1P1XA

Comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
250
structure length
250
Chain Sequence
b'MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Analysis of the class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase at 0.99A resolution.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 104
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1p1xA00
3NQAA 4QQ3A 1Q6LA 2E6FA 2DJXA 4HIBA 4UMBA 4CCDA 2ATSA 1W5NA 4O54A 3W7CA 2FIQA 1EEPA 1SZGA 1VC4A 1GWJA 3LLDA 4JTFA 3C6CA 4ZQNA 4CCCA 1TQXA 1Q6OA 4R7JA 2HS6A 1W5MA 3GR8A 1B3OA 5K2ZA 2CLOA 5D32A 3HGJA 3FKRA 4MY1A 2QCDB 3R5EA 1JCLA 4LW7A 3KFTA 1D9EA 3TW6A 1K8YA 3GVGA 3PUOA 1EIXA 1B57A 2A2IA 1R2SA 4RXFA 2Z2UA 3MP4A 2QCEA 1F6PA 4JTLA 3G1HA 5G1TA 3W75A 3FJ6A 5FF0A 1SO3A 3GLCA 4OWGA 1KM5A 3GB6A 2CWNA 1XBYA 4GUHA 2P1FA 2JKEA 1NAL1 2Y7EA 2EAWA 1OF8A 3M7WA 3TH6A 1TJPA 5TIMA 3W2JA 4C1KA 1F5ZA 5LNUA 1GYLA 4EOUA 3LLFA 4DELA 5F2MA 1KLZA 4DXVA 3BW4A 3IV3A 1LYXA 4IMEA 3WK0A 2WOQA 3VFLA 3INPA 1PS9A 4A29A 1K3UA 4AH7A 2ZTJA 4QJ1A 5G2HA 2HSAA 1NSJA 4QM1A 4YL2A 5FEWA 5AYZA 3N34A 1F05A 3W1AA 4A3UA 1OX6A 4FXSA 2VFIA 3MYOA 1AMKA 3LHUA 2B7QA 4KWWA 4OHQA 3W87A 5D05A 1K8XA 2NWSA 2JGYA 3P8IA 3GDKA 3SI9A 1I2RA 5ABTA 4AF0A 2JKPA 4N9DA 3UXDA 3M5VA 3DKJA 1KM4A 1MEIA 2A7RA 4LC8A 3C3NA 4QSHA 4OU1A 3HPZA 1ML1A 1KM0A 1ZHAA 1LORA 4JTGA 2YR1A 1KFKA 4ADTA 3N19B 1IXPA 4ADSA 1YTEA 1QPNA 4RX0A 1YLVA 2GJNA 4BFAA 1VJIA 4RJEA 4BK9A 2E5CA 1JRBA 2QJIA 4AAJA 4FB7A 4HHPA 5BMXA 5AYXA 1LOLA 3LB0A 3TAKA 1XC4A 5I3HA 3O05A 3P61A 1WBHA 3NOEA 1FCUA 2WSRA 4HN4A 1PL9A 2E77A 4MVAA 2GQ8A 1P4CA 1W1ZA 3P84A 4M6VA 1HG3A 4QIUA 1ZAHA 3TMLA 2YPIA 2GVJA 4GUIA 3HGOA 1LBFA 4S2CA 4WY0B 3W7NA 3W1QA 3I68A 3QZEA 3NGJA 4R33A 1C29A 4O14A 2VENA 2YXGA 2ZZ6A 1TV7A 2YZRA 1OYBA 2WV8A 5U4NA 1PIIA 4ORIA 2CZFA 2E6AA 1IGSA 3TA6A 4JXCA 1N8FA 3N9RA 3EWBX 2D73A 2O7QA 2XN0A 3I6RA 2A7NA 2ISWA 3NDOA 1MO0A 4X9SA 5AB3A 5K9CA 4ZQMA 1OX5A 3G1DA 2FPVA 2VOMA 4RZ5A 4RR4A 3T4CA 3FS2A 1IF2A 4ALDA 1TRIA 3TC6A 2RDWA 3OBKA 1KV8A 2H3BA 5H2ZA 4UFMA 3L0KA 1F7BA 3EXRA 1SW7A 2VEIA 1WBJA 3C2VA 2CLLA 3LTPA 1SZNA 4NU7A 2NX1A 4NZJA 3CEUA 3KRUA 1GG1A 4I7VA 4BR1A 1AL7A 5E1QA 3LBCA 2GPTA 4HPXA 3TX9A 3M41A 1YXYA 1ALDA 3KVMA 1X6UA 1B4KA 1G4SA 3JR2A 3L5MA 2B0MA 2DZSA 3NPXA 3GKAA 1I8JA 1I2NA 3GXTA 5L6UA 3B06A 4OV9A 1AG1O 2C19A 1SFJA 2NV1A 1WV2A 1JQXA 4M7TA 4UFJA 3W07A 1BKSA 2QAPA 3DZ1A 3IRDA 4GRSA 1W5PA 4OBTA 3KVLA 3NQMA 1HFBA 4UTIA 1SFLA 2ZZ3A 2F84A 4KKXA 3UYCA 4FIQA 3CIXA 2NUXA 3QSRA 5E0KA 3HG3A 4MY8A 4MUZA 5MHBA 3N2XA 1JULA 3KHJA 1XBVA 1EP1A 3ZS4A 5EL1A 5EY5A 3GAYA 2ZYFA 1QAPA 1KFBA 4FNUA 4OV4A 2WO5A 4JGDA 1VYPX 3LCLA 4FIRA 4LVBA 3TE9A 5LGZA 1XXXA 2J9YA 3MBFA 2WPBA 3CIWA 1GTHA 3G8RA 4LT9A 5FI8A 2X2GA 2RDUA 5K3VA 1QPOA 3N9SA 5DCEA 1KFLA 2AGKA 5I3GA 5HR6A 4MJMA 1R46A 1DL3A 1OABA 3QW3A 4KFNA 5D2WA 1TPC1 2Y7GA 2YYTA 3H54A 1QO5A 1T8XA 3M9YA 4LOCA 3CB8A 1TPB1 3EB2A 4JICA 3LXBA 1A5AA 3W7IA 4PH6A 3L21A 2E1DA 3G3DA 2QJGA 3ZWSA 1FWWA 3D0CA 4YWIA 3PUEA 4UNKA 3W7DA 3IGUA 4MY9A 3GNDA 1KBJA 4AF0B 5C6MA 5AHEA 4M6PA 2CW6A 3VI2A 3QPZA 4FNPA 1IXNA 2TPSA 4JYFA 3B03A 3U6WA 1TV5A 1JUKA 2G96A 1YPIA 1QDSA 1I4NA 4K7YA 5BRBA 3TDFA 3CM4A 5E93A 2FPTA 4YMZA 2DZPA 3WK1A 3MMTA 1XCFA 2QCNA 4WY0F 4BI6A 3KVJA 2VFEA 1K7EA 4QISA 3ELFA 3G24A 1TMHA 1SQ7A 4U4MA 3A9IA 3W1TA 4ZMGA 3E49A 2EPHA 5HWJA 3E9AA 2Y61A 1N7KA 2C15A 1G7VA 1GVQA 2X1UA 1LBMA 5J5DA 2ZA3A 3HIJA 3TSDA 2Q8ZA 3GDLA 3LCFA 3W2KA 4N9EA 2HMCA 3M0ZA 3QH2A 4WOZA 4BI5A 3PB0A 3R13A 1Z44A 4IGHA 1V5XA 1XFBA 4L4LA 1L6YA 3KVKA 3EKLA 2CU0A 5DXYA 1FXPA 4FX8A 4ZL1A 2XFWA 4YXGA 2YFNA 5TQLA 3ZWTA 2ZZ2A 1VS1A 3WK2A 1OFBA 2X1TA 1TTQA 3QPYA 4FHAA 1QOPA 2IQTA 4NJIA 5CG7A 3O63A 3PY2A 5BNKA 5AHLA 1XUUA 4LS1A 4HKPA 4UTUA 3MJYA 3RU6A 3U8GA 3NQ8A 4R53A 5C2XA 2ISSA 3S9YA 1QCWA 4O1DA 3TFXA 1HUVA 1XUZA 1M5WA 3ABQA 4L4MA 3OEXA 4JX5A 1TJRA 3FEMA 3R12A 4PODA 3MP3A 3NM1A 3PVFA 1EPXA 1NF0A 3IVUA 4K8EA 1H7NA 4TMBA 2TYSA 3QM3A 2ZFAA 3LBMA 5FEZA 3EWXA 5AHNA 1O94A 4ONVA 3LCWA 2EGZA 4WJEA 4MYAA 3FOKA 5HULA 1H1ZA 2NLIA 4UC5A 2A4AA 1FQ0A 4N9CA 2QUUA 1RR2A 3NG3A 1S5TA 1QPQA 3GDMA 3EX6A 1FWTA 1KBIA 1H51A 4E2BA 4HNTA 3MHGA 4EWND 1KM6A 3EWUA 1W3NA 3UZJA 3HG2A 1VCVA 4O17A 1OG0A 4XQ6A 1EP2A 2VELA 3O15A 4DBEA 1G4PA 1SO4A 4C1LA 3G1SA 3MBDA 1KA9F 3UXAA 5H91A 3MW7A 3WJXA 2ATMA 3RFAA 3W7RA 1L2UA 3ATZA 4FX6M 2B7OA 3EEGA 3IGSA 1P0NA 3M5ZA 4FNTA 1U83A 4UTKA 4Q33A 2AQWA 3TQVA 4UTWA 8TIMA 4KFPA 3MI6A 4ZQRA 3W7MA 3ZR4A 3O1NA 3MO7A 2C14A 5CSRA 3G18A 5D04C 2B7NA 3MWAA 1DORA 3GYEA 4FNSA 4DF2A 1JRCA 5IBXA 2AAMA 1R2RA 4NJKA 4GNJA 4EF8A 5BW6A 2X1SA 2CLHA 2DZWA 3S42A 1H1YA 4LS0A 3W1MA 4HT3A 4QNEA 2V5BA 3OVQA 2DORA 1PCKA 2FLIA 1Z42A 5CZ0A 2V0TA 1JQVA 4MJZA 1YADA 5I3JA 1VYSX 1VHCA 3ZFHA 3C52A 2Y6ZA 3DHFA 1M6JA 3TNOA 2A6LA 1OX4A 4O16A 4GJ1A 2NUWA 4GUGA 5FF4A 3TAOA 4IUOA 1W37A 3P5ZA 3HGRA 4DF1A 3H55A 2C1HA 3FJLA 3QSTA 5KMYA 3NVTA 3M43A 4LRSA 2QDHA 3VE9A 5KZEA 3NL2A 4AXKA 1K8ZA 1OFOA 1S5VA 3W1LA 4HSOA 1GJPA 3CWNA 2V5LA 3QMTA 4CQ9A 2P10A 1LRTA 3GNNA 2A0NA 4YCOA 1ZCOA 3GXNA 1LLZA 1OK6A 5AHMA 3K30A 3LXCA 4UNLA 3STGA 1BTMA 1RZMA 3QRHA 1P0KA 1QO2A 1D3GA 4P2VA 1DBTA 3L68A 3DBPA 1HTIA 3GX9A 1BWKA 1AW5A 3IVTA 4GBUA 1L6WA 2OCZA 1H5YA 4JDBA 4UFKA 4D2JA 3W7JA 1L6SA 1LTDA 3DFTA 3MI2A 3A24A 1OFRA 5I3IA 4XBKA 2VFHA 1TPH1 3NR0A 1SW0A 5FF3A 2GVLA 1W3TA 1DQXA 1JR1A 3F1QA 5HUPA 3TFCA 2ZQ0A 3R2GA 1ZAJA 5EBUA 4MZ8A 3TR2A 1KTNA 3V75A 3USBA 2TMDA 2VFGA 1SSDA 2OT1A 3P74A 2ZA2A 3PWAA 1ZJIA 4UTJA 3ABSA 3KRSA 3Q94A 3LTYA 1W5OA 2FPYA 3L5LA 2G97A 3LHYA 3L2IA 3THAA 3CC1A 3IIOA 5U7SA 4M6QA 4DPQA 1WOBA 3UD6A 3CQ0A 3H53A 3W71A 1OFDA 1VRDA 1FWRA 1ONRA 1KM2A 3TSMA 3TROA 5AN7A 3N3MA 1PHWA 3G1XA 4DO4A 3WJYA 5G4EA 5HR7A 1EX5A 4QITA 1LRQA 3W3OA 1RD5A 1W56A 1C8VA 4AMAA 4O52A 3C8FA 5F1UA 4TX9A 3KX6A 5L9FA 2QUTA 3E0IA 1ME9A 2OZ0A 1UB3A 1GVOA 2BX7A 3WJSA 3QC3A 3DFQA 1VH7A 4CLMA 3NQCA 5IBXC 3B0UX 4MLRA 4Y6GA 1GG0A 4GUJA 1O5XA 4XTDA 5CGQA 1FXQA 4H4IA 3TJLA 4J9JA 1EWEA 3KRZA 5G5IA 4RK8A 1VZWA 4DO6A 5K4ZA 1IIGA 2XN2A 4IMFA 3UY7A 2HTMA 3BGGA 4FF7A 4S1FA 3GAKA 2H90A 4UMCA 3MHFA 3EX2A 4IWWA 3TXZA 2Q3RA 4X22A 3FLUA 4MYXA 1W31A 3RLVA 4OQVA 4UUIA 4Z1BA 4JNMA 1WX0A 3IEBA 3L9CA 1O4UA 4IXHA 4Z0SA 4JYDA 2BSLA 1N55A 1TTPA 2QCCA 4UR8A 4CCEA 3STFA 1FDZA 4UFIA 2FTPA 1DJQA 4UTHA 1EWDA 1OFQA 1TPDA 4BWLA 1VGAA 4UIOA 3W7OA 3VCRA 5D30A 2FJKA 4O12A 3O6YX 3IIVA 2KZHA 3TC7A 5FESA 5EMUA 2CLKA 4AWUA 3DI1A 2PE4A 1OX4B 4N6EA 2H8ZA 4MOZA 3LXAA 5FF2A 4AWTA 3O8AA 2TRSA 4QAIA 2NX9A 2FB3A 3W74A 3IIZA 2PURA 4LV9A 5CKSA 5DELA 3UWYA 3GDRA 1GT8A 1O95A 1F6KA 5HQEA 5KTLA 1TPWA 2BXVA 1Z41A 4ADUA 2ABAA 2QCFA 3EWWA 4MKNA 3DU0A 4H3DA 3ABRA 3I7QA 2QAFA 4O1CA 3TQKA 4Q4KA 3A22A 4JN6A 3BG5A 3EX1A 1X1OA 4GXMA 4RZ4A 1XI3A 3CHVA 5LNVA 2GQAA 1GQNA 1JUBA 1Z48A 1DOSA 1T96A 1HL2A 4KWVA 2WNZA 3M44A 3HQ1A 1SUXA 3Q2DA 5KZMA 2F7FA 3V1PA 1I2QA 1LDCA 1S3HA 1TYGA 3KXQA 3T78A 3UWUA 3P82A 3BPWA 2Y88A 1AK5A 3W9ZA 1BEUA 3NZRA 4MIMA 1H50A 1XKYA 5DY3A 1YTDA 2DZXA 1R47A 2BTMA 2PRLA 1VR6A 2I1OA 3Q37A 1Q3NA 4GC4A 1LROA 4P61A 4AWSA 3TUUA 4CQAA 1I2OA 3THQA 5D38A 4JR5A 1GTEA 1ADOA 1J4EA 5DBUA 1RV8A 1UCWA 3QW4B 1DJNA 1TPEA 3SSJA 4PL2A 4RCXA 1NEYA 4EF9A 4FO4A 3NYZA 1AL8A 5F4XA 3NEVA 3TQ0A 5D2TA 3T55A 3R89A 3L66A 3LHWA 1DKWA 5LHFA 4MZ1A 4WZHA 6TIMA 3B4UA 4LUIA 3B8DA 5D2YA 1ME8A 1Y0EA 4NJJA 2V30A 2CZDA 2R8WA 4NNAA 1SPQA 5DXXA 1GEQA 1I2PA 3HG5A 3W7PA 2FDSA 4JEQA 1TPVA 1KV5A 1JCXA 3G1VA 5AFDA 2QEZA 3DENA 1XL9A 4Z1DA 3PB2A 2C16A 4I7UA 1AW2A 3FYOA 1OFAA 3IIXA 3S5YA 4TMCA 4U28A 3PSVA 4NT0A 2ZRVA 1X7FA 3LERA 3W7QA 2RDTA 1W0MA 3W1XA 4RKAA 4FNQA 4WXYA 3G0UA 2ZRWA 3NQGA 1H7PA 4HSNA 4I9AA 3B05A 5C5YA 5EKYA 5DBTA 4RZ6A 2JK2A 4E38A 2VC6A 5AC8A 4MZYA 3M1ZA 4Y8FA 3SECA 5LNWA 1RQBA 2ISVA 2NXGA 4HNNA 5AYYA 4N6FA 5KZDA 1KFJA 3LHVA 3C2RA 4FNRA 5EPDA 3LCXA 1TIMA 2H8XA 1TTIA 3FKKA 3A5FA 4XTIA 3W84A 1DVJA 5AC7A 1Q45A 1PVNA 2OX1A 4DEFA 1FUYA 4WD0A 2E6DA 5C54A 2EHHA 2OT0A 3UPWA 3M16A 5SWUA 3PBYA 1YDNA 3HBLA 3LRLA 3GIYA 4MPQA 3LCHA 3S1UA 4NNCA 1KFEA 4LV4A 5K7JA 2CZ5A 1SO5A 1ICQA 2Z0IA 3PSWA 1IXQA 3JS3A 3L0GA 3W2NA 2NWRA 3TU9A 1RQHA 4Y96A 4XKYA 3S1WA 3W7HA 1TPFA 3MP5A 1RPXA 4IMGA 4RLIA 2NXHA 2V9DA 3LHTA 1G7UA 1UJPA 1NF7A 2JKAA 3VNDA 2NX3A 1BWLA 2CLIA 4NXSA 2A1YA 4LS2A 3MUXA 1D3HA 4LVAA 5LHEA 2VKZG 4K8HA 4E2DA 2VXNA 3P81A 3PBWA 2EF9A 3UNDA 3RF9A 2DP3A 2O7SA 4JYEA 4POCA 2B7PA 1J2WA 1V7YA 1OFPA 3C2OA 3LX9A 1QR7A 1WYIA 4LRTA 3LDVA 1W5QA 5FEXA 4YLWA 1UUOA 2YW3A 3W1UA 3F4NA 1WOAA 3W85A 3DAQA 4O10A 2YSWA 3GDTA 4N4QA 2J9XA 3CU2A 3M5YA 5FF7A 5HUOA 4NJGA 4WXZA 3PULA 4EIVA 1HO1A 3A5VA 4ZQOA 5F2IA 3QJAA 1X1ZA 4W9TA 4TO8A 1VYRA 4IMDA 3I65A 5D2VA 2DU2A 4JTEA 3SZ8A 4DO5A 1ICPA 3IVSA 3UQNA 4A2RA 1VQTA 2JBMA 1B4EA 4O1BA 4X2RA 2I14A 2V2HA 4B5NA 1QWGA 2EKCA 4UR7A 3QQ0A 3W7GA 3SGZA 1ME7A 4O0ZA 3RLUA 1FBAA 4XZ9A 3G1YA 3N2MA 2C6QA 2QCHA 4ML9A 3O07A 3PG9A 4QNWA 5CZTA 3YPIA 2RHGA 4DF0A 3LOTA 3LI1A 2Y7DA 4LVDA 2PRHA 5EYWA 4K36A 1DV7A 2Y70A 4JTHA 3UY8A 7TIMA 3QF0A 2R91A 3PR2A 3DFSA 2ZTKA 1XBXA 4AHPA 3VKJA 5FEPA 4S2BA 4A21A 2A7PA 4NXKA 1OVDA 6ALDA 5IM51 2W0UA 2P0OA 5F4SA 4CNNA 3G1AA 3NPVA 3HO8A 1GVSA 2PC4A 1ZY9A 2G95A 3HF3A 4O57A 5CPLA 3W7KA 1IXOA 3W22A 1SO6A 3PF3A 3AO0A 1B9BA 1H7XA 5KSWA 1U5JA 3RMJA 3LI0A 3UZ5A 3LRKA 3GZ3A 4RXGA 2VEMA 3NPWA 1OYAA 4JIQA 2Z6JA 4RV8A 4NQ1A 3M47A 4O19A 1TPUA 3IIPA 3NQFA 4JY8A 1F73A 1TO3A 4GE8A 2ZRUA 3TXVA 1KM3A 2YGYA 5C55A 2RFGA 2CLMA 2FB2A 4LVFA 3UWZA 1FY6A 1R30A 2WSYA 1CI1A 2Y63A 5LKYA 1KTBA 4LC6A 2QCGA 5DCDA 1OJXA 2E5BA 2ZA1A 5K4XA 1KW1A 2YDAA 3MYPA 2TSYA 3C2FA 1XDLA 3P62A 4KFOA 2Y89A 3BW3A 4YCPA 4O4WA 3M6YA 4Q32A 3SIZA 4XKYB 3WFAA 3BV4A 1VCFA 1K7FA 3NQ7A 1ZNNA 1FDJA 3BLIA 5A8GA 3I7RA 1G6CA 2YFOA 4IJBA 3W1PA 2QCLA 1TREA 4GFSA 1S5WA 2J6XA 3FFSA 2I9EA 3QQ1A 2NXIA 2CLFA 3DHDA 1W8SA 3CLMA 3E12A 4PEKA 3W76A 1HO4A 2QDGA 2YYUA 1QFEA 1LCOA 1QOQA 1JJKA 1PCWA 1YTKA 3EX3A 1F74A 3TW7A 4ICNA 5CZJA 4MFDA 3W88A 1ICSA 5G4WA 2WKJA 1MEHA 4O50A 3BK0A 4IOTA 1UUMA 4UTLA 3C0JA 4LY8A 1XM3A 3W6YA 4UCGA 1H63A 4K6AA 5HWMA 3P5YA 1PHQA 3RK8A 3NL5A 3TMQA 1CX9A 1F2JA 2DZTA 5HWNA 4ZVJA 3AJXA 3FA5A 4ORMA 5CPOA 3W1NA 1KM1A 3T40A 5J5RA 4UTMA 2CZEA 1GYNA 3TCEA 3SFKA 3W2UA 4UTWC 2A21A 2GUUA 1P5BA 3BLEA 3NQ2A 2Y85A 2ZCGA 3C56A 2DZUA 2QCMA 3NM3A 5G1YA 2QKFA 2B4GA 3NQ6A 4HPJA 4Z1CA 3DKLA 4O15A 4NZFA 4FX7A 3QYQA 3I7SA 1Q6QA 5DLCA 4NJHA 3A21A 3OHIA 4BF9A 1GOXA 4AHOA 5AHIA 2YW4A 3HJZA 3P67A 1A50A 4E0CA 3PUDA 2ZDRA 2X30A 3NPUA 4WQ6A 3G22A 1AW1A 1GZGA 3G8EA 5D02A 3EKZA 2R14A 4UMAA 1LBLA 1ZENA 3IGXA 4JTKA 2NZLA 3EXTA 3OVRA 1K02A 4O1AA 4Z08A 2Z1BA 1H7OA 1VLWA 2W79A 2FFCA 1DHPA 2Y7FA 4TIMA 3L5AA 2W6RA 1SSGA 5EA9A 4IXXA 2ZBTA 4JX6A 4IQLA 4JIPA 1T0OA 3PBVA 1M7OA 3W2MA 3P80A 3LV5A 3S5OA 1NVMA 3DFNA 1W3IA 2X16A 4LVGA 1TB3A 1X8FA 1SW3A 3TV8A 1G4EA 3W7EA 4AVFA 2A85A 3NAVA 1FDYA 3KOFA 1W54A 3C2EA 2LLEA 4LWWA 2YX0A 3W83A 5CPNA 4DQWA 3ABOA 4JTJA 3G0XA 3QEZA 1TCDA 2CLEA 4UFLA 4N2YA 4UTTA 2E68A 3KAOA 3SJ3A 4O18A 4JS3A 4JDYA 4M19A 1MXSA 3LCGA 3C61A 1SU5A 2PRMA 5K9DA 2CFFA 2WJZA 1MZHA 2BWGA 5TBOA 3TKFA 1JVNA 4O13A 1LP6A 1GVFA 4NUWA 3VE7A 1H62A 3CPRA 2WQPA 4CNOA 3HMJG 5D37A 1DQWA 4MLJA 1H7WA 4AHQA 1KLYA 4K7VA 3CEPA 3O16A 5I3KA 2XN1A 4O28A 3NL3A 3B0PA 3UWWA 1EUNA 2ZRXA 5HJLA 4NNBA 5HMSA 3NQVA 2ZZ5A 2UV8G 3W70A 4TR9A 3W7LA 1GPWA 4I7WA 1WA3A 3OVPA 3SY5A 3CT7A 3W72A 3O6CA 3PC0A 2OJPA 3GR7A 2A6NA 3W23A 1YDVA 1G4TA 1LLWA 2V2DA 2J24A 1YDOA 3PG8A 4IX2A 4LU0A 4O11A 3L65A 3S8HA 3GXPA 1WAUA 5G2WA 3S1VA 3FIGA 1RQEA 4UFHA 5LNRA 2Y62A 4IPJA 4HNVA 1KFCA 1LM1A 3S5ZA 4OT7A 1YXDA 1TRDA 2JGQA 3LCIA 3LM7A 1VHNA 2C18A 5DCBA 3QMSA 2E09A 3NL6A 2C0AA 2OMAA 1JCNA 1FX6A 1O60A 3EXSA 5I3FA 2C13A 5D33A 2DZVA 3T44A 3L0NA 4NVTA 4G1KA 4PC8A 4JTUA 3LRMA 4PA8A 2E6YA 4WOQA 3BO9A 3LTSA 1MSSA 2QF7A 2HS8A 5AHFA 3C4UA 4N4PA 1VPXA 3P60A 5F2GA 1NFBA 3BVJA 3EX4A 3QFEA 4A2SA 3DFOA 3GK0A 4K39A 4Z0JA 4LNYA 3DH7A 5T26A 2GVGA 1WXJA 4LUJA 4ZZ9A 3UWQA 5LGXA 5BOOA 3NXFA 4PCFA 4R34A 4NX0A 1FWSA 2QJHA 1YYAA 1KTCA 2E5DA 3EWYA 5CZSA 3U2OA 4DBDA 2WNNA 4ZQPA 4Z1AA 5LNSA 2ABBA 1QPRA 5D2XA 3G1FA 3TK7A 2X1RA 4UXDA 4BWLC 4K38A 1F76A 2GOUA 3SW6A 3TIMA 2YCEA 1VCGA 3W73A 1C9DA 1O5KA 3B0VC 3WJWA 1XDMA 1J5TA 3PAJA 1L9WA 4M5PA 1OF6A 4ZQCA 5DN1A 3BG9A 3DFPA 1H61A 3W1RA 1EA0A 3W86A 1PV8A 3F03K 3BG3A 1JCMP 3LGEA 5BMWA 1H60A 4UTTC 3A23A 5F2LA 5LSMA 1R2TA 4NX5A 2VFFA 1QNVA 1SR9A 2J88A 4XBSA 3TSBA 2WNQA 2DJLA 1FCBA 2ZRYA 3P8JA 2NUYA 4N02A 2QUVA 1G69A 2A5HA 2Z6IA 3O06A 1EP3A 4OE7A 4CNPA 1OFEA 1T99A 4FXRA 1FWNA 2ZRZA 2QCDA 4BI7A 1K03A 5AC6A 4JD4A 3N14A 1ZAIA 2ZZ7A 4IPIA 5HNRA 1MEWA 4IX0A 1LOSA 1OK4A 2R94A 3DI0A 4O0KA 3UPBA 1QMLA 2ZZ4A 3ATYA 2VEPA 3WK3A 3QMRA 4Y90A 2Q8LA 2NV2A 1JCYA 2GQ9A 3BARA 3R8RA 2RKXA 1ZALA 2V2CA 1WDWA 1THFD 4XWUA 2J9ZA 1G67A 1E51A 5G2IA 3S5NA 4PTNA 5DY2A 4LTSA 3M5XA 4O53A 2QR6A 3HPSA 2H3DA 1A53A 1YPFA 4K37A 3S1XA 3ANYA 1K7XA 1Q6RA 3NQEA 5HINA 3MHUA 1SZEA 2Q3OA 1UBSA 3OA3A 3O6DA 3UWVA 5CPMA 1IIHA 1TV8A 1WQ5A 2BZNA 3HB9A 2V8ZA 1CW2A 2GJLA 5AOUA 3Q58A 3FYPA 1LZOA 4A22A 3PM6A 4PFMA 4AB4A 2V81A 3OG3A 3RNDA 3G3MA 1P1XA 1YXCA 3P7YA 4O8RA 2H6RA 2PCQA 3SGUA 3PS7A 1A5BA 1M7PA 1LRNA 5F4WA 2C3ZA 3TJXA 3GKFA 4WX2A 3T7VA 3NZ1A 5CSSA 1OYCA 3CWOX 3CTLA 4GUFA 5F1VA 4Y9AA 1H7RA 4OGZA 2VFDA 4H6KA 3B04A 4JY9A 3HOJA 3HG4A 4JX4A 2FQIA 3JRKA 3G0SA 4JTIA 3BLFA 2BLEA 2ALDA 4IMCA 4CQ8A 3SR7A 2RH9A 4EVZA 4AEOA 1A5SA 2ZZ1A 3E96A 3EWZA 1EB3A 1XBZA 4DPPA 5D03A 3N73A 3LHZA 1SZFA 4X3ZA 3S6DA 4O4VA 1JCJA 1ZFJA 2VEKA 1FCVA 4WY0A 5KINA 4HNUA 4PL1A 1LOQA 4MFEA 1VLIA 3L67A 4WUIA 3MI3A 1RVGA 4M7SA 3NA8A 5K9XA 3HGSA 1TTJA 5LZLA 3DXIA 5D09A 4GWEA 1UASA 3STEA 5GVJA 4FEZA 4TU1A 4N9BA 3F4WA 1A5CA 3WJZA 2J27A 4XUGA 3NO5A 1OHLA 1FCQA 2G5WA 3NNTA 5A5WA 3W2LA 1PE1A 3NQDA 3PBUA 3HPXA 5KITA 1TQJA 1I45A 3S0CA 1JUEA 2WSQA 3OIXA 1TSIA 1EUAA 3BGJA 3STCA 3LV6A 4JTSA 3DGRA 3E02A 4JTTA 2V82A 1GVRA 3BW2A
chains in the Genus database with same CATH superfamily
4IIEA 4PMUA 5I07A 3KZSA 2ATSA 3W7CA 5HNUA 1SZGA 1UPPA 3RPMA 3VVGA 3WQPA 4LBRA 1GWJA 1ZSXA 1E1CB 2HS6A 2PDWA 3E2VA 2PDNA 5K2ZA 2CLOA 3ITCA 2WWDA 3EWCA 2QCDB 2R1NA 1O6IA 1U1UA 3FGCB 3R79A 1OCNA 2HXTA 1EIXA 2A2IA 1R2SA 3SDOA 5A8OA 9CGTA 3K8LA 2Z2UA 3SY1A 1XLJA 3MP4A 1F6PA 3G1HA 1QWKA 3FSUA 3II1A 3GLCA 1PIGA 3KOXA 4CNSA 4Y7EA 1XBYA 2WZTA 3EA1A 3LA4A 4F8XA 2JKEA 2EAWA 4K2SA 3TJIA 2E8ZA 1FHVA 3MZ2A 4H6QA 1TJPA 1TCMA 4IT1A 2W62A 4AD4A 1ISWA 4C1KA 1HW6A 4IP7A 4DELA 4A6GA 4DO7A 1TKKA 1EJ7L 4XVEA 1ZTVA 3IV3A 4P8WA 2XH2A 3VFLA 1ITQA 1K3UA 4AH7A 4QJ1A 1MFVA 4WR3A 5FEWA 4A3UA 1PSCA 1GQJA 4MTVA 3UYIA 5MKGA 4KWWA 2OZ3A 3L4YA 3OA5A 3AS0A 1WNOA 2JGYA 3E5PA 4G5DA 4G7FA 1O68A 2NSOA 3GDKA 3SI9A 3MSGA 4AF0A 1GYMA 3M5VA 1KM4A 4LEQA 4B5WA 3SSZA 1QBAA 1ML1A 5AVHA 4I6KA 1Y5VA 1H49A 1QI4A 1KFKA 4GX9A 3VGHA 3HZ3A 4BFAA 1R9XA 5DFAA 3MSYA 1WAWA 3MS8A 1MW0A 4HHPA 4H2CA 1LOLA 3TAKA 3VDBA 3D47A 4MJ2A 1PUDA 3DFYA 4ROQA 4U33A 1VRXA 3O05A 3POHA 5GJPA 2C7FA 1IEIA 1FCUA 4IIFA 2WSRA 2GQ8A 3P84A 4QIUA 1EHAA 3HGOA 4WY0B 3W1QA 3I68A 4GZIA 2IPJA 4O14A 3A4WA 2VENA 3N4EA 3ITVA 2D0HA 1GZJA 4AD2A 4JXCA 1N8FA 2XN0A 3I6RA 2E3ZA 5CLWA 2BVTA 3F2BA 5HMEA 5AB3A 4IIBA 4J3XA 4ZQMA 3G1DA 2FPVA 1UZDA 3OZPA 2RDWA 1KV8A 4A4AA 3EXRA 1NP2A 1XFCA 3KCJA 1KCLA 1GG1A 2F2KA 4BR1A 4HA1A 2IKGA 3CUZA 3R6IA 4ZENA 1ALDA 2XG9A 1DTUA 2CZVA 1J6PA 1X6UA 1G4SA 4GGBA 2WC4A 1DE5A 2B0MA 4S3KA 1KD0A 1I8JA 5L6UA 1Q85A 2HE5A 3SCSA 1A49A 1SFJA 2NV1A 1JQXA 4M7TA 3WLOA 3W07A 4YIWA 1S2VA 1K9TA 5HJXA 3GW3A 4OBTA 4REQB 3QSRA 4MY8A 2Z1WA 3KHJA 1GCYA 4CNTA 5E0CA 2CKSA 2ZYFA 1QAPA 4JFTA 4JGDA 4FIRA 2QZRA 4S3DA 3LMZA 4LVBA 3TE9A 5LGZA 2J9YA 3MBFA 2NLYA 4PE8A 3PPGA 1DJIA 3G8RA 4LT9A 5FI8A 2RDUA 1QATA 5K3VA 3B9EA 3WUEA 3N9SA 1KFLA 2OZTA 2AGKA 2DUZA 5HR6A 3MQTA 3WDJA 2GVYA 4KFNA 4PB4A 4AY7A 5D2WA 1QNPA 2ZWZA 2YYTA 1PBGA 1QO5A 3VIPA 4YYFA 2VVSA 3LXBA 1JIBA 1BRLB 5BXRA 4ECLA 5RUBA 2INZA 1FWWA 4JBRA 1UKQA 3PUEA 3AUJA 3IGUA 4W7WA 4MY9A 1KBJA 3OLEA 4J1OA 4WDWA 5C6MA 3ZR6A 1QOXA 3L2LA 3W01A 3VI2A 1XRFA 2Y8UA 5T9CE 1IXNA 2TPSA 3TW9A 1K9EA 4WIWA 3AAMA 1CBGA 5E70A 1A5MC 2G96A 2DY3A 1QDSA 5HJYA 5BOEA 1UKSA 5DT5A 3VDHA 1EZWA 1VEOA 5HK4A 4NZ3A 3CZKA 4HU4A 4GIEA 4ZEPA 3TTQA 2FJUB 4EAMA 1XR2A 3UR5A 3KVJA 4BI6A 1K7EA 1OD0A 4EE9A 3H2CA 4W4QA 4U4MA 3A9IA 3W1TA 4ZMGA 4G56A 3AI0A 1E6QM 1HJXA 1N7KA 2X1UA 4TTGA 1ZP3A 5A6BD 1Y8BA 4N9EA 3BSHA 3KEHA 4AZBA 1E0VA 3BH4A 4GBDA 2Z25A 4N7QA 2ISFA 1TFVA 1ESWA 4L4LA 1L6YA 3K4DA 2CU0A 1B31A 4F0LA 4Y9OA 3KCOA 1X98A 3WK2A 1RLDA 5HBFA 1Q6FA 4FHAA 1QOPA 4NJIA 5CG7A 4DB7A 3O63A 1ITUA 3LEPA 3CS2A 4PBEA 4UTUA 3SRDA 3RU6A 4LANA 3CMFA 1JPDX 1J11A 1ONEA 3GG1A 4EKJA 4M29A 4MNMA 1CXFA 2HEJA 2WXDM 1TR1A 1DXFA 2ISSA 3S2JA 3AROA 3TFXA 2VTFA 3EA2A 4DNHA 1HUVA 1XUZA 1S2WA 1WZMA 3R12A 4OVXA 2Z1VA 3NM1A 4HK5A 1H7NA 1RCQA 3PJWA 4TMBA 2TYSA 3QHNA 3LBMA 5CAKA 2FHFA 4DZHA 4BZYA 1O94A 3GM8A 4Q8OA 4ONVA 2IQDA 2EGZA 1DIKA 3L23A 5HULA 1KR0A 2A4AA 4N9CA 2QUUA 1RR2A 4IQEA 1MUCA 2WMFA 3NG3A 1QPQA 3EX6A 3ARXA 1FWTA 3E1F1 1KM6A 4TQTA 3EWUA 1W3NA 4NL1A 2VZUA 1VCVA 4XQ6A 2WLYA 2VELA 3O15A 1G4PA 1V51A 1MZRA 4ZODA 3WBXA 3CV6A 4AZ7A 1BSLA 3WJXA 3ZSSA 1L2UA 1JCTA 3ATZA 4YJ5A 2B7OA 5DQPA 3QQWA 3HM7A 2WBGA 4Q33A 4S3FA 4RDVA 1BAGA 4C6JA 1QRQA 4HCLA 5FA5A 2HK1A 2VEFA 3D3FA 2C14A 5D04C 3WKZA 2DH2A 2EO7A 4UTFA 1NM9A 2X0HA 5HNTA 4QHRA 5EMYA 1TVLA 4GNJA 2DZWA 4ACYA 3W1MA 2PP1A 3T08A 2BFGA 3BJTA 1C92A 1KCKA 4MJZA 2ZVIA 2EQDA 5I3JA 1LL4A 4Z2HA 1T6MA 1VHCA 1B3WA 3C52A 4DUOA 2Y6ZA 1A5OC 1OX4A 3TAOA 3S2CA 3P5ZA 3WQCA 4PR4A 3SQMA 3QSTA 3NVTA 3M43A 3T0BA 6XIMA 3VE9A 4ATDA 4AXKA 1K8ZA 1R3YA 1OFOA 3NGFA 1S5VA 3VZYA 1GJPA 3OLGA 2Z1XA 3VZZA 6REQB 3AIWA 2ZXBA 3GNNA 2A0NA 3L2MA 4ERGA 1GW9A 4KEMA 2XVGA 2V5CA 2BASA 2XGZA 1LLZA 5AHMA 1EXBA 3K30A 3VM7A 2ZE3A 1DQUA 2WWCA 3LMYA 3RPDA 2DUAA 2V63A 3F5LA 1Q13A 3L68A 3DBPA 4HTYA 3FDKA 1W1B1 1MUWA 3ORWA 3VNIA 4RNFA 4L9YA 2XIIA 2VNCA 4GGHA 4IFKA 4ENLA 5IFPA 3SCNA 3WG6A 2WHMA 2XVPA 1MDLA 3H7UA 1L6SA 3MI2A 1GKQA 5I23A 4XD6A 5JH1A 2V3FA 4XBKA 1XP3A 1SW0A 5FF3A 1DQXA 1JR1A 2VGIA 3KM8A 3T0CA 5JUVA 4MZ8A 3V75A 1KTNA 2Y4SA 2VFGA 1XS2A 2OT1A 4G2DA 3WENA 2QUNA 3EA3A 3ABSA 4M1BA 1W5OA 4LBSA 2PD5A 5D9PA 3THAA 3OBAA 5U7SA 1R3SA 1GORA 3VDGA 4FOUA 1WOBA 3CQ0A 3A47A 1OFDA 1VRDA 4QP0A 5FJPA 1KWGA 3R0UA 3SURA 1FWRA 1HN1A 1KM2A 1ONRA 2V6AA 4RPPA 4S3AA 3GDBA 1LRQA 1HT6A 1RD5A 1W56A 4GH3A 4L6OA 4DM2A 4O52A 2CPUA 4FLRA 2GJXA 4JTRA 5A6AA 4NZ1A 3VNYA 3MA8A 3JZEA 1EA9C 1E6PA 2HBXA 1R8LA 4GACA 4TV6A 3B0UX 3WLPA 1O5XA 4MPKA 1WKFA 4H4IA 4RK8A 4CKQA 5K4ZA 4UOJA 1IIGA 2HTMA 1RBLA 1VBHA 5M5DA 4R9OA 3MHFA 3EX2A 1CLVA 4IWWA 2Q3RA 2J47A 5IRPA 3FY1A 4MYXA 3UWEA 4L56A 2Z00A 2VZTA 2F61A 4JOMA 1O4UA 1MXGA 1FH7A 1OD8A 1OGBA 3KLLA 3VD9A 3EDJA 1K4HA 1DJQA 1TPDA 4GC3A 2OWCA 1Q2RA 5G1MA 3L12A 1VGAA 2BY3A 5EMMA 4B4HA 4JZ5A 1W9PA 3WNPA 1W1PA 3IIVA 1M3UA 4W87A 3DESA 1EXPA 4AY1A 1MI3A 4H83A 4XAZA 1EC7A 2HPIA 1EDTA 4QAIA 1E6NA 2PEVA 3EWDA 2FB3A 4FLSA 1JAEA 2VOTA 3H8AA 1E9LA 2D2OA 1X1NA 4S38A 1F6KA 3GH7A 2O56A 4ADUA 1TMLA 1J93A 1E70M 2OODA 4Q4KA 3BWWA 5JU6A 5HQLA 1U33A 4RZ4A 4TX8A 3CHVA 2VWSA 4ERAA 4I6VA 2Z28A 2PB1A 1HL2A 1A5NC 1IEQA 3ZMRA 2Y8KA 4HZMA 4XAGA 2OEMA 3RG6A 3LD5A 1JF6A 4H7ZA 3F7JA 3CV7A 1B3ZA 2VP8A 1JPMA 1BEUA 2WMHA 4GYPC 1H50A 1XKYA 3C0SA 2QT3A 4JIRA 4X61A 1OT1A 3K4WA 5BRQA 1Q3NA 3VD5A 4P61A 4XO6A 1BXNA 3MVTA 1TJ1A 1GTEA 3G6MA 4MWAE 1ADOA 4XZWA 4YVXA 4NF7A 1RV8A 3QW4B 3S83A 2G3NA 1CENA 3RRAA 4CUCA 2EG8A 4CD4A 3K8KA 3KOYA 2IKHA 1NFGA 4MZ1A 1LQAA 1H1NA 2CZDA 1LWIA 1FWIC 5DXXA 3W00A 3IJ9A 2MANA 1KV5A 1E6RA 1JCXA 1PDYA 3WD0A 5AFDA 3NO3A 4ZB0A 4I7UA 4AY8A 1AW2A 3BAJA 1OFAA 3IIXA 4TMCA 3FVDA 2PCEA 1RLCL 4TVUA 2R24A 3ES8A 4DYEA 3LERA 1BD0A 1W0MA 3GH4A 4C6LA 4RKAA 4WXYA 4I5UA 4I9AA 3B05A 4LUYA 1OC7A 1B0IA 3GRIA 5LA2A 1VFTA 4RZ6A 2J7HA 2VYOA 3C3UA 2GUBA 4GZJA 2QV4A 2EG6A 4IPLA 1DWFM 4N6FA 4S39A 5KZDA 4Q4MA 1KFJA 3LHVA 3MT1A 1KBKA 5EFFA 3APGA 3E0LA 3FKKA 2QMKA 5AC7A 1XH0A 1DVJA 1B3XA 4U5IA 3LYEA 2GGIA 4M82A 1FUYA 3FHQA 3UPWA 3NURA 4Q7NA 3HBLA 1P6BA 4DYJA 3GIYA 3V36A 2GOKA 2CZ5A 1ICQA 2RGMA 3PSWA 3L0GA 1JYWA 3H12A 3W2NA 2NWRA 3URQA 1Q65A 3GU2A 4XKYA 3W7HA 1TPFA 4NI8A 1RCOB 1UIOA 4IMGA 1IZKA 1AJ0A 1XGEA 1A0EA 1NF7A 4LS2A 3MUXA 3OHMB 5LHEA 2VKZG 4ZB5A 3ENLA 1IGWA 4UQCA 4E2DA 5CEWA 3B40A 4JYEA 2B7PA 1XW8A 1J2WA 4IFOA 3WLSA 4Q8VA 1LWHA 1NOUA 1H0IA 3AYTA 5JVLA 1S38A 4LRTA 2OQYA 3M0YA 4YLWA 1F3TA 6PTDA 4JFSA 5D9MA 1YNPA 4ZO9A 5D8WA 2E4TA 4O10A 4LYKA 1PX3A 4N4QA 2A3AA 3CU2A 3ITTA 1JNEA 2WNWA 4JFWA 1GOQA 5PTDA 2OLAA 3CPUA 4HNLA 4TV5A 3MUCA 3L4VA 1W3KA 1X1ZA 1E9IA 2DU2A 4JTEA 3AZTA 2D2GA 4Y2WA 3IVSA 5I06A 4UQDA 3LENA 5KZ6A 5I79A 3BSMA 4B5NA 3UERA 4DAFA 3CL7A 4UR7A 3QQ0A 1ME7A 2D23A 4WHBA 3RLUA 1FBAA 2BY0A 1XYMA 3IJLA 3G1YA 4NIRA 5ABFB 1UH3A 3M0VA 1TWDA 2QCHA 4F0KA 2DT3A 4HCDA 2Y7DA 4LVDA 1UJQA 5EYWA 4K36A 4HMEA 3FV9A 1K6AA 3UY8A 3PR2A 1DWAM 2WMIB 2CXEA 3DFSA 5FEPA 1XIGA 4S2BA 2A7PA 2BBFA 1OVDA 6ALDA 5IM51 1MWOA 2P0OA 2XTKA 4MB5A 4CNNA 2VQTA 2NT0A 3UZYA 3VD3A 1PWMA 1F3WA 3W22A 3QVQA 3PF3A 1A3WA 3S2NA 3TR9A 2WPGA 3AIVA 1BVNP 4J40A 3KL5A 3UZ5A 3LRKA 1V6YA 3AHYA 1HX0A 3NPWA 1NP0A 2BHUA 4FSAA 4JIQA 5TAOA 1J10A 4F48A 1R38A 4AISA 3TA9A 1TPUA 1DTNA 3AIRA 5A8NA 3PBMA 3IARA 3UGVA 4MB3A 4GE8A 3FXGA 4GY0A 3TYAA 2WHKA 4LVFA 4XZIA 3UWZA 2NQJA 1R30A 1VFFA 1US2A 2WSYA 4DXKA 3A13A 5LYRA 2QCGA 4E8GA 1E5JA 1OJXA 3A9BA 2E5BA 1OZQA 3W6LA 3N2CA 4FLQA 3MYPA 4Q8QA 3KWSA 1XDLA 4LPCA 2Y89A 3BW3A 3M6YA 3A3HA 1Z3NA 3WFAA 1K7FA 5KEZA 5LA0A 1V08A 4WGXA 1ZNNA 4Q4OA 3KTCA 3W1PA 1JDDA 1TREA 1LQ0A 2NXIA 3DHDA 4Q4RA 5FL1A 1DEDA 1ENUA 3KBWA 2YYUA 1UPMB 3BOLA 1JJKA 1PCWA 3EB4A 1F74A 3TW7A 4ICNA 4Q4PA 3T0AA 1NOFA 1ICSA 4O50A 1XJBA 1ZLPA 4DRSA 3W6YA 1YRRA 4UCGA 3RJXA 1H63A 1Q66A 2PGFA 1WKDA 2WZHA 3NL5A 2X05A 3TMQA 3WLMA 2QVNA 4ORMA 4EPEC 1ONXA 5CPOA 3TTOA 2EJAA 3WDIA 4UWMA 5J5RA 4UTMA 4QG9A 3WD4A 3SFKA 2A21A 5BCAA 2QCMA 3NM3A 3FCPA 3DKLA 3N1AA 1NELA 1M01A 1R5YA 5DLCA 1HL8A 3A21A 5J04A 4BF9A 1TELA 2F9RA 1ZQ5A 3P67A 2RAGA 2ZDRA 3S6TA 3G22A 1TVNA 1KXVA 3WQFA 4M6UA 3UJ2A 4C5YA 3IGXA 1ZU8A 1EQCA 3WNMA 2FFCA 1MXDA 1SSGA 5EA9A 1E9YB 2WVTA 4JX6A 5C7VA 1KXTA 3W2MA 1HKJA 3ZR5A 3P80A 1RJPA 2GYIA 2JE8A 3IJ7A 3ITOA 3DFNA 3L4XA 1W3IA 4LVGA 3W02A 1TB3A 3RUBL 1IHIA 2P76A 5TF0A 2BV9A 2YB4A 3V3WA 3LNMA 2D69A 4DX3A 1IZCA 3IJIA 1QXLA 2X41A 3GE7A 2QJMA 4UFLA 5I5RA 2X42A 1KRBC 3P3BA 1Z8AA 3GVWA 4O18A 4F2TA 1RY8A 1MXSA 3WF4A 1EGVA 1F8MA 3LCGA 2PDXA 4IM4A 7A3HA 5K9DA 2CFFA 1JVNA 1LP6A 1GVFA 4NUWA 3W25A 3VE7A 3VCCA 3VTRA 3HMJG 4F79A 3EPOA 4K7VA 1E5NA 2Y0FA 3CEPA 2W27A 2GJPA 2Y5SA 3O16A 5I3KA 2XN1A 4O28A 3CMGA 4D1JA 3L7RA 4PUKA 5HJLA 5EB8A 3TTYA 2F8QA 3H26A 4XZHA 2QIIA 3VKBA 4BS0A 3MKKA 3PC0A 3QGAC 4NI3A 2OJPA 3GR7A 1TV3A 2CIPA 2ZDSA 4CEUC 1YDVA 3SIMA 2I9UA 2RDXA 2V2DA 1F61A 2J24A 1PJ9A 4O11A 3FAWA 3S8HA 4L6DA 1QASA 4KEZA 1VFHA 4C6KA 4JHMA 5LNRA 4Z2JA 3BMVA 3J7HA 1LQ2A 1YXDA 2ZX7A 4UNIA 3LCIA 3B0XA 3LM7A 1VHNA 3GNRA 2C0AA 1DJWA 1JCNA 1O60A 3EXSA 2HJPA 1UR8A 2DZVA 3U2ZA 1W9XA 4DBUA 4HOZA 3L0NA 4E8CA 4PC8A 3LRMA 1MSSA 2HS8A 1P7TA 1JDFA 5HMDA 3UR8A 4N4PA 5BU9A 1C8QA 5GJNA 3BVJA 3UGRA 3QY7A 4Z0JA 1I6NA 2E7FA 3UCDA 1WXJA 4C7FA 3P6LA 3UWQA 4CD7A 1LJYA 3W38A 2J25A 1FWSA 3EWYA 5CZSA 3U2OA 4DBDA 5EMKA 5D2XA 2PGRA 1EJRC 1IWPA 2WCAA 4B3LA 4UXDA 4PGLA 2AMGA 3E6EA 2HQAA 1DXEA 3SW6A 4ZE4A 4AU0A 1HGYA 3TN3A 1V3HA 2OG9A 1O5KA 3B0VC 1O5QA 3WJWA 1TX2A 1AVAA 4YTQA 4M5PA 2DZAA 5DN1A 3QTPA 4KRUA 2NQHA 3FA4A 1EDQA 4DJDA 3A3WA 3LGEA 3A23A 5F2LA 4AYGA 1JI2A 1V3KA 2VFFA 4GVGA 2R1KA 2WNQA 2PTZA 4N02A 2QUVA 1G69A 4QDWA 2Z6IA 3O06A 4GKLA 4B90A 4C1NB 3B8IA 1AD1A 2ZRZA 5C9WA 1Y65A 2XFYA 3NJ3A 4LCQA 1MQPA 1RP8A 4MAVA 5HNRA 1MEWA 2R94A 3DI0A 3IUDA 5BZAA 3LGDA 4CGTA 4Y90A 2Q8LA 2CHOA 3BARA 3R8RA 1ZALA 1G67A 1V7AA 2HCVA 2OR2A 4G7EB 3S1XA 4CN1A 5TD4A 3U9IA 2F6UA 4BQ5A 1AQFA 1Q6RA 3M0HA 3UWVA 3WMSA 4W8BA 3SM0A 5JIWA 2BZNA 3HB9A 2GJLA 4PRWA 2CBJA 4A22A 1DXIA 4D8AA 3ONCA 3LUTA 2OO0A 4V33A 2REQA 1V03A 2PUZA 4Q8PA 1EJWC 4KCUA 3VGGA 2Z4GA 4XK2A 4CQDA 3GKFA 3WZ0E 2OKTA 4MM1A 3TQPA 4FMVA 3CTLA 3RRXA 1Y5XA 4LAZA 3U5YA 4Y9AA 4QQUA 2PTXA 4C91A 4KETA 2YL6A 4KBXA 4KWOA 3HG4A 4R88A 1PO9A 1CT5A 3V16A 2FQIA 3JRKA 4YS1A 3UW6A 3H22A 3BLFA 1ODUA 4OFCA 3SR7A 5ABEA 4UR9A 4EVZA 4AEOA 3EYPA 1QNOA 4GH1A 4LEFA 4F9JA 4QR6A 1Q8AA 4GYJA 2G4FA 3D46A 3N13A 1LUCB 3LHZA 1HP5A 9XIMA 4S3JA 2VEKA 4HNUA 4PL1A 1W1TA 3AISA 1OG6A 2F6XA 1NARA 4CU6A 2WHJA 5K9XA 2OKOA 1SJCA 1V0LA 2ZX9A 5IXEA 4ES4A 3F4DA 5GVJA 3BAWA 4TU1A 4IG2A 4N9BA 2ZIDA 2J27A 3VKCA 2V5JA 1UR2A 3U0HA 1AH4A 1I75A 1TQJA 2J79A 1EUAA 3GHTA 2W92A 4JTSA 4PULA 4R5EA 3WLNA 4HNOA 3BOXA 3WQOA 3DHPA 2V82A 2XVKA 3NQAA 4Q8TA 1Q6LA 4UMBA 2DJXA 3MY9A 2PLJA 1UKOA 2FIQA 2OLHA 3LBOA 3CL8A 4H8NA 2XH7A 4CCCA 1Q6OA 1E71M 2G3IA 4L65A 1W9BM 4PTMA 4DM1A 3HGJA 3FKRA 1A0CA 3R10A 3R5EA 4LW7A 1TE1A 1PIFA 1K8YA 1HJWA 3GVGA 4MWAC 2IPGA 3UG3A 3M0JA 2QCEA 4GISA 2NQ5A 3KBJA 5G1TA 2VUYA 3GVQA 2X7WA 5CC5A 5DMLA 4Z2GA 5T91A 1FWHC 3OBEA 3UP8A 1UWQA 3CUHA 1J79A 4PMNA 4FP1A 3WEZA 5BWFA 2Y7EA 1E72M 3TYCA 2JFEX 3M7WA 5CSYA 2P53A 3JU2A 5TIMA 1VFOA 1F5ZA 4EOUA 3LLFA 1EYEA 8XIAA 4MWAB 2X09A 1W1A1 1LYXA 3WK0A 4JIIX 1PS9A 1NSJA 5CJMA 3A12A 4QM1A 1TV4A 1K6WA 3V7PA 3N34A 4XZBA 4I5XA 1CGXA 3W1AA 5DMMA 1TZ7A 4KEUA 4FXSA 4QE4A 1Q6DA 4IIHA 3FDGA 4UB9A 4WSHA 2G4JA 5D05A 2PDYA 3SCWA 1K8XA 2PWUA 2E9LA 1Z89A 2D24A 1P0EA 4HK6A 3P8IA 3REQB 4KIEA 5ABTA 3VCNA 3AMLA 2JKPA 4N9DA 3UXDA 1UP3A 1MDRA 2EXOA 2QVHA 1MEIA 3H21A 4B2DA 4A8RA 5IDIA 4LC8A 1D7FA 4OU1A 1E9ZB 1EX1A 1FA2A 2DSVA 1ZHAA 1TG7A 3FXYA 1JXJA 3GY1A 5D9OA 4ADTA 3N19B 1F07A 1IXPA 2D3LA 5AYBA 1QPNA 3I4KA 3BOFA 4ATLA 1BFNA 2GJNA 1VJIA 3ZSTA 1DPMA 3QGKC 1JRBA 3HQPA 1RK5A 3VA8A 4DNMA 3AU2A 3QZAA 3WLQA 3P61A 3RXZA 1WBHA 2ZC1A 1PL9A 2E77A 2BVDA 1P4CA 4O0QA 1ADSA 4J27A 4UZSA 4JTAA 5BU6A 3XISA 2WJFA 2GVJA 4C7GA 4GUIA 1LBFA 4HZ8A 2E1WA 3W7NA 2Y2WA 3NGJA 3CAQA 2ZZ6A 2D20A 3VK5A 2YZRA 2WV8A 5U4NA 4ORIA 1J5SA 2E6AA 3WQ4A 1IQ8A 3ZVIA 3EWBX 3DYMA 2J7BA 2A7NA 2C8NA 4KF1A 1FVPA 2ISWA 3MDUA 3NDOA 3SCOA 2BOFX 1MO0A 3CL6A 4G8TA 5FJIA 1IT0A 4RR4A 3T8LA 3TC6A 3SUSA 3OBKA 1FWGC 1J96A 6A3HA 1F7BA 2VEIA 2CLLA 3IUIA 4OBRA 2NX1A 2VUNA 4I7VA 1CPUA 5E1QA 2Y5EA 3AHXA 1RBAA 4HPXA 3VOCA 3T9PA 1XPYA 4IF2A 3M41A 4DJFA 1YXYA 3C0LA 8CGTA 4AC1X 1B4KA 3JR2A 3L5MA 3NPXA 1CZ1A 3GKAA 3PZNA 5KETA 3OGVA 4AX6A 2J8FA 2QAPA 4F40A 3B8VA 3IRDA 4GRSA 1RALA 4MGGA 2VR4A 1Q4WA 1EQPA 4A8NA 1BSIA 2XU2A 2ZZ3A 4C90A 4FIQA 3CIXA 2PODA 4MUZA 4GQRA 3GTXA 1JULA 1XBVA 4DJDD 1I1XA 5EL1A 3B9OA 4ZFMA 3UXLA 4MMWA 4KQNA 1VYPX 3HTWA 1XXXA 2WPBA 4QTGA 3UJEA 3CIWA 1R7OA 1M04A 4U5KA 1Z69A 1QPOA 1SFSA 3IANA 2XIMA 4MJMA 2W91A 4HCHA 1UYQA 1DL3A 4GZ7A 2PDHA 3AS1A 2E0PA 2Z27A 1TPC1 2Y7GA 3MZNA 3M9YA 3VNKA 4LOCA 3EB2A 1A5AA 4KEVA 3D0CA 4UNKA 2HRWA 3GNDA 1W1IE 2I5IA 5AHEA 3GO2A 4H8VA 3U48A 4B9ZA 2CW6A 1WPCA 1VFMA 3QPZA 1DWHM 3V0SA 3T6CA 4JYFA 2XVLA 2Z7KA 2XSXA 3WUBA 1Q63A 4JIHA 2ESCA 1JUKA 4K8GA 1I4NA 1PKNA 4K7YA 2DVTA 4HQVA 3CM4A 3GWQA 2QUMA 1CYGA 3MMTA 1XCFA 1BGAA 3VOFA 4QISA 2JEPA 4B15A 1O1ZA 3ZLHA 4KGJA 5HWJA 5A6TC 2Y61A 3VAVA 1G7VA 2O9RA 1WP6A 2ZA3A 3TSDA 4HHHA 2Q8ZA 2HMCA 3M0ZA 1BVWA 2P8BA 4BI5A 4I5RA 3UCQA 3QKEA 4D6IA 3PPCA 1DWGM 1V5XA 1XFBA 2J7GA 3ZLFA 5T9BG 3XIMA 1FXPA 3ISIX 2YFNA 5E6YA 4GI9A 2FDMA 4C6NA 1OFBA 4IQDA 4C7DA 3QPYA 3IJ6A 1RP9A 3QLDA 3S2LA 3OIHA 2FH6A 1GK8A 5AHLA 2WCGA 4BJHA 3I3EA 4OIFA 4AD3A 4HKPA 5HA7A 4MNJA 1E4MM 5AYIA 1H2JA 3CQIA 3U8GA 3NQ8A 3LS9A 4R53A 2QGYA 3WQVA 3ARRA 3S9YA 4NHVA 3CZLA 2FVMA 1RVKA 3C2YA 4QE1A 1M5WA 1QJWA 1VKFA 3PZ9A 1Q6CA 2NW0A 3TONA 1P6WA 4FXJA 4LUSB 1EPXA 1NF0A 3NTYA 3IVUA 3ZJKA 3BQ5A 1KFWA 3EWXA 1UP0A 5I0DA 1OCJA 2OWXA 3LCWA 4Q6XA 2EG7A 3DCPA 4WJEA 3PUGA 2WVUA 3ZJ7A 3MUIA 1H1ZA 2NLIA 4UC5A 1FQ0A 2QXWA 1XDJA 1S5TA 4A3HA 3GDMA 1E40A 1KBIA 3GVVA 2J7CA 4HNTA 3MHGA 4IMAA 5CPSA 4F0SA 3UZJA 4JTQA 2VD8A 4O17A 1WDDA 1OG0A 1EP2A 4I8DA 4KT2A 2FHBA 2UY5A 3UXAA 3TTSA 2GFTA 1NWTA 1J2BA 3W7RA 4L80A 4FX6M 3SN4A 3M5ZA 4UTKA 2RUSA 1KBBA 4PTVA 3MI6A 2GDVA 3MO7A 1PTGA 2WANA 3G18A 1E0TA 3MWAA 2PDKA 4M0XA 4DF2A 1JRCA 3BL3A 2AAMA 3OGRA 3MU7A 4DJDC 3M0IA 5BW6A 4PUNA 3MVIA 3PTMA 1MW1A 4HT3A 4QNEA 3BC9A 2DORA 1TMQA 3V35A 2FLIA 2V0TA 1F3XA 1DWIM 3DEQA 1YADA 4GYKA 2YIHA 4ZO8A 3DGBA 3BAXA 3DHFA 1M6JA 3TNOA 3WLHA 1OGGA 2A6LA 1LT7A 4O16A 2NUWA 4XIAA 2BGQA 1O5RA 3BICA 5CC3A 4PUEA 1FH9A 1AFSA 2XJ7A 1ECEA 3FJLA 3MV01 4H9ZA 4UZUA 3CO8A 4DLMA 1CGTA 4P7NA 5KZEA 3NL2A 2VRQA 2YB1A 3UNTA 2PDCA 1GEHA 2V5LA 2FTYA 4PB5A 2XSAA 4B2DD 2YXOA 1LRTA 2FGLA 1WUEA 3CNYA 1BKHA 1A5KC 1ZCOA 1V93A 5H8UA 3M07A 4GI6A 4UNLA 4RUBA 2OYKA 4ZOEA 1QO2A 3CHDA 2FH8A 1D3GA 2G3MA 1DBTA 1HTIA 3GX9A 1BWKA 5A94A 4TUFA 5I03A 1XYCA 2OCZA 3SAZA 1H5YA 3ARWA 2GGJA 3W7JA 4PRTA 5I02A 1LTDA 2Y5JA 1AUSL 2O4QA 4LXFA 3P14A 3A24A 2GVLA 1W3TA 4HZ6A 1YPXA 2XZ9A 3F1QA 1V8EA 3TFCA 4E4UA 4HMDA 3USBA 1XX1A 2I57A 3NSMA 1XLLA 3LHYA 2XUCA 4PTWA 2VX7A 5I3DA 3WF3A 4QAWA 1XIFA 1K8CA 3H53A 5M1TA 4F66A 3BAYA 1GGOA 3TSMA 3TROA 3CH9A 1BWVA 1PHWA 4DO4A 5G4EA 4QITA 3W3OA 5E9AA 2BS9A 1RAKA 3IV8A 3P0XA 3C8FA 2QUTA 3UBPC 2OZ8A 2BMBA 2BX7A 3N2TA 3WJSA 4DJFD 1UD2A 1GVEA 2H9AA 5IHSA 5IBXC 4F4RA 2PP3A 2PZ0A 1JDCA 1M7XA 1EJXC 4XTDA 1QNSA 5CGQA 4BEQA 5A3HA 3HMCA 3TJLA 3KRZA 5I77A 4H2HA 4DO6A 3Q67A 3UXIA 2PDMA 4OOUA 1JG9A 4UMCA 2J6VA 2DUXA 2X8RA 3RLVA 1O66A 4Z1BA 2EEXA 4QFUA 3AMCA 3L9CA 4IXHA 2CHRA 4D8LA 2QCCA 3A4XA 4UR8A 4CCEA 3KRBA 1FDZA 4UFIA 5E5CA 3QR0A 1B3YA 3SUWA 4UTHA 2VC9A 4HSHA 3WLTA 4JKKA 4DWSA 3KZPA 2XIOA 4R9XA 2FJKA 4U2YA 3O6YX 2KZHA 5FACA 3WLJA 4HHMA 1GJWA 5FESA 3H2EA 2CLKA 4FLOA 3RGTA 2PE4A 4J3VA 4NAEB 5FF2A 3PANA 3EOOA 4G9PA 3W74A 2BHZA 2PURA 2TAAA 3UWYA 3GDRA 4P7OA 1GT8A 4D1IA 1O95A 2YOCA 2BXVA 2F2HA 1S5NA 4Z2IA 3EWWA 3ABRA 3PJTA 5DMNA 4O1CA 1XIBA 1US3A 3UCCA 1XYFA 1L0PA 3TQKA 3CK5A 1E43A 4JN6A 3MUY1 3BZJA 4GXMA 1PKLA 2UZ9A 1AMYA 5LNVA 5FJJA 2ZICA 3DN5A 3WF1A 1Z48A 1DOSA 3EOSA 2ZUTA 1FHUA 3M44A 1T7LA 1FWJC 1VBJA 4NYYA 5KZMA 4EXAA 1LDCA 1TYGA 5HNNA 2YDRA 2Y88A 5IOBA 1AK5A 1KGXA 3NDZA 4DUWA 4WSKA 3KDNA 4K1GA 1ZJHA 3OQ8A 3H7RA 1YTDA 3PZQA 3WF0A 1M03A 1R47A 2BTMA 2HPMA 1TWSA 3PNZA 4J3WA 3ZZ1A 4F3HA 4GC4A 1XSIA 1UUQA 1I2OA 2CBVA 3PZUA 4ICCX 1XSKA 3HJEA 4U2ZA 1TPEA 4LALA 1NEYA 2CBIA 3TEVA 1G1YA 3ITLA 4EF9A 3NYZA 1AL8A 1MMFA 3NEVA 3TQ0A 3EAUA 5D2TA 3R89A 3L66A 3AIEA 5E0FA 1DKWA 3B8DA 1GQKA 4AZCB 5D2YA 2V30A 3IS4A 4J2PA 2WKGA 4N42A 4NNAA 1SPQA 4HU3A 2XZ7A 1XC6A 3CYVA 2OPJA 3SFWA 1RA0A 3DENA 3PB2A 3S5YA 3S3GA 3PSVA 4NT0A 1JF5A 2ZRVA 3O0FA 3W1XA 4AZ5A 2YKKA 4FNQA 3W81A 2AQVA 3CO4A 4HSNA 4YWSA 4DYKA 2VD9A 5DBTA 3P93A 1U2YA 5AC8A 3ZVHB 2R1MA 3M1ZA 4ICMA 4Y8FA 2NXGA 2ZWYA 3FN9A 3KOZA 3C2RA 4FNRA 2WK2A 2P8CA 4RW5A 2WZIA 1Q45A 1EO7A 5AECA 2OX1A 3BTNA 2EHHA 3BLPX 3R0KA 2EKGA 3M16A 1R3QA 1YDNA 3LRLA 1Q2SA 1L8NA 4NNCA 1KFEA 2CERA 4RNJA 5K7JA 1PYMA 1DE6A 4AD0A 4X2PA 1RQHA 4Y96A 4OKDA 5JMUA 1T41A 4MAZA 3ABXA 5JIPA 2QJJA 2PLCA 2NX3A 2A1YA 1D3HA 4LVAA 1BTCA 4K8HA 1H11A 3S6OA 2VXNA 3P81A 3PBWA 3UNDA 1MRAA 4IIGA 4C6FA 3PAOA 2AKMA 1QT1A 4POCA 3NSNA 2EBNA 4HK7A 4XSMA 1QR7A 3PK7A 1WYIA 1YBQB 3KP1A 1W5QA 1J0IA 2YW3A 3W1UA 3AU6A 3PZIA 4W5UA 1VFLA 1MUMA 4HPGA 1WOAA 3W85A 3U3HA 1QPKA 3GDTA 4F0MA 2J9XA 1BF2A 3M5YA 5FCZA 5HUOA 4NJGA 3OTRA 4AIUA 4FI4A 2EPOA 1UD5A 4C6MA 1FH8A 2J74A 2C1GA 1HKMA 4ZQOA 2D2HA 4IICA 3I3BA 1UIPA 4C6BA 5F2IA 3ICJA 4YTTA 1CEOA 4IMDA 3I65A 4GINA 3SZ8A 4Z2LA 4DO5A 1J8VA 3H4XA 3VPLA 4B3ZA 1VQTA 4QG6A 5CBBA 1QWGA 3SGZA 4QLKA 4FXFA 2D1ZA 4J2MA 2IXVA 1UW9A 2RHGA 3WIJA 3MCMA 4GPNA 7TIMA 2C91A 3BLOA 1NDZA 8RUCA 5AY7A 2VL4A 5H1WA 1YMYA 2ZUNA 3G1AA 4AZ6A 1K4GA 1LG2A 4TVCA 3S9IA 2PC4A 4P8VA 3CYJA 3W7KA 3VYLA 1SO6A 4MDOA 2IKIA 5KSWA 4C6QA 1U5JA 3LI0A 3N11A 3GZ3A 4W89A 2QNEA 2VEMA 4L9ZA 1HJVA 3M47A 4O19A 3GC2A 3SUUA 3SADA 1Q6EA 2YCLA 3FA3A 1V79A 4JY8A 1NU5A 3CAVA 5D8ZA 1R86A 1GVIA 5HDRA 4GI8A 1KM3A 4J5NA 2YGYA 4O8AA 5C55A 3ID7A 2AOSA 1IE7C 2CLMA 1CECA 1FY6A 5LKYA 2IUZA 1KTBA 4S3GA 5DCDA 3ARQA 4RDYA 2ZA1A 1TVPA 1KW1A 2D2JA 2TSYA 2VCCA 2X40A 3GU9A 3VDAA 3WBAA 4S3BA 5FKYA 5GJMA 3BV4A 1QK2A 3NQ7A 3MB9A 1V77A 1RXOB 5A8GA 2DSKA 1G6CA 3PZGA 4HBKA 4FR1A 2J6XA 3IJ8A 3E12A 3W76A 2VMFA 3L4TA 4QLJA 1BYBA 3GIPA 1QOQA 1FWFC 1BYDA 2ACUA 5CZJA 4MFDA 3W88A 1MEHA 3BK0A 4DWSD 2ONEA 3C0JA 4K6AA 5HWMA 1NH6A 1CX9A 3OLDA 5DRIA 1CXIA 1OCQA 3FA5A 1Q8JA 1RY0A 3TCEA 5BYWA 3W2UA 1GOKA 2GUUA 4HOWA 2ZCGA 2YCIX 3C56A 3C8NA 3WBEA 5XINA 3TYBA 2VZVA 1TJ0A 3STPA 4HPJA 3NQ6A 4Z1CA 4AWEA 4O15A 5GNYA 1UROA 3DG7A 4FX7A 3QYQA 1Q6QA 5AKQA 3O9NA 2G8ZA 3OODA 1A50A 3PUDA 2VRKA 2X30A 4AC7C 1OGSA 3WNLA 1GZGA 1U1JA 2PBOA 1ZJAA 3PTQA 2R14A 3MV11 3GHUA 3KOWA 3W53A 2FZ8A 2Q02A 3D6NA 1PZ2A 5B7YA 4NAFB 3EXTA 3WLLA 2Z1BA 4J3ZA 1TWIA 3WQGA 2W79A 4HYWA 2Y7FA 4TIMA 3L5AA 2CXGA 1CGWA 4MKSA 3WEMA 4IQLA 3N29A 3PBVA 1M7OA 2AMXA 3NO1A 3WX7A 3LV5A 2VM8A 3CHEA 5JBEA 4Z17A 2YA2A 1G01A 2A85A 3NAVA 3VINA 1AQHA 1IWAA 5CPNA 4GOAA 4DQWA 3ARYA 3ABOA 4JTJA 2E40A 3G0XA 1TCDA 3WSUA 3RJYA 4MJ4A 3GH5A 4I3GA 2BXYA 3N6QA 3WDPP 4UTTA 3MMDA 3SJ3A 4JS3A 4M19A 2WMJA 1X97A 2PRMA 4IUGA 1K1DA 3THDA 1MZHA 2BWGA 3TKFA 1J0KA 1HZYA 4L5ZA 4PMOA 1GHSA 3CHCA 3PZVA 3TZFA 5AZ0A 2WVVA 2WQPA 4AMCA 5D37A 2P88A 5GQBA 1DQWA 1H7WA 5BXPA 1WE5A 1X7IA 5AZ1A 3UEQA 3E2SA 5HMSA 2UV8G 3W70A 3W7LA 2YJQA 1GPWA 4I7WA 1RBOB 3CT2A 3SY5A 2X0YA 3HU7A 3GXFA 3VNJA 4ZSTA 3CT7A 3CWHA 1RJRA 5HANA 3SGGA 3O6CA 8A3HA 2ANUA 3W23A 3ZYZA 1KGWA 1WO2A 1J01A 2WC7A 2HDJA 3PG8A 1KO0A 4IX2A 4PRRA 1EGMA 1OM0A 3S1VA 3FIGA 1RQEA 5CC6A 3VOIA 3DC0A 4R3UA 3B97A 4D6GA 1KFCA 1LM1A 5A8PA 3OZMA 3VOGA 4QEHA 2JGQA 2J7FA 1DIOA 1RCXB 2E09A 2YCKX 3NL6A 4H1ZA 1Z6KA 2C13A 5D33A 3BUVA 4NVTA 2QPSA 4G1KA 2W9MA 3FNDA 2QF7A 5AHFA 2V3GA 4NYUA 4WJXA 1QI3A 2HE8A 3ARSA 1XKJA 3GK0A 4HB7A 4LUJA 4WKHA 5LIKX 3OYXA 5BOOA 3I3DA 4PCFA 2QJHA 3WDQA 2WNNA 3S47A 2ABBA 3PJXA 3K46A 4P5UA 2TODA 3TK7A 2PLMA 2VVNA 4V15A 1F76A 5M3WA 3TIMA 2DT1A 3WDRA 4DWSC 4GI4A 3BLLA 2J8GA 1XDMA 1J5TA 5JQ9A 1OF6A 4ZQCA 3BG9A 4QX4A 3T2QA 2PPGA 4W86A 1FWDC 4KCWA 2AGTA 1REQB 1XQKA 3U7VA 5BMWA 1QTWA 1MVYA 9XIAA 2DZBA 2DT2A 3S9ZA 2FYMA 1SR9A 2J88A 2FGZA 1E1CA 2QS8A 5BROA 2ZRYA 1FWEC 3MMUA 4DWSB 1F6YA 3NEHA 4UQAA 1QHZA 2A5HA 3PBGA 4OE7A 4CNPA 2AL1A 1OFEA 4GHRA 4NILA 2RJHA 2QCDA 1DJXA 2CCRA 3FGCA 1J18A 5AC6A 4Y8EA 4IPIA 4OJYA 1KCXA 1LOSA 1OK4A 4O0KA 3DC8A 1HJSA 4AVOA 1UD4A 1QMLA 2ZZ4A 3ATYA 1MNZA 4JL1A 3WK3A 3QMRA 4D6DA 2GQ9A 3PZMA 1ISVA 1WDWA 3KHDA 2J9ZA 2PWFA 5ECVA 3SCVA 1E51A 3H2NA 2VURA 2QDDA 3TNBA 4LTSA 3M5XA 4O53A 3EDEA 4FPSA 2QR6A 4PYSA 3HPSA 2H3DA 3ALFA 1IZJA 1UMLA 1YPFA 3CZ8A 4K37A 2J66A 2OO6A 1EOKA 1K7XA 1KQZA 5HINA 2Q3OA 3O6DA 1WQ5A 1B90A 4MKVA 2V8ZA 2C0HA 1CW2A 1CGUA 1LZOA 2QPXA 1GKPA 1PXGA 3BAIA 4ZTYA 4ILSA 3G3MA 1P1XA 4H9XA 3P7YA 4BF5A 4O8RA 3H70A 2PMQA 2PCQA 4QSFA 1TWWA 4A8IA 1M7PA 1LRNA 3KTXA 4WX2A 3RM8A 3NZ1A 5CSSA 1OYCA 3LNPA 4GUFA 3KW3A 3VKKA 2GK1B 7REQB 4TX6A 2VFDA 2OFJA 3WCZA 3VU2A 3ABZA 4H6KA 3JZUA 2BVWA 2VQUA 4F2UA 2J4GA 4WCJA 4D6EA 4CQ8A 4RE4A 5A8QA 1A5SA 2ZZ1A 3E96A 4EWJA 2PDPA 1W6TA 2PC8A 3EWZA 2HNEA 2NT1A 2HZGA 3B9AA 2WSPA 4DPPA 1XYZA 2GDUA 4RNHA 5A69A 3AYSA 3S6DA 4MDPA 5M17A 3W4RA 4WY0A 1PAMA 1MW2A 1XG4A 4YN5A 1GOMA 2V3DA 4LAMA 1VLIA 3MI3A 4NKCA 4DY1A 1RVGA 1BF6A 1VPYA 3LPOA 3NA8A 3SCPA 2VX6A 5LZLA 2GUYA 1C8XA 1YX1A 3ANVA 4H8UA 4F0RA 3K5XA 3I6TA 1FCQA 2A3BA 1PE1A 1W3LA 2WSQA 1TSIA 3STCA 4G6CA 4Y9MA 5FL0A 2ZUWA 3KWXA 1AQMA 1GVRA 1XLIA 4CCDA 1VC4A 3QXBA 3UA3A 3R0DA 3LLDA 3C6CA 1P0DA 3DERA 1HVQA 1TQXA 4R7JA 5I09A 1B3OA 1R3WA 1OWQA 5D32A 3LSCA 2DVXA 3OW1A 1UC5A 3QN3A 3N12A 4PCNA 3SY8A 4I90A 4GQGA 1W3JA 4GZEA 2J13A 4C6OA 1B57A 3LY0A 4QE5A 4REQA 4RXFA 4IGSA 3AOFA 2YA1A 3W75A 4D9PA 2VJXA 3FJ6A 5FF0A 5JBDA 3EOEA 1KM5A 3GB6A 2CWNA 4GUHA 3RITA 4DN1A 1NAL1 3WO8A 1OF8A 4H6EA 3TH6A 1YE4A 4MG4A 3W2JA 4X60A 5LNUA 3EPMA 2B81A 5F2MA 4L9XA 1KLZA 3BW4A 2YZ5A 3T05A 4IMEA 2WOQA 4A29A 2ZTJA 1N82A 4YL2A 5AYZA 1F05A 2PGWA 4KMQA 1OX6A 2PAJA 1C93A 4KW2A 1EC9A 4KRTA 3VIJA 3LHUA 2B7QA 1BRLA 4GNKB 3IAQA 2XWDA 1L2QA 2P3EA 1F3EA 3BANA 4UOZA 4PEEA 2NWSA 2WYSA 2CEQA 1I2RA 2BB0A 2XFFA 3A64A 3DKJA 3O3RA 3ANUA 4MHBA 4GQBA 1FOBA 2XHYA 3HPZA 5ENLA 1W9DM 1LORA 4DAIA 4ZGYA 3TYDA 2WKLA 4JTGA 5J8LA 1J12A 1CDGA 1YLVA 3CTTA 4H9VA 4GVHA 4RJEA 4AAJA 5AYXA 4QJ4B 3LB0A 1XC4A 3M7SA 1E6XM 4BEUA 2HVNA 1RSCA 1YNQA 3I6EA 1CNVA 1HF6A 3ZM8A 3BZGA 4MVAA 3WH9A 4GIYA 1V6UA 4M6VA 2YPIA 2ISDA 4S2CA 3QZEA 1JZ7A 4R33A 4LUTB 4EAYA 4XZNX 1JPHA 4DIAA 4M8UA 2AL2B 1TV7A 4PUMA 7XIMA 4ERIA 1OYBA 3GHSA 1OZMA 1PIIA 2CZFA 4WJ8A 2WVSA 1F4AA 3VMOA 3MJMA 1KKRA 2WMGA 2ACSA 4Q3MA 1J0JA 3L4ZA 5A6KA 3VIFA 2ZUSA 4XVDA 4X9SA 3WUFA 1XWYA 5K9CA 3AXIA 1OX5A 3PFMA 1VF8A 2VOMA 4RZ5A 3T4CA 1IF2A 2CBUA 1TRIA 4EACA 5H2ZA 3KS6A 4H9YA 1V3JA 3VGFA 4UFMA 1Q4NX 3LSBA 3KDOA 2XFRA 2HVMA 3E3HA 4IGNA 1SZNA 3LTPA 1JZ5A 3CEUA 2HVOA 3VGDA 4C6EA 1VPQA 1KCZA 3LBCA 1OC5A 1AJ2A 4IFRA 3TX9A 1C91A 3KVMA 4AZGA 1WUFA 1TZZA 1CTNA 3LK6A 3SRHA 2FZ9A 3N2BA 3L4UA 4W93A 4CVWA 1I2NA 3QOKA 4OV9A 1R87A 1WV2A 4GXPA 1VFUA 1UZ4A 3AIUA 4IP4A 1A5UA 4Y9PA 3WD3A 1W5PA 3F5JA 3AFBA 3KVLA 4FK9A 3AXXA 3NQMA 1HFBA 4UTIA 1SFLA 2F84A 2CC0A 5E0KA 3HG3A 1I0DA 4B3KA 2VT0A 3N2XA 1EP1A 2X7VA 3ZS4A 4B91A 2J78A 3BMWA 3GAYA 2V5KA 4H8HA 4CD5A 4FNUA 1KFBA 3OQEA 1BLIA 2WO5A 1QI0A 3LQLA 3LCLA 1K77A 3IGHX 1GKRA 5GNZA 4LF1A 3WH6A 1YE6A 5C0QA 1GTHA 3ZXWA 1XLHA 1CWYA 1UZ1A 5DCEA 1R46A 3QW3A 2EJ1A 3CJPA 3TN6A 5CBJA 1T8XA 6ENLA 1F4HA 5HQMA 1XG3A 4XISA 4HYRA 2WLZA 3PPFA 4DZIA 3H4WA 3W7IA 1GHRA 3L21A 1HL9A 5MKGB 1Z32X 2E1DA 1ZZMA 2E28A 4FAMA 4D6CA 2J75A 4AF0B 4FOJA 4CD6A 2VR2A 1SYTA 3G1RA 3WMBA 4AX7A 1EO5A 3U6WA 1E4NA 1TV5A 5FJTA 3E2RA 1K70A 4HPHA 5BRBA 3GTHA 2O9PA 2QYGA 3TDFA 5E93A 2FPTA 2MUCA 5I00A 1W2PA 1V4YA 3QGVA 4H01A 1UA3A 3AHTA 2F6KA 2VFEA 3SCUA 3MSRA 2G41A 4IIDA 1TMHA 1KRMA 4F2BA 2GWGA 1EH9A 5A6LA 4HMNA 1GVQA 2OB3A 5J5DA 3GFXA 3VFCA 6REQA 3GDLA 3W2KA 3QH2A 3CH0A 2YL8A 4WOZA 1Z44A 4JEJA 1NWUA 1SZRA 1WCGA 3PPHA 3MCNA 4Q8WA 3WN6A 4FX8A 1JL8A 2XFWA 1QBBA 5TQLA 4CEXC 3ZWTA 2ZZ2A 1VS1A 3E5BA 4DJEA 2X1TA 1TTQA 3WYZA 1ISXA 1OQFA 1B5TA 1ECQA 2VDHA 2OSWA 3APTA 1E6SM 3PY2A 5LIUX 4GJJA 5BNKA 1XUUA 1NDYA 4LBUA 2Q8XA 4LS1A 2A79A 1LLOA 2E67A 1XYAA 2OXNA 3MJYA 3VIMA 2NQZA 4CNUA 3WF2A 1PX8A 5C2XA 2ICSA 4LB4A 1QCWA 3BAKA 3B8TA 2KAUC 4JX5A 1TJRA 2PWGA 4R85A 3FEMA 4PODA 3MP3A 3OU8A 5ABGA 3PWIA 3PVFA 3PNUA 3ZT7A 4K8EA 4HJWA 3E74A 1HKKA 4E3TA 3MUAA 2ACQA 2DQXA 3FOKA 3WL0A 4A35A 5C9UA 1EFZA 3URBA 2GLKA 2VX5A 2VO5A 1FP8A 2UWFA 2PTDA 5A95A 4AFYA 3KBVA 4E2BA 2I56A 3Q45A 5ABHA 2EPKX 4L4PA 3S4TA 1QHOA 3HG2A 1O12A 4H6RA 4J28A 4PMXA 3G5EA 1BVZA 4GYFA 3GC5A 4PMYA 3VOJA 2DV0A 3EKGA 1R9ZA 5H91A 1P0BA 3GTFA 5A6SA 3AJ7A 2ATMA 1V6TA 3IGSA 1AQ0A 1PZ1A 4LB3A 1J6OA 3TC3A 1U83A 3NYDA 2CNCA 2AQWA 3TQVA 8TIMA 4KFPA 3KL3A 1IEWA 1B9ZA 4ZQRA 3ZR4A 1U5HA 4WSJA 4FALA 1TE6A 2D22A 5CSRA 3AWOA 1TUFA 3GYEA 3CLWA 1PKMA 4LNCA 5C8BB 4JTCA 3WLIA 2Z29A 4M80A 1R2RA 2ZX5A 3BURA 4NJKA 3RIKA 4EF8A 2CLHA 3S42A 3DYPA 4LS0A 1TZ9A 1EGZA 2XPKA 2V5BA 2E8YA 2QDEA 4LGXA 3DG6A 4HYVA 1BPLB 4QEEA 5CZ0A 4B5XA 1GPFA 1JQVA 4DBWA 1VYSX 4URIA 4QS6A 2XIJA 1ONWA 4GJ1A 5FF4A 1UKPA 3ITYA 4IUOA 1SMDA 1W37A 1EIBA 4UOQA 4KIRA 2JF6A 3HGRA 3H55A 3LPFA 4LRSA 3BLKA 2Z26A 1Q7MA 4EPKA 3NCOA 2OVLA 2R82A 1EL3A 1FWCC 4HSOA 2VHLA 2R9RA 2OWWA 4Q7IA 3QMTA 1UKTA 1XLGA 4CQ9A 4KPLA 1H4PA 2P10A 1UH2A 1KRCC 3LLXA 3OP2A 2PWHA 3GXNA 1OK6A 4XV0A 4ZCWA 3IPWA 2OEKA 1P0KA 3MWCA 3MDWA 3QLLA 1W9VA 3IVTA 4TOQA 3ZJ8A 5E6ZA 3E0FA 4GBUA 1L6WA 4JDBA 4UFKA 2VDIA 2P3ZA 4XD4A 4ATWA 3MANA 1H0GA 4ZOCA 1OFRA 2VFHA 2C1IA 3SN0A 1EBHA 2DPEA 1TPH1 3NR0A 3AYVA 5HUPA 2ZQ0A 3R2GA 1ZAJA 1FFQA 1GUVA 3TR2A 5CSUA 4P7LA 2ZA2A 1P48A 3PWAA 1ZJIA 4UTJA 6CGTA 3KRSA 1AD4A 3L5LA 4WGHA 3L2IA 3CC1A 3IIOA 5BXTA 4IJCA 4DPQA 1WDPA 1V6XA 3WL1A 2VCBA 1SMAA 3N3MA 5AN7A 3WNKA 3T0DA 3WJYA 4GYPA 2XISA 1N8WA 5CAHA 4DUXA 3RM4A 5F1UA 4U10A 3R43A 5L9FA 1OEPA 5GNXA 4V28A 3CZEA 1I60A 1GVOA 2XWEA 3UJFA 4EANA 1VH7A 3NQCA 3RX4A 1AZ1A 4MLRA 2R1LA 3TN4A 2W61A 3QV8A 1EF2A 5D9NA 1SR0A 4V1YA 5G5IA 1PZ3A 1QW7A 4IMFA 3UY7A 4J3TA 2NQLA 3UZZA 4W8AA 3GAKA 2H90A 2VZSA 3TXZA 1ZL1A 3AXKA 2ZUMA 4X22A 1W31A 4OQVA 1XRTA 4UUIA 2XDFA 4JNMA 3IEBA 3SO7A 3C5QA 1EBGA 1N55A 2OOGA 1NOWA 2G0WA 5A6MA 3H7VA 1HJQA 2FGBA 1Q5MA 3CUJA 2FVKA 1XD0A 4PCPA 2FTPA 1ZS2A 3GS6A 3AYRA 1UH4A 1EWDA 3GBDA 1XF0A 1UZHA 5D30A 1A3XA 3TC7A 1TX0A 1NFPA 3DI1A 1OX4B 4GJIA 1GONA 4MOZA 1S2AA 4AWTA 2Z1KA 1Y5WA 2TRSA 4AEEA 2NX9A 1GNXA 3KTSA 4X0VA 1XLKA 3IIZA 4LV9A 5CKSA 5IHRA 3KCLA 4DI9A 2FKPA 1LF1A 1BXBA 1TPWA 2WZMA 3RX3A 3ARZA 1Z41A 2WM1A 4MKNA 5DANA 3BV7A 3T2OA 4H3DA 5LA1A 1VJZA 3I7QA 2QAFA 3DBNA 3QV9A 5EGRA 1XRVA 1I1WA 3P2VA 3EX1A 3WUGA 4A3RA 2I7GA 2POZA 1XI3A 3S5SA 1EJSC 1QK0A 3KUMA 2GQAA 4US5A 1EKOA 1UR4A 4Q7BA 2WM0A