1P1XA

Comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
250
structure length
250
Chain Sequence
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the class I aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase at 0.99A resolution.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
total genus 104
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1p1xA00
3AJXA 1M5WA 3EX3A 4H6KA 1OK4A 3NQCA 5AHNA 3IIXA 4LS1A 3O6YX 4UTWC 1XUZA 2GOUA 4JX4A 1AW2A 1P0KA 3O8AA 5F4XA 3S42A 2ZZ7A 3QH2A 5D38A 3TROA 4OQVA 3INPA 1F6KA 4O16A 4UFHA 5CZSA 2H3BA 3C52A 1R2TA 2ATMA 3GX9A 4WZHA 4GE8A 1UCWA 1W3TA 3C4UA 3P67A 5AC7A 1VR6A 1FCVA 1XXXA 2X1RA 3MI6A 3TXZA 1TYGA 1X1ZA 4ICNA 4RZ4A 1M7PA 1MO0A 2GJNA 3QYQA 1ADOA 3N9RA 2GPTA 5LNUA 1LP6A 3LBMA 4TR9A 3M5YA 3SGZA 1VGAA 4UMBA 3O6CA 4MKNA 5AYZA 3BGGA 4RV8A 4YWIA 1LROA 4JTKA 3BPWA 1N55A 4TX9A 4FB7A 1TCDA 2VFGA 5C2XA 5CPLA 3MP3A 2VFFA 1K7XA 1WBHA 4JYDA 2A4AA 3E12A 4OE7A 3GAYA 3HG2A 3F1QA 2E6AA 1SO4A 4FNPA 3PBVA 1VCGA 4DELA 2FJKA 1WV2A 5FEWA 3N9SA 4WXYA 1YPIA 3O6DA 1OYAA 2V0TA 2RDUA 3P60A 1JUEA 4UTJA 2V8ZA 1SUXA 1FWRA 2ZZ4A 4UTIA 2NUXA 1QWGA 4NNAA 3JRKA 1PIIA 4RCXA 1KM0A 2WKJA 1Z41A 2JKPA 2GQAA 3TQVA 4HNNA 5K9DA 1W56A 4MY9A 2FDSA 3OHIA 5DXYA 4NX0A 1K8XA 2ZQ0A 3QZEA 2HS6A 1ONRA 1ZNNA 1KV8A 1BWLA 2NXHA 3BVJA 5DCBA 3TJXA 3C8FA 1OX6A 3UQNA 2TPSA 3W2MA 3S8HA 1XBVA 1SSDA 2J88A 1QO5A 2E1DA 3HPSA 1W3IA 5CSRA 4ZVJA 1YTEA 4WXZA 4JDYA 1SO6A 1H7PA 1DQWA 1B3OA 1YPFA 4Z1CA 1RPXA 3MHUA 3MW7A 4LUJA 3TE9A 3KVMA 1RZMA 5K2ZA 3R89A 1KFJA 1W3NA 4HPJA 1VH7A 5I3HA 4RKAA 1ZAJA 4O53A 2C19A 3B05A 4QQ3A 3QMTA 2DJXA 2QJIA 1EWDA 3S6DA 3EWUA 1JCYA 5HR6A 3EXTA 4A29A 4GNJA 5HUPA 2H90A 1JULA 2VELA 3NPWA 4MVAA 3W83A 3G0XA 2C13A 3O1NA 4O11A 3BG9A 5KINA 4AHPA 4FX8A 5BOOA 3LRMA 4S2CA 2A1YA 5DN1A 1TTIA 3ELFA 4MPQA 1B4KA 3PSVA 5I3FA 5LSMA 2V2CA 4QM1A 3TW7A 5CGQA 3UWWA 1XDLA 1SW3A 3C61A 1QFEA 2B7PA 4DO5A 5DELA 2EKCA 2ISSA 4LV4A 5K3VA 4HKPA 1MSSA 1GJPA 2CZEA 2FTPA 3ABRA 1ME7A 1LOLA 3DHFA 3M44A 3LCGA 1XKYA 3IIZA 1TSIA 2QCNA 2YR1A 2WO5A 3IGSA 2QCDA 4LTSA 2BLEA 2C18A 4BWLA 1VCFA 3GNDA 5G1TA 1N7KA 1TJRA 1F73A 1JCXA 1JCMP 1EB3A 1OK6A 2Z0IA 4O4WA 2FQIA 4P61A 2YFNA 1FQ0A 3LTPA 1W8SA 3QEZA 3FJ6A 1YDVA 2R94A 4ZQCA 7TIMA 1G4PA 1OVDA 1P1XA 3C2OA 4Y90A 4RR4A 5DXXA 2PRMA 3FEMA 3NQMA 1V7YA 3WJSA 4UTTA 4RLIA 3MBFA 1VLWA 3TA6A 3W7HA 1LRNA 3NL2A 4AB4A 3B8DA 1I2NA 4IMDA 4JTGA 5LNSA 2B0MA 3S5NA 2ZCGA 2ZZ6A 3HQ1A 1UUOA 1WBJA 2ZRVA 3ABOA 3EXSA 1O5XA 5FEPA 1H7NA 3STCA 4O50A 2QDHA 3N34A 1EX5A 4QNEA 2VOMA 3ZFHA 1I45A 4GUJA 4K38A 1PVNA 1ZENA 5F2MA 1QO2A 3SIZA 3LLFA 3W7IA 2B7NA 5E0KA 4X2RA 4M19A 4QSHA 2E5CA 1LBFA 1EP2A 3NPXA 2Y6ZA 3M9YA 1PHWA 4MIMA 3WJZA 3CB8A 4EF8A 3L0GA 2ZZ2A 4NJKA 1QPQA 4JTEA 1G4SA 4UNLA 3HO8A 3NQGA 4RXGA 5G2HA 1W37A 4C1LA 2YZRA 3UPBA 3KAOA 4YLWA 3PVFA 1DORA 2V2HA 3DFPA 4JTLA 4YCOA 2Z1BA 4TU1A 1RV8A 1TTJA 3DBPA 5KZEA 4DF2A 3P74A 1F5ZA 3M0ZA 3W86A 3DFQA 1LORA 4Y6GA 5AHEA 4MJZA 2OCZA 4O54A 5G2IA 3P5YA 1UB3A 4UMCA 3RNDA 4XKYB 3L2IA 3W1AA 1FWTA 3P81A 3G8EA 3N14A 1SQ7A 2NX3A 3F03K 3FLUA 4XBKA 2ZBTA 5LNVA 5EMUA 1XM3A 2PCQA 2WSRA 3ZR4A 4TMCA 2YFOA 2ALDA 4NUWA 4WD0A 1AL7A 3WK1A 3TXVA 1H5YA 3ABSA 1X7FA 2JKEA 4FNSA 2VFDA 4KWWA 3DAQA 3FOKA 1IGSA 4UTUA 2X2GA 4EWND 2HSAA 3QMRA 3PR2A 3LHVA 1TPFA 3NYZA 1OFRA 1H7RA 2BSLA 1RQEA 4AWTA 3W1LA 3NQ2A 1LBMA 5C6MA 5FF4A 3SSJA 1DQXA 3EWYA 3LX9A 3T40A 1GYLA 2YDAA 4N9DA 4N2YA 1EPXA 3QQ1A 2NLIA 2FLIA 1WAUA 5FF3A 3HPZA 3TAOA 1QPOA 1JJKA 3PAJA 5D09A 5AHLA 4KWVA 4CNNA 2D73A 4I9AA 4I7WA 2WPBA 3KXQA 1F74A 4PL2A 3W72A 4CLMA 4K36A 4PODA 1WYIA 3DFNA 2C3ZA 4MLJA 5GVJA 4UTHA 1D3GA 3CM4A 1A5SA 4RZ5A 5LHFA 1J4EA 1L6SA 4AAJA 3P84A 3GK0A 2GVGA 2FB3A 4UXDA 5L9FA 1TPUA 3NGJA 3W88A 4NXSA 3W7MA 1OFBA 5AB3A 3KVJA 2A85A 3NL5A 4FO4A 3A23A 1K3UA 4K8HA 1B4EA 2A7RA 2CLLA 3L67A 4ADTA 3GXPA 4WY0A 5I3IA 1GWJA 3W74A 1XFBA 1H51A 1XBYA 3NQ6A 3PC0A 1CI1A 1XBZA 3EWZA 3PSWA 3GR7A 4PEKA 3HJZA 1WOBA 1Q6LA 1ALDA 4XBSA 3WK3A 1P4CA 4A3UA 3HG5A 1K7EA 5LGZA 3CTLA 3NDOA 3B4UA 1VC4A 3GXTA 5DLCA 3H54A 5EKYA 1VCVA 2A21A 3B0VC 1I2QA 4GWEA 3IRDA 2FPYA 2RHGA 3Q58A 3TH6A 3W84A 1LLZA 4MJMA 2CLHA 1OFEA 1G4TA 4PCFA 2CZ5A 5HULA 3N2MA 2GUUA 2OX1A 3UPWA 3LXBA 4GUGA 1VPXA 3KVLA 3W7CA 3O63A 2E5BA 4KFOA 4K39A 1KM1A 3FS2A 4U28A 1HUVA 1JCLA 1DL3A 3TSBA 2W79A 1A53A 4H3DA 3OA3A 3TAKA 3HGSA 4ZMGA 3Q94A 4IMGA 2E77A 1SW0A 1R30A 5D2YA 5K4XA 1JQXA 4JY8A 1K03A 3RFAA 3LRKA 3H53A 1W31A 1Q3NA 3B04A 3ATYA 1FBAA 3NA8A 3OBKA 3CIXA 3HG3A 1FWNA 3DFTA 5CPOA 3OVQA 4JD4A 1S5VA 2QEZA 3W7JA 3KX6A 2QCEA 3FYPA 1D3HA 1TV7A 5F2IA 3PUEA 4AHQA 5D37A 3KFTA 1Q6RA 3D0CA 5HNRA 2ZYFA 3MBDA 2X1TA 2PRHA 5LZLA 3HIJA 5CPMA 5DCEA 3B06A 2UV8G 4QNWA 4IMCA 4BI6A 1B57A 2RKXA 2Y7FA 4NZJA 1D9EA 4LVDA 3G3MA 3LHYA 2GQ8A 4NNBA 3G1YA 2A7NA 4AWUA 5J5RA 1VYSX 4RZ6A 4JYFA 4XUGA 4GUIA 3UNDA 4TMBA 3C2EA 2CFFA 4DO4A 5CKSA 5G4EA 1SR9A 3NQ7A 4WJEA 3A5VA 2P1FA 2J24A 1MEIA 3LOTA 5F1VA 3MYPA 3MO7A 3U6WA 3PG8A 4K6AA 1SSGA 2YPIA 1X6UA 4DXVA 1ICPA 3P7YA 4EF9A 4O10A 4ZQNA 5HWMA 4N9EA 1I2RA 1KTCA 3W1NA 3EWXA 2AAMA 5G2WA 4I7UA 3W2UA 3JR2A 4QITA 4UR8A 4JIPA 3IVTA 4DBDA 3PM6A 4GC4A 3W1MA 4MYAA 1TPDA 4YMZA 3V75A 2CLOA 4IPJA 4JS3A 3K30A 1C29A 1EIXA 3DH7A 3TCEA 3HGOA 2OZ0A 5BNKA 4O1DA 5EY5A 3LXAA 2ZZ1A 1PCWA 3W75A 1XI3A 1GQNA 2O7SA 4AWSA 3HF3A 1OFDA 1K02A 2CW6A 2OMAA 1GVRA 1VJIA 3HG4A 3UXDA 4UIOA 2TYSA 4ZZ9A 4O8RA 2AQWA 2BWGA 1O4UA 2WSYA 1JVNA 4UCGA 3NQ8A 5DCDA 3CPRA 3I7QA 3THAA 4AMAA 5LKYA 4GFSA 5FF2A 2FIQA 3P80A 3MHGA 3WK2A 1FDYA 4E2BA 3NL6A 1LLWA 3O16A 1H7OA 3BW4A 4JEQA 5LNRA 2ABAA 5D30A 2EF9A 1OX4A 1T96A 1VHCA 4Y8FA 1S3HA 2ZRWA 1M7OA 4NJGA 4Z0SA 4MZ1A 4NT0A 1W5MA 3UY7A 2O7QA 3CWOX 4MZYA 1I2PA 3M1ZA 3NVTA 4X3ZA 3FKKA 3UY8A 1DKWA 1TPVA 1GPWA 3FFSA 4DEFA 4JTUA 3GZ3A 1EA0A 1NSJA 5LNWA 2YYTA 2GVLA 3G8RA 3NQEA 2KZHA 1R2RA 3PBWA 2I14A 3VCRA 5BRBA 1FY6A 3LI0A 3LRLA 2NWSA 4NVTA 4CCCA 2E68A 5D04C 4BF9A 5AHFA 1X8FA 3I68A 1DJNA 2JGQA 3DI0A 3E9AA 1L2UA 3LXCA 2Y88A 4AEOA 3G1SA 5HWNA 3S1WA 4AVFA 1KFLA 2HTMA 1KM5A 3W76A 3EWBX 1O94A 2G96A 4IMFA 4JNMA 1GZGA 2EPHA 2Z2UA 5CZJA 3RLVA 3L0KA 3IIOA 1MEWA 3LB0A 3CEUA 1FWSA 3DXIA 3EX6A 2ZDRA 3M5XA 3MYOA 3B03A 1W0MA 1Z48A 1ZALA 3C0JA 4HNVA 2TRSA 1GG1A 5I3JA 3W73A 3PY2A 3NO5A 3EEGA 2DZSA 3SW6A 5DY2A 4UMAA 2YW3A 2G5WA 4JTFA 4UUIA 3SJ3A 3A24A 2ZRUA 3TX9A 3LCHA 1EWEA 4LRSA 3S1XA 1VLIA 3DFOA 4GXMA 3W7QA 1P5BA 2PURA 4S1FA 3W22A 2WNQA 3GXNA 1H7XA 5J5DA 2R91A 2A5HA 4E38A 2NUWA 1TPH1 1W1ZA 5FESA 3W87A 4WY0F 1QPRA 4D2JA 2WOQA 1PS9A 2NX9A 3TIMA 3G1VA 4LUIA 3BLFA 1F6PA 1LYXA 3N2XA 5ABTA 3P82A 1LM1A 2ZRYA 3V1PA 4O13A 4GUFA 6TIMA 3H55A 3G1FA 5D32A 4AHOA 1OF6A 1WA3A 2HMCA 4JR5A 3IIVA 3ZWTA 5DY3A 3TJLA 4FNQA 3BG3A 3UZJA 1KBJA 5K4ZA 2QCHA 3FYOA 4M7TA 1AW5A 3LLDA 4LVGA 1ZAIA 5A8GA 2DORA 3TDFA 3I7RA 5D2VA 2Q3OA 1DOSA 5AFDA 1K8ZA 3W3OA 3MHFA 1WOAA 3P61A 5CZ0A 3HB9A 3M16A 3EX1A 3STEA 4YXGA 3MP5A 4WUIA 1JUBA 1R2SA 2NV2A 2A7PA 3LERA 3M5VA 4NXKA 3TSDA 5I3KA 3L9CA 4E2DA 5D33A 3BV4A 3B0UX 1T8XA 4LNYA 2F84A 3U8GA 2H8ZA 3VKJA 4I7VA 1SU5A 1THFD 2C6QA 3U2OA 2GQ9A 4M7SA 1VZWA 4GUHA 3LCLA 4HT3A 2A6NA 1YTDA 3PUOA 4CNOA 2XN2A 4TIMA 1PV8A 1OABA 4JY9A 3O15A 2FPTA 2YX0A 3R13A 4LT9A 5FI8A 2JKAA 2C0AA 4XWUA 1LOSA 1T0OA 2B4GA 3CHVA 1CW2A 2QCLA 2BX7A 3YPIA 2OJPA 1W5NA 3LCFA 4WOZA 4ZQPA 1Q6QA 3IVSA 3P8JA 1GVSA 1A5BA 3UD6A 3ZWSA 3FKRA 2G95A 4IXHA 3UWZA 5C55A 1NFBA 2RH9A 1RD5A 3NZ1A 1R47A 1BTMA 2OT0A 1BEUA 4O4VA 1TREA 3USBA 3W7PA 3CQ0A 1PCKA 4CCDA 3KOFA 1UUMA 4O14A 3A22A 3R2GA 1ML1A 1TQXA 4IOTA 3S5YA 2TSYA 1RQHA 3ATZA 4FXRA 3EKZA 4LC6A 4UFKA 3TKFA 1LRTA 2QCGA 4UTKA 5TBOA 1F05A 3WK0A 2VEIA 1B9BA 1PHQA 2VFEA 4M6QA 1FDJA 3NOEA 3OVRA 2ISVA 3LHUA 4G1KA 3W7OA 4BWLC 3G0UA 4CQ8A 4UFIA 3THQA 3G18A 1H61A 4UFLA 4Z08A 5A5WA 3CC1A 3IEBA 1RVGA 3T55A 3C56A 1H1ZA 2Y89A 4BI7A 4OT7A 4JXCA 2VEKA 3ABQA 3QRHA 5HJLA 3TUUA 5DBTA 3AO0A 5LGXA 3R12A 3RLUA 1O95A 2CLMA 4IXXA 3TC7A 1ZJIA 2BZNA 4NNCA 5E1QA 3O05A 1KM3A 2Z6IA 4IWWA 3TC6A 2X30A 2QF7A 2AGKA 3W1QA 3S0CA 8TIMA 5LHEA 3Q37A 3GIYA 1OJXA 4FIQA 3DZ1A 1FWWA 2QCDB 1GTHA 1OFQA 2EHHA 3CIWA 5G5IA 1TTQA 5HWJA 1TB3A 1TIMA 1EP3A 3C6CA 1AMKA 3NEVA 4IGHA 4KFPA 5KSWA 2X1UA 2V9DA 2XN1A 3PB0A 4GBUA 2E09A 4LV9A 2ZRXA 2V5LA 3G1XA 4JYEA 1OX5A 4JX5A 1TMHA 3DKJA 1IIGA 3LHZA 2DZWA 3E49A 1SZNA 1ME9A 1UJPA 3FA5A 4IX2A 4N6EA 2YSWA 1JUKA 3GYEA 3TR2A 2E6FA 2E5DA 4AF0A 5TIMA 1H1YA 1EEPA 1GTEA 3QW3A 4Z1BA 1A5AA 3L66A 2ZA3A 1G4EA 1SFJA 2YCEA 3O07A 4O1BA 2RFGA 4LW7A 1T99A 4P2VA 4PC8A 4X22A 5EBUA 4AH7A 3G3DA 3P5ZA 1I8JA 3PG9A 2H6RA 3NQVA 4NJHA 3RF9A 1IF2A 5C54A 3M47A 1VRDA 3PWAA 4PA8A 1TRIA 4OV4A 1GVQA 3NL3A 4LC8A 3W1RA 3I7SA 5AC6A 4NU7A 1JCJA 3PUDA 3BG5A 1QR7A 3PULA 2F7FA 3LV6A 3Q2DA 1GVFA 2CWNA 1KBIA 2DU2A 5AC8A 3MI3A 2FFCA 4EVZA 1JCNA 4XQ6A 3W1PA 5FEZA 2OT1A 3A5FA 5AOUA 3DFSA 4NX5A 4CQAA 4Z1AA 5DBUA 1OG0A 1A50A 4RJEA 5HMSA 4ADUA 1PE1A 3GDKA 1GVOA 2A6LA 1L9WA 4Q32A 3GKFA 2DZXA 3EWWA 1OF8A 5F2GA 1SZEA 1LTDA 5KTLA 1NVMA 4JDBA 1KM4A 2FPVA 1N8FA 3MI2A 3W6YA 3KHJA 2E6YA 4B5NA 4DF1A 5D2WA 2Y7DA 3EX2A 4O1AA 3WFAA 5I3GA 3W7RA 3NR0A 3QMSA 1DVJA 3W85A 4PTNA 4PFMA 3SFKA 4JICA 2PE4A 5FF7A 2JBMA 2QCMA 2H3DA 4JIQA 1XL9A 1OYCA 3GB6A 3CU2A 4XTDA 3ZS4A 2NX1A 1QAPA 2DZTA 1RR2A 5EL1A 2ZZ3A 1LDCA 3KVKA 5C5YA 5CPNA 3LGEA 2B7OA 2P10A 2QUVA 1YXCA 2Q8LA 4FNRA 3ANYA 3KRSA 3TW6A 2NZLA 3QFEA 4GJ1A 4QIUA 3LTYA 3VNDA 1TPC1 5SWUA 3BARA 3VE7A 4MUZA 3C2FA 1SPQA 3BW3A 5BMXA 2VEPA 3BK0A 3BW2A 4MYXA 3CLMA 1UBSA 1H62A 1U83A 3FJLA 4PL1A 4YCPA 2C16A 2CLFA 3QF0A 1KTBA 1XBXA 4EOUA 2V81A 4QISA 2CLKA 3LTSA 1J5TA 4J9JA 2YYUA 1AL8A 4TO8A 1YYAA 3QJAA 4N4PA 1GEQA 1IXOA 3NM3A 3HGJA 4Z1DA 3LHTA 4RXFA 1F7BA 2A2IA 3M43A 3LDVA 1VYRA 1C8VA 4POCA 4LS2A 1ZAHA 3OVPA 5T26A 3S1VA 2Y62A 4ZQMA 3VFLA 3L21A 3GAKA 4AXKA 1KV5A 5HINA 2DZVA 3HMJG 4K7YA 3G0SA 1H60A 1XC4A 4ADSA 4FF7A 5F1UA 3VE9A 1JRCA 2XFWA 3LM7A 1ME8A 3P62A 4WOQA 3IGXA 4KKXA 4HN4A 1AK5A 2RDTA 4UC5A 4N9CA 1YDOA 2QAFA 3L68A 5EPDA 4O28A 4HPXA 1KFEA 1NF0A 3LCXA 3OG3A 2WNNA 5H91A 4O19A 2Y85A 4O57A 4Q4KA 4LY8A 4IPIA 1GOXA 3UWQA 1F2JA 3W7KA 4L4MA 1OX4B 5BW6A 2QAPA 3W1XA 3UXAA 4PH6A 4LRTA 4JTJA 4UFJA 4MLRA 5L6UA 2J9ZA 4MZ8A 3EKLA 3HGRA 5CSSA 2ZFAA 2J27A 1ZFJA 2P0OA 2QKFA 2RDWA 1J2WA 2C1HA 2W0UA 1UASA 3M6YA 4FIRA 3G22A 1DHPA 3S5ZA 4Y9AA 4W9TA 3UWVA 3S1UA 3STFA 1NF7A 2WSQA 3EB2A 1G7UA 1YXDA 2Y70A 2X16A 1I4NA 3C2VA 3P8IA 1FCBA 1W5QA 4M5PA 1DJQA 3TMQA 3C3NA 3QSRA 4MOZA 2C14A 3E0IA 1BWKA 4ALDA 3B0PA 1H7WA 3IVUA 5FEXA 4AF0B 2H8XA 2CZFA 2VENA 3LBCA 1KW1A 3LCIA 3IV3A 3E96A 3W71A 3QC3A 3L5MA 5HUOA 3TMLA 2IQTA 1KTNA 1MZHA 2V82A 4LVFA 4E0CA 1M6JA 3DKLA 2R8WA 4O17A 3DI1A 3F4NA 2A0NA 4FXSA 4K8EA 4A21A 4HSNA 1U5JA 3S9YA 1KLZA 2CLIA 2QJGA 1TPEA 4N6FA 1E51A 1DV7A 1EUNA 4YL2A 2WNZA 4DF0A 1LBLA 5K9CA 1Q45A 2NUYA 4BI5A 2VFIA 1K8YA 1VQTA 3SGUA 2J9YA 2NXGA 3E02A 3W2JA 2ZA2A 2WQPA 2PC4A 3N73A 1X1OA 4LVBA 2Q8ZA 3GDRA 4O52A 2QDGA 1GT8A 4S2BA 4JX6A 1ICSA 1YLVA 4A22A 1YDNA 1W5OA 2EGZA 4IJBA 2C15A 3T44A 4UNKA 1HL2A 1HO1A 4QJ1A 2WV8A 4UTLA 1HTIA 1NEYA 4NQ1A 3I65A 4M6PA 3NG3A 1FCUA 1FXPA 1WQ5A 4JN6A 3GVGA 1FDZA 1PL9A 3N3MA 3UWUA 2EAWA 4Q33A 3LCWA 3NPUA 3WJWA 4CCEA 2ZZ5A 2ZTKA 1TTPA 1Z44A 2TMDA 1MEHA 2X1SA 5KZDA 1OFOA 4HHPA 3TNOA 1H63A 4OWGA 4DO6A 3KRZA 2VKZG 1FUYA 1TV8A 2ZA1A 5CZTA 1FXQA 4O0KA 5F4WA 5E93A 1DBTA 2VFHA 3PBYA 4UTTC 1KM6A 3TQKA 4XTIA 3QM3A 4C1KA 3NQDA 5D2TA 4BK9A 2WJZA 1L6WA 3GR8A 4O15A 1TV5A 3CEPA 4BFAA 2FB2A 3BGJA 1JRBA 5KITA 1V5XA 4K37A 2W6RA 3DENA 3QSTA 4R34A 4XKYA 3W2NA 5D02A 3SZ8A 1TPWA 5BMWA 1OHLA 1LRQA 4NJJA 3MWAA 6ALDA 1XUUA 4LVAA 2ZTJA 1QCWA 3IGUA 5IBXC 3L5AA 3L65A 4LWWA 3T78A 3L5LA 2V5BA 1KFCA 3SR7A 5D2XA 3NXFA 4EIVA 1EUAA 3TU9A 5D03A 4OV9A 5KMYA 4JTTA 4ONVA 2ISWA 3T7VA 5IBXA 2HS8A 3W1TA 4OHQA 5EA9A 3N19B 3IIPA 1JR1A 2JGYA 2ZRZA 1JQVA 1LZOA 4RX0A 3W7NA 3CT7A 2DJLA 3BLIA 5K7JA 4FEZA 4JTIA 5AN7A 4DPQA 1C9DA 5D05A 5G4WA 1QDSA 4HIBA 1IXQA 3PF3A 2ABBA 3UZ5A 3MP4A 5EYWA 2DP3A 3W7GA 3G24A 3C2RA 4UTMA 4UTWA 1Q6OA 4LU0A 3TFCA 1YXYA 3VI2A 3STGA 1SZFA 2I1OA 3LHWA 1OFPA 3R5EA 3W7DA 4O18A 1KLYA 2NWRA 3NZRA 5MHBA 4JTSA 1F76A 2ATSA 3GDLA 3O06A 4HNTA 4FHAA 1HFBA 3W07A 4L4LA 4FX7A 2Y63A 3LI1A 3HPXA 1G67A 3W9ZA 2B7QA 4MY8A 3DHDA 3A21A 3LV5A 2V30A 1AW1A 4HNUA 3TSMA 4WX2A 1IXNA 1Y0EA 1GG0A 1S5WA 1WXJA 3UYCA 1XDMA 4H4IA 4JTHA 1ICQA 1S5TA 4U4MA 3T4CA 5AYYA 2QUUA 1TPB1 4N02A 2XN0A 1Z42A 5F2LA 3G1HA 5TQLA 2LLEA 3EX4A 3TQ0A 3DU0A 1FX6A 1WX0A 2J9XA 3MJYA 4IX0A 4LOCA 3KRUA 1KFBA 2QCCA 3EXRA 1LOQA 1XCFA 4CQ9A 1OYBA 1VYPX 2DZPA 2JK2A 2Y61A 1YADA 4DQWA 1R46A 3FIGA 2BXVA 4M6VA 4FNTA 4JGDA 2YGYA 2PRLA 2E6DA 3SECA 1ZY9A 1VS1A 3TFXA 3G1AA 3SY5A 1OFAA 1SFLA 1RQBA 3RU6A 2NXIA 1G7VA 1QPNA 2G97A 3QPYA 1KM2A 3RK8A 4OU1A 4O1CA 1AG1O 3S5OA 1TO3A 3OIXA 3NM1A 4HSOA 5F4SA 4ZQOA 2BTMA 4RK8A 4ZQRA 2CLEA 3WJYA 1W5PA 3GDTA 3W1UA 4WY0B 4DBEA 3GLCA 2VEMA 4ORIA 3W2KA 3BLEA 4UFMA 3R8RA 1CX9A 1K7FA 2R14A 3TV8A 3I6RA 4ML9A 4A2RA 2Z6JA 4O0ZA 2J6XA 3MMTA 2QCFA 4XZ9A 3PS7A 1VHNA 2YW4A 3DGRA 5CG7A 1HG3A 5K9XA 1HO4A 1EP1A 1YTKA 4BR1A 2GVJA 3PBUA 1SW7A 4OGZA 1H50A 3MUXA 1NAL1 5U7SA 5IM51 1LCOA 3M41A 4R33A 3GKAA 4NJIA 2GJLA 4MFDA 3BO9A 3W7LA 2YXGA 4MY1A 2CZDA 3RMJA 1TJPA 4FX6M 2VXNA 4ZL1A 1G6CA 5G1YA 1WDWA 3NPVA 1G69A 2QJHA 3QW4B 3UWYA 3GDMA 3HOJA 5H2ZA 3G1DA 4GRSA 4IUOA 3WJXA 1MXSA 2QR6A 3TK7A 5KZMA 3QPZA 4QAIA 1SO5A 3PB2A 4K7VA 4ORMA 5HQEA 4LS0A 2Y7EA 4N9BA 4X9SA 2QUTA 1KFKA 3A9IA 3L0NA 1QMLA 3M5ZA 4NZFA 3NQAA 5AHMA 3W7EA 4CNPA 1ZCOA 2DZUA 5FF0A 3F4WA 1L6YA 1ZHAA 4UR7A 4Y96A 4R53A 2NV1A 1FCQA 3JS3A 4IQLA 4Z0JA 2Y7GA 2I9EA 4O12A 4IMEA 1O60A 4OBTA 1GYNA 1KA9F 2VC6A 4MFEA 3W23A 2V2DA 4FNUA 3SI9A 1I2OA 5AYXA 4DPPA 3CWNA 3NAVA 4WQ6A 1O5KA 4KFNA 2CU0A 2Q3RA 1W54A 3OEXA 4N4QA 1IXPA 3GNNA 3HBLA 3W70A 1TQJA 4A2SA 1TRDA 3NNTA 3W2LA 1QOPA 4R7JA 1BKSA 5HR7A 3NQFA 1QOQA 3QQ0A 1P0NA 1QNVA 5U4NA 5AHIA 1SZGA 1IIHA 3M7WA 1A5CA 1SO3A
chains in the Genus database with same CATH superfamily
4DO7A 3UCCA 3EX3A 4GVIA 4H6KA 4IHCA 3O6YX 1BG9A 4JX4A 1P0KA 2OEJA 3VOJA 4ILSA 4PB4A 3QH2A 4WKHA 5D38A 2EJ1A 4OQVA 5CZSA 1FWJC 4WZHA 3W6LA 5AC7A 3EDEA 1KRAC 1FCVA 3VIGA 3MI6A 3HU7A 3A3WA 1HVQA 3AS3A 1R38A 1B1YA 3LMYA 3GG8A 3KWXA 1ADOA 3R25A 7REQA 1LP6A 3UT0A 3O6CA 5ABEA 1V77A 3BPWA 1N55A 1MQPA 1P6BA 2PF0A 3AFBA 5C2XA 4UZSA 2A4AA 4TVUA 3ARUA 3MY9A 4HTYA 4N42A 1Q7ZA 4D72A 3F1QA 3WO8A 1SO4A 1UJQA 3GTXA 1Q6CA 2BGQA 2ISDA 2D3NA 1VPQA 5FEWA 3RR1A 4I3GA 3N9SA 1E6SM 3CO4A 2CPUA 1OYAA 4ZENA 1QBBA 1JUEA 4UTJA 1DP0A 1B30A 2X05A 1SUXA 3ORWA 2ZZ4A 3IANA 1QWGA 4PMDA 3T2PA 4RCXA 1J5SA 5A6JA 3WBYA 1Z41A 3M4HA 2GQAA 1EDTA 1FWCC 1W56A 4K3ZA 1FHDA 2FDSA 3RPMA 4NX0A 4KH2A 2PLJA 2HS6A 1P0EA 4DBWA 3CUHA 3AXMA 1YRRA 3M7SA 3HN3A 4GYPA 2TPSA 3BCFA 3PBMA 1RXOB 1HVXA 4GYFA 4GKTA 3HPSA 4L6DA 5AVHA 4PMUA 1MUCA 1YTEA 4ICCX 4P8VA 4KEZA 2OQYA 1DQWA 1B3OA 1YPFA 4Z1CA 1S5MA 3MW7A 1T40A 1W2PA 2QULA 1KFJA 1W3NA 2X8RA 5BU6A 3WQVA 1JF5A 2DJXA 3QMTA 2OZ3A 3EXTA 4LCQA 1V0NA 5HUPA 4NAEA 3BURA 5HMDA 5LXEA 1EYEA 4Y9NA 3G0XA 5FSDC 4IP7A 5IDZA 3O1NA 1Q7QA 1F07A 1IGWA 1K6AA 4AHPA 1E9LA 4FX8A 2DSKA 5BOOA 3M0KA 3JVAA 2A1YA 2NVAA 3LSCA 4Q4PA 3WF4A 1W1A1 4EAMA 1XG3A 2OGJA 3VIFA 4GO9A 4M24A 4QM1A 1TWDA 1NARA 1SW3A 3C61A 1F3EA 3ME3A 4YTSA 4HKPA 1BSLA 5C8BB 1DTUA 2FTPA 1LOLA 2VM8A 3M44A 1HGWA 1W6TA 4C6LA 3N4AA 2QCDA 1E70M 3AU2A 1VCFA 4GNKB 3OIHA 1TVNA 1XH2A 4M8UA 2P0IA 4JHOA 1F73A 1PDYA 4X0NA 2Y0FA 3CL6A 4JZ5A 4O4WA 4P61A 3O0FA 2FDMA 3DOPA 3APTA 3LTPA 1E15A 2A3CA 4S3JA 1G4PA 5E9AA 1NP0A 1V7YA 1OINA 1SZRA 1GQJA 1KBLA 4Q4RA 4PR4A 4UQAA 3RM8A 4TV6A 1LRNA 1I2NA 4IMDA 3EGJA 4CU6A 2ZZ6A 1UUOA 1WBJA 1KXHA 3BLOA 3N34A 4K38A 5F2MA 3AYTA 1KGUA 3SIZA 2PDCA 4PCPA 2B7NA 5E0KA 4X2RA 4M19A 1LBFA 1EP2A 1XX1A 5LIWX 2WAGA 5HMEA 3CAQA 3L0GA 1HF6A 2ZZ2A 1QPQA 3NQGA 4RXGA 1E73M 4JIHA 3RMEA 4C1LA 3UR7A 4YLWA 3DFPA 2JFEX 4DWSC 3P74A 1NIUA 2DEPA 4Y6GA 2OCZA 2J7GA 1SM9A 4B5WA 3COTA 3LN3A 4UMCA 3P3BA 3W1AA 1XSIA 3BLDA 1FWTA 3P81A 3G8EA 2WZTA 1GZJA 3KDNA 1WKDA 4FZIA 2NX3A 3F03K 2PDBA 2VEFA 3CQKA 3M0JA 3GHSA 4Z2GA 1XM3A 4V1YA 4ZB5A 5DMNA 4JHZA 1NWTA 1H5YA 2ZE3A 5FJUA 3ABSA 3H6OA 5GPRA 1UR9A 3DAQA 3FOKA 1Z6KA 4HU8A 3LHVA 5A2AA 3BAXA 3NYZA 2PDXA 2Q02A 3W1LA 2OODA 5FF4A 1DQXA 3VD9A 3V18A 4MUPA 1GYLA 2D22A 5FF3A 3EPMA 3HPZA 5JUVA 2PDIA 3PAJA 4KWVA 3WF1A 4CNNA 2D73A 2WPBA 4I9AA 4PL2A 3W72A 4E3VA 5GVJA 4UTHA 3ZZ1A 1V3IA 4RZ5A 1C9WA 1N8WA 1E72M 4AAJA 2GJXA 2FB3A 2CWXA 5L9FA 4BQ2A 3LQGA 3VIHA 5AB3A 3KVJA 1J6PA 4GG9A 4FF5A 4ADTA 4H00A 3AMGA 3B8UA 4Q7NA 5BCAA 3I4KA 2WZHA 4IIFA 2CITA 2CC0A 1H51A 5KETA 3ZSTA 2GWGA 1CI1A 3U4AA 2C1GA 2CCRA 3WUBA 2D0FA 3OJGA 3MUIA 3W82A 4A3UA 1KKRA 2HEJA 1PPIA 4H9VA 3KRBA 5HDRA 2BFGA 3S83A 3NDOA 3B4UA 3ALGA 3IJ8A 3DHUA 2Y5EA 4M6UA 2FPYA 3Q58A 5CAHA 1LLZA 4MJMA 1M53A 4UQDA 1QBAA 4GXPA 3N2MA 3SUUA 3QOMA 5C9XA 5HK4A 4Q8MA 3LXBA 2YL8A 3W7CA 3O63A 2XSAA 4KFOA 1KM1A 4U28A 1HUVA 3TSBA 1A53A 1E1FA 2YB1A 3TAKA 1QHPA 3VC5A 5JBEA 1SW0A 3IACA 5D2YA 4JY8A 1K03A 3LRKA 3OBKA 1UKQA 5FOOA 4MB3A 3CIXA 2PTZA 1E6XM 2VCCA 3OVQA 3PJWA 4HMNA 4JD4A 1RD6A 1FP9A 1GOMA 3CZJA 1JGIA 1ELSA 2J7DA 2VX4A 4ZE5A 1TV7A 5F2IA 1Q6RA 2ACUA 3D0CA 5EGRA 3NFUA 2ESCA 1TWZA 1E1CB 2J7CA 4QNWA 4Q3MA 4LVDA 3G3MA 3CHFA 4GK8A 1AODA 1XLHA 1K9FA 4NAFA 2PWEA 4RZ6A 1BWVA 5A6LA 5CEWA 2BVYA 3POCA 5CKSA 1UZHA 5G4EA 2KAUC 1OADA 4M0XA 2PU0A 5F1VA 3VOGA 1GVIA 4K6AA 1XKJA 5M2FX 1SSGA 2FGZA 3NO3A 4XZLX 3VDHA 2YPIA 1X6UA 5A3HA 1W9XA 4ZQNA 3TLQA 1DIOA 4N9EA 4R9OA 1I2RA 1KXTA 1QI5A 4PBEA 4JCLA 3S9ZA 3W2UA 3LNMA 3SCTA 1V0KA 4E8CA 3FDGA 1UZ4A 5E6ZA 3WLTA 4E2OA 4I9TA 4MYAA 4Z2IA 1QW9A 2CLOA 4IPJA 4ENLA 1JDDA 2J25A 2PBOA 1W3JA 1XRTA 1W9UA 2VGIA 4QX4A 1TE6A 2OZ0A 1F6YA 2YDQA 3LXAA 6REQA 1XI3A 2I17A 3BAKA 3K8KA 1OFDA 3E0WA 3UXDA 2X0HA 4UIOA 5H8UA 4ZZ9A 4IT1A 2BWGA 3WD4A 3CPRA 5LKYA 4GFSA 4KESA 5E09A 1C92A 3MHGA 4E2BA 1NDZA 3NL6A 4GLEA 3T0BA 3O16A 1H7OA 3V5FA 5LNRA 5D30A 1RCQA 2EF9A 1OX4A 1X38A 4IH3A 2YJQA 1C7TA 4IIHA 2XZ9A 4NJGA 3H24A 3CWOX 4MZYA 2GOKA 1VJSA 3V35A 1OCQA 3UGRA 1BGGA 2PGRA 3FKKA 1DKWA 1TPVA 3ZXWA 5BOFA 1ZCCA 4DEFA 4YYCA 3V0UA 2ZADA 3GZ3A 3KW3A 4IICA 4YJ5A 3RRXA 1LT7A 2IPGA 5A2CA 5A6MA 2OYLA 2QGHA 3S5SA 3OP2A 3G8RA 3NQEA 3ZR6A 4RPPA 1JPIA 3OG2A 3S47A 2QT3A 3LRLA 1VFSA 2ADAA 4GY1A 3V36A 5C70A 2X7VA 3E9AA 3K2GA 4S3CA 3GU9A 2WANA 2Y88A 2BASA 3G1SA 3S1WA 1KFLA 2HTMA 2X09A 4XAFA 3NVDA 1CGWA 1O94A 3N6HA 3L4XA 2VHLA 5BXRA 2G37A 4IMFA 1JYVA 4JNMA 3EPOA 1SFTA 5CZJA 3RLVA 1AD1A 4UOJA 3IIOA 1TJ0A 1UR8A 1GK8A 2R1LA 4DYKA 1U30A 4X60A 3EX6A 2W63A 2ZDRA 1V7AA 4QXIA 3C0JA 5REQA 3OQ8A 4NRRA 2VDHA 1J8VA 2DZSA 3BXWA 4GQ0A 3SW6A 1ITUA 1LF1A 2HXTA 4UUIA 3LCHA 4LRSA 1H7XA 2GSHA 3BICA 3OLDA 4P7LA 4E38A 1E5NA 4WSHA 1W3LA 3UG3A 4Y9PA 1TPH1 4MADA 1Z8AA 1QPRA 4M80A 3TIMA 2IKIA 5AZ0A 3EDDA 2PLMA 4HP5A 3VCCA 1LYXA 1V08A 3TOPA 3V1PA 2PWFA 8CGTA 4QE4A 6TIMA 3G1FA 3ITLA 3AHTA 2FFIA 3IIVA 3NJ3A 5DY3A 3BJSA 3BG3A 1LT8A 2QCHA 3FYOA 1AW5A 2I9UA 3CH9A 4DZIA 4PTMA 1JD7A 1ZAIA 2P3EA 3GH7A 4UTFA 1QVBA 3D46A 4H2HA 1VFLA 1DE5A 2X0SA 3I7RA 5D2VA 2NQJA 2WMJA 3EOSA 3W3OA 3L12A 5CZ0A 1E40A 1QT1A 3K13A 1QI2A 4NP7A 1UWIA 1V6WA 1JUBA 1V8EA 4GNVA 2A7PA 4DYJA 2WSKA 1BXCA 3UFYA 3WUFA 2VD8A 5DEZA 3BV4A 3AYRA 1SU5A 2RJGA 3H2CA 2GQ9A 4GYPC 4M7SA 2VRQA 4DJFD 3PZOA 1YTDA 2OOFA 3PUOA 4Y2WA 3PTKA 3WL0A 4TIMA 1OABA 3WLOA 1MNSA 4BJHA 4LT9A 2VR4A 3F4VA 4GYKA 1M1BA 3RO8A 5DT5A 3AIVA 3U7VA 1W5NA 3CZKA 3EOOA 2Z26A 2DUXA 2ZXDA 3BSMA 1E9ZB 2YLLA 3PZMA 4E4UA 1AD4A 5BRPA 3ZWSA 1Q7MA 2G95A 5C55A 1RD5A 3W27A 5I7GA 4RDVA 1BTMA 2WJEA 3UETA 4O4VA 1KC7A 3ARRA 3T8LA 3WNPA 3KCOA 1ML1A 1TQXA 1XLLA 4W93A 2TSYA 3ATZA 3LA4A 3EKZA 4FP1A 1WZMA 1YPXA 1W3KA 4XUYA 1O66A 3TCSA 4EPEC 2EKGA 2VFEA 3ARSA 3NOEA 2OG9A 4OECA 3AIEA 4MTVA 3GBDA 3W7OA 4BWLC 1EQCA 4CD4A 1B3ZA 1U33A 2YCKX 1WP6A 4GQGA 3RAOA 3WDHA 2AKZA 1XF0A 1XGZA 3IEBA 4GMEA 3T55A 1H1ZA 2Y89A 4DJEC 5HJLA 5DBTA 1OT1A 1O95A 2XGIA 2CLMA 3SRHA 4DM1A 4RE2A 2ACSA 2BZNA 4NNCA 2E28A 4IWWA 2QF7A 2WSPA 3TYAA 1GOQA 8TIMA 3Q37A 3HFTA 4LH8A 4IGNA 3FAWA 2EHHA 1V3HA 4XZWA 3IJ6A 3TTSA 4IGHA 4ZTYA 4EXBA 3QHMA 2VEGA 4IFKB 3KEHA 1MDRA 3H12A 4LV9A 2REQB 1W32A 4ATLA 5FJTA 1VFMA 3CJPA 3QVQA 1DWFM 8XIAA 2GQ3A 1SZNA 3K4AA 1ESWA 1UJPA 4UR9A 4N6EA 4GA8A 1GHSA 2E6FA 4E2VA 2E5DA 1EEPA 1CZ1A 1GTEA 3UZXA 3NZQA 1SFJA 3TEVA 4H01A 5EBUA 3P5ZA 3RF9A 5C9RA 3K1GA 3PWAA 4NY2A 3T08A 1TRIA 2Z24A 1GVQA 3NL3A 4DLFA 3W1RA 5AC6A 4C65A 3W24A 3PUDA 3T8QA 5I00A 3PULA 3U7BA 4PRTA 3WF3A 2F7FA 1B9ZA 3LV6A 4HK7A 3T0AA 2Y8KA 5AC8A 2FFCA 1LQ2A 3CQJA 4XQ6A 1IYXA 2WVTA 4F8XA 3IAQA 4PUJA 1XLDA 4HZMA 4XZMX 4NX5A 3OZYA 4Z1AA 1WNOA 3N29A 4ADUA 3WL1A 1GVOA 3Q67A 5HA7A 1DWIM 1TZ9A 4A3HA 4QJ3B 3FDKA 2WPGA 3MI2A 3LY0A 2C79A 1EXBA 4B5NA 3DBNA 3VDCA 5D2WA 1CXLA 3WLSA 2V5CA 3IRSA 4O1AA 3LG3A 4BQ4A 2DH2A 1XYBA 1D8CA 4PTNA 4PFMA 3WLNA 4XKMA 2PE4A 1RK6A 3IPWA 3OQEA 1YKWA 4YVVA 1R3QA 3ZSSA 5IHSA 4KWSA 1PZ3A 1PO9A 3VIPA 1A4MA 4AC7C 2VL4A 1YXCA 2HWGA 3KRSA 3UJRA 2NZLA 3A12A 3SURA 3QFEA 1JDFA 4QIUA 3WF0A 2WM0A 3IJLA 1MUMA 5BXPA 4MUZA 1AZ2A 1SPQA 3BW3A 5BMXA 4BEUA 1J0JA 5I24A 1XP3A 3P0XA 1GKPA 4J3SA 3PNUA 4ES4A 3CLMA 1U83A 3FJLA 2C16A 2CLFA 3NSXA 2V81A 4QISA 1JYXA 4UB9A 1AL8A 1XG4A 1AJ0A 4XAYA 1XC6A 1IXOA 3SM0A 2QGYA 2UY3A 1M04A 1P0BA 3LDVA 2IXUA 1C8VA 3L2MA 3AXIA 4LS2A 1ZAHA 2WM1A 5T26A 2Y62A 4QG6A 3EWDA 3AZSA 2X7WA 5HINA 4KQNA 1K8CA 1FWHC 3V5OA 4Q4QA 4ADSA 5JBDA 4A4AA 4I9JA 1JRCA 1RUSA 3B4YA 6A3HA 4KKXA 4HN4A 2RDTA 4A35A 4N9CA 4IPNB 3LCXA 2Y85A 2J62A 4O57A 5FIPA 4L4MA 3CMJA 1QNPA 1KB3A 1W9PA 4D8AA 3VO0A 4PH6A 3T6CA 4RUBA 3LUTA 1OC5A 4GH1A 4MZ8A 1UH4A 3EMCA 1XIBA 3HGRA 3LPGA 2GLKA 1IT0A 2J27A 2P0OA 3DG7A 2V69A 4F40A 3TJIA 4UBPC 3NZGA 3UWVA 2VZOA 1NJJA 3WNKA 3STFA 3R79A 1G7UA 2ODOA 1V79A 3AMDA 1FCBA 3UA4A 2C14A 3E0IA 3NXLA 4ALDA 1PTAA 5FEXA 4AF0B 3G2GA 6CGTA 4E3TA 3L7RA 3M0MA 2CZFA 1UR0A 3LBCA 2I56A 3IV3A 4XZHA 4DRSA 3L5MA 5HUOA 4U3AA 4PRRA 2TAAA 3DKLA 3QFWA 4O17A 3FV9A 1FHVA 4L6OA 5H1WA 2CLIA 1DV7A 1IE7C 4YVPA 5EMMA 2FVKA 2WNZA 3TLLA 1JL8A 1AUSL 3MVIA 5K9CA 2G3FA 3ZVIA 4BI5A 2VFIA 4PRWA 1K8YA 4F2BA 1N82A 2J9YA 3SGUA 2WQPA 2PC4A 3N73A 4GX8A 2KX9A 1RSCA 4O52A 1TX2A 1GT8A 1YLVA 3WNNA 1B54A 2PTXA 1XISA 4P7NA 4DI9A 3K4WA 4AVNA 1IWPA 4KIEA 4IJBA 3S3GA 3VGEA 4UNKA 1HTIA 1BHGA 4MPKA 3A47A 1KXQA 2CXGA 1PL9A 3N3MA 4AD1A 3TP4A 3E0FA 2EAWA 1OFOA 5HPCA 1JDEA 4HHPA 3TNOA 5CQ1A 4DO6A 2GSEA 3MSRA 5FD0A 1FXQA 4O0KA 5F4WA 3HMCA 4C1NB 2VFHA 5TNVA 3TQKA 4KERA 3CXOA 1HJVA 4Q8PA 1L6WA 1XLCA 3ONBA 3SQSA 3WIJA 1W1IE 3CEPA 1UH2A 2QMJA 3EAUA 3C8NA 4KPLA 1RBLA 5KITA 2CXEA 2DSZA 2FZMA 4K37A 2W6RA 1KCZA 3DESA 3VINA 1B31A 3SZ8A 2ON3A 3GDBA 4PMNA 2DSVA 2XU2A 3N2OA 2J4GA 4P7OA 1LRQA 2ALRA 1EHAA 3MWAA 4XO7A 2ZTJA 3WMSA 4O1FA 3IGUA 1YQ2A 2Q8XA 3VXGA 1KFCA 3O3RA 4EIVA 3MB9A 5KMYA 2OFJA 3CUGA 4ZSTA 3WSUA 5IBXA 4L1WA 3ITVA 1HJWA 3IIPA 1JQVA 3CT7A 2DJLA 3BLIA 2ZVIA 3FSUA 3OZMA 4FXJA 4Q6JA 5A94A 2CHNA 1C9DA 4HIBA 3ZR5A 1IXQA 3N6JA 3PF3A 2ZC1A 1V03A 1W3HA 2DP3A 3W7GA 3G24A 2G3NA 4LU0A 3TFCA 2HPMA 4JQ3A 6PTDA 3VI2A 4FLOA 2DFAA 5JVLA 2I1OA 1CGYA 4FS9A 4AUBA 5D9PA 1BVNP 4XAPA 3WMLA 3NZRA 3O06A 4WSKA 2E3ZA 3B9EA 1HFBA 2BOGX 4URIA 4Z17A 4LF2A 1H09A 3TYDA 2Y63A 1EQPA 1XRFA 2E4TA 2DDXA 1V6XA 3UCDA 3O7UA 2VP8A 1IXNA 3DYPA 3JZUA 4GINA 2EBNA 3EBVA 2VMFA 2Q71A 1GG0A 3U2CA 4KBXA 7REQB 5F7UA 4H4IA 2HBXA 4A8NA 4JTHA 2BXYA 3T4CA 2ZUWA 1IEXA 3CB3A 1QI3A 3P0WA 3RX2A 2LLEA 3W37A 1UA3A 1GUVA 2PDFA 3VKCA 1EJUC 1WDPA 4KEMA 2Y61A 3K4DA 4FNTA 2PA6A 3CZ8A 3SECA 3KBJA 1EJWC 1GOIA 1X6NA 4OZOA 1RQBA 1Q85A 2NXIA 1QPNA 1KM2A 2XHYA 1AG1O 3XISA 4WJ8A 3NM1A 4ZQOA 4JAWA 5A2BA 3V4BA 4NZ4A 4ZQRA 2CBJA 3BANA 1W5PA 3CASA 2VVNA 2HE8A 3W2KA 3BLEA 3WDJA 3R8RA 3PPCA 2RAGA 3F5LA 1MZRA 6REQB 3TV8A 3GG1A 4ML9A 3VGBA 2J6XA 1V02A 2PD9A 4PTXA 1FWEC 1XS2A 1VHNA 3PZQA 3AHYA 3DGRA 1Z69A 5K9XA 1WKFA 5HNUA 3B9NA 3KLLA 2QDDA 1F3TA 1MVYA 4OGZA 1H50A 1J10A 4I6KA 3M41A 1OGSA 4MFDA 1RALA 2QJJA 3H2AA 2OKOA 5HATA 1MFUA 2POZA 4ZL1A 1G6CA 4G1NA 4QLKA 2HVOA 1WDWA 1JGMA 2PDYA 2ZWYA 3UWYA 5JIWA 3G1DA 3U4FA 3IJQA 3WJXA 1MXSA 4DJDA 5KZMA 3CV7A 4QAIA 3SQMA 3PB2A 4ORMA 1SGJA 1XLMA 4LS0A 4QEEA 3HZ3A 3DECA 1E6QM 3M5ZA 3NQAA 4CNPA 1ZCOA 1L6YA 4UR7A 3QGKC 4PMZA 1JPMA 2I9EA 3O9NA 4LAZA 4LBSA 4IMEA 4XBJA 3H4GA 2V2DA 4XVDA 3SI9A 1E1CA 2YKKA 5AYXA 7TAAA 1ZL1A 4DPPA 3NAVA 1B3VA 5CC5A 4KFNA 2WZMA 1DEDA 3E38A 5LA0A 4N4QA 4ZB0A 1TQJA 1J11A 4A2SA 1TRDA 4Q7IA 5C9UA 3NNTA 1FWGC 4C6MA 3MJMA 3N6QA 1DJWA 1SYTA 1P0NA 4JIIX 2ZUSA 4YWSA 2YDSA 2DGAA 3KDOA 4GZIA 1JXJA 3OBAA 1YEYA 4GABA 2UY4A 1UD6A 5C0QA 4S39A 2GDVA 5AHNA 4YTUA 1XUZA 2GOUA 1AW2A 3O8AA 4ZO7A 3TVAA 5E5CA 3IJ7A 4QSFA 2HCVA 4O16A 4GIEA 2ZC8A 4FSAA 2H3BA 2ISFA 4GE8A 4FR1A 1UCWA 3P67A 1PTDA 1UZ1A 4C6IA 3TN3A 1RBOB 1IT8A 4R85A 1JNDA 4XD4A 1MO0A 4IGMA 4JEJA 4MM1A 2GPTA 4CN1A 2CZVA 3BV7A 4PB3A 4H83A 1JZ5A 2OTDA 1YHTA 2O9OA 3ZT6A 3M0HA 4UMBA 3A64A 3BGGA 4YWIA 1OWQA 2F2KA 2DVUA 2QPUA 4JTKA 3ZYZA 3VKAA 3BDKA 5JIPA 4FB7A 4D8ZA 2VFGA 4QHRA 1VFOA 1W1TA 3MP3A 3OBEA 2WNWA 3AIRA 1MI3A 1VCGA 3MUCA 1S39A 1WDSA 1YPIA 1JPKA 2V8ZA 1PKLA 1MW3A 4H7VA 1IZJA 1FWIC 2WKJA 5T8GA 3KBSA 1XIGA 2JKPA 2P5NA 3TQVA 3GG0A 4NI3A 1PBGA 1TELA 3D47A 2EPKX 1M9HA 3OB8A 3M0VA 1K8XA 3UG4A 5AECA 3QZEA 1Y8BA 2HRWA 2QS8A 5I0DA 4FK9A 2XGZA 4ECLA 1E71M 1FKWA 1BWLA 2NXHA 4QG9A 4W87A 5I02A 1DJXA 3S8HA 2NQ9A 1ZJBA 1GNXA 1SSDA 1KCLA 1QO5A 1W3IA 4ZVJA 3ZLHA 4WXZA 4A8RA 2WMIA 3JZEA 1MW0A 4H6QA 2DVTA 1NWSA 4LUJA 5J04A 2WLZA 5IXEA 3G77A 1HXJA 3LPFA 3VGFA 4RKAA 1E3ZA 4QQ3A 1XYMA 2CHRA 2QJIA 1EWDA 2DT2A 1QU4A 3GHUA 3EKGA 3OPSA 1Q6FA 3RU8X 1E5JA 1JULA 2VELA 2O9RA 3UEQA 4ZGYA 1UMLA 4O11A 4GC3A 1OCJA 2BP1A 4EX4A 2HROA 3T09A 3I6TA 1TTIA 3WY1A 3HQNA 2AQVA 2E0PA 5I3FA 3LYEA 1TZ7A 4B5UA 1JDAA 1RCOB 3KM8A 3UWWA 2PWUA 5TF0A 3A9BA 2QUMA 4FLRA 3T07A 4LV4A 1Q4NX 2O9TA 3W81A 2J13A 1GJPA 4HOWA 1YBQB 2W66A 2CZEA 3ABRA 3HQPA 3DHFA 4PTWA 3LCGA 1XKYA 3IIZA 2QCNA 3FGCA 1HKMA 4WJXA 2WO5A 3IGSA 1G9HA 2BLEA 1J79A 3WEOA 1Q13A 5G1TA 3TTEA 1JCXA 4XSMA 3CNYA 2Z0IA 1XYFA 5JQ9A 4IFKA 4PEEA 3KS5A 1FQ0A 2BHUA 1KXVA 1W8SA 3QEZA 1UKSA 4IM4A 1YDVA 2R94A 7TIMA 1OVDA 4OUEA 4LAMA 3II1A 2C1IA 5DXXA 4HOZA 4L9ZA 4UTTA 3ARPA 2X41A 3QGAC 4RLIA 3KOYA 4RNIA 1Q66A 4J2MA 4M81A 2JEPA 2WC4A 4AB4A 3B8DA 4HQVA 3UWEA 2ASHA 2B0MA 2CERA 1GEHA 2ZCGA 2PP1A 1BQCA 4ZFMA 1XDJA 1AQMA 1W17A 1KR0A 3STCA 1UR4A 2QDHA 2WHLA 2VOMA 3ZFHA 3PTQA 1PKYA 5CSUA 4QDMA 4EKJA 2O9PA 3NPXA 1E6RA 3BOXA 3S2JA 3F7JA 3BZJA 2J8GA 3DYOA 3OO2A 4AZGA 4NJKA 1AZ1A 1S2CA 2HNEA 1MQRA 1EZWA 2OWCA 3I6EA 1TCMA 3UPBA 3KOZA 3KAOA 4AEEA 3PVFA 1DORA 4JTLA 1EDGA 3A4AA 4LANA 4TU1A 3DBPA 5KZEA 3S2NA 3BJTA 3DFQA 4WK9A 4LXFA 4O54A 5G2IA 3QPEA 3P5YA 4Q8VA 4PSPA 5M17A 2J7BA 4Q7BA 4AZ5A 1F4HA 2J79A 3N14A 2WVUA 1SQ7A 4XBKA 4MKVA 2P3ZA 2ZBTA 3PZGA 4QCFA 3VAVA 2VUYA 2PCQA 2WSRA 1K1DA 5CPQA 3LEPA 2ALDA 3K1DA 1UKOA 4NUWA 4WD0A 1IEVA 3VNYA 1X7FA 2JKEA 4S3BA 4RDZA 3VFCA 3CHDA 1PIGA 4DXKA 2X2GA 2IMRA 3PR2A 2FHFA 3GNOA 3B8IA 2OR2A 1TPFA 2OSWA 3U2ZA 4ERGA 4QS5A 5BWFA 3FSTA 2BSLA 1HQTA 3SQLA 3EWYA 3LX9A 3WDRA 4N9DA 1OGBA 4P8UA 4N2YA 4PCTA 2FLIA 4RZBA 4U33A 1WAUA 3TAOA 1Z89A 1OQFA 4H7ZA 4E4PA 5GJMA 1T5AA 1HX0A 1IZCA 3GM8A 1WYIA 4MLJA 1HKJA 2OWXA 1A5SA 2IW0A 1RY8A 2ZUMA 5JBFA 2D3LA 2REQA 5DMLA 2GVGA 3SCQA 1TPUA 3NGJA 1XHGA 1YNQA 1OFBA 1ISYA 1EA9C 4FO4A 3A23A 4K8HA 1B4EA 2XH0A 3L67A 4PZVA 1FVPA 3GXPA 4GI8A 3ITGA 3T0TA 1HIZA 5EU9A 1XBYA 4HU4A 3NQ6A 3PC0A 1XBZA 3PSWA 3R8GA 1KWKA 4PEKA 1WOBA 1Q6LA 4OIFA 1ALDA 3CIVA 1V6UA 1W91A 1VENA 3WFZA 4F0RA 4NYUA 3DG3A 3CTLA 1T7LA 3OHMB 3GXTA 5DLCA 4EE9A 5EKYA 3GTHA 2A21A 3B0VC 1EJRC 4GWEA 2RHGA 3TH6A 3W84A 4M3PA 3WD3A 1N2VA 1TV3A 2CLHA 1OFEA 1LL4A 5HULA 4E8DA 4JL1A 1U2YA 2DT1A 2YIHA 1IR1A 3RUBL 1EPVA 4K39A 2W79A 2CLPA 4L4OA 4AD4A 1U22A 4H3DA 2D23A 2W61A 4HD5A 4ZMGA 3BE7A 3Q94A 1FOBA 2E77A 1R30A 2VC7A 4W8BA 3WBXA 4AX7A 1W31A 4PMOA 1EJ7L 3NA8A 3T05A 4LY4A 4AZHA 3HG3A 3OZPA 5AY7A 1C7SA 4IFOA 3FYPA 2YBUA 4GZ7A 1KNWA 1GPFA 4AHQA 2VT0A 5LZLA 2PRHA 5CPMA 4J4KA 4HN8A 4IMCA 4P8XA 1B57A 1E0WA 2VJXA 3TW9A 4AW7A 5FSEC 4NZJA 4GGHA 2GQ8A 4WR3A 1S38A 1LWHA 1VYSX 4JYFA 4KGLA 2X1IA 4XUGA 4GUIA 2INEA 1XINA 4IJRA 3EDFA 5A8OA 3TWAA 2CFFA 4DO4A 4HB7A 3NQ7A 1D8WA 1GKRA 1ADSA 2P1FA 2J24A 3GD6A 3GWQA 4E6MA 2R6OA 1L6GA 6XIMA 3H4XA 2PD5A 1QHZA 4O10A 3CZEA 2FJUB 5HWMA 3Q45A 2OSYA 2C7FA 3WNLA 1ITQA 3EWXA 2AAMA 1RA5A 3MC5A 2PFHA 2ZXQA 1HJUA 3IVTA 1BPLB 1U1HA 4W88A 4GC4A 3W1MA 2WC3A 3VABA 5IFPA 1OCBA 3H26A 1OC6A 1C29A 4K8GA 5LIXX 3LLXA 4H6RA 5ECVA 1EIXA 3DH7A 4G7EA 1F3XA 4O1DA 5EY5A 2ZZ1A 1PCWA 2E9MA 1UROA 1GQNA 2YDRA 3L4VA 2O7SA 1O6IA 5CLWA 1K02A 3H22A 2GSJA 1GVRA 4QGCA 4UOQA 3W38A 2VX5A 3CPGA 4JHMA 1ONWA 2TYSA 2DPEA 1NELA 2WSYA 1JVNA 3NQ8A 4J35A 5DCDA 3I7QA 3AQUA 3THAA 1ZBVA 1FHLA 1WKYA 1GVYA 3P80A 1V0MA 4RNHA 3NIYA 1LLWA 4JEQA 3E0VA 3VC6A 3TZFA 4IP4A 3A4XA 1T96A 1U1UA 1VHCA 3SIMA 1S3HA 3EA2A 3SDOA 1M7OA 4MZ1A 2H9AB 3UY7A 1B3WA 1PX4A 3M1ZA 3AWOA 3NVTA 4EAYA 4Z1YA 2AOSA 3EMQA 1C3FA 5CJMA 1MDLA 3FFSA 2UY5A 4F0KA 5DANA 4WIWA 2ZUVA 4EPBC 4AYGA 1GJUA 1NSJA 2OWWA 3SCOA 1P48A 3CV2A 4FALA 2YOCA 4LBRA 4JKKA 1FY6A 3LI0A 3BZGA 4IZGA 2NWSA 2OQLA 4C6CA 2E68A 1C8XA 3KE0A 3VUPA 5AHFA 3VZZA 1X8FA 3I68A 1DJNA 1V3JA 1R3TA 2HQAA 3W53A 4LX4A 4AMCA 4GD0A 2DSUA 2IQ0A 1GZGA 3LB0A 1MEWA 4M29A 3CEUA 4XX6A 3KBVA 4DJDC 1Q63A 2QV4A 3M5XA 4F2UA 1HJQA 4F79A 3B03A 3S1GA 3THCA 1ZALA 2OO6A 4HNVA 2TRSA 4RDWA 2CHOA 2CYGA 5I3JA 3PY2A 3NO5A 4J28A 5DY2A 4UMAA 1JZ4A 2G5WA 2Q6ZA 4AXNA 3AMCA 3A24A 1J0IA 3TX9A 3S1XA 1EWEA 3MANA 4ASTA 3DFOA 4GXMA 2PURA 3VDBA 1X97A 4JL2A 1AFSA 2R91A 2NUWA 3R6IA 3LD5A 3W87A 4D2JA 1WDQA 1PS9A 2NX9A 3EOEA 3F5KA 4EXQA 3VIMA 4WDUA 2YL6A 5EMYA 2GZXA 1F6PA 2YCIX 4X0VA 4ROQA 5D4YA 2ZRYA 3FAXA 4O13A 4GUFA 2PMQA 3H55A 5D32A 1GQKA 2HMCA 2W67A 3OGRA 4KMQA 3UZJA 3CK5A 5K4ZA 2Z2BA 4HHMA 5XINA 3LLDA 3PPGA 3APYA 4LVGA 5FACA 1WZKA 3VOCA 1J0HA 4WHBA 2L5HA 2F6KA 3TDFA 4KRZA 4DXXA 1XYLA 3UJSA 3UJFA 3ZVHA 1K8ZA 3MHFA 3E6EA 4CNSA 1WOAA 1NOWA 3P61A 3DGBA 1NH6A 4ZE4A 5KZ6A 3M16A 3EX1A 1ZZMA 2XIMA 4B91A 4DZAA 1JFXA 2FZBA 5CCZA 3MP5A 4IP5A 3RR4A 3FA3A 4A05A 3ITXA 2NV2A 3TSDA 4ACYA 3UVAA 4HSHA 4E2DA 1NP2A 1ISVA 2YB4A 1OSEA 3CTTA 5D33A 3N4EA 3U8GA 3VKJA 1NDWA 4I7VA 4RE4A 3URQA 4LNCA 4AY1A 2A6NA 4WCJA 4CNOA 4JY9A 3O15A 1RJQA 2FPTA 3R13A 1RH9A 3LPOA 3LS9A 2OLSA 3OLGA 1QNQA 2FZDA 2B4GA 3YPIA 1HKIA 1DQUA 2OJPA 3LCFA 3GH5A 4QR6A 4ZQPA 1Q6QA 3WCZA 5A6BA 1A5BA 3UD6A 1D2KA 4KW2A 4TX8A 2RH9A 6TAAA 3NZ1A 3AXKA 1R47A 4WDTA 3W00A 2PTYA 3GW3A 4X2PA 3USBA 7ODCA 4HA1A 1Z9AA 1BYCA 1BYAA 4O14A 3A22A 3WH5A 1RQHA 3E5BA 3ZLFA 3LK6A 2WVVB 3UVIA 4PBGA 4JNZA 3CL8A 1F05A 3WK0A 1PHQA 1FDJA 1W9BM 2OKTA 4JPGA 1P6WA 3FJ4A 3N9KA 2ISVA 2VTFA 1JI1A 4LFYA 1MW2A 4C6PA 3NWRA 1XSJA 1Z3NA 4UFLA 4GIYA 4C91A 4Z08A 2EPNA 3CC1A 1EGMA 1RVGA 2Y2WA 1VJZA 3PWGA 2V67A 4BI7A 1UIOA 2VEKA 3QRHA 1O7AA 3TR9A 2P8BA 3AO0A 3RLUA 1V3KA 2WW5A 3LU2A 3BSHA 1X96A 4D6DA 4JFWA 3RM9A 3DERA 2YA0A 1CEOA 1B3YA 2OPJA 3U5YA 3KBMA 4F2TA 5FCZA 3TC6A 2X30A 4CQDA 3S0CA 2I7GA 4V15A 2XTKA 3VNZA 1H4PA 4FIQA 3DZ1A 4B90A 1I60A 3MO4A 1GTHA 1OFQA 2BOFX 1K77A 2P53A 5HWJA 2QJMA 1XGDA 1UOKA 2PUZA 1TIMA 4KFPA 1PWLA 4BF5A 2V9DA 7ENLA 4W85A 2ZRXA 4JYEA 4DNMA 3PZNA 3DKJA 1IIGA 2ACRA 3LHZA 2DZWA 3GSMA 1ME9A 4B2DD 2PWDA 3AHXA 1X8CA 4C6EA 4G6CA 1OM0A 1XSKA 3URNA 3TR2A 5AYBA 3QW3A 4Z1BA 1A5AA 4FMVA 2YCEA 3O07A 3SJNA 1A5NC 3G3DA 4NJHA 1IF2A 5C54A 4IIEA 1VRDA 3GVVA 3TN4A 2OEKA 5JH2A 3T42A 3APGA 4PUNA 1OY0A 4DHGA 2PP0A 3I7SA 4V27A 3U48A 1JCJA 3BG5A 4MB5A 1GVFA 1PJ9A 2CWNA 1KBIA 1WZLA 2DU2A 5DX7A 3PK7A 1JCNA 5FEZA 2OT1A 3A5FA 5GJPA 5AOUA 3DFSA 3V7PA 4WGXA 1A50A 3CQHA 4DAIA 3GDKA 2AMGA 1M03A 2QF8A 4CD5A 2A6LA 4Q32A 1TA3A 2BNJA 3FXYA 3NURA 3WNMA 3CS2A 3R0DA 2GGHA 1X6LA 1LTDA 4C6KA 5F2GA 1NVMA 4RW5A 1KM4A 3KZPA 1JZ7A 3W6YA 4XB3A 1UOZA 3H8AA 1KCXA 1V3LA 5DMMA 4DNHA 1J93A 4J2PA 3WFAA 3W7RA 1DVJA 2OOGA 4GO8A 2G50A 3SFKA 2ICSA 2OX4A 4JICA 2QCMA 4C7GA 4JIQA 2WQDA 3CYVA 1OYCA 3GB6A 3CU2A 1MFVA 2PDKA 1UC5A 2DZTA 2E25A 4LBUA 2ZZ3A 4LALA 3BMXA 4GQBA 4PMQA 2P10A 5CSYA 2QUVA 1DJHA 2WWDA 5CC3A 2Q8LA 3ANYA 3TW6A 1ZGDA 1BG4A 5SWUA 3BARA 1DXEA 1LG1A 4QE1A 1DIDA 3L4TA 4KWUA 1JAEA 4PUDA 4F9JA 3TZNA 1CGXA 4NIRA 3LTSA 4J9JA 3VIIA 4DWSA 5CXPA 3H23A 4N4PA 3FXGA 3MUZ1 1GEQA 2G4FA 1REQB 3Q65A 2J8FA 3HGJA 3NCOA 4Z1DA 3LHTA 1R3SA 4RXFA 4BY3A 1F7BA 1LWJA 3T9PA 4J3XA 1VYRA 1H0IA 4POCA 1SR0A 5EFFA 1XRVA 4BQ5A 4L5ZA 1PYFA 2VX7A 1B5TA 4TVCA 1VBJA 1M01A 1EFZA 1V4YA 3G0SA 1H60A 1FRBA 1PIFA 3QR0A 4B3KA 3CPUA 1JDCA 4S3AA 3LM7A 3P62A 2YL5A 4AU0A 1PX3A 2D20A 3ONCA 3MSGA 4HPXA 2IPFA 1UMYA 3WQCA 2WCSA 2WNNA 5H91A 1BF2A 1OEPA 3QV9A 1VIWA 1UIPA 3MT1A 2XINA 1VIZA 4MLRA 3UGVA 4H9UA 3AISA 3TTOA 3JUGA 2ZFAA 4LJ3A 2QVNA 2VR5A 2PGFA 1V93A 3THDA 2RGMA 2XSXA 5A95A 1J2WA 2C1HA 1UASA 4MKSA 3WH7A 5AC4A 4FIRA 1R3YA 1ISZA 2QJNA 1VP5A 1WDRA 3S1UA 2WSQA 1YXDA 2Y70A 1G5AA 3C2VA 1W5QA 3TOYA 1DJQA 3TMQA 3C3NA 3WX7A 3SGGA 1K9TA 1BWKA 1ODZA 3B0PA 3IVUA 1XIJA 3LENA 1UP0A 4JKLA 4RL3A 3PZ9A 4YYFA 2P88A 1PZ1A 2IQTA 1KTNA 3AYSA 4PUMA 1M6JA 2GWNA 3AS0A 4H1ZA 2R8WA 2BBFA 2PDNA 1PKMA 2Z27A 3MUAA 2BY1A 2D2GA 3S9YA 1SJDA 1KLZA 3RO6A 3SO7A 4KCWA 1E51A 3CWHA 1OD0A 1BFNA 4GY7A 4DF0A 1HP4A 1Q65A 9XIMA 2GUBA 5A6TC 2FGLA 4C5ZA 3RPTA 3DCPA 2ZA2A 1LL6A 1X1OA 2O92A 4LVBA 8XIMA 3GDRA 5D9OA 2DZAA 2PC8A 4A22A 4LAOA 1YDNA 3AYVA 4HJWA 4JBRA 4HYWA 1ZB5A 2C15A 4KWOA 3UR2A 1NEYA 3BLPX 3I65A 5FJOA 4HYRA 2WVSA 1EOMA 2Z28A 4MAZA 2FHBA 1RCXB 5JMUA 3WJWA 3ITOA 4CCEA 1Z44A 5KZDA 4ACZB 4LYRA 2VKZG 4ATDA 5EMKA 2ZA1A 3GNPA 4PB5A 1ZUAX 5E93A 3PBYA 3PBGA 2BOEX 3OOQA 1DJYA 1R85A 2X0YA 2PI6A 5I23A 2XDFA 3GR8A 3QKEA 2IPJA 5DMYA 3TYEA 3W28A 2XSBA 4FLQA 2ZVRA 3DENA 4NL1A 4R34A 5EBAA 5BMWA 4IFRA 6ALDA 1YNPA 2EQDA 1WDDA 4LVAA 3QHOA 3TA9A 4MB4A 4PMJA 5I07A 4F0SA 5IBXC 3L5AA 3ZM8A 2VRJA 3L65A 1R6WA 3T78A 3P6LA 3SCUA 2Z25A 4GOAA 5D2XA 1BGAA 3TU9A 3K5XA 3ZT5A 1XIMA 1MNZA 2ZUTA 5D03A 3GFXA 3PPFA 1OC7A 2J66A 4B9YA 3ARVA 1JR1A 2JGYA 2ZRZA 1LZOA 4RX0A 2D2HA 5K7JA 4L56A 4JTIA 3VMNA 5D05A 1QDSA 2WWCA 3QV8A 2ABBA 2WB5A 3UZ5A 3VCNA 1KGXA 5JXQA 4J5NA 3DN5A 4UTMA 3OW1A 1DYSA 1Q6OA 5C7HA 1ISXA 1DJIA 2XH2A 2HDJA 1SZFA 4ZTXA 4H9MA 2CBUA 1IT7A 4TX6A 4XAZA 1F76A 1XLIA 4LAUA 2PTDA 4FHAA 3IK2A 3W07A 4IUGA 3DDMA 3QY8A 3CUIA 2BVDA 1Y5WA 1QNSA 1KR1A 3HPXA 1CXFA 1G67A 1XYZA 4HJFA 2DQXA 4GIAA 3LV5A 2A3LA 3W4RA 3GU2A 1E4LA 2A79A 4B5TA 4C60A 1CGVA 1S5WA 3UYCA 1XDMA 5XIMA 1BTCA 1S5TA 4U4MA 3A3XA 3WLIA 4OTKA 5E6YA 3IGHX 2QUUA 4MWAD 2XN0A 3MQTA 5F2LA 2IXVA 5ABFB 3MV11 3EX4A 3UA3A 1Q6GA 3TQ0A 1FX6A 4LOCA 2J9XA 3DHPA 4Y9OA 1GHRA 3EXRA 1XCFA 4CQ9A 1OYBA 2DZPA 4DQWA 3MSYA 4XD3A 2JF6A 2BXVA 4FXFA 4JN8A 1VS1A 3G1AA 1M7JA 1OFAA 2ZX6A 3RU6A 1G7VA 4U2YA 2G97A 3QPYA 4OU1A 1H49A 1EC8A 4TTGA 4GFIA 3PTDA 5IHRA 1ISWA 4RV3A 3GDTA 3W1UA 3PJXA 3GFYA 4A8LA 2J47A 1I0BA 1CX9A 1ZRQA 3VA8A 1ENUA 5ECUA 1IEWA 4PMYA 4PSRA 4A2RA 3VDAA 4DUWA 4O0ZA 3DC8A 3WQWA 2GGJA 2YXOA 1TUXA 3WLQA 3QYSA 4IISA 1HG3A 4MWAE 1EJSC 1EP1A 3HV8A 3WBWA 5H8MA 2ZXAA 2GVJA 1EO7A 1VD6A 2XZ7A 2WMIB 1WUFA 1EOKA 4KRTA 3MUXA 4GIRA 1XGEA 4HTBA 4GI9A 5IM51 1ZU8A 4NJIA 3QKZA 4MY1A 4C7FA 4D6CA 3ERPA 3CZGA 3LMZA 3SRKA 1GYMA 4C1NA 5H2ZA 1E4IA 4IUOA 3IJIA 3QPZA 1CECA 4R5EA 4GVHA 4ZA0A 1RK5A 2QUTA 1KFKA 1QMLA 3WF2A 5FF0A 4R53A 3JS3A 4Z0JA 3UU0A 4QTGA 1FWAC 1S3TC 3GR4A 3BL3A 1O60A 1QWKA 4OBTA 1GYNA 1KA9F 1GQIA 4MFEA 3W23A 1F61A 3GH4A 1E0TA 3QN3A 1TVLA 1BVZA 3LPPA 1O5KA 4S3GA 1W54A 5HANA 3L4YA 1Z7AA 3TC3A 1QOPA 3BAYA 1XLAA 3V3WA 3QQ0A 1QNVA 5AHIA 3B9OA 4OBSA 1SZGA 2FVLA 3WH9A 4Q22A 4Y8EA 1IIHA 1AVAA 1A5CA 3B3DA 1HW6A 1TA3B 4JTAA 1M5WA 4JTDA 3ZJ7A 3SUVA 1GOWA 3NQCA 3IIXA 4LS1A 4G9PA 4PUEA 4UTWC 3S4TA 1UD4A 2FVMA 2ZZ7A 3MZ2A 4C6QA 1F6KA 1UW9A 3GX9A 3C4UA 1VR6A 2XUCA 5FJJA 1XXXA 1QNRA 3R43A 1GQLA 1M7PA 2W9MA 4PULA 1OB0A 3QYQA 4YS1A 1P1MA 1XLKA 5A8NA 3SGZA 1VGAA 5CPSA 4TUFA 4MKNA 1CGTA 4RV8A 2FHCA 2EG8A 2PAJA 1XYCA 5I79A 1S2UA 1J0KA 1TCDA 1VEMA 2POTA 4IJCA 4NZ1A 4I5XA 1WBHA 4JYDA 3N15A 3E12A 4OE7A 3SN1A 3HG2A 2OGYA 4W8LA 2PWGA 3WMCA 2E6AA 4GI6A 4OFCA 2F9RA 3QGVA 4DELA 1WV2A 1XIIA 4WXYA 4PCSA 4B5SA 3ISIX 5XIAA 2WC7A 4DIAA 2RDUA 3CLWA 3P60A 5B80A 2Y4SA 3EDJA 2QW5A 3VGGA 2WZEA 2NUXA 3JRKA 1PIIA 1J12A 1R9XA 1P6CA 2IKJA 4HNOA 4IL2A 4HNNA 4FLSA 1R5YA 3H21A 5A6AA 3H70A 2VX6A 3OLEA 1ZNNA 4ZR8A 2J8TA 1KV8A 3NYDA 3WN6A 2FZNA 3UP8A 5DCBA 3C8FA 1OX6A 3SCVA 4ROPA 3NSMA 4QDPA 4AX6A 2E1DA 5HMFA 3GZAA 5H8PA 1SO6A 3U0HA 1YDYA 1UC4A 4EPDC 2BMBA 1XCXA 1RPXA 3MHUA 5BOEA 1RZMA 5K2ZA 1VH7A 5I3HA 1ZAJA 4O53A 4CU7A 2C19A 3B05A 1CYGA 2C8NA 3M0YA 4GYJA 3T2QA 3S6DA 3EWUA 4GNJA 3NDZA 4HYVA 3VUSA 1H11A 2H90A 1JZ2A 3NPWA 1Q4WA 3W83A 3CUFA 4DZ5A 1G01A 3LSBA 3BG9A 5KINA 4D1IA 3VGDA 3UZYA 4C6JA 4H9ZA 4LUTB 1HKVA 2XFYA 2IKHA 2EO7A 2I5QA 3ELFA 1X1NA 3CL7A 3PSVA 1CPUA 1XIHA 1JYWA 2VDGA 2CKSA 2CBVA 1XDLA 4R88A 2B7PA 3E0LA 5DELA 1ZP4A 1DIEA 2FZ8A 5K3VA 3LM3A 3QR1A 3ARYA 3QLLA 2WHKA 4E8GA 4ERIA 4LTSA 3SCPA 2VI0A 2GYIA 4ERAA 4BWLA 4GVGA 1VFUA 1N7KA 1J18A 1JCMP 1UD5A 1EB3A 3ARTA 3LGGA 5IOBA 2FQIA 1AH3A 2YFNA 4LYQA 1I6NA 5HAOA 5CC7A 3FJ6A 3UR5A 1NOFA 2V6AA 1P1XA 3C2OA 4Y90A 4RR4A 3CUJA 5RUBA 2PRMA 2VRKA 3NQMA 1X7IA 4HNCA 3U5UA 2BB0A 1JFHA 5BROA 3MBFA 4H19A 2PGWA 1VLWA 3TA6A 2NT0A 3NL2A 3OGVA 4AD2A 5LNSA 3S5NA 5A6KA 3HQ1A 3HQOA 1OGGA 4O50A 5EMJA 5C2CA 1AQHA 4W7UA 1UQYA 1I45A 4GUJA 1PVNA 1ZENA 4AZ7A 3HPFA 3LLFA 3W7IA 2DT3A 3PZTA 4EXAA 2OZTA 4QSHA 2E5CA 2XH7A 4ZOBA 2Y6ZA 1R87A 3RIKA 1PHWA 3W02A 4MIMA 1CLXA 3CB8A 3VZXA 3R7MA 3W6MA 2V5JA 4UNLA 5G2HA 4MWAB 4K1WA 1W37A 4WLCA 4I6VA 2WMGA 2Z1BA 4A3RA 3AIBA 1F5ZA 3MDUA 4W4QA 3W86A 3T81A 4MJZA 3WMBA 2BY0A 2PDWA 5LIKX 1UB3A 2E7FA 4C6DA 3RNDA 4XKYB 3L2IA 2OSXA 4TQTA 1E4NA 2HISA 1UG6A 3UXKA 5LNVA 5EMUA 3M64A 3SEPA 3ZR4A 3R11A 2YFOA 2VVSA 4AZ6A 1R3RA 2D1ZA 3H2EA 1AL7A 3TXVA 3WBEA 2WK2A 4FNSA 2EPLX 4Z2HA 2VFDA 4KWWA 3A13A 4J40A 2XVGA 3N11A 5A69A 1GONA 1IGSA 4BZYA 4EWND 2HSAA 3F2CA 3IUDA 1OFRA 1RQEA 3E74A 3H7UA 5C6MA 1EJTC 3T40A 2YDAA 1FH9A 4GXWA 3QQ1A 3I4EA 4B4FA 4BS0A 1QOXA 4H9YA 3RX3A 4HCLA 4F0HA 3OYZA 2WBKA 2RUSA 1BRLA 1A0DA 3TYZA 4YVXA 3UZWA 1F74A 4K36A 1CXKA 4UCFA 4PODA 2C3ZA 3HTWA 1XD0A 5LHFA 3ARQA 1J4EA 3IUIA 3AUOA 4NXSA 3W7MA 3NL5A 1K3UA 2A7RA 3EOUA 4GJIA 1GWJA 1FP8A 1RHCA 3GNRA 4LCRA 3RCMA 3EWZA 4JIRA 1ZQ5A 3WH6A 4XBSA 3V1HA 3WD1A 3WKZA 2FH6A 1WB0A 5LGZA 3LNPA 3B97A 4NF7A 5M03A 4Z2JA 2Z1WA 2Z4GA 4OBRA 6XIAA 1I2QA 3VDGA 1MUWA 3IRDA 3AMKA 1TX0A 2A3BA 2CZ5A 4L6HA 2OX1A 4FPSA 1PSCA 3SY8A 4GUGA 3RG6A 1VBRA 3UG8A 3SUTA 1JD9A 1VPXA 3KVLA 3IK4A 3PFRA 2E5BA 1R9ZA 3FS2A 1JCLA 3EDKA 3VOFA 2XM2A 2DIEA 3HGSA 1QI0A 3FY1A 5K4XA 3DEQA 3RFAA 4NRSA 3GG7A 5A6BD 2VUNA 3ATYA 1FBAA 3ZQ9A 3M0XA 3VGHA 3B9AA 1FWNA 3WEZA 2E67A 2PZNA 2QEZA 1RLDA 3MCNA 3W7JA 3MCOA 2VZVA 3KX6A 2PWHA 1D3HA 3GC5A 5D37A 3KFTA 1ZBWA 1EGZA 2ZYFA 2X1TA 5C7VA 4NYYA 5CC6A 4MMWA 1G1YA 5DCEA 1A80A 3B06A 3GTNA 2RKXA 1D9EA 3LHYA 4LEFA 4NNBA 1UYQA 2ZX9A 9RUBA 4AWUA 5J5RA 2XVPA 1JNEA 1PKNA 4Q8TA 4WKFA 4TMBA 3C2EA 4YTTA 3AOFA 2PEVA 3A5VA 3NO1A 3MYPA 2PBGA 3MO7A 3PG8A 3WQ5A 5DFAA 1JYNA 1ECEA 5CH9A 4UWMA 4DXVA 4AZCB 1GGOA 1ICPA 3P7YA 4EF9A 3EYPA 3UJEA 1J0YA 3W1NA 4I7UA 1NTHA 4HU3A 3JR2A 4QITA 4JIPA 5A6SA 3PM6A 1TPDA 2CEQA 4YIWA 5BRQA 4YMZA 3V75A 2EXOA 4JS3A 4ZBCA 2XH4A 3AAMA 1K4HA 3TCEA 5CG0A 1US0A 5BNKA 4Q4MA 3EA3A 4D6FA 1R7OA 4AWSA 3HF3A 3ARWA 4ZOAA 3HG4A 4B5XA 1O4UA 2JALA 4UCGA 4J3VA 3AICA 1GORA 2FIQA 2W91A 1TFVA 1UR2A 1Z32X 4QAWA 1VBUA 3FYYA 2ABAA 1LUCA 4HCHA 1LJYA 3F2BA 3GVRA 1B90A 2HJPA 5ABHA 2WVVA 3DIPA 2ZRWA 4LPCA 4YHGA 4Z0SA 1X98A 1W5MA 2O7QA 4W86A 2E9LA 2VCAA 1VBHA 5MKGB 2XIJA 3ICJA 2BV9A 1B3XA 2AL2B 3WG6A 4JTUA 4KEUA 4EPKA 4DY1A 1DIKA 3VYLA 2YYTA 3RM4A 3VCRA 5BRBA 3OZOA 2QZRA 4JFSA 1UH3A 4CCCA 4BF9A 1G94A 1UR1A 1M3UA 2JGQA 1L2UA 3D6NA 2WKGA 3NEHA 2DH3A 3RX4A 3AI0A 5HWNA 3W76A 2DUZA 5A8QA 2G96A 2PGEA 2EPHA 3KHDA 4DN1A 4IL0A 2P8CA 4Q8UA 1U5HA 4H7CA 2XFFA 4GKLA 1XLEA 1FWSA 3DXIA 1NY1A 2BODX 1W0MA 1Z48A 3BAJA 2XVNA 1P7TB 3W73A 4CN4A 4W7VA 1FKXA 3EEGA 4MDPA 5HJYA 1EXPA 3GTFA 2YW3A 3PHAA 1CENA 3ITTA 4F0MA 3SJ3A 4J1OA 1L6FA 2X40A 3CHEA 3D5HA 3VX0A 3W22A 4FR6A 3UYIA 1UD3A 4DLMA 1YW1A 2AQOA 1W1ZA 3E5PA 4WY0F 2WOQA 4NG3A 4HOXA 4KEVA 2XM1A 1UWRA 2PU1A 3P82A 1LM1A 4TVDA 1ZBCA 2NQLA 3CGTA 1GKQA 1VAHA 4L80A 4AHOA 1OF6A 1WA3A 4JR5A 3ZWTA 3VZYA 3TJLA 4FNQA 4JNYA 1WPCA 1KBJA 4M7TA 3OLIA 2CKRA 5LA1A 1XLJA 9CGTA 4HNLA 5A8GA 3NZPA 4LGXA 1DPMA 1WO2A 1Q8AA 3MTWA 1K70A 3PPHA 3HB9A 4NZ3A 4WKAA 1ZBKA 2GVEA 3STEA 1B2YA 3GUWA 3A6OA 4G2DA 4NHVA 5GNXA 1R2SA 3ARZA 1M65A 4KIRA 4ZFCA 3LERA 5CBIA 5I3KA 1CNVA 3B0UX 3QOKA 7A3HA 1HN1A 2C91A 1T8XA 2F84A 2H8ZA 1V3MA 1THFD 3U2OA 3AIUA 3CAKA 2OVLA 1TVPA 4ZOEA 5T9CE 3I3EA 4GUHA 3LCLA 5G1MA 1NU5A 4I5RA 2GJPA 1XH0A 2PDQA 5FI8A 4HMDA 1S46A 2JEQA 3AJ7A 4XISA 3XINA 1KRBC