1EP2A

Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
309
structure length
305
Chain Sequence
ENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAANVKAIELNISCPNGQAFGTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
publication title Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 93
structure length 305
sequence length 309
ec nomenclature ec 1.3.1.14: Dihydroorotate dehydrogenase (NAD(+)).
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ep2A00
3UNDA 5KSWA 5C55A 1KTNA 3KVMA 3HGSA 3C56A 1TCDA 3ATYA 4CCDA 2WNQA 4QAIA 2Z1BA 4P2VA 3ATZA 4DO4A 4K37A 1KFJA 1KTBA 3RNDA 4ORIA 4BI6A 1R47A 2J6XA 3EWZA 4IMDA 1OFBA 2BTMA 3TE9A 4L4LA 3W23A 3TQVA 4OWGA 1EUNA 3EWUA 1A50A 2EHHA 3NOEA 4KFPA 1KM3A 5EL1A 3OHIA 1H51A 3BVJA 3QC3A 3W7DA 3R8RA 1KFLA 3H54A 4MY1A 1EP2A 5AHFA 3L0NA 1T0OA 2YSWA 3C0JA 3E49A 4EOUA 3UQNA 1H5YA 4OV4A 1IF2A 4XUGA 1LYXA 2P10A 3BV4A 1JQXA 3WFAA 1NF0A 2YX0A 4TMCA 4N9CA 3MMTA 1KTCA 3PUEA 1QOQA 3LDVA 4MFEA 1W5OA 1OX4B 1FDYA 3W1LA 1MXSA 3NL6A 1K8ZA 1RVGA 1C8VA 3SR7A 3TMQA 6TIMA 2VKZG 1B4KA 4QITA 1YPFA 1WYIA 5BMWA 3I7SA 3IV3A 1GYLA 3SJ3A 1K7EA 1TB3A 2A6LA 1T99A 5L6UA 2BXVA 4FNSA 3MI2A 3QQ0A 3PBYA 4WUIA 2FPVA 1TTQA 1FX6A 2TPSA 4R33A 2E1DA 5HQEA 3FS2A 3TKFA 2YFOA 3GAYA 1SO3A 1X7FA 3EX1A 1OFQA 3BW3A 3W86A 2ZZ3A 1T96A 4UTHA 2FB2A 3YPIA 1ZY9A 4LVBA 3UWVA 3EWXA 2WV8A 1PS9A 3M7WA 1EUAA 3HG4A 2QUVA 4IMGA 1I2QA 2VENA 3BO9A 3LXBA 1WA3A 4HNNA 3LRMA 1WBHA 4O53A 2CLMA 2DORA 1TPVA 3GIYA 2QCNA 2YFNA 4UMCA 2Z2UA 3QYQA 1IIHA 5F2MA 3B06A 3M9YA 4XQ6A 4XKYA 2Y7DA 1L6YA 3VCRA 3VNDA 4IXHA 3PG8A 3QRHA 4WXZA 1OFDA 3DENA 4BI5A 1H7PA 4FF7A 3G18A 1ZFJA 5C2XA 3I7RA 4A21A 3HPZA 4WOQA 2CLIA 5BRBA 1KFCA 3DKJA 3PUOA 3KHJA 3I68A 1M7OA 2CFFA 1K3UA 4JX5A 2E77A 1LTDA 3W07A 4NX0A 4WX2A 5DXYA 2E6FA 3UPBA 2X1SA 2IQTA 1GOXA 3HIJA 3TR2A 2CLHA 4Z1BA 4OQVA 1ZJIA 1VYPX 2W79A 3LERA 3A24A 3EWBX 3LB0A 1JCXA 3LX9A 3VE9A 4ZQMA 2C14A 2H8XA 4XWUA 3PG9A 1WDWA 1DVJA 4K8EA 4LVDA 3O06A 5AC6A 1O94A 1EWEA 1ZAHA 3W2LA 1AK5A 4CLMA 3EEGA 5AHIA 3O16A 3OVRA 4C1KA 3E9AA 3DXIA 5G2IA 5C5YA 5FEZA 2VFIA 1L6SA 3SZ8A 3W2MA 3QPYA 3BPWA 4DF1A 2ZA2A 1CI1A 3MBFA 4FNTA 1V7YA 3U6WA 1F6KA 1VPXA 1A5BA 1M5WA 3L5AA 3M5VA 2WNNA 3CEPA 3KRSA 2ZFAA 1SPQA 1D3HA 2NUYA 5FF3A 1CX9A 1KBIA 3W72A 1FCUA 2YYTA 5K4XA 3W2JA 1JRBA 1J5TA 2J9XA 2VFFA 2PRLA 1AW5A 1OVDA 1KFBA 2NXGA 2H8ZA 4O13A 4S2BA 1XUUA 2FJKA 3NXFA 3R5EA 4IPIA 2BSLA 2XN1A 2Y7EA 2R94A 5I3KA 3D0CA 1O60A 3O6YX 4WD0A 3H53A 5I3FA 4JTUA 4CNOA 3TXZA 3MYOA 1XDLA 1Z44A 4JYDA 3CHVA 1F7BA 1SR9A 3G8EA 2YDAA 4FEZA 2V0TA 5LKYA 3GB6A 3FIGA 2FIQA 2DZPA 2WSQA 3STGA 5SWUA 3V1PA 1TYGA 3KXQA 4K6AA 2PURA 1QPQA 1TV7A 3B03A 4RXGA 1H1YA 4DBEA 3GXPA 5HWMA 1SUXA 4AB4A 3B0PA 3W88A 1DJNA 2ZZ4A 2E6DA 3GDKA 3C6CA 3STCA 4IMEA 2EGZA 1JCNA 1G6CA 2E5BA 3DAQA 1HTIA 1OFOA 3NQGA 3P5YA 5FEWA 5D2YA 4MVAA 2RHGA 3WK3A 5EMUA 3L0GA 2E5CA 3A9IA 4UTIA 5D37A 3M5XA 3MBDA 2J27A 2C3ZA 4QIUA 3QSRA 5BMXA 3DBPA 3WK2A 3DFPA 1KM5A 5KINA 1QPNA 1X1ZA 2NUWA 4K7VA 4K8HA 2DJLA 1OHLA 5FF0A 2QCMA 4WJEA 1X8FA 4AHOA 1OFEA 2X1TA 1MZHA 4JDBA 2A7PA 3PUDA 3S0CA 4GUJA 5EY5A 4UTTC 2JKEA 4MLJA 3DFOA 3I6RA 2C15A 3T55A 5D30A 3NAVA 5G2HA 2NV1A 3SSJA 3T7VA 3DHDA 3M43A 2V5LA 5AHMA 5K7JA 1TV8A 3EXSA 1H7RA 5K9CA 5F2GA 1XC4A 3A21A 2YW4A 4FX6M 1FWTA 4QISA 5EBUA 3HO8A 1JUBA 3G1DA 3OVPA 4HNUA 2RH9A 3QEZA 4O54A 1MEHA 5DCEA 1BTMA 4A22A 1YTKA 5AHNA 4O12A 3PSWA 1VLWA 2I1OA 2G97A 4NXSA 1FQ0A 3E96A 1X6UA 1HG3A 2QCDA 4DO6A 3Q2DA 1U83A 3SI9A 1TPUA 2E68A 4TR9A 3P82A 3TJXA 1EEPA 3W1MA 1I2NA 1G7UA 2ZRXA 1KM4A 1OJXA 3QZEA 4JGDA 1XDMA 2ZZ1A 2A5HA 5TQLA 5I3JA 4JY9A 3LHZA 2CLOA 3PB2A 4GUHA 2EKCA 4UR7A 2E6YA 4ICNA 5D05A 3R13A 3ANYA 3VI2A 5CGQA 5BNKA 4RZ6A 4NX5A 5CPNA 2HSAA 2QCCA 4UCGA 4UFHA 4ZL1A 1LORA 4E0CA 3NEVA 1O5KA 3LOTA 2ZYFA 3KVLA 3LHUA 3UWZA 3IGXA 3MHUA 3LBCA 3IIZA 5HWJA 3INPA 3M47A 5DY2A 5CPOA 3W7PA 4LUJA 4QNWA 1Z41A 5FF2A 2GVLA 2DZVA 5F4SA 1G4TA 2O7QA 2QAPA 1KV5A 1LBFA 1SFJA 1OX4A 3HQ1A 4PCFA 1Z48A 3NQ2A 3M16A 3W7CA 4AXKA 1GWJA 3SECA 1KBJA 1XXXA 5LGZA 1TV5A 5G1YA 1FY6A 2R91A 3G24A 4JIQA 4JTLA 3LHTA 4ZQRA 3MUXA 3IGSA 5LNSA 2WNZA 4Z0JA 1HO1A 3UWUA 4DF0A 4PODA 3DU0A 1T8XA 3EX4A 3ZR4A 2CLKA 5I3HA 4FXSA 1WOBA 3QSTA 1VHNA 3PBWA 3IIVA 1TRIA 4LU0A 3B4UA 4O15A 4UNLA 3W7HA 4HT3A 3HG5A 5D33A 2DZXA 5D09A 4AAJA 4EIVA 3KVJA 3M5YA 4JNMA 2QCHA 5CKSA 2VELA 4JX6A 3L9CA 3WK1A 1RD5A 2X1RA 2J88A 4ORMA 3C2VA 4MPQA 3C4UA 3NYZA 3WJWA 5LNRA 2O7SA 4J9JA 4OV9A 3QPZA 5ABTA 3HJZA 1F74A 1G4PA 1D3GA 1QDSA 2QDHA 4JTEA 3PAJA 1O95A 1AW2A 1QWGA 3L5LA 3S1WA 4BK9A 4JYEA 4FX7A 5F2IA 1LP6A 3O8AA 3NDOA 3G1YA 1K8XA 1SW0A 1B3OA 1MSSA 1H7NA 3UXAA 2XN2A 1TPFA 3TQ0A 1OF6A 1SZNA 3EWWA 4UC5A 1H63A 1S3HA 4MJMA 4YCOA 4DBDA 1K7XA 4R53A 4WOZA 2J9ZA 3W74A 4IOTA 4LRSA 4UFIA 4ADTA 3G8RA 3UXDA 4NZFA 3CIXA 3TUUA 3N9SA 3BLIA 4A2RA 2Y62A 2BLEA 4LY8A 3W7JA 1TTPA 3MP4A 3HGRA 3MHGA 3EKLA 2ZBTA 1DOSA 3P61A 4IX0A 4BR1A 3FOKA 1TJPA 5AN7A 1RQEA 3HGJA 4JICA 4QSHA 1VC4A 2D73A 2ZTKA 1MEIA 3QMTA 1GT8A 1DKWA 1LLZA 4NJGA 4BFAA 1UBSA 1VZWA 1W3IA 3UWYA 4DQWA 3WJSA 1KFEA 3P81A 3OVQA 4MY9A 5H91A 3NO5A 3W22A 3B8DA 3PBVA 3HPSA 3TNOA 2RFGA 3KAOA 4I7WA 2Y88A 4O4VA 2VEPA 2FTPA 2ZRWA 1W37A 3OEXA 4GBUA 5AHLA 1QFEA 1VCFA 3LGEA 4AWTA 3Q37A 5HUPA 5CPLA 2CZEA 4JIPA 1MEWA 2FB3A 3PS7A 2J9YA 1OK4A 4L4MA 4IPJA 1OG0A 5J5DA 4O0ZA 1K7FA 1LCOA 3T78A 1RV8A 1BKSA 2OZ0A 2VOMA 2YZRA 3S1VA 2G95A 1R2RA 4TO8A 1LZOA 5K2ZA 4UTWC 4LRTA 3HB9A 5I3GA 1KM1A 3QFEA 3W1XA 5U4NA 2FDSA 1OK6A 2Y7GA 4A2SA 4DXVA 5FEXA 3L67A 2QR6A 1TPH1 5U7SA 3PF3A 4XBKA 5K9XA 4PL1A 1OX5A 2B4GA 4M6PA 1AG1O 1FCVA 1XFBA 4ZZ9A 2VEIA 1LDCA 1QO2A 2V2DA 5DBUA 3STEA 2OJPA 3NQCA 2Q3OA 2NWSA 4YCPA 3A22A 1XBYA 1IGSA 2P0OA 4IJBA 1QCWA 1SO6A 3LTYA 1LBLA 1HL2A 5IBXC 2GQAA 1ICSA 1Q6QA 1SSDA 1OF8A 3O6DA 4PA8A 5C54A 4IMFA 2B7OA 1NEYA 3M44A 1PV8A 5I3IA 5D02A 4O14A 2KZHA 1N7KA 2ISSA 4KWVA 1G69A 1TPC1 1GVOA 4EF8A 3NPXA 4O1BA 2EF9A 3QM3A 1I45A 4WZHA 2Q8LA 3O1NA 4AMAA 2Y89A 1N55A 2NX9A 4RKAA 4GE8A 2C0AA 3TW6A 1TREA 1OYAA 1SZEA 3DZ1A 2QCGA 4TMBA 1LOSA 4MUZA 1TTJA 4UFKA 3AJXA 3MP3A 5T26A 4WY0B 2B7NA 1BWLA 3IIPA 1GVQA 3IVTA 3CTLA 3L5MA 1TIMA 3R89A 3KVKA 3TJLA 3O05A 3ABRA 1WBJA 2WKJA 1W3NA 3SGZA 1YXYA 3LCGA 1YXDA 4JS3A 4KWWA 3R12A 3PULA 4UTTA 3P5ZA 2V2CA 2WSRA 1OYCA 3PWAA 4K36A 3W9ZA 1F05A 3LHVA 1TJRA 2RDTA 3UD6A 1GPWA 4O8RA 1LOLA 3C2RA 3G1HA 2QCLA 3VE7A 1I4NA 3S9YA 4HSNA 5AFDA 1NVMA 4M5PA 1OX6A 1JJKA 3C3NA 1JQVA 3OG3A 5D2VA 5CZTA 1RR2A 1KLZA 3PB0A 3PC0A 4LV4A 1JULA 1YYAA 5CG7A 1RZMA 4N4QA 2GOUA 4GXMA 4FO4A 1SO5A 5LZLA 1VR6A 3FLUA 3G1FA 2QDGA 3F03K 4O1DA 3HGOA 3OIXA 1W5NA 3BK0A 1GVSA 3GNDA 1P0NA 4NU7A 1C9DA 4K7YA 1ICPA 2TSYA 3HOJA 5D2WA 3W1AA 3VKJA 1TQXA 2C16A 2Y6ZA 5KZEA 3NA8A 3L68A 3IVUA 3TDFA 3S5YA 2R8WA 5AYYA 1SSGA 2NZLA 1SU5A 2YCEA 1FCQA 1ZALA 4G1KA 2RDWA 1VCGA 2Q8ZA 1H50A 1W54A 4FXRA 4NNCA 4Y9AA 3P62A 5AHEA 3BW4A 5AYZA 3UY8A 1Q6LA 4JX4A 3TSMA 1W3TA 3DI0A 3NQ7A 4PEKA 3W7IA 5FESA 1HFBA 4POCA 4WXYA 3GLCA 4QJ1A 1IXPA 3I7QA 1DL3A 3K30A 4LV9A 5D38A 3WK0A 4E38A 4CQ8A 3RF9A 3TROA 4M7SA 5KITA 2RKXA 2V82A 3W7KA 1IXNA 3NM1A 1QPRA 3W6YA 1PCKA 1XCFA 1LROA 1NSJA 3W71A 5AC8A 3TX9A 2VFGA 1XM3A 4UUIA 4LVFA 2X1UA 1H60A 3S5ZA 1VCVA 1H7WA 4UTLA 2HMCA 1LLWA 1JCJA 3W83A 4A3UA 4BWLC 1OFPA 4JTFA 4S2CA 1EIXA 1ZAIA 3CEUA 1EPXA 1Q6RA 3LRLA 3G1VA 3KFTA 4B5NA 1OFRA 3CIWA 3W7GA 3N2MA 5LNUA 1KFKA 3GXTA 3OA3A 1LM1A 2QJHA 5F4WA 5A5WA 3NZRA 5AB3A 3C8FA 4AF0B 3LTPA 2I14A 2JGYA 4TIMA 3G0UA 3T40A 4ALDA 2QKFA 1PHWA 1FUYA 4LOCA 3PVFA 3WJXA 3GR7A 1UASA 3O6CA 3TV8A 2RDUA 5FF7A 1GJPA 4YMZA 5A8GA 2CLFA 4RK8A 1KM6A 3GDRA 3S1UA 1DHPA 2E6AA 3KOFA 2BWGA 4YXGA 3MW7A 4K39A 3TC6A 2WO5A 4K38A 1ZENA 4JY8A 4PC8A 3W1PA 4UMAA 3GNNA 1F6PA 3O15A 1UJPA 4QNEA 1LRNA 1FXPA 3ZS4A 3H55A 4FX8A 5DELA 1W5PA 2GQ9A 3HG3A 3CC1A 2NUXA 3NQVA 4KFOA 4N4PA 1H7OA 3W7LA 2XN0A 5E0KA 3F4NA 4IMCA 2V8ZA 3UPWA 1FDZA 4IGHA 2GJLA 3SW6A 1JCYA 3C2EA 1Y0EA 2GVGA 1O5XA 5KZDA 4LS2A 3GAKA 3MWAA 4ONVA 4FNQA 3TK7A 3TQKA 2ISWA 4M6VA 2HS8A 3EXRA 1OFAA 4NUWA 1YTEA 2UV8G 3QMRA 3LXCA 3IVSA 4UIOA 1P5BA 4X9SA 4PH6A 3W2NA 3NL5A 4MIMA 3W7OA 2ISVA 3ZWTA 2BZNA 3S5OA 3RK8A 5MHBA 1YLVA 3NPUA 5HNRA 2ZRYA 4PFMA 3LCLA 5CZ0A 2CWNA 4ZQPA 1K8YA 2QCEA 3N19B 1B4EA 4ADSA 2OT0A 1IXOA 1RPXA 2ZRVA 3S1XA 1FWRA 3TAKA 1A53A 4Z1DA 1G4SA 1H1ZA 2ZZ6A 1S5VA 3HPXA 1QO5A 1K02A 4HN4A 3NQ6A 4GUIA 4O1CA 3P7YA 2ZCGA 3I65A 1HUVA 1VRDA 2A7RA 4HNTA 1W31A 4X3ZA 3G3DA 1GG1A 1TSIA 3RFAA 1F76A 3W7RA 2B0MA 3LI0A 3JR2A 3MI6A 1C29A 2VXNA 3N14A 4RZ4A 5KTLA 1W5MA 2A21A 3TFXA 4I9AA 4UXDA 5AC7A 5KZMA 2ZQ0A 6ALDA 2Z0IA 3JRKA 2NV2A 3CWOX 4O57A 3W3OA 4RX0A 2DZWA 3NQMA 3M5ZA 4UTWA 3Q94A 3V75A 3LI1A 3W1QA 1Q6OA 3DFNA 4JYFA 3R2GA 4NJKA 1HO4A 2DZTA 3IEBA 1SQ7A 3CM4A 3ZFHA 5HR7A 4MYXA 1B57A 1LBMA 5L9FA 1THFD 4ZVJA 3EKZA 3QW3A 3LHWA 3E02A 1EP3A 4LTSA 2ATMA 3TIMA 3GDMA 2V81A 3T44A 4JTKA 3O07A 2OCZA 4CNNA 3P67A 3U2OA 3TFCA 4TU1A 3LCXA 2JKPA 2WSYA 2JBMA 2AAMA 1MO0A 5D2XA 2VFHA 2XFWA 4LUIA 4DPPA 4LVAA 4XZ9A 4PTNA 1WXJA 1SW3A 3W84A 3DFSA 3EXTA 1FXQA 4Y96A 4MOZA 1NAL1 1UUMA 3S5NA 5BOOA 4X2RA 2NXHA 3ABQA 2YR1A 4Y6GA 1P0KA 1I2OA 3ABSA 4RV8A 1AL8A 1M7PA 3G0SA 1JCLA 1EWDA 3BG3A 3E12A 3UZJA 3LCWA 5LNVA 4W9TA 4LWWA 3G22A 1QAPA 3NQFA 3DKLA 3TAOA 1VS1A 1F2JA 2VFEA 2A2IA 4N9EA 1G67A 4OBTA 3F4WA 3BG9A 1TPDA 1M6JA 1J2WA 5CSSA 5K4ZA 3NQAA 2ZA1A 3BLEA 3P8JA 1KLYA 4WY0A 2JGQA 3ABOA 3LBMA 2C1HA 5DY3A 2V5BA 4QM1A 2OX1A 3EX6A 3P80A 4CNPA 5E93A 3W70A 3VFLA 3S6DA 3CLMA 4NJHA 3UWWA 3WJYA 1ZAJA 1QMLA 2JK2A 2Z6JA 3P8IA 2DP3A 3TH6A 3C52A 3DHFA 3G0XA 2ATSA 4MZ8A 2QF7A 2Y63A 3G1SA 3W2UA 1XBZA 2V2HA 2NWRA 3NL3A 3RU6A 2OT1A 2F7FA 4LNYA 4O50A 3EB2A 1LOQA 3W73A 5CSRA 2E5DA 2GJNA 3BARA 1I2PA 2F84A 2A0NA 2GUUA 3BGJA 5DN1A 1PCWA 1FWNA 4O1AA 5HMSA 1R2SA 3DGRA 3P84A 1KW1A 1RQHA 3QH2A 3IIOA 5LNWA 1S5TA 1AW1A 2GPTA 4O19A 1ML1A 3NM3A 2C18A 2ZZ7A 1TPB1 3M0ZA 4E2DA 3KRZA 3MYPA 4M6QA 5BW6A 1WAUA 2A85A 1TQJA 4WY0F 4U28A 2DJXA 2AGKA 2QJIA 4YLWA 4JXCA 3L21A 1G4EA 3GDTA 3KRUA 4O28A 2CLEA 2Y70A 1TTIA 1W5QA 5G4EA 3TSBA 3FYOA 1GTEA 3NQEA 1VH7A 4YWIA 3N2XA 4N6FA 1FCBA 3S8HA 5AYXA 5IM51 1YADA 3NZ1A 4O52A 1EP1A 3N73A 4H4IA 4JTIA 3BG5A 2OMAA 4HPXA 3C2FA 3GKAA 3W75A 3W1UA 4JTGA 5K3VA 1F5ZA 1SZFA 3B0VC 2CZ5A 2PE4A 4FNUA 4RZ5A 3PR2A 1F73A 1AMKA 2FQIA 4AEOA 3MHFA 2WJZA 1UUOA 3FA5A 5DXXA 3LCFA 2CU0A 3F1QA 1N8FA 1W8SA 1JVNA 1X1OA 5J5RA 3LV5A 3A5FA 4GNJA 4I7UA 5HUOA 1U5JA 3MI3A 2NLIA 1GEQA 4JTTA 4LC6A 1ME7A 4O0KA 3GXNA 3NQDA 1JR1A 4BWLA 1WOAA 5D2TA 4AHPA 3B05A 3EX2A 2QAFA 3PSVA 2HTMA 4GFSA 3SFKA 4ZQOA 4CQAA 5TIMA 4CCCA 1UB3A 1YDOA 2YGYA 1DJQA 2ABBA 2X30A 5FI8A 2W0UA 1R2TA 1GG0A 4AF0A 3DFQA 4DPQA 3ELFA 2QCFA 3M6YA 4N2YA 4DF2A 4OE7A 5LGXA 4UFJA 2ZZ5A 4ZQCA 2WPBA 4IUOA 4AH7A 4NNAA 4LW7A 1GTHA 5CZSA 1NFBA 5D32A 1A5AA 1VJIA 2H3BA 2G96A 1TRDA 5F1UA 1DQXA 4CCEA 3TW7A 1I2RA 4UTUA 1VLIA 2EAWA 1Q3NA 3A5VA 4U4MA 2V9DA 4Z08A 4NJJA 3DI1A 3PBUA 1W0MA 3RLVA 2NX1A 4UFLA 3SGUA 4RJEA 1SW7A 1QNVA 4BF9A 3STFA 2YPIA 3N3MA 1JRCA 3HBLA 4YL2A 1XI3A 3FKRA 3NR0A 1ONRA 3BW2A 3CT7A 3W85A 1Z42A 3FEMA 4Q4KA 3G1AA 4Y8FA 2J24A 3NG3A 3DFTA 3NQ8A 5DLCA 1R46A 3MJYA 2C13A 1VYRA 2Y61A 4GWEA 4MJZA 2X16A 2ALDA 3W2KA 1W1ZA 3LHYA 3QF0A 1UCWA 4O18A 5K9DA 1SO4A 4FNPA 5GVJA 1YTDA 2Z6IA 3UY7A 1ME9A 4OU1A 4RLIA 4MZYA 2YW3A 3GDLA 4RR4A 5G1TA 2R14A 1PVNA 1VGAA 1VHCA 3QW4B 4HKPA 2A7NA 3B0UX 1GVRA 5HWNA 4O16A 4UNKA 4GJ1A 5CPMA 1I8JA 1TPWA 2WQPA 2C19A 3PM6A 2QEZA 3FKKA 2EPHA 1W56A 2TMDA 4UMBA 1QPOA 5F2LA 2PC4A 3TMLA 2Y85A 4FIRA 4OGZA 5F4XA 2FPTA 3W1NA 2FFCA 5EYWA 4NNBA 3W7MA 2PRMA 2NXIA 2Q3RA 1XKYA 2VEMA 5KMYA 1GVFA 4CQ9A 3TU9A 7TIMA 1L2UA 4NXKA 3PY2A 4I7VA 1ZNNA 4JD4A 2E09A 4GUGA 5TBOA 2DU2A 5AOUA 4Q33A 4N6EA 2V30A 2HS6A 4UFMA 4MFDA 3TA6A 2GQ8A 4BI7A 2VEKA 3E0IA 1FBAA 3UWQA 4EWND 1Q45A 3HF3A 5HR6A 3EX3A 3LM7A 4UTJA 1SZGA 1ADOA 2BX7A 4LVGA 4X22A 1ZCOA 3IRDA 1FWWA 3LCIA 1H7XA 2AQWA 2G5WA 1EB3A 4IQLA 3CQ0A 4DEFA 2PRHA 3M41A 8TIMA 1LRQA 5LHFA 5DBTA 2H3DA 4WQ6A 1EA0A 1K03A 4XKYB 1KV8A 4FHAA 1PL9A 1JUKA 3LLDA 1SFLA 1H62A 4JTSA 4DO5A 4IX2A 3W1TA 3GYEA 5D04C 3RMJA 1VYSX 3CB8A 2VC6A 1XBXA 4N9DA 1FDJA 2I9EA 3LTSA 4NVTA 3TSDA 1D9EA 4XBSA 4AVFA 2YXGA 3G1XA 3FJ6A 3T4CA 1OYBA 3BLFA 3L0KA 1BWKA 4ZQNA 2CZFA 1A5SA 3SY5A 1KM0A 2QUUA 2DZSA 1DV7A 4NJIA 1DBTA 5G5IA 1PIIA 5HINA 3KX6A 4LS0A 4Q32A 1TMHA 4MYAA 1YPIA 1WV2A 2H90A 4HNVA 3MP5A 4ML9A 3A23A 4A29A 1A5CA 4Z0SA 3IIXA 1YDNA 2ZZ2A 4M19A 2H6RA 3UZ5A 2YYUA 3W87A 1H61A 1L9WA 3ZWSA 3NPWA 1QR7A 4MKNA 4AWUA 4PL2A 1WQ5A 2ZRUA 3N9RA 5FF4A 2ABAA 5EPDA 4C1LA 3GKFA 5EA9A 1VQTA 4JDYA 3NL2A 1L6WA 4JTJA 3W7QA 2Y7FA 4UTMA 1NF7A 2A1YA 3OBKA 3P60A 1R30A 3EWYA 4XTDA 4LT9A 4RCXA 1PE1A 2TYSA 1EX5A 3N34A 4MLRA 5EKYA 3GVGA 2ZDRA 3NNTA 3Q58A 4OHQA 1DORA 1P4CA 2A6NA 3GZ3A 4P61A 1KA9F 2CZDA 4EF9A 3WJZA 4Z1AA 1YDVA 2GVJA 4QQ3A 4TX9A 3NVTA 4O4WA 1XL9A 3CPRA 3CWNA 4GRSA 3B04A 5G4WA 1IIGA 4HHPA 4AWSA 3UYCA 1OABA 5CZJA 1FWSA 4FIQA 1J4EA 5H2ZA 3S42A 2B7PA 5FEPA 3LXAA 4IXXA 4XTIA 1KM2A 4FNRA 4MY8A 1DQWA 3G3MA 3LCHA 4ADUA 4O10A 4UTKA 2CW6A 1ICQA 3FYPA 3TC7A 2TRSA 3BGGA 4KFNA 2ZRZA 3U8GA 3L65A 1ZHAA 3C2OA 4R7JA 3P74A 2VFDA 5D03A 2QJGA 1ME8A 4JTHA 3O63A 3C61A 3LLFA 4HSOA 2NX3A 2FLIA 5LHEA 5HULA 2LLEA 4FB7A 4O17A 3THQA 4E2BA 5G2WA 1JCMP 3QMSA 4N9BA 1WX0A 1GQNA 2ZA3A 1V5XA 4O11A 3L66A 3M1ZA 3NGJA 1GZGA 2P1FA 4R34A 2QUTA 2PCQA 1BEUA 4DELA 2CLLA 5C6MA 3FFSA 1QOPA 3W76A 3JS3A 3LRKA 4NZJA 3AO0A 4KKXA 3TXVA 3THAA 1GYNA 1RQBA 4M7TA 4ZMGA 3IGUA 5DCDA 1YXCA 4D2JA 1ALDA 4JEQA 1B9BA 1XBVA 5IBXA 1LRTA 1O4UA 4JR5A 1TPEA 2DZUA 2X2GA 3W7EA 5F1VA 2A4AA 4GUFA 2W6RA 4JN6A 4HPJA 2B7QA 4Y90A 3LV6A 4GC4A 3GX9A 4UR8A 1E51A 4N02A 5DCBA 1PHQA 1IXQA 2WOQA 3FJLA 5HJLA 4NQ1A 3USBA 4IWWA 4S1FA 3GK0A 3L2IA 3MO7A 3CU2A 1AL7A 1S5WA 3TCEA 2FPYA 5LSMA 3DH7A 4H3DA 3SIZA 4AHQA 4RXFA 1CW2A 4NT0A 3QJAA 4H6KA 1P1XA 1XUZA 4MZ1A 4OT7A 2ZTJA 3QQ1A 3GR8A 1JUEA 3W1RA 5E1QA 4HIBA 4LS1A 3RLUA 4EVZA 1G7VA 3W7NA 3NPVA 2QCDB 4Z1CA 1TO3A 2C6QA 4LC8A 2JKAA 3HG2A 3HMJG
chains in the Genus database with same CATH superfamily
3UNDA 5A2BA 1FWBC 3KVMA 4KCTA 1VJSA 1TCDA 4DZ5A 4W84A 3GH5A 1VFHA 2W66A 3AHZA 3DX5A 3ATZA 4DO4A 1CZ1A 1KTBA 3RNDA 2BP1A 4ORIA 1R47A 3RRAA 4D72A 2JIEA 3EWZA 4QLKA 3REQB 4DZAA 2VT0A 1E3ZA 1Q4WA 4UTFA 4OWGA 4KFPA 5EL1A 2W62A 3FVDA 2DV0A 3W7DA 4HOWA 1S5MA 3WO8A 2GVYA 4XUGA 1LYXA 3BV4A 3VIFA 5CGMA 1NF0A 2YX0A 4TMCA 5I03A 3MMTA 3R58A 1Z8AA 3RXZA 1KTCA 3PUEA 4DRSA 3A4WA 2FTYA 4FS9A 5DT5A 1QOQA 1W1A1 3LDVA 4MFEA 5FKYA 1OX4B 1UD3A 1MXSA 1ISXA 5G4HC 3MSYA 2VKZG 4DI9A 1XIBA 1Q85A 1WYIA 5BMWA 2X0HA 5M1TA 3SJ3A 1TB3A 2QPSA 4RE3A 4FNSA 3ARSA 1OC6A 3LQGA 3RJYA 1WAWA 2O4MA 1PIGA 4GO8A 3GAYA 3R94A 1N82A 1OFQA 5CJMA 3F2CA 3YPIA 2PWFA 2W3ZA 5I78A 3EWXA 4I6KA 4MWAD 1PZ2A 2PDJA 3HG4A 2QUVA 4IMGA 1I2QA 1CCWB 1E0VA 3BO9A 5E70A 1DTUA 4UOJA 2EPKX 4CN1A 3GIYA 4FK9A 2YFNA 5HQMA 4UMCA 5EB8A 1Z89A 3MJMA 4E8DA 2AL1A 3B06A 3ZVIA 4XKYA 1XCXA 4UB9A 2PTDA 3DENA 1UQZA 4ZO7A 2V3DA 5A2AA 4CD7A 3L4ZA 1ZFJA 3DKJA 4J3ZA 4Q8PA 4L1GA 3K1DA 2CFFA 1VFFA 1ISYA 3GUWA 1UD4A 4J3SA 4W85A 4G8TA 5DXYA 4WSHA 2E6FA 4H19A 1ZJIA 2A3BA 1KCXA 4MNKA 4CD6A 2Y4SA 4KMQA 6REQA 2Z1VA 3LB0A 1JCXA 1MQPA 3DERA 2H8XA 1Q7ZA 4E3TA 4D1IA 1DVJA 4LVDA 2Z25A 4LYKA 2YDRA 3FY1A 1JAEA 2J66A 5AC6A 3NXLA 2X05A 3GW0A 2D3NA 3MY9A 5IRPA 4XUYA 3RLGA 4I5UA 3OVRA 1DQUA 2W27A 5FEZA 3VKBA 3WF0A 5FJJA 3SZ8A 4C6IA 3BPWA 1PKNA 2PZNA 2ZA2A 1V7YA 3U6WA 1F6KA 1VPXA 2INEA 1M5WA 3CEPA 1JDDA 2ZFAA 3KRSA 3RPTA 1FP9A 1JRBA 3KWSA 2GVEA 2ZUSA 1G94A 2D23A 3SY8A 2BB0A 1S2TA 2PWEA 3DYMA 5H8UA 2R94A 1AQFA 3D0CA 4KH2A 1BF2A 4DIAA 3O6YX 4A8LA 3H53A 4BJHA 4CNOA 3RX2A 4Q4PA 2I57A 3AWNA 2DIKA 4FEZA 4ZE4A 3V16A 2X09A 3TWAA 4J27A 5SWUA 4K6AA 1TV7A 4DO7A 1H1YA 1LQAA 2DFAA 3GG0A 2D20A 3OG2A 1PX8A 2QPUA 3ITYA 3S3GA 3H21A 3I3EA 4WR3A 2E5BA 3AQUA 2IMRA 3NQGA 1O5QA 2RHGA 3UXLA 3QR3A 5D37A 1EO5A 4S3DA 3V18A 1VFLA 1EJWC 3BXWA 3GHUA 3WBWA 1X1ZA 3T6CA 4K7VA 4LCSA 1GOIA 1VF8A 4K8HA 3VIGA 5B7ZA 2EG6A 1MUMA 1J6OA 3B8VA 2CYGA 2QCMA 3AIRA 4JPGA 3K8KA 3O6AA 2X1TA 2V5KA 3ITLA 4JDBA 3PUDA 2J78A 4DJDC 4IH3A 3DFOA 4MLJA 5D30A 5JH1A 2VZUA 1B1YA 2GFTA 1H7RA 5K9CA 8A3HA 4QISA 1JUBA 2BHUA 4HNUA 3BAKA 1MEHA 1TMLA 3VNIA 3QHMA 3KBVA 1BRLA 4US6A 4N0RA 1JDEA 1VLWA 5GNYA 2G97A 1IR1A 1E72M 3LK6A 4NXSA 3T2QA 1X6UA 5TF0A 1IEIA 1WKFA 3Q2DA 2Z1SA 2E68A 3P82A 4ZXOA 1EEPA 1KNWA 1P43A 1S1PA 1B3VA 2ZRXA 1FWEC 3MC5A 1CXKA 3HU7A 5CPSA 2A5HA 3CAWA 3LHZA 1VBJA 4F0KA 3FA3A 3HQOA 2EKCA 4UR7A 1J0ZA 5D05A 3QZ6A 4IQJA 4UFHA 1O5KA 3AUJA 3WQ8A 4QE4A 4RDVA 1VENA 3NVDA 4YTSA 2G8ZA 3KVLA 3UWZA 3IIZA 3FDGA 1DJIA 2OODA 4LUJA 3NUKA 1VFMA 1UWSA 4XX6A 2BBFA 5A8OA 4KF1A 1UKPA 3GNRA 4U2YA 1D2KA 1ECQA 5F4SA 1G4TA 1PZ0A 3SSZA 2XPKA 3ENLA 1Z48A 2BGNE 3M16A 5HXMA 4AXKA 3P6LA 2ANUA 5KZ6A 3PUGA 1KBJA 4IP7A 4NI3A 1TV5A 3GBEA 3DG3A 2BGQA 4HYVA 1C8QA 1UHVA 2P3EA 4F2UA 3MUXA 4U5KA 1C7SA 4C7DA 2Z2BA 1KRBC 3L4XA 4FXSA 2GSJA 1JI2A 1NWUA 4EP8C 3BOXA 3B4UA 4O15A 3W7HA 2YXXA 3NSNA 3HG5A 4GISA 1R86A 5I2UA 5BOEA 2XSAA 3KVJA 5CKSA 1BHGA 3SUUA 2GDUA 3IJLA 4HMDA 3C2VA 3C4UA 4DZHA 2FGZA 4JIRA 2XVNA 2CIPA 4F2BA 4MDOA 4WRHA 4DBUA 4D6IA 3NOYA 3BOLA 4JYEA 3T0CA 2WM0A 3FYYA 4P7NA 4FX7A 5F2IA 2G4FA 2WMJA 1UC5A 3NDOA 1XHGA 1B3OA 3D3AA 2EXOA 2J8FA 2YIHA 3AYRA 1WDDA 4U10A 3UXAA 1LJYA 2XN2A 1TPFA 1W8GA 4LCRA 3TQ0A 1UROA 3EWWA 3SQLA 2XVGA 1UZ4A 3W74A 1TWSA 4EXQA 1UD2A 4ADTA 4NZFA 1YE6A 3CIXA 4OBRA 2EQDA 1TTPA 3MP4A 3BSMA 3HGRA 2BY3A 3B40A 1A5LC 3HGJA 1JPIA 3M64A 3EAUA 4IZGA 2D73A 1V77A 3FGCA 3AIUA 3QMTA 5I09A 2GSEA 2XIJA 1LLZA 3H23A 1YRRA 1EPVA 4LY4A 3P81A 5H91A 4ENLA 2DT3A 2Z1KA 5AC5A 4KBXA 2ZRWA 1W37A 1UR4A 1QFEA 1PYMA 3RMEA 4W8BA 3WQGA 4MJ2A 3EWCA 1K70A 3S4TA 2D2HA 1OK4A 5FAJA 3KTXA 3V5CA 2IPJA 3ZVHA 1V0LA 2DUAA 4HCDA 3VGDA 4GHRA 2X42A 4IP4A 4MTVA 4PRTA 1LZOA 1R9ZA 2PP1A 3QFEA 3N29A 5BU9A 2FDSA 2GLKA 1ITCA 4A2SA 5FEXA 3FEQA 1RA5A 1DJHA 4XBKA 5K9XA 1ADSA 3WSUA 4PBEA 5DMLA 2VEIA 1LDCA 1BD0A 5DBUA 2OJPA 2GJPA 3ITXA 1OCBA 4HK6A 3WD3A 1IGSA 4IJBA 4NY2A 3CQHA 3LTYA 3BMXA 3WL1A 3RITA 3SUVA 4Y9MA 1Q2SA 1T6MA 3DYOA 4PA8A 3H26A 3G1RA 2EJ1A 3UR2A 4RUBA 5D02A 1OGBA 2KZHA 4E6MA 3B3DA 1TPC1 3NPXA 3NZGA 2QV4A 3QM3A 4KWOA 1EDGA 5FIPA 4DX3A 1E6QM 5I02A 2C0AA 3F4VA 2NQLA 2ZUWA 3PPHA 4QE1A 2OSYA 2GGIA 4J5NA 1SZEA 1U2YA 3DZ1A 3DN5A 1ZJBA 4UFKA 5EU9A 1MXDA 3AJXA 3MP3A 5T26A 1AH0A 1VBUA 3IVTA 3CTLA 3AU2A 1VBRA 1TIMA 4K8GA 3R89A 3PNZA 4QX4A 1WBJA 1KFWA 1QOXA 2DQWA 1W3NA 1YKWA 3SGZA 3LCGA 3MTWA 4JS3A 2QGHA 3P5ZA 4AZCB 2CETA 4DJDA 4XO7A 4DUXA 1OYCA 3KS5A 3W9ZA 3VGGA 4D8LA 4BEQA 2CBUA 1TVNA 4O8RA 3CB3A 4QXIA 1RLCL 1LOLA 3C2RA 2C1IA 1JZ2A 2QCLA 1M65A 3S9YA 1F61A 3EMZA 4AISA 1OX6A 1JJKA 3GS6A 1XIHA 1KLZA 4MAVA 3PC0A 1GVIA 1JULA 4YYCA 1YYAA 1XYMA 1QT1A 1RZMA 4XD6A 3ANVA 3EMCA 3PJUA 3WG6A 1YHTA 4L56A 4GXMA 4U31A 4FO4A 2VD8A 5LIYX 2UY4A 3RDKA 3E1F1 1K1DA 2DUZA 5GJMA 1P0NA 4GQQA 3CUZA 4K7YA 1ICPA 3HOJA 2VRKA 1T5AA 2XIMA 3A64A 2DT2A 1IZJA 3NA8A 4DVOA 2CERA 1YNQA 5FD0A 1UZDA 3LEPA 3WLQA 2J7FA 3BC9A 2WVSA 1VCGA 3ZQ9A 4HA4A 1ISWA 1H50A 1W54A 2YA1A 1AFSA 4FXRA 4Y9AA 5EMMA 3BW4A 1Q6LA 1W1TA 4JX4A 1X39A 5FESA 1XICA 4YU1A 4POCA 4B5TA 3I3DA 1IXPA 1DL3A 4OUIA 4LV9A 5D38A 4EAYA 4CU7A 4CQ8A 5KITA 1JYWA 4UZUA 3W7KA 1E70M 4J3XA 1W3KA 2J6VA 3R43A 1AJZA 1LROA 2PODA 3ARXA 4S3JA 4I90A 1BYAA 1NDVA 5AC8A 3TX9A 3A4XA 2VFGA 1QHZA 1OCJA 2J7HA 4LAUA 1VCVA 1H7WA 4UTLA 2HMCA 2G4JA 1JCJA 3B8UA 4JTFA 1EIXA 1VEPA 3EPMA 1ODUA 2Z7GA 3W7GA 3VIPA 3DUGA 5LNUA 3F7JA 1BXCA 4AF0B 1EX1A 4M1RA 1DWFM 1Q8JA 1M3UA 3W26A 3E0LA 5A6LA 4LOCA 3OW1A 3GR7A 4EPBC 2D0FA 3O6CA 2ZC1A 1DJWA 2P76A 5FF7A 4F0RA 2CLFA 5GPRA 4HPNA 1W9BM 1KM6A 2E6AA 3RCYA 2BWGA 4YXGA 5H8MA 2VNCA 4K39A 3TC6A 2WO5A 1W3JA 3AJ7A 4K38A 1GPFA 1ZENA 4JY8A 3WFZA 1HJSA 2C7FA 3N18A 2ZWZA 1UH3A 1PX4A 5DELA 2BASA 2GQ9A 4N4PA 3ARVA 4NRSA 3U5YA 1AQ0A 4IMCA 1AJ0A 5IFTA 3LA4A 1M9HA 2V8ZA 4IGHA 1RCQA 1JCYA 5C0QA 3KBSA 2PTWA 3EDDA 2Y8UA 5KZDA 4OVXA 3WEZA 2AOSA 4ONVA 4GIRA 2XYLA 4FNQA 3TQKA 1K9EA 2HS8A 3EXRA 3M46A 4FALA 3AWOA 4GZIA 3V7PA 3WQDA 3BURA 3QMRA 2OVLA 4PH6A 3NL5A 4MIMA 3W7OA 3VO0A 2GGHA 4EKJA 2QJMA 4QDMA 1DXEA 3GTNA 3RK8A 2ZRYA 1XH1A 3PJTA 4FOJA 3DOPA 3ZLHA 5I23A 3LCLA 5CZ0A 5XIMA 3IANA 2XHYA 2ZRVA 3TAKA 3II1A 1G4SA 4AQLA 3NO1A 4WK9A 1QO5A 1K02A 2E8ZA 4HN4A 4IM4A 4GUIA 2W9MA 4G6CA 1KR1A 1LUCA 1HUVA 2A7RA 1UWUA 3G3DA 1GG1A 1TSIA 1J12A 2Y24A 2B0MA 1HP5A 3JR2A 3MI6A 2PP3A 1C29A 3MDUA 4I9AA 1O5RA 4MGGA 2ZX6A 1XC6A 5E0FA 4RNIA 3CWOX 3VKAA 1J6PA 4PTXA 1GOQA 4RX0A 4QGCA 3M5ZA 2X8RA 1EO7A 1YDYA 3LI1A 1Q6OA 2XDFA 3N04A 4UR9A 3ID7A 3GD6A 1HO4A 1HJQA 1SQ7A 5EMYA 4MYXA 5L9FA 1THFD 1W1B1 4OZOA 1CGVA 3LHWA 4C6PA 3E02A 3WLNA 2V38A 3VNZA 3CUFA 3KEHA 2WSYA 1H5VA 2PDIA 1AA1B 2AAMA 5D2XA 1NOFA 3D46A 3KCOA 2PSNA 4G7FA 1SW3A 4GO9A 4P8VA 2E7FA 1R85A 3OZMA 1POKA 4BKNA 3UU0A 1OZQA 3VMPA 4Y96A 4AC7C 1IEWA 4S3BA 4LH8A 3SCNA 2NXHA 3MV11 2ISDA 4DUVA 2R9RA 3ABQA 1JXJA 1P0KA 3H22A 1TUFA 1CT5A 4LWWA 3G22A 3T2PA 4ZB5A 3NQFA 4J2PA 3ZT6A 1A3HA 2A2IA 3CYVA 3MWCA 1QBBA 1UMYA 3T0TA 2PDFA 3TTOA 3ARWA 1J2WA 3U7BA 4CQCA 3NQAA 3PBGA 1G1YA 1HT6A 2Y2WA 3FJ4A 4H00A 1MW3A 3DEQA 2OQLA 3QY6A 4WY0A 2YDSA 4FOUA 2EKGA 2VGBA 4QM1A 2OX1A 5E93A 1I0BA 3VFLA 3CLMA 4D9PA 1ELSA 2VZTA 3VFCA 2Z6JA 2FMNA 4CNSA 1Q13A 3JU2A 2IPFA 4GY7A 3G0XA 2OQYA 4MZ8A 1IEXA 2PD9A 2QF7A 1RAKA 2DIEA 4L65A 2X40A 3UF9A 4EPKA 3KBJA 2E9MA 1J11A 3OHMB 1QW7A 2NT1A 1Q4NX 3QR0A 1AW1A 3NM3A 2ZZ7A 1TPB1 1H4PA 2CWXA 3KRZA 1UPMB 1S2WA 4JL1A 2OR2A 1XR2A 4GCAA 4B92A 4KEMA 3KRUA 4C6DA 2VR2A 5DMNA 4DN1A 2Y70A 3LSCA 3W27A 1TTIA 2CXGA 3TSBA 3FYOA 5CC5A 2QDEA 2RUSA 4K2SA 4B5UA 3PZTA 4CQDA 3T8QA 1WDRA 3S8HA 5AYXA 1Y5VA 3N73A 5MKGB 4JTIA 3BG5A 1XLIA 4HPXA 4GJJA 3VGFA 4DJEC 3W75A 3B0VC 4B16A 4IL0A 1OD8A 4C5ZA 4FNUA 4PFHA 2J62A 1UUOA 4JTAA 4AVOA 3VU2A 4TTGA 1P6WA 2VEGA 2DT0A 5FJTA 3CHFA 4HVXA 2WZTA 3IUIA 4OBSA 3F1QA 3S83A 1JZ6A 1A80A 3R0KA 4GINA 1V3LA 1UWTA 4XAYA 1GW9A 1U5VA 2VWSA 2NLIA 1YBQB 5AVHA 4GNKB 4FI4A 1PZ3A 3B05A 2QAFA 4S38A 1V3JA 4ZQOA 4CQAA 5TIMA 5I5RA 1KXQA 3F2DA 1UB3A 4JFVA 2PTYA 4IJRA 5FI8A 3H2AA 2Z4GA 1UOKA 1R2TA 2QCFA 3M6YA 4N2YA 1J01A 3PZQA 1H2JA 1XYFA 4IUOA 3TOPA 4NNAA 3TP4A 6A3HA 1RP9A 1NFBA 1Q2RA 4C6KA 2AAAA 2FHFA 1UZHA 2H3BA 4CCEA 1K8CA 3VX0A 2WLZA 4GIAA 1E9IA 1UYQA 4AZGA 4NJJA 3DI1A 2NX1A 1W32A 2PDWA 1AJ2A 3LN3A 1QNVA 1DJZA 1LQ0A 3S9ZA 3FKRA 3R6IA 1ONRA 4Q4KA 3VD5A 2VQTA 4IIHA 4U5IA 3NQ8A 4DWSB 3LPFA 3K46A 1W1ZA 1NWTA 1RBOB 2PBOA 4FNPA 3CK5A 2Z6IA 4ML4A 1PXGA 2OZ8A 3T08A 1RUSA 3URNA 4RDYA 1ZBVA 5G1TA 4JNZA 1W2VA 2OWXA 2BOEX 1C91A 3B0UX 3GXMA 5HWNA 1DWIM 4O16A 1SJCA 3TVAA 1DYSA 5CPMA 3V5OA 2QEZA 2PDHA 1QPOA 4MPKA 1DP0A 2PC4A 3ZSSA 3CQKA 4MAZA 2FFCA 5EYWA 2VVSA 4XD5A 4GZEA 2Q01A 1GGOA 2F6XA 2Q3RA 1E73M 4KCUA 1J0YA 3AXXA 3H7UA 3VAVA 3FXYA 2J79A 3QYSA 1K77A 3VDBA 5AOUA 4GYPA 1GKQA 4US5A 2V30A 4UFMA 2XGIA 4F0HA 2GQ8A 4CGTA 4J3WA 4EWND 2BS9A 4REQA 2BX7A 3AHYA 4KT2A 4LVGA 2PRHA 3M41A 3T0BA 5LHFA 1AQMA 5DBTA 3WQ6A 2D0GA 4WQ6A 4F0SA 3EDJA 5XINA 5FJOA 5HDRA 1SFLA 3VGHA 1RBLA 4UCFA 1H62A 3UZWA 5E9XA 3GWQA 4JTSA 3UFYA 2IQ0A 3RN6A 3W1TA 1C93A 5D04C 3E2RA 1AODA 2VC6A 1XBXA 2HZGA 2WQDA 4XBSA 2ZWYA 3TONA 4H41A 1W3LA 2PWUA 3SY5A 2GZXA 2QUUA 1DV7A 5HNUA 4XZNX 1DBTA 4DJDD 3BICA 3EA3A 2MANA 4BHYA 4ML9A 3ZM8A 3A23A 1TJ0A 4A29A 1A5CA 3CUHA 4A3QA 1W1PA 1GOOA 3BJTA 4C7GA 1FWAC 2H6RA 3ZR5A 3KOZA 3AYSA 5JUVA 4KQNA 1NDWA 2MNRA 3MMWA 3NPWA 2X7WA 4KWSA 1OIMA 5CSUA 1WQ5A 4HCHA 2ZRUA 3N9RA 1ZGDA 3AIVA 4CKQA 4JDYA 4IPNB 4GACA 3Q4DA 2VC7A 3A4JA 1NF7A 3BLKA 3OBKA 4RCXA 1AD4A 4IFKB 4HNOA 4G7EA 3WF2A 3NNTA 3Q58A 4OHQA 1BAGA 1LL6A 3WNOA 3RG6A 4QQ3A 3WDQA 1NJJA 3CWNA 1OABA 1KB3A 3WNMA 1K6WA 4FIQA 2VEFA 1KWKA 1XGDA 2G3IA 5M03A 4IXXA 3WX7A 3R10A 1KM2A 3CASA 3AOFA 4IFOA 3UZYA 2HBVA 4O10A 5GJPA 3AHXA 2TRSA 3BGGA 4HMEA 4KFNA 3N4FA 1CWYA 3HN3A 1V0MA 1ZHAA 2BV9A 3BZJA 2BOFX 3HJEA 4QROA 3LLFA 1BTCA 2NX3A 5FOOA 1C92A 3THQA 4E2BA 4Y9OA 3QMSA 4N9BA 1WX0A 5BXRA 3T42A 2AL2A 4ZOBA 1PJ9A 3PZNA 1E5NA 1UR9A 5LXXA 3I10A 4DUOA 2AQVA 1BEUA 1HJXA 2ONEA 1F9CA 1QOPA 2UZ9A 3W76A 2WM1A 2HE8A 4MNLA 3AO0A 3OJGA 4KKXA 2GGJA 2Z2AA 4UWMA 2UBPC 1XF0A 2VQUA 1ALDA 1HJUA 1E6SM 3ONBA 1LRTA 3ITVA 3V4BA 3S2CA 2FH8A 2PF0A 3W7EA 2A4AA 3EOLA 4GUFA 2W6RA 2WMFA 2OX4A 3E74A 4Y90A 3LV6A 2DVUA 3CAQA 1QI3A 4WDWA 1PHQA 1IXQA 2WOQA 4IWWA 4LX4A 4I6VA 2ZKMX 2GGEA 3SIZA 2UY5A 3QJAA 2CBVA 5I06A 4H6KA 1X7IA 3R8HA 5EFFA 1XUZA 4OT7A 2WCAA 3GR8A 3V36A 1JUEA 2YA0A 6XIMA 2BG5A 4HIBA 1GNXA 3LG3A 4GIEA 2XH0A 3URQA 2VCAA 8XIAA 5CC3A 4W8AA 4GYKA 5A94A 3E3HA 3OBEA 4HN8A 2JKAA 3HMJG 5C9ZA 3QVQA 5C55A 3H2MA 1GCYA 4PUDA 4S3EA 2Z27A 3ATYA 4CCDA 5TD4A 2WNQA 1E1CA 3WLLA 4P2VA 4PB5A 2Z1XA 1KFJA 2FJUB 3SB0A 1XLJA 4BI6A 3R8GA 2UWFA 4H8NA 1OFBA 2BTMA 4NASA 3TE9A 2VRJA 3W23A 3QV6A 1PUDA 3EWUA 2EHHA 2OGJA 3BVJA 3QC3A 3R8RA 1KFLA 3DHPA 4EK7A 5AHFA 3L0NA 2YSWA 5IOBA 3E49A 4EOUA 1H5YA 1XPGA 2NQHA 1XIJA 2P10A 2VTFA 1FRBA 4YTTA 4N9CA 4YTQA 2GJXA 4ZSTA 3V0SA 1QUMA 3GXDA 1YW1A 5FL1A 1W5OA 3W1LA 4GNVA 1K8ZA 1ZS2A 4Q6XA 1YEYA 4QITA 4LCQA 3T8LA 1Q6CA 3TC3A 3I7SA 4HPHA 4HA3A 1T99A 3ZJ8A 1W1YA 3E0FA 1A5UA 5L6UA 3WQOA 3APYA 2JF6A 3AIEA 4R88A 1TTQA 3IK4A 2TPSA 2OEMA 1ZP3A 3EB4A 4Y9PA 3M0YA 3SUTA 2YFOA 3TTEA 3UGRA 4KESA 2E40A 1HN1A 5FL0A 3BW3A 1WP6A 2ZZ3A 1GOMA 1T96A 4NZ3A 4LB4A 3WBYA 4F2TA 1V51A 1J79A 4QAWA 1ZY9A 3UWVA 1V79A 3VIJA 2E8YA 1EUAA 1VRXA 3LXBA 4HNNA 3OZOA 3KZSA 2FGLA 2CLMA 4MWAC 2DORA 1TPVA 3PPCA 2XJ7A 4Z2GA 1Y5XA 1L6YA 1XRFA 3VCRA 3VNDA 1E6PA 3PG8A 3QRHA 4WXZA 1E6XM 4HBKA 3MKVA 2OOFA 3HV9A 3HPZA 3M0LA 2CESA 3PUOA 3VGEA 3B97A 1O12A 1K3UA 2PU1A 4HMCA 3GU2A 4HOXA 3M0XA 4CD4A 4QEHA 3FAWA 3T2OA 3AMCA 4L80A 4WHBA 2IQTA 4LQ1A 2CLHA 1MZRA 5A8MA 1VYPX 2F8QA 7REQA 5HAOA 4EPDC 3EWBX 2INFA 3LX9A 3VE9A 5A6SA 3A9BA 4M80A 2ZADA 4K8EA 2R1NA 4D8AA 2V5CA 1NWRA 1K6AA 2YCLB 1ZAHA 2DVTA 4J40A 4JTQA 3MANA 4FR1A 5AHIA 1Z9AA 1XG4A 3O16A 2BVTA 4C1KA 2GK1A 9CGTA 1L6SA 3QPYA 1CXEA 3WLMA 1CI1A 4FNTA 1QATA 4PMOA 3M5VA 4BQ2A 3CLWA 1EYEA 1CX9A 1PTGA 3VOIA 3W72A 1FCUA 2YYTA 3CL6A 1J5TA 2Z28A 2YZ5A 4HK7A 2VFFA 1A0CA 2PRLA 1AW5A 1OVDA 4BEUA 2NXGA 4O13A 4Y8EA 4J2MA 2FJKA 1JYXA 3R7MA 3R5EA 4IPIA 4GXPA 3I6EA 2FYMA 2XN1A 3GH7A 4AD2A 1Q66A 1B54A 4WD0A 5I3FA 4I9JA 3ECQA 3FDKA 2QMJA 2J13A 5FJUA 1L0PA 1OCQA 1U1JA 3G8EA 1CBGA 2YDAA 1FWHC 2KX9A 4QSFA 3FIGA 2PEVA 3QOKA 1QASA 2WSQA 3V1PA 3GVQA 4KRTA 1HKMA 2PURA 4DBEA 4ZO6A 3B0PA 1DJNA 4Q8VA 2ZZ4A 1AVAA 1HKKA 2YLLA 3GDKA 4P5UA 2J7CA 3C6CA 4CNTA 4IG2A 2EGZA 3PZUA 2WK2A 4QHRA 1HTIA 4RW5A 3KP0A 5D2YA 3GFZA 2QVNA 3WK3A 5EMUA 2OKTA 2X1IA 2QNEA 2E5CA 4HYWA 3M5XA 4MADA 3V3WA 2PC8A 4QIUA 4ATWA 4AIOA 5BMXA 2IKGA 3WK2A 1K4HA 4AD1A 3DFPA 4P8UA 2XISA 2NQJA 2NUWA 1ITXA 1H49A 4QFUA 1X8CA 1Y7VA 2WVVB 1OHLA 1IYXA 4WJEA 1X8FA 6PTDA 1MZHA 5AC4A 2A7PA 1HVXA 3S0CA 2C8NA 4GUJA 4XZMX 4S3CA 3COTA 4NRRA 2C15A 3T55A 3EOUA 5G2HA 2VI0A 4EX4A 1REQA 5AHMA 3PK7A 3EXSA 5FA5A 1XC4A 3N2CA 4FX6M 1NDZA 3HO8A 3G1DA 1CB7B 1GQLA 2BDQA 2RH9A 4O54A 2YDQA 2CBIA 5DCEA 1BTMA 1C90A 3IK2A 1YTKA 1B3ZA 4O12A 1IZCA 4Q8NA 1ZCCA 5LIWX 3E96A 1TX0A 1HF6A 4IIGA 2F2HA 1TPUA 1WO2A 5I00A 4TR9A 1C8XA 2QJNA 3LPPA 3QZEA 4JGDA 3DCPA 1XDMA 3AZRA 2WWDA 5I3JA 2ADAA 5A3HA 3UP8A 3PB2A 4GUHA 2DSKA 3GE7A 2OG9A 3ANYA 5CGQA 4Q8MA 4PCNA 5FAGA 5C2CA 4RZ6A 2YJQA 4A8IA 2OOGA 4ZL1A 2EEXA 1T41A 3G77A 4E0CA 4XAFA 1NOUA 1IV8A 5HPOA 2W63A 3SJNA 3UR7A 3LHUA 4GFIA 3LBCA 4US5D 3VM5A 5AZ1A 3INPA 5DY2A 1W91A 3WYZA 3S2NA 4PB4A 1Z41A 3BQ6A 1E56A 1UOZA 1EJXC 2DZVA 4Z1YA 4JL2A 1V8EA 5I3DA 3GTFA 3WLHA 1HXJA 5FJRA 1J0JA 1SFJA 1BGGA 3NQ2A 1GEHA 2OXNA 3JZUA 3W7CA 1XXXA 5LGZA 1DIKA 2R91A 1FWJC 2QZRA 3RGTA 3G24A 4JIQA 4KCWA 5CJNA 4JTLA 1CLXA 4B4FA 2CC0A 3LHTA 4ZQRA 1L2QA 2I5GA 3ALFA 5A8PA 1M53A 4XVDA 4AZIA 2WNZA 2PWGA 3DU0A 4PODA 3MSGA 2OYKA 2REQA 3AFBA 4BQ3A 4LPCA 1QJWA 4IGNA 1MYRA 3PBWA 1PWMA 4HU0A 1KGUA 1TRIA 4H9YA 4LU0A 1PDZA 5I79A 5C9WA 3IGHX 2DZXA 3L4VA 4EIVA 1XSKA 3B4YA 4JNMA 1CTNA 2VELA 4JFUA 3L9CA 4JX6A 3A3WA 1RD5A 2X1RA 4ORMA 1ZP4A 1B0IA 1SJDA 4MPQA 3WJWA 5LNRA 1RPKA 5LA1A 3VIKA 4QDWA 3N11A 1A3WA 2F9RA 1KCZA 4JTEA 4IIDA 4Q8WA 1AW2A 3S1WA 1EXPA 1OGGA 5EFDA 1D7KA 5GNXA 2PB1A 3O8AA 2WKLA 1SW0A 3CGTA 1FHLA 1H7NA 4TTUA 4HJFA 1OY0A 4WEVX 1LT7A 3CZEA 3B8SA 2JALA 1S3HA 4MJMA 3V0UA 4YCOA 1WXYA 4ATDA 4R53A 1JZ5A 2J9ZA 4IOTA 5IHRA 3G8RA 3UXDA 1O1HA 4GX9A 2ZUUA 2G3NA 3ZZ1A 3N9SA 3QZAA 4GZ7A 1W9PA 2Y62A 4TXEA 4BY3A 3SN1A 3W7JA 3SADA 3MCOA 2YCKX 3I4KA 3OTRA 3QBUA 1QNRA 3PZVA 1JG9A 3EKLA 4AYSA 4MM1A 1DOSA 3P61A 4BR1A 3WMLA 3FOKA 1TJPA 5AN7A 4JICA 4NL1A 3N2OA 1VC4A 2ZTKA 1MEIA 1GT8A 1US2A 1KXTA 2J4GA 3S2LA 4KIEA 1W3IA 3UWYA 4F9DA 1RY8A 4MY9A 3NO5A 3B8DA 3ZOAA 3KAOA 2Y88A 3HZ3A 4O4VA 3W4RA 3IUHA 2VEPA 2FTPA 3OEXA 4ATLA 5AHLA 4MUPA 7TAAA 1UWQA 2FTWA 3Q37A 4TVDA 3FK4A 4G9PA 3EEZA 3PS7A 1HIZA 3TYBA 1OG0A 1XIEA 5IDZA 4O0ZA 3GIQA 1ZJAA 1RV8A 1BKSA 3LSBA 2YZRA 5AYIA 3S1VA 1GQJA 4UTWC 3HB9A 5I3GA 5U4NA 2QR6A 1TPH1 3USZA 2QS8A 1XRTA 2PGRA 1Y65A 2B4GA 3TA9A 3NJ3A 3UA4A 1JNDA 1KWGA 2P8BA 1WZLA 1EYWA 2P0OA 4MWAE 1TIWA 1LBLA 1CLVA 4UQAA 2PFHA 5IDIA 5IBXC 1ICSA 2XZ9A 4JKLA 3WLJA 1VD6A 2B7OA 2BMBA 3M44A 3MVTA 5I3IA 3R1ZA 3UERA 3SCUA 1Q6DA 2PDCA 4MWAB 3R4IA 3HQPA 2ISSA 1IHIA 3VD4A 4BF5A 1GVOA 1WZAA 1XIIA 1J5SA 1C9WA 3NTYA 3RLHA 5A6JA 1QNQA 4GE8A 1F8MA 4ICCX 3TW6A 4L9XA 3AROA 2D24A 2VUNA 1S2CA 3UGVA 2QCGA 4LGXA 4AD5A 1ZUAX 1BWLA 3IIPA 1GVQA 3ZLFA 5DX7A 2VO5A 4WKHA 4OFCA 4Z2JA 3EZ4A 3O05A 3ABRA 3W01A 2YL8A 3QGKC 3BSHA 2RJGA 4JQAA 1YXDA 3BCFA 4ROQA 2WSRA 1RBAA 4Q4OA 3SFWA 2G3JA 2RDTA 2ZXQA 4LALA 3QV7A 3VE7A 5AFDA 1O66A 1RR2A 3VUPA 2Q8XA 4KRUA 1R9YA 1A47A 4N4QA 5ABFA 2DSZA 5LZLA 3T4WA 3FLUA 3VK5A 5T91A 5C71A 3WFLA 2QQ6A 1SJBA 1W5NA 3U57A 4NU7A 3EGJA 3QN3A 3W28A 1Q7MA 1R3RA 1WXZA 2C16A 3AMKA 2W92A 1DXIA 3IVUA 1LG1A 5AYYA 1SSGA 2VZSA 4HA1A 2Q8ZA 2V63A 3WDJA 7XIMA 4NNCA 5AYZA 2GDQA 2WBGA 3RUBL 3UY8A 1W3TA 2QPXA 3W24A 4WXYA 3GLCA 4PUKA 3WK0A 4E38A 5CC6A 3RF9A 1XH2A 3OYZA 1XLMA 3U5UA 2RKXA 2V82A 1PPIA 4GY1A 1FTXA 1QPRA 3RRXA 1PEZA 3VNKA 3HPFA 1QU4A 2F6UA 3BLDA 1MUWA 1SVDA 4UQEA 4UQCA 3UCCA 2WMHA 1WCGA 3CJPA 2ZUTA 3UW6A 2X1UA 1SGJA 3S5ZA 4BWLC 1ZLPA 1FWDC 1ZAIA 1EPXA 5LIXX 1Q6RA 3LRLA 3G1VA 1CENA 1E1EA 1LM1A 3NZRA 1EZWA 3CTTA 4TIMA 3C0SA 3U2EA 4ECLA 3CXOA 3C8NA 3QC0A 1PHWA 3A3HA 3UJEA 3TV8A 1UZ1A 2YOCA 3QY8A 4D6DA 1J10A 3WZ0E 4QG6A 2AQOA 1ZU8A 4RK8A 1X97A 1DHPA 2ZUNA 3MSRA 4Q7NA 2IUZA 1U30A 1HX0A 2OWWA 2PDLA 3U3HA 1N8WA 4S3KA 1TA3B 3LU2A 2D69A 4JNYA 3O15A 4C7FA 3H55A 4MB5A 1H7OA 2WVUA 5E0KA 5G1MA 1MW1A 5D9MA 3UPWA 1V6XA 3UG3A 1S46A 3DC0A 1GKPA 1O5XA 4LS2A 1FHVA 3GAKA 5CPTA 2ISWA 4M6VA 4H8VA 1OFAA 2RDXA 3B0XA 1UKSA 3LXCA 5I07A 3IVSA 4GKTA 2B31A 3W2NA 4I8DA 3QTPA 4M8UA 2ISVA 3ZWTA 5LIKX 1KXVA 2YCJA 5MHBA 1MXGA 3UXIA 3KTSA 3VC5A 2VDHA 2I5IA 3N4EA 3ES7A 3N19B 1TWZA 4Z1DA 3B9OA 1H1ZA 2A3AA 2GWNA 4OOUA 4V1XA 3P7YA 2ZCGA 3I65A 2YXOA 1VRDA 2VCCA 1EJVC 4WKFA 3EBVA 3W82A 5D8ZA 4JTDA 3W7RA 3ZJ7A 3N14A 2ZX9A 2DDXA 4NAFB 1W5MA 2RGMA 1XSIA 5CJ5A 6ALDA 1GVEA 3N13A 2NV2A 3THUA 3IJQA 4UZSA 3NQMA 4UTWA 2OLHA 3V75A 4FZIA 4JKKA 3DFNA 5XIAA 1Z6KA 4JYFA 2D3LA 3R2GA 1Q65A 3L2LA 3FHQA 2DZTA 3IEBA 3BL3A 4BF7A 3ZFHA 1LBMA 4ZVJA 3H2CA 3KCLA 4AIEA 3M0MA 1EP3A 4H6QA 2ATMA 2V81A 3T44A 3TWBA 4JTKA 2NT0A 4CNNA 3D5HA 4TU1A 4HZ8A 3MSDA 1RSCA 3LD5A 5C9RA 2WHLA 4E2VA 2JBMA 4FLSA 1MO0A 5A69A 3KDOA 4M0XA 4HP5A 3HQNA 1M01A 3W84A 3G6MA 3I3BA 2DW6A 1FXQA 1QI4A 2QT3A 1NAL1 1UUMA 3S5NA 4X2RA 4E3VA 2UY2A 1ONEA 1OC7A 2J25A 1I2OA 3ABSA 4J3VA 2J74A 4C6QA 1E9YB 1M7PA 4CQBA 3G0SA 3E12A 3UZJA 1IWAA 4W9TA 1RJRA 3GG1A 1QAPA 1FFRA 3F4WA 3BG9A 1HKVA 1TPDA 4YYFA 1WB0A 3O3RA 4TOQA 3BLEA 2JGQA 1PKYA 3LBMA 3CNYA 3WBEA 2VGGA 3P80A 5REQA 4CNPA 5BROA 4HMNA 4NAEB 1HKWA 3ERPA 1QMLA 1OG6A 4AFYA 2DP3A 3TH6A 2Q71A 3C52A 1YPXA 3UEQA 4H2HA 1W9UA 1FKXA 3DHFA 1V7AA 2NV9A 3IACA 3AS0A 1CNVA 1VFTA 2Y63A 4MSSA 1BVZA 4MB3A 2NWRA 4U3AA 3RU6A 2OT1A 3SM0A 4MKVA 3W73A 3AALA 3SQMA 5CSRA 4JFWA 1KRMA 2GJNA 4HA0A 2GUUA 1NFGA 1FWNA 3AIWA 3DGRA 3R25A 1RQHA 5H8PA 3W0KA 5LNWA 1S5TA 4TVCA 4ZA0A 4PUWA 3LNPA 4O19A 3RM8A 4R7OA 2C18A 3E2VA 3N1AA 3BCDA 4E2DA 3C0LA 3AMDA 4B3LA 3MYPA 4YNGA 3BE7A 4M6QA 5BW6A 1UA3A 4Q22A 4F40A 4GGBA 3UA3A 3AHTA 3G6LA 2QJIA 4C6CA 4DLFA 1G4EA 1CB2A 3GRIA 1EGZA 3RX4A 2CLEA 1AUSL 1O1ZA 5G4EA 2NLYA 3N2XA 3SCSA 3LY0A 4W5ZA 1EP1A 3TCSA 3DG7A 4GIYA 3NGFA 3C2FA 4PE8A 3VNJA 1SZRA 1V3KA 1DWHM 3PR2A 1F73A 1AMKA 2EO7A 2FQIA 3MHFA 4AEOA 1RALA 3SAZA 1F3XA 1XIMA 1F07A 3VC6A 3OGSA 1X1OA 1JVNA 1LL4A 7ODCA 1E40A 4MJ4A 1LL7A 2E1WA 4GBDA 1P7TB 1OQFA 2Q6ZA 4XKMA 5HUOA 1LWHA 2CPUA 4Q6JA 3U4FA 3W53A 1ME7A 4O0KA 3GXNA 1JR1A 3NQDA 4O1FA 1WOAA 1XG3A 4BWLA 5D2TA 3PSVA 5I77A 4RL3A 4CCCA 1DJGA 2X2YA 1A5OC 2Y8VA 4LBRA 1BGAA 2YGYA 4I9MA 2X30A 3GDBA 3DFQA 3ELFA 3RM9A 1WDSA 5LGXA 1XYCA 1GQKA 2ZZ5A 4UQBA 4PCTA 1XLAA 1GTHA 2V3FA 4RZBA 5LXEA 3ICJA 3MA8A 2WJFA 2G96A 5F1UA 5HNNA 1BPLB 1HKJA 2EAWA 3PTQA 4WCJA 1BQCA 1Q3NA 3ES8A 5HMFA 3NZPA 4H2CA 3PBUA 4DLMA 1TVPA 4GLEA 3BH4A 2FZ8A 3STFA 2W91A 1HL8A 2YPIA 3PJWA 1V3MA 1VFOA 3N3MA 3HBLA 4YL2A 2ZIDA 4D6FA 3FEMA 4Y8FA 1B5TA 2J24A 3NG3A 3MUAA 2UY3A 5F7UA 3MJYA 2C13A 2VCBA 1XPYA 8XIMA 2X16A 2SFPA 3ZO9A 2ALDA 2HNHA 3W2KA 3LHYA 5C7VA 4A3YA 3QF0A 1DWAM 2VX7A 3UNTA 1JD9A 1JDFA 5GVJA 4FA3A 3UY7A 1ME9A 4GVHA 4OU1A 2XFRA 4KW2A 4RLIA 4DI8A 4RR4A 1TVLA 2R14A 1VGAA 3QW4B 4HKPA 1GVRA 4DBWA 4UNKA 3W6MA 4YWSA 3PM6A 4L6OA 4J35A 3A47A 3T9PA 4ES4A 2B81A 4NNBA 1WKEA 3W7MA 2PRMA 1OGSA 2NXIA 4AEEA 1XKYA 5KMYA 1KQYA 5A95A 4CQ9A 1L2UA 3PY2A 3VKKA 4ZE5A 4I7VA 4XAZA 2E09A 2DU2A 1JYNA 3CWHA 4JZ5A 3P14A 4ERIA 1RJQA 5T9BG 3QLDA 3FHAA 4MFDA 3CV2A 1MFVA 2VEKA 4P7RA 4EAMA 1BG9A 2EPMX 3HF3A 2FZ9A 1FVPA 3A6OA 1SZGA 4RPPA 3O0KA 3N2TA 3WBAA 1ADOA 1TFVA 3LCIA 4IQLA 1XYZA 4ROPA 3WQPA 1LRQA 2ZXAA 2H3DA 4XKYB 1KV8A 1J9YA 1JUKA 2WAGA 3AXMA 3GXIA 4AU0A 4AX7A 1GZJA 4DO5A 4ZXLA 3GYEA 3KLKA 1VYSX 4HTYA 4QP0A 4N9DA 2YXGA 1V6TA 3T4CA 1G9HA 1MDRA 1EF2A 1XD1A 2CZFA 1KM0A 2IKHA 3POCA 3MUZ1 1OZMA 2DZAA 4O8AA 5BXTA 1SM9A 4LS0A 3W29A 5FACA 3MUCA 3OO2A 2A3CA 1WV2A 2H90A 4V2XA 3MP5A 1Q7QA 3VYLA 2F6KA 1Z3NA 2FZNA 6REQB 3IIXA 1YDNA 4N7QA 4M19A 3FX4A 4LUTA 3UZ5A 2YYUA 3W87A 3GR4A 3JVAA 4MKNA 2G37A 3BMVA 3KCJA 1MW2A 1OWQA 4H9XA 4PL2A 5FF4A 1M1BA 2ABAA 4P8WA 4QG8A 3MMDA 1J18A 1VQTA 2BY2A 4Q4MA 4JTJA 5EMKA 3VNLA 3VNMA 3H4XA 4ZB0A 4G5DA 5D4YA 3OOQA 5AVNA 4MB1A 3P60A 4P7OA 4XTDA 4S3AA 1PE1A 3B9NA 3N34A 2PI6A 2F38A 1P4CA 1XH0A 4ZB2A 2OKOA 4P61A 1KA9F 4EF9A 1JZ7A 4Z1AA 4TX9A 1R38A 1I0DA 1XL9A 3CPRA 5G4WA 4HHPA 1GQIA 4GI4A 4AWSA 4S3GA 5CZJA 4E8GA 1J4EA 4JIIX 3S42A 3LXAA 2VGFA 4XTIA 1JDCA 4FNRA 5LA0A 4V27A 3LYEA 4KPLA 4ADUA 4UTKA 1S2AA 3TTYA 1ICQA 3TC7A 1QW9A 1V3IA 2WSPA 1E4MM 2ZRZA 3U8GA 3SCWA 4H9VA 4XZWA 1GW1A 2VFDA 3UT0A 5D03A 1S39A 1ME8A 4JTHA 3O63A 3BAXA 1RCXB 4HSOA 3HA1A 2FLIA 5LHEA 2O0TA 2LLEA 2ZX8A 5FJIA 4K68A 4O11A 2H9AA 3LLXA 3EOEA 4MF4A 2PCQA 3O9NA 5C6MA 3FFSA 4LUSA 3JS3A 2DT1A 1J2BA 2DQXA 4NZJA 1IWBA 3TXVA 5AYBA 3THAA 5C7HA 1GYNA 4M7TA 4UBPC 2BOGX 1ENUA 3LBOA 4D2JA 2VL4A 2X0SA 2OB3A 4YN5A 4L64A 4JEQA 1X98A 4JR5A 4FXJA 4LEQA 5F1VA 1E1FA 4DBSA 3SN4A 3UG4A 4JN6A 5DRIA 2NVDA 4GC4A 2JEPA 3GX9A 5CXPA 4HHMA 3KHDA 1E51A 4S39A 3KBMA 1MMFA 3FJLA 5HJLA 3USBA 4S1FA 4NZ4A 2WW5A 4JFSA 3PWIA 3S2JA 1AL7A 4MG4A 2Y5JA 5LSMA 3DH7A 4AY1A 3ITCA 4NZ1A 2PGFA 3STPA 3VD7A 4WJXA 2A3EA 3MUIA 1P1XA 4DYEA 2QW5A 3QQ1A 1BRLB 3W1RA 4TX6A 2VURA 4LS1A 4EVZA 4C5YA 4Z1CA 1J0KA 3LQLA 4H8UA 1R3SA 3N15A 5KSWA 1KTNA 3C56A 4IPPA 4W7VA 1V4YA 2I7GA 4LUYA 2Z1BA 3SUSA 3OQEA 4PGLA 2VMFA 3VZZA 3CZLA 4GYJA 2EG7A 2J6XA 2XGZA 4F0LA 2OSXA 4WGHA 3E0WA 1R3YA 4GQRA 3TQVA 1EUNA 3OQ8A 5BYWA 3NOEA 1H51A 3A4AA 2QHAA 1XIFA 1MQRA 6XIAA 3PTMA 4B5VA 4Q3MA 1EP2A 1CXIA 3C0JA 3EKGA 5HPCA 3AZTA 3IJ7A 2C79A 4C1NA 1S3TC 2OELA 1NOWA 3WFAA 1BG4A 3EWDA 1KKRA 4PCPA 1F8IA 4NILA 3NL6A 1RVGA 3SR7A 3TMQA 2ZOXA 5M2FX 3MB9A 3UJSA 2ZXBA 3O7UA 1MI3A 2WPGA 2HWGA 3DESA 5CC7A 2A6LA 4AZ7A 3N25A 4ZOCA 2BXVA 1M41A 4AMCA 2XVPA 2YBTA 3MI2A 3QQ0A 3PBYA 4WUIA 3BAIA 2FPVA 1DE5A 3GFXA 3QTGA 5HQEA 3FS2A 5BXPA 2ZC8A 3K8MA 2INZA 3F4CA 3EX1A 5EBAA 2XH2A 9XIMA 2FB2A 4LVBA 4B3ZA 1QWKA 4NF7A 2VOTA 4F0MA 1XLGA 3F4DA 4CVWA 1PS9A 5AKQA 3WDHA 1C3FA 1ZTVA 4C6OA 2PDGA 3LRMA 1PIFA 4O53A 1GHRA 4B15A 3IWPA 4I5XA 3RR4A 2HXTA 1RK6A 1V08A 4B9ZA 5DO8A 3WNLA 3M9YA 4XQ6A 9XIAA 4IXHA 1OFDA 4JQ1A 2NW0A 1QBAA 1H7PA 4D6JA 3AXIA 1E0WA 3PZ9A 4A05A 5C2XA 3I7RA 4A21A 2GOKA 4WOQA 2CLIA 5BRBA 1TCMA 3ARZA 4PUMA 1M7OA 3JZEA 5CQ1A 4JX5A 2PU0A 1UP0A 4GZJA 1A5KC 2E77A 2WC3A 3AS2A 4NX0A 4WX2A 4KERA 5FJPA 4WDXA 3UPBA 4PMXA 3EA1A 3HIJA 4ACZA 2P5NA 4HGXA 3H2OA 8CGTA 2W79A 4JIEA 4AC1X 1QXLA 1R3TA 3A24A 5CLTA 3NDZA 4BS0A 3FGCB 1FH7A 2C14A 4XWUA 1CYGA 1KCKA 2OTDA 2PMQA 3ALGA 3WENA 3N4AA 3N6JA 1E6ZA 4W87A 2O4QA 1F6YA 2PTXA 4L9ZA 4CLMA 3EEGA 1JFXA 5BWFA 3AC0A 3TYCA 3WLOA 4XZBA 4A6GA 3E9AA 3DXIA 5G2IA 3AICA 1TV3A 5C5YA 3OGVA 2XIIA 3MO4A 3W2MA 1UIOA 1S2VA 4DF1A 1BSIA 1A0DA 3ZVHB 1A5BA 4S23A 3L5AA 2WNNA 5JBEA 3WLKX 2G41A 2E25A 1SPQA 1D3HA 1ECEA 1KGXA 4E4UA 1MVYA 2J8GA 4HOZA 4HZ7A 2Z24A 1W9VA 4C90A 2J9XA 1JCTA 1NU5A 4GI9A 4V15A 1KFBA 3ME3A 1Q63A 2H8ZA 4WF7A 4S2BA 3KW3A 3VXGA 1HGWA 4IIEA 3NXFA 3WH6A 4PN2A 4MNMA 3GG7A 3MV01 2Y7EA 5I3KA 1FWCC 1O60A 1BYBA 1ZZMA 3SBFA 5DMYA 4JTUA 1QI0A 2P3ZA 3TXZA 3CHVA 1Q6GA 1RP8A 5LKYA 5DFAA 3PZOA 3JUGA 2ZVRA 4H7CA 2FIQA 2DZPA 1TYGA 3KXQA 1JFHA 3B03A 4RXGA 3WH7A 3GXPA 4GX8A 3UETA 4RNHA 3W88A 3KDNA 3STCA 4IMEA 1V6WA 1XQKA 3APTA 4BCEA 1G6CA 1ESWA 4CD5A 1OFOA 1TZ9A 4QLJA 5FEWA 2FVLA 4MVAA 3CBWA 1NTHA 3L0GA 4CVUA 3A9IA 4UTIA 4URIA 3AUOA 1SMAA 3WLSA 2J27A 3GM8A 2IS7A 4A3RA 3PN8A 1YIXA 3BGAA 1KM5A 5KINA 1QPNA 4ILSA 1EDTA 4EXBA 1UH4A 1EJRC 3UPMA 1OFEA 1XYAA 3BOFA 4CEXC 3RJXA 4HYRA 3ANUA 5EY5A 4WSKA 2JKEA 2CITA 3NAVA 2XM2A 1G0CA 3GVRA 3SSJA 3T7VA 3DHDA 3M43A 2V5LA 5K7JA 1TV8A 2DSUA 1JAKA 4W4QA 3A21A 2YW4A 3KBNA 1GHSA 1BVNP 1FWTA 5EBUA 3OVPA 2ZUMA 1OC5A 3WUEA 1XJBA 2ALRA 2WJEA 3CV7A 2I1OA 2BXZA 4Q8UA 4W7WA 1O6IA 4QR6A 2QCDA 4DO6A 1U83A 3BZGA 3SI9A 4IFRA 3DFYA 2WMIA 1UD8A 4UNIA 4DAIA 4PBGA 1QHPA 4DXXA 2ZZ1A 3V1HA 1P0BA 5TQLA 2OFJA 2CLOA 3KS6A 4ICNA 3R13A 3VI2A 2XIQA 4IMAA 2FZDA 3REQA 4MKSA 4LB3A 4PEEA 5JH2A 1LORA 1WUEA 3NEVA 1KCLA 3IGXA 3MHUA 1A3XA 5HWJA 7PTDA 2QIIA 3M47A 3N3TA 5CPOA 4HNLA 3W7PA 2E67A 4GYPC 2GVLA 3WF4A 2PLKA 3SEPA 1CGUA 3BLLA 2CLPA 2QAPA 4RDZA 3HFTA 1OX4A 4J7RA 3HQ1A 4WVXA 5GQBA 4XV0A 4B2DA 4OECA 1RA0A 3WMSA 3U4AA 2V3GA 3VCCA 1NY1A 2VP8A 1GWJA 4WDUA 5G1YA 2BNJA 3KRBA 4Q7BA 3KLLA 5LNSA 1HO1A 1M7JA 1S38A 4DF0A 3H7RA 1EIBA 1J93A 3EX4A 4PTWA 2CLKA 1WOBA 3AZSA 3QSTA 1VHNA 4LNCA 1JIBA 1I9CB 4UQDA 4WSJA 5D33A 4C6NA 5DQPA 5D09A 3FVMA 1LWIA 3WD4A 3WK1A 3DGBA 3F5LA 4MMWA 4PMUA 4YS1A 1VEOA 3WH5A 4LANA 3WQCA 4PMYA 1UA7A 3NYZA 2O7SA 4OV9A 3QPZA 3SO7A 4XBJA 5ABTA 2VRQA 3PPFA 2GJRA 1VPYA 1D3GA 2QDHA 2EPNA 3SCOA 3WLTA 3EA2A 1O95A 1ZBCA 4BK9A 3EOOA 1NELA 1F3WA 4W8LA 5E6YA 5ABGA 1MNSA 1LP6A 3MQTA 3WNNA 3WEOA 3L4TA 2ACRA 1QK0A 3IJIA 2BVWA 4N42A 1E0XA 1A49A 1OF6A 1SZNA 2A3LA 4UC5A 3T0DA 2E9BA 1HVQA 1K7XA 4WOZA 3MDWA 1V3HA 4UFIA 7A3HA 4XSLA 3AMLA 3ARYA 3BV7A 4A2RA 3TTQA 2VDGA 4AD0A 2BLEA 4LY8A 3AIQA 2GYIA 1I1XA 1C8YA 2D2GA 2ZBTA 2O55A 1RQEA 1SFSA 4WKAA 4IGSA 4QSHA 1IEVA 3IJDA 3VIIA 1DKWA 3P3BA 4PSRA 1E9ZB 4NJGA 1J0IA 3UJFA 3ITGA 2PBGA 3WH8A 1JEZA 1LUCB 4DQWA 3N6QA 4IIFA 3WJSA 1KFEA 1XD0A 4ZTYA 4AY8A 3HPSA 1UD6A 4I7WA 1GZ1A 1QNOA 2O9TA 3N17A 2F61A 4H9TA 3WIJA 3TLQA 3LGEA 4AWTA 5AY7A 4Q4RA 3IS4A 5HUPA 4DUWA 1B90A 1Q6EA 3THDA 1MEWA 4NHVA 2J9YA 4L4MA 2FKPA 3OGRA 5J5DA 1GKRA 4FP1A 1HGYA 2ZVIA 2G95A 1DPMA 4FAMA 4HHLA 3W1XA 2NVCA 5E6ZA 1E43A 2POTA 1OK6A 1VKFA 3L67A 3FW6A 1ZSXA 4PL1A 4RE4A 1OX5A 4M6PA 1AG1O 1FCVA 1XFBA 2XG9A 2V2DA 4EANA 3D3FA 3STEA 4IQDA 1W3HA 2PLMA 1W2PA 2NWSA 4YCPA 5HJXA 1HL2A 5D9PA 4L6DA 1Q6QA 1SSDA 3M0VA 3O6DA 3S6OA 2PTZA 2PP0A 3WQ4A 4LF2A 4O14A 1N7KA 4YTRA 1G69A 4U33A 2EBNA 1P0EA 3B8TA 2EF9A 4GQ0A 1I45A 4AW7A 2Q8LA 4AYGA 1VBGA 2BXYA 4QRNA 4AMAA 3M0IA 1TREA 2MUCA 3M07A 4MB4A 4TMBA 1LOSA 4MUZA 1XV8A 1TTJA 4J28A 2HK0A 4Z2IA 4AXNA 4WY0B 2B7NA 4Z2HA 4QCEA 3KVKA 3TJLA 1V03A 3ABXA 4YHGA 2WKJA 3IRSA 4V1YA 2XSXA 2QXWA 1YXYA 5HJYA 1H09A 1IGWA 2Z29A 3K5XA 3SCQA 1CEOA 1H41A 3VM7A 1GUVA 2V2CA 4M6UA 4PMZA 1EJUC 3TYZA 3H2NA 3MU7A 4K36A 3LHVA 4LBSA 1WKDA 3GO2A 3TYEA 2DSVA 3E0VA 3G1HA 2ZE0A 2QDDA 2RGLA 5CBBA 1TR1A 3WKZA 2I17A 1DWGM 1JQVA 3ZMRA 5CZTA 1V0NA 2JE8A 2PDBA 1CGXA 4KIRA 3WLIA 3A12A 4GC3A 2EPOA 5CG7A 4C60A 2VD9A 1PDYA 2GOUA 1SO5A 1PTDA 1VR6A 3PP7A 3TN3A 3HGOA 4RW3A 2NQ5A 4YVVA 4Q4QA 3OIXA 4NKCA 2XZ7A 3BK0A 3GNDA 4GOAA 1C9DA 4H6EA 3TTSA 1B3YA 1TJ2A 5D2WA 3CO8A 1TQXA 1M7XA 5KZEA 3L68A 3TDFA 3S5YA 4GXWA 2R8WA 2OZTA 2YCEA 1SU5A 1SMDA 1VJZA 4G1KA 1RY0A 3LENA 2P8CA 5AHEA 1PKLA 1LLOA 3W7IA 3NQ7A 2VGIA 1HFBA 1KBLA 2DPEA 3I7QA 3VA8A 3WDPP 4PTDA 2DEPA 2CNCA 1KC7A 3CH9A 4QCFA 1IXNA 3NM1A 2PPGA 1UKQA 1PCKA 1XCFA 2BHYA 2QUMA