC 4KQNA 3RCMA 2Q01A 2W9MA 4EPEC 4GY7A 2YXOA 5A6TC 2QVNA 4DZIA 4RDZA 2D2JA 1V51A 1S3TC 1KRMA 1I0DA 3DCPA 2DVXA 4XD3A 1A5KC 1YMYA 3DUGA 3E38A 2PAJA 1YNYA 1EJSC 2ANUA 1VFLA 2Z25A 3OODA 3OVGA 1V79A 3EGJA 2E1WA 2I5GA 4GK8A 2ZC1A 3F2CA 4IH3A 2Z00A 4XAGA 4D8LA 3MJMA 1FWGC 3FEQA 4YIWA 1KRCC 4XAZA 4GBDA 2HPMA 4ICMA 1RAKA 4QSFA 1RA5A 4NI8A 4IFKB 3ITCA 4C60A 2Q09A 1EYWA 3B0YA 1P1MA 4KERA 2FFIA 4RDVA 4C6IA 4C6JA 3IV8A 1EJVC 4EP8C 3S2NA 1GKRA 5E5CA 3GIPA 4RDYA 4P5UA 4LAKA 4NP7A 3LS9A 4EPBC 1WXYA 4C6PA 3IACA 4HK5A 4E3TA 2CZVA 3TN4A 4C6EA 3PNUA 4CEXC 1V77A 3WYZA 3T8LA 3F4CA 4AC7C 4QS6A 3MVTA 1RJQA 3GIQA 1M68A 3GUWA 2R1KA 1A5OC 2QS8A 5HMEA 3DC8A 3PANA 3K4WA 3E74A 2GSEA 3ID7A 2Z29A 3SO7A 1NDYA 4B91A 4LEFA 5HMFA 2D2HA 3AU2A 2AQVA 3S2MA 4PE8A 1FKWA 3EWCA 1K6WA 3E3HA 1WXZA 3QY6A 4IG2B 4WVXA 4F0LA 3UR2A 4KETA 2XIOA 1ITQA 3F2DA 3AU6A 3MDUA 4C6DA 3HM7A 3URAA 4BJHA 3CAKA 4C6KA 4G7EB 2QPXA 4QRNA 1A4LA 1EF2A 2D2GA 2Z2AA 2HBXA 1FWDC 2Z2BA 4CQCA 1FWJC 4WHBA 1J79A 4H9UA 3ISIX 4PBFA 2I9UA 4UBPC 4C6NA 2IMRA 2R1MA 3FDKA 1RJRA 4H00A 2PUZA 4R88A 1A5NC 1XGEA 2FTYA 4DO7A 1XRFA 2UZ9A 3MSRA 2WJDA 1V7AA 4I6KA 2YB4A 4CQDA 3QY8A 2ADAA 3E2VA 1E9YB 3UR5A 3B0XA 2PGRA 4ZSTA 2OOFA 4IF2A 3MPGA 1EJTC 4KF1A 1K70A 3D6NA 4KEZA 3WMLA 4AQLA 4CEUC 3OJGA 2KAUC 4JOMA 4MUPA 3HTWA 4CNUA 3A3WA 3LGGA 5HMDA 1R9XA 5CH9A 4I6VA 3GG7A 1YBQA 2FTWA 4LALA 2FVKA 4GY0A 1GKPA 3UPMA 1POKA 4H9VA 2EG7A 3HPAA 4EPKA 1FWCC 3ICJA 2R1NA 1XWYA 4G2DA 4NG3A 3T81A 4HJWA 2G3FA 4HA0A 3URNA 5G4HC 4IGMA 3TN6A 4PCNA 4B92A 4XD5A 3TNBA 2OB3A 4C6OA 2AQOA 3LU2A 4J35A 2VC7A 1QXLA 3UF9A 2EG6A 2HNHA 4H9XA 4F0RA 1RA0A 4HK7A 4IFRA 1M65A 4INFA 3LGDA 4GX9A 3MDWA 2P53A 1IE7C 4QTGA 3QY7A 1O12A 3K5XA 1V4YA 1POJA 3LSCA 4B3ZA 3E0FA 4ERIA 3AUOA 4PBEA 2VC5A 4B90A 4DI9A 1A5LC 1FKXA 1ADDA 3RHGA 1DPMA 2P50A 3R0DA 2Z28A 3GU9A 4IGNA 3QGAC 1ZZMA 1EJXC 1HZYA 4C5YA 4R85A 3S2JA 3C86A 4IFOA 4V1XA 4IQJA 2GWNA 1YIXA 1JGMA 1UIPA 2DVUA 4C6CA 3IGHX 3MVIA 2AMXA 4IFKA 4LH8A 1J5SA 4GY1A 4QROA 4XAFA 4C6FA 4DLFA 1A4MA 2WJFA 1YRRA 4GXWA 3A3XA 3MTWA 4LFYA 1R9ZA 3E0LA 1O5RA 1E9ZB 3T1GA 4DIAA 3GTXA 1KRBC 1PTAA 2HBVA 3CS2A 2Z4GA 1NFGA 1EJWC 3B40A 3IRSA 2BB0A 4LCQA
chains in the Genus database with same CATH superfamily
2WKLA 3HB9A 1CENA 2CHRA 1LWIA 3A24A 2DT1A 3GLCA 4M56A 2BP1A 4TXEA 2CNCA 3DG3A 3LOTA 3UJRA 4RNJA 3ARXA 2YIHA 2VT0A 4EPDC 4O50A 3W4RA 1BXBA 1ZCOA 1S5TA 4HSNA 3CQIA 3SCWA 3BW2A 3CEUA 4AYSA 4B5TA 1QPRA 2B0MA 2BHYA 3GU2A 1XIJA 1MEIA 2C19A 3G77A 3NQ6A 5TBOA 2VWSA 2JGYA 2VFFA 3OP2A 3VCCA 2RGMA 1GONA 4RDWA 1W2VA 4G1NA 3H4WA 3AWOA 2BY2A 3GU1A 3ARYA 2HMCA 3GNDA 5JQ9A 4CU8A 4HPHA 1PUDA 2WAGA 3VM5A 4YCPA 3K30A 4UQ9A 5AC5A 4PTXA 3UJEA 4RE4A 5I02A 3WFZA 3EB3A 3FV9A 1TE1A 3VU2A 3DFSA 4HMEA 1BWKA 3PFMA 3V1HA 3L2IA 2Y24A 1VFUA 2E4TA 4LANA 1VIZA 4FX8A 4PMYA 2BODX 5D4YA 1NIUA 4EXQA 1TV4A 3OOQA 3W7JA 2Y88A 8XIAA 1NDZA 5CLWA 5MKGB 4PMXA 2WSRA 1HVQA 1J9YA 3BH4A 3PHAA 4MY1A 5C6MA 3S6OA 3WDQA 1B0IA 3K46A 4JFVA 2W66A 3NVDA 3NZ1A 4HNOA 3V3WA 2Y8UA 5ABFB 4PN2A 5M03A 3KCLA 4XV0A 3CUFA 3GZAA 4M1BA 2V6AA 3NO3A 2ACRA 3GDRA 1GG0A 4JQ3A 1XSKA 1IV8A 1IZJA 4B5XA 2FFCA 3QGKC 3CQ0A 2CZEA 3KOFA 3VX0A 3RCMA 2Q01A 3KLKA 4UTJA 3P0WA 4GUFA 4YHGA 1YADA 1G4PA 5M1TA 6ALDA 4ICNA 1NOUA 2JKAA 3GHTA 3AIQA 2XVNA 1V79A 1MRQA 2E1WA 1NWTA 4GK8A 2P1FA 5A5WA 3MJMA 1KRCC 3GSMA 2OU4A 1W5NA 5FF4A 3B97A 3WJZA 4CNNA 4JNYA 4O15A 4LVBA 1F3XA 4HNTA 2OGYA 2VDGA 1Y0EA 3Q37A 5M2FX 4Q6XA 4ML4A 1EBHA 3A23A 1WBJA 4FK9A 1E6QM 4QDMA 3L4YA 3VFLA 1YPXA 2DGAA 2EO7A 1TMQA 4H41A 2ON3A 2XVGA 1R86A 1DL3A 3QHNA 4ZXOA 2WCAA 1V02A 3LV6A 4H7ZA 2HE5A 3E74A 1MW1A 1NDYA 2WNWA 1OSEA 2XZ7A 2ISSA 3BMWA 1C90A 3SDOA 1SU5A 1OGBA 4M82A 3SM0A 4AZ6A 4D8AA 2J77A 3E3HA 4PEKA 3E0WA 3FIGA 5FA5A 3GD6A 2INZA 3VIPA 3C5QA 3HM7A 4LAZA 3OO2A 3P5YA 3W88A 1JEZA 4GQBA 4LUTA 1EF2A 2OPJA 2HBXA 4GPNA 1ELSA 2CLMA 1H7PA 3ANYA 3O07A 1SJCA 3PBVA 4JTEA 3TCSA 3R8HA 4LUSB 3OW1A 1QO5A 2XJ7A 1QPKA 3WUEA 4AD5A 1PXGA 4I6KA 7TAAA 1MXGA 4M7TA 4D6EA 5BZAA 3GR8A 3UWEA 4QISA 3DFNA 1S1PA 2DY3A 4JR5A 4L6OA 4O4VA 4XVEA 3BK0A 2IPGA 1EX1A 3IV3A 3ABQA 4AFYA 3P93A 1OF8A 1AQ0A 2NSXA 1TFVA 4UQAA 4JXCA 5K4ZA 3ZT6A 2OYMA 1WB0A 2J13A 4I6VA 4S39A 1ZS2A 3P74A 5BXSA 1O5XA 1V6UA 5CGQA 2FPTA 2EPKX 1ZP3A 4WZHA 3JR2A 2V2CA 4EXAA 3M5XA 3WNMA 4B2DA 1DWAM 4AHOA 1R3VA 4RV3A 1X7IA 5D9OA 4QLLA 3URNA 3IWPA 3VD3A 2PTDA 3L0GA 1J8VA 2QCMA 1PYFA 3PG9A 2VC7A 4YCOA 2AQWA 3WG6A 3LYEA 3W1XA 3PUOA 4EF9A 4L80A 4ZO7A 1B30A 1D3GA 2DZXA 2QDEA 5ECUA 4L64A 4YS1A 3VAVA 2V63A 4B3KA 2GSHA 3CHCA 3N73A 3VNYA 3TW6A 1UUMA 4MB4A 3ZFHA 2VUYA 1KXHA 3UZXA 3EWUA 3W07A 5A2BA 4W8LA 1LYXA 4B90A 2WC7A 4E8DA 2Z0IA 3R0DA 2E8YA 3R2GA 1B3ZA 1IR2A 3EDDA 4M6QA 1TVNA 4RXGA 3WQDA 4R85A 3WQ4A 1VGAA 4Z0JA 1WYIA 4US6A 4OU1A 4UQBA 1RQEA 2YJQA 2VR5A 2WJFA 1HKMA 2YCEA 4M6UA 3UU0A 1ZP4A 3A3XA 3BGJA 2ZZ4A 4NT0A 3DERA 4QDWA 4XKYA 1JDAA 1XYZA 4AWTA 4AVNA 2XIMA 2W27A 3C2FA 1YDOA 5FD0A 5IBXC 3LHYA 4Z1AA 4BEQA 1FCUA 5H8MA 5I78A 4FHAA 3CZJA 5D03A 2P3ZA 3XINA 1AH0A 4LF2A 4PH6A 1UKTA 4H4IA 4Q8WA 4LCRA 1A3XA 3SN1A 3RXZA 2XSAA 1JZ6A 3QV7A 1FWWA 1RR2A 3SEPA 3RMEA 1FWHC 1M9HA 3W1MA 3S4TA 4REQA 2PDPA 3TFCA 3L65A 5CSYA 3DC0A 1F3EA 5CC3A 2VR2A 3TN3A 2BOGX 5HULA 1M04A 4RE0A 1J2WA 4AXNA 1EZ2A 3ZXWA 3AMKA 4EOUA 1JNEA 1FWTA 5AHEA 4WKAA 1QHPA 1GGOA 4HPJA 2BGNE 2R9RA 4M6PA 2FGZA 3W26A 1Q66A 4BY3A 1JZ8A 2CHOA 1UWQA 3TONA 1KBLA 3BJTA 4UFLA 2DU2A 1W9BM 2WSYA 2INFA 5IOBA 1P7TB 2Z7GA 4P7NA 2D1ZA 5I09A 2E5CA 4FI4A 2J62A 4ZR8A 1OFQA 2WMHA 3NQBA 5DCDA 3VNMA 2GUYA 1TTIA 4JS3A 1RJPA 1JI2A 2ZA3A 2WQPA 1YLVA 4MPQA 3GXIA 5M5DA 1KM3A 4I9AA 5AYBA 4B5VA 3ZIZA 2EBNA 4W8BA 4NQ1A 1UR9A 4O8RA 1EC9A 2NWSA 3CMFA 3RIKA 1JYXA 1V02E 2OODA 4BHYA 2OGJA 4JQ4A 2ZRZA 3PUGA 5DY2A 2C13A 1OT1A 2VD9A 3HA1A 3IIOA 4FS9A 3VKCA 4H9ZA 3TSDA 4AEOA 1PO9A 3MUAA 4D1IA 3PC0A 3T08A 2VFHA 2RDXA 2FJKA 3L9CA 1SQ7A 4BKNA 5JIPA 3PPCA 5IXEA 2ZICA 4NRSA 5ABHA 2JEPA 4I5UA 2ZX9A 2NQHA 2ZXAA 3WLTA 2YXOA 3JS3A 4J4KA 3ZSTA 4L4PA 3OZMA 2ZUNA 3LHTA 2MNRA 4MKVA 4ATWA 4E4PA 4GNVA 1Q7MA 3BAYA 1W3NA 4J3UA 3HPXA 1V3JA 4FOUA 5BWFA 5HR7A 4DUWA 3EX2A 1W9PA 1RZMA 1OGGA 1YX1A 3MSYA 3UXAA 2E6FA 5GNZA 2GUBA 1UR4A 1MUWA 1S5NA 4EAYA 2JKPA 1DIEA 3GXPA 3N9KA 4GFSA 3NSXA 3VKJA 2E5DA 1A3WA 4IJBA 4Y6GA 1NEYA 5IFPA 4LAKA 3MYOA 3TZFA 4U2ZA 2BVDA 2V81A 3LHVA 1F07A 1R3QA 4PFHA 1D3CA 3QXBA 1W1ZA 4WIWA 5EMJA 4AC7C 2EKGA 4R33A 1TPFA 1PIGA 1EOMA 3JZUA 1LF1A 2AOSA 3W6YA 3WO8A 5CC7A 2NQLA 1WDWA 3HMJG 2PRHA 3A13A 4TMCA 3GKAA 3S5SA 4J40A 2CKRA 4Z0SA 3OZYA 3TROA 3ZO9A 3WH8A 1J18A 3BANA 4C1LA 1FHVA 1MZRA 2IKGA 2OQYA 3BLFA 3FCPA 4V2XA 1U1HA 2QCDA 1CLVA 3TQVA 2PZ0A 2HTMA 3NQ8A 3HIJA 1A3HA 3WLRA 1K77A 3N04A 2Y7GA 3L4UA 3GR7A 4ROPA 4FOJA 1RALA 2Y63A 2VKZG 3RF9A 4GC4A 4H00A 3WD1A 1VFFA 3H2OA 1HO4A 3W75A 3QZAA 3N12A 1XG3A 3LZ3A 3LZ5A 4CQDA 1O1ZA 3G8EA 3E5BA 2O9RA 2CBIA 3VOCA 1UCWA 4ES4A 3N17A 1XKJA 3VOGA 3D0CA 2QCLA 1OFRA 4ZBCA 4UTTA 2V3EA 3FJNA 4BQ5A 4MLJA 1UKPA 2NQ9A 1BQGA 4OBTA 2SFPA 4MKSA 1PX4A 4ATLA 2ACQA 2HVOA 1YBQA 1W3HA 3ARVA 3P6LA 2XISA 4Z1BA 1Q65A 2CZDA 3SBFA 5LIUX 4O16A 3T81A 2BBFA 1MEWA 3HN3A 1W17A 4IGMA 5D37A 1OD8A 3TN6A 2DEPA 1TPWA 1TWSA 1E9LA 5A69A 3UF9A 3GB6A 2W0UA 2ZYFA 1VLWA 3WBAA 4B2DD 2TYSA 1ZUAX 2O7SA 5TNVA 1MFUA 5EU9A 1IR1A 2XGIA 5IBXA 3L2LA 4FLQA 1XSJA 1H1YA 4J3XA 3P81A 2NV9A 5F2GA 3CH0A 1K02A 5EMYA 2IPFA 3G1HA 3B8WA 5A8MA 3HFYA 3IJIA 1OYBA 1A5LC 2WHLA 4PUEA 3SRFA 1GJPA 3ARSA 3GU9A 3UVAA 1J5TA 4Q4RA 2J66A 1PX8A 4XO7A 4LPCA 1HQTA 4V1XA 4UTWC 4E2OA 3EMZA 4O54A 3MVIA 3TIMA 2AMXA 4QM1A 5RUBA 1J5SA 1US2A 4JTLA 2G3IA 4O1DA 3IVSA 5GPRA 3NCOA 5C54A 3N14A 1HG3A 1DEDA 2E09A 3NR0A 3GVQA 4B5SA 1V6WA 3GW3A 2IPJA 7ENLA 3VIFA 4DO4A 4K36A 2Z4GA 4AUBA 2WCSA 4IMGA 1QATA 2AGTA 2P0IA 5D8ZA 4O19A 3S9ZA 5DMLA 4ZSUA 5A6AA 3MBDA 4DUVA 1XGDA 3G1DA 3BGGA 1TREA 1I4NA 2WMIB 3BL3A 1RBLA 3W7CA 3WNOA 3R8GA 3CZGA 1OJXA 3TW7A 3HPSA 3NURA 4AD4A 3T0AA 2YCJA 2RGLA 1GTEA 1Q6CA 4RZBA 4HPGA 1GVRA 4IMCA 1TB3A 4LAUA 2BZNA 1FWEC 4NIRA 3TTSA 1PZ3A 4ZCWA 3FA5A 3NPWA 3BICA 2OT0A 4IXHA 1G1YA 1V93A 2DJXA 5CZ0A 4JQ1A 3OBAA 1OGSA 2XM2A 4HSHA 1E6PA 4NZ3A 1Q7QA 3AXIA 1TV8A 4LVFA 3UBPC 4H7CA 3F4DA 3UD6A 1DJXA 1FDZA 1TV5A 4DBWA 3WLQA 3B3DA 4A8RA 3AS1A 3QR0A 3LMZA 3TWBA 1TV2A 5JU6A 2WZEA 4UFIA 1EF3A 2WZTA 3MQTA 4DLMA 4LYKA 4GX8A 2RJGA 3PZQA 4ZE4A 3HFTA 1VZWA 2VUNA 2PMQA 3EOLA 4QS5A 1RCXB 1H1ZA 3H8AA 3WQOA 3QLDA 3YPIA 3AYRA 4WDXA 1R9YA 3KX6A 3WBWA 1TQJA 5C9WA 3EWXA 1SSDA 2VFGA 3W81A 2PCEA 3IUIA 3KHJA 4FX7A 4YHEA 1OYAA 2NVDA 4NXSA 1FHDA 3FSTA 2G41A 4Q4KA 3HMCA 1HIZA 1E72M 3F4NA 3I3BA 9XIAA 2PZNA 3K4DA 3SCRA 1FBAA 3GZ3A 3B8IA 2BY3A 5FJUA 1G0CA 3VIKA 2TRSA 1RCOB 1FH7A 3VNJA 1SUXA 3MP4A 3TE9A 3TXVA 4I5RA 4RDZA 1UKQA 1V51A 2C71A 3UPWA 2XVPA 1JPDX 2J25A 4I5XA 1J0HA 3H2NA 2V69A 1JCJA 1GQLA 1DHPA 3BAWA 5D32A 4Q8PA 3TSBA 1KFBA 1XINA 4MNMA 1FWGC 1SGJA 1KTCA 2HPMA 4E2VA 5JH1A 1Y65A 3CIWA 3NPXA 2D2OA 2XH2A 4W4QA 1EYWA 1IT0A 2E6DA 3QBUA 4HU4A 4C6IA 4LC8A 3MZNA 2PDFA 4X9SA 3WFLA 3D3FA 2FDSA 4JY8A 5TF0A 4A8LA 1ISXA 1EDGA 3B9DA 3PBUA 2EGZA 3UFYA 1WZAA 3F4CA 1GOMA 2HDJA 3RU6A 3QQWA 5AHLA 1F05A 3QVQA 1GOXA 1JYVA 3DYOA 1H51A 3T2PA 4AZ7A 1C91A 2VCAA 1DJGA 1Z89A 2HS6A 4KCUA 3KBSA 3BMXA 4PUJA 3WD3A 4B91A 2FGBA 4NJKA 4CNOA 4DBDA 3S9IA 4KETA 4NZ4A 3EDFA 2OX4A 5HUOA 1QNRA 2XGBA 3CWOX 4QJ5B 2V5LA 1X8FA 3RJXA 4GH3A 3MMUA 4BF7A 3MUIA 1A4LA 4B4HA 4CQCA 3T9PA 5E1QA 4JYDA 1FWJC 3LTPA 4J27A 1E0TA 2HWGA 3CO8A 1KFWA 7REQA 3STPA 3FA3A 4F40A 1EGZA 3CUHA 4K8HA 4TIMA 3STFA 4QHRA 5LNRA 4GYPC 3ZVHA 3E2SA 1E4MM 5GJNA 3VD7A 4JTIA 4JFUA 4IX0A 3TJXA 3SCTA 4H1ZA 4O1BA 5F4SA 5A8PA 5C70A 1VYRA 3N4AA 2OQHA 1EUNA 1ZJBA 3UW6A 4GVGA 7A3HA 1X39A 4CEUC 3HTWA 2CZ5A 5AFDA 1MYRA 5HMDA 5CH9A 2DZSA 4P2VA 4NY2A 2DUZA 1CEOA 2G96A 1WZLA 4QE4A 4HHMA 4ACZA 4NYUA 3GH7A 4MWAB 1VCGA 3PM6A 1KFKA 4XSLA 3ALFA 4AZBA 4B3LA 2O9TA 4HA0A 1IHIA 1YEYA 1JR1A 4R3UA 3CZLA 1K7FA 2NX9A 4GUIA 2AQOA 4A3RA 2P76A 4NX5A 3L5AA 1XRSA 4LRTA 1BSLA 3GBDA 4DWSC 4X2RA 3VX1A 3KDOA 4K1WA 3EA3A 1XYFA 4XB3A 2Z1SA 1HJVA 2XYLA 1UR8A 4HU0A 3KP0A 3ABZA 1DWHM 3IIPA 3GAKA 1U1UA 1BTMA 2NT1A 3KDNA 1JF5A 1HZYA 2X1SA 4K3ZA 2Q02A 5EYWA 3C86A 4B16A 4XAPA 5M3WA 1TPC1 4IFKA 1NOWA 5HPCA 4YVVA 1KB3A 1XJBA 3R94A 5HNRA 2VCCA 3WEZA 1GQIA 3TP4A 3G5EA 3UZJA 1RBOB 3M6YA 1Z32X 2GGEA 3DGBA 4IMFA 3CV6A 3WNKA 1ICSA 2ZUVA 2D20A 5HJXA 1ZY9A 2XN1A 5D38A 4Q4QA 1MUCA 2NV1A 2F2KA 2BB0A 3CWHA 3LUTA 3EPOA 4POCA 1B3YA 3NQGA 4AC1X 1FH8A 3R43A 1XIFA 2ESCA 3L4ZA 4YN5A 2HXUA 1KCXA 4A6GA 3S1VA 2CWXA 1JD9A 2Y5JA 3H7UA 3LXBA 3MSGA 3TOPA 3BLDA 4M19A 4DBUA 3AIVA 2VEMA 3KS6A 3K2GA 4G7EA 1WOAA 1LLOA 4FSAA 3K8LA 3RFAA 2ZRXA 2UY4A 1HO1A 3RM9A 1AL8A 1OK4A 2QMJA 4O0KA 4JTQA 8A3HA 1M3UA 4GMEA 3WZ0E 5AKQA 3LSBA 4MSSA 3LPFA 1KV5A 4Q8OA 1JUKA 1NM9A 4DO5A 2PFHA 1VPXA 2V9DA 2VYOA 5CPOA 3DFPA 4AX6A 3UJSA 3LTSA 4Q8NA 1KXVA 1E6RA 3O15A 3EWBX 4XKYB 1PSCA 2QCCA 3S6TA 4ONVA 1AVAA 4R27A 1D9EA 3NAVA 3PSVA 1J96A 3DECA 4QDPA 3AJXA 2FHBA 3PZOA 2WHMA 2Z27A 2WJZA 3QPYA 4PRRA 4MMWA 3WDHA 3KM8A 3QJAA 4L9XA 5EA9A 4RNFA 1BXNA 1VIWA 4UTUA 4GG9A 1QBBA 4W5UA 3ONCA 3LCLA 3RPMA 3OU8A 4KEUA 4REQB 4Z42C 2Z26A 5T8GA 2PPGA 3BQ6A 1GEQA 3PB2A 3CO4A 3MMWA 4ZE5A 3GTFA 1ZBKA 2AL2A 2EF9A 3W82A 3EAUA 1EJRC 3N3MA 2C14A 3UQNA 5IHRA 1MO0A 2X0HA 3FFSA 5K9DA 1FHLA 2TMDA 1EP1A 2RH9A 1ZRQA 1TTQA 2VURA 5AVNA 1SFLA 4J28A 4MGGA 3RCYA 3AHTA 2PD5A 1RP8A 1OCNA 5H2ZA 3VGGA 3FGCB 4NKCA 1U83A 1DQUA 5A6LA 5DY3A 3SY8A 2W9MA 4W7UA 1H11A 1XBVA 3LD5A 4XK2A 2C15A 2XH0A 3WIJA 2EPHA 3VMPA 4IZGA 1K4HA 3BLPX 1OFOA 4FOKA 5KMYA 5D33A 1H62A 2PDLA 1VD6A 2HVMA 3QV9A 4P8WA 3ES7A 2PI6A 5K3VA 4KH2A 1TPEA 4FF5A 4IX2A 3WCZA 4BCEA 1RPXA 3EX3A 4ENLA 4NI8A 3GDTA 1C8VA 4C60A 4HMNA 2BG5A 1A49A 2DZBA 3K1GA 3SN0A 2GDVA 1Y7VA 1HTIA 3M5VA 4XUGA 1L6GA 1YYAA 1NH6A 5HATA 1DXFA 4UZSA 1NWRA 1V77A 1LT7A 2BHZA 4KT2A 2F61A 5CBJA 3M0MA 1XLEA 2Q6ZA 2PSNA 4PODA 3U2OA 5CQ1A 4GYPA 1GOIA 3RRXA 4WDTA 2CC0A 2FH8A 3VPLA 4WXZA 1WO2A 1OIMA 4V33A 4GIEA 1MEHA 4KGJA 3NQ2A 1E56A 3VIMA 2QJIA 2VZTA 4MFDA 4F9DA 1MZHA 2XIBA 5AN7A 1LG2A 4GBUA 1CB7B 1OC6A 1CNVA 1CLKA 4B9YA 4D6FA 5GJPA 4D6DA 5CXPA 2VGIA 1OX4A 2DIKA 4MY8A 2PUZA 5I00A 4DAIA 1X6LA 2I16A 1V7AA 3MBFA 1SW7A 3CUJA 4O1EA 2Z2UA 4N6EA 4CVWA 5A6SA 4UTHA 4F4RA 4H7VA 2QLYA 2DT3A 4JQ2A 3A47A 3L4XA 2PGRA 1Z48A 4HYWA 1XLFA 1UD5A 1BYCA 1XLHA 3U7BA 4MZYA 3NWRA 1V6XA 4L9ZA 2AGKA 2V5CA 2GSJA 3E96A 5CZJA 3QTGA 3IUHA 2YYUA 3AI0A 4GQRA 1HKWA 1VLIA 4DJDA 3A6OA 3ABRA 3GYEA 2ZRVA 3ICJA 2QUUA 1QWGA 4IPPA 4HMCA 1EP3A 2HCVA 3WK0A 4G2DA 1HP4A 2W5FA 3M1ZA 3KL5A 1JYWA 3F4VA 4S3FA 2QCDB 3EXTA 1E70M 2BLEA 2W79A 4B92A 1ZLPA 3C52A 1JCMP 4C6OA 2BVTA 1CBGA 5F4XA 4IFRA 1TYGA 1T7LA 2UY5A 5I3JA 4QLJA 4FNPA 1VKFA 4D6GA 3ZT7A 1W0MA 1HL2A 3E0FA 3W71A 5BRBA 3SY1A 4MDPA 1RCQA 4MB5A 3ECQA 3TA9A 3BC9A 5HR6A 1X98A 2W67A 1OM0A 1ZZMA 4ZZ9A 5CG0A 1UJPA 2E5BA 1XV8A 2NT0A 3RX3A 2DVUA 1Q7ZA 3ARUA 5KZEA 2EPMX 4OIFA 2QF8A 2J79A 3TKFA 1NF7A 4DYJA 4O17A 1K8ZA 3GTXA 2BASA 3N1AA 5EBAA 1KRBC 1UH2A 3COTA 1HKJA 4QQUA 2YFOA 3RGTA 5I3DA 3KXQA 5E0FA 3SIZA 2X42A 5DRCA 1B2YA 3RLGA 3RO8A 1U30A 2ALDA 3O0FA 1WDDA 3UWVA 5D8WA 1EOKA 1DIKA 1ZJAA 2CLFA 3BE7A 3PPGA 3TXZA 2G50A 3FN9A 4IP5A 2FZBA 1TRIA 1FA2A 3PNZA 3LCXA 1LBMA 3PZMA 3A12A 3PZVA 3CMJA 4JTSA 3HV9A 3OVPA 3TDFA 2YL8A 3B0PA 4N7QA 3KL3A 1UIOA 2QEZA 5I07A 1WDRA 3NQVA 1WZKA 3VNDA 2NQ5A 4CKQA 4QE1A 1AD4A 1Q6EA 3TTEA 2OKOA 4PBGA 4K38A 1KBBA 3SI9A 3PPFA 1WKDA 4H9TA 5K9CA 3NA8A 2CBJA 4GE8A 3PJTA 4GOAA 2EPOA 5E9AA 4KFNA 2DDXA 1IEQA 3AMDA 4ZOAA 3ATZA 3F1QA 1ZFJA 4GD0A 3EWZA 2BTMA 1SJAA 3DEQA 2E25A 1M53A 1PHWA 2Q71A 3OGRA 4L9YA 2X1UA 1KC7A 1KQZA 2QULA 3ATYA 2FTPA 2QVHA 2GVJA 1FFQA 4XG1A 4JQAA 2WKJA 5AZ0A 2ZRWA 2PLJA 3H2CA 4AWEA 3VE9A 3VD5A 2QIWA 2QPSA 2Y62A 4O1AA 2VHLA 4M51A 1QDSA 1QK0A 1TMLA 4OUIA 1V6VA 2OVLA 1ESWA 4S2CA 1HX0A 3MUXA 1XLCA 1XLJA 4OTKA 2W6RA 1R30A 1H49A 1X1ZA 1W54A 4NXKA 1UA3A 4JNMA 3E12A 4JIQA 1ZGDA 4Y8EA 1H3GA 1H50A 3AIWA 5A1AA 4WJEA 1O60A 3UGRA 3W2KA 2P5NA 1M7JA 4US5A 1ADSA 1TSIA 4HZMA 1DE5A 3UZZA 2A0NA 2D22A 1JGIA 1KO0A 3KAOA 3JZEA 4UMAA 4YNGA 4ERAA 3V18A 3LRLA 2OZ0A 4CU6A 1O68A 2ZX7A 5T9BG 4G5DA 4M5PA 1HVXA 3PN8A 3MHGA 2DH2A 4HU8A 4BF5A 4HCLA 1DJNA 3VK5A 1H7RA 3H7RA 2WLZA 3W87A 4NAEB 3WQ6A 3W0KA 3N15A 3MI6A 1MNSA 1EGMA 5I24A 4E4FA 1B31A 1X6UA 1TR1A 3MO4A 4JD4A 3GNNA 1FCVA 2Q09A 4Q33A 1A5CA 1CXHA 1EPVA 1GWJA 3KP1A 1GKRA 3NYDA 2DV0A 4JX5A 1V3LA 3GR4A 3BJFA 1R3WA 2W3ZA 4JTRA 2V8ZA 3P2VA 1W3IA 3PSWA 2DSKA 3DBPA 2E6AA 1UWSA 3NM3A 5CAKA 4V27A 1ALDA 1TJ2A 3PJXA 2QDDA 2VFDA 2FIQA 3FSUA 1W3LA 3WBXA 4WVXA 1VENA 2C6QA 1B54A 1Q8JA 5KZMA 4W9TA 3RAOA 4KIEA 4QE5A 3B03A 3LRKA 1XFCA 3G1SA 4NILA 3VIHA 5C71A 3W00A 4ZTXA 4FXRA 1T6MA 2QPXA 2Y2WA 2EJAA 4JTJA 2RDUA 5KETA 3CV2A 3N2BA 2YL9A 4PCFA 5AYXA 5MHBA 3CIVA 3ISIX 4PBFA 3GNOA 2J8TA 4FMVA 2C16A 2FB3A 4R88A 3RX4A 1PZ0A 4UQCA 5F1UA 1XGEA 2FHFA 4F0HA 2YLAA 2WC3A 1BXCA 2EEXA 4PTNA 4W8AA 3M41A 2CETA 2BFGA 1RXOB 4O8AA 2DH3A 3WEMA 2WVVA 4PA8A 3MPGA 3WLIA 3ZVIA 3VCNA 1XH2A 4XVDA 1K70A 4I8DA 1OYCA 2HE8A 3CT7A 4FXJA 2JEQA 3OJGA 3A3WA 3I65A 5HOSA 5ABEA 5F2IA 2PWHA 3DAQA 4IJCA 4A4AA 3I7RA 4CD5A 3NEVA 4WQ6A 1H41A 5D2YA 2V0TA 2QV5A 2XGZA 1H60A 4FP1A 1HJXA 4DJDD 3POHA 2OB3A 4DXVA 5LA2A 4AF0A 1TTJA 4IIHA 1UBSA 1M7PA 3TTYA 2QKFA 2XU2A 3SRDA 3GFYA 2QW5A 4B3ZA 2H9AB 5DN1A 3KLLA 4DJED 3G2GA 3N2MA 4PBEA 1CGWA 3W7PA 3MU7A 4YWIA 3W70A 1K3UA 1HJSA 4Z2GA 1EIBA 4QP0A 4R9OA 5LIYX 2X30A 4AZIA 1VR6A 1TPVA 4QXIA 4CNPA 2VNCA 5CSSA 3TJIA 4IQJA 1JGMA 1I45A 2DUAA 3E2RA 3T0DA 3ONBA 4C6FA 3CV1A 2D73A 1A5SA 3ABSA 5HBFA 4L1GA 2DIJA 3A4XA 4HNCA 1E3ZA 3VI2A 1O5RA 3VO0A 3N4EA 5AHIA 3LPPA 1JQVA 5EMKA 5DRIA 1D8CA 2QMKA 1Y5VA 4XTIA 4Q4MA 4ZO9A 4JEJA 3E0VA 4ACZB 1AH4A 3VXGA 3TAKA 4HMDA 4JX4A 2J8FA 3A5FA 4Y9PA 4S38A 2OTDA 1UZDA 4WX2A 3MKVA 1KLZA 1KGXA 1ECQA 4LVGA 4PEEA 3FHAA 3W73A 2TAAA 3BAJA 5D05A 1LOLA 3BLEA 3IARA 3TC3A 3HO8A 4K1GA 4IUGA 1K9DA 8XIMA 3W1PA 4FALA 2L5HA 3TZNA 5DF0A 4LUYA 2PBOA 2YCIX 3I68A 1P0NA 3PULA 4KIRA 1PE1A 5H91A 4HD5A 5CZTA 1F73A 1EEXA 1BYBA 4AZHA 3INPA 4MJ4A 3BOLA 5EGRA 2HQAA 4W87A 2XHYA 4K68A 3KZSA 5A6KA 3LRMA 3QPEA 3RM4A 1Y8BA 2R1PA 3QMSA 1G69A 1S5WA 4GIYA 3EXSA 1LDCA 3CL8A 4F0SA 1DJHA 2IUZA 5A6MA 1OY0A 3B8UA 1JCYA 4NASA 3S42A 4Q8TA 1IXNA 4HTBA 4C7DA 2QYGA 2REQB 1GJWA 1DYSA 1H5YA 3AIBA 1PKNA 2GK1A 1IXPA 3GHRA 3AUJA 3V7PA 2HVNA 3NL5A 3URQA 1XS2A 4CUCA 1UW9A 4V1YA 1KM5A 3L4WA 2YCLB 1OT2A 5D2XA 1BQCA 5I3FA 3G1FA 4TOQA 3G6LA 3U4FA 3KTCA 3CK5A 3STGA 1EJUC 1FWFC 1Q6QA 5F2LA 1LCOA 1W3TA 3GXNA 3W7DA 4IISA 2ATMA 1GVIA 4ML9A 1FRBA 2YZ5A 3WEOA 1KR1A 3OGVA 4DM2A 3V0SA 5FJRA 2YB1A 4GYJA 3AMLA 1WKYA 3HQ1A 3CYJA 4YL2A 3WUBA 3BG5A 4WDUA 4J7RA 1LL4A 2OFJA 4MNJA 2R14A 4IXXA 4QEEA 2XINA 2F8QA 3HV8A 3O2LA 4J3SA 1VC4A 1YNPA 3NZGA 4Q4SA 4KWWA 1IGWA 3VD9A 4WEVX 3LQLA 4E2DA 3GH4A 3GDKA 2ANUA 1Y5XA 5LNUA 3WMBA 2YW4A 1S2UA 1I2QA 3TFXA 4YVXA 4WK9A 3M5YA 4GBDA 4XISA 3CPRA 3WQPA 1B4EA 1P0KA 2PWDA 3SRKA 4GVIA 1UWTA 3O63A 4RDVA 2PLCA 2DZPA 1DIOA 3U2CA 4BFAA 1O7AA 1A53A 1HN1A 3A21A 4LBRA 1EJVC 5E5CA 1US0A 4P5UA 4F0MA 1DJZA 2WNNA 3C6CA 2GGIA 3IACA 2ZZ7A 5BROA 3F5KA 3AIEA 3HZ3A 4C6EA 3SSJA 4CVUA 1W2PA 2AL2B 3W27A 1SO4A 3IJ8A 1UMYA 1Q3NA 2C8NA 3T07A 1OWQA 1GVYA 2C91A 4XQ6A 1H1NA 1PTDA 3D3AA 3RG6A 4JZ5A 5C2CA 3ID7A 2O7QA 3VC5A 4EK7A 2Z29A 1NOFA 4DO6A 2D2HA 4X9YA 1K6AA 1ZBWA 3S5NA 4IG2B 3HG4A 2C7FA 2XIOA 4N0RA 4HNNA 3H26A 4LSBA 3A4WA 1DWFM 5REQA 1TWDA 3TR9A 4HGXA 1RVKA 3AYSA 4MVAA 2Z2AA 4Q32A 4KGLA 2NV2A 4N6FA 1XLDA 5D09A 3Q65A 2PB1A 4JIIX 1GHRA 3SQLA 2OEKA 1P7TA 2I9UA 4C6NA 5IFTA 1EGVA 4J3TA 2DSVA 2Z1BA 3U5YA 1GQKA 2UZ9A 1I8JA 1V8EA 4ZA0A 4GUHA 1YXYA 3M46A 3CHVA 3AXMA 3C2OA 4IPJA 4MAZA 3U4AA 3GO2A 4CCCA 5K2ZA 2OOFA 3CPUA 2C79A 2WZHA 5HMSA 4KEZA 3LHUA 3M0YA 2QCGA 3R5EA 3ITYA 4RUBA 3VKDA 3C3NA 3W1RA 4I9TA 2GVEA 3ZM8A 2FVKA 2ZUUA 3Q58A 3M7WA 5CJNA 2FZ8A 1P4CA 4AHPA 4EPKA 2YFNA 4A05A 2CLEA 4R53A 1IQ8A 4JL1A 3DHDA 3DFTA 2G3FA 4PYSA 2A3BA 4HPNA 4Y9AA 4NNAA 4RPQA 2X05A 4JHOA 3L21A 4ZFMA 4XIMA 3ZWTA 1KFCA 5D9PA 1H4PA 3MKCA 3PWGA 3KBWA 1MFVA 2XN2A 4RPPA 1M65A 1O66A 3EBVA 3H7VA 1TZZA 1B5TA 1A5AA 3W7EA 4GZJA 3LLFA 1MW0A 1DIDA 4JEQA 3BJSA 1GOQA 1XYMA 1K4GA 3SCPA 4XZMX 1XCXA 4L65A 2H3BA 1G01A 2Z1WA 3AIUA 1WA3A 2CW6A 3P80A 2GDQA 2CIPA 1FWNA 1T99A 4UFHA 4DWSB 1EUAA 4GJIA 4LH8A 2ISVA 3CL6A 3O6AA 3HPFA 4QROA 4CN4A 3CQHA 4BS0A 1UWAA 2H8ZA 5TIMA 1BG4A 1GORA 2ZQ0A 3ITGA 1ZPTA 3LPOA 4I9JA 3TYUA 3W1TA 3M0HA 1NQ6A 3GY1A 4MTVA 2ZDSA 1QBAA 2XTKA 3VIOA 2GJXB 4OQVA 2X2YA 4I3GA 1C9DA 2E67A 4S1FA 4JPGA 4AHQA 2ISWA 1AQMA 3UJ2A 5BMWA 1ZTVA 1PAMA 2NVAA 2X7VA 1QR7A 3WQ5A 1UG6A 3CUIA 2CLOA 1IYXA 1EA0A 1KTNA 2P88A 1XL9A 3WNPA 3DHPA 4NNBA 4LW7A 1A0EA 1JCNA 1P0EA 1CB2A 1GCYA 5FJTA 2WPGA 3JU2A 3NZQA 1EZWA 3KOYA 3WLKX 4ACYA 1GVFA 1SVDA 4H2HA 1A47A 4HT3A 1XI3A 3R0KA 1YDYA 2A1YA 1K9EA 3OA3A 4KKXA 2Z1VA 1RD6A 3QMRA 5A6JA 3GRIA 4ZQMA 3BLIA 1HJUA 3TYZA 3WD4A 1DE6A 3CQJA 3GG1A 4Q8UA 4RW3A 2XFFA 1ONEA 3TA6A 4BI6A 3GTIA 3VYLA 1NDVA 2WMGA 2V3DA 3VE7A 2QCHA 2WK2A 3M0LA 3UETA 1Q4NX 1XUUA 1Q6LA 3T05A 1XYAA 3NFUA 2YYTA 1HFBA 1GNXA 2PDKA 4P61A 2PURA 4JTKA 3F2BA 2Q8XA 3MUZ1 5HK4A 2ZVRA 4MDOA 1E0WA 1FCBA 4R7WA 4GC3A 2PGEA 4TO8A 3CNYA 2GVLA 2VX5A 5HQEA 2A4AA 3C0QA 1R5YA 4DQWA 1FDJA 5A94A 1K03A 1TCDA 3AXHA 2Y8VA 4IP7A 3UG8A 4L5ZA 3S6DA 3TWAA 2OSXA 4HZ8A 2P8CA 1K9FA 4URIA 3UPBA 1Z69A 3S2LA 3W1LA 4NUWA 5KTLA 1IZKA 5HDRA 5E70A 3WH9A 4HQVA 1G94A 3UEQA 2WW5A 5L6UA 1J10A 1UR3M 2UY3A 1OC7A 2VGBA 3FW6A 2VXNA 2E3ZA 3BURA 2V30A 2ZZ5A 3TC6A 3MV11 3GE7A 1EA9C 2A3EA 5AC4A 3M47A 4YJ5A 3V16A 1IF2A 4LXFA 4OVXA 1Z7AA 3FXGA 3PZTA 1JIBA 4KWSA 3B0YA 1P1MA 1E51A 3QW4B 3QHOA 4S3KA 4TV5A 1QVBA 4OGZA 4ZMGA 4YU1A 3APTA 4XZNX 4EP8C 3WD0A 5DCBA 4OOZA 1A0CA 2DT2A 1QU4A 4OHQA 1OCBA 2WMIA 1VBJA 4NX0A 3T4WA 3MP5A 2A3CA 4HCDA 4H19A 4NJHA 4Z1YA 4KBXA 3ZZ1A 2CXEA 1R2TA 3ARRA 3ZSSA 1A5OC 5B7ZA 4H6RA 3VDCA 2A7RA 2FMNA 3VC6A 4DJFA 2WSPA 3S2MA 3BG3A 2LLEA 1G7UA 2Z1KA 3BSMA 2ZIDA 3UR2A 4AMAA 5DO8A 3H2EA 2X1IA 1PTGA 4C6DA 4MOZA 3QKZA 3VMOA 3SN4A 2ABBA 3GDMA 2PDMA 1R87A 4QRNA 4PUMA 5BMXA 3QMTA 5H1WA 1EWDA 3IRDA 3M64A 2BMBA 3R79A 2JE8A 3C3UA 4FLRA 2IMRA 1R2SA 3ENLA 1Q5MA 4DZ5A 1TJ0A 1CGXA 3CH9A 2QZRA 2XM1A 2FTYA 1BYAA 1XRFA 1E73M 4GZEA 3LCWA 2PTYA 2YB4A 4AWSA 2IXVA 1JYNA 2WBGA 1Z44A 2OG9A 1IEIA 4JFWA 4UOJA 3QZ6A 4KF1A 3W7QA 3OGSA 1CX9A 1HL8A 1SM9A 5LNWA 3CAQA 1BWVA 5IM51 2CESA 5JXQA 1UWIA 2JIEA 4N4QA 1W6TA 4IOTA 2G97A 2QXWA 4Q3MA 4ZOEA 3S1XA 4NF7A 3GVRA 3UR7A 1L8NA 3VDGA 3FOKA 2WSKA 4NG3A 1IT8A 2PTWA 9CGTA 2CPUA 3PF3A 3W37A 4HVXA 3CLMA 3AHZA 3SRHA 2D0GA 2PD9A 1GPFA 1QASA 3AALA 2J75A 4UTIA 1FOBA 3LU2A 1QXLA 1PV8A 1WKFA 4G1KA 1UKOA 1XKYA 1XLBA 2WB5A 1W1B1 1E5JA 3E0IA 3N2XA 4IQEA 3TYDA 2WHJA 1NTHA 4GX9A 4FZIA 3VD4A 2WBKA 4CCZA 4F48A 3E5PA 4AIOA 3LSCA 3F4WA 5C9ZA 4UCFA 1FDYA 3NJ3A 3TYBA 1NWSA 1WAWA 2YX0A 4GACA 5FAGA 1TE6A 1JAEA 2VL4A 3HBLA 2ZXDA 3JW7A 1FCQA 3RRAA 2FZNA 4ZQCA 3GVGA 1REQA 1EJXC 1VBHA 1KXTA 1JDDA 1IWAA 1NU5A 1YIXA 2W62A 3W25A 3UESA 3UXIA 3WD2A 1EWEA 3W23A 2WVVB 2XVKA 1MSSA 3EEZA 3MA8A 1W3KA 3NG3A 2X41A 1ISWA 4HCHA 2WMKA 3P14A 3RILA 2D69A 4DIAA 1ITXA 4ATDA 4ZQPA 2HK0A 1XC6A 1NY1A 3KVMA 2FGLA 4Y9OA 4LRSA 5I5RA 3ABOA 1R8LA 1Z41A 2A79A 3M5ZA 3NGFA 2Z6IA 4DRSA 4W86A 1Z42A 3LA4A 2XPKA 4GO9A 4C6BA 1QHZA 4L1WA 4LNYA 4AF0B 3FEMA 2Y1HA 4K7YA 2ACSA 1T41A 1VCFA 3V75A 2ZXQA 4N9DA 2WMFA 4WD0A 5AYZA 5J04A 3WDRA 5I7GA 1YXDA 2Y0FA 5D2TA 2DQWA 2DVTA 2OXNA 1PIIA 5I3KA 3BG9A 4NZ1A 4CN1A 3IK2A 4NAFB 2IQDA 1LM1A 5IRPA 3O9NA 2GLKA 1R7OA 1VCVA 3ARWA 1WBHA 4LF1A 4AZCA 4BWLC 3BUVA 3DOPA 3USBA 2IKIA 2FB2A 4U5IA 4WOZA 2VEIA 3N34A 3SJNA 4N02A 3CUGA 3WF4A 1Q13A 4DN1A 5C7HA 1UMLA 4MF4A 2PC4A 4UTMA 3EA1A 4BA0A 2QJGA 3O7UA 2VRKA 4XD6A 3WF2A 3KVLA 2C1IA 1FXPA 3P5ZA 4Y7EA 3SAZA 3IPWA 4OUEA 3SCOA 3DFQA 4QGCA 1F61A 1E9IA 3AMGA 1V3MA 4MWAA 1IIGA 5HNNA 4P7LA 5DELA 4LV4A 4LOCA 4LEQA 2QCEA 2Z7KA 1UOKA 1NQKA 1UD8A 4WLCA 1QT1A 2JF6A 5FEWA 1I9CB 3OB8A 2J7HA 3BCJA 2OO6A 1V7YA 4WKHA 3DG7A 1C7TA 1S1RA 4LNCA 3B8TA 2V5JA 3T09A 3UXDA 2WWCA 4GKLA 3R1ZA 4QG9A 1FWAC 5LXXA 2D0FA 3NNTA 1WP6A 1EHNA 4KQNA 4F9JA 5A6TC 4ILSA 3LBOA 3LCGA 3S3GA 4Z2JA 1TRDA 3DCPA 2DVXA 5L9FA 4WXYA 3VIJA 1CGYA 3E38A 1QPNA 2PAJA 3GG8A 4M24A 2CLKA 1OX6A 3LM3A 3LCIA 1X8CA 1W1A1 4TX8A 4IH3A 3NL2A 4JTGA 4RZ5A 4DNHA 1XH0A 4Z1CA 5LHEA 1LZOA 1ICQA 3KRSA 2GK1B 1JPHA 5ENLA 3KTXA 4R7OA 1RD5A 3H70A 1PKMA 4KERA 2ACUA 1XQLA 3LB0A 3H12A 3AYVA 4MNLA 3PY2A 1QAPA 4HHLA 3S2NA 5AC6A 2GVYA 5H8UA 1QPOA 4W88A 2B4GA 3TQ0A 1UYQA 2OEJA 4AAJA 3WYZA 1FX6A 1XH1A 3AZTA 1RJQA 4BI7A 3J7HA 4A29A 3GUWA 1EH9A 4NJJA 2ZUTA 2QCNA 2ONEA 4P7OA 3LDVA 4GUJA 3TMLA 3PANA 4HP5A 5M17A 5KZ6A 3O05A 4B4FA 1ODZA 2D3LA 5HMFA 5C55A 1KWKA 4JFTA 4PSRA 2J7DA 2ZTJA 5DT5A 1K6WA 2J6VA 5XINA 2ZX8A 1Q6RA 2NWRA 4JTTA 2TODA 3DKLA 3EYPA 5E9XA 4HB7A 1TV3A 4DJFD 3N2OA 3IVUA 2D2GA 1X6NA 1VBUA 1FWDC 1AK5A 2Z2BA 3Q94A 3MCNA 2W91A 1R7AA 1C29A 2Y70A 4FXSA 1J79A 5A6BA 4ZEPA 1EXPA 2XFWA 2EPLX 3M07A 2PDUA 5C7VA 2XIJA 3U5UA 1BWLA 1VB9A 2EQDA 3WL1A 1F7BA 1I1XA 1O94A 3UYCA 4JIEA 4B5NA 1GZ1A 4PFMA 5ABGA 4ICCX 5BU9A 3FYOA 2GJPA 6XIAA 3G0XA 3NOYA 4AISA 5BXTA 1MXSA 5D02A 4Z2IA 1E1EA 4BI5A 1BVZA 4AQLA 1BGGA 3PBGA 3L67A 2YBUA 1R9XA 4ZOBA 2B81A 3PUEA 3GXMA 3NSMA 2PDWA 2ASHA 2GYIA 3C0SA 1R3TA 3UPMA 1P1XA 4LYRA 3FKRA 1HGWA 3S1WA 1PZ1A 3SZ8A 4Q7NA 1T96A 3VOJA 1S2VA 5CG7A 5HWNA 3IGUA 1XPYA 2AAAA 4F8XA 1F5ZA 1MQRA 1VYSX 1LQAA 5REQB 2GQAA 4GGBA 5HJLA 4NHVA 3FGCA 2NUYA 1R3RA 4JKMA 1NSJA 3MDWA 1OZMA 1KBKA 5LNVA 3IJDA 1L6WA 1L2UA 2DP3A 4YTRA 5T9CE 2F6UA 3BV4A 1AW2A 1CT5A 2WNQA 4ERIA 2PU0A 2C3ZA 2VC9A 4EVZA 4HOZA 1NELA 4O28A 2YDRA 1FKXA 3RPDA 1WPCA 2OZ8A 1QPQA 3MMDA 3PTQA 5I23A 1XD0A 3NPUA 3RCNA 4PL1A 5AC7A 4TTUA 2E9LA 3TNOA 3G18A 4DBEA 4D6HA 3S46A 4ZL1A 1H2JA 4EX4A 1FP9A 3AIRA 3D5HA 1QW8A 1ME9A 5EMLA 3AS0A 3B8SA 4HA1A 4UNLA 4Y96A 5AY7A 5EB8A 1E9ZB 3OHIA 1XICA 5GNXA 4BQ3A 2BGQA 3CS2A 5LIWX 4GFIA 4MWAE 1IEWA 3KFTA 2E77A 1CXKA 2DSUA 3VILA 2J4GA 4IT1A 4Y8FA 1S5MA 3AXKA 1P6CA 1Q45A 1RK5A 3II1A 5DCEA 2G0WA 3AOFA 2CBVA 1EDTA 1BPLB 2FZDA 4BWLA 3IJ6A 3O0KA 1QRQA 1K8YA 3V5CA 1DTUA 4CD6A 3NL3A 7TIMA 1S38A 2Q3RA 4LAOA 1J0IA 1XC4A 2O92A 2J9YA 2E40A 3MCMA 1EPXA 4NYYA 1VF8A 2HRWA 2J9ZA 1BKHA 1K8CA 2CLIA 4O13A 5DQPA 1UB3A 3GNPA 2ZE0A 4XBSA 3RK8A 5A8QA 1BEUA 3A4AA 3CC1A 5BWAA 3W86A 4AY7A 2DQXA 3BPWA 4RLIA 3W84A 5FESA 2GQ8A 3SQMA 1WXJA 3GUGA 4A3QA 2WWDA 3T2OA 3LNMA 3G8RA 1R0MA 1SSGA 1W1IE 4NJIA 2QJHA 1G4TA 1OADA 3QKEA 2GZXA 3B05A 4PCPA 4G9PA 3CAVA 1NWUA 2DW6A 3WK3A 3TJLA 3KCOA 3ARQA 4HK6A 4FNUA 4CQ8A 3VZXA 1TIMA 2XDFA 4U5KA 2RKXA 4KCWA 1QUMA 3H6OA 4KESA 1WV2A 2FHCA 3QC0A 4WGXA 1UPPA 4FNSA 1WDPA 1GQJA 4CNSA 1O1HA 1XSIA 4UR8A 1BF6A 1OF6A 3IK4A 1S5VA 1H63A 3V4BA 1KGUA 1M1BA 4BZYA 2NX1A 2NVCA 2OKTA 3U6WA 1WDQA 4MWAD 3VNKA 3MT1A 5XIAA 1S3HA 3T7VA 3BAXA 4M0XA 2PDNA 4C6LA 2PP0A 3WN6A 3I6EA 3NDOA 2GPTA 2R1LA 2V2DA 4E38A 2J8GA 4BEUA 2XG9A 3L23A 4CNTA 4TVCA 1JZ7A 1PCWA 4QCFA 3WK1A 3C0JA 1OABA 3RN6A 5CGTA 1LUCA 4CD8A 3CIXA 3GDLA 4K2SA 1UASA 3L4VA 1AMYA 3MY9A 3VOIA 1US3A 3XISA 1QI3A 3GM8A 5CPTA 4A3YA 4CD4A 1ADOA 5A8NA 2DZUA 1HUVA 4L4OA 3HG2A 3OVGA 3CAWA 1ZNNA 3EDJA 1SO3A 2ZC1A 2Z00A 4XAGA 3WQVA 1VPQA 4HA4A 4CLMA 3FEQA 1V5XA 4AB4A 4ZOCA 1W9XA 5A8GA 5HUPA 5CPLA 3E6EA 3NGJA 3EPMA 3HGJA 1Q6DA 4O0QA 4ZGYA 1MW2A 2OYKA 3A22A 3WUGA 4Z08A 2NXHA 1C3FA 1KW1A 4RDYA 4DZAA 4NP7A 1CZ1A 3LS9A 4EPBC 5ABTA 2JK2A 1CGVA 3U9IA 2OEMA 3I3EA 1LL7A 1SJDA 3VNIA 4QS6A 4WGHA 3MVTA 3QR1A 5LYRA 3M0KA 1W5QA 2D24A 3IGSA 5G2IA 3NQEA 2V5KA 1UR2A 5JBFA 1EDQA 3L5LA 1JRBA 2GSEA 3R8RA 5FEPA 5FF7A 2ZZ3A 4X63A 1OQFA 4RNHA 3W7MA 3AU2A 4JIRA 2R82A 1EHAA 4PE8A 3QY6A 3WLNA 4D6IA 1IT7A 4LUJA 3CHDA 1A5UA 3MDUA 5JBEA 1TPDA 1D8WA 3EWWA 4U28A 3NOEA 1E40A 4GYKA 1XBZA 5AHMA 3QSTA 2Y5EA 5LIKX 4ZQOA 2ZWYA 3U2EA 3OA5A 1R47A 1C7SA 3SSZA 4QJ4B 4JYFA 4O57A 4UMCA 4N9CA 4ZO6A 1UR0A 1Z9AA 3KWSA 5A6BD 2DSZA 2DPEA 2ADAA 2YXXA 1I60A 3ME3A 3BCDA 1A50A 2R6OA 3F5LA 4HZ6A 1EJTC 3EX4A 4O14A 4EKJA 2VD8A 4C1NB 5T91A 4IIBA 1JPIA 4DEFA 2HEJA 4RKAA 3WMLA 4DF1A 3LGGA 4AIBA 5LGZA 2QPUA 2O56A 3ERPA 1XIHA 4H9VA 4LUIA 4AD0A 3W7KA 1NVMA 1R46A 4GQGA 1OCJA 2R1NA 3MC5A 3HQNA 1T40A 3VNLA 4HJWA 1ME8A 3E49A 4AX7A 3TCEA 5LZLA 3TJ4A 2NX3A 1L9WA 4PCNA 2P8BA 3A9IA 1S2TA 3ZOAA 1GPWA 5I3HA 3H4GA 3DDMA 2F2HA 4H3DA 3B9AA 4DWDA 4H9XA 4F0RA 1RA0A 4INFA 1S46A 2A6LA 1N2VA 4C90A 3THDA 3K5XA 1SMAA 3RDKA 4IJRA 1N55A 2FKPA 2WC4A 4NAEA 4JTCA 3CUXA 3OVQA 3T4CA 3S2JA 3TAOA 4BQ4A 3ARZA 3QYSA 4XZWA 3LXCA 3XIMA 1UIPA 2ZRYA 1LLWA 3GC5A 2FH6A 3LN3A 3R58A 1YRRA 4O52A 2VRJA 3W24A 3LLXA 4RR4A 1TKKA 3N6HA 4C7FA 2J9XA 4HYVA 1F4HA 3C2VA 4JHZA 4M80A 1VFOA 5C5YA 3UCQA 4U2YA 4BQ2A 2ZC8A 3NQ7A 2WKGA 1DXIA 1L6YA 2BXZA 1KM0A 4ORIA 1PIFA 2BDQA 3WSUA 1FWRA 4XKMA 3UERA 2VX7A 3NTYA 4X0VA 3PAOA 1EEPA 3H53A 3DYMA 3SCSA 3L2MA 1JDFA 1Q6OA 4H01A 2GOUA 2NW0A 8RUCA 2BVWA 2GDUA 2GWGA 5KZDA 3LBCA 2OQLA 2VRQA 3PUDA 3R6IA 2ZA2A 1TQXA 1W91A 5CPMA 1A80A 3EOSA 4UFMA 4QNWA 3SUUA 3L5MA 4DHGA 1REQB 2O4QA 2OZ3A 3T55A 3T42A 1MVYA 2XN0A 3S5OA 3MYPA 4W7WA 4PTVA 2CLPA 3MW7A 3N25A 4GJJA 1ISVA 1H0IA 4PB5A 2VX4A 1Q63A 3ZS4A 1AQHA 2AKZA 4V15A 4XZBA 3HOJA 4OFCA 4CN6A 4ZFCA 4Y90A 3RYSA 1QK2A 3LG3A 4C6MA 1AL7A 2DZWA 3PG8A 1N82A 5I3GA 1VYPX 3ZJKA 1HKVA 4GZIA 1OG0A 1PX3A 4MG4A 3WNNA 1JPKA 1JG9A 3WF0A 5LA1A 1WUEA 3BLKA 3ZLGA 4XBJA 1J6OA 1U2YA 1YHTA 4AVOA 3W83A 4PRTA 3B8DA 1DJWA 2ALRA 4AH7A 5I03A 2W4XA 3IUDA 4H9MA 2VELA 4DZHA 1GVQA 4PMDA 2PGFA 1XFBA 2VO5A 1VBRA 3AYTA 1X7FA 1VJIA 2PP1A 2I5IA 3FY1A 1E6ZA 1ONXA 3PBMA 2VQUA 1NDWA 1QTWA 2H9AA 3PTMA 4F2TA 4OKDA 1MDRA 5DFAA 1U5JA 1T8XA 2IS7A 1GVOA 4M8UA 1FWBC 4AZCB 1YW1A 3H22A 1VRDA 1XIMA 4J3WA 2BGSA 1BLIA 3RX2A 2I56A 1JCTA 3SGUA 1SJBA 1SFJA 1EJSC 2Z25A 1VFLA 3OODA 2ZUWA 3S9YA 3LENA 5EL1A 3G1RA 1U33A 4QX4A 1ZBCA 2D23A 4JTHA 4YVPA 3WNLA 2PRLA 3ITCA 3PBWA 3QR3A 3BLLA 4LU0A 4Q8VA 5CPQA 2PDCA 3O8AA 3KS5A 3M4HA 1LP6A 1XRVA 1GK8A 3LGEA 4LVDA 3VZZA 4ADSA 1DWJM 4UTWA 3QOKA 1N8WA 3GFZA 1QI4A 4C1KA 1BTCA 1TUXA 3O6CA 3UZYA 1Q2SA 2IKJA 3PNUA 1OFBA 1R38A 3RMJA 6TAAA 1Y5WA 1V0NA 4H83A 4PMJA 4JL2A 1GTHA 2VJXA 1M68A 3CXOA 2Y5SA 5HQMA 2O9PA 2QS8A 3FS2A 4PR4A 3DC8A 3FJ4A 2Q8ZA 1IXQA 3SO7A 4PMQA 3IAPA 1NJJA 3VMNA 1EYEA 1THFD 1VFSA 4ZVJA 3ARPA 4BK9A 1XDJA 4Z1DA 2A7PA 2QDHA 4AMCA 2OSYA 4U3AA 2HZGA 3URAA 1J93A 2GUUA 1N8FA 2PWUA 1E15A 1DKWA 3C61A 4ZODA 3EKLA 3W7OA 1YXCA 4UIOA 1JCXA 4H9UA 3AHXA 2QGHA 3LTYA 4D8ZA 1J11A 1PWMA 5D2VA 3UJFA 5G1YA 5B80A 4X2PA 4DO7A 3S83A 3MSRA 1E0VA 3R25A 5D30A 4K6AA 4FX6M 3MHUA 3MB9A 4HJFA 2REQA 4MFEA 4E2BA 5EMUA 2YBTA 5IDIA 4Q8QA 4L6HA 2PDQA 1C8YA 3B4UA 4JYEA 2Y85A 2A6NA 1TELA 2ZCGA 3BARA 3EDEA 3MWAA 2YCLA 4HBKA 5BYWA 3Q45A 1FVPA 3TTQA 4WF7A 1OVDA 4IPIA 1ZQ5A 4CNUA 1TIWA 3GG7A 1DJIA 4UZUA 4Z17A 2WHKA 3SCNA 5D9MA 3SCUA 1ZSXA 1XBYA 3NQAA 4DVOA 3ZJ8A 4RNIA 2ZA1A 4WY0B 5FCZA 2BV9A 4RW5A 1E43A 3V36A 3LCFA 4XZIA 4DELA 4NJGA 2FJUB 1QI2A 1W8SA 3S5ZA 3W02A 3AFBA 1AD1A 2Y6ZA 2PDJA 1DP0A 2IW0A 1HT6A 1QMLA 3MI3A 3WK2A 4HK7A 2DIEA 4GXPA 2G3NA 3STCA 3LGDA 5LXEA 1XLAA 2VEFA 1UUOA 4EWND 1O12A 3PB0A 4FAMA 1Q6FA 2WO5A 1M41A 1QNVA 1ZJHA 5G2HA 1Z8AA 1AJZA 3N11A 3Q4DA 1TA3B 6ENLA 4IGNA 2PGWA 2PA6A 2EHHA 3TH6A 1SFSA 4IL2A 4AY1A 1OC5A 4W5ZA 2FPVA 4V28A 4LB4A 3MCOA 1OB0A 1H7XA 2WVSA 2VEPA 1MUMA 4OECA 3NQFA 2B7OA 4CD7A 1U1JA 3MTWA 4QR6A 5CC6A 1OFAA 5DEZA 3VINA 4E8GA 2HSAA 2HBVA 3M43A 4AZ5A 5CPSA 1EJWC 4W89A 1G4SA 2O55A 1UP3A 1J0KA 3Q67A 2WANA 3SFWA 2OR2A 3WF3A 2XSBA 2PDXA 2IPWA 4PSPA 4MJMA 4FLOA 3TQPA 3NPVA 4FNTA 4HYRA 2DUXA 1R3YA 5AYYA 1OFDA 2J6XA 1JZ5A 4UR7A 4IG2A 3TN5A 3WQEA 3BTNA 3OQEA 3NZPA 3USZA 1JNDA 3JRKA 2CKSA 4TX6A 1PL9A 1ONWA 1UBPC 4FR6A 3CJPA 4GISA 5HJYA 3O6YX 1KCZA 1P48A 2DT0A 1GYMA 3AQUA 1FWIC 4MKNA 3KWXA 1N7KA 3EOOA 4IIDA 1LT8A 1SYTA 5DBUA 4Z2LA 1M6JA 3WH6A 3WLLA 3WX7A 1E5NA 3G1AA 2DORA 4OE7A 5JVLA 4O1FA 4RK8A 3G0UA 4NRRA 2F6KA 1KRAC 3GNRA 2PS2A 3DHUA 5JIWA 1SZEA 4UTTC 2CYGA 3LQGA 4GWEA 2VZSA 3P84A 3S0CA 3VKBA 1UWUA 3VDAA 3QYQA 3TLLA 1ITUA 6A3HA 4C7GA 4DF0A 5DLCA 3BW3A 4D72A 1JFXA 1XLIA 2A3AA 3N29A 1XDLA 4FA3A 5DANA 4QG8A 2PF0A 4L4LA 4ZTYA 2BY0A 4AXKA 2A3HA 2YR1A 2G4JA 2UY2A 9XIMA 2WM1A 1BRLB 3QRHA 1DOSA 3L7RA 1KM1A 5CSUA 2UBPC 4GGHA 1BVWA 3KBMA 4O1CA 2E7FA 2V68A 2PDYA 2Y61A 3PP7A 4FO4A 3UWQA 1XIBA 2PTXA 4I90A 1B9BA 4IMDA 2PRMA 3AMCA 3C4UA 2GGGA 3W29A 2QUNA 2YOCA 3KL0A 3SURA 3K13A 3QLLA 1UC5A 5LKYA 3V0UA 4XD4A 4LQ1A 4XTDA 1JD7A 1L0PA 1FP8A 4LWWA 3O16A 3OYZA 2OWXA 4DF2A 3ANVA 2TSYA 1H7OA 4XZ9A 1YTKA 4GY7A 3PAJA 1QCWA 1KBIA 4WSKA 1VH7A 1S3TC 1EC8A 1I0DA 4FEZA 4XD3A 2FLIA 2YA0A 2YPIA 4DWSA 1RY8A 4E3VA 4PZVA 2QJNA 3LCHA 2OLAA 1W5PA 4IWWA 2YGYA 1UZHA 5G5IA 1C92A 5E93A 3F2CA 3TTOA 1EQPA 4DX3A 5F2MA 3FHQA 3V0TA 1GQNA 1O5KA 4RV8A 3BZGA 3UR8A 2AKMA 1ICPA 1U5HA 4GQ0A 1FHUA 1EL3A 1RQBA 3DG6A 2GJXA 1H0GA 4LX4A 3HG5A 4A3HA 3SJ3A 1VJZA 4HK5A 4E3TA 1GT8A 1PKLA 4CEXC 2J47A 3IGXA 4ADTA 3VNZA 3PTDA 1KA9F 2WVTA 5HMEA 3I7SA 4EF8A 4Q7BA 4TU1A 4UC5A 4LEFA 1Q2RA 4GCXA 3WJYA 1QW9A 5AHNA 1LUCB 3EWCA 3PTKA 2ZZ1A 3DYPA 4IIFA 5E6ZA 3ARTA 4MNKA 2WM0A 3T6CA 3VKKA 3UA4A 3GXTA 4HOWA 4ZB5A 3B8VA 3AHYA 4JTAA 4MY9A 4F0KA 2H6RA 1GYLA 4QG6A 3SUVA 4GA8A 5J5RA 1JZ2A 1E1CA 4AEFA 4U31A 2R1MA 6REQB 3W85A 4GI6A 1RJRA 3AC0A 4UUIA 3VKAA 3M44A 4JDYA 1A5NC 3NO1A 4GLEA 1JAKA 1H7WA 4NL1A 5C0QA 4FB7A 3MWCA 1XCWA 1F2JA 1ODUA 3QOMA 4K39A 3TYAA 1RHCA 1E9YB 4ZENA 1KWGA 1RH9A 1KGWA 4S23A 4CQAA 2X16A 3MMTA 4UQDA 2O9OA 3WLPA 1X1NA 4IP4A 2Y89A 3B9NA 3OZOA 5EMMA 3WLOA 1HGYA 3QPZA 4S3AA 4B15A 1F76A 2VR4A 5HQLA 2NLYA 3CB3A 4QFUA 4RL3A 5A95A 2F7FA 2HJPA 1W8GA 3LV5A 5HANA 3BV7A 3W6LA 2JKEA 3TUUA 2PWEA 2HNHA 4I7UA 1DWGM 1I75A 4PMOA 4FNQA 2VX6A 5BOOA 1E0XA 3F7JA 2FZMA 5D9NA 2I57A 4QTGA 5DT7A 4ZQRA 3DZ1A 5CZKA 2PTZA 1OFEA 3GXDA 3RHGA 1DPMA 3GQYA 4WUIA 4H8UA 4IFOA 2J7FA 3HJEA 4KRTA 4AEEA 2YXGA 1TV7A 4C6CA 3TYEA 2ZFAA 3IGHX 3OIXA 1JF6A 3O3RA 5HWJA 2V3GA 5BOEA 5CBIA 2WVUA 4Q4OA 4DLFA 1J4EA 1A4MA 1L2QA 4DM1A 1JDEA 2DSWA 4JNZA 4X3ZA 1XLGA 3T1GA 5CSRA 5BRQA 2VTFA 2V3FA 1PTAA 1CXFA 5D2WA 2QR6A 4ZB2A 3NXLA 3V5OA 4A8IA 3PZUA 1JZ3A 4J3ZA 2GQ3A 3OLGA 3WMCA 2YZRA 4W7VA 2JQXA 1TO3A 4TUFA 3WBEA 4GUGA 2C1HA 3P7YA 1GG1A 3TR2A 4JFSA 5JMUA 5BXRA 2X09A 4GHRA 2VFEA 3IJQA 2GGJA 1F8IA 3M7SA 2XZ9A 4YTSA 5LIXX 5PTDA 3RR1A 4JTFA 4D71A 4QNEA 1BYDA 3LNPA 3A4JA 1QNPA 4YTTA 4WJ8A 3HGOA 3QN3A 1LROA 2P3EA 2E1DA 3ZJ7A 3ITTA 4IIEA 2RDTA 3WLMA 4KEVA 1QW7A 3W2UA 4PRWA 1Q8AA 3IEBA 3GKFA 2C0AA 1ZBVA 1S2AA 1G4EA 2HPIA 4OOUA 3W2NA 3CHEA 4U33A 4Q22A 3GTNA 2FYMA 3M16A 3SUWA 4J2MA 3RLVA 3WLSA 1CW2A 1CWYA 1W1PA 2VGGA 3BW4A 2UWFA 3W76A 4GI4A 4EANA 1H09A 2YL5A 3I7QA 1J6PA 3UWWA 2HK1A 1LQ2A 4X61A 2J78A 1XGZA 2H8XA 1BGAA 3ES8A 4DBSA 3QSRA 3WQWA 1HL9A 2BNJA 1XCFA 3W01A 1TJRA 2OLSA 3HQPA 4LYPA 4L61A 3NQDA 3C8NA 2ZTKA 3REQB 1M7XA 4CQBA 3BLOA 2FZ9A 4M81A 3B04A 2ZZ2A 4J5NA 2V38A 1IEVA 1SR9A 4TQTA 2VM8A 4I8YA 4KCVA 4AG0A 1YNQA 2JBMA 3B0VC 3UCDA 4XAYA 1OX5A 3WMSA 3P62A 3NL6A 1ME7A 1SO6A 2A3LA 1OBAA 3BWWA 4E4UA 1V3KA 4OWGA 3FVDA 3QV6A 3CTTA 2ICSA 3EPNA 3UGVA 3EXRA 1C9WA 1ZAIA 2R8WA 1KXQA 1E4NA 5BU6A 2J7CA 3PWAA 2YSWA 2IKHA 1HW6A 1IWBA 4JTUA 4DZIA 3PBYA 4B9ZA 4O0ZA 1E6XM 1P43A 3P60A 5GVJA 4YTUA 3CL7A 1G6CA 3CWNA 3I6RA 4PB4A 3DESA 4D8LA 4DWSD 4AY8A 3QM3A 2YL6A 3BAKA 4IPNB 3S47A 2Z6JA 3R10A 3OEXA 3ITXA 4YXGA 1YTDA 3WQ8A 3VGDA 4MIMA 4YYFA 3LMYA 3O06A 4TVUA 5FJOA 5KITA 4LYQA 4X0NA 3GIPA 4G56A 3DU0A 2X0YA 3G22A 4C6PA 2CZVA 3FKKA 4Y9MA 3GWQA 3T8LA 4HA3A 1PS9A 2F6XA 4DPPA 3KE0A 3KBJA 1W5MA 1TPB1 2ATSA 3UVIA 1W3JA 1X38A 2VENA 1FKWA 1YPFA 4NVTA 3UWUA 4F0LA 2INEA 4NI3A 3SIMA 4QQ3A 1UQZA 3F2DA 3OPSA 4NAFA 3G1VA 4IQDA 3IVTA 5DMMA 3I6TA 1RQHA 4RZ4A 4XIAA 1PDYA 2Y4SA 3KOZA 4JX6A 2BS9A 3F03K 3UXLA 1KLYA 1E71M 1AUSL 1QJWA 1TVLA 3T44A 2B7NA 4UBPC 4PMNA 3W7HA 3U48A 3FVMA 3W1UA 4PUKA 4Y2WA 3WUFA 2AMGA 1NP0A 4E0CA 4GIAA 3P8JA 4EWJA 3QY8A 2J7EA 1J0YA 4UXDA 4O18A 3KZPA 1QHOA 1D7KA 1SPQA 4YMZA 4BR1A 3UR5A 3B0XA 2CBUA 4HPXA 2OMAA 3ITLA 2OWWA 1UROA 3CUZA 4GH1A 4KWOA 2BXVA 1M5WA 3U57A 2H3DA 1ZCCA 4K8GA 1EO5A 4AD2A 2YDAA 4ADUA 3M0VA 4XZHA 3MO7A 1O6IA 3E9AA 3PR2A 2QGYA 1OD0A 3FLUA 3N9SA 3HPAA 2ZXBA 4EE9A 1ML1A 5HAOA 4UQEA 5CCZA 2X7WA 3CPGA 5CKSA 1WKEA 1DORA 2DZTA 4JCLA 4MPKA 3RJYA 2E8ZA 3W38A 3U8GA 1R6WA 3TNBA 2PLKA 2YDSA 3QQ0A 1HP5A 4QLKA 5JH2A 1MI3A 1XIEA 2XVLA 4JKKA 2DZVA 2F9RA 1WE5A 4LJ3A 1L6FA 4IGHA 2O0TA 1POJA 2H90A 2CFFA 4O11A 3T40A 5XIMA 3RM8A 4DI9A 2X1TA 1GEHA 3NQMA 4O10A 3DI0A 3I10A 1PCKA 4WY0F 2I7GA 1X96A 3GC2A 4HN4A 4WRHA 5BXPA 1FXQA 3WQGA 4R7JA 1S2WA 2VC6A 4KMQA 2VFIA 4GY1A 3TVAA 4AWUA 1ZALA 1W1VA 1I2OA 2IQTA 4QEHA 3DFHA 1Q6GA 3APYA 3EKZA 4GIRA 3W2MA 5E0KA 1GW1A 3G1YA 1R9ZA 4H6EA 3TLQA 1BSIA 2BX7A 2WQDA 4K37A 5I2UA 1KV8A 2E6YA 2YLLA 4OBRA 1JL8A 3CU2A 4AIUA 1AW1A 4KW2A 3GS6A 1DTNA 2ZZ6A 3CGTA 2QAFA 3LERA 3VZYA 1VBGA 2GOKA 1GHSA 2VWTA 3L4TA 4JTDA 2A85A 3A3HA 3OQ8A 5E0CA 1HJQA 3A5VA 4W93A 3N4FA 1SR0A 4FNRA 2IXUA 3LPGA 4YYCA 4I7WA 1OHLA 2YA1A 1XP3A 4TX9A 5E6YA 1JJKA 3AWNA 4H04A 3SY5A 3BGAA 4US5D 3FYPA 4LCSA 5FF2A 4P7RA 2VZVA 3PJUA 4PTDA 5EPDA 4HTYA 4EACA 3DI1A 5DXXA 2XH4A 1LWHA 2NXGA 3IIZA 1XISA 4WSHA 3N6JA 1KM6A 4K7VA 3EB4A 4AVFA 4QIUA 4MJZA 1DVJA 1UA7A 2CLHA 2RHGA 1OINA 5DX7A 1J0ZA 3P8IA 3U2ZA 4U4MA 2GFTA 4C65A 5ECVA 5IDZA 4LUTB 4PL2A 2DW7A 4GI8A 3TEVA 1DQWA 3HU7A 1GZGA 5BRPA 4LBUA 4DUXA 1V08A 3WDPP 1J2BA 3PZGA 2RFGA 6PTDA 3SCVA 2G37A 1GUVA 4A22A 1BFNA 1ISZA 4JHMA 4KPLA 2QT3A 4DJDC 1QNOA 3GC4A 3CHFA 3WENA 4PCTA 1ONRA 2G95A 4E5TA 4RXFA 1TZ7A 3K1DA 3MANA 3SGGA 1TCMA 3OIHA 1EB3A 5H8PA 1GJUA 3FDGA 5JBDA 3CT2A 1TWIA 4OT7A 1LWJA 3GTHA 1XPGA 2CITA 4UTLA 3W53A 3VDBA 4PMVA 3OBEA 4DJEC 5CJMA 5TD4A 1UC4A 3AO0A 3WQFA 3WJWA 4NZ5A 3ZR4A 1NFBA 1JXJA 2Z24A 4GVFA 4N4PA 1W32A 3V1PA 1RK6A 3M0JA 1E6SM 1J12A 1LG1A 2V67A 3EMQA 4HNUA 1DJQA 3VM7A 1ZB5A 3L12A 4Y9NA 4L6DA 3EOUA 1TJ1A 3VUPA 1JUEA 3VGFA 3ORWA 5U7SA 3RO6A 1VPYA 4M1RA 4HIBA 4PTWA 2CHNA 3UT0A 5SWUA 1SW3A 3KBNA 2QVNA 1QI5A 1KRMA 5AVHA 1G9HA 1YMYA 1JULA 3RPTA 1V0MA 4LT9A 4QCEA 4D6JA 4JKLA 2PCQA 2OOGA 3EGJA 4LV9A 1M03A 1ISYA 2RJHA 3TQKA 3B06A 2E9BA 3CMGA 3LM7A 1B3WA 5D04C 1UPMB 3KRBA 2BXYA 3WQCA 3R11A 1W31A 1P6WA 3IV8A 4LY8A 2QJJA 3P67A 3WH5A 4GXMA 3E1F1 3M0IA 1F3WA 3H2FA 4F3HA 1YDVA 4I7VA 5G1TA 2Y7DA 1XW8A 3NZRA 3H2MA 4D6CA 4KWUA 2RUSA 3VCRA 2G3JA 1PYMA 3W74A 1B3OA 4A35A 3TC7A 4IUOA 3MZ2A 1W5OA 3EA2A 4CQ9A 3KRUA 3HPZA 1VFTA 3IIVA 5CC5A 1XUZA 1ZENA 2AQVA 2Q8LA 4IICA 5HINA 3CZEA 4HHHA 4Q6JA 3ZLFA 3QV8A 3RLUA 3T8QA 1CYGA 2AAMA 4UOZA 4E6MA 3GFXA 1TUFA 4QJ3B 1SZFA 1XQKA 4C6KA 2I1OA 1LL6A 2GVGA 4HU3A 3AZRA 2WZMA 3KVKA 1V0KA 5CPNA 3WF1A 3T0BA 4OJYA 4UWMA 2Y7FA 3GXFA 2VVSA 3N19B 4PB3A 3M6DA 3P0XA 3BOFA 3LX9A 5HNUA 3Q2DA 4XUYA 3LI0A 2YW3A 4KRUA 3R7MA 1GW9A 3MP3A 2QHAA 1WQ5A 4L7ZA 2X8RA 3TMQA 1IZCA 1M01A 3E2VA 4ALDA 1T8QA 3VFCA 4KCTA 1KNWA 3QW3A 4IF2A 4J9JA 4OV9A 5I06A 3KW3A 5DXYA 1E3XA 2KAUC 2XWEA 4JOMA 1E6NA 3KBVA 3OVRA 3KOXA 4NZFA 3EZ4A 4AU0A 4G7FA 1RP9A 1OZQA 3WBYA 4H2CA 2VOTA 1SZGA 4QSHA 2VMFA 1OK6A 1AFSA 1I2PA 5G4HC 4LB3A 1F6YA 1QOQA 1FQ0A 4J35A 2EG6A 2GJRA 5AC8A 3H55A 4EIVA 2Q3OA 1KM2A 4W84A 1UH3A 2OELA 1E1CB 3QTPA 1IE7C 1ZAHA 3ZQ9A 1JDCA 5GJMA 4LBSA 3U3HA 2ISDA 3MKKA 3D47A 1KBJA 4M29A 4GCAA 1PHQA 1C93A 1UD6A 2PP3A 1ADDA 3S1GA 5CBBA 3KCJA 1D7FA 1KFJA 4MM1A 4CGTA 1EP2A 2PDHA 1V03A 1NP2A 3QGAC 1JZ4A 4MZ8A 3DIPA 1RLCL 3L0KA 4A21A 3W22A 4MAVA 3QGVA 3AJ7A 1OFPA 1Q85A 3BMVA 3T0TA 2XIQA 4JCMA 4EXBA 1EQCA 4JGDA 3WY1A 3E0LA 2ZX5A 2YDQA 4HZ7A 2A7NA 2I5QA 3K4AA 4IQLA 5AHFA 1WOBA 5I3IA 1W37A 1EC7A 4LCQA 3C56A 1QWKA 3THQA 4S3DA 4N42A 3N9RA 1MXDA 4LS0A 2EG8A 2WJEA 3B0UX 3AISA 3C8FA 5AECA 3EX1A 5BOFA 2WMJA 1XLMA 3LLDA 3W28A 5C9UA 3CLWA 2MUCA 2PDIA 3D46A 5I79A 1ZJIA 1P6BA 2VI0A 1XBXA 3H24A 1JI1A 4R34A 1MQPA 1SZNA 3P3BA 5F1VA 1K8XA 1C8QA 1KCLA 4F2BA 3PZIA 3C2EA 5DMNA 1NAL1 2OCZA 2O4MA 3UY7A 3N6QA 4IL0A 1O5QA 2OYLA 1YE6A 3CV7A 1UJQA 4H8NA 2CLLA 4UMBA 1QFEA 4GZ7A 4DJEA 3LY0A 5EY5A 1WX0A 3ZLHA 3H4XA 1BKSA 1CXIA 4G6CA 4E8CA 1CGUA 1LLZA 5E09A 2W63A 4H8VA 4C1NA 1B57A 4JN7A 5I77A 2NXIA 2OT1A 4O53A 4RZ6A 3BQ5A 4AD1A 4L4MA 1IEXA 3T2QA 2F84A 3E02A 1MQQA 3CBWA 1OEPA 3BO9A 7PTDA 1CXEA 3NO5A 1LRTA 1HXJA 1W1TA 2J74A 1XRTA 1EJ7L 5FSDC 1PPIA 5CLTA 1N8IA 1XIGA 3QH2A 1YBQB 2Z1XA 5C9RA 4MLRA 4F66A 1CCWB 4P7QA 1MNZA 4KFOA 3R4IA 1XD1A 4IPLA 1J0JA 3SADA 2EPNA 4NNCA 2YCKX 1I0BA 1PZ2A 2A5HA 3M0ZA 4LY4A 2ZRUA 3N13A 1VS1A 4YTQA 3GW0A 3QHMA 3ELFA 3HGRA 1TWZA 3O6DA 3SB0A 3BCFA 3OLDA 4DI8A 3OLEA 3C2YA 1KFEA 1WAUA 1S39A 2WLYA 1CGTA 3A64A 1GOKA 2B7PA 3B4YA 5HWMA 2V82A 1UD3A 1BD0A 1LJYA 3EDKA 1TX0A 4PUDA 3LEPA 1TJPA 5K7JA 1ECEA 4WKFA 3FJ6A 4J2PA 3GAYA 2I5GA 1RBAA 5U4NA 3PZ9A 3UNTA 3THUA 4QSFA 2DZAA 2KX9A 1KR0A 1JVNA 1PJ9A 4W85A 4Z2HA 4NZCA 2CZFA 2FFIA 2ODOA 3O1NA 1GVEA 2PBGA 1EIXA 1W1YA 3UP8A 6XIMA 1MMFA 3ZYZA 1UUQA 3L0NA 3MUY1 3KOWA 1DHKA 1ZL1A 4K8EA 3WDIA 1VEMA 2E28A 1F6PA 2PDBA 1QI0A 3VIGA 4B5UA 5GNYA 3GYCA 3GIYA 2PE4A 4HN8A 3CB8A 3NDZA 3VGHA 3AHVA 3W2JA 2R1KA 4N2YA 3UG5A 5K4XA 1E1FA 4WR3A 3VDHA 3K4WA 4D1JA 2X2GA 5EFFA 3VVGA 4QAWA 3RNDA 1W9DM 3GH5A 2P0OA 3TSMA 4F2UA 1PDZA 3K8MA 4PUNA 2WZIA 3W1NA 2OLHA 2XWDA 1VEOA 1EFZA 1ITQA 2EXOA 5BW6A 1CI1A 3AIC