1P1XA

Comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Analysis of the class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase at 0.99A resolution.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 104
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1p1xA00
1IF2A 5K7JA 1DKWA 4JTFA 5FF4A 2G97A 1A50A 3TV8A 4H3DA 3UY7A 3NPWA 3TIMA 3LGEA 4UNLA 2QJGA 1JUKA 4IQLA 3GKAA 3CPRA 1YXYA 3I68A 1XBXA 4FNPA 1VHCA 1LTDA 3W2UA 1LRQA 1LRNA 4MUZA 3TX9A 3N14A 1TV7A 3VKJA 4DPPA 3LRLA 1N7KA 1VH7A 2RH9A 2H3BA 3LXCA 1XUZA 2A7NA 3O1NA 3KHJA 4JYEA 3USBA 4UC5A 5F2IA 4TMCA 2BX7A 2J9XA 4N9EA 2DU2A 3O63A 1X8FA 4RV8A 1J2WA 3TUUA 4NQ1A 3BG3A 2R8WA 4LV4A 2DJXA 2ZRUA 4Z1CA 4ORIA 2A6LA 5F4WA 5AHNA 3Q2DA 2XN0A 3UWUA 4ZL1A 3PY2A 4PC8A 1EP1A 2QUUA 2YR1A 3MP3A 3QF0A 3S6DA 2ZA1A 2JGQA 4PL2A 4XTIA 3LHWA 3NM1A 1C8VA 2CLLA 5G5IA 1KFLA 4ZQRA 4R53A 3Q58A 4A2RA 4ZQPA 3EB2A 2ISSA 1VR6A 4UMBA 4E2BA 2ATSA 4GRSA 3L0KA 4IX2A 4CQ9A 3W87A 4JTSA 2YCEA 3JS3A 2A6NA 1H51A 4QSHA 4ORMA 5U7SA 4HPXA 3HPZA 3MJYA 4CQ8A 3KXQA 4TMBA 3M5VA 3WK2A 4UTJA 3PBUA 4MPQA 3UNDA 2QEZA 4HNTA 4KFOA 2HTMA 2ZRZA 3TSMA 4UMAA 3W1LA 2V0TA 5C5YA 4HNUA 2Y6ZA 4UUIA 4YL2A 4OQVA 1VCVA 5FI8A 1JCJA 2GQAA 1VYPX 3HG3A 2NLIA 3SIZA 1JCXA 3DU0A 3M41A 2HSAA 2FIQA 4IMDA 1HG3A 3LBMA 2ZZ4A 4ONVA 4CLMA 1UBSA 3N3MA 1LROA 3W22A 1H1YA 3PC0A 4MJZA 1FBAA 4BWLC 1GG0A 3DH7A 4JTUA 2X30A 3LHZA 4UTIA 1LZOA 3S5YA 3KAOA 3B0PA 4CCCA 3V1PA 5L6UA 1RQHA 4MZYA 1AL8A 3M47A 4X2RA 4MFDA 3M44A 1DJQA 5D38A 3G1HA 5KINA 1OFOA 1I8JA 3ATYA 4ADSA 2E68A 1GVSA 3NL2A 4RX0A 4BFAA 3O8AA 3M1ZA 2OCZA 4O1CA 4U28A 5DCDA 3DKJA 1ZFJA 1R2RA 4QNEA 1OK4A 4DF1A 2HMCA 4FB7A 5HNRA 3QSRA 4FNSA 3W7RA 3L2IA 3G1FA 3UZ5A 1YTKA 1Q6LA 2PURA 1OFRA 1RR2A 4LRTA 4MYXA 1H7XA 3NAVA 2WSYA 1Z41A 3O06A 4AHOA 4LT9A 5CZSA 3TKFA 1ZALA 5I3IA 5DBTA 5G4EA 3C0JA 3UWZA 5HUOA 3ABSA 4LS0A 1Q6QA 3HGOA 4RK8A 1JCNA 4CNOA 3O6DA 2C0AA 1H60A 3DGRA 4FHAA 1F6PA 1WAUA 2WPBA 3QJAA 4DF0A 4O17A 2PE4A 5CPLA 3N2XA 1A5SA 1A5BA 1FDYA 4PFMA 4MY9A 1L2UA 3WJWA 3K30A 3WK3A 1OFEA 4NUWA 3O07A 1LM1A 3W7KA 1H7RA 8TIMA 4MYAA 3W7LA 3MP5A 4UFHA 5BMXA 1X7FA 1VJIA 2E6YA 2BWGA 3QRHA 3M16A 1TTQA 2GQ8A 3E02A 4O4WA 4IGHA 2GJLA 4LWWA 3NYZA 3EX3A 2Z6JA 2EKCA 4ICNA 2Q3RA 3DKLA 1NF0A 3VCRA 3PWAA 4A3UA 1PCKA 1KFEA 3FJ6A 3W9ZA 4O28A 2RDWA 3STFA 5MHBA 3A23A 5TBOA 3G1AA 4WJEA 1GVQA 1QPRA 2NV1A 3EWZA 3MI3A 4A22A 4JTJA 3W71A 1ZENA 5C2XA 1JULA 4RJEA 1K8ZA 1ZJIA 3T78A 5HWMA 3CIXA 2WV8A 1FWTA 2O7SA 2Q3OA 1W1ZA 1YPFA 5E93A 5EMUA 2FDSA 4IMGA 4IMEA 4LVBA 3L5MA 4DXVA 1IXNA 6ALDA 1AW2A 4L4LA 3JR2A 3W7PA 4N2YA 4BK9A 4FF7A 1OG0A 4YXGA 3QSTA 3G0XA 3LM7A 1Q45A 3E12A 5SWUA 3UWQA 3HMJG 2C16A 2OZ0A 1IIHA 3LTPA 2ZRXA 3LOTA 1PCWA 1TV5A 4O0ZA 1SUXA 1QDSA 4O16A 3BLFA 1SW3A 2UV8G 2D73A 3M5YA 3B06A 1TPVA 3ABQA 4XBSA 4WXYA 1LBFA 1TTJA 1NFBA 4FX8A 1V5XA 3MHFA 3A24A 1LYXA 5D33A 3W2KA 1OYAA 4MVAA 4O15A 3NQFA 4O54A 1S3HA 3RMJA 5LHFA 1KM2A 3W2MA 2ZTKA 5FEWA 2CW6A 2DP3A 4B5NA 3W74A 3W1MA 4M6PA 4JNMA 3V75A 2P0OA 3MW7A 1FX6A 4POCA 4O12A 4S2BA 3S1UA 5I3JA 3Q94A 1M6JA 1ZAHA 3NDOA 1JQXA 4RR4A 4OV9A 1H5YA 1W8SA 5DXXA 3F4NA 3ELFA 3CLMA 3SR7A 5AC7A 3NQ8A 1ME8A 1XUUA 3A22A 2WNZA 1MO0A 3PG8A 5HWJA 3R8RA 1XFBA 1O60A 1QMLA 4WY0B 1L9WA 3DENA 1TTPA 3GIYA 2B7NA 3TE9A 4NXSA 3OVRA 4D2JA 3W76A 2I14A 4O10A 3MI2A 3KVJA 3L67A 4OV4A 2VFFA 5CSRA 2DZPA 3AJXA 3MP4A 2E77A 1LLWA 4LVAA 3TAOA 1OYBA 1K8XA 1I2OA 1PV8A 1VPXA 1EP2A 3E96A 2E6FA 4FX6M 4DO6A 2CLEA 5I3KA 5HR6A 4EF8A 3F1QA 4KWWA 1F73A 4O1AA 2E5CA 2ZZ3A 3H55A 1SO5A 3BW2A 3N2MA 1ME9A 1F76A 2QCNA 3I7QA 2GUUA 1NAL1 3W83A 1HUVA 3N19B 3M5XA 3OHIA 2BSLA 2YYTA 1SSGA 3IVUA 3MO7A 2V2DA 1L6SA 1N8FA 4JDYA 3W75A 3LHUA 1MXSA 5DELA 4PTNA 2ZZ6A 2QCEA 2BLEA 4KFPA 4UFLA 2DZUA 5HWNA 1YLVA 1WQ5A 4L4MA 5BRBA 2W6RA 4UFIA 3C2RA 5FF0A 3ZR4A 4JTKA 4O57A 2J88A 1K7EA 2RFGA 1XBYA 4PCFA 1DV7A 4NNCA 1O4UA 1EB3A 1TYGA 3RLUA 3IGSA 4DPQA 1P0KA 1SU5A 3M7WA 2E5DA 3PUDA 3TSDA 1W54A 3EWBX 2PCQA 3L5LA 4HSOA 3TC7A 5FF2A 5G2HA 3IVTA 4I9AA 2QCHA 5DLCA 3EXTA 3FS2A 1YDNA 2NZLA 4GUJA 3C3NA 4MKNA 1YTDA 3TXZA 2Y61A 2OMAA 3TMQA 3HGSA 1Z42A 4Q33A 3G1YA 1GTEA 5DCBA 3HG2A 3STEA 3A21A 3I65A 2Y63A 4JS3A 3L68A 2HS6A 4P2VA 1K02A 1QPOA 1J5TA 3P7YA 3LCXA 3M6YA 4O1BA 3QM3A 2ZFAA 3NVTA 4KKXA 4DBDA 3KFTA 2QAFA 5BOOA 1F5ZA 1OABA 3C61A 2FPYA 1TPUA 2Y85A 2CU0A 4UTWA 4ZQOA 1Z44A 5AYZA 3LDVA 1GT8A 3SW6A 2YSWA 3W7QA 1K3UA 2AAMA 4K6AA 4N6EA 3NL5A 1G4EA 1TO3A 3C6CA 3I7RA 4UTLA 1C29A 5LNVA 3VI2A 5HJLA 4HSNA 1VZWA 3UPWA 1KTCA 3G8RA 1VGAA 3W70A 1IXPA 3QMSA 3GDLA 4AWUA 1QPQA 3LTSA 1ALDA 3GDMA 4ZZ9A 3PG9A 4JDBA 2ATMA 3W7OA 3MI6A 1XBVA 4HKPA 4LVFA 2VEMA 2B7QA 3NQ7A 1ONRA 4NNAA 5AHLA 3A9IA 3S5ZA 3UWVA 4AWSA 2PRMA 2JKEA 1D3HA 2FB3A 1ICSA 4LOCA 1GYLA 3W1TA 4Z1AA 3E49A 1GG1A 3DFSA 4Y8FA 2WKJA 3QW4B 2RHGA 4O14A 1KA9F 1NEYA 3UQNA 2J9ZA 1FWRA 4MZ8A 3A5FA 5KITA 2NX1A 1AL7A 5CZTA 1O95A 1HO4A 1G69A 3LERA 3QQ1A 3DFOA 1H50A 3IV3A 4E0CA 4K36A 1XDLA 4O53A 5HMSA 3S1XA 4YMZA 3TNOA 1W31A 5GVJA 1DQXA 1TPDA 2FLIA 5KZEA 3SECA 3NO5A 3HBLA 3OEXA 4K39A 4DO4A 3UZJA 4GUGA 4M6QA 3WJYA 4JY8A 4ML9A 1F74A 4AHQA 4AXKA 4WOQA 4MY1A 1W3IA 4JTEA 4DBEA 5D2XA 4N4PA 4C1KA 3CM4A 3NA8A 4WQ6A 3SZ8A 1EPXA 1AK5A 2Y89A 1DORA 1GVOA 4AH7A 4WD0A 1QPNA 1VYSX 4JN6A 1TCDA 3M43A 3Q37A 5U4NA 4FIRA 2V2HA 2CLOA 2B7PA 1KM0A 1QO5A 3L21A 4JY9A 2FPVA 5I3GA 4Y90A 3NR0A 3KVLA 1KBIA 4HN4A 5ABTA 4ZQCA 4PL1A 1F05A 3IIZA 3QC3A 1SO6A 1VQTA 4Z08A 4UFKA 2XFWA 3C8FA 3BV4A 3EX6A 5D2VA 1R2TA 3QW3A 1S5WA 4IMFA 3OG3A 1DOSA 4JX4A 4RZ5A 1QR7A 1R46A 1AG1O 2A4AA 4GWEA 4UTWC 4M7SA 5DXYA 5HR7A 4CCEA 4NU7A 1LRTA 3GNNA 4LU0A 2JGYA 3ZS4A 3WJSA 1XBZA 3VNDA 3W1RA 4NX0A 3EXRA 2JKAA 3LLFA 7TIMA 3LRMA 2NXGA 1KBJA 1QWGA 2FTPA 1OFQA 1KLYA 2Y7EA 2GQ9A 1G7VA 3ANYA 2J9YA 1OFBA 3KVKA 4GFSA 4AB4A 2EAWA 1H63A 4UTTC 3THAA 1KTNA 2YYUA 3DFPA 3M0ZA 3EWUA 1SFLA 1SQ7A 5HULA 2QCFA 2P10A 4JX5A 5A8GA 3WK1A 3R89A 5K9CA 3C52A 4M5PA 2TPSA 5F1UA 3W86A 3EEGA 1LOLA 1XC4A 4U4MA 1QOPA 5CZJA 3KOFA 4OT7A 3ZWSA 1ME7A 1B4EA 3LLDA 3P74A 3CU2A 1H62A 3M5ZA 1W56A 3PF3A 4JYDA 2NWRA 4IX0A 3LCFA 4JIQA 1V7YA 5G4WA 3FA5A 4Y96A 3CHVA 3NM3A 1Q6OA 2BZNA 4FNUA 1WBHA 3VE7A 2WSRA 2B7OA 3PAJA 4EVZA 4AMAA 4PODA 3W1XA 2QR6A 5K2ZA 3LX9A 1AW1A 1J4EA 2ZRVA 4XBKA 1I2NA 1YTEA 4K7VA 2B4GA 3KRSA 1ICPA 1MZHA 2QUVA 1FXQA 4LRSA 4G1KA 5HQEA 2R94A 1JCLA 1Z48A 4WUIA 5BW6A 2X1UA 3LCIA 3GDRA 2BXVA 2VC6A 5K9XA 3EXSA 2ALDA 2TYSA 3G22A 4O0KA 4WX2A 4GUHA 3P67A 2ZBTA 5D03A 3P60A 1KFCA 1S5VA 2NX3A 4O11A 3BGGA 1FCVA 3QYQA 2JBMA 3G3DA 4J9JA 5I3FA 2A5HA 5D04C 1E51A 3TR2A 3W7JA 2ZZ7A 4UFJA 4JTTA 1UB3A 3C2OA 2NUWA 5AHMA 3INPA 1TV8A 3IGXA 1F2JA 3B8DA 5DN1A 1U5JA 3TFCA 3W88A 5H91A 1FQ0A 5IBXA 4K38A 4AWTA 1PVNA 4FO4A 3T55A 2NWSA 2R91A 3T7VA 3NQVA 2E09A 5BNKA 4IPIA 3RNDA 3CT7A 1JVNA 5AYXA 1G4PA 3IIVA 4FNRA 4C1LA 5C6MA 2IQTA 3SSJA 4DO5A 1LOQA 4UFMA 1BTMA 3GAKA 1FY6A 3AO0A 2A21A 2I1OA 2VFDA 1EX5A 1W3TA 3BK0A 3EWWA 4FNTA 5G2IA 4N9DA 2H8XA 2VKZG 4O18A 3NL6A 2A7RA 3RLVA 3L9CA 1ZNNA 4NNBA 4RZ6A 2QUTA 4Z0SA 4NJKA 2ABAA 1SZFA 4JX6A 1TPC1 3T4CA 3C56A 3E9AA 4HIBA 5HINA 1GZGA 1SZNA 1PIIA 1L6YA 2J24A 3I6RA 4TU1A 1JJKA 5AHFA 3W3OA 2YW4A 4HHPA 3O15A 2OX1A 4MY8A 5K9DA 3W1AA 5BMWA 3G1DA 2R14A 3EX1A 4FEZA 3A5VA 4ADUA 2X1SA 3O6YX 2Y7GA 4X9SA 1H7NA 2TMDA 1KM6A 1TMHA 5AFDA 2WOQA 3EWYA 2DZVA 2W0UA 1GYNA 1B4KA 4O8RA 1I45A 2X1TA 1DHPA 3GXPA 5CG7A 3QPYA 4NJHA 3S5OA 4JIPA 1I2PA 3W7DA 4ZQMA 1QNVA 2KZHA 4EWND 5KZMA 4K37A 4O13A 4QIUA 2C1HA 3NQEA 1GJPA 5EL1A 5G1YA 2C15A 1OX6A 5LZLA 4NX5A 2NUXA 1F6KA 4RXFA 2C3ZA 3H53A 1FDZA 2VXNA 1ML1A 4LC8A 3B4UA 2H90A 3PS7A 4NJGA 3STCA 3LHVA 4OHQA 2EGZA 3DZ1A 3DHFA 2VEIA 5G2WA 2VEKA 1YXCA 3RU6A 2V9DA 4UIOA 2ZDRA 2TSYA 2YPIA 3NZRA 5EBUA 3MUXA 5EY5A 3L0NA 1RV8A 3LXBA 4WY0A 4HNVA 4LY8A 5D2YA 1LORA 4QAIA 4NZJA 4LV9A 2Z0IA 4UNKA 4X3ZA 1WDWA 5LNSA 3U8GA 3BG9A 5EKYA 3UY8A 3PM6A 4JICA 2A2IA 4HT3A 2ISWA 1FCQA 3HPXA 5T26A 2Y7DA 4K8EA 4LW7A 1L6WA 3PB0A 5D05A 1A5AA 1VLIA 1KV5A 1EUAA 3W7MA 3W72A 3O05A 5IBXC 5CKSA 1H7PA 3F4WA 2V2CA 2NXIA 3CEUA 4NZFA 1QAPA 1C9DA 4RXGA 1M5WA 3W1PA 2DZXA 2AGKA 1BWLA 2ZQ0A 1H61A 5F2LA 4OGZA 3CTLA 3SGZA 2H8ZA 3P61A 1TPB1 4UXDA 3G0UA 4LS2A 3TH6A 3G1SA 3LRKA 3NGJA 2ZZ1A 2YW3A 3KVMA 4O1DA 5L9FA 4GUIA 3NL3A 4IJBA 3P82A 2LLEA 3QH2A 3UWYA 5G1TA 3W2JA 1O5KA 4AF0B 4K7YA 3TCEA 4IXHA 2DZSA 2WJZA 2GVGA 2PC4A 5F4XA 3HGRA 3NPVA 1OX5A 1XL9A 3PULA 3GDTA 1SW7A 4I7WA 1HTIA 4AF0A 2Y88A 4IWWA 3DFQA 4JYFA 3P81A 4DF2A 3R2GA 1DJNA 2VFEA 3TJXA 3VFLA 3LBCA 3SI9A 1OX4B 2ZRYA 3P62A 4NJIA 1CW2A 3TU9A 4YWIA 2Z1BA 2E6AA 4UTUA 3S1WA 1X1ZA 1TPWA 4GE8A 1UUMA 3HQ1A 3W84A 2HS8A 2QCGA 2GOUA 3NQ2A 5CPMA 1LOSA 3JRKA 5J5DA 1X6UA 3NOEA 4NVTA 4NXKA 2E6DA 2WNNA 4XTDA 4Z0JA 3W7GA 3PSWA 3BLIA 3HG5A 1SW0A 4GNJA 1ZAIA 3HIJA 1W0MA 4HNNA 3IIOA 1TJRA 3FOKA 4CNNA 1RPXA 2CWNA 5D37A 4LS1A 4JTLA 1YDOA 5EA9A 2Q8ZA 3MBDA 4JEQA 4MLRA 1RQEA 1W3NA 3B0VC 1YYAA 1QO2A 1GVFA 4LC6A 4Z1DA 4KFNA 3CWOX 5HUPA 5F2GA 3B0UX 3NPUA 2Z6IA 3NQDA 4LVDA 1LBMA 5K4XA 1N55A 3UWWA 3W6YA 3ZFHA 2C14A 4PH6A 3PB2A 5DCEA 1U83A 1QOQA 1W5QA 5D32A 3FEMA 2ZRWA 2FJKA 4ZMGA 3DHDA 1W5MA 2AQWA 3NEVA 5FF3A 1OYCA 3TK7A 3W1UA 3HPSA 2V30A 2QCMA 3TC6A 2CLHA 3TFXA 3CEPA 2ZA3A 4MIMA 5AC8A 3FKRA 3C2EA 3RK8A 1X1OA 2JK2A 1IXOA 1TIMA 1P0NA 1MEHA 5LGZA 3C2VA 2RKXA 5AHEA 1PHQA 1BEUA 3GZ3A 2VELA 4KWVA 4QISA 2B0MA 4MZ1A 2QJIA 3W85A 1FXPA 1KM5A 3UXAA 1TSIA 3YPIA 1YADA 3TMLA 4UTKA 3ABRA 1IGSA 3OIXA 1VCFA 2WSQA 2CLKA 3GAYA 4OU1A 5AB3A 5CPOA 3WJZA 1ZAJA 3OVQA 4LNYA 1O94A 2X1RA 1SZEA 4QITA 1RVGA 3P80A 1HO1A 3HGJA 5E0KA 2GVJA 4LTSA 2YZRA 2VFIA 3G8EA 4AHPA 3DBPA 4YCPA 5LKYA 4CCDA 1JRCA 3BARA 3GB6A 3L66A 4FX7A 5F4SA 1PHWA 2QCLA 1YXDA 2V8ZA 3R13A 5AC6A 1G67A 2G96A 3W7NA 4S1FA 3QMRA 5CZ0A 1BKSA 2CZ5A 2EF9A 2VENA 3HB9A 3GLCA 1H7OA 1JCYA 3G24A 2WO5A 4LVGA 3FLUA 5AHIA 3C4UA 5LNWA 3DI1A 1AMKA 3SFKA 1TPEA 4X22A 4DQWA 3W07A 3EWXA 1THFD 1ZHAA 2QAPA 3THQA 1Q6RA 4OWGA 5CSSA 5FESA 3BG5A 1S5TA 2YXGA 5AOUA 5C55A 1XI3A 1NF7A 1UASA 2V5LA 4M6VA 3W7IA 5LSMA 1A53A 3KRUA 1SO4A 2ZTJA 3PR2A 1LCOA 4UR8A 5AN7A 1G4SA 4BI7A 3HG4A 4S2CA 1T96A 2Z2UA 2I9EA 4ZVJA 1XCFA 3N73A 3UXDA 2VFHA 2CZEA 3UD6A 2EPHA 1MSSA 2CZFA 4LUJA 3T40A 5DY3A 3ZWTA 1A5CA 3L65A 3C2FA 3PUEA 3DFNA 3GXNA 3DAQA 4BF9A 1PL9A 2V5BA 1Y0EA 1WYIA 3G1XA 3IGUA 5KMYA 2J6XA 3MHUA 2ABBA 4OE7A 3U6WA 3MWAA 1M7PA 3UYCA 5LHEA 1W5PA 2QDHA 4ADTA 4FIQA 3TA6A 4ALDA 3LB0A 4A21A 3GNDA 1TREA 1DQWA 2TRSA 4M7TA 3NQCA 5F2MA 4N02A 1WXJA 4WXZA 1KV8A 4UTHA 5DBUA 4JXCA 2GJNA 1W5NA 4UCGA 4BI6A 3QEZA 2OJPA 1CX9A 1OF8A 3B05A 2G95A 3RFAA 2YGYA 1NSJA 3G0SA 3LCLA 4N4QA 3BLEA 5IM51 3EX4A 2QKFA 1EWDA 1OF6A 2F84A 4R33A 5K4ZA 1T8XA 3STGA 1RD5A 1XKYA 1CI1A 4JR5A 3UPBA 4CNPA 1DBTA 1ICQA 3KRZA 4UR7A 1RZMA 2NX9A 3O16A 1LBLA 4IOTA 2F7FA 3N9SA 3TQ0A 1KFBA 2V81A 4TIMA 3P5ZA 4GJ1A 3W2NA 4O19A 4UTMA 3QPZA 1OVDA 4CQAA 3OVPA 4TX9A 1AW5A 2GPTA 3QMTA 3PBYA 1I4NA 3TXVA 2YFOA 1R2SA 4WOZA 5AYYA 3PBVA 3SGUA 2C19A 1WX0A 4ZQNA 2DJLA 3NQ6A 3G18A 3W1QA 5D2TA 4FNQA 5DY2A 1Q3NA 3VE9A 1KM3A 1TRIA 3QFEA 3B04A 2ZYFA 1D9EA 1VHNA 2FPTA 1FWSA 3WJXA 5F1VA 5TIMA 1IIGA 2W79A 3I7SA 5D2WA 1FWWA 1FWNA 1VLWA 3W73A 3TW6A 1JUEA 1KW1A 3BPWA 4IPJA 4IMCA 1YPIA 4EIVA 2RDTA 3IIPA 2YFNA 1WBJA 2FB2A 2XN1A 4R7JA 2PRLA 2A1YA 1GTHA 2YX0A 4MOZA 1VC4A 1T99A 4XWUA 3NXFA 3RF9A 1P5BA 3D0CA 2ZZ5A 1SPQA 2JKPA 1R30A 3W7CA 4JTIA 1QFEA 2QDGA 3P5YA 2OT1A 1KTBA 1VRDA 3NQGA 1K8YA 3BW3A 3PUOA 3MYPA 4Y6GA 3LCWA 3P84A 4RKAA 1IXQA 1NVMA 3S9YA 1SZGA 4JGDA 4YLWA 3S8HA 3NZ1A 2O7QA 5EYWA 1B3OA 2GVLA 1WV2A 4XKYB 2QCDB 3LI0A 4TR9A 4O50A 4O4VA 1VCGA 1WOAA 3NQMA 3P8IA 3S1VA 2OT0A 2PRHA 1TB3A 3W1NA 4GUFA 4IUOA 1OK6A 3DFTA 1XXXA 2QCDA 4XKYA 3TAKA 5D09A 5LNRA 1JR1A 3IEBA 1GQNA 3U2OA 1F7BA 1DVJA 3LV5A 2ZZ2A 2H6RA 3F03K 4NJJA 1H1ZA 1SFJA 2BTMA 4RCXA 4GC4A 2E1DA 4E2DA 2C13A 3HOJA 2CLIA 3GK0A 2CLMA 3FYOA 1H7WA 3LI1A 3M9YA 1HFBA 2QF7A 5FEPA 2E5BA 1DL3A 3GVGA 5LGXA 1EA0A 2C6QA 3N9RA 3PVFA 4MJMA 3TQKA 1KLZA 3SY5A 1QCWA 4XQ6A 4XUGA 1LDCA 4Q32A 1UCWA 2QCCA 4N6FA 2CZDA 3TDFA 4W9TA 3GX9A 3MHGA 2NV2A 3P8JA 3W23A 5I3HA 2DZTA 1TQXA 1SSDA 3ATZA 4RZ4A 4LUIA 3LCGA 3FIGA 1MEWA 4Y9AA 3TW7A 3MYOA 3NQAA 2Y70A 1OFAA 3G1VA 2Q8LA 1HL2A 1B57A 4IXXA 4PA8A 3CIWA 3BGJA 2FQIA 4RLIA 3N34A 2Y7FA 3HO8A 4MFEA 4JD4A 1VYRA 4GBUA 3OA3A 3PSVA 3IVSA 2X2GA 3LTYA 2ISVA 3EKLA 1JQVA 1JRBA 3LHYA 1KFKA 1T0OA 4Z1BA 4QM1A 1D3GA 1PS9A 1K7FA 4NT0A 1LLZA 1G6CA 1SO3A 1KFJA 2CFFA 5A5WA 1EUNA 5D02A 1MEIA 4QNWA 1YDVA 3FYPA 1O5XA 4EF9A 3DI0A 4WY0F 4Q4KA 3EX2A 2NXHA 1LP6A 3FJLA 3CC1A 4MLJA 1WA3A 5D30A 5KTLA 4PEKA 1JCMP 5CGQA 1JUBA 2VFGA 4QJ1A 1VS1A 4N9BA 4O52A 3T44A 3GXTA 3TROA 3NNTA 1TQJA 3BW4A 1EWEA 1GWJA 1K7XA 3L0GA 1K03A 1XDMA 4I7UA 3GR8A 4FXSA 4BI5A 4H6KA 3LV6A 1FDJA 3GYEA 3FFSA 4YCOA 1OFDA 1PE1A 4XZ9A 5H2ZA 3GDKA 2ZCGA 2J27A 3S42A 2C18A 2DZWA 1GPWA 3B03A 3LCHA 1W37A 1W5OA 1GVRA 1OFPA 4BR1A 2YDAA 4R34A 4A29A 1OX4A 1OJXA 3HJZA 4OBTA 1EEPA 2WQPA 2CLFA 3NG3A 1RQBA 2V82A 1SR9A 5KZDA 6TIMA 3GR7A 1OHLA 2H3DA 1R47A 3G3MA 4K8HA 2VOMA 4GXMA 2EHHA 1FCUA 2A7PA 3W7HA 1GOXA 1TPH1 2QJHA 2G5WA 3NPXA 3TQVA 3MMTA 3KX6A 3MBFA 4JTHA 3ABOA 4I7VA 2XN2A 3QQ0A 1M7OA 2Y62A 4P61A 2FFCA 4AEOA 3FKKA 5LNUA 3IIXA 4HPJA 5KSWA 5J5RA 2RDUA 4AVFA 3PBWA 3WK0A 4UMCA 4JTGA 3BVJA 1I2QA 2X16A 3TJLA 3CB8A 3LXAA 4EOUA 5FF7A 1KM4A 1P1XA 1WOBA 1TTIA 1B9BA 3O6CA 4A2SA 2ZA2A 1EP3A 1FCBA 3QZEA 4QQ3A 1EIXA 1BWKA 5CPNA 1TRDA 5C54A 2WNQA 3R12A 1FUYA 1I2RA 3S0CA 2VEPA 3CWNA 3SJ3A 4BWLA 3TSBA 1KM1A 3OBKA 5E1QA 3S5NA 5FEXA 4H4IA 4UTTA 1TJPA 1UUOA 1UJPA 2A0NA 5FEZA 5EPDA 3EKZA 3H54A 1ADOA 3E0IA 2P1FA 4DELA 3CQ0A 5TQLA 1G7UA 5K3VA 2A85A 4WZHA 1ZCOA 3W7EA 4N9CA 1G4TA 1P4CA 4M19A 3DXIA 3R5EA 4E38A 1XM3A 4DEFA 1GEQA 3IRDA 1TPFA 3L5AA 3LHTA 4TO8A 3WFAA 2NUYA 2DORA 3HF3A 4FXRA 3W2LA 3GKFA 4AAJA 1ZY9A 3BO9A
chains in the Genus database with same CATH superfamily
2VQTA 1AA1B 2ZVIA 1KRBC 4V2XA 4XZLX 2ESCA 1F61A 4H3DA 3UCDA 3EPNA 3D46A 4IGSA 4IQLA 1EHNA 3GKAA 3CPRA 5TF0A 3I68A 1XBXA 4FNPA 5D9NA 1W3KA 2X09A 3BWWA 3R25A 1PIGA 1LRQA 3GWQA 3VKJA 1WNOA 1C8QA 1R8LA 3WL0A 4DLFA 3PTMA 2J9XA 1J2WA 3B4YA 1SJAA 1E6QM 3UU0A 3SRKA 4NQ1A 3BG3A 1VD6A 5CGTA 3KCOA 4LV4A 3RJXA 1EIBA 1WDPA 4BS0A 3MUAA 3IK2A 2I56A 4TQTA 5F4WA 3QY6A 3UGRA 3PY2A 2YR1A 2JGQA 3U7BA 2WMHA 3N4FA 3ZYZA 3LHWA 4DWSB 3V18A 2BFGA 1W1VA 3R94A 3K8LA 3MQTA 1GOQA 4ZQRA 3Q58A 4ZQPA 3OTRA 1VR6A 4UMBA 3ZT6A 4E2BA 4GRSA 1QW8A 1TVNA 2CIPA 4CQ9A 3W87A 2YCEA 2D1ZA 2A6NA 1CIUA 4ORMA 4TMBA 1XIHA 4GZ7A 4UTJA 3KCJA 3CMFA 2QEZA 1HKMA 4HNTA 2HTMA 3T0DA 3TSMA 2V0TA 3N25A 1ZUAX 4ZENA 1IWBA 4UUIA 3RRAA 1U30A 5FI8A 1UKSA 1JCXA 4XZWA 4ERGA 2HSAA 2UY2A 2HXTA 1HG3A 4GI6A 3SCNA 3WLRA 1UBSA 2YBTA 4ZSUA 4B9YA 1BQGA 3B97A 3WL1A 4BWLC 1GG0A 2BG5A 4ES4A 3DH7A 4UTIA 1H09A 1LZOA 5FJUA 1HQTA 3B0PA 4ICMA 1FWCC 3AHYA 3V1PA 1L8NA 3RUBL 4IQDA 4H1ZA 3M47A 4DI8A 4X2RA 2O9TA 4CEUC 4MFDA 3I4KA 1DJQA 1EX1A 3L4UA 4V1XA 3DERA 5C9WA 1ZU8A 4JL2A 1XLEA 4O1CA 4U28A 1VBRA 4V1YA 3AI0A 1ZFJA 1OK4A 4FB7A 2FH8A 1BXBA 4FNSA 1JZ7A 4A8RA 1FKWA 1PX4A 1VBJA 2FTWA 2GSEA 5C2GA 3TTYA 2GUBA 3WQCA 4P7NA 4GIYA 4PUJA 3AYTA 4L1GA 3TKFA 1EJUC 3H21A 1ZALA 5I3IA 4GYPC 5HUOA 1XIEA 3HGOA 4NZCA 4CNOA 3NZPA 1RA5A 4H9XA 3KLLA 1YMYA 2PODA 1YBQB 5IRPA 2PDWA 1WAUA 3FJNA 2WPBA 4DF0A 4O17A 1Q5MA 1WO2A 5CPLA 1A5SA 1FDYA 1AJ0A 4YIWA 4MY9A 1XIFA 2VCAA 3K30A 5HANA 3LUTA 4YNGA 3CZ8A 1LM1A 1RSCA 3UZZA 3W7LA 3MP5A 4WKFA 2G3IA 1PZ2A 4PCPA 5I09A 3BTNA 3LBOA 2GJLA 2Z6JA 5FSDC 1HKJA 3E3HA 4GY1A 3ALGA 1VBUA 2Z26A 3PWAA 5A2CA 3NSXA 3DHPA 2D2GA 3QVQA 3A23A 5TBOA 2HK0A 1GVQA 3R7MA 2BVYA 2W63A 1EH9A 1JULA 1FWEC 1DWIM 4J3WA 1FWTA 3E5PA 2G0WA 2Z24A 3N15A 4IMGA 4L4LA 4N2YA 4BK9A 3CUGA 3GFXA 4DXKA 4US5A 2HZGA 3QSTA 4DN1A 3G0XA 1Q45A 3E12A 1GJWA 3UWQA 1XLKA 2OZ0A 2F6UA 1RUSA 2HE8A 1IIHA 4GQRA 5FIPA 5BU6A 3LOTA 1L0PA 5C70A 4LYRA 4O0ZA 4JHZA 5C9XA 4H2CA 3O0KA 3UZWA 2D73A 1TPVA 4A8IA 4XBSA 4WXYA 1KD0A 4BQ4A 2G3MA 4DY1A 1UH4A 1OBAA 1OYAA 3OBEA 5BXRA 2VZUA 3NQFA 3FK4A 3LLXA 1JG9A 3TYUA 3GVWA 3W2MA 2ZTKA 3W74A 3W1MA 2P0OA 4O12A 4S2BA 4KS0A 2D22A 3CLMA 5IFPA 2D2OA 3NQ8A 1ME8A 5XIAA 2R6OA 1CXLA 3EOOA 1E0VA 2G41A 1DE5A 2Y5EA 1KBKA 1O60A 4MDPA 3GIYA 3TE9A 1H2JA 2C1GA 3OVRA 3W76A 3CPUA 2J74A 2VJXA 3MI2A 4OV4A 3L67A 1UWAA 3MP4A 4X63A 1RK5A 8XIMA 2E8ZA 1E4IA 2FVKA 1G01A 4PTMA 4LVAA 3MVTA 1NTHA 3QGVA 1K8XA 4XZNX 1I2OA 1VPXA 2V3GA 4P7LA 2XSBA 3E96A 1M7JA 4NZ3A 3AIEA 1PTDA 4EF8A 1D7KA 3UEQA 1LLOA 2QLYA 3TTOA 2PD9A 3QGKC 1F76A 2IQDA 3AWOA 3TTSA 4WKHA 1UR3M 1CCWB 1SSGA 2YLAA 3MO7A 3LG3A 3LHUA 4MJ4A 1CGVA 3VVGA 3OODA 3WLPA 4GXWA 3WX7A 4L4MA 5BRBA 4GMEA 4KF1A 3N2BA 3ZR4A 5IXEA 2J88A 1PKLA 5JXQA 1EB3A 4N0RA 2JIEA 2BVDA 3AXXA 3K8MA 4DPQA 1MRQA 1SU5A 3M7WA 3PUDA 1JF5A 1UIOA 1US3A 1E6SM 4AXNA 4XZBA 4D6HA 4I9AA 2WVTA 1TJ0A 5DLCA 3AMGA 3E6EA 3EXTA 3FS2A 2NZLA 1B54A 4MKNA 5FAGA 3RM8A 1Z42A 4Y2WA 3G1YA 3QHMA 3HG2A 3STEA 1FH9A 2GGEA 2W9MA 4LCSA 1YNYA 2HS6A 3T0CA 4CU6A 3MUZ1 2V63A 4M82A 3P7YA 2XWEA 3M6YA 2XIMA 2ZFAA 4AEFA 1TWIA 4Y7EA 2QAFA 4FP1A 3ZT7A 4UTWA 1IGWA 5AYZA 3U4FA 1PTGA 3T8QA 3ITYA 1A0DA 2C71A 2YSWA 3H2OA 3TYEA 3FY1A 3KE0A 1EGZA 1P48A 1PZ3A 1TO3A 1PX8A 2QMJA 1C29A 1PEZA 4UTLA 1OCJA 4CNSA 3QZ6A 4NI8A 3MY9A 4K3ZA 4QG6A 2E9BA 1X1NA 1VGAA 2HE5A 3QMSA 2XWDA 3GDMA 4DUOA 3BAJA 5EMMA 2ATMA 3RN6A 3MI6A 1XBVA 3ZJKA 1ONRA 1XPYA 1Q6CA 1QI4A 5AHLA 3A9IA 1GNXA 3DFHA 2C91A 2DIJA 4LOCA 2OSWA 4J3UA 2DZAA 4IFKB 4QJ4B 2CPUA 3UQNA 4YTUA 4IUGA 4JIHA 1EJVC 4MZ8A 3A5FA 3VOCA 2PPGA 1MFVA 3T42A 2NX1A 4W88A 4WDTA 3LERA 7PTDA 1ZLPA 6TAAA 4L6HA 3UCCA 2ZOXA 1VKFA 3IV3A 2XPKA 3DHUA 3URNA 1XDLA 3QQWA 4B90A 4HYWA 3MUCA 4CD6A 3U5UA 3AIRA 2RJHA 3OGVA 3KP0A 1Q65A 3NO5A 4KWSA 4GNKB 1FWDC 3UZJA 1R3TA 4JY8A 1UC4A 3ZT5A 4EKJA 3N6HA 4AZCB 3FAXA 1GHRA 4S3KA 1K1DA 2WSPA 1TVLA 3T6CA 2XISA 1EQCA 4WQ6A 3SZ8A 2R1PA 1SJCA 5AYBA 2Y89A 1Z7AA 1DORA 4WCJA 1QPNA 1BF2A 1VYSX 4JN6A 5A8NA 6CGTA 1TCDA 3Q37A 5U4NA 2V2HA 1AQ0A 1KM0A 2WVVA 3L21A 4PBEA 3VNKA 3KVLA 4ICCX 5ABTA 4HN4A 2PWDA 4PL1A 3QC3A 3ZR6A 1EJXC 4F79A 1J10A 2XFWA 3DBNA 4J28A 3DG6A 5A6BD 3I6TA 2OOFA 3UA4A 2X41A 3IANA 1DOSA 4ZSTA 4YHGA 4GKLA 4GWEA 1DJWA 3O2LA 4UTWC 4M7SA 5DXYA 4AIOA 4W8LA 1LRTA 4LU0A 2JGYA 3ZS4A 1YNPA 3W1RA 2JKAA 3LRMA 2NXGA 1QWGA 1V0KA 5BRQA 4L80A 1KLYA 2E3ZA 4E5TA 2J9YA 2PLCA 3KVKA 4GFSA 2ZUMA 1JGIA 4AB4A 3M0ZA 2RGMA 1Y65A 2R9RA 4HU4A 5M5DA 2PEVA 2NQJA 4IM4A 4M5PA 2R1KA 1AJ2A 3W86A 3EEGA 4WSJA 1H62A 2DSKA 4CD4A 2NWRA 3BMWA 3WQEA 3CBWA 4IX0A 5J04A 1V7YA 4Y96A 1S1RA 4GD0A 3CH9A 2E67A 1G94A 3RLGA 4FNUA 2J7BA 4KEUA 4AMAA 1FP9A 2E9LA 3W1XA 5BOEA 5K2ZA 3LX9A 4IP5A 4FR6A 1ISXA 1E55A 3DYMA 4PMYA 4QE5A 5HQEA 1AJZA 5BW6A 1UIPA 1RAKA 5K9XA 2O0TA 3G22A 3KL0A 4WDXA 2BODX 2VEFA 2X7VA 5D03A 3P60A 1RPKA 1S5VA 4ZOAA 4LYKA 1MZRA 1CGXA 2OWXA 3S2JA 1WDQA 3QYQA 4W8AA 4Z17A 1CLXA 3W7JA 1OQFA 1E56A 3TVAA 1QNRA 5T8GA 1UB3A 2O56A 3C2OA 4A3RA 1EYWA 1ZJHA 1LG1A 3INPA 2INFA 4W7VA 3R6IA 3B8DA 3BQ6A 1NQKA 1DJHA 1OC7A 2Y8KA 1A47A 5H91A 1O66A 1PVNA 2NWSA 1NH6A 3T08A 3ARVA 3VGGA 1HGYA 4FK9A 1JVNA 1LF1A 2HNEA 5AYXA 2IQTA 1XLDA 3S6OA 3GAKA 4G9PA 3BOLA 5T91A 1UH3A 1EX5A 3EWWA 2PTZA 2ZXAA 1GYMA 2H8XA 2VKZG 4O18A 1T40A 2A7RA 2HISA 3S1GA 3SCSA 1CB7B 1ZNNA 1MMFA 4RZ6A 2G3JA 1TPC1 2HRWA 3MANA 3PJUA 3T4CA 5A94A 1L6YA 2J24A 4Z2IA 1C90A 1IEVA 2VGFA 3MDUA 2PTWA 4J2MA 4HHPA 3UJSA 4ACZB 3BZJA 4MY8A 1OINA 1V02A 5BMWA 2R14A 3EX1A 1XRFA 1MRAA 4NRRA 2OR2A 1QVBA 3AIBA 4C90A 4IIDA 2WW5A 2QGHA 3EWYA 2W0UA 1GYNA 3HMCA 3P93A 1B4KA 4O8RA 3OHMB 2Y2WA 3NSNA 3SCRA 3VD9A 1XLBA 4QLKA 3S5OA 4JIPA 3MC5A 3WBEA 3CHEA 1REQB 1LUCA 4QIUA 2C1HA 3PZIA 2PAJA 2DSZA 2C3ZA 3LGDA 3H53A 4LAUA 5MF5A 3APGA 2VXNA 3FHAA 2H90A 3VM7A 3AAMA 3GG8A 5I78A 3WH6A 1QNPA 2EGZA 1KCZA 5G2WA 2VEKA 1YXCA 4KGLA 2P3ZA 2TSYA 3NZRA 5EY5A 1RV8A 2GDUA 1BVZA 2PDIA 4QAIA 4NZJA 2I9UA 1O5RA 4B9ZA 5IHRA 1EDQA 1WDWA 4CVWA 1M3UA 1SFTA 5LNSA 3BG9A 3LQGA 2MUCA 1GJUA 1O1HA 2VD9A 2XYLA 3PM6A 2ISWA 3T81A 3OLEA 5T26A 4P7QA 4K8EA 5B7ZA 3SRFA 1HJXA 1XP3A 5D05A 1UMLA 5G4HC 3W7MA 4EAYA 5CKSA 3ARXA 2REQB 4CQBA 1IV8A 2J7DA 2PGWA 4RW3A 2I5GA 3REQB 1IEWA 3W02A 2ZQ0A 3CTLA 1W1B1 4F0RA 3G1RA 3NWRA 4FXJA 1YQ2A 4KESA 5CPTA 4O1DA 5E0FA 2PWVA 4IJBA 4J40A 4KEZA 3UWYA 3W2JA 3TZNA 3B3DA 4PBGA 2FFIA 3ANUA 5CC5A 1V0NA 1MQPA 2QPUA 2YCKX 3ITTA 2ISDA 5F4XA 3KZSA 4PN2A 3EB3A 1XL9A 3UVIA 4AF0A 2Y88A 3MMUA 3R8GA 1XYBA 2FHFA 3CT2A 1R9XA 3R2GA 2CETA 4LSBA 3LBCA 3GH7A 1CW2A 4YWIA 1JPKA 4S3AA 1BYCA 3DC0A 3GSMA 2JEPA 3HQ1A 5BCAA 2QCGA 1D7FA 5CPMA 4DJFD 2O92A 3C0SA 4XTDA 4Z0JA 3W7GA 3PSWA 3OGSA 3BLIA 1SW0A 1CPUA 1NIUA 2Y5JA 4OBSA 3HIJA 3HN3A 2BOFX 4BQ3A 3GIPA 2CWNA 3CHCA 3M0KA 4JTLA 4QGCA 3WDQA 3H12A 4KPLA 3MBDA 4JEQA 1H3GA 3B0VC 3MKVA 1GVFA 1DXEA 3GTNA 3LM3A 3B0UX 2Z6IA 4LVDA 1VFOA 2I57A 2C14A 3T0TA 5DCEA 4H8VA 1U83A 3H2NA 1QOQA 1GQIA 2ZRWA 4J1OA 3IRSA 3PAOA 4ATWA 3NEVA 4AWEA 2Z2BA 1P7TA 2Z29A 3TK7A 1DIKA 1WKFA 1R3YA 2ZWYA 1W3HA 2CLHA 3TFXA 2E8YA 1PDZA 2ZA3A 3FKRA 3SN0A 3B9NA 4LBRA 1FHUA 3FV9A 2HK1A 5LGZA 2PDJA 3SUSA 4FA3A 1BEUA 2WNWA 3V0SA 3VIMA 3G2GA 4KWVA 4QISA 2B0MA 5DMLA 2VL4A 2O9RA 3C3UA 4H7ZA 1FXPA 4JAWA 3UXAA 1TSIA 3S9IA 2F38A 4KW2A 3D3AA 1NWUA 3S2LA 4UTKA 1WZKA 3ZVHB 1VFFA 1VCFA 3BLPX 3VC5A 3VGHA 1D3CA 3AMDA 1VFUA 1ZAJA 3LENA 1SZEA 1RVGA 1UBPC 3P80A 1KCLA 4JNZA 3AHZA 4C6FA 2PP0A 1YHTA 3VOIA 2ZC1A 3K1GA 4ZA0A 4YCPA 2W62A 5LKYA 1EKOA 2YIHA 2HVMA 3GB6A 4FX7A 4LUSB 3CHDA 4DJED 1M68A 2QCLA 4HJWA 1I75A 4C1NB 3CUJA 1CWYA 4M24A 1ECEA 1G67A 3QR3A 5CZ0A 5A8MA 5JQ9A 1RCXB 2ASHA 3GLCA 1QPKA 2ACSA 2WO5A 4LVGA 4ZE5A 1UA7A 3VNYA 3FLUA 4HTYA 3MJMA 1AMKA 3H23A 2O4QA 4HMNA 3N9KA 4F0LA 2UWFA 3URQA 4DQWA 1KWGA 1DJGA 4NSBA 2FMOA 1VBHA 4ZBCA 2GYIA 3V5OA 3ANVA 5C55A 1XI3A 2G3NA 2OWWA 2XVKA 2V5LA 5LSMA 1SO4A 2X2YA 2ZTJA 3PR2A 4HZ6A 4TUFA 2VZSA 4FZIA 2GJRA 1G4SA 3LMYA 4IL2A 1T96A 2Z2UA 1XCFA 3BV7A 3WQDA 3N73A 2PF8A 4JZ5A 1RBOB 2CZEA 3UD6A 4JFWA 2CZFA 4AZIA 2ZXBA 3JU2A 3T40A 5DY3A 1JNDA 3ZWTA 1A5CA 2BXZA 4O0QA 1HJUA 3WQOA 1XISA 3C2FA 3PUEA 1JYWA 1PL9A 2OX4A 3IGUA 3KL3A 1XYFA 4OFCA 5KMYA 1LJYA 3MHUA 4LYPA 3T8LA 1W9DM 4NI3A 4ADTA 4QHRA 4FIQA 2ZXQA 1BYBA 4W5UA 1EXBA 3GH5A 3EOEA 3EAUA 1WB0A 2AOSA 1DQWA 4M7TA 4XISA 2CHNA 4UTHA 4JXCA 2WKGA 2OJPA 4HYRA 4QX4A 4HHMA 4L61A 3RFAA 3ZZ1A 3G0SA 3LCLA 3BLEA 3BQ5A 1BAGA 4R33A 1E9ZB 2D20A 2VX4A 4Z2HA 5ABGA 3V1HA 1CI1A 2PDHA 1Y5XA 1F9CA 4CNPA 3WNKA 3QPEA 3ARRA 1H4PA 1ICQA 2HXUA 3SGGA 1MI3A 2XGIA 4IPNB 2NX9A 3O16A 1UD3A 1LBLA 4HK6A 3M7SA 1W1YA 3VIOA 1KFBA 3GHTA 1VFTA 2ZKMX 4ZOEA 4LB4A 4O19A 5CJNA 1RD6A 3QPZA 4CQAA 3OVPA 4TX9A 2GPTA 4J35A 3PBYA 3H8AA 4S3GA 5LIWX 4KMQA 3QN3A 3KOWA 2GWGA 1XQKA 3PBVA 3SGUA 4UQBA 4ZODA 1E6ZA 2VGIA 1Q3NA 2BNJA 2QNEA 3T2QA 1FWGC 4W7WA 3AWNA 4MJ2A 1TRIA 3WLLA 1PWLA 3BLLA 3N4EA 2W79A 3VD4A 1B9ZA 4M1BA 3VU2A 1GKPA 1JUEA 4EIVA 1W1A1 1WBJA 2FB2A 2GSJA 2XN1A 1OCBA 3VKCA 4ASTA 1X96A 2YX0A 4MNJA 2GJPA 1AVAA 2C7FA 3H7UA 4A35A 4BEQA 3KP1A 3RF9A 3FGCA 3W7CA 4JTIA 7TAAA 3G5EA 4HMEA 2P50A 3EMQA 4H9UA 1K8YA 2OXNA 3VZXA 1VBGA 3R10A 2R82A 4RKAA 1IXQA 1NVMA 4CD8A 1SZGA 1K4HA 3BLDA 2CLPA 3NZ1A 4JHOA 1OG6A 2A3HA 5EYWA 1B3OA 2QCDB 3F4CA 2DV0A 2YCIX 4O4VA 1VCGA 2WMFA 3S1VA 4JBRA 2PRHA 2OLHA 1VJSA 2WC7A 2YCLB 1OK6A 3A6OA 1JR1A 1F7BA 3IWPA 3LV5A 3F03K 5EMJA 3KUMA 1M9HA 1H1ZA 4AMCA 4NZ5A 5FL0A 4HN8A 3PZUA 4OUIA 4C6EA 1GORA 3SUVA 3Q67A 9RUBA 3ORWA 3ARYA 5CQ1A 2CLMA 3FYOA 4JKLA 4W87A 3M9YA 2XFFA 3U9IA 5LGXA 3F2DA 2C6QA 1KLZA 3SY5A 1QCWA 1V6VA 7ENLA 1L2QA 4V28A 4W9TA 3AMCA 1UW9A 2ZUWA 1AQFA 4AX7A 5HAOA 1HW6A 1S2AA 5D9OA 3S3GA 1JNEA 3LY0A 4MKVA 4MADA 4FLRA 1MEWA 4Y9AA 9CGTA 3CIWA 3BGJA 2FQIA 2BV9A 2PBGA 1XH1A 1A3WA 3PSVA 3IVSA 2VGBA 2X2GA 2QF8A 4LF1A 3KBJA 3E2RA 3RO8A 1JQVA 1ZP3A 2YB4A 4Z1BA 1D3GA 1IEIA 4JEJA 1K7FA 2IPWA 5H1WA 1OZMA 1KFJA 4X2PA 5A5WA 1EUNA 4QNWA 5I03A 3OVGA 3DI0A 5I77A 3EX2A 1XG4A 2NXHA 1E5JA 3AYRA 4OTKA 3WENA 2BGSA 2Z1KA 3ZMRA 3TLLA 3FNDA 4R7OA 3PWIA 3H2CA 4K2SA 4PEKA 1SR0A 1JCMP 5CGQA 1JUBA 1S2CA 3R43A 1QHOA 4QJ1A 1C8XA 3T44A 3I6EA 3TROA 3EEZA 5C9UA 5JU6A 2PDXA 1K03A 2BBFA 3OZMA 1UKTA 1UQYA 1XDMA 4FXSA 3NURA 2Z7KA 5GNZA 3FFSA 4AW7A 2Y4SA 5JH2A 2NSXA 1UUQA 3GDKA 2IMRA 4UOQA 1GPWA 1W37A 4AZ6A 4BR1A 2YDAA 4A29A 5E6YA 3RCNA 3C2YA 3GXFA 4Q8WA 3CV2A 4LALA 3CUIA 4DXXA 3LK6A 1RQBA 2V82A 3STPA 3SQSA 4M1RA 3S47A 1C8YA 3VDHA 3G3MA 4ZO6A 3GM8A 1TWDA 4QDWA 4H9VA 1FCUA 1EGMA 1KGXA 4EAMA 4A8NA 2G5WA 3PTQA 3TQVA 4XSLA 3JZEA 1S2VA 4KH2A 3VOFA 1W9XA 2Y62A 1BVWA 1W9VA 2FFCA 1XHGA 5LNUA 5KSWA 3TN4A 3T0BA 2Z4GA 1BYDA 4AC7C 4UMCA 4LUTB 1KC7A 2ZX8A 3T09A 2PF0A 1WOBA 1UH2A 1TTIA 4U31A 4F0KA 2WXDM 3WUBA 1TX0A 2VP8A 2ZA2A 4XVEA 4B92A 3L12A 1BWKA 1V51A 5C54A 7XIMA 3S0CA 3CWNA 4A3QA 5E9XA 3H6OA 2DQWA 3HU7A 4XIMA 1BG4A 4Q22A 5FEXA 2BGNE 5A6KA 1UUOA 2DPEA 5EPDA 3LGGA 2D23A 3DG7A 4Z2GA 4PTXA 3RO6A 3UP8A 3E0IA 5K3VA 4WZHA 4JTRA 5HQMA 4M19A 2XIBA 4AD5A 1KXVA 1EF2A 3CAVA 5HPOA 3IRDA 2V68A 3PTKA 2PWEA 4MAZA 3D6NA 5FAJA 3W2LA 3GKFA 1RA0A 4AAJA 1ZY9A 4DWSD 4IICA 2XIQA 2F8QA 5K7JA 4IH3A 5FF4A 3NPWA 3R0DA 3TIMA 3LGEA 2QJGA 3TZFA 1FFQA 1MNZA 5CEWA 3DUGA 3F2BA 3HM7A 1CBGA 2DQXA 1CYGA 4HHHA 3TYAA 1VHCA 2Q02A 1BQCA 4BKNA 3OZPA 3BAKA 2H3BA 4M6UA 3LXCA 3T4WA 3O1NA 1M7XA 2CKSA 2BX7A 3BZGA 2DU2A 3O63A 4GKTA 3AICA 4H2HA 1A5UA 5EMLA 1CXKA 1OY0A 4NZ1A 5HQLA 4ORIA 2FZDA 1X39A 1UR2A 5DMMA 3UWUA 1Z8AA 4DNMA 3QF0A 2OELA 4AC1X 1PO9A 4ZB5A 3V36A 1X98A 1C8VA 3NM1A 1LL4A 2CLLA 4E3TA 4A2RA 3EB2A 3M64A 3PNUA 5JBFA 4IX2A 3JS3A 4QSHA 1ITCA 2CBIA 1ZGDA 3MJYA 3WLKX 1J8VA 2AQOA 3ISIX 3PBUA 4MPQA 3VAVA 3BSMA 1J0IA 1FVPA 2MANA 1EOMA 4RE3A 3JUGA 2Y6ZA 4OQVA 3OO2A 1V3HA 1VYPX 3HG3A 3SIZA 3MTWA 1J6PA 3B9DA 1XYLA 1XLMA 1B30A 4MGGA 4ONVA 5H8UA 4CLMA 3U48A 2WSKA 1LROA 3OOQA 3A9BA 1RP8A 4MJZA 3WBAA 1FBAA 2YL8A 3LSBA 3VCNA 4BQ2A 3B0YA 4ENLA 3LHZA 4RDYA 2XVLA 1JPHA 3KAOA 4HGXA 4CCCA 3WNPA 5L6UA 4KGJA 1RQHA 1AL8A 3LZ5A 1V3IA 3VDAA 3GXDA 1Q8JA 3G1HA 3V4BA 1OFOA 4JFTA 4ADSA 2E68A 2C0HA 3O8AA 1DPMA 3N2OA 3M1ZA 2OCZA 1E9YB 5DCDA 2DVTA 1V4YA 3DKJA 1UOZA 7REQA 2HMCA 3DYPA 1OGBA 3A4WA 4DJDD 4HOZA 1MQQA 1CGWA 1YTKA 3GU2A 2HPMA 4LRTA 2DT1A 4KBXA 2EPOA 1H7XA 3NAVA 2WSYA 3WBWA 3O06A 4Q3MA 4LT9A 4B2DA 3OP2A 4WF7A 2ZX9A 4J5NA 3W01A 2PTDA 1JAEA 5HNTA 1NM9A 3C0JA 4NY2A 3ITVA 4Q8PA 1R3QA 4QROA 5A6JA 3UA3A 2G4JA 4BQ5A 2PFHA 2XSXA 4W85A 3HQNA 1FFRA 2PE4A 3OW1A 6PTDA 4I8YA 2D3NA 2YA0A 4PFMA 3KS6A 3WJWA 2XIOA 3WK3A 1OFEA 2GVEA 3WQGA 3APYA 4MYAA 4TTGA 5REQB 1XH0A 1TTQA 1ZPTA 3MVIA 2BHZA 4IGHA 1KKOA 3RJYA 3EX3A 3FVDA 2EKCA 3MSRA 2VGGA 4ICNA 1KGWA 4DBWA 4XO7A 4HU0A 2PI6A 1VFMA 2YXOA 3QR0A 1KFEA 2VVSA 3LQLA 2W66A 3GHRA 3W9ZA 2EPLX 1F3TA 3HTWA 3QXBA 4IG2B 1IT7A 2E7FA 1QPRA 1YW1A 2NVDA 3W71A 1ZENA 1QRQA 3WG6A 1ZJIA 5HWMA 4PB5A 2WV8A 4J3XA 3UR7A 5DMYA 5C2CA 5E93A 4HU3A 5EFFA 5IOBA 3U2EA 6ALDA 4IMEA 2HQAA 5G1MA 3W7PA 1OG0A 1OIMA 4XAFA 3H7RA 1UWTA 3HV8A 3HMJG 4HU8A 1XG3A 4JTQA 1EC7A 4WSHA 4AY7A 1PCWA 1S3TC 1TV5A 1P1MA 4PMDA 1QDSA 4O16A 3BLFA 3UG8A 2PTXA 2UV8G 4F4RA 4BY3A 2OSXA 3N18A 1K9DA 1TTJA 4Z2LA 1XJBA 1V5XA 3WNLA 4CVUA 5C71A 2XU2A 3PWGA 4GVFA 4MVAA 1S3HA 3L4WA 4D8LA 5FEWA 2CW6A 2DP3A 4FMVA 4M6PA 3MW7A 4POCA 1U1JA 3Q94A 3NDOA 4OV9A 1KRCC 4DLMA 3F4NA 5DQPA 5AC7A 4HA1A 3ZSSA 1XUUA 4ZB0A 1MO0A 3R8RA 3L4XA 1VJZA 1J18A 5CGMA 1TV4A 1XCWA 2J47A 4MNLA 3L2MA 2VFFA 4UZUA 5CSRA 3AJXA 1V3MA 3K2GA 1TMLA 3OLIA 3QTGA 4LCQA 3JZUA 3TAOA 1OYBA 4DIAA 1E1EA 1YE6A 1PV8A 3TR9A 2Z1WA 5I3KA 4DAFA 2VHLA 1EJTC 1F73A 2ZZ3A 3H55A 1X6LA 4AZ5A 3WF0A 1NAL1 3SUTA 1HUVA 3N19B 1AH0A 1U1HA 1PKYA 4HBKA 2YYTA 2X8RA 3SY1A 1Q6DA 4R9OA 4XBJA 4JDYA 1MXSA 4ZGYA 4PTNA 6ENLA 1NOWA 2BLEA 1UG6A 3OYZA 4LQ1A 5FJRA 1AODA 1J9YA 1YEYA 5GJPA 3CUZA 4X9YA 4UFIA 5FF0A 4JTKA 3A64A 3VM5A 2IUZA 1K7EA 1R85A 1XBYA 4PCFA 1O4UA 1UP0A 3RLUA 2PZNA 3IGSA 1WKDA 2RJGA 2P76A 3FW6A 5M3WA 1P0KA 3ONCA 2QJMA 1W54A 2PCQA 2CHRA 3L5LA 2RAGA 4XIAA 3TC7A 5FF2A 5G2HA 3OA5A 3FSUA 4GYJA 3LPPA 1YDNA 4GUJA 3V0TA 3C3NA 3AOFA 4U2YA 3TXZA 4RDWA 2OMAA 3TMQA 3HGSA 3A21A 3I65A 1X38A 2WPGA 5PTDA 1RY0A 4RE0A 3ONBA 4P2VA 1HXJA 4ZR8A 2OZ3A 3LCXA 4U3CA 2ODOA 4KKXA 4DBDA 1F8IA 1F5ZA 2WK2A 1LG2A 1OABA 1R5YA 1HN1A 3CL7A 1TPUA 2CU0A 4AZBA 3SW6A 1K3UA 2AAMA 4N6EA 4KT2A 2RUSA 3C6CA 3WUGA 3VI2A 3MO4A 5HJLA 4ZE4A 1POKA 1Y5WA 2YJQA 4HSNA 1YKWA 3HV9A 3UPWA 4GY0A 1BTCA 2V69A 3LTSA 1ALDA 2GZXA 3VFCA 4JDBA 2WMIA 3W7OA 2OU4A 3U2CA 4IJCA 2R1MA 5H8MA 1BKHA 4UOZA 4GC3A 2OG9A 3AFBA 4R27A 4S3JA 2FB3A 1GYLA 4L6DA 4OKDA 3E49A 3DFSA 1MYRA 3QW4B 2RHGA 4IJRA 3WMSA 1NWTA 4O14A 1NEYA 3C0QA 3L23A 4HZ8A 2PC8A 4PB4A 5KITA 3EMCA 4PSPA 1AL7A 1O68A 1G69A 3H4XA 1IE7C 2IPFA 3IJIA 1XW8A 3U3HA 5DANA 1YIXA 4V33A 3S5SA 1PXGA 3CIVA 1VENA 4E0CA 2X0SA 4K36A 4XD4A 5CBJA 3GY1A 2IKHA 4PEEA 1RLCL 5KZEA 1XINA 3SCUA 3AYSA 2PSNA 4GUGA 2OQLA 1HP4A 4ML9A 3S4TA 3QV7A 4WOQA 1GW1A 2WWCA 1W3IA 4MY1A 4DBEA 1PZ1A 2GJXA 4EXQA 1R9YA 4GIRA 2NV9A 3CPGA 1RVKA 4AH7A 2FJUB 2FGZA 1QNSA 3M43A 3ARSA 4FIRA 1PAMA 3V5FA 1PJ9A 4YHEA 1WDDA 4PMJA 1QI5A 4ZQCA 3R1ZA 4FF5A 1XDJA 3LD5A 1B1YA 4Z08A 3MCNA 2YDRA 3PBMA 1R2TA 3VK5A 1CGTA 5E09A 2VX5A 4Q4OA 1S5WA 4G8TA 3OG3A 1RHCA 3PNZA 4RZ5A 1QR7A 2A4AA 5I02A 4PUMA 1U22A 5HR7A 3NJ3A 4NU7A 3GNNA 4CQDA 3AZTA 1WDRA 4CU7A 3VNDA 3WEMA 3F5KA 1Y8BA 2J79A 1G7VA 3ANYA 4N7QA 4O8AA 2CBVA 1E6XM 3F5JA 5GPRA 3BE7A 1KTNA 2YBUA 2YYUA 3DFPA 3EWUA 1GW9A 1VPYA 1SQ7A 9XIAA 1XD0A 5FKYA 2P10A 1MW3A 5A8GA 3R89A 2JF6A 5K9CA 3C52A 3WY1A 7CGTA 5F1UA 1LOLA 3IUIA 1RALA 4ZO9A 3R0UA 1QOPA 2VNCA 2WKLA 4MTVA 5GNYA 1UKPA 4G1NA 3LLDA 3CU2A 1W56A 1GOOA 4JYDA 3W00A 3LCFA 4MMWA 4KRTA 2WSRA 4GQ0A 4EVZA 3UGVA 5HPCA 4CD7A 3WLTA 2PGRA 1E73M 4PBFA 3WBYA 1VAHA 4KRUA 1AW1A 3K1DA 2QV5A 1ICPA 4AVOA 1MZHA 2QUVA 1FXQA 2WC4A 2R94A 3LCIA 3ZXWA 2DUAA 2VC6A 1ISZA 1ZBKA 3EXSA 2D69A 4QSFA 4AD1A 3P67A 1XD1A 4J9JA 2F6KA 1YBQA 2A5HA 2UY4A 4RE2A 2NUWA 3AMLA 1UR8A 3AJ7A 1TV8A 3IGXA 3APTA 2HEJA 5DN1A 4C6NA 2RDXA 4K38A 4AWTA 2P53A 3T55A 4DWSC 2TAAA 4DX3A 2E09A 1TA3B 4FNRA 4C1LA 3SSJA 3UZXA 1AZ2A 3AO0A 1V79A 1A3HA 2I1OA 2VFDA 4NYUA 5AC5A 3BK0A 4WJ8A 4XAYA 4OBRA 4K1GA 1EL3A 2I5IA 4H6EA 3GXIA 4D6JA 2UY5A 5EFDA 3WO8A 1XRSA 2QUTA 4Z0SA 4NJKA 4JX6A 4YWSA 1SZNA 3I6RA 1J79A 4R9XA 3WLMA 5K9DA 4D6GA 1JZ4A 4FEZA 3A5VA 3W28A 3O6YX 4LB3A 2OLAA 1QT1A 4HNCA 1TMHA 2XVGA 5LA0A 4LAZA 3GTXA 4Q4PA 1I45A 4PMXA 4QCEA 2VZTA 2X1TA 1TELA 4QAWA 3GXPA 1PSCA 2UZ9A 4RL3A 4NJHA 1I2PA 3WF2A 4PTWA 4UCFA 1DE6A 3WQPA 1GJPA 3NGFA 2C15A 5LZLA 2DT3A 3LPOA 3H2MA 4DUVA 5E9AA 1JD7A 2O4MA 5JBEA 3BLOA 2H9AB 3B4UA 1E71M 4NJGA 1A5LC 1R3RA 3DECA 1BRLA 3STCA 2WBKA 1HP5A 4IFRA 2NQHA 4OHQA 4B5VA 1H49A 3W37A 2VEIA 3AU2A 5ABEA 3PJWA 1PPIA 4UIOA 2ZDRA 4DI9A 1UWIA 5EBUA 2EG7A 5D2YA 1LORA 3MUY1 3QKEA 1V3LA 4LV9A 3N13A 4UNKA 2ZICA 2I5QA 5IHSA 3L4YA 2A2IA 2V38A 1FCQA 3U2ZA 4LW7A 5CC6A 1L6WA 1R6WA 3RIKA 3PB0A 1VLIA 1V08A 1ODZA 4X0NA 3W72A 3TJIA 5FA5A 3O05A 3KDNA 1DJYA 4GX8A 1N2VA 1VFLA 2TODA 3F4WA 4PUDA 5CSUA 1CGUA 1MFUA 4OZOA 4HTBA 1NP2A 4H7CA 2V3EA 4F0MA 3W1PA 2Z28A 5JIPA 3IUDA 1SMDA 2Q09A 1TE6A 1IZKA 2AGKA 4LBSA 2INZA 1SM9A 2PWUA 1H61A 2EPMX 1SMAA 4OGZA 3RPTA 4B91A 3P61A 1TPB1 4UXDA 1XIIA 4CD5A 3LRKA 1AFSA 2KX9A 3UERA 1R0MA 3KVMA 2GOKA 3QFWA 4C7GA 2LLEA 3QH2A 2ZADA 1HKWA 2VC7A 1S46A 5G1TA 3RCYA 5I6SA 3WDIA 3S83A 3VINA 3SRHA 4Q6XA 5IDIA 4D6FA 3MZNA 4AF0B 3TCEA 1U1UA 1W91A 2DZSA 2DVUA 3ARUA 2DUZA 3PULA 5A6AA 3GDTA 1SW7A 1UD4A 4I7WA 4OECA 5I00A 4IWWA 3BUVA 1WZLA 5CLTA 3P81A 4DF2A 3VFLA 4L5ZA 2AMXA 2ZRYA 2YA2A 3PZNA 3TU9A 2Z1BA 4QBXA 1HIZA 3VX1A 4JTDA 1TWWA 3H24A 3S1WA 4QDPA 1DQUA 1UUMA 2VM8A 3BJSA 5B80A 1G1YA 1IWAA 5JIWA 3MKKA 1UWQA 4FSAA 1ZS2A 4NXKA 3FEQA 3KOXA 2E6DA 4IMAA 4FLSA 2YDQA 3VNZA 2DW7A 1BSLA 2IPGA 4XZIA 2XZ9A 4CNNA 2VZOA 3UVAA 1F3EA 2VC9A 5DFAA 2ZVRA 1CECA 1Q4WA 1AD1A 4H8HA 1QO2A 3LMZA 3EDKA 4NG3A 4LC6A 3RR1A 4KFNA 3CWOX 2FYMA 3QOMA 3NPUA 4ILSA 1QOXA 3UWWA 1F4HA 3ZFHA 3PB2A 4EWJA 2NQ5A 1W5QA 3FEMA 2FJKA 1P7TB 5CAKA 3WSUA 3BL3A 2AQWA 3U0HA 3I3BA 2F6XA 3GG7A 1OYCA 1JPIA 2J75A 2ZDSA 3CEPA 2PDUA 3FXGA 3WELA 2PBOA 4MIMA 1E70M 3ICJA 3WQ6A 3RK8A 1QI3A 1JDCA 5FJOA 5GJNA 4AZ7A 1MEHA 3C2VA 3GC4A 3GVRA 3HPAA 4BA0A 1A5NC 4GK8A 4ROQA 4IFKA 2GFTA 1HKKA 2QJIA 1KNWA 1F6YA 1FWJC 3M6DA 3NUKA 1W9UA 3M0MA 1YADA 1R3WA 2VR2A 5EBAA 3VMNA 4D72A 3V16A 3OPSA 3VIPA 2XVNA 2OKTA 4HOXA 1MW1A 3GG1A 1NDVA 3CL8A 2D0HA 3GAYA 3QTPA 3GYCA 5FOOA 5AB3A 3SM0A 3CASA 2WZHA 3E0VA 3AISA 4GYPA 4LTSA 3EB4A 2VFIA 2QHAA 3LPFA 2C8NA 2PDKA 4AHPA 1GOWA 2OO6A 2P0IA 3TOYA 1JRCA 1HNYA 3BARA 3L66A 4DO7A 1DEDA 3HPFA 1PHWA 1S2UA 5HMEA 3W7NA 2HPIA 4JOMA 1BKSA 2E28A 4CEXC 3HB9A 1JCYA 1LT8A 1OEPA 1RY8A 2XINA 1MUCA 2QQ6A 2QVNA 4BHYA 3W07A 3EWXA 4LEFA 1OCNA 4REQA 2QAPA 1Q6RA 1VFSA 4OWGA 1P0DA 4Q8QA 2A79A 1QHPA 2YXGA 2VX6A 4GH1A 4Y9MA 3ERPA 2VZVA 4U2ZA 1OD8A 3TYBA 4PUNA 3MCOA 5KEZA 3UXDA 4MB5A 3ZJ8A 3XIMA 3RILA 3RYSA 1K8CA 1WKEA 4PRRA 1IYXA 1XSJA 2BDQA 3OZYA 4MSSA 2INEA 2FVLA 3L65A 3M0YA 4GZJA 3H26A 3DFNA 3SBFA 3DAQA 4BF9A 3B9EA 1WYIA 3PHAA 3G1XA 4RV3A 4LBUA 4D6DA 1MDRA 2J6XA 3RXZA 3CUXA 1M7PA 1ONEA 3RX2A 2X0YA 2D2JA 3TA6A 4ALDA 3LB0A 3VIIA 3GNDA 1A49A 4ERAA 5F2MA 4N02A 1FTXA 1XYZA 4JFUA 2UY3A 1W5NA 4UCGA 3W26A 2B81A 3EA3A 1A5MC 2PB1A 1AQMA 1OF8A 1GPFA 1XR2A 2G95A 1NSJA 4HD5A 4HHLA 4N4QA 4F2BA 5IM51 4M3PA 3PBGA 2Q8XA 1OF6A 2F84A 3HURA 2OQHA 5BXSA 3VILA 2HNHA 1XKYA 3L4TA 3SB0A 4FOJA 3KRZA 1ZQ5A 4XZMX 3KBSA 4E4FA 2QUMA 4GJ1A 2BY0A 3RDKA 3AS1A 3UFYA 1VEMA 5C9ZA 1FOBA 4NKCA 2PP1A 3WBXA 4WOZA 4GYKA 2C19A 2EG6A 3Q45A 3M0JA 2HBXA 3NQ6A 1SJBA 2OYLA 3UXLA 1KM3A 1VHNA 4NAFA 3SY8A 4W4QA 1JL8A 3PTDA 1FWWA 5C7HA 4CUCA 3GNRA 3D5HA 2W92A 1KW1A 1YPIA 2RDTA 3C0LA 1TX2A 3FGCB 3P14A 4GYFA 1I60A 2A1YA 1KXQA 2JIWA 3FN9A 1T99A 3WF4A 2YL6A 3IJDA 3D0CA 2ZWZA 4H8UA 1JIBA 3AHTA 8CGTA 6XIAA 1I9CB 1PIFA 4C5ZA 1KBLA 1C7TA 1TV2A 3VD7A 3HFYA 1KTBA 1E43A 2XHYA 4XUYA 3BW3A 4GPNA 3MYPA 4NILA 4Y6GA 3B9OA 4H7VA 3W81A 2Y1HA 4IZGA 4W89A 3CGTA 3P0XA 3KZPA 3E74A 4PTVA 3OYXA 1Z32X 1WOAA 3NQMA 4GACA 2OT0A 2P88A 4GUFA 4IUOA 1XXXA 3S46A 3IEBA 1GQNA 4CNUA 1A4LA 2VI0A 2Q71A 1VF8A 3KWSA 3MV01 1REQA 3KCLA 4NYYA 3T05A 4GC4A 4W86A 2E1DA 4E2DA 4JTCA 3USZA 3M0LA 3OGRA 3UJFA 4NASA 2VMFA 4AFYA 3LI1A 3IJQA 2QF7A 1CXIA 1DL3A 4PCTA 4UQCA 1EA0A 3PVFA 4MJMA 2VURA 1GHSA 3HZ3A 4Q32A 4UQDA 3VZZA 3GX9A 4XAGA 1ISVA 4OJYA 4UZSA 2D3LA 3WFZA 1TQXA 1SSDA 3ATZA 4RZ4A 3LCGA 2VRQA 3FIGA 1DIEA 1DJXA 3CUHA 3TW7A 1HL9A 2AL1A 4Q8OA 3B9AA 2Y70A 1OFAA 1EHAA 5CCZA 4WVXA 3GBDA 5BZAA 2OYMA 5CBIA 3NQBA 4JD4A 1VYRA 1DJZA 2ONEA 1V0LA 1MXGA 4JQ4A 3A12A 1JRBA 2J13A 3W82A 3LHYA 1KFKA 2BY3A 4QM1A 3ES7A 1SO3A 2CFFA 2QXWA 2PA6A 2REQA 4KCWA 4Q4KA 4LANA 5AECA 1H1NA 5D30A 2D2HA 3SSZA 4CCZA 4AD2A 1A5OC 3V0UA 4YVXA 3CZKA 4GGHA 4N9BA 4O52A 1EXPA 4CN4A 3EWCA 3V5CA 2DY3A 4QLLA 1TWSA 2OPJA 4I7UA 3U7VA 1B3XA 4CQCA 4H6KA 4H9MA 4YCOA 4J7RA 4EPDC 3C86A 1PE1A 1NDWA 3IV8A 3R79A 2XZ7A 1QJWA 2CNCA 3ENLA 1GVRA 4ATLA 3HJZA 4H19A 3ZJ6A 4M56A 4UQ9A 2CLFA 2BASA 2GGJA 2J7CA 1ZSXA 2VX7A 6TIMA 4P8VA 2PDYA 3GR7A 4HPHA 2G3FA 2H3DA 2OZTA 4RDVA 4K8HA 2A7PA 3WQ5A 2QJHA 4Z2KA 1GOKA 3MMTA 3KX6A 3MBFA 4OOUA 3TOPA 2XN2A 3FX4A 1M7OA 4S3CA 4P61A 1Q85A 4E8DA 2BVWA 5F7UA 1EC8A 3PBWA 7ODCA 1O5QA 3T1GA 1I2QA 4ATDA 3UW6A 3QHNA 3LXAA 2CITA 1KM4A 4GOAA 5DRCA 1LL7A 5C7VA 3UNTA 4A2SA 3QZEA 2ACUA 3CMJA 2YL5A 1EIXA 2FH6A 3RMEA 3SJNA 3SCWA 3TSBA 3OBKA 5E1QA 2R24A 5DT5A 4XG1A 1GEHA 1UJPA 3E1F1 5FEZA 4Y8EA 2PGFA 1E6RA 3IJ7A 3CJPA 4AVNA 1CLKA 2OFJA 3CQ0A 1A4MA 1PKNA 4MWAA 4K68A 4FOKA 1P4CA 4E2OA 3CO4A 1XM3A 1JCTA 5C8BB 1GEQA 1K9FA 3W0KA 1TPFA 3L5AA 3LHTA 2NUYA 4FXRA 2ALRA 5ABFA 3BO9A 1B0IA 1J12A 3WDJA 4JTFA 1A50A 3WLOA 4YYCA 3TV8A 1QUMA 3EPOA 1JUKA 1CB2A 1YXYA 5GQBA 3ZVHA 2XGZA 1JI1A 3W2UA 3QV9A 4MUZA 3N14A 3TX9A 1N8WA 5JVLA 1N7KA 2RH9A 1E3ZA 4CU8A 3AROA 3USBA 4B5TA 1U2YA 2AMGA 3CZLA 2WCSA 4B5WA 1Q66A 4RV8A 3LPGA 4L4OA 1U33A 3WDPP 2J8GA 1JXKA 3TA9A 2DJXA 2ZRUA 4Z1CA 3E38A 3DC8A 3GHSA 4LUSA 5AHNA 3Q2DA 3EOSA 5C0QA 2XN0A 4ZL1A 3S2CA 1EP1A 2QUUA 3MP3A 3GW0A 3S6DA 2VWSA 3UXKA 1IR2A 4P7OA 5G5IA 4J27A 2A3LA 2XIIA 3GD6A 3L0KA 4JTSA 1ZBCA 1RJQA 1H51A 4HPXA 3HPZA 3LZ3A 3M5VA 4LPCA 3WK2A 3WNOA 1QHZA 1M01A 3MZ2A 4KEVA 2ZRZA 3GVQA 4WR3A 3VX0A 2X42A 3CLWA 1JCJA 2GQAA 2NLIA 1CXEA 2CYGA 2PDFA 3IAPA 2FIQA 1C3FA 2L5HA 3W22A 4HMDA 3PC0A 2J7GA 5CJMA 1GOIA 3VD3A 4JTUA 3KTXA 1Z69A 3W27A 1FWBC 3WMLA 4AEEA 3GW3A 2WANA 3VABA 2WZTA 1EJRC 4MZYA 3OJGA 4KWUA 4TVDA 1QK2A 1E0UA 1EJ7L 3M44A 4MHBA 5KINA 7REQB 4MWAC 1I8JA 3ATYA 3NL2A 1GVSA 1ITXA 4RX0A 4LAKA 3UR8A 3E0WA 4F40A 4A6GA 3E2QA 3MMWA 2POZA 4QNEA 4DF1A 2W5FA 2VYOA 5HNRA 3QSRA 3R11A 1QU4A 3W7RA 2XJ7A 2PDGA 1RBLA 3G1FA 3UZ5A 2W4XA 3WEZA 1OZQA 1OFRA 1D2KA 2WBGA 2HVNA 4MYXA 2Z1VA 3L2LA 3DX5A 4KIEA 2X05A 3IARA 4GO8A 2NVCA 1ONXA 5DBTA 5E70A 5G4EA 4Z42C 3UWZA 1Q7ZA 2VVNA 1Q6QA 4HA0A 4F0SA 4Q7IA 4RK8A 3IACA 1LWHA 3AALA 1VP5A 3O6DA 4I5XA 1H60A 2WC3A 4FHAA 3AIQA 3L7RA 3AQUA 3CO8A 5CXPA 3QJAA 4GJJA 1UMYA 4US5D 1RCOB 3PPCA 3N2XA 1A5BA 1XLCA 3SQLA 1MVYA 4YU1A 1VEOA 4P8WA 3W7KA 4Q8VA 1H7RA 1XIDA 4GQQA 2DSVA 2GL5A 4UFHA 3VNMA 1X7FA 2BWGA 3QRHA 2GQ8A 5A1AA 1JZ3A 3TJ4A 2DSWA 4ZEPA 4IIEA 3VCRA 1AUSL 2GUYA 1YE4A 1JZ2A 4A3UA 1PCKA 2E0PA 4ZOBA 4R3UA 3W6MA 3NVDA 5DT7A 4O28A 1PYFA 5MHBA 1JYNA 4U3AA 1EZ2A 2VO5A 3EPMA 2NV1A 3MI3A 4A22A 1RJRA 4RJEA 3VMPA 2NT1A 3ID7A 1K8ZA 1XYAA 3T78A 4GABA 2P8BA 1XGEA 2PS2A 4WSKA 2Q3OA 4N42A 1W1ZA 1YPFA 5EMUA 1UP2A 2FDSA 3EDJA 3ME3A 4LVBA 5T9BG 3JR2A 4FF7A 2AQVA 3WNMA 3ITCA 2WM0A 2W91A 3B40A 3GBEA 2HBVA 4BCEA 3FXYA 4MPKA 2C16A 4NHVA 3LTPA 2ZRXA 2GK1B 5E5CA 1FA2A 3ITOA 4RPPA 3M5YA 3ABQA 3NDZA 1W9PA 2CESA 2DT0A 4LNCA 5D33A 4LAOA 4O54A 3TEVA 1KM2A 2DGAA 4JNMA 3CZEA 3F5LA 3S1UA 1V77A 5I3JA 3VCCA 1M6JA 1ZAHA 1JQXA 5DXXA 4INFA 2R1LA 3WQVA 4DUXA 4YTRA 2VQUA 3A22A 2WNZA 4WK9A 2EEXA 2FGLA 3GR4A 1CXFA 4TTUA 3H70A 5HWJA 4DHGA 3N04A 1QMLA 3KOZA 4WY0B 1BG9A 1L9WA 1MW0A 3ITXA 1TTPA 2FDMA 3I10A 2B7NA 1PTAA 1TUFA 4KCUA 4D2JA 4O10A 4Q7NA 3G6MA 2DZPA 4C60A 1W2VA 2DZBA 1WKYA 2ZUTA 2E77A 2GDVA 1UR4A 4JN8A 8RUCA 2E6FA 4DO6A 1J96A 1EPVA 5HR6A 4QG8A 3LA4A 4I3GA 3F1QA 4KWWA 4L9YA 2E5CA 2FZMA 3BW2A 1Q6FA 1ME9A 2QCNA 3I7QA 5LIKX 3W83A 2P5NA 1JDDA 2PLMA 2BSLA 3WN6A 1J93A 4B3LA 3VIFA 3IVUA 3FA3A 2V2DA 4HJFA 3GS6A 2E4TA 2OTDA 4KFPA 4J3ZA 4UFLA 2GSHA 4D6EA 1FRBA 2QZRA 1WQ5A 2VT0A 1BVNP 3M0VA 3SUUA 4YN5A 4MB1A 1UD5A 2BY1A 4Y9PA 4NNCA 2PWHA 2E5DA 3TSDA 2XH7A 4H8NA 4UB9A 7A3HA 4RPQA 4AIBA 3EWBX 2DFAA 4RUBA 1V0MA 3IVTA 2QGYA 2QCHA 2QVHA 4AISA 4NAEA 1E4NA 1YTDA 1OD0A 4JQAA 4LUYA 4DYJA 1I1XA 1GTEA 4Z2JA 3FCPA 3O6AA 5DCBA 3AXKA 3URAA 1V6YA 2Y63A 3RITA 3AUOA 4MNMA 3L68A 4EANA 1XRVA 1QPOA 2HWGA 4O1BA 3QM3A 2DVXA 1JZ5A 2Q01A 2WMJA 4Q8UA 1HX0A 1QXLA 3GG0A 3ZO9A 3AXMA 1H11A 1W8GA 3CQJA 1Z44A 4QEHA 2G37A 5HDRA 3N29A 4LXFA 1D8WA 4YTTA 3UG3A 3NL5A 1G4EA 1UWRA 5LNVA 2CBUA 3EMZA 1EBGA 2Z27A 2WM1A 1VZWA 5DX7A 1KTCA 3RM9A 2JEQA 3W70A 1IXPA 3GDLA 4AWUA 4RE4A 4P8UA 2WQDA 4HKPA 2IS7A 4J3SA 4LVFA 3NQ7A 2WCAA 5LA2A 2PRMA 1D3HA 2DSUA 5C9RA 1X7IA 1UD2A 1IT0A 4Z1AA 5I3DA 2J9ZA 1FWRA 2WHMA 4B5XA 2WVUA 2XVPA 5CJ5A 4EPEC 1M03A 1EDGA 5CZTA 1O95A 3QQ1A 4PMQA 2OGJA 3M0XA 2ZC8A 1H50A 1HL8A 4O53A 3V3WA 5CSYA 4MG4A 3WEOA 3S1XA 4YMZA 1DQXA 2FLIA 3VNIA 3SECA 1P0BA 1GONA 3OEXA 4K39A 4DO4A 2GJXB 1ELSA 2VRKA 4M6QA 3BOFA 5A69A 4E3VA 2G50A 4TV6A 1F74A 4AXKA 4M29A 4PCNA 4L9ZA 4N4PA 1ECQA 4C1KA 3CM4A 1WCGA 3NA8A 4H9TA 4J3TA 2WZIA 1Y5VA 3BAIA 2QIWA 3KDOA 4V27A 1Q13A 2CLOA 4GVIA 2B7PA 1W1IE 3GZAA 3RHGA 1QO5A 4JY9A 3OB8A 5I3GA 3PK7A 1KBIA 1HVQA 3IIZA 1FKXA 1WPCA 4H41A 5CH9A 3W6LA 4EK7A 3BV4A 4NRSA 1BWVA 1IQ8A 3QW3A 4EX4A 1B90A 4KCTA 4P8XA 3UJRA 1AG1O 1V02E 1Q63A 4FLOA 3BSGA 3F4DA 1M65A 2GQ3A 1A0CA 4ECLA 5RUBA 3E5BA 3S2MA 1EF3A 3WJSA 4CN1A 3VIHA 5D4YA 3V35A 2GQ9A 1L6FA 1H63A 4UTTC 1SFLA 2FZNA 3R4IA 8XIAA 2IKGA 4FLQA 4XD3A 3WK1A 1J01A 1TMQA 6A3HA 1XC4A 3ABXA 3PPFA 4UTFA 2CC0A 3VOJA 3ZWSA 1ME7A 5HOSA 4MDOA 3P74A 3M5ZA 2HJPA 3CHFA 3PF3A 2ZXDA 4R85A 4Q8MA 2OO0A 4JIQA 2AKZA 2PZ0A 3FA5A 3M4HA 3KBNA 1XLIA 3CHVA 3NM3A 4GGBA 4GVHA 1Q6OA 3F2CA 1OT2A 4U5KA 1C9WA 1WBHA 3VE7A 5A6BA 3WLQA 3PAJA 4AUBA 3QR1A 3OQ8A 3R8HA 2QR6A 5MKGB 1Y7VA 3HQPA 1B3YA 4J3VA 1J4EA 4XBKA 1YTEA 4K7VA 1B3ZA 2B4GA 5EGRA 3FVMA 1Q2RA 2Z2AA 3CB3A 2PD5A 4YVVA 4LRSA 4HPGA 1JCLA 1Z48A 4PULA 1W9BM 2IXUA 4LYQA 4PE8A 3IJLA 2IXVA 4FPSA 4F2UA 3SCVA 2TYSA 4UQAA 4H6RA 1TIWA 2NX3A 3A4AA 4O11A 3PP7A 2XFYA 3CWHA 2QW5A 4AY1A 1FCVA 5I3FA 2JBMA 1VFHA 3TR2A 3NO1A 3WD4A 4JTTA 2IKIA 4AU0A 1WZMA 3ZR5A 1A0EA 2WB5A 4CNTA 1D8CA 3XINA 4DBSA 5A6LA 1U5JA 3TFCA 3W88A 1WZAA 3BURA 3T7VA 4I5UA 1TVPA 5HBFA 3RNDA 3VGBA 5REQA 1H0GA 2DH3A 3IIVA 5C6MA 4DO5A 3GFYA 2OODA 4UFMA 4PMNA 1FY6A 1LQ2A 2A21A 4FNTA 3VC6A 1NELA 2J66A 2YBVA 3NL6A 4I5RA 1G5AA 3UBPC 3RLVA 4PTDA 3L9CA 1IHIA 1KCXA 4IG2A 4W5ZA 1SZFA