1EP2A

Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
309
structure length
305
Chain Sequence
ENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAANVKAIELNISCPNGQAFGTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
publication title Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 93
structure length 305
sequence length 309
ec nomenclature ec 1.3.1.14: Dihydroorotate dehydrogenase (NAD(+)).
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ep2A00
2Y7FA 1Q45A 1VR6A 3TUUA 3VE7A 3L0KA 3ZR4A 2RDUA 3KRUA 4NJGA 3TIMA 3W23A 5FEPA 5BNKA 4GXMA 5CZ0A 4JY8A 3TAOA 1C9DA 4A22A 1KM1A 3I7RA 3W75A 2CLEA 3DBPA 1HO4A 2I1OA 3WJWA 1JCNA 1R47A 1G7VA 2Q8LA 2X16A 3GYEA 3YPIA 1PCKA 1DKWA 4ZQOA 3UPWA 4GUIA 2A6LA 3KVLA 3QC3A 3NQVA 1KFKA 3O6CA 1X1ZA 3W2UA 1KV5A 2ALDA 4CQAA 4LVFA 2GVGA 3L67A 5DN1A 4KKXA 4JX6A 4K8HA 2OJPA 4AHOA 3T7VA 1JRBA 4IMFA 4IPJA 4N9DA 4A29A 4BI7A 4AF0A 4WY0B 4A2RA 1QR7A 2RFGA 3UWUA 2VFFA 1ZAJA 2ZA1A 4QM1A 3SGZA 4QISA 4MY9A 3STEA 1ICQA 1IF2A 5MHBA 3H55A 3STGA 4MLJA 3NVTA 1QPQA 3W2MA 2X1RA 3NM1A 3BPWA 4YMZA 4NX5A 1FCQA 4ORIA 4IXHA 4UMCA 3TFCA 5AHEA 4NZJA 3L66A 4NXSA 4XWUA 4E2BA 4M5PA 1PVNA 3UYCA 3GXTA 3S8HA 1CI1A 5FEWA 5CZSA 4PFMA 3MBFA 5F2GA 4ZQRA 4ZL1A 5BW6A 5SWUA 3W85A 1EWDA 4U4MA 1OX4B 1KFBA 3MHGA 3QFEA 1EA0A 1GEQA 4ZQNA 5LZLA 3SSJA 3G1DA 4JGDA 1ZALA 3ZFHA 1KM0A 3BGGA 1HTIA 1W3IA 1LBLA 2DZWA 1FBAA 4HNVA 3OIXA 3GDRA 1L6SA 2Y61A 5CSSA 4AH7A 1KFCA 4J9JA 2DJLA 5I3IA 3PBWA 3LHZA 1G6CA 5AHMA 5D37A 3O07A 1JRCA 1DHPA 3M5VA 3QYQA 5CZTA 2CLLA 3W74A 1N7KA 3W1UA 3G24A 3M47A 2EKCA 3GKAA 4JYEA 2PRMA 3W7OA 5TQLA 1SO6A 2GQ8A 3L21A 2A0NA 1TO3A 4IX0A 4CLMA 2XN1A 3T4CA 4ICNA 4YLWA 2NWSA 1GVQA 4AWSA 3STFA 3DAQA 4K39A 2JGQA 3LV6A 3G0XA 5F4XA 4JTKA 2V5LA 3I7SA 2WNZA 4Z08A 2FB2A 3DU0A 2QCHA 2W6RA 5D04C 2YW3A 2EPHA 2HTMA 4TX9A 2Y85A 4CNPA 3W76A 2C14A 5BMXA 3RMJA 1JQVA 3DXIA 1VCFA 4RZ5A 3MJYA 3UXAA 1V5XA 3GNDA 3G1FA 1IGSA 1RPXA 4FXSA 3CEPA 4UFLA 1YLVA 3PWAA 5KMYA 3SFKA 3HGOA 2E6FA 4MKNA 3P61A 4GRSA 5G2IA 4PEKA 3TC7A 5CGQA 4ADTA 1IXNA 2R91A 2A85A 4HN4A 1D3HA 3PY2A 1QDSA 1K8ZA 2NUYA 1W5NA 2ZZ3A 3P81A 4Q33A 5AYXA 1ADOA 3FJ6A 2X1UA 5F1VA 3GDTA 4YXGA 3SR7A 5DY2A 3QSTA 3NPWA 4AWUA 4ADSA 1GVRA 3LGEA 3W72A 4Y8FA 1VC4A 3G1XA 3Q37A 5F2LA 1QMLA 2CU0A 3L0GA 3LM7A 1OHLA 1JVNA 2J9XA 5D02A 5I3KA 4O10A 1TMHA 2AAMA 1Z41A 1KM5A 3HPSA 3VFLA 3MWAA 5AYZA 4UTUA 1ZNNA 1G7UA 3IGUA 1EP1A 2A7PA 4Y9AA 1L6YA 1WAUA 4CNOA 5DCEA 2VXNA 3QMSA 4XTDA 5CZJA 2UV8G 4GUHA 2Y6ZA 3G1SA 3RNDA 2VKZG 3G22A 1SU5A 3CTLA 1ZFJA 4MZ8A 1MZHA 2YSWA 1MXSA 4I7WA 3W2JA 1VCVA 4CNNA 4IMGA 3S0CA 3FLUA 3Q2DA 3W6YA 3MP4A 3STCA 1SSGA 1VCGA 2J24A 3N14A 4Z1AA 3UWZA 1C8VA 2CLMA 5HQEA 4JS3A 3G1YA 3L5LA 3S5NA 1NSJA 4IMEA 1TPB1 4WOZA 5HNRA 5C6MA 5HUOA 3E49A 3LBMA 2W0UA 1ALDA 1SFLA 1FCUA 2E77A 3MHUA 4I9AA 5A8GA 3RLUA 3O05A 4K8EA 4O15A 5J5DA 1GWJA 4O1DA 2ZTKA 4UTIA 2H3DA 4OQVA 2F7FA 2E6YA 3IGSA 3QW4B 3B4UA 5DLCA 3IIOA 5D30A 3IVTA 1J4EA 1P0NA 3UY8A 5AHIA 4UTTC 1GG0A 4LOCA 4S2BA 1HFBA 1GTHA 2Z2UA 5LNVA 1QFEA 3EEGA 4POCA 4R7JA 4JX4A 3VKJA 4IGHA 4AHQA 1H51A 3NGJA 1WA3A 3LOTA 2RDTA 4UC5A 2JKEA 2WNQA 3EWWA 4HSOA 5I3JA 1JCYA 1SZNA 4O16A 4XBKA 3SJ3A 3MO7A 1OFOA 4DBEA 3L68A 4O1CA 4DO4A 2Y89A 3NA8A 4P2VA 5CPMA 2WV8A 3I6RA 2LLEA 4Y96A 5D03A 4DO5A 3TE9A 3M5XA 3LHUA 3W7LA 3R13A 3NL2A 4QNWA 4UUIA 3WFAA 1G67A 2YXGA 1TQJA 4NNBA 2BLEA 3TXVA 1CW2A 1W5OA 4CCEA 3HMJG 2A6NA 3GVGA 1K03A 5G5IA 3OHIA 3PB0A 4O57A 4FIQA 4W9TA 3ZS4A 1XBVA 4DBDA 5LSMA 3C2VA 3PG9A 3SIZA 2CW6A 2VFDA 4H4IA 3PM6A 1GOXA 3A21A 1IIHA 1KTCA 4FX8A 2V81A 2Z1BA 3MP5A 4I7VA 2ZRUA 2QCDB 1XDMA 2HMCA 3LX9A 1X7FA 3LHWA 2XN0A 3NYZA 2QDGA 5FF4A 3R2GA 1OF8A 3ATYA 3CM4A 4O17A 5D2YA 1HO1A 1W0MA 2ZCGA 2NV1A 2WSRA 5FF3A 2ABBA 4RR4A 4UMAA 3TCEA 3THAA 3M43A 1SUXA 3GIYA 2QEZA 3TJLA 3CQ0A 5G1YA 3EXRA 3ABOA 1QOPA 2CLFA 3G1VA 1THFD 1WYIA 4WD0A 3DKLA 3LCIA 3UPBA 4JDBA 4X2RA 1P5BA 3QMRA 1SO5A 3OVPA 3KAOA 4MJZA 2DORA 4LS2A 3LXAA 3C2RA 2PRLA 4KFPA 1X6UA 5EPDA 5LNSA 3NQEA 1AW1A 1HUVA 3PULA 4KWWA 1KTNA 1QAPA 4DELA 4WY0A 1DL3A 1EWEA 3CT7A 1OYAA 1WBHA 3S5ZA 4LRTA 4O1BA 4UXDA 3DFSA 3S1XA 2FDSA 5K9DA 2CLIA 1SZFA 3O16A 1GPWA 2ZTJA 3NEVA 2GJLA 2X1TA 3B8DA 3LCFA 4ALDA 4ZZ9A 2E6AA 3M1ZA 5F2IA 3LCHA 1UB3A 1R2RA 3QEZA 4EF8A 3VCRA 3MUXA 3NL3A 1ME7A 3U2OA 4AXKA 1LRQA 2WOQA 2P1FA 3QZEA 1XC4A 2PURA 2TRSA 5D38A 2Y7EA 3A5FA 4DF2A 1OX6A 1ZCOA 3E12A 2NUXA 1FWRA 4UFMA 2NX1A 1EX5A 3PAJA 1OX4A 4L4MA 4O0KA 4YWIA 5KITA 1SZEA 2GVJA 4KFNA 2H8ZA 2NV2A 1TTJA 2C13A 2O7QA 3S42A 1TYGA 3W7GA 2CFFA 4ZQPA 4JIQA 1SO3A 1K3UA 3ABQA 3MW7A 1H7RA 4PTNA 1I2QA 5J5RA 3T44A 5BRBA 1N8FA 2DZVA 3TSBA 3W9ZA 3W2KA 4GE8A 2FLIA 2JKPA 1KW1A 8TIMA 2E5CA 1H62A 4ZQCA 5K7JA 2NXGA 1TPDA 1XBZA 5AYYA 1MSSA 2DP3A 2RHGA 4M6PA 1TV7A 4IMCA 4WQ6A 2ZRYA 2E1DA 4HIBA 1IXQA 4JX5A 1MEIA 1WDWA 2ISSA 1K7FA 2PE4A 1LLWA 1EUAA 3JRKA 1YTDA 2C18A 4JYFA 2BTMA 3UD6A 3PG8A 4CQ9A 3HGSA 1W31A 1SW7A 1OFEA 2V5BA 3NPVA 1TPH1 3NQ2A 4GUFA 3CPRA 3W1LA 3A5VA 5IM51 1AMKA 3W7CA 4EOUA 2ABAA 2VFIA 3NZRA 5FF0A 3ZWTA 2Y7GA 1S5WA 2H8XA 3LHTA 4FX7A 3UZJA 3W87A 1YDOA 4M6VA 1ZAHA 4HT3A 3QPYA 4ONVA 1KBIA 2GPTA 3N2MA 1TTIA 1F76A 3MI3A 5K4ZA 1Z44A 3N9SA 1XCFA 4NT0A 3TROA 3W2LA 4BI5A 3NPXA 3M5YA 3HB9A 2QCLA 3BW2A 1IXPA 1OYBA 2V2HA 1Q6LA 1BWKA 1DQXA 3W7DA 1F7BA 3NDOA 2PCQA 3JS3A 4IXXA 3HG2A 3MI2A 2QCGA 1PCWA 4UMBA 3C52A 4WZHA 3P8IA 2Y63A 3SZ8A 4Z0SA 4PL1A 3N34A 2Z6IA 1OX5A 3EX4A 3PR2A 3B0VC 1B57A 5KZEA 1SW3A 1EIXA 5EL1A 5L9FA 2C1HA 3DH7A 1FY6A 2DZXA 3NL6A 3DHDA 4EF9A 3M7WA 2G96A 3EX1A 3R12A 4HNNA 3RU6A 5KZDA 3BLFA 4XTIA 3DI0A 3N2XA 3V75A 3KOFA 4YCOA 3G3DA 4M19A 1VRDA 3USBA 1ME9A 4X22A 3F03K 3CU2A 4AMAA 2YFOA 6TIMA 3GDMA 3C6CA 1GYLA 3FKKA 3C8FA 2ATMA 4UFKA 3N73A 5CPNA 3UWVA 2FQIA 4OGZA 3P74A 3E0IA 3GXNA 1H7NA 4N2YA 1H5YA 3RLVA 4LC6A 1QWGA 4E38A 2O7SA 1L9WA 1WV2A 2GQ9A 1G69A 3HQ1A 4Z1CA 1S5TA 4NVTA 1E51A 1DOSA 1ML1A 4UNKA 2GUUA 4Q32A 3LXCA 4HNTA 3M9YA 3WJYA 3M44A 4ZQMA 4FNQA 3W1RA 3W7NA 5H2ZA 1R2TA 4RLIA 2E5BA 3GR7A 1TTPA 3G3MA 1A53A 1LBMA 2QJIA 5AC7A 5LHFA 2FPYA 2J6XA 3FYPA 4UFHA 3S5YA 2EF9A 4AEOA 4QIUA 3LB0A 3IIPA 1VYSX 3CLMA 4O13A 5C5YA 1DBTA 2BWGA 3KRZA 3PSVA 4CCCA 4K6AA 1SFJA 1EEPA 4X3ZA 3TMLA 4OE7A 5TBOA 1ONRA 3PBVA 3EX6A 1KFJA 4ZVJA 3TKFA 3W7MA 3MI6A 3DFPA 3TA6A 3W1PA 1KM3A 2NXIA 1W5PA 2TYSA 2W79A 3CIWA 2YPIA 4RJEA 5DBUA 1EPXA 1PHQA 3LHVA 1UUOA 2NZLA 4BF9A 2GQAA 3W7PA 5DXXA 5G4WA 2C19A 3TXZA 4IMDA 4O28A 5D2WA 2B7NA 2YDAA 3DFTA 3P67A 2VENA 3R5EA 4HPXA 1FUYA 2A1YA 4WOQA 5HULA 1JUEA 3NQ6A 3NQCA 4G1KA 3HGRA 3S6DA 2QCDA 1NF0A 1UJPA 2G5WA 4NXKA 4FNRA 1F6PA 1MO0A 3S1VA 3W70A 2ZZ5A 3TV8A 4FIRA 1DV7A 4NJIA 5D05A 3LCXA 3RFAA 3LTSA 3L0NA 1XL9A 5LNWA 1RR2A 1XDLA 4CQ8A 1I2NA 2ISVA 4BWLC 4K7YA 3FYOA 3O15A 3S1WA 4GUGA 5BOOA 4R53A 4MLRA 3G1AA 2OZ0A 3GKFA 4MOZA 4LU0A 3HBLA 3GR8A 3G18A 3C61A 4RZ4A 1LROA 2OT0A 4IWWA 3I65A 3G8RA 3EWUA 3O1NA 4Y6GA 1OFAA 2TSYA 3B0UX 3P5YA 4UTHA 1H1ZA 1KM4A 1A5AA 1T0OA 3VI2A 5AC6A 4O8RA 3UXDA 1I2OA 3ANYA 2QKFA 1XBYA 1T99A 4MZYA 3MYOA 4RZ6A 5KZMA 2J88A 2TMDA 3IRDA 4YCPA 3LCGA 3IV3A 3EWXA 2WO5A 3C56A 5FEXA 1T8XA 1KM6A 1A5CA 1WOBA 4EWND 4M7TA 3EKLA 1TPUA 4JDYA 4N6EA 1K7EA 4K38A 1TREA 3QQ1A 2NLIA 1H7WA 2G95A 4PODA 1W5QA 1JQXA 2AQWA 2P0OA 4QNEA 4X9SA 2XFWA 3IIXA 4LY8A 3L5MA 4CCDA 2HS8A 3IEBA 1AL7A 1XUZA 3OVQA 4LVAA 1KV8A 3DENA 6ALDA 3P8JA 4OU1A 3GAKA 4JTJA 4N4PA 1VHCA 3TNOA 3OVRA 4FO4A 3LRMA 4NQ1A 4PL2A 1FXQA 1WBJA 1RQBA 1P1XA 3NQ8A 3M41A 5F4WA 3Q58A 1Q6RA 1F2JA 2Q3OA 1SW0A 1LP6A 2ZRXA 2TPSA 2Y88A 4O12A 3TFXA 3W7RA 1QPRA 1VLIA 3PC0A 3O6DA 4O19A 4LW7A 3WK1A 4UR7A 2QAPA 5AHNA 3HF3A 1LM1A 3R89A 4FNTA 1LRTA 1OJXA 4S2CA 4O54A 3PBYA 4JTTA 4PCFA 5HR7A 3WK3A 1LLZA 3C2EA 1VHNA 2Y7DA 1IXOA 2XN2A 2GVLA 5IBXA 4WJEA 3FS2A 2FFCA 3PF3A 1LTDA 2HSAA 2AGKA 3SGUA 4OBTA 4LV4A 4TMCA 3G8EA 2QCFA 3THQA 4O14A 3C0JA 1VYRA 3IGXA 1FXPA 2ZA3A 4LS0A 3PSWA 3TQ0A 3N9RA 1UUMA 4TMBA 5DXYA 5D32A 1H63A 2CLHA 1ICSA 2ZZ2A 4MYAA 1U83A 1JCXA 3QF0A 4JEQA 2D73A 1SZGA 1WX0A 1JJKA 1WXJA 3UZ5A 4UTMA 1R30A 3B0PA 1OFPA 1T96A 1X1OA 2JGYA 4UNLA 1MEHA 5HUPA 4AWTA 1HG3A 1QNVA 1TTQA 3L65A 5FESA 4JD4A 1F6KA 3L5AA 4N9BA 1I2PA 4NX0A 1FQ0A 1F73A 4IX2A 1I45A 1VPXA 4O4WA 1DJNA 1FWNA 3TX9A 1XXXA 1G4SA 2A7RA 3LV5A 3WJXA 3LRKA 1P0KA 5FF7A 2ZDRA 5AB3A 4BK9A 1Y0EA 1U5JA 5CSRA 1KBJA 1H61A 3HO8A 4JN6A 5K4XA 4MYXA 1FWSA 5EYWA 4UIOA 2JK2A 2QJGA 1XUUA 2CZEA 1X8FA 3H53A 3BW4A 3TC6A 4JTFA 4ADUA 5U7SA 3E9AA 4BR1A 3DFNA 5DY3A 4C1KA 4HSNA 1F05A 1OFBA 3TSMA 4GJ1A 1DORA 3UNDA 4RV8A 3TR2A 4NJHA 1QOQA 1TPC1 1YDNA 1W3TA 1SSDA 4PH6A 2YR1A 2H6RA 2FPVA 1H1YA 4OHQA 1GYNA 3IIVA 2NXHA 2ISWA 4DQWA 4IQLA 5E0KA 3I68A 4LS1A 3A23A 1TJPA 3C2FA 4K36A 4JTSA 2E68A 3LRLA 3PS7A 4NU7A 2BXVA 1RQEA 4XQ6A 3UWWA 1H7OA 2ZZ7A 2YW4A 2ZZ4A 1OG0A 1N55A 3PBUA 5AC8A 3BK0A 3T78A 4O50A 1FWTA 3GZ3A 2PRHA 4A2SA 2B7PA 3O6YX 4DEFA 1QPNA 1XI3A 1G4EA 1TRIA 1Z42A 2ZRVA 3NXFA 2YYTA 3H54A 2YGYA 4UFJA 2JKAA 4AB4A 1WOAA 3M6YA 3LHYA 2CZFA 4DF0A 2HS6A 2Q8ZA 5F4SA 1W54A 1D3GA 1G4TA 3QQ0A 1R2SA 3A9IA 4UTKA 5LNUA 1KA9F 2VFGA 3S5OA 1KFEA 3GX9A 3R8RA 3V1PA 5I3FA 3QPZA 3W2NA 3F4WA 1LOSA 7TIMA 1W1ZA 2IQTA 2YX0A 1GVSA 3QSRA 1NVMA 4JNMA 2OT1A 2OX1A 3M16A 3IVSA 5D2TA 2B7QA 4EVZA 3ATZA 4WX2A 1OFDA 3EXSA 3FKRA 1PHWA 3GLCA 2V2CA 3DKJA 4YL2A 3W83A 3HPXA 5K9XA 3S9YA 2I9EA 3QW3A 3G0SA 1TQXA 2ZZ6A 2NUWA 5HR6A 4H3DA 3MP3A 4UTLA 4JY9A 4UTTA 5H91A 2WSYA 2V30A 1GG1A 2C0AA 1VQTA 1FDJA 1JUKA 4LVDA 1GT8A 1W8SA 3QRHA 3EX3A 2ATSA 3MHFA 5D33A 1A50A 3W22A 1ZAIA 3B04A 2VEIA 3LI1A 3NPUA 1RV8A 1J2WA 1PE1A 2CZ5A 3AJXA 4JICA 2NX9A 3A22A 3RF9A 4JTEA 1AW5A 3SY5A 2ZBTA 3I7QA 2E6DA 4LUJA 4FX6M 3KVJA 4MUZA 3NQFA 4ORMA 1VLWA 2X30A 3GNNA 4MFDA 1AW2A 1VZWA 2VEPA 1OFRA 4R34A 1O5KA 3DGRA 1YTEA 5G2HA 2GJNA 4XKYB 3NQ7A 3WK0A 1TV8A 2NWRA 1PL9A 4DO6A 1B4EA 4NUWA 1YXCA 4RX0A 2CZDA 4IUOA 1FDZA 1YYAA 3SECA 1QCWA 3P7YA 1G4PA 3DZ1A 3EKZA 4Z1DA 1KLYA 1XBXA 1Q3NA 1DVJA 1YPIA 5EBUA 3U6WA 2A7NA 3B03A 4N02A 3K30A 3BW3A 3G0UA 5HWMA 3TW7A 3NQGA 4D2JA 4A21A 3WJZA 3EXTA 3HPZA 2B7OA 1AK5A 4LUIA 1H60A 2Z6JA 3IIZA 1KM2A 1K8XA 1K8YA 4K7VA 2FIQA 1ICPA 2QCNA 4O4VA 4NJJA 4E0CA 3W88A 3PUEA 3BGJA 3CWOX 2FPTA 4TR9A 2OCZA 4Z1BA 3TMQA 1S3HA 1RZMA 4GNJA 2F84A 1SPQA 5IBXC 4OV9A 5DBTA 1L6WA 3TQVA 2RH9A 3TK7A 1BWLA 4JYDA 3P62A 1F74A 3FJLA 4PC8A 1YADA 1ZY9A 3CHVA 1HL2A 5DCDA 1ZENA 5C54A 4UTWA 1VGAA 3T55A 4B5NA 4P61A 1FX6A 1LRNA 1IIGA 4JTLA 1C29A 3CC1A 2NX3A 4N9CA 3DHFA 1EP3A 1TPVA 2JBMA 3HG4A 4JTUA 3EB2A 3KRSA 4BFAA 1JR1A 3MBDA 5I3GA 3WJSA 4TO8A 3LTYA 3NZ1A 4M7SA 3KXQA 5AFDA 1FCVA 1D9EA 3W1XA 2WJZA 4QSHA 4WXYA 2QUTA 3C3NA 5CKSA 3GAYA 2QCMA 2B0MA 1GVOA 4JTHA 4MPQA 3BG5A 2C16A 1H7PA 3EWBX 3W71A 1Q6QA 4XBSA 1R46A 3L9CA 4LC8A 1P4CA 1JCLA 5G1TA 3S1UA 2VOMA 1S5VA 3KVKA 1VH7A 4MY1A 4WXZA 1BKSA 4UTJA 5HWNA 2ZRWA 2V82A 3D0CA 2R8WA 1TJRA 3HG3A 2E09A 4K37A 4QQ3A 3MMTA 1KLZA 4QJ1A 4NNCA 3FIGA 2RDWA 2V8ZA 3UQNA 4FNUA 1O95A 4AAJA 3BG9A 3W84A 2EAWA 1RVGA 1QO5A 1TB3A 4JXCA 4UR8A 2WKJA 5CG7A 1W37A 3W86A 2J9YA 4LVBA 1SR9A 3FA5A 2C15A 3PB2A 2WQPA 1NEYA 5D09A 4XUGA 3BARA 5LGXA 1YDVA 2H90A 4Q4KA 3NQDA 1OYCA 3CEUA 3ABRA 4O11A 5BMWA 4IPIA 4QITA 3TDFA 1NFBA 3BV4A 3O63A 1YTKA 1LZOA 3TQKA 2WPBA 1I4NA 2DJXA 2QUVA 2H3BA 4EIVA 2VEKA 3LCWA 4FNSA 3NNTA 2OMAA 3HG5A 1W56A 4MFEA 1W5MA 4HHPA 3PUDA 3OEXA 5D2XA 4Y90A 5AHLA 1LBFA 3TAKA 5EKYA 2EGZA 4RK8A 1O5XA 5G4EA 3BLIA 2VELA 2C3ZA 2CLKA 5F1UA 3O8AA 1XKYA 1O94A 5F2MA 3W7KA 5KINA 1GZGA 3DFQA 3NAVA 2FB3A 4AF0B 2X1SA 2FJKA 2VFHA 3W07A 4O53A 2YCEA 5EA9A 3BLEA 1FWWA 1PV8A 1XM3A 3M5ZA 5I3HA 3BVJA 2DZTA 3OBKA 4O1AA 4JTIA 4LNYA 3KHJA 1ZHAA 3TU9A 2DZSA 3W7JA 3PVFA 3FOKA 3NM3A 5LHEA 4O18A 4O52A 2ZFAA 5U4NA 2DZPA 5HWJA 3TW6A 3SI9A 3BG3A 1LYXA 5CPOA 3AO0A 5DELA 3QMTA 2EHHA 2RKXA 1JCMP 4AHPA 4GBUA 3MYPA 3OG3A 4MVAA 2I14A 1OK4A 4DF1A 3VNDA 1SO4A 5K2ZA 1ZJIA 1JUBA 3INPA 5C55A 1UASA 2YZRA 4FHAA 2VFEA 4HPJA 3NQAA 1NAL1 1KFLA 3NOEA 1LDCA 3CB8A 3LLDA 1O60A 4UCGA 1V7YA 4LRSA 1BTMA 4XZ9A 2DZUA 5EY5A 3O06A 1DJQA 2QR6A 1TCDA 3EWZA 1B4KA 3DFOA 4GUJA 3GDLA 3HOJA 5GVJA 3E96A 2QCEA 1B3OA 1VS1A 1DQWA 5K9CA 4IOTA 1A5BA 2V9DA 4FF7A 4FB7A 5E93A 4MIMA 2A21A 5FF2A 5KSWA 3SW6A 1VJIA 3N19B 3G1HA 3W7EA 1K02A 3W1NA 1PS9A 3LBCA 4L4LA 4MZ1A 4WUIA 1O4UA 1TV5A 1M6JA 2J9ZA 1OFQA 2KZHA 4Z0JA 3QM3A 4RXGA 2YFNA 4MJMA 3GB6A 2VEMA 4DPPA 1RD5A 3DI1A 3JR2A 4QAIA 3F1QA 1L2UA 4N9EA 3CWNA 1QPOA 1RQHA 1OK6A 3ELFA 3W3OA 2X2GA 4LT9A 2VC6A 3W73A 4RKAA 4JR5A 1W3NA 2PC4A 4NNAA 4M6QA 3NR0A 1KTBA 2Q3RA 3EX2A 1H50A 2WSQA 1MEWA 1TSIA 2ZZ1A 1H7XA 3N3MA 2V2DA 3NQMA 2ZA2A 1VYPX 3KX6A 3TSDA 3LI0A 4FEZA 5HINA 3Q94A 5AOUA 3P80A 4DXVA 5LGZA 3NL5A 2B4GA 1PIIA 4E2DA 3FEMA 4LV9A 4RCXA 1EUNA 1K7XA 4NZFA 3IVUA 4FXRA 4XKYA 2C6QA 2Y70A 5DCBA 3TJXA 3M0ZA 1JULA 2QF7A 3C4UA 2QAFA 2A4AA 1LORA 4NJKA 2G97A 1LOQA 1AL8A 3F4NA 3B06A 4ML9A 3W1MA 3LXBA 2ZQ0A 1AG1O 3LTPA 1EB3A 2BZNA 5K3VA 3LCLA 1ME8A 1QO2A 4WY0F 3HJZA 1M5WA 3VE9A 2V0TA 3KFTA 4GC4A 4LVGA 4DPQA 1UCWA 1UBSA 1M7OA 3GDKA 2QCCA 5L6UA 4JTGA 3W1AA 3W7IA 4BWLA 4PA8A 2ZYFA 4ZMGA 3A24A 3E02A 1TRDA 2J27A 4UTWC 1A5SA 5FEZA 5ABTA 1OABA 3GK0A 3BO9A 3T40A 1FDYA 1YXDA 2CLOA 4JIPA 1TIMA 5T26A 1TPFA 4KFOA 2ZRZA 4HNUA 5C2XA 3HIJA 1YPFA 4I7UA 3CIXA 2CWNA 4R33A 1CX9A 1YXYA 4N6FA 4GWEA 4AVFA 3EWYA 1Z48A 2A2IA 3UY7A 1OVDA 1FCBA 1SQ7A 2Z0IA 1B9BA 4RXFA 3TH6A 3ZWSA 1I8JA 4BI6A 1GTEA 5A5WA 2FTPA 1LCOA 3L2IA 2A5HA 3KVMA 5KTLA 3GXPA 4LWWA 2P10A 4FNPA 5TIMA 3C2OA 3LERA 2BSLA 1XFBA 4OT7A 3P5ZA 4H6KA 2E5DA 1BEUA 3W1TA 2R94A 3W1QA 5AHFA 2DU2A 2BX7A 3P84A 4UFIA 4A3UA 3PUOA 3P82A 3WK2A 1M7PA 4MY8A 3P60A 1TPWA 2QUUA 4HKPA 3NO5A 1JCJA 3FFSA 5FI8A 4C1LA 3HGJA 1F5ZA 3UWQA 1WQ5A 3LDVA 5HJLA 3W7HA 3W7QA 2YYUA 3QH2A 5AN7A 3NG3A 1OF6A 1I2RA 4OV4A 5EMUA 1TPEA 3ABSA 2R14A 1J5TA 5LKYA 1NF7A 4LTSA 5E1QA 1GQNA 2WNNA 1EP2A 1LOLA 2GOUA 1GVFA 5CPLA 2QDHA 5HMSA 4IJBA 5G2WA 4TU1A 4KWVA 4OWGA 3B05A 2QJHA 4S1FA 3LLFA 4GFSA 4TIMA 2Y62A 5D2VA 3UWYA 3RK8A 1Q6OA 3QJAA 5LNRA 1GJPA 4N4QA 3U8GA 4U28A 3OA3A 4O0ZA
chains in the Genus database with same CATH superfamily
2YA2A 1YDYA 1ITCA 2VMFA 4C6EA 2XIBA 1US3A 3ZR4A 3KRUA 4NJGA 4EPBC 5CZ0A 1BG4A 1V51A 4MWAD 4HBKA 1C9DA 1KM1A 3W75A 3AMKA 2QNEA 1HO4A 2I1OA 1A5LC 1QT1A 1R47A 4DVOA 1G7VA 3GYEA 3YPIA 3VDAA 4UQ9A 2QV5A 2QDDA 2XISA 4FOJA 4DLFA 1LJYA 1KCXA 3SQLA 3KZPA 3UJFA 2ALDA 4CQAA 5CC7A 2D24A 3GH7A 4KKXA 4AHOA 4NAEB 3T7VA 3DHUA 1MWOA 4HB7A 3WUGA 1RP8A 1QR7A 3PZ9A 3BCFA 2BY1A 3H12A 3LUTA 4PGLA 3SGZA 3STEA 1ICQA 1IF2A 3IGHX 5MHBA 2OPJA 5CPQA 1RLCL 2WW5A 4M82A 3NM1A 3BPWA 3BQ5A 3ZSTA 2PU0A 3EA1A 2IPFA 1JDEA 1ZSXA 1JGIA 4LPCA 4XD6A 3BC9A 1CXFA 3GTXA 5FJUA 5F2GA 4GQGA 5AC5A 5MKGA 3W85A 1EWDA 4MGGA 1KFBA 4C90A 3QFEA 3G1DA 4H8NA 3DBNA 5AC4A 1QOXA 1W3JA 4HYVA 5M1TA 3QLLA 4DXKA 1J0HA 3IJQA 1E6XM 2Y61A 5CSSA 1BSLA 4AH7A 5I23A 4XBJA 5EB8A 4WDUA 1PB0A 3M47A 5HNTA 3GKAA 4US5A 2PRMA 3VD9A 4GI6A 3LLXA 2FDMA 1IR1A 3FSTA 4AYGA 1UR8A 2NWSA 1W17A 4AWSA 2G50A 5JH1A 1VIWA 4K39A 3A4JA 2JGQA 3G0XA 3LV6A 5F4XA 4GPNA 4DJFC 2FTYA 3I7SA 1CDGA 2WNZA 2MANA 4Z08A 3ZLFA 4ZXLA 2Z2AA 1B3VA 5D04C 2CCRA 1M3UA 1B9ZA 2RDXA 5BMXA 1VCFA 3LM3A 1V5XA 1BSIA 3REQA 1UA7A 2OR2A 2KAUC 4AC7C 3PWAA 3SFKA 3KWXA 4WSHA 3CHCA 2GGJA 1EDQA 2OLAA 1FFQA 3TC7A 2QHAA 3IARA 2A85A 1TKKA 2NUYA 4GD0A 1I60A 3FJ6A 5F1VA 3GDTA 4YXGA 3WF3A 2J25A 5DY2A 4PUWA 4LEQA 1GVRA 3LGEA 3D46A 1PKYA 1H09A 5F2LA 4M29A 4MUPA 4WVXA 1QMLA 3LM7A 2J9XA 1JVNA 5D02A 1TUFA 3M4HA 4YWSA 1KM5A 3HPSA 1X6NA 3RM4A 4UTUA 1G7UA 1EP1A 1L6YA 5DCEA 1UD2A 4XTDA 5CZJA 1HJWA 1JL8A 2UV8G 3GNOA 4R7OA 3RNDA 5BU9A 4I8DA 1C9WA 4PUJA 5CSUA 1MZHA 3H6OA 3MA8A 1MXSA 3W2JA 4Q4RA 4CNNA 3KP0A 3S0CA 1C90A 1VCGA 5CLWA 1VEPA 3SDOA 3VM5A 3N14A 3DERA 3L4WA 3W24A 1C8VA 4Q6JA 4UZSA 2CLMA 2PCEA 2FJUB 4D6CA 3CZJA 3AZSA 2ALRA 1VEOA 1TPB1 4R3UA 3RCNA 5HNRA 5C6MA 5HUOA 3E49A 2PGEA 1ECEA 5A8GA 4RPPA 3RLUA 2CYGA 4LUYA 3O05A 4XO7A 3CZLA 5J5DA 2PDMA 1DWIM 4O1DA 4UTIA 4ZOAA 5GJPA 4HA1A 2E6YA 3IGSA 2WC3A 3QW4B 3IIOA 3SEPA 1J4EA 3RO8A 3GNRA 3N17A 5JUVA 1HFBA 4CD8A 5LNVA 4EXQA 4C6LA 3AYSA 3T0TA 1CB7B 1RCQA 1PIFA 4V27A 5H6HA 4V1XA 4R7JA 4F0SA 4AHQA 4PMYA 3VIKA 1WA3A 1XYAA 4LSBA 4LQ1A 2JKEA 3WKZA 1QPKA 5DMNA 2CC0A 1XYZA 3SJ3A 2PP1A 1JZ6A 1TWIA 2W27A 3H2AA 1Z7AA 4P2VA 3PZGA 5CPMA 5I03A 2WV8A 3C5QA 6CGTA 3W7LA 4IQDA 3URQA 4AY8A 4M24A 1QNRA 3OZYA 2Y4SA 1A47A 2I5QA 3TXVA 4CCEA 1A3WA 3K1GA 3JZUA 3WG6A 5G5IA 3OHIA 4WK9A 4O57A 1QI2A 1GEHA 3QPEA 3ZS4A 4XK2A 5CJMA 4D6DA 3C2VA 1XS2A 3PG9A 1CT5A 4G56A 2CW6A 2VFDA 3RN6A 1J79A 2E7FA 4I8YA 3A21A 3V5FA 1SFTA 4OTKA 2Z1BA 2QCDB 4HMEA 1XDMA 1VRXA 4C6JA 3ATYA 4O17A 1HO1A 2ZCGA 5FF3A 1YKWA 4UMAA 3TCEA 1JIBA 3ES8A 5G1YA 3EXRA 4XSMA 1P43A 1RY0A 1UP3A 3N4AA 3FK4A 4WD0A 3ECQA 4BQ4A 1XX1A 3WO8A 1EKOA 3QMRA 1Y5WA 1SO5A 3OVPA 9XIAA 6REQB 2DORA 4C6QA 4NAEA 1RVKA 4HTYA 1KTNA 4JIHA 4DELA 1QBBA 2G3MA 4B9YA 1EWEA 3A6OA 1AMYA 3S5ZA 3VIIA 4UXDA 4AZ5A 3PNZA 2JEQA 1OZMA 1ZBWA 3NEVA 1MNZA 3E38A 4K2SA 2VZVA 4DWSC 4ZZ9A 3LCHA 4ZB0A 3UVAA 3VD4A 1LRQA 4PMJA 2WOQA 2W91A 4AD3A 3QZEA 1GNXA 1XC4A 4H19A 2PURA 1PSCA 2Y7EA 3E12A 3NTYA 2I5GA 2GSHA 1ADSA 3UBPC 4DBUA 1OG6A 1XV8A 4B92A 4NL1A 4KFNA 1TTJA 3AU2A 3R11A 1B2YA 3CZGA 3ABQA 3MW7A 4J1OA 4XO6A 4S3CA 4JIIX 2XH0A 1KQYA 1BKHA 1UZHA 3TSBA 4GE8A 2JKPA 3CV1A 2Z1WA 5JQ9A 4TV6A 2GVEA 3DG7A 5LA2A 1V3HA 2W67A 1TV7A 3AC0A 1KRAC 3KOWA 3NUKA 1IXQA 1JYVA 1WDWA 3CH0A 1B90A 1CGXA 4H00A 3VPLA 3MKVA 1YTDA 4HA3A 2C18A 3WQEA 4E8GA 3F7JA 3W1LA 5D8WA 5IM51 2ABAA 3OBEA 4F0RA 4FX7A 1WNOA 2ZUMA 3W87A 4M6VA 4NZ5A 3QPYA 1JF6A 4ONVA 1C7TA 3WX7A 1D8WA 2F8QA 4WF7A 5LIYX 3N2MA 1TVPA 1Z44A 4GI4A 3M5YA 1ZS2A 3BW2A 4LF1A 1US0A 4E3TA 1MUMA 3PZQA 2GL5A 3AQUA 4V28A 1FWEC 1Q6LA 2WLZA 3W82A 4HMDA 4RE3A 1AQMA 3K4WA 1KBKA 1PCWA 3C52A 3KRBA 4WZHA 1WB0A 1EBHA 1VEMA 4Z0SA 3CHDA 5I78A 3N34A 2PD9A 2HBXA 5LXXA 2WHJA 3DDMA 1EIXA 1EO7A 2J62A 3K5XA 2C1HA 3SN0A 2V67A 3KWSA 3NL6A 3WLIA 3M7WA 3EX1A 4GIAA 3RU6A 5KZDA 4MDOA 4HCHA 4G8TA 4XZIA 3Q65A 1OADA 2ESCA 4GI9A 4OIFA 2FGZA 2BVWA 1LUCB 5BRQA 3LSBA 4M19A 3F03K 3WYZA 2YFOA 4F4RA 1GYLA 3FKKA 4OGZA 2GJPA 3TN4A 3GXNA 1H7NA 1H5YA 3LENA 1QWGA 5D9NA 2C1IA 5BOFA 3GXDA 1J0IA 2ASHA 1L9WA 1IE7C 1JAKA 3RUBL 1AD4A 4NVTA 1E51A 1ML1A 1NFGA 3OA5A 4UNKA 4BCEA 1VPQA 4HNTA 3WLHA 2IQDA 5BWFA 1X7IA 4UZUA 5FD0A 2AQVA 1UOKA 1FVPA 5ABEA 4KEZA 1TTPA 3PTMA 3G3MA 1A53A 5AC7A 4AIUA 2G3IA 2FPYA 3FYPA 1F9CA 1UKOA 3S5YA 1DJHA 3B3DA 5C8BB 4N7QA 3SSZA 3GY1A 4E4UA 5C5YA 1V3MA 4CQDA 3PSVA 1EEPA 2WCAA 1W3HA 1LL6A 4QXIA 1KFJA 3W7MA 2PWUA 3OPSA 4HU0A 4A6GA 1KM3A 3EMQA 2NXIA 4S3JA 1WUFA 2YPIA 5IOBA 2RJGA 1EPXA 3MTWA 2VGBA 3MT1A 1OBAA 2XSXA 5A6BD 2HK1A 2NZLA 4BF9A 3MUY1 3MSYA 5DXXA 3GRIA 3TXZA 5JMUA 4GQBA 4BQ2A 3B4YA 2YDAA 5C70A 1PZ0A 2WMHA 4WOQA 3A47A 1JUEA 1UPPA 3NQCA 1UQZA 3CMGA 2F2KA 3HGRA 1N8IA 2V3DA 2QCDA 3CUZA 2OOFA 4X61A 3AMGA 4FNRA 4NKCA 3HPFA 2VDIA 3PNUA 1V79A 4PYSA 2BASA 3BSHA 2ZZ5A 1FWAC 3TV8A 4H8HA 4X63A 5D05A 3PJXA 4CQ8A 1CLKA 2QPXA 3OJGA 2OTDA 4QBXA 3HBLA 3GR8A 3EWUA 3ALFA 3VI2A 4KW2A 6REQA 4ZODA 1K8CA 1XBYA 5KZMA 3SCTA 4PTMA 1W9UA 1EH9A 2HVOA 4YCPA 4EAMA 3TC3A 3VO0A 3C56A 5FEXA 1T8XA 3RMEA 1KM6A 4H9YA 2QF8A 4AZHA 3C0QA 4PFHA 4N6EA 5D9OA 3IUHA 1TREA 1H7WA 2CHNA 3PANA 4A4AA 4PODA 4QCFA 4ZR8A 1A5UA 3P2VA 1QHPA 1AL7A 1XUZA 3DENA 1RK5A 3P8JA 4OU1A 3GAKA 4JTJA 5G4HC 4PEEA 1OY0A 1OC6A 4PMXA 2DEPA 4Z2GA 4NQ1A 4D6FA 5TF0A 2EBNA 5F4WA 1B30A 3EWCA 1Q6RA 5XIMA 1NM9A 4QQUA 2TPSA 4J2MA 4NYUA 4QTGA 3CUHA 2NQLA 2HROA 3W7RA 4O19A 2VEGA 4UR7A 2OEKA 3S2JA 1LQAA 2VJXA 2QPSA 1LM1A 2CKRA 3R89A 4FNTA 4O54A 4DWSB 5LYRA 4PCFA 4HVXA 3WK3A 1KB3A 3FVMA 4Q4PA 2XN2A 2GVLA 2XIMA 2R9RA 4ACYA 2FFCA 1HXJA 3L4XA 3NQBA 1LTDA 2HSAA 2AGKA 3S9ZA 4OBTA 4XZWA 2ADAA 3G8EA 4P7NA 3C0JA 5M5DA 4AG0A 2YIHA 4FPSA 3VMPA 3N2OA 5DXYA 5D32A 1H63A 3T0DA 1A0EA 1U83A 4JL2A 1JCXA 4JEQA 2HCVA 1W2PA 1D8CA 3B0PA 4U10A 3U2EA 1U1JA 1WXZA 1HG3A 3MSRA 3WEOA 1MW1A 2HNEA 1I2PA 4NX0A 8XIAA 1XLLA 2C71A 4DAIA 3GIPA 2OQLA 3ERPA 3WH9A 1XLAA 4WDWA 3EDKA 1S5MA 2EXOA 2VC5A 3WJXA 4IF2A 5FF7A 2ZDRA 3TYDA 2ZXBA 1CCWB 2CITA 1KBJA 1H61A 1RCOB 4R27A 2BB0A 2G8ZA 3TJIA 4EANA 3VD3A 3LMZA 1HKKA 2X0YA 4HZMA 1I75A 4DJFA 1X38A 3FXYA 4JL1A 3M0JA 3WQ5A 1U30A 1OCJA 3RPDA 4MKVA 2WZEA 4TVUA 2Q09A 5U7SA 3E9AA 4BR1A 1F3WA 3GU1A 1LUCA 3ARTA 3NSMA 2PP3A 3BH4A 2WAGA 4RL3A 1N82A 1J9YA 3N04A 3I3EA 1J93A 2YR1A 4TTUA 5A2AA 4IICA 2E8ZA 4OHQA 1GYNA 2ISWA 4IQLA 1J6PA 2J7CA 3IJLA 2IW0A 4IIHA 3A23A 1TJPA 3C2FA 4JTSA 3N11A 3LRLA 1QRQA 1RQEA 3BJFA 1DJIA 2PD5A 1FWTA 1TE1A 4A2SA 3O6YX 1WP6A 2IKJA 4DEFA 1T8QA 1XI3A 3WL1A 2ZRVA 3V0SA 4NZ1A 2DH3A 1T7LA 2JKAA 2CZFA 3QV8A 2XIOA 2Z4GA 2INFA 2PDQA 3LQLA 4L80A 4PTXA 1EL3A 3E2SA 1QUMA 3A9IA 1R6WA 2VGFA 3GVRA 2UWFA 3SBFA 2BOGX 3UF9A 1XIIA 3VNKA 3KDOA 5A2BA 1P48A 3V1PA 2HRWA 1JFXA 1HKVA 4YTRA 5I3FA 3FHQA 1VFTA 1UD6A 2BVYA 4UWMA 1W1ZA 3KUMA 1JPDX 2IQTA 3CQHA 3QSRA 3VOGA 1S5NA 4DBWA 4QHRA 3N4EA 3DECA 3GTFA 1GONA 2AGTA 3KEHA 4C6FA 3GLCA 4LUSA 4YL2A 3W6LA 4EE9A 2I9EA 2OOGA 2DSZA 3U7BA 4QLJA 3MJMA 3G0SA 1QASA 1W1B1 5HR6A 5EU9A 1IQ8A 3RCYA 2DFAA 1EQCA 3T2PA 3IJ6A 1VQTA 1FDJA 4LVDA 1W8SA 2OU4A 1P1MA 1VFUA 3ORWA 2ATSA 3FDGA 1D7KA 2WQDA 4A3YA 2D0GA 1ZAIA 4GVGA 1PE1A 4E8DA 4C6DA 2FZDA 3A22A 3FA4A 3KZSA 3KTCA 1AJZA 1Q4WA 4JTEA 1P6CA 1QVBA 1HJVA 1BFNA 3SY5A 1IT8A 4LUJA 4O1EA 3PN8A 4YVPA 3KVJA 1GZJA 1DHKA 2WWCA 4O1FA 3ID7A 4NF7A 1AW2A 4Z1YA 1OFRA 3RGTA 1RBLA 3SY8A 2INEA 5IHSA 4J3XA 3UJRA 3WNPA 4DO6A 1V4YA 4WDXA 3U57A 4RX0A 4HK6A 4WDTA 3SECA 2PDPA 3EKZA 3ARQA 1P6WA 4J4KA 4AD4A 1XBXA 3ZQ9A 2ZVIA 1Q3NA 1E9IA 3U0HA 2DH2A 3QGKC 1NP0A 4MKSA 1DJYA 4N02A 1ZU8A 3K30A 1KGXA 3KOXA 3G0UA 2QJJA 4FALA 3WJZA 3EXTA 3HU7A 3GQYA 4S3EA 4JHOA 1OGSA 2B7OA 4LAZA 1L8PA 3R6IA 2V5CA 5HQMA 1JZ3A 5C7HA 3THDA 5FAJA 2OXNA 1JAEA 3QGAC 2XG9A 3PUEA 4A8RA 4F79A 1S3HA 2VX6A 2XGZA 4AZGA 2D0HA 2J13A 5G1MA 1A80A 3UG8A 1OC5A 3OODA 1A0CA 1BWLA 1YHTA 3P62A 4JYDA 4PC8A 2EEXA 1J10A 1YADA 2ZX8A 1H5VA 5AVNA 3CHVA 1HL2A 3ZZ1A 2AL2B 3CUXA 5CH9A 1ZENA 5I07A 4UTWA 4B5NA 4P61A 1IIGA 4C60A 4IH3A 3V1HA 1MXGA 4N9CA 3RRXA 5CPTA 3UNTA 4DWSA 1YIXA 3DHFA 1TPVA 4NI3A 3PJTA 3K2GA 4GJIA 1NH6A 3HG4A 4R9XA 4BFAA 3MBDA 3GNXA 5AFDA 1XH0A 1FCVA 3T08A 2WJZA 3KP1A 5BYWA 3W29A 1YMYA 2QIWA 2B0MA 4NI8A 1QNOA 2XGIA 1RP9A 1Q6QA 5TAOA 4JN7A 2G3NA 1W3LA 1JCLA 5G1TA 2OLSA 1S5VA 2ZE0A 2NSOA 4WXZA 1Z8AA 1BKSA 1GYMA 2DW7A 4F3HA 3CQKA 1BVZA 3MY9A 3HG3A 3CIVA 3MMTA 4WJXA 4NNCA 5E0CA 3FIGA 2V8ZA 1ZBVA 2HE5A 4GACA 4I6KA 1I1XA 4UBPC 2CKSA 2O4QA 3R79A 4UR8A 4JXCA 4ZO6A 4C6CA 2WKJA 4GCXA 1W37A 1PYFA 1IWBA 2XIIA 3FA5A 2C15A 1CXKA 3C86A 4GZEA 1XLCA 3O2LA 5FJTA 5LGXA 2O0TA 3E3HA 2D3LA 3VGFA 3GHSA 1E3ZA 1MQRA 2VUNA 3C8NA 4H7VA 3QYSA 3O63A 2FZNA 3LS9A 4MWAB 2WPBA 2POZA 1NWSA 2VEKA 4CU7A 1KR1A 4XZLX 2V5JA 1W56A 4MFEA 1W5MA 1Q7ZA 4P8UA 3WLPA 3TAKA 5EKYA 2EGZA 2WMIB 4B16A 5F1UA 1UYQA 3ITGA 3QHNA 4NYYA 3AIWA 5AECA 3DFQA 2FB3A 2X1SA 2FJKA 4O53A 1PV8A 4NRSA 3BVJA 3OBKA 3OW1A 4LNYA 3KHJA 1CPUA 1ZHAA 3TYAA 4G2DA 2WMKA 2WM0A 3AHTA 2C91A 3W81A 1TZZA 4F9DA 2DZPA 1DIKA 4GXWA 1JPIA 2Z7GA 5HWJA 4AVNA 1XG4A 1JZ2A 3SI9A 2OKTA 4HZ8A 2YL6A 2JIEA 2ZXQA 4A3RA 3PPHA 3FHAA 1S1PA 1EA9C 2EHHA 2AQOA 2PU1A 3WN6A 1PWMA 5HNNA 1E0XA 1TX2A 3BMXA 3GS6A 1UPMB 3PZUA 1TV4A 3CASA 1C93A 4DF1A 2QPUA 5K2ZA 3CZKA 5FJOA 1JUBA 4AEEA 4HPJA 4WCJA 2WCGA 3B9OA 3CB8A 3T07A 5E9XA 4FZIA 1TMLA 1DJQA 2QR6A 7XIMA 5GVJA 2WHKA 1VS1A 3MDWA 1DQWA 2BODX 4IOTA 4FF7A 4MIMA 4IL0A 5KSWA 4GZIA 1ITUA 1TE6A 5CZKA 1BPLB 3W1NA 1PS9A 4WUIA 3KCJA 3NSNA 1TV5A 1M6JA 3A4XA 2OYKA 1OFQA 4Z0JA 4ZE4A 1MMFA 3JR2A 4S3KA 1MYRA 2FMOA 3CWNA 3HURA 1RQHA 5LIXX 5RUBA 5A8OA 3AWNA 2Z1VA 3SN1A 3OLDA 4LT9A 4WKFA 4K8GA 1W3NA 4B5XA 3WNNA 3NR0A 1KTBA 4MHBA 2Q3RA 1T6MA 2A3HA 2FVLA 4KRUA 1UG6A 2BG5A 1H7XA 3AXKA 2ZA2A 5GPRA 5DQPA 2JALA 3DIPA 3LI0A 2P5NA 4FEZA 3N29A 5AOUA 5LGZA 1QTWA 4MF4A 3FEMA 4LV9A 4RCXA 4E2DA 2YLAA 4NZFA 3T0AA 2HZGA 2YL5A 2Y70A 3M0ZA 2Z1SA 4IMAA 1W32A 2A4AA 1LORA 2G97A 4AIBA 3NJ3A 4XD4A 2NVCA 1K70A 3B06A 4L5ZA 4HHLA 1KR0A 4PMNA 4IP5A 3LNPA 1ME8A 4O0QA 1QO2A 5EFFA 1WZLA 2PMQA 4IFOA 4F0HA 4H83A 3T81A 5EMMA 3DESA 5KETA 3GDKA 1K6WA 3W7IA 1S1RA 4ZMGA 3E02A 2J27A 3WUBA 5ABTA 1OABA 1HX0A 3K4DA 4QLLA 4PTVA 1P0BA 4EKJA 2DGAA 1QI0A 5T26A 1TIMA 2EPOA 3BANA 1TPFA 1P7TB 1KFWA 2OSXA 4ZFCA 3WBWA 1LG2A 4I7UA 1CX9A 4GH1A 1Z48A 3A4AA 2A2IA 3TTEA 1FCBA 2VDGA 3MVTA 7ODCA 2BY2A 2WSKA 1GTEA 2AL2A 3L2IA 4F66A 3QGVA 2A5HA 5KTLA 4FLQA 3GXPA 4LWWA 3WMSA 2P10A 3U3HA 3PZNA 1F61A 1YPXA 3VD5A 3P5ZA 2DW6A 4H6KA 1BGAA 3SCUA 4Z2JA 4UOQA 2BX7A 1UC4A 4UFIA 3PUOA 5TNVA 3P82A 1JXKA 5CAKA 3DOPA 3WK2A 4LJ3A 3VOJA 1O66A 3NYDA 2PDXA 4ATWA 4HKPA 3FFSA 2L5HA 2VR4A 5FI8A 3HGJA 2J8GA 3LDVA 5HJLA 4ZFMA 1KKRA 5DMYA 1QW9A 3NG3A 4B5WA 4MAVA 2Z26A 1RCXB 1NF7A 4YTTA 1GQNA 1GVFA 2QDHA 4QG9A 4IJBA 4TU1A 3VC5A 4KWVA 4E2VA 4EXBA 1DXIA 3LLFA 3OIHA 3APTA 4DBSA 5D2VA 2YL9A 3RK8A 1UH2A 3RYSA 1MW3A 1Q6OA 3PK7A 1AD1A 1JPKA 3U8GA 3H70A 2VX5A 1V6TA 1Q66A 1Q45A 3TUUA 2J4GA 2OZ8A 4JFUA 5IFPA 3TIMA 3W23A 3VKDA 8A3HA 3N6HA 2GK1B 4C1NB 1EXBA 1PKNA 4KWUA 3WJWA 1JCNA 3D5HA 2R1MA 1IV8A 2Q8LA 1VAHA 2OQYA 4CCZA 4IISA 3QY6A 4GUIA 2A6LA 3KVLA 3NQVA 3O6CA 1R38A 3W2UA 4HD5A 4LVFA 2WMIA 3TN5A 3LEPA 1UOZA 3SGGA 4JX6A 2OJPA 2UY2A 1QXLA 4A29A 1BG9A 4A2RA 1FHLA 3V4BA 2C8NA 3MSDA 2ZA1A 4MMWA 1BVNP 3H55A 2J6VA 1FA2A 4IP4A 3VGBA 2GWNA 4ORIA 3R94A 5AHEA 3TFCA 1XGDA 3EWDA 4NXSA 3H7VA 3GSMA 2NQ9A 2AMGA 1UD3A 2Z1KA 5T9CE 5FEWA 4PFMA 3MBFA 4ZTXA 3JUGA 3MC5A 4HHHA 4AISA 1EOKA 4DX3A 4JHMA 5DANA 1E40A 4ZQNA 3SSJA 3ZFHA 1YX1A 4AX7A 4AMCA 3E6EA 2P0IA 3LK6A 3TLQA 2DZWA 3GDRA 3T05A 1EJTC 4M80A 4LH8A 3LGDA 1QNSA 1DIEA 4QAWA 3AUOA 1KFCA 4QX4A 4J9JA 5FKYA 2E4TA 3PBWA 3LHZA 5AHMA 3O07A 4QROA 3QYQA 5CZTA 2CLLA 5A94A 1N7KA 1U22A 4JTQA 4RW3A 4JYEA 2GUBA 4LXFA 2Y8UA 3W7OA 1PZ3A 3WNKA 3BAWA 4IX0A 3FY1A 4GIRA 4ICNA 4YLWA 3WNMA 2VVSA 3DAQA 4G7EB 3W25A 3R1ZA 4JTKA 2V5LA 3JZEA 3GU9A 1YQ2A 4KWOA 3DU0A 3V0TA 4H9XA 2YW3A 3FYYA 3FV9A 2YCIX 2DIKA 4EAYA 1DWJM 3RMJA 1MQQA 4KBXA 3AMLA 3P14A 3CEPA 3TLLA 4C7GA 3VM7A 5KMYA 2Y0FA 3HGOA 3VNJA 4GK8A 1HF6A 2E6FA 4MKNA 2YA0A 4GRSA 4ADTA 4LYKA 2QT3A 5E9AA 4MPKA 3EOLA 4PMZA 2ZZ3A 3LPFA 2D2JA 3OQEA 5AYXA 1ZCCA 1RJPA 3SR7A 3L4VA 1ONWA 3V16A 4W87A 3CAVA 1JCTA 2CU0A 2J7FA 5I3KA 3CQIA 4Z17A 4TXEA 1TMHA 1XLHA 2AAMA 2PDFA 4ZO8A 1BYDA 3AU6A 3MWAA 1ZNNA 1WAUA 4CNOA 3SQSA 3GG1A 4KCVA 2DQXA 1SU5A 1S2CA 1VCVA 4IMGA 4KMQA 3TYEA 3STCA 3V3WA 1P7TA 3M6DA 3VNMA 2WCSA 3AFBA 1UMLA 3AMCA 1K9TA 4F2BA 3N6QA 2VRKA 3G1YA 3LN3A 2HVNA 3S5NA 1NSJA 3L23A 4IMEA 1Q63A 1NOFA 2PDJA 5A6SA 3RX4A 2VC9A 1S3TC 3KBVA 2E77A 2X40A 2EJAA 5A8QA 3S5SA 3M46A 3WD0A 4HU4A 2H3DA 4AZCB 2F7FA 1GOKA 3B4UA 5D30A 2ANUA 1XIGA 3UY8A 5AHIA 4UTTC 4S2BA 4W89A 1GTHA 2J47A 2Z2UA 3TONA 1FWBC 3BUVA 4POCA 1KRCC 2PA6A 1H51A 3NGJA 5I06A 2ZICA 4K3ZA 5I3JA 1JCYA 3WQ8A 4PUEA 1SZNA 4O16A 1B0IA 4MNKA 4J5NA 1OFOA 4JIEA 3L68A 4O1CA 4YN5A 3G6LA 5D03A 2WJEA 3M5XA 3LHUA 1R3YA 3NL2A 1KNWA 4YTUA 4S3DA 3ZT6A 1GHSA 1X8CA 2VO5A 3GFYA 1GOMA 3VU2A 1YE6A 1XBVA 4DBDA 3VKAA 1EC7A 3HV9A 5HQLA 2PLJA 4H4IA 3HM7A 4Q4OA 2TODA 4ICMA 1GOXA 1JDAA 2GJXB 3UCDA 1E4IA 1HJQA 4RNHA 1CEOA 2GSJA 3LX9A 1X7FA 3LHWA 2QDGA 5FF4A 3CM4A 4J3VA 2GK1A 5D2YA 1W0MA 4C1NA 4B5SA 1SUXA 2Q8XA 3TJLA 3CQ0A 3ABOA 4YYFA 3M0KA 3BXWA 3MZ2A 4IIDA 2JF6A 5IHRA 1V77A 4C6NA 3LCIA 3UPBA 3S46A 4X2RA 1RALA 4S3BA 4LS2A 2OSWA 2PRLA 5CC5A 4KFPA 1NARA 3RAOA 2QGHA 1R3SA 1OYAA 1WBHA 3AXXA 5K9DA 2CLIA 4XUYA 2ZTJA 2GJLA 1GKRA 3B8DA 4OECA 4ALDA 3CL7A 1UWTA 1TELA 2VWSA 1UB3A 3QEZA 4L6OA 4EF8A 2OGJA 1BGGA 4K1WA 3H22A 3EB3A 1UD4A 4QEEA 1CGYA 3A5FA 3UG5A 3TTYA 3ZT7A 4S23A 2WSPA 1QK0A 1EX5A 5KITA 3BL3A 2R1NA 4MNMA 4JBRA 5XINA 1PXGA 3W7GA 5CG0A 5GNZA 4I5XA 3CAWA 4RNJA 3EMCA 4PTNA 1QBAA 3LZ5A 4HU3A 4HMNA 1N8FA 1E15A 8TIMA 2E5CA 4W8AA 1M65A 4ZQCA 1JZ4A 1XBZA 4RZBA 1XQLA 1YNYA 5BZAA 2BHUA 3OOQA 5A6KA 3GWQA 2X05A 4GGBA 3SO7A 2PE4A 2VUYA 3E2VA 3TR9A 2EPMX 2FGLA 2GDUA 4JYFA 2BTMA 3MANA 1EXPA 1E6ZA 1AVAA 4G7EA 4CN4A 2VZSA 4CQ9A 2YKKA 1W31A 2V5BA 1TPH1 3NQ2A 2Y5SA 1ITQA 1JYNA 1ISVA 1REQA 3ZWTA 4LCRA 1S5WA 1YDOA 4ZO7A 4PUMA 2YCKX 5LXEA 4S3GA 3EGJA 2GPTA 2WXDM 2HK0A 3TOPA 1F76A 1E43A 3MI3A 1J0YA 1CLXA 3ENLA 3N9SA 3WEMA 4BI5A 3NPXA 3HB9A 2OEJA 1NWRA 2WZMA 2NW0A 3T6CA 2V2HA 5FJPA 4JKMA 2PB1A 3WD1A 2OYMA 5C2CA 4QS6A 1UC5A 3FX4A 1Q6FA 2DT3A 1F7BA 2VZTA 2XVLA 1IT0A 3I6TA 2Y8KA 1V6YA 3F2CA 2YCJA 4UMBA 3R58A 1XIBA 3SZ8A 1KXQA 1PBGA 2DUXA 3ARZA 1OX5A 3PR2A 4C6PA 1UKTA 5KZEA 3EMZA 5L9FA 3DH7A 1FY6A 2DZXA 3DHDA 3SCOA 3TN3A 3TJ4A 3WLMA 2G96A 4RV3A 3R12A 4HNNA 4DNMA 5HMEA 5H1WA 1JDCA 7CGTA 2GFTA 2QUNA 3DI0A 2BNJA 3V75A 4YCOA 2RAGA 1ME9A 3CU2A 3RR1A 4GG9A 1YNPA 3GDMA 1CBGA 3N73A 2ZDSA 1OIFA 3VINA 4N2YA 5T91A 4AEFA 1M7XA 1ISWA 1L0PA 1O5RA 2YXOA 1O7AA 1CGWA 1G69A 2DSVA 3HQ1A 4KCUA 3GIQA 4Z1CA 4P5UA 3OVGA 1DOSA 2GUUA 4G6CA 4Q32A 1QHZA 2PDNA 1FKWA 1SM9A 1ENUA 4AZCA 1J8VA 5H2ZA 3BZGA 3WUEA 1BTCA 1WDDA 3WLJA 1LBMA 5LHFA 3SCVA 3EPNA 5DX7A 2CBVA 2A79A 1VYSX 2BOFX 3CAKA 4PRRA 2PWEA 4US5D 3R8GA 1WKYA 5C0QA 1DYSA 4K6AA 1E1FA 5A2CA 2ZKMX 4GOAA 3TKFA 5AVHA 4QE1A 1JG9A 2QGYA 3MI6A 1VJZA 3TA6A 3DG3A 2W79A 2X09A 2TYSA 2PLCA 5ECVA 4RJEA 4H9TA 1XPGA 1UP0A 3ZO9A 1HT6A 4DLMA 4CQCA 4PULA 4X0NA 4GABA 4B2DD 2OFJA 5D2WA 1J2BA 4GYKA 1EX1A 3D3FA 5A6BA 3DFTA 3LG3A 4HPXA 5HULA 3WENA 5I6SA 2GJXA 2CZVA 3VC6A 3AWOA 2G5WA 2W4XA 1A5OC 1MO0A 3UETA 1JI2A 4XVEA 5ABFB 4NJIA 3KBMA 3RFAA 2XM2A 4XAFA 4JIRA 3AS1A 5BOOA 1S2VA 4AZ6A 1E1CB 4TV5A 2CXEA 3UZYA 2INZA 4RZ4A 4IWWA 3Q4DA 2NV9A 1MDLA 3AIVA 2ACRA 3B0UX 3P5YA 4UTHA 1IWAA 4TOQA 6XIAA 1KM4A 2Y24A 5AC6A 2X7WA 2QKFA 3OHMB 1XQKA 2DSUA 3MYOA 2NT0A 4RZ6A 4ECLA 1EZWA 2J88A 3PPFA 3T1GA 3IV3A 4EWJA 1W1YA 1YW1A 1WOBA 1I9CB 4EWND 3EKLA 3FN9A 1Q65A 4K38A 2XSBA 3QQ1A 3H26A 2NLIA 3D6NA 3EAUA 5DRCA 4J28A 1W5QA 4H2HA 4HN8A 1JQXA 4DUOA 2P0OA 4QNEA 4ES4A 3AALA 3IIXA 1H1NA 3ZVHB 4CCDA 2HS8A 3CJPA 1EJUC 3OVQA 4LVAA 6ALDA 4KEVA 2ZVRA 4M6UA 3WBEA 3TNOA 3OVRA 2VYOA 1Q85A 4LAUA 1ODZA 1FXQA 1RQBA 2PTXA 3VIOA 3M41A 4XZBA 3Q58A 1Z69A 4G5DA 2VT0A 5DEZA 4BF5A 1TIWA 4GKLA 2Q3OA 4ZEPA 1SW0A 1LP6A 2ZRXA 5J8LA 4O12A 4FP1A 5BXTA 2Q71A 3OGVA 3WK1A 3DGBA 1U2YA 2W63A 1OD0A 5AHNA 3QR0A 1ODUA 5FSDC 4S2CA 4Q8MA 3OZMA 4FAMA 4AIOA 1XIDA 3C2EA 6XIMA 2YL8A 2QMJA 3NSXA 5IBXA 2DVXA 2GLKA 4J3ZA 1CXLA 3FS2A 3NZGA 1V0MA 1U1UA 1R5YA 3UW6A 2OLHA 4TMCA 4IPPA 2QCFA 3KOZA 3SIMA 3T9PA 1QI3A 1VFOA 3IGXA 4OFCA 4QDPA 3PSWA 3P0XA 4XZHA 1UWIA 4U3AA 4MYAA 2GVYA 1TMQA 4Q7IA 3UZ5A 2XH4A 1VFSA 3KDNA 1T96A 2JGYA 2PLKA 3VVGA 1QNVA 5ABHA 2VD9A 2ZWZA 1E0VA 4YIWA 4UNIA 3BSGA 1BXCA 4NAFB 4O4WA 1I45A 1MFVA 3W6MA 1TR1A 3H2NA 1XXXA 1G4SA 3ZLHA 1SJAA 2P53A 2Z24A 5HXMA 4MNJA 3CUIA 4PN2A 5CSRA 1DPMA 3VDCA 4DJDD 4JN6A 3N4FA 3BOLA 2UY4A 1FWSA 5EYWA 1WE5A 2ONEA 3VUPA 3GH4A 3KL0A 2PS2A 1XUUA 4L4PA 4J40A 3IACA 3H7UA 4JTFA 5JU6A 1QNPA 3DFNA 5DY3A 2XWDA 2BY0A 3QR3A 2QZRA 3TSMA 1FP9A 1J6OA 1V6VA 2OO6A 3UNDA 2VCBA 1TPC1 3CZEA 1YDNA 2JFEX 3WBXA 4PH6A 1J5SA 2FPVA 1XWYA 1KRBC 5E0KA 3ARSA 1QW8A 1W9BM 3G5EA 3I4KA 2OYLA 2JIWA 5C9UA 2XINA 4NU7A 4AZIA 1H41A 4CN1A 4RE4A 3E5BA 2I56A 1OG0A 3WQDA 3T78A 4O50A 4XVDA 1ZTVA 1QPNA 4YHEA 4GYJA 3UCCA 1A4MA 1Z42A 5DMMA 2YGYA 1VBJA 5HANA 3LYEA 3U2CA 5F4SA 1W54A 1D3GA 4RUBA 4V1YA 3OGSA 4W4QA 3ICJA 1KA9F 3DFHA 5TD4A 3S5OA 3GX9A 2OO0A 4BJHA 3SUVA 1ZBCA 1UIOA 3QPZA 1DJWA 1LOSA 4IT1A 1BQGA 3B8IA 2IKHA 2Z7KA 1NVMA 4JTCA 2OT1A 3VX0A 1VB9A 4XZNX 4M81A 2NLYA 4L61A 2B7QA 4EVZA 1FWIC 3ATZA 4WX2A 4W85A 1OFDA 3EXSA 3FKRA 1PHWA 3DKJA 3W83A 1WXYA 1X6LA 1MW0A 2XZ9A 3L4UA 3QW3A 4KQNA 1C7SA 1TQXA 2NUWA 2QXWA 4H3DA 2V3FA 3R8HA 5CSYA 3GO2A 7TAAA 3MB9A 4UTTA 4IIFA 5H91A 2ZUSA 4NP7A 2WSYA 2ACUA 2V30A 1P6BA 1GZ1A 2PFHA 2VX4A 3ITTA 1UWSA 4HOZA 3GG7A 4L9XA 1KBLA 5CPSA 1A50A 2PDYA 2XYLA 1J2WA 5ABFA 3V36A 5GQBA 1RD6A 2J77A 4G9PA 5DF0A 4JICA 3RF9A 1H2JA 5CCZA 3G6MA 1AW5A 2CIPA 2UY3A 2ZBTA 3PZTA 2R1KA 1NOWA 2WKLA 4FX6M 4JTDA 4QSFA 4MUZA 4ORMA 4XAYA 2BGQA 3NO1A 1V93A 1JZ7A 1MFUA 1O5KA 3EKGA 1FH8A 5G2HA 4XKYB 1TV8A 5B7YA 1PL9A 2CZDA 5EMKA 1XW8A 3VDGA 4ERGA 2DQWA 4GMEA 5LIKX 1NDVA 3H24A 1DTUA 3DYMA 2Q02A 1S2AA 1L8NA 7REQB 2F2HA 2J7HA 1GK8A 1EBGA 3XISA 3TW7A 4D2JA 3UJEA 3R25A 2VRJA 4EX4A 3ZVHA 1UKSA 3GVQA 1AK5A 3GXMA 5ECUA 4LUIA 2Z6JA 1IWPA 3IIZA 2QCNA 4E5TA 4E0CA 2BGSA 3TMQA 4Z1BA 2IKGA 1HVQA 2WMGA 4CEUC 4GNJA 3D47A 3ARWA 3MMWA 1L6WA 3TQVA 2RH9A 1JNDA 4INFA 2A3AA 3B40A 1F74A 3FJLA 1BHGA 4ROQA 3LPGA 3CWHA 3PPCA 4BF7A 1XLJA 1ZBKA 1FX6A 1LRNA 1Q6CA 1IEIA 3NVDA 2DZAA 3CC1A 2NX3A 4LFYA 4DIAA 3VGEA 1SJBA 3KBSA 2JBMA 2WB5A 1R3TA 3T8QA 3UR8A 3BLLA 3WJSA 3NZ1A 3KM8A 4FXFA 1GOWA 1FRBA 5T9BG 2QUTA 1XCXA 3GAYA 4JTHA 3BG5A 4P7OA 4MB1A 1U1HA 2P76A 4W93A 4QGCA 1QI5A 1Q2RA 3S1UA 2R1PA 3KVKA 1VH7A 2VDHA 1FWFC 3S47A 2R82A 4GA8A 2V82A 3D0CA 4YVXA 2R8WA 3ARPA 3SB0A 4K37A 2VURA 3DUGA 4MDPA 1BLIA 4DJEC 4ACZB 1KCZA 1B54A 4NAFA 3W84A 1RVGA 2PDHA 4H6EA 1TB3A 4B3KA 4OOUA 3TQPA 1LWHA 4LVBA 3PB2A 3B8TA 5D09A 4DB7A 4ZGYA 4ZENA 1H4PA 1I6NA 1YDVA 4Q4KA 1HNYA 2GGIA 1MI3A 3NQDA 3CEUA 1FWDC 3ABRA 4QITA 3AYRA 1NFBA 1E73M 2DUZA 1E0TA 3O3RA 1JEZA 2DJXA 4E4FA 2H3BA 4EIVA 1PTGA 4FNSA 4KGJA 3FAXA 3HG5A 1FWGC 2QV4A 4PBFA 4JNZA 1C3FA 2CHRA 2XFYA 4IZGA 5AHLA 4YNGA 1LBFA 5D2XA 3WDHA 3AUJA 4RK8A 1O5XA 5JBFA 5G4EA 3BLIA 3GZAA 4CVUA 1B31A 2OKOA 3GNPA 3O8AA 1O94A 4RDZA 1GZGA 3NAVA 4AF0B 2YCEA 5EA9A 4H8VA 4QJ5B 3KBWA 1CB2A 1XM3A 2VX7A 5I3HA 2DZTA 4LF2A 2OEMA 1EYEA 3VOFA 3TU9A 3UPMA 2MUCA 1LT8A 3PWGA 4O18A 6PTDA 1E6NA 4O52A 2ZFAA 1ZB5A 1KWGA 1E4NA 2VHLA 4UB9A 1XLGA 1E3XA 2BMBA 2J78A 3WBAA 5CPOA 4IUGA 3WQVA 1XHGA 4YU1A 1LL7A 3QMTA 3CT2A 4J3TA 2G3JA 1ZJAA 2IS7A 4ICCX 5HOSA 1QI4A 3MYPA 4MVAA 3WDIA 3A9BA 4WJ8A 4DYKA 3BAIA 1XSKA 1SO4A 1VFFA 1OM0A 3INPA 5C55A 1UASA 2VFEA 3WH6A 3RLHA 1KFLA 1LDCA 1I0BA 2QS8A 3LLDA 1Z9AA 1AJ2A 4GJJA 4PMDA 1V7YA 4C6IA 3VGHA 1BTMA 4XZ9A 3O06A 2QCEA 5A8NA 2G4FA 4IP7A 2BV9A 1A5BA 5E93A 2O4MA 1VJIA 5F7UA 4UTFA 1J18A 3G1HA 3W7EA 3GTHA 1K02A 3GG0A 1Y65A 4MZ1A 3ZJ6A 1GOOA 2J79A 5HA7A 5H8MA 1PX4A 1G9HA 4Q4QA 3E0WA 1WAWA 4RXGA 2YFNA 4MJMA 4E6MA 3HN3A 1Z32X 4N9EA 4L9YA 1XLDA 4H9UA 4YTSA 3W3OA 3WQWA 4CEXC 2X2GA 2EG8A 3W73A 4HTBA 4Q8UA 3PZOA 1TVNA 4M6QA 2WVTA 3WMBA 3V35A 3EDFA 4I90A 4H01A 1H50A 4IGSA 3RJYA 1EF3A 5FL1A 2V2DA 4DJFD 4KERA 2CNCA 1JYXA 4LNCA 3KX6A 3W28A 1PPIA 2WBGA 3Q94A 3P80A 3IV8A 4DXVA 3NL5A 1PIIA 3TN6A 1K7XA 2ACSA 4XKYA 4U2YA 7A3HA 5HJXA 2C6QA 3SCPA 1JULA 2QF7A 2O9RA 3MO4A 2QAFA 4NJKA 1AL8A 2VQTA 3W1MA 4L1WA 3GYCA 3LTPA 3PUGA 2F9RA 1EB3A 2BZNA 5K3VA 3LCLA 1E71M 1EC9A 4WY0F 3IWPA 3RRAA 3B9AA 3OP2A 4FXJA 3M0VA 1M5WA 3ZSSA 2V0TA 3KFTA 4ZBCA 2PDCA 3GHUA 2E25A 1R85A 3PZIA 3LD5A 1UCWA 1Y7VA 3R0KA 1M7OA 2QCCA 1XLIA 3W1AA 2ZYFA 3A24A 4UTWC 3MPGA 2DY3A 2VOTA 3MKCA 1M41A 3W38A 1DWGM 3T40A 1V3KA 3QXBA 3F4VA 1HIZA 4DYEA 4TVCA 1Q4NX 1OT2A 2ZRZA 4HNUA 1XKJA 2D69A 3HIJA 1EJSC 3PAOA 4IIGA 3L4YA 1ZGDA 3CIXA 3UEQA 3UU0A 3A3XA 4R33A 3UY7A 1B9BA 2W9MA 1CGVA 5BRPA 3SJNA 4CVWA 2D3NA 4FNPA 4LCSA 3LERA 2BSLA 1V0LA 2GDVA 3W1TA 5AHFA 2DU2A 3QTGA 4LGXA 3FNDA 4A3UA 3T2OA 1M7PA 4MY8A 4B3ZA 1CYGA 3NO5A 2X1IA 5LIUX 3THUA 1B3YA 4ZE5A 1LG1A 3UWQA 1D3CA 3W7QA 2XVGA 2DIEA 2YYUA 3OYZA 1I2RA 3M0HA 3WLOA 1TPEA 2GJRA 3ABSA 4PUUA 1HL9A 3VZZA 1V3JA 1XYFA 1J5TA 1GVYA 5LKYA 1XYMA 1E72M 1D2KA 3TCSA 2NQZA 4LTSA 1KGUA 2ON3A 1LOLA 2OWCA 2VCAA 3HPAA 3G77A 2XFRA 5G2WA 3ZJ7A 1JPHA 3AI0A 3B05A 4XIMA 4TX6A 2QJHA 1TVLA 4JQ3A 4GFSA 1V0NA 2Y62A 3N18A 1GOQA 3ARXA 3VIGA 1OZQA 4PB5A 4RDWA 3OA3A 3MZNA 3XINA 1LT7A 3WLRA 1VR6A 2A3EA 3E0LA 3S6TA 1RBOB 2RDUA 1X1NA 2XSAA 4A22A 3H2OA 3I7RA 2XH2A 2CLEA 3DBPA 1XJBA 1SGJA 1U5VA 1UZ1A 1DXFA 3ANVA 4CKQA 1DKWA 4GFIA 1UR2A 2X41A 1JDFA 3QC3A 3CO8A 2FVMA 3MKKA 2F6UA 4GQRA 1X1ZA 1W3KA 3QVQA 2V69A 2WJFA 4H9ZA 3HJEA 4PB4A 1JRBA 4IMFA 4IPJA 3VOHA 4BI7A 4AF0A 4ZB5A 4ZSTA 2PDUA 4E8CA 4PCNA 1AUSL 1O12A 2VZUA 1EF2A 2XPKA 2VGIA 1W8GA 2PTYA 4MY9A 3NVTA 1QPQA 1QWKA 4Q3MA 4YMZA 4QJ4B 2FFIA 4NX5A 3HFTA 3CPUA 4NZJA 3L66A 4IPNB 4XWUA 4H6QA 4E2BA 1PVNA 3UYCA 3BDKA 3GXTA 3HV8A 3S8HA 3H2EA 1W1PA 1F8IA 3EOSA 3QV7A 4EPKA 1XYLA 1HZYA 1QHOA 4ZQRA 3S2NA 5BW6A 3BGAA 1GJWA 3AIBA 5SWUA 4CU8A 1OX4B 4EPDC 3MHGA 5DMLA 4DWSD 5DT5A 1EA0A 1GEQA 3CGTA 1RAKA 1LF1A 4JGDA 1KM0A 3BGGA 1IGWA 3VD7A 1FBAA 3UXIA 4AWEA 3OIXA 4HNVA 1LL4A 1WDSA 3GBDA 2O55A 1OGGA 1T40A 1J12A 3CL6A 5I3IA 5D37A 1NQ6A 3QR1A 4D71A 1JRCA 3M5VA 3W74A 4FA3A 5JXQA 2OG9A 5BU6A 4JQAA 5TQLA 4PMRA 4DHGA 1ZL1A 1OEPA 8XIMA 1J0JA 5CGTA 1SO6A 2GQ8A 4CNUA 1FWJC 3L21A 4CLMA 5I3DA 2UZ9A 1UIPA 4OVXA 2XN1A 1E55A 3CLWA 3HFYA 3IUDA 1FTXA 2FH6A 4EP8C 3RITA 1E6SM 1WDQA 4HYRA 1HJUA 3AHYA 3URBA 3PFMA 2QCHA 3HTWA 3IJ7A 2W6RA 3ARRA 2HTMA 3AHVA 2WC4A 4AUBA 1UR9A 2Y85A 3BAJA 4BKNA 4RZ5A 1KQZA 3GNDA 1RPKA 1IGSA 1B1YA 5D9MA 1NDZA 4UFLA 1YLVA 3U48A 6ENLA 1U33A 1AH0A 4I9JA 5G2IA 4PEKA 3TYZA 4HHMA 5CGQA 1IXNA 2YCLB 3PY2A 1QDSA 2PTZA 4U5KA 2GGEA 1K4GA 3CHFA 3VX1A 3SQMA 1KD0A 4QDMA 3NPWA 4NHVA 4AWUA 3JW7A 3W72A 1NFPA 3G1XA 1OHLA 4FI4A 3QQWA 3UGRA 3IAQA 1Z41A 3VFLA 3IGUA 2A7PA 4KPLA 3MDUA 3QMSA 1MW2A 5A8MA 3NIYA 4GISA 3VILA 5I2UA 4QE4A 1E6PA 4GUHA 3ANUA 3G22A 2DUAA 4HK7A 3CTLA 4K68A 4I7WA 3SADA 1DTNA 3CXOA 3FLUA 3W6YA 3MP4A 3UWZA 5HQEA 3VIMA 1H49A 2ZOXA 3UG4A 2Z25A 4WOZA 1RUSA 4F2UA 3B8VA 3LBMA 1ALDA 3MHUA 5MKGB 3DC0A 4I9AA 4AD5A 2ODOA 2GGHA 4K8EA 4O15A 2FHBA 3VZXA 1FHVA 1Q7MA 1EGMA 5DLCA 3IVTA 1P0NA 1GG0A 3MV11 3TWAA 1DQUA 4I5UA 3MMDA 3VKBA 1S2TA 3TYBA 2HV5A 1QFEA 3QC0A 4JX4A 3KLKA 3VKJA 3B8SA 1UH3A 3LOTA 2O9OA 4UC5A 3CPGA 2VR2A 5FIPA 2BDQA 5HPCA 1DWFM 4BZYA 2WHMA 4DBEA 2AMXA 2Y89A 3NA8A 4PCSA 3SUUA 2LLEA 1OIMA 4DO5A 1NDWA 3TE9A 3RJXA 4S3FA 3DFYA 4QNWA 1POJA 4A8NA 1G67A 4DM2A 2XM1A 2YXGA 1TQJA 4NNBA 5FCZA 2BLEA 3EDDA 1CW2A 3HMJG 2A6NA 3GVGA 1A4LA 1EJRC 4XAGA 4MJ4A 1FWHC 4MWAC 2WANA 3G1RA 4RE2A 2PWDA 3F4DA 4PMUA 1GPFA 1SJDA 3SIZA 1BXBA 1QJWA 2ZUNA 4BA0A 4ERAA 3W26A 5DO8A 2W61A 1Q7QA 1KTCA 3REQB 4JCLA 1HKWA 3H2MA 4FX8A 2V81A 4I7VA 3VZYA 3W0KA 3HQNA 1DWHM 2FTWA 3NYZA 5I24A 3UGVA 3C0LA 1E1EA 2IMRA 2QVNA 1TV3A 2AAAA 2ISDA 2NV1A 3GFXA 2ABBA 3THAA 1UROA 1MRAA 3A4WA 2V3EA 4X0VA 1F3TA 1WDPA 4Y9MA 1HJXA 5I77A 1HVXA 3PJUA 1THFD 4ZXOA 1UZ4A 1AZ2A 3CH9A 4MTVA 3DKLA 5AY7A 3R10A 1RJRA 4DJEA 2FKPA 3KAOA 4MJZA 3QZAA 3LXAA 3C2RA 3P93A 1X6UA 5EPDA 5LNSA 1AW1A 4KWWA 1HUVA 2WYSA 1DL3A 1O68A 1BYAA 3B97A 4O1BA 3NGFA 3S1XA 4PUDA 4GY0A 1FKXA 1V6WA 2X1TA 2J7EA 3VUSA 1P0DA 3BMWA 4S38A 2E6AA 3M1ZA 5F2IA 3WF4A 3MUXA 4XKMA 3DYPA 1ME7A 3U2OA 4AXKA 4DZ5A 2FYMA 2BVTA 3GH5A 5HK4A 5D38A 1HKMA 1PKMA 4DF2A 3RILA 4KETA 1Z3NA 4OUIA 2DIJA 1ONXA 3N6JA 4C5YA 3RU8X 2E1WA 4J3WA 4XIAA 3PAJA 1OX4A 4L4MA 4O0KA 4PB3A 5GNYA 1SZEA 1ZQ5A 2PDLA 2FZMA 2H8ZA 2NV2A 2O7QA 4LEFA 2CFFA 2DT2A 4JIQA 1SO3A 1K3UA 3MS8A 5AZ0A 3LSCA 1FH9A 3T44A 2AOSA 2DZVA 4D6IA 4NSBA 9CGTA 4Q8PA 1KW1A 1IHIA 5K7JA 2NXGA 2WJDA 3KS5A 4JFWA 4WGHA 2DP3A 2VD8A 2I7GA 2E1DA 3T0CA 1ISZA 1XSIA 1ZJBA 2ISSA 1K7FA 4L56A 1Y8BA 1CECA 4AU0A 1LLWA 1EC8A 1EUAA 1BF6A 4I6VA 2V5DA 3PG8A 6TAAA 3AXIA 3HGSA 2DT0A 1OFEA 3CUGA 3I3BA 4P7LA 3NPVA 4BQ3A 3A5VA 1M7JA 4CD6A 1AZ1A 5CLTA 3W7CA 4EOUA 2VFIA 3R0UA 4S3AA 5FF0A 4LBSA 2VL4A 2G4JA 2H8XA 3LHTA 1M03A 2E28A 4LUTB 3AIUA 4HT3A 2WLYA 1RY8A 5EMLA 1KBIA 1WO2A 3RM8A 1J0KA 4NZ3A 1GHRA 2YB4A 2YJQA 4NT0A 1XCFA 3ARVA 4Q4MA 2QUMA 1R3VA 4IIEA 2YCLA 2V6AA 3TTQA 2P50A 1DQXA 3LNMA 1H3GA 3NDOA 2PCQA 3JS3A 4IXXA 3HG2A 4UQAA 2QCGA 3P8IA 1EGZA 2YDRA 2Y63A 2ZX9A 4PL1A 1AQHA 2Z6IA 3WH5A 3B0VC 2QJNA 1B57A 2BOEX 3FJNA 5EL1A 4Z42C 1YNQA 3BICA 4L1XA 4EF9A 4L7ZA 1UR0A 3FA3A 3L2LA 5EMYA 1X97A 4ZTYA 4Y9PA 2PDGA 3N2XA 3G3DA 1EJ7L 4AMAA 5E70A 4IQEA 2ZUVA 3C6CA 3C8FA 3W37A 3UWVA 4QEHA 4NY2A 3E0IA 4L65A 4W8LA 1E9LA 4X2PA 1TWSA 4E38A 4HOWA 3L4TA 1W9XA 2GQ9A 5CEWA 4OKDA 1I0DA 5FOOA 1S5TA 2REQB 3LXCA 4JFVA 5ABGA 4CD5A 3M44A 1KRMA 4FNQA 5HPOA 4ILSA 3POHA 4AD2A 5C9XA 3GR7A 5D8ZA 3TYCA 1BYCA 3GXFA 1OGBA 2J6XA 5A8PA 4L9ZA 4FK9A 4AEOA 3WLTA 3CLMA 3SUSA 4QE5A 4O13A 3R0DA 5A6MA 4CCCA 2A3LA 6A3HA 3TMLA 2WVSA 5TBOA 1NWTA 3PBVA 3NDYA 2QIIA 1F3EA 4H1ZA 4JAWA 1EFZA 2PLMA 2YBTA 3ZM8A 4Q8QA 4GO9A 1G01A 3CIWA 3ITXA 1BD0A 5DBUA 2HPMA 3LHVA 1UUOA 3RR4A 2GQAA 1J96A 3QKZA 4IMDA 3GM8A 2B7NA 4B2DA 3R5EA 2BGNE 3EOUA 4FOUA 1FUYA 4FMVA 3NQ6A 3PBGA 3S2CA 3VNZA 3S6DA 3OB8A 2I57A 4NXKA 4C6MA 3S1VA 4R7WA 3W70A 4DZAA 1HKJA 2J75A 4NZCA 3FEQA 1PX8A 4Y9NA 3RPMA 3LTSA 3L7RA 1XYCA 1XL9A 5LNWA 1RR2A 1KXHA 4BWLC 2ISVA 4K7YA 3O15A 4MNLA 4GYFA 1OCBA 2OZ0A 3GKFA 4MOZA 4LU0A 3C61A 5EMJA 1CXIA 1DJGA 1Z6KA 3I65A 3G8RA 2YBVA 3O1NA 1B5TA 4Y6GA 1CNVA 1XG3A 3UCQA 1PDYA 1H1ZA 1ZP3A 3PBMA 2NVDA 4C6KA 3AZTA 2NVAA 1T0OA 2BY3A 3WEZA 4O8RA 3I6EA 4A8IA 4PUNA 3ANYA 4LY4A 1T99A 2PDIA 1RH9A 4C7FA 1O1HA 4UQBA 1BF2A 3EWXA 1A5NC 3MU7A 2HPIA 3LU2A 3AIRA 1XLBA 3WD4A 3UESA 3MUZ1 1K7EA 3POCA 4UCFA 1VBHA 4J7RA 4FSAA 3NOYA 4US6A 4HK5A 1DP0A 4E3VA 1E70M 3KOYA 3PTKA 1EGVA 3RO6A 2OWXA 1XFCA 2ZXAA 3L5MA 4LY8A 3IEBA 1W9DM 4IQJA 1XISA