1P1XA

Comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase at 0.99A resolution.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
total genus 104
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1p1xA00
3LCXA 4WY0B 2E6AA 1ZY9A 4GWEA 4FB7A 3PSWA 1MO0A 2RDUA 4UFJA 1SO5A 2XFWA 4YCPA 3NQ8A 1V5XA 3F03K 1FCQA 3P8IA 4JN6A 2QJGA 2VFIA 5I3IA 1VYRA 4JX6A 5C5YA 1LYXA 1TPEA 3TE9A 2E1DA 1OFOA 1HL2A 3B06A 1EP2A 1WXJA 5G2WA 4O53A 2A85A 5CKSA 1KFLA 4NQ1A 3W2MA 2A7RA 4K6AA 2VENA 5D33A 3KOFA 3OG3A 2F84A 3LCFA 4CQ8A 5D38A 3B05A 4O15A 4QJ1A 1QOQA 1WYIA 2V2CA 1UB3A 3A5FA 2OJPA 4O1AA 4AHQA 2VFEA 2FIQA 3N3MA 4NX0A 1FCBA 4LY8A 7TIMA 4UTKA 5G5IA 3GDMA 3PSVA 1M5WA 3IIZA 4RK8A 1VCGA 2ZZ6A 5CG7A 2OCZA 1YADA 2B0MA 4FNSA 4NJJA 4GUGA 4I7VA 1VYPX 3R8RA 5D09A 5AC8A 1VRDA 3UZJA 4UR8A 2AQWA 2VFFA 1IGSA 4TX9A 4AH7A 3U8GA 4QISA 1WA3A 1P1XA 2ZTKA 4W9TA 2BXVA 4Z08A 1IIGA 4JTJA 3SFKA 3L21A 3EEGA 4K37A 3EX1A 2DZXA 3MI3A 1IIHA 3UNDA 1LCOA 5D2VA 3S5OA 2QDGA 5FESA 2Y70A 3W7KA 3F4NA 1JCJA 1KV5A 3R12A 4M5PA 3G0XA 3RK8A 5IBXA 1VHCA 3QM3A 3N73A 4K39A 5K9CA 3C2FA 2BSLA 3UXDA 2I9EA 3LV5A 1OFQA 1J2WA 1QPQA 2QR6A 2YSWA 1TJPA 2FDSA 4Z1AA 3W7EA 5LZLA 2BWGA 1UJPA 3BGGA 3GX9A 4AWUA 3NVTA 4CCCA 2J9ZA 5HWJA 1W54A 4FHAA 4AEOA 1G69A 3M5YA 2Y62A 5J5RA 5F2MA 1YXDA 3MBDA 1S5WA 3CM4A 3DKJA 3G3DA 4MZYA 4QITA 3PM6A 3TJLA 1I2QA 3TV8A 2NUWA 3W2UA 1F6PA 3TXVA 3ATYA 3KVMA 1VH7A 3NQEA 4FXSA 3ZS4A 3FIGA 3W7GA 4JTFA 3TUUA 2QJHA 1QCWA 1QFEA 2A7PA 3NQ7A 3LB0A 1ICPA 1VQTA 4PL2A 2B7QA 4Q4KA 2YW3A 3EKLA 1QPRA 4IMFA 5I3HA 5BOOA 2DJLA 1JJKA 1A50A 4Z1CA 1T99A 1K8ZA 3TW7A 2CZ5A 2CLEA 4L4LA 4JD4A 2ZA2A 3UWQA 1QWGA 2D73A 4NJKA 3HPZA 4JR5A 2OX1A 3CQ0A 1R2TA 4DO4A 4WUIA 4IWWA 5J5DA 2ZZ1A 1V7YA 4IJBA 5EL1A 3NNTA 2W6RA 5D2XA 3EXRA 2Y7DA 1PV8A 3VFLA 3PR2A 1P0NA 1QO5A 1ME7A 3JRKA 4UIOA 3EX4A 5EKYA 3EWZA 5AB3A 3GAYA 4LWWA 5G2HA 1IXOA 4Z0SA 1DL3A 3E0IA 3MMTA 4G1KA 3SGZA 4ADSA 4ZL1A 2QCHA 1G4TA 1YXYA 1ML1A 2DORA 2NWSA 3CTLA 1B3OA 5TQLA 3S1WA 4O11A 3W7CA 2FFCA 3GVGA 4EIVA 2VC6A 3AJXA 4OE7A 1DJNA 5DCEA 3WJZA 4FX6M 4L4MA 1YTEA 2JKPA 2RDWA 3L65A 1W1ZA 2V81A 4JXCA 1D3GA 4ONVA 3MI6A 3GR7A 2ABAA 3T55A 3GR8A 3IRDA 3S8HA 2QKFA 3TXZA 3O06A 4U28A 1YPIA 4M6QA 5D02A 4BWLA 1N7KA 1NAL1 1VPXA 3TNOA 1G4PA 3MWAA 3MO7A 4XQ6A 2CFFA 1RD5A 1AL7A 3DAQA 2ALDA 4NXKA 5D32A 5HWMA 1LOQA 3BARA 4QNWA 4DF0A 1K7EA 2WSRA 3LM7A 1B4EA 5BMWA 5AFDA 1XI3A 3WK0A 4A21A 2XN2A 5D2WA 4Q32A 2X16A 3MBFA 5H91A 2ISVA 4IQLA 4DF1A 3WJYA 5EBUA 4WXZA 2YYTA 2G96A 1GT8A 1OYAA 3HF3A 3QMRA 4WJEA 2GJNA 3MJYA 3NPXA 4RR4A 5BRBA 1O60A 1P5BA 3W6YA 2R14A 2Q3OA 3MW7A 4R33A 2WJZA 2FB2A 1AK5A 3OHIA 1KFBA 4J9JA 4MPQA 5DCBA 4MUZA 3M41A 2C19A 4KFNA 1LRNA 3QPYA 4O10A 1G6CA 1WDWA 3W7IA 1DQWA 3B0UX 1SUXA 2NZLA 3MHUA 3NGJA 4UMBA 3OVRA 3LRKA 4WY0A 1SW7A 5KZEA 2ZA1A 4NX5A 1ICQA 4DBDA 4LOCA 1WAUA 3MP5A 4MY9A 3THAA 1GPWA 4IPIA 2I14A 3WK1A 3W07A 3G1FA 4GBUA 3W87A 1VJIA 3DFOA 4BF9A 4LS2A 2ZRZA 5AYYA 1LBLA 1FDYA 1A5SA 2V8ZA 1I45A 2J24A 5CPOA 4K8HA 1H60A 1W5PA 2ZRVA 4O4VA 1OVDA 4PEKA 3H55A 2UV8G 2V2HA 2CWNA 3UZ5A 2C14A 3CIXA 3E49A 3C52A 5F1VA 4DBEA 2X1RA 1TTQA 3I7RA 2CZDA 4JIPA 2PRLA 1IXNA 5F2GA 1JULA 4HSNA 2YXGA 2V0TA 3KAOA 5U7SA 1T0OA 2JK2A 1LLWA 4UC5A 2ZZ2A 4UTUA 4GRSA 4RXGA 2QCLA 4LNYA 3TQ0A 2QJIA 3RLUA 4DXVA 1TIMA 2NXIA 1CW2A 4UFLA 1DHPA 1GOXA 3L0NA 4BWLC 3TK7A 3SECA 4ZQPA 3LTPA 2ABBA 3STCA 4X3ZA 5EYWA 5TBOA 1ONRA 1UUOA 1NVMA 2XN1A 3PF3A 4DQWA 2HSAA 2YW4A 4XUGA 1ALDA 2W0UA 5E0KA 1H1ZA 2CLLA 3DFQA 4NVTA 4JGDA 4HNTA 4E2DA 4NXSA 4I9AA 4IOTA 1SZFA 4FF7A 1YLVA 4OHQA 2C0AA 5U4NA 5LGZA 2EKCA 1OYCA 3OVQA 1U5JA 3KVKA 3GK0A 4K8EA 5DBTA 2A7NA 1JCMP 3W7LA 4RCXA 5BMXA 1SO6A 3BG9A 1UCWA 4LVAA 4X22A 4GJ1A 2ZCGA 4UTHA 3S1VA 4A22A 1WBHA 3WFAA 3C6CA 4LS1A 1C9DA 5CGQA 1EUNA 1KM2A 2E09A 3WJSA 1YYAA 2A5HA 4PODA 1W31A 4S2CA 1OK6A 5DELA 3W85A 3CPRA 1TO3A 4UXDA 3GNNA 3W1MA 4MIMA 5DXYA 3RLVA 4N9EA 1GQNA 1LOLA 3LRMA 1H7OA 2TRSA 3DFNA 3TQKA 1K7XA 3USBA 5I3FA 4QM1A 1SZGA 1KTBA 4DF2A 2ZRUA 1MZHA 1EWEA 2GVGA 3C2RA 5T26A 4UTMA 1XBXA 2X30A 3BW2A 4YCOA 3LHYA 5AHMA 3EKZA 2E5DA 2EGZA 3G3MA 4DPQA 3THQA 4NU7A 2ATSA 2NV2A 2NX9A 1A5CA 1AW2A 2C15A 5FF0A 2ZZ7A 3N19B 1KLZA 4AXKA 2DZSA 3NPVA 4CCDA 1NFBA 3P7YA 1G4SA 2HTMA 5DN1A 3W7QA 4HNUA 1GWJA 4MFDA 1TPUA 3O6CA 3G1VA 3W74A 1CI1A 1FX6A 5LNRA 3LV6A 4JY8A 5E1QA 1TQXA 4JNMA 4YMZA 1BTMA 2ZZ4A 3N9RA 4KWWA 3GDRA 2DJXA 3O16A 1LOSA 4H4IA 1F6KA 2Q8ZA 3TFXA 3W7PA 5DY3A 3P74A 3IGXA 1PVNA 3R13A 3R2GA 3LTYA 3T78A 3U6WA 3P84A 3S6DA 1XCFA 3W7JA 4K38A 1TPVA 3G22A 3TJXA 2OT0A 2GQ9A 4X9SA 4ZVJA 5HUPA 1MEHA 1DORA 4N9BA 4XWUA 2G95A 1EPXA 1DV7A 4WOQA 3L0KA 4ZQOA 5SWUA 1R47A 3IIVA 3MI2A 4RLIA 3FS2A 3WJXA 2Z6IA 2ZYFA 4O13A 3EWBX 2VFDA 1OK4A 4WOZA 1GTEA 1O5XA 1W56A 4CNNA 3HGJA 2FPVA 5HULA 3M0ZA 4KWVA 3N9SA 3KRUA 4AWSA 5I3GA 2NUYA 5FF4A 5L6UA 1THFD 3S5YA 3NQDA 5F2IA 3C2EA 3LGEA 4CCEA 2E6YA 1OJXA 2WO5A 5K9DA 4M7TA 5K3VA 1HUVA 3L5AA 2P0OA 3M5XA 3TAOA 5MHBA 1P4CA 2GQAA 2PRHA 2E6DA 3WJWA 4RJEA 3A5VA 2BX7A 5CPMA 3C8FA 4K36A 5D30A 1SO3A 3IIPA 3QSTA 2Y7EA 3BPWA 5HMSA 3L2IA 2PURA 3N2MA 3IIXA 4GNJA 3GXPA 2GUUA 3C3NA 3TIMA 1SO4A 2A4AA 3W1XA 1WBJA 3C2OA 3DFTA 4O12A 1NF0A 2V2DA 2VFHA 3DFPA 3NEVA 3IEBA 1ZJIA 1JCYA 3A21A 4UMCA 5D37A 5HWNA 4O14A 1B4KA 5KZDA 4CLMA 2Y61A 4ADTA 4UTTA 3I7SA 4Z0JA 4JTLA 5LGXA 3HO8A 3V1PA 3L68A 3L9CA 1ZCOA 2OMAA 2QF7A 5CZ0A 4O1CA 3G1AA 1R30A 1YPFA 1SSDA 4LRSA 4FXRA 3QF0A 2RFGA 3QC3A 4EVZA 3W7OA 3TAKA 2RDTA 1FCUA 3W1RA 1PHWA 4HNVA 1KBJA 4WY0F 3F1QA 3C2VA 1TPH1 3KVLA 3B0VC 3O6DA 4Z1BA 2OT1A 3PB0A 3GXTA 4LVDA 5AC6A 1DKWA 3SSJA 1H50A 1F7BA 4AMAA 2VEKA 4Z1DA 5KMYA 1KFCA 1TPC1 3A23A 2J9YA 4IUOA 2FQIA 1XBVA 3M1ZA 2AGKA 1GVQA 3PBYA 1ICSA 4BI6A 4Y90A 1TPWA 1BEUA 5LNVA 3N14A 2WKJA 3HG3A 3N2XA 1D9EA 2TSYA 2VELA 2DZPA 2A6LA 1JQXA 4X2RA 4O16A 1OX4A 3VNDA 3CWNA 1O4UA 3FA5A 1EA0A 4LVBA 3KRZA 5AHIA 1FBAA 1VR6A 3FOKA 3LX9A 2ISSA 2RHGA 1FWRA 3DFSA 1Z41A 3FLUA 2Z0IA 4IX0A 1N8FA 4ML9A 4OBTA 5AN7A 1PCWA 3IIOA 2WV8A 2C18A 2YFOA 2Y6ZA 2I1OA 3PUDA 1H61A 1FXQA 1JUEA 4FNQA 2H3BA 4UNKA 4O54A 1ZHAA 3RNDA 3LLDA 3LCHA 5HUOA 2H8ZA 2Z1BA 5AOUA 5BW6A 3DBPA 3QW3A 1HO1A 3NA8A 4N02A 1OABA 3MP3A 5FEWA 4MJMA 1RV8A 2A6NA 4OQVA 2IQTA 4FNTA 3G1DA 5K9XA 4UFHA 3N34A 4MLRA 3U2OA 2WSQA 4AVFA 1YTKA 5F4XA 1OFBA 3IGSA 3LXCA 1X1OA 4D2JA 4PL1A 2CLHA 5AHLA 4MOZA 5I3KA 4JYDA 4H3DA 2GJLA 4UTWC 3CWOX 4PA8A 4WZHA 3W76A 1TV7A 3CIWA 2J6XA 4TO8A 3L0GA 1AL8A 4JX4A 3A24A 1Q6LA 3TA6A 3GKFA 4O1BA 5HINA 1K8XA 5GVJA 3FJLA 1YTDA 5F4SA 3W7DA 3WK2A 4A29A 4JTSA 3P8JA 1XM3A 1ZALA 1SW0A 3FYOA 2V5BA 3PG8A 1HTIA 3UWVA 4OT7A 4JYFA 4EWND 1LRTA 5LSMA 2E5BA 2NWRA 1W5QA 4UMAA 3NQFA 2PC4A 3CT7A 1VZWA 1UBSA 3E02A 1ZNNA 3EB2A 3I6RA 1FY6A 4PC8A 1RQHA 3PS7A 4AF0A 4MLJA 2VOMA 3P62A 1KA9F 2BTMA 1XBZA 3EWYA 4JYEA 2AAMA 3P61A 1QDSA 1EX5A 1QPNA 4O18A 1P0KA 3NL3A 3LCGA 1C8VA 1IXPA 1LZOA 3NDOA 5CZJA 1Z48A 3T7VA 4K7VA 1YDOA 4M7SA 4HKPA 4MZ1A 5HR7A 1X7FA 1X1ZA 2VEIA 2A21A 2CU0A 2YDAA 1XDLA 3SJ3A 3DHDA 4AWTA 5ABTA 2W79A 2QCDA 4MY1A 2EF9A 4FX7A 2NX3A 2KZHA 3JS3A 3LHWA 4KFOA 3E96A 1OX5A 4RZ4A 3LERA 4TR9A 4N9DA 3LDVA 1TJRA 3CEPA 4GC4A 5LHFA 3S0CA 1AW1A 1EIXA 1OFRA 1PIIA 3W1QA 3TSDA 4A2RA 3UWYA 1EP3A 3S42A 4O8RA 3W22A 3D0CA 1WOBA 3ZFHA 2E6FA 3W23A 3TSBA 1JUKA 3HQ1A 4MJZA 1XUUA 2E68A 3M9YA 4MYXA 3P60A 4IMCA 4NZFA 2B7PA 2QAPA 3BK0A 4EF8A 3LOTA 3IVSA 3MYPA 3DU0A 5D04C 1SSGA 1O95A 1XFBA 5CPNA 1GTHA 2H90A 2YR1A 3HG2A 4PFMA 3NM3A 1B9BA 3SW6A 3K30A 1JQVA 1F05A 2H6RA 1CX9A 1Q6RA 1TV5A 4JEQA 3TH6A 4O19A 3VE7A 4NJIA 1DVJA 4FEZA 2G97A 1KM5A 3W3OA 3S5ZA 5KITA 3PBUA 3W1TA 3SI9A 3W7RA 4E2BA 1VC4A 2WNQA 3L5LA 3INPA 3NQVA 2QCGA 2JGYA 5AHEA 3ZWSA 2ZA3A 3LRLA 3OVPA 5KSWA 1JUBA 2DZVA 4UFIA 1ZAJA 5K2ZA 2NV1A 3CLMA 1QAPA 4C1KA 1DJQA 1OFPA 1RQBA 3GXNA 1FCVA 1RR2A 1F73A 2E5CA 4IGHA 1Q6QA 2ZDRA 2PRMA 3TC6A 1X8FA 3EX6A 4RV8A 2YYUA 4CNOA 1W5MA 2FPYA 4K7YA 4GUFA 1QR7A 1LM1A 4OU1A 2QAFA 1EEPA 1A5BA 4UFMA 5K4ZA 3LHUA 1TMHA 1H63A 2J9XA 2B7OA 5AHNA 4FX8A 3W7NA 5G1YA 3KX6A 4H6KA 1GYLA 2JKAA 1G7VA 1LTDA 5AYZA 4I7UA 4P61A 3P81A 2R94A 3B03A 4PH6A 2VEMA 3SY5A 3UWUA 2ZZ5A 1BKSA 1EB3A 4N6EA 5A5WA 3M5VA 2QUVA 1ZFJA 1I4NA 4ALDA 2VKZG 3QH2A 3NQGA 2B7NA 3TC7A 5LNWA 2X1SA 2GOUA 1SU5A 2CLFA 3QZEA 3HJZA 3PWAA 4LS0A 3NZRA 3LHVA 4U4MA 4NNBA 3KHJA 1UUMA 4KFPA 2QCFA 2DZUA 4AB4A 2QCCA 1BWKA 4JTEA 1GVOA 3NYZA 3ANYA 3PBWA 3FKKA 1SR9A 1Z44A 4DPPA 1VLWA 2PCQA 4BI5A 1LLZA 1SZEA 3M7WA 1TREA 2WNNA 1K3UA 3OBKA 4M6PA 3QPZA 3CB8A 5FF3A 1TQJA 2HMCA 1PE1A 3TSMA 1LRQA 1KBIA 4MYAA 1W8SA 1I8JA 5HR6A 1XDMA 4GE8A 4GFSA 2E77A 2GVJA 4NT0A 4TMBA 3TW6A 5LNUA 3BV4A 4XTDA 5EPDA 3ATZA 3WK3A 2R91A 1AMKA 2VXNA 3EWXA 5C2XA 3PC0A 4BR1A 4MKNA 1TTIA 1KFJA 1H7WA 1H1YA 5D05A 1GYNA 4UCGA 6ALDA 3W73A 5CPLA 3NXFA 3NQ2A 3M5ZA 3HGSA 1FWSA 1AW5A 4QSHA 5FI8A 3QMTA 3NOEA 4LUJA 1XXXA 5AYXA 4AHOA 3HG4A 3ABOA 2YZRA 4JY9A 3HGOA 2LLEA 3G0SA 3ZR4A 3UPBA 1TB3A 2G5WA 3NM1A 3QSRA 1F2JA 1S3HA 1PS9A 4UTIA 1L9WA 3ABQA 4IMEA 1J5TA 1J4EA 3A22A 3W88A 3TU9A 4XKYA 4POCA 4CNPA 3SIZA 1TTPA 1LDCA 5DLCA 2VEPA 3EWUA 3GDKA 4S1FA 5LKYA 3GYEA 1VS1A 4NNAA 1OX6A 3PULA 3W1LA 3DGRA 2Y7FA 4R34A 1KM6A 2R8WA 1G4EA 2O7SA 3C61A 3IVUA 5FEPA 1SW3A 4IX2A 1TRIA 2YCEA 4Y9AA 5D2YA 5FF2A 3GB6A 4LT9A 1D3HA 4IMDA 2CZEA 2HS6A 3HPXA 4MFEA 3TQVA 3SGUA 5G4WA 2XN0A 5H2ZA 1KM4A 3HMJG 4OWGA 1TPDA 3W75A 5G2IA 1TYGA 1RPXA 2J27A 1RZMA 3QEZA 2Q3RA 1TCDA 3STEA 3DXIA 2DU2A 4QQ3A 1I2RA 3LBMA 2V9DA 4Y96A 3PVFA 1FWTA 3BW4A 1TSIA 1MEIA 1FWNA 5C55A 5IM51 3O1NA 3EXTA 2YFNA 3O63A 3LHZA 1I2PA 4ICNA 3BO9A 4O0ZA 2Y63A 3BG5A 3KVJA 2QCDB 3JR2A 3GDLA 1EUAA 3EX2A 4UNLA 1W0MA 1VLIA 4O0KA 4BFAA 3W70A 1K02A 4JTUA 4WD0A 3W7MA 1MXSA 2TYSA 1AG1O 3TKFA 1SFJA 3QQ0A 3NL6A 3PAJA 1FDZA 3LCLA 5BNKA 4N4PA 2Y88A 3STFA 4O52A 3G1YA 1SZNA 2VFGA 1KM0A 2H3DA 4DELA 1W3TA 1WOAA 3QFEA 1K03A 1R2RA 5KZMA 5CSSA 1LORA 5HJLA 3P80A 1S5VA 3S1UA 1OYBA 2V30A 4JDYA 3W86A 2GVLA 1QOPA 1DQXA 3TROA 1QMLA 3BG3A 4RXFA 3IGUA 2CLKA 2RH9A 2WPBA 3LXAA 1C29A 3M47A 4WXYA 3UY7A 3P5ZA 1ZAIA 1VYSX 2B4GA 2ZZ3A 4N9CA 4TIMA 1W5OA 3ABSA 4JTTA 4GUIA 1N55A 2JKEA 3EWWA 2EPHA 1SQ7A 3HG5A 1JCNA 2F7FA 2O7QA 4GUJA 3W7HA 3UQNA 3RU6A 3M43A 3B4UA 1LROA 3W71A 5EA9A 3NZ1A 3PY2A 3LTSA 3O6YX 3FJ6A 1Q3NA 1MEWA 1WV2A 2Y85A 3UWZA 2WOQA 1W5NA 5FEXA 4HIBA 1F5ZA 1HFBA 4GUHA 1B57A 1O5KA 2WQPA 5TIMA 3LBCA 1H51A 4MY8A 1JRBA 5KINA 2A0NA 1W3IA 3L67A 1GVRA 3P5YA 2CW6A 2Y7GA 3NPWA 1Y0EA 2QCEA 4NJHA 3GKAA 4PTNA 3PBVA 4ZQMA 5I3JA 1G67A 4R53A 3GLCA 3I7QA 2TMDA 3GDTA 1T96A 6TIMA 2C13A 5CSRA 4AHPA 3G18A 4RKAA 1DBTA 2ZQ0A 1SPQA 3NQMA 2ZBTA 1WX0A 4UTLA 3DI1A 4XKYB 4XBKA 3AO0A 1OF6A 3PUEA 1FDJA 3QRHA 4LV4A 4RZ6A 4RZ5A 1KFKA 2ZRYA 2RKXA 3FKRA 4ADUA 4M19A 3HOJA 3HBLA 1QPOA 2DZWA 4FIRA 1OFAA 4HT3A 2CZFA 4LC6A 5LHEA 5AHFA 3W1NA 3G24A 1OX4B 4CQAA 1JRCA 3RF9A 2QCMA 4A2SA 3IV3A 1HO4A 2H8XA 3W2NA 2JGQA 1XL9A 1OF8A 3BGJA 4UTWA 3PUOA 5F4WA 4CQ9A 3B0PA 4JICA 3NAVA 4UUIA 1LBFA 3VCRA 3HGRA 4E0CA 3UXAA 4EF9A 1ADOA 2NXHA 1JVNA 5A8GA 2ZFAA 3TMLA 3QQ1A 5C54A 1FXPA 5FEZA 3RMJA 3MYOA 1GG0A 5EY5A 3UYCA 4HHPA 4OV4A 3O05A 2CLIA 3UY8A 2A1YA 3L5MA 4IPJA 3QMSA 1KW1A 4IXXA 1QO2A 1NF7A 1H5YA 3UWWA 1MSSA 1HG3A 4NUWA 4E38A 4WX2A 3FFSA 5C6MA 3VI2A 3SR7A 1ZAHA 4FNUA 3MP4A 3BLFA 3C0JA 4GXMA 3NO5A 4NNCA 4LC8A 3GAKA 4WQ6A 2EAWA 3PG9A 4DEFA 1BWLA 4ZQRA 1E51A 3C56A 3QYQA 2NXGA 3TR2A 4UFKA 4YXGA 4LW7A 1TTJA 3H54A 3TDFA 1DOSA 1R46A 2X2GA 3LCWA 1XKYA 2P10A 2CLOA 4JTIA 4FIQA 4JTGA 1XUZA 5EMUA 3TX9A 2X1UA 3G8RA 3I68A 4FNPA 3BLIA 2DZTA 3LCIA 5FF7A 8TIMA 2ZRXA 4O57A 4O4WA 4O1DA 5D2TA 2C1HA 4IMGA 1IXQA 1H7XA 1OG0A 2ZTJA 4MZ8A 4NJGA 1OHLA 4YL2A 3ZWTA 4LVFA 2QUTA 4IXHA 4EOUA 4S2BA 2GPTA 1F76A 1I2OA 3FYPA 1R2SA 2J88A 2QUUA 3CU2A 3T40A 3NR0A 3S9YA 3YPIA 4DO6A 4QIUA 1PHQA 4R7JA 4Y8FA 1Q45A 3NG3A 3Q2DA 4LTSA 1K7FA 1SFLA 1NSJA 3UD6A 1GVFA 4QNEA 1VCVA 2NUXA 1YXCA 5HQEA 3HPSA 1KTNA 1GVSA 3F4WA 3E9AA 1TPFA 1A5AA 3W2LA 1EP1A 3MHFA 3R5EA 4XBSA 3KFTA 5KTLA 2C16A 4BI7A 3A9IA 1KV8A 4I7WA 1H62A 4FO4A 1UASA 4ZQNA 4XTIA 3ABRA 1M7OA 1T8XA 4HPJA 3T44A 1JCXA 1GEQA 4BK9A 1W37A 1KM3A 5DBUA 5F1UA 2C6QA 4PCFA 1O94A 4UTTC 5DXXA 1YDVA 3RFAA 2YGYA 3OIXA 2C3ZA 5D03A 4JDBA 5E93A 1GZGA 3NQ6A 3S1XA 4TMCA 4TU1A 4FNRA 3CC1A 2OZ0A 4O28A 1NEYA 3OA3A 2FB3A 3P82A 2EHHA 3NL2A 3NQAA 3MUXA 3PB2A 3DZ1A 3W72A 1L6SA 4QAIA 1KFEA 4XZ9A 5F2LA 3HIJA 3LI0A 4Y6GA 3FEMA 3DKLA 4DO5A 1U83A 1M6JA 4A3UA 2QCNA 2Q8LA 4UTJA 2QDHA 4JIQA 1LP6A 3I65A 1GJPA 2WNZA 1KM1A 3DI0A 3V75A 3W83A 2P1FA 3BLEA 4MVAA 4M6VA 3GIYA 3H53A 4YWIA 1PL9A 1FUYA 1K8YA 1L6YA 3TCEA 3O8AA 1XC4A 1VGAA 3B04A 3G0UA 1X6UA 4RX0A 5LNSA 2FPTA 3MHGA 5K7JA 3KRSA 3W1PA 3P67A 4JTHA 5DY2A 1RVGA 4JS3A 3C4UA 2V82A 1JR1A 3G8EA 4HSOA 4JX5A 5G4EA 3B8DA 2NLIA 4P2VA 2Y89A 4OV9A 2HS8A 3R89A 1WQ5A 3TFCA 1ME9A 5DCDA 5K4XA 4N2YA 1JCLA 1TV8A 1I2NA 1ZENA 1YDNA 1A53A 2WSYA 4HNNA 3ELFA 1OFDA 1VHNA 2FLIA 3DENA 3T4CA 1FQ0A 3DH7A 1H7PA 4O17A 4AF0B 5L9FA 4LUIA 3Q37A 2ZRWA 1ME8A 1F74A 3M44A 2X1TA 3BW3A 5CZTA 3W2JA 2BLEA 1XBYA 4N4QA 2CLMA 1IF2A 4LVGA 2A2IA 4HPXA 4OGZA 3GNDA 3W9ZA 3W2KA 1EWDA 1Q6OA 1G7UA 3EX3A 3LLFA 4HN4A 4N6FA 4YLWA 1Z42A 3CHVA 1LBMA 4UR7A 1KTCA 3G1SA 3L66A 1QNVA 3NPUA 2YPIA 1KLYA 3M6YA 4B5NA 2QEZA 2YX0A 4LU0A 4ZMGA 2Z6JA 1PCKA 1H7NA 3O07A 3CEUA 1W3NA 4ZQCA 3BVJA 3HB9A 3W1UA 3IVTA 2TPSA 3S5NA 3STGA 2DP3A 4KKXA 4ZZ9A 4LRTA 3W1AA 3LXBA 4ORIA 3VE9A 3SZ8A 1OFEA 3LHTA 3Q94A 3O15A 1TRDA 1RQEA 3TMQA 4AAJA 4C1LA 1TPB1 2FJKA 1L6WA 3M16A 1FWWA 2NX1A 2Z2UA 3G1HA 3QJAA 5IBXC 4Q33A 3UPWA 5AC7A 2ATMA 5G1TA 3DHFA 3NQCA 3OEXA 1GG1A 5CZSA 1L2UA 3W84A 3E12A 2FTPA 2JBMA 4O50A 3KXQA 3NL5A 2V5LA 2GQ8A 4JTKA 2ISWA 4ORMA 3EXSA 1VCFA 3G1XA 2PE4A 1M7PA 1S5TA 3LI1A 1H7RA 4LV9A 5HNRA 3Q58A 3QW4B 3GZ3A 2BZNA 4NZJA 3VKJA
chains in the Genus database with same CATH superfamily
1J0HA 4GWEA 4FB7A 1E1CB 3PN8A 5JBDA 1V5XA 3BLPX 2PMQA 3TA9A 5I3IA 1VYRA 4JHZA 4KW2A 3CT2A 5C5YA 1EDGA 3GVRA 1VRXA 3ARQA 2AGTA 4NAEB 3BZJA 3AS3A 4R85A 4K6AA 4P7LA 3KOFA 3OG3A 4DYJA 3S46A 3A4XA 4LUYA 4QJ1A 1UB3A 1RLCL 2CBIA 2YOCA 3GRIA 4A4AA 3N3MA 4DAFA 2PEVA 1S3TC 1KRAC 1WE5A 5JUVA 2ZXBA 4H6QA 5G5IA 3FN9A 1OZQA 3CO8A 2J8TA 3IIZA 3RDKA 3D3AA 2OCZA 4KRUA 4BF5A 3ZSTA 3FVDA 1NWRA 1YADA 2IKJA 4B5UA 5D09A 1VYPX 3N6HA 3TN3A 1IGSA 4KCTA 1AQFA 3CV6A 4F0SA 2D24A 4ZB5A 1HXJA 4IISA 3ARTA 1RK6A 1P1XA 2ZTKA 3F5LA 2J78A 4QHRA 1CGXA 3AWNA 1IIHA 1TVLA 5CEWA 3BLOA 2Y70A 1JCJA 2D3NA 4J3VA 1KV5A 1KCZA 3G0XA 3GHTA 4OOZA 3QM3A 4KRZA 4IG2B 1DIOA 4K39A 4IPNB 5K9CA 3E38A 3CGTA 3LV5A 3FJNA 3F2CA 1VPYA 1RHCA 2BWGA 3FX4A 1XCXA 3BGGA 3UJSA 3UU0A 3W81A 1G5AA 2Q6ZA 3NVTA 4CCCA 1MQPA 3H7RA 3DG6A 3M5YA 3K13A 1YXDA 3AXMA 3CM4A 4BZYA 3V3WA 3WF3A 2X42A 4QITA 1GQKA 3K4DA 2NSXA 1TV4A 3PM6A 3AIVA 3DN5A 3PZOA 5LA1A 1UIPA 3TXVA 3SN4A 1DE5A 3ATYA 1DWFM 1VH7A 1VFUA 3EA3A 4MDPA 2QJHA 3RHGA 1CB7B 3PK7A 1CGWA 2I9UA 2J47A 3A47A 3NQ7A 2VUNA 1ICPA 3AICA 2YW3A 1QPRA 2OWXA 3N15A 3GTFA 4L6DA 5BOOA 2VP8A 4LYRA 1HKIA 3SN0A 2D20A 4WDWA 2ZICA 2J6VA 2CLEA 3VGGA 1C8QA 2ZA2A 3UWQA 2D73A 1BSLA 3BMWA 3WNLA 4W93A 4YYFA 1XSIA 4IQDA 5J5DA 5FJUA 1E5JA 5D2XA 1HJWA 2Y7DA 1PV8A 3GU2A 1EYEA 1GZJA 3PR2A 3VFLA 4JIEA 1RJRA 3U7VA 1ME7A 3JRKA 1TE1A 2CCRA 5DQPA 1TJ1A 3WDJA 5IRPA 2WWCA 1IXOA 4FK9A 4HPGA 1QW7A 3MMTA 2WB5A 3W29A 3R0DA 2Z28A 4WKFA 1U2YA 4ZOBA 1B3OA 2YL9A 1JI2A 2WVUA 4WDXA 2I57A 3AJXA 3EMQA 3GTXA 3ISIX 1H11A 1MFUA 1DJNA 2FZDA 2Y8KA 4HTBA 4BQ3A 4L4MA 1YTEA 3CUGA 1GOMA 2DFAA 3MI6A 3GR7A 3WLOA 1BXBA 4AMCA 3TXZA 1LWIA 2R82A 4U28A 1YPIA 1DJGA 4A3RA 1F8IA 3LZ3A 1AZ1A 2HWGA 3EOEA 3TNOA 3MWAA 3KTXA 2W63A 2CFFA 3DAQA 3S4TA 1J6OA 5HWMA 5CQ1A 1PKNA 4PYSA 3WQ8A 4QNWA 4DF0A 3LM7A 5BMWA 4J35A 3CZEA 5DT7A 1CWYA 3WK0A 2XN2A 3ERPA 5D2WA 3MBFA 4Q8NA 4L80A 1G9HA 3GNPA 3WJYA 4WXZA 2G96A 1LL7A 4WJEA 1DIEA 1FP9A 3MJYA 4RR4A 3MUCA 1O7AA 1XYBA 3W6YA 3KL0A 1UZ1A 2Q3OA 4K3ZA 4R33A 1UR8A 2EBNA 3P0WA 1UROA 1AK5A 1A4MA 3OHIA 4J9JA 3IUHA 4MPQA 5B7ZA 5I0DA 2C19A 4KFNA 3QPYA 4O10A 3MHUA 2CXGA 1V0NA 2XIBA 2ZA1A 3HPAA 2BS9A 4DBDA 3H2MA 2XWDA 4LOCA 3MP5A 2IKIA 2P8BA 1GPWA 2I14A 1FH9A 2VM8A 3DFOA 1GOIA 5JIWA 2HBVA 1I45A 2J24A 5CPOA 5AVNA 2YBTA 2ZRVA 4YTUA 3H55A 2X8RA 2UV8G 4GA8A 2CWNA 2X0HA 4YS1A 3AQUA 4DBEA 1PSCA 3MZ2A 1TTQA 3I7RA 2OYMA 2CZDA 3ALFA 4JIPA 3SUVA 1IXNA 2D0HA 3LUTA 3A4WA 4QG9A 4B5VA 5A6SA 4D6HA 1JULA 3JU2A 1A47A 2YXGA 1XD0A 2F61A 1XIMA 3KAOA 4UC5A 2QJIA 3UBPC 2VGBA 3AYSA 3D46A 3WQFA 3L0NA 2XPKA 4UBPC 3URNA 3E5PA 3KCJA 5EYWA 5TBOA 2XN1A 1WKEA 1JPIA 2XIJA 2IKGA 3SBFA 2W0UA 3W6LA 3DFQA 4NVTA 3M0LA 4HNTA 2V5CA 4E2DA 4IOTA 4FF7A 4QX4A 4OHQA 3ZO9A 5U4NA 2EKCA 1XISA 3EDKA 5DMNA 5DMMA 3WQWA 4F2UA 3MWCA 1TV2A 2PUZA 4X22A 1PTDA 5A3HA 2ZCGA 3VUSA 4J27A 3C6CA 5A8MA 1C9DA 1RA0A 5LIXX 1KM2A 1W31A 4R9OA 3LD5A 3UNTA 4C7GA 4JTAA 1VBGA 5M1TA 3PJTA 2G37A 3W1MA 1ZS2A 4KEVA 5DXYA 1GQNA 3VILA 1LOLA 1XINA 2A3EA 2TRSA 3G77A 3TQKA 2QLYA 3TOPA 4UB9A 3USBA 5FAJA 4QM1A 3T6CA 1F4AA 1S2VA 2GVGA 3C2RA 4V1XA 1M3UA 1Q13A 3GFYA 4IIEA 2ZOXA 4GINA 4NKCA 3UZYA 3MS8A 4LCSA 4E3VA 5FF0A 3UT0A 1NFBA 3VD9A 4DBUA 2NVCA 3ES8A 3QHNA 3O6CA 5FAGA 2DZBA 3W74A 5C71A 4HK7A 3VM5A 4GIRA 4Q7BA 4U2YA 3WH9A 2NQJA 3CASA 4YMZA 4UCFA 4BCEA 1MDRA 1Q6EA 4IT1A 2J7DA 4H4IA 2ZUTA 2Q8ZA 4EWJA 4FLQA 1PVNA 3S6DA 3RN6A 1XCFA 1RK5A 4EANA 4EPBC 4X9SA 5HUPA 1DORA 1LQAA 4W4QA 5I7GA 5B7YA 4R88A 5SWUA 5ECUA 3T0CA 5I00A 1R47A 3IIVA 2J75A 1ONXA 2GDUA 1W1A1 2BY2A 2WC7A 2INFA 2ZYFA 1YE4A 3EWBX 2PGFA 1OK4A 3O6AA 1GTEA 1EEXA 1O5XA 1BGGA 2G3MA 4KWVA 1E73M 3BGAA 1A80A 3KRUA 4AWSA 5I3GA 5L6UA 3S5YA 2P3EA 3NQDA 2A3HA 1OJXA 2WO5A 3I3BA 4MB5A 1UMYA 5K9DA 3VDGA 4XSLA 4E2OA 1R9ZA 3ARXA 3TAOA 2HDJA 2OQLA 4RJEA 3ZZ1A 1TCMA 5D30A 1WUFA 1KD0A 5BXPA 4NYUA 3L2IA 1XLMA 8A3HA 1RP8A 4GNJA 3C3NA 3W1XA 1U1UA 4FSAA 3WQGA 1MNSA 4LCQA 2IMRA 3IEBA 4FOJA 1JCYA 4LEQA 5D37A 4EPDC 4JCMA 3PBMA 4O14A 2VJXA 2Y61A 3I7SA 1TUXA 2GJRA 1DEDA 1ZCOA 2QJMA 5HBFA 3VOIA 2QF7A 2Z1XA 2H9AA 3SUSA 2J7GA 3QC3A 4GQQA 1X1NA 1YX1A 3W7OA 4F0RA 1B5TA 1A5UA 1DYSA 1PHWA 4DWSB 4DJEA 2G4JA 3N9KA 3F1QA 1TPH1 2PDQA 2OO6A 4PMOA 4Z1BA 3QHMA 4XAFA 2WVVA 4JQ4A 4LVDA 1NARA 3CAVA 3VC6A 1H50A 3U9IA 2UZ9A 4Z1DA 1KFCA 3A23A 1JZ6A 3HZ3A 2FQIA 3WD4A 9XIMA 1ZCCA 3VOCA 4BI6A 3VM7A 2DT3A 1BEUA 3TP4A 3LMYA 3NXLA 3WZ0E 3N2XA 2TSYA 4A6GA 3GE7A 1BRLB 2VWSA 2VELA 3NWRA 1OADA 1XSJA 3WD2A 2Q02A 4LJ3A 1V0LA 1OX4A 5H1WA 4L61A 3VNDA 3CWNA 2BHZA 4LF1A 4LUTB 4HPHA 3LX9A 1V02E 4LYPA 1Z41A 4ROPA 1F6YA 1X6NA 4IX0A 1N8FA 3IJ9A 1CPUA 1UWUA 3P14A 3SQLA 2C18A 5C9XA 1TVPA 2AQOA 4YVXA 3MY9A 4MG4A 3T09A 1O6IA 2Y6ZA 3W0KA 3S83A 4PMYA 4FNQA 4S23A 3RNDA 1OGSA 3UA4A 2Z1BA 5BW6A 1ITUA 4DUXA 3LNMA 2DSWA 1XIIA 1HO1A 3QW3A 3DHPA 5HMFA 4MJMA 1RV8A 4PMXA 4OQVA 1KCXA 3SN1A 4XAZA 1KXTA 3N34A 1Z9AA 3BAWA 3GNRA 5F4XA 3OHMB 2DVTA 1OFBA 3LXCA 1AD1A 1Q8JA 1IWPA 2VQTA 4MOZA 5I3KA 3CWOX 4PA8A 3CIWA 1IR2A 3CUZA 1W91A 4TV5A 3BCFA 4TO8A 3ARUA 4HHMA 1K8XA 5GVJA 2Q8XA 3FJLA 1ECQA 3VZYA 2XZ7A 3W7DA 3WK2A 2FMNA 4A29A 2F9RA 2GK1A 1K77A 1BG9A 1VBHA 3FYOA 4GI9A 1RCQA 2CHNA 4OT7A 3LPGA 1OGGA 2G3IA 2PTWA 4KWUA 4UMAA 3WENA 3WDRA 2EEXA 1GOOA 1TKKA 2PC4A 1E3ZA 5FA5A 3E02A 5JXQA 1XIGA 3AXXA 4LEFA 2VR4A 2BTMA 4MHBA 3CUIA 5IOBA 3HV9A 1CGYA 2I56A 1QPNA 1Y5WA 4DAIA 2W62A 1B3VA 3ME3A 1TV3A 1ADSA 3IARA 1JFXA 1BRLA 4K1GA 6XIMA 1W9UA 4LYKA 5CZJA 4S3CA 2YKKA 4HKPA 4MZ1A 5HR7A 1RBAA 1X1ZA 4PR4A 4MADA 1XDLA 2ISDA 3SJ3A 5I09A 2QCDA 3S6TA 3DHUA 4FX7A 1EJVC 2KZHA 4JL2A 2XVLA 3JS3A 5DMLA 4QAWA 4J3XA 4JKKA 1TJRA 4DJDC 4GC4A 4ERGA 5JVLA 3DX5A 4DWSA 3S0CA 4MWAE 4DUWA 3W37A 1AW1A 2FH8A 6ENLA 5J04A 3W22A 3D0CA 2OYLA 3WELA 3HQ1A 2OZ8A 4MJZA 3VPLA 1XUUA 3H2CA 1FH7A 2W4XA 3IWPA 4GH1A 4MYXA 4IMCA 2BY0A 4B5WA 1O95A 2POTA 1GTHA 2YR1A 3APGA 1JQVA 5TF0A 3H2AA 1CX9A 4FOUA 4U5IA 3TH6A 4J1OA 3VE7A 4NJIA 3WD1A 4JTRA 3TZNA 1UPMB 2PSNA 2G97A 1KM5A 3W3OA 5KITA 3M4HA 4E2BA 3L5LA 3INPA 3NQVA 2QCGA 1XLBA 2VDIA 3TJ4A 4BQ5A 1UPPA 5CLTA 5FSDC 2NV1A 5CLWA 2ZKMX 2J8GA 1M1BA 3N4EA 2R1LA 5E6YA 3UJFA 4IGHA 4PMJA 1F73A 4A8IA 2ZDRA 1EC8A 3KZPA 4Q8VA 2UY2A 2OXNA 1SFTA 1LM1A 4OU1A 2QAFA 4X0VA 1E0UA 2XGBA 4UZUA 5K4ZA 3NZPA 5AHNA 5B80A 3W7NA 5G1YA 4PUDA 3RR1A 1GYLA 1F4HA 3DECA 1OCBA 1OM0A 1LT7A 4P61A 2O4QA 3B03A 3GH4A 2IKHA 5A5WA 4HOZA 5DX7A 5LYRA 4W84A 1GVYA 1I4NA 4CN6A 5EMMA 3F4VA 1B3ZA 2CLFA 4AZBA 2XSAA 4XIAA 2WWDA 3VD7A 4U4MA 1CXLA 3KHJA 1UUMA 2XSXA 1DXEA 4IQJA 3U0HA 3ITOA 1KGWA 1BWKA 1TZ7A 3GNOA 4WDUA 1E4NA 1GVOA 4L65A 3S2LA 7TAAA 3PBWA 1XWYA 1LLZA 2YDQA 3M7WA 3PJUA 4YIWA 1TREA 9XIAA 4M6PA 2PTXA 3IACA 4H7CA 1PE1A 4MYAA 4PMDA 2EPLX 3KL3A 1XDMA 3PFRA 4F4RA 1NOWA 5IHRA 2GVJA 3BV4A 4XTDA 5EPDA 5BCAA 3PTKA 3UXKA 1FWDC 1Z6KA 1QNQA 1KFJA 5D05A 1GYNA 3K4AA 4IZGA 3QC0A 4GC3A 2GUYA 3NXFA 3NQ2A 4PFHA 1Z89A 5XIAA 5CC3A 4XD4A 4QSHA 1AH4A 4S3FA 4LUJA 3QZAA 2VD8A 3EOOA 1BYBA 1UD5A 3HGOA 1YEYA 3UPBA 3QXBA 1PTGA 3NM1A 3OYZA 2ZUNA 1S3HA 2JEQA 4UTIA 1GNXA 2PWFA 2IS7A 1KQYA 1W8GA 3SIZA 1TTPA 1LDCA 1UP2A 4G9PA 1H09A 3GDKA 4L4PA 1Y7VA 4LBRA 4HQVA 4R34A 1KM6A 1MI3A 4QROA 4H6RA 3WQ5A 5FEPA 3TYEA 1HL9A 5FF2A 2YCEA 5D2YA 4IMDA 3TQVA 1VAHA 2XN0A 3HMJG 1TPDA 1RAKA 5G2IA 1SZRA 4P7NA 1BVZA 2FVLA 4GNVA 4N0RA 1BG4A 3DXIA 2XIOA 2R1KA 2V9DA 3BW4A 3FCPA 1TJ2A 3N29A 4ZO9A 5IM51 2YFNA 2XZ9A 3OW1A 3BO9A 4O0ZA 2Y63A 4Q8UA 2QCDB 4UNLA 1VLIA 1J79A 1QUMA 3H4WA 3U3HA 3TKFA 4D1IA 1FDZA 3LCLA 3M07A 5I78A 4AW7A 3G1YA 3BLKA 2YLAA 1J0JA 4XD5A 4ICMA 4DVOA 1QTWA 1W3TA 2VRKA 3SY8A 5KZMA 5CSSA 4MUPA 3P80A 3A3HA 1S5VA 9CGTA 4M82A 4GHRA 3ITXA 3CUJA 3MANA 2OEMA 4JHMA 1QMLA 3BG3A 4XX6A 1J12A 1FOBA 3BURA 3IGUA 4WXYA 1UR9A 1VYSX 1I60A 4PN2A 3ABSA 3UGVA 2JKEA 2EPHA 1US2A 4R9XA 3WEZA 1ZB5A 4FALA 7XIMA 2QT3A 4AD4A 3CH0A 3AWOA 4FLSA 1Q3NA 3UWZA 1PZ1A 2WOQA 3N25A 1W5NA 1KB3A 2IXUA 2PDNA 4HIBA 5LIWX 1HFBA 4GUHA 1HZYA 3HTWA 4WHBA 3MV11 3W01A 3OZOA 4HA1A 3WUFA 2CW6A 4J3WA 2QCEA 3PBVA 4PMVA 3I7QA 4NG3A 5ENLA 2TMDA 1NFPA 1T96A 3I10A 3MCOA 5CSRA 2DVXA 4V15A 1GOKA 2EXOA 4I90A 5HNUA 3DI1A 3PUEA 4RZ5A 5TNVA 1KFKA 3BOLA 2RKXA 1FA2A 4M19A 3WNPA 3HOJA 2HVMA 3WG6A 3AIQA 5AHFA 3W1NA 1OX4B 1JRCA 3K46A 1GQJA 3IV3A 4FR6A 3W2NA 2JGQA 4UTWA 4GY1A 5F4WA 1PXGA 1UH2A 3NAVA 2X2YA 3HU7A 1WDRA 2X7VA 2ZFAA 1HJVA 4HOXA 2TODA 3U7BA 3MUIA 3QQ1A 4QLJA 1FXPA 5FEZA 1F3TA 5A69A 2O9TA 3O05A 3DERA 2BY3A 5JQ9A 4DJDA 3EEZA 4IXXA 2WVVB 4HGXA 4E38A 4WX2A 1WDSA 3FFSA 1NDYA 3XINA 1BFNA 3BLFA 3C0JA 4GXMA 3R10A 4B15A 5BXTA 3WLSA 2EAWA 1JYXA 1E51A 1XGDA 5CZKA 2HVOA 1KNWA 3QY8A 1V6YA 4UFKA 5C9WA 3NDYA 3H54A 3LCWA 4FIQA 1W1VA 3TX9A 5CBBA 2FHBA 2ZXAA 4XZHA 3RLGA 4O1DA 5D2TA 4IMGA 1XYLA 1LWHA 3LA4A 1E15A 1LLOA 1TZ9A 4J3UA 1NJJA 4MZ8A 3V16A 4YL2A 4PB4A 3L4TA 4S2BA 2GWGA 3FYPA 2J88A 4IG2A 2QUUA 3T40A 2AL1A 2DUZA 4PUEA 4QIUA 1LF1A 3NG3A 1Q6FA 4LTSA 4C6EA 1V3LA 4PCPA 4KT2A 1XYZA 4JN8A 4B4FA 2J7CA 4PB3A 3ZXWA 5KETA 4G7EA 1KC7A 1PZ0A 3W2LA 3KFTA 2C16A 3A9IA 4FO4A 1UASA 4ZQNA 4LAKA 2OLAA 2VOTA 4PMZA 2YXXA 1W37A 1IGWA 1E0TA 3ENLA 2D2GA 4UTTC 2YGYA 3OIXA 5AY7A 4A8RA 3AUJA 1EJRC 3NQ6A 1E9IA 3UR8A 3M0HA 2OZ0A 3QPEA 1NEYA 1TUFA 2PZ0A 3BSHA 4NAEA 2Y4SA 1O1ZA 4EPKA 4J4KA 1LT8A 1FVPA 2HBXA 2QIWA 1C92A 2WJEA 5JH1A 4QS6A 5E09A 5T9BG 1XIFA 3LGGA 3U57A 1B1YA 3VD4A 3URQA 3I65A 3N17A 1AD4A 1KM1A 4J2PA 4MVAA 4IIDA 1UC5A 3M0IA 3WQCA 1A4LA 1FUYA 1K8YA 1K4GA 4AZCB 4H8VA 5K7JA 4YVVA 2E8YA 3KRSA 3URBA 3P67A 1SMDA 4X0NA 2V69A 2GGIA 4D1JA 1TWDA 2OKTA 2CIPA 3C4UA 3MDUA 1DJYA 1WQ5A 1ME9A 4LBSA 1YDNA 4RW3A 3F5KA 1OFDA 1EPVA 3DH7A 3NURA 5CPTA 1P48A 3MO4A 2VX4A 4AF0B 3E0WA 3B4YA 2ZRWA 1ME8A 5I2UA 4AD0A 3BW3A 3RIKA 1XRTA 4Z42C 1UD6A 3WF2A 4C6BA 1IR1A 1IF2A 2QVNA 4ZFMA 3BCJA 5D8WA 8CGTA 1M65A 3W9ZA 4REQA 3W2KA 3W28A 2OZ3A 1Z42A 3RM4A 3VAVA 4UR7A 2WM1A 3PZQA 2JEPA 3L66A 1QNVA 5AZ1A 1RBOB 1KLYA 2UY5A 3M6YA 3SFWA 1PAMA 3UG5A 4V33A 4JCLA 4X9YA 1XLGA 2EPOA 3O0FA 1EXPA 1UIOA 2BBFA 2VWTA 4L1XA 4WEVX 3WLMA 3CTTA 4AC1X 3HB9A 3S5NA 3M0YA 3TJIA 1W9PA 1JZ3A 1FWGC 3LXBA 1J0ZA 4ORIA 2BXZA 4M29A 4HVXA 1RQEA 1W3KA 3TMQA 2FJKA 4JBRA 4JEJA 1CNVA 2HNEA 2D2JA 2RJGA 1XLEA 2O9PA 3UPWA 1AQ0A 5AC7A 4MNMA 3E0FA 3NQCA 1GG1A 3UA3A 4JIHA 3AIBA 3W84A 3QY7A 3CS2A 2FTPA 4MWAC 2EJAA 3II1A 2ZXDA 4CQCA 3SO7A 3NL5A 1QI3A 2GQ8A 4ROQA 4XVDA 4JTKA 4ORMA 2PF8A 2DW6A 3G1XA 2PE4A 1SM9A 2QPUA 4MJ2A 4IGSA 3QW4B 4ZO6A 1MUCA 4GVGA 3NTYA 2BZNA 2OKOA 3PSWA 3RYSA 3PNUA 3NSMA 4UFJA 3WYZA 2XFWA 5DMYA 2P3ZA 2Z26A 4UQAA 3F03K 1FCQA 1CDGA 2WK2A 3OG2A 1L2QA 5JU6A 3ZM8A 1LYXA 3TCSA 2HK1A 2UY3A 3TE9A 2GVYA 1HIZA 1HN1A 1V77A 1WXJA 4O53A 1V3MA 5CKSA 1A5NC 2A7RA 4INFA 3PZTA 2VENA 2HVNA 3CBWA 3LCFA 5D38A 3W24A 1WYIA 6A3HA 3BAIA 4HTYA 4ZO7A 3W38A 1TFVA 4CD7A 4DJFC 1FCBA 1R3TA 1E9ZB 2QJNA 2VQUA 4LY8A 7TIMA 4UTKA 2DZAA 3GDMA 1SR0A 4AEEA 4FR1A 1OCJA 1M5WA 4RK8A 3BJFA 4EXBA 1BYDA 3B40A 5D9NA 4FNSA 4J28A 5AC8A 3UZJA 4UR8A 2AQWA 2VFFA 4H6EA 1OCQA 4TX9A 2EPMX 4C1NA 3M7SA 5HQLA 1WA3A 3V5OA 1CGUA 3AIEA 4JTJA 3SFKA 3IJLA 3FXYA 4K37A 2DZXA 5CAHA 3AC0A 3UNDA 5D2VA 2C71A 2QDGA 2BHUA 4H01A 4M81A 1WPCA 1VHCA 2DQXA 4H2HA 4FA3A 3C2FA 4F40A 1L6GA 2I9EA 4C7DA 4D8ZA 4Z1AA 1GOQA 3WLJA 2J7BA 4BA0A 4L9XA 1J6PA 4GVHA 3IAPA 4D6IA 3W4RA 2J9ZA 5HWJA 2BVYA 1W54A 4FHAA 3SCRA 1G69A 2C8NA 1DWHM 3R0KA 4H19A 3RCMA 3SRDA 3DKJA 2V63A 4M80A 3K2GA 3G3DA 4U3CA 1J0KA 1V6XA 4YTRA 1C8XA 1I2QA 3TV8A 2NUWA 4YTTA 1E9LA 1F6PA 4GY0A 3R4IA 3DEQA 3EOUA 3KVMA 3UZWA 2I5GA 1S5MA 4H9UA 4FXSA 3TYBA 3TUUA 4JTFA 1QCWA 2BG5A 3WL1A 5I6SA 2A7PA 3LB0A 4GI4A 3GQYA 2B7QA 2W67A 3EKLA 1RP9A 1IT8A 2ALRA 3REQA 1UBPC 1M68A 2PTDA 3VOGA 3WF0A 4Z1CA 1T99A 4HN8A 1C90A 1K8ZA 4NJKA 3KWXA 3B9AA 1R2TA 4DO4A 4IWWA 3GG0A 4IJBA 3NNTA 4Q4OA 2W6RA 4IGNA 4H7ZA 3QR1A 5FACA 3W00A 1P0NA 4ML4A 2HQAA 5EKYA 1W3HA 3EWZA 1OCNA 4LWWA 3C5QA 3VNMA 4AFYA 1O68A 1DL3A 3GXDA 1UJQA 3SQSA 5MKGB 3SGZA 1R9YA 1Y65A 1YXYA 1ML1A 2NWSA 4O11A 1QNRA 2FFCA 2VC6A 4OE7A 2YZ5A 1WP6A 1M7XA 3B8IA 1PJ9A 2RDXA 4KWOA 5JBFA 4Y9PA 1W1ZA 2V81A 1D3GA 3BE7A 4H04A 4ONVA 3UZXA 1G0CA 1N8IA 3T42A 3IRDA 3M0XA 4ZE5A 3RR4A 2QKFA 1WXYA 1LJYA 3TTEA 4AYSA 1RUSA 1ELSA 3G6MA 3O2LA 4BWLA 5C0QA 5HPOA 2AKZA 2ADAA 3B8TA 3N3TA 3MO7A 1RD5A 1AL7A 2L5HA 4RNFA 5GJNA 4C5YA 4NXKA 5D32A 5EU9A 3UERA 4HCLA 3VOJA 4A21A 1ZBWA 3VVGA 1V02A 4IHCA 3QV8A 1JCTA 4QTGA 2YYTA 1GT8A 3HF3A 1HNYA 1ZP4A 3R58A 1P5BA 1AH0A 1W2PA 3ZQ9A 2PDHA 2VC5A 3KBVA 5M03A 1KFBA 3N2TA 5DCBA 1S46A 3M41A 2FGZA 4C6QA 3J7HA 5CBIA 1WDWA 3PZGA 3V36A 3B0UX 3I4EA 3LRKA 5KZEA 3U2ZA 4RNIA 3WUEA 4NX5A 3VKBA 1YNQA 4LF2A 2ESCA 2QUNA 3THAA 3G1FA 5CJMA 4LS2A 1FDYA 1HGWA 3KUMA 1A5SA 2V8ZA 1XG4A 4IIGA 4PEKA 3OODA 4J7RA 1W6TA 2GLKA 5AC4A 1U1HA 3ITCA 4GYPA 1WDDA 1ONWA 4E2VA 3NUKA 3TNBA 2V0TA 3UESA 4RXGA 3TQ0A 4ACZB 1XYMA 4DXVA 4F3HA 1XGEA 1MUMA 1DHPA 4HPNA 1P0BA 3BAXA 2F6KA 3A4JA 1V6TA 3RPDA 2E9MA 1ONRA 2BOEX 3T07A 1FKXA 3PF3A 3QKZA 4OJYA 4AY8A 4R3UA 5A6LA 1H1ZA 1EQCA 2CLLA 3EZ4A 4UNIA 3FJ4A 3COTA 2VMFA 4I9AA 1SZFA 2PD5A 1YLVA 1TZZA 1QHZA 2WZTA 1M7JA 3WF1A 2WC4A 5HXMA 1OYCA 3VX0A 1E0WA 3OVQA 3KVKA 3GK0A 5DBTA 1JCMP 5BMXA 3BG9A 1UCWA 1X39A 1SFSA 4C6KA 3WNMA 4B4HA 4A22A 1DWJM 5JMUA 1XLJA 3U4FA 2E09A 2WVSA 3HV8A 1HW6A 4PODA 3EA1A 1OSEA 3CPRA 4F79A 1QNSA 2PF0A 4MIMA 3RLVA 4N9EA 1H7OA 4PB5A 5DANA 1UKPA 1WO2A 2REQB 3DFNA 5FJRA 3MKVA 1E0VA 4G7EB 5I3FA 4DF2A 3TYZA 3AXHA 1PKMA 5T26A 5A6BD 4HNCA 1EFZA 3BW2A 4YCOA 3WLNA 1MRAA 2OODA 2FFIA 2NV2A 2NX9A 1AW2A 2PC8A 4HU0A 4AXKA 1KLZA 4CCDA 1TX0A 2NQ9A 1GWJA 3XISA 1JI1A 4R27A 3SCNA 5MKGA 4AVOA 5D9OA 4W88A 1GQLA 3QBUA 2XGZA 3LV6A 2HE5A 4JY8A 4PCNA 2QQ6A 1NQKA 3WDHA 1BTMA 3K4WA 3N9RA 3UXLA 4DUVA 4H8NA 1PKLA 5ABGA 1H41A 3P74A 3IGXA 3R13A 3WY1A 3LTYA 3T78A 3U6WA 2G0WA 1K6AA 2SFPA 3REQB 4W7UA 2OT0A 2GQ9A 4HCDA 1MEHA 3FY1A 4DJED 1FHDA 1ZBVA 2G95A 5BYWA 4ZQOA 3L0KA 4PRWA 1E6PA 3OB8A 3MI2A 2Y8UA 3CH9A 2Z6IA 3SEPA 4O13A 3ZLFA 2VFDA 2J79A 4S3EA 4AIUA 4GIAA 1AJ2A 1W56A 1IZKA 4ZO8A 3VUPA 4LXFA 5HULA 2C91A 1GUVA 2NUYA 1THFD 5F2IA 5ABHA 2JIWA 2PPGA 4QCFA 4NP7A 5K3VA 1NY1A 2WNWA 5CPSA 1XX1A 3AMDA 5HA7A 3MSDA 5MHBA 2E6DA 1EBGA 4JPGA 2CERA 5CPMA 3C8FA 4K36A 3SUTA 3P2VA 1ZJBA 4C91A 5ECVA 3ITTA 4CU8A 4OBSA 1XYCA 3VK5A 3KOWA 1FFRA 2XIQA 5A2BA 1MDLA 1J0IA 2GUUA 3TIMA 1SO4A 1WBJA 4HD5A 3C2OA 5FOOA 4OOUA 2VFHA 2F38A 3DFPA 1I75A 1EJSC 3EB4A 2V67A 1B4KA 1B2YA 4HU4A 4UTTA 1K8CA 1S1PA 2XM1A 2JQXA 3B8UA 3L68A 2VO5A 3KP0A 4FXJA 1SSDA 3QF0A 2YA0A 4Q8MA 3VMPA 4EVZA 4J2MA 3TAKA 5M2FX 1FCUA 4WGXA 3F4DA 1R3SA 1NIUA 4WY0F 3UCCA 3C2VA 1PDYA 4NZ4A 5AC6A 3SSJA 4OZOA 1F7BA 4AMAA 5E9AA 1UD4A 5EFDA 2J9YA 3VFCA 4GD0A 4IUOA 4TVUA 1DJZA 4A3YA 3VGDA 4H41A 1ICSA 1R0MA 4Y90A 3N14A 3CHCA 2WKJA 4E8GA 4BF7A 1K9DA 3U2CA 1V0MA 2XHYA 3GM8A 2BGNE 3FA5A 4ASTA 4LVBA 1FBAA 3H24A 4GQRA 4RNJA 3O0KA 3WBAA 3DGBA 4OBTA 5AN7A 4M1RA 3UR2A 1X97A 1PCWA 2OLSA 4B5TA 3R94A 3IJDA 2I1OA 2NT0A 1FXQA 3VGEA 1ZHAA 1UWSA 3DBPA 3NZGA 1Q2RA 1WUEA 1J9YA 3NA8A 4N02A 3ITVA 2A6NA 2IQTA 4U33A 4FNTA 3G1DA 4QE4A 5K9XA 3HPFA 1HJXA 3SB0A 3IGSA 1X1OA 3ES7A 1DJIA 1KO0A 5FJTA 3GWQA 1H5VA 1TV7A 2GGHA 2WCSA 3WQ6A 1E1EA 4BKNA 3ABXA 3L0GA 3CL6A 1DIKA 1IYXA 4WR3A 1YTDA 5F4SA 2PTZA 4FF5A 4QEEA 4Q3MA 1E9YB 4JTSA 2WYSA 4IL0A 4PRTA 1XM3A 4MGGA 2OO0A 3BMXA 4LAZA 1JAKA 3T1GA 4QJ5B 4AVNA 4JYFA 5LSMA 4F2TA 2NWRA 1IEWA 2C1IA 3VXGA 4QDWA 1S2CA 4E8DA 2ZWYA 2Z2AA 2X1IA 4UZSA 5I02A 3EB2A 3I6RA 4PC8A 4AF0A 3P62A 4KERA 2AAMA 3MMWA 3P61A 4JNYA 1EX5A 3EGJA 1QXLA 3GC5A 4O18A 3EPOA 4B2DA 1UOZA 3OIHA 3NDOA 3T7VA 4UOZA 1M53A 1YDOA 2YCIX 2XUCA 3UZZA 3BOFA 1XGZA 2PDXA 2A21A 3CPUA 1VKFA 2YDAA 3LNPA 1OWQA 4AZCA 2EF9A 3LHWA 3E96A 7PTDA 4D6FA 4C6LA 1PX4A 2HZGA 4TR9A 4N9DA 5D9PA 2E28A 2BASA 2W27A 4UQEA 1US0A 5LHFA 4QS5A 1EIXA 3TSDA 1ZZMA 3S42A 2POZA 3ITYA 4A8LA 3VDBA 1DP0A 4MM1A 3SCPA 4CVUA 2WJFA 5BWAA 1XIDA 2VC7A 3ZFHA 3W23A 2XVGA 3TSBA 1A0EA 4PZVA 3UJRA 3GZAA 2D22A 1DWGM 1RCOB 1ZQ5A 1OC6A 1TX2A 3KBWA 1P7TB 4NZFA 4JKMA 1V4YA 2B7PA 2CESA 4JAWA 3WLTA 3DU0A 5D04C 3UYIA 1SSGA 2PAJA 3K30A 4LPCA 2WCAA 2J25A 1TV5A 2RJHA 3MT1A 4O19A 6REQA 2Z00A 1DVJA 1E6SM 3QN3A 1A3XA 3S5ZA 3W7RA 1VC4A 3APTA 4H9YA 4S3AA 2D1ZA 5A95A 3H12A 3LRLA 3ABZA 1EHAA 1DJQA 2VEGA 1RQBA 1KKOA 3MSGA 2AQVA 1Q6QA 1X8FA 4RV8A 2YYUA 1W5MA 2FPYA 1Q66A 4GUFA 3PBGA 1QR7A 1A3WA 4KEUA 4UFMA 1GKRA 2J9XA 2B7OA 2XIIA 3ZT5A 2ZUSA 3KOZA 2JKAA 1LTDA 3UR5A 3H21A 4OKDA 1P6CA 4DX3A 4PH6A 1NU5A 2J77A 3SY5A 3UWUA 1BKSA 5EBAA 1K9EA 3A9BA 3H70A 4CN1A 3W6MA 3AS0A 3GIQA 4ALDA 4PRRA 4DZHA 2B7NA 4NL1A 1TR9A 2GOUA 4L1GA 3OU8A 4M6UA 4ZE4A 2VVSA 2W92A 3PWAA 4LS0A 3NZRA 4C7FA 1CLXA 2I7GA 3TTSA 3SCQA 4NNBA 3BDKA 4M3PA 4GYFA 2R1MA 2DZUA 3IK2A 3V5FA 4AB4A 4W89A 3GO2A 3A3WA 2DY3A 3ZIZA 3B0YA 3VCNA 2F2KA 1Z44A 4DPPA 1VLWA 2WLYA 5CCZA 5T91A 4TTGA 3F5JA 1A5KC 4WDTA 4GVIA 5HNTA 1UKOA 2FVKA 1TQJA 3TSMA 4B90A 4WGHA 1I8JA 3QOMA 4Y8EA 5RUBA 2QPXA 3R11A 5IDZA 4TMBA 1J96A 3DYOA 3WQ4A 4PE8A 3THUA 4QG8A 2YB4A 1AMKA 1ZU8A 5C2XA 3B9DA 4XAPA 1FHVA 1SGJA 1B0IA 1H1YA 1AJ0A 6ALDA 3M0KA 1KFWA 3DG7A 3CL7A 3F4CA 4KRTA 4GLEA 1AW5A 1KQZA 3WMLA 1XXXA 3IPWA 4AHOA 4C65A 1VENA 3HG4A 2YZRA 3G0SA 3GVVA 3K1GA 3CV2A 3KP1A 1L9WA 2OSXA 2QF8A 4IMEA 1J4EA 2VUYA 3OLDA 1HKWA 4CNPA 4C6IA 2VEPA 4S1FA 3GYEA 4MNLA 1OX6A 1IT7A 3PULA 4BQ4A 1HKVA 1XPYA 1BXNA 3T2QA 1G4EA 1CB2A 5FJJA 3C61A 4KPLA 3IVUA 1SW3A 4OIFA 1RD6A 4IX2A 3THDA 3GB6A 4ZENA 4MFEA 4JIRA 5H2ZA 4S39A 1YPXA 2X0YA 3W75A 3ZVHB 1RPXA 3DESA 1RZMA 1BYCA 3QEZA 4H83A 2DU2A 4QQ3A 1FFQA 1I2RA 5GJPA 4Y96A 4XZBA 3RJYA 1YE6A 5C55A 3GU1A 4BEQA 1XYFA 1OEPA 2VZVA 1EUAA 1H3GA 3VNLA 1V6VA 3EX2A 4O0KA 1MXSA 4C6NA 3OLIA 4OBRA 1SFJA 3QQ0A 3NL6A 4B91A 3IANA 3CAKA 4GIEA 4LX4A 4ZCWA 4D6JA 1BSIA 3GH7A 4C6JA 3N1AA 4Q8QA 2VFGA 1KM0A 3AMKA 2Z25A 1GHSA 4DELA 3EAUA 3QFEA 2EG6A 3AS2A 5HJLA 3URAA 2UWFA 1YIXA 4NRRA 3DC8A 4DNHA 1KGXA 1BF2A 3S1UA 4XV0A 1OYBA 2V30A 4JDYA 4E6MA 7ENLA 4FAMA 3W86A 4GQBA 5AYBA 2PCEA 4PUWA 3L4YA 4H2CA 1QHPA 1JNDA 2XVNA 2CLKA 3M46A 1XDJA 2GQ3A 3M47A 3QTGA 2CHRA 1V3KA 5I3DA 1E0XA 4DHGA 3T0DA 2ZZ3A 4N9CA 1W5OA 4O0QA 4XKMA 4GUIA 6CGTA 4UOJA 3EWWA 2INZA 4GKLA 1OT2A 2F7FA 4AXNA 2OSWA 4GUJA 4AZIA 5HATA 3GG8A 1KRBC 3M43A 3NO1A 3GS6A 2VZTA 3W71A 1UWAA 1MEWA 1WV2A 4S3GA 2BGSA 1EX1A 5HOSA 1O5KA 2GGJA 3KTSA 3GTNA 1J0YA 1H51A 4F66A 3BQ6A 2KX9A 2EO7A 2A0NA 3L67A 1GPFA 5M3WA 1SVDA 1XLHA 3P5YA 2H9AB 2Y7GA 1HX0A 3SCSA 4NJHA 1JDEA 3GKAA 3CHFA 4PTNA 2ANUA 4LB4A 3OQEA 3UG3A 1UUQA 2FHFA 1QT1A 4FZIA 6TIMA 4AHPA 3NIYA 4LSBA 1GGOA 1DBTA 2ZQ0A 3NQMA 3BH4A 1WX0A 5HAOA 4CD5A 1OF6A 3QRHA 4RZ6A 2ZRYA 3CNYA 1VJZA 2VT0A 3AHXA 1JF5A 1UZHA 3HBLA 1OFAA 4Q22A 2DQWA 4LC6A 3U4AA 5LHEA 3CZLA 2I16A 4HA0A 2QCMA 3POCA 4CCZA 1HO4A 4WF7A 1XL9A 1OF8A 2ZX9A 3KLLA 4JICA 5BRPA 4G8TA 3OGSA 2ACQA 3VCRA 1TELA 1F3EA 1ADOA 3GU9A 4AZ5A 1JVNA 3KBJA 4NRSA 3CUHA 3TMLA 4M0XA 4IP7A 1B54A 3ZJKA 1GG0A 3TYAA 5EY5A 3UYCA 2I17A 4S38A 2GJPA 1GKPA 1XIHA 2XVKA 2A1YA 3UR7A 1KW1A 4HU3A 1EZWA 3UWWA 1HG3A 4IH3A 3SR7A 1K70A 1B3WA 3NO5A 4LC8A 4MTVA 4ZQRA 3B9NA 2O9OA 4PUJA 1MZRA 3VKDA 2W9MA 1P43A 3QYQA 2NXGA 4JQ3A 4EACA 4YXGA 4LW7A 1TTJA 1ISVA 3BXWA 3UJEA 4GY7A 1LG2A 1R46A 1UHVA 2XG9A 4C6CA 3W27A 2GUBA 3AYVA 4JTIA 1TIWA 4JTGA 5EMUA 3G8RA 2V3FA 3IAQA 2Y5JA 2JFEX 4X63A 4IIHA 8TIMA 4DM1A 4O57A 2CKRA 1NM9A 1NP0A 1IXQA 2BP1A 1H7XA 2PLCA 4FI4A 4QRNA 4NJGA 4ILSA 4GO8A 2YB1A 3ZWTA 4MWAD 3PP7A 4QE1A 1XSKA 1I2OA 2WQDA 1RVKA 1Z7AA 3BAYA 1UG6A 2NLYA 3UVAA 3DBNA 2IPJA 4V2XA 1Q45A 4AIOA 3GG7A 5CG0A 1VJSA 4DYEA 1SFLA 4EPEC 1EGVA 1S2AA 4QNEA 2VX7A 3GBEA 2NUXA 1YXCA 1XRVA 3QGAC 3HPSA 5EMKA 1N8WA 3F4WA 2YLLA 3OQ8A 1TPFA 1NWTA 2AKMA 3ZT7A 4BI7A 1KV8A 4I7WA 4JKLA 3EWCA 4F9DA 1PZ3A 3MUAA 3WLLA 4DZ5A 1KWGA 1GEQA 4BK9A 1QJWA 3PUGA 1KM3A 5F1UA 4PCFA 4CNSA 1W3JA 1BHGA 4JDBA 5E93A 3NQBA 1PO9A 3S1XA 4TU1A 3BL3A 3MV01 4C6DA 5CAKA 5FJOA 3CC1A 3VTRA 1QVBA 3OA3A 1NELA 4GNKB 1JYNA 3AHYA 2R6OA 1MW2A 5I23A 2EHHA 4Z2JA 2JF7A 3PB2A 1HF6A 1EF3A 3GHSA 1QHOA 3W72A 2FVMA 4E4PA 1L6SA 1KFEA 1KR1A 5A6AA 3IGHX 1DJXA 3LI0A 4KIEA 3BCDA 3DKLA 1Q8AA 3H2FA 1W1B1 4A3UA 2QCNA 3CYVA 5BWFA 4DBSA 3E74A 2DDXA 4LBUA 2D69A 2WNZA 2CHOA 2P1FA 1WKDA 3GIYA 1GONA 3KEHA 1MFVA 1O5RA 1L6YA 1M9HA 3B8WA 1XC4A 3G0UA 3WLKX 1X6UA 4RX0A 2WBKA 1U5VA 4FMVA 2OVLA 3SURA 2WMFA 1VBUA 2WZHA 2VCBA 2QGYA 2V82A 3CB3A 3U2EA 1V0KA 4QP0A 4RDWA 3H26A 5G4EA 3B8DA 1J5SA 4QJ3B 3R89A 3TTOA 1F9CA 5K4XA 4N2YA 1TV8A 1I2NA 1A53A 1DTUA 1VHNA 3DC0A 2FLIA 3VIHA 1FQ0A 2VR5A 1H7PA 3Q37A 1FHUA 1HVXA 1MWOA 4NAFB 4WSJA 3G1RA 3SRHA 3UGRA 4K2SA 1PBGA 4OGZA 3GNDA 2ICSA 2WZMA 1YHTA 4AD2A 2WXDM 2MUCA 5A6KA 4V28A 1Q6OA 1L8NA 1XRSA 5J8LA 4RNHA 5GNZA 2GK1B 1F3XA 1N2VA 3CHVA 3G1SA 1WNOA 4PMUA 3RXZA 1AJZA 1LL6A 3C8NA 3VKAA 3QVQA 1CEOA 3L2MA 3WF4A 1DJWA 3RU8X 3O07A 4JQAA 2CLPA 1V6WA 1VFHA 3BVJA 1VFFA 1YRRA 1XRFA 2DP3A 4Y9OA 3W1AA 2XH0A 2W91A 3WBEA 2PDUA 1JFHA 1AFSA 3S1GA 1FWWA 2Z2UA 4ZSTA 4W86A 3FEQA 1PIGA 5A6TC 2ATMA 1QATA 4WIWA 1C7TA 5G1TA 3OEXA 1L2UA 3AU6A 4MB1A 1POJA 3RGTA 3LYEA 3WQVA 3KXQA 3WX7A 3WEOA 3LI1A 4WVXA 1OC7A 5HNRA 1W9DM 2VEFA 3Q58A 4ZXLA 1T6MA 3VKJA 4ZA0A 4P5UA 1SJBA 3LCXA 4WY0B 1ZY9A 3MSYA 1MO0A 3O3RA 1NTHA 4LUTA 2BGQA 1KBLA 2RDUA 3PPHA 1SO5A 4GH3A 4YCPA 2X41A 4XZMX 1XIBA 4H00A 2F8QA 2ZVIA 3NQ8A 4JN6A 3ANUA 3JW7A 2VFIA 3CIVA 4M51A 3KBMA 3SY1A 8XIAA 4Q8OA 1F07A 1ZL1A 1EP2A 1L8PA 5G2WA 2AMXA 2A85A 1IV8A 3PFMA 1Z69A 1NWSA 5D33A 4KCUA 5CC7A 3GD6A 3VIJA 2F84A 3TQPA 4OUIA 3U5UA 4CQ8A 3STPA 3Q65A 1HP4A 4O15A 1QOQA 2V2CA 3OZPA 2VFEA 2FIQA 4GISA 4QXIA 3TTYA 3HMCA 4NX0A 2O4MA 1KRCC 2YDSA 1Q4WA 1UP3A 4ZXOA 1LUCB 5I07A 1V93A 1VCGA 1HP5A 4S3DA 2B0MA 4NJJA 4GUGA 4I7VA 3RO8A 1UR4A 5CJNA 4DO7A 4NIRA 3VMOA 1HKMA 1E5NA 1EKOA 3DYPA 4GVFA 5I79A 1FKWA 3U8GA 4W9TA 4CD8A 3CMJA 2VR2A 3PTQA 1CGVA 2PD9A 2OELA 2XU2A 1Z8AA 3WQPA 3WMCA 1QI2A 4XAGA 3OVGA 3S5OA 2ZX6A 4I6KA 4PBFA 3QY6A 4HU8A 3BJTA 1UC4A 3FDGA 3RK8A 4QE5A 1RY0A 3LENA 6PTDA 1V7AA 3N73A 5FSEC 1W32A 2BSLA 3UXDA 2JIEA 2FDMA 1OFQA 4JFWA 1J2WA 1QPQA 3WL0A 2YDRA 3W7EA 4CVWA 4EAMA 1UQYA 2O9RA 4AWUA 2QS8A 3A64A 3WLQA 1EGMA 5G1MA 4ZFCA 1CXIA 2ACRA 4PCTA 4AEOA 1I0BA 2Y62A 5J5RA 3ARZA 1JDDA 5F2MA 3WH5A 3MBDA 1S5WA 5HMEA 2D3LA 2IPWA 3L4XA 3BQ5A 3VIOA 1JDAA 1GCYA 1NQ6A 5CBJA 4I5UA 5AZ0A 1PPIA 9RUBA 3KRBA 2XSBA 3NQEA 5GPRA 3ZS4A 2OEJA 4IL2A 1YBQA 3VU2A 1FWFC 3WH7A 2P88A 1EHNA 1VQTA 4Q4KA 2G3NA 2PZNA 1NH6A 1A49A 3KZSA 3VNKA 4MNJA 1D8CA 2DJLA 4PEEA 1JJKA 1A50A 4KETA 1H4PA 4I9MA 3TW7A 1EJWC 4B2DD 2DSKA 2D2OA 5GQBA 2OX1A 3SJNA 2WZEA 3H4XA 3TN5A 3CQ0A 2ZZ1A 4UR9A 2VRQA 4L9ZA 2PDJA 3EXRA 4GZIA 1E3XA 1WZMA 1BGAA 1QO5A 4MB3A 1OC5A 3EX4A 3GXMA 3MDWA 3ID7A 5AB3A 3GAYA 2PLKA 5G2HA 3R8HA 4Z0SA 3E0IA 4JTDA 4ADSA 4ZL1A 3NSXA 1E1CA 1G4TA 2DORA 5TQLA 1ECEA 2NV9A 3W7CA 5FL1A 4PUKA 4KWSA 2DUAA 4LCRA 3UW6A 3WJZA 5LA2A 4FX6M 2VDHA 1MMFA 2R1NA 3K8MA 3L65A 4JXCA 1JGMA 4E8CA 4IQEA 2ABAA 3T55A 1KXVA 3DG3A 3FV9A 3K5XA 3O06A 1OIFA 2IPGA 4M6QA 1HJSA 1N7KA 1A5MC 1NAL1 1VPXA 2R24A 3CV1A 2ALDA 3V0UA 1LOQA 3BARA 4QR6A 5CGTA 3OPSA 1K7EA 5AFDA 1XI3A 5BU6A 4CNUA 2FMOA 3ONBA 4H8HA 1W9XA 1LL4A 4IJCA 1IZJA 4IQLA 2WKLA 2ZIDA 5HPCA 1OYAA 3QMRA 2BXYA 2OZTA 4N7QA 3NPXA 5BRBA 4NI3A 3VGFA 4LALA 3CZKA 3BJSA 3AI0A 4FS9A 2WJZA 2BB0A 3C86A 2FB2A 2DT2A 1ISZA 4MUZA 3EMCA 4MAZA 4KBXA 1LRNA 1QW9A 2CWXA 3VNZA 1DQWA 1SUXA 2NZLA 2PWUA 4BS0A 3NGJA 4WRHA 3OVRA 2E1WA 3CZJA 1OG6A 3IRSA 3LEPA 1WAUA 1XCWA 3QLLA 4MY9A 4IPIA 4GBUA 3VOFA 3AS1A 3W87A 1VJIA 3VYLA 1LBLA 1R3YA 4XSMA 3EB3A 2X09A 1GVEA 4P7RA 4O4VA 3WCZA 1OVDA 1V3JA 3I3EA 1J18A 2Q01A 3CIXA 4GCAA 2PRLA 5F2GA 3E3HA 4QBXA 1JYVA 4W7WA 4PTMA 3LG3A 2DEPA 3V0SA 1T0OA 3RX2A 2C79A 4ZB0A 4GZEA 2ZZ2A 4UTUA 4GRSA 2QCLA 3RLUA 4KS0A 3V4BA 2HE8A 3TW9A 3L12A 4BWLC 1EA9C 4GMEA 1XV8A 1XLAA 2V5KA 3SECA 4ZQPA 3LTPA 4AUBA 5XIMA 4X3ZA 2A3CA 2VURA 1NVMA 3NFUA 2HSAA 2YW4A 1F8MA 2G41A 1JEZA 5E0KA 1J93A 2XFYA 4QJ4B 3M0VA 1ADDA 2VX5A 1WB0A 2HCVA 2FH6A 1CENA 4E5TA 2C0AA 2XJ7A 1FWBC 4AIEA 4K8EA 4CEXC 2VHLA 4RCXA 2VCCA 3LPOA 2WM0A 1MQRA 4XD3A 4UTHA 2ZDSA 3WFAA 3R25A 2NVAA 4LNCA 5CGQA 1EUNA 3ORWA 1YYAA 2A5HA 1Q7ZA 5DELA 3GH5A 1OK6A 3VNIA 3H2OA 2PODA 1MW1A 4JFUA 4UXDA 3AROA 3DCPA 3ARSA 2WKGA 3LRMA 1XFCA 4KCWA 4DIAA 2VRJA 2HK0A 3WQDA 3ECQA 4UTMA 3O9NA 2X30A 3P0XA 3LHYA 4K1WA 5AHMA 3LQGA 2E5DA 2EGZA 2AAAA 3THQA 1ZBCA 2P0IA 3SCUA 3N19B 1XJBA 2DZSA 1G4SA 4HNUA 3GSMA 4L6HA 4ZSUA 1X96A 1CI1A 1Z32X 5LNRA 2DH3A 3E1F1 3DYMA 1Q4NX 1F61A 4JZ5A 4MJ4A 1TQXA 4JNMA 2ZZ4A 4KWWA 3GDRA 3TEVA 1WDPA 4YU1A 1EOMA 3O16A 3Q67A 1REQB 1ODZA 1LOSA 4PUUA 1F6KA 4HYWA 3W7PA 5DY3A 5CXPA 1OBAA 4HA4A 3KHDA 3R2GA 3FXGA 4YJ5A 4K38A 3G22A 4J5NA 3OZMA 1CLKA 4BHYA 1GK8A 2OLHA 1DWAM 1QW8A 3KTCA 3EKGA 4N9BA 4XWUA 1EPXA 1DV7A 4LAMA 3VDAA 1QOXA 1R7OA 3QQWA 3WJXA 3ZMRA 1UA3A 2DV0A 1Q2SA 5DEZA 2OPJA 2PI6A 2FPVA 2PB1A 3M0ZA 3N9SA 4US6A 3PZUA 3TOYA 4C90A 1XLCA 3LGEA 4XG1A 2E6YA 3WN6A 3R0UA 4M7TA 2B31A 4ZTYA 3M5XA 3IJQA 1P4CA 2GQAA 2PRHA 3WJWA 2Z7KA 2BFGA 2FKPA 3A5VA 1ZRQA 1SO3A 1V3IA 1Y5VA 3WUBA 3BPWA 2VCAA 1ZP3A 3BICA 3KM8A 2BODX 3IIXA 2MNRA 3GXPA 2ONEA 3DFTA 2ZXQA 2P5NA 2WCGA 1NF0A 2V2DA 4MWAB 3GXFA 5CSUA 1ZJAA 3MCMA 3H8AA 3U5YA 1ZJIA 3I4KA 4UMCA 3QV6A 1WZAA 3ICJA 5HWNA 3R43A 3UCQA 2WMKA 5KZDA 4CLMA 2WW5A 4Z0JA 5LGXA 3HO8A 5I77A 3FA4A 2OMAA 4Q4RA 1VEMA 5CZ0A 4O1CA 4TVCA 1YPFA 4AD5A 1VEOA 2RFGA 4DJEC 2KAUC 4MB4A 3AZRA 5AC5A 3W1RA 4HNVA 4IP4A 4LUSB 3SGGA 3O6DA 2VL4A 3AXIA 3EYPA 1P0EA 3GXTA 1JZ4A 1DKWA 3UCDA 4Q6XA 3SM0A 2ZC8A 4X2PA 3MZNA 4GXPA 2VEKA 1MXDA 1O1HA 1ZPTA 5KMYA 7ODCA 3KBNA 4UTFA 2YA2A 3QZ6A 3JVAA 1I0DA 1XBVA 3C3UA 2AGKA 3M1ZA 3B8SA 4QSFA 1GVQA 1H49A 6TAAA 4Z2KA 1CBGA 2C7FA 5ABFB 5LNVA 2XVPA 4L56A 5E0CA 3HG3A 1D9EA 4JQ2A 3CO4A 4B5SA 1NOFA 3WH6A 4M1BA 4RDVA 1O4UA 1EA0A 3KRZA 4HNLA 1VR6A 1DPMA 3UVIA 2ISSA 1X7IA 1FWRA 4ML9A 5G4HC 3KLKA 1MW3A 4P8VA 2W5FA 2G50A 3PPCA 2GFTA 1TA3A 2YFOA 3IJ7A 3PUDA 5PTDA 1RJQA 2VNCA 1U1JA 2H3BA 1OZMA 3CHEA 4O54A 3RO6A 3BTNA 3LLDA 3LCHA 2IQ0A 3E2QA 5HUOA 3NSNA 4AISA 2BHYA 1XW8A 1CIUA 1K9TA 1X8CA 2E9BA 1CXHA 2A79A 3BSGA 5FEWA 1GEHA 5T8GA 5C7HA 1BVNP 4CUCA 1VFSA 4UFHA 4DXKA 3OLEA 3U2OA 1UWQA 2WSQA 1YTKA 4BY3A 4GZJA 1KGUA 1R86A 4AIBA 4JYDA 4H3DA 3EOSA 1OINA 4W87A 4QQUA 1EH9A 5JH2A 4HK5A 2G8ZA 3W76A 4H9MA 1AL8A 4JX4A 3KDNA 3A24A 3SUWA 1Q6LA 1PB0A 1AQHA 4O1BA 5HINA 3FK4A 2CETA 2NW0A 3EPMA 2OWWA 4AZ7A 4WJ8A 1ZALA 1SW0A 3HN3A 1NFGA 2OQYA 4WK9A 2OQHA 1JG9A 1PIFA 2ZUWA 5A6JA 1EJ7L 3WKZA 1JAEA 4EWND 2E5BA 5IFTA 3NQFA 2PLMA 4TOQA 3UG8A 4KF1A 3TONA 1FY6A 1RQHA 5HK4A 1KA9F 1C7SA 5A8PA 2Y1HA 3WIJA 1R3RA 1CCWB 2PWHA 3BANA 1P0KA 2DUXA 4KGJA 3LCGA 1HJUA 4GIYA 1IXPA 2DIKA 4F48A 4LAOA 4K7VA 2GL5A 1A5OC 1G1YA 4DN1A 2WZIA 1S1RA 3WDPP 3E0VA 3MB9A 2CU0A 4NY2A 1XICA 2W79A 5CC6A 3S2NA 4MY1A 2NX3A 4Y9NA 1VIWA 5EMLA 3A4AA 4KFOA 1OX5A 2DSUA 3LERA 4XIMA 4PTWA 4F0MA 5MF5A 2OFJA 4LUSA 3LGDA 2BVTA 3S47A 2PBGA 1A5LC 3W26A 1PIIA 1OFRA 4A2RA