1P1XA

Comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Analysis of the class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase at 0.99A resolution.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 104
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1p1xA00
3NM3A 5F1VA 3RLUA 3HGOA 2PRLA 1P4CA 4UNLA 4YWIA 2RFGA 4EF9A 1LRQA 4AWUA 3T7VA 2V30A 1GZGA 4XKYB 2CLHA 3NZRA 4UFHA 5AHMA 1H1ZA 4UR8A 4O16A 3WJWA 2V8ZA 3EKZA 2NUXA 3NQGA 2ZRYA 3TROA 1T0OA 1YYAA 1BKSA 4MZ1A 1TPDA 5LNSA 4UTKA 4JTLA 3CB8A 4O1CA 4O28A 3EXSA 4I7VA 3LOTA 2ZDRA 3UD6A 1SFLA 1OX4A 1TPUA 2G95A 4PEKA 3TJLA 1GG0A 3PSWA 1GEQA 4JIQA 1W1ZA 2C14A 2Q3OA 3EXTA 3W1AA 1VYSX 2Q3RA 3O63A 5BW6A 1O4UA 4GUFA 5G1TA 5SWUA 4KFOA 4NNCA 2VC6A 1LP6A 3INPA 1MEHA 1T99A 5G4EA 1AW2A 3M6YA 4UNKA 4NNBA 4MFEA 4RJEA 4O0KA 2NXGA 4MVAA 1UASA 4MZYA 5G1YA 3W7KA 5BNKA 2RH9A 3VNDA 5BRBA 4JICA 1QPOA 2E5CA 1OG0A 1GQNA 3HOJA 4DXVA 4RK8A 2CU0A 4XBSA 1N8FA 2Y63A 5IBXA 4FNSA 3TXZA 5IBXC 3S0CA 3TW6A 1TMHA 5FEWA 1KFLA 1BWLA 3T78A 3S5NA 1PCKA 2JKPA 3W7OA 2YW4A 1A5AA 1KFEA 4ORMA 1KFKA 1H1YA 1QDSA 5C6MA 1KA9F 3LV5A 1QO5A 2VFIA 3LCHA 4UR7A 2V2HA 4DELA 2QJIA 2Y88A 5F4SA 1TPEA 1TPWA 4K6AA 3JR2A 4EIVA 4IPIA 1PS9A 5LGXA 1IXOA 2YYUA 4KFNA 4UXDA 1YTKA 3BGGA 3N9SA 3EXRA 4NX5A 1V5XA 1L9WA 4NQ1A 3CT7A 5D03A 3G0UA 3CM4A 3MHFA 3S9YA 2AAMA 5EPDA 2NX9A 1JCMP 5KZEA 4M19A 1AMKA 1SSGA 1YTDA 3L5AA 3UWWA 4LS2A 3A23A 1H7OA 1Q6OA 1NF0A 2FQIA 1DL3A 4LY8A 1I2QA 4FHAA 1KLZA 3G24A 3G8RA 3PC0A 4ALDA 5HUPA 4H4IA 2NXHA 4FNRA 3TXVA 4N4QA 3M16A 1GTEA 3QZEA 2RHGA 4Q4KA 5DELA 3LCLA 2B7OA 1OFAA 4WX2A 2ZTKA 4X22A 3L0NA 3PG8A 3B8DA 3G1FA 4XTDA 3PBWA 5F2LA 5U4NA 3NQDA 2ZFAA 3O15A 1W5NA 2ZZ3A 1XUZA 3UXAA 1VHNA 3BGJA 2J9XA 3GZ3A 2G97A 4UFLA 3P8IA 3LB0A 1R2RA 4KFPA 3DI0A 4PA8A 1YDNA 1FWRA 1M7OA 3USBA 3W71A 2ZZ5A 1K7FA 1ZENA 4N6EA 3KRSA 1EPXA 4LRSA 4EWND 1Q3NA 5KTLA 2QCNA 3FKRA 3GVGA 2E68A 3L67A 4M7SA 3B04A 3NXFA 1SQ7A 3MUXA 2ZCGA 1Q6LA 1WAUA 1W5MA 4LNYA 2ISWA 5FF7A 2DORA 1EB3A 3A5FA 4LUJA 4YXGA 1OFBA 2TYSA 1EUAA 2CLLA 4D2JA 2QCHA 2NXIA 3GX9A 3O6YX 3PBVA 3E0IA 1LBMA 4AH7A 3MHUA 2V9DA 3IGXA 3AO0A 5AFDA 3GXNA 5CZTA 1WXJA 4NVTA 5J5RA 2C6QA 3W83A 1LLWA 3NQMA 2NV1A 4DPPA 1UCWA 4TO8A 4LU0A 2OX1A 3W2MA 3PB2A 3TAKA 3TW7A 1YPFA 3PSVA 4B5NA 4MIMA 3EX1A 2WOQA 1KM2A 3ABSA 3K30A 1A50A 1MO0A 3LERA 3NPVA 5AYXA 3G1VA 2CLIA 3LRLA 4QIUA 3GXPA 2P0OA 5EMUA 4JGDA 4PCFA 1FXPA 2WSRA 4OQVA 3LBCA 1WBJA 3WJXA 1HL2A 2FLIA 3R12A 4MKNA 3STEA 1SU5A 5DCBA 1OFPA 3W88A 1XBZA 1VYPX 3KRZA 3O16A 1O94A 1QFEA 1L6SA 2VFHA 3EX3A 4JN6A 3THQA 3PUOA 2EGZA 3SR7A 3W73A 4IX2A 1GVFA 2ZRZA 3IVTA 3M47A 2V5LA 2DJXA 2OJPA 3MBFA 2A21A 4WXYA 4YCPA 3S1WA 4IX0A 2Z2UA 2E6YA 5HNRA 3C4UA 4DPQA 3HPXA 1SZNA 1TV7A 2X1SA 4DO5A 1PE1A 2TPSA 3G1YA 4MY9A 3L9CA 4L4MA 4LV9A 1TIMA 4O10A 3C2EA 3M41A 4GNJA 4M5PA 3BG3A 3IGUA 3QW4B 5AN7A 3EWBX 3NA8A 4QNWA 4UTTA 3A24A 1GVSA 4UTTC 3C0JA 5CPMA 1R30A 2DZWA 1M5WA 4NNAA 4FIRA 4OWGA 3RU6A 4HKPA 5FF0A 4NU7A 3TMQA 4HNTA 2G5WA 3QQ1A 2W0UA 3UWZA 3OVRA 4UTWA 1W0MA 2A5HA 4UTWC 3TC7A 3TSBA 3M0ZA 3NAVA 4H3DA 1FDYA 3BO9A 5G5IA 3ZWTA 3EWYA 4WQ6A 4FO4A 4IUOA 1G4PA 8TIMA 2O7SA 4TX9A 2DZPA 3HQ1A 3D0CA 4NJGA 3CLMA 1K3UA 4EOUA 2LLEA 2W6RA 2JGYA 5D32A 3W2UA 3G1AA 4MJZA 5ABTA 3QM3A 5HR6A 3DFQA 4O11A 1M6JA 3I7RA 4PODA 1MZHA 4RLIA 4DO4A 3HG4A 3S1UA 2Y7EA 5CG7A 4IMGA 2WSQA 3ZR4A 2X1TA 2Y7FA 3P60A 4Z0SA 5AYZA 4K8HA 1PCWA 3KVMA 1F6KA 4LS1A 1FXQA 2QCGA 1GVRA 4AHPA 2YFOA 3W7EA 2Z6IA 4FX7A 5CGQA 1SW7A 1UBSA 1AW5A 3B03A 2QEZA 5DCDA 4LW7A 4UMCA 5AHNA 2GOUA 5CPOA 2ZRWA 3ELFA 4UMAA 4ZQNA 3G1HA 4DBDA 1D3GA 1MEWA 2VFEA 3OBKA 2DZXA 3HGSA 2E6AA 3O1NA 3DKJA 5CZ0A 1DHPA 4ADUA 1XXXA 2BWGA 2J9ZA 2F7FA 3TA6A 1GOXA 4AMAA 1OK6A 4OHQA 3HMJG 1RV8A 2YSWA 3SECA 4O17A 1SUXA 3QMSA 3TDFA 4LOCA 5K4ZA 3BVJA 3Q37A 1G4SA 2NX1A 4JTIA 5A8GA 1B4EA 3GDLA 1EWEA 3U8GA 5G4WA 1O5KA 1M7PA 2V82A 4Z0JA 3W86A 3LLDA 2PRHA 4JTHA 4BWLA 4BWLC 1ALDA 2ZZ6A 7TIMA 1OJXA 4KWWA 4NXKA 2QUVA 1OX4B 4WZHA 5KITA 4AWTA 1N7KA 2C19A 3KXQA 2H8XA 4JDYA 1JQVA 2HTMA 3Q94A 2YCEA 4RX0A 2BZNA 5D09A 1Y0EA 1YTEA 3LXAA 1AW1A 5FEPA 3HF3A 3P67A 1X6UA 4A3UA 2E6DA 5DY2A 4PFMA 3R5EA 2EHHA 4NX0A 2A85A 1QPRA 2J27A 1YXCA 5D30A 1QOQA 2HMCA 3H53A 2A4AA 2J24A 3W2NA 1QPQA 2I9EA 1G7UA 5K4XA 3NM1A 2WNZA 3W70A 2DU2A 2CZDA 2ZZ2A 2ABBA 3EKLA 5HQEA 3LI1A 4LC6A 3TJXA 4IMDA 1GVOA 2DZUA 1K8YA 2VENA 1A5BA 2RDUA 4BR1A 4DF2A 1A5SA 3W72A 1LLZA 3MWAA 1O60A 4NZFA 4PL2A 3W75A 2FB3A 3VE7A 3PS7A 3W3OA 3T55A 3IIVA 1TPB1 1OFDA 1TTIA 1DOSA 1DJNA 3QEZA 3W7GA 3P61A 3SSJA 1YXYA 3WJZA 1K03A 1P0KA 4FNTA 4HSNA 5HULA 2C15A 2E77A 2YXGA 3LM7A 3UY8A 1UUOA 4CLMA 3C2VA 1WYIA 1ZHAA 2DP3A 4K37A 1RZMA 1GYNA 5KINA 2QJGA 5LKYA 4PTNA 3W1PA 5I3GA 3TSMA 4C1LA 1W56A 3R8RA 3HO8A 3L5MA 5FEZA 3PAJA 1U83A 4O57A 3M44A 2CWNA 1SW0A 4WY0A 1JCLA 3FYOA 3M43A 3GK0A 2NUYA 1SO5A 2GVLA 3P84A 4OGZA 1I2PA 3QRHA 2A1YA 4CCEA 3E02A 2Y89A 1B4KA 1TV8A 5A5WA 1KM1A 3SY5A 1GYLA 1R46A 3N73A 4TMBA 3UWYA 4LVAA 2ATSA 1S5VA 3P82A 1OFEA 2WPBA 4JTGA 1L6WA 2NWRA 3W1LA 2A7PA 1PHQA 4JDBA 3C52A 1YLVA 4O15A 3G0SA 1RQHA 2V2DA 4EF8A 2JKAA 3P80A 1YDOA 2QCCA 3GIYA 4JYEA 4MUZA 3MJYA 1BWKA 3WK0A 2TMDA 3QJAA 5DXXA 1WOAA 3BARA 4C1KA 1I8JA 1R2SA 4JR5A 3THAA 2R8WA 1WDWA 2QCLA 3ABQA 2X1UA 2H8ZA 1VRDA 1SZGA 3FYPA 2VEIA 3SFKA 2PE4A 2EKCA 1EP3A 1DKWA 1VZWA 3L66A 5K2ZA 3IIZA 2NUWA 1XDLA 1JCYA 1X1ZA 1EP1A 3W07A 5L6UA 2A6LA 4O14A 5DLCA 4O4WA 4JTUA 2BTMA 2WNQA 3LRMA 3W7HA 5D38A 5MHBA 2AGKA 3L5LA 3W1TA 2Q8LA 4O52A 4PH6A 1ADOA 1XDMA 1LBLA 1RVGA 3EB2A 3NG3A 5LGZA 3MW7A 1F5ZA 3LHVA 4K38A 4O54A 4IJBA 3VI2A 3TR2A 3PULA 5AHLA 5F4WA 1R47A 5U7SA 2CLKA 3E12A 3H54A 2ALDA 5I3FA 1L2UA 4RCXA 1F74A 1B3OA 5BMXA 4MFDA 4AWSA 1KTBA 1HFBA 2XFWA 1KW1A 1WQ5A 3IIPA 3N19B 4LV4A 1XBXA 3LV6A 1TV5A 5K3VA 4AAJA 3IVUA 3KHJA 1HG3A 2BX7A 3G8EA 4PL1A 2QAPA 4ZQRA 1K7XA 1QO2A 3OHIA 1KFCA 1OFQA 1OYBA 1MXSA 3NQFA 3CEUA 4K7YA 1DJQA 3TV8A 1ICSA 1D3HA 3M5XA 5TBOA 3W1UA 4CCCA 3DFTA 1ZCOA 3BG5A 3LCFA 5LNRA 5G2WA 3DBPA 2YYTA 5I3JA 3LTYA 1OF8A 4EVZA 4LVBA 1FWWA 1FCBA 1LYXA 1MEIA 3SW6A 4O1DA 2X30A 1LM1A 4ZQMA 4FX6M 1SSDA 2J88A 2R14A 3QPYA 3BW3A 3PF3A 2H3DA 1H50A 3NQAA 4S2CA 3DFOA 3EWXA 1HUVA 3BW2A 4HT3A 3ZFHA 1ZAJA 3RF9A 4E38A 1VR6A 3S1XA 4GUIA 3DZ1A 2ATMA 5HWMA 4HNNA 3VCRA 5F2GA 3L68A 4LC8A 2Y85A 2NX3A 2YPIA 1H61A 2QUTA 2QCFA 2QAFA 4FXSA 1DV7A 2QCMA 1OX5A 1XL9A 3P5YA 3EX6A 1ME7A 2CZEA 1H5YA 3PY2A 1FWTA 4UC5A 5HWJA 1WBHA 5D05A 4TIMA 3OIXA 5DY3A 5EY5A 4A21A 3HIJA 4IGHA 3M7WA 1ZNNA 3L65A 1NFBA 4AHQA 4UIOA 1BEUA 1LZOA 1K02A 3EEGA 2PC4A 3IVSA 3C56A 2OZ0A 2YW3A 3QW3A 4OV4A 4ICNA 2PRMA 1TJRA 3M9YA 5K7JA 1FWNA 4DO6A 2P1FA 1I4NA 5HWNA 1OHLA 1DVJA 2V2CA 3Q58A 1KM0A 2YGYA 2A7NA 4FEZA 4GRSA 2FPYA 1KM4A 5AC6A 5KMYA 1NSJA 3P8JA 2X1RA 1ZFJA 3W7DA 3C2FA 3JS3A 1FUYA 4KKXA 1VQTA 2B0MA 1KLYA 1QPNA 1LRTA 3N2MA 5E0KA 3L0KA 4CQAA 4IXXA 4JTFA 4NJIA 1AL7A 2CLFA 3L21A 1TTPA 3C3NA 1W54A 5E93A 4OE7A 1LOLA 2QCEA 1SZFA 4M7TA 3G0XA 3S8HA 3LXCA 1I2NA 1RQBA 2F84A 2VFFA 2FDSA 3PG9A 4Y96A 5I3IA 3Q2DA 3BLEA 5C55A 4GXMA 4FB7A 4L4LA 5FI8A 4QQ3A 1G67A 1W5PA 1IF2A 1J5TA 3M5YA 3LTPA 4LVGA 3GDKA 4XZ9A 2EF9A 4NUWA 5D2TA 3UPWA 4O19A 3MP4A 3W6YA 3MYPA 3GDRA 2QDGA 1H7XA 4JTJA 1ICPA 3O05A 3PUDA 5KZMA 1RPXA 4ML9A 1AG1O 3LCXA 3SJ3A 1ZAHA 1JUEA 3LBMA 3CWNA 2CLEA 3I7QA 3UXDA 5L9FA 1W5OA 1VCFA 4UFIA 3IV3A 4X9SA 3NQ7A 3TC6A 3F4NA 1UB3A 4WJEA 3STGA 3W23A 4LTSA 3P81A 1FDZA 2RDWA 1HO4A 1H51A 1GTHA 4DF1A 2PURA 3MI3A 4OU1A 5EKYA 2ZQ0A 3S5OA 1S5WA 4WOQA 3V1PA 4JTSA 4RV8A 1KTCA 1RQEA 4RXFA 2FFCA 2QDHA 1TQJA 2HS6A 3P74A 1NAL1 3W7PA 3O06A 2YDAA 1HO1A 4BI7A 3UY7A 1XKYA 3ZWSA 3KFTA 1LTDA 1JVNA 1C29A 1RR2A 4IPJA 4JY9A 1FX6A 3KRUA 4QNEA 1TSIA 5F4XA 4Z1CA 3STFA 1VLIA 3QC3A 3MMTA 3LHYA 2VXNA 3NEVA 4JD4A 1SO4A 3QSRA 1PVNA 2FTPA 1OYAA 5HUOA 2VEKA 1SO3A 5I3HA 1T8XA 4JTTA 2NZLA 2QF7A 3KAOA 3VKJA 4UFJA 4Z1BA 2QR6A 1WV2A 4UTHA 1WX0A 3C61A 1Q45A 1YADA 2Y62A 1X7FA 3LLFA 3NOEA 4IMCA 4O4VA 4E0CA 5AB3A 5CSRA 1KM3A 5T26A 4Z08A 3TMLA 1VLWA 1G69A 4WY0B 4ZQCA 3V75A 3N2XA 5DN1A 4O53A 3W87A 4N4PA 3NQEA 4N9EA 2JKEA 2J6XA 3S5YA 4RKAA 3N14A 2YX0A 4M6QA 3FS2A 1LRNA 4MLJA 4WOZA 3EX4A 2QJHA 3TK7A 4MOZA 2EPHA 2YR1A 1JULA 3NZ1A 4S2BA 4LT9A 2A6NA 3TIMA 3IRDA 1YXDA 3I6RA 1D9EA 1QR7A 3B05A 4MPQA 5G2HA 3F4WA 1G4TA 2G96A 4U28A 4N9BA 1B57A 1J4EA 2CFFA 1K8ZA 1ICQA 3DFPA 2ZA1A 3HGJA 2RDTA 1VGAA 4GJ1A 1X8FA 4LRTA 4GUHA 2AQWA 2Q8ZA 4LUIA 2GVGA 3CC1A 3GYEA 1ME8A 2ZRUA 3ABRA 4GE8A 2VEMA 5AOUA 2V0TA 3BW4A 4RZ6A 3PR2A 4RR4A 4WY0F 3HPSA 2GUUA 1GT8A 2GJLA 4W9TA 4GFSA 1R2TA 4GWEA 1KV5A 1L6YA 5D02A 5D2VA 4NJKA 4AVFA 2QKFA 3GNNA 3W2JA 3TSDA 2TRSA 1QNVA 4O1BA 2C18A 3B0UX 3FA5A 2I1OA 4WXZA 3LXBA 3G1XA 1VCGA 1N55A 3MI2A 1IXNA 3W7QA 3KVKA 3M5VA 1ME9A 4YCOA 4MY1A 1KM5A 1XI3A 4WD0A 1TPC1 3A9IA 3TU9A 1OFOA 4DF0A 4N9DA 3FEMA 1NF7A 2Z0IA 3HBLA 4S1FA 4CQ8A 1AL8A 4MYXA 4K8EA 4JEQA 4G1KA 3G1SA 1DQWA 4CNNA 3LGEA 1TTJA 3TX9A 3O07A 3QQ0A 2O7QA 4DBEA 1O95A 1LOSA 1CX9A 3QFEA 4XTIA 1VJIA 3FJLA 1JUKA 1W31A 4R34A 3W7IA 3BG9A 3VFLA 1TPVA 1X1OA 1DBTA 3HG3A 3DXIA 4K36A 3W2KA 1WA3A 2NV2A 1I2RA 2E1DA 1JCNA 5LSMA 1OYCA 5HR7A 1YDVA 1TREA 2GQAA 3G18A 2C1HA 2YZRA 3TFCA 2XN1A 3UWVA 2CZFA 5D2YA 3TE9A 4NXSA 1PV8A 3NYZA 2GVJA 3W7MA 1FWSA 3CPRA 5H91A 5EBUA 3QPZA 1W37A 5EL1A 1G4EA 2VOMA 4ZVJA 3UWUA 1W3IA 3W84A 4IQLA 4O18A 1EA0A 4ZZ9A 3CWOX 3IEBA 1Z41A 5F2IA 4OV9A 2HSAA 3RFAA 1I45A 1ONRA 4HNVA 1ZJIA 3I7SA 4O12A 3WJYA 5LHFA 6TIMA 4E2BA 4O13A 4UTIA 5I3KA 3W22A 3GKAA 4BK9A 1UUMA 3LCIA 3KOFA 3W7RA 5J5DA 2JBMA 5AYYA 4AB4A 4ADTA 4JX5A 5FF2A 1GPWA 3DAQA 4Y6GA 4XWUA 1RD5A 3OVQA 4KWVA 3M5ZA 2ZTJA 4IXHA 5D04C 4P2VA 3P62A 1FDJA 5EA9A 2DZSA 3NL2A 5DXYA 1K7EA 2CW6A 3BLFA 1CI1A 3S5ZA 3MP5A 4OBTA 3R13A 3NL5A 1IGSA 1SFJA 2BXVA 4DEFA 3LCGA 3G22A 3F03K 3NGJA 4DQWA 2C16A 3CHVA 1FY6A 4E2DA 4UUIA 3PUEA 1Z44A 2XN2A 1OK4A 1TYGA 5K9DA 3MP3A 2WV8A 1P5BA 3WJSA 2Z1BA 4U4MA 1H7PA 1KBJA 3OVPA 1BTMA 3G3DA 1VYRA 4Z1AA 3C2OA 2B4GA 4RXGA 4RZ4A 1MSSA 2TSYA 3FKKA 3UNDA 3ANYA 4QM1A 1THFD 1T96A 4Q33A 3IIOA 4N6FA 5AC8A 4JTKA 1A5CA 1LBFA 5C54A 2ZZ7A 3OEXA 1P0NA 2FIQA 4P61A 3WFAA 4Y90A 4MY8A 2ZZ4A 3CQ0A 3MYOA 4GUGA 3W1NA 4ADSA 1IXQA 2GQ9A 3PB0A 4MLRA 3DHFA 3NL6A 1EWDA 3W7CA 4A2SA 4JX4A 5BOOA 2FPVA 3P7YA 4GC4A 3SGZA 4CNOA 4XKYA 3FJ6A 4O8RA 1IIHA 2QCDB 3HJZA 4JIPA 2B7QA 3HG5A 3NL3A 4NZJA 1TJPA 1U5JA 4UTJA 4NJHA 1XM3A 3MI6A 2Y6ZA 4HSOA 1S3HA 1W5QA 1P1XA 2H3BA 2HS8A 4HPJA 4TMCA 3NQ8A 1TTQA 2UV8G 1GJPA 1W3NA 2ZYFA 2NLIA 4IMFA 5FEXA 4HHPA 4GBUA 3LI0A 1TRDA 1QWGA 4N02A 4AXKA 4CCDA 2ZRVA 4NJJA 3OA3A 2CZ5A 4ZMGA 3FIGA 4JY8A 5H2ZA 4UFMA 3T40A 1FQ0A 1TPFA 4UTUA 1VPXA 3KVLA 1OABA 3ATYA 3L2IA 5FESA 4YL2A 3EWZA 2DJLA 4WUIA 3W7NA 1TRIA 3NR0A 4Y9AA 3W7JA 1YPIA 1HTIA 3TKFA 4XUGA 4ZL1A 4AHOA 1LROA 4LVDA 4RZ5A 4UCGA 1ZAIA 2OCZA 5IM51 3HPZA 1ZY9A 1ZALA 3C2RA 4AF0B 1OVDA 4H6KA 1TCDA 1H62A 2QUUA 1F2JA 4K39A 2A7RA 4HPXA 3DFNA 1H63A 3CIWA 2ISSA 1LDCA 1OX6A 2I14A 3C8FA 1KV8A 4X3ZA 3GAYA 4R53A 1H7RA 4QJ1A 2WKJA 3LDVA 1DQXA 3GKFA 4JX6A 3W85A 5LZLA 1F05A 2B7PA 3T44A 3LHTA 3HB9A 1LCOA 1TO3A 3RLVA 3HGRA 2FB2A 3LRKA 1Z42A 3EWUA 3HG2A 3E9AA 3QMTA 1OFRA 5LNVA 4Y8FA 3TQKA 3DENA 3WK3A 1J2WA 2Y7DA 4J9JA 1DORA 2KZHA 3LCWA 5AHIA 2ZRXA 3O6CA 5KSWA 3W2LA 2XN0A 1FCQA 1C9DA 3W76A 5CZJA 3KVJA 3NQ6A 3STCA 3PBUA 1JRCA 3N34A 1XBYA 1JRBA 1I2OA 1LOQA 3ABOA 2OMAA 2D73A 3E96A 2QCDA 1H7NA 3JRKA 2CLMA 2R94A 3G3MA 3W1XA 3PBYA 2EAWA 3GDMA 3H55A 2FJKA 2Y61A 2H90A 4HN4A 5CPNA 2OT1A 2WNNA 3NO5A 1QOPA 3B4UA 3TAOA 3SI9A 2ZBTA 4FX8A 2J9YA 4IOTA 5DBTA 1WOBA 4A2RA 3UZ5A 4QITA 3FLUA 1H7WA 4A29A 3LHWA 3I65A 1KM6A 1Q6QA 4POCA 4QSHA 1GVQA 2JK2A 2DZTA 3YPIA 1CW2A 3CIXA 3RNDA 4BFAA 1XC4A 5FF4A 3W1QA 5K9XA 2FPTA 4TU1A 3TNOA 4FIQA 5CKSA 3W1RA 4BI5A 5HINA 5TIMA 4CQ9A 4YMZA 4O0ZA 4QAIA 1B9BA 3KX6A 4FNQA 1JR1A 1TB3A 3A5VA 2V81A 2BLEA 3G1DA 2RKXA 2E09A 5KZDA 4MYAA 5AHFA 1JUBA 2A0NA 3I68A 2R91A 1Q6RA 3SGUA 2VKZG 3DU0A 3A22A 5CSSA 1EP2A 3UYCA 3ATZA 3NNTA 5HMSA 4AF0A 3UPBA 3ZS4A 1KFJA 2WSYA 5D33A 5GVJA 2VEPA 4K7VA 1O5XA 2OT0A 3QH2A 1FBAA 3T4CA 2C3ZA 3DI1A 2CLOA 2C13A 2BSLA 1EX5A 3CEPA 1XCFA 4OT7A 1XUUA 1KFBA 2GQ8A 5FF3A 4UFKA 2YFNA 1IIGA 5D2XA 4Z1DA 3UQNA 3B0VC 5HJLA 3IGSA 3LHZA 3FOKA 4FNUA 1S5TA 3S6DA 1GWJA 1NEYA 2C0AA 3TQ0A 1JCJA 2ZA2A 4XQ6A 1E51A 1EEPA 3EX2A 4O50A 1LORA 5TQLA 2E6FA 5BMWA 4IWWA 1PHWA 4NT0A 5F2MA 4CNPA 2B7NA 3LX9A 3MHGA 2DZVA 4M6VA 1SW3A 1SZEA 1W8SA 4PC8A 3L0GA 3NQCA 1IXPA 4MJMA 4I7WA 3GXTA 5D2WA 4IMEA 3UZJA 5LHEA 4TR9A 4FF7A 4JYFA 5CPLA 4ZQOA 3E49A 4HNUA 2NWSA 2VFDA 2Z6JA 3DGRA 3TFXA 3CTLA 4ZQPA 1EIXA 5DBUA 3SZ8A 3P5ZA 3NPXA 6ALDA 4UTMA 1JJKA 4O1AA 1OF6A 3S1VA 5C2XA 4JYDA 2JGQA 1PIIA 1F76A 2PCQA 4YLWA 1VCVA 3DFSA 1G7VA 2ISVA 3VE9A 1QMLA 3F1QA 4JNMA 2E5BA 3TCEA 5D37A 3OG3A 4LWWA 3TH6A 1QAPA 3DKLA 3O8AA 3GB6A 2W79A 3W9ZA 1F73A 3N3MA 1KTNA 3NQ2A 4I7UA 2V5BA 3U2OA 1SR9A 3GR7A 3O6DA 3RK8A 4A22A 1H60A 2GPTA 1VHCA 2ABAA 1F6PA 3M1ZA 3B06A 4JS3A 5DCEA 3GAKA 3W1MA 4LVFA 3GLCA 1GG1A 2Y70A 2E5DA 1VC4A 3GR8A 4ORIA 1UJPA 3EWWA 1W3TA 4FXRA 3NVTA 3QSTA 5LNUA 4R33A 1C8VA 4HIBA 4UTLA 2VFGA 1EUNA 3BK0A 3QYQA 5E1QA 3TUUA 4N2YA 2VELA 3SIZA 3A21A 2X16A 5F1UA 3PVFA 1JCXA 2ZA3A 3W74A 3DH7A 1SO6A 5EYWA 3LHUA 3WK2A 4R7JA 5AC7A 1VS1A 3RMJA 4FNPA 1K8XA 1QCWA 2WJZA 3NPWA 4AEOA 1G6CA 2IQTA 3QMRA 1V7YA 3PWAA 4X2RA 1TQXA 3W7LA 3BV4A 4N9CA 1SPQA 1FCVA 2ZZ1A 3MBDA 1FCUA 3GNDA 3NPUA 3S42A 2Y7GA 3LTSA 3NDOA 3NQVA 3WK1A 2WQPA 3TQVA 4Q32A 2P10A 4M6PA 2H6RA 1A53A 1Z48A 2X2GA 4JXCA 5G2IA 1XBVA 4LS0A 1KBIA 3BLIA 4XBKA 3R2GA 5K9CA 3UWQA 2GJNA 3AJXA 2WO5A 3IIXA 1VH7A 1NVMA 4BI6A 4QISA 5AHEA 3MO7A 5CZSA 3FFSA 5LNWA 4GUJA 3QF0A 4UMBA 1F7BA 3U6WA 3GDTA 1XFBA 3DHDA 4JTEA 5C5YA 3B0PA 4I9AA 1JQXA 1PL9A 3PM6A 2A2IA 4ONVA 1AK5A 3N9RA 1TPH1 3C6CA 3R89A 3CU2A 1ML1A 4BF9A 4MZ8A 3BPWA
chains in the Genus database with same CATH superfamily
3VNIA 3F4CA 3GNOA 2X42A 4PRRA 5ABFA 2V30A 1DJWA 1UBPC 1UWUA 2YL8A 4UFHA 3ANVA 1GZJA 4LSBA 4JCLA 4U31A 1LUCB 1CXFA 3NQGA 2ZRYA 3TROA 1T0OA 1BKSA 1Z89A 4Q7NA 5CPTA 4IQEA 1E55A 4NZ5A 1GG0A 2VUYA 4MTVA 3PSWA 4JIQA 2VDGA 1BAGA 2C14A 4MMWA 3AALA 1HJUA 1DIEA 4FXFA 2ZX6A 3U7BA 2Q3RA 3HTWA 5BW6A 5G1TA 1N8WA 4QDPA 2VC6A 1J79A 2D20A 4Y9NA 1AW2A 4JQ3A 4N0RA 4NNBA 1JEZA 4AUBA 1GONA 3NZGA 1W1B1 3FYYA 4MZYA 3UJSA 2F2HA 2D0GA 1B54A 5BNKA 5CC3A 4DUOA 4JICA 2BV9A 2J7GA 1KWGA 3EMCA 3VMNA 3HOJA 4JN8A 2CU0A 4XD6A 4XBSA 1F3WA 4GG9A 2QPUA 5IBXC 1IZKA 7XIMA 1J18A 4IG2B 1A3XA 3S0CA 2X8RA 5FEWA 1KFLA 5I24A 1A5AA 4ORMA 4DUWA 3KS6A 1QDSA 2GVYA 3LV5A 1UR0A 3WSUA 1BGGA 4XZHA 2PPGA 5F4SA 3EYPA 4DJDD 1TPWA 1NDZA 1WNOA 4K6AA 3QV9A 4EIVA 4GNKB 5LGXA 1IXOA 2YYUA 3TYZA 2OEKA 1XX1A 4KFNA 1BG4A 1W9DM 4AWEA 4PMDA 1P0DA 4UOQA 1RVKA 3BJTA 4GJJA 2NT0A 1KXVA 1S2AA 1SJBA 3M0YA 4M19A 1AMKA 1PIGA 4ZENA 2Y24A 3GU2A 1DWJM 2DFAA 1MW3A 1R0MA 3G8RA 4CQCA 1YRRA 2WMHA 3CHDA 4FNRA 3VIMA 3TXVA 4N4QA 1YQ2A 3WUEA 4S38A 3IWPA 5B7ZA 1EKOA 2OODA 1K4GA 4YU1A 2RHGA 3I6EA 2DVUA 1CDGA 2QHAA 1L0PA 3EBVA 2ZTKA 4M51A 3B8DA 2VZSA 3RHGA 1QK0A 5F2LA 2ZFAA 4F79A 1W5NA 1XUZA 2J9XA 4XZWA 1OD8A 1VPYA 3GY1A 1IHIA 2OPJA 3M0JA 5MKGB 1GEHA 3L4TA 3VDCA 1EPXA 5CEWA 2BBFA 1O68A 3PJWA 4HA4A 2QCNA 3PWIA 1K1DA 3ARSA 3VDGA 2E68A 4M7SA 1S5NA 2EJ1A 3NXFA 4MDOA 5A6TC 1JZ8A 4HU3A 1W5MA 4LNYA 3SUUA 5FF7A 2DORA 2C71A 4YXGA 3KCOA 4KGLA 4D2JA 2BMBA 3WLTA 4U10A 2QF8A 2W63A 3OVGA 3TN6A 2AL2B 3AO0A 5E5CA 3B9OA 1CXLA 3W2MA 3HFTA 2OX1A 4LU0A 3G5EA 2VNCA 4MWAD 2XYLA 5HQLA 1XINA 3EX1A 4DWSC 3ABSA 1A50A 4YWSA 1EJXC 4B9YA 3GXPA 2P0OA 2FDMA 5EMUA 4PCFA 2DSVA 3SQLA 1XLLA 4OQVA 1YW1A 3VGHA 3VNJA 4W8BA 2FLIA 3WBYA 4ICMA 1K4HA 1OFPA 4PMOA 1VYPX 5HK4A 3KRZA 3O16A 2Z7KA 2VFHA 4JN6A 1W3HA 3THQA 3CIVA 2EGZA 1QNPA 3SR7A 4PMZA 3LQLA 3UWEA 4IX2A 3RPTA 1TFVA 3KM8A 4IX0A 2E6YA 5I03A 4DO5A 4AVNA 1PE1A 3L9CA 4L4MA 1QK2A 4GNJA 4UTTA 3SCRA 4GQQA 2OLSA 2CHOA 4U3CA 1H0IA 3O7UA 2W92A 4FIRA 3SY8A 4HKPA 4IICA 4PTMA 2G5WA 3HQOA 3QQ1A 4UTWA 1NJJA 4UQCA 2QMKA 1DQUA 1ZB5A 3IPWA 4WLCA 3M0ZA 4H3DA 1S2WA 3BO9A 3H4GA 5A6LA 4HYRA 3U0HA 1CBGA 4N42A 3BXWA 8TIMA 1PBGA 2O7SA 2DZPA 2D2HA 4NJGA 3S6TA 3CLMA 1EC8A 2A3HA 1EXBA 2LLEA 2JGYA 3Q65A 4QEHA 5D32A 3G1AA 1LWIA 3QM3A 1M6JA 4U5KA 3URAA 1IT0A 1MZHA 1ZBKA 2QGYA 4AD3A 4IMGA 2X1TA 4Z0SA 3S6OA 4K8HA 1UKSA 3KVMA 4IZGA 3E2RA 1Q66A 1GVRA 2GYIA 2I9UA 3A13A 4AHPA 3IJDA 4C6CA 1EBGA 1P7TB 4MGGA 3W00A 2GOUA 5T9BG 4UMAA 2F8QA 1KCXA 2DZXA 4Q4OA 3HGSA 1DHPA 1XXXA 4RZBA 4K68A 3PJTA 4CD7A 2F9RA 3VKCA 1GOXA 3MQTA 4AMAA 4OHQA 3HMJG 2YSWA 4O17A 3IJLA 2CWXA 2BY0A 5FD0A 5CC5A 4OTKA 3Q37A 4RNHA 2PDMA 2WZHA 2DUXA 2WMJA 1SFTA 2DZBA 2ZVIA 7TIMA 2A3EA 2QUVA 3PNUA 3FXYA 4C6DA 2C19A 4CN4A 2OU4A 1YPXA 3AHXA 2V6AA 1NTHA 2HTMA 2J47A 1LQ0A 3MANA 5I79A 5IDZA 2BZNA 5D09A 5EB8A 1QI4A 1MRQA 3EOLA 1HJVA 4LBRA 1A0DA 1U5VA 4PB5A 1X6UA 3WF0A 3AIBA 3TN5A 1QTWA 3NSXA 4PFMA 3OLGA 4B91A 2OR2A 3WBAA 2A85A 1QPRA 5AC4A 1UWTA 2P0IA 1QOQA 2A4AA 4J3VA 4JTQA 1TWIA 2OQHA 2VOTA 3ZVHB 5KZ6A 3W70A 2W5FA 2ABBA 5A8OA 1F3TA 3N2CA 5HQEA 1ZJBA 4D1IA 4YVPA 1BG9A 4FMVA 1K8YA 3R11A 1A5BA 1J0YA 4IIFA 4BR1A 2WZEA 3EDEA 3H6OA 3BQ5A 1LLZA 3MWAA 1M1BA 3UJRA 3PS7A 4LH8A 4B5XA 3W3OA 3ECQA 2GDUA 1QI0A 2WVUA 4W93A 3T1GA 1I0DA 1P0KA 5TNVA 2A3LA 4F2TA 3VUSA 3GU1A 4H8VA 3MT1A 3UY8A 3CO8A 1ZHAA 1L6FA 2DP3A 4H00A 5BROA 1RZMA 2QJGA 2E8ZA 3MB9A 3TSMA 1KXQA 1GQLA 1U83A 3M44A 1KR0A 1SW0A 3M43A 4YTSA 1UD8A 1SO5A 2GVLA 4WK9A 1I2PA 2GJXA 3BSGA 2A1YA 3WF4A 1B31A 4J35A 3E02A 2PWEA 4F0SA 1XLIA 4BEQA 2QIWA 3BAYA 3LGDA 1XRFA 2J62A 4D6DA 1S5VA 1PSCA 1OFEA 3R4IA 1HX0A 3KW3A 1JIBA 2A7PA 1R87A 2WC3A 3C52A 3NQBA 5FCZA 4DYJA 2V2DA 4GPNA 3P80A 3WK0A 2TMDA 1C92A 3NGFA 4H9VA 4F40A 4GCAA 4UOJA 3LZ5A 4QDMA 4AY8A 1GOKA 5DXXA 4C1KA 3BARA 4YHGA 3H4WA 1V02A 1KXTA 5EMJA 3THAA 3ONBA 2QCLA 2PGRA 2X1UA 3U5YA 5JH2A 2O4MA 1DKWA 2C91A 3L66A 4XZMX 4FS9A 3PPFA 3W38A 1X38A 2NVCA 1NWUA 2A6LA 1AH4A 2WNQA 3URNA 3NUKA 3N04A 5D38A 3E3HA 1CXKA 3KOXA 2AGKA 3AWNA 3L5LA 2Q8LA 4LEQA 2OEMA 4DM1A 4G1NA 3WIJA 1LBLA 1T6MA 3EB2A 2FZDA 3MW7A 3LHVA 3ZLFA 1B0IA 1RUSA 5AHLA 1LL7A 5U7SA 2C1IA 4GGBA 4K3ZA 3H2FA 3B0XA 2ALDA 3OGSA 1O66A 4AIBA 1JYNA 4AWSA 6REQA 2Q01A 2XFWA 3BLLA 4KETA 4LV4A 3OIHA 5K3VA 3VIPA 1RD6A 5I5RA 3O9NA 2BX7A 1YNQA 5C2GA 3G8EA 4GI9A 3KBNA 3VABA 2OZ3A 4WGHA 3GQYA 3ZOAA 5A6BD 4IPPA 2J25A 2XWEA 3VIFA 2PGFA 2WB5A 3DBPA 5I3JA 3ITTA 2BOEX 4Z17A 1X97A 4EVZA 1FWWA 3RJYA 1R9ZA 1U2YA 3UA4A 4S3BA 1LYXA 4B3ZA 2X30A 1U5HA 1LM1A 3GFZA 4S3DA 1IEXA 1QHZA 1SMAA 1GOOA 4AIUA 4L9YA 3QPYA 4GFIA 4REQB 3CMFA 5CBJA 3EWXA 2POTA 4W4QA 3P2VA 3N25A 1V3HA 2PF8A 3S1XA 4GUIA 3DZ1A 3ENLA 5HNUA 5HWMA 1JPKA 2ZX7A 1M53A 3WH9A 4ZXLA 4PCNA 2YA1A 1YE4A 1DV7A 4UNIA 1XLMA 4HU8A 4RL3A 3TOPA 3WFZA 2ZUVA 3SUTA 3VKDA 1FWTA 1AJ0A 3OIXA 5AKQA 1S2VA 4A21A 3QPEA 4IGHA 4RW5A 3ZJ8A 3RX4A 4JZ5A 1ZNNA 3RR4A 1MNZA 2EBNA 1BEUA 1LZOA 4CU8A 4ZSUA 3A6OA 4OV4A 1TJRA 3HN3A 5IRPA 1GQKA 1EFZA 1Q4WA 5HPCA 1TE6A 5LIYX 5HWNA 3U57A 2ZIDA 1KM0A 1UR4A 2A7NA 1J0HA 1KM4A 5AC6A 2GLKA 4GIYA 4QROA 5KMYA 2X1RA 5A2BA 1XH0A 4Q6XA 4WDUA 4BQ5A 2VEFA 1V51A 7TAAA 3GZAA 1FUYA 1VQTA 2ADAA 1LRTA 1ITQA 1MDRA 3B9DA 4IXXA 4AZBA 4JTFA 2Y5JA 3RLHA 3N1AA 1NH6A 1DWHM 1K9DA 4QP0A 5HJYA 1PWLA 5CH9A 2VFFA 4NAFA 2W91A 1KRMA 4FB7A 4L4LA 5FI8A 1G67A 1W5PA 3H7VA 3M5YA 3S2LA 4NUWA 3CMJA 3IK2A 3UPWA 3MP4A 5E9XA 4JTJA 1DE6A 1E6ZA 4AEEA 5JVLA 3NWRA 3SJ3A 4C6LA 1ZAHA 3CUGA 1OCJA 3LBMA 3CWNA 1QT1A 2J7FA 2XVNA 1W5OA 1JZ3A 5DANA 1XKJA 2QIIA 3NQ7A 4PEEA 4QR6A 1UB3A 4WCJA 3APTA 1FDZA 4C6KA 1H51A 4YVVA 4WDWA 5HQMA 4H9ZA 4WOQA 3V1PA 4JTSA 3ITCA 1W17A 2EPMX 4AZHA 1KTCA 4HZMA 2HVNA 4YTUA 3SCNA 1NELA 1XGEA 1NAL1 1HKMA 3ZT5A 2Z24A 3XINA 3VD9A 4RDWA 3W6LA 5C7HA 1SVDA 2Z29A 2PLCA 3KFTA 2ZUWA 2OSYA 3SM0A 4IPJA 4JQ2A 1R5YA 4JY9A 2WHJA 3KRUA 4QNEA 3STFA 1CT5A 4FPSA 3WH6A 3SIMA 1SO4A 3QSRA 1T8XA 4JTTA 3AC0A 1X39A 2QF7A 3VKJA 4UFJA 3MUAA 1FWAC 1OINA 5PTDA 1FWEC 1XG3A 1IEQA 4IMCA 4O4VA 2OWXA 5CSRA 4Z08A 3TMLA 1VLWA 1VJZA 2WYSA 1G69A 4WY0B 4ZQCA 3N2XA 1Y7VA 4DYKA 1US2A 4N9EA 1HJXA 1TVLA 3GNXA 1ENUA 4GI8A 3S5YA 4KWOA 4CEXC 3N14A 1TVPA 4P5UA 2OB3A 4GMEA 2GGJA 4MOZA 1UWIA 3ZT7A 4B9ZA 4TX8A 2A6NA 2HE5A 3MCNA 2WM0A 4PUMA 3AYRA 1CXEA 3I6RA 1KRAC 3OGRA 1D9EA 3B05A 3FX4A 1B3ZA 1O5QA 3SY1A 3AIWA 1H11A 5G2HA 3F4WA 1G4TA 2G96A 4U28A 3VOGA 5TD4A 1EHAA 3DFPA 2ZA1A 3MC5A 1ELSA 1R3RA 4KPLA 1UIPA 2AQWA 2Q8ZA 2GVGA 1LT7A 4E6MA 2V5JA 4GE8A 5AOUA 3UXIA 3RO6A 3BW4A 4RR4A 4GFSA 4GWEA 1L6YA 5E6YA 3EB3A 1A4MA 3TTSA 4AQLA 2O9RA 2C18A 3KBJA 1UC4A 1MW1A 3FA5A 4MNMA 1VCGA 5LA0A 2PGWA 2E40A 1OB0A 5HPOA 3MI2A 3FY1A 3PTQA 1CEOA 1ME9A 4YCOA 2YCKX 1TPC1 1OFOA 4D9PA 3QHMA 3N11A 3HBLA 4OUEA 4S1FA 1VAHA 2FH8A 1DQWA 4CNNA 2FTWA 4N7QA 1UA3A 4DBEA 4I9TA 4WSHA 3QFEA 1YX1A 3VU2A 3EPOA 4XD4A 1JUKA 2BHZA 4LUYA 3BLOA 4AU0A 3ES7A 4R34A 2NLYA 4C60A 1LLOA 3VFLA 1TPVA 3SCVA 3VD3A 3DXIA 1WA3A 2OO0A 1NWRA 4MWAA 3E2VA 5LSMA 5D8WA 4PMRA 1E0WA 2OGYA 3TFCA 5EGRA 3BSMA 1BVZA 3UWVA 2CZFA 1PYFA 1Q13A 3IUDA 2HDJA 3TA9A 1KQZA 1VFTA 2CIPA 3RLGA 4DRSA 4M1BA 3H2CA 4R27A 1DJIA 5FJRA 2IPGA 5J8LA 4D6HA 3W84A 1EA0A 2ZXDA 3CWOX 3THCA 2V3EA 4D8AA 3A12A 5E0FA 1ZJIA 3I7SA 2ZXAA 3UCQA 1G5AA 5I3KA 1BKHA 3KOFA 4YIWA 3PFRA 3CUZA 2JBMA 4ADTA 3UZZA 3QTGA 3SJNA 1Q65A 3QHOA 3GTFA 1UQYA 3BWWA 4KWVA 4LFYA 4P2VA 4IH3A 2DZSA 5A6AA 2VGFA 2PDGA 3MP5A 3LM3A 2I56A 3LCGA 1QWKA 3H21A 3CHVA 1JPHA 4UUIA 4AIEA 3MSRA 2XN2A 1K9EA 3R8GA 2RDXA 2PZ0A 3N13A 2Z1BA 2IPWA 2KX9A 4A3YA 1BTMA 4ECLA 5XINA 3VAVA 2WVSA 4Z1AA 3N9KA 1EQCA 1KR1A 1MSSA 2TSYA 3CZGA 2FHFA 4QM1A 4G56A 1T96A 3GC2A 3P0XA 5AC8A 1LBFA 1E71M 1V6XA 4P61A 4Y90A 4MY8A 1MQPA 3MYOA 3VNMA 2XISA 3DHFA 4IIBA 2D3NA 4A2SA 4F48A 3AZRA 4JX4A 5BOOA 4P8XA 3E6EA 3P7YA 3DIPA 4DB7A 1X98A 2D2OA 2I5QA 1SJDA 1FWIC 3OZMA 4NJHA 1FTXA 1XG4A 1XM3A 3VM7A 1XLFA 3LGGA 3LLXA 1OBAA 1S3HA 3M0MA 2F2KA 1D3CA 1N82A 4BEUA 5A2AA 2UV8G 4H01A 1W3NA 4AZCA 2YL9A 2W3ZA 1TRDA 4IP5A 4N02A 2YB1A 3SN0A 3WENA 3T40A 3MA8A 2F61A 3AMKA 4UTUA 1HJSA 1E6XM 3SO7A 3ZVIA 1WB0A 2G4JA 1OABA 4WUIA 3W7NA 5C9RA 3B3DA 2A79A 3R94A 4UR9A 2HE8A 4WGXA 1TWWA 4U33A 4B2DD 3CLWA 5E70A 2C7FA 4LVDA 3B4YA 3A4AA 1ZY9A 2P50A 4IG2A 3MPGA 4H6EA 1TCDA 2QUUA 1GOQA 1F2JA 3UG5A 1XLCA 1H63A 2ISSA 1TKKA 4HJWA 2D3LA 1OX6A 1EZWA 7A3HA 3KBMA 1BPLB 1KV8A 4R53A 1H7RA 4S3GA 2WKJA 4LUTB 5A8NA 1DQXA 1IWBA 2B7PA 3VKAA 3LHTA 3GSMA 5DMMA 1YHTA 2FB2A 3NEHA 4PTXA 1OFRA 4C6NA 3POHA 4Y8FA 3DENA 1PX4A 4Q8TA 1CB2A 2KZHA 1R38A 3O6CA 2XN0A 1ISVA 1V6VA 5CZJA 3NQ6A 3STCA 1RCQA 3N34A 1F4AA 4EAMA 3GHUA 1JDDA 4LPCA 2ZX9A 4HNLA 4DZHA 4LCQA 4XSLA 2QCDA 3E96A 3WEOA 4J3TA 3JRKA 1RA0A 1TR1A 1NFPA 4L1XA 3COTA 3H55A 3VDHA 1JDFA 1VFLA 2FJKA 1UR9A 4H83A 3RM9A 3L4XA 1HVXA 2D0HA 2UY2A 4BS0A 2VZVA 2OKOA 1WOBA 3HQNA 2BVDA 3FLUA 5I07A 4JNZA 3I65A 4IL2A 1GVQA 2JK2A 2ZXBA 4HPGA 1HGYA 4UCFA 4Q4RA 3C86A 3R7MA 3WQGA 3UYIA 3KTCA 2FPTA 1Q6CA 4DYEA 4BI5A 3W1RA 4GXWA 3CH9A 4GOAA 1W3LA 4YMZA 2DPEA 1AZ1A 2BLEA 1OIMA 2RKXA 2E09A 1KO0A 4MYAA 5AHFA 5IHRA 4PMNA 3I68A 5MKGA 3SGUA 1VRXA 4LYRA 3NNTA 4Q8OA 4CD4A 1KKOA 4AF0A 5DT5A 2WSYA 4K7VA 3DFYA 1M3UA 2OT0A 4F9JA 5BXSA 3ARXA 4ZOAA 4QCEA 2C3ZA 1IWPA 2BSLA 2BHYA 4L6OA 3KBSA 4AD0A 1XCFA 3WH8A 3KP1A 2GQ8A 1E56A 2E8YA 3WNKA 3B0VC 5HJLA 4OFCA 2DIJA 1G94A 3LHZA 4D6EA 1A80A 1WPCA 3S6DA 1GWJA 2VVSA 4P7NA 4AY1A 1E51A 1EEPA 4O50A 3WO8A 1LORA 3AUJA 4Q7IA 5TQLA 5BMWA 4X61A 5CAHA 5GNZA 1Z6KA 2B7NA 3LX9A 3F2DA 3QLLA 1J0IA 4PC8A 1MWOA 4NI8A 1HN1A 4MJMA 4ZODA 3GXTA 3KCJA 4ZTYA 3UZJA 3S2CA 4FF7A 1EJRC 3PK7A 4QLLA 4NG3A 1U1JA 1IEWA 3CTLA 3SZ8A 4KMQA 3P5ZA 6ALDA 1ECEA 3PZNA 1DIKA 3BGAA 4JYDA 4GISA 4YLWA 5HBFA 2V3GA 1G7VA 4JNMA 4P7RA 4LYKA 3TCEA 5D37A 3TTQA 2GVEA 3RX2A 1UR8A 3N3MA 1KTNA 2AQOA 3O6DA 4ROQA 4B4HA 4IFKA 1EQPA 1POKA 3AMDA 2W27A 4F4RA 3SRDA 5A1AA 3SFWA 2E5DA 3GR8A 3UZWA 1FWFC 2ZADA 5A6BA 2HVMA 4S3JA 1W3TA 2ACRA 3MSDA 5C70A 4MNKA 1OGSA 4UTLA 2PTZA 4IJCA 1UQZA 1ZBCA 4ZFCA 2XIBA 3PVFA 4JFTA 4M1RA 3S5SA 2B31A 1CGYA 3LHUA 3V5OA 3WK2A 1TWDA 4Q4MA 3RMJA 2IXUA 4CD6A 1C8QA 1MZRA 4UQBA 1RY0A 1V7YA 3W7LA 1SPQA 3AXMA 4MSSA 1FCUA 1KBBA 2PUZA 3GNDA 3NPUA 5H8PA 1IR1A 3NDOA 4PUKA 4XBJA 4Q32A 1E9YB 2X2GA 3VOIA 2QS8A 2NQJA 1KBIA 1WE5A 1FWHC 3R2GA 3GBEA 3KCLA 2GJNA 4NAEB 6CGTA 2WO5A 4PCSA 2O4QA 4QISA 1UROA 5AHEA 5CZSA 3FFSA 5LNWA 1WDPA 1NM9A 2XIJA 4UMBA 1F7BA 1GORA 3U6WA 3PPHA 2JEQA 1P7TA 3UERA 2J4GA 1ADSA 3GXFA 5C5YA 2WHMA 4GYPC 5EFFA 3FDKA 2UY4A 1JQXA 1E5NA 4TVDA 4JOMA 3R89A 2PMQA 3NM3A 4PUDA 4QQUA 5F1VA 4HU4A 3FSUA 4WKAA 4EF9A 3TNBA 1VIWA 3AAMA 1KKRA 2CLHA 1CENA 5G1MA 2NUXA 4L4OA 3AHTA 1TPDA 5LNSA 4JTLA 3MCMA 4O1CA 3QR0A 1GQIA 1XSIA 3EXSA 3LOTA 2ZDSA 1BSLA 1GEQA 1W1ZA 5JIPA 2GGHA 4PMVA 3ABZA 3USZA 3TLLA 2ZKMX 3LNMA 2QV5A 4GUFA 5SWUA 1IZJA 5G4EA 4GK8A 1T99A 1IT7A 3IJ9A 4PUEA 2NXGA 4MVAA 3CBWA 3O2LA 3SADA 1UKQA 4W8AA 3OODA 5G1YA 3UGRA 4D6GA 3CWHA 3QYSA 2PP1A 5BU9A 5JBEA 3VNDA 3GFYA 2D0FA 5BRBA 5FL0A 1EHNA 2E5CA 1GQNA 3UETA 1Q5MA 1RHCA 3ZVHA 4DXVA 2WJDA 4RK8A 4IGMA 1N8FA 2Y63A 4FNSA 3TXZA 2PP3A 3L2LA 4H04A 2PWGA 5AVHA 5I6SA 2XU2A 2QULA 3V18A 1H09A 1JNDA 2DT1A 2BVYA 2JKPA 2R24A 1KFEA 2YOCA 2HBVA 1KFKA 1H1YA 6A3HA 3WUFA 5C6MA 4R7OA 3LCHA 3C2YA 5GNYA 3KBVA 2QW5A 3KUMA 1UMLA 1EDTA 4MHBA 1J93A 3BJFA 3M6DA 1U33A 1PS9A 3L12A 1YTKA 4TVUA 1RJRA 3N9SA 4NX5A 4LBUA 1L9WA 4NQ1A 3CT7A 5D03A 3L4WA 2Z2AA 2AAMA 5EPDA 1JCMP 3OLDA 1YTDA 1XIJA 1ZRQA 3OLIA 4H6QA 2XSBA 4LS2A 1Q6OA 1MXDA 2YDSA 1RXOB 3CT2A 1QOXA 2DZAA 5HUPA 2FZ8A 3WLPA 1XPYA 4H2CA 3M16A 2WMKA 2CBJA 2Z1XA 1EO7A 3BSHA 1MW2A 3GC5A 3UU0A 1HKKA 2PDXA 1XS2A 3LCLA 3M0LA 3AOFA 3RM8A 1P48A 2OOFA 2C0HA 4YN5A 3NSMA 2X7VA 1YNYA 3PBWA 2VGGA 3NQDA 2PA6A 4GVGA 2YXOA 2YCJA 3UXAA 4XG1A 3BGJA 1PB0A 3GZ3A 4XZIA 2WM1A 3P8IA 1R2RA 5HXMA 4KFPA 4PA8A 3GTXA 1M7OA 3AQUA 2FVMA 2V5CA 2CNCA 3NZPA 1UD4A 3KRSA 3O3RA 1BXCA 3AZTA 1Q3NA 2IQ0A 3XIMA 4JFVA 4PN2A 3L67A 3K46A 3B04A 1SQ7A 5KETA 3MUXA 2ZCGA 3VPLA 1WAUA 2ISWA 2XZ9A 3A5FA 1OFBA 4H8UA 1UKTA 3UG4A 4DUVA 5A95A 4GY0A 4CQBA 1LBMA 3MHUA 2ZXQA 1PIFA 1ONWA 2V9DA 4XV0A 3QVQA 3EAUA 4EPEC 5AFDA 5CZTA 4MB4A 2JEPA 4NVTA 1AUSL 3WD3A 1GPFA 4EP8C 3EDFA 1V6YA 3NQMA 2NV1A 2HISA 3A4WA 4J3XA 1PYMA 4B5UA 1UCWA 4TO8A 4WSKA 3PB2A 3TAKA 1YPFA 1PKNA 1LWJA 4E4PA 4B5NA 4F0HA 1E0UA 4DUXA 1H4PA 1KM2A 4YPJA 3K30A 3M0VA 1MO0A 3LERA 3NPVA 3G1VA 2CLIA 1Q6DA 4AZ7A 3A3HA 3VZXA 3LN3A 4JGDA 4HU0A 4GIAA 4DO7A 1MW0A 3WJXA 4OUIA 1HL2A 1JAKA 4GLEA 4MKNA 1SJAA 3W88A 1XBZA 1IE7C 3N4FA 4IL0A 5BOEA 4WKHA 1E0VA 4UZSA 1O94A 1Q8AA 4NZCA 1L6SA 3EX3A 3N2TA 3PUOA 4IPNB 1A5UA 3OP2A 4B92A 5A6MA 2DVXA 3IVTA 2DJXA 2J79A 1IR2A 2GSJA 5CCZA 3MBFA 4KEMA 1JDCA 2PDPA 3MDWA 2Z2UA 3S3GA 4DPQA 1REQB 1TV7A 2PDIA 3G1YA 4MY9A 1TIMA 4M5PA 3BG3A 3QW4B 4REQA 4L61A 2E3ZA 5FACA 1GVSA 2OYMA 4UTTC 5CPMA 4A8IA 4H1ZA 1OC6A 4XAGA 2OQYA 4S3FA 1GOIA 4HSHA 4G6CA 3DGBA 4ZB0A 4RE3A 3LS9A 4NNAA 2PD5A 4OWGA 1CIUA 2WVVA 4NU7A 3BAJA 2GGGA 5C9ZA 3ITXA 3OVRA 2A5HA 4UTWC 4NZ4A 1VEOA 3NAVA 4XK2A 1FDYA 4W5ZA 1OIFA 4G8TA 1O1ZA 4FO4A 4GKTA 2P3ZA 3CAVA 4TX9A 3AHYA 3P3BA 4HP5A 1Q2RA 6ENLA 5ABTA 3WQFA 5HR6A 3DFQA 4PODA 3JZEA 4DO4A 2Y7EA 3ZR4A 2Y7FA 3AICA 1WKDA 1FXQA 3EOOA 1IYXA 3ZYZA 1VBRA 2WBKA 2Y1HA 3EOEA 4JFUA 5AY7A 2OWCA 1UH4A 3VNKA 5M5DA 2ZRWA 3VKKA 2VDHA 1MEWA 4Y9OA 5HA7A 1A3WA 2E6AA 1TVNA 4ADUA 3QV7A 3ITYA 3RDKA 4Y7EA 1JCTA 2I5IA 1XLHA 5JUVA 1VBUA 1A4LA 1JXJA 3WLMA 2DGAA 3QMSA 4LOCA 2PDJA 4H7VA 1B3WA 4JTIA 5A8PA 5A8GA 1TWZA 5G4WA 3GH5A 2FZBA 1Z8AA 2V82A 3STPA 2GJXB 4JTHA 4BWLA 2NQLA 2ZZ6A 1HL9A 1OX4B 2RAGA 1K70A 1EGZA 2H8XA 1JQVA 3Q94A 5GJPA 1FOBA 2OWWA 1Y0EA 1UIOA 3W82A 4HZ8A 1O6IA 4DJEA 3OBEA 3HF3A 3P67A 1C3FA 1CTNA 3FK4A 3R5EA 3GH4A 1OD0A 4GI4A 3FVMA 1EF3A 2HMCA 3V7PA 4CU6A 2DT0A 3W2NA 1QPQA 1X6LA 3R25A 1Q6FA 2E0PA 5K4XA 3NM1A 1CECA 2AOSA 4Q4PA 5FSDC 3WG6A 2DU2A 2CZDA 3LI1A 2H9AB 4JL1A 3TJXA 2VENA 4KEZA 3ZLGA 1A5SA 4B2DA 3W72A 3DX5A 1NDVA 2PWUA 1HXJA 3CZ8A 5AVNA 4NZFA 3PPGA 2FB3A 3VE7A 3ARYA 5EMYA 1E6QM 3VIIA 1PKLA 2BXYA 1WUFA 3FEQA 3QR3A 3QEZA 1DJNA 3W7GA 4HZ6A 3SSJA 3NIYA 1YXYA 2VGBA 4QAWA 1DWGM 4FNTA 5HULA 3SQSA 4AYGA 2E77A 2J6VA 2YXGA 3UFYA 2JIWA 4GZEA 4CLMA 1WYIA 4K37A 2XH2A 3W1PA 3CUHA 4XO6A 3CS2A 3UPMA 3MV11 5FEZA 6REQB 5AZ1A 2W61A 3PAJA 4O57A 3UBPC 4WY0A 1JCLA 5CGMA 2NUYA 1XDJA 3U4AA 3BURA 3C0QA 2WQDA 3VILA 4MKVA 2Y89A 4ZTXA 5A5WA 3V0TA 1KM1A 1GYLA 4XAZA 1ZGDA 1R46A 3BOLA 4TXEA 4TMBA 1VFMA 2EQDA 2VM8A 3SUWA 5A6JA 5FJOA 3W1LA 7ODCA 1PHQA 3CUXA 4O15A 1DIOA 1QVBA 3B8IA 1RBAA 1RQHA 4L6HA 4EF8A 3ITVA 3DCPA 1YDOA 2QCCA 4JYEA 1A5MC 3MJYA 1BWKA 4X63A 3RN6A 3M07A 3B9AA 4LNCA 2D22A 2VX7A 2R6OA 4W86A 1R2SA 1FWCC 1NOWA 4JR5A 2XVPA 2QNEA 3ABQA 1TR9A 1VRDA 1SZGA 4HPNA 3NXLA 1EP3A 5A6KA 3IIZA 2NUWA 1JCYA 5FL1A 1UW9A 3W07A 4EK7A 4LYQA 4YTTA 5DLCA 3I10A 1UZ1A 4PMJA 4JTUA 3LRMA 3W7HA 2GJRA 2AMXA 2FYMA 4J27A 2MANA 2P76A 4TQTA 1QUMA 5BWAA 1XDMA 4KRTA 4QG8A 4AC7C 4H2HA 3NG3A 5LGZA 3AXKA 1F5ZA 3DDMA 3T08A 1R47A 1WXYA 1QW7A 2CLKA 3E12A 2YZ5A 4AZGA 1A47A 1B3OA 3IK4A 3ZQ9A 1J0KA 2VC5A 3LV6A 4QGCA 3IVUA 4US5A 1WP6A 2QAPA 4ZQRA 1K7XA 1QO2A 1RBLA 4AG0A 1OYBA 1K77A 3BLPX 4J40A 3BTNA 3W1UA 3WDQA 4KERA 1XD0A 4EXAA 3WYZA 3DFTA 3BG5A 3LCFA 2YYTA 3W53A 3LTYA 1OF8A 4XUYA 4C6OA 4URIA 4LVBA 3UCCA 3BH4A 1VJSA 3VIGA 4A3HA 5E0CA 3PZVA 4ZQMA 1UWSA 1YEYA 1TUFA 5HATA 3A4JA 3W81A 3BW3A 5BCAA 3B8SA 4CN1A 1PZ0A 1OC7A 4LXFA 2BVTA 4DN1A 8A3HA 2BODX 3RF9A 1XSJA 4HK6A 4L1GA 1RJQA 2RJGA 4HNNA 4HQVA 2X0HA 4D8LA 4QE4A 3WD2A 1A5NC 3CXOA 1OCBA 4FXSA 4AIOA 3EX6A 2CZEA 4YVXA 4XAYA 2GZXA 4UC5A 3T2PA 4CVWA 1WBHA 3S2MA 2E28A 4HTBA 5DY3A 1KGXA 1V93A 3AWOA 3M7WA 1NFBA 1BYAA 1M04A 4AHQA 1K02A 3A3XA 2PC4A 2OZ0A 2YW3A 3UR7A 4HMDA 5D9PA 4TTUA 2F6KA 3RJXA 3QR1A 1RLDA 1W32A 3BDKA 2V2CA 4LF2A 2VX6A 4GRSA 4A8LA 2FPYA 4B5TA 3P0WA 2IKJA 3P8JA 4WJ8A 4QFUA 4GVHA 3W7DA 3C2FA 2ALRA 2WHLA 1UWAA 3JS3A 5B7YA 3IGHX 4MDPA 1C8XA 2B0MA 3T8QA 4ZGYA 1KLYA 4HMEA 2INFA 3N2MA 4IIDA 3L0KA 4CQAA 1E6SM 3L21A 5JBDA 3C3NA 1GZ1A 1OCNA 5E93A 3VC6A 3QV6A 3UNTA 3HV9A 5AYBA 4H41A 4V15A 3SCQA 1Q7ZA 4C1NA 4LQ1A 2E9LA 1SZFA 2CZVA 4M7TA 5JMUA 3LXCA 1I2NA 5D4YA 3GIPA 4Y96A 1FH7A 1MQRA 3BLEA 3UW6A 5C55A 5IFTA 1IF2A 1J5TA 1DWIM 3WN6A 2EPLX 4JQAA 6XIMA 3HV8A 1T8QA 1E6RA 5D2TA 3L7RA 5LA2A 4O19A 2W4XA 4WF7A 3H7RA 3MYPA 3GDRA 2VCAA 4DXKA 3O05A 3PUDA 2ACSA 1TX0A 5LXEA 5M2FX 4OOZA 2CLEA 5BU6A 1OSEA 4UFIA 3VOFA 2PTYA 4MADA 4X9SA 2NQZA 3F4NA 4GJIA 3T07A 3WKZA 5ECUA 1FWDC 4PSRA 4BQ3A 4WJEA 4LTSA 3S2JA 4PBFA 3B40A 1EYEA 3JVAA 1GTHA 4XIMA 1Y5XA 2BY2A 3LG3A 3IRSA 4LUTA 3IARA 1FH8A 4Z2IA 2QDHA 3CNYA 1RPKA 3TTOA 3GHSA 3I6TA 3SCWA 3O06A 2YDAA 1HO1A 1SJCA 3W4RA 1XKYA 4UZUA 4RE2A 2PLJA 4CD5A 1RR2A 3OHMB 5F4XA 4Z1CA 2ZUSA 1HP4A 3MMTA 1ZCCA 1E0XA 2VXNA 4DNMA 1W1YA 4ZBCA 2VEKA 2QR6A 1WV2A 2VL4A 2ZX8A 5E9AA 1YADA 2Y62A 4NILA 1X7FA 1Z69A 5AB3A 1KM3A 5T26A 1PX3A 3UESA 5I02A 1XWYA 1IWAA 3R79A 2DH2A 5IDIA 5DN1A 4QE1A 3W87A 2WLYA 3NQEA 4L5ZA 2ZWZA 5DFAA 1BXBA 4ICCX 2J6XA 3MZ2A 2YX0A 5MF5A 3KOYA 1ITCA 1GJWA 4MLJA 5RUBA 2AL1A 3NZ1A 4S2BA 4WR3A 5BZAA 1YXDA 4Q8PA 3T09A 3WLOA 4MPQA 4KRUA 1B57A 2CFFA 2IPJA 3AS0A 1ICQA 2W66A 3HGJA 3UG8A 3RIKA 2FTYA 1ME8A 2ZRUA 3ABRA 2WPGA 3GWQA 1EF2A 1VD6A 3ARQA 3CHCA 3PN8A 3HPSA 1GT8A 4WJXA 2OTDA 4TUFA 3PUGA 4FOJA 4AVFA 3GNNA 5ENLA 3W2JA 3TSDA 2J13A 4O1BA 4X9YA 1QNSA 3WF3A 3G1XA 1N55A 5FAGA 5EMKA 3W7QA 2NQ9A 1CGWA 3AJ7A 3A9IA 3LU2A 5T9CE 1NF7A 3GG0A 3TYEA 3G1RA 4CQ8A 4K8EA 1S2CA 3G1SA 8XIAA 4MJ4A 3LGEA 3CK5A 3PWGA 4ERAA 3IJQA 1DP0A 2O7QA 3U2ZA 1LOSA 1JDAA 9RUBA 1EJWC 2CYGA 1W31A 2QXWA 3KDOA 4NRSA 1C91A 4HYVA 3AXHA 3TZNA 4RPQA 1X1OA 4K36A 3ONCA 3K1GA 3NURA 1I2RA 2E1DA 4MWAC 1N8IA 3IV8A 1J96A 5LIUX 1JCNA 5I09A 3TQPA 3V0UA 5HR7A 1CGTA 1TREA 3G18A 3GR4A 4ZB2A 2C1HA 4ZO7A 1A0CA 4W7WA 5D2YA 4I6VA 1TG7A 2PDFA 4PULA 1FWSA 4NI3A 3PNZA 5EL1A 1QRQA 2V67A 4KF1A 1Q2SA 4IQLA 4ZZ9A 4C91A 3ZJKA 1Z41A 4RUBA 1NP0A 4QSFA 3UJ2A 2XGZA 3WX7A 4AZCB 1GKRA 1ONRA 4HNVA 1Y65A 4FSAA 4O12A 1OCQA 4JIHA 3NVDA 3WJYA 5LHFA 1TJ0A 6TIMA 4E2BA 2P8CA 4PBGA 1UHVA 3GKAA 5I7GA 4XZNX 1BLIA 3R6IA 3LCIA 2GFTA 3V1HA 4AB4A 4JX5A 1GPWA 4XWUA 3DC8A 2PI6A 1RD5A 4FLSA 3OLEA 5J04A 3WD1A 3GVQA 1S1RA 2Z7GA 2VURA 3FAXA 2E7FA 4MM1A 1EL3A 4DEFA 2PCEA 3G22A 2CBUA 4JAWA 1SM9A 2VUNA 2C16A 1FY6A 2GL5A 3PUEA 3M4HA 1OK4A 1TYGA 2WV8A 1P5BA 1W1TA 4NAEA 1KBJA 4CGTA 5I3DA 3PTKA 1NP2A 2VR4A 3G3DA 1VYRA 4NRRA 1UZHA 4RXGA 4RZ4A 3WDRA 3UNDA 1C90A 1THFD 2GUYA 3IIOA 4JN7A 2O9TA 4ACYA 3JU2A 2ZZ7A 3AS1A 4GQRA 1XYAA 3FCPA 2PSNA 3ZJ7A 3WFAA 2RGLA 4LUSA 4WSJA 3KTSA 4OOUA 2BGQA 4O1EA 3CQ0A 1HP5A 3GTIA 2GQ9A 4L9ZA 3AIQA 4R9OA 1EWDA 2WKLA 4B15A 4KIEA 1L8NA 1LT8A 4Y9PA 3AHVA 2I57A 2FPVA 4GC4A 5FJTA 4CNOA 4KCVA 4GYJA 2MUCA 3FJ6A 1IIHA 2QCDB 3NL3A 3VMPA 4NZJA 1TJPA 3PZOA 4UBPC 3H2AA 2XH0A 4DZ5A 3N4AA 4BF5A 1IQ8A 2Y2WA 1FKWA 1TWSA 4C5ZA 4HSOA 2XVGA 3ARRA 5FJPA 1V3LA 5JH1A 2EO7A 1DYSA 2BG5A 3F7JA 2OGJA 3E0FA 1TUXA 2ZYFA 1E1FA 3LI0A 4RNJA 1E6NA 3T2OA 3EMZA 3S46A 2E67A 3B8TA 3PHAA 4UFMA 3FJNA 5FIPA 1M01A 3WQVA 4EX4A 3CMGA 4EPBC 1HL8A 1M7XA 3L2IA 5FESA 2DJLA 1TRIA 4DZAA 3W7JA 2QDDA 4FXJA 3TKFA 5CBIA 4ZL1A 4NHVA 4AHOA 1LROA 3F4VA 1ZAIA 3HPZA 4CNTA 3U48A 3MUY1 4AF0B 3HURA 1L2QA 3S83A 1H62A 2Z1WA 4K39A 1LDCA 2WAGA 4KGJA 3V16A 3GW3A 3QV8A 4H8HA 1OADA 1S3TC 1XIMA 3LDVA 3QTPA 5LZLA 3GKFA 4JX6A 3W85A 3WQCA 1F05A 2ANUA 2WSKA 2XVKA 2J8TA 5C7VA 3HB9A 3MY9A 1LCOA 1TO3A 3MZNA 1V7AA 1V3KA 1XCXA 3LRKA 1Z42A 3E9AA 3K4WA 3TQKA 3OJGA 3WK3A 1OY0A 4C6BA 1TJ2A 4AX7A 4GXPA 5KSWA 3W2LA 1HGWA 3POCA 4NYYA 4ZE5A 4BQ4A 2XDFA 4TV5A 1XBYA 4BJHA 1LOQA 3ABOA 2D73A 2R94A 3DYPA 4IF2A 1ZU8A 4MNLA 1TIWA 1V0NA 4HN4A 1WKEA 2FVKA 2WMGA 3PTDA 3NO5A 3B4UA 3TAOA 4AD4A 2ZBTA 1Q63A 4X0VA 4QITA 2HROA 4Q8MA 1KWKA 3WNLA 3LHWA 1F8IA 1Q6QA 2F38A 3BAIA 2DZTA 4WKFA 3YPIA 3BV7A 4GYFA 4BFAA 5FF4A 1I9CB 1V8EA 5K9XA 4FIQA 2O9PA 4MPKA 1J6OA 3OO2A 3QLDA 3ES8A 4CQ9A 4IFKB 4O0ZA 4QAIA 3KX6A 4FNQA 1JR1A 2DT3A 3A5VA 3VGFA 2DV0A 1WDRA 3ZJ6A 4KRZA 2Y8UA 5KZDA 5BXTA 4OBRA 1JUBA 2FZNA 1CB7B 5EBAA 4AD1A 2XH7A 2R91A 2VKZG 4DXXA 3A22A 3UYCA 3ATZA 2V63A 2D2GA 5D33A 5GVJA 2WJFA 2VEPA 1B5TA 1E9ZB 4MG4A 1MUMA 1V02E 1FBAA 4IIHA 1RH9A 2CLOA 1XIIA 1R9XA 4QJ3B 1LG1A 1FWGC 1XUUA 2PF0A 3OGVA 4UFKA 1F3EA 4DBSA 3UQNA 4JTDA 2QQ6A 3S2NA 3FOKA 4FNUA 1S5TA 1NARA 4XQ6A 4M80A 2XHYA 1UD2A 3ZR5A 2R1KA 4IWWA 4NT0A 5F2MA 4CNPA 2DZVA 4J1OA 1QPKA 1SW3A 4M6VA 1W8SA 3B8WA 3L0GA 5M03A 4C6JA 3NQCA 4I7WA 1V79A 1F8MA 4TR9A 5LHEA 4JYFA 3ARVA 4KW2A 4Z2GA 3WQEA 3UVAA 2EXOA 3O0KA 5HAOA 1O5RA 3WF1A 4ATWA 5HOSA 1OF6A 4B16A 3DOPA 3S1VA 5C2XA 3MMWA 5M3WA 2ZUUA 1S2UA 3HZ3A 1BWVA 2QVNA 3VVGA 3DFSA 3VE9A 1QMLA 3AZSA 3THUA 5CLTA 3LENA 3OG3A 4LWWA 3VNYA 2W79A 1QBBA 3WCZA 3NQ2A 4I7UA 2PWDA 3RK8A 1BHGA 1VKFA 3H70A 4A22A 4A8NA 3AMGA 4OIFA 2GPTA 1F6PA 3B06A 3GAKA 1REQA 1E72M 1DJZA 3QGVA 1E1EA 2TODA 3VGGA 1VC4A 4ORIA 4GH1A 1W3JA 4GYKA 2FMOA 1H49A 4F0LA 3QSTA 4ZB5A 5XIMA 3H7UA 3NFUA 1UKPA 5JXQA 2WLZA 4HIBA 3ANUA 2A3CA 2VFGA 1EUNA 3WNOA 3BK0A 5DMLA 2ASHA 4CQDA 1AQ0A 2PODA 2VELA 3A21A 5F1UA 4S3AA 1JCXA 4J2MA 1AQMA 2DSUA 3VXGA 1K6AA 3W74A 3R0DA 3DH7A 5AC7A 1EO5A 4XIAA 2FVLA 4CCZA 4F9DA 1IZCA 3EWDA 3GG7A 3VCNA 4X2RA 3U5UA 4ERIA 2ZZ1A 2I5GA 1QHPA 2FJUB 2WQPA 3PZIA 1GKPA 2IQDA 4M6PA 4NP7A 1OC5A 1A53A 2G3IA 4JXCA 5HNTA 4RW3A 1XBVA 1ISXA 4OBSA 4V27A 2QJNA 4FLOA 4XBKA 5BWFA 2XGIA 3AJXA 1VH7A 3FVDA 1NVMA 1JGIA 4OJYA 3U2EA 1MI3A 4XVEA 1XRSA 3HU7A 3DHDA 2AMGA 3WD4A 2QUMA 4F66A 5CGTA 1J9YA 3K8KA 6PTDA 2J8GA 4M56A 3C6CA 2Q09A 1GGOA 1DJXA 2XZ7A 3RLUA 2VRQA 3HGOA 2PRLA 5CSYA 3GG8A 4G7FA 1HJQA 4UNLA 2QJMA 4JHMA 1LRQA 4AWUA 1PWMA 1D2KA 4XKYB 1K9TA 3KZSA 4OVXA 1W1PA 3SRHA 2DSKA 3WJWA 2V8ZA 3LPPA 1W6TA 5H8MA 3B9EA 1YYAA 3WBEA 4UTKA 3CB8A 2ZDRA 3CQKA 3MCOA 1SFLA 1OX4A 2G95A 4PEKA 4GA8A 2VO5A 4YHEA 2VYOA 3EXTA 3WMCA 2SFPA 1VYSX 3C0SA 4QBXA 4NNCA 1LP6A 2Y8KA 1I60A 3INPA 1MEHA 3DEQA 1TV4A 5DQPA 3TYAA 2X0YA 3M6YA 4UNKA 4MFEA 4O0KA 1NDYA 3VZYA 1BSIA 1UASA 3AHZA 1S39A 3DECA 2RH9A 4ZO8A 1QPOA 3MSYA 1E1CB 1TZZA 4XD5A 3VD4A 3PZTA 2IS7A 3TW6A 1TMHA 2H9AA 2Y8VA 2C1GA 1R8LA 1BWLA 3T78A 1PJ9A 3S5NA 3W7OA 2YW4A 3P6LA 1C93A 4HGXA 2P5NA 4XB3A 4ZE4A 1KA9F 1XICA 2VFIA 2G41A 3M0IA 4UR7A 4DELA 3KL3A 5REQB 2Y88A 1TPEA 5JBFA 1RY8A 4LAOA 1HKWA 3D6NA 3HPFA 3BGGA 3IACA 3SURA 3EXRA 3PZQA 3CAWA 1ZPTA 3IJ8A 1Y8BA 2W62A 4H8NA 2NT1A 3G0UA 3ARZA 3S9YA 2NX9A 3E38A 3GU9A 2G4FA 5KZEA 2PTWA 3LA4A 4NASA 3A23A 1H7OA 1NF0A 2FQIA 4NKCA 4LY8A 2IKIA 1I2QA 4M81A 1Z32X 4FHAA 3G24A 3PC0A 1EJVC 1XP3A 2EJAA 2WBGA 2NXHA 4JKMA 3WDJA 1R3YA 1ISYA 3EGJA 4E3VA 2J74A 5IFPA 2VEGA 3QZEA 1UH3A 4XVDA 4Q4KA 3CTTA 5DELA 2B7OA 2CLPA 4X22A 4IT1A 3GH7A 1QHOA 1RBOB 4C7GA 4XTDA 5AC5A 4FAMA 1KFWA 2CPUA 2P3EA 2ZZ3A 3QHNA 4I3GA 5I78A 1GOWA 2G97A 2XJ7A 2XFRA 3LB0A 3DI0A 1B3XA 3QOKA 4OKDA 2QJJA 2ZZ5A 1ZENA 4EWND 1UA7A 5KTLA 3FKRA 1GNXA 1BYBA 2DSZA 1WZKA 3PTMA 2AAAA 2WVVB 4EPKA 3ZLHA 5I00A 3FDGA 4CVUA 1FFRA 1Q6LA 2WANA 3SCOA 4JHOA 1RP8A 1GW9A 1EB3A 2V68A 3D46A 4LUJA 3IAQA 1EUAA 2CLLA 2QCHA 2NXIA 1XQLA 2PFHA 3IJIA 1E0TA 3O6YX 3PBVA 3E0IA 3B9NA 4AH7A 3IGXA 1GUVA 3D47A 3GXNA 3D5HA 1WXJA 2PDKA 1VFFA 1QXLA 4V33A 1P1MA 2F6UA 3W83A 3OTRA 4DPPA 4BF7A 4DJFA 3TW7A 3PSVA 4MIMA 1TA3B 2XINA 3TWBA 4INFA 2J8FA 3LMZA 3LRLA 4QIUA 4G5DA 2DQWA 4C6IA 3CO4A 3WL0A 2DVTA 2GSHA 1HT6A 3R12A 3STEA 4Q8UA 5DCBA 3WD0A 4MWAE 1AMYA 3M0HA 2CERA 5GNXA 3LSBA 1RP9A 3W73A 3IANA 1HZYA 1GVFA 2ZRZA 1JI1A 3DBNA 4LAUA 2V5LA 1E70M 3RMEA 3S1WA 3LK6A 5HNRA 1SZNA 4KT2A 3E0VA 1C7TA 4XZBA 4RDZA 4O10A 3C2EA 3U7VA 5AN7A 4WRHA 4QNWA 1UR3M 3A24A 3GTHA 3C0JA 3FA4A 1R30A 2OOGA 2Z1KA 1TX2A 2UBPC 3CPGA 2Y0FA 1VEPA 1M5WA 3HFYA 3RU6A 5FF0A 3UR2A 3WLSA 4ZEPA 4HNTA 2BB0A 2W0UA 3UXLA 3UWZA 3E1F1 3TSBA 1JYWA 1FHVA 4UQ9A 4W5UA 4IGSA 5G5IA 3ZWTA 4Z42C 1XYLA 3EWYA 2VGIA 2GK1B 1B90A 1AH0A 3SCPA 3HQ1A 2HRWA 3D0CA 1K3UA 4EOUA 2ZUMA 2ZUTA 3EEZA 2ZE3A 1UWQA 4MJZA 4Q6JA 5EMMA 2W67A 4A35A 4O11A 1GVEA 3XISA 1J01A 3HG4A 3S1UA 2QLYA 3WEMA 3KS5A 1F6KA 4LS1A 5C9WA 3VGDA 2QCGA 3PJUA 4GACA 2ESCA 2YFOA 5T8GA 3W7EA 2Z6IA 4FX7A 4QDWA 1XLAA 2O56A 5FJIA 5T91A 2WWCA 3KLLA 1XFCA 4UMCA 3V5FA 5AHNA 2OYLA 3ELFA 4AYSA 4ZQNA 2JE8A 1D3GA 4C6QA 4L1WA 3O1NA 3DKJA 2OELA 1DPMA 5C71A 1JPDX 2UWFA 4GABA 1B9ZA 3AXIA 3RR1A 1AD4A 4MB3A 2PP0A 1RV8A 3SECA 3ZR6A 4C6PA 3BVJA 1G4SA 2NX1A 3U3HA 2ISDA 3DYMA 3TEVA 1BD0A 1B4EA 3K2GA 2G3FA 3PFMA 1O5KA 3WLNA 1UH2A 3LLDA 2J78A 4BWLC 3S9ZA 1ALDA 1R3TA 3OQEA 1OJXA 4G7EB 4LAKA 1KCLA 3BAXA 4WZHA 4TTGA 1HQTA 3N6JA 9CGTA 2Z26A 1H5VA 4JDYA 2YCEA 4RX0A 2CETA 1YDYA 4GO8A 4HBKA 3BCFA 3LXAA 5E6ZA 1AW1A 4XSMA 5FEPA 5AYIA 4DJEC 1XQKA 4A3UA 2E6DA 1FHLA 2WWDA 3NTYA 2PDNA 1YXCA 3T9PA 2V3DA 3SEPA 3H53A 1CLVA 1XYCA 3VD7A 2I9EA 4PMQA 3OYXA 3RGTA 3F5KA 3M46A 1FHDA 2HQAA 1NWSA 3VIHA 3E74A 1MUWA 2CBIA 3CZKA 4LC6A 3I3DA 4IMDA 2DZUA 4EACA 3LPFA 1V0LA 3T2QA 1XRVA 5ABGA 3UGVA 1ISZA 2GDVA 1R9YA 3MDUA 4PL2A 3QGKC 1RJPA 3T55A 3IIVA 1M68A 1TTIA 1EJTC 1YIXA 1VF8A 1TZ7A 1PZ1A 3EZ4A 3P61A 4F2UA 1EDQA 2V38A 2DH3A 3NDYA 2C15A 5D8ZA 3AI0A 3LM7A 1UUOA 5BXPA 4Y9MA 5CC7A 3ABXA 1BQCA 1BQGA 4PTNA 3FXGA 5I3GA 4J3ZA 1W56A 3CAKA 3HO8A 3L5MA 4MB5A 2EEXA 1UP3A 3GK0A 3KRBA 4H9UA 3QRHA 4PCPA 3LD5A 4FR6A 4LANA 4JTCA 1B4KA 3KEHA 1EIBA 3N73A 1FRBA 4R7WA 3UWYA 2ATSA 1V4YA 5HMFA 3EA3A 1EH9A 2WPBA 2NWRA 3DG7A 2Z28A 1S1PA 3C0LA 4FP1A 3VYLA 4J2PA 1NOFA 3D3AA 2JKAA 1I0BA 3GIYA 1XLGA 4JCMA 7REQA 2NQ5A 6TAAA 2XPKA 3SGGA 1WOAA 4MUPA 1E4NA 1I8JA 3VCCA 2R8WA 4I9MA 3ZMRA 3NSNA 2CKSA 2Z1VA 3FYPA 2VEIA 3SFKA 2PE4A 2HPMA 1UD5A 3MV01 1VZWA 1XDLA 3I4EA 5HJXA 3T0TA 3UJEA 2YJQA 5L6UA 4I8DA 2QDEA 4O14A 4Q22A 2XIMA 3VOJA 4PB3A 1WDDA 1IT8A 5MHBA 2ZX5A 2YLAA 3QZ6A 1XD1A 3W1TA 4A8RA 4O52A 4PH6A 1NFGA 3CASA 1KCKA 1P0EA 1RVGA 4IPLA 3VKBA 4K38A 4O54A 1S2TA 3VI2A 2PD9A 2DY3A 3TR2A 1J8VA 3VX0A 1MQQA 4KWSA 3WY1A 3H54A 3UR8A 4DWSB 3QKZA 3BC9A 4YYFA 5I3FA 1L2UA 1F74A 3BMXA 4MFDA 4PRWA 1HFBA 2DUAA 4CU7A 2R1LA 1X7IA 3IIPA 4DHGA 3F5LA 1TV5A 4AAJA 1T40A 1E3ZA 3CV2A 3PZUA 2E4TA 3REQA 2O55A 3OHIA 1FP9A 1KFCA 1OFQA 3C8NA 1UP0A 4E8DA 1MXSA 4K7YA 3T05A 5ABEA 1DJQA 1XISA 1W2PA 3MWCA 4DZIA 1SYTA 1UPMB 3CL8A 1J6PA 4YJ5A 5LNRA 3AU2A 5G2WA 5IHSA 4C1NB 1PTGA 3SSZA 4AY7A 1AODA 1FCBA 1MEIA 4DJED 2CXEA 4XO7A 2FZMA 1SSDA 1AZ2A 4RE4A 2DEPA 3QQWA 1EZ2A 4J3UA 1FWJC 3K4AA 3PF3A 2H3DA 4D6IA 4P8WA 2WMIA 1H50A 3NQAA 1JD9A 3DFOA 3BW2A 3ZFHA 3CHEA 4UWMA 4KEVA 1BTCA 1JGMA 2ATMA 1DTNA 5CJNA 9XIAA 3VCRA 3L68A 2Y85A 3W26A 2NX3A 2YPIA 4GVIA 1H61A 2QUTA 4PSPA 1OX5A 2IMRA 2INZA 1FWBC 4KCUA 4P7LA 5H6HA 1OM0A 1ONEA 1UOZA 1H5YA 3ZZ1A 3KP0A 2VCCA 3BZGA 4ZO9A 5D05A 2JFEX 2WZTA 1W9XA 3HIJA 1C9WA 4A05A 1XIGA 1O12A 5CZKA 1LG2A 4UIOA 2DIEA 3EEGA 3W25A 3N17A 4JIIX 3A47A 3IVSA 1ZJAA 1P43A 3TW9A 1GCYA 5D9MA 2PRMA 1DHKA 3ERPA 4DO6A 5D9OA 1R86A 4JEJA 3R8HA 4QS5A 1I4NA 5JQ9A 3V0SA 1NIUA 1ZQ5A