1P1XA

Comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
publication title Analysis of the class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase at 0.99A resolution.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 104
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1p1xA00
4XKYA 1YDVA 2Z0IA 3C6CA 4LVGA 4Y96A 1U83A 3GYEA 5E93A 3PBUA 3PUDA 2Y88A 5LGZA 4IXHA 4UTIA 3W7RA 1H63A 2C14A 4JDBA 4Z1CA 3W1RA 3GAYA 5I3IA 3TSDA 4O50A 2DZVA 3P5ZA 3IV3A 2FPVA 2VEKA 3SJ3A 5HUPA 2A6NA 3A5VA 3LGEA 1MZHA 4NJKA 3NYZA 1BKSA 2R14A 1QR7A 3W3OA 3PS7A 2Q3RA 3NPUA 3G1FA 1LYXA 2C6QA 3WJYA 5BMWA 3N2XA 3TSBA 3LHVA 1KFEA 3KXQA 3RF9A 3NGJA 1KBIA 3C3NA 1HL2A 3ANYA 3GZ3A 1OJXA 4MIMA 3LTPA 4DEFA 1TIMA 1H1YA 4BF9A 2Q8LA 2NUYA 5D2YA 3STGA 3MUXA 4IPJA 2V9DA 2QCDA 1W37A 1FDJA 2J9YA 1RD5A 1QDSA 3EKZA 5D02A 5F1VA 1QOQA 4K8EA 3TMLA 3QYQA 4KWVA 1I4NA 1V7YA 3S5OA 1G69A 5I3KA 1H50A 3G1DA 1Y0EA 4K6AA 2RDUA 4RV8A 2QCFA 4JYEA 1GYLA 3O8AA 2DJLA 2QCMA 1GVRA 2PRMA 3HGOA 3EWUA 5HQEA 2WJZA 3LLFA 4CCDA 1I2QA 1GVOA 3TK7A 3L0NA 4Z0JA 3I7SA 1JRBA 2J6XA 1YYAA 5C5YA 4N9DA 7TIMA 4UC5A 1QFEA 3S42A 3W2MA 1NSJA 1QPQA 2E1DA 3S9YA 4U28A 3TDFA 4RKAA 4HSNA 2JBMA 5D03A 4EF9A 2QJHA 3IVUA 1GWJA 2CFFA 3S1WA 2H8ZA 5DBTA 3CB8A 3FLUA 1P4CA 4RZ5A 2BWGA 2ZZ3A 3DZ1A 5U4NA 2R91A 1Q6RA 4LU0A 3R8RA 1B3OA 4M7TA 3I65A 4WX2A 1R2RA 4MUZA 1EUAA 4O8RA 4X2RA 3W1PA 1PL9A 1NEYA 5K9CA 3LLDA 3NVTA 2ABBA 3O06A 3NA8A 1YLVA 2DZWA 5HR6A 3LV5A 1KTBA 5G2HA 4RJEA 3R5EA 2WKJA 3EWXA 3THAA 1TCDA 2O7QA 3GXTA 1FDZA 1I2NA 2NXHA 2WOQA 2Y7GA 4NX5A 4OU1A 1K8ZA 5D2TA 4UCGA 2GVJA 5F1UA 4YXGA 4QM1A 1Z48A 5HMSA 3W75A 4BI7A 4UR7A 4M6QA 4Y90A 2LLEA 2GQ9A 4MKNA 2VFIA 4JY8A 1IXOA 3VKJA 3W07A 1YADA 2C19A 5CG7A 3UZ5A 1ZHAA 4JTTA 3BVJA 3A22A 1XBYA 1H61A 3WK0A 3W23A 2ZZ7A 4HNVA 4K7YA 1S5VA 1SO3A 1FDYA 3PG8A 1NF0A 3S0CA 1ICQA 3FOKA 3PVFA 5AN7A 4EWND 3KRUA 3UD6A 3P74A 3DGRA 5D04C 3NQ7A 3DHDA 2WSQA 4OGZA 4IWWA 4XWUA 4NNAA 4FIQA 3BG3A 4O28A 4UFJA 3R13A 2A7NA 4MJZA 1SO5A 2CZ5A 4Q4KA 3UZJA 1SW7A 4LRTA 4PL1A 4M19A 1YPIA 2C1HA 4E2DA 5AHIA 5AC8A 3MP5A 3NQEA 3EX2A 3DFPA 4YCOA 1VCVA 1H7XA 2E77A 3OIXA 4WY0F 3LHTA 5CGQA 3CWOX 3WJXA 2A2IA 2QCNA 4I9AA 3EX3A 3KX6A 3IIVA 4YMZA 3WJZA 3B0UX 4LVAA 3CLMA 4N6FA 3RLUA 3ABQA 1F6KA 3UQNA 5FF3A 1WV2A 3ELFA 1KM2A 1NFBA 3B0PA 2Y89A 2VOMA 2B7OA 4MYAA 5D30A 1IIGA 4R7JA 1TJPA 1OFEA 5DBUA 5D37A 1XI3A 3NPXA 5EY5A 3E9AA 5D05A 1RR2A 3BGJA 4JTEA 1EB3A 2PC4A 3M6YA 5BNKA 1W5MA 3W70A 1ZAJA 2OCZA 1WA3A 3S5ZA 1T96A 4O57A 3L5MA 4J9JA 3PBVA 2DZPA 3ABRA 6TIMA 3NOEA 2OX1A 1B4KA 1FCQA 1K02A 2R8WA 4NU7A 2I14A 3NM1A 3W22A 2HS8A 3EKLA 1FWTA 4Y9AA 1K7XA 3FIGA 4JTSA 4MLRA 2B4GA 3LB0A 3N73A 1MEWA 1R2SA 3TU9A 3A21A 3TCEA 1VS1A 5CKSA 1O5KA 4RK8A 4CQAA 1L2UA 1YXDA 3CM4A 2CZEA 1OK6A 1X7FA 2YFOA 3MP4A 5AHNA 1RQBA 3DBPA 4L4MA 3FJLA 4GWEA 3W7CA 1IIHA 4UTUA 1G7VA 1Z41A 2QKFA 4FNSA 4LOCA 3Q58A 3M5VA 2DZUA 5D2VA 1X1OA 5F4SA 4MZ8A 3M7WA 1EWDA 4WY0B 3T78A 2NV2A 4FNTA 3RK8A 2Y63A 3UNDA 1B57A 3EEGA 4WQ6A 4GUGA 4O54A 1TPEA 3F4NA 4FX6M 2VENA 1F7BA 1EP1A 3O6CA 5G2WA 3S5NA 5DELA 4ZZ9A 3KVLA 5LNVA 4JICA 2FB2A 5DN1A 4ZL1A 3N9SA 2GPTA 1GTEA 2TPSA 2WNQA 2E5CA 1EP2A 1O95A 5LNSA 3WK3A 4EVZA 1TV7A 1SZGA 2EPHA 4AMAA 3NQDA 2CLKA 3TFXA 4S1FA 1MEHA 1GEQA 5BOOA 1TREA 2RH9A 3THQA 1RQEA 4JIPA 1D3GA 2A7PA 4OE7A 3LV6A 1YDOA 4WUIA 3O6DA 5D33A 4XZ9A 3ZWSA 5AFDA 3LBMA 4YL2A 3P8IA 1GQNA 4JD4A 2ZDRA 3UXAA 4GNJA 4O4WA 4M6PA 2QJGA 1DVJA 2J9XA 2FJKA 3L65A 3GNNA 2GQ8A 4QIUA 1ADOA 4N2YA 3GXNA 2V82A 5K4XA 3NQ8A 1AL8A 4HNTA 1VLIA 3U8GA 5LNUA 1IGSA 4UTMA 1G7UA 2B0MA 3P8JA 4ORIA 2JKEA 1DQXA 3C61A 3R12A 5KZMA 5DCDA 1H7RA 1F76A 5L6UA 3NL2A 4RXFA 4FHAA 3W7PA 1YTKA 1GJPA 3OVPA 1KLZA 2CLLA 3W83A 5G4EA 5CZ0A 3M41A 5CSRA 4DO6A 3CIWA 4FO4A 1XUUA 1ONRA 4QSHA 1TPFA 4R34A 3TJXA 4OHQA 4HKPA 1R30A 3QQ0A 3G8RA 3TMQA 1W5PA 1TTIA 3PUOA 5CPMA 5K4ZA 1Q3NA 3LM7A 4GUFA 5HNRA 3SGUA 4N02A 3M5ZA 3QZEA 2ALDA 3MO7A 3MBFA 5FEZA 3QW4B 1SFJA 4RZ6A 1SO6A 3GKFA 5ABTA 1R2TA 3LX9A 3PM6A 4CNNA 1VHCA 1LLZA 2V81A 5LHEA 3TX9A 3SSJA 1I45A 2ABAA 2E09A 3FKKA 4B5NA 3SIZA 3CEUA 1W54A 1FY6A 2XN2A 4UTHA 2X1TA 3LCHA 1HO4A 4N9EA 4M7SA 2A6LA 4LWWA 1F2JA 4KFNA 1OABA 3W1NA 2GJLA 3L0GA 4X9SA 1XL9A 3OVRA 6ALDA 3TA6A 3HB9A 2Y7DA 1AG1O 3C2FA 1YTEA 5F2IA 1F74A 1MEIA 4RLIA 4Z1AA 4UMCA 1LOSA 4HNUA 2ZFAA 1SW0A 3GB6A 4IXXA 3B4UA 3N9RA 3DFSA 4NJHA 3G0XA 2E6YA 1QAPA 4WXYA 1DL3A 1SZNA 5FESA 1QCWA 2GVGA 1IF2A 4UFMA 3TKFA 1HFBA 1FCVA 3G1AA 3NNTA 1X8FA 2QJIA 3EWZA 4P2VA 5GVJA 4ORMA 4NJIA 4MJMA 3W7QA 4AHQA 2BLEA 1C9DA 1LBLA 1KM0A 1TPDA 1WAUA 4WY0A 3K30A 2WSRA 1S5WA 4DELA 2PRHA 3KFTA 3OHIA 4AVFA 3NAVA 5FI8A 3DXIA 5SWUA 2DU2A 1FWNA 1ME9A 3PBYA 3RNDA 1SFLA 3LBCA 4FXSA 5KITA 1I8JA 3PB0A 1U5JA 4JTGA 3DHFA 2E68A 1E51A 3STCA 1K7FA 4O53A 3WK1A 2A85A 4RR4A 4OWGA 3UWYA 2QEZA 2EGZA 5LZLA 3N19B 3HPZA 2XN0A 1TYGA 3IVSA 2BZNA 4LS2A 1SSGA 2KZHA 2HSAA 3ZR4A 3I7RA 4O17A 4U4MA 4MYXA 1TTJA 4MPQA 5A8GA 3HG4A 1HO1A 4L4LA 2E6DA 1R47A 2FTPA 2QDGA 3W76A 3ZS4A 1VQTA 2I1OA 4I7WA 3Q2DA 3TR2A 3IGXA 4BFAA 3LHYA 5C54A 3T55A 3C2OA 4A3UA 1WBHA 2CLMA 1OFBA 1XCFA 2FIQA 1P0KA 1Z44A 2WNZA 4TX9A 4MFEA 1WYIA 5D2XA 1RQHA 1ZAHA 3MBDA 2V5LA 5KSWA 1RVGA 3LDVA 3QPZA 3UWVA 4S2CA 3P82A 1RZMA 1D9EA 1AW2A 3T4CA 1PHQA 4K37A 2YGYA 4GUJA 4RZ4A 4JTIA 1W1ZA 2W79A 1EP3A 3LRKA 2NZLA 1S3HA 2F84A 4GFSA 1LDCA 1EWEA 1VZWA 5IBXC 1YPFA 2HS6A 4AHOA 1J4EA 2V30A 2YW4A 4IX0A 4NQ1A 4POCA 4N4PA 2G95A 2BXVA 2CU0A 4JGDA 1GG0A 2NWRA 2V2CA 1KFKA 4HHPA 2XFWA 4UNLA 4ZQMA 3C2VA 2FPYA 1XBVA 4YWIA 5F2MA 2QUTA 5C2XA 3HQ1A 2PURA 2VEIA 4OV4A 4OT7A 3SY5A 1LZOA 1LROA 3QMTA 4FF7A 3KVJA 1O4UA 2OZ0A 3MHGA 3FYPA 3STFA 2X1UA 2ZRWA 1TPVA 4ZQPA 2Y61A 4JTKA 3GLCA 5I3JA 4W9TA 2Y7EA 3GAKA 4TR9A 1Z42A 4O1DA 5AOUA 3F4WA 4MZYA 4ML9A 4NVTA 4UTLA 3RLVA 3EWWA 1W3IA 3C2RA 4O16A 3NQCA 4A22A 1HG3A 4CQ8A 1TQJA 4H3DA 3BLEA 1LP6A 1TV5A 1JUKA 1QWGA 1GVSA 3IGUA 2IQTA 4CNPA 2YW3A 4AXKA 3TW6A 1JR1A 1DJNA 1FXQA 2C0AA 1UUOA 4NUWA 4LS1A 3W7JA 3QH2A 3KAOA 1CI1A 4NNBA 4LS0A 2VFEA 5BW6A 3EXTA 4D2JA 4CLMA 1V5XA 4DF1A 2ZTJA 3N3MA 4K38A 3INPA 8TIMA 2A5HA 4JR5A 2ZRXA 3W7IA 3LTSA 1K7EA 1LOLA 1N7KA 3E96A 3C2EA 2VFDA 3C52A 2GUUA 2ZQ0A 3HMJG 5MHBA 1DHPA 5L9FA 5HR7A 4PODA 1LRQA 2TRSA 3KRZA 4ICNA 2VXNA 3MW7A 3TC7A 1J5TA 1EUNA 1OK4A 5F2LA 1QPRA 1SZEA 1TPH1 3PBWA 4Q32A 1GYNA 3I68A 4E2BA 3S1UA 1JRCA 1QO2A 3ABSA 1IXPA 2CZFA 3NXFA 3O05A 4ONVA 1UUMA 1ZFJA 1H1ZA 3EXRA 1ZJIA 2E5BA 4LTSA 5KMYA 1TPUA 2ZTKA 3UY7A 2CLIA 2Y70A 3P80A 4JS3A 4IQLA 1W3NA 1W56A 3GR7A 1OFDA 4I7VA 2H8XA 1ZALA 4JDYA 3CIXA 2Y62A 2H6RA 4O1AA 1G4TA 2W6RA 4WOQA 4O4VA 3O07A 2YCEA 2J24A 1VGAA 2PRLA 3W7OA 1VJIA 5DXYA 2Y6ZA 5AYXA 4YCPA 1DORA 5C6MA 2ISWA 2ZBTA 1JCLA 1KM3A 4WXZA 4DF2A 3W7KA 1SR9A 3SGZA 3VE9A 3SECA 5T26A 3W74A 2DP3A 3VNDA 4Z1BA 1CW2A 4PEKA 3LCLA 5K3VA 2HMCA 4A2SA 1K8YA 1LRTA 3SI9A 3NL6A 4MY8A 3G1YA 3UPWA 3DFOA 3G0UA 2NLIA 3L21A 2NX3A 4HN4A 5AC7A 3KRSA 3TXZA 4IMDA 3HGRA 3B03A 2J88A 3TQVA 1TTQA 1SPQA 1LORA 4HNNA 3MJYA 2X16A 2FFCA 1AL7A 2EKCA 5CPLA 2B7QA 4JX5A 2TSYA 3G22A 5I3FA 3IVTA 1O5XA 4AH7A 3HG5A 5IBXA 1WXJA 2Z2UA 4PCFA 3V1PA 1A5AA 1PS9A 3BGGA 2ZRUA 1ME8A 2AGKA 1H7PA 3LHUA 2QCCA 2YDAA 3PULA 4O14A 4NX0A 3MWAA 4LY8A 5HWMA 3AO0A 3MI3A 3P81A 1LBFA 2W0UA 2Y85A 4RXGA 2YR1A 2OMAA 2RFGA 4HPXA 4HPJA 4A21A 5LHFA 3UWQA 4FNRA 5KTLA 3L0KA 3LI1A 5LKYA 3NPVA 3W2JA 3LXCA 3G3MA 3W7GA 4N9CA 1ZENA 1WDWA 3OEXA 2P10A 4FEZA 3GDMA 1GTHA 3GDLA 3TNOA 4FNPA 3BO9A 2BTMA 1KM6A 3CC1A 4WD0A 4BWLC 2VFHA 4LC6A 1H5YA 4QJ1A 4UUIA 3M5YA 3N2MA 1XDLA 3M47A 4KFOA 1DBTA 3DFNA 3DAQA 4CCEA 4EIVA 5F4WA 1P0NA 4XBSA 1F5ZA 1OFPA 3QJAA 1ZCOA 4FXRA 4MZ1A 3FA5A 3G1VA 4LVDA 2WO5A 3BARA 3M9YA 1GOXA 4O18A 3NQAA 3USBA 2VEPA 1A5BA 5KZDA 3B8DA 4O0KA 3GVGA 1Q6OA 5U7SA 3N14A 1KBJA 2Y7FA 1W31A 5TQLA 3SR7A 4BK9A 1EX5A 1QO5A 2AQWA 1ME7A 3TAKA 1DJQA 2P1FA 3B04A 1VYSX 1VLWA 4IGHA 1D3HA 3AJXA 3G0SA 3W85A 1M7OA 1XDMA 4FNUA 1KLYA 1KTCA 2A21A 5FF7A 3H53A 1TJRA 2V2DA 3W9ZA 2H3BA 5G1YA 4MVAA 1OFQA 2VKZG 5CZTA 4IMGA 1OFOA 2FLIA 4EOUA 1H7WA 1AW5A 1ML1A 3W7MA 2QAPA 4AWUA 5K7JA 5K2ZA 3HG2A 3G1XA 2B7NA 1VHNA 4BI6A 1YDNA 4UTTC 1A50A 4WZHA 2A1YA 3DI1A 5FF2A 3BLIA 4K36A 4E0CA 1GZGA 1H62A 4UIOA 3DU0A 3MYOA 4Y6GA 3I7QA 4QNWA 3M43A 4ZMGA 3KVKA 4C1LA 4JX6A 1XM3A 5E0KA 5CZJA 3HPXA 3MP3A 4JIQA 3CU2A 4KWWA 3EB2A 3STEA 2ZRYA 1SQ7A 3WK2A 1GVFA 3M1ZA 1UB3A 5AC6A 3S1VA 3HG3A 2HTMA 4QQ3A 3OA3A 4IMFA 4UTWC 4GC4A 4MOZA 1QPOA 3MHUA 4AB4A 3GNDA 1M5WA 1KFLA 3M44A 4S2BA 2NXIA 4G1KA 1JCMP 3I6RA 2RDTA 3UWWA 2VELA 3S6DA 3W71A 3NQFA 3PR2A 3NZ1A 1JULA 4HIBA 4R33A 2NXGA 4H4IA 4Z1DA 2E6AA 4JYFA 1J2WA 1XBZA 3G18A 2ISVA 1G4PA 4K7VA 1H51A 2ATMA 3H54A 1JUBA 3RMJA 2ZRZA 5AHLA 5G2IA 3W2NA 3PY2A 5AHMA 2JK2A 3BG5A 5CZSA 4XQ6A 3NO5A 3G1HA 1TPC1 3O63A 5DLCA 2GVLA 4O12A 1BEUA 2WV8A 1OYBA 3IRDA 4LNYA 5D2WA 3W1AA 1T99A 4FIRA 4IOTA 4JXCA 2QDHA 4OV9A 3QW3A 4LV9A 4UR8A 4AEOA 4CCCA 4P61A 1VC4A 3W7LA 3LRLA 4O15A 5AHEA 3TQ0A 2V0TA 3DFQA 1BWLA 4M6VA 3CTLA 4IX2A 5F2GA 2H90A 2EF9A 3NZRA 3W73A 3KOFA 2FPTA 1DQWA 3P5YA 4BWLA 2V5BA 3EX6A 1VH7A 3DFTA 1FX6A 3OG3A 3CPRA 2X1SA 2ZZ1A 3TROA 4UFHA 1DOSA 5CSSA 4X22A 3QFEA 5IM51 2VEMA 2C16A 1VYRA 1LOQA 4O19A 3WJSA 3M16A 3MI2A 1KM4A 1LRNA 3BPWA 3L9CA 2PCQA 4JYDA 1KA9F 4ZQNA 3L2IA 3GDRA 3RFAA 1UASA 1ZAIA 4MFDA 2GOUA 1ZNNA 1TPWA 2ZYFA 1OFRA 4OBTA 1T0OA 4AF0B 3A23A 4GBUA 4YLWA 5D09A 2WSYA 2ZA1A 1UCWA 2YXGA 4IMCA 4DBEA 1TPB1 3TIMA 1VR6A 1AMKA 1G6CA 3W88A 1FWRA 3OVQA 1JCXA 4ADSA 5HINA 2BSLA 4FX7A 1AW1A 3S1XA 3TV8A 1R46A 1KTNA 4WJEA 1FCBA 2ISSA 4TMCA 1TMHA 3HJZA 4C1KA 3P67A 4ADTA 3UWUA 1FXPA 1W8SA 1A5CA 3GDTA 4ZVJA 1WOAA 3H55A 4N6EA 4DF0A 1XBXA 1I2RA 4UFIA 3GK0A 2H3DA 4ZQOA 2CW6A 3CWNA 2YZRA 3YPIA 2DZTA 3NEVA 3ABOA 1QOPA 1B9BA 3BG9A 3L67A 5HULA 3C56A 5E1QA 1JQVA 5KINA 1O94A 3BLFA 4UTJA 1OF8A 4UTTA 3NR0A 4JY9A 1K3UA 2DORA 3W72A 3R89A 3NQ2A 1FUYA 1TV8A 2A4AA 1L6YA 3P60A 2NWSA 1DKWA 3DH7A 5KZEA 3W2KA 3T44A 5EMUA 3IIOA 3CT7A 1GG1A 3EWBX 4O52A 1PCKA 3IIZA 2JGQA 1FCUA 1T8XA 1ALDA 1TB3A 4GJ1A 2V8ZA 1TQXA 4FX8A 5TBOA 3W1XA 3W1LA 2JKPA 3SZ8A 3FJ6A 4JX4A 2FQIA 1IXNA 5BMXA 1P5BA 3ZWTA 3LTYA 5TIMA 5DY3A 3GX9A 2WQPA 1F6PA 2EHHA 4UTWA 1XUZA 2ZZ6A 5HUOA 2RHGA 2X30A 3R2GA 1QMLA 2CLEA 1L9WA 3MYPA 2ZZ4A 4TU1A 2J27A 2JKAA 3C8FA 4Z0SA 1I2PA 4PH6A 3TH6A 4DPPA 3WFAA 4PTNA 3DENA 4JNMA 2AAMA 4DQWA 1BWKA 1UBSA 1PHWA 3A24A 3QC3A 3CQ0A 1TTPA 4GRSA 1PV8A 4GUIA 3PF3A 3UYCA 4JTJA 1OHLA 3GDKA 2DZSA 1A53A 4JTLA 3W84A 3NL3A 1M7PA 3C0JA 3NQ6A 3L5AA 4FNQA 1X1ZA 4N4QA 4GE8A 2GJNA 3CHVA 1KM1A 2J9ZA 2A7RA 3W2UA 1OX4B 4NXSA 3LHWA 1EPXA 3LCGA 5DCBA 3DKJA 4TIMA 3IIPA 3TC6A 2V2HA 2YSWA 3FKRA 3W7DA 1THFD 3HO8A 2G96A 4JTFA 4UXDA 4LT9A 1TSIA 1OX6A 2EAWA 3NQMA 1AK5A 4AWTA 1LM1A 5H91A 3G3DA 5EA9A 1LBMA 1OYAA 2B7PA 2YYUA 1H60A 4PA8A 3RU6A 4NXKA 1KW1A 3F1QA 5EBUA 4LRSA 5CPOA 3L68A 3M5XA 5LSMA 2D73A 3E49A 4QITA 5G1TA 2YPIA 1NAL1 3HGSA 3E0IA 2RKXA 1JCYA 3HIJA 4R53A 3QMRA 5A5WA 3HPSA 1KV5A 5C55A 2NX9A 1KFCA 2YFNA 4O1BA 4O0ZA 1I2OA 3NQVA 5J5DA 1ZY9A 3EX1A 1DV7A 3GKAA 1JCNA 3W7HA 3GXPA 4O13A 3PUEA 2QCHA 4I7UA 3QF0A 2Z6IA 3NL5A 2Q8ZA 1TRDA 2OJPA 3W86A 4NNCA 1N8FA 3IIXA 4MY1A 3W7EA 3HBLA 3P62A 5LGXA 1B4EA 2TMDA 3BK0A 4CQ9A 1PIIA 3WJWA 3MMTA 5AYYA 4NT0A 1ICPA 4ZQCA 4PC8A 1L6WA 1G4EA 5HWNA 4AF0A 2G97A 4LUJA 3LXBA 1KV8A 2Z1BA 3JRKA 4KKXA 3UY8A 2NX1A 4IUOA 4NZFA 1JUEA 3E02A 3EWYA 5HJLA 3D0CA 1O60A 4MLJA 3TQKA 1OYCA 1C29A 1NVMA 2WPBA 4ALDA 4XTIA 3W7NA 3SFKA 1LLWA 2C13A 3W1TA 5K9XA 2QUVA 4M5PA 4BR1A 1VCFA 5DCEA 3T40A 3FYOA 5AHFA 1NF7A 4UFKA 4DBDA 1LTDA 5H2ZA 2YYTA 4Y8FA 3UWZA 4XBKA 3B0VC 4RX0A 4FB7A 3GR8A 1S5TA 2WNNA 2C3ZA 3LXAA 2VFGA 2BX7A 3PG9A 2X1RA 2OT1A 4A29A 3PWAA 4NZJA 4JTHA 2QCGA 4LVBA 2QAFA 2ATSA 3W1QA 3W1MA 3P7YA 1K03A 4HSOA 1FBAA 3EX4A 4DO4A 1MSSA 3MHFA 2XN1A 2DZXA 1SUXA 3O6YX 3L5LA 3W1UA 4H6KA 4GXMA 1KM5A 4A2RA 1QPNA 3ATYA 1N55A 3C4UA 3O1NA 1LCOA 3W6YA 3IEBA 3P84A 3TJLA 3S5YA 3QQ1A 1OG0A 1SO4A 1SZFA 4DXVA 1SU5A 2E5DA 2O7SA 3A5FA 4HT3A 2CZDA 3PSWA 2R94A 3QEZA 1W5OA 4TO8A 4UFLA 4WOZA 4XKYB 1PE1A 5AYZA 2CLOA 1BTMA 3PB2A 5D38A 1XKYA 1YXCA 1W5QA 3A9IA 2I9EA 4QAIA 5EPDA 5LNRA 3LRMA 1VCGA 2Q3OA 4IJBA 4BI5A 4QISA 1PVNA 5AB3A 1HUVA 5G5IA 1KFBA 4UMAA 4QNEA 2QUUA 3HF3A 3HGJA 3G1SA 3QM3A 3W87A 1K8XA 2OT0A 4ZQRA 2Z6JA 1IXQA 3NPWA 4NJJA 3W2LA 1WOBA 4ADUA 1JVNA 4IPIA 3TFCA 1P1XA 2ZRVA 2DJXA 1YTDA 5CPNA 1OX4A 1FWWA 4DPQA 5LNWA 3N34A 3PAJA 3TSMA 1RV8A 5FF0A 3U2OA 3JS3A 5EYWA 1F05A 1VRDA 1ICSA 3QSTA 3Q37A 2CLFA 2F7FA 3LCFA 3TW7A 3U6WA 2P0OA 1F73A 1JQXA 2YX0A 1XXXA 5HWJA 4UMBA 5EKYA 5FEPA 5I3HA 2QCLA 1G67A 2CWNA 2PE4A 5FEWA 1GVQA 4E38A 2QCDB 2X2GA 3KHJA 4LV4A 4PL2A 3B06A 3V75A 1G4SA 2C18A 3F03K 1WBJA 1EEPA 3TE9A 1H7OA 2ZZ2A 1YXYA 1WQ5A 4LC8A 1UJPA 2CLHA 1Q6QA 1W5NA 1W0MA 5K9DA 3DKLA 2JGYA 4KFPA 3NM3A 3Q94A 2QR6A 1C8VA 4O10A 1M6JA 1VYPX 1OX5A 1X6UA 2ZZ5A 1XC4A 1Q6LA 2QF7A 3T7VA 2E6FA 4EF8A 4UNKA 3M0ZA 3VFLA 3UXDA 1H7NA 1OFAA 3BW3A 1QNVA 4JEQA 4N9BA 4PFMA 1WX0A 5D32A 3KVMA 2VC6A 4NJGA 4OQVA 2ZA3A 5EL1A 1OF6A 4IMEA 3OBKA 3CEPA 3TAOA 4XUGA 3FS2A 1TRIA 1W3TA 1PCWA 4CNOA 3LCWA 2UV8G 3BV4A 4JTUA 3NQGA 2A0NA 2NUXA 2FB3A 3FEMA 4K39A 1MXSA 5J5RA 4JN6A 3E12A 3SW6A 3FFSA 1JJKA 2TYSA 3BW4A 3QMSA 3O15A 3G8EA 5I3GA 5G4WA 3QRHA 4Z08A 4O11A 4UTKA 5DXXA 4O1CA 1KFJA 1L6SA 1XFBA 4AHPA 3HOJA 4DO5A 1GT8A 4LVFA 4Q33A 4AWSA 1MO0A 3BW2A 3JR2A 4LW7A 3PSVA 3P61A 1FQ0A 4XTDA 3LI0A 5FF4A 3NG3A 3LERA 4RCXA 1TO3A 3TUUA 3QSRA 2RDWA 3ATZA 4MY9A 3MI6A 3EXSA 1RPXA 3LHZA 1SSDA 2GQAA 5FEXA 4TMBA 3LCXA 4AAJA 1VPXA 2VFFA 1A5SA 3GIYA 3LOTA 3PC0A 3VE7A 1CX9A 3ZFHA 1GPWA 1FWSA 1OVDA 3O16A 3UPBA 2QCEA 1Q45A 3B05A 1EIXA 2NUWA 1EA0A 1JCJA 2FDSA 4K8HA 4X3ZA 3QPYA 5BRBA 1HTIA 4GUHA 3VI2A 3L66A 2ZA2A 5F4XA 2NV1A 3TXVA 3S8HA 2G5WA 3G24A 3NDOA 3DI0A 2C15A 3LCIA 3IGSA 5DY2A 4LUIA 1SW3A 2ZCGA 3VCRA
chains in the Genus database with same CATH superfamily
4FOJA 3K2GA 2Z0IA 3WD1A 4DWSD 4JFSA 4DNHA 3RU8X 2HPMA 5E93A 3PBUA 3JZUA 2Y88A 4UTIA 4HNLA 2L5HA 3DG7A 4M6UA 1H63A 4Z1CA 2XSAA 3W1RA 4DLFA 4O50A 1W1IE 3GW3A 3P5ZA 3FA3A 2FPVA 2R9RA 2VEKA 4JTAA 3VIFA 4IPNB 2HZGA 2I17A 1W2PA 3LGEA 4G56A 2E9LA 3AIUA 3BH4A 4R27A 2R14A 4L5ZA 3GU9A 3G1FA 2DEPA 3A4JA 2O55A 3CO8A 2WBGA 3KDNA 1WZMA 3LHVA 5LXXA 1B5TA 1KBIA 3GTXA 3ORWA 3N13A 1DJXA 3MS8A 1Q7MA 1MWOA 4Q3MA 1NDYA 2QVNA 1H1YA 5AVHA 4LYQA 4BF9A 1T5AA 3VDAA 2ZC8A 4QQUA 4H6QA 3MUZ1 1Q8JA 5AZ0A 2BVYA 3TMLA 4C6NA 4HZ8A 2PEVA 3QYQA 4KWVA 1I4NA 1XF0A 4DJEC 2I5GA 3EPNA 1KRMA 2FZ9A 1GQKA 2O4MA 4K6AA 4S38A 2YKKA 4RV8A 2QCFA 3EOLA 3O8AA 3N2CA 3MWCA 1PWMA 3HGOA 5HQEA 4E4UA 2WJZA 3LLFA 1GVOA 3CUJA 3TJ4A 3AJ7A 3W82A 2AKMA 3H6OA 2WVVB 2HV5A 3H23A 1FA2A 4N9DA 3PPFA 3V35A 1NSJA 1E0UA 3TDFA 4HSNA 1M1BA 4IFOA 1FHDA 3EEZA 3S2JA 2QJHA 5FD0A 1HKKA 2CFFA 5DBTA 1HXJA 2BY3A 2AQVA 2OB3A 3WF1A 2YBVA 4UZUA 3I65A 3DERA 1R2RA 1EUAA 2INZA 4R5EA 1PL9A 1D2KA 1CEOA 3T1GA 2VUNA 5K9CA 3P0WA 3O06A 4HHMA 5D8ZA 4MDOA 4C6KA 4M56A 4M82A 2DZWA 5CC7A 2BVWA 5G2HA 3UFYA 5CSUA 1A0DA 2WKJA 4HNOA 2P5NA 3CZGA 2NXHA 1R7AA 2WOQA 2UZ9A 1EGMA 3P0XA 1K8ZA 3WF2A 4ZB5A 5F1UA 4BI7A 4GZJA 2Y5EA 4UR7A 1XV8A 2NQ9A 2IKHA 1JDCA 3I4EA 3CL7A 5H8UA 3E1F1 1V0LA 1NM9A 1REQB 1YADA 2C19A 3W07A 3V7PA 1ZHAA 2AQOA 3W23A 4ATLA 2HXUA 4HNVA 4K7YA 1CGXA 2AL2A 2P8CA 4KRTA 1Q8AA 5AECA 1UD8A 2IQ0A 3H2AA 3OBAA 2VWSA 4HTBA 3WF4A 1BD0A 4HU3A 2PGEA 3KRUA 4DNMA 4F2UA 3DGRA 2DY3A 3PZVA 2WSQA 3THDA 1UP3A 2BXYA 3CS2A 4I9MA 4XWUA 2XVNA 2ZVIA 1XPGA 1VBGA 2X7WA 2CHNA 5IFTA 3U3HA 2CZ5A 4Q4KA 1SW7A 2BY2A 5DEZA 3BURA 2PWFA 3TYCA 2DSWA 3GNRA 4YCOA 2WSPA 1RBOB 2HBVA 1UZHA 3LPFA 1VENA 2E77A 5EMJA 3LHTA 5CGQA 2PU1A 3CWOX 4H7CA 3WJXA 3NDZA 3RILA 3B0UX 2WAGA 1G1YA 4N6FA 3ABQA 1WV2A 1JPIA 3VMPA 1KM2A 3JW7A 4K1GA 2VOMA 4MYAA 2DQXA 1CENA 1IIGA 4ASTA 3AMDA 4GO8A 3T42A 3PZOA 3E9AA 1F3XA 2G3IA 2XFYA 1RR2A 3BGJA 4IIDA 1GORA 2ODOA 5BNKA 3UCDA 2WCSA 4IQEA 3W70A 1WA3A 2VCBA 4ATWA 3IK2A 4F2BA 4GO9A 2EQDA 3OJGA 4YS1A 1Q13A 3ABRA 2IXUA 1B4KA 2YXOA 1NWSA 3ES7A 2R8WA 4DAIA 3QR3A 1DWAM 2HS8A 4QLJA 2O0TA 1KQZA 1FWTA 4EKJA 1K7XA 2EPKX 4JTSA 4MLRA 3N73A 1H4PA 2EJAA 1CXFA 1VS1A 1E73M 4XB3A 4GGBA 4ZGYA 4PMNA 5CKSA 3POCA 1O5KA 2D0GA 2QQ6A 4RK8A 1L2UA 3VM7A 1X7FA 3TR9A 4I9JA 1R7OA 3DBPA 3CASA 4GWEA 2OYMA 1UP2A 1DIDA 4JZ5A 3N25A 2QKFA 2ON3A 2DZUA 5D2VA 5ENLA 4DJFC 1TR9A 3M7WA 3ARXA 2WMFA 3FGCA 3URNA 1YKWA 1B57A 1A47A 1NH6A 4WQ6A 3TEVA 3E5BA 4FX6M 1PKMA 3EB4A 1R87A 1C7SA 5HAOA 5CPQA 1TELA 4E4FA 1EP1A 5G2WA 4C1NA 3WBXA 3GU1A 2J79A 4GI8A 4JICA 3SUTA 5LNVA 1GTEA 1GHSA 2QLYA 3DC8A 3QXBA 1O95A 5LNSA 2ZC1A 2FVMA 3WFZA 3WK3A 1TV7A 4W89A 2EPHA 4AMAA 3NQDA 4QJ4B 4S1FA 1GEQA 1LLOA 3TYEA 1XLEA 1DJIA 4RDWA 4JIPA 2WWDA 2A7PA 3LV6A 4WUIA 4Q8TA 5HJXA 2W91A 3LBMA 4H6EA 3CHFA 1GQNA 2HK0A 4LQ1A 1UBPC 3UXAA 4GNJA 4AISA 1NOWA 3K5XA 3QV7A 3GNNA 4KPLA 4QIUA 3LY0A 3GUGA 3QQWA 6XIAA 3QZ6A 3T6CA 3LK6A 3IJ9A 3GXNA 3N2BA 4EXAA 2PDNA 1AL8A 1VLIA 3MSYA 1Q6FA 1FWEC 3E2VA 3P8JA 4HCHA 3C61A 1XR2A 5DCDA 4YIWA 4RXFA 1YTKA 2CLLA 4H9ZA 5CZ0A 7PTDA 2QUMA 3CIWA 1ONRA 2PDIA 4IQDA 3TJXA 3B40A 2P3ZA 4C90A 3G8RA 3FX4A 1TTIA 3PUOA 2WZTA 5CPMA 1S2VA 3FK4A 3SGUA 2ALDA 5A8OA 1QPKA 3KS5A 4LYPA 2HRWA 5FEZA 3TTYA 4RZ6A 2VT0A 1J0HA 3GKFA 3FJNA 3LX9A 3PM6A 4CNNA 2HROA 1F8IA 2V81A 3PFMA 2HXTA 1QK2A 1I45A 2ABAA 2E09A 5GJPA 4L1GA 2P53A 1EJXC 4GX8A 1OC5A 2ALRA 4PMUA 3EPOA 1NWRA 4M7SA 4GPNA 4LWWA 4HPHA 1F2JA 2JE8A 2GJLA 4KW2A 1J01A 1CGVA 1TX2A 5TAOA 4QLLA 1B9ZA 1B2YA 3C2FA 1KXQA 3W0KA 5F2IA 2QXWA 1F74A 2R24A 3ABZA 3V5FA 1LOSA 5A6AA 5FJOA 4KEUA 3CUFA 2ZFAA 1SW0A 5M17A 4JCLA 5HOSA 1JCTA 4K1WA 3G0XA 2E6YA 1GZ1A 1FP8A 3EDDA 1CLXA 5CGMA 1IF2A 1VD6A 3ITLA 1X8FA 2QJIA 1JXJA 4C7GA 2CITA 3M0XA 3NZQA 4C6QA 3KWSA 3RM9A 4E3VA 4NJIA 1XRTA 1B3XA 2BLEA 3S5SA 1R3VA 3UXLA 3ICJA 3KFTA 4H9UA 5FI8A 2GDQA 3BZJA 2DIKA 2YLLA 4MWAE 2UY5A 4HZ7A 5AC5A 1CLKA 3SRHA 3PBYA 1SFLA 5IHSA 4NYYA 2PP3A 1IR2A 3QV6A 4DBSA 3RGTA 2Y0FA 2JQXA 4JTGA 2CBVA 1BXCA 3WBYA 3STCA 3L4WA 5HMDA 2A85A 3CUXA 3QPEA 4OWGA 3UWYA 2QEZA 5LZLA 3IVSA 2HSAA 4JIRA 1XD1A 1F61A 4MYXA 5A8GA 1VBUA 4L4LA 1VB9A 1XYMA 2Z1VA 3W76A 3PZ9A 3Q2DA 3IGXA 5C54A 3T55A 3BCJA 4JBRA 2WNZA 4MFEA 2WBKA 3CHDA 5D2XA 4UWMA 4R9OA 2XH7A 1JZ5A 3QPZA 1J0KA 2QULA 4Q8WA 3P82A 3W28A 1E3XA 5I5RA 1W91A 4W4QA 3T2QA 4JKLA 4RZ4A 1A0CA 1PBGA 4LX4A 1RH9A 1VRXA 2GLKA 1EP3A 2FVKA 2NZLA 1EJUC 1LQ2A 2F84A 3DGBA 5IBXC 1J4EA 2CBIA 2DIEA 3GG1A 4IX0A 1H11A 4NQ1A 4POCA 1UPMB 1V6UA 4W85A 1GOIA 1N2VA 2NWRA 4AZ5A 1KFKA 4HHPA 5A6MA 3W38A 3MV01 3M6DA 1DTUA 2POTA 1EQCA 5F2MA 2VEIA 4WJXA 1UHVA 3B9EA 3RDKA 4P8VA 1PAMA 1O4UA 3MHGA 1XINA 3BLOA 1PEZA 3CGTA 3FYPA 2X1UA 1IGWA 1R3RA 1TPVA 2Y61A 4JTKA 4B5XA 3KRBA 4S39A 2YL9A 4O1DA 5AOUA 3BSHA 3MCMA 4NAEB 3DDMA 3C2RA 4GKTA 3W6LA 3IUHA 1HG3A 1LT7A 3BLEA 1WPCA 1QWGA 2VI0A 2EPLX 1GVSA 4FZIA 4ZBCA 5T91A 1JR1A 1XRVA 4DWSB 1OD8A 1V3LA 5A6TC 1CI1A 1AFSA 2QT3A 5HQMA 3KOYA 4D2JA 4LEFA 4J2PA 5C0QA 3BMVA 4DF1A 2GYIA 1OIMA 4DWSC 2ZXBA 4GK8A 4JR5A 3I6TA 2ZDSA 3NCOA 4LBSA 3ITGA 1VFTA 3VTRA 1N7KA 3C2EA 3C52A 1RY0A 2ZQ0A 3HMJG 5MHBA 3N2TA 5L9FA 4Z2LA 3AWOA 2TRSA 4US6A 4N42A 3D5HA 3KRZA 4ICNA 4M3PA 1J5TA 2GJXA 1R9YA 1QPRA 1SZEA 3PBWA 3AIVA 3TTOA 2J7HA 1JDFA 1IXPA 3NXFA 2KX9A 1JF5A 2HDJA 3WUEA 4AZBA 4V28A 1H1ZA 2XFFA 3B3DA 3EXRA 4LTSA 3M4HA 1QHPA 2CLIA 4AD1A 3P80A 2PB1A 3C2YA 4IQLA 1W56A 4GVHA 4I7VA 2H8XA 1VKFA 3SUSA 1FFRA 2BOGX 1BPLB 4O1AA 3MVIA 1JEZA 3UT0A 1E5JA 1XYZA 3RYSA 1BYCA 4GVFA 4GACA 4ILSA 2PTWA 3AICA 2PRLA 3W7OA 1VJIA 4ZEPA 4YCPA 2ISWA 2ZBTA 3VPLA 2VX7A 4KCUA 3CQKA 1SR9A 3SGZA 3FV9A 3BSMA 3W74A 2AAAA 1W3KA 3NL6A 3ZO9A 4R88A 3UPWA 3DFOA 2D2GA 2FHFA 2NX3A 2ZUUA 3TXZA 2CC0A 2XU2A 4M51A 4XAZA 2AMXA 3RXZA 1SPQA 2W63A 4ROQA 4QDMA 2D20A 1P6CA 5FKYA 1AODA 2TSYA 3CBWA 3IVTA 4NILA 2EEXA 4NHVA 5DRCA 4UB9A 1WXJA 4AY8A 7ENLA 4JTDA 3AU6A 3EDJA 3WEZA 3V1PA 3WYZA 2J62A 3BGGA 2E4TA 3LHUA 4LF2A 2XIMA 4W7VA 4LH8A 4O14A 4XAPA 4LY8A 5HWMA 4C6FA 5E9AA 1TUXA 2XSXA 2W0UA 2Y85A 4RE2A 4HPXA 5LHFA 2I5QA 3S6TA 3SRDA 3VGHA 5JBFA 3WNMA 1HJQA 3MVTA 3W4RA 4FEZA 3GDMA 3BO9A 4LNCA 3PTDA 3VA8A 4QJ1A 3ANUA 8XIMA 1I1WA 1TR1A 1XRFA 4KFOA 1DBTA 5HK4A 4HJWA 5FJPA 1IT7A 1GOOA 4J3SA 3M0LA 3K46A 1OFPA 1A3XA 1XPYA 4JTQA 1P43A 2X05A 1QUMA 4KF1A 3B0YA 2VEPA 4O0KA 5FL1A 5U7SA 1SZRA 3QY7A 4CNUA 5TQLA 3SR7A 2W5FA 3WBWA 2AQWA 1ME7A 4IJRA 1VLWA 2E9BA 1W1PA 1KLYA 4WDXA 4PMJA 2P3EA 1E3ZA 3P14A 3W9ZA 6XIMA 3GXMA 5G1YA 3H4GA 1OFQA 4F3HA 4L64A 4XO7A 1DEDA 4MB1A 1OFOA 4HZ6A 2FLIA 3LN3A 1PUDA 3UR7A 3OOQA 2QAPA 1J10A 5K2ZA 3ZQ9A 1KO0A 3G1XA 3BAKA 3VZXA 4WRHA 3PPHA 2ACRA 4EACA 1QU4A 5LA1A 4J3TA 3DI1A 1MNSA 4ZA0A 2JEQA 3GTIA 1H62A 1O5QA 3L4YA 3QHMA 5A8PA 2XSBA 3VAVA 1E6PA 3KVKA 1KC7A 4ROPA 4D6CA 3T0AA 4KWWA 2WSKA 3WK2A 2FGBA 4IUGA 5FJUA 5AC6A 1GNXA 3S1VA 4GLEA 3OLIA 1QK0A 3TYAA 3PTKA 3GNDA 3JVAA 3A4XA 2IPJA 1JYVA 2NXIA 1UH2A 1JCMP 1S2AA 3N3TA 2HK1A 3NQFA 4JN7A 2HEJA 3R7MA 4H4IA 1UG6A 4WSKA 4JYFA 4IM4A 3EAUA 3CMFA 3G18A 1WKFA 4K7VA 1H51A 4XAGA 2WW5A 5AHLA 4D6JA 4G5DA 3GR4A 4HJFA 5AHMA 5CC3A 4AZ6A 4XQ6A 1B3YA 1TJ1A 5DLCA 4HGXA 3IV8A 5G4HC 1ZBWA 5AZ1A 4NZ1A 4LNYA 2V3EA 4FIRA 3LM3A 3QLLA 1AVAA 1AZ1A 1O5RA 2EKGA 3URAA 4AVOA 1S5MA 1VC4A 3BL3A 4R85A 5AHEA 4GIAA 2WHMA 5C2GA 2OTDA 1BWLA 4ERGA 2A79A 2QMJA 3S4TA 2I16A 4CQCA 2EF9A 1JGIA 4PMZA 4BWLA 1LUCA 3DFTA 1ISZA 4X22A 3ALGA 5IM51 4GI9A 1VYRA 4O8AA 3WJSA 3U57A 1KM4A 3HQNA 1UKSA 4TX6A 3DYMA 2O92A 3L2IA 1R38A 4Q7BA 4AIBA 4F0KA 1ZAIA 1H2JA 1GQJA 1OGGA 4ACYA 1K9EA 4OBTA 1GUVA 3ONCA 4DXKA 3A23A 1P0BA 2WSYA 4W84A 3QGKC 1ZPTA 1UCWA 2D22A 3VKCA 1DPMA 1TPB1 2VZVA 3ES8A 3ZSSA 2WM1A 1M03A 2WJEA 1G6CA 1M41A 5HA7A 4ADSA 5HINA 2BSLA 4WGHA 1R46A 1HW6A 3TV8A 1MNZA 1BRLA 2ISSA 1TMHA 1XLHA 4Y2WA 4DY1A 3CAVA 1XHGA 4CNSA 1XP3A 1FXPA 4N6EA 3HFYA 1I2RA 3TTSA 4EPDC 3PZTA 1OIFA 4ZQOA 2HVMA 3SUWA 3UJFA 2XIJA 3YPIA 4PZVA 3ABOA 3N9KA 1TWDA 3BG9A 1ELSA 2CYGA 4U3AA 4NZ3A 1W3HA 3CQHA 3SAZA 1MMFA 3RCYA 3EWDA 2HPIA 4UTJA 1OF8A 1V02A 4UTTA 3NR0A 2YDQA 3NQ2A 4H01A 1FUYA 1MRQA 1W1VA 4CU6A 2IPWA 4M29A 3B8UA 2NWSA 1Z3NA 3SO7A 3W2KA 2EJ1A 3IIOA 3IIZA 5CH9A 1FCUA 1TB3A 3FYYA 3W1LA 4A35A 2D24A 4G2DA 1S38A 3FJ6A 2QPSA 2FQIA 4KIRA 5IDZA 1IXNA 3EDEA 4H8VA 5TIMA 3WLLA 2WQPA 1XUZA 2OSXA 2RHGA 2X30A 4ES4A 2CLEA 3DEQA 3MYPA 1AZ2A 3PWIA 1RLDA 4S3GA 4B5TA 2PDGA 4Z0SA 3EZ4A 4PTNA 1J8VA 1FWJC 3QYSA 2AAMA 4Q6JA 3A24A 3QC3A 2VRQA 3GDKA 4D6IA 4KCTA 5A1AA 4R7OA 3LBOA 3C0JA 3NQ6A 4FNQA 1XLDA 3CHVA 2VRJA 5RUBA 2A7RA 1OX4B 4NXSA 3LHWA 4FR1A 5DCBA 3DKJA 5IRPA 3MU7A 2YB1A 1THFD 1VFHA 2WJDA 4JTFA 3SCPA 2PI6A 2EBNA 1AK5A 4AWTA 4CVWA 1LM1A 2WYSA 5EA9A 1LBMA 3M7SA 4AD2A 1KW1A 2NQZA 5C7HA 2DV0A 3M5XA 4I9TA 4NAFA 4RNFA 2VRKA 4D6GA 3MSGA 3KLKA 1BVWA 3U48A 4WGXA 2YA1A 2EG8A 3E49A 4OBRA 5G1TA 2YPIA 2G37A 3E0IA 3UXKA 1JPKA 1RK5A 2OOFA 3EOUA 4R53A 3WLQA 3M0JA 3HPSA 1RBLA 1KV5A 5A5WA 4O1BA 1I2OA 1ITQA 3EX1A 1S46A 2PUZA 2OLHA 5CEWA 2WLYA 4GZEA 1AD1A 4NSBA 3PUEA 2QCHA 1GONA 4GQRA 1QI3A 4I7UA 3NL5A 1PIGA 1QHOA 1N8FA 4JEJA 2J25A 4CEUC 3P62A 3BK0A 4LANA 4IGSA 2FTWA 1E4IA 3MMTA 2WKGA 4NT0A 2F6XA 4WF7A 2I56A 3OODA 4GZIA 4TX8A 5DRIA 3L4XA 1JUEA 5HJLA 3D0CA 1O60A 4MLJA 3QY6A 4HU8A 2PLCA 5K9XA 4BS0A 1GYMA 1JDAA 5DCEA 3USZA 1Q4WA 1XLLA 7TAAA 3T40A 1Q2SA 1T7LA 1NF7A 1J93A 4UFKA 5H2ZA 1P7TB 2XH2A 3VGGA 3PZUA 1Q5MA 2DSZA 5DMNA 4G7EB 3GR8A 3OZYA 3GDBA 2OT1A 1QATA 1MW2A 3MDWA 2AMGA 5CBJA 2SFPA 5CPTA 1GOMA 1ZJAA 4H83A 1K03A 4HOZA 1EQPA 3TWAA 1OSEA 2RGLA 1MSSA 5AVNA 2DZXA 4A2RA 3QY8A 1NIUA 1MDLA 2QIWA 3TJLA 2XYLA 1OG0A 1SO4A 5A8NA 1K9DA 4HT3A 1YBQB 1HKVA 2FFIA 3A5FA 4FK9A 3PSWA 3QKEA 2OEMA 3QEZA 1MI3A 3AHTA 2CLOA 2GJPA 1RALA 1BTMA 1OCBA 1IT8A 2DUXA 2OKOA 3LRMA 1QNPA 2YBTA 4RZBA 3KUMA 4QNEA 3QM3A 1K8XA 3EDKA 4ZQRA 4HP5A 4NJJA 3GC2A 5C2CA 1J0YA 4P8XA 4LGXA 3PTMA 4LJ3A 5CPNA 2BV9A 3TTQA 1FWWA 2WZHA 1CGTA 4HHLA 5FF0A 3GXFA 1ICSA 1OB0A 2CLFA 1MQRA 2OQHA 1L8NA 4RE4A 1F3WA 3GC5A 3ALFA 2CWXA 2P0OA 1B0IA 4GCAA 1JQXA 4EAYA 3KBMA 4L6DA 1G67A 1GVQA 3QOMA 2QCDB 4E38A 4PMRA 3IAPA 4GI4A 1BG4A 3B8TA 4PL2A 1IT0A 3AALA 3I3BA 4MMWA 4C5ZA 5A2CA 2C18A 1WBJA 5JH1A 3K8LA 4MWAD 1QBAA 4Q7NA 1WQ5A 4X60A 4OZOA 3WEMA 1Q6QA 3QBUA 4H04A 4E8GA 2QR6A 1OX5A 2I57A 3DOPA 4O0QA 1JIBA 2ZZ5A 4AEEA 1RBAA 1YMYA 3C3UA 3WMSA 1QHZA 4EF8A 2D3LA 3UXDA 3VFLA 1H7NA 1PO9A 1QNVA 4JEQA 1E56A 1WX0A 2Y8KA 5D32A 3FJ4A 1HKJA 2X09A 4V1XA 4WLCA 4BZYA 1OF6A 2HQAA 3GW0A 3TAOA 2I9UA 2GSJA 1W3TA 1PCWA 3VD5A 2HE5A 4S3AA 2ZX6A 4INFA 3WQWA 3TA9A 4Z2HA 5J5RA 4JN6A 4PSPA 3WL1A 2R1LA 5KEZA 2ZKMX 3O15A 5HBFA 5JMUA 4Z08A 1OG6A 4XX6A 4O1CA 3B9AA 1CXEA 4WR3A 3VOFA 3W02A 3U2CA 2IKJA 4Q33A 2Q01A 3WQ6A 3N29A 4GABA 4HMCA 2CXEA 1BG9A 1FQ0A 2PFHA 4HA1A 3QSRA 3MI6A 1UH4A 2GK1B 5I0DA 1WXYA 1V7AA 1YDYA 5FEXA 1O66A 2A3HA 1PZ2A 4Y9MA 3GIYA 1ZP3A 3ZFHA 1GPWA 1OVDA 4RW5A 4Q6XA 1IEIA 1Q45A 2CKRA 3BLPX 3RJYA 1WDPA 5F4XA 3A9BA 3S8HA 5AC4A 3SN0A 1FH8A 4FLQA 4EPEC 1XH2A 2WMIB 4LUIA 2ZCGA 4XKYA 2X0SA 4MTVA 4OKDA 3RUBL 2QNEA 5LGZA 2V5JA 4Q22A 1B90A 3W7RA 4JDBA 1XIMA 3CUZA 2PWEA 3TSDA 5I77A 3HPFA 2DZVA 3OB8A 4HHHA 3SDOA 2IW0A 1RXOB 3AIWA 1E6ZA 4GYJA 1PKLA 3V18A 1VBJA 4LB4A 1MZHA 3AS1A 3NYZA 3CAQA 3MUCA 3W3OA 5M2FX 1E0VA 2C6QA 5BMWA 3RX2A 1E1CA 1DHKA 3TSBA 5FCZA 3PN8A 3RF9A 4MKVA 2OODA 3BDKA 3C3NA 2GSEA 1RJQA 1TMQA 4U5KA 3ANYA 5CLWA 3OPSA 3GZ3A 4RV3A 4MIMA 3A4WA 1WP6A 1TIMA 2OSWA 2NUYA 5D2YA 1NDZA 4DYEA 1KXTA 1CXKA 2E8ZA 3EOEA 1RD5A 3HJEA 5D02A 5F1VA 4JFUA 1FOBA 1MYRA 3EWCA 1V3KA 4JFVA 1GQLA 1XLAA 1VFOA 4GJIA 4GYPA 3BAYA 3EWUA 1JYXA 3E74A 4IF2A 4GFIA 4LYRA 4Z0JA 1FTXA 3PZMA 1KWGA 3I7SA 1JRBA 5C5YA 3S2NA 7TIMA 1QFEA 3W2MA 3JUGA 3GIPA 1XH1A 1QPQA 4PTDA 3S9YA 4U28A 4RKAA 4XIMA 3A47A 4LXFA 3DC0A 3IVUA 1GWJA 1BXBA 2H8ZA 9RUBA 1ZBVA 1EYEA 4QLKA 5U4NA 1Q6RA 4CGTA 4LU0A 3LLXA 4XSLA 4W8LA 4MUZA 1TE6A 4O8RA 3W1PA 4JIHA 2ZIDA 2YB4A 1QNSA 5CCZA 1YX1A 3H7UA 2ABBA 1IYXA 1HX0A 1XIGA 4LBRA 3OZPA 4OUIA 1N82A 3U0HA 1Y5WA 3R5EA 5MF5A 3WD4A 3DN5A 2OKTA 3FDKA 4NX5A 4OU1A 5BU6A 3QR1A 5D2TA 4QM1A 1Z48A 3QLDA 1NDVA 1JPHA 3MC5A 2GQ9A 9CGTA 4JY8A 2GGGA 3VKJA 2PSNA 3UZ5A 1C8XA 1NOUA 1UR0A 4JTTA 4K68A 3STPA 1XBYA 2XTKA 3WK0A 1CWYA 3UBPC 1SFSA 2VX6A 1XS2A 1S5VA 1JPMA 2QHAA 3RPMA 2VD8A 1X8CA 1FKXA 1NF0A 2CEQA 1GOQA 2VYOA 3S0CA 1ICQA 2J7CA 2R6OA 4EWND 3UD6A 4DM1A 4IT1A 5D04C 3DHDA 5I23A 5EFDA 3IJLA 4FIQA 5IFPA 4W88A 1ZS2A 2A7NA 4MJZA 2E7FA 1NARA 4LRTA 1HL9A 1YPIA 4M19A 2C1HA 2YL6A 5AHIA 1LF1A 3MP5A 3SIMA 4PUDA 4M81A 3WCZA 1QW9A 4WY0F 4I90A 3NVDA 2EPNA 4REQB 5T9BG 1R3WA 4ACZB 3EX3A 3IIVA 4J27A 4YMZA 3RLGA 3HZ3A 1F6KA 2VVSA 1Y5XA 1QI0A 2Y89A 3AZSA 1RK6A 3T8LA 4QXIA 1OFEA 2PWDA 5J8LA 1XI3A 3BOFA 5EY5A 3ZVHB 1U33A 4L7ZA 5B7YA 4PR4A 4EWJA 1CGUA 3VIPA 4F48A 1ZAJA 3S5ZA 4J9JA 5DMLA 3IACA 4ZO6A 2DZPA 4DJEA 2ZX8A 1FCQA 1K02A 4NU7A 3W22A 3MUAA 3VGDA 4IPPA 3OZOA 1HJXA 1EJSC 3A3HA 2B4GA 3TU9A 4RDYA 1NQ6A 1EKOA 1YXDA 3CM4A 2NQLA 4H9YA 3VOJA 4HMEA 2YFOA 3MP4A 1RQBA 3SCVA 3DIPA 2ZXQA 4UTUA 2P8BA 3GTNA 4LOCA 3UU0A 4MZ8A 1B3ZA 1SR0A 1AJ0A 1EWDA 3NSMA 3SB0A 4Z42C 3RRXA 4IFRA 2WVVA 3T78A 2NV2A 3VMNA 4FNTA 3BC9A 3MUIA 4RUBA 1V77A 3K1GA 2MANA 4CCZA 4GUGA 1TPEA 1IEQA 4XVEA 4PMVA 2BMBA 1IWPA 5DELA 3VABA 2Z29A 3KVLA 5DN1A 3WZ0E 4ZL1A 3LQGA 3N9SA 2GPTA 2TPSA 2E5CA 1SYTA 2XVLA 5CQ1A 2X1IA 1BYBA 4GJJA 1XFCA 3WLTA 1US2A 2BY0A 4NZCA 2VM8A 1UC5A 4FS9A 3KP0A 1SZGA 2CLKA 2DVTA 2OSYA 3FCPA 1MEHA 3SY1A 1RQEA 4YYCA 1V6YA 1AD4A 3O6DA 4NP7A 3S2CA 3IS4A 3DG6A 2BODX 3ARUA 1FRBA 2PDBA 4KIEA 5AFDA 1US3A 1Y8BA 4O4WA 3KZPA 4M6PA 3WNPA 4PYSA 2QJGA 1DVJA 3M0KA 1REQA 4ECLA 6ENLA 4H41A 3II1A 5K4XA 1PKNA 2Z2BA 4HNTA 1UD2A 4IIGA 3GH7A 2IKIA 4ORIA 1CBGA 1LWJA 3SUVA 3BMXA 1UC4A 5E6YA 4E4PA 3OVPA 5E0CA 5G4EA 2DVUA 4OVXA 4PTMA 3M41A 1CZ1A 5CSRA 3RG6A 1EYWA 1EL3A 3ARZA 4OHQA 2OPJA 5DT5A 4HKPA 2CKSA 1R30A 4PULA 1NU5A 2IXVA 3KHDA 2X0HA 1PZ1A 1UUQA 3E6EA 3G5EA 2NVAA 5K4ZA 3FY1A 3LM7A 3LU2A 4GUFA 1A80A 3NSXA 2V3FA 5FSDC 2VHLA 2R1KA 1TX0A 1W3LA 1XISA 3PJXA 4PUNA 3TX9A 1E1FA 3I3EA 1LL6A 3AS2A 1ISXA 1D8WA 2AKZA 4UTHA 1HO4A 1XSJA 2XDFA 1GW1A 1UROA 2GGEA 4ICCX 1EHAA 4X9SA 3L2LA 1LL7A 3HB9A 2Y7DA 1DIKA 3R25A 3K8KA 2BHYA 1E9YB 4F40A 4LAMA 5C9WA 4RLIA 4KRZA 4A3HA 4Z1AA 1VIWA 1WCGA 2G50A 1FWGC 3GB6A 1W9BM 4PRTA 3B4UA 3S3GA 4NJHA 3ZOAA 2BGNE 1QAPA 4WXYA 4DJFA 3KL0A 4XZIA 2DUZA 4UFMA 1IEVA 1FCVA 4C6MA 2HWGA 3G1AA 1UA3A 4ZSTA 2WK2A 3EWZA 1W1TA 4ZODA 4MJMA 5ABEA 3TN6A 1LBLA 3SCOA 4CUCA 4B15A 2WSRA 2CCRA 4DRSA 1HKMA 4JQ3A 3WQOA 1W2VA 2EXOA 3NAVA 3UVAA 2OR2A 1D7FA 1JZ7A 3MUY1 2DT1A 3PJTA 3MCOA 4X0NA 4JTCA 3RNDA 2GZXA 3ZLGA 3IARA 4FXSA 3PB0A 1U5JA 1WKEA 1K6AA 2XFRA 1XCWA 1E51A 2UY3A 4M8UA 4O53A 4MWAB 3WK1A 4RR4A 1BHGA 2EGZA 1BSLA 1TYGA 1TWZA 1XD0A 2KZHA 3I7RA 4O17A 4U4MA 4MPQA 1R5YA 2E6DA 2QDGA 1Q2RA 3W37A 4MWAC 1U22A 2I1OA 4JQAA 3R0UA 4J28A 1WBHA 1GEHA 1XCFA 3CT2A 2ZWZA 5ABFB 3KOZA 1T40A 3SJNA 3D46A 3MBDA 2VZSA 2V5LA 4HA4A 1RVGA 2PDYA 3UWVA 4GNVA 1A4MA 1ODUA 4DAFA 2W67A 4RDVA 5FAJA 3VD4A 4GUJA 5FOOA 5I02A 3UJSA 3Q65A 3GG8A 3SY8A 1KGXA 3ZJKA 3T2OA 4DBUA 4PRWA 3W24A 4GFSA 1LDCA 1E70M 1EWEA 4IIFA 1YPFA 4AHOA 1EF3A 2V30A 4N4PA 1Q4NX 1BLIA 4JGDA 1HVXA 1GG0A 4WVXA 2V2CA 3QGAC 2Z27A 4UNLA 1QWKA 3WUBA 3C2VA 3S2MA 1P48A 2GSHA 1JG9A 1GKQA 2VJXA 3QMTA 4FF7A 3KVJA 2VGBA 3GU2A 2CESA 2ZOXA 2GJRA 3A12A 3PBMA 4W9TA 2Y7EA 2OOGA 1DYSA 4H2HA 2HISA 1YW1A 1MFVA 4MZYA 3K8MA 4FP1A 3MA8A 1WXZA 1W3IA 3EWWA 4O16A 4QGCA 5E09A 4LAZA 1KWKA 5XIMA 4P8WA 1JUKA 2NQHA 3B0XA 4DJFD 3OGSA 1JD7A 2IQTA 2PDKA 2QGYA 2WC7A 4CD5A 1A49A 1XYBA 1ZTVA 3WDHA 4D71A 3LMZA 2C0AA 3R0KA 1UMLA 4NUWA 1GGOA 1ITXA 4GA8A 2UBPC 1G94A 4CLMA 3EOSA 2ZTJA 3IJ6A 3N3MA 3NUKA 3INPA 2A5HA 4HOXA 3LTSA 2QJNA 2C79A 1CXIA 1MUWA 1V3IA 1QVBA 1EJRC 1LRQA 3UYIA 1C90A 4MHBA 5CXPA 3MW7A 3W29A 1OK4A 1TPH1 1FH7A 1ADSA 1S2WA 2C8NA 4BY3A 3O05A 3MZ2A 1ZFJA 4YWSA 3EBVA 2H9AB 1ZJIA 2PTXA 5ECUA 3AXIA 1TPUA 1A5MC 2PWVA 4WKAA 3TZNA 2NSXA 5I09A 3NFUA 5LIXX 1OFDA 4JDYA 1ZALA 1XC6A 3SN4A 3E0FA 2H6RA 3F4VA 1GJUA 4A8IA 2OGJA 2NQ5A 4YVXA 2J24A 4CEXC 3WQDA 1VGAA 1XIBA 5C6MA 3CMJA 5I3DA 3W7KA 3VE9A 3N12A 4US5D 3LQLA 2DP3A 3KDOA 4Z1BA 1CW2A 4H2CA 5K3VA 2HMCA 3NZGA 4JHMA 1T8QA 2IUZA 4MAVA 2NLIA 3L21A 3ZXWA 4TV6A 2NQJA 5HQLA 2J88A 7REQB 3EMCA 1XQKA 4HNNA 3MJYA 2FFCA 3NWRA 2EKCA 4LSBA 2W62A 2J8FA 2Z26A 3PNZA 3HG5A 4KS0A 2BNJA 1TZ7A 5CJNA 3CAKA 2BFGA 3VVGA 1LG1A 5IBXA 2RUSA 2CETA 4WDUA 1RCXB 1PS9A 2JIWA 4JNYA 1DE5A 4AWEA 3MWAA 1ZQ5A 3P81A 2FH8A 4QE1A 1UKOA 2RFGA 3BQ6A 4LAOA 4A21A 3UWQA 1W6TA 1L6GA 3NPVA 1UWUA 3W7GA 5HDRA 4LCSA 2VUYA 1VIZA 3AOFA 4LCRA 3OEXA 2P10A 1GTHA 3L4VA 3GDLA 3TNOA 2BTMA 4Z1YA 3LGDA 2PWHA 3PHAA 5FL0A 1GKRA 4MADA 4UUIA 4DIAA 3ZM8A 3M47A 3DFNA 1WDQA 3AWNA 5F4WA 1P0NA 2O9TA 4XBSA 1F5ZA 4NAEA 4XAFA 4FXRA 3FA5A 1JAKA 3G1VA 5H1WA 5TNVA 1GOXA 2RJGA 4O18A 4KT2A 3TW9A 4ZR8A 1XW8A 1A5BA 4OOZA 3MB9A 5KZDA 4L9ZA 3UXIA 3N14A 1KBJA 4DWSA 4CU8A 1W31A 4U3CA 1TCMA 4MKSA 1WNOA 1GPFA 4TVUA 4PB5A 3TAKA 4S3DA 1W1YA 4IGHA 3T9PA 1PZ3A 3W85A 2DIJA 1NFPA 5D9PA 3ZIZA 3H53A 3VMOA 1HJSA 4C6BA 4NYUA 5GQBA 3WLKX 3CYJA 4ZSUA 4HCDA 2E9MA 1ML1A 4EE9A 3H21A 2WJFA 4PGLA 3SCTA 4BI6A 4L4PA 4WZHA 5FF2A 5LIYX 3C86A 1KCZA 4UIOA 1QW7A 4WIWA 1JYWA 4QNWA 3VIOA 1EZWA 3CPUA 3VX1A 2VVNA 2ASHA 4JX6A 1XM3A 4PUMA 5E0KA 5CZJA 2WC4A 1QNRA 4E2OA 4NASA 3EB2A 3JZEA 2V69A 1Y7VA 3AHVA 1QJWA 2GDUA 3M1ZA 2HTMA 4QQ3A 3OA3A 1VEOA 4UTWC 1M5WA 5EMMA 3LPOA 1W3JA 3GSMA 2RDTA 5M5DA 1Q7ZA 2VELA 3UP8A 3WBEA 3NZ1A 1JULA 2NXGA 4B3ZA 2IPFA 4GVIA 1FKWA 1J2WA 2VD9A 5CAKA 1XBZA 1OGBA 3HPAA 5FJJA 2UY2A 2ATMA 5DMYA 2ZRZA 1UOKA 1PPIA 4Q8UA 4IHCA 2BY1A 1CXHA 3S46A 2DH2A 4O12A 4PUKA 3RO8A 1A3WA 3E5PA 3GNXA 4H8HA 1OYBA 4IOTA 4JXCA 4L1XA 3KBJA 3QW3A 3DX5A 4LV9A 4CCCA 4P61A 3W7LA 4ZTXA 4GIRA 1E9ZB 3DFQA 4AC1X 4M6VA 3WD0A 5F2GA 1EBHA 1QRQA 3UGVA 2FPTA 2GWGA 3MKVA 3P5YA 1AH3A 4HD5A 2DSUA 1NWUA 2PDXA 4UBPC 2ZADA 3CPRA 2X1SA 4UFHA 5M03A 4DUXA 1UZ4A 1SJCA 3QFEA 4G8TA 3UR2A 2Q09A 3BPWA 3WQFA 1V3JA 3L9CA 4AIOA 2PCQA 5BWFA 1C92A 4P8UA 2X41A 3GDRA 4YJ5A 4MAZA 4MFDA 3NURA 2OEKA 1ZNNA 1TPWA 1VBRA 3B9OA 2F2HA 3M07A 4BCEA 3XIMA 4AF0B 4L65A 1S3TC 4YLWA 1WZKA 2WVUA 3GXIA 3VYLA 3OVQA 3WDJA 4FX7A 1AW1A 2OX4A 4WJEA 5C7VA 3AYRA 3H12A 3XINA 4TMCA 1X6NA 4MG4A 3P67A 4ADTA 3GDTA 3H55A 4IFKB 3I10A 2Z25A 2CW6A 3CWNA 2I7GA 3ZMRA 3NEVA 2G0WA 4JTRA 4ZFCA 4S23A 6REQB 4C6IA 4B5WA 2XG9A 1O94A 3E38A 2OYKA 3KBWA 1TJ0A 3AROA 2WQDA 3PPGA 3T08A 1H49A 3R89A 4AXNA 3CH0A 2A4AA 3CQIA 3ITOA 3E0LA 3VNZA 3T44A 5EMUA 1HP4A 4HPNA 2XGBA 5DT7A 1ALDA 1KFWA 4GJ1A 1XX1A 2V8ZA 5CJMA 3D47A 4JX4A 4GZ7A 2Y8VA 4BEUA 3EA2A 2E1WA 2G4FA 2EHHA 3NDYA 2ZZ6A 5HUOA 1QMLA 3W6MA 1L9WA 3WH7A 4PMYA 1X96A 2J27A 2JKAA 1I2PA 4PH6A 3AMGA 1UWAA 4DPPA 3GHTA 3R94A 3WFAA 2Q02A 4D8LA 3DENA 4JKKA 4JNMA 1BWKA 1H0GA 4PTWA 5I00A 4ZOBA 3GD6A 1PV8A 3NJ3A 3UYCA 4QROA 1C3FA 1ESWA 1X1ZA 4N4QA 4GE8A 4KH2A 3U2EA 1Q65A 4FF5A 3FVDA 3W2UA 1UD3A 3H2FA 3TC6A 2J7FA 4LCQA 1F9CA 3SN1A 3WQ5A 5BRQA 3HO8A 4GMEA 1FP9A 4LT9A 1UOZA 3CV2A 3K4AA 3UZYA 3DFYA 2B7PA 1PX8A 2YYUA 1PYMA 4CN4A 4C60A 4F8XA 3RU6A 1X1NA 3NQBA 4UZSA 3MTWA 2W9MA 2NLYA 3ZT5A 1DJWA 2BGSA 3U4AA 1CCWB 3VM5A 3BANA 3HGSA 4FLSA 1LL4A 1JCYA 4J35A 3KOXA 3GFYA 3HIJA 1XCXA 4ATDA 2X8RA 3SCNA 1TKKA 2GGJA 3OZMA 2YCKX 2NX9A 5CC6A 4O0ZA 3LZ5A 1ZY9A 3PAOA 1DV7A 1JCNA 4M80A 2Z4GA 3W7HA 5T9CE 1WZLA 2Z6IA 1FWHC 1TRDA 3N15A 4S3FA 3K1DA 3W7EA 3HBLA 4E6MA 3WQCA 4KCWA 7XIMA 1AQFA 1B4EA 2TMDA 5LGXA 1F4AA 2FZ8A 5REQB 4A8RA 5AYYA 1ICPA 4PC8A 2FH6A 4J3VA 5A69A 2OGYA 1NY1A 2G97A 1KV8A 1ZU8A 3JRKA 3QHOA 3UY8A 4NZFA 3EB3A 2WPBA 3QN3A 4ALDA 3W7NA 2CNCA 5E70A 3V0UA 4BR1A 2HVOA 1UP0A 3CJPA 3NXLA 1P1MA 2MNRA 4QJ3B 1VFMA 1H41A 4P7OA 1US0A 3B0VC 4L1WA 3VD9A 4QFUA 3UVIA 4FOUA 1JNDA 3GNOA 5A6JA 4GY1A 3I6EA 3N6QA 4QS5A 2F61A 1NP2A 4V1YA 1XIEA 1CYGA 1FBAA 3EX4A 3CZLA 1JNEA 4I3GA 1SUXA 3L5LA 3W1UA 1POKA 1JD9A 1F3TA 1N55A 2VC9A 3W6YA 1BYAA 2YA0A 3P84A 1KD0A 3S5YA 3QQ1A 3WLNA 1SU5A 4DZIA 2CZDA 2R94A 5G1MA 2BHUA 5H6HA 2A3LA 4FPSA 1NFGA 1W5OA 1NTHA 3C0QA 2W61A 1GKPA 1PE1A 5AYZA 4Z2KA 1V0MA 2Q6ZA 1XKYA 3TCSA 3A9IA 2DVXA 4BQ4A 3SGGA 1EJ7L 5EPDA 5LNRA 1VCGA 1M7JA 4Y9OA 4BI5A 3H26A 4QISA 1MZRA 3ZJ7A 3ZVIA 4UMAA 3S47A 2QUUA 3HGJA 3N04A 2R1PA 1XJBA 2OT0A 2Z6JA 1IXQA 3NPWA 2WHLA 1TZ9A 3LEPA 4ADUA 1LT8A 1OX4A 2D2HA 4DPQA 5LNWA 1V3HA 2WM0A 3N34A 3TSMA 2OELA 5EYWA 4C7DA 1VRDA 3Q37A 4AZHA 1XLCA 2XIIA 3NGFA 3UZXA 4D1JA 4URIA 4WKFA 1OT1A 2OWWA 3OW1A 4GXPA 2ZVRA 3VUPA 2BOFX 2YX0A 1XXXA 4D9PA 2CWNA 2QPUA 1WE5A 3KHJA 3B06A 3EOOA 3VC6A 3WF3A 3V75A 1MXDA 4XD6A 4ML4A 3TE9A 2ZZ2A 5EFFA 4LC8A 4ENLA 4A4AA 4W5UA 5HPOA 1VJSA 3L4TA 2O9PA 2ACUA 3NM3A 3Q94A 3MSDA 3ARVA 2G4JA 1M6JA 1VYPX 3PZIA 1Q6LA 1QI5A 2QF7A 3T7VA 5I06A 1DWGM 1I60A 4UR9A 4PFMA 4X63A 1FWFC 4P7LA 3P6LA 1R85A 3BWWA 3HTWA 3ITTA 2VC6A 4OQVA 5EL1A 4IMEA 4IP4A 3OBKA 1X6LA 3H7VA 4XUGA 3NZPA 4CNOA 1M65A 1J96A 2V5CA 4DZAA 2UV8G 5BOFA 3BV4A 1CPUA 2FB3A 2J7BA 3CXOA 2QJMA 3AIRA 3E12A 3SW6A 3BW4A 3KE0A 4X2PA 1FWIC 5LA2A 4B2DA 1RJPA 1U1UA 4PUUA 1E40A 3UZZA 1H5VA 2J75A 2E0PA 3D3AA 4I5XA 2CLPA 1KFJA 1GVYA 1VFSA 3FXYA 4S3CA 1AQMA 4LVFA 1UKPA 3AZRA 4LB3A 1P7TA 4JCMA 2XPKA 3P61A 5FF4A 3LI0A 4G7EA 5BU9A 4JAWA 2A3EA 1TO3A 2RDWA 4GYFA 4TQTA 3EXSA 1RPXA 1K9FA 2QV4A 4PE8A 2VCAA 4AAJA 1JDDA 3VE7A 3IUDA 4C6PA 3O16A 1FWSA 2QCEA 3R10A 1HJWA 4MB4A 4CVUA 4ZO7A 1EA0A 1JCJA 3URQA 4ZB2A 2DQWA 4X3ZA 3QPYA 4GIEA 1HTIA 4HMDA 3VI2A 1RCQA 4AUBA 1EBGA 3L66A 4Q4QA 1ECEA 1YBQA 3WDQA 4W7UA 3RITA 3G24A 3OTRA 3NDOA 3DI0A 2C15A 3LCIA 4XZNX 2OZTA 5DY2A 1UZ1A 1SW3A 3N11A 4H8UA 5JH2A 4LVGA 3S1GA 4DBWA 4EP8C 4Y96A 2VGFA 1FWBC 1KQYA 3GYEA 4D72A 3PUDA 2ADAA 1HT6A 1EIBA 2C14A 3GAYA 4S3BA 4OTKA 4AMCA 4HTYA 1NOFA 3IV3A 1I1XA 3SJ3A 3VKKA 2A6NA 3A5VA 5BWAA 2ZUVA 3KOWA 3R79A 3VOIA 4NJKA 2QJJA 4RPQA 3PS7A 2Q3RA 4HMNA 1MQQA 3RN6A 3KXQA 5CGTA 4HVXA 2REQB 3NGJA 1E0XA 4AIUA 3UERA 1OJXA 4DEFA 3CO4A 2PDWA 1ZSXA 1U1JA 1P6BA 3PANA 3UG3A 1I0DA 3STGA 4IPJA 1XQLA 2V9DA 5C9ZA 2QCDA 5EBAA 1FDJA 2RGMA 3EKZA 1QDSA 1EHNA 5EU9A 1V7YA 3S5OA 2VC7A 3WELA 4GBDA 1H50A 2E3ZA 3AHXA 1HN1A 1FH9A 2ZE0A 4B9ZA 3L4UA 2WB5A 2G3MA 2DJLA 4P5UA 4YTQA 1GVRA 4KWOA 1H3GA 4CCDA 1I2QA 1YNQA 2PBGA 1R9ZA 1Q85A 3L0NA 4CNTA 3MZNA 1E0WA 2NW0A 3THUA 4UC5A 4B2DD 5I6SA 2E1DA 3O2LA 4A8LA 3VZZA 2UY4A 2ZXDA 1ZB5A 4EF9A 1K1DA 2ZUTA 3GVQA 3CB8A 1P4CA 1FWAC 4GOAA 4RZ5A 2ZZ3A 2R91A 4G1NA 4AY1A 2VZUA 5A2AA 3R8RA 3I4KA 4K3ZA 1C93A 3C8NA 4X2RA 2WHKA 3RR4A 3GTFA 1MQPA 1RPKA 5CLTA 3NA8A 1B3VA 1AJ2A 2UWFA 4AZIA 4NI3A 3LV5A 1KTBA 3GZAA 3GXTA 3QV9A 5AKQA 1FDZA 1RJRA 5BXTA 2ZX7A 4WDWA 1L8PA 4H7VA 1ISWA 1W8GA 5LYRA 2RAGA 2GK1A 1KGUA 5HMSA 3W75A 1M7XA 4M6QA 4Y90A 5CPSA 3E0WA 4MKNA 2VFIA 1IXOA 1JZ2A 5CG7A 3BVJA 3A22A 4QR6A 3V0TA 1H61A 3BAIA 3WDRA 3IWPA 2ZZ7A 1GQIA 5TD4A 1SO3A 3ARRA 3KW3A 5EMKA 3PG8A 3WEOA 3P93A 3FOKA 3PVFA 4D8AA 4NL1A 2C7FA 4IWWA 4NNAA 2WMIA 3ZT7A 2FTYA 4UFJA 3R13A 4PL1A 3U7BA 3FN9A 4E2DA 2ZXAA 2XWEA 2O9OA 3OA5A 1MVYA 1VCVA 4PUEA 1XIIA 1PIFA 2XJ7A 1TWWA 3VCNA 3NO3A 2ZUWA 2JF6A 1CB2A 1J0ZA 3N1AA 4ICMA 3MY9A 3WJZA 1A0EA 1R0MA 1IEWA 2J66A 4XZMX 4LVAA 3CLMA 3RLUA 2XVGA 2VTFA 2WXDM 3A3WA 3ELFA 4QDPA 1NFBA 2W3ZA 1EXBA 1UWTA 1MRAA 3UA4A 4CD8A 5D30A 1KGWA 4KMQA 2Q71A 4BQ3A 3B9NA 2XH0A 3TJIA 4LPCA 3ARQA 2GWNA 5A95A 1ZCCA 3WLSA 4W93A 1EB3A 3ZYZA 3F2BA 4XVDA 3AYSA 2Y2WA 1W5MA 3T2PA 4O57A 3L5MA 6TIMA 2OX1A 4ZOEA 4ZO8A 1BGGA 2Z00A 5FSEC 3UA3A 4IG2B 3EKLA 4C7FA 3WQPA 4DVOA 4Y9AA 3FIGA 5LIUX 3VD3A 4PN2A 3VKBA 3TLQA 3TLLA 1AH4A 1R2SA 3A21A 1KR0A 2FZBA 1SGJA 3KTSA 1JZ6A 2E67A 1ZJHA 2DSKA 5LIWX 3ABXA 5FA5A 5AHNA 1OWQA 3FJLA 1V6WA 1UKQA 1Z41A 4FNSA 3M5VA 1X1OA 1W9VA 5F4SA 4DUWA 3VOHA 2D3NA 1XLJA 4WY0B 1BSIA 1EC8A 1RAKA 1BGAA 3MMUA 3RK8A 3WLPA 3RCNA 3A64A 4DJDC 2J74A 2PCEA 3MMWA 4DYKA 1Q6CA 2VENA 2XISA 3OHMB 1BKHA 2PDPA 4AD4A 3PBGA 1TA3B 1ZZMA 3WNOA 1IHIA 3ECQA 3ZZ1A 2BB0A 3TVAA 3ZJ6A 3A6OA 2GDVA 1GW9A 1UD6A 4JFTA 3TYZA 4XISA 2F6UA 3TFXA 3CMGA 1TREA 1RY8A 2RH9A 1KRCC 4W87A 1D3GA 1YDOA 5XIAA 4PCTA 5D33A 4XZ9A 1TWIA 1OC7A 3ZWSA 3BCFA 1TJ2A 2X0YA 2ZDRA 1V79A 3WSUA 5TF0A 4PCNA 1CT5A 1A4LA 1BQCA 1EJWC 4UQ9A 4B16A 1TWSA 5BXRA 1WKDA 2DT0A 3VGEA 3L65A 4B5VA 3VK5A 4JL1A 3LENA 2GQ8A 1ADOA 3PTQA 3WF0A 3VUSA 4Q4OA 3CZ8A 3GUWA 2V82A 2XM2A 4JFWA 4B90A 4QE5A 3NQ8A 2EPOA 1LG2A 1E1EA 5H8PA 4B5SA 2ZX9A 1IGSA 2QIIA 1G7UA 4G6CA 4UTMA 3LZ3A 3VDCA 3R12A 5KZMA 4N0RA 3TYBA 1JI1A 3S9ZA 4FHAA 1GJPA 4ZTYA 3W83A 3PK7A 4DO6A 4QSHA 4WSJA 4GYPC 4R34A 3KBSA 3VIJA 3AHZA 4PMQA 4GG9A 1CB7B 3QQ0A 1EOKA 4MM1A 4YVPA 2AGTA 3TMQA 1S1RA 4J1OA 4OUEA 1MW0A 4REQA 2VP8A 3SURA 3M5ZA 4ACZA 1AQ0A 1TG7A 3QVQA 4RNIA 3MO7A 4IGMA 3MBFA 1JL8A 3QW4B 1EEXA 1SFJA 3CL8A 4F0HA 2G41A 1VHCA 1LLZA 4PCSA 3VOCA 3SSJA 3FKKA 4B5NA 3CH9A 3ZVHA 3CEUA 1W54A 5A6BD 2X1TA 3WQGA 2A6LA 1CECA 2YJQA 1HKWA 1OABA 3W1NA 3OVRA 1EDTA 3TA6A 3BE7A 2D2JA 3PNUA 1YTEA 1V0NA 2JEPA 5FJIA 5HNUA 4UMCA 3AISA 1R8LA 4UNIA 1POJA 4QS6A 1W9PA 4FSAA 4IXXA 1AUSL 3DFSA 2ZWYA 1DL3A 4DI9A 4GKLA 3IJ7A 3CHCA 3KWXA 3ZLFA 1QCWA 1WAWA 3URBA 1HFBA 3NNTA 2QUNA 3E2SA 3OLDA 4Q8QA 5GVJA 2OG9A 2P50A 3SRKA 4QP0A 1C9DA 1KM0A 4JQ4A 2WZIA 1WAUA 3N4AA 5C9XA 3K30A 3EA3A 3KTCA 1V0KA 4AZCA 2PD9A 3OHIA 4AVFA 1ZBKA 2DT3A 5EB8A 3WNNA 3AS3A 1G01A 3RX3A 1ME9A 4W7WA 4L61A 4U2ZA 4NG3A 3LBCA 4L56A 4H8NA 1I8JA 4PBEA 1I75A 3D6NA 1ZJBA 3KL3A 3WQ8A 2YDRA 4AQLA 4KESA 1HP5A 1K7FA 4RE0A 4YTTA 3N19B 3HPZA 8A3HA 4LS2A 1ONEA 1SSGA 4IP5A 3ERPA 2FZMA 3ZR4A 1TTJA 3UJEA 2MUCA 3T05A 5CG0A 1HO1A 1R47A 4GGHA 1E0TA 3ZS4A 3KLLA 3UF9A 4I7WA 1WDRA 4A3QA 1KKOA 3LHYA 1YRRA 3F5JA 3C2OA 5D9MA 1OFBA 3WMCA 1C8QA 4TX9A 1TVPA 4F79A 5BXSA 3ZSTA 1V3MA 4JKMA 3LDVA 1ONWA 1R3TA 2VEGA 1RZMA 1D9EA 5HJYA 1AW2A 3T4CA 3TOYA 2YGYA 1OC6A 4JTIA 2WMGA 3WUFA 1WB0A 5J04A 1S3HA 1ITCA 2KAUC 1VZWA 2HS6A 1NELA 4XZHA 4DN1A 1GZJA 1R86A 2VO5A 2G95A 3TN3A 3P2VA 2XFWA 4ZQMA 2FPYA 1XBVA 2NV9A 3RX4A 3IK4A 1FHLA 3QV8A 4H9VA 3OG2A 1ONXA 1TVNA 4I6VA 2PURA 4OV4A 5FIPA 4OT7A 1C9WA 1J0IA 3SY5A 1LZOA 1LROA 5LIKX 1Z32X 2OZ0A 3HN3A 3Q67A 3VKAA 3UCQA 4ZQPA 2VC5A 1BFNA 2Y4SA 5JBDA 3GAKA 1Z42A 3KZSA 2QGHA 1O6IA 4UTLA 2E25A 2VDIA 3NQCA 4CQ8A 1OGSA 4JHZA 1TQJA 5CC5A 4H3DA 4XAYA 4LUTB 1VBHA 4CNPA 2YW3A 1R3QA 1DJNA 1FXQA 1M3UA 1UUOA 1XLMA 3W7JA 2D69A 2PWGA 4LS0A 2VFEA 5BW6A 3GC4A 2OZ3A 1K8CA 1V5XA 1VPYA 4K38A 4DZ5A 8TIMA 1PTDA 3W7IA 1K7EA 1IEXA 1LWIA 3GH5A 3E96A 2OFJA 1E72M 4MJ2A 5HR7A 4PODA 3MJMA 1K70A 3OQ8A 4UCFA 3UZWA 1UWRA 1EUNA 4IP7A 4Q32A 4AU0A 3I68A 3S1UA 1JRCA 1QXLA 1M04A 4ONVA 1UUMA 1PDZA 5MKGB 4B92A 5CBBA 2CBUA 1KKRA 2ZTKA 3UY7A 2Y70A 4UOZA 2J4GA 1K9TA 5KETA 3C0LA 4F66A 4QG6A 3GR7A 3BICA 4GINA 2YOCA 4OIFA 2NT0A 4XD5A 1W9DM 2YL5A 4C65A 3O07A 2YCEA 4GQBA 4PTVA 4G7FA 4MWAA 4CD7A 3ONBA 3VNLA 4AD5A 1ITUA 7A3HA 2ZE3A 3CUHA 2Y6ZA 5AYXA 1OEPA 3O7UA 3BGAA 1EGVA 1V4YA 4GNKB 3VNDA 4PEKA 3LCLA 1O68A 1K8YA 3MO4A 2GL5A 3SI9A 3G1YA